data_6CU0
# 
_entry.id   6CU0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6CU0         
WWPDB D_1000233364 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6CU0 
_pdbx_database_status.recvd_initial_deposition_date   2018-03-23 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Aruna, B.'    1 ? 
'Zajonc, D.M.' 2 ? 
'Doukov, T.'   3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Biol. Chem.' 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            293 
_citation.language                  ? 
_citation.page_first                9958 
_citation.page_last                 9969 
_citation.title                     
;Crystal structures of the human 4-1BB receptor bound to its ligand 4-1BBL reveal covalent receptor dimerization as a potential signaling amplifier.
;
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.RA118.003176 
_citation.pdbx_database_id_PubMed   29720398 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bitra, A.'    1 ? 
primary 'Doukov, T.'   2 ? 
primary 'Croft, M.'    3 ? 
primary 'Zajonc, D.M.' 4 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   101.240 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6CU0 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     72.961 
_cell.length_a_esd                 ? 
_cell.length_b                     114.745 
_cell.length_b_esd                 ? 
_cell.length_c                     126.039 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6CU0 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Tumor necrosis factor ligand superfamily member 9'   17488.945 6  ? ?     ?                 ? 
2 polymer     man 'Tumor necrosis factor receptor superfamily member 9' 14875.773 6  ? C121S 'residues 23-160' ? 
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose              221.208   2  ? ?     ?                 ? 
4 water       nat water                                                 18.015    44 ? ?     ?                 ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 '4-1BB ligand,4-1BBL'                                                          
2 '4-1BB ligand receptor,CDw137,T-cell antigen 4-1BB homolog,T-cell antigen ILA' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;DPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSG
SVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFR
VTPEI
;
;DPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSG
SVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFR
VTPEI
;
A,B,C,D,E,F ? 
2 'polypeptide(L)' no no 
;SLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMC
EQDCKQGQELTKKGCKDCSFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGP
;
;SLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMC
EQDCKQGQELTKKGCKDCSFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGP
;
G,H,J,K,L,I ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   PRO n 
1 3   ALA n 
1 4   GLY n 
1 5   LEU n 
1 6   LEU n 
1 7   ASP n 
1 8   LEU n 
1 9   ARG n 
1 10  GLN n 
1 11  GLY n 
1 12  MET n 
1 13  PHE n 
1 14  ALA n 
1 15  GLN n 
1 16  LEU n 
1 17  VAL n 
1 18  ALA n 
1 19  GLN n 
1 20  ASN n 
1 21  VAL n 
1 22  LEU n 
1 23  LEU n 
1 24  ILE n 
1 25  ASP n 
1 26  GLY n 
1 27  PRO n 
1 28  LEU n 
1 29  SER n 
1 30  TRP n 
1 31  TYR n 
1 32  SER n 
1 33  ASP n 
1 34  PRO n 
1 35  GLY n 
1 36  LEU n 
1 37  ALA n 
1 38  GLY n 
1 39  VAL n 
1 40  SER n 
1 41  LEU n 
1 42  THR n 
1 43  GLY n 
1 44  GLY n 
1 45  LEU n 
1 46  SER n 
1 47  TYR n 
1 48  LYS n 
1 49  GLU n 
1 50  ASP n 
1 51  THR n 
1 52  LYS n 
1 53  GLU n 
1 54  LEU n 
1 55  VAL n 
1 56  VAL n 
1 57  ALA n 
1 58  LYS n 
1 59  ALA n 
1 60  GLY n 
1 61  VAL n 
1 62  TYR n 
1 63  TYR n 
1 64  VAL n 
1 65  PHE n 
1 66  PHE n 
1 67  GLN n 
1 68  LEU n 
1 69  GLU n 
1 70  LEU n 
1 71  ARG n 
1 72  ARG n 
1 73  VAL n 
1 74  VAL n 
1 75  ALA n 
1 76  GLY n 
1 77  GLU n 
1 78  GLY n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  VAL n 
1 83  SER n 
1 84  LEU n 
1 85  ALA n 
1 86  LEU n 
1 87  HIS n 
1 88  LEU n 
1 89  GLN n 
1 90  PRO n 
1 91  LEU n 
1 92  ARG n 
1 93  SER n 
1 94  ALA n 
1 95  ALA n 
1 96  GLY n 
1 97  ALA n 
1 98  ALA n 
1 99  ALA n 
1 100 LEU n 
1 101 ALA n 
1 102 LEU n 
1 103 THR n 
1 104 VAL n 
1 105 ASP n 
1 106 LEU n 
1 107 PRO n 
1 108 PRO n 
1 109 ALA n 
1 110 SER n 
1 111 SER n 
1 112 GLU n 
1 113 ALA n 
1 114 ARG n 
1 115 ASN n 
1 116 SER n 
1 117 ALA n 
1 118 PHE n 
1 119 GLY n 
1 120 PHE n 
1 121 GLN n 
1 122 GLY n 
1 123 ARG n 
1 124 LEU n 
1 125 LEU n 
1 126 HIS n 
1 127 LEU n 
1 128 SER n 
1 129 ALA n 
1 130 GLY n 
1 131 GLN n 
1 132 ARG n 
1 133 LEU n 
1 134 GLY n 
1 135 VAL n 
1 136 HIS n 
1 137 LEU n 
1 138 HIS n 
1 139 THR n 
1 140 GLU n 
1 141 ALA n 
1 142 ARG n 
1 143 ALA n 
1 144 ARG n 
1 145 HIS n 
1 146 ALA n 
1 147 TRP n 
1 148 GLN n 
1 149 LEU n 
1 150 THR n 
1 151 GLN n 
1 152 GLY n 
1 153 ALA n 
1 154 THR n 
1 155 VAL n 
1 156 LEU n 
1 157 GLY n 
1 158 LEU n 
1 159 PHE n 
1 160 ARG n 
1 161 VAL n 
1 162 THR n 
1 163 PRO n 
1 164 GLU n 
1 165 ILE n 
2 1   SER n 
2 2   LEU n 
2 3   GLN n 
2 4   ASP n 
2 5   PRO n 
2 6   CYS n 
2 7   SER n 
2 8   ASN n 
2 9   CYS n 
2 10  PRO n 
2 11  ALA n 
2 12  GLY n 
2 13  THR n 
2 14  PHE n 
2 15  CYS n 
2 16  ASP n 
2 17  ASN n 
2 18  ASN n 
2 19  ARG n 
2 20  ASN n 
2 21  GLN n 
2 22  ILE n 
2 23  CYS n 
2 24  SER n 
2 25  PRO n 
2 26  CYS n 
2 27  PRO n 
2 28  PRO n 
2 29  ASN n 
2 30  SER n 
2 31  PHE n 
2 32  SER n 
2 33  SER n 
2 34  ALA n 
2 35  GLY n 
2 36  GLY n 
2 37  GLN n 
2 38  ARG n 
2 39  THR n 
2 40  CYS n 
2 41  ASP n 
2 42  ILE n 
2 43  CYS n 
2 44  ARG n 
2 45  GLN n 
2 46  CYS n 
2 47  LYS n 
2 48  GLY n 
2 49  VAL n 
2 50  PHE n 
2 51  ARG n 
2 52  THR n 
2 53  ARG n 
2 54  LYS n 
2 55  GLU n 
2 56  CYS n 
2 57  SER n 
2 58  SER n 
2 59  THR n 
2 60  SER n 
2 61  ASN n 
2 62  ALA n 
2 63  GLU n 
2 64  CYS n 
2 65  ASP n 
2 66  CYS n 
2 67  THR n 
2 68  PRO n 
2 69  GLY n 
2 70  PHE n 
2 71  HIS n 
2 72  CYS n 
2 73  LEU n 
2 74  GLY n 
2 75  ALA n 
2 76  GLY n 
2 77  CYS n 
2 78  SER n 
2 79  MET n 
2 80  CYS n 
2 81  GLU n 
2 82  GLN n 
2 83  ASP n 
2 84  CYS n 
2 85  LYS n 
2 86  GLN n 
2 87  GLY n 
2 88  GLN n 
2 89  GLU n 
2 90  LEU n 
2 91  THR n 
2 92  LYS n 
2 93  LYS n 
2 94  GLY n 
2 95  CYS n 
2 96  LYS n 
2 97  ASP n 
2 98  CYS n 
2 99  SER n 
2 100 PHE n 
2 101 GLY n 
2 102 THR n 
2 103 PHE n 
2 104 ASN n 
2 105 ASP n 
2 106 GLN n 
2 107 LYS n 
2 108 ARG n 
2 109 GLY n 
2 110 ILE n 
2 111 CYS n 
2 112 ARG n 
2 113 PRO n 
2 114 TRP n 
2 115 THR n 
2 116 ASN n 
2 117 CYS n 
2 118 SER n 
2 119 LEU n 
2 120 ASP n 
2 121 GLY n 
2 122 LYS n 
2 123 SER n 
2 124 VAL n 
2 125 LEU n 
2 126 VAL n 
2 127 ASN n 
2 128 GLY n 
2 129 THR n 
2 130 LYS n 
2 131 GLU n 
2 132 ARG n 
2 133 ASP n 
2 134 VAL n 
2 135 VAL n 
2 136 CYS n 
2 137 GLY n 
2 138 PRO n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 165 Human ? TNFSF9                ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Insect cell expression vector pTIE1' 266783 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 138 Human ? 'TNFRSF9, CD137, ILA' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Insect cell expression vector pTIE1' 266783 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP TNFL9_HUMAN P41273 ? 1 
;DPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSG
SVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFR
VTPEI
;
80 
2 UNP TNR9_HUMAN  Q07011 ? 2 
;SLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMC
EQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGP
;
23 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6CU0 A 1 ? 165 ? P41273 80 ? 244 ? 80 244 
2  1 6CU0 B 1 ? 165 ? P41273 80 ? 244 ? 80 244 
3  1 6CU0 C 1 ? 165 ? P41273 80 ? 244 ? 80 244 
4  1 6CU0 D 1 ? 165 ? P41273 80 ? 244 ? 80 244 
5  1 6CU0 E 1 ? 165 ? P41273 80 ? 244 ? 80 244 
6  1 6CU0 F 1 ? 165 ? P41273 80 ? 244 ? 80 244 
7  2 6CU0 G 1 ? 138 ? Q07011 23 ? 160 ? 23 160 
8  2 6CU0 H 1 ? 138 ? Q07011 23 ? 160 ? 23 160 
9  2 6CU0 J 1 ? 138 ? Q07011 23 ? 160 ? 23 160 
10 2 6CU0 K 1 ? 138 ? Q07011 23 ? 160 ? 23 160 
11 2 6CU0 L 1 ? 138 ? Q07011 23 ? 160 ? 23 160 
12 2 6CU0 I 1 ? 138 ? Q07011 23 ? 160 ? 23 160 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
7  6CU0 SER G 99 ? UNP Q07011 CYS 121 'engineered mutation' 121 1 
8  6CU0 SER H 99 ? UNP Q07011 CYS 121 'engineered mutation' 121 2 
9  6CU0 SER J 99 ? UNP Q07011 CYS 121 'engineered mutation' 121 3 
10 6CU0 SER K 99 ? UNP Q07011 CYS 121 'engineered mutation' 121 4 
11 6CU0 SER L 99 ? UNP Q07011 CYS 121 'engineered mutation' 121 5 
12 6CU0 SER I 99 ? UNP Q07011 CYS 121 'engineered mutation' 121 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6CU0 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.66 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         53.84 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M bicine and 30% W/V PEG 6000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-03-21 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRL BEAMLINE BL9-2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL9-2 
_diffrn_source.pdbx_synchrotron_site       SSRL 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6CU0 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.200 
_reflns.d_resolution_low                 50.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       32003 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             94.900 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.200 
_reflns.pdbx_Rmerge_I_obs                0.085 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            17.800 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 2.857 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.097 
_reflns.pdbx_Rpim_I_all                  0.045 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
3.200 3.310  ? ? ? ? ? ? 3027 89.500 ? ? ? ? 0.541 ? ? ? ? ? ? ? ? 3.500 ? 0.780 ? ? 0.628 0.311 ? 1  1 0.849 ? 
3.310 3.450  ? ? ? ? ? ? 3166 95.400 ? ? ? ? 0.408 ? ? ? ? ? ? ? ? 4.200 ? 0.977 ? ? 0.465 0.217 ? 2  1 0.937 ? 
3.450 3.600  ? ? ? ? ? ? 3319 98.900 ? ? ? ? 0.267 ? ? ? ? ? ? ? ? 4.400 ? 0.984 ? ? 0.303 0.141 ? 3  1 0.973 ? 
3.600 3.790  ? ? ? ? ? ? 3299 98.000 ? ? ? ? 0.167 ? ? ? ? ? ? ? ? 4.400 ? 1.349 ? ? 0.190 0.088 ? 4  1 0.985 ? 
3.790 4.030  ? ? ? ? ? ? 3289 98.100 ? ? ? ? 0.124 ? ? ? ? ? ? ? ? 4.200 ? 2.070 ? ? 0.142 0.066 ? 5  1 0.992 ? 
4.030 4.340  ? ? ? ? ? ? 3214 95.300 ? ? ? ? 0.081 ? ? ? ? ? ? ? ? 4.300 ? 3.358 ? ? 0.092 0.042 ? 6  1 0.996 ? 
4.340 4.780  ? ? ? ? ? ? 3308 98.500 ? ? ? ? 0.068 ? ? ? ? ? ? ? ? 4.500 ? 3.643 ? ? 0.077 0.036 ? 7  1 0.996 ? 
4.780 5.470  ? ? ? ? ? ? 3269 96.500 ? ? ? ? 0.066 ? ? ? ? ? ? ? ? 4.200 ? 4.442 ? ? 0.076 0.035 ? 8  1 0.995 ? 
5.470 6.890  ? ? ? ? ? ? 3350 98.800 ? ? ? ? 0.070 ? ? ? ? ? ? ? ? 4.500 ? 5.016 ? ? 0.079 0.035 ? 9  1 0.994 ? 
6.890 50.000 ? ? ? ? ? ? 2762 80.000 ? ? ? ? 0.080 ? ? ? ? ? ? ? ? 4.100 ? 5.821 ? ? 0.091 0.042 ? 10 1 0.988 ? 
# 
_refine.aniso_B[1][1]                            7.4300 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            3.8900 
_refine.aniso_B[2][2]                            1.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            -9.2400 
_refine.B_iso_max                                363.510 
_refine.B_iso_mean                               146.2150 
_refine.B_iso_min                                30.000 
_refine.correlation_coeff_Fo_to_Fc               0.9050 
_refine.correlation_coeff_Fo_to_Fc_free          0.8840 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : WITH TLS ADDED' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6CU0 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.2000 
_refine.ls_d_res_low                             50.0 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     30300 
_refine.ls_number_reflns_R_free                  1668 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    94.6400 
_refine.ls_percent_reflns_R_free                 5.2000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2497 
_refine.ls_R_factor_R_free                       0.2960 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2472 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      '2X29, 5WI8' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.6050 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             75.4300 
_refine.overall_SU_ML                            0.5420 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       3.2000 
_refine_hist.d_res_low                        50.0 
_refine_hist.pdbx_number_atoms_ligand         28 
_refine_hist.number_atoms_solvent             44 
_refine_hist.number_atoms_total               11476 
_refine_hist.pdbx_number_residues_total       1672 
_refine_hist.pdbx_B_iso_mean_ligand           196.52 
_refine_hist.pdbx_B_iso_mean_solvent          204.08 
_refine_hist.pdbx_number_atoms_protein        11404 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.009  0.019  11704 ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  9742  ? r_bond_other_d         ? ? 
'X-RAY DIFFRACTION' ? 1.338  1.946  16012 ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 0.928  3.000  22461 ? r_angle_other_deg      ? ? 
'X-RAY DIFFRACTION' ? 6.937  5.000  1649  ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 36.831 24.801 402   ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 15.634 15.000 1420  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 12.918 15.000 37    ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.086  0.200  1861  ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.005  0.021  13713 ? r_gen_planes_refined   ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  2315  ? r_gen_planes_other     ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1  'X-RAY DIFFRACTION' 1  1 'interatomic distance' A 7948 0.040 0.050 ? ? ? 
2  'X-RAY DIFFRACTION' 1  2 'interatomic distance' B 7948 0.040 0.050 ? ? ? 
3  'X-RAY DIFFRACTION' 2  1 'interatomic distance' A 7736 0.040 0.050 ? ? ? 
4  'X-RAY DIFFRACTION' 2  2 'interatomic distance' C 7736 0.040 0.050 ? ? ? 
5  'X-RAY DIFFRACTION' 3  1 'interatomic distance' A 7806 0.040 0.050 ? ? ? 
6  'X-RAY DIFFRACTION' 3  2 'interatomic distance' D 7806 0.040 0.050 ? ? ? 
7  'X-RAY DIFFRACTION' 4  1 'interatomic distance' A 7286 0.040 0.050 ? ? ? 
8  'X-RAY DIFFRACTION' 4  2 'interatomic distance' E 7286 0.040 0.050 ? ? ? 
9  'X-RAY DIFFRACTION' 5  1 'interatomic distance' A 7842 0.050 0.050 ? ? ? 
10 'X-RAY DIFFRACTION' 5  2 'interatomic distance' F 7842 0.050 0.050 ? ? ? 
11 'X-RAY DIFFRACTION' 6  1 'interatomic distance' B 7658 0.030 0.050 ? ? ? 
12 'X-RAY DIFFRACTION' 6  2 'interatomic distance' C 7658 0.030 0.050 ? ? ? 
13 'X-RAY DIFFRACTION' 7  1 'interatomic distance' B 7640 0.030 0.050 ? ? ? 
14 'X-RAY DIFFRACTION' 7  2 'interatomic distance' D 7640 0.030 0.050 ? ? ? 
15 'X-RAY DIFFRACTION' 8  1 'interatomic distance' B 7266 0.050 0.050 ? ? ? 
16 'X-RAY DIFFRACTION' 8  2 'interatomic distance' E 7266 0.050 0.050 ? ? ? 
17 'X-RAY DIFFRACTION' 9  1 'interatomic distance' B 7712 0.050 0.050 ? ? ? 
18 'X-RAY DIFFRACTION' 9  2 'interatomic distance' F 7712 0.050 0.050 ? ? ? 
19 'X-RAY DIFFRACTION' 10 1 'interatomic distance' C 7568 0.050 0.050 ? ? ? 
20 'X-RAY DIFFRACTION' 10 2 'interatomic distance' D 7568 0.050 0.050 ? ? ? 
21 'X-RAY DIFFRACTION' 11 1 'interatomic distance' C 7122 0.050 0.050 ? ? ? 
22 'X-RAY DIFFRACTION' 11 2 'interatomic distance' E 7122 0.050 0.050 ? ? ? 
23 'X-RAY DIFFRACTION' 12 1 'interatomic distance' C 7610 0.040 0.050 ? ? ? 
24 'X-RAY DIFFRACTION' 12 2 'interatomic distance' F 7610 0.040 0.050 ? ? ? 
25 'X-RAY DIFFRACTION' 13 1 'interatomic distance' D 7230 0.050 0.050 ? ? ? 
26 'X-RAY DIFFRACTION' 13 2 'interatomic distance' E 7230 0.050 0.050 ? ? ? 
27 'X-RAY DIFFRACTION' 14 1 'interatomic distance' D 7642 0.050 0.050 ? ? ? 
28 'X-RAY DIFFRACTION' 14 2 'interatomic distance' F 7642 0.050 0.050 ? ? ? 
29 'X-RAY DIFFRACTION' 15 1 'interatomic distance' E 7232 0.050 0.050 ? ? ? 
30 'X-RAY DIFFRACTION' 15 2 'interatomic distance' F 7232 0.050 0.050 ? ? ? 
31 'X-RAY DIFFRACTION' 16 1 'interatomic distance' G 6526 0.040 0.050 ? ? ? 
32 'X-RAY DIFFRACTION' 16 2 'interatomic distance' H 6526 0.040 0.050 ? ? ? 
33 'X-RAY DIFFRACTION' 17 1 'interatomic distance' G 6472 0.040 0.050 ? ? ? 
34 'X-RAY DIFFRACTION' 17 2 'interatomic distance' J 6472 0.040 0.050 ? ? ? 
35 'X-RAY DIFFRACTION' 18 1 'interatomic distance' G 6414 0.040 0.050 ? ? ? 
36 'X-RAY DIFFRACTION' 18 2 'interatomic distance' K 6414 0.040 0.050 ? ? ? 
37 'X-RAY DIFFRACTION' 19 1 'interatomic distance' G 6326 0.050 0.050 ? ? ? 
38 'X-RAY DIFFRACTION' 19 2 'interatomic distance' L 6326 0.050 0.050 ? ? ? 
39 'X-RAY DIFFRACTION' 20 1 'interatomic distance' G 6420 0.040 0.050 ? ? ? 
40 'X-RAY DIFFRACTION' 20 2 'interatomic distance' I 6420 0.040 0.050 ? ? ? 
41 'X-RAY DIFFRACTION' 21 1 'interatomic distance' H 6500 0.040 0.050 ? ? ? 
42 'X-RAY DIFFRACTION' 21 2 'interatomic distance' J 6500 0.040 0.050 ? ? ? 
43 'X-RAY DIFFRACTION' 22 1 'interatomic distance' H 6388 0.040 0.050 ? ? ? 
44 'X-RAY DIFFRACTION' 22 2 'interatomic distance' K 6388 0.040 0.050 ? ? ? 
45 'X-RAY DIFFRACTION' 23 1 'interatomic distance' H 6326 0.060 0.050 ? ? ? 
46 'X-RAY DIFFRACTION' 23 2 'interatomic distance' L 6326 0.060 0.050 ? ? ? 
47 'X-RAY DIFFRACTION' 24 1 'interatomic distance' H 6626 0.020 0.050 ? ? ? 
48 'X-RAY DIFFRACTION' 24 2 'interatomic distance' I 6626 0.020 0.050 ? ? ? 
49 'X-RAY DIFFRACTION' 25 1 'interatomic distance' J 6248 0.030 0.050 ? ? ? 
50 'X-RAY DIFFRACTION' 25 2 'interatomic distance' K 6248 0.030 0.050 ? ? ? 
51 'X-RAY DIFFRACTION' 26 1 'interatomic distance' J 6244 0.060 0.050 ? ? ? 
52 'X-RAY DIFFRACTION' 26 2 'interatomic distance' L 6244 0.060 0.050 ? ? ? 
53 'X-RAY DIFFRACTION' 27 1 'interatomic distance' J 6340 0.040 0.050 ? ? ? 
54 'X-RAY DIFFRACTION' 27 2 'interatomic distance' I 6340 0.040 0.050 ? ? ? 
55 'X-RAY DIFFRACTION' 28 1 'interatomic distance' K 6142 0.060 0.050 ? ? ? 
56 'X-RAY DIFFRACTION' 28 2 'interatomic distance' L 6142 0.060 0.050 ? ? ? 
57 'X-RAY DIFFRACTION' 29 1 'interatomic distance' K 6294 0.040 0.050 ? ? ? 
58 'X-RAY DIFFRACTION' 29 2 'interatomic distance' I 6294 0.040 0.050 ? ? ? 
59 'X-RAY DIFFRACTION' 30 1 'interatomic distance' L 6246 0.060 0.050 ? ? ? 
60 'X-RAY DIFFRACTION' 30 2 'interatomic distance' I 6246 0.060 0.050 ? ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       3.2000 
_refine_ls_shell.d_res_low                        3.2830 
_refine_ls_shell.number_reflns_all                2187 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             107 
_refine_ls_shell.number_reflns_R_work             2080 
_refine_ls_shell.percent_reflns_obs               88.0800 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.3610 
_refine_ls_shell.R_factor_R_free_error            0.0000 
_refine_ls_shell.R_factor_R_work                  0.3690 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1  1 A 
1  2 B 
2  1 A 
2  2 C 
3  1 A 
3  2 D 
4  1 A 
4  2 E 
5  1 A 
5  2 F 
6  1 B 
6  2 C 
7  1 B 
7  2 D 
8  1 B 
8  2 E 
9  1 B 
9  2 F 
10 1 C 
10 2 D 
11 1 C 
11 2 E 
12 1 C 
12 2 F 
13 1 D 
13 2 E 
14 1 D 
14 2 F 
15 1 E 
15 2 F 
16 1 G 
16 2 H 
17 1 G 
17 2 J 
18 1 G 
18 2 K 
19 1 G 
19 2 L 
20 1 G 
20 2 I 
21 1 H 
21 2 J 
22 1 H 
22 2 K 
23 1 H 
23 2 L 
24 1 H 
24 2 I 
25 1 J 
25 2 K 
26 1 J 
26 2 L 
27 1 J 
27 2 I 
28 1 K 
28 2 L 
29 1 K 
29 2 I 
30 1 L 
30 2 I 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1  1 0 0 A 91 A 242 ? ? ? ? ? ? ? ? ? 
1  2 0 0 B 91 B 242 ? ? ? ? ? ? ? ? ? 
2  1 0 0 A 91 A 242 ? ? ? ? ? ? ? ? ? 
2  2 0 0 C 91 C 242 ? ? ? ? ? ? ? ? ? 
3  1 0 0 A 91 A 241 ? ? ? ? ? ? ? ? ? 
3  2 0 0 D 91 D 241 ? ? ? ? ? ? ? ? ? 
4  1 0 0 A 91 A 242 ? ? ? ? ? ? ? ? ? 
4  2 0 0 E 91 E 242 ? ? ? ? ? ? ? ? ? 
5  1 0 0 A 91 A 242 ? ? ? ? ? ? ? ? ? 
5  2 0 0 F 91 F 242 ? ? ? ? ? ? ? ? ? 
6  1 0 0 B 91 B 242 ? ? ? ? ? ? ? ? ? 
6  2 0 0 C 91 C 242 ? ? ? ? ? ? ? ? ? 
7  1 0 0 B 91 B 240 ? ? ? ? ? ? ? ? ? 
7  2 0 0 D 91 D 240 ? ? ? ? ? ? ? ? ? 
8  1 0 0 B 91 B 242 ? ? ? ? ? ? ? ? ? 
8  2 0 0 E 91 E 242 ? ? ? ? ? ? ? ? ? 
9  1 0 0 B 91 B 242 ? ? ? ? ? ? ? ? ? 
9  2 0 0 F 91 F 242 ? ? ? ? ? ? ? ? ? 
10 1 0 0 C 90 C 241 ? ? ? ? ? ? ? ? ? 
10 2 0 0 D 90 D 241 ? ? ? ? ? ? ? ? ? 
11 1 0 0 C 91 C 242 ? ? ? ? ? ? ? ? ? 
11 2 0 0 E 91 E 242 ? ? ? ? ? ? ? ? ? 
12 1 0 0 C 90 C 242 ? ? ? ? ? ? ? ? ? 
12 2 0 0 F 90 F 242 ? ? ? ? ? ? ? ? ? 
13 1 0 0 D 91 D 241 ? ? ? ? ? ? ? ? ? 
13 2 0 0 E 91 E 241 ? ? ? ? ? ? ? ? ? 
14 1 0 0 D 90 D 241 ? ? ? ? ? ? ? ? ? 
14 2 0 0 F 90 F 241 ? ? ? ? ? ? ? ? ? 
15 1 0 0 E 91 E 242 ? ? ? ? ? ? ? ? ? 
15 2 0 0 F 91 F 242 ? ? ? ? ? ? ? ? ? 
16 1 0 0 G 26 G 158 ? ? ? ? ? ? ? ? ? 
16 2 0 0 H 26 H 158 ? ? ? ? ? ? ? ? ? 
17 1 0 0 G 27 G 158 ? ? ? ? ? ? ? ? ? 
17 2 0 0 J 27 J 158 ? ? ? ? ? ? ? ? ? 
18 1 0 0 G 26 G 157 ? ? ? ? ? ? ? ? ? 
18 2 0 0 K 26 K 158 ? ? ? ? ? ? ? ? ? 
19 1 0 0 G 29 G 158 ? ? ? ? ? ? ? ? ? 
19 2 0 0 L 29 L 158 ? ? ? ? ? ? ? ? ? 
20 1 0 0 G 26 G 158 ? ? ? ? ? ? ? ? ? 
20 2 0 0 I 26 I 158 ? ? ? ? ? ? ? ? ? 
21 1 0 0 H 27 H 158 ? ? ? ? ? ? ? ? ? 
21 2 0 0 J 27 J 158 ? ? ? ? ? ? ? ? ? 
22 1 0 0 H 26 H 156 ? ? ? ? ? ? ? ? ? 
22 2 0 0 K 26 K 157 ? ? ? ? ? ? ? ? ? 
23 1 0 0 H 29 H 157 ? ? ? ? ? ? ? ? ? 
23 2 0 0 L 29 L 157 ? ? ? ? ? ? ? ? ? 
24 1 0 0 H 26 H 158 ? ? ? ? ? ? ? ? ? 
24 2 0 0 I 26 I 158 ? ? ? ? ? ? ? ? ? 
25 1 0 0 J 27 J 157 ? ? ? ? ? ? ? ? ? 
25 2 0 0 K 27 K 158 ? ? ? ? ? ? ? ? ? 
26 1 0 0 J 29 J 158 ? ? ? ? ? ? ? ? ? 
26 2 0 0 L 29 L 158 ? ? ? ? ? ? ? ? ? 
27 1 0 0 J 27 J 158 ? ? ? ? ? ? ? ? ? 
27 2 0 0 I 27 I 158 ? ? ? ? ? ? ? ? ? 
28 1 0 0 K 29 K 157 ? ? ? ? ? ? ? ? ? 
28 2 0 0 L 29 L 156 ? ? ? ? ? ? ? ? ? 
29 1 0 0 K 26 K 158 ? ? ? ? ? ? ? ? ? 
29 2 0 0 I 26 I 157 ? ? ? ? ? ? ? ? ? 
30 1 0 0 L 29 L 158 ? ? ? ? ? ? ? ? ? 
30 2 0 0 I 29 I 158 ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1  ? 
2  ? 
3  ? 
4  ? 
5  ? 
6  ? 
7  ? 
8  ? 
9  ? 
10 ? 
11 ? 
12 ? 
13 ? 
14 ? 
15 ? 
16 ? 
17 ? 
18 ? 
19 ? 
20 ? 
21 ? 
22 ? 
23 ? 
24 ? 
25 ? 
26 ? 
27 ? 
28 ? 
29 ? 
30 ? 
# 
_struct.entry_id                     6CU0 
_struct.title                        'Crystal structure of 4-1BBL/4-1BB (C121S) complex in P21 space group' 
_struct.pdbx_descriptor              
'Tumor necrosis factor ligand superfamily member 9, Tumor necrosis factor receptor superfamily member 9' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6CU0 
_struct_keywords.text            'complex, CYTOKINE' 
_struct_keywords.pdbx_keywords   CYTOKINE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
K N N 2 ? 
L N N 2 ? 
M N N 3 ? 
N N N 3 ? 
O N N 4 ? 
P N N 4 ? 
Q N N 4 ? 
R N N 4 ? 
S N N 4 ? 
T N N 4 ? 
U N N 4 ? 
V N N 4 ? 
W N N 4 ? 
X N N 4 ? 
Y N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ALA A 143 ? HIS A 145 ? ALA A 222 HIS A 224 5 ? 3 
HELX_P HELX_P2  AA2 ALA B 143 ? HIS B 145 ? ALA B 222 HIS B 224 5 ? 3 
HELX_P HELX_P3  AA3 ALA C 143 ? HIS C 145 ? ALA C 222 HIS C 224 5 ? 3 
HELX_P HELX_P4  AA4 ALA D 143 ? HIS D 145 ? ALA D 222 HIS D 224 5 ? 3 
HELX_P HELX_P5  AA5 ALA E 143 ? HIS E 145 ? ALA E 222 HIS E 224 5 ? 3 
HELX_P HELX_P6  AA6 ALA F 143 ? HIS F 145 ? ALA F 222 HIS F 224 5 ? 3 
HELX_P HELX_P7  AA7 PRO G 5   ? CYS G 9   ? PRO G 27  CYS G 31  5 ? 5 
HELX_P HELX_P8  AA8 ASN G 116 ? GLY G 121 ? ASN G 138 GLY G 143 1 ? 6 
HELX_P HELX_P9  AA9 PRO H 5   ? CYS H 9   ? PRO H 27  CYS H 31  5 ? 5 
HELX_P HELX_P10 AB1 ASN H 116 ? GLY H 121 ? ASN H 138 GLY H 143 1 ? 6 
HELX_P HELX_P11 AB2 PRO I 5   ? CYS I 9   ? PRO J 27  CYS J 31  5 ? 5 
HELX_P HELX_P12 AB3 PRO J 5   ? CYS J 9   ? PRO K 27  CYS K 31  5 ? 5 
HELX_P HELX_P13 AB4 ASN J 116 ? GLY J 121 ? ASN K 138 GLY K 143 1 ? 6 
HELX_P HELX_P14 AB5 ASN K 116 ? GLY K 121 ? ASN L 138 GLY L 143 1 ? 6 
HELX_P HELX_P15 AB6 PRO L 5   ? CYS L 9   ? PRO I 27  CYS I 31  5 ? 5 
HELX_P HELX_P16 AB7 ASN L 116 ? GLY L 121 ? ASN I 138 GLY I 143 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?   ? G CYS 6   SG  ? ? ? 1_555 G CYS 15  SG ? ? G CYS 28  G CYS 37  1_555 ? ? ? ? ? ? ? 2.044 ? ?               
disulf2  disulf ?   ? G CYS 9   SG  ? ? ? 1_555 G CYS 23  SG ? ? G CYS 31  G CYS 45  1_555 ? ? ? ? ? ? ? 2.063 ? ?               
disulf3  disulf ?   ? G CYS 26  SG  ? ? ? 1_555 G CYS 40  SG ? ? G CYS 48  G CYS 62  1_555 ? ? ? ? ? ? ? 2.055 ? ?               
disulf4  disulf ?   ? G CYS 43  SG  ? ? ? 1_555 G CYS 56  SG ? ? G CYS 65  G CYS 78  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf5  disulf ?   ? G CYS 46  SG  ? ? ? 1_555 G CYS 64  SG ? ? G CYS 68  G CYS 86  1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf6  disulf ?   ? G CYS 66  SG  ? ? ? 1_555 G CYS 80  SG ? ? G CYS 88  G CYS 102 1_555 ? ? ? ? ? ? ? 2.067 ? ?               
disulf7  disulf ?   ? G CYS 72  SG  ? ? ? 1_555 G CYS 77  SG ? ? G CYS 94  G CYS 99  1_555 ? ? ? ? ? ? ? 2.053 ? ?               
disulf8  disulf ?   ? G CYS 84  SG  ? ? ? 1_555 G CYS 95  SG ? ? G CYS 106 G CYS 117 1_555 ? ? ? ? ? ? ? 2.056 ? ?               
disulf9  disulf ?   ? G CYS 98  SG  ? ? ? 1_555 G CYS 111 SG ? ? G CYS 120 G CYS 133 1_555 ? ? ? ? ? ? ? 2.055 ? ?               
disulf10 disulf ?   ? G CYS 117 SG  ? ? ? 1_555 G CYS 136 SG ? ? G CYS 139 G CYS 158 1_555 ? ? ? ? ? ? ? 2.044 ? ?               
disulf11 disulf ?   ? H CYS 6   SG  ? ? ? 1_555 H CYS 15  SG ? ? H CYS 28  H CYS 37  1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf12 disulf ?   ? H CYS 9   SG  ? ? ? 1_555 H CYS 23  SG ? ? H CYS 31  H CYS 45  1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf13 disulf ?   ? H CYS 26  SG  ? ? ? 1_555 H CYS 40  SG ? ? H CYS 48  H CYS 62  1_555 ? ? ? ? ? ? ? 2.049 ? ?               
disulf14 disulf ?   ? H CYS 43  SG  ? ? ? 1_555 H CYS 56  SG ? ? H CYS 65  H CYS 78  1_555 ? ? ? ? ? ? ? 2.051 ? ?               
disulf15 disulf ?   ? H CYS 46  SG  ? ? ? 1_555 H CYS 64  SG ? ? H CYS 68  H CYS 86  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf16 disulf ?   ? H CYS 66  SG  ? ? ? 1_555 H CYS 80  SG ? ? H CYS 88  H CYS 102 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf17 disulf ?   ? H CYS 72  SG  ? ? ? 1_555 H CYS 77  SG ? ? H CYS 94  H CYS 99  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf18 disulf ?   ? H CYS 84  SG  ? ? ? 1_555 H CYS 95  SG ? ? H CYS 106 H CYS 117 1_555 ? ? ? ? ? ? ? 2.049 ? ?               
disulf19 disulf ?   ? H CYS 98  SG  ? ? ? 1_555 H CYS 111 SG ? ? H CYS 120 H CYS 133 1_555 ? ? ? ? ? ? ? 2.055 ? ?               
disulf20 disulf ?   ? H CYS 117 SG  ? ? ? 1_555 H CYS 136 SG ? ? H CYS 139 H CYS 158 1_555 ? ? ? ? ? ? ? 2.057 ? ?               
disulf21 disulf ?   ? I CYS 6   SG  ? ? ? 1_555 I CYS 15  SG ? ? J CYS 28  J CYS 37  1_555 ? ? ? ? ? ? ? 2.045 ? ?               
disulf22 disulf ?   ? I CYS 9   SG  ? ? ? 1_555 I CYS 23  SG ? ? J CYS 31  J CYS 45  1_555 ? ? ? ? ? ? ? 2.045 ? ?               
disulf23 disulf ?   ? I CYS 26  SG  ? ? ? 1_555 I CYS 40  SG ? ? J CYS 48  J CYS 62  1_555 ? ? ? ? ? ? ? 2.040 ? ?               
disulf24 disulf ?   ? I CYS 43  SG  ? ? ? 1_555 I CYS 56  SG ? ? J CYS 65  J CYS 78  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf25 disulf ?   ? I CYS 46  SG  ? ? ? 1_555 I CYS 64  SG ? ? J CYS 68  J CYS 86  1_555 ? ? ? ? ? ? ? 2.043 ? ?               
disulf26 disulf ?   ? I CYS 66  SG  ? ? ? 1_555 I CYS 80  SG ? ? J CYS 88  J CYS 102 1_555 ? ? ? ? ? ? ? 2.058 ? ?               
disulf27 disulf ?   ? I CYS 72  SG  ? ? ? 1_555 I CYS 77  SG ? ? J CYS 94  J CYS 99  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf28 disulf ?   ? I CYS 84  SG  ? ? ? 1_555 I CYS 95  SG ? ? J CYS 106 J CYS 117 1_555 ? ? ? ? ? ? ? 2.049 ? ?               
disulf29 disulf ?   ? I CYS 98  SG  ? ? ? 1_555 I CYS 111 SG ? ? J CYS 120 J CYS 133 1_555 ? ? ? ? ? ? ? 2.043 ? ?               
disulf30 disulf ?   ? I CYS 117 SG  ? ? ? 1_555 I CYS 136 SG ? ? J CYS 139 J CYS 158 1_555 ? ? ? ? ? ? ? 2.070 ? ?               
disulf31 disulf ?   ? J CYS 6   SG  ? ? ? 1_555 J CYS 15  SG ? ? K CYS 28  K CYS 37  1_555 ? ? ? ? ? ? ? 2.037 ? ?               
disulf32 disulf ?   ? J CYS 9   SG  ? ? ? 1_555 J CYS 23  SG ? ? K CYS 31  K CYS 45  1_555 ? ? ? ? ? ? ? 2.046 ? ?               
disulf33 disulf ?   ? J CYS 26  SG  ? ? ? 1_555 J CYS 40  SG ? ? K CYS 48  K CYS 62  1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf34 disulf ?   ? J CYS 43  SG  ? ? ? 1_555 J CYS 56  SG ? ? K CYS 65  K CYS 78  1_555 ? ? ? ? ? ? ? 2.050 ? ?               
disulf35 disulf ?   ? J CYS 46  SG  ? ? ? 1_555 J CYS 64  SG ? ? K CYS 68  K CYS 86  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf36 disulf ?   ? J CYS 66  SG  ? ? ? 1_555 J CYS 80  SG ? ? K CYS 88  K CYS 102 1_555 ? ? ? ? ? ? ? 2.065 ? ?               
disulf37 disulf ?   ? J CYS 72  SG  ? ? ? 1_555 J CYS 77  SG ? ? K CYS 94  K CYS 99  1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf38 disulf ?   ? J CYS 84  SG  ? ? ? 1_555 J CYS 95  SG ? ? K CYS 106 K CYS 117 1_555 ? ? ? ? ? ? ? 2.051 ? ?               
disulf39 disulf ?   ? J CYS 98  SG  ? ? ? 1_555 J CYS 111 SG ? ? K CYS 120 K CYS 133 1_555 ? ? ? ? ? ? ? 2.051 ? ?               
disulf40 disulf ?   ? J CYS 117 SG  ? ? ? 1_555 J CYS 136 SG ? ? K CYS 139 K CYS 158 1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf41 disulf ?   ? K CYS 9   SG  ? ? ? 1_555 K CYS 23  SG ? ? L CYS 31  L CYS 45  1_555 ? ? ? ? ? ? ? 1.983 ? ?               
disulf42 disulf ?   ? K CYS 26  SG  ? ? ? 1_555 K CYS 40  SG ? ? L CYS 48  L CYS 62  1_555 ? ? ? ? ? ? ? 2.048 ? ?               
disulf43 disulf ?   ? K CYS 43  SG  ? ? ? 1_555 K CYS 56  SG ? ? L CYS 65  L CYS 78  1_555 ? ? ? ? ? ? ? 2.065 ? ?               
disulf44 disulf ?   ? K CYS 46  SG  ? ? ? 1_555 K CYS 64  SG ? ? L CYS 68  L CYS 86  1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf45 disulf ?   ? K CYS 66  SG  ? ? ? 1_555 K CYS 80  SG ? ? L CYS 88  L CYS 102 1_555 ? ? ? ? ? ? ? 2.065 ? ?               
disulf46 disulf ?   ? K CYS 72  SG  ? ? ? 1_555 K CYS 77  SG ? ? L CYS 94  L CYS 99  1_555 ? ? ? ? ? ? ? 2.047 ? ?               
disulf47 disulf ?   ? K CYS 84  SG  ? ? ? 1_555 K CYS 95  SG ? ? L CYS 106 L CYS 117 1_555 ? ? ? ? ? ? ? 2.065 ? ?               
disulf48 disulf ?   ? K CYS 98  SG  ? ? ? 1_555 K CYS 111 SG ? ? L CYS 120 L CYS 133 1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf49 disulf ?   ? K CYS 117 SG  ? ? ? 1_555 K CYS 136 SG ? ? L CYS 139 L CYS 158 1_555 ? ? ? ? ? ? ? 1.959 ? ?               
disulf50 disulf ?   ? L CYS 6   SG  ? ? ? 1_555 L CYS 15  SG ? ? I CYS 28  I CYS 37  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf51 disulf ?   ? L CYS 9   SG  ? ? ? 1_555 L CYS 23  SG ? ? I CYS 31  I CYS 45  1_555 ? ? ? ? ? ? ? 2.043 ? ?               
disulf52 disulf ?   ? L CYS 26  SG  ? ? ? 1_555 L CYS 40  SG ? ? I CYS 48  I CYS 62  1_555 ? ? ? ? ? ? ? 2.052 ? ?               
disulf53 disulf ?   ? L CYS 43  SG  ? ? ? 1_555 L CYS 56  SG ? ? I CYS 65  I CYS 78  1_555 ? ? ? ? ? ? ? 2.074 ? ?               
disulf54 disulf ?   ? L CYS 46  SG  ? ? ? 1_555 L CYS 64  SG ? ? I CYS 68  I CYS 86  1_555 ? ? ? ? ? ? ? 2.047 ? ?               
disulf55 disulf ?   ? L CYS 66  SG  ? ? ? 1_555 L CYS 80  SG ? ? I CYS 88  I CYS 102 1_555 ? ? ? ? ? ? ? 2.055 ? ?               
disulf56 disulf ?   ? L CYS 72  SG  ? ? ? 1_555 L CYS 77  SG ? ? I CYS 94  I CYS 99  1_555 ? ? ? ? ? ? ? 2.050 ? ?               
disulf57 disulf ?   ? L CYS 84  SG  ? ? ? 1_555 L CYS 95  SG ? ? I CYS 106 I CYS 117 1_555 ? ? ? ? ? ? ? 2.047 ? ?               
disulf58 disulf ?   ? L CYS 98  SG  ? ? ? 1_555 L CYS 111 SG ? ? I CYS 120 I CYS 133 1_555 ? ? ? ? ? ? ? 2.053 ? ?               
disulf59 disulf ?   ? L CYS 117 SG  ? ? ? 1_555 L CYS 136 SG ? ? I CYS 139 I CYS 158 1_555 ? ? ? ? ? ? ? 2.065 ? ?               
covale1  covale one ? G ASN 127 ND2 ? ? ? 1_555 M NAG .   C1 ? ? G ASN 149 G NAG 500 1_555 ? ? ? ? ? ? ? 1.449 ? N-Glycosylation 
covale2  covale one ? H ASN 127 ND2 ? ? ? 1_555 N NAG .   C1 ? ? H ASN 149 H NAG 501 1_555 ? ? ? ? ? ? ? 1.450 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLN 89 A . ? GLN 168 A PRO 90 A ? PRO 169 A 1 3.42 
2 GLN 89 B . ? GLN 168 B PRO 90 B ? PRO 169 B 1 6.14 
3 GLN 89 C . ? GLN 168 C PRO 90 C ? PRO 169 C 1 5.58 
4 GLN 89 D . ? GLN 168 D PRO 90 D ? PRO 169 D 1 6.40 
5 GLN 89 E . ? GLN 168 E PRO 90 E ? PRO 169 E 1 5.78 
6 GLN 89 F . ? GLN 168 F PRO 90 F ? PRO 169 F 1 1.41 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 5 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 3 ? 
AA6 ? 3 ? 
AA7 ? 5 ? 
AA8 ? 4 ? 
AA9 ? 4 ? 
AB1 ? 3 ? 
AB2 ? 3 ? 
AB3 ? 5 ? 
AB4 ? 4 ? 
AB5 ? 4 ? 
AB6 ? 3 ? 
AB7 ? 3 ? 
AB8 ? 5 ? 
AB9 ? 4 ? 
AC1 ? 4 ? 
AC2 ? 3 ? 
AC3 ? 3 ? 
AC4 ? 5 ? 
AC5 ? 4 ? 
AC6 ? 4 ? 
AC7 ? 3 ? 
AC8 ? 3 ? 
AC9 ? 5 ? 
AD1 ? 4 ? 
AD2 ? 4 ? 
AD3 ? 3 ? 
AD4 ? 2 ? 
AD5 ? 2 ? 
AD6 ? 2 ? 
AD7 ? 2 ? 
AD8 ? 2 ? 
AD9 ? 2 ? 
AE1 ? 2 ? 
AE2 ? 2 ? 
AE3 ? 2 ? 
AE4 ? 2 ? 
AE5 ? 2 ? 
AE6 ? 2 ? 
AE7 ? 2 ? 
AE8 ? 2 ? 
AE9 ? 2 ? 
AF1 ? 2 ? 
AF2 ? 2 ? 
AF3 ? 2 ? 
AF4 ? 2 ? 
AF5 ? 2 ? 
AF6 ? 2 ? 
AF7 ? 2 ? 
AF8 ? 2 ? 
AF9 ? 2 ? 
AG1 ? 2 ? 
AG2 ? 2 ? 
AG3 ? 2 ? 
AG4 ? 2 ? 
AG5 ? 2 ? 
AG6 ? 2 ? 
AG7 ? 2 ? 
AG8 ? 2 ? 
AG9 ? 2 ? 
AH1 ? 2 ? 
AH2 ? 2 ? 
AH3 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA7 4 5 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB3 4 5 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB8 3 4 ? anti-parallel 
AB8 4 5 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC4 4 5 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AC9 3 4 ? anti-parallel 
AC9 4 5 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD2 3 4 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE8 1 2 ? anti-parallel 
AE9 1 2 ? anti-parallel 
AF1 1 2 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF3 1 2 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF6 1 2 ? anti-parallel 
AF7 1 2 ? anti-parallel 
AF8 1 2 ? anti-parallel 
AF9 1 2 ? anti-parallel 
AG1 1 2 ? anti-parallel 
AG2 1 2 ? anti-parallel 
AG3 1 2 ? anti-parallel 
AG4 1 2 ? anti-parallel 
AG5 1 2 ? anti-parallel 
AG6 1 2 ? anti-parallel 
AG7 1 2 ? anti-parallel 
AG8 1 2 ? anti-parallel 
AG9 1 2 ? anti-parallel 
AH1 1 2 ? anti-parallel 
AH2 1 2 ? anti-parallel 
AH3 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 TRP A 30  ? TYR A 31  ? TRP A 109 TYR A 110 
AA1 2 PHE A 13  ? ALA A 18  ? PHE A 92  ALA A 97  
AA1 3 SER A 40  ? LEU A 41  ? SER A 119 LEU A 120 
AA2 1 TRP A 30  ? TYR A 31  ? TRP A 109 TYR A 110 
AA2 2 PHE A 13  ? ALA A 18  ? PHE A 92  ALA A 97  
AA2 3 VAL A 155 ? ARG A 160 ? VAL A 234 ARG A 239 
AA2 4 GLY A 60  ? GLN A 67  ? GLY A 139 GLN A 146 
AA2 5 PHE A 120 ? LEU A 127 ? PHE A 199 LEU A 206 
AA3 1 GLY A 26  ? PRO A 27  ? GLY A 105 PRO A 106 
AA3 2 GLN A 131 ? ARG A 142 ? GLN A 210 ARG A 221 
AA3 3 GLU A 53  ? VAL A 56  ? GLU A 132 VAL A 135 
AA3 4 LEU A 45  ? LYS A 48  ? LEU A 124 LYS A 127 
AA4 1 GLY A 26  ? PRO A 27  ? GLY A 105 PRO A 106 
AA4 2 GLN A 131 ? ARG A 142 ? GLN A 210 ARG A 221 
AA4 3 SER A 79  ? GLN A 89  ? SER A 158 GLN A 168 
AA4 4 LEU A 100 ? LEU A 106 ? LEU A 179 LEU A 185 
AA5 1 SER A 116 ? ALA A 117 ? SER A 195 ALA A 196 
AA5 2 LEU A 70  ? ARG A 72  ? LEU A 149 ARG A 151 
AA5 3 TRP A 147 ? LEU A 149 ? TRP A 226 LEU A 228 
AA6 1 TRP B 30  ? TYR B 31  ? TRP B 109 TYR B 110 
AA6 2 PHE B 13  ? ALA B 18  ? PHE B 92  ALA B 97  
AA6 3 SER B 40  ? LEU B 41  ? SER B 119 LEU B 120 
AA7 1 TRP B 30  ? TYR B 31  ? TRP B 109 TYR B 110 
AA7 2 PHE B 13  ? ALA B 18  ? PHE B 92  ALA B 97  
AA7 3 VAL B 155 ? ARG B 160 ? VAL B 234 ARG B 239 
AA7 4 GLY B 60  ? GLN B 67  ? GLY B 139 GLN B 146 
AA7 5 PHE B 120 ? LEU B 127 ? PHE B 199 LEU B 206 
AA8 1 GLY B 26  ? PRO B 27  ? GLY B 105 PRO B 106 
AA8 2 GLN B 131 ? ARG B 142 ? GLN B 210 ARG B 221 
AA8 3 GLU B 53  ? VAL B 56  ? GLU B 132 VAL B 135 
AA8 4 LEU B 45  ? LYS B 48  ? LEU B 124 LYS B 127 
AA9 1 GLY B 26  ? PRO B 27  ? GLY B 105 PRO B 106 
AA9 2 GLN B 131 ? ARG B 142 ? GLN B 210 ARG B 221 
AA9 3 SER B 79  ? GLN B 89  ? SER B 158 GLN B 168 
AA9 4 LEU B 100 ? LEU B 106 ? LEU B 179 LEU B 185 
AB1 1 SER B 116 ? ALA B 117 ? SER B 195 ALA B 196 
AB1 2 LEU B 70  ? ARG B 72  ? LEU B 149 ARG B 151 
AB1 3 TRP B 147 ? LEU B 149 ? TRP B 226 LEU B 228 
AB2 1 TRP C 30  ? TYR C 31  ? TRP C 109 TYR C 110 
AB2 2 PHE C 13  ? ALA C 18  ? PHE C 92  ALA C 97  
AB2 3 SER C 40  ? LEU C 41  ? SER C 119 LEU C 120 
AB3 1 TRP C 30  ? TYR C 31  ? TRP C 109 TYR C 110 
AB3 2 PHE C 13  ? ALA C 18  ? PHE C 92  ALA C 97  
AB3 3 VAL C 155 ? ARG C 160 ? VAL C 234 ARG C 239 
AB3 4 GLY C 60  ? GLN C 67  ? GLY C 139 GLN C 146 
AB3 5 PHE C 120 ? LEU C 127 ? PHE C 199 LEU C 206 
AB4 1 GLY C 26  ? PRO C 27  ? GLY C 105 PRO C 106 
AB4 2 GLN C 131 ? ARG C 142 ? GLN C 210 ARG C 221 
AB4 3 GLU C 53  ? VAL C 56  ? GLU C 132 VAL C 135 
AB4 4 LEU C 45  ? LYS C 48  ? LEU C 124 LYS C 127 
AB5 1 GLY C 26  ? PRO C 27  ? GLY C 105 PRO C 106 
AB5 2 GLN C 131 ? ARG C 142 ? GLN C 210 ARG C 221 
AB5 3 SER C 79  ? GLN C 89  ? SER C 158 GLN C 168 
AB5 4 LEU C 100 ? LEU C 106 ? LEU C 179 LEU C 185 
AB6 1 SER C 116 ? ALA C 117 ? SER C 195 ALA C 196 
AB6 2 LEU C 70  ? ARG C 72  ? LEU C 149 ARG C 151 
AB6 3 TRP C 147 ? LEU C 149 ? TRP C 226 LEU C 228 
AB7 1 TRP D 30  ? TYR D 31  ? TRP D 109 TYR D 110 
AB7 2 PHE D 13  ? ALA D 18  ? PHE D 92  ALA D 97  
AB7 3 SER D 40  ? LEU D 41  ? SER D 119 LEU D 120 
AB8 1 TRP D 30  ? TYR D 31  ? TRP D 109 TYR D 110 
AB8 2 PHE D 13  ? ALA D 18  ? PHE D 92  ALA D 97  
AB8 3 VAL D 155 ? ARG D 160 ? VAL D 234 ARG D 239 
AB8 4 GLY D 60  ? GLN D 67  ? GLY D 139 GLN D 146 
AB8 5 PHE D 120 ? LEU D 127 ? PHE D 199 LEU D 206 
AB9 1 GLY D 26  ? PRO D 27  ? GLY D 105 PRO D 106 
AB9 2 GLN D 131 ? ARG D 142 ? GLN D 210 ARG D 221 
AB9 3 GLU D 53  ? VAL D 56  ? GLU D 132 VAL D 135 
AB9 4 LEU D 45  ? LYS D 48  ? LEU D 124 LYS D 127 
AC1 1 GLY D 26  ? PRO D 27  ? GLY D 105 PRO D 106 
AC1 2 GLN D 131 ? ARG D 142 ? GLN D 210 ARG D 221 
AC1 3 SER D 79  ? GLN D 89  ? SER D 158 GLN D 168 
AC1 4 LEU D 100 ? LEU D 106 ? LEU D 179 LEU D 185 
AC2 1 SER D 116 ? ALA D 117 ? SER D 195 ALA D 196 
AC2 2 LEU D 70  ? ARG D 72  ? LEU D 149 ARG D 151 
AC2 3 TRP D 147 ? LEU D 149 ? TRP D 226 LEU D 228 
AC3 1 TRP E 30  ? TYR E 31  ? TRP E 109 TYR E 110 
AC3 2 PHE E 13  ? ALA E 18  ? PHE E 92  ALA E 97  
AC3 3 SER E 40  ? LEU E 41  ? SER E 119 LEU E 120 
AC4 1 TRP E 30  ? TYR E 31  ? TRP E 109 TYR E 110 
AC4 2 PHE E 13  ? ALA E 18  ? PHE E 92  ALA E 97  
AC4 3 VAL E 155 ? ARG E 160 ? VAL E 234 ARG E 239 
AC4 4 GLY E 60  ? GLN E 67  ? GLY E 139 GLN E 146 
AC4 5 PHE E 120 ? LEU E 127 ? PHE E 199 LEU E 206 
AC5 1 GLY E 26  ? PRO E 27  ? GLY E 105 PRO E 106 
AC5 2 GLN E 131 ? ARG E 142 ? GLN E 210 ARG E 221 
AC5 3 GLU E 53  ? VAL E 56  ? GLU E 132 VAL E 135 
AC5 4 LEU E 45  ? LYS E 48  ? LEU E 124 LYS E 127 
AC6 1 GLY E 26  ? PRO E 27  ? GLY E 105 PRO E 106 
AC6 2 GLN E 131 ? ARG E 142 ? GLN E 210 ARG E 221 
AC6 3 SER E 79  ? GLN E 89  ? SER E 158 GLN E 168 
AC6 4 LEU E 100 ? LEU E 106 ? LEU E 179 LEU E 185 
AC7 1 SER E 116 ? ALA E 117 ? SER E 195 ALA E 196 
AC7 2 LEU E 70  ? ARG E 72  ? LEU E 149 ARG E 151 
AC7 3 TRP E 147 ? LEU E 149 ? TRP E 226 LEU E 228 
AC8 1 TRP F 30  ? TYR F 31  ? TRP F 109 TYR F 110 
AC8 2 PHE F 13  ? ALA F 18  ? PHE F 92  ALA F 97  
AC8 3 SER F 40  ? LEU F 41  ? SER F 119 LEU F 120 
AC9 1 TRP F 30  ? TYR F 31  ? TRP F 109 TYR F 110 
AC9 2 PHE F 13  ? ALA F 18  ? PHE F 92  ALA F 97  
AC9 3 VAL F 155 ? ARG F 160 ? VAL F 234 ARG F 239 
AC9 4 GLY F 60  ? GLN F 67  ? GLY F 139 GLN F 146 
AC9 5 PHE F 120 ? LEU F 127 ? PHE F 199 LEU F 206 
AD1 1 GLY F 26  ? PRO F 27  ? GLY F 105 PRO F 106 
AD1 2 GLN F 131 ? ARG F 142 ? GLN F 210 ARG F 221 
AD1 3 GLU F 53  ? VAL F 56  ? GLU F 132 VAL F 135 
AD1 4 LEU F 45  ? LYS F 48  ? LEU F 124 LYS F 127 
AD2 1 GLY F 26  ? PRO F 27  ? GLY F 105 PRO F 106 
AD2 2 GLN F 131 ? ARG F 142 ? GLN F 210 ARG F 221 
AD2 3 SER F 79  ? GLN F 89  ? SER F 158 GLN F 168 
AD2 4 LEU F 100 ? LEU F 106 ? LEU F 179 LEU F 185 
AD3 1 SER F 116 ? ALA F 117 ? SER F 195 ALA F 196 
AD3 2 LEU F 70  ? ARG F 72  ? LEU F 149 ARG F 151 
AD3 3 TRP F 147 ? LEU F 149 ? TRP F 226 LEU F 228 
AD4 1 THR G 13  ? ASP G 16  ? THR G 35  ASP G 38  
AD4 2 ILE G 22  ? PRO G 25  ? ILE G 44  PRO G 47  
AD5 1 SER G 30  ? PHE G 31  ? SER G 52  PHE G 53  
AD5 2 ASP G 41  ? ILE G 42  ? ASP G 63  ILE G 64  
AD6 1 PHE G 50  ? LYS G 54  ? PHE G 72  LYS G 76  
AD6 2 GLU G 63  ? CYS G 66  ? GLU G 85  CYS G 88  
AD7 1 PHE G 70  ? LEU G 73  ? PHE G 92  LEU G 95  
AD7 2 MET G 79  ? GLN G 82  ? MET G 101 GLN G 104 
AD8 1 GLN G 88  ? THR G 91  ? GLN G 110 THR G 113 
AD8 2 GLY G 94  ? ASP G 97  ? GLY G 116 ASP G 119 
AD9 1 THR G 102 ? PHE G 103 ? THR G 124 PHE G 125 
AD9 2 ARG G 112 ? PRO G 113 ? ARG G 134 PRO G 135 
AE1 1 THR H 13  ? ASP H 16  ? THR H 35  ASP H 38  
AE1 2 ILE H 22  ? PRO H 25  ? ILE H 44  PRO H 47  
AE2 1 SER H 30  ? PHE H 31  ? SER H 52  PHE H 53  
AE2 2 ASP H 41  ? ILE H 42  ? ASP H 63  ILE H 64  
AE3 1 PHE H 50  ? LYS H 54  ? PHE H 72  LYS H 76  
AE3 2 GLU H 63  ? CYS H 66  ? GLU H 85  CYS H 88  
AE4 1 PHE H 70  ? LEU H 73  ? PHE H 92  LEU H 95  
AE4 2 MET H 79  ? GLN H 82  ? MET H 101 GLN H 104 
AE5 1 GLN H 88  ? THR H 91  ? GLN H 110 THR H 113 
AE5 2 GLY H 94  ? ASP H 97  ? GLY H 116 ASP H 119 
AE6 1 THR H 102 ? PHE H 103 ? THR H 124 PHE H 125 
AE6 2 ARG H 112 ? PRO H 113 ? ARG H 134 PRO H 135 
AE7 1 THR I 13  ? ASP I 16  ? THR J 35  ASP J 38  
AE7 2 ILE I 22  ? PRO I 25  ? ILE J 44  PRO J 47  
AE8 1 SER I 30  ? PHE I 31  ? SER J 52  PHE J 53  
AE8 2 ASP I 41  ? ILE I 42  ? ASP J 63  ILE J 64  
AE9 1 PHE I 50  ? LYS I 54  ? PHE J 72  LYS J 76  
AE9 2 GLU I 63  ? CYS I 66  ? GLU J 85  CYS J 88  
AF1 1 PHE I 70  ? LEU I 73  ? PHE J 92  LEU J 95  
AF1 2 MET I 79  ? GLN I 82  ? MET J 101 GLN J 104 
AF2 1 GLN I 88  ? THR I 91  ? GLN J 110 THR J 113 
AF2 2 GLY I 94  ? ASP I 97  ? GLY J 116 ASP J 119 
AF3 1 THR I 102 ? PHE I 103 ? THR J 124 PHE J 125 
AF3 2 ARG I 112 ? PRO I 113 ? ARG J 134 PRO J 135 
AF4 1 THR J 13  ? ASP J 16  ? THR K 35  ASP K 38  
AF4 2 ILE J 22  ? PRO J 25  ? ILE K 44  PRO K 47  
AF5 1 SER J 30  ? PHE J 31  ? SER K 52  PHE K 53  
AF5 2 ASP J 41  ? ILE J 42  ? ASP K 63  ILE K 64  
AF6 1 PHE J 50  ? LYS J 54  ? PHE K 72  LYS K 76  
AF6 2 GLU J 63  ? CYS J 66  ? GLU K 85  CYS K 88  
AF7 1 PHE J 70  ? LEU J 73  ? PHE K 92  LEU K 95  
AF7 2 MET J 79  ? GLN J 82  ? MET K 101 GLN K 104 
AF8 1 GLN J 88  ? THR J 91  ? GLN K 110 THR K 113 
AF8 2 GLY J 94  ? ASP J 97  ? GLY K 116 ASP K 119 
AF9 1 THR J 102 ? PHE J 103 ? THR K 124 PHE K 125 
AF9 2 ARG J 112 ? PRO J 113 ? ARG K 134 PRO K 135 
AG1 1 THR K 13  ? ASP K 16  ? THR L 35  ASP L 38  
AG1 2 ILE K 22  ? PRO K 25  ? ILE L 44  PRO L 47  
AG2 1 SER K 30  ? PHE K 31  ? SER L 52  PHE L 53  
AG2 2 ASP K 41  ? ILE K 42  ? ASP L 63  ILE L 64  
AG3 1 PHE K 50  ? LYS K 54  ? PHE L 72  LYS L 76  
AG3 2 GLU K 63  ? CYS K 66  ? GLU L 85  CYS L 88  
AG4 1 PHE K 70  ? LEU K 73  ? PHE L 92  LEU L 95  
AG4 2 MET K 79  ? GLN K 82  ? MET L 101 GLN L 104 
AG5 1 GLN K 88  ? THR K 91  ? GLN L 110 THR L 113 
AG5 2 GLY K 94  ? ASP K 97  ? GLY L 116 ASP L 119 
AG6 1 THR K 102 ? PHE K 103 ? THR L 124 PHE L 125 
AG6 2 ARG K 112 ? PRO K 113 ? ARG L 134 PRO L 135 
AG7 1 THR L 13  ? ASP L 16  ? THR I 35  ASP I 38  
AG7 2 ILE L 22  ? PRO L 25  ? ILE I 44  PRO I 47  
AG8 1 SER L 30  ? PHE L 31  ? SER I 52  PHE I 53  
AG8 2 ASP L 41  ? ILE L 42  ? ASP I 63  ILE I 64  
AG9 1 PHE L 50  ? LYS L 54  ? PHE I 72  LYS I 76  
AG9 2 GLU L 63  ? CYS L 66  ? GLU I 85  CYS I 88  
AH1 1 PHE L 70  ? LEU L 73  ? PHE I 92  LEU I 95  
AH1 2 MET L 79  ? GLN L 82  ? MET I 101 GLN I 104 
AH2 1 GLN L 88  ? THR L 91  ? GLN I 110 THR I 113 
AH2 2 GLY L 94  ? ASP L 97  ? GLY I 116 ASP I 119 
AH3 1 THR L 102 ? PHE L 103 ? THR I 124 PHE I 125 
AH3 2 ARG L 112 ? PRO L 113 ? ARG I 134 PRO I 135 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O TYR A 31  ? O TYR A 110 N VAL A 17  ? N VAL A 96  
AA1 2 3 N GLN A 15  ? N GLN A 94  O SER A 40  ? O SER A 119 
AA2 1 2 O TYR A 31  ? O TYR A 110 N VAL A 17  ? N VAL A 96  
AA2 2 3 N LEU A 16  ? N LEU A 95  O LEU A 156 ? O LEU A 235 
AA2 3 4 O GLY A 157 ? O GLY A 236 N PHE A 65  ? N PHE A 144 
AA2 4 5 N GLY A 60  ? N GLY A 139 O LEU A 127 ? O LEU A 206 
AA3 1 2 N GLY A 26  ? N GLY A 105 O LEU A 137 ? O LEU A 216 
AA3 2 3 O LEU A 133 ? O LEU A 212 N LEU A 54  ? N LEU A 133 
AA3 3 4 O VAL A 55  ? O VAL A 134 N SER A 46  ? N SER A 125 
AA4 1 2 N GLY A 26  ? N GLY A 105 O LEU A 137 ? O LEU A 216 
AA4 2 3 O HIS A 138 ? O HIS A 217 N SER A 83  ? N SER A 162 
AA4 3 4 N GLY A 80  ? N GLY A 159 O LEU A 106 ? O LEU A 185 
AA5 1 2 O ALA A 117 ? O ALA A 196 N LEU A 70  ? N LEU A 149 
AA5 2 3 N ARG A 71  ? N ARG A 150 O GLN A 148 ? O GLN A 227 
AA6 1 2 O TYR B 31  ? O TYR B 110 N VAL B 17  ? N VAL B 96  
AA6 2 3 N GLN B 15  ? N GLN B 94  O SER B 40  ? O SER B 119 
AA7 1 2 O TYR B 31  ? O TYR B 110 N VAL B 17  ? N VAL B 96  
AA7 2 3 N LEU B 16  ? N LEU B 95  O LEU B 156 ? O LEU B 235 
AA7 3 4 O GLY B 157 ? O GLY B 236 N PHE B 65  ? N PHE B 144 
AA7 4 5 N GLY B 60  ? N GLY B 139 O LEU B 127 ? O LEU B 206 
AA8 1 2 N GLY B 26  ? N GLY B 105 O LEU B 137 ? O LEU B 216 
AA8 2 3 O LEU B 133 ? O LEU B 212 N LEU B 54  ? N LEU B 133 
AA8 3 4 O VAL B 55  ? O VAL B 134 N SER B 46  ? N SER B 125 
AA9 1 2 N GLY B 26  ? N GLY B 105 O LEU B 137 ? O LEU B 216 
AA9 2 3 O HIS B 138 ? O HIS B 217 N SER B 83  ? N SER B 162 
AA9 3 4 N GLY B 80  ? N GLY B 159 O LEU B 106 ? O LEU B 185 
AB1 1 2 O ALA B 117 ? O ALA B 196 N LEU B 70  ? N LEU B 149 
AB1 2 3 N ARG B 71  ? N ARG B 150 O GLN B 148 ? O GLN B 227 
AB2 1 2 O TYR C 31  ? O TYR C 110 N VAL C 17  ? N VAL C 96  
AB2 2 3 N GLN C 15  ? N GLN C 94  O SER C 40  ? O SER C 119 
AB3 1 2 O TYR C 31  ? O TYR C 110 N VAL C 17  ? N VAL C 96  
AB3 2 3 N LEU C 16  ? N LEU C 95  O LEU C 156 ? O LEU C 235 
AB3 3 4 O GLY C 157 ? O GLY C 236 N PHE C 65  ? N PHE C 144 
AB3 4 5 N GLY C 60  ? N GLY C 139 O LEU C 127 ? O LEU C 206 
AB4 1 2 N GLY C 26  ? N GLY C 105 O LEU C 137 ? O LEU C 216 
AB4 2 3 O LEU C 133 ? O LEU C 212 N LEU C 54  ? N LEU C 133 
AB4 3 4 O VAL C 55  ? O VAL C 134 N SER C 46  ? N SER C 125 
AB5 1 2 N GLY C 26  ? N GLY C 105 O LEU C 137 ? O LEU C 216 
AB5 2 3 O HIS C 138 ? O HIS C 217 N SER C 83  ? N SER C 162 
AB5 3 4 N GLY C 80  ? N GLY C 159 O LEU C 106 ? O LEU C 185 
AB6 1 2 O ALA C 117 ? O ALA C 196 N LEU C 70  ? N LEU C 149 
AB6 2 3 N ARG C 71  ? N ARG C 150 O GLN C 148 ? O GLN C 227 
AB7 1 2 O TYR D 31  ? O TYR D 110 N VAL D 17  ? N VAL D 96  
AB7 2 3 N GLN D 15  ? N GLN D 94  O SER D 40  ? O SER D 119 
AB8 1 2 O TYR D 31  ? O TYR D 110 N VAL D 17  ? N VAL D 96  
AB8 2 3 N LEU D 16  ? N LEU D 95  O LEU D 156 ? O LEU D 235 
AB8 3 4 O GLY D 157 ? O GLY D 236 N PHE D 65  ? N PHE D 144 
AB8 4 5 N GLY D 60  ? N GLY D 139 O LEU D 127 ? O LEU D 206 
AB9 1 2 N GLY D 26  ? N GLY D 105 O LEU D 137 ? O LEU D 216 
AB9 2 3 O LEU D 133 ? O LEU D 212 N LEU D 54  ? N LEU D 133 
AB9 3 4 O VAL D 55  ? O VAL D 134 N SER D 46  ? N SER D 125 
AC1 1 2 N GLY D 26  ? N GLY D 105 O LEU D 137 ? O LEU D 216 
AC1 2 3 O HIS D 138 ? O HIS D 217 N SER D 83  ? N SER D 162 
AC1 3 4 N GLY D 80  ? N GLY D 159 O LEU D 106 ? O LEU D 185 
AC2 1 2 O ALA D 117 ? O ALA D 196 N LEU D 70  ? N LEU D 149 
AC2 2 3 N ARG D 71  ? N ARG D 150 O GLN D 148 ? O GLN D 227 
AC3 1 2 O TYR E 31  ? O TYR E 110 N VAL E 17  ? N VAL E 96  
AC3 2 3 N GLN E 15  ? N GLN E 94  O SER E 40  ? O SER E 119 
AC4 1 2 O TYR E 31  ? O TYR E 110 N VAL E 17  ? N VAL E 96  
AC4 2 3 N LEU E 16  ? N LEU E 95  O LEU E 156 ? O LEU E 235 
AC4 3 4 O GLY E 157 ? O GLY E 236 N PHE E 65  ? N PHE E 144 
AC4 4 5 N GLY E 60  ? N GLY E 139 O LEU E 127 ? O LEU E 206 
AC5 1 2 N GLY E 26  ? N GLY E 105 O LEU E 137 ? O LEU E 216 
AC5 2 3 O LEU E 133 ? O LEU E 212 N LEU E 54  ? N LEU E 133 
AC5 3 4 O VAL E 55  ? O VAL E 134 N SER E 46  ? N SER E 125 
AC6 1 2 N GLY E 26  ? N GLY E 105 O LEU E 137 ? O LEU E 216 
AC6 2 3 O HIS E 138 ? O HIS E 217 N SER E 83  ? N SER E 162 
AC6 3 4 N GLY E 80  ? N GLY E 159 O LEU E 106 ? O LEU E 185 
AC7 1 2 O ALA E 117 ? O ALA E 196 N LEU E 70  ? N LEU E 149 
AC7 2 3 N ARG E 71  ? N ARG E 150 O GLN E 148 ? O GLN E 227 
AC8 1 2 O TYR F 31  ? O TYR F 110 N VAL F 17  ? N VAL F 96  
AC8 2 3 N GLN F 15  ? N GLN F 94  O SER F 40  ? O SER F 119 
AC9 1 2 O TYR F 31  ? O TYR F 110 N VAL F 17  ? N VAL F 96  
AC9 2 3 N LEU F 16  ? N LEU F 95  O LEU F 156 ? O LEU F 235 
AC9 3 4 O GLY F 157 ? O GLY F 236 N PHE F 65  ? N PHE F 144 
AC9 4 5 N GLY F 60  ? N GLY F 139 O LEU F 127 ? O LEU F 206 
AD1 1 2 N GLY F 26  ? N GLY F 105 O LEU F 137 ? O LEU F 216 
AD1 2 3 O LEU F 133 ? O LEU F 212 N LEU F 54  ? N LEU F 133 
AD1 3 4 O VAL F 55  ? O VAL F 134 N SER F 46  ? N SER F 125 
AD2 1 2 N GLY F 26  ? N GLY F 105 O LEU F 137 ? O LEU F 216 
AD2 2 3 O HIS F 138 ? O HIS F 217 N SER F 83  ? N SER F 162 
AD2 3 4 N GLY F 80  ? N GLY F 159 O LEU F 106 ? O LEU F 185 
AD3 1 2 O ALA F 117 ? O ALA F 196 N LEU F 70  ? N LEU F 149 
AD3 2 3 N ARG F 71  ? N ARG F 150 O GLN F 148 ? O GLN F 227 
AD4 1 2 N PHE G 14  ? N PHE G 36  O SER G 24  ? O SER G 46  
AD5 1 2 N PHE G 31  ? N PHE G 53  O ASP G 41  ? O ASP G 63  
AD6 1 2 N ARG G 51  ? N ARG G 73  O ASP G 65  ? O ASP G 87  
AD7 1 2 N HIS G 71  ? N HIS G 93  O GLU G 81  ? O GLU G 103 
AD8 1 2 N GLU G 89  ? N GLU G 111 O LYS G 96  ? O LYS G 118 
AD9 1 2 N PHE G 103 ? N PHE G 125 O ARG G 112 ? O ARG G 134 
AE1 1 2 N PHE H 14  ? N PHE H 36  O SER H 24  ? O SER H 46  
AE2 1 2 N PHE H 31  ? N PHE H 53  O ASP H 41  ? O ASP H 63  
AE3 1 2 N ARG H 51  ? N ARG H 73  O ASP H 65  ? O ASP H 87  
AE4 1 2 N HIS H 71  ? N HIS H 93  O GLU H 81  ? O GLU H 103 
AE5 1 2 N GLU H 89  ? N GLU H 111 O LYS H 96  ? O LYS H 118 
AE6 1 2 N PHE H 103 ? N PHE H 125 O ARG H 112 ? O ARG H 134 
AE7 1 2 N PHE I 14  ? N PHE J 36  O SER I 24  ? O SER J 46  
AE8 1 2 N PHE I 31  ? N PHE J 53  O ASP I 41  ? O ASP J 63  
AE9 1 2 N ARG I 51  ? N ARG J 73  O ASP I 65  ? O ASP J 87  
AF1 1 2 N HIS I 71  ? N HIS J 93  O GLU I 81  ? O GLU J 103 
AF2 1 2 N GLU I 89  ? N GLU J 111 O LYS I 96  ? O LYS J 118 
AF3 1 2 N PHE I 103 ? N PHE J 125 O ARG I 112 ? O ARG J 134 
AF4 1 2 N PHE J 14  ? N PHE K 36  O SER J 24  ? O SER K 46  
AF5 1 2 N PHE J 31  ? N PHE K 53  O ASP J 41  ? O ASP K 63  
AF6 1 2 N ARG J 51  ? N ARG K 73  O ASP J 65  ? O ASP K 87  
AF7 1 2 N HIS J 71  ? N HIS K 93  O GLU J 81  ? O GLU K 103 
AF8 1 2 N GLU J 89  ? N GLU K 111 O LYS J 96  ? O LYS K 118 
AF9 1 2 N PHE J 103 ? N PHE K 125 O ARG J 112 ? O ARG K 134 
AG1 1 2 N PHE K 14  ? N PHE L 36  O SER K 24  ? O SER L 46  
AG2 1 2 N PHE K 31  ? N PHE L 53  O ASP K 41  ? O ASP L 63  
AG3 1 2 N ARG K 51  ? N ARG L 73  O ASP K 65  ? O ASP L 87  
AG4 1 2 N HIS K 71  ? N HIS L 93  O GLU K 81  ? O GLU L 103 
AG5 1 2 N GLU K 89  ? N GLU L 111 O LYS K 96  ? O LYS L 118 
AG6 1 2 N PHE K 103 ? N PHE L 125 O ARG K 112 ? O ARG L 134 
AG7 1 2 N PHE L 14  ? N PHE I 36  O SER L 24  ? O SER I 46  
AG8 1 2 N PHE L 31  ? N PHE I 53  O ASP L 41  ? O ASP I 63  
AG9 1 2 N ARG L 51  ? N ARG I 73  O ASP L 65  ? O ASP I 87  
AH1 1 2 N HIS L 71  ? N HIS I 93  O GLU L 81  ? O GLU I 103 
AH2 1 2 N GLU L 89  ? N GLU I 111 O LYS L 96  ? O LYS I 118 
AH3 1 2 N PHE L 103 ? N PHE I 125 O ARG L 112 ? O ARG I 134 
# 
_atom_sites.entry_id                    6CU0 
_atom_sites.fract_transf_matrix[1][1]   0.013706 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002725 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008715 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008089 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . MET A 1 12  ? -25.603 -57.939  0.760   1.00 154.69 ? 91  MET A N   1 
ATOM   2     C CA  . MET A 1 12  ? -25.292 -59.126  1.631   1.00 156.35 ? 91  MET A CA  1 
ATOM   3     C C   . MET A 1 12  ? -24.851 -60.288  0.738   1.00 152.26 ? 91  MET A C   1 
ATOM   4     O O   . MET A 1 12  ? -25.670 -61.095  0.298   1.00 152.10 ? 91  MET A O   1 
ATOM   5     C CB  . MET A 1 12  ? -26.493 -59.531  2.516   1.00 155.24 ? 91  MET A CB  1 
ATOM   6     N N   . PHE A 1 13  ? -23.550 -60.334  0.463   1.00 143.21 ? 92  PHE A N   1 
ATOM   7     C CA  . PHE A 1 13  ? -22.968 -61.341  -0.414  1.00 134.35 ? 92  PHE A CA  1 
ATOM   8     C C   . PHE A 1 13  ? -21.501 -61.575  -0.113  1.00 131.47 ? 92  PHE A C   1 
ATOM   9     O O   . PHE A 1 13  ? -20.828 -60.719  0.432   1.00 132.71 ? 92  PHE A O   1 
ATOM   10    C CB  . PHE A 1 13  ? -23.108 -60.905  -1.867  1.00 134.52 ? 92  PHE A CB  1 
ATOM   11    C CG  . PHE A 1 13  ? -22.369 -59.639  -2.195  1.00 139.58 ? 92  PHE A CG  1 
ATOM   12    C CD1 . PHE A 1 13  ? -23.031 -58.414  -2.190  1.00 139.64 ? 92  PHE A CD1 1 
ATOM   13    C CD2 . PHE A 1 13  ? -21.007 -59.666  -2.517  1.00 136.84 ? 92  PHE A CD2 1 
ATOM   14    C CE1 . PHE A 1 13  ? -22.359 -57.248  -2.506  1.00 136.64 ? 92  PHE A CE1 1 
ATOM   15    C CE2 . PHE A 1 13  ? -20.333 -58.500  -2.826  1.00 136.20 ? 92  PHE A CE2 1 
ATOM   16    C CZ  . PHE A 1 13  ? -21.010 -57.287  -2.822  1.00 136.84 ? 92  PHE A CZ  1 
ATOM   17    N N   . ALA A 1 14  ? -21.006 -62.725  -0.536  1.00 131.18 ? 93  ALA A N   1 
ATOM   18    C CA  . ALA A 1 14  ? -19.612 -63.097  -0.330  1.00 129.75 ? 93  ALA A CA  1 
ATOM   19    C C   . ALA A 1 14  ? -19.082 -63.867  -1.528  1.00 123.19 ? 93  ALA A C   1 
ATOM   20    O O   . ALA A 1 14  ? -19.850 -64.446  -2.288  1.00 116.94 ? 93  ALA A O   1 
ATOM   21    C CB  . ALA A 1 14  ? -19.463 -63.925  0.937   1.00 132.72 ? 93  ALA A CB  1 
ATOM   22    N N   . GLN A 1 15  ? -17.767 -63.843  -1.695  1.00 119.93 ? 94  GLN A N   1 
ATOM   23    C CA  . GLN A 1 15  ? -17.086 -64.693  -2.662  1.00 115.32 ? 94  GLN A CA  1 
ATOM   24    C C   . GLN A 1 15  ? -15.655 -64.915  -2.204  1.00 115.99 ? 94  GLN A C   1 
ATOM   25    O O   . GLN A 1 15  ? -14.884 -63.969  -2.123  1.00 114.66 ? 94  GLN A O   1 
ATOM   26    C CB  . GLN A 1 15  ? -17.100 -64.078  -4.053  1.00 112.48 ? 94  GLN A CB  1 
ATOM   27    C CG  . GLN A 1 15  ? -16.378 -64.920  -5.087  1.00 110.44 ? 94  GLN A CG  1 
ATOM   28    C CD  . GLN A 1 15  ? -16.756 -64.570  -6.511  1.00 110.25 ? 94  GLN A CD  1 
ATOM   29    O OE1 . GLN A 1 15  ? -17.886 -64.780  -6.933  1.00 112.54 ? 94  GLN A OE1 1 
ATOM   30    N NE2 . GLN A 1 15  ? -15.807 -64.049  -7.259  1.00 109.02 ? 94  GLN A NE2 1 
ATOM   31    N N   . LEU A 1 16  ? -15.310 -66.162  -1.901  1.00 113.63 ? 95  LEU A N   1 
ATOM   32    C CA  . LEU A 1 16  ? -13.971 -66.511  -1.439  1.00 111.51 ? 95  LEU A CA  1 
ATOM   33    C C   . LEU A 1 16  ? -13.200 -67.249  -2.520  1.00 109.23 ? 95  LEU A C   1 
ATOM   34    O O   . LEU A 1 16  ? -13.791 -67.850  -3.419  1.00 111.73 ? 95  LEU A O   1 
ATOM   35    C CB  . LEU A 1 16  ? -14.066 -67.380  -0.187  1.00 112.32 ? 95  LEU A CB  1 
ATOM   36    C CG  . LEU A 1 16  ? -14.924 -66.817  0.951   1.00 113.10 ? 95  LEU A CG  1 
ATOM   37    C CD1 . LEU A 1 16  ? -14.794 -67.728  2.165   1.00 114.55 ? 95  LEU A CD1 1 
ATOM   38    C CD2 . LEU A 1 16  ? -14.555 -65.388  1.299   1.00 112.19 ? 95  LEU A CD2 1 
ATOM   39    N N   . VAL A 1 17  ? -11.877 -67.202  -2.416  1.00 105.11 ? 96  VAL A N   1 
ATOM   40    C CA  . VAL A 1 17  ? -10.985 -67.824  -3.382  1.00 101.77 ? 96  VAL A CA  1 
ATOM   41    C C   . VAL A 1 17  ? -10.102 -68.812  -2.661  1.00 100.26 ? 96  VAL A C   1 
ATOM   42    O O   . VAL A 1 17  ? -9.358  -68.427  -1.770  1.00 105.63 ? 96  VAL A O   1 
ATOM   43    C CB  . VAL A 1 17  ? -10.110 -66.760  -4.043  1.00 102.35 ? 96  VAL A CB  1 
ATOM   44    C CG1 . VAL A 1 17  ? -9.069  -67.401  -4.949  1.00 104.17 ? 96  VAL A CG1 1 
ATOM   45    C CG2 . VAL A 1 17  ? -10.988 -65.800  -4.831  1.00 105.35 ? 96  VAL A CG2 1 
ATOM   46    N N   . ALA A 1 18  ? -10.176 -70.081  -3.044  1.00 97.52  ? 97  ALA A N   1 
ATOM   47    C CA  . ALA A 1 18  ? -9.425  -71.114  -2.337  1.00 99.41  ? 97  ALA A CA  1 
ATOM   48    C C   . ALA A 1 18  ? -7.926  -70.878  -2.443  1.00 97.13  ? 97  ALA A C   1 
ATOM   49    O O   . ALA A 1 18  ? -7.429  -70.525  -3.512  1.00 95.25  ? 97  ALA A O   1 
ATOM   50    C CB  . ALA A 1 18  ? -9.774  -72.495  -2.875  1.00 102.06 ? 97  ALA A CB  1 
ATOM   51    N N   . GLN A 1 19  ? -7.237  -71.081  -1.325  1.00 97.56  ? 98  GLN A N   1 
ATOM   52    C CA  . GLN A 1 19  ? -5.788  -70.955  -1.257  1.00 103.28 ? 98  GLN A CA  1 
ATOM   53    C C   . GLN A 1 19  ? -5.077  -72.190  -1.766  1.00 100.49 ? 98  GLN A C   1 
ATOM   54    O O   . GLN A 1 19  ? -3.939  -72.105  -2.230  1.00 104.09 ? 98  GLN A O   1 
ATOM   55    C CB  . GLN A 1 19  ? -5.330  -70.728  0.187   1.00 111.30 ? 98  GLN A CB  1 
ATOM   56    C CG  . GLN A 1 19  ? -5.943  -69.535  0.897   1.00 115.01 ? 98  GLN A CG  1 
ATOM   57    C CD  . GLN A 1 19  ? -5.308  -69.310  2.253   1.00 115.77 ? 98  GLN A CD  1 
ATOM   58    O OE1 . GLN A 1 19  ? -5.960  -69.455  3.287   1.00 116.75 ? 98  GLN A OE1 1 
ATOM   59    N NE2 . GLN A 1 19  ? -4.018  -68.987  2.256   1.00 116.47 ? 98  GLN A NE2 1 
ATOM   60    N N   . ASN A 1 20  ? -5.761  -73.330  -1.713  1.00 95.19  ? 99  ASN A N   1 
ATOM   61    C CA  . ASN A 1 20  ? -5.118  -74.629  -1.866  1.00 93.91  ? 99  ASN A CA  1 
ATOM   62    C C   . ASN A 1 20  ? -4.721  -74.806  -3.319  1.00 92.15  ? 99  ASN A C   1 
ATOM   63    O O   . ASN A 1 20  ? -5.378  -74.286  -4.212  1.00 90.71  ? 99  ASN A O   1 
ATOM   64    C CB  . ASN A 1 20  ? -6.056  -75.770  -1.445  1.00 92.37  ? 99  ASN A CB  1 
ATOM   65    C CG  . ASN A 1 20  ? -6.732  -75.517  -0.123  1.00 93.75  ? 99  ASN A CG  1 
ATOM   66    O OD1 . ASN A 1 20  ? -6.352  -76.056  0.909   1.00 98.50  ? 99  ASN A OD1 1 
ATOM   67    N ND2 . ASN A 1 20  ? -7.746  -74.682  -0.145  1.00 96.65  ? 99  ASN A ND2 1 
ATOM   68    N N   . VAL A 1 21  ? -3.612  -75.502  -3.542  1.00 91.96  ? 100 VAL A N   1 
ATOM   69    C CA  . VAL A 1 21  ? -3.209  -75.878  -4.908  1.00 95.51  ? 100 VAL A CA  1 
ATOM   70    C C   . VAL A 1 21  ? -3.031  -77.384  -5.080  1.00 95.86  ? 100 VAL A C   1 
ATOM   71    O O   . VAL A 1 21  ? -3.399  -77.920  -6.110  1.00 103.76 ? 100 VAL A O   1 
ATOM   72    C CB  . VAL A 1 21  ? -1.948  -75.106  -5.388  1.00 101.37 ? 100 VAL A CB  1 
ATOM   73    C CG1 . VAL A 1 21  ? -2.016  -73.636  -4.967  1.00 102.84 ? 100 VAL A CG1 1 
ATOM   74    C CG2 . VAL A 1 21  ? -0.666  -75.706  -4.854  1.00 105.97 ? 100 VAL A CG2 1 
ATOM   75    N N   . LEU A 1 22  ? -2.487  -78.059  -4.069  1.00 98.30  ? 101 LEU A N   1 
ATOM   76    C CA  . LEU A 1 22  ? -2.319  -79.496  -4.121  1.00 101.12 ? 101 LEU A CA  1 
ATOM   77    C C   . LEU A 1 22  ? -3.608  -80.215  -3.767  1.00 98.43  ? 101 LEU A C   1 
ATOM   78    O O   . LEU A 1 22  ? -4.334  -79.807  -2.856  1.00 97.68  ? 101 LEU A O   1 
ATOM   79    C CB  . LEU A 1 22  ? -1.199  -79.920  -3.169  1.00 101.86 ? 101 LEU A CB  1 
ATOM   80    C CG  . LEU A 1 22  ? 0.162   -79.311  -3.450  1.00 100.90 ? 101 LEU A CG  1 
ATOM   81    C CD1 . LEU A 1 22  ? 1.174   -80.083  -2.611  1.00 105.93 ? 101 LEU A CD1 1 
ATOM   82    C CD2 . LEU A 1 22  ? 0.558   -79.375  -4.913  1.00 99.36  ? 101 LEU A CD2 1 
ATOM   83    N N   . LEU A 1 23  ? -3.870  -81.299  -4.491  1.00 98.08  ? 102 LEU A N   1 
ATOM   84    C CA  . LEU A 1 23  ? -5.051  -82.117  -4.238  1.00 99.77  ? 102 LEU A CA  1 
ATOM   85    C C   . LEU A 1 23  ? -4.774  -82.963  -2.991  1.00 98.58  ? 102 LEU A C   1 
ATOM   86    O O   . LEU A 1 23  ? -4.075  -83.969  -3.050  1.00 98.58  ? 102 LEU A O   1 
ATOM   87    C CB  . LEU A 1 23  ? -5.400  -82.993  -5.456  1.00 96.63  ? 102 LEU A CB  1 
ATOM   88    C CG  . LEU A 1 23  ? -5.778  -82.204  -6.712  1.00 96.56  ? 102 LEU A CG  1 
ATOM   89    C CD1 . LEU A 1 23  ? -6.000  -83.133  -7.890  1.00 95.06  ? 102 LEU A CD1 1 
ATOM   90    C CD2 . LEU A 1 23  ? -6.970  -81.267  -6.517  1.00 97.46  ? 102 LEU A CD2 1 
ATOM   91    N N   . ILE A 1 24  ? -5.313  -82.513  -1.860  1.00 97.74  ? 103 ILE A N   1 
ATOM   92    C CA  . ILE A 1 24  ? -5.151  -83.198  -0.588  1.00 101.47 ? 103 ILE A CA  1 
ATOM   93    C C   . ILE A 1 24  ? -6.515  -83.321  0.084   1.00 101.23 ? 103 ILE A C   1 
ATOM   94    O O   . ILE A 1 24  ? -7.139  -82.313  0.377   1.00 100.13 ? 103 ILE A O   1 
ATOM   95    C CB  . ILE A 1 24  ? -4.155  -82.437  0.311   1.00 104.67 ? 103 ILE A CB  1 
ATOM   96    C CG1 . ILE A 1 24  ? -2.742  -82.562  -0.275  1.00 107.78 ? 103 ILE A CG1 1 
ATOM   97    C CG2 . ILE A 1 24  ? -4.186  -82.954  1.744   1.00 107.65 ? 103 ILE A CG2 1 
ATOM   98    C CD1 . ILE A 1 24  ? -1.758  -81.542  0.222   1.00 110.94 ? 103 ILE A CD1 1 
ATOM   99    N N   . ASP A 1 25  ? -6.958  -84.560  0.330   1.00 103.71 ? 104 ASP A N   1 
ATOM   100   C CA  . ASP A 1 25  ? -8.226  -84.827  1.020   1.00 106.59 ? 104 ASP A CA  1 
ATOM   101   C C   . ASP A 1 25  ? -8.284  -84.013  2.306   1.00 103.65 ? 104 ASP A C   1 
ATOM   102   O O   . ASP A 1 25  ? -7.354  -84.078  3.108   1.00 108.22 ? 104 ASP A O   1 
ATOM   103   C CB  . ASP A 1 25  ? -8.381  -86.316  1.371   1.00 116.80 ? 104 ASP A CB  1 
ATOM   104   C CG  . ASP A 1 25  ? -8.680  -87.205  0.154   1.00 128.78 ? 104 ASP A CG  1 
ATOM   105   O OD1 . ASP A 1 25  ? -8.623  -88.456  0.327   1.00 134.04 ? 104 ASP A OD1 1 
ATOM   106   O OD2 . ASP A 1 25  ? -9.000  -86.673  -0.944  1.00 144.15 ? 104 ASP A OD2 1 
ATOM   107   N N   . GLY A 1 26  ? -9.360  -83.244  2.488   1.00 100.03 ? 105 GLY A N   1 
ATOM   108   C CA  . GLY A 1 26  ? -9.544  -82.398  3.668   1.00 100.82 ? 105 GLY A CA  1 
ATOM   109   C C   . GLY A 1 26  ? -9.970  -80.993  3.279   1.00 100.90 ? 105 GLY A C   1 
ATOM   110   O O   . GLY A 1 26  ? -9.918  -80.642  2.108   1.00 103.96 ? 105 GLY A O   1 
ATOM   111   N N   . PRO A 1 27  ? -10.357 -80.175  4.268   1.00 101.74 ? 106 PRO A N   1 
ATOM   112   C CA  . PRO A 1 27  ? -11.048 -78.915  4.016   1.00 102.69 ? 106 PRO A CA  1 
ATOM   113   C C   . PRO A 1 27  ? -10.183 -77.811  3.395   1.00 104.07 ? 106 PRO A C   1 
ATOM   114   O O   . PRO A 1 27  ? -9.001  -77.680  3.709   1.00 109.62 ? 106 PRO A O   1 
ATOM   115   C CB  . PRO A 1 27  ? -11.541 -78.509  5.402   1.00 104.91 ? 106 PRO A CB  1 
ATOM   116   C CG  . PRO A 1 27  ? -10.498 -79.053  6.321   1.00 105.96 ? 106 PRO A CG  1 
ATOM   117   C CD  . PRO A 1 27  ? -9.989  -80.315  5.687   1.00 104.93 ? 106 PRO A CD  1 
ATOM   118   N N   . LEU A 1 28  ? -10.802 -77.024  2.516   1.00 103.30 ? 107 LEU A N   1 
ATOM   119   C CA  . LEU A 1 28  ? -10.121 -75.973  1.782   1.00 100.80 ? 107 LEU A CA  1 
ATOM   120   C C   . LEU A 1 28  ? -10.008 -74.731  2.648   1.00 107.17 ? 107 LEU A C   1 
ATOM   121   O O   . LEU A 1 28  ? -10.969 -74.341  3.329   1.00 108.21 ? 107 LEU A O   1 
ATOM   122   C CB  . LEU A 1 28  ? -10.870 -75.614  0.493   1.00 94.84  ? 107 LEU A CB  1 
ATOM   123   C CG  . LEU A 1 28  ? -11.087 -76.679  -0.561  1.00 93.90  ? 107 LEU A CG  1 
ATOM   124   C CD1 . LEU A 1 28  ? -11.918 -76.072  -1.670  1.00 93.21  ? 107 LEU A CD1 1 
ATOM   125   C CD2 . LEU A 1 28  ? -9.784  -77.240  -1.108  1.00 94.66  ? 107 LEU A CD2 1 
ATOM   126   N N   . SER A 1 29  ? -8.811  -74.143  2.624   1.00 108.94 ? 108 SER A N   1 
ATOM   127   C CA  . SER A 1 29  ? -8.544  -72.816  3.154   1.00 110.84 ? 108 SER A CA  1 
ATOM   128   C C   . SER A 1 29  ? -8.843  -71.741  2.118   1.00 104.54 ? 108 SER A C   1 
ATOM   129   O O   . SER A 1 29  ? -8.641  -71.963  0.929   1.00 102.26 ? 108 SER A O   1 
ATOM   130   C CB  . SER A 1 29  ? -7.079  -72.746  3.571   1.00 120.98 ? 108 SER A CB  1 
ATOM   131   O OG  . SER A 1 29  ? -6.648  -74.032  4.032   1.00 130.26 ? 108 SER A OG  1 
ATOM   132   N N   . TRP A 1 30  ? -9.273  -70.567  2.582   1.00 106.22 ? 109 TRP A N   1 
ATOM   133   C CA  . TRP A 1 30  ? -9.816  -69.493  1.728   1.00 106.78 ? 109 TRP A CA  1 
ATOM   134   C C   . TRP A 1 30  ? -9.182  -68.126  1.951   1.00 107.65 ? 109 TRP A C   1 
ATOM   135   O O   . TRP A 1 30  ? -8.978  -67.715  3.090   1.00 112.68 ? 109 TRP A O   1 
ATOM   136   C CB  . TRP A 1 30  ? -11.313 -69.346  1.994   1.00 106.49 ? 109 TRP A CB  1 
ATOM   137   C CG  . TRP A 1 30  ? -12.048 -70.585  1.703   1.00 102.90 ? 109 TRP A CG  1 
ATOM   138   C CD1 . TRP A 1 30  ? -12.359 -71.571  2.578   1.00 102.27 ? 109 TRP A CD1 1 
ATOM   139   C CD2 . TRP A 1 30  ? -12.523 -71.000  0.430   1.00 100.79 ? 109 TRP A CD2 1 
ATOM   140   N NE1 . TRP A 1 30  ? -13.019 -72.571  1.932   1.00 105.31 ? 109 TRP A NE1 1 
ATOM   141   C CE2 . TRP A 1 30  ? -13.135 -72.245  0.606   1.00 102.51 ? 109 TRP A CE2 1 
ATOM   142   C CE3 . TRP A 1 30  ? -12.489 -70.434  -0.847  1.00 104.00 ? 109 TRP A CE3 1 
ATOM   143   C CZ2 . TRP A 1 30  ? -13.719 -72.950  -0.452  1.00 103.89 ? 109 TRP A CZ2 1 
ATOM   144   C CZ3 . TRP A 1 30  ? -13.070 -71.130  -1.901  1.00 104.42 ? 109 TRP A CZ3 1 
ATOM   145   C CH2 . TRP A 1 30  ? -13.677 -72.377  -1.691  1.00 104.59 ? 109 TRP A CH2 1 
ATOM   146   N N   . TYR A 1 31  ? -8.898  -67.414  0.860   1.00 108.17 ? 110 TYR A N   1 
ATOM   147   C CA  . TYR A 1 31  ? -8.560  -65.989  0.932   1.00 109.95 ? 110 TYR A CA  1 
ATOM   148   C C   . TYR A 1 31  ? -9.841  -65.209  1.235   1.00 113.33 ? 110 TYR A C   1 
ATOM   149   O O   . TYR A 1 31  ? -10.844 -65.382  0.562   1.00 111.27 ? 110 TYR A O   1 
ATOM   150   C CB  . TYR A 1 31  ? -7.967  -65.491  -0.380  1.00 108.51 ? 110 TYR A CB  1 
ATOM   151   C CG  . TYR A 1 31  ? -6.662  -66.131  -0.747  1.00 109.06 ? 110 TYR A CG  1 
ATOM   152   C CD1 . TYR A 1 31  ? -5.536  -65.952  0.038   1.00 111.22 ? 110 TYR A CD1 1 
ATOM   153   C CD2 . TYR A 1 31  ? -6.543  -66.900  -1.903  1.00 109.13 ? 110 TYR A CD2 1 
ATOM   154   C CE1 . TYR A 1 31  ? -4.318  -66.531  -0.309  1.00 113.18 ? 110 TYR A CE1 1 
ATOM   155   C CE2 . TYR A 1 31  ? -5.333  -67.481  -2.259  1.00 110.27 ? 110 TYR A CE2 1 
ATOM   156   C CZ  . TYR A 1 31  ? -4.221  -67.293  -1.457  1.00 111.66 ? 110 TYR A CZ  1 
ATOM   157   O OH  . TYR A 1 31  ? -3.027  -67.867  -1.807  1.00 110.15 ? 110 TYR A OH  1 
ATOM   158   N N   . SER A 1 32  ? -9.792  -64.365  2.264   1.00 123.89 ? 111 SER A N   1 
ATOM   159   C CA  . SER A 1 32  ? -10.943 -63.563  2.715   1.00 127.38 ? 111 SER A CA  1 
ATOM   160   C C   . SER A 1 32  ? -10.743 -62.037  2.658   1.00 128.59 ? 111 SER A C   1 
ATOM   161   O O   . SER A 1 32  ? -11.722 -61.303  2.780   1.00 130.01 ? 111 SER A O   1 
ATOM   162   C CB  . SER A 1 32  ? -11.308 -63.982  4.147   1.00 131.47 ? 111 SER A CB  1 
ATOM   163   O OG  . SER A 1 32  ? -10.167 -63.921  4.990   1.00 134.64 ? 111 SER A OG  1 
ATOM   164   N N   . ASP A 1 33  ? -9.511  -61.569  2.461   1.00 129.77 ? 112 ASP A N   1 
ATOM   165   C CA  . ASP A 1 33  ? -9.205  -60.131  2.435   1.00 134.86 ? 112 ASP A CA  1 
ATOM   166   C C   . ASP A 1 33  ? -9.664  -59.525  1.101   1.00 131.59 ? 112 ASP A C   1 
ATOM   167   O O   . ASP A 1 33  ? -9.108  -59.864  0.062   1.00 132.61 ? 112 ASP A O   1 
ATOM   168   C CB  . ASP A 1 33  ? -7.694  -59.917  2.647   1.00 140.24 ? 112 ASP A CB  1 
ATOM   169   C CG  . ASP A 1 33  ? -7.270  -58.441  2.619   1.00 146.76 ? 112 ASP A CG  1 
ATOM   170   O OD1 . ASP A 1 33  ? -7.997  -57.561  2.095   1.00 147.57 ? 112 ASP A OD1 1 
ATOM   171   O OD2 . ASP A 1 33  ? -6.166  -58.165  3.139   1.00 155.85 ? 112 ASP A OD2 1 
ATOM   172   N N   . PRO A 1 34  ? -10.660 -58.599  1.130   1.00 126.69 ? 113 PRO A N   1 
ATOM   173   C CA  . PRO A 1 34  ? -11.239 -58.058  -0.118  1.00 122.64 ? 113 PRO A CA  1 
ATOM   174   C C   . PRO A 1 34  ? -10.342 -57.104  -0.920  1.00 124.28 ? 113 PRO A C   1 
ATOM   175   O O   . PRO A 1 34  ? -10.729 -56.679  -2.013  1.00 123.51 ? 113 PRO A O   1 
ATOM   176   C CB  . PRO A 1 34  ? -12.520 -57.369  0.351   1.00 121.50 ? 113 PRO A CB  1 
ATOM   177   C CG  . PRO A 1 34  ? -12.257 -57.007  1.750   1.00 126.26 ? 113 PRO A CG  1 
ATOM   178   C CD  . PRO A 1 34  ? -11.273 -57.983  2.324   1.00 127.72 ? 113 PRO A CD  1 
ATOM   179   N N   . GLY A 1 35  ? -9.163  -56.767  -0.391  1.00 125.59 ? 114 GLY A N   1 
ATOM   180   C CA  . GLY A 1 35  ? -8.103  -56.164  -1.199  1.00 124.48 ? 114 GLY A CA  1 
ATOM   181   C C   . GLY A 1 35  ? -7.488  -57.106  -2.218  1.00 123.38 ? 114 GLY A C   1 
ATOM   182   O O   . GLY A 1 35  ? -6.759  -56.654  -3.107  1.00 124.16 ? 114 GLY A O   1 
ATOM   183   N N   . LEU A 1 36  ? -7.746  -58.411  -2.074  1.00 122.43 ? 115 LEU A N   1 
ATOM   184   C CA  . LEU A 1 36  ? -7.375  -59.427  -3.070  1.00 118.14 ? 115 LEU A CA  1 
ATOM   185   C C   . LEU A 1 36  ? -8.397  -59.530  -4.209  1.00 117.71 ? 115 LEU A C   1 
ATOM   186   O O   . LEU A 1 36  ? -9.614  -59.480  -3.988  1.00 115.21 ? 115 LEU A O   1 
ATOM   187   C CB  . LEU A 1 36  ? -7.227  -60.801  -2.412  1.00 115.51 ? 115 LEU A CB  1 
ATOM   188   C CG  . LEU A 1 36  ? -6.017  -60.965  -1.470  1.00 116.16 ? 115 LEU A CG  1 
ATOM   189   C CD1 . LEU A 1 36  ? -6.056  -62.265  -0.675  1.00 115.44 ? 115 LEU A CD1 1 
ATOM   190   C CD2 . LEU A 1 36  ? -4.751  -60.774  -2.266  1.00 117.05 ? 115 LEU A CD2 1 
ATOM   191   N N   . ALA A 1 37  ? -7.877  -59.700  -5.425  1.00 117.57 ? 116 ALA A N   1 
ATOM   192   C CA  . ALA A 1 37  ? -8.692  -59.787  -6.634  1.00 116.70 ? 116 ALA A CA  1 
ATOM   193   C C   . ALA A 1 37  ? -9.538  -61.055  -6.646  1.00 115.19 ? 116 ALA A C   1 
ATOM   194   O O   . ALA A 1 37  ? -9.010  -62.163  -6.503  1.00 115.58 ? 116 ALA A O   1 
ATOM   195   C CB  . ALA A 1 37  ? -7.801  -59.751  -7.865  1.00 118.15 ? 116 ALA A CB  1 
ATOM   196   N N   . GLY A 1 38  ? -10.850 -60.883  -6.804  1.00 115.36 ? 117 GLY A N   1 
ATOM   197   C CA  . GLY A 1 38  ? -11.795 -61.993  -6.776  1.00 114.99 ? 117 GLY A CA  1 
ATOM   198   C C   . GLY A 1 38  ? -12.539 -62.071  -5.466  1.00 116.39 ? 117 GLY A C   1 
ATOM   199   O O   . GLY A 1 38  ? -13.746 -62.341  -5.451  1.00 114.66 ? 117 GLY A O   1 
ATOM   200   N N   . VAL A 1 39  ? -11.829 -61.813  -4.366  1.00 121.50 ? 118 VAL A N   1 
ATOM   201   C CA  . VAL A 1 39  ? -12.406 -61.921  -3.030  1.00 125.50 ? 118 VAL A CA  1 
ATOM   202   C C   . VAL A 1 39  ? -13.302 -60.730  -2.723  1.00 131.44 ? 118 VAL A C   1 
ATOM   203   O O   . VAL A 1 39  ? -12.972 -59.596  -3.062  1.00 140.08 ? 118 VAL A O   1 
ATOM   204   C CB  . VAL A 1 39  ? -11.318 -62.023  -1.946  1.00 127.75 ? 118 VAL A CB  1 
ATOM   205   C CG1 . VAL A 1 39  ? -11.943 -62.100  -0.552  1.00 129.30 ? 118 VAL A CG1 1 
ATOM   206   C CG2 . VAL A 1 39  ? -10.417 -63.232  -2.194  1.00 128.79 ? 118 VAL A CG2 1 
ATOM   207   N N   . SER A 1 40  ? -14.437 -61.003  -2.087  1.00 134.41 ? 119 SER A N   1 
ATOM   208   C CA  . SER A 1 40  ? -15.345 -59.962  -1.612  1.00 143.30 ? 119 SER A CA  1 
ATOM   209   C C   . SER A 1 40  ? -16.235 -60.496  -0.487  1.00 144.12 ? 119 SER A C   1 
ATOM   210   O O   . SER A 1 40  ? -16.912 -61.499  -0.664  1.00 139.01 ? 119 SER A O   1 
ATOM   211   C CB  . SER A 1 40  ? -16.187 -59.398  -2.766  1.00 145.83 ? 119 SER A CB  1 
ATOM   212   O OG  . SER A 1 40  ? -16.450 -60.373  -3.753  1.00 144.27 ? 119 SER A OG  1 
ATOM   213   N N   . LEU A 1 41  ? -16.169 -59.842  0.672   1.00 147.62 ? 120 LEU A N   1 
ATOM   214   C CA  . LEU A 1 41  ? -17.084 -60.047  1.792   1.00 146.46 ? 120 LEU A CA  1 
ATOM   215   C C   . LEU A 1 41  ? -17.838 -58.743  2.017   1.00 151.08 ? 120 LEU A C   1 
ATOM   216   O O   . LEU A 1 41  ? -17.283 -57.662  1.803   1.00 160.59 ? 120 LEU A O   1 
ATOM   217   C CB  . LEU A 1 41  ? -16.309 -60.395  3.063   1.00 146.19 ? 120 LEU A CB  1 
ATOM   218   C CG  . LEU A 1 41  ? -15.807 -61.816  3.225   1.00 148.01 ? 120 LEU A CG  1 
ATOM   219   C CD1 . LEU A 1 41  ? -14.889 -61.867  4.441   1.00 150.40 ? 120 LEU A CD1 1 
ATOM   220   C CD2 . LEU A 1 41  ? -16.975 -62.776  3.402   1.00 150.82 ? 120 LEU A CD2 1 
ATOM   221   N N   . THR A 1 42  ? -19.104 -58.857  2.425   1.00 148.56 ? 121 THR A N   1 
ATOM   222   C CA  . THR A 1 42  ? -19.938 -57.706  2.807   1.00 150.92 ? 121 THR A CA  1 
ATOM   223   C C   . THR A 1 42  ? -20.831 -58.105  3.972   1.00 152.40 ? 121 THR A C   1 
ATOM   224   O O   . THR A 1 42  ? -20.766 -59.234  4.435   1.00 154.54 ? 121 THR A O   1 
ATOM   225   C CB  . THR A 1 42  ? -20.839 -57.194  1.648   1.00 150.04 ? 121 THR A CB  1 
ATOM   226   O OG1 . THR A 1 42  ? -21.831 -58.173  1.319   1.00 142.83 ? 121 THR A OG1 1 
ATOM   227   C CG2 . THR A 1 42  ? -20.017 -56.837  0.414   1.00 151.34 ? 121 THR A CG2 1 
ATOM   228   N N   . GLY A 1 43  ? -21.640 -57.157  4.452   1.00 157.89 ? 122 GLY A N   1 
ATOM   229   C CA  . GLY A 1 43  ? -22.696 -57.421  5.431   1.00 158.02 ? 122 GLY A CA  1 
ATOM   230   C C   . GLY A 1 43  ? -22.224 -58.217  6.634   1.00 158.87 ? 122 GLY A C   1 
ATOM   231   O O   . GLY A 1 43  ? -21.069 -58.104  7.069   1.00 156.34 ? 122 GLY A O   1 
ATOM   232   N N   . GLY A 1 44  ? -23.118 -59.046  7.159   1.00 162.51 ? 123 GLY A N   1 
ATOM   233   C CA  . GLY A 1 44  ? -22.790 -59.963  8.241   1.00 166.68 ? 123 GLY A CA  1 
ATOM   234   C C   . GLY A 1 44  ? -22.291 -61.289  7.697   1.00 164.96 ? 123 GLY A C   1 
ATOM   235   O O   . GLY A 1 44  ? -22.944 -62.320  7.860   1.00 160.20 ? 123 GLY A O   1 
ATOM   236   N N   . LEU A 1 45  ? -21.133 -61.245  7.039   1.00 161.11 ? 124 LEU A N   1 
ATOM   237   C CA  . LEU A 1 45  ? -20.461 -62.429  6.512   1.00 151.71 ? 124 LEU A CA  1 
ATOM   238   C C   . LEU A 1 45  ? -18.980 -62.319  6.845   1.00 145.89 ? 124 LEU A C   1 
ATOM   239   O O   . LEU A 1 45  ? -18.382 -61.253  6.682   1.00 145.08 ? 124 LEU A O   1 
ATOM   240   C CB  . LEU A 1 45  ? -20.667 -62.548  5.003   1.00 151.23 ? 124 LEU A CB  1 
ATOM   241   C CG  . LEU A 1 45  ? -22.062 -62.995  4.544   1.00 151.62 ? 124 LEU A CG  1 
ATOM   242   C CD1 . LEU A 1 45  ? -22.388 -62.498  3.139   1.00 150.99 ? 124 LEU A CD1 1 
ATOM   243   C CD2 . LEU A 1 45  ? -22.187 -64.514  4.631   1.00 151.07 ? 124 LEU A CD2 1 
ATOM   244   N N   . SER A 1 46  ? -18.397 -63.419  7.306   1.00 142.86 ? 125 SER A N   1 
ATOM   245   C CA  . SER A 1 46  ? -17.044 -63.409  7.853   1.00 144.33 ? 125 SER A CA  1 
ATOM   246   C C   . SER A 1 46  ? -16.378 -64.781  7.768   1.00 137.77 ? 125 SER A C   1 
ATOM   247   O O   . SER A 1 46  ? -17.055 -65.809  7.828   1.00 133.48 ? 125 SER A O   1 
ATOM   248   C CB  . SER A 1 46  ? -17.105 -62.968  9.313   1.00 150.74 ? 125 SER A CB  1 
ATOM   249   O OG  . SER A 1 46  ? -18.080 -63.724  10.020  1.00 153.44 ? 125 SER A OG  1 
ATOM   250   N N   . TYR A 1 47  ? -15.056 -64.784  7.643   1.00 133.20 ? 126 TYR A N   1 
ATOM   251   C CA  . TYR A 1 47  ? -14.273 -66.009  7.523   1.00 128.44 ? 126 TYR A CA  1 
ATOM   252   C C   . TYR A 1 47  ? -13.443 -66.260  8.793   1.00 129.57 ? 126 TYR A C   1 
ATOM   253   O O   . TYR A 1 47  ? -12.668 -65.400  9.211   1.00 132.12 ? 126 TYR A O   1 
ATOM   254   C CB  . TYR A 1 47  ? -13.369 -65.920  6.285   1.00 125.44 ? 126 TYR A CB  1 
ATOM   255   C CG  . TYR A 1 47  ? -12.501 -67.133  6.079   1.00 123.56 ? 126 TYR A CG  1 
ATOM   256   C CD1 . TYR A 1 47  ? -11.117 -67.030  6.108   1.00 125.74 ? 126 TYR A CD1 1 
ATOM   257   C CD2 . TYR A 1 47  ? -13.063 -68.395  5.879   1.00 120.43 ? 126 TYR A CD2 1 
ATOM   258   C CE1 . TYR A 1 47  ? -10.314 -68.154  5.935   1.00 124.26 ? 126 TYR A CE1 1 
ATOM   259   C CE2 . TYR A 1 47  ? -12.268 -69.518  5.707   1.00 118.39 ? 126 TYR A CE2 1 
ATOM   260   C CZ  . TYR A 1 47  ? -10.895 -69.392  5.735   1.00 118.25 ? 126 TYR A CZ  1 
ATOM   261   O OH  . TYR A 1 47  ? -10.088 -70.491  5.562   1.00 114.48 ? 126 TYR A OH  1 
ATOM   262   N N   . LYS A 1 48  ? -13.625 -67.433  9.397   1.00 129.10 ? 127 LYS A N   1 
ATOM   263   C CA  . LYS A 1 48  ? -12.826 -67.884  10.546  1.00 132.50 ? 127 LYS A CA  1 
ATOM   264   C C   . LYS A 1 48  ? -11.592 -68.661  10.064  1.00 134.62 ? 127 LYS A C   1 
ATOM   265   O O   . LYS A 1 48  ? -11.696 -69.831  9.710   1.00 131.32 ? 127 LYS A O   1 
ATOM   266   C CB  . LYS A 1 48  ? -13.674 -68.760  11.480  1.00 129.08 ? 127 LYS A CB  1 
ATOM   267   N N   . GLU A 1 49  ? -10.430 -68.006  10.064  1.00 141.52 ? 128 GLU A N   1 
ATOM   268   C CA  . GLU A 1 49  ? -9.171  -68.611  9.588   1.00 142.58 ? 128 GLU A CA  1 
ATOM   269   C C   . GLU A 1 49  ? -8.784  -69.933  10.275  1.00 144.31 ? 128 GLU A C   1 
ATOM   270   O O   . GLU A 1 49  ? -8.179  -70.794  9.642   1.00 141.20 ? 128 GLU A O   1 
ATOM   271   C CB  . GLU A 1 49  ? -8.007  -67.610  9.724   1.00 140.13 ? 128 GLU A CB  1 
ATOM   272   N N   . ASP A 1 50  ? -9.127  -70.085  11.554  1.00 154.00 ? 129 ASP A N   1 
ATOM   273   C CA  . ASP A 1 50  ? -8.765  -71.293  12.322  1.00 161.41 ? 129 ASP A CA  1 
ATOM   274   C C   . ASP A 1 50  ? -9.557  -72.533  11.900  1.00 155.38 ? 129 ASP A C   1 
ATOM   275   O O   . ASP A 1 50  ? -8.971  -73.595  11.673  1.00 155.74 ? 129 ASP A O   1 
ATOM   276   C CB  . ASP A 1 50  ? -8.850  -71.070  13.852  1.00 175.11 ? 129 ASP A CB  1 
ATOM   277   C CG  . ASP A 1 50  ? -10.243 -70.639  14.338  1.00 187.26 ? 129 ASP A CG  1 
ATOM   278   O OD1 . ASP A 1 50  ? -10.879 -69.779  13.684  1.00 201.22 ? 129 ASP A OD1 1 
ATOM   279   O OD2 . ASP A 1 50  ? -10.689 -71.143  15.394  1.00 196.40 ? 129 ASP A OD2 1 
ATOM   280   N N   . THR A 1 51  ? -10.874 -72.386  11.774  1.00 149.20 ? 130 THR A N   1 
ATOM   281   C CA  . THR A 1 51  ? -11.769 -73.494  11.413  1.00 146.48 ? 130 THR A CA  1 
ATOM   282   C C   . THR A 1 51  ? -11.988 -73.649  9.896   1.00 137.77 ? 130 THR A C   1 
ATOM   283   O O   . THR A 1 51  ? -12.533 -74.662  9.449   1.00 136.08 ? 130 THR A O   1 
ATOM   284   C CB  . THR A 1 51  ? -13.134 -73.317  12.100  1.00 152.25 ? 130 THR A CB  1 
ATOM   285   O OG1 . THR A 1 51  ? -13.588 -71.966  11.926  1.00 156.31 ? 130 THR A OG1 1 
ATOM   286   C CG2 . THR A 1 51  ? -13.021 -73.630  13.587  1.00 159.16 ? 130 THR A CG2 1 
ATOM   287   N N   . LYS A 1 52  ? -11.560 -72.648  9.124   1.00 134.76 ? 131 LYS A N   1 
ATOM   288   C CA  . LYS A 1 52  ? -11.714 -72.612  7.668   1.00 133.10 ? 131 LYS A CA  1 
ATOM   289   C C   . LYS A 1 52  ? -13.190 -72.566  7.260   1.00 129.39 ? 131 LYS A C   1 
ATOM   290   O O   . LYS A 1 52  ? -13.622 -73.279  6.355   1.00 133.82 ? 131 LYS A O   1 
ATOM   291   C CB  . LYS A 1 52  ? -10.978 -73.784  6.998   1.00 135.40 ? 131 LYS A CB  1 
ATOM   292   C CG  . LYS A 1 52  ? -9.568  -74.048  7.496   1.00 141.24 ? 131 LYS A CG  1 
ATOM   293   C CD  . LYS A 1 52  ? -8.883  -75.109  6.641   1.00 145.52 ? 131 LYS A CD  1 
ATOM   294   C CE  . LYS A 1 52  ? -7.815  -75.876  7.408   1.00 153.54 ? 131 LYS A CE  1 
ATOM   295   N NZ  . LYS A 1 52  ? -6.807  -74.989  8.060   1.00 163.02 ? 131 LYS A NZ  1 
ATOM   296   N N   . GLU A 1 53  ? -13.950 -71.696  7.919   1.00 128.95 ? 132 GLU A N   1 
ATOM   297   C CA  . GLU A 1 53  ? -15.398 -71.636  7.760   1.00 128.41 ? 132 GLU A CA  1 
ATOM   298   C C   . GLU A 1 53  ? -15.858 -70.215  7.445   1.00 128.95 ? 132 GLU A C   1 
ATOM   299   O O   . GLU A 1 53  ? -15.363 -69.256  8.025   1.00 131.89 ? 132 GLU A O   1 
ATOM   300   C CB  . GLU A 1 53  ? -16.089 -72.127  9.033   1.00 135.73 ? 132 GLU A CB  1 
ATOM   301   C CG  . GLU A 1 53  ? -15.805 -73.582  9.382   1.00 143.94 ? 132 GLU A CG  1 
ATOM   302   C CD  . GLU A 1 53  ? -16.603 -74.078  10.598  1.00 150.52 ? 132 GLU A CD  1 
ATOM   303   O OE1 . GLU A 1 53  ? -16.521 -73.448  11.673  1.00 150.60 ? 132 GLU A OE1 1 
ATOM   304   O OE2 . GLU A 1 53  ? -17.295 -75.104  10.503  1.00 151.13 ? 132 GLU A OE2 1 
ATOM   305   N N   . LEU A 1 54  ? -16.800 -70.098  6.511   1.00 129.01 ? 133 LEU A N   1 
ATOM   306   C CA  . LEU A 1 54  ? -17.519 -68.850  6.261   1.00 132.00 ? 133 LEU A CA  1 
ATOM   307   C C   . LEU A 1 54  ? -18.674 -68.814  7.254   1.00 139.56 ? 133 LEU A C   1 
ATOM   308   O O   . LEU A 1 54  ? -19.347 -69.826  7.435   1.00 145.09 ? 133 LEU A O   1 
ATOM   309   C CB  . LEU A 1 54  ? -18.056 -68.811  4.830   1.00 127.87 ? 133 LEU A CB  1 
ATOM   310   C CG  . LEU A 1 54  ? -18.779 -67.532  4.385   1.00 129.76 ? 133 LEU A CG  1 
ATOM   311   C CD1 . LEU A 1 54  ? -17.840 -66.345  4.280   1.00 130.91 ? 133 LEU A CD1 1 
ATOM   312   C CD2 . LEU A 1 54  ? -19.476 -67.734  3.055   1.00 127.92 ? 133 LEU A CD2 1 
ATOM   313   N N   . VAL A 1 55  ? -18.907 -67.660  7.886   1.00 142.41 ? 134 VAL A N   1 
ATOM   314   C CA  . VAL A 1 55  ? -19.928 -67.520  8.936   1.00 141.18 ? 134 VAL A CA  1 
ATOM   315   C C   . VAL A 1 55  ? -20.980 -66.482  8.548   1.00 142.61 ? 134 VAL A C   1 
ATOM   316   O O   . VAL A 1 55  ? -20.656 -65.307  8.375   1.00 142.52 ? 134 VAL A O   1 
ATOM   317   C CB  . VAL A 1 55  ? -19.305 -67.120  10.282  1.00 141.97 ? 134 VAL A CB  1 
ATOM   318   C CG1 . VAL A 1 55  ? -20.304 -67.330  11.413  1.00 147.85 ? 134 VAL A CG1 1 
ATOM   319   C CG2 . VAL A 1 55  ? -18.037 -67.920  10.538  1.00 141.31 ? 134 VAL A CG2 1 
ATOM   320   N N   . VAL A 1 56  ? -22.234 -66.927  8.447   1.00 143.98 ? 135 VAL A N   1 
ATOM   321   C CA  . VAL A 1 56  ? -23.349 -66.082  8.016   1.00 149.52 ? 135 VAL A CA  1 
ATOM   322   C C   . VAL A 1 56  ? -24.071 -65.503  9.225   1.00 156.57 ? 135 VAL A C   1 
ATOM   323   O O   . VAL A 1 56  ? -24.529 -66.255  10.079  1.00 167.20 ? 135 VAL A O   1 
ATOM   324   C CB  . VAL A 1 56  ? -24.374 -66.884  7.193   1.00 150.74 ? 135 VAL A CB  1 
ATOM   325   C CG1 . VAL A 1 56  ? -25.433 -65.958  6.601   1.00 155.03 ? 135 VAL A CG1 1 
ATOM   326   C CG2 . VAL A 1 56  ? -23.678 -67.674  6.093   1.00 149.61 ? 135 VAL A CG2 1 
ATOM   327   N N   . ALA A 1 57  ? -24.193 -64.177  9.285   1.00 158.88 ? 136 ALA A N   1 
ATOM   328   C CA  . ALA A 1 57  ? -24.836 -63.515  10.425  1.00 164.84 ? 136 ALA A CA  1 
ATOM   329   C C   . ALA A 1 57  ? -26.358 -63.508  10.270  1.00 167.84 ? 136 ALA A C   1 
ATOM   330   O O   . ALA A 1 57  ? -27.068 -64.186  11.023  1.00 162.50 ? 136 ALA A O   1 
ATOM   331   C CB  . ALA A 1 57  ? -24.303 -62.103  10.608  1.00 166.47 ? 136 ALA A CB  1 
ATOM   332   N N   . LYS A 1 58  ? -26.850 -62.757  9.281   1.00 167.35 ? 137 LYS A N   1 
ATOM   333   C CA  . LYS A 1 58  ? -28.280 -62.606  9.054   1.00 163.44 ? 137 LYS A CA  1 
ATOM   334   C C   . LYS A 1 58  ? -28.792 -63.842  8.328   1.00 157.11 ? 137 LYS A C   1 
ATOM   335   O O   . LYS A 1 58  ? -28.249 -64.221  7.290   1.00 157.24 ? 137 LYS A O   1 
ATOM   336   C CB  . LYS A 1 58  ? -28.563 -61.354  8.216   1.00 162.58 ? 137 LYS A CB  1 
ATOM   337   N N   . ALA A 1 59  ? -29.825 -64.478  8.884   1.00 152.98 ? 138 ALA A N   1 
ATOM   338   C CA  . ALA A 1 59  ? -30.444 -65.645  8.257   1.00 151.57 ? 138 ALA A CA  1 
ATOM   339   C C   . ALA A 1 59  ? -31.216 -65.268  6.987   1.00 152.10 ? 138 ALA A C   1 
ATOM   340   O O   . ALA A 1 59  ? -31.364 -64.084  6.650   1.00 152.36 ? 138 ALA A O   1 
ATOM   341   C CB  . ALA A 1 59  ? -31.366 -66.343  9.244   1.00 152.52 ? 138 ALA A CB  1 
ATOM   342   N N   . GLY A 1 60  ? -31.692 -66.294  6.284   1.00 150.30 ? 139 GLY A N   1 
ATOM   343   C CA  . GLY A 1 60  ? -32.464 -66.126  5.048   1.00 148.98 ? 139 GLY A CA  1 
ATOM   344   C C   . GLY A 1 60  ? -32.175 -67.198  4.019   1.00 142.35 ? 139 GLY A C   1 
ATOM   345   O O   . GLY A 1 60  ? -31.584 -68.232  4.344   1.00 147.65 ? 139 GLY A O   1 
ATOM   346   N N   . VAL A 1 61  ? -32.613 -66.958  2.786   1.00 134.85 ? 140 VAL A N   1 
ATOM   347   C CA  . VAL A 1 61  ? -32.328 -67.843  1.670   1.00 133.27 ? 140 VAL A CA  1 
ATOM   348   C C   . VAL A 1 61  ? -31.294 -67.176  0.761   1.00 131.16 ? 140 VAL A C   1 
ATOM   349   O O   . VAL A 1 61  ? -31.427 -66.010  0.413   1.00 130.17 ? 140 VAL A O   1 
ATOM   350   C CB  . VAL A 1 61  ? -33.612 -68.210  0.897   1.00 132.94 ? 140 VAL A CB  1 
ATOM   351   C CG1 . VAL A 1 61  ? -33.281 -68.943  -0.408  1.00 133.52 ? 140 VAL A CG1 1 
ATOM   352   C CG2 . VAL A 1 61  ? -34.524 -69.058  1.770   1.00 133.25 ? 140 VAL A CG2 1 
ATOM   353   N N   . TYR A 1 62  ? -30.273 -67.939  0.380   1.00 128.24 ? 141 TYR A N   1 
ATOM   354   C CA  . TYR A 1 62  ? -29.174 -67.463  -0.453  1.00 125.62 ? 141 TYR A CA  1 
ATOM   355   C C   . TYR A 1 62  ? -28.991 -68.377  -1.655  1.00 120.79 ? 141 TYR A C   1 
ATOM   356   O O   . TYR A 1 62  ? -29.219 -69.578  -1.555  1.00 115.38 ? 141 TYR A O   1 
ATOM   357   C CB  . TYR A 1 62  ? -27.874 -67.485  0.343   1.00 127.91 ? 141 TYR A CB  1 
ATOM   358   C CG  . TYR A 1 62  ? -27.831 -66.559  1.524   1.00 130.23 ? 141 TYR A CG  1 
ATOM   359   C CD1 . TYR A 1 62  ? -28.553 -66.829  2.677   1.00 132.30 ? 141 TYR A CD1 1 
ATOM   360   C CD2 . TYR A 1 62  ? -27.024 -65.425  1.501   1.00 133.20 ? 141 TYR A CD2 1 
ATOM   361   C CE1 . TYR A 1 62  ? -28.490 -65.976  3.779   1.00 138.09 ? 141 TYR A CE1 1 
ATOM   362   C CE2 . TYR A 1 62  ? -26.954 -64.567  2.585   1.00 135.60 ? 141 TYR A CE2 1 
ATOM   363   C CZ  . TYR A 1 62  ? -27.687 -64.846  3.721   1.00 139.64 ? 141 TYR A CZ  1 
ATOM   364   O OH  . TYR A 1 62  ? -27.618 -63.992  4.793   1.00 146.72 ? 141 TYR A OH  1 
ATOM   365   N N   . TYR A 1 63  ? -28.578 -67.798  -2.780  1.00 120.03 ? 142 TYR A N   1 
ATOM   366   C CA  . TYR A 1 63  ? -28.071 -68.570  -3.911  1.00 118.22 ? 142 TYR A CA  1 
ATOM   367   C C   . TYR A 1 63  ? -26.599 -68.772  -3.621  1.00 114.73 ? 142 TYR A C   1 
ATOM   368   O O   . TYR A 1 63  ? -25.833 -67.818  -3.602  1.00 115.52 ? 142 TYR A O   1 
ATOM   369   C CB  . TYR A 1 63  ? -28.253 -67.823  -5.230  1.00 118.23 ? 142 TYR A CB  1 
ATOM   370   C CG  . TYR A 1 63  ? -27.753 -68.569  -6.456  1.00 116.39 ? 142 TYR A CG  1 
ATOM   371   C CD1 . TYR A 1 63  ? -28.474 -69.640  -6.996  1.00 115.74 ? 142 TYR A CD1 1 
ATOM   372   C CD2 . TYR A 1 63  ? -26.578 -68.184  -7.092  1.00 116.01 ? 142 TYR A CD2 1 
ATOM   373   C CE1 . TYR A 1 63  ? -28.038 -70.306  -8.132  1.00 115.50 ? 142 TYR A CE1 1 
ATOM   374   C CE2 . TYR A 1 63  ? -26.122 -68.839  -8.225  1.00 116.36 ? 142 TYR A CE2 1 
ATOM   375   C CZ  . TYR A 1 63  ? -26.856 -69.900  -8.753  1.00 116.84 ? 142 TYR A CZ  1 
ATOM   376   O OH  . TYR A 1 63  ? -26.398 -70.539  -9.891  1.00 114.05 ? 142 TYR A OH  1 
ATOM   377   N N   . VAL A 1 64  ? -26.225 -70.021  -3.361  1.00 109.67 ? 143 VAL A N   1 
ATOM   378   C CA  . VAL A 1 64  ? -24.859 -70.392  -3.043  1.00 106.74 ? 143 VAL A CA  1 
ATOM   379   C C   . VAL A 1 64  ? -24.336 -71.190  -4.215  1.00 104.48 ? 143 VAL A C   1 
ATOM   380   O O   . VAL A 1 64  ? -25.015 -72.093  -4.693  1.00 107.80 ? 143 VAL A O   1 
ATOM   381   C CB  . VAL A 1 64  ? -24.813 -71.268  -1.783  1.00 109.04 ? 143 VAL A CB  1 
ATOM   382   C CG1 . VAL A 1 64  ? -23.371 -71.576  -1.384  1.00 107.50 ? 143 VAL A CG1 1 
ATOM   383   C CG2 . VAL A 1 64  ? -25.572 -70.579  -0.659  1.00 113.25 ? 143 VAL A CG2 1 
ATOM   384   N N   . PHE A 1 65  ? -23.135 -70.861  -4.670  1.00 102.79 ? 144 PHE A N   1 
ATOM   385   C CA  . PHE A 1 65  ? -22.529 -71.529  -5.812  1.00 101.57 ? 144 PHE A CA  1 
ATOM   386   C C   . PHE A 1 65  ? -21.054 -71.768  -5.561  1.00 100.46 ? 144 PHE A C   1 
ATOM   387   O O   . PHE A 1 65  ? -20.369 -70.929  -4.970  1.00 106.11 ? 144 PHE A O   1 
ATOM   388   C CB  . PHE A 1 65  ? -22.693 -70.697  -7.094  1.00 101.91 ? 144 PHE A CB  1 
ATOM   389   C CG  . PHE A 1 65  ? -22.042 -69.346  -7.022  1.00 102.26 ? 144 PHE A CG  1 
ATOM   390   C CD1 . PHE A 1 65  ? -20.753 -69.161  -7.479  1.00 100.67 ? 144 PHE A CD1 1 
ATOM   391   C CD2 . PHE A 1 65  ? -22.716 -68.265  -6.462  1.00 105.19 ? 144 PHE A CD2 1 
ATOM   392   C CE1 . PHE A 1 65  ? -20.141 -67.924  -7.385  1.00 103.24 ? 144 PHE A CE1 1 
ATOM   393   C CE2 . PHE A 1 65  ? -22.112 -67.026  -6.370  1.00 104.99 ? 144 PHE A CE2 1 
ATOM   394   C CZ  . PHE A 1 65  ? -20.824 -66.852  -6.835  1.00 104.82 ? 144 PHE A CZ  1 
ATOM   395   N N   . PHE A 1 66  ? -20.557 -72.909  -6.014  1.00 95.35  ? 145 PHE A N   1 
ATOM   396   C CA  . PHE A 1 66  ? -19.128 -73.062  -6.119  1.00 92.33  ? 145 PHE A CA  1 
ATOM   397   C C   . PHE A 1 66  ? -18.656 -73.599  -7.459  1.00 91.49  ? 145 PHE A C   1 
ATOM   398   O O   . PHE A 1 66  ? -19.398 -74.184  -8.218  1.00 89.06  ? 145 PHE A O   1 
ATOM   399   C CB  . PHE A 1 66  ? -18.487 -73.743  -4.890  1.00 94.53  ? 145 PHE A CB  1 
ATOM   400   C CG  . PHE A 1 66  ? -18.995 -75.102  -4.541  1.00 93.86  ? 145 PHE A CG  1 
ATOM   401   C CD1 . PHE A 1 66  ? -19.707 -75.903  -5.419  1.00 95.21  ? 145 PHE A CD1 1 
ATOM   402   C CD2 . PHE A 1 66  ? -18.668 -75.606  -3.290  1.00 94.73  ? 145 PHE A CD2 1 
ATOM   403   C CE1 . PHE A 1 66  ? -20.124 -77.162  -5.039  1.00 98.75  ? 145 PHE A CE1 1 
ATOM   404   C CE2 . PHE A 1 66  ? -19.081 -76.859  -2.896  1.00 97.94  ? 145 PHE A CE2 1 
ATOM   405   C CZ  . PHE A 1 66  ? -19.810 -77.645  -3.778  1.00 101.88 ? 145 PHE A CZ  1 
ATOM   406   N N   . GLN A 1 67  ? -17.394 -73.314  -7.719  1.00 96.37  ? 146 GLN A N   1 
ATOM   407   C CA  . GLN A 1 67  ? -16.766 -73.385  -9.009  1.00 97.31  ? 146 GLN A CA  1 
ATOM   408   C C   . GLN A 1 67  ? -15.501 -74.155  -8.711  1.00 95.16  ? 146 GLN A C   1 
ATOM   409   O O   . GLN A 1 67  ? -14.910 -73.975  -7.644  1.00 101.24 ? 146 GLN A O   1 
ATOM   410   C CB  . GLN A 1 67  ? -16.445 -71.941  -9.401  1.00 102.09 ? 146 GLN A CB  1 
ATOM   411   C CG  . GLN A 1 67  ? -16.252 -71.647  -10.865 1.00 110.29 ? 146 GLN A CG  1 
ATOM   412   C CD  . GLN A 1 67  ? -16.245 -70.148  -11.134 1.00 116.70 ? 146 GLN A CD  1 
ATOM   413   O OE1 . GLN A 1 67  ? -17.259 -69.576  -11.554 1.00 118.62 ? 146 GLN A OE1 1 
ATOM   414   N NE2 . GLN A 1 67  ? -15.103 -69.506  -10.890 1.00 121.99 ? 146 GLN A NE2 1 
ATOM   415   N N   . LEU A 1 68  ? -15.076 -75.025  -9.606  1.00 92.26  ? 147 LEU A N   1 
ATOM   416   C CA  . LEU A 1 68  ? -13.846 -75.783  -9.371  1.00 93.02  ? 147 LEU A CA  1 
ATOM   417   C C   . LEU A 1 68  ? -13.118 -76.017  -10.676 1.00 93.13  ? 147 LEU A C   1 
ATOM   418   O O   . LEU A 1 68  ? -13.573 -76.833  -11.470 1.00 94.58  ? 147 LEU A O   1 
ATOM   419   C CB  . LEU A 1 68  ? -14.198 -77.118  -8.714  1.00 94.62  ? 147 LEU A CB  1 
ATOM   420   C CG  . LEU A 1 68  ? -13.083 -78.157  -8.614  1.00 97.16  ? 147 LEU A CG  1 
ATOM   421   C CD1 . LEU A 1 68  ? -11.976 -77.605  -7.758  1.00 96.88  ? 147 LEU A CD1 1 
ATOM   422   C CD2 . LEU A 1 68  ? -13.586 -79.479  -8.052  1.00 102.91 ? 147 LEU A CD2 1 
ATOM   423   N N   . GLU A 1 69  ? -12.009 -75.302  -10.911 1.00 97.25  ? 148 GLU A N   1 
ATOM   424   C CA  . GLU A 1 69  ? -11.160 -75.573  -12.095 1.00 98.57  ? 148 GLU A CA  1 
ATOM   425   C C   . GLU A 1 69  ? -9.902  -76.306  -11.644 1.00 96.58  ? 148 GLU A C   1 
ATOM   426   O O   . GLU A 1 69  ? -9.375  -76.043  -10.566 1.00 97.48  ? 148 GLU A O   1 
ATOM   427   C CB  . GLU A 1 69  ? -10.794 -74.317  -12.875 1.00 102.39 ? 148 GLU A CB  1 
ATOM   428   C CG  . GLU A 1 69  ? -10.439 -74.632  -14.326 1.00 112.23 ? 148 GLU A CG  1 
ATOM   429   C CD  . GLU A 1 69  ? -9.479  -73.624  -14.963 1.00 123.92 ? 148 GLU A CD  1 
ATOM   430   O OE1 . GLU A 1 69  ? -8.503  -74.086  -15.632 1.00 130.90 ? 148 GLU A OE1 1 
ATOM   431   O OE2 . GLU A 1 69  ? -9.706  -72.385  -14.795 1.00 125.32 ? 148 GLU A OE2 1 
ATOM   432   N N   . LEU A 1 70  ? -9.451  -77.239  -12.472 1.00 92.75  ? 149 LEU A N   1 
ATOM   433   C CA  . LEU A 1 70  ? -8.280  -78.055  -12.207 1.00 92.63  ? 149 LEU A CA  1 
ATOM   434   C C   . LEU A 1 70  ? -7.381  -78.029  -13.437 1.00 94.18  ? 149 LEU A C   1 
ATOM   435   O O   . LEU A 1 70  ? -7.875  -77.859  -14.546 1.00 94.08  ? 149 LEU A O   1 
ATOM   436   C CB  . LEU A 1 70  ? -8.727  -79.480  -11.913 1.00 92.21  ? 149 LEU A CB  1 
ATOM   437   C CG  . LEU A 1 70  ? -9.609  -79.607  -10.671 1.00 95.84  ? 149 LEU A CG  1 
ATOM   438   C CD1 . LEU A 1 70  ? -10.615 -80.730  -10.797 1.00 102.27 ? 149 LEU A CD1 1 
ATOM   439   C CD2 . LEU A 1 70  ? -8.753  -79.835  -9.446  1.00 99.60  ? 149 LEU A CD2 1 
ATOM   440   N N   . ARG A 1 71  ? -6.072  -78.186  -13.232 1.00 97.03  ? 150 ARG A N   1 
ATOM   441   C CA  . ARG A 1 71  ? -5.094  -78.181  -14.332 1.00 99.97  ? 150 ARG A CA  1 
ATOM   442   C C   . ARG A 1 71  ? -4.111  -79.335  -14.233 1.00 97.30  ? 150 ARG A C   1 
ATOM   443   O O   . ARG A 1 71  ? -3.583  -79.598  -13.165 1.00 95.59  ? 150 ARG A O   1 
ATOM   444   C CB  . ARG A 1 71  ? -4.334  -76.866  -14.386 1.00 103.73 ? 150 ARG A CB  1 
ATOM   445   C CG  . ARG A 1 71  ? -3.816  -76.340  -13.069 1.00 108.43 ? 150 ARG A CG  1 
ATOM   446   C CD  . ARG A 1 71  ? -3.302  -74.905  -13.272 1.00 115.73 ? 150 ARG A CD  1 
ATOM   447   N NE  . ARG A 1 71  ? -2.019  -74.875  -13.997 1.00 118.05 ? 150 ARG A NE  1 
ATOM   448   C CZ  . ARG A 1 71  ? -0.810  -74.837  -13.437 1.00 117.02 ? 150 ARG A CZ  1 
ATOM   449   N NH1 . ARG A 1 71  ? -0.655  -74.786  -12.111 1.00 117.42 ? 150 ARG A NH1 1 
ATOM   450   N NH2 . ARG A 1 71  ? 0.260   -74.831  -14.220 1.00 118.61 ? 150 ARG A NH2 1 
ATOM   451   N N   . ARG A 1 72  ? -3.880  -80.029  -15.346 1.00 96.35  ? 151 ARG A N   1 
ATOM   452   C CA  . ARG A 1 72  ? -2.866  -81.072  -15.400 1.00 97.58  ? 151 ARG A CA  1 
ATOM   453   C C   . ARG A 1 72  ? -1.506  -80.394  -15.371 1.00 101.24 ? 151 ARG A C   1 
ATOM   454   O O   . ARG A 1 72  ? -1.232  -79.527  -16.202 1.00 105.75 ? 151 ARG A O   1 
ATOM   455   C CB  . ARG A 1 72  ? -2.987  -81.905  -16.675 1.00 100.09 ? 151 ARG A CB  1 
ATOM   456   C CG  . ARG A 1 72  ? -2.190  -83.194  -16.641 1.00 101.81 ? 151 ARG A CG  1 
ATOM   457   C CD  . ARG A 1 72  ? -2.120  -83.844  -18.020 1.00 105.67 ? 151 ARG A CD  1 
ATOM   458   N NE  . ARG A 1 72  ? -3.430  -84.127  -18.621 1.00 106.02 ? 151 ARG A NE  1 
ATOM   459   C CZ  . ARG A 1 72  ? -4.263  -85.092  -18.254 1.00 106.36 ? 151 ARG A CZ  1 
ATOM   460   N NH1 . ARG A 1 72  ? -3.968  -85.940  -17.266 1.00 107.43 ? 151 ARG A NH1 1 
ATOM   461   N NH2 . ARG A 1 72  ? -5.423  -85.207  -18.894 1.00 103.49 ? 151 ARG A NH2 1 
ATOM   462   N N   . VAL A 1 73  ? -0.674  -80.773  -14.396 1.00 100.64 ? 152 VAL A N   1 
ATOM   463   C CA  . VAL A 1 73  ? 0.665   -80.201  -14.207 1.00 98.39  ? 152 VAL A CA  1 
ATOM   464   C C   . VAL A 1 73  ? 1.797   -81.154  -14.565 1.00 100.25 ? 152 VAL A C   1 
ATOM   465   O O   . VAL A 1 73  ? 2.934   -80.726  -14.654 1.00 104.60 ? 152 VAL A O   1 
ATOM   466   C CB  . VAL A 1 73  ? 0.883   -79.685  -12.764 1.00 97.51  ? 152 VAL A CB  1 
ATOM   467   C CG1 . VAL A 1 73  ? -0.080  -78.553  -12.444 1.00 95.11  ? 152 VAL A CG1 1 
ATOM   468   C CG2 . VAL A 1 73  ? 0.760   -80.797  -11.734 1.00 98.43  ? 152 VAL A CG2 1 
ATOM   469   N N   . VAL A 1 74  ? 1.507   -82.439  -14.733 1.00 103.64 ? 153 VAL A N   1 
ATOM   470   C CA  . VAL A 1 74  ? 2.499   -83.399  -15.207 1.00 106.95 ? 153 VAL A CA  1 
ATOM   471   C C   . VAL A 1 74  ? 1.981   -83.952  -16.520 1.00 108.64 ? 153 VAL A C   1 
ATOM   472   O O   . VAL A 1 74  ? 1.085   -84.782  -16.532 1.00 105.76 ? 153 VAL A O   1 
ATOM   473   C CB  . VAL A 1 74  ? 2.726   -84.535  -14.192 1.00 106.88 ? 153 VAL A CB  1 
ATOM   474   C CG1 . VAL A 1 74  ? 3.707   -85.560  -14.756 1.00 107.67 ? 153 VAL A CG1 1 
ATOM   475   C CG2 . VAL A 1 74  ? 3.236   -83.965  -12.874 1.00 105.87 ? 153 VAL A CG2 1 
ATOM   476   N N   . ALA A 1 75  ? 2.552   -83.474  -17.623 1.00 111.23 ? 154 ALA A N   1 
ATOM   477   C CA  . ALA A 1 75  ? 2.124   -83.875  -18.963 1.00 112.71 ? 154 ALA A CA  1 
ATOM   478   C C   . ALA A 1 75  ? 2.075   -85.392  -19.104 1.00 113.24 ? 154 ALA A C   1 
ATOM   479   O O   . ALA A 1 75  ? 2.963   -86.090  -18.634 1.00 111.06 ? 154 ALA A O   1 
ATOM   480   C CB  . ALA A 1 75  ? 3.045   -83.282  -20.018 1.00 114.45 ? 154 ALA A CB  1 
ATOM   481   N N   . GLY A 1 76  ? 1.010   -85.876  -19.735 1.00 116.12 ? 155 GLY A N   1 
ATOM   482   C CA  . GLY A 1 76  ? 0.809   -87.286  -20.017 1.00 118.58 ? 155 GLY A CA  1 
ATOM   483   C C   . GLY A 1 76  ? 0.549   -88.195  -18.836 1.00 115.54 ? 155 GLY A C   1 
ATOM   484   O O   . GLY A 1 76  ? 0.732   -89.417  -18.927 1.00 117.66 ? 155 GLY A O   1 
ATOM   485   N N   . GLU A 1 77  ? 0.121   -87.618  -17.726 1.00 113.46 ? 156 GLU A N   1 
ATOM   486   C CA  . GLU A 1 77  ? -0.096  -88.391  -16.506 1.00 116.17 ? 156 GLU A CA  1 
ATOM   487   C C   . GLU A 1 77  ? -1.299  -87.861  -15.760 1.00 112.74 ? 156 GLU A C   1 
ATOM   488   O O   . GLU A 1 77  ? -1.674  -86.691  -15.906 1.00 112.91 ? 156 GLU A O   1 
ATOM   489   C CB  . GLU A 1 77  ? 1.141   -88.322  -15.596 1.00 121.17 ? 156 GLU A CB  1 
ATOM   490   C CG  . GLU A 1 77  ? 2.324   -89.169  -15.991 1.00 128.34 ? 156 GLU A CG  1 
ATOM   491   C CD  . GLU A 1 77  ? 2.131   -90.668  -15.810 1.00 138.08 ? 156 GLU A CD  1 
ATOM   492   O OE1 . GLU A 1 77  ? 3.146   -91.365  -16.009 1.00 148.21 ? 156 GLU A OE1 1 
ATOM   493   O OE2 . GLU A 1 77  ? 1.012   -91.164  -15.491 1.00 139.57 ? 156 GLU A OE2 1 
ATOM   494   N N   . GLY A 1 78  ? -1.917  -88.732  -14.971 1.00 112.16 ? 157 GLY A N   1 
ATOM   495   C CA  . GLY A 1 78  ? -2.966  -88.331  -14.040 1.00 112.63 ? 157 GLY A CA  1 
ATOM   496   C C   . GLY A 1 78  ? -4.349  -88.575  -14.578 1.00 112.82 ? 157 GLY A C   1 
ATOM   497   O O   . GLY A 1 78  ? -4.652  -88.196  -15.697 1.00 120.25 ? 157 GLY A O   1 
ATOM   498   N N   . SER A 1 79  ? -5.187  -89.194  -13.760 1.00 110.75 ? 158 SER A N   1 
ATOM   499   C CA  . SER A 1 79  ? -6.573  -89.473  -14.115 1.00 113.29 ? 158 SER A CA  1 
ATOM   500   C C   . SER A 1 79  ? -7.389  -89.645  -12.859 1.00 110.17 ? 158 SER A C   1 
ATOM   501   O O   . SER A 1 79  ? -6.832  -89.704  -11.761 1.00 116.25 ? 158 SER A O   1 
ATOM   502   C CB  . SER A 1 79  ? -6.660  -90.739  -14.957 1.00 120.21 ? 158 SER A CB  1 
ATOM   503   O OG  . SER A 1 79  ? -6.097  -91.833  -14.270 1.00 128.89 ? 158 SER A OG  1 
ATOM   504   N N   . GLY A 1 80  ? -8.705  -89.707  -13.017 1.00 105.88 ? 159 GLY A N   1 
ATOM   505   C CA  . GLY A 1 80  ? -9.605  -89.921  -11.883 1.00 107.73 ? 159 GLY A CA  1 
ATOM   506   C C   . GLY A 1 80  ? -10.633 -88.828  -11.677 1.00 103.96 ? 159 GLY A C   1 
ATOM   507   O O   . GLY A 1 80  ? -11.224 -88.340  -12.637 1.00 108.56 ? 159 GLY A O   1 
ATOM   508   N N   . SER A 1 81  ? -10.831 -88.434  -10.425 1.00 100.45 ? 160 SER A N   1 
ATOM   509   C CA  . SER A 1 81  ? -11.948 -87.589  -10.063 1.00 101.13 ? 160 SER A CA  1 
ATOM   510   C C   . SER A 1 81  ? -11.656 -86.748  -8.829  1.00 97.29  ? 160 SER A C   1 
ATOM   511   O O   . SER A 1 81  ? -10.894 -87.147  -7.977  1.00 98.06  ? 160 SER A O   1 
ATOM   512   C CB  . SER A 1 81  ? -13.164 -88.483  -9.820  1.00 108.51 ? 160 SER A CB  1 
ATOM   513   O OG  . SER A 1 81  ? -14.037 -87.910  -8.866  1.00 115.17 ? 160 SER A OG  1 
ATOM   514   N N   . VAL A 1 82  ? -12.297 -85.590  -8.740  1.00 97.90  ? 161 VAL A N   1 
ATOM   515   C CA  . VAL A 1 82  ? -12.105 -84.641  -7.644  1.00 97.58  ? 161 VAL A CA  1 
ATOM   516   C C   . VAL A 1 82  ? -13.460 -84.077  -7.287  1.00 95.81  ? 161 VAL A C   1 
ATOM   517   O O   . VAL A 1 82  ? -14.250 -83.790  -8.183  1.00 92.40  ? 161 VAL A O   1 
ATOM   518   C CB  . VAL A 1 82  ? -11.199 -83.470  -8.070  1.00 97.68  ? 161 VAL A CB  1 
ATOM   519   C CG1 . VAL A 1 82  ? -11.081 -82.410  -6.976  1.00 96.05  ? 161 VAL A CG1 1 
ATOM   520   C CG2 . VAL A 1 82  ? -9.838  -83.987  -8.490  1.00 96.73  ? 161 VAL A CG2 1 
ATOM   521   N N   . SER A 1 83  ? -13.696 -83.879  -5.989  1.00 97.13  ? 162 SER A N   1 
ATOM   522   C CA  . SER A 1 83  ? -15.022 -83.530  -5.484  1.00 97.40  ? 162 SER A CA  1 
ATOM   523   C C   . SER A 1 83  ? -14.968 -82.437  -4.435  1.00 94.36  ? 162 SER A C   1 
ATOM   524   O O   . SER A 1 83  ? -14.186 -82.529  -3.511  1.00 97.23  ? 162 SER A O   1 
ATOM   525   C CB  . SER A 1 83  ? -15.674 -84.766  -4.871  1.00 99.83  ? 162 SER A CB  1 
ATOM   526   O OG  . SER A 1 83  ? -15.287 -85.936  -5.583  1.00 106.42 ? 162 SER A OG  1 
ATOM   527   N N   . LEU A 1 84  ? -15.797 -81.410  -4.591  1.00 94.93  ? 163 LEU A N   1 
ATOM   528   C CA  . LEU A 1 84  ? -16.104 -80.489  -3.495  1.00 96.72  ? 163 LEU A CA  1 
ATOM   529   C C   . LEU A 1 84  ? -17.393 -80.904  -2.803  1.00 99.25  ? 163 LEU A C   1 
ATOM   530   O O   . LEU A 1 84  ? -18.272 -81.512  -3.412  1.00 105.48 ? 163 LEU A O   1 
ATOM   531   C CB  . LEU A 1 84  ? -16.269 -79.052  -3.991  1.00 94.39  ? 163 LEU A CB  1 
ATOM   532   C CG  . LEU A 1 84  ? -15.065 -78.342  -4.602  1.00 92.19  ? 163 LEU A CG  1 
ATOM   533   C CD1 . LEU A 1 84  ? -15.364 -76.854  -4.683  1.00 93.90  ? 163 LEU A CD1 1 
ATOM   534   C CD2 . LEU A 1 84  ? -13.805 -78.600  -3.816  1.00 90.81  ? 163 LEU A CD2 1 
ATOM   535   N N   . ALA A 1 85  ? -17.495 -80.558  -1.525  1.00 97.48  ? 164 ALA A N   1 
ATOM   536   C CA  . ALA A 1 85  ? -18.706 -80.776  -0.757  1.00 98.66  ? 164 ALA A CA  1 
ATOM   537   C C   . ALA A 1 85  ? -18.838 -79.670  0.251   1.00 101.00 ? 164 ALA A C   1 
ATOM   538   O O   . ALA A 1 85  ? -17.927 -79.448  1.039   1.00 104.46 ? 164 ALA A O   1 
ATOM   539   C CB  . ALA A 1 85  ? -18.647 -82.114  -0.057  1.00 103.09 ? 164 ALA A CB  1 
ATOM   540   N N   . LEU A 1 86  ? -19.956 -78.952  0.195   1.00 105.33 ? 165 LEU A N   1 
ATOM   541   C CA  . LEU A 1 86  ? -20.255 -77.905  1.153   1.00 110.05 ? 165 LEU A CA  1 
ATOM   542   C C   . LEU A 1 86  ? -21.000 -78.545  2.301   1.00 114.04 ? 165 LEU A C   1 
ATOM   543   O O   . LEU A 1 86  ? -22.048 -79.142  2.086   1.00 118.52 ? 165 LEU A O   1 
ATOM   544   C CB  . LEU A 1 86  ? -21.118 -76.838  0.514   1.00 111.49 ? 165 LEU A CB  1 
ATOM   545   C CG  . LEU A 1 86  ? -21.428 -75.621  1.383   1.00 112.84 ? 165 LEU A CG  1 
ATOM   546   C CD1 . LEU A 1 86  ? -20.224 -74.705  1.416   1.00 113.33 ? 165 LEU A CD1 1 
ATOM   547   C CD2 . LEU A 1 86  ? -22.656 -74.894  0.844   1.00 116.49 ? 165 LEU A CD2 1 
ATOM   548   N N   . HIS A 1 87  ? -20.444 -78.429  3.507   1.00 119.70 ? 166 HIS A N   1 
ATOM   549   C CA  . HIS A 1 87  ? -21.052 -78.935  4.733   1.00 120.27 ? 166 HIS A CA  1 
ATOM   550   C C   . HIS A 1 87  ? -21.438 -77.775  5.637   1.00 123.03 ? 166 HIS A C   1 
ATOM   551   O O   . HIS A 1 87  ? -20.678 -76.825  5.783   1.00 119.78 ? 166 HIS A O   1 
ATOM   552   C CB  . HIS A 1 87  ? -20.078 -79.854  5.456   1.00 119.36 ? 166 HIS A CB  1 
ATOM   553   C CG  . HIS A 1 87  ? -19.823 -81.129  4.735   1.00 123.33 ? 166 HIS A CG  1 
ATOM   554   N ND1 . HIS A 1 87  ? -20.834 -81.994  4.374   1.00 128.89 ? 166 HIS A ND1 1 
ATOM   555   C CD2 . HIS A 1 87  ? -18.672 -81.699  4.320   1.00 127.03 ? 166 HIS A CD2 1 
ATOM   556   C CE1 . HIS A 1 87  ? -20.315 -83.040  3.753   1.00 132.85 ? 166 HIS A CE1 1 
ATOM   557   N NE2 . HIS A 1 87  ? -19.003 -82.884  3.702   1.00 132.91 ? 166 HIS A NE2 1 
ATOM   558   N N   . LEU A 1 88  ? -22.618 -77.875  6.241   1.00 129.76 ? 167 LEU A N   1 
ATOM   559   C CA  . LEU A 1 88  ? -23.131 -76.863  7.158   1.00 134.88 ? 167 LEU A CA  1 
ATOM   560   C C   . LEU A 1 88  ? -22.921 -77.292  8.602   1.00 141.49 ? 167 LEU A C   1 
ATOM   561   O O   . LEU A 1 88  ? -23.366 -78.366  8.989   1.00 153.84 ? 167 LEU A O   1 
ATOM   562   C CB  . LEU A 1 88  ? -24.626 -76.667  6.920   1.00 136.39 ? 167 LEU A CB  1 
ATOM   563   C CG  . LEU A 1 88  ? -25.046 -76.251  5.519   1.00 138.39 ? 167 LEU A CG  1 
ATOM   564   C CD1 . LEU A 1 88  ? -26.561 -76.170  5.471   1.00 143.70 ? 167 LEU A CD1 1 
ATOM   565   C CD2 . LEU A 1 88  ? -24.410 -74.923  5.124   1.00 139.16 ? 167 LEU A CD2 1 
ATOM   566   N N   . GLN A 1 89  ? -22.248 -76.456  9.391   1.00 148.16 ? 168 GLN A N   1 
ATOM   567   C CA  . GLN A 1 89  ? -22.155 -76.645  10.837  1.00 157.49 ? 168 GLN A CA  1 
ATOM   568   C C   . GLN A 1 89  ? -22.882 -75.459  11.504  1.00 168.80 ? 168 GLN A C   1 
ATOM   569   O O   . GLN A 1 89  ? -22.574 -74.307  11.177  1.00 175.40 ? 168 GLN A O   1 
ATOM   570   C CB  . GLN A 1 89  ? -20.694 -76.726  11.273  1.00 157.40 ? 168 GLN A CB  1 
ATOM   571   C CG  . GLN A 1 89  ? -20.473 -77.108  12.736  1.00 164.04 ? 168 GLN A CG  1 
ATOM   572   C CD  . GLN A 1 89  ? -20.696 -78.591  13.035  1.00 169.19 ? 168 GLN A CD  1 
ATOM   573   O OE1 . GLN A 1 89  ? -21.480 -79.281  12.375  1.00 170.47 ? 168 GLN A OE1 1 
ATOM   574   N NE2 . GLN A 1 89  ? -19.993 -79.089  14.050  1.00 172.31 ? 168 GLN A NE2 1 
ATOM   575   N N   . PRO A 1 90  ? -23.780 -75.741  12.453  1.00 181.78 ? 169 PRO A N   1 
ATOM   576   C CA  . PRO A 1 90  ? -24.113 -77.060  12.992  1.00 182.93 ? 169 PRO A CA  1 
ATOM   577   C C   . PRO A 1 90  ? -24.910 -77.817  11.961  1.00 181.48 ? 169 PRO A C   1 
ATOM   578   O O   . PRO A 1 90  ? -25.518 -77.191  11.099  1.00 178.11 ? 169 PRO A O   1 
ATOM   579   C CB  . PRO A 1 90  ? -25.002 -76.724  14.176  1.00 186.81 ? 169 PRO A CB  1 
ATOM   580   C CG  . PRO A 1 90  ? -25.711 -75.500  13.730  1.00 187.94 ? 169 PRO A CG  1 
ATOM   581   C CD  . PRO A 1 90  ? -24.681 -74.706  12.981  1.00 187.81 ? 169 PRO A CD  1 
ATOM   582   N N   . LEU A 1 91  ? -24.971 -79.134  12.064  1.00 179.03 ? 170 LEU A N   1 
ATOM   583   C CA  . LEU A 1 91  ? -25.669 -79.870  11.036  1.00 183.33 ? 170 LEU A CA  1 
ATOM   584   C C   . LEU A 1 91  ? -27.171 -79.822  11.201  1.00 192.40 ? 170 LEU A C   1 
ATOM   585   O O   . LEU A 1 91  ? -27.738 -80.446  12.087  1.00 195.57 ? 170 LEU A O   1 
ATOM   586   C CB  . LEU A 1 91  ? -25.211 -81.325  11.054  1.00 179.53 ? 170 LEU A CB  1 
ATOM   587   N N   . ARG A 1 92  ? -27.809 -79.077  10.308  1.00 201.40 ? 171 ARG A N   1 
ATOM   588   C CA  . ARG A 1 92  ? -29.253 -78.960  10.302  1.00 208.56 ? 171 ARG A CA  1 
ATOM   589   C C   . ARG A 1 92  ? -29.837 -80.321  9.984   1.00 217.58 ? 171 ARG A C   1 
ATOM   590   O O   . ARG A 1 92  ? -30.830 -80.736  10.570  1.00 222.71 ? 171 ARG A O   1 
ATOM   591   C CB  . ARG A 1 92  ? -29.706 -77.943  9.261   1.00 201.50 ? 171 ARG A CB  1 
ATOM   592   N N   . SER A 1 93  ? -29.215 -81.019  9.043   1.00 223.32 ? 172 SER A N   1 
ATOM   593   C CA  . SER A 1 93  ? -29.698 -82.352  8.680   1.00 227.59 ? 172 SER A CA  1 
ATOM   594   C C   . SER A 1 93  ? -29.435 -83.338  9.812   1.00 229.86 ? 172 SER A C   1 
ATOM   595   O O   . SER A 1 93  ? -30.303 -84.149  10.143  1.00 235.89 ? 172 SER A O   1 
ATOM   596   C CB  . SER A 1 93  ? -28.986 -82.853  7.423   1.00 228.37 ? 172 SER A CB  1 
ATOM   597   N N   . ALA A 1 94  ? -28.227 -83.265  10.376  1.00 229.12 ? 173 ALA A N   1 
ATOM   598   C CA  . ALA A 1 94  ? -27.763 -84.156  11.446  1.00 235.59 ? 173 ALA A CA  1 
ATOM   599   C C   . ALA A 1 94  ? -27.608 -85.609  10.956  1.00 238.03 ? 173 ALA A C   1 
ATOM   600   O O   . ALA A 1 94  ? -28.050 -86.561  11.618  1.00 237.72 ? 173 ALA A O   1 
ATOM   601   C CB  . ALA A 1 94  ? -28.672 -84.059  12.672  1.00 236.85 ? 173 ALA A CB  1 
ATOM   602   N N   . ALA A 1 95  ? -26.960 -85.753  9.796   1.00 230.94 ? 174 ALA A N   1 
ATOM   603   C CA  . ALA A 1 95  ? -26.731 -87.065  9.159   1.00 226.13 ? 174 ALA A CA  1 
ATOM   604   C C   . ALA A 1 95  ? -25.357 -87.265  8.473   1.00 221.14 ? 174 ALA A C   1 
ATOM   605   O O   . ALA A 1 95  ? -24.771 -88.346  8.591   1.00 222.82 ? 174 ALA A O   1 
ATOM   606   C CB  . ALA A 1 95  ? -27.846 -87.346  8.165   1.00 225.38 ? 174 ALA A CB  1 
ATOM   607   N N   . GLY A 1 96  ? -24.855 -86.240  7.775   1.00 211.56 ? 175 GLY A N   1 
ATOM   608   C CA  . GLY A 1 96  ? -23.700 -86.355  6.868   1.00 200.82 ? 175 GLY A CA  1 
ATOM   609   C C   . GLY A 1 96  ? -23.941 -85.926  5.421   1.00 190.68 ? 175 GLY A C   1 
ATOM   610   O O   . GLY A 1 96  ? -23.036 -86.044  4.601   1.00 183.91 ? 175 GLY A O   1 
ATOM   611   N N   . ALA A 1 97  ? -25.138 -85.404  5.118   1.00 183.03 ? 176 ALA A N   1 
ATOM   612   C CA  . ALA A 1 97  ? -25.545 -85.001  3.773   1.00 174.63 ? 176 ALA A CA  1 
ATOM   613   C C   . ALA A 1 97  ? -25.009 -83.603  3.399   1.00 162.80 ? 176 ALA A C   1 
ATOM   614   O O   . ALA A 1 97  ? -25.154 -82.653  4.180   1.00 166.11 ? 176 ALA A O   1 
ATOM   615   C CB  . ALA A 1 97  ? -27.063 -85.006  3.685   1.00 177.33 ? 176 ALA A CB  1 
ATOM   616   N N   . ALA A 1 98  ? -24.403 -83.495  2.220   1.00 143.54 ? 177 ALA A N   1 
ATOM   617   C CA  . ALA A 1 98  ? -23.817 -82.246  1.764   1.00 132.14 ? 177 ALA A CA  1 
ATOM   618   C C   . ALA A 1 98  ? -24.865 -81.316  1.177   1.00 126.18 ? 177 ALA A C   1 
ATOM   619   O O   . ALA A 1 98  ? -25.725 -81.746  0.433   1.00 123.33 ? 177 ALA A O   1 
ATOM   620   C CB  . ALA A 1 98  ? -22.720 -82.510  0.738   1.00 134.33 ? 177 ALA A CB  1 
ATOM   621   N N   . ALA A 1 99  ? -24.771 -80.031  1.516   1.00 124.25 ? 178 ALA A N   1 
ATOM   622   C CA  . ALA A 1 99  ? -25.721 -79.009  1.061   1.00 124.89 ? 178 ALA A CA  1 
ATOM   623   C C   . ALA A 1 99  ? -25.582 -78.746  -0.426  1.00 126.24 ? 178 ALA A C   1 
ATOM   624   O O   . ALA A 1 99  ? -26.578 -78.583  -1.139  1.00 137.81 ? 178 ALA A O   1 
ATOM   625   C CB  . ALA A 1 99  ? -25.515 -77.719  1.831   1.00 122.57 ? 178 ALA A CB  1 
ATOM   626   N N   . LEU A 1 100 ? -24.329 -78.690  -0.867  1.00 122.24 ? 179 LEU A N   1 
ATOM   627   C CA  . LEU A 1 100 ? -23.952 -78.462  -2.255  1.00 117.00 ? 179 LEU A CA  1 
ATOM   628   C C   . LEU A 1 100 ? -22.805 -79.435  -2.549  1.00 108.82 ? 179 LEU A C   1 
ATOM   629   O O   . LEU A 1 100 ? -21.931 -79.640  -1.703  1.00 106.87 ? 179 LEU A O   1 
ATOM   630   C CB  . LEU A 1 100 ? -23.493 -77.016  -2.406  1.00 119.51 ? 179 LEU A CB  1 
ATOM   631   C CG  . LEU A 1 100 ? -23.506 -76.388  -3.797  1.00 125.92 ? 179 LEU A CG  1 
ATOM   632   C CD1 . LEU A 1 100 ? -24.920 -76.269  -4.314  1.00 127.52 ? 179 LEU A CD1 1 
ATOM   633   C CD2 . LEU A 1 100 ? -22.845 -75.025  -3.754  1.00 128.87 ? 179 LEU A CD2 1 
ATOM   634   N N   . ALA A 1 101 ? -22.823 -80.065  -3.716  1.00 104.39 ? 180 ALA A N   1 
ATOM   635   C CA  . ALA A 1 101 ? -21.769 -81.018  -4.053  1.00 101.92 ? 180 ALA A CA  1 
ATOM   636   C C   . ALA A 1 101 ? -21.491 -81.090  -5.550  1.00 103.69 ? 180 ALA A C   1 
ATOM   637   O O   . ALA A 1 101 ? -22.381 -80.926  -6.384  1.00 108.53 ? 180 ALA A O   1 
ATOM   638   C CB  . ALA A 1 101 ? -22.110 -82.386  -3.510  1.00 102.17 ? 180 ALA A CB  1 
ATOM   639   N N   . LEU A 1 102 ? -20.228 -81.346  -5.866  1.00 104.36 ? 181 LEU A N   1 
ATOM   640   C CA  . LEU A 1 102 ? -19.724 -81.246  -7.223  1.00 103.59 ? 181 LEU A CA  1 
ATOM   641   C C   . LEU A 1 102 ? -18.661 -82.289  -7.432  1.00 97.10  ? 181 LEU A C   1 
ATOM   642   O O   . LEU A 1 102 ? -17.870 -82.543  -6.542  1.00 97.77  ? 181 LEU A O   1 
ATOM   643   C CB  . LEU A 1 102 ? -19.084 -79.878  -7.404  1.00 106.75 ? 181 LEU A CB  1 
ATOM   644   C CG  . LEU A 1 102 ? -19.371 -79.143  -8.705  1.00 107.40 ? 181 LEU A CG  1 
ATOM   645   C CD1 . LEU A 1 102 ? -18.524 -77.886  -8.751  1.00 105.64 ? 181 LEU A CD1 1 
ATOM   646   C CD2 . LEU A 1 102 ? -19.105 -80.014  -9.921  1.00 109.85 ? 181 LEU A CD2 1 
ATOM   647   N N   . THR A 1 103 ? -18.646 -82.902  -8.597  1.00 93.01  ? 182 THR A N   1 
ATOM   648   C CA  . THR A 1 103 ? -17.549 -83.782  -8.941  1.00 97.21  ? 182 THR A CA  1 
ATOM   649   C C   . THR A 1 103 ? -17.114 -83.471  -10.358 1.00 100.52 ? 182 THR A C   1 
ATOM   650   O O   . THR A 1 103 ? -17.945 -83.147  -11.210 1.00 106.38 ? 182 THR A O   1 
ATOM   651   C CB  . THR A 1 103 ? -17.939 -85.261  -8.761  1.00 99.47  ? 182 THR A CB  1 
ATOM   652   O OG1 . THR A 1 103 ? -18.319 -85.477  -7.394  1.00 101.79 ? 182 THR A OG1 1 
ATOM   653   C CG2 . THR A 1 103 ? -16.801 -86.190  -9.107  1.00 99.43  ? 182 THR A CG2 1 
ATOM   654   N N   . VAL A 1 104 ? -15.805 -83.552  -10.587 1.00 101.39 ? 183 VAL A N   1 
ATOM   655   C CA  . VAL A 1 104 ? -15.188 -83.182  -11.845 1.00 102.95 ? 183 VAL A CA  1 
ATOM   656   C C   . VAL A 1 104 ? -14.312 -84.336  -12.277 1.00 103.57 ? 183 VAL A C   1 
ATOM   657   O O   . VAL A 1 104 ? -13.481 -84.791  -11.510 1.00 104.13 ? 183 VAL A O   1 
ATOM   658   C CB  . VAL A 1 104 ? -14.352 -81.908  -11.638 1.00 105.18 ? 183 VAL A CB  1 
ATOM   659   C CG1 . VAL A 1 104 ? -13.448 -81.628  -12.830 1.00 106.01 ? 183 VAL A CG1 1 
ATOM   660   C CG2 . VAL A 1 104 ? -15.273 -80.722  -11.363 1.00 104.67 ? 183 VAL A CG2 1 
ATOM   661   N N   . ASP A 1 105 ? -14.511 -84.830  -13.492 1.00 108.63 ? 184 ASP A N   1 
ATOM   662   C CA  . ASP A 1 105 ? -13.696 -85.931  -13.998 1.00 116.62 ? 184 ASP A CA  1 
ATOM   663   C C   . ASP A 1 105 ? -12.391 -85.348  -14.508 1.00 114.90 ? 184 ASP A C   1 
ATOM   664   O O   . ASP A 1 105 ? -12.374 -84.287  -15.146 1.00 115.40 ? 184 ASP A O   1 
ATOM   665   C CB  . ASP A 1 105 ? -14.394 -86.692  -15.120 1.00 131.68 ? 184 ASP A CB  1 
ATOM   666   C CG  . ASP A 1 105 ? -15.616 -87.506  -14.646 1.00 147.72 ? 184 ASP A CG  1 
ATOM   667   O OD1 . ASP A 1 105 ? -16.031 -88.384  -15.425 1.00 163.76 ? 184 ASP A OD1 1 
ATOM   668   O OD2 . ASP A 1 105 ? -16.167 -87.253  -13.534 1.00 155.27 ? 184 ASP A OD2 1 
ATOM   669   N N   . LEU A 1 106 ? -11.286 -86.020  -14.182 1.00 114.18 ? 185 LEU A N   1 
ATOM   670   C CA  . LEU A 1 106 ? -9.970  -85.694  -14.711 1.00 108.53 ? 185 LEU A CA  1 
ATOM   671   C C   . LEU A 1 106 ? -9.700  -86.654  -15.879 1.00 109.86 ? 185 LEU A C   1 
ATOM   672   O O   . LEU A 1 106 ? -9.506  -87.857  -15.675 1.00 111.77 ? 185 LEU A O   1 
ATOM   673   C CB  . LEU A 1 106 ? -8.912  -85.867  -13.635 1.00 106.39 ? 185 LEU A CB  1 
ATOM   674   C CG  . LEU A 1 106 ? -9.132  -85.104  -12.330 1.00 106.97 ? 185 LEU A CG  1 
ATOM   675   C CD1 . LEU A 1 106 ? -7.977  -85.438  -11.402 1.00 107.03 ? 185 LEU A CD1 1 
ATOM   676   C CD2 . LEU A 1 106 ? -9.280  -83.599  -12.531 1.00 107.15 ? 185 LEU A CD2 1 
ATOM   677   N N   . PRO A 1 107 ? -9.696  -86.138  -17.112 1.00 107.42 ? 186 PRO A N   1 
ATOM   678   C CA  . PRO A 1 107 ? -9.538  -87.034  -18.256 1.00 108.72 ? 186 PRO A CA  1 
ATOM   679   C C   . PRO A 1 107 ? -8.138  -87.665  -18.323 1.00 111.57 ? 186 PRO A C   1 
ATOM   680   O O   . PRO A 1 107 ? -7.174  -87.057  -17.870 1.00 116.83 ? 186 PRO A O   1 
ATOM   681   C CB  . PRO A 1 107 ? -9.756  -86.100  -19.441 1.00 112.65 ? 186 PRO A CB  1 
ATOM   682   C CG  . PRO A 1 107 ? -9.335  -84.756  -18.940 1.00 112.52 ? 186 PRO A CG  1 
ATOM   683   C CD  . PRO A 1 107 ? -9.715  -84.709  -17.503 1.00 109.37 ? 186 PRO A CD  1 
ATOM   684   N N   . PRO A 1 108 ? -8.031  -88.860  -18.885 1.00 117.11 ? 187 PRO A N   1 
ATOM   685   C CA  . PRO A 1 108 ? -6.770  -89.553  -18.855 1.00 121.90 ? 187 PRO A CA  1 
ATOM   686   C C   . PRO A 1 108 ? -5.734  -89.207  -19.856 1.00 128.26 ? 187 PRO A C   1 
ATOM   687   O O   . PRO A 1 108 ? -5.267  -90.208  -20.396 1.00 144.97 ? 187 PRO A O   1 
ATOM   688   C CB  . PRO A 1 108 ? -7.204  -91.022  -19.033 1.00 122.52 ? 187 PRO A CB  1 
ATOM   689   C CG  . PRO A 1 108 ? -8.311  -90.924  -20.000 1.00 123.97 ? 187 PRO A CG  1 
ATOM   690   C CD  . PRO A 1 108 ? -9.008  -89.615  -19.677 1.00 122.97 ? 187 PRO A CD  1 
ATOM   691   N N   . ALA A 1 109 ? -5.319  -88.024  -20.166 1.00 129.40 ? 188 ALA A N   1 
ATOM   692   C CA  . ALA A 1 109 ? -4.037  -87.819  -20.934 1.00 133.90 ? 188 ALA A CA  1 
ATOM   693   C C   . ALA A 1 109 ? -3.901  -88.601  -22.263 1.00 140.53 ? 188 ALA A C   1 
ATOM   694   O O   . ALA A 1 109 ? -3.095  -89.553  -22.468 1.00 145.50 ? 188 ALA A O   1 
ATOM   695   C CB  . ALA A 1 109 ? -2.743  -87.842  -20.119 1.00 130.03 ? 188 ALA A CB  1 
ATOM   696   N N   . SER A 1 110 ? -4.793  -88.216  -23.161 1.00 145.40 ? 189 SER A N   1 
ATOM   697   C CA  . SER A 1 110 ? -4.858  -88.753  -24.504 1.00 148.10 ? 189 SER A CA  1 
ATOM   698   C C   . SER A 1 110 ? -4.026  -87.882  -25.415 1.00 153.39 ? 189 SER A C   1 
ATOM   699   O O   . SER A 1 110 ? -3.612  -86.793  -25.037 1.00 146.68 ? 189 SER A O   1 
ATOM   700   C CB  . SER A 1 110 ? -6.296  -88.766  -24.999 1.00 148.42 ? 189 SER A CB  1 
ATOM   701   N N   . SER A 1 111 ? -3.803  -88.393  -26.615 1.00 166.62 ? 190 SER A N   1 
ATOM   702   C CA  . SER A 1 111 ? -3.028  -87.711  -27.627 1.00 173.55 ? 190 SER A CA  1 
ATOM   703   C C   . SER A 1 111 ? -3.762  -86.438  -27.919 1.00 174.78 ? 190 SER A C   1 
ATOM   704   O O   . SER A 1 111 ? -3.156  -85.389  -28.085 1.00 175.36 ? 190 SER A O   1 
ATOM   705   C CB  . SER A 1 111 ? -2.928  -88.559  -28.887 1.00 179.04 ? 190 SER A CB  1 
ATOM   706   N N   . GLU A 1 112 ? -5.094  -86.514  -27.939 1.00 175.56 ? 191 GLU A N   1 
ATOM   707   C CA  . GLU A 1 112 ? -5.898  -85.322  -28.158 1.00 175.82 ? 191 GLU A CA  1 
ATOM   708   C C   . GLU A 1 112 ? -5.600  -84.403  -26.993 1.00 175.05 ? 191 GLU A C   1 
ATOM   709   O O   . GLU A 1 112 ? -5.297  -83.240  -27.201 1.00 173.27 ? 191 GLU A O   1 
ATOM   710   C CB  . GLU A 1 112 ? -7.378  -85.676  -28.162 1.00 175.00 ? 191 GLU A CB  1 
ATOM   711   N N   . ALA A 1 113 ? -5.647  -84.966  -25.784 1.00 173.58 ? 192 ALA A N   1 
ATOM   712   C CA  . ALA A 1 113 ? -5.259  -84.322  -24.539 1.00 165.01 ? 192 ALA A CA  1 
ATOM   713   C C   . ALA A 1 113 ? -5.931  -83.053  -24.057 1.00 154.50 ? 192 ALA A C   1 
ATOM   714   O O   . ALA A 1 113 ? -5.616  -81.949  -24.486 1.00 160.71 ? 192 ALA A O   1 
ATOM   715   C CB  . ALA A 1 113 ? -3.746  -84.132  -24.527 1.00 163.27 ? 192 ALA A CB  1 
ATOM   716   N N   . ARG A 1 114 ? -6.805  -83.208  -23.084 1.00 135.32 ? 193 ARG A N   1 
ATOM   717   C CA  . ARG A 1 114 ? -7.419  -82.050  -22.513 1.00 125.67 ? 193 ARG A CA  1 
ATOM   718   C C   . ARG A 1 114 ? -6.696  -81.948  -21.204 1.00 119.57 ? 193 ARG A C   1 
ATOM   719   O O   . ARG A 1 114 ? -6.741  -82.861  -20.406 1.00 121.94 ? 193 ARG A O   1 
ATOM   720   C CB  . ARG A 1 114 ? -8.895  -82.298  -22.276 1.00 125.28 ? 193 ARG A CB  1 
ATOM   721   N N   . ASN A 1 115 ? -5.992  -80.853  -20.997 1.00 113.82 ? 194 ASN A N   1 
ATOM   722   C CA  . ASN A 1 115 ? -5.249  -80.623  -19.717 1.00 109.51 ? 194 ASN A CA  1 
ATOM   723   C C   . ASN A 1 115 ? -5.933  -79.708  -18.672 1.00 106.15 ? 194 ASN A C   1 
ATOM   724   O O   . ASN A 1 115 ? -5.255  -79.043  -17.891 1.00 106.95 ? 194 ASN A O   1 
ATOM   725   C CB  . ASN A 1 115 ? -3.855  -80.110  -20.020 1.00 109.07 ? 194 ASN A CB  1 
ATOM   726   C CG  . ASN A 1 115 ? -3.118  -80.986  -20.986 1.00 112.10 ? 194 ASN A CG  1 
ATOM   727   O OD1 . ASN A 1 115 ? -3.225  -82.206  -20.895 1.00 112.63 ? 194 ASN A OD1 1 
ATOM   728   N ND2 . ASN A 1 115 ? -2.381  -80.386  -21.932 1.00 118.02 ? 194 ASN A ND2 1 
ATOM   729   N N   . SER A 1 116 ? -7.262  -79.720  -18.605 1.00 103.00 ? 195 SER A N   1 
ATOM   730   C CA  . SER A 1 116 ? -7.992  -78.978  -17.585 1.00 100.78 ? 195 SER A CA  1 
ATOM   731   C C   . SER A 1 116 ? -9.430  -79.494  -17.408 1.00 97.67  ? 195 SER A C   1 
ATOM   732   O O   . SER A 1 116 ? -9.907  -80.308  -18.195 1.00 97.98  ? 195 SER A O   1 
ATOM   733   C CB  . SER A 1 116 ? -7.984  -77.468  -17.879 1.00 103.22 ? 195 SER A CB  1 
ATOM   734   O OG  . SER A 1 116 ? -8.835  -77.154  -18.948 1.00 108.42 ? 195 SER A OG  1 
ATOM   735   N N   . ALA A 1 117 ? -10.104 -79.020  -16.361 1.00 94.69  ? 196 ALA A N   1 
ATOM   736   C CA  . ALA A 1 117 ? -11.412 -79.537  -15.996 1.00 92.26  ? 196 ALA A CA  1 
ATOM   737   C C   . ALA A 1 117 ? -12.159 -78.582  -15.091 1.00 91.23  ? 196 ALA A C   1 
ATOM   738   O O   . ALA A 1 117 ? -11.678 -78.260  -14.037 1.00 84.37  ? 196 ALA A O   1 
ATOM   739   C CB  . ALA A 1 117 ? -11.270 -80.900  -15.331 1.00 91.12  ? 196 ALA A CB  1 
ATOM   740   N N   . PHE A 1 118 ? -13.344 -78.150  -15.528 1.00 100.74 ? 197 PHE A N   1 
ATOM   741   C CA  . PHE A 1 118 ? -14.185 -77.179  -14.816 1.00 102.98 ? 197 PHE A CA  1 
ATOM   742   C C   . PHE A 1 118 ? -15.370 -77.911  -14.215 1.00 95.59  ? 197 PHE A C   1 
ATOM   743   O O   . PHE A 1 118 ? -15.668 -79.052  -14.550 1.00 91.48  ? 197 PHE A O   1 
ATOM   744   C CB  . PHE A 1 118 ? -14.710 -76.075  -15.749 1.00 116.61 ? 197 PHE A CB  1 
ATOM   745   C CG  . PHE A 1 118 ? -13.619 -75.269  -16.458 1.00 135.46 ? 197 PHE A CG  1 
ATOM   746   C CD1 . PHE A 1 118 ? -13.534 -73.878  -16.271 1.00 139.68 ? 197 PHE A CD1 1 
ATOM   747   C CD2 . PHE A 1 118 ? -12.693 -75.874  -17.350 1.00 141.39 ? 197 PHE A CD2 1 
ATOM   748   C CE1 . PHE A 1 118 ? -12.556 -73.122  -16.925 1.00 140.80 ? 197 PHE A CE1 1 
ATOM   749   C CE2 . PHE A 1 118 ? -11.711 -75.125  -17.980 1.00 141.69 ? 197 PHE A CE2 1 
ATOM   750   C CZ  . PHE A 1 118 ? -11.648 -73.747  -17.779 1.00 144.26 ? 197 PHE A CZ  1 
ATOM   751   N N   . GLY A 1 119 ? -16.053 -77.215  -13.327 1.00 93.35  ? 198 GLY A N   1 
ATOM   752   C CA  . GLY A 1 119 ? -17.228 -77.743  -12.648 1.00 90.21  ? 198 GLY A CA  1 
ATOM   753   C C   . GLY A 1 119 ? -17.880 -76.614  -11.886 1.00 87.32  ? 198 GLY A C   1 
ATOM   754   O O   . GLY A 1 119 ? -17.225 -75.942  -11.088 1.00 86.94  ? 198 GLY A O   1 
ATOM   755   N N   . PHE A 1 120 ? -19.158 -76.389  -12.142 1.00 87.43  ? 199 PHE A N   1 
ATOM   756   C CA  . PHE A 1 120 ? -19.911 -75.343  -11.458 1.00 89.94  ? 199 PHE A CA  1 
ATOM   757   C C   . PHE A 1 120 ? -21.205 -75.918  -10.947 1.00 88.32  ? 199 PHE A C   1 
ATOM   758   O O   . PHE A 1 120 ? -21.860 -76.662  -11.649 1.00 87.50  ? 199 PHE A O   1 
ATOM   759   C CB  . PHE A 1 120 ? -20.231 -74.203  -12.415 1.00 93.58  ? 199 PHE A CB  1 
ATOM   760   C CG  . PHE A 1 120 ? -21.094 -73.141  -11.820 1.00 94.90  ? 199 PHE A CG  1 
ATOM   761   C CD1 . PHE A 1 120 ? -20.530 -72.017  -11.253 1.00 96.02  ? 199 PHE A CD1 1 
ATOM   762   C CD2 . PHE A 1 120 ? -22.475 -73.273  -11.822 1.00 98.90  ? 199 PHE A CD2 1 
ATOM   763   C CE1 . PHE A 1 120 ? -21.331 -71.028  -10.698 1.00 100.76 ? 199 PHE A CE1 1 
ATOM   764   C CE2 . PHE A 1 120 ? -23.274 -72.299  -11.257 1.00 101.63 ? 199 PHE A CE2 1 
ATOM   765   C CZ  . PHE A 1 120 ? -22.708 -71.176  -10.696 1.00 102.05 ? 199 PHE A CZ  1 
ATOM   766   N N   . GLN A 1 121 ? -21.572 -75.544  -9.734  1.00 90.05  ? 200 GLN A N   1 
ATOM   767   C CA  . GLN A 1 121 ? -22.891 -75.826  -9.216  1.00 96.16  ? 200 GLN A CA  1 
ATOM   768   C C   . GLN A 1 121 ? -23.351 -74.669  -8.352  1.00 96.54  ? 200 GLN A C   1 
ATOM   769   O O   . GLN A 1 121 ? -22.548 -74.008  -7.707  1.00 91.80  ? 200 GLN A O   1 
ATOM   770   C CB  . GLN A 1 121 ? -22.898 -77.118  -8.405  1.00 98.93  ? 200 GLN A CB  1 
ATOM   771   C CG  . GLN A 1 121 ? -24.244 -77.410  -7.780  1.00 104.26 ? 200 GLN A CG  1 
ATOM   772   C CD  . GLN A 1 121 ? -24.533 -78.871  -7.595  1.00 112.96 ? 200 GLN A CD  1 
ATOM   773   O OE1 . GLN A 1 121 ? -24.785 -79.331  -6.465  1.00 122.50 ? 200 GLN A OE1 1 
ATOM   774   N NE2 . GLN A 1 121 ? -24.528 -79.625  -8.701  1.00 117.98 ? 200 GLN A NE2 1 
ATOM   775   N N   . GLY A 1 122 ? -24.653 -74.423  -8.361  1.00 102.28 ? 201 GLY A N   1 
ATOM   776   C CA  . GLY A 1 122 ? -25.259 -73.518  -7.409  1.00 104.36 ? 201 GLY A CA  1 
ATOM   777   C C   . GLY A 1 122 ? -26.706 -73.876  -7.178  1.00 109.17 ? 201 GLY A C   1 
ATOM   778   O O   . GLY A 1 122 ? -27.334 -74.485  -8.036  1.00 109.53 ? 201 GLY A O   1 
ATOM   779   N N   . ARG A 1 123 ? -27.218 -73.508  -6.007  1.00 114.13 ? 202 ARG A N   1 
ATOM   780   C CA  . ARG A 1 123 ? -28.651 -73.599  -5.712  1.00 119.66 ? 202 ARG A CA  1 
ATOM   781   C C   . ARG A 1 123 ? -29.010 -72.730  -4.524  1.00 119.72 ? 202 ARG A C   1 
ATOM   782   O O   . ARG A 1 123 ? -28.134 -72.193  -3.856  1.00 116.07 ? 202 ARG A O   1 
ATOM   783   C CB  . ARG A 1 123 ? -29.075 -75.044  -5.441  1.00 123.38 ? 202 ARG A CB  1 
ATOM   784   C CG  . ARG A 1 123 ? -28.425 -75.642  -4.222  1.00 127.21 ? 202 ARG A CG  1 
ATOM   785   C CD  . ARG A 1 123 ? -28.198 -77.132  -4.370  1.00 134.41 ? 202 ARG A CD  1 
ATOM   786   N NE  . ARG A 1 123 ? -29.348 -77.943  -4.025  1.00 140.24 ? 202 ARG A NE  1 
ATOM   787   C CZ  . ARG A 1 123 ? -29.349 -79.279  -4.055  1.00 144.98 ? 202 ARG A CZ  1 
ATOM   788   N NH1 . ARG A 1 123 ? -28.271 -79.977  -4.432  1.00 143.53 ? 202 ARG A NH1 1 
ATOM   789   N NH2 . ARG A 1 123 ? -30.441 -79.950  -3.694  1.00 154.78 ? 202 ARG A NH2 1 
ATOM   790   N N   . LEU A 1 124 ? -30.311 -72.605  -4.278  1.00 122.17 ? 203 LEU A N   1 
ATOM   791   C CA  . LEU A 1 124 ? -30.820 -71.854  -3.138  1.00 120.76 ? 203 LEU A CA  1 
ATOM   792   C C   . LEU A 1 124 ? -30.708 -72.688  -1.865  1.00 123.84 ? 203 LEU A C   1 
ATOM   793   O O   . LEU A 1 124 ? -31.118 -73.848  -1.842  1.00 124.66 ? 203 LEU A O   1 
ATOM   794   C CB  . LEU A 1 124 ? -32.267 -71.435  -3.369  1.00 117.91 ? 203 LEU A CB  1 
ATOM   795   C CG  . LEU A 1 124 ? -32.489 -70.552  -4.595  1.00 118.01 ? 203 LEU A CG  1 
ATOM   796   C CD1 . LEU A 1 124 ? -33.961 -70.509  -4.970  1.00 121.79 ? 203 LEU A CD1 1 
ATOM   797   C CD2 . LEU A 1 124 ? -31.962 -69.145  -4.347  1.00 117.34 ? 203 LEU A CD2 1 
ATOM   798   N N   . LEU A 1 125 ? -30.135 -72.092  -0.820  1.00 128.83 ? 204 LEU A N   1 
ATOM   799   C CA  . LEU A 1 125 ? -30.004 -72.727  0.487   1.00 133.47 ? 204 LEU A CA  1 
ATOM   800   C C   . LEU A 1 125 ? -30.619 -71.807  1.525   1.00 138.87 ? 204 LEU A C   1 
ATOM   801   O O   . LEU A 1 125 ? -30.262 -70.634  1.590   1.00 132.79 ? 204 LEU A O   1 
ATOM   802   C CB  . LEU A 1 125 ? -28.535 -72.945  0.844   1.00 132.29 ? 204 LEU A CB  1 
ATOM   803   C CG  . LEU A 1 125 ? -27.688 -73.856  -0.033  1.00 133.05 ? 204 LEU A CG  1 
ATOM   804   C CD1 . LEU A 1 125 ? -26.293 -73.983  0.570   1.00 132.77 ? 204 LEU A CD1 1 
ATOM   805   C CD2 . LEU A 1 125 ? -28.326 -75.228  -0.192  1.00 138.34 ? 204 LEU A CD2 1 
ATOM   806   N N   . HIS A 1 126 ? -31.540 -72.330  2.330   1.00 145.31 ? 205 HIS A N   1 
ATOM   807   C CA  . HIS A 1 126 ? -32.025 -71.612  3.501   1.00 147.67 ? 205 HIS A CA  1 
ATOM   808   C C   . HIS A 1 126 ? -30.929 -71.746  4.550   1.00 141.54 ? 205 HIS A C   1 
ATOM   809   O O   . HIS A 1 126 ? -30.606 -72.850  4.974   1.00 140.86 ? 205 HIS A O   1 
ATOM   810   C CB  . HIS A 1 126 ? -33.372 -72.172  3.994   1.00 160.31 ? 205 HIS A CB  1 
ATOM   811   C CG  . HIS A 1 126 ? -33.728 -71.771  5.398   1.00 179.30 ? 205 HIS A CG  1 
ATOM   812   N ND1 . HIS A 1 126 ? -33.680 -70.466  5.840   1.00 180.62 ? 205 HIS A ND1 1 
ATOM   813   C CD2 . HIS A 1 126 ? -34.141 -72.509  6.460   1.00 190.35 ? 205 HIS A CD2 1 
ATOM   814   C CE1 . HIS A 1 126 ? -34.047 -70.414  7.109   1.00 184.98 ? 205 HIS A CE1 1 
ATOM   815   N NE2 . HIS A 1 126 ? -34.336 -71.641  7.510   1.00 191.01 ? 205 HIS A NE2 1 
ATOM   816   N N   . LEU A 1 127 ? -30.334 -70.622  4.928   1.00 145.67 ? 206 LEU A N   1 
ATOM   817   C CA  . LEU A 1 127 ? -29.281 -70.597  5.936   1.00 153.96 ? 206 LEU A CA  1 
ATOM   818   C C   . LEU A 1 127 ? -29.806 -70.024  7.248   1.00 158.13 ? 206 LEU A C   1 
ATOM   819   O O   . LEU A 1 127 ? -30.601 -69.079  7.251   1.00 158.38 ? 206 LEU A O   1 
ATOM   820   C CB  . LEU A 1 127 ? -28.094 -69.768  5.441   1.00 153.90 ? 206 LEU A CB  1 
ATOM   821   C CG  . LEU A 1 127 ? -27.441 -70.239  4.139   1.00 147.58 ? 206 LEU A CG  1 
ATOM   822   C CD1 . LEU A 1 127 ? -26.281 -69.324  3.759   1.00 145.62 ? 206 LEU A CD1 1 
ATOM   823   C CD2 . LEU A 1 127 ? -26.979 -71.688  4.260   1.00 145.54 ? 206 LEU A CD2 1 
ATOM   824   N N   . SER A 1 128 ? -29.345 -70.616  8.352   1.00 155.60 ? 207 SER A N   1 
ATOM   825   C CA  . SER A 1 128 ? -29.694 -70.157  9.691   1.00 160.62 ? 207 SER A CA  1 
ATOM   826   C C   . SER A 1 128 ? -28.791 -68.997  10.089  1.00 162.68 ? 207 SER A C   1 
ATOM   827   O O   . SER A 1 128 ? -27.751 -68.766  9.469   1.00 158.99 ? 207 SER A O   1 
ATOM   828   C CB  . SER A 1 128 ? -29.530 -71.295  10.695  1.00 164.31 ? 207 SER A CB  1 
ATOM   829   O OG  . SER A 1 128 ? -30.016 -72.507  10.153  1.00 174.80 ? 207 SER A OG  1 
ATOM   830   N N   . ALA A 1 129 ? -29.195 -68.277  11.130  1.00 167.02 ? 208 ALA A N   1 
ATOM   831   C CA  . ALA A 1 129 ? -28.364 -67.226  11.705  1.00 163.43 ? 208 ALA A CA  1 
ATOM   832   C C   . ALA A 1 129 ? -27.157 -67.881  12.371  1.00 157.96 ? 208 ALA A C   1 
ATOM   833   O O   . ALA A 1 129 ? -27.299 -68.900  13.050  1.00 163.21 ? 208 ALA A O   1 
ATOM   834   C CB  . ALA A 1 129 ? -29.157 -66.404  12.709  1.00 168.08 ? 208 ALA A CB  1 
ATOM   835   N N   . GLY A 1 130 ? -25.973 -67.317  12.147  1.00 151.13 ? 209 GLY A N   1 
ATOM   836   C CA  . GLY A 1 130 ? -24.728 -67.869  12.693  1.00 152.46 ? 209 GLY A CA  1 
ATOM   837   C C   . GLY A 1 130 ? -24.319 -69.228  12.133  1.00 152.28 ? 209 GLY A C   1 
ATOM   838   O O   . GLY A 1 130 ? -23.620 -69.991  12.807  1.00 150.82 ? 209 GLY A O   1 
ATOM   839   N N   . GLN A 1 131 ? -24.749 -69.527  10.903  1.00 154.17 ? 210 GLN A N   1 
ATOM   840   C CA  . GLN A 1 131 ? -24.406 -70.779  10.231  1.00 147.25 ? 210 GLN A CA  1 
ATOM   841   C C   . GLN A 1 131 ? -22.983 -70.699  9.692   1.00 145.13 ? 210 GLN A C   1 
ATOM   842   O O   . GLN A 1 131 ? -22.606 -69.699  9.065   1.00 135.38 ? 210 GLN A O   1 
ATOM   843   C CB  . GLN A 1 131 ? -25.388 -71.059  9.082   1.00 143.52 ? 210 GLN A CB  1 
ATOM   844   C CG  . GLN A 1 131 ? -25.231 -72.421  8.419   1.00 139.98 ? 210 GLN A CG  1 
ATOM   845   C CD  . GLN A 1 131 ? -26.109 -73.476  9.032   1.00 143.49 ? 210 GLN A CD  1 
ATOM   846   O OE1 . GLN A 1 131 ? -25.639 -74.314  9.821   1.00 145.97 ? 210 GLN A OE1 1 
ATOM   847   N NE2 . GLN A 1 131 ? -27.395 -73.456  8.665   1.00 146.71 ? 210 GLN A NE2 1 
ATOM   848   N N   . ARG A 1 132 ? -22.210 -71.755  9.938   1.00 145.57 ? 211 ARG A N   1 
ATOM   849   C CA  . ARG A 1 132 ? -20.811 -71.840  9.510   1.00 145.57 ? 211 ARG A CA  1 
ATOM   850   C C   . ARG A 1 132 ? -20.685 -72.831  8.337   1.00 139.50 ? 211 ARG A C   1 
ATOM   851   O O   . ARG A 1 132 ? -20.747 -74.047  8.541   1.00 142.31 ? 211 ARG A O   1 
ATOM   852   C CB  . ARG A 1 132 ? -19.921 -72.253  10.687  1.00 151.36 ? 211 ARG A CB  1 
ATOM   853   C CG  . ARG A 1 132 ? -20.099 -71.371  11.924  1.00 162.85 ? 211 ARG A CG  1 
ATOM   854   C CD  . ARG A 1 132 ? -20.058 -72.173  13.218  1.00 171.96 ? 211 ARG A CD  1 
ATOM   855   N NE  . ARG A 1 132 ? -18.739 -72.779  13.410  1.00 180.46 ? 211 ARG A NE  1 
ATOM   856   C CZ  . ARG A 1 132 ? -18.463 -73.816  14.202  1.00 187.43 ? 211 ARG A CZ  1 
ATOM   857   N NH1 . ARG A 1 132 ? -19.412 -74.416  14.922  1.00 194.25 ? 211 ARG A NH1 1 
ATOM   858   N NH2 . ARG A 1 132 ? -17.210 -74.264  14.267  1.00 188.66 ? 211 ARG A NH2 1 
ATOM   859   N N   . LEU A 1 133 ? -20.519 -72.301  7.122   1.00 133.17 ? 212 LEU A N   1 
ATOM   860   C CA  . LEU A 1 133 ? -20.344 -73.107  5.911   1.00 124.28 ? 212 LEU A CA  1 
ATOM   861   C C   . LEU A 1 133 ? -18.857 -73.418  5.733   1.00 119.84 ? 212 LEU A C   1 
ATOM   862   O O   . LEU A 1 133 ? -18.013 -72.538  5.883   1.00 116.64 ? 212 LEU A O   1 
ATOM   863   C CB  . LEU A 1 133 ? -20.848 -72.367  4.661   1.00 125.30 ? 212 LEU A CB  1 
ATOM   864   C CG  . LEU A 1 133 ? -22.288 -71.941  4.408   1.00 129.77 ? 212 LEU A CG  1 
ATOM   865   C CD1 . LEU A 1 133 ? -22.726 -70.907  5.424   1.00 137.41 ? 212 LEU A CD1 1 
ATOM   866   C CD2 . LEU A 1 133 ? -22.411 -71.357  3.001   1.00 128.42 ? 212 LEU A CD2 1 
ATOM   867   N N   . GLY A 1 134 ? -18.540 -74.679  5.426   1.00 119.71 ? 213 GLY A N   1 
ATOM   868   C CA  . GLY A 1 134 ? -17.176 -75.113  5.095   1.00 119.48 ? 213 GLY A CA  1 
ATOM   869   C C   . GLY A 1 134 ? -17.170 -76.078  3.918   1.00 117.94 ? 213 GLY A C   1 
ATOM   870   O O   . GLY A 1 134 ? -18.126 -76.817  3.714   1.00 123.03 ? 213 GLY A O   1 
ATOM   871   N N   . VAL A 1 135 ? -16.076 -76.088  3.165   1.00 117.98 ? 214 VAL A N   1 
ATOM   872   C CA  . VAL A 1 135 ? -15.963 -76.877  1.932   1.00 114.83 ? 214 VAL A CA  1 
ATOM   873   C C   . VAL A 1 135 ? -14.866 -77.927  2.066   1.00 110.59 ? 214 VAL A C   1 
ATOM   874   O O   . VAL A 1 135 ? -13.767 -77.610  2.490   1.00 110.16 ? 214 VAL A O   1 
ATOM   875   C CB  . VAL A 1 135 ? -15.626 -75.981  0.727   1.00 117.69 ? 214 VAL A CB  1 
ATOM   876   C CG1 . VAL A 1 135 ? -15.653 -76.786  -0.560  1.00 120.79 ? 214 VAL A CG1 1 
ATOM   877   C CG2 . VAL A 1 135 ? -16.602 -74.823  0.631   1.00 118.80 ? 214 VAL A CG2 1 
ATOM   878   N N   . HIS A 1 136 ? -15.171 -79.156  1.659   1.00 111.38 ? 215 HIS A N   1 
ATOM   879   C CA  . HIS A 1 136 ? -14.243 -80.284  1.777   1.00 115.91 ? 215 HIS A CA  1 
ATOM   880   C C   . HIS A 1 136 ? -13.915 -80.892  0.418   1.00 114.30 ? 215 HIS A C   1 
ATOM   881   O O   . HIS A 1 136 ? -14.807 -81.225  -0.370  1.00 117.74 ? 215 HIS A O   1 
ATOM   882   C CB  . HIS A 1 136 ? -14.821 -81.353  2.708   1.00 121.88 ? 215 HIS A CB  1 
ATOM   883   C CG  . HIS A 1 136 ? -14.778 -80.966  4.147   1.00 129.74 ? 215 HIS A CG  1 
ATOM   884   N ND1 . HIS A 1 136 ? -15.666 -80.060  4.696   1.00 134.26 ? 215 HIS A ND1 1 
ATOM   885   C CD2 . HIS A 1 136 ? -13.956 -81.350  5.153   1.00 132.99 ? 215 HIS A CD2 1 
ATOM   886   C CE1 . HIS A 1 136 ? -15.391 -79.901  5.977   1.00 137.61 ? 215 HIS A CE1 1 
ATOM   887   N NE2 . HIS A 1 136 ? -14.357 -80.670  6.279   1.00 139.48 ? 215 HIS A NE2 1 
ATOM   888   N N   . LEU A 1 137 ? -12.617 -81.043  0.167   1.00 110.17 ? 216 LEU A N   1 
ATOM   889   C CA  . LEU A 1 137 ? -12.091 -81.605  -1.066  1.00 107.18 ? 216 LEU A CA  1 
ATOM   890   C C   . LEU A 1 137 ? -11.828 -83.092  -0.896  1.00 106.01 ? 216 LEU A C   1 
ATOM   891   O O   . LEU A 1 137 ? -11.234 -83.495  0.086   1.00 107.38 ? 216 LEU A O   1 
ATOM   892   C CB  . LEU A 1 137 ? -10.783 -80.911  -1.411  1.00 106.90 ? 216 LEU A CB  1 
ATOM   893   C CG  . LEU A 1 137 ? -10.161 -81.298  -2.753  1.00 107.82 ? 216 LEU A CG  1 
ATOM   894   C CD1 . LEU A 1 137 ? -10.980 -80.697  -3.886  1.00 109.81 ? 216 LEU A CD1 1 
ATOM   895   C CD2 . LEU A 1 137 ? -8.700  -80.858  -2.801  1.00 109.35 ? 216 LEU A CD2 1 
ATOM   896   N N   . HIS A 1 138 ? -12.271 -83.896  -1.850  1.00 107.44 ? 217 HIS A N   1 
ATOM   897   C CA  . HIS A 1 138 ? -11.974 -85.321  -1.863  1.00 112.86 ? 217 HIS A CA  1 
ATOM   898   C C   . HIS A 1 138 ? -11.569 -85.705  -3.269  1.00 112.45 ? 217 HIS A C   1 
ATOM   899   O O   . HIS A 1 138 ? -12.104 -85.162  -4.234  1.00 109.38 ? 217 HIS A O   1 
ATOM   900   C CB  . HIS A 1 138 ? -13.184 -86.153  -1.431  1.00 123.10 ? 217 HIS A CB  1 
ATOM   901   C CG  . HIS A 1 138 ? -12.886 -87.614  -1.324  1.00 133.39 ? 217 HIS A CG  1 
ATOM   902   N ND1 . HIS A 1 138 ? -12.420 -88.199  -0.166  1.00 141.75 ? 217 HIS A ND1 1 
ATOM   903   C CD2 . HIS A 1 138 ? -12.958 -88.605  -2.242  1.00 139.89 ? 217 HIS A CD2 1 
ATOM   904   C CE1 . HIS A 1 138 ? -12.235 -89.492  -0.369  1.00 146.80 ? 217 HIS A CE1 1 
ATOM   905   N NE2 . HIS A 1 138 ? -12.538 -89.762  -1.625  1.00 148.20 ? 217 HIS A NE2 1 
ATOM   906   N N   . THR A 1 139 ? -10.644 -86.653  -3.388  1.00 112.69 ? 218 THR A N   1 
ATOM   907   C CA  . THR A 1 139 ? -10.079 -86.990  -4.695  1.00 111.18 ? 218 THR A CA  1 
ATOM   908   C C   . THR A 1 139 ? -9.744  -88.473  -4.839  1.00 110.93 ? 218 THR A C   1 
ATOM   909   O O   . THR A 1 139 ? -8.962  -88.995  -4.066  1.00 112.98 ? 218 THR A O   1 
ATOM   910   C CB  . THR A 1 139 ? -8.852  -86.086  -5.038  1.00 110.77 ? 218 THR A CB  1 
ATOM   911   O OG1 . THR A 1 139 ? -7.892  -86.824  -5.813  1.00 108.73 ? 218 THR A OG1 1 
ATOM   912   C CG2 . THR A 1 139 ? -8.167  -85.540  -3.797  1.00 111.09 ? 218 THR A CG2 1 
ATOM   913   N N   . GLU A 1 140 ? -10.371 -89.120  -5.828  1.00 115.52 ? 219 GLU A N   1 
ATOM   914   C CA  . GLU A 1 140 ? -10.012 -90.475  -6.280  1.00 121.29 ? 219 GLU A CA  1 
ATOM   915   C C   . GLU A 1 140 ? -8.707  -90.433  -7.092  1.00 124.05 ? 219 GLU A C   1 
ATOM   916   O O   . GLU A 1 140 ? -8.712  -90.231  -8.313  1.00 117.47 ? 219 GLU A O   1 
ATOM   917   C CB  . GLU A 1 140 ? -11.133 -91.096  -7.125  1.00 119.42 ? 219 GLU A CB  1 
ATOM   918   N N   . ALA A 1 141 ? -7.598  -90.646  -6.383  1.00 131.29 ? 220 ALA A N   1 
ATOM   919   C CA  . ALA A 1 141 ? -6.251  -90.482  -6.927  1.00 141.27 ? 220 ALA A CA  1 
ATOM   920   C C   . ALA A 1 141 ? -5.799  -91.640  -7.812  1.00 142.17 ? 220 ALA A C   1 
ATOM   921   O O   . ALA A 1 141 ? -5.742  -92.785  -7.366  1.00 158.97 ? 220 ALA A O   1 
ATOM   922   C CB  . ALA A 1 141 ? -5.252  -90.308  -5.779  1.00 145.41 ? 220 ALA A CB  1 
ATOM   923   N N   . ARG A 1 142 ? -5.497  -91.335  -9.068  1.00 134.48 ? 221 ARG A N   1 
ATOM   924   C CA  . ARG A 1 142 ? -4.612  -92.166  -9.874  1.00 134.74 ? 221 ARG A CA  1 
ATOM   925   C C   . ARG A 1 142 ? -3.544  -91.208  -10.386 1.00 137.80 ? 221 ARG A C   1 
ATOM   926   O O   . ARG A 1 142 ? -3.657  -90.667  -11.481 1.00 139.58 ? 221 ARG A O   1 
ATOM   927   C CB  . ARG A 1 142 ? -5.362  -92.862  -11.008 1.00 132.55 ? 221 ARG A CB  1 
ATOM   928   N N   . ALA A 1 143 ? -2.525  -90.998  -9.547  1.00 141.75 ? 222 ALA A N   1 
ATOM   929   C CA  . ALA A 1 143 ? -1.496  -89.954  -9.713  1.00 137.15 ? 222 ALA A CA  1 
ATOM   930   C C   . ALA A 1 143 ? -2.025  -88.544  -9.409  1.00 135.13 ? 222 ALA A C   1 
ATOM   931   O O   . ALA A 1 143 ? -1.881  -87.631  -10.214 1.00 133.98 ? 222 ALA A O   1 
ATOM   932   C CB  . ALA A 1 143 ? -0.828  -90.035  -11.089 1.00 136.23 ? 222 ALA A CB  1 
ATOM   933   N N   . ARG A 1 144 ? -2.604  -88.377  -8.218  1.00 134.45 ? 223 ARG A N   1 
ATOM   934   C CA  . ARG A 1 144 ? -3.100  -87.068  -7.727  1.00 129.70 ? 223 ARG A CA  1 
ATOM   935   C C   . ARG A 1 144 ? -2.063  -85.932  -7.824  1.00 131.29 ? 223 ARG A C   1 
ATOM   936   O O   . ARG A 1 144 ? -2.427  -84.772  -7.934  1.00 136.53 ? 223 ARG A O   1 
ATOM   937   C CB  . ARG A 1 144 ? -3.573  -87.196  -6.271  1.00 127.87 ? 223 ARG A CB  1 
ATOM   938   N N   . HIS A 1 145 ? -0.776  -86.272  -7.774  1.00 130.04 ? 224 HIS A N   1 
ATOM   939   C CA  . HIS A 1 145 ? 0.308   -85.309  -7.994  1.00 124.72 ? 224 HIS A CA  1 
ATOM   940   C C   . HIS A 1 145 ? 0.343   -84.684  -9.397  1.00 119.76 ? 224 HIS A C   1 
ATOM   941   O O   . HIS A 1 145 ? 0.930   -83.623  -9.582  1.00 121.53 ? 224 HIS A O   1 
ATOM   942   C CB  . HIS A 1 145 ? 1.655   -85.972  -7.717  1.00 128.82 ? 224 HIS A CB  1 
ATOM   943   N N   . ALA A 1 146 ? -0.246  -85.357  -10.381 1.00 113.12 ? 225 ALA A N   1 
ATOM   944   C CA  . ALA A 1 146 ? -0.256  -84.883  -11.772 1.00 107.21 ? 225 ALA A CA  1 
ATOM   945   C C   . ALA A 1 146 ? -1.269  -83.780  -12.035 1.00 101.79 ? 225 ALA A C   1 
ATOM   946   O O   . ALA A 1 146 ? -1.222  -83.174  -13.099 1.00 108.36 ? 225 ALA A O   1 
ATOM   947   C CB  . ALA A 1 146 ? -0.498  -86.039  -12.729 1.00 105.84 ? 225 ALA A CB  1 
ATOM   948   N N   . TRP A 1 147 ? -2.178  -83.525  -11.097 1.00 93.99  ? 226 TRP A N   1 
ATOM   949   C CA  . TRP A 1 147 ? -3.186  -82.472  -11.232 1.00 92.90  ? 226 TRP A CA  1 
ATOM   950   C C   . TRP A 1 147 ? -3.132  -81.525  -10.041 1.00 90.19  ? 226 TRP A C   1 
ATOM   951   O O   . TRP A 1 147 ? -2.794  -81.927  -8.935  1.00 93.59  ? 226 TRP A O   1 
ATOM   952   C CB  . TRP A 1 147 ? -4.585  -83.106  -11.314 1.00 95.09  ? 226 TRP A CB  1 
ATOM   953   C CG  . TRP A 1 147 ? -4.937  -83.680  -12.672 1.00 96.88  ? 226 TRP A CG  1 
ATOM   954   C CD1 . TRP A 1 147 ? -4.638  -84.920  -13.138 1.00 99.40  ? 226 TRP A CD1 1 
ATOM   955   C CD2 . TRP A 1 147 ? -5.682  -83.038  -13.697 1.00 97.17  ? 226 TRP A CD2 1 
ATOM   956   N NE1 . TRP A 1 147 ? -5.131  -85.085  -14.405 1.00 98.40  ? 226 TRP A NE1 1 
ATOM   957   C CE2 . TRP A 1 147 ? -5.782  -83.941  -14.771 1.00 98.57  ? 226 TRP A CE2 1 
ATOM   958   C CE3 . TRP A 1 147 ? -6.269  -81.775  -13.815 1.00 99.06  ? 226 TRP A CE3 1 
ATOM   959   C CZ2 . TRP A 1 147 ? -6.448  -83.623  -15.963 1.00 101.49 ? 226 TRP A CZ2 1 
ATOM   960   C CZ3 . TRP A 1 147 ? -6.924  -81.452  -15.004 1.00 100.70 ? 226 TRP A CZ3 1 
ATOM   961   C CH2 . TRP A 1 147 ? -7.010  -82.378  -16.066 1.00 101.38 ? 226 TRP A CH2 1 
ATOM   962   N N   . GLN A 1 148 ? -3.464  -80.264  -10.264 1.00 87.72  ? 227 GLN A N   1 
ATOM   963   C CA  . GLN A 1 148 ? -3.585  -79.288  -9.190  1.00 86.73  ? 227 GLN A CA  1 
ATOM   964   C C   . GLN A 1 148 ? -4.842  -78.461  -9.388  1.00 82.32  ? 227 GLN A C   1 
ATOM   965   O O   . GLN A 1 148 ? -5.354  -78.352  -10.504 1.00 80.59  ? 227 GLN A O   1 
ATOM   966   C CB  . GLN A 1 148 ? -2.359  -78.365  -9.192  1.00 91.71  ? 227 GLN A CB  1 
ATOM   967   C CG  . GLN A 1 148 ? -1.044  -79.092  -8.967  1.00 96.86  ? 227 GLN A CG  1 
ATOM   968   C CD  . GLN A 1 148 ? 0.124   -78.218  -8.527  1.00 100.88 ? 227 GLN A CD  1 
ATOM   969   O OE1 . GLN A 1 148 ? 0.001   -77.012  -8.313  1.00 108.63 ? 227 GLN A OE1 1 
ATOM   970   N NE2 . GLN A 1 148 ? 1.276   -78.851  -8.368  1.00 103.30 ? 227 GLN A NE2 1 
ATOM   971   N N   . LEU A 1 149 ? -5.317  -77.855  -8.314  1.00 82.31  ? 228 LEU A N   1 
ATOM   972   C CA  . LEU A 1 149 ? -6.338  -76.819  -8.425  1.00 85.29  ? 228 LEU A CA  1 
ATOM   973   C C   . LEU A 1 149 ? -5.753  -75.653  -9.205  1.00 86.99  ? 228 LEU A C   1 
ATOM   974   O O   . LEU A 1 149 ? -4.641  -75.221  -8.938  1.00 85.85  ? 228 LEU A O   1 
ATOM   975   C CB  . LEU A 1 149 ? -6.765  -76.316  -7.044  1.00 87.48  ? 228 LEU A CB  1 
ATOM   976   C CG  . LEU A 1 149 ? -7.442  -77.322  -6.122  1.00 89.89  ? 228 LEU A CG  1 
ATOM   977   C CD1 . LEU A 1 149 ? -7.545  -76.681  -4.751  1.00 93.08  ? 228 LEU A CD1 1 
ATOM   978   C CD2 . LEU A 1 149 ? -8.860  -77.679  -6.582  1.00 89.71  ? 228 LEU A CD2 1 
ATOM   979   N N   . THR A 1 150 ? -6.496  -75.167  -10.189 1.00 90.13  ? 229 THR A N   1 
ATOM   980   C CA  . THR A 1 150 ? -6.113  -73.963  -10.930 1.00 92.80  ? 229 THR A CA  1 
ATOM   981   C C   . THR A 1 150 ? -6.292  -72.781  -10.008 1.00 94.87  ? 229 THR A C   1 
ATOM   982   O O   . THR A 1 150 ? -7.339  -72.644  -9.382  1.00 96.46  ? 229 THR A O   1 
ATOM   983   C CB  . THR A 1 150 ? -6.962  -73.768  -12.188 1.00 93.57  ? 229 THR A CB  1 
ATOM   984   O OG1 . THR A 1 150 ? -6.838  -74.918  -13.036 1.00 95.28  ? 229 THR A OG1 1 
ATOM   985   C CG2 . THR A 1 150 ? -6.520  -72.543  -12.944 1.00 96.39  ? 229 THR A CG2 1 
ATOM   986   N N   . GLN A 1 151 ? -5.275  -71.927  -9.935  1.00 99.08  ? 230 GLN A N   1 
ATOM   987   C CA  . GLN A 1 151 ? -5.187  -70.933  -8.860  1.00 102.76 ? 230 GLN A CA  1 
ATOM   988   C C   . GLN A 1 151 ? -6.044  -69.724  -9.160  1.00 104.56 ? 230 GLN A C   1 
ATOM   989   O O   . GLN A 1 151 ? -6.006  -69.203  -10.277 1.00 105.41 ? 230 GLN A O   1 
ATOM   990   C CB  . GLN A 1 151 ? -3.762  -70.483  -8.662  1.00 109.08 ? 230 GLN A CB  1 
ATOM   991   C CG  . GLN A 1 151 ? -2.822  -71.592  -8.242  1.00 111.09 ? 230 GLN A CG  1 
ATOM   992   C CD  . GLN A 1 151 ? -1.437  -71.061  -7.900  1.00 114.26 ? 230 GLN A CD  1 
ATOM   993   O OE1 . GLN A 1 151 ? -0.432  -71.624  -8.334  1.00 117.39 ? 230 GLN A OE1 1 
ATOM   994   N NE2 . GLN A 1 151 ? -1.376  -69.967  -7.115  1.00 113.01 ? 230 GLN A NE2 1 
ATOM   995   N N   . GLY A 1 152 ? -6.810  -69.286  -8.163  1.00 107.95 ? 231 GLY A N   1 
ATOM   996   C CA  . GLY A 1 152 ? -7.799  -68.225  -8.349  1.00 113.01 ? 231 GLY A CA  1 
ATOM   997   C C   . GLY A 1 152 ? -9.111  -68.635  -9.014  1.00 108.73 ? 231 GLY A C   1 
ATOM   998   O O   . GLY A 1 152 ? -9.999  -67.805  -9.182  1.00 107.40 ? 231 GLY A O   1 
ATOM   999   N N   . ALA A 1 153 ? -9.246  -69.916  -9.344  1.00 107.75 ? 232 ALA A N   1 
ATOM   1000  C CA  . ALA A 1 153 ? -10.382 -70.443  -10.092 1.00 112.32 ? 232 ALA A CA  1 
ATOM   1001  C C   . ALA A 1 153 ? -11.396 -71.200  -9.226  1.00 114.17 ? 232 ALA A C   1 
ATOM   1002  O O   . ALA A 1 153 ? -12.590 -71.180  -9.526  1.00 117.52 ? 232 ALA A O   1 
ATOM   1003  C CB  . ALA A 1 153 ? -9.877  -71.356  -11.190 1.00 114.22 ? 232 ALA A CB  1 
ATOM   1004  N N   . THR A 1 154 ? -10.908 -71.895  -8.197  1.00 112.61 ? 233 THR A N   1 
ATOM   1005  C CA  . THR A 1 154 ? -11.772 -72.571  -7.233  1.00 107.92 ? 233 THR A CA  1 
ATOM   1006  C C   . THR A 1 154 ? -12.367 -71.522  -6.294  1.00 102.75 ? 233 THR A C   1 
ATOM   1007  O O   . THR A 1 154 ? -11.643 -70.847  -5.565  1.00 99.01  ? 233 THR A O   1 
ATOM   1008  C CB  . THR A 1 154 ? -10.984 -73.622  -6.416  1.00 110.18 ? 233 THR A CB  1 
ATOM   1009  O OG1 . THR A 1 154 ? -10.339 -74.531  -7.320  1.00 105.63 ? 233 THR A OG1 1 
ATOM   1010  C CG2 . THR A 1 154 ? -11.904 -74.392  -5.462  1.00 107.25 ? 233 THR A CG2 1 
ATOM   1011  N N   . VAL A 1 155 ? -13.689 -71.398  -6.326  1.00 102.23 ? 234 VAL A N   1 
ATOM   1012  C CA  . VAL A 1 155 ? -14.390 -70.264  -5.738  1.00 107.19 ? 234 VAL A CA  1 
ATOM   1013  C C   . VAL A 1 155 ? -15.677 -70.722  -5.075  1.00 108.20 ? 234 VAL A C   1 
ATOM   1014  O O   . VAL A 1 155 ? -16.422 -71.488  -5.652  1.00 105.71 ? 234 VAL A O   1 
ATOM   1015  C CB  . VAL A 1 155 ? -14.739 -69.241  -6.838  1.00 112.18 ? 234 VAL A CB  1 
ATOM   1016  C CG1 . VAL A 1 155 ? -15.725 -68.191  -6.353  1.00 115.17 ? 234 VAL A CG1 1 
ATOM   1017  C CG2 . VAL A 1 155 ? -13.472 -68.576  -7.348  1.00 115.69 ? 234 VAL A CG2 1 
ATOM   1018  N N   . LEU A 1 156 ? -15.927 -70.234  -3.866  1.00 112.44 ? 235 LEU A N   1 
ATOM   1019  C CA  . LEU A 1 156 ? -17.223 -70.359  -3.206  1.00 111.29 ? 235 LEU A CA  1 
ATOM   1020  C C   . LEU A 1 156 ? -17.809 -68.973  -3.163  1.00 109.68 ? 235 LEU A C   1 
ATOM   1021  O O   . LEU A 1 156 ? -17.122 -68.025  -2.782  1.00 107.26 ? 235 LEU A O   1 
ATOM   1022  C CB  . LEU A 1 156 ? -17.050 -70.857  -1.774  1.00 115.20 ? 235 LEU A CB  1 
ATOM   1023  C CG  . LEU A 1 156 ? -18.257 -70.795  -0.846  1.00 120.15 ? 235 LEU A CG  1 
ATOM   1024  C CD1 . LEU A 1 156 ? -19.386 -71.682  -1.369  1.00 123.96 ? 235 LEU A CD1 1 
ATOM   1025  C CD2 . LEU A 1 156 ? -17.814 -71.219  0.548   1.00 121.10 ? 235 LEU A CD2 1 
ATOM   1026  N N   . GLY A 1 157 ? -19.075 -68.856  -3.543  1.00 109.10 ? 236 GLY A N   1 
ATOM   1027  C CA  . GLY A 1 157 ? -19.761 -67.580  -3.502  1.00 112.22 ? 236 GLY A CA  1 
ATOM   1028  C C   . GLY A 1 157 ? -21.213 -67.722  -3.121  1.00 111.97 ? 236 GLY A C   1 
ATOM   1029  O O   . GLY A 1 157 ? -21.818 -68.771  -3.309  1.00 106.61 ? 236 GLY A O   1 
ATOM   1030  N N   . LEU A 1 158 ? -21.765 -66.649  -2.570  1.00 119.94 ? 237 LEU A N   1 
ATOM   1031  C CA  . LEU A 1 158 ? -23.194 -66.580  -2.270  1.00 123.72 ? 237 LEU A CA  1 
ATOM   1032  C C   . LEU A 1 158 ? -23.694 -65.145  -2.231  1.00 124.15 ? 237 LEU A C   1 
ATOM   1033  O O   . LEU A 1 158 ? -22.922 -64.214  -2.038  1.00 120.61 ? 237 LEU A O   1 
ATOM   1034  C CB  . LEU A 1 158 ? -23.511 -67.294  -0.956  1.00 122.08 ? 237 LEU A CB  1 
ATOM   1035  C CG  . LEU A 1 158 ? -22.658 -66.945  0.278   1.00 122.49 ? 237 LEU A CG  1 
ATOM   1036  C CD1 . LEU A 1 158 ? -22.997 -65.590  0.860   1.00 124.24 ? 237 LEU A CD1 1 
ATOM   1037  C CD2 . LEU A 1 158 ? -22.828 -68.006  1.352   1.00 125.66 ? 237 LEU A CD2 1 
ATOM   1038  N N   . PHE A 1 159 ? -24.996 -64.992  -2.427  1.00 123.14 ? 238 PHE A N   1 
ATOM   1039  C CA  . PHE A 1 159 ? -25.672 -63.722  -2.218  1.00 124.34 ? 238 PHE A CA  1 
ATOM   1040  C C   . PHE A 1 159 ? -27.101 -63.959  -1.742  1.00 130.69 ? 238 PHE A C   1 
ATOM   1041  O O   . PHE A 1 159 ? -27.719 -64.958  -2.106  1.00 129.39 ? 238 PHE A O   1 
ATOM   1042  C CB  . PHE A 1 159 ? -25.625 -62.850  -3.478  1.00 120.76 ? 238 PHE A CB  1 
ATOM   1043  C CG  . PHE A 1 159 ? -26.139 -63.515  -4.729  1.00 117.85 ? 238 PHE A CG  1 
ATOM   1044  C CD1 . PHE A 1 159 ? -27.497 -63.498  -5.039  1.00 119.50 ? 238 PHE A CD1 1 
ATOM   1045  C CD2 . PHE A 1 159 ? -25.262 -64.105  -5.626  1.00 115.58 ? 238 PHE A CD2 1 
ATOM   1046  C CE1 . PHE A 1 159 ? -27.973 -64.078  -6.210  1.00 117.70 ? 238 PHE A CE1 1 
ATOM   1047  C CE2 . PHE A 1 159 ? -25.731 -64.683  -6.804  1.00 117.10 ? 238 PHE A CE2 1 
ATOM   1048  C CZ  . PHE A 1 159 ? -27.096 -64.678  -7.089  1.00 117.66 ? 238 PHE A CZ  1 
ATOM   1049  N N   . ARG A 1 160 ? -27.605 -63.045  -0.911  1.00 138.28 ? 239 ARG A N   1 
ATOM   1050  C CA  . ARG A 1 160 ? -28.935 -63.184  -0.304  1.00 139.92 ? 239 ARG A CA  1 
ATOM   1051  C C   . ARG A 1 160 ? -30.015 -62.897  -1.340  1.00 141.25 ? 239 ARG A C   1 
ATOM   1052  O O   . ARG A 1 160 ? -29.863 -62.009  -2.177  1.00 138.63 ? 239 ARG A O   1 
ATOM   1053  C CB  . ARG A 1 160 ? -29.108 -62.252  0.901   1.00 141.25 ? 239 ARG A CB  1 
ATOM   1054  N N   . VAL A 1 161 ? -31.080 -63.682  -1.288  1.00 144.73 ? 240 VAL A N   1 
ATOM   1055  C CA  . VAL A 1 161 ? -32.261 -63.471  -2.113  1.00 151.26 ? 240 VAL A CA  1 
ATOM   1056  C C   . VAL A 1 161 ? -33.426 -62.914  -1.270  1.00 165.26 ? 240 VAL A C   1 
ATOM   1057  O O   . VAL A 1 161 ? -34.099 -61.972  -1.681  1.00 171.29 ? 240 VAL A O   1 
ATOM   1058  C CB  . VAL A 1 161 ? -32.657 -64.770  -2.825  1.00 148.20 ? 240 VAL A CB  1 
ATOM   1059  C CG1 . VAL A 1 161 ? -33.900 -64.531  -3.684  1.00 154.42 ? 240 VAL A CG1 1 
ATOM   1060  C CG2 . VAL A 1 161 ? -31.505 -65.253  -3.687  1.00 144.76 ? 240 VAL A CG2 1 
ATOM   1061  N N   . THR A 1 162 ? -33.654 -63.497  -0.089  1.00 174.06 ? 241 THR A N   1 
ATOM   1062  C CA  . THR A 1 162 ? -34.667 -62.999  0.845   1.00 177.58 ? 241 THR A CA  1 
ATOM   1063  C C   . THR A 1 162 ? -34.199 -61.651  1.412   1.00 186.56 ? 241 THR A C   1 
ATOM   1064  O O   . THR A 1 162 ? -33.045 -61.531  1.869   1.00 184.59 ? 241 THR A O   1 
ATOM   1065  C CB  . THR A 1 162 ? -34.919 -63.960  2.017   1.00 169.92 ? 241 THR A CB  1 
ATOM   1066  N N   . PRO A 1 163 ? -35.085 -60.624  1.399   1.00 191.30 ? 242 PRO A N   1 
ATOM   1067  C CA  . PRO A 1 163 ? -34.804 -59.419  2.199   1.00 193.52 ? 242 PRO A CA  1 
ATOM   1068  C C   . PRO A 1 163 ? -34.975 -59.662  3.711   1.00 203.87 ? 242 PRO A C   1 
ATOM   1069  O O   . PRO A 1 163 ? -34.604 -58.815  4.509   1.00 215.38 ? 242 PRO A O   1 
ATOM   1070  C CB  . PRO A 1 163 ? -35.836 -58.407  1.695   1.00 193.73 ? 242 PRO A CB  1 
ATOM   1071  C CG  . PRO A 1 163 ? -36.377 -58.981  0.422   1.00 191.42 ? 242 PRO A CG  1 
ATOM   1072  C CD  . PRO A 1 163 ? -36.294 -60.462  0.571   1.00 188.53 ? 242 PRO A CD  1 
ATOM   1073  N N   . MET B 1 12  ? -31.684 -53.851  -13.035 1.00 158.80 ? 91  MET B N   1 
ATOM   1074  C CA  . MET B 1 12  ? -30.349 -53.588  -13.648 1.00 158.77 ? 91  MET B CA  1 
ATOM   1075  C C   . MET B 1 12  ? -29.709 -54.923  -14.038 1.00 147.66 ? 91  MET B C   1 
ATOM   1076  O O   . MET B 1 12  ? -28.976 -55.525  -13.255 1.00 143.56 ? 91  MET B O   1 
ATOM   1077  C CB  . MET B 1 12  ? -29.473 -52.796  -12.670 1.00 165.97 ? 91  MET B CB  1 
ATOM   1078  C CG  . MET B 1 12  ? -28.064 -52.469  -13.126 1.00 173.31 ? 91  MET B CG  1 
ATOM   1079  S SD  . MET B 1 12  ? -28.018 -51.283  -14.480 1.00 190.20 ? 91  MET B SD  1 
ATOM   1080  C CE  . MET B 1 12  ? -26.276 -50.815  -14.448 1.00 192.52 ? 91  MET B CE  1 
ATOM   1081  N N   . PHE B 1 13  ? -30.016 -55.374  -15.251 1.00 136.88 ? 92  PHE B N   1 
ATOM   1082  C CA  . PHE B 1 13  ? -29.556 -56.660  -15.750 1.00 126.84 ? 92  PHE B CA  1 
ATOM   1083  C C   . PHE B 1 13  ? -29.505 -56.698  -17.264 1.00 126.39 ? 92  PHE B C   1 
ATOM   1084  O O   . PHE B 1 13  ? -30.196 -55.945  -17.936 1.00 125.35 ? 92  PHE B O   1 
ATOM   1085  C CB  . PHE B 1 13  ? -30.485 -57.764  -15.262 1.00 124.03 ? 92  PHE B CB  1 
ATOM   1086  C CG  . PHE B 1 13  ? -31.893 -57.646  -15.772 1.00 120.68 ? 92  PHE B CG  1 
ATOM   1087  C CD1 . PHE B 1 13  ? -32.871 -57.048  -14.998 1.00 122.20 ? 92  PHE B CD1 1 
ATOM   1088  C CD2 . PHE B 1 13  ? -32.242 -58.149  -17.024 1.00 118.11 ? 92  PHE B CD2 1 
ATOM   1089  C CE1 . PHE B 1 13  ? -34.175 -56.945  -15.460 1.00 124.65 ? 92  PHE B CE1 1 
ATOM   1090  C CE2 . PHE B 1 13  ? -33.540 -58.041  -17.495 1.00 119.84 ? 92  PHE B CE2 1 
ATOM   1091  C CZ  . PHE B 1 13  ? -34.510 -57.442  -16.713 1.00 122.34 ? 92  PHE B CZ  1 
ATOM   1092  N N   . ALA B 1 14  ? -28.721 -57.631  -17.790 1.00 126.75 ? 93  ALA B N   1 
ATOM   1093  C CA  . ALA B 1 14  ? -28.583 -57.804  -19.226 1.00 127.29 ? 93  ALA B CA  1 
ATOM   1094  C C   . ALA B 1 14  ? -28.469 -59.277  -19.578 1.00 123.81 ? 93  ALA B C   1 
ATOM   1095  O O   . ALA B 1 14  ? -28.107 -60.099  -18.733 1.00 124.20 ? 93  ALA B O   1 
ATOM   1096  C CB  . ALA B 1 14  ? -27.365 -57.050  -19.724 1.00 129.49 ? 93  ALA B CB  1 
ATOM   1097  N N   . GLN B 1 15  ? -28.805 -59.599  -20.824 1.00 120.37 ? 94  GLN B N   1 
ATOM   1098  C CA  . GLN B 1 15  ? -28.553 -60.924  -21.376 1.00 119.28 ? 94  GLN B CA  1 
ATOM   1099  C C   . GLN B 1 15  ? -28.447 -60.817  -22.885 1.00 121.08 ? 94  GLN B C   1 
ATOM   1100  O O   . GLN B 1 15  ? -29.413 -60.449  -23.543 1.00 124.24 ? 94  GLN B O   1 
ATOM   1101  C CB  . GLN B 1 15  ? -29.656 -61.906  -20.999 1.00 116.47 ? 94  GLN B CB  1 
ATOM   1102  C CG  . GLN B 1 15  ? -29.440 -63.293  -21.575 1.00 114.56 ? 94  GLN B CG  1 
ATOM   1103  C CD  . GLN B 1 15  ? -30.241 -64.361  -20.859 1.00 115.00 ? 94  GLN B CD  1 
ATOM   1104  O OE1 . GLN B 1 15  ? -30.005 -64.658  -19.691 1.00 111.40 ? 94  GLN B OE1 1 
ATOM   1105  N NE2 . GLN B 1 15  ? -31.174 -64.964  -21.570 1.00 121.05 ? 94  GLN B NE2 1 
ATOM   1106  N N   . LEU B 1 16  ? -27.274 -61.135  -23.424 1.00 122.61 ? 95  LEU B N   1 
ATOM   1107  C CA  . LEU B 1 16  ? -27.030 -61.065  -24.859 1.00 126.08 ? 95  LEU B CA  1 
ATOM   1108  C C   . LEU B 1 16  ? -26.954 -62.456  -25.465 1.00 123.87 ? 95  LEU B C   1 
ATOM   1109  O O   . LEU B 1 16  ? -26.655 -63.425  -24.772 1.00 121.22 ? 95  LEU B O   1 
ATOM   1110  C CB  . LEU B 1 16  ? -25.734 -60.304  -25.131 1.00 128.93 ? 95  LEU B CB  1 
ATOM   1111  C CG  . LEU B 1 16  ? -25.590 -58.945  -24.450 1.00 133.27 ? 95  LEU B CG  1 
ATOM   1112  C CD1 . LEU B 1 16  ? -24.316 -58.283  -24.940 1.00 138.43 ? 95  LEU B CD1 1 
ATOM   1113  C CD2 . LEU B 1 16  ? -26.801 -58.057  -24.723 1.00 137.02 ? 95  LEU B CD2 1 
ATOM   1114  N N   . VAL B 1 17  ? -27.215 -62.528  -26.767 1.00 124.22 ? 96  VAL B N   1 
ATOM   1115  C CA  . VAL B 1 17  ? -27.214 -63.779  -27.503 1.00 123.77 ? 96  VAL B CA  1 
ATOM   1116  C C   . VAL B 1 17  ? -26.213 -63.677  -28.632 1.00 127.17 ? 96  VAL B C   1 
ATOM   1117  O O   . VAL B 1 17  ? -26.353 -62.828  -29.493 1.00 133.24 ? 96  VAL B O   1 
ATOM   1118  C CB  . VAL B 1 17  ? -28.597 -64.064  -28.082 1.00 123.08 ? 96  VAL B CB  1 
ATOM   1119  C CG1 . VAL B 1 17  ? -28.582 -65.281  -28.981 1.00 123.47 ? 96  VAL B CG1 1 
ATOM   1120  C CG2 . VAL B 1 17  ? -29.595 -64.238  -26.946 1.00 122.98 ? 96  VAL B CG2 1 
ATOM   1121  N N   . ALA B 1 18  ? -25.210 -64.547  -28.635 1.00 127.93 ? 97  ALA B N   1 
ATOM   1122  C CA  . ALA B 1 18  ? -24.154 -64.467  -29.632 1.00 133.17 ? 97  ALA B CA  1 
ATOM   1123  C C   . ALA B 1 18  ? -24.700 -64.676  -31.037 1.00 137.31 ? 97  ALA B C   1 
ATOM   1124  O O   . ALA B 1 18  ? -25.538 -65.548  -31.256 1.00 131.65 ? 97  ALA B O   1 
ATOM   1125  C CB  . ALA B 1 18  ? -23.063 -65.481  -29.345 1.00 133.21 ? 97  ALA B CB  1 
ATOM   1126  N N   . GLN B 1 19  ? -24.213 -63.860  -31.968 1.00 146.38 ? 98  GLN B N   1 
ATOM   1127  C CA  . GLN B 1 19  ? -24.588 -63.949  -33.374 1.00 151.88 ? 98  GLN B CA  1 
ATOM   1128  C C   . GLN B 1 19  ? -23.810 -65.028  -34.102 1.00 148.42 ? 98  GLN B C   1 
ATOM   1129  O O   . GLN B 1 19  ? -24.286 -65.567  -35.097 1.00 152.48 ? 98  GLN B O   1 
ATOM   1130  C CB  . GLN B 1 19  ? -24.313 -62.626  -34.090 1.00 159.90 ? 98  GLN B CB  1 
ATOM   1131  C CG  . GLN B 1 19  ? -24.981 -61.401  -33.500 1.00 163.70 ? 98  GLN B CG  1 
ATOM   1132  C CD  . GLN B 1 19  ? -24.772 -60.182  -34.376 1.00 169.06 ? 98  GLN B CD  1 
ATOM   1133  O OE1 . GLN B 1 19  ? -24.105 -59.226  -33.977 1.00 174.90 ? 98  GLN B OE1 1 
ATOM   1134  N NE2 . GLN B 1 19  ? -25.317 -60.224  -35.594 1.00 170.78 ? 98  GLN B NE2 1 
ATOM   1135  N N   . ASN B 1 20  ? -22.632 -65.365  -33.588 1.00 142.11 ? 99  ASN B N   1 
ATOM   1136  C CA  . ASN B 1 20  ? -21.651 -66.144  -34.337 1.00 140.78 ? 99  ASN B CA  1 
ATOM   1137  C C   . ASN B 1 20  ? -22.141 -67.574  -34.431 1.00 138.43 ? 99  ASN B C   1 
ATOM   1138  O O   . ASN B 1 20  ? -22.815 -68.053  -33.522 1.00 132.45 ? 99  ASN B O   1 
ATOM   1139  C CB  . ASN B 1 20  ? -20.272 -66.118  -33.664 1.00 141.31 ? 99  ASN B CB  1 
ATOM   1140  C CG  . ASN B 1 20  ? -19.849 -64.733  -33.241 1.00 143.21 ? 99  ASN B CG  1 
ATOM   1141  O OD1 . ASN B 1 20  ? -19.031 -64.092  -33.887 1.00 149.95 ? 99  ASN B OD1 1 
ATOM   1142  N ND2 . ASN B 1 20  ? -20.411 -64.262  -32.144 1.00 142.17 ? 99  ASN B ND2 1 
ATOM   1143  N N   . VAL B 1 21  ? -21.837 -68.239  -35.539 1.00 144.85 ? 100 VAL B N   1 
ATOM   1144  C CA  . VAL B 1 21  ? -22.132 -69.672  -35.680 1.00 149.60 ? 100 VAL B CA  1 
ATOM   1145  C C   . VAL B 1 21  ? -20.893 -70.503  -36.007 1.00 150.85 ? 100 VAL B C   1 
ATOM   1146  O O   . VAL B 1 21  ? -20.753 -71.609  -35.499 1.00 141.97 ? 100 VAL B O   1 
ATOM   1147  C CB  . VAL B 1 21  ? -23.281 -69.954  -36.688 1.00 152.18 ? 100 VAL B CB  1 
ATOM   1148  C CG1 . VAL B 1 21  ? -24.425 -68.968  -36.493 1.00 152.37 ? 100 VAL B CG1 1 
ATOM   1149  C CG2 . VAL B 1 21  ? -22.799 -69.917  -38.127 1.00 155.51 ? 100 VAL B CG2 1 
ATOM   1150  N N   . LEU B 1 22  ? -20.002 -69.978  -36.849 1.00 158.20 ? 101 LEU B N   1 
ATOM   1151  C CA  . LEU B 1 22  ? -18.777 -70.681  -37.196 1.00 157.54 ? 101 LEU B CA  1 
ATOM   1152  C C   . LEU B 1 22  ? -17.717 -70.473  -36.118 1.00 153.17 ? 101 LEU B C   1 
ATOM   1153  O O   . LEU B 1 22  ? -17.573 -69.372  -35.565 1.00 152.06 ? 101 LEU B O   1 
ATOM   1154  C CB  . LEU B 1 22  ? -18.253 -70.186  -38.537 1.00 153.87 ? 101 LEU B CB  1 
ATOM   1155  N N   . LEU B 1 23  ? -16.993 -71.548  -35.811 1.00 144.57 ? 102 LEU B N   1 
ATOM   1156  C CA  . LEU B 1 23  ? -15.962 -71.504  -34.783 1.00 143.97 ? 102 LEU B CA  1 
ATOM   1157  C C   . LEU B 1 23  ? -14.736 -70.819  -35.363 1.00 148.15 ? 102 LEU B C   1 
ATOM   1158  O O   . LEU B 1 23  ? -13.976 -71.425  -36.114 1.00 158.72 ? 102 LEU B O   1 
ATOM   1159  C CB  . LEU B 1 23  ? -15.645 -72.931  -34.285 1.00 141.32 ? 102 LEU B CB  1 
ATOM   1160  C CG  . LEU B 1 23  ? -16.804 -73.668  -33.612 1.00 138.33 ? 102 LEU B CG  1 
ATOM   1161  C CD1 . LEU B 1 23  ? -16.411 -75.097  -33.287 1.00 137.16 ? 102 LEU B CD1 1 
ATOM   1162  C CD2 . LEU B 1 23  ? -17.227 -72.917  -32.354 1.00 134.45 ? 102 LEU B CD2 1 
ATOM   1163  N N   . ILE B 1 24  ? -14.575 -69.542  -35.050 1.00 151.64 ? 103 ILE B N   1 
ATOM   1164  C CA  . ILE B 1 24  ? -13.466 -68.738  -35.574 1.00 157.78 ? 103 ILE B CA  1 
ATOM   1165  C C   . ILE B 1 24  ? -12.839 -67.961  -34.420 1.00 157.29 ? 103 ILE B C   1 
ATOM   1166  O O   . ILE B 1 24  ? -13.513 -67.168  -33.767 1.00 153.11 ? 103 ILE B O   1 
ATOM   1167  C CB  . ILE B 1 24  ? -13.952 -67.771  -36.678 1.00 155.58 ? 103 ILE B CB  1 
ATOM   1168  N N   . ASP B 1 25  ? -11.549 -68.206  -34.179 1.00 158.22 ? 104 ASP B N   1 
ATOM   1169  C CA  . ASP B 1 25  ? -10.785 -67.513  -33.132 1.00 157.03 ? 104 ASP B CA  1 
ATOM   1170  C C   . ASP B 1 25  ? -10.993 -66.009  -33.263 1.00 153.85 ? 104 ASP B C   1 
ATOM   1171  O O   . ASP B 1 25  ? -10.799 -65.458  -34.346 1.00 159.11 ? 104 ASP B O   1 
ATOM   1172  C CB  . ASP B 1 25  ? -9.279  -67.817  -33.233 1.00 164.16 ? 104 ASP B CB  1 
ATOM   1173  C CG  . ASP B 1 25  ? -8.914  -69.248  -32.801 1.00 166.55 ? 104 ASP B CG  1 
ATOM   1174  O OD1 . ASP B 1 25  ? -7.757  -69.660  -33.050 1.00 172.64 ? 104 ASP B OD1 1 
ATOM   1175  O OD2 . ASP B 1 25  ? -9.764  -69.957  -32.211 1.00 171.19 ? 104 ASP B OD2 1 
ATOM   1176  N N   . GLY B 1 26  ? -11.398 -65.360  -32.172 1.00 144.99 ? 105 GLY B N   1 
ATOM   1177  C CA  . GLY B 1 26  ? -11.654 -63.917  -32.153 1.00 142.89 ? 105 GLY B CA  1 
ATOM   1178  C C   . GLY B 1 26  ? -12.962 -63.596  -31.468 1.00 139.60 ? 105 GLY B C   1 
ATOM   1179  O O   . GLY B 1 26  ? -13.756 -64.498  -31.227 1.00 147.58 ? 105 GLY B O   1 
ATOM   1180  N N   . PRO B 1 27  ? -13.212 -62.308  -31.179 1.00 136.26 ? 106 PRO B N   1 
ATOM   1181  C CA  . PRO B 1 27  ? -14.305 -61.895  -30.308 1.00 135.97 ? 106 PRO B CA  1 
ATOM   1182  C C   . PRO B 1 27  ? -15.720 -62.090  -30.890 1.00 133.85 ? 106 PRO B C   1 
ATOM   1183  O O   . PRO B 1 27  ? -15.940 -61.911  -32.088 1.00 132.49 ? 106 PRO B O   1 
ATOM   1184  C CB  . PRO B 1 27  ? -14.011 -60.416  -30.067 1.00 134.74 ? 106 PRO B CB  1 
ATOM   1185  C CG  . PRO B 1 27  ? -13.368 -59.976  -31.310 1.00 138.40 ? 106 PRO B CG  1 
ATOM   1186  C CD  . PRO B 1 27  ? -12.591 -61.154  -31.836 1.00 139.70 ? 106 PRO B CD  1 
ATOM   1187  N N   . LEU B 1 28  ? -16.652 -62.450  -30.012 1.00 128.20 ? 107 LEU B N   1 
ATOM   1188  C CA  . LEU B 1 28  ? -18.018 -62.754  -30.398 1.00 126.79 ? 107 LEU B CA  1 
ATOM   1189  C C   . LEU B 1 28  ? -18.817 -61.470  -30.544 1.00 130.23 ? 107 LEU B C   1 
ATOM   1190  O O   . LEU B 1 28  ? -18.710 -60.563  -29.707 1.00 122.14 ? 107 LEU B O   1 
ATOM   1191  C CB  . LEU B 1 28  ? -18.702 -63.652  -29.363 1.00 124.55 ? 107 LEU B CB  1 
ATOM   1192  C CG  . LEU B 1 28  ? -18.110 -65.023  -29.063 1.00 122.22 ? 107 LEU B CG  1 
ATOM   1193  C CD1 . LEU B 1 28  ? -18.921 -65.632  -27.925 1.00 120.23 ? 107 LEU B CD1 1 
ATOM   1194  C CD2 . LEU B 1 28  ? -18.092 -65.930  -30.288 1.00 120.23 ? 107 LEU B CD2 1 
ATOM   1195  N N   . SER B 1 29  ? -19.585 -61.406  -31.630 1.00 136.70 ? 108 SER B N   1 
ATOM   1196  C CA  . SER B 1 29  ? -20.622 -60.407  -31.847 1.00 137.65 ? 108 SER B CA  1 
ATOM   1197  C C   . SER B 1 29  ? -21.943 -60.837  -31.211 1.00 134.67 ? 108 SER B C   1 
ATOM   1198  O O   . SER B 1 29  ? -22.252 -62.021  -31.186 1.00 127.81 ? 108 SER B O   1 
ATOM   1199  C CB  . SER B 1 29  ? -20.818 -60.203  -33.345 1.00 135.79 ? 108 SER B CB  1 
ATOM   1200  N N   . TRP B 1 30  ? -22.732 -59.864  -30.747 1.00 138.08 ? 109 TRP B N   1 
ATOM   1201  C CA  . TRP B 1 30  ? -23.922 -60.098  -29.912 1.00 138.39 ? 109 TRP B CA  1 
ATOM   1202  C C   . TRP B 1 30  ? -25.189 -59.403  -30.411 1.00 139.79 ? 109 TRP B C   1 
ATOM   1203  O O   . TRP B 1 30  ? -25.147 -58.242  -30.800 1.00 144.97 ? 109 TRP B O   1 
ATOM   1204  C CB  . TRP B 1 30  ? -23.652 -59.590  -28.498 1.00 139.75 ? 109 TRP B CB  1 
ATOM   1205  C CG  . TRP B 1 30  ? -22.517 -60.269  -27.876 1.00 142.57 ? 109 TRP B CG  1 
ATOM   1206  C CD1 . TRP B 1 30  ? -21.221 -59.857  -27.873 1.00 147.45 ? 109 TRP B CD1 1 
ATOM   1207  C CD2 . TRP B 1 30  ? -22.552 -61.517  -27.195 1.00 140.86 ? 109 TRP B CD2 1 
ATOM   1208  N NE1 . TRP B 1 30  ? -20.440 -60.773  -27.209 1.00 148.77 ? 109 TRP B NE1 1 
ATOM   1209  C CE2 . TRP B 1 30  ? -21.236 -61.804  -26.781 1.00 143.24 ? 109 TRP B CE2 1 
ATOM   1210  C CE3 . TRP B 1 30  ? -23.571 -62.418  -26.886 1.00 138.70 ? 109 TRP B CE3 1 
ATOM   1211  C CZ2 . TRP B 1 30  ? -20.907 -62.961  -26.082 1.00 141.03 ? 109 TRP B CZ2 1 
ATOM   1212  C CZ3 . TRP B 1 30  ? -23.252 -63.568  -26.186 1.00 141.93 ? 109 TRP B CZ3 1 
ATOM   1213  C CH2 . TRP B 1 30  ? -21.925 -63.832  -25.791 1.00 142.93 ? 109 TRP B CH2 1 
ATOM   1214  N N   . TYR B 1 31  ? -26.317 -60.112  -30.371 1.00 136.12 ? 110 TYR B N   1 
ATOM   1215  C CA  . TYR B 1 31  ? -27.631 -59.490  -30.541 1.00 136.40 ? 110 TYR B CA  1 
ATOM   1216  C C   . TYR B 1 31  ? -27.958 -58.698  -29.275 1.00 135.55 ? 110 TYR B C   1 
ATOM   1217  O O   . TYR B 1 31  ? -27.868 -59.231  -28.171 1.00 127.96 ? 110 TYR B O   1 
ATOM   1218  C CB  . TYR B 1 31  ? -28.714 -60.534  -30.777 1.00 135.39 ? 110 TYR B CB  1 
ATOM   1219  C CG  . TYR B 1 31  ? -28.546 -61.322  -32.044 1.00 136.80 ? 110 TYR B CG  1 
ATOM   1220  C CD1 . TYR B 1 31  ? -28.617 -60.700  -33.282 1.00 140.95 ? 110 TYR B CD1 1 
ATOM   1221  C CD2 . TYR B 1 31  ? -28.335 -62.697  -32.011 1.00 138.12 ? 110 TYR B CD2 1 
ATOM   1222  C CE1 . TYR B 1 31  ? -28.478 -61.423  -34.459 1.00 143.46 ? 110 TYR B CE1 1 
ATOM   1223  C CE2 . TYR B 1 31  ? -28.192 -63.430  -33.179 1.00 140.43 ? 110 TYR B CE2 1 
ATOM   1224  C CZ  . TYR B 1 31  ? -28.266 -62.788  -34.403 1.00 143.40 ? 110 TYR B CZ  1 
ATOM   1225  O OH  . TYR B 1 31  ? -28.121 -63.504  -35.568 1.00 146.91 ? 110 TYR B OH  1 
ATOM   1226  N N   . SER B 1 32  ? -28.320 -57.426  -29.442 1.00 141.14 ? 111 SER B N   1 
ATOM   1227  C CA  . SER B 1 32  ? -28.641 -56.520  -28.326 1.00 142.57 ? 111 SER B CA  1 
ATOM   1228  C C   . SER B 1 32  ? -30.073 -55.953  -28.324 1.00 147.34 ? 111 SER B C   1 
ATOM   1229  O O   . SER B 1 32  ? -30.501 -55.391  -27.316 1.00 140.11 ? 111 SER B O   1 
ATOM   1230  C CB  . SER B 1 32  ? -27.643 -55.362  -28.334 1.00 145.55 ? 111 SER B CB  1 
ATOM   1231  O OG  . SER B 1 32  ? -27.585 -54.743  -29.606 1.00 149.30 ? 111 SER B OG  1 
ATOM   1232  N N   . ASP B 1 33  ? -30.811 -56.107  -29.431 1.00 155.60 ? 112 ASP B N   1 
ATOM   1233  C CA  . ASP B 1 33  ? -32.166 -55.557  -29.557 1.00 161.02 ? 112 ASP B CA  1 
ATOM   1234  C C   . ASP B 1 33  ? -33.149 -56.440  -28.770 1.00 161.08 ? 112 ASP B C   1 
ATOM   1235  O O   . ASP B 1 33  ? -33.349 -57.600  -29.143 1.00 160.75 ? 112 ASP B O   1 
ATOM   1236  C CB  . ASP B 1 33  ? -32.550 -55.466  -31.042 1.00 165.12 ? 112 ASP B CB  1 
ATOM   1237  C CG  . ASP B 1 33  ? -33.977 -54.956  -31.286 1.00 172.15 ? 112 ASP B CG  1 
ATOM   1238  O OD1 . ASP B 1 33  ? -34.837 -54.953  -30.374 1.00 170.61 ? 112 ASP B OD1 1 
ATOM   1239  O OD2 . ASP B 1 33  ? -34.242 -54.545  -32.433 1.00 181.15 ? 112 ASP B OD2 1 
ATOM   1240  N N   . PRO B 1 34  ? -33.787 -55.891  -27.704 1.00 160.16 ? 113 PRO B N   1 
ATOM   1241  C CA  . PRO B 1 34  ? -34.659 -56.700  -26.833 1.00 155.28 ? 113 PRO B CA  1 
ATOM   1242  C C   . PRO B 1 34  ? -36.002 -57.149  -27.444 1.00 154.02 ? 113 PRO B C   1 
ATOM   1243  O O   . PRO B 1 34  ? -36.742 -57.891  -26.797 1.00 150.20 ? 113 PRO B O   1 
ATOM   1244  C CB  . PRO B 1 34  ? -34.881 -55.794  -25.617 1.00 155.22 ? 113 PRO B CB  1 
ATOM   1245  C CG  . PRO B 1 34  ? -34.735 -54.407  -26.145 1.00 159.40 ? 113 PRO B CG  1 
ATOM   1246  C CD  . PRO B 1 34  ? -33.761 -54.478  -27.281 1.00 161.46 ? 113 PRO B CD  1 
ATOM   1247  N N   . GLY B 1 35  ? -36.311 -56.708  -28.665 1.00 153.16 ? 114 GLY B N   1 
ATOM   1248  C CA  . GLY B 1 35  ? -37.354 -57.332  -29.470 1.00 155.16 ? 114 GLY B CA  1 
ATOM   1249  C C   . GLY B 1 35  ? -37.010 -58.743  -29.948 1.00 155.67 ? 114 GLY B C   1 
ATOM   1250  O O   . GLY B 1 35  ? -37.890 -59.457  -30.433 1.00 159.77 ? 114 GLY B O   1 
ATOM   1251  N N   . LEU B 1 36  ? -35.726 -59.123  -29.857 1.00 152.97 ? 115 LEU B N   1 
ATOM   1252  C CA  . LEU B 1 36  ? -35.275 -60.495  -30.091 1.00 150.05 ? 115 LEU B CA  1 
ATOM   1253  C C   . LEU B 1 36  ? -35.456 -61.406  -28.878 1.00 146.27 ? 115 LEU B C   1 
ATOM   1254  O O   . LEU B 1 36  ? -35.198 -61.008  -27.740 1.00 137.70 ? 115 LEU B O   1 
ATOM   1255  C CB  . LEU B 1 36  ? -33.804 -60.516  -30.510 1.00 149.43 ? 115 LEU B CB  1 
ATOM   1256  C CG  . LEU B 1 36  ? -33.380 -60.024  -31.875 1.00 153.75 ? 115 LEU B CG  1 
ATOM   1257  C CD1 . LEU B 1 36  ? -34.550 -59.921  -32.850 1.00 158.78 ? 115 LEU B CD1 1 
ATOM   1258  C CD2 . LEU B 1 36  ? -32.526 -58.773  -31.882 1.00 154.44 ? 115 LEU B CD2 1 
ATOM   1259  N N   . ALA B 1 37  ? -35.868 -62.645  -29.153 1.00 148.85 ? 116 ALA B N   1 
ATOM   1260  C CA  . ALA B 1 37  ? -36.100 -63.657  -28.126 1.00 146.30 ? 116 ALA B CA  1 
ATOM   1261  C C   . ALA B 1 37  ? -34.802 -64.062  -27.442 1.00 139.82 ? 116 ALA B C   1 
ATOM   1262  O O   . ALA B 1 37  ? -33.842 -64.463  -28.105 1.00 142.75 ? 116 ALA B O   1 
ATOM   1263  C CB  . ALA B 1 37  ? -36.764 -64.881  -28.747 1.00 147.14 ? 116 ALA B CB  1 
ATOM   1264  N N   . GLY B 1 38  ? -34.779 -63.950  -26.117 1.00 134.04 ? 117 GLY B N   1 
ATOM   1265  C CA  . GLY B 1 38  ? -33.587 -64.247  -25.323 1.00 127.45 ? 117 GLY B CA  1 
ATOM   1266  C C   . GLY B 1 38  ? -32.890 -62.983  -24.874 1.00 123.23 ? 117 GLY B C   1 
ATOM   1267  O O   . GLY B 1 38  ? -32.413 -62.904  -23.745 1.00 122.54 ? 117 GLY B O   1 
ATOM   1268  N N   . VAL B 1 39  ? -32.825 -61.996  -25.764 1.00 123.53 ? 118 VAL B N   1 
ATOM   1269  C CA  . VAL B 1 39  ? -32.098 -60.761  -25.510 1.00 126.62 ? 118 VAL B CA  1 
ATOM   1270  C C   . VAL B 1 39  ? -32.881 -59.852  -24.571 1.00 126.98 ? 118 VAL B C   1 
ATOM   1271  O O   . VAL B 1 39  ? -34.096 -59.721  -24.696 1.00 127.60 ? 118 VAL B O   1 
ATOM   1272  C CB  . VAL B 1 39  ? -31.788 -59.995  -26.811 1.00 130.40 ? 118 VAL B CB  1 
ATOM   1273  C CG1 . VAL B 1 39  ? -31.054 -58.688  -26.509 1.00 133.10 ? 118 VAL B CG1 1 
ATOM   1274  C CG2 . VAL B 1 39  ? -30.943 -60.857  -27.734 1.00 132.02 ? 118 VAL B CG2 1 
ATOM   1275  N N   . SER B 1 40  ? -32.162 -59.230  -23.637 1.00 128.55 ? 119 SER B N   1 
ATOM   1276  C CA  . SER B 1 40  ? -32.737 -58.236  -22.741 1.00 129.97 ? 119 SER B CA  1 
ATOM   1277  C C   . SER B 1 40  ? -31.640 -57.329  -22.183 1.00 134.55 ? 119 SER B C   1 
ATOM   1278  O O   . SER B 1 40  ? -30.673 -57.814  -21.597 1.00 131.87 ? 119 SER B O   1 
ATOM   1279  C CB  . SER B 1 40  ? -33.535 -58.905  -21.613 1.00 127.23 ? 119 SER B CB  1 
ATOM   1280  O OG  . SER B 1 40  ? -33.002 -60.164  -21.260 1.00 122.35 ? 119 SER B OG  1 
ATOM   1281  N N   . LEU B 1 41  ? -31.789 -56.021  -22.421 1.00 143.71 ? 120 LEU B N   1 
ATOM   1282  C CA  . LEU B 1 41  ? -30.991 -54.976  -21.779 1.00 146.55 ? 120 LEU B CA  1 
ATOM   1283  C C   . LEU B 1 41  ? -31.937 -54.122  -20.944 1.00 150.43 ? 120 LEU B C   1 
ATOM   1284  O O   . LEU B 1 41  ? -33.097 -53.939  -21.318 1.00 147.79 ? 120 LEU B O   1 
ATOM   1285  C CB  . LEU B 1 41  ? -30.313 -54.094  -22.824 1.00 145.52 ? 120 LEU B CB  1 
ATOM   1286  C CG  . LEU B 1 41  ? -29.063 -54.628  -23.503 1.00 143.87 ? 120 LEU B CG  1 
ATOM   1287  C CD1 . LEU B 1 41  ? -28.700 -53.713  -24.660 1.00 151.51 ? 120 LEU B CD1 1 
ATOM   1288  C CD2 . LEU B 1 41  ? -27.914 -54.726  -22.524 1.00 140.26 ? 120 LEU B CD2 1 
ATOM   1289  N N   . THR B 1 42  ? -31.441 -53.626  -19.811 1.00 156.28 ? 121 THR B N   1 
ATOM   1290  C CA  . THR B 1 42  ? -32.170 -52.684  -18.949 1.00 164.99 ? 121 THR B CA  1 
ATOM   1291  C C   . THR B 1 42  ? -31.182 -51.683  -18.367 1.00 176.69 ? 121 THR B C   1 
ATOM   1292  O O   . THR B 1 42  ? -29.984 -51.760  -18.650 1.00 180.60 ? 121 THR B O   1 
ATOM   1293  C CB  . THR B 1 42  ? -32.908 -53.388  -17.775 1.00 162.97 ? 121 THR B CB  1 
ATOM   1294  O OG1 . THR B 1 42  ? -31.966 -53.954  -16.850 1.00 156.94 ? 121 THR B OG1 1 
ATOM   1295  C CG2 . THR B 1 42  ? -33.861 -54.476  -18.279 1.00 164.33 ? 121 THR B CG2 1 
ATOM   1296  N N   . GLY B 1 43  ? -31.691 -50.739  -17.573 1.00 189.50 ? 122 GLY B N   1 
ATOM   1297  C CA  . GLY B 1 43  ? -30.865 -49.817  -16.789 1.00 190.23 ? 122 GLY B CA  1 
ATOM   1298  C C   . GLY B 1 43  ? -29.758 -49.152  -17.580 1.00 190.55 ? 122 GLY B C   1 
ATOM   1299  O O   . GLY B 1 43  ? -29.911 -48.880  -18.776 1.00 194.27 ? 122 GLY B O   1 
ATOM   1300  N N   . GLY B 1 44  ? -28.632 -48.913  -16.913 1.00 186.63 ? 123 GLY B N   1 
ATOM   1301  C CA  . GLY B 1 44  ? -27.445 -48.367  -17.559 1.00 186.63 ? 123 GLY B CA  1 
ATOM   1302  C C   . GLY B 1 44  ? -26.562 -49.477  -18.098 1.00 180.73 ? 123 GLY B C   1 
ATOM   1303  O O   . GLY B 1 44  ? -25.439 -49.670  -17.625 1.00 181.67 ? 123 GLY B O   1 
ATOM   1304  N N   . LEU B 1 45  ? -27.084 -50.213  -19.079 1.00 173.14 ? 124 LEU B N   1 
ATOM   1305  C CA  . LEU B 1 45  ? -26.358 -51.279  -19.753 1.00 167.85 ? 124 LEU B CA  1 
ATOM   1306  C C   . LEU B 1 45  ? -26.611 -51.160  -21.245 1.00 168.97 ? 124 LEU B C   1 
ATOM   1307  O O   . LEU B 1 45  ? -27.747 -50.945  -21.668 1.00 169.99 ? 124 LEU B O   1 
ATOM   1308  C CB  . LEU B 1 45  ? -26.800 -52.657  -19.242 1.00 163.15 ? 124 LEU B CB  1 
ATOM   1309  C CG  . LEU B 1 45  ? -26.306 -53.049  -17.843 1.00 156.37 ? 124 LEU B CG  1 
ATOM   1310  C CD1 . LEU B 1 45  ? -27.229 -54.053  -17.179 1.00 151.46 ? 124 LEU B CD1 1 
ATOM   1311  C CD2 . LEU B 1 45  ? -24.898 -53.598  -17.932 1.00 153.13 ? 124 LEU B CD2 1 
ATOM   1312  N N   . SER B 1 46  ? -25.553 -51.312  -22.036 1.00 171.85 ? 125 SER B N   1 
ATOM   1313  C CA  . SER B 1 46  ? -25.607 -51.033  -23.465 1.00 177.89 ? 125 SER B CA  1 
ATOM   1314  C C   . SER B 1 46  ? -24.540 -51.803  -24.235 1.00 175.50 ? 125 SER B C   1 
ATOM   1315  O O   . SER B 1 46  ? -23.462 -52.086  -23.709 1.00 177.05 ? 125 SER B O   1 
ATOM   1316  C CB  . SER B 1 46  ? -25.407 -49.533  -23.679 1.00 186.69 ? 125 SER B CB  1 
ATOM   1317  O OG  . SER B 1 46  ? -24.260 -49.077  -22.976 1.00 193.01 ? 125 SER B OG  1 
ATOM   1318  N N   . TYR B 1 47  ? -24.843 -52.105  -25.500 1.00 170.47 ? 126 TYR B N   1 
ATOM   1319  C CA  . TYR B 1 47  ? -23.930 -52.825  -26.379 1.00 164.08 ? 126 TYR B CA  1 
ATOM   1320  C C   . TYR B 1 47  ? -23.361 -51.904  -27.468 1.00 160.12 ? 126 TYR B C   1 
ATOM   1321  O O   . TYR B 1 47  ? -24.113 -51.274  -28.203 1.00 165.29 ? 126 TYR B O   1 
ATOM   1322  C CB  . TYR B 1 47  ? -24.660 -54.020  -26.992 1.00 160.99 ? 126 TYR B CB  1 
ATOM   1323  C CG  . TYR B 1 47  ? -23.820 -54.833  -27.943 1.00 159.98 ? 126 TYR B CG  1 
ATOM   1324  C CD1 . TYR B 1 47  ? -24.164 -54.947  -29.283 1.00 159.29 ? 126 TYR B CD1 1 
ATOM   1325  C CD2 . TYR B 1 47  ? -22.660 -55.468  -27.500 1.00 162.48 ? 126 TYR B CD2 1 
ATOM   1326  C CE1 . TYR B 1 47  ? -23.382 -55.685  -30.157 1.00 163.16 ? 126 TYR B CE1 1 
ATOM   1327  C CE2 . TYR B 1 47  ? -21.869 -56.203  -28.372 1.00 162.86 ? 126 TYR B CE2 1 
ATOM   1328  C CZ  . TYR B 1 47  ? -22.231 -56.314  -29.693 1.00 164.34 ? 126 TYR B CZ  1 
ATOM   1329  O OH  . TYR B 1 47  ? -21.463 -57.052  -30.568 1.00 169.16 ? 126 TYR B OH  1 
ATOM   1330  N N   . LYS B 1 48  ? -22.032 -51.828  -27.546 1.00 156.76 ? 127 LYS B N   1 
ATOM   1331  C CA  . LYS B 1 48  ? -21.324 -51.096  -28.604 1.00 158.55 ? 127 LYS B CA  1 
ATOM   1332  C C   . LYS B 1 48  ? -21.048 -52.022  -29.799 1.00 159.78 ? 127 LYS B C   1 
ATOM   1333  O O   . LYS B 1 48  ? -20.117 -52.822  -29.764 1.00 162.58 ? 127 LYS B O   1 
ATOM   1334  C CB  . LYS B 1 48  ? -20.007 -50.522  -28.063 1.00 157.74 ? 127 LYS B CB  1 
ATOM   1335  N N   . GLU B 1 49  ? -21.855 -51.906  -30.851 1.00 166.03 ? 128 GLU B N   1 
ATOM   1336  C CA  . GLU B 1 49  ? -21.741 -52.764  -32.047 1.00 172.91 ? 128 GLU B CA  1 
ATOM   1337  C C   . GLU B 1 49  ? -20.359 -52.753  -32.719 1.00 179.87 ? 128 GLU B C   1 
ATOM   1338  O O   . GLU B 1 49  ? -19.944 -53.769  -33.282 1.00 178.62 ? 128 GLU B O   1 
ATOM   1339  C CB  . GLU B 1 49  ? -22.813 -52.396  -33.088 1.00 175.56 ? 128 GLU B CB  1 
ATOM   1340  N N   . ASP B 1 50  ? -19.652 -51.616  -32.661 1.00 187.53 ? 129 ASP B N   1 
ATOM   1341  C CA  . ASP B 1 50  ? -18.336 -51.482  -33.310 1.00 193.83 ? 129 ASP B CA  1 
ATOM   1342  C C   . ASP B 1 50  ? -17.234 -52.282  -32.602 1.00 193.48 ? 129 ASP B C   1 
ATOM   1343  O O   . ASP B 1 50  ? -16.479 -53.001  -33.252 1.00 200.94 ? 129 ASP B O   1 
ATOM   1344  C CB  . ASP B 1 50  ? -17.929 -49.994  -33.459 1.00 197.32 ? 129 ASP B CB  1 
ATOM   1345  N N   . THR B 1 51  ? -17.162 -52.163  -31.277 1.00 189.93 ? 130 THR B N   1 
ATOM   1346  C CA  . THR B 1 51  ? -16.140 -52.832  -30.468 1.00 187.82 ? 130 THR B CA  1 
ATOM   1347  C C   . THR B 1 51  ? -16.557 -54.229  -29.971 1.00 184.85 ? 130 THR B C   1 
ATOM   1348  O O   . THR B 1 51  ? -15.717 -54.987  -29.467 1.00 183.34 ? 130 THR B O   1 
ATOM   1349  C CB  . THR B 1 51  ? -15.768 -51.959  -29.257 1.00 187.92 ? 130 THR B CB  1 
ATOM   1350  O OG1 . THR B 1 51  ? -16.962 -51.484  -28.619 1.00 179.37 ? 130 THR B OG1 1 
ATOM   1351  C CG2 . THR B 1 51  ? -14.926 -50.765  -29.705 1.00 194.30 ? 130 THR B CG2 1 
ATOM   1352  N N   . LYS B 1 52  ? -17.842 -54.557  -30.114 1.00 180.96 ? 131 LYS B N   1 
ATOM   1353  C CA  . LYS B 1 52  ? -18.420 -55.828  -29.668 1.00 170.91 ? 131 LYS B CA  1 
ATOM   1354  C C   . LYS B 1 52  ? -18.343 -55.975  -28.145 1.00 164.74 ? 131 LYS B C   1 
ATOM   1355  O O   . LYS B 1 52  ? -17.981 -57.030  -27.628 1.00 165.08 ? 131 LYS B O   1 
ATOM   1356  C CB  . LYS B 1 52  ? -17.768 -57.029  -30.382 1.00 170.60 ? 131 LYS B CB  1 
ATOM   1357  C CG  . LYS B 1 52  ? -17.601 -56.884  -31.886 1.00 175.08 ? 131 LYS B CG  1 
ATOM   1358  C CD  . LYS B 1 52  ? -17.104 -58.205  -32.483 1.00 175.15 ? 131 LYS B CD  1 
ATOM   1359  C CE  . LYS B 1 52  ? -16.334 -57.997  -33.778 1.00 183.28 ? 131 LYS B CE  1 
ATOM   1360  N NZ  . LYS B 1 52  ? -17.133 -57.270  -34.801 1.00 188.19 ? 131 LYS B NZ  1 
ATOM   1361  N N   . GLU B 1 53  ? -18.722 -54.914  -27.438 1.00 163.59 ? 132 GLU B N   1 
ATOM   1362  C CA  . GLU B 1 53  ? -18.568 -54.835  -25.990 1.00 167.39 ? 132 GLU B CA  1 
ATOM   1363  C C   . GLU B 1 53  ? -19.875 -54.454  -25.309 1.00 161.87 ? 132 GLU B C   1 
ATOM   1364  O O   . GLU B 1 53  ? -20.606 -53.603  -25.797 1.00 161.92 ? 132 GLU B O   1 
ATOM   1365  C CB  . GLU B 1 53  ? -17.487 -53.806  -25.636 1.00 177.79 ? 132 GLU B CB  1 
ATOM   1366  C CG  . GLU B 1 53  ? -16.092 -54.156  -26.149 1.00 184.43 ? 132 GLU B CG  1 
ATOM   1367  C CD  . GLU B 1 53  ? -15.007 -53.197  -25.685 1.00 192.50 ? 132 GLU B CD  1 
ATOM   1368  O OE1 . GLU B 1 53  ? -15.144 -51.981  -25.910 1.00 202.29 ? 132 GLU B OE1 1 
ATOM   1369  O OE2 . GLU B 1 53  ? -14.003 -53.649  -25.103 1.00 196.85 ? 132 GLU B OE2 1 
ATOM   1370  N N   . LEU B 1 54  ? -20.160 -55.106  -24.184 1.00 161.61 ? 133 LEU B N   1 
ATOM   1371  C CA  . LEU B 1 54  ? -21.241 -54.697  -23.284 1.00 161.01 ? 133 LEU B CA  1 
ATOM   1372  C C   . LEU B 1 54  ? -20.663 -53.624  -22.368 1.00 162.24 ? 133 LEU B C   1 
ATOM   1373  O O   . LEU B 1 54  ? -19.547 -53.792  -21.876 1.00 167.89 ? 133 LEU B O   1 
ATOM   1374  C CB  . LEU B 1 54  ? -21.728 -55.888  -22.454 1.00 158.44 ? 133 LEU B CB  1 
ATOM   1375  C CG  . LEU B 1 54  ? -22.902 -55.661  -21.505 1.00 160.12 ? 133 LEU B CG  1 
ATOM   1376  C CD1 . LEU B 1 54  ? -24.200 -55.379  -22.260 1.00 165.05 ? 133 LEU B CD1 1 
ATOM   1377  C CD2 . LEU B 1 54  ? -23.090 -56.891  -20.622 1.00 159.96 ? 133 LEU B CD2 1 
ATOM   1378  N N   . VAL B 1 55  ? -21.411 -52.542  -22.143 1.00 158.38 ? 134 VAL B N   1 
ATOM   1379  C CA  . VAL B 1 55  ? -20.924 -51.391  -21.369 1.00 159.45 ? 134 VAL B CA  1 
ATOM   1380  C C   . VAL B 1 55  ? -21.805 -51.128  -20.152 1.00 157.32 ? 134 VAL B C   1 
ATOM   1381  O O   . VAL B 1 55  ? -22.993 -50.822  -20.298 1.00 149.37 ? 134 VAL B O   1 
ATOM   1382  C CB  . VAL B 1 55  ? -20.872 -50.107  -22.223 1.00 165.07 ? 134 VAL B CB  1 
ATOM   1383  C CG1 . VAL B 1 55  ? -20.034 -49.040  -21.525 1.00 169.11 ? 134 VAL B CG1 1 
ATOM   1384  C CG2 . VAL B 1 55  ? -20.306 -50.405  -23.595 1.00 169.46 ? 134 VAL B CG2 1 
ATOM   1385  N N   . VAL B 1 56  ? -21.206 -51.217  -18.964 1.00 161.94 ? 135 VAL B N   1 
ATOM   1386  C CA  . VAL B 1 56  ? -21.923 -51.075  -17.695 1.00 163.30 ? 135 VAL B CA  1 
ATOM   1387  C C   . VAL B 1 56  ? -21.822 -49.641  -17.191 1.00 168.89 ? 135 VAL B C   1 
ATOM   1388  O O   . VAL B 1 56  ? -20.720 -49.136  -17.010 1.00 171.35 ? 135 VAL B O   1 
ATOM   1389  C CB  . VAL B 1 56  ? -21.339 -52.004  -16.615 1.00 161.10 ? 135 VAL B CB  1 
ATOM   1390  C CG1 . VAL B 1 56  ? -22.206 -51.975  -15.364 1.00 161.52 ? 135 VAL B CG1 1 
ATOM   1391  C CG2 . VAL B 1 56  ? -21.204 -53.425  -17.149 1.00 158.26 ? 135 VAL B CG2 1 
ATOM   1392  N N   . ALA B 1 57  ? -22.964 -49.002  -16.936 1.00 171.57 ? 136 ALA B N   1 
ATOM   1393  C CA  . ALA B 1 57  ? -22.984 -47.612  -16.473 1.00 171.79 ? 136 ALA B CA  1 
ATOM   1394  C C   . ALA B 1 57  ? -22.757 -47.524  -14.965 1.00 168.84 ? 136 ALA B C   1 
ATOM   1395  O O   . ALA B 1 57  ? -21.714 -47.030  -14.522 1.00 173.34 ? 136 ALA B O   1 
ATOM   1396  C CB  . ALA B 1 57  ? -24.288 -46.928  -16.867 1.00 173.53 ? 136 ALA B CB  1 
ATOM   1397  N N   . LYS B 1 58  ? -23.721 -48.022  -14.188 1.00 164.87 ? 137 LYS B N   1 
ATOM   1398  C CA  . LYS B 1 58  ? -23.658 -47.956  -12.732 1.00 165.86 ? 137 LYS B CA  1 
ATOM   1399  C C   . LYS B 1 58  ? -22.723 -49.047  -12.227 1.00 164.03 ? 137 LYS B C   1 
ATOM   1400  O O   . LYS B 1 58  ? -22.898 -50.209  -12.570 1.00 160.46 ? 137 LYS B O   1 
ATOM   1401  C CB  . LYS B 1 58  ? -25.055 -48.130  -12.127 1.00 162.68 ? 137 LYS B CB  1 
ATOM   1402  N N   . ALA B 1 59  ? -21.737 -48.666  -11.421 1.00 164.91 ? 138 ALA B N   1 
ATOM   1403  C CA  . ALA B 1 59  ? -20.809 -49.626  -10.815 1.00 166.11 ? 138 ALA B CA  1 
ATOM   1404  C C   . ALA B 1 59  ? -21.491 -50.490  -9.751  1.00 169.07 ? 138 ALA B C   1 
ATOM   1405  O O   . ALA B 1 59  ? -22.655 -50.267  -9.393  1.00 173.45 ? 138 ALA B O   1 
ATOM   1406  C CB  . ALA B 1 59  ? -19.615 -48.897  -10.212 1.00 167.21 ? 138 ALA B CB  1 
ATOM   1407  N N   . GLY B 1 60  ? -20.753 -51.481  -9.260  1.00 171.82 ? 139 GLY B N   1 
ATOM   1408  C CA  . GLY B 1 60  ? -21.241 -52.409  -8.230  1.00 167.72 ? 139 GLY B CA  1 
ATOM   1409  C C   . GLY B 1 60  ? -20.730 -53.825  -8.426  1.00 161.27 ? 139 GLY B C   1 
ATOM   1410  O O   . GLY B 1 60  ? -19.789 -54.056  -9.190  1.00 166.03 ? 139 GLY B O   1 
ATOM   1411  N N   . VAL B 1 61  ? -21.352 -54.766  -7.720  1.00 149.05 ? 140 VAL B N   1 
ATOM   1412  C CA  . VAL B 1 61  ? -21.051 -56.183  -7.874  1.00 143.38 ? 140 VAL B CA  1 
ATOM   1413  C C   . VAL B 1 61  ? -22.209 -56.853  -8.610  1.00 140.03 ? 140 VAL B C   1 
ATOM   1414  O O   . VAL B 1 61  ? -23.373 -56.638  -8.274  1.00 141.41 ? 140 VAL B O   1 
ATOM   1415  C CB  . VAL B 1 61  ? -20.783 -56.853  -6.511  1.00 144.48 ? 140 VAL B CB  1 
ATOM   1416  C CG1 . VAL B 1 61  ? -20.705 -58.368  -6.647  1.00 144.25 ? 140 VAL B CG1 1 
ATOM   1417  C CG2 . VAL B 1 61  ? -19.490 -56.305  -5.907  1.00 147.85 ? 140 VAL B CG2 1 
ATOM   1418  N N   . TYR B 1 62  ? -21.868 -57.661  -9.614  1.00 140.03 ? 141 TYR B N   1 
ATOM   1419  C CA  . TYR B 1 62  ? -22.842 -58.362  -10.448 1.00 134.83 ? 141 TYR B CA  1 
ATOM   1420  C C   . TYR B 1 62  ? -22.526 -59.852  -10.477 1.00 130.48 ? 141 TYR B C   1 
ATOM   1421  O O   . TYR B 1 62  ? -21.359 -60.240  -10.421 1.00 128.45 ? 141 TYR B O   1 
ATOM   1422  C CB  . TYR B 1 62  ? -22.766 -57.852  -11.875 1.00 135.62 ? 141 TYR B CB  1 
ATOM   1423  C CG  . TYR B 1 62  ? -23.150 -56.406  -12.055 1.00 139.95 ? 141 TYR B CG  1 
ATOM   1424  C CD1 . TYR B 1 62  ? -22.304 -55.374  -11.622 1.00 144.30 ? 141 TYR B CD1 1 
ATOM   1425  C CD2 . TYR B 1 62  ? -24.339 -56.058  -12.693 1.00 141.23 ? 141 TYR B CD2 1 
ATOM   1426  C CE1 . TYR B 1 62  ? -22.651 -54.052  -11.798 1.00 146.25 ? 141 TYR B CE1 1 
ATOM   1427  C CE2 . TYR B 1 62  ? -24.694 -54.735  -12.873 1.00 140.97 ? 141 TYR B CE2 1 
ATOM   1428  C CZ  . TYR B 1 62  ? -23.861 -53.736  -12.414 1.00 143.84 ? 141 TYR B CZ  1 
ATOM   1429  O OH  . TYR B 1 62  ? -24.234 -52.426  -12.609 1.00 145.61 ? 141 TYR B OH  1 
ATOM   1430  N N   . TYR B 1 63  ? -23.569 -60.678  -10.569 1.00 124.44 ? 142 TYR B N   1 
ATOM   1431  C CA  . TYR B 1 63  ? -23.413 -62.087  -10.917 1.00 121.97 ? 142 TYR B CA  1 
ATOM   1432  C C   . TYR B 1 63  ? -23.401 -62.131  -12.427 1.00 121.10 ? 142 TYR B C   1 
ATOM   1433  O O   . TYR B 1 63  ? -24.403 -61.818  -13.055 1.00 123.03 ? 142 TYR B O   1 
ATOM   1434  C CB  . TYR B 1 63  ? -24.558 -62.935  -10.369 1.00 119.11 ? 142 TYR B CB  1 
ATOM   1435  C CG  . TYR B 1 63  ? -24.465 -64.417  -10.682 1.00 115.41 ? 142 TYR B CG  1 
ATOM   1436  C CD1 . TYR B 1 63  ? -23.587 -65.243  -9.991  1.00 116.85 ? 142 TYR B CD1 1 
ATOM   1437  C CD2 . TYR B 1 63  ? -25.287 -64.994  -11.642 1.00 114.17 ? 142 TYR B CD2 1 
ATOM   1438  C CE1 . TYR B 1 63  ? -23.522 -66.613  -10.250 1.00 118.54 ? 142 TYR B CE1 1 
ATOM   1439  C CE2 . TYR B 1 63  ? -25.231 -66.351  -11.922 1.00 116.75 ? 142 TYR B CE2 1 
ATOM   1440  C CZ  . TYR B 1 63  ? -24.345 -67.163  -11.231 1.00 117.49 ? 142 TYR B CZ  1 
ATOM   1441  O OH  . TYR B 1 63  ? -24.306 -68.515  -11.511 1.00 112.80 ? 142 TYR B OH  1 
ATOM   1442  N N   . VAL B 1 64  ? -22.250 -62.475  -12.993 1.00 120.60 ? 143 VAL B N   1 
ATOM   1443  C CA  . VAL B 1 64  ? -22.056 -62.544  -14.434 1.00 115.60 ? 143 VAL B CA  1 
ATOM   1444  C C   . VAL B 1 64  ? -21.893 -64.005  -14.792 1.00 113.22 ? 143 VAL B C   1 
ATOM   1445  O O   . VAL B 1 64  ? -21.131 -64.713  -14.143 1.00 112.26 ? 143 VAL B O   1 
ATOM   1446  C CB  . VAL B 1 64  ? -20.794 -61.784  -14.848 1.00 114.15 ? 143 VAL B CB  1 
ATOM   1447  C CG1 . VAL B 1 64  ? -20.661 -61.745  -16.360 1.00 114.94 ? 143 VAL B CG1 1 
ATOM   1448  C CG2 . VAL B 1 64  ? -20.828 -60.377  -14.270 1.00 115.23 ? 143 VAL B CG2 1 
ATOM   1449  N N   . PHE B 1 65  ? -22.607 -64.448  -15.820 1.00 108.92 ? 144 PHE B N   1 
ATOM   1450  C CA  . PHE B 1 65  ? -22.571 -65.845  -16.243 1.00 108.72 ? 144 PHE B CA  1 
ATOM   1451  C C   . PHE B 1 65  ? -22.549 -65.940  -17.751 1.00 107.56 ? 144 PHE B C   1 
ATOM   1452  O O   . PHE B 1 65  ? -23.203 -65.152  -18.438 1.00 115.88 ? 144 PHE B O   1 
ATOM   1453  C CB  . PHE B 1 65  ? -23.791 -66.608  -15.708 1.00 109.26 ? 144 PHE B CB  1 
ATOM   1454  C CG  . PHE B 1 65  ? -25.104 -66.070  -16.193 1.00 109.66 ? 144 PHE B CG  1 
ATOM   1455  C CD1 . PHE B 1 65  ? -25.705 -66.585  -17.333 1.00 109.83 ? 144 PHE B CD1 1 
ATOM   1456  C CD2 . PHE B 1 65  ? -25.723 -65.035  -15.530 1.00 115.13 ? 144 PHE B CD2 1 
ATOM   1457  C CE1 . PHE B 1 65  ? -26.902 -66.077  -17.796 1.00 110.70 ? 144 PHE B CE1 1 
ATOM   1458  C CE2 . PHE B 1 65  ? -26.934 -64.516  -15.987 1.00 116.51 ? 144 PHE B CE2 1 
ATOM   1459  C CZ  . PHE B 1 65  ? -27.521 -65.047  -17.121 1.00 114.21 ? 144 PHE B CZ  1 
ATOM   1460  N N   . PHE B 1 66  ? -21.803 -66.906  -18.272 1.00 105.96 ? 145 PHE B N   1 
ATOM   1461  C CA  . PHE B 1 66  ? -21.983 -67.266  -19.656 1.00 105.49 ? 145 PHE B CA  1 
ATOM   1462  C C   . PHE B 1 66  ? -22.128 -68.763  -19.895 1.00 108.80 ? 145 PHE B C   1 
ATOM   1463  O O   . PHE B 1 66  ? -21.751 -69.586  -19.085 1.00 107.19 ? 145 PHE B O   1 
ATOM   1464  C CB  . PHE B 1 66  ? -21.013 -66.553  -20.617 1.00 105.98 ? 145 PHE B CB  1 
ATOM   1465  C CG  . PHE B 1 66  ? -19.554 -66.753  -20.356 1.00 107.80 ? 145 PHE B CG  1 
ATOM   1466  C CD1 . PHE B 1 66  ? -19.046 -67.791  -19.577 1.00 106.21 ? 145 PHE B CD1 1 
ATOM   1467  C CD2 . PHE B 1 66  ? -18.663 -65.903  -20.989 1.00 111.57 ? 145 PHE B CD2 1 
ATOM   1468  C CE1 . PHE B 1 66  ? -17.687 -67.937  -19.398 1.00 107.29 ? 145 PHE B CE1 1 
ATOM   1469  C CE2 . PHE B 1 66  ? -17.304 -66.053  -20.817 1.00 113.99 ? 145 PHE B CE2 1 
ATOM   1470  C CZ  . PHE B 1 66  ? -16.811 -67.073  -20.022 1.00 110.20 ? 145 PHE B CZ  1 
ATOM   1471  N N   . GLN B 1 67  ? -22.735 -69.058  -21.030 1.00 115.24 ? 146 GLN B N   1 
ATOM   1472  C CA  . GLN B 1 67  ? -23.302 -70.325  -21.376 1.00 116.55 ? 146 GLN B CA  1 
ATOM   1473  C C   . GLN B 1 67  ? -22.740 -70.567  -22.762 1.00 114.29 ? 146 GLN B C   1 
ATOM   1474  O O   . GLN B 1 67  ? -22.617 -69.631  -23.535 1.00 116.36 ? 146 GLN B O   1 
ATOM   1475  C CB  . GLN B 1 67  ? -24.816 -70.127  -21.420 1.00 120.14 ? 146 GLN B CB  1 
ATOM   1476  C CG  . GLN B 1 67  ? -25.679 -71.362  -21.271 1.00 124.72 ? 146 GLN B CG  1 
ATOM   1477  C CD  . GLN B 1 67  ? -27.141 -70.996  -21.035 1.00 131.58 ? 146 GLN B CD  1 
ATOM   1478  O OE1 . GLN B 1 67  ? -27.614 -71.025  -19.902 1.00 128.03 ? 146 GLN B OE1 1 
ATOM   1479  N NE2 . GLN B 1 67  ? -27.856 -70.624  -22.106 1.00 133.97 ? 146 GLN B NE2 1 
ATOM   1480  N N   . LEU B 1 68  ? -22.389 -71.793  -23.094 1.00 114.48 ? 147 LEU B N   1 
ATOM   1481  C CA  . LEU B 1 68  ? -21.881 -72.085  -24.426 1.00 118.99 ? 147 LEU B CA  1 
ATOM   1482  C C   . LEU B 1 68  ? -22.341 -73.459  -24.888 1.00 126.40 ? 147 LEU B C   1 
ATOM   1483  O O   . LEU B 1 68  ? -21.840 -74.455  -24.379 1.00 123.00 ? 147 LEU B O   1 
ATOM   1484  C CB  . LEU B 1 68  ? -20.361 -72.026  -24.393 1.00 120.83 ? 147 LEU B CB  1 
ATOM   1485  C CG  . LEU B 1 68  ? -19.611 -72.542  -25.625 1.00 123.40 ? 147 LEU B CG  1 
ATOM   1486  C CD1 . LEU B 1 68  ? -20.002 -71.694  -26.815 1.00 127.17 ? 147 LEU B CD1 1 
ATOM   1487  C CD2 . LEU B 1 68  ? -18.101 -72.546  -25.398 1.00 125.42 ? 147 LEU B CD2 1 
ATOM   1488  N N   . GLU B 1 69  ? -23.303 -73.508  -25.822 1.00 134.22 ? 148 GLU B N   1 
ATOM   1489  C CA  . GLU B 1 69  ? -23.721 -74.783  -26.423 1.00 135.87 ? 148 GLU B CA  1 
ATOM   1490  C C   . GLU B 1 69  ? -23.161 -74.888  -27.829 1.00 129.75 ? 148 GLU B C   1 
ATOM   1491  O O   . GLU B 1 69  ? -23.068 -73.889  -28.539 1.00 129.76 ? 148 GLU B O   1 
ATOM   1492  C CB  . GLU B 1 69  ? -25.241 -74.983  -26.440 1.00 143.65 ? 148 GLU B CB  1 
ATOM   1493  C CG  . GLU B 1 69  ? -25.631 -76.463  -26.510 1.00 153.83 ? 148 GLU B CG  1 
ATOM   1494  C CD  . GLU B 1 69  ? -26.970 -76.732  -27.178 1.00 164.85 ? 148 GLU B CD  1 
ATOM   1495  O OE1 . GLU B 1 69  ? -27.046 -77.655  -28.030 1.00 168.97 ? 148 GLU B OE1 1 
ATOM   1496  O OE2 . GLU B 1 69  ? -27.953 -76.037  -26.845 1.00 172.22 ? 148 GLU B OE2 1 
ATOM   1497  N N   . LEU B 1 70  ? -22.773 -76.103  -28.209 1.00 123.95 ? 149 LEU B N   1 
ATOM   1498  C CA  . LEU B 1 70  ? -22.187 -76.386  -29.509 1.00 125.19 ? 149 LEU B CA  1 
ATOM   1499  C C   . LEU B 1 70  ? -22.901 -77.590  -30.110 1.00 126.49 ? 149 LEU B C   1 
ATOM   1500  O O   . LEU B 1 70  ? -23.396 -78.434  -29.365 1.00 126.66 ? 149 LEU B O   1 
ATOM   1501  C CB  . LEU B 1 70  ? -20.709 -76.689  -29.330 1.00 127.64 ? 149 LEU B CB  1 
ATOM   1502  C CG  . LEU B 1 70  ? -19.897 -75.522  -28.755 1.00 126.22 ? 149 LEU B CG  1 
ATOM   1503  C CD1 . LEU B 1 70  ? -18.757 -75.966  -27.853 1.00 124.17 ? 149 LEU B CD1 1 
ATOM   1504  C CD2 . LEU B 1 70  ? -19.378 -74.672  -29.893 1.00 129.33 ? 149 LEU B CD2 1 
ATOM   1505  N N   . ARG B 1 71  ? -22.957 -77.666  -31.442 1.00 127.63 ? 150 ARG B N   1 
ATOM   1506  C CA  . ARG B 1 71  ? -23.620 -78.782  -32.143 1.00 132.61 ? 150 ARG B CA  1 
ATOM   1507  C C   . ARG B 1 71  ? -22.767 -79.337  -33.270 1.00 133.63 ? 150 ARG B C   1 
ATOM   1508  O O   . ARG B 1 71  ? -22.205 -78.572  -34.051 1.00 138.80 ? 150 ARG B O   1 
ATOM   1509  C CB  . ARG B 1 71  ? -24.972 -78.347  -32.698 1.00 139.90 ? 150 ARG B CB  1 
ATOM   1510  C CG  . ARG B 1 71  ? -25.004 -77.020  -33.421 1.00 144.89 ? 150 ARG B CG  1 
ATOM   1511  C CD  . ARG B 1 71  ? -26.442 -76.624  -33.700 1.00 155.37 ? 150 ARG B CD  1 
ATOM   1512  N NE  . ARG B 1 71  ? -27.040 -77.388  -34.796 1.00 160.46 ? 150 ARG B NE  1 
ATOM   1513  C CZ  . ARG B 1 71  ? -27.104 -76.994  -36.072 1.00 166.99 ? 150 ARG B CZ  1 
ATOM   1514  N NH1 . ARG B 1 71  ? -26.593 -75.825  -36.479 1.00 168.58 ? 150 ARG B NH1 1 
ATOM   1515  N NH2 . ARG B 1 71  ? -27.688 -77.784  -36.965 1.00 172.35 ? 150 ARG B NH2 1 
ATOM   1516  N N   . ARG B 1 72  ? -22.653 -80.662  -33.345 1.00 134.77 ? 151 ARG B N   1 
ATOM   1517  C CA  . ARG B 1 72  ? -21.953 -81.303  -34.456 1.00 141.18 ? 151 ARG B CA  1 
ATOM   1518  C C   . ARG B 1 72  ? -22.818 -81.164  -35.699 1.00 143.01 ? 151 ARG B C   1 
ATOM   1519  O O   . ARG B 1 72  ? -23.977 -81.562  -35.680 1.00 153.85 ? 151 ARG B O   1 
ATOM   1520  C CB  . ARG B 1 72  ? -21.698 -82.781  -34.170 1.00 143.24 ? 151 ARG B CB  1 
ATOM   1521  C CG  . ARG B 1 72  ? -20.691 -83.425  -35.114 1.00 145.00 ? 151 ARG B CG  1 
ATOM   1522  C CD  . ARG B 1 72  ? -20.677 -84.943  -34.976 1.00 144.58 ? 151 ARG B CD  1 
ATOM   1523  N NE  . ARG B 1 72  ? -20.418 -85.402  -33.604 1.00 139.44 ? 151 ARG B NE  1 
ATOM   1524  C CZ  . ARG B 1 72  ? -19.230 -85.406  -32.995 1.00 132.94 ? 151 ARG B CZ  1 
ATOM   1525  N NH1 . ARG B 1 72  ? -18.132 -84.944  -33.596 1.00 132.53 ? 151 ARG B NH1 1 
ATOM   1526  N NH2 . ARG B 1 72  ? -19.141 -85.866  -31.753 1.00 130.41 ? 151 ARG B NH2 1 
ATOM   1527  N N   . VAL B 1 73  ? -22.256 -80.578  -36.754 1.00 140.84 ? 152 VAL B N   1 
ATOM   1528  C CA  . VAL B 1 73  ? -22.965 -80.345  -38.025 1.00 139.24 ? 152 VAL B CA  1 
ATOM   1529  C C   . VAL B 1 73  ? -22.493 -81.238  -39.169 1.00 139.71 ? 152 VAL B C   1 
ATOM   1530  O O   . VAL B 1 73  ? -23.144 -81.286  -40.194 1.00 149.35 ? 152 VAL B O   1 
ATOM   1531  C CB  . VAL B 1 73  ? -22.886 -78.864  -38.480 1.00 135.24 ? 152 VAL B CB  1 
ATOM   1532  C CG1 . VAL B 1 73  ? -23.566 -77.948  -37.467 1.00 131.67 ? 152 VAL B CG1 1 
ATOM   1533  C CG2 . VAL B 1 73  ? -21.451 -78.418  -38.716 1.00 137.78 ? 152 VAL B CG2 1 
ATOM   1534  N N   . VAL B 1 74  ? -21.359 -81.909  -39.018 1.00 139.88 ? 153 VAL B N   1 
ATOM   1535  C CA  . VAL B 1 74  ? -20.897 -82.881  -40.008 1.00 139.29 ? 153 VAL B CA  1 
ATOM   1536  C C   . VAL B 1 74  ? -20.822 -84.221  -39.300 1.00 137.93 ? 153 VAL B C   1 
ATOM   1537  O O   . VAL B 1 74  ? -19.897 -84.471  -38.524 1.00 138.13 ? 153 VAL B O   1 
ATOM   1538  C CB  . VAL B 1 74  ? -19.522 -82.501  -40.580 1.00 142.35 ? 153 VAL B CB  1 
ATOM   1539  C CG1 . VAL B 1 74  ? -19.009 -83.577  -41.526 1.00 145.84 ? 153 VAL B CG1 1 
ATOM   1540  C CG2 . VAL B 1 74  ? -19.610 -81.154  -41.287 1.00 144.89 ? 153 VAL B CG2 1 
ATOM   1541  N N   . ALA B 1 75  ? -21.807 -85.072  -39.562 1.00 141.80 ? 154 ALA B N   1 
ATOM   1542  C CA  . ALA B 1 75  ? -21.905 -86.380  -38.913 1.00 146.93 ? 154 ALA B CA  1 
ATOM   1543  C C   . ALA B 1 75  ? -20.602 -87.158  -39.026 1.00 150.75 ? 154 ALA B C   1 
ATOM   1544  O O   . ALA B 1 75  ? -19.962 -87.161  -40.088 1.00 153.79 ? 154 ALA B O   1 
ATOM   1545  C CB  . ALA B 1 75  ? -23.041 -87.193  -39.520 1.00 150.65 ? 154 ALA B CB  1 
ATOM   1546  N N   . GLY B 1 76  ? -20.205 -87.788  -37.922 1.00 150.46 ? 155 GLY B N   1 
ATOM   1547  C CA  . GLY B 1 76  ? -19.027 -88.655  -37.912 1.00 151.27 ? 155 GLY B CA  1 
ATOM   1548  C C   . GLY B 1 76  ? -17.683 -87.947  -37.973 1.00 150.52 ? 155 GLY B C   1 
ATOM   1549  O O   . GLY B 1 76  ? -16.673 -88.593  -38.232 1.00 150.24 ? 155 GLY B O   1 
ATOM   1550  N N   . GLU B 1 77  ? -17.656 -86.644  -37.716 1.00 148.22 ? 156 GLU B N   1 
ATOM   1551  C CA  . GLU B 1 77  ? -16.441 -85.871  -37.828 1.00 148.67 ? 156 GLU B CA  1 
ATOM   1552  C C   . GLU B 1 77  ? -16.365 -84.817  -36.739 1.00 148.44 ? 156 GLU B C   1 
ATOM   1553  O O   . GLU B 1 77  ? -17.379 -84.393  -36.207 1.00 147.30 ? 156 GLU B O   1 
ATOM   1554  C CB  . GLU B 1 77  ? -16.369 -85.209  -39.213 1.00 148.60 ? 156 GLU B CB  1 
ATOM   1555  C CG  . GLU B 1 77  ? -15.660 -86.145  -40.211 1.00 149.49 ? 156 GLU B CG  1 
ATOM   1556  C CD  . GLU B 1 77  ? -15.459 -85.575  -41.579 1.00 147.26 ? 156 GLU B CD  1 
ATOM   1557  O OE1 . GLU B 1 77  ? -14.385 -85.819  -42.177 1.00 146.21 ? 156 GLU B OE1 1 
ATOM   1558  O OE2 . GLU B 1 77  ? -16.382 -84.911  -42.062 1.00 148.30 ? 156 GLU B OE2 1 
ATOM   1559  N N   . GLY B 1 78  ? -15.139 -84.410  -36.423 1.00 153.79 ? 157 GLY B N   1 
ATOM   1560  C CA  . GLY B 1 78  ? -14.896 -83.262  -35.561 1.00 151.42 ? 157 GLY B CA  1 
ATOM   1561  C C   . GLY B 1 78  ? -14.611 -83.656  -34.133 1.00 144.63 ? 157 GLY B C   1 
ATOM   1562  O O   . GLY B 1 78  ? -15.342 -84.453  -33.544 1.00 142.91 ? 157 GLY B O   1 
ATOM   1563  N N   . SER B 1 79  ? -13.556 -83.070  -33.577 1.00 141.12 ? 158 SER B N   1 
ATOM   1564  C CA  . SER B 1 79  ? -13.184 -83.290  -32.186 1.00 144.17 ? 158 SER B CA  1 
ATOM   1565  C C   . SER B 1 79  ? -12.368 -82.111  -31.692 1.00 142.80 ? 158 SER B C   1 
ATOM   1566  O O   . SER B 1 79  ? -11.987 -81.248  -32.478 1.00 148.36 ? 158 SER B O   1 
ATOM   1567  C CB  . SER B 1 79  ? -12.375 -84.576  -32.055 1.00 146.36 ? 158 SER B CB  1 
ATOM   1568  O OG  . SER B 1 79  ? -11.222 -84.507  -32.880 1.00 156.26 ? 158 SER B OG  1 
ATOM   1569  N N   . GLY B 1 80  ? -12.105 -82.082  -30.392 1.00 137.61 ? 159 GLY B N   1 
ATOM   1570  C CA  . GLY B 1 80  ? -11.263 -81.041  -29.799 1.00 135.45 ? 159 GLY B CA  1 
ATOM   1571  C C   . GLY B 1 80  ? -11.943 -80.237  -28.706 1.00 130.26 ? 159 GLY B C   1 
ATOM   1572  O O   . GLY B 1 80  ? -12.640 -80.798  -27.862 1.00 127.19 ? 159 GLY B O   1 
ATOM   1573  N N   . SER B 1 81  ? -11.748 -78.924  -28.727 1.00 127.59 ? 160 SER B N   1 
ATOM   1574  C CA  . SER B 1 81  ? -12.108 -78.083  -27.606 1.00 125.22 ? 160 SER B CA  1 
ATOM   1575  C C   . SER B 1 81  ? -12.409 -76.655  -28.036 1.00 121.51 ? 160 SER B C   1 
ATOM   1576  O O   . SER B 1 81  ? -11.865 -76.173  -29.012 1.00 126.02 ? 160 SER B O   1 
ATOM   1577  C CB  . SER B 1 81  ? -10.953 -78.096  -26.602 1.00 132.03 ? 160 SER B CB  1 
ATOM   1578  O OG  . SER B 1 81  ? -10.892 -76.873  -25.879 1.00 139.62 ? 160 SER B OG  1 
ATOM   1579  N N   . VAL B 1 82  ? -13.269 -75.979  -27.283 1.00 118.35 ? 161 VAL B N   1 
ATOM   1580  C CA  . VAL B 1 82  ? -13.705 -74.614  -27.584 1.00 120.19 ? 161 VAL B CA  1 
ATOM   1581  C C   . VAL B 1 82  ? -13.790 -73.862  -26.278 1.00 121.06 ? 161 VAL B C   1 
ATOM   1582  O O   . VAL B 1 82  ? -14.241 -74.428  -25.276 1.00 123.86 ? 161 VAL B O   1 
ATOM   1583  C CB  . VAL B 1 82  ? -15.106 -74.609  -28.224 1.00 120.31 ? 161 VAL B CB  1 
ATOM   1584  C CG1 . VAL B 1 82  ? -15.614 -73.193  -28.457 1.00 119.29 ? 161 VAL B CG1 1 
ATOM   1585  C CG2 . VAL B 1 82  ? -15.102 -75.418  -29.526 1.00 122.09 ? 161 VAL B CG2 1 
ATOM   1586  N N   . SER B 1 83  ? -13.399 -72.588  -26.291 1.00 121.04 ? 162 SER B N   1 
ATOM   1587  C CA  . SER B 1 83  ? -13.230 -71.811  -25.062 1.00 122.94 ? 162 SER B CA  1 
ATOM   1588  C C   . SER B 1 83  ? -13.776 -70.406  -25.181 1.00 119.64 ? 162 SER B C   1 
ATOM   1589  O O   . SER B 1 83  ? -13.480 -69.727  -26.145 1.00 120.48 ? 162 SER B O   1 
ATOM   1590  C CB  . SER B 1 83  ? -11.734 -71.723  -24.717 1.00 126.46 ? 162 SER B CB  1 
ATOM   1591  O OG  . SER B 1 83  ? -11.061 -72.914  -25.100 1.00 127.96 ? 162 SER B OG  1 
ATOM   1592  N N   . LEU B 1 84  ? -14.578 -69.978  -24.210 1.00 118.38 ? 163 LEU B N   1 
ATOM   1593  C CA  . LEU B 1 84  ? -14.907 -68.562  -24.035 1.00 118.82 ? 163 LEU B CA  1 
ATOM   1594  C C   . LEU B 1 84  ? -14.000 -67.944  -22.980 1.00 119.94 ? 163 LEU B C   1 
ATOM   1595  O O   . LEU B 1 84  ? -13.517 -68.629  -22.078 1.00 115.97 ? 163 LEU B O   1 
ATOM   1596  C CB  . LEU B 1 84  ? -16.356 -68.356  -23.593 1.00 119.25 ? 163 LEU B CB  1 
ATOM   1597  C CG  . LEU B 1 84  ? -17.483 -68.783  -24.521 1.00 119.03 ? 163 LEU B CG  1 
ATOM   1598  C CD1 . LEU B 1 84  ? -18.781 -68.146  -24.054 1.00 120.12 ? 163 LEU B CD1 1 
ATOM   1599  C CD2 . LEU B 1 84  ? -17.210 -68.413  -25.961 1.00 120.63 ? 163 LEU B CD2 1 
ATOM   1600  N N   . ALA B 1 85  ? -13.794 -66.635  -23.092 1.00 124.47 ? 164 ALA B N   1 
ATOM   1601  C CA  . ALA B 1 85  ? -13.047 -65.880  -22.099 1.00 127.66 ? 164 ALA B CA  1 
ATOM   1602  C C   . ALA B 1 85  ? -13.605 -64.477  -22.042 1.00 128.16 ? 164 ALA B C   1 
ATOM   1603  O O   . ALA B 1 85  ? -13.675 -63.804  -23.063 1.00 128.59 ? 164 ALA B O   1 
ATOM   1604  C CB  . ALA B 1 85  ? -11.576 -65.837  -22.470 1.00 131.65 ? 164 ALA B CB  1 
ATOM   1605  N N   . LEU B 1 86  ? -14.035 -64.060  -20.861 1.00 130.06 ? 165 LEU B N   1 
ATOM   1606  C CA  . LEU B 1 86  ? -14.543 -62.716  -20.647 1.00 132.52 ? 165 LEU B CA  1 
ATOM   1607  C C   . LEU B 1 86  ? -13.372 -61.862  -20.232 1.00 134.67 ? 165 LEU B C   1 
ATOM   1608  O O   . LEU B 1 86  ? -12.713 -62.167  -19.232 1.00 138.34 ? 165 LEU B O   1 
ATOM   1609  C CB  . LEU B 1 86  ? -15.590 -62.716  -19.541 1.00 134.48 ? 165 LEU B CB  1 
ATOM   1610  C CG  . LEU B 1 86  ? -16.279 -61.384  -19.276 1.00 134.92 ? 165 LEU B CG  1 
ATOM   1611  C CD1 . LEU B 1 86  ? -17.313 -61.107  -20.351 1.00 135.84 ? 165 LEU B CD1 1 
ATOM   1612  C CD2 . LEU B 1 86  ? -16.917 -61.394  -17.898 1.00 134.57 ? 165 LEU B CD2 1 
ATOM   1613  N N   . HIS B 1 87  ? -13.113 -60.806  -21.001 1.00 136.74 ? 166 HIS B N   1 
ATOM   1614  C CA  . HIS B 1 87  ? -12.053 -59.836  -20.701 1.00 139.71 ? 166 HIS B CA  1 
ATOM   1615  C C   . HIS B 1 87  ? -12.673 -58.483  -20.370 1.00 138.97 ? 166 HIS B C   1 
ATOM   1616  O O   . HIS B 1 87  ? -13.637 -58.057  -21.028 1.00 137.84 ? 166 HIS B O   1 
ATOM   1617  C CB  . HIS B 1 87  ? -11.122 -59.697  -21.895 1.00 144.30 ? 166 HIS B CB  1 
ATOM   1618  C CG  . HIS B 1 87  ? -10.317 -60.928  -22.167 1.00 147.48 ? 166 HIS B CG  1 
ATOM   1619  N ND1 . HIS B 1 87  ? -9.494  -61.503  -21.218 1.00 152.55 ? 166 HIS B ND1 1 
ATOM   1620  C CD2 . HIS B 1 87  ? -10.214 -61.704  -23.274 1.00 147.54 ? 166 HIS B CD2 1 
ATOM   1621  C CE1 . HIS B 1 87  ? -8.934  -62.585  -21.727 1.00 150.59 ? 166 HIS B CE1 1 
ATOM   1622  N NE2 . HIS B 1 87  ? -9.357  -62.732  -22.970 1.00 146.09 ? 166 HIS B NE2 1 
ATOM   1623  N N   . LEU B 1 88  ? -12.128 -57.818  -19.359 1.00 142.02 ? 167 LEU B N   1 
ATOM   1624  C CA  . LEU B 1 88  ? -12.592 -56.495  -18.940 1.00 146.47 ? 167 LEU B CA  1 
ATOM   1625  C C   . LEU B 1 88  ? -11.684 -55.402  -19.491 1.00 154.74 ? 167 LEU B C   1 
ATOM   1626  O O   . LEU B 1 88  ? -10.482 -55.439  -19.259 1.00 155.32 ? 167 LEU B O   1 
ATOM   1627  C CB  . LEU B 1 88  ? -12.599 -56.390  -17.415 1.00 144.54 ? 167 LEU B CB  1 
ATOM   1628  C CG  . LEU B 1 88  ? -13.426 -57.425  -16.669 1.00 138.67 ? 167 LEU B CG  1 
ATOM   1629  C CD1 . LEU B 1 88  ? -13.234 -57.224  -15.177 1.00 137.01 ? 167 LEU B CD1 1 
ATOM   1630  C CD2 . LEU B 1 88  ? -14.897 -57.341  -17.058 1.00 135.26 ? 167 LEU B CD2 1 
ATOM   1631  N N   . GLN B 1 89  ? -12.259 -54.443  -20.216 1.00 164.10 ? 168 GLN B N   1 
ATOM   1632  C CA  . GLN B 1 89  ? -11.542 -53.243  -20.637 1.00 174.10 ? 168 GLN B CA  1 
ATOM   1633  C C   . GLN B 1 89  ? -12.204 -52.036  -19.940 1.00 179.93 ? 168 GLN B C   1 
ATOM   1634  O O   . GLN B 1 89  ? -13.426 -51.887  -20.038 1.00 172.50 ? 168 GLN B O   1 
ATOM   1635  C CB  . GLN B 1 89  ? -11.582 -53.104  -22.161 1.00 175.62 ? 168 GLN B CB  1 
ATOM   1636  C CG  . GLN B 1 89  ? -10.708 -51.988  -22.735 1.00 183.06 ? 168 GLN B CG  1 
ATOM   1637  C CD  . GLN B 1 89  ? -9.214  -52.308  -22.754 1.00 184.61 ? 168 GLN B CD  1 
ATOM   1638  O OE1 . GLN B 1 89  ? -8.702  -53.080  -21.937 1.00 181.68 ? 168 GLN B OE1 1 
ATOM   1639  N NE2 . GLN B 1 89  ? -8.506  -51.693  -23.692 1.00 186.35 ? 168 GLN B NE2 1 
ATOM   1640  N N   . PRO B 1 90  ? -11.444 -51.177  -19.242 1.00 199.53 ? 169 PRO B N   1 
ATOM   1641  C CA  . PRO B 1 90  ? -9.967  -51.193  -19.166 1.00 205.46 ? 169 PRO B CA  1 
ATOM   1642  C C   . PRO B 1 90  ? -9.374  -52.213  -18.180 1.00 202.63 ? 169 PRO B C   1 
ATOM   1643  O O   . PRO B 1 90  ? -10.002 -52.573  -17.180 1.00 196.30 ? 169 PRO B O   1 
ATOM   1644  C CB  . PRO B 1 90  ? -9.629  -49.762  -18.729 1.00 211.57 ? 169 PRO B CB  1 
ATOM   1645  C CG  . PRO B 1 90  ? -10.820 -49.322  -17.944 1.00 209.90 ? 169 PRO B CG  1 
ATOM   1646  C CD  . PRO B 1 90  ? -12.016 -49.997  -18.563 1.00 205.97 ? 169 PRO B CD  1 
ATOM   1647  N N   . GLY B 1 96  ? -2.748  -60.688  -17.897 1.00 206.29 ? 175 GLY B N   1 
ATOM   1648  C CA  . GLY B 1 96  ? -3.613  -61.201  -18.972 1.00 204.02 ? 175 GLY B CA  1 
ATOM   1649  C C   . GLY B 1 96  ? -4.705  -62.169  -18.508 1.00 197.96 ? 175 GLY B C   1 
ATOM   1650  O O   . GLY B 1 96  ? -5.108  -63.072  -19.261 1.00 194.08 ? 175 GLY B O   1 
ATOM   1651  N N   . ALA B 1 97  ? -5.195  -61.961  -17.282 1.00 192.27 ? 176 ALA B N   1 
ATOM   1652  C CA  . ALA B 1 97  ? -6.140  -62.874  -16.623 1.00 181.38 ? 176 ALA B CA  1 
ATOM   1653  C C   . ALA B 1 97  ? -7.581  -62.595  -17.051 1.00 177.13 ? 176 ALA B C   1 
ATOM   1654  O O   . ALA B 1 97  ? -8.047  -61.461  -17.004 1.00 185.41 ? 176 ALA B O   1 
ATOM   1655  C CB  . ALA B 1 97  ? -6.009  -62.754  -15.109 1.00 179.31 ? 176 ALA B CB  1 
ATOM   1656  N N   . ALA B 1 98  ? -8.303  -63.651  -17.437 1.00 164.65 ? 177 ALA B N   1 
ATOM   1657  C CA  . ALA B 1 98  ? -9.716  -63.546  -17.808 1.00 148.99 ? 177 ALA B CA  1 
ATOM   1658  C C   . ALA B 1 98  ? -10.588 -63.520  -16.553 1.00 141.24 ? 177 ALA B C   1 
ATOM   1659  O O   . ALA B 1 98  ? -10.346 -64.274  -15.597 1.00 129.59 ? 177 ALA B O   1 
ATOM   1660  C CB  . ALA B 1 98  ? -10.099 -64.713  -18.683 1.00 144.29 ? 177 ALA B CB  1 
ATOM   1661  N N   . ALA B 1 99  ? -11.605 -62.662  -16.571 1.00 142.13 ? 178 ALA B N   1 
ATOM   1662  C CA  . ALA B 1 99  ? -12.528 -62.502  -15.436 1.00 139.02 ? 178 ALA B CA  1 
ATOM   1663  C C   . ALA B 1 99  ? -13.397 -63.737  -15.234 1.00 136.36 ? 178 ALA B C   1 
ATOM   1664  O O   . ALA B 1 99  ? -13.647 -64.153  -14.100 1.00 135.54 ? 178 ALA B O   1 
ATOM   1665  C CB  . ALA B 1 99  ? -13.430 -61.290  -15.653 1.00 136.66 ? 178 ALA B CB  1 
ATOM   1666  N N   . LEU B 1 100 ? -13.853 -64.288  -16.356 1.00 134.00 ? 179 LEU B N   1 
ATOM   1667  C CA  . LEU B 1 100 ? -14.657 -65.491  -16.417 1.00 129.35 ? 179 LEU B CA  1 
ATOM   1668  C C   . LEU B 1 100 ? -14.122 -66.323  -17.580 1.00 127.35 ? 179 LEU B C   1 
ATOM   1669  O O   . LEU B 1 100 ? -13.787 -65.776  -18.627 1.00 121.70 ? 179 LEU B O   1 
ATOM   1670  C CB  . LEU B 1 100 ? -16.118 -65.082  -16.659 1.00 129.88 ? 179 LEU B CB  1 
ATOM   1671  C CG  . LEU B 1 100 ? -17.228 -66.036  -16.279 1.00 130.03 ? 179 LEU B CG  1 
ATOM   1672  C CD1 . LEU B 1 100 ? -17.234 -66.232  -14.770 1.00 133.57 ? 179 LEU B CD1 1 
ATOM   1673  C CD2 . LEU B 1 100 ? -18.554 -65.480  -16.776 1.00 128.58 ? 179 LEU B CD2 1 
ATOM   1674  N N   . ALA B 1 101 ? -14.021 -67.634  -17.409 1.00 127.06 ? 180 ALA B N   1 
ATOM   1675  C CA  . ALA B 1 101 ? -13.512 -68.489  -18.487 1.00 127.00 ? 180 ALA B CA  1 
ATOM   1676  C C   . ALA B 1 101 ? -14.100 -69.899  -18.453 1.00 126.21 ? 180 ALA B C   1 
ATOM   1677  O O   . ALA B 1 101 ? -14.403 -70.449  -17.387 1.00 118.53 ? 180 ALA B O   1 
ATOM   1678  C CB  . ALA B 1 101 ? -12.005 -68.542  -18.441 1.00 129.09 ? 180 ALA B CB  1 
ATOM   1679  N N   . LEU B 1 102 ? -14.237 -70.479  -19.640 1.00 126.54 ? 181 LEU B N   1 
ATOM   1680  C CA  . LEU B 1 102 ? -14.972 -71.713  -19.829 1.00 125.99 ? 181 LEU B CA  1 
ATOM   1681  C C   . LEU B 1 102 ? -14.343 -72.497  -20.944 1.00 128.70 ? 181 LEU B C   1 
ATOM   1682  O O   . LEU B 1 102 ? -13.935 -71.924  -21.943 1.00 134.04 ? 181 LEU B O   1 
ATOM   1683  C CB  . LEU B 1 102 ? -16.402 -71.368  -20.246 1.00 124.75 ? 181 LEU B CB  1 
ATOM   1684  C CG  . LEU B 1 102 ? -17.521 -72.173  -19.599 1.00 124.52 ? 181 LEU B CG  1 
ATOM   1685  C CD1 . LEU B 1 102 ? -18.824 -71.780  -20.271 1.00 126.05 ? 181 LEU B CD1 1 
ATOM   1686  C CD2 . LEU B 1 102 ? -17.287 -73.671  -19.714 1.00 124.42 ? 181 LEU B CD2 1 
ATOM   1687  N N   . THR B 1 103 ? -14.266 -73.808  -20.797 1.00 131.26 ? 182 THR B N   1 
ATOM   1688  C CA  . THR B 1 103 ? -13.852 -74.643  -21.914 1.00 136.22 ? 182 THR B CA  1 
ATOM   1689  C C   . THR B 1 103 ? -14.793 -75.832  -21.997 1.00 139.05 ? 182 THR B C   1 
ATOM   1690  O O   . THR B 1 103 ? -15.252 -76.338  -20.965 1.00 145.93 ? 182 THR B O   1 
ATOM   1691  C CB  . THR B 1 103 ? -12.388 -75.072  -21.763 1.00 139.54 ? 182 THR B CB  1 
ATOM   1692  O OG1 . THR B 1 103 ? -11.560 -73.901  -21.709 1.00 140.29 ? 182 THR B OG1 1 
ATOM   1693  C CG2 . THR B 1 103 ? -11.939 -75.949  -22.923 1.00 143.15 ? 182 THR B CG2 1 
ATOM   1694  N N   . VAL B 1 104 ? -15.089 -76.249  -23.227 1.00 132.06 ? 183 VAL B N   1 
ATOM   1695  C CA  . VAL B 1 104 ? -16.059 -77.290  -23.503 1.00 124.42 ? 183 VAL B CA  1 
ATOM   1696  C C   . VAL B 1 104 ? -15.385 -78.303  -24.414 1.00 122.81 ? 183 VAL B C   1 
ATOM   1697  O O   . VAL B 1 104 ? -14.853 -77.930  -25.445 1.00 124.49 ? 183 VAL B O   1 
ATOM   1698  C CB  . VAL B 1 104 ? -17.283 -76.674  -24.189 1.00 123.68 ? 183 VAL B CB  1 
ATOM   1699  C CG1 . VAL B 1 104 ? -18.201 -77.746  -24.775 1.00 127.54 ? 183 VAL B CG1 1 
ATOM   1700  C CG2 . VAL B 1 104 ? -18.026 -75.792  -23.212 1.00 121.80 ? 183 VAL B CG2 1 
ATOM   1701  N N   . ASP B 1 105 ? -15.394 -79.574  -24.027 1.00 124.35 ? 184 ASP B N   1 
ATOM   1702  C CA  . ASP B 1 105 ? -14.810 -80.611  -24.860 1.00 132.93 ? 184 ASP B CA  1 
ATOM   1703  C C   . ASP B 1 105 ? -15.811 -80.989  -25.942 1.00 133.37 ? 184 ASP B C   1 
ATOM   1704  O O   . ASP B 1 105 ? -16.990 -81.103  -25.676 1.00 134.12 ? 184 ASP B O   1 
ATOM   1705  C CB  . ASP B 1 105 ? -14.402 -81.841  -24.046 1.00 145.03 ? 184 ASP B CB  1 
ATOM   1706  C CG  . ASP B 1 105 ? -13.147 -81.589  -23.177 1.00 159.52 ? 184 ASP B CG  1 
ATOM   1707  O OD1 . ASP B 1 105 ? -12.324 -82.517  -22.967 1.00 177.43 ? 184 ASP B OD1 1 
ATOM   1708  O OD2 . ASP B 1 105 ? -12.953 -80.456  -22.689 1.00 165.99 ? 184 ASP B OD2 1 
ATOM   1709  N N   . LEU B 1 106 ? -15.317 -81.147  -27.164 1.00 135.32 ? 185 LEU B N   1 
ATOM   1710  C CA  . LEU B 1 106 ? -16.093 -81.661  -28.285 1.00 126.79 ? 185 LEU B CA  1 
ATOM   1711  C C   . LEU B 1 106 ? -15.780 -83.151  -28.429 1.00 130.02 ? 185 LEU B C   1 
ATOM   1712  O O   . LEU B 1 106 ? -14.665 -83.521  -28.806 1.00 132.32 ? 185 LEU B O   1 
ATOM   1713  C CB  . LEU B 1 106 ? -15.734 -80.926  -29.571 1.00 124.04 ? 185 LEU B CB  1 
ATOM   1714  C CG  . LEU B 1 106 ? -15.835 -79.410  -29.538 1.00 123.67 ? 185 LEU B CG  1 
ATOM   1715  C CD1 . LEU B 1 106 ? -15.398 -78.909  -30.913 1.00 126.75 ? 185 LEU B CD1 1 
ATOM   1716  C CD2 . LEU B 1 106 ? -17.223 -78.935  -29.178 1.00 121.04 ? 185 LEU B CD2 1 
ATOM   1717  N N   . PRO B 1 107 ? -16.751 -84.015  -28.108 1.00 129.44 ? 186 PRO B N   1 
ATOM   1718  C CA  . PRO B 1 107 ? -16.458 -85.444  -28.118 1.00 133.72 ? 186 PRO B CA  1 
ATOM   1719  C C   . PRO B 1 107 ? -16.182 -85.993  -29.508 1.00 142.19 ? 186 PRO B C   1 
ATOM   1720  O O   . PRO B 1 107 ? -16.731 -85.489  -30.480 1.00 147.13 ? 186 PRO B O   1 
ATOM   1721  C CB  . PRO B 1 107 ? -17.715 -86.062  -27.534 1.00 132.77 ? 186 PRO B CB  1 
ATOM   1722  C CG  . PRO B 1 107 ? -18.785 -85.098  -27.886 1.00 130.40 ? 186 PRO B CG  1 
ATOM   1723  C CD  . PRO B 1 107 ? -18.162 -83.742  -27.806 1.00 128.15 ? 186 PRO B CD  1 
ATOM   1724  N N   . PRO B 1 108 ? -15.346 -87.035  -29.612 1.00 156.45 ? 187 PRO B N   1 
ATOM   1725  C CA  . PRO B 1 108 ? -14.969 -87.530  -30.931 1.00 163.36 ? 187 PRO B CA  1 
ATOM   1726  C C   . PRO B 1 108 ? -16.043 -88.513  -31.444 1.00 167.64 ? 187 PRO B C   1 
ATOM   1727  O O   . PRO B 1 108 ? -16.474 -89.418  -30.716 1.00 174.19 ? 187 PRO B O   1 
ATOM   1728  C CB  . PRO B 1 108 ? -13.657 -88.246  -30.659 1.00 169.03 ? 187 PRO B CB  1 
ATOM   1729  C CG  . PRO B 1 108 ? -13.802 -88.764  -29.259 1.00 169.59 ? 187 PRO B CG  1 
ATOM   1730  C CD  . PRO B 1 108 ? -14.715 -87.813  -28.524 1.00 163.38 ? 187 PRO B CD  1 
ATOM   1731  N N   . ALA B 1 109 ? -16.406 -88.375  -32.707 1.00 166.69 ? 188 ALA B N   1 
ATOM   1732  C CA  . ALA B 1 109 ? -17.490 -89.163  -33.239 1.00 164.28 ? 188 ALA B CA  1 
ATOM   1733  C C   . ALA B 1 109 ? -17.237 -90.613  -32.964 1.00 164.47 ? 188 ALA B C   1 
ATOM   1734  O O   . ALA B 1 109 ? -16.131 -91.105  -33.097 1.00 169.07 ? 188 ALA B O   1 
ATOM   1735  C CB  . ALA B 1 109 ? -17.611 -88.932  -34.727 1.00 166.79 ? 188 ALA B CB  1 
ATOM   1736  N N   . SER B 1 110 ? -18.292 -91.284  -32.541 1.00 168.08 ? 189 SER B N   1 
ATOM   1737  C CA  . SER B 1 110 ? -18.242 -92.686  -32.189 1.00 172.65 ? 189 SER B CA  1 
ATOM   1738  C C   . SER B 1 110 ? -19.610 -93.288  -32.399 1.00 175.04 ? 189 SER B C   1 
ATOM   1739  O O   . SER B 1 110 ? -20.503 -92.655  -32.948 1.00 164.00 ? 189 SER B O   1 
ATOM   1740  C CB  . SER B 1 110 ? -17.821 -92.858  -30.736 1.00 175.01 ? 189 SER B CB  1 
ATOM   1741  N N   . SER B 1 111 ? -19.802 -94.495  -31.890 1.00 183.85 ? 190 SER B N   1 
ATOM   1742  C CA  . SER B 1 111 ? -21.082 -95.158  -32.035 1.00 187.65 ? 190 SER B CA  1 
ATOM   1743  C C   . SER B 1 111 ? -22.135 -94.323  -31.344 1.00 189.09 ? 190 SER B C   1 
ATOM   1744  O O   . SER B 1 111 ? -23.220 -94.120  -31.873 1.00 187.27 ? 190 SER B O   1 
ATOM   1745  C CB  . SER B 1 111 ? -21.034 -96.544  -31.407 1.00 187.70 ? 190 SER B CB  1 
ATOM   1746  N N   . GLU B 1 112 ? -21.805 -93.813  -30.162 1.00 193.87 ? 191 GLU B N   1 
ATOM   1747  C CA  . GLU B 1 112 ? -22.727 -92.963  -29.426 1.00 196.11 ? 191 GLU B CA  1 
ATOM   1748  C C   . GLU B 1 112 ? -22.847 -91.708  -30.252 1.00 194.21 ? 191 GLU B C   1 
ATOM   1749  O O   . GLU B 1 112 ? -21.837 -91.188  -30.719 1.00 184.78 ? 191 GLU B O   1 
ATOM   1750  C CB  . GLU B 1 112 ? -22.160 -92.625  -28.055 1.00 194.27 ? 191 GLU B CB  1 
ATOM   1751  N N   . ALA B 1 113 ? -24.055 -91.184  -30.420 1.00 200.07 ? 192 ALA B N   1 
ATOM   1752  C CA  . ALA B 1 113 ? -24.166 -90.018  -31.278 1.00 198.24 ? 192 ALA B CA  1 
ATOM   1753  C C   . ALA B 1 113 ? -23.391 -88.817  -30.758 1.00 193.06 ? 192 ALA B C   1 
ATOM   1754  O O   . ALA B 1 113 ? -22.561 -88.295  -31.490 1.00 196.63 ? 192 ALA B O   1 
ATOM   1755  C CB  . ALA B 1 113 ? -25.628 -89.654  -31.472 1.00 198.75 ? 192 ALA B CB  1 
ATOM   1756  N N   . ARG B 1 114 ? -23.608 -88.437  -29.497 1.00 181.59 ? 193 ARG B N   1 
ATOM   1757  C CA  . ARG B 1 114 ? -22.857 -87.356  -28.850 1.00 165.35 ? 193 ARG B CA  1 
ATOM   1758  C C   . ARG B 1 114 ? -22.694 -86.112  -29.713 1.00 158.06 ? 193 ARG B C   1 
ATOM   1759  O O   . ARG B 1 114 ? -21.591 -85.627  -29.870 1.00 164.11 ? 193 ARG B O   1 
ATOM   1760  C CB  . ARG B 1 114 ? -21.495 -87.868  -28.407 1.00 163.73 ? 193 ARG B CB  1 
ATOM   1761  N N   . ASN B 1 115 ? -23.761 -85.580  -30.269 1.00 150.11 ? 194 ASN B N   1 
ATOM   1762  C CA  . ASN B 1 115 ? -23.596 -84.480  -31.206 1.00 145.81 ? 194 ASN B CA  1 
ATOM   1763  C C   . ASN B 1 115 ? -23.585 -83.082  -30.637 1.00 140.75 ? 194 ASN B C   1 
ATOM   1764  O O   . ASN B 1 115 ? -23.630 -82.110  -31.383 1.00 143.38 ? 194 ASN B O   1 
ATOM   1765  C CB  . ASN B 1 115 ? -24.655 -84.572  -32.295 1.00 145.66 ? 194 ASN B CB  1 
ATOM   1766  N N   . SER B 1 116 ? -23.522 -82.960  -29.325 1.00 134.27 ? 195 SER B N   1 
ATOM   1767  C CA  . SER B 1 116 ? -23.614 -81.613  -28.742 1.00 130.72 ? 195 SER B CA  1 
ATOM   1768  C C   . SER B 1 116 ? -22.774 -81.471  -27.458 1.00 128.62 ? 195 SER B C   1 
ATOM   1769  O O   . SER B 1 116 ? -22.259 -82.456  -26.931 1.00 133.71 ? 195 SER B O   1 
ATOM   1770  C CB  . SER B 1 116 ? -25.073 -81.218  -28.487 1.00 128.45 ? 195 SER B CB  1 
ATOM   1771  O OG  . SER B 1 116 ? -25.601 -81.927  -27.391 1.00 125.08 ? 195 SER B OG  1 
ATOM   1772  N N   . ALA B 1 117 ? -22.631 -80.239  -26.976 1.00 120.77 ? 196 ALA B N   1 
ATOM   1773  C CA  . ALA B 1 117 ? -21.745 -79.957  -25.851 1.00 116.94 ? 196 ALA B CA  1 
ATOM   1774  C C   . ALA B 1 117 ? -22.079 -78.636  -25.186 1.00 113.76 ? 196 ALA B C   1 
ATOM   1775  O O   . ALA B 1 117 ? -22.035 -77.618  -25.845 1.00 113.17 ? 196 ALA B O   1 
ATOM   1776  C CB  . ALA B 1 117 ? -20.297 -79.956  -26.327 1.00 116.33 ? 196 ALA B CB  1 
ATOM   1777  N N   . PHE B 1 118 ? -22.387 -78.675  -23.892 1.00 112.85 ? 197 PHE B N   1 
ATOM   1778  C CA  . PHE B 1 118 ? -22.783 -77.490  -23.109 1.00 111.64 ? 197 PHE B CA  1 
ATOM   1779  C C   . PHE B 1 118 ? -21.661 -77.107  -22.178 1.00 108.03 ? 197 PHE B C   1 
ATOM   1780  O O   . PHE B 1 118 ? -20.732 -77.860  -21.954 1.00 108.95 ? 197 PHE B O   1 
ATOM   1781  C CB  . PHE B 1 118 ? -24.066 -77.729  -22.275 1.00 108.91 ? 197 PHE B CB  1 
ATOM   1782  N N   . GLY B 1 119 ? -21.783 -75.917  -21.614 1.00 103.48 ? 198 GLY B N   1 
ATOM   1783  C CA  . GLY B 1 119 ? -20.796 -75.375  -20.684 1.00 96.64  ? 198 GLY B CA  1 
ATOM   1784  C C   . GLY B 1 119 ? -21.349 -74.115  -20.078 1.00 94.61  ? 198 GLY B C   1 
ATOM   1785  O O   . GLY B 1 119 ? -21.745 -73.209  -20.804 1.00 98.11  ? 198 GLY B O   1 
ATOM   1786  N N   . PHE B 1 120 ? -21.397 -74.055  -18.758 1.00 94.89  ? 199 PHE B N   1 
ATOM   1787  C CA  . PHE B 1 120 ? -21.909 -72.895  -18.046 1.00 96.79  ? 199 PHE B CA  1 
ATOM   1788  C C   . PHE B 1 120 ? -20.931 -72.508  -16.966 1.00 98.75  ? 199 PHE B C   1 
ATOM   1789  O O   . PHE B 1 120 ? -20.415 -73.363  -16.266 1.00 93.21  ? 199 PHE B O   1 
ATOM   1790  C CB  . PHE B 1 120 ? -23.243 -73.220  -17.394 1.00 100.53 ? 199 PHE B CB  1 
ATOM   1791  C CG  . PHE B 1 120 ? -23.785 -72.111  -16.545 1.00 101.85 ? 199 PHE B CG  1 
ATOM   1792  C CD1 . PHE B 1 120 ? -24.671 -71.185  -17.073 1.00 102.98 ? 199 PHE B CD1 1 
ATOM   1793  C CD2 . PHE B 1 120 ? -23.394 -71.979  -15.224 1.00 104.27 ? 199 PHE B CD2 1 
ATOM   1794  C CE1 . PHE B 1 120 ? -25.169 -70.167  -16.306 1.00 103.28 ? 199 PHE B CE1 1 
ATOM   1795  C CE2 . PHE B 1 120 ? -23.882 -70.944  -14.451 1.00 106.83 ? 199 PHE B CE2 1 
ATOM   1796  C CZ  . PHE B 1 120 ? -24.776 -70.036  -14.993 1.00 105.78 ? 199 PHE B CZ  1 
ATOM   1797  N N   . GLN B 1 121 ? -20.706 -71.209  -16.818 1.00 104.11 ? 200 GLN B N   1 
ATOM   1798  C CA  . GLN B 1 121 ? -19.993 -70.681  -15.676 1.00 107.19 ? 200 GLN B CA  1 
ATOM   1799  C C   . GLN B 1 121 ? -20.594 -69.346  -15.279 1.00 103.24 ? 200 GLN B C   1 
ATOM   1800  O O   . GLN B 1 121 ? -21.093 -68.605  -16.118 1.00 100.28 ? 200 GLN B O   1 
ATOM   1801  C CB  . GLN B 1 121 ? -18.519 -70.512  -15.995 1.00 115.06 ? 200 GLN B CB  1 
ATOM   1802  C CG  . GLN B 1 121 ? -17.746 -69.907  -14.833 1.00 123.17 ? 200 GLN B CG  1 
ATOM   1803  C CD  . GLN B 1 121 ? -16.300 -70.329  -14.793 1.00 135.74 ? 200 GLN B CD  1 
ATOM   1804  O OE1 . GLN B 1 121 ? -15.387 -69.490  -14.851 1.00 143.83 ? 200 GLN B OE1 1 
ATOM   1805  N NE2 . GLN B 1 121 ? -16.073 -71.649  -14.656 1.00 146.11 ? 200 GLN B NE2 1 
ATOM   1806  N N   . GLY B 1 122 ? -20.561 -69.054  -13.986 1.00 101.79 ? 201 GLY B N   1 
ATOM   1807  C CA  . GLY B 1 122 ? -20.880 -67.726  -13.500 1.00 103.60 ? 201 GLY B CA  1 
ATOM   1808  C C   . GLY B 1 122 ? -20.212 -67.459  -12.182 1.00 108.11 ? 201 GLY B C   1 
ATOM   1809  O O   . GLY B 1 122 ? -19.891 -68.390  -11.460 1.00 111.16 ? 201 GLY B O   1 
ATOM   1810  N N   . ARG B 1 123 ? -19.975 -66.182  -11.889 1.00 112.39 ? 202 ARG B N   1 
ATOM   1811  C CA  . ARG B 1 123 ? -19.500 -65.747  -10.570 1.00 114.10 ? 202 ARG B CA  1 
ATOM   1812  C C   . ARG B 1 123 ? -19.733 -64.266  -10.371 1.00 112.49 ? 202 ARG B C   1 
ATOM   1813  O O   . ARG B 1 123 ? -20.123 -63.569  -11.298 1.00 109.34 ? 202 ARG B O   1 
ATOM   1814  C CB  . ARG B 1 123 ? -18.024 -66.066  -10.377 1.00 113.98 ? 202 ARG B CB  1 
ATOM   1815  C CG  . ARG B 1 123 ? -17.118 -65.336  -11.329 1.00 113.59 ? 202 ARG B CG  1 
ATOM   1816  C CD  . ARG B 1 123 ? -15.884 -66.172  -11.645 1.00 116.71 ? 202 ARG B CD  1 
ATOM   1817  N NE  . ARG B 1 123 ? -14.815 -65.973  -10.674 1.00 120.22 ? 202 ARG B NE  1 
ATOM   1818  C CZ  . ARG B 1 123 ? -13.609 -66.524  -10.766 1.00 125.77 ? 202 ARG B CZ  1 
ATOM   1819  N NH1 . ARG B 1 123 ? -13.290 -67.339  -11.779 1.00 126.34 ? 202 ARG B NH1 1 
ATOM   1820  N NH2 . ARG B 1 123 ? -12.703 -66.265  -9.826  1.00 132.79 ? 202 ARG B NH2 1 
ATOM   1821  N N   . LEU B 1 124 ? -19.496 -63.801  -9.152  1.00 116.37 ? 203 LEU B N   1 
ATOM   1822  C CA  . LEU B 1 124 ? -19.624 -62.391  -8.811  1.00 119.56 ? 203 LEU B CA  1 
ATOM   1823  C C   . LEU B 1 124 ? -18.394 -61.624  -9.289  1.00 124.40 ? 203 LEU B C   1 
ATOM   1824  O O   . LEU B 1 124 ? -17.255 -62.039  -9.039  1.00 126.83 ? 203 LEU B O   1 
ATOM   1825  C CB  . LEU B 1 124 ? -19.796 -62.210  -7.302  1.00 118.55 ? 203 LEU B CB  1 
ATOM   1826  C CG  . LEU B 1 124 ? -21.023 -62.919  -6.717  1.00 116.14 ? 203 LEU B CG  1 
ATOM   1827  C CD1 . LEU B 1 124 ? -20.884 -63.102  -5.216  1.00 115.48 ? 203 LEU B CD1 1 
ATOM   1828  C CD2 . LEU B 1 124 ? -22.308 -62.169  -7.117  1.00 116.56 ? 203 LEU B CD2 1 
ATOM   1829  N N   . LEU B 1 125 ? -18.633 -60.517  -9.995  1.00 126.22 ? 204 LEU B N   1 
ATOM   1830  C CA  . LEU B 1 125 ? -17.571 -59.635  -10.471 1.00 129.58 ? 204 LEU B CA  1 
ATOM   1831  C C   . LEU B 1 125 ? -17.871 -58.231  -9.974  1.00 134.84 ? 204 LEU B C   1 
ATOM   1832  O O   . LEU B 1 125 ? -18.972 -57.726  -10.188 1.00 136.66 ? 204 LEU B O   1 
ATOM   1833  C CB  . LEU B 1 125 ? -17.531 -59.609  -11.995 1.00 127.17 ? 204 LEU B CB  1 
ATOM   1834  C CG  . LEU B 1 125 ? -17.226 -60.902  -12.747 1.00 126.56 ? 204 LEU B CG  1 
ATOM   1835  C CD1 . LEU B 1 125 ? -17.139 -60.614  -14.238 1.00 124.22 ? 204 LEU B CD1 1 
ATOM   1836  C CD2 . LEU B 1 125 ? -15.944 -61.568  -12.273 1.00 131.95 ? 204 LEU B CD2 1 
ATOM   1837  N N   . HIS B 1 126 ? -16.904 -57.607  -9.307  1.00 144.39 ? 205 HIS B N   1 
ATOM   1838  C CA  . HIS B 1 126 ? -16.996 -56.187  -8.990  1.00 154.48 ? 205 HIS B CA  1 
ATOM   1839  C C   . HIS B 1 126 ? -16.675 -55.451  -10.287 1.00 151.11 ? 205 HIS B C   1 
ATOM   1840  O O   . HIS B 1 126 ? -15.577 -55.585  -10.823 1.00 150.92 ? 205 HIS B O   1 
ATOM   1841  C CB  . HIS B 1 126 ? -16.033 -55.799  -7.852  1.00 169.20 ? 205 HIS B CB  1 
ATOM   1842  C CG  . HIS B 1 126 ? -15.757 -54.325  -7.752  1.00 185.61 ? 205 HIS B CG  1 
ATOM   1843  N ND1 . HIS B 1 126 ? -16.761 -53.374  -7.737  1.00 190.35 ? 205 HIS B ND1 1 
ATOM   1844  C CD2 . HIS B 1 126 ? -14.587 -53.642  -7.662  1.00 192.97 ? 205 HIS B CD2 1 
ATOM   1845  C CE1 . HIS B 1 126 ? -16.216 -52.171  -7.653  1.00 195.18 ? 205 HIS B CE1 1 
ATOM   1846  N NE2 . HIS B 1 126 ? -14.900 -52.307  -7.606  1.00 196.07 ? 205 HIS B NE2 1 
ATOM   1847  N N   . LEU B 1 127 ? -17.653 -54.718  -10.806 1.00 149.09 ? 206 LEU B N   1 
ATOM   1848  C CA  . LEU B 1 127 ? -17.485 -53.951  -12.034 1.00 153.26 ? 206 LEU B CA  1 
ATOM   1849  C C   . LEU B 1 127 ? -17.382 -52.461  -11.727 1.00 159.57 ? 206 LEU B C   1 
ATOM   1850  O O   . LEU B 1 127 ? -18.075 -51.947  -10.843 1.00 158.06 ? 206 LEU B O   1 
ATOM   1851  C CB  . LEU B 1 127 ? -18.660 -54.214  -12.982 1.00 148.70 ? 206 LEU B CB  1 
ATOM   1852  C CG  . LEU B 1 127 ? -18.870 -55.666  -13.404 1.00 145.74 ? 206 LEU B CG  1 
ATOM   1853  C CD1 . LEU B 1 127 ? -20.067 -55.797  -14.332 1.00 145.40 ? 206 LEU B CD1 1 
ATOM   1854  C CD2 . LEU B 1 127 ? -17.607 -56.231  -14.055 1.00 145.11 ? 206 LEU B CD2 1 
ATOM   1855  N N   . SER B 1 128 ? -16.516 -51.781  -12.471 1.00 164.32 ? 207 SER B N   1 
ATOM   1856  C CA  . SER B 1 128 ? -16.338 -50.338  -12.373 1.00 168.02 ? 207 SER B CA  1 
ATOM   1857  C C   . SER B 1 128 ? -17.402 -49.632  -13.199 1.00 170.20 ? 207 SER B C   1 
ATOM   1858  O O   . SER B 1 128 ? -18.066 -50.246  -14.041 1.00 169.78 ? 207 SER B O   1 
ATOM   1859  C CB  . SER B 1 128 ? -14.956 -49.943  -12.890 1.00 169.71 ? 207 SER B CB  1 
ATOM   1860  O OG  . SER B 1 128 ? -13.976 -50.862  -12.445 1.00 171.98 ? 207 SER B OG  1 
ATOM   1861  N N   . ALA B 1 129 ? -17.568 -48.334  -12.950 1.00 169.11 ? 208 ALA B N   1 
ATOM   1862  C CA  . ALA B 1 129 ? -18.457 -47.509  -13.763 1.00 166.05 ? 208 ALA B CA  1 
ATOM   1863  C C   . ALA B 1 129 ? -17.845 -47.374  -15.156 1.00 168.81 ? 208 ALA B C   1 
ATOM   1864  O O   . ALA B 1 129 ? -16.639 -47.171  -15.287 1.00 174.17 ? 208 ALA B O   1 
ATOM   1865  C CB  . ALA B 1 129 ? -18.657 -46.150  -13.118 1.00 165.07 ? 208 ALA B CB  1 
ATOM   1866  N N   . GLY B 1 130 ? -18.670 -47.521  -16.188 1.00 168.78 ? 209 GLY B N   1 
ATOM   1867  C CA  . GLY B 1 130 ? -18.199 -47.466  -17.579 1.00 172.11 ? 209 GLY B CA  1 
ATOM   1868  C C   . GLY B 1 130 ? -17.280 -48.604  -18.002 1.00 171.37 ? 209 GLY B C   1 
ATOM   1869  O O   . GLY B 1 130 ? -16.465 -48.433  -18.913 1.00 171.23 ? 209 GLY B O   1 
ATOM   1870  N N   . GLN B 1 131 ? -17.416 -49.760  -17.350 1.00 170.81 ? 210 GLN B N   1 
ATOM   1871  C CA  . GLN B 1 131 ? -16.618 -50.949  -17.673 1.00 168.10 ? 210 GLN B CA  1 
ATOM   1872  C C   . GLN B 1 131 ? -17.181 -51.611  -18.927 1.00 163.92 ? 210 GLN B C   1 
ATOM   1873  O O   . GLN B 1 131 ? -18.399 -51.802  -19.045 1.00 158.33 ? 210 GLN B O   1 
ATOM   1874  C CB  . GLN B 1 131 ? -16.632 -51.942  -16.505 1.00 164.50 ? 210 GLN B CB  1 
ATOM   1875  C CG  . GLN B 1 131 ? -15.698 -53.134  -16.665 1.00 163.13 ? 210 GLN B CG  1 
ATOM   1876  C CD  . GLN B 1 131 ? -14.322 -52.905  -16.069 1.00 163.76 ? 210 GLN B CD  1 
ATOM   1877  O OE1 . GLN B 1 131 ? -13.364 -52.645  -16.780 1.00 165.42 ? 210 GLN B OE1 1 
ATOM   1878  N NE2 . GLN B 1 131 ? -14.224 -52.997  -14.754 1.00 156.56 ? 210 GLN B NE2 1 
ATOM   1879  N N   . ARG B 1 132 ? -16.283 -51.955  -19.850 1.00 168.14 ? 211 ARG B N   1 
ATOM   1880  C CA  . ARG B 1 132 ? -16.640 -52.587  -21.117 1.00 169.74 ? 211 ARG B CA  1 
ATOM   1881  C C   . ARG B 1 132 ? -16.238 -54.076  -21.095 1.00 167.41 ? 211 ARG B C   1 
ATOM   1882  O O   . ARG B 1 132 ? -15.052 -54.406  -21.203 1.00 176.22 ? 211 ARG B O   1 
ATOM   1883  C CB  . ARG B 1 132 ? -15.966 -51.846  -22.279 1.00 173.38 ? 211 ARG B CB  1 
ATOM   1884  N N   . LEU B 1 133 ? -17.229 -54.955  -20.948 1.00 160.36 ? 212 LEU B N   1 
ATOM   1885  C CA  . LEU B 1 133 ? -17.011 -56.410  -20.956 1.00 154.18 ? 212 LEU B CA  1 
ATOM   1886  C C   . LEU B 1 133 ? -17.076 -56.916  -22.403 1.00 148.26 ? 212 LEU B C   1 
ATOM   1887  O O   . LEU B 1 133 ? -17.973 -56.521  -23.158 1.00 145.10 ? 212 LEU B O   1 
ATOM   1888  C CB  . LEU B 1 133 ? -18.084 -57.139  -20.124 1.00 154.10 ? 212 LEU B CB  1 
ATOM   1889  C CG  . LEU B 1 133 ? -18.270 -56.954  -18.619 1.00 157.16 ? 212 LEU B CG  1 
ATOM   1890  C CD1 . LEU B 1 133 ? -18.741 -55.548  -18.293 1.00 160.51 ? 212 LEU B CD1 1 
ATOM   1891  C CD2 . LEU B 1 133 ? -19.271 -57.980  -18.092 1.00 155.27 ? 212 LEU B CD2 1 
ATOM   1892  N N   . GLY B 1 134 ? -16.125 -57.775  -22.777 1.00 146.87 ? 213 GLY B N   1 
ATOM   1893  C CA  . GLY B 1 134 ? -16.105 -58.418  -24.097 1.00 146.36 ? 213 GLY B CA  1 
ATOM   1894  C C   . GLY B 1 134 ? -15.681 -59.877  -24.002 1.00 143.75 ? 213 GLY B C   1 
ATOM   1895  O O   . GLY B 1 134 ? -14.907 -60.246  -23.112 1.00 150.22 ? 213 GLY B O   1 
ATOM   1896  N N   . VAL B 1 135 ? -16.178 -60.710  -24.915 1.00 138.34 ? 214 VAL B N   1 
ATOM   1897  C CA  . VAL B 1 135 ? -15.995 -62.161  -24.849 1.00 134.08 ? 214 VAL B CA  1 
ATOM   1898  C C   . VAL B 1 135 ? -15.224 -62.657  -26.064 1.00 133.99 ? 214 VAL B C   1 
ATOM   1899  O O   . VAL B 1 135 ? -15.562 -62.303  -27.193 1.00 134.79 ? 214 VAL B O   1 
ATOM   1900  C CB  . VAL B 1 135 ? -17.352 -62.896  -24.814 1.00 133.89 ? 214 VAL B CB  1 
ATOM   1901  C CG1 . VAL B 1 135 ? -17.147 -64.392  -24.610 1.00 134.52 ? 214 VAL B CG1 1 
ATOM   1902  C CG2 . VAL B 1 135 ? -18.250 -62.322  -23.727 1.00 133.85 ? 214 VAL B CG2 1 
ATOM   1903  N N   . HIS B 1 136 ? -14.230 -63.515  -25.834 1.00 133.37 ? 215 HIS B N   1 
ATOM   1904  C CA  . HIS B 1 136 ? -13.361 -64.026  -26.894 1.00 136.56 ? 215 HIS B CA  1 
ATOM   1905  C C   . HIS B 1 136 ? -13.421 -65.546  -27.015 1.00 129.49 ? 215 HIS B C   1 
ATOM   1906  O O   . HIS B 1 136 ? -13.268 -66.264  -26.025 1.00 121.24 ? 215 HIS B O   1 
ATOM   1907  C CB  . HIS B 1 136 ? -11.916 -63.571  -26.652 1.00 145.59 ? 215 HIS B CB  1 
ATOM   1908  C CG  . HIS B 1 136 ? -11.690 -62.128  -26.948 1.00 153.38 ? 215 HIS B CG  1 
ATOM   1909  N ND1 . HIS B 1 136 ? -12.107 -61.124  -26.100 1.00 155.84 ? 215 HIS B ND1 1 
ATOM   1910  C CD2 . HIS B 1 136 ? -11.104 -61.515  -28.003 1.00 161.54 ? 215 HIS B CD2 1 
ATOM   1911  C CE1 . HIS B 1 136 ? -11.783 -59.953  -26.617 1.00 163.05 ? 215 HIS B CE1 1 
ATOM   1912  N NE2 . HIS B 1 136 ? -11.171 -60.163  -27.770 1.00 168.18 ? 215 HIS B NE2 1 
ATOM   1913  N N   . LEU B 1 137 ? -13.623 -66.014  -28.241 1.00 128.28 ? 216 LEU B N   1 
ATOM   1914  C CA  . LEU B 1 137 ? -13.715 -67.429  -28.563 1.00 128.81 ? 216 LEU B CA  1 
ATOM   1915  C C   . LEU B 1 137 ? -12.365 -67.953  -29.023 1.00 132.04 ? 216 LEU B C   1 
ATOM   1916  O O   . LEU B 1 137 ? -11.722 -67.333  -29.853 1.00 137.23 ? 216 LEU B O   1 
ATOM   1917  C CB  . LEU B 1 137 ? -14.726 -67.628  -29.684 1.00 128.55 ? 216 LEU B CB  1 
ATOM   1918  C CG  . LEU B 1 137 ? -15.038 -69.075  -30.048 1.00 127.43 ? 216 LEU B CG  1 
ATOM   1919  C CD1 . LEU B 1 137 ? -15.879 -69.706  -28.960 1.00 128.23 ? 216 LEU B CD1 1 
ATOM   1920  C CD2 . LEU B 1 137 ? -15.751 -69.172  -31.382 1.00 130.23 ? 216 LEU B CD2 1 
ATOM   1921  N N   . HIS B 1 138 ? -11.945 -69.093  -28.494 1.00 134.30 ? 217 HIS B N   1 
ATOM   1922  C CA  . HIS B 1 138 ? -10.756 -69.789  -28.975 1.00 141.09 ? 217 HIS B CA  1 
ATOM   1923  C C   . HIS B 1 138 ? -11.085 -71.257  -29.140 1.00 138.63 ? 217 HIS B C   1 
ATOM   1924  O O   . HIS B 1 138 ? -11.859 -71.799  -28.359 1.00 146.06 ? 217 HIS B O   1 
ATOM   1925  C CB  . HIS B 1 138 ? -9.594  -69.625  -27.995 1.00 150.67 ? 217 HIS B CB  1 
ATOM   1926  C CG  . HIS B 1 138 ? -8.313  -70.233  -28.480 1.00 160.29 ? 217 HIS B CG  1 
ATOM   1927  N ND1 . HIS B 1 138 ? -7.400  -69.534  -29.237 1.00 163.59 ? 217 HIS B ND1 1 
ATOM   1928  C CD2 . HIS B 1 138 ? -7.811  -71.483  -28.346 1.00 164.99 ? 217 HIS B CD2 1 
ATOM   1929  C CE1 . HIS B 1 138 ? -6.384  -70.324  -29.539 1.00 167.74 ? 217 HIS B CE1 1 
ATOM   1930  N NE2 . HIS B 1 138 ? -6.611  -71.514  -29.015 1.00 166.86 ? 217 HIS B NE2 1 
ATOM   1931  N N   . THR B 1 139 ? -10.482 -71.907  -30.130 1.00 138.37 ? 218 THR B N   1 
ATOM   1932  C CA  . THR B 1 139 ? -10.839 -73.288  -30.457 1.00 140.64 ? 218 THR B CA  1 
ATOM   1933  C C   . THR B 1 139 ? -9.653  -74.117  -30.958 1.00 138.68 ? 218 THR B C   1 
ATOM   1934  O O   . THR B 1 139 ? -9.037  -73.766  -31.952 1.00 136.60 ? 218 THR B O   1 
ATOM   1935  C CB  . THR B 1 139 ? -12.034 -73.350  -31.458 1.00 145.04 ? 218 THR B CB  1 
ATOM   1936  O OG1 . THR B 1 139 ? -11.907 -74.494  -32.324 1.00 146.99 ? 218 THR B OG1 1 
ATOM   1937  C CG2 . THR B 1 139 ? -12.138 -72.080  -32.318 1.00 150.79 ? 218 THR B CG2 1 
ATOM   1938  N N   . GLU B 1 140 ? -9.349  -75.205  -30.239 1.00 140.32 ? 219 GLU B N   1 
ATOM   1939  C CA  . GLU B 1 140 ? -8.414  -76.247  -30.684 1.00 147.95 ? 219 GLU B CA  1 
ATOM   1940  C C   . GLU B 1 140 ? -9.062  -77.120  -31.765 1.00 156.08 ? 219 GLU B C   1 
ATOM   1941  O O   . GLU B 1 140 ? -9.745  -78.119  -31.473 1.00 152.30 ? 219 GLU B O   1 
ATOM   1942  C CB  . GLU B 1 140 ? -7.961  -77.123  -29.512 1.00 146.35 ? 219 GLU B CB  1 
ATOM   1943  N N   . ALA B 1 141 ? -8.829  -76.732  -33.020 1.00 172.55 ? 220 ALA B N   1 
ATOM   1944  C CA  . ALA B 1 141 ? -9.479  -77.333  -34.187 1.00 180.33 ? 220 ALA B CA  1 
ATOM   1945  C C   . ALA B 1 141 ? -8.891  -78.691  -34.583 1.00 187.57 ? 220 ALA B C   1 
ATOM   1946  O O   . ALA B 1 141 ? -7.689  -78.798  -34.877 1.00 196.54 ? 220 ALA B O   1 
ATOM   1947  C CB  . ALA B 1 141 ? -9.354  -76.382  -35.378 1.00 176.94 ? 220 ALA B CB  1 
ATOM   1948  N N   . ARG B 1 142 ? -9.731  -79.721  -34.561 1.00 185.48 ? 221 ARG B N   1 
ATOM   1949  C CA  . ARG B 1 142 ? -9.467  -80.937  -35.325 1.00 188.19 ? 221 ARG B CA  1 
ATOM   1950  C C   . ARG B 1 142 ? -10.738 -81.157  -36.139 1.00 190.13 ? 221 ARG B C   1 
ATOM   1951  O O   . ARG B 1 142 ? -11.641 -81.886  -35.725 1.00 188.66 ? 221 ARG B O   1 
ATOM   1952  C CB  . ARG B 1 142 ? -9.154  -82.128  -34.426 1.00 190.47 ? 221 ARG B CB  1 
ATOM   1953  C CG  . ARG B 1 142 ? -8.735  -83.383  -35.183 1.00 193.37 ? 221 ARG B CG  1 
ATOM   1954  C CD  . ARG B 1 142 ? -7.253  -83.668  -35.009 1.00 196.52 ? 221 ARG B CD  1 
ATOM   1955  N NE  . ARG B 1 142 ? -6.941  -84.150  -33.654 1.00 197.03 ? 221 ARG B NE  1 
ATOM   1956  C CZ  . ARG B 1 142 ? -5.738  -84.148  -33.081 1.00 200.17 ? 221 ARG B CZ  1 
ATOM   1957  N NH1 . ARG B 1 142 ? -4.652  -83.725  -33.732 1.00 201.06 ? 221 ARG B NH1 1 
ATOM   1958  N NH2 . ARG B 1 142 ? -5.614  -84.591  -31.827 1.00 198.56 ? 221 ARG B NH2 1 
ATOM   1959  N N   . ALA B 1 143 ? -10.796 -80.480  -37.290 1.00 197.02 ? 222 ALA B N   1 
ATOM   1960  C CA  . ALA B 1 143 ? -12.004 -80.325  -38.120 1.00 192.81 ? 222 ALA B CA  1 
ATOM   1961  C C   . ALA B 1 143 ? -13.029 -79.358  -37.497 1.00 182.44 ? 222 ALA B C   1 
ATOM   1962  O O   . ALA B 1 143 ? -14.204 -79.697  -37.339 1.00 175.38 ? 222 ALA B O   1 
ATOM   1963  C CB  . ALA B 1 143 ? -12.627 -81.674  -38.471 1.00 190.85 ? 222 ALA B CB  1 
ATOM   1964  N N   . ARG B 1 144 ? -12.571 -78.139  -37.191 1.00 175.84 ? 223 ARG B N   1 
ATOM   1965  C CA  . ARG B 1 144 ? -13.424 -77.051  -36.679 1.00 171.14 ? 223 ARG B CA  1 
ATOM   1966  C C   . ARG B 1 144 ? -14.703 -76.807  -37.504 1.00 167.80 ? 223 ARG B C   1 
ATOM   1967  O O   . ARG B 1 144 ? -15.712 -76.345  -36.965 1.00 165.18 ? 223 ARG B O   1 
ATOM   1968  C CB  . ARG B 1 144 ? -12.632 -75.736  -36.600 1.00 168.11 ? 223 ARG B CB  1 
ATOM   1969  N N   . HIS B 1 145 ? -14.651 -77.114  -38.803 1.00 164.01 ? 224 HIS B N   1 
ATOM   1970  C CA  . HIS B 1 145 ? -15.823 -77.038  -39.674 1.00 163.79 ? 224 HIS B CA  1 
ATOM   1971  C C   . HIS B 1 145 ? -16.955 -78.010  -39.315 1.00 155.16 ? 224 HIS B C   1 
ATOM   1972  O O   . HIS B 1 145 ? -18.103 -77.777  -39.702 1.00 158.06 ? 224 HIS B O   1 
ATOM   1973  C CB  . HIS B 1 145 ? -15.410 -77.290  -41.128 1.00 171.57 ? 224 HIS B CB  1 
ATOM   1974  N N   . ALA B 1 146 ? -16.630 -79.095  -38.614 1.00 143.39 ? 225 ALA B N   1 
ATOM   1975  C CA  . ALA B 1 146 ? -17.615 -80.116  -38.248 1.00 136.15 ? 225 ALA B CA  1 
ATOM   1976  C C   . ALA B 1 146 ? -18.497 -79.722  -37.070 1.00 135.39 ? 225 ALA B C   1 
ATOM   1977  O O   . ALA B 1 146 ? -19.481 -80.408  -36.808 1.00 131.93 ? 225 ALA B O   1 
ATOM   1978  C CB  . ALA B 1 146 ? -16.924 -81.442  -37.947 1.00 133.89 ? 225 ALA B CB  1 
ATOM   1979  N N   . TRP B 1 147 ? -18.149 -78.650  -36.359 1.00 135.14 ? 226 TRP B N   1 
ATOM   1980  C CA  . TRP B 1 147 ? -18.939 -78.169  -35.219 1.00 129.74 ? 226 TRP B CA  1 
ATOM   1981  C C   . TRP B 1 147 ? -19.310 -76.704  -35.407 1.00 127.15 ? 226 TRP B C   1 
ATOM   1982  O O   . TRP B 1 147 ? -18.562 -75.940  -36.016 1.00 134.31 ? 226 TRP B O   1 
ATOM   1983  C CB  . TRP B 1 147 ? -18.126 -78.324  -33.927 1.00 127.70 ? 226 TRP B CB  1 
ATOM   1984  C CG  . TRP B 1 147 ? -18.084 -79.727  -33.371 1.00 124.49 ? 226 TRP B CG  1 
ATOM   1985  C CD1 . TRP B 1 147 ? -17.222 -80.732  -33.719 1.00 125.72 ? 226 TRP B CD1 1 
ATOM   1986  C CD2 . TRP B 1 147 ? -18.921 -80.256  -32.349 1.00 118.06 ? 226 TRP B CD2 1 
ATOM   1987  N NE1 . TRP B 1 147 ? -17.488 -81.860  -32.982 1.00 123.70 ? 226 TRP B NE1 1 
ATOM   1988  C CE2 . TRP B 1 147 ? -18.529 -81.591  -32.134 1.00 119.38 ? 226 TRP B CE2 1 
ATOM   1989  C CE3 . TRP B 1 147 ? -19.967 -79.732  -31.597 1.00 120.25 ? 226 TRP B CE3 1 
ATOM   1990  C CZ2 . TRP B 1 147 ? -19.156 -82.414  -31.196 1.00 122.24 ? 226 TRP B CZ2 1 
ATOM   1991  C CZ3 . TRP B 1 147 ? -20.599 -80.555  -30.666 1.00 124.19 ? 226 TRP B CZ3 1 
ATOM   1992  C CH2 . TRP B 1 147 ? -20.189 -81.879  -30.476 1.00 125.16 ? 226 TRP B CH2 1 
ATOM   1993  N N   . GLN B 1 148 ? -20.462 -76.312  -34.884 1.00 121.68 ? 227 GLN B N   1 
ATOM   1994  C CA  . GLN B 1 148 ? -20.857 -74.910  -34.867 1.00 123.82 ? 227 GLN B CA  1 
ATOM   1995  C C   . GLN B 1 148 ? -21.418 -74.546  -33.504 1.00 122.21 ? 227 GLN B C   1 
ATOM   1996  O O   . GLN B 1 148 ? -21.864 -75.417  -32.751 1.00 123.91 ? 227 GLN B O   1 
ATOM   1997  C CB  . GLN B 1 148 ? -21.920 -74.654  -35.935 1.00 130.92 ? 227 GLN B CB  1 
ATOM   1998  C CG  . GLN B 1 148 ? -21.451 -74.959  -37.353 1.00 131.74 ? 227 GLN B CG  1 
ATOM   1999  C CD  . GLN B 1 148 ? -22.305 -74.350  -38.464 1.00 131.12 ? 227 GLN B CD  1 
ATOM   2000  O OE1 . GLN B 1 148 ? -23.285 -73.637  -38.230 1.00 127.91 ? 227 GLN B OE1 1 
ATOM   2001  N NE2 . GLN B 1 148 ? -21.917 -74.638  -39.692 1.00 131.29 ? 227 GLN B NE2 1 
ATOM   2002  N N   . LEU B 1 149 ? -21.402 -73.257  -33.189 1.00 118.59 ? 228 LEU B N   1 
ATOM   2003  C CA  . LEU B 1 149 ? -22.143 -72.758  -32.042 1.00 120.46 ? 228 LEU B CA  1 
ATOM   2004  C C   . LEU B 1 149 ? -23.627 -73.003  -32.283 1.00 123.12 ? 228 LEU B C   1 
ATOM   2005  O O   . LEU B 1 149 ? -24.128 -72.705  -33.371 1.00 125.07 ? 228 LEU B O   1 
ATOM   2006  C CB  . LEU B 1 149 ? -21.913 -71.270  -31.840 1.00 119.49 ? 228 LEU B CB  1 
ATOM   2007  C CG  . LEU B 1 149 ? -20.497 -70.821  -31.510 1.00 118.93 ? 228 LEU B CG  1 
ATOM   2008  C CD1 . LEU B 1 149 ? -20.358 -69.334  -31.757 1.00 124.34 ? 228 LEU B CD1 1 
ATOM   2009  C CD2 . LEU B 1 149 ? -20.111 -71.162  -30.090 1.00 112.88 ? 228 LEU B CD2 1 
ATOM   2010  N N   . THR B 1 150 ? -24.308 -73.569  -31.291 1.00 122.56 ? 229 THR B N   1 
ATOM   2011  C CA  . THR B 1 150 ? -25.745 -73.758  -31.355 1.00 121.96 ? 229 THR B CA  1 
ATOM   2012  C C   . THR B 1 150 ? -26.402 -72.403  -31.225 1.00 127.04 ? 229 THR B C   1 
ATOM   2013  O O   . THR B 1 150 ? -26.069 -71.644  -30.331 1.00 127.04 ? 229 THR B O   1 
ATOM   2014  C CB  . THR B 1 150 ? -26.254 -74.679  -30.233 1.00 119.60 ? 229 THR B CB  1 
ATOM   2015  O OG1 . THR B 1 150 ? -25.610 -75.941  -30.316 1.00 118.35 ? 229 THR B OG1 1 
ATOM   2016  C CG2 . THR B 1 150 ? -27.756 -74.887  -30.346 1.00 122.42 ? 229 THR B CG2 1 
ATOM   2017  N N   . GLN B 1 151 ? -27.348 -72.120  -32.115 1.00 134.66 ? 230 GLN B N   1 
ATOM   2018  C CA  . GLN B 1 151 ? -27.874 -70.769  -32.282 1.00 135.87 ? 230 GLN B CA  1 
ATOM   2019  C C   . GLN B 1 151 ? -28.896 -70.425  -31.230 1.00 134.18 ? 230 GLN B C   1 
ATOM   2020  O O   . GLN B 1 151 ? -29.791 -71.219  -30.951 1.00 134.52 ? 230 GLN B O   1 
ATOM   2021  C CB  . GLN B 1 151 ? -28.508 -70.629  -33.653 1.00 139.99 ? 230 GLN B CB  1 
ATOM   2022  C CG  . GLN B 1 151 ? -27.500 -70.773  -34.787 1.00 140.61 ? 230 GLN B CG  1 
ATOM   2023  C CD  . GLN B 1 151 ? -28.097 -70.337  -36.112 1.00 143.31 ? 230 GLN B CD  1 
ATOM   2024  O OE1 . GLN B 1 151 ? -27.961 -71.032  -37.121 1.00 149.44 ? 230 GLN B OE1 1 
ATOM   2025  N NE2 . GLN B 1 151 ? -28.724 -69.154  -36.123 1.00 141.45 ? 230 GLN B NE2 1 
ATOM   2026  N N   . GLY B 1 152 ? -28.757 -69.236  -30.654 1.00 131.35 ? 231 GLY B N   1 
ATOM   2027  C CA  . GLY B 1 152 ? -29.588 -68.819  -29.514 1.00 131.45 ? 231 GLY B CA  1 
ATOM   2028  C C   . GLY B 1 152 ? -29.155 -69.366  -28.162 1.00 129.12 ? 231 GLY B C   1 
ATOM   2029  O O   . GLY B 1 152 ? -29.786 -69.047  -27.155 1.00 124.51 ? 231 GLY B O   1 
ATOM   2030  N N   . ALA B 1 153 ? -28.100 -70.184  -28.130 1.00 133.13 ? 232 ALA B N   1 
ATOM   2031  C CA  . ALA B 1 153 ? -27.690 -70.926  -26.944 1.00 134.25 ? 232 ALA B CA  1 
ATOM   2032  C C   . ALA B 1 153 ? -26.451 -70.354  -26.262 1.00 132.81 ? 232 ALA B C   1 
ATOM   2033  O O   . ALA B 1 153 ? -26.325 -70.457  -25.036 1.00 133.27 ? 232 ALA B O   1 
ATOM   2034  C CB  . ALA B 1 153 ? -27.425 -72.363  -27.319 1.00 137.06 ? 232 ALA B CB  1 
ATOM   2035  N N   . THR B 1 154 ? -25.518 -69.796  -27.039 1.00 128.81 ? 233 THR B N   1 
ATOM   2036  C CA  . THR B 1 154 ? -24.350 -69.111  -26.497 1.00 126.73 ? 233 THR B CA  1 
ATOM   2037  C C   . THR B 1 154 ? -24.796 -67.741  -25.982 1.00 123.79 ? 233 THR B C   1 
ATOM   2038  O O   . THR B 1 154 ? -25.253 -66.907  -26.752 1.00 122.09 ? 233 THR B O   1 
ATOM   2039  C CB  . THR B 1 154 ? -23.250 -68.939  -27.558 1.00 131.31 ? 233 THR B CB  1 
ATOM   2040  O OG1 . THR B 1 154 ? -22.925 -70.214  -28.114 1.00 141.00 ? 233 THR B OG1 1 
ATOM   2041  C CG2 . THR B 1 154 ? -21.984 -68.283  -26.955 1.00 129.80 ? 233 THR B CG2 1 
ATOM   2042  N N   . VAL B 1 155 ? -24.652 -67.531  -24.674 1.00 120.15 ? 234 VAL B N   1 
ATOM   2043  C CA  . VAL B 1 155 ? -25.285 -66.430  -23.974 1.00 115.60 ? 234 VAL B CA  1 
ATOM   2044  C C   . VAL B 1 155 ? -24.358 -65.842  -22.930 1.00 109.97 ? 234 VAL B C   1 
ATOM   2045  O O   . VAL B 1 155 ? -23.750 -66.573  -22.187 1.00 107.01 ? 234 VAL B O   1 
ATOM   2046  C CB  . VAL B 1 155 ? -26.568 -66.931  -23.273 1.00 116.51 ? 234 VAL B CB  1 
ATOM   2047  C CG1 . VAL B 1 155 ? -27.119 -65.911  -22.287 1.00 117.09 ? 234 VAL B CG1 1 
ATOM   2048  C CG2 . VAL B 1 155 ? -27.622 -67.280  -24.303 1.00 119.96 ? 234 VAL B CG2 1 
ATOM   2049  N N   . LEU B 1 156 ? -24.267 -64.519  -22.889 1.00 108.78 ? 235 LEU B N   1 
ATOM   2050  C CA  . LEU B 1 156 ? -23.637 -63.790  -21.791 1.00 107.60 ? 235 LEU B CA  1 
ATOM   2051  C C   . LEU B 1 156 ? -24.754 -63.080  -21.065 1.00 105.74 ? 235 LEU B C   1 
ATOM   2052  O O   . LEU B 1 156 ? -25.595 -62.444  -21.695 1.00 109.46 ? 235 LEU B O   1 
ATOM   2053  C CB  . LEU B 1 156 ? -22.661 -62.753  -22.322 1.00 111.13 ? 235 LEU B CB  1 
ATOM   2054  C CG  . LEU B 1 156 ? -22.112 -61.729  -21.316 1.00 112.62 ? 235 LEU B CG  1 
ATOM   2055  C CD1 . LEU B 1 156 ? -21.300 -62.404  -20.236 1.00 109.42 ? 235 LEU B CD1 1 
ATOM   2056  C CD2 . LEU B 1 156 ? -21.249 -60.702  -22.021 1.00 116.07 ? 235 LEU B CD2 1 
ATOM   2057  N N   . GLY B 1 157 ? -24.766 -63.179  -19.747 1.00 105.72 ? 236 GLY B N   1 
ATOM   2058  C CA  . GLY B 1 157 ? -25.771 -62.512  -18.939 1.00 107.86 ? 236 GLY B CA  1 
ATOM   2059  C C   . GLY B 1 157 ? -25.218 -62.027  -17.625 1.00 112.55 ? 236 GLY B C   1 
ATOM   2060  O O   . GLY B 1 157 ? -24.226 -62.549  -17.122 1.00 113.43 ? 236 GLY B O   1 
ATOM   2061  N N   . LEU B 1 158 ? -25.860 -61.001  -17.077 1.00 119.37 ? 237 LEU B N   1 
ATOM   2062  C CA  . LEU B 1 158 ? -25.526 -60.498  -15.749 1.00 123.65 ? 237 LEU B CA  1 
ATOM   2063  C C   . LEU B 1 158 ? -26.685 -59.773  -15.102 1.00 122.76 ? 237 LEU B C   1 
ATOM   2064  O O   . LEU B 1 158 ? -27.599 -59.318  -15.783 1.00 126.12 ? 237 LEU B O   1 
ATOM   2065  C CB  . LEU B 1 158 ? -24.300 -59.574  -15.817 1.00 131.50 ? 237 LEU B CB  1 
ATOM   2066  C CG  . LEU B 1 158 ? -24.286 -58.449  -16.864 1.00 134.08 ? 237 LEU B CG  1 
ATOM   2067  C CD1 . LEU B 1 158 ? -25.204 -57.305  -16.486 1.00 138.08 ? 237 LEU B CD1 1 
ATOM   2068  C CD2 . LEU B 1 158 ? -22.853 -57.943  -17.006 1.00 135.79 ? 237 LEU B CD2 1 
ATOM   2069  N N   . PHE B 1 159 ? -26.643 -59.691  -13.780 1.00 123.71 ? 238 PHE B N   1 
ATOM   2070  C CA  . PHE B 1 159 ? -27.580 -58.872  -13.023 1.00 129.83 ? 238 PHE B CA  1 
ATOM   2071  C C   . PHE B 1 159 ? -26.907 -58.338  -11.764 1.00 132.61 ? 238 PHE B C   1 
ATOM   2072  O O   . PHE B 1 159 ? -26.026 -59.000  -11.200 1.00 136.12 ? 238 PHE B O   1 
ATOM   2073  C CB  . PHE B 1 159 ? -28.870 -59.643  -12.696 1.00 132.45 ? 238 PHE B CB  1 
ATOM   2074  C CG  . PHE B 1 159 ? -28.657 -60.969  -12.011 1.00 131.37 ? 238 PHE B CG  1 
ATOM   2075  C CD1 . PHE B 1 159 ? -28.522 -61.047  -10.628 1.00 129.78 ? 238 PHE B CD1 1 
ATOM   2076  C CD2 . PHE B 1 159 ? -28.639 -62.151  -12.747 1.00 132.07 ? 238 PHE B CD2 1 
ATOM   2077  C CE1 . PHE B 1 159 ? -28.354 -62.268  -9.996  1.00 130.25 ? 238 PHE B CE1 1 
ATOM   2078  C CE2 . PHE B 1 159 ? -28.474 -63.378  -12.118 1.00 130.96 ? 238 PHE B CE2 1 
ATOM   2079  C CZ  . PHE B 1 159 ? -28.334 -63.437  -10.740 1.00 130.50 ? 238 PHE B CZ  1 
ATOM   2080  N N   . ARG B 1 160 ? -27.312 -57.137  -11.342 1.00 132.01 ? 239 ARG B N   1 
ATOM   2081  C CA  . ARG B 1 160 ? -26.694 -56.465  -10.200 1.00 134.30 ? 239 ARG B CA  1 
ATOM   2082  C C   . ARG B 1 160 ? -27.141 -57.116  -8.901  1.00 134.69 ? 239 ARG B C   1 
ATOM   2083  O O   . ARG B 1 160 ? -28.291 -57.518  -8.761  1.00 128.36 ? 239 ARG B O   1 
ATOM   2084  C CB  . ARG B 1 160 ? -27.043 -54.968  -10.180 1.00 137.94 ? 239 ARG B CB  1 
ATOM   2085  N N   . VAL B 1 161 ? -26.204 -57.232  -7.967  1.00 142.06 ? 240 VAL B N   1 
ATOM   2086  C CA  . VAL B 1 161 ? -26.482 -57.696  -6.617  1.00 153.21 ? 240 VAL B CA  1 
ATOM   2087  C C   . VAL B 1 161 ? -26.431 -56.528  -5.616  1.00 169.90 ? 240 VAL B C   1 
ATOM   2088  O O   . VAL B 1 161 ? -27.301 -56.445  -4.736  1.00 177.27 ? 240 VAL B O   1 
ATOM   2089  C CB  . VAL B 1 161 ? -25.491 -58.810  -6.235  1.00 152.72 ? 240 VAL B CB  1 
ATOM   2090  C CG1 . VAL B 1 161 ? -25.691 -59.264  -4.795  1.00 154.93 ? 240 VAL B CG1 1 
ATOM   2091  C CG2 . VAL B 1 161 ? -25.624 -59.973  -7.219  1.00 152.17 ? 240 VAL B CG2 1 
ATOM   2092  N N   . THR B 1 162 ? -25.427 -55.651  -5.740  1.00 184.43 ? 241 THR B N   1 
ATOM   2093  C CA  . THR B 1 162 ? -25.302 -54.492  -4.859  1.00 196.34 ? 241 THR B CA  1 
ATOM   2094  C C   . THR B 1 162 ? -26.426 -53.490  -5.134  1.00 210.89 ? 241 THR B C   1 
ATOM   2095  O O   . THR B 1 162 ? -26.667 -53.146  -6.303  1.00 215.43 ? 241 THR B O   1 
ATOM   2096  C CB  . THR B 1 162 ? -23.951 -53.760  -5.037  1.00 196.69 ? 241 THR B CB  1 
ATOM   2097  O OG1 . THR B 1 162 ? -22.874 -54.685  -4.890  1.00 203.72 ? 241 THR B OG1 1 
ATOM   2098  C CG2 . THR B 1 162 ? -23.793 -52.652  -3.997  1.00 198.66 ? 241 THR B CG2 1 
ATOM   2099  N N   . PRO B 1 163 ? -27.124 -53.024  -4.071  1.00 224.19 ? 242 PRO B N   1 
ATOM   2100  C CA  . PRO B 1 163 ? -28.085 -51.926  -4.263  1.00 223.22 ? 242 PRO B CA  1 
ATOM   2101  C C   . PRO B 1 163 ? -27.404 -50.572  -4.460  1.00 220.44 ? 242 PRO B C   1 
ATOM   2102  O O   . PRO B 1 163 ? -28.067 -49.601  -4.821  1.00 219.92 ? 242 PRO B O   1 
ATOM   2103  C CB  . PRO B 1 163 ? -28.904 -51.930  -2.964  1.00 225.57 ? 242 PRO B CB  1 
ATOM   2104  C CG  . PRO B 1 163 ? -28.634 -53.250  -2.320  1.00 226.78 ? 242 PRO B CG  1 
ATOM   2105  C CD  . PRO B 1 163 ? -27.237 -53.603  -2.716  1.00 225.10 ? 242 PRO B CD  1 
ATOM   2106  N N   . GLY C 1 11  ? 25.051  -37.016  -54.388 1.00 161.83 ? 90  GLY C N   1 
ATOM   2107  C CA  . GLY C 1 11  ? 24.123  -35.879  -54.068 1.00 157.34 ? 90  GLY C CA  1 
ATOM   2108  C C   . GLY C 1 11  ? 24.386  -34.624  -54.883 1.00 153.24 ? 90  GLY C C   1 
ATOM   2109  O O   . GLY C 1 11  ? 25.531  -34.345  -55.230 1.00 158.26 ? 90  GLY C O   1 
ATOM   2110  N N   . MET C 1 12  ? 23.317  -33.902  -55.211 1.00 149.84 ? 91  MET C N   1 
ATOM   2111  C CA  . MET C 1 12  ? 23.365  -32.710  -56.071 1.00 146.89 ? 91  MET C CA  1 
ATOM   2112  C C   . MET C 1 12  ? 22.554  -31.587  -55.413 1.00 142.70 ? 91  MET C C   1 
ATOM   2113  O O   . MET C 1 12  ? 21.341  -31.438  -55.653 1.00 142.74 ? 91  MET C O   1 
ATOM   2114  C CB  . MET C 1 12  ? 22.821  -33.024  -57.476 1.00 147.63 ? 91  MET C CB  1 
ATOM   2115  N N   . PHE C 1 13  ? 23.233  -30.814  -54.566 1.00 139.28 ? 92  PHE C N   1 
ATOM   2116  C CA  . PHE C 1 13  ? 22.603  -29.750  -53.805 1.00 135.46 ? 92  PHE C CA  1 
ATOM   2117  C C   . PHE C 1 13  ? 23.596  -28.673  -53.410 1.00 135.31 ? 92  PHE C C   1 
ATOM   2118  O O   . PHE C 1 13  ? 24.794  -28.918  -53.325 1.00 138.40 ? 92  PHE C O   1 
ATOM   2119  C CB  . PHE C 1 13  ? 21.973  -30.319  -52.543 1.00 135.93 ? 92  PHE C CB  1 
ATOM   2120  C CG  . PHE C 1 13  ? 22.957  -30.935  -51.592 1.00 140.76 ? 92  PHE C CG  1 
ATOM   2121  C CD1 . PHE C 1 13  ? 23.186  -32.309  -51.608 1.00 145.53 ? 92  PHE C CD1 1 
ATOM   2122  C CD2 . PHE C 1 13  ? 23.654  -30.147  -50.675 1.00 144.74 ? 92  PHE C CD2 1 
ATOM   2123  C CE1 . PHE C 1 13  ? 24.085  -32.884  -50.725 1.00 151.50 ? 92  PHE C CE1 1 
ATOM   2124  C CE2 . PHE C 1 13  ? 24.557  -30.718  -49.793 1.00 150.07 ? 92  PHE C CE2 1 
ATOM   2125  C CZ  . PHE C 1 13  ? 24.772  -32.090  -49.817 1.00 152.60 ? 92  PHE C CZ  1 
ATOM   2126  N N   . ALA C 1 14  ? 23.072  -27.494  -53.109 1.00 135.84 ? 93  ALA C N   1 
ATOM   2127  C CA  . ALA C 1 14  ? 23.893  -26.364  -52.704 1.00 134.85 ? 93  ALA C CA  1 
ATOM   2128  C C   . ALA C 1 14  ? 23.188  -25.549  -51.635 1.00 132.54 ? 93  ALA C C   1 
ATOM   2129  O O   . ALA C 1 14  ? 21.960  -25.607  -51.507 1.00 136.37 ? 93  ALA C O   1 
ATOM   2130  C CB  . ALA C 1 14  ? 24.211  -25.489  -53.904 1.00 135.68 ? 93  ALA C CB  1 
ATOM   2131  N N   . GLN C 1 15  ? 23.979  -24.807  -50.861 1.00 129.64 ? 94  GLN C N   1 
ATOM   2132  C CA  . GLN C 1 15  ? 23.443  -23.814  -49.942 1.00 127.67 ? 94  GLN C CA  1 
ATOM   2133  C C   . GLN C 1 15  ? 24.499  -22.750  -49.701 1.00 129.22 ? 94  GLN C C   1 
ATOM   2134  O O   . GLN C 1 15  ? 25.569  -23.046  -49.163 1.00 133.29 ? 94  GLN C O   1 
ATOM   2135  C CB  . GLN C 1 15  ? 23.044  -24.455  -48.618 1.00 127.54 ? 94  GLN C CB  1 
ATOM   2136  C CG  . GLN C 1 15  ? 22.504  -23.451  -47.611 1.00 129.89 ? 94  GLN C CG  1 
ATOM   2137  C CD  . GLN C 1 15  ? 21.690  -24.102  -46.510 1.00 131.40 ? 94  GLN C CD  1 
ATOM   2138  O OE1 . GLN C 1 15  ? 20.608  -24.632  -46.766 1.00 134.10 ? 94  GLN C OE1 1 
ATOM   2139  N NE2 . GLN C 1 15  ? 22.198  -24.064  -45.284 1.00 131.96 ? 94  GLN C NE2 1 
ATOM   2140  N N   . LEU C 1 16  ? 24.197  -21.515  -50.099 1.00 129.39 ? 95  LEU C N   1 
ATOM   2141  C CA  . LEU C 1 16  ? 25.123  -20.397  -49.928 1.00 130.75 ? 95  LEU C CA  1 
ATOM   2142  C C   . LEU C 1 16  ? 24.651  -19.464  -48.827 1.00 127.27 ? 95  LEU C C   1 
ATOM   2143  O O   . LEU C 1 16  ? 23.467  -19.420  -48.503 1.00 125.02 ? 95  LEU C O   1 
ATOM   2144  C CB  . LEU C 1 16  ? 25.251  -19.631  -51.239 1.00 132.89 ? 95  LEU C CB  1 
ATOM   2145  C CG  . LEU C 1 16  ? 25.578  -20.462  -52.481 1.00 136.47 ? 95  LEU C CG  1 
ATOM   2146  C CD1 . LEU C 1 16  ? 25.787  -19.525  -53.661 1.00 138.46 ? 95  LEU C CD1 1 
ATOM   2147  C CD2 . LEU C 1 16  ? 26.796  -21.352  -52.250 1.00 136.45 ? 95  LEU C CD2 1 
ATOM   2148  N N   . VAL C 1 17  ? 25.593  -18.715  -48.267 1.00 125.18 ? 96  VAL C N   1 
ATOM   2149  C CA  . VAL C 1 17  ? 25.319  -17.787  -47.174 1.00 122.54 ? 96  VAL C CA  1 
ATOM   2150  C C   . VAL C 1 17  ? 25.749  -16.402  -47.605 1.00 122.08 ? 96  VAL C C   1 
ATOM   2151  O O   . VAL C 1 17  ? 26.912  -16.186  -47.902 1.00 129.72 ? 96  VAL C O   1 
ATOM   2152  C CB  . VAL C 1 17  ? 26.109  -18.193  -45.933 1.00 125.36 ? 96  VAL C CB  1 
ATOM   2153  C CG1 . VAL C 1 17  ? 25.979  -17.156  -44.835 1.00 129.88 ? 96  VAL C CG1 1 
ATOM   2154  C CG2 . VAL C 1 17  ? 25.642  -19.563  -45.459 1.00 127.79 ? 96  VAL C CG2 1 
ATOM   2155  N N   . ALA C 1 18  ? 24.815  -15.463  -47.633 1.00 119.61 ? 97  ALA C N   1 
ATOM   2156  C CA  . ALA C 1 18  ? 25.115  -14.120  -48.121 1.00 120.13 ? 97  ALA C CA  1 
ATOM   2157  C C   . ALA C 1 18  ? 26.156  -13.442  -47.250 1.00 122.30 ? 97  ALA C C   1 
ATOM   2158  O O   . ALA C 1 18  ? 26.108  -13.542  -46.021 1.00 120.50 ? 97  ALA C O   1 
ATOM   2159  C CB  . ALA C 1 18  ? 23.856  -13.269  -48.178 1.00 119.80 ? 97  ALA C CB  1 
ATOM   2160  N N   . GLN C 1 19  ? 27.092  -12.759  -47.905 1.00 127.56 ? 98  GLN C N   1 
ATOM   2161  C CA  . GLN C 1 19  ? 28.143  -12.006  -47.229 1.00 133.14 ? 98  GLN C CA  1 
ATOM   2162  C C   . GLN C 1 19  ? 27.648  -10.644  -46.766 1.00 132.81 ? 98  GLN C C   1 
ATOM   2163  O O   . GLN C 1 19  ? 28.179  -10.085  -45.809 1.00 140.70 ? 98  GLN C O   1 
ATOM   2164  C CB  . GLN C 1 19  ? 29.323  -11.768  -48.169 1.00 139.16 ? 98  GLN C CB  1 
ATOM   2165  C CG  . GLN C 1 19  ? 29.950  -13.015  -48.768 1.00 144.47 ? 98  GLN C CG  1 
ATOM   2166  C CD  . GLN C 1 19  ? 31.204  -12.682  -49.554 1.00 146.79 ? 98  GLN C CD  1 
ATOM   2167  O OE1 . GLN C 1 19  ? 31.248  -12.851  -50.767 1.00 150.14 ? 98  GLN C OE1 1 
ATOM   2168  N NE2 . GLN C 1 19  ? 32.219  -12.166  -48.864 1.00 148.62 ? 98  GLN C NE2 1 
ATOM   2169  N N   . ASN C 1 20  ? 26.611  -10.128  -47.426 1.00 123.98 ? 99  ASN C N   1 
ATOM   2170  C CA  . ASN C 1 20  ? 26.244  -8.722   -47.312 1.00 118.74 ? 99  ASN C CA  1 
ATOM   2171  C C   . ASN C 1 20  ? 25.622  -8.499   -45.948 1.00 118.53 ? 99  ASN C C   1 
ATOM   2172  O O   . ASN C 1 20  ? 24.985  -9.393   -45.395 1.00 112.45 ? 99  ASN C O   1 
ATOM   2173  C CB  . ASN C 1 20  ? 25.250  -8.309   -48.401 1.00 117.42 ? 99  ASN C CB  1 
ATOM   2174  C CG  . ASN C 1 20  ? 25.656  -8.782   -49.777 1.00 120.04 ? 99  ASN C CG  1 
ATOM   2175  O OD1 . ASN C 1 20  ? 26.161  -8.029   -50.595 1.00 124.76 ? 99  ASN C OD1 1 
ATOM   2176  N ND2 . ASN C 1 20  ? 25.432  -10.052  -50.038 1.00 125.39 ? 99  ASN C ND2 1 
ATOM   2177  N N   . VAL C 1 21  ? 25.835  -7.314   -45.391 1.00 123.76 ? 100 VAL C N   1 
ATOM   2178  C CA  . VAL C 1 21  ? 25.177  -6.910   -44.145 1.00 125.85 ? 100 VAL C CA  1 
ATOM   2179  C C   . VAL C 1 21  ? 24.393  -5.607   -44.293 1.00 120.05 ? 100 VAL C C   1 
ATOM   2180  O O   . VAL C 1 21  ? 23.319  -5.471   -43.712 1.00 123.05 ? 100 VAL C O   1 
ATOM   2181  C CB  . VAL C 1 21  ? 26.152  -6.853   -42.937 1.00 131.71 ? 100 VAL C CB  1 
ATOM   2182  C CG1 . VAL C 1 21  ? 27.095  -8.048   -42.942 1.00 131.14 ? 100 VAL C CG1 1 
ATOM   2183  C CG2 . VAL C 1 21  ? 26.968  -5.583   -42.923 1.00 135.76 ? 100 VAL C CG2 1 
ATOM   2184  N N   . LEU C 1 22  ? 24.925  -4.648   -45.044 1.00 118.18 ? 101 LEU C N   1 
ATOM   2185  C CA  . LEU C 1 22  ? 24.246  -3.386   -45.267 1.00 123.47 ? 101 LEU C CA  1 
ATOM   2186  C C   . LEU C 1 22  ? 23.197  -3.513   -46.360 1.00 127.58 ? 101 LEU C C   1 
ATOM   2187  O O   . LEU C 1 22  ? 23.426  -4.174   -47.380 1.00 130.78 ? 101 LEU C O   1 
ATOM   2188  C CB  . LEU C 1 22  ? 25.248  -2.297   -45.629 1.00 121.46 ? 101 LEU C CB  1 
ATOM   2189  C CG  . LEU C 1 22  ? 26.355  -2.065   -44.608 1.00 122.28 ? 101 LEU C CG  1 
ATOM   2190  C CD1 . LEU C 1 22  ? 27.172  -0.874   -45.047 1.00 126.48 ? 101 LEU C CD1 1 
ATOM   2191  C CD2 . LEU C 1 22  ? 25.795  -1.908   -43.182 1.00 123.48 ? 101 LEU C CD2 1 
ATOM   2192  N N   . LEU C 1 23  ? 22.045  -2.879   -46.138 1.00 128.47 ? 102 LEU C N   1 
ATOM   2193  C CA  . LEU C 1 23  ? 20.962  -2.908   -47.112 1.00 127.96 ? 102 LEU C CA  1 
ATOM   2194  C C   . LEU C 1 23  ? 21.309  -1.944   -48.239 1.00 129.06 ? 102 LEU C C   1 
ATOM   2195  O O   . LEU C 1 23  ? 21.154  -0.737   -48.099 1.00 132.23 ? 102 LEU C O   1 
ATOM   2196  C CB  . LEU C 1 23  ? 19.613  -2.563   -46.457 1.00 128.98 ? 102 LEU C CB  1 
ATOM   2197  C CG  . LEU C 1 23  ? 19.152  -3.536   -45.371 1.00 131.29 ? 102 LEU C CG  1 
ATOM   2198  C CD1 . LEU C 1 23  ? 17.875  -3.047   -44.710 1.00 130.09 ? 102 LEU C CD1 1 
ATOM   2199  C CD2 . LEU C 1 23  ? 18.948  -4.928   -45.928 1.00 131.75 ? 102 LEU C CD2 1 
ATOM   2200  N N   . ILE C 1 24  ? 21.818  -2.488   -49.341 1.00 131.26 ? 103 ILE C N   1 
ATOM   2201  C CA  . ILE C 1 24  ? 22.218  -1.695   -50.497 1.00 134.81 ? 103 ILE C CA  1 
ATOM   2202  C C   . ILE C 1 24  ? 21.648  -2.346   -51.753 1.00 133.07 ? 103 ILE C C   1 
ATOM   2203  O O   . ILE C 1 24  ? 21.981  -3.500   -52.050 1.00 129.31 ? 103 ILE C O   1 
ATOM   2204  C CB  . ILE C 1 24  ? 23.754  -1.593   -50.580 1.00 136.46 ? 103 ILE C CB  1 
ATOM   2205  C CG1 . ILE C 1 24  ? 24.274  -0.726   -49.427 1.00 137.27 ? 103 ILE C CG1 1 
ATOM   2206  C CG2 . ILE C 1 24  ? 24.195  -1.016   -51.927 1.00 137.61 ? 103 ILE C CG2 1 
ATOM   2207  C CD1 . ILE C 1 24  ? 25.740  -0.898   -49.131 1.00 140.45 ? 103 ILE C CD1 1 
ATOM   2208  N N   . ASP C 1 25  ? 20.805  -1.603   -52.483 1.00 134.96 ? 104 ASP C N   1 
ATOM   2209  C CA  . ASP C 1 25  ? 20.211  -2.081   -53.735 1.00 136.70 ? 104 ASP C CA  1 
ATOM   2210  C C   . ASP C 1 25  ? 21.308  -2.631   -54.641 1.00 137.70 ? 104 ASP C C   1 
ATOM   2211  O O   . ASP C 1 25  ? 22.305  -1.945   -54.886 1.00 145.41 ? 104 ASP C O   1 
ATOM   2212  C CB  . ASP C 1 25  ? 19.482  -0.949   -54.484 1.00 142.67 ? 104 ASP C CB  1 
ATOM   2213  C CG  . ASP C 1 25  ? 18.157  -0.538   -53.836 1.00 148.10 ? 104 ASP C CG  1 
ATOM   2214  O OD1 . ASP C 1 25  ? 17.596  0.506    -54.234 1.00 153.74 ? 104 ASP C OD1 1 
ATOM   2215  O OD2 . ASP C 1 25  ? 17.660  -1.240   -52.933 1.00 157.50 ? 104 ASP C OD2 1 
ATOM   2216  N N   . GLY C 1 26  ? 21.127  -3.863   -55.117 1.00 136.17 ? 105 GLY C N   1 
ATOM   2217  C CA  . GLY C 1 26  ? 22.097  -4.528   -55.992 1.00 138.19 ? 105 GLY C CA  1 
ATOM   2218  C C   . GLY C 1 26  ? 22.366  -5.947   -55.533 1.00 133.32 ? 105 GLY C C   1 
ATOM   2219  O O   . GLY C 1 26  ? 21.968  -6.319   -54.438 1.00 129.10 ? 105 GLY C O   1 
ATOM   2220  N N   . PRO C 1 27  ? 23.086  -6.731   -56.355 1.00 130.88 ? 106 PRO C N   1 
ATOM   2221  C CA  . PRO C 1 27  ? 23.184  -8.176   -56.166 1.00 130.08 ? 106 PRO C CA  1 
ATOM   2222  C C   . PRO C 1 27  ? 24.018  -8.619   -54.959 1.00 128.20 ? 106 PRO C C   1 
ATOM   2223  O O   . PRO C 1 27  ? 25.026  -7.992   -54.618 1.00 129.91 ? 106 PRO C O   1 
ATOM   2224  C CB  . PRO C 1 27  ? 23.819  -8.646   -57.470 1.00 132.04 ? 106 PRO C CB  1 
ATOM   2225  C CG  . PRO C 1 27  ? 24.691  -7.501   -57.874 1.00 130.70 ? 106 PRO C CG  1 
ATOM   2226  C CD  . PRO C 1 27  ? 24.004  -6.255   -57.404 1.00 130.74 ? 106 PRO C CD  1 
ATOM   2227  N N   . LEU C 1 28  ? 23.576  -9.704   -54.326 1.00 125.44 ? 107 LEU C N   1 
ATOM   2228  C CA  . LEU C 1 28  ? 24.207  -10.221  -53.120 1.00 125.30 ? 107 LEU C CA  1 
ATOM   2229  C C   . LEU C 1 28  ? 25.413  -11.062  -53.485 1.00 123.19 ? 107 LEU C C   1 
ATOM   2230  O O   . LEU C 1 28  ? 25.359  -11.869  -54.417 1.00 123.82 ? 107 LEU C O   1 
ATOM   2231  C CB  . LEU C 1 28  ? 23.226  -11.071  -52.300 1.00 123.44 ? 107 LEU C CB  1 
ATOM   2232  C CG  . LEU C 1 28  ? 21.945  -10.437  -51.784 1.00 121.45 ? 107 LEU C CG  1 
ATOM   2233  C CD1 . LEU C 1 28  ? 21.143  -11.529  -51.099 1.00 122.06 ? 107 LEU C CD1 1 
ATOM   2234  C CD2 . LEU C 1 28  ? 22.207  -9.273   -50.839 1.00 118.09 ? 107 LEU C CD2 1 
ATOM   2235  N N   . SER C 1 29  ? 26.497  -10.836  -52.751 1.00 124.59 ? 108 SER C N   1 
ATOM   2236  C CA  . SER C 1 29  ? 27.677  -11.690  -52.739 1.00 129.96 ? 108 SER C CA  1 
ATOM   2237  C C   . SER C 1 29  ? 27.514  -12.832  -51.738 1.00 127.97 ? 108 SER C C   1 
ATOM   2238  O O   . SER C 1 29  ? 26.897  -12.650  -50.696 1.00 132.06 ? 108 SER C O   1 
ATOM   2239  C CB  . SER C 1 29  ? 28.890  -10.843  -52.368 1.00 133.81 ? 108 SER C CB  1 
ATOM   2240  O OG  . SER C 1 29  ? 28.722  -9.522   -52.864 1.00 138.21 ? 108 SER C OG  1 
ATOM   2241  N N   . TRP C 1 30  ? 28.118  -13.983  -52.046 1.00 127.18 ? 109 TRP C N   1 
ATOM   2242  C CA  . TRP C 1 30  ? 27.889  -15.244  -51.320 1.00 128.12 ? 109 TRP C CA  1 
ATOM   2243  C C   . TRP C 1 30  ? 29.169  -15.945  -50.866 1.00 130.88 ? 109 TRP C C   1 
ATOM   2244  O O   . TRP C 1 30  ? 30.129  -16.040  -51.626 1.00 135.45 ? 109 TRP C O   1 
ATOM   2245  C CB  . TRP C 1 30  ? 27.131  -16.216  -52.223 1.00 126.87 ? 109 TRP C CB  1 
ATOM   2246  C CG  . TRP C 1 30  ? 25.832  -15.681  -52.639 1.00 122.96 ? 109 TRP C CG  1 
ATOM   2247  C CD1 . TRP C 1 30  ? 25.556  -14.986  -53.773 1.00 121.26 ? 109 TRP C CD1 1 
ATOM   2248  C CD2 . TRP C 1 30  ? 24.620  -15.754  -51.902 1.00 121.66 ? 109 TRP C CD2 1 
ATOM   2249  N NE1 . TRP C 1 30  ? 24.234  -14.633  -53.796 1.00 119.53 ? 109 TRP C NE1 1 
ATOM   2250  C CE2 . TRP C 1 30  ? 23.634  -15.094  -52.655 1.00 119.75 ? 109 TRP C CE2 1 
ATOM   2251  C CE3 . TRP C 1 30  ? 24.269  -16.320  -50.674 1.00 121.06 ? 109 TRP C CE3 1 
ATOM   2252  C CZ2 . TRP C 1 30  ? 22.314  -14.976  -52.215 1.00 118.87 ? 109 TRP C CZ2 1 
ATOM   2253  C CZ3 . TRP C 1 30  ? 22.958  -16.206  -50.237 1.00 119.20 ? 109 TRP C CZ3 1 
ATOM   2254  C CH2 . TRP C 1 30  ? 21.994  -15.538  -51.011 1.00 119.60 ? 109 TRP C CH2 1 
ATOM   2255  N N   . TYR C 1 31  ? 29.165  -16.461  -49.635 1.00 130.90 ? 110 TYR C N   1 
ATOM   2256  C CA  . TYR C 1 31  ? 30.196  -17.394  -49.185 1.00 137.34 ? 110 TYR C CA  1 
ATOM   2257  C C   . TYR C 1 31  ? 29.957  -18.745  -49.867 1.00 145.04 ? 110 TYR C C   1 
ATOM   2258  O O   . TYR C 1 31  ? 28.837  -19.269  -49.831 1.00 141.16 ? 110 TYR C O   1 
ATOM   2259  C CB  . TYR C 1 31  ? 30.153  -17.579  -47.673 1.00 139.07 ? 110 TYR C CB  1 
ATOM   2260  N N   . SER C 1 32  ? 31.000  -19.285  -50.499 1.00 156.77 ? 111 SER C N   1 
ATOM   2261  C CA  . SER C 1 32  ? 30.922  -20.560  -51.233 1.00 160.74 ? 111 SER C CA  1 
ATOM   2262  C C   . SER C 1 32  ? 31.850  -21.676  -50.718 1.00 162.82 ? 111 SER C C   1 
ATOM   2263  O O   . SER C 1 32  ? 31.681  -22.834  -51.108 1.00 164.15 ? 111 SER C O   1 
ATOM   2264  C CB  . SER C 1 32  ? 31.220  -20.308  -52.711 1.00 164.76 ? 111 SER C CB  1 
ATOM   2265  O OG  . SER C 1 32  ? 32.445  -19.598  -52.864 1.00 174.23 ? 111 SER C OG  1 
ATOM   2266  N N   . ASP C 1 33  ? 32.806  -21.345  -49.843 1.00 164.32 ? 112 ASP C N   1 
ATOM   2267  C CA  . ASP C 1 33  ? 33.778  -22.321  -49.332 1.00 170.83 ? 112 ASP C CA  1 
ATOM   2268  C C   . ASP C 1 33  ? 33.102  -23.204  -48.271 1.00 169.73 ? 112 ASP C C   1 
ATOM   2269  O O   . ASP C 1 33  ? 32.729  -22.694  -47.211 1.00 163.02 ? 112 ASP C O   1 
ATOM   2270  C CB  . ASP C 1 33  ? 35.001  -21.582  -48.762 1.00 176.85 ? 112 ASP C CB  1 
ATOM   2271  C CG  . ASP C 1 33  ? 36.056  -22.507  -48.143 1.00 179.50 ? 112 ASP C CG  1 
ATOM   2272  O OD1 . ASP C 1 33  ? 35.788  -23.693  -47.835 1.00 178.61 ? 112 ASP C OD1 1 
ATOM   2273  O OD2 . ASP C 1 33  ? 37.182  -22.004  -47.946 1.00 179.15 ? 112 ASP C OD2 1 
ATOM   2274  N N   . PRO C 1 34  ? 32.974  -24.530  -48.535 1.00 173.88 ? 113 PRO C N   1 
ATOM   2275  C CA  . PRO C 1 34  ? 32.238  -25.423  -47.619 1.00 175.70 ? 113 PRO C CA  1 
ATOM   2276  C C   . PRO C 1 34  ? 32.927  -25.731  -46.275 1.00 173.70 ? 113 PRO C C   1 
ATOM   2277  O O   . PRO C 1 34  ? 32.331  -26.406  -45.432 1.00 170.48 ? 113 PRO C O   1 
ATOM   2278  C CB  . PRO C 1 34  ? 32.048  -26.700  -48.449 1.00 177.65 ? 113 PRO C CB  1 
ATOM   2279  C CG  . PRO C 1 34  ? 33.191  -26.704  -49.404 1.00 178.03 ? 113 PRO C CG  1 
ATOM   2280  C CD  . PRO C 1 34  ? 33.541  -25.271  -49.679 1.00 175.70 ? 113 PRO C CD  1 
ATOM   2281  N N   . GLY C 1 35  ? 34.151  -25.243  -46.076 1.00 169.70 ? 114 GLY C N   1 
ATOM   2282  C CA  . GLY C 1 35  ? 34.742  -25.163  -44.742 1.00 165.76 ? 114 GLY C CA  1 
ATOM   2283  C C   . GLY C 1 35  ? 34.074  -24.144  -43.826 1.00 160.23 ? 114 GLY C C   1 
ATOM   2284  O O   . GLY C 1 35  ? 34.332  -24.141  -42.626 1.00 156.80 ? 114 GLY C O   1 
ATOM   2285  N N   . LEU C 1 36  ? 33.260  -23.245  -44.400 1.00 155.26 ? 115 LEU C N   1 
ATOM   2286  C CA  . LEU C 1 36  ? 32.401  -22.333  -43.640 1.00 151.01 ? 115 LEU C CA  1 
ATOM   2287  C C   . LEU C 1 36  ? 31.092  -22.982  -43.188 1.00 147.88 ? 115 LEU C C   1 
ATOM   2288  O O   . LEU C 1 36  ? 30.453  -23.720  -43.947 1.00 144.45 ? 115 LEU C O   1 
ATOM   2289  C CB  . LEU C 1 36  ? 32.075  -21.085  -44.458 1.00 149.35 ? 115 LEU C CB  1 
ATOM   2290  C CG  . LEU C 1 36  ? 33.147  -20.045  -44.723 1.00 150.71 ? 115 LEU C CG  1 
ATOM   2291  C CD1 . LEU C 1 36  ? 34.371  -20.178  -43.826 1.00 154.66 ? 115 LEU C CD1 1 
ATOM   2292  C CD2 . LEU C 1 36  ? 33.557  -19.896  -46.177 1.00 152.27 ? 115 LEU C CD2 1 
ATOM   2293  N N   . ALA C 1 37  ? 30.690  -22.663  -41.956 1.00 148.34 ? 116 ALA C N   1 
ATOM   2294  C CA  . ALA C 1 37  ? 29.479  -23.210  -41.351 1.00 149.86 ? 116 ALA C CA  1 
ATOM   2295  C C   . ALA C 1 37  ? 28.228  -22.699  -42.061 1.00 146.28 ? 116 ALA C C   1 
ATOM   2296  O O   . ALA C 1 37  ? 28.036  -21.487  -42.194 1.00 149.27 ? 116 ALA C O   1 
ATOM   2297  C CB  . ALA C 1 37  ? 29.422  -22.848  -39.875 1.00 150.98 ? 116 ALA C CB  1 
ATOM   2298  N N   . GLY C 1 38  ? 27.391  -23.630  -42.519 1.00 142.47 ? 117 GLY C N   1 
ATOM   2299  C CA  . GLY C 1 38  ? 26.186  -23.302  -43.266 1.00 140.05 ? 117 GLY C CA  1 
ATOM   2300  C C   . GLY C 1 38  ? 26.354  -23.526  -44.748 1.00 139.48 ? 117 GLY C C   1 
ATOM   2301  O O   . GLY C 1 38  ? 25.432  -23.997  -45.413 1.00 141.16 ? 117 GLY C O   1 
ATOM   2302  N N   . VAL C 1 39  ? 27.537  -23.198  -45.269 1.00 141.45 ? 118 VAL C N   1 
ATOM   2303  C CA  . VAL C 1 39  ? 27.814  -23.314  -46.697 1.00 143.25 ? 118 VAL C CA  1 
ATOM   2304  C C   . VAL C 1 39  ? 28.045  -24.771  -47.087 1.00 146.56 ? 118 VAL C C   1 
ATOM   2305  O O   . VAL C 1 39  ? 28.708  -25.518  -46.362 1.00 147.29 ? 118 VAL C O   1 
ATOM   2306  C CB  . VAL C 1 39  ? 29.041  -22.483  -47.113 1.00 143.05 ? 118 VAL C CB  1 
ATOM   2307  C CG1 . VAL C 1 39  ? 29.337  -22.656  -48.603 1.00 145.24 ? 118 VAL C CG1 1 
ATOM   2308  C CG2 . VAL C 1 39  ? 28.811  -21.009  -46.784 1.00 140.22 ? 118 VAL C CG2 1 
ATOM   2309  N N   . SER C 1 40  ? 27.492  -25.157  -48.236 1.00 150.52 ? 119 SER C N   1 
ATOM   2310  C CA  . SER C 1 40  ? 27.720  -26.483  -48.798 1.00 158.78 ? 119 SER C CA  1 
ATOM   2311  C C   . SER C 1 40  ? 27.437  -26.479  -50.299 1.00 159.55 ? 119 SER C C   1 
ATOM   2312  O O   . SER C 1 40  ? 26.347  -26.092  -50.730 1.00 155.77 ? 119 SER C O   1 
ATOM   2313  C CB  . SER C 1 40  ? 26.868  -27.548  -48.081 1.00 163.41 ? 119 SER C CB  1 
ATOM   2314  O OG  . SER C 1 40  ? 25.643  -27.015  -47.617 1.00 169.19 ? 119 SER C OG  1 
ATOM   2315  N N   . LEU C 1 41  ? 28.457  -26.862  -51.077 1.00 163.27 ? 120 LEU C N   1 
ATOM   2316  C CA  . LEU C 1 41  ? 28.333  -27.136  -52.510 1.00 161.39 ? 120 LEU C CA  1 
ATOM   2317  C C   . LEU C 1 41  ? 28.660  -28.609  -52.722 1.00 167.40 ? 120 LEU C C   1 
ATOM   2318  O O   . LEU C 1 41  ? 29.494  -29.169  -52.007 1.00 172.34 ? 120 LEU C O   1 
ATOM   2319  C CB  . LEU C 1 41  ? 29.317  -26.285  -53.307 1.00 156.90 ? 120 LEU C CB  1 
ATOM   2320  C CG  . LEU C 1 41  ? 28.969  -24.822  -53.544 1.00 155.02 ? 120 LEU C CG  1 
ATOM   2321  C CD1 . LEU C 1 41  ? 30.145  -24.082  -54.129 1.00 157.46 ? 120 LEU C CD1 1 
ATOM   2322  C CD2 . LEU C 1 41  ? 27.777  -24.709  -54.473 1.00 154.27 ? 120 LEU C CD2 1 
ATOM   2323  N N   . THR C 1 42  ? 27.987  -29.227  -53.693 1.00 170.93 ? 121 THR C N   1 
ATOM   2324  C CA  . THR C 1 42  ? 28.265  -30.610  -54.119 1.00 178.13 ? 121 THR C CA  1 
ATOM   2325  C C   . THR C 1 42  ? 28.093  -30.705  -55.631 1.00 184.50 ? 121 THR C C   1 
ATOM   2326  O O   . THR C 1 42  ? 27.781  -29.708  -56.274 1.00 193.70 ? 121 THR C O   1 
ATOM   2327  C CB  . THR C 1 42  ? 27.331  -31.649  -53.451 1.00 176.64 ? 121 THR C CB  1 
ATOM   2328  O OG1 . THR C 1 42  ? 25.976  -31.472  -53.911 1.00 181.23 ? 121 THR C OG1 1 
ATOM   2329  C CG2 . THR C 1 42  ? 27.401  -31.562  -51.926 1.00 176.46 ? 121 THR C CG2 1 
ATOM   2330  N N   . GLY C 1 43  ? 28.333  -31.895  -56.184 1.00 187.66 ? 122 GLY C N   1 
ATOM   2331  C CA  . GLY C 1 43  ? 28.047  -32.202  -57.585 1.00 186.12 ? 122 GLY C CA  1 
ATOM   2332  C C   . GLY C 1 43  ? 28.588  -31.165  -58.560 1.00 189.35 ? 122 GLY C C   1 
ATOM   2333  O O   . GLY C 1 43  ? 29.630  -30.532  -58.321 1.00 190.32 ? 122 GLY C O   1 
ATOM   2334  N N   . GLY C 1 44  ? 27.857  -30.972  -59.649 1.00 188.20 ? 123 GLY C N   1 
ATOM   2335  C CA  . GLY C 1 44  ? 28.163  -29.924  -60.616 1.00 186.62 ? 123 GLY C CA  1 
ATOM   2336  C C   . GLY C 1 44  ? 27.460  -28.628  -60.257 1.00 181.96 ? 123 GLY C C   1 
ATOM   2337  O O   . GLY C 1 44  ? 26.555  -28.176  -60.960 1.00 183.56 ? 123 GLY C O   1 
ATOM   2338  N N   . LEU C 1 45  ? 27.881  -28.049  -59.136 1.00 175.50 ? 124 LEU C N   1 
ATOM   2339  C CA  . LEU C 1 45  ? 27.382  -26.754  -58.663 1.00 166.05 ? 124 LEU C CA  1 
ATOM   2340  C C   . LEU C 1 45  ? 28.578  -25.932  -58.204 1.00 159.56 ? 124 LEU C C   1 
ATOM   2341  O O   . LEU C 1 45  ? 29.459  -26.453  -57.512 1.00 158.88 ? 124 LEU C O   1 
ATOM   2342  C CB  . LEU C 1 45  ? 26.377  -26.926  -57.529 1.00 161.38 ? 124 LEU C CB  1 
ATOM   2343  C CG  . LEU C 1 45  ? 24.985  -27.431  -57.934 1.00 160.21 ? 124 LEU C CG  1 
ATOM   2344  C CD1 . LEU C 1 45  ? 24.272  -28.143  -56.796 1.00 158.51 ? 124 LEU C CD1 1 
ATOM   2345  C CD2 . LEU C 1 45  ? 24.123  -26.293  -58.427 1.00 158.55 ? 124 LEU C CD2 1 
ATOM   2346  N N   . SER C 1 46  ? 28.602  -24.662  -58.593 1.00 152.94 ? 125 SER C N   1 
ATOM   2347  C CA  . SER C 1 46  ? 29.776  -23.817  -58.409 1.00 147.77 ? 125 SER C CA  1 
ATOM   2348  C C   . SER C 1 46  ? 29.412  -22.330  -58.366 1.00 144.72 ? 125 SER C C   1 
ATOM   2349  O O   . SER C 1 46  ? 28.441  -21.904  -58.996 1.00 140.95 ? 125 SER C O   1 
ATOM   2350  C CB  . SER C 1 46  ? 30.746  -24.067  -59.554 1.00 148.33 ? 125 SER C CB  1 
ATOM   2351  O OG  . SER C 1 46  ? 30.073  -23.972  -60.806 1.00 147.58 ? 125 SER C OG  1 
ATOM   2352  N N   . TYR C 1 47  ? 30.207  -21.555  -57.633 1.00 141.85 ? 126 TYR C N   1 
ATOM   2353  C CA  . TYR C 1 47  ? 29.973  -20.123  -57.463 1.00 142.80 ? 126 TYR C CA  1 
ATOM   2354  C C   . TYR C 1 47  ? 31.045  -19.305  -58.200 1.00 147.37 ? 126 TYR C C   1 
ATOM   2355  O O   . TYR C 1 47  ? 32.241  -19.489  -57.965 1.00 154.90 ? 126 TYR C O   1 
ATOM   2356  C CB  . TYR C 1 47  ? 29.948  -19.774  -55.970 1.00 141.44 ? 126 TYR C CB  1 
ATOM   2357  C CG  . TYR C 1 47  ? 29.743  -18.308  -55.686 1.00 140.84 ? 126 TYR C CG  1 
ATOM   2358  C CD1 . TYR C 1 47  ? 30.711  -17.566  -55.024 1.00 142.05 ? 126 TYR C CD1 1 
ATOM   2359  C CD2 . TYR C 1 47  ? 28.586  -17.656  -56.095 1.00 140.54 ? 126 TYR C CD2 1 
ATOM   2360  C CE1 . TYR C 1 47  ? 30.530  -16.216  -54.768 1.00 145.22 ? 126 TYR C CE1 1 
ATOM   2361  C CE2 . TYR C 1 47  ? 28.389  -16.305  -55.845 1.00 139.57 ? 126 TYR C CE2 1 
ATOM   2362  C CZ  . TYR C 1 47  ? 29.364  -15.587  -55.185 1.00 143.27 ? 126 TYR C CZ  1 
ATOM   2363  O OH  . TYR C 1 47  ? 29.199  -14.243  -54.928 1.00 145.06 ? 126 TYR C OH  1 
ATOM   2364  N N   . LYS C 1 48  ? 30.605  -18.416  -59.093 1.00 146.41 ? 127 LYS C N   1 
ATOM   2365  C CA  . LYS C 1 48  ? 31.487  -17.472  -59.794 1.00 142.57 ? 127 LYS C CA  1 
ATOM   2366  C C   . LYS C 1 48  ? 31.601  -16.164  -58.988 1.00 141.21 ? 127 LYS C C   1 
ATOM   2367  O O   . LYS C 1 48  ? 30.704  -15.323  -59.028 1.00 133.31 ? 127 LYS C O   1 
ATOM   2368  C CB  . LYS C 1 48  ? 30.949  -17.182  -61.201 1.00 136.45 ? 127 LYS C CB  1 
ATOM   2369  N N   . GLU C 1 49  ? 32.713  -15.995  -58.272 1.00 143.87 ? 128 GLU C N   1 
ATOM   2370  C CA  . GLU C 1 49  ? 32.941  -14.814  -57.421 1.00 145.19 ? 128 GLU C CA  1 
ATOM   2371  C C   . GLU C 1 49  ? 32.842  -13.463  -58.150 1.00 150.57 ? 128 GLU C C   1 
ATOM   2372  O O   . GLU C 1 49  ? 32.429  -12.473  -57.542 1.00 155.41 ? 128 GLU C O   1 
ATOM   2373  C CB  . GLU C 1 49  ? 34.301  -14.908  -56.713 1.00 145.42 ? 128 GLU C CB  1 
ATOM   2374  N N   . ASP C 1 50  ? 33.212  -13.421  -59.431 1.00 156.43 ? 129 ASP C N   1 
ATOM   2375  C CA  . ASP C 1 50  ? 33.190  -12.166  -60.210 1.00 159.14 ? 129 ASP C CA  1 
ATOM   2376  C C   . ASP C 1 50  ? 31.773  -11.684  -60.538 1.00 152.56 ? 129 ASP C C   1 
ATOM   2377  O O   . ASP C 1 50  ? 31.456  -10.509  -60.331 1.00 147.40 ? 129 ASP C O   1 
ATOM   2378  C CB  . ASP C 1 50  ? 34.062  -12.244  -61.488 1.00 166.01 ? 129 ASP C CB  1 
ATOM   2379  C CG  . ASP C 1 50  ? 33.647  -13.364  -62.453 1.00 168.58 ? 129 ASP C CG  1 
ATOM   2380  O OD1 . ASP C 1 50  ? 33.363  -14.492  -61.985 1.00 171.49 ? 129 ASP C OD1 1 
ATOM   2381  O OD2 . ASP C 1 50  ? 33.636  -13.119  -63.681 1.00 168.20 ? 129 ASP C OD2 1 
ATOM   2382  N N   . THR C 1 51  ? 30.929  -12.595  -61.018 1.00 149.31 ? 130 THR C N   1 
ATOM   2383  C CA  . THR C 1 51  ? 29.552  -12.274  -61.414 1.00 152.98 ? 130 THR C CA  1 
ATOM   2384  C C   . THR C 1 51  ? 28.525  -12.427  -60.276 1.00 152.25 ? 130 THR C C   1 
ATOM   2385  O O   . THR C 1 51  ? 27.375  -11.981  -60.408 1.00 148.48 ? 130 THR C O   1 
ATOM   2386  C CB  . THR C 1 51  ? 29.118  -13.153  -62.596 1.00 157.45 ? 130 THR C CB  1 
ATOM   2387  O OG1 . THR C 1 51  ? 29.469  -14.524  -62.329 1.00 165.14 ? 130 THR C OG1 1 
ATOM   2388  C CG2 . THR C 1 51  ? 29.805  -12.683  -63.879 1.00 161.79 ? 130 THR C CG2 1 
ATOM   2389  N N   . LYS C 1 52  ? 28.946  -13.049  -59.170 1.00 155.34 ? 131 LYS C N   1 
ATOM   2390  C CA  . LYS C 1 52  ? 28.096  -13.308  -58.004 1.00 154.67 ? 131 LYS C CA  1 
ATOM   2391  C C   . LYS C 1 52  ? 26.944  -14.260  -58.347 1.00 154.88 ? 131 LYS C C   1 
ATOM   2392  O O   . LYS C 1 52  ? 25.801  -14.031  -57.961 1.00 154.26 ? 131 LYS C O   1 
ATOM   2393  C CB  . LYS C 1 52  ? 27.587  -11.996  -57.384 1.00 150.99 ? 131 LYS C CB  1 
ATOM   2394  N N   . GLU C 1 53  ? 27.273  -15.342  -59.049 1.00 156.63 ? 132 GLU C N   1 
ATOM   2395  C CA  . GLU C 1 53  ? 26.282  -16.266  -59.583 1.00 153.20 ? 132 GLU C CA  1 
ATOM   2396  C C   . GLU C 1 53  ? 26.598  -17.705  -59.196 1.00 146.18 ? 132 GLU C C   1 
ATOM   2397  O O   . GLU C 1 53  ? 27.754  -18.121  -59.215 1.00 142.73 ? 132 GLU C O   1 
ATOM   2398  C CB  . GLU C 1 53  ? 26.231  -16.153  -61.109 1.00 164.25 ? 132 GLU C CB  1 
ATOM   2399  C CG  . GLU C 1 53  ? 25.799  -14.785  -61.630 1.00 175.14 ? 132 GLU C CG  1 
ATOM   2400  C CD  . GLU C 1 53  ? 25.642  -14.729  -63.145 1.00 188.39 ? 132 GLU C CD  1 
ATOM   2401  O OE1 . GLU C 1 53  ? 26.602  -15.070  -63.865 1.00 200.84 ? 132 GLU C OE1 1 
ATOM   2402  O OE2 . GLU C 1 53  ? 24.568  -14.332  -63.632 1.00 197.94 ? 132 GLU C OE2 1 
ATOM   2403  N N   . LEU C 1 54  ? 25.560  -18.454  -58.829 1.00 145.19 ? 133 LEU C N   1 
ATOM   2404  C CA  . LEU C 1 54  ? 25.649  -19.901  -58.654 1.00 146.70 ? 133 LEU C CA  1 
ATOM   2405  C C   . LEU C 1 54  ? 25.441  -20.515  -60.031 1.00 149.89 ? 133 LEU C C   1 
ATOM   2406  O O   . LEU C 1 54  ? 24.544  -20.086  -60.752 1.00 154.20 ? 133 LEU C O   1 
ATOM   2407  C CB  . LEU C 1 54  ? 24.566  -20.398  -57.689 1.00 146.42 ? 133 LEU C CB  1 
ATOM   2408  C CG  . LEU C 1 54  ? 24.550  -21.893  -57.347 1.00 145.14 ? 133 LEU C CG  1 
ATOM   2409  C CD1 . LEU C 1 54  ? 25.758  -22.274  -56.508 1.00 146.50 ? 133 LEU C CD1 1 
ATOM   2410  C CD2 . LEU C 1 54  ? 23.267  -22.266  -56.628 1.00 142.65 ? 133 LEU C CD2 1 
ATOM   2411  N N   . VAL C 1 55  ? 26.254  -21.515  -60.386 1.00 150.42 ? 134 VAL C N   1 
ATOM   2412  C CA  . VAL C 1 55  ? 26.220  -22.132  -61.717 1.00 151.54 ? 134 VAL C CA  1 
ATOM   2413  C C   . VAL C 1 55  ? 25.898  -23.625  -61.632 1.00 152.66 ? 134 VAL C C   1 
ATOM   2414  O O   . VAL C 1 55  ? 26.662  -24.388  -61.041 1.00 154.22 ? 134 VAL C O   1 
ATOM   2415  C CB  . VAL C 1 55  ? 27.558  -21.952  -62.458 1.00 149.82 ? 134 VAL C CB  1 
ATOM   2416  C CG1 . VAL C 1 55  ? 27.401  -22.279  -63.940 1.00 153.37 ? 134 VAL C CG1 1 
ATOM   2417  C CG2 . VAL C 1 55  ? 28.074  -20.532  -62.274 1.00 149.13 ? 134 VAL C CG2 1 
ATOM   2418  N N   . VAL C 1 56  ? 24.789  -24.023  -62.256 1.00 153.00 ? 135 VAL C N   1 
ATOM   2419  C CA  . VAL C 1 56  ? 24.299  -25.399  -62.218 1.00 158.69 ? 135 VAL C CA  1 
ATOM   2420  C C   . VAL C 1 56  ? 24.783  -26.175  -63.432 1.00 169.25 ? 135 VAL C C   1 
ATOM   2421  O O   . VAL C 1 56  ? 24.526  -25.762  -64.560 1.00 184.62 ? 135 VAL C O   1 
ATOM   2422  C CB  . VAL C 1 56  ? 22.753  -25.441  -62.214 1.00 158.11 ? 135 VAL C CB  1 
ATOM   2423  C CG1 . VAL C 1 56  ? 22.256  -26.871  -61.990 1.00 161.73 ? 135 VAL C CG1 1 
ATOM   2424  C CG2 . VAL C 1 56  ? 22.194  -24.507  -61.155 1.00 160.79 ? 135 VAL C CG2 1 
ATOM   2425  N N   . ALA C 1 57  ? 25.448  -27.307  -63.208 1.00 168.03 ? 136 ALA C N   1 
ATOM   2426  C CA  . ALA C 1 57  ? 25.950  -28.138  -64.308 1.00 168.04 ? 136 ALA C CA  1 
ATOM   2427  C C   . ALA C 1 57  ? 24.867  -29.035  -64.891 1.00 158.86 ? 136 ALA C C   1 
ATOM   2428  O O   . ALA C 1 57  ? 24.445  -28.835  -66.032 1.00 154.46 ? 136 ALA C O   1 
ATOM   2429  C CB  . ALA C 1 57  ? 27.151  -28.964  -63.858 1.00 172.46 ? 136 ALA C CB  1 
ATOM   2430  N N   . LYS C 1 58  ? 24.415  -30.004  -64.101 1.00 156.56 ? 137 LYS C N   1 
ATOM   2431  C CA  . LYS C 1 58  ? 23.439  -30.997  -64.560 1.00 154.32 ? 137 LYS C CA  1 
ATOM   2432  C C   . LYS C 1 58  ? 22.056  -30.368  -64.518 1.00 148.45 ? 137 LYS C C   1 
ATOM   2433  O O   . LYS C 1 58  ? 21.654  -29.842  -63.489 1.00 143.19 ? 137 LYS C O   1 
ATOM   2434  C CB  . LYS C 1 58  ? 23.476  -32.253  -63.682 1.00 148.94 ? 137 LYS C CB  1 
ATOM   2435  N N   . ALA C 1 59  ? 21.339  -30.410  -65.636 1.00 148.12 ? 138 ALA C N   1 
ATOM   2436  C CA  . ALA C 1 59  ? 19.971  -29.895  -65.709 1.00 145.96 ? 138 ALA C CA  1 
ATOM   2437  C C   . ALA C 1 59  ? 18.987  -30.761  -64.916 1.00 141.72 ? 138 ALA C C   1 
ATOM   2438  O O   . ALA C 1 59  ? 19.340  -31.822  -64.396 1.00 134.54 ? 138 ALA C O   1 
ATOM   2439  C CB  . ALA C 1 59  ? 19.529  -29.779  -67.162 1.00 148.34 ? 138 ALA C CB  1 
ATOM   2440  N N   . GLY C 1 60  ? 17.750  -30.276  -64.829 1.00 144.00 ? 139 GLY C N   1 
ATOM   2441  C CA  . GLY C 1 60  ? 16.665  -30.970  -64.127 1.00 145.63 ? 139 GLY C CA  1 
ATOM   2442  C C   . GLY C 1 60  ? 15.732  -30.019  -63.400 1.00 142.01 ? 139 GLY C C   1 
ATOM   2443  O O   . GLY C 1 60  ? 15.750  -28.809  -63.643 1.00 145.73 ? 139 GLY C O   1 
ATOM   2444  N N   . VAL C 1 61  ? 14.914  -30.578  -62.513 1.00 136.87 ? 140 VAL C N   1 
ATOM   2445  C CA  . VAL C 1 61  ? 14.043  -29.793  -61.652 1.00 132.83 ? 140 VAL C CA  1 
ATOM   2446  C C   . VAL C 1 61  ? 14.602  -29.823  -60.230 1.00 129.83 ? 140 VAL C C   1 
ATOM   2447  O O   . VAL C 1 61  ? 14.964  -30.878  -59.716 1.00 125.84 ? 140 VAL C O   1 
ATOM   2448  C CB  . VAL C 1 61  ? 12.591  -30.309  -61.703 1.00 133.80 ? 140 VAL C CB  1 
ATOM   2449  C CG1 . VAL C 1 61  ? 11.733  -29.657  -60.624 1.00 133.44 ? 140 VAL C CG1 1 
ATOM   2450  C CG2 . VAL C 1 61  ? 11.999  -30.059  -63.091 1.00 134.23 ? 140 VAL C CG2 1 
ATOM   2451  N N   . TYR C 1 62  ? 14.665  -28.645  -59.609 1.00 130.56 ? 141 TYR C N   1 
ATOM   2452  C CA  . TYR C 1 62  ? 15.199  -28.475  -58.260 1.00 130.13 ? 141 TYR C CA  1 
ATOM   2453  C C   . TYR C 1 62  ? 14.187  -27.744  -57.391 1.00 129.07 ? 141 TYR C C   1 
ATOM   2454  O O   . TYR C 1 62  ? 13.439  -26.894  -57.887 1.00 130.22 ? 141 TYR C O   1 
ATOM   2455  C CB  . TYR C 1 62  ? 16.457  -27.623  -58.308 1.00 132.93 ? 141 TYR C CB  1 
ATOM   2456  C CG  . TYR C 1 62  ? 17.614  -28.238  -59.048 1.00 132.66 ? 141 TYR C CG  1 
ATOM   2457  C CD1 . TYR C 1 62  ? 17.612  -28.348  -60.439 1.00 133.19 ? 141 TYR C CD1 1 
ATOM   2458  C CD2 . TYR C 1 62  ? 18.742  -28.673  -58.356 1.00 133.42 ? 141 TYR C CD2 1 
ATOM   2459  C CE1 . TYR C 1 62  ? 18.679  -28.902  -61.111 1.00 136.07 ? 141 TYR C CE1 1 
ATOM   2460  C CE2 . TYR C 1 62  ? 19.825  -29.224  -59.018 1.00 134.69 ? 141 TYR C CE2 1 
ATOM   2461  C CZ  . TYR C 1 62  ? 19.798  -29.328  -60.387 1.00 137.66 ? 141 TYR C CZ  1 
ATOM   2462  O OH  . TYR C 1 62  ? 20.886  -29.884  -61.021 1.00 145.77 ? 141 TYR C OH  1 
ATOM   2463  N N   . TYR C 1 63  ? 14.173  -28.072  -56.101 1.00 127.89 ? 142 TYR C N   1 
ATOM   2464  C CA  . TYR C 1 63  ? 13.491  -27.260  -55.102 1.00 128.21 ? 142 TYR C CA  1 
ATOM   2465  C C   . TYR C 1 63  ? 14.495  -26.208  -54.695 1.00 125.31 ? 142 TYR C C   1 
ATOM   2466  O O   . TYR C 1 63  ? 15.529  -26.526  -54.104 1.00 124.41 ? 142 TYR C O   1 
ATOM   2467  C CB  . TYR C 1 63  ? 13.074  -28.093  -53.892 1.00 126.77 ? 142 TYR C CB  1 
ATOM   2468  C CG  . TYR C 1 63  ? 12.341  -27.316  -52.811 1.00 125.45 ? 142 TYR C CG  1 
ATOM   2469  C CD1 . TYR C 1 63  ? 11.003  -26.943  -52.974 1.00 123.76 ? 142 TYR C CD1 1 
ATOM   2470  C CD2 . TYR C 1 63  ? 12.971  -26.986  -51.619 1.00 127.57 ? 142 TYR C CD2 1 
ATOM   2471  C CE1 . TYR C 1 63  ? 10.313  -26.267  -51.974 1.00 124.82 ? 142 TYR C CE1 1 
ATOM   2472  C CE2 . TYR C 1 63  ? 12.311  -26.306  -50.613 1.00 130.36 ? 142 TYR C CE2 1 
ATOM   2473  C CZ  . TYR C 1 63  ? 10.970  -25.952  -50.784 1.00 129.37 ? 142 TYR C CZ  1 
ATOM   2474  O OH  . TYR C 1 63  ? 10.312  -25.276  -49.771 1.00 126.10 ? 142 TYR C OH  1 
ATOM   2475  N N   . VAL C 1 64  ? 14.204  -24.958  -55.049 1.00 122.22 ? 143 VAL C N   1 
ATOM   2476  C CA  . VAL C 1 64  ? 15.071  -23.828  -54.763 1.00 118.16 ? 143 VAL C CA  1 
ATOM   2477  C C   . VAL C 1 64  ? 14.358  -22.987  -53.724 1.00 117.76 ? 143 VAL C C   1 
ATOM   2478  O O   . VAL C 1 64  ? 13.173  -22.704  -53.867 1.00 116.58 ? 143 VAL C O   1 
ATOM   2479  C CB  . VAL C 1 64  ? 15.293  -22.983  -56.016 1.00 118.64 ? 143 VAL C CB  1 
ATOM   2480  C CG1 . VAL C 1 64  ? 16.289  -21.861  -55.745 1.00 119.83 ? 143 VAL C CG1 1 
ATOM   2481  C CG2 . VAL C 1 64  ? 15.767  -23.874  -57.151 1.00 122.10 ? 143 VAL C CG2 1 
ATOM   2482  N N   . PHE C 1 65  ? 15.084  -22.594  -52.683 1.00 118.32 ? 144 PHE C N   1 
ATOM   2483  C CA  . PHE C 1 65  ? 14.512  -21.814  -51.595 1.00 116.45 ? 144 PHE C CA  1 
ATOM   2484  C C   . PHE C 1 65  ? 15.479  -20.734  -51.155 1.00 111.62 ? 144 PHE C C   1 
ATOM   2485  O O   . PHE C 1 65  ? 16.692  -20.953  -51.114 1.00 111.91 ? 144 PHE C O   1 
ATOM   2486  C CB  . PHE C 1 65  ? 14.175  -22.710  -50.394 1.00 118.38 ? 144 PHE C CB  1 
ATOM   2487  C CG  . PHE C 1 65  ? 15.366  -23.413  -49.812 1.00 119.58 ? 144 PHE C CG  1 
ATOM   2488  C CD1 . PHE C 1 65  ? 16.070  -22.852  -48.760 1.00 122.89 ? 144 PHE C CD1 1 
ATOM   2489  C CD2 . PHE C 1 65  ? 15.803  -24.619  -50.340 1.00 119.45 ? 144 PHE C CD2 1 
ATOM   2490  C CE1 . PHE C 1 65  ? 17.186  -23.487  -48.239 1.00 123.35 ? 144 PHE C CE1 1 
ATOM   2491  C CE2 . PHE C 1 65  ? 16.920  -25.255  -49.823 1.00 120.63 ? 144 PHE C CE2 1 
ATOM   2492  C CZ  . PHE C 1 65  ? 17.613  -24.689  -48.766 1.00 121.38 ? 144 PHE C CZ  1 
ATOM   2493  N N   . PHE C 1 66  ? 14.948  -19.571  -50.817 1.00 108.16 ? 145 PHE C N   1 
ATOM   2494  C CA  . PHE C 1 66  ? 15.746  -18.619  -50.079 1.00 112.60 ? 145 PHE C CA  1 
ATOM   2495  C C   . PHE C 1 66  ? 15.053  -18.041  -48.852 1.00 114.14 ? 145 PHE C C   1 
ATOM   2496  O O   . PHE C 1 66  ? 13.849  -18.078  -48.715 1.00 118.33 ? 145 PHE C O   1 
ATOM   2497  C CB  . PHE C 1 66  ? 16.445  -17.572  -50.973 1.00 114.07 ? 145 PHE C CB  1 
ATOM   2498  C CG  . PHE C 1 66  ? 15.556  -16.745  -51.847 1.00 114.17 ? 145 PHE C CG  1 
ATOM   2499  C CD1 . PHE C 1 66  ? 14.188  -16.601  -51.637 1.00 116.62 ? 145 PHE C CD1 1 
ATOM   2500  C CD2 . PHE C 1 66  ? 16.145  -16.022  -52.865 1.00 111.64 ? 145 PHE C CD2 1 
ATOM   2501  C CE1 . PHE C 1 66  ? 13.425  -15.800  -52.470 1.00 114.09 ? 145 PHE C CE1 1 
ATOM   2502  C CE2 . PHE C 1 66  ? 15.391  -15.219  -53.693 1.00 114.77 ? 145 PHE C CE2 1 
ATOM   2503  C CZ  . PHE C 1 66  ? 14.023  -15.104  -53.497 1.00 114.43 ? 145 PHE C CZ  1 
ATOM   2504  N N   . GLN C 1 67  ? 15.889  -17.556  -47.956 1.00 117.16 ? 146 GLN C N   1 
ATOM   2505  C CA  . GLN C 1 67  ? 15.578  -17.264  -46.585 1.00 115.67 ? 146 GLN C CA  1 
ATOM   2506  C C   . GLN C 1 67  ? 16.146  -15.865  -46.415 1.00 115.43 ? 146 GLN C C   1 
ATOM   2507  O O   . GLN C 1 67  ? 17.192  -15.559  -46.980 1.00 109.09 ? 146 GLN C O   1 
ATOM   2508  C CB  . GLN C 1 67  ? 16.355  -18.269  -45.743 1.00 119.43 ? 146 GLN C CB  1 
ATOM   2509  C CG  . GLN C 1 67  ? 15.867  -18.533  -44.340 1.00 126.16 ? 146 GLN C CG  1 
ATOM   2510  C CD  . GLN C 1 67  ? 16.540  -19.768  -43.744 1.00 128.62 ? 146 GLN C CD  1 
ATOM   2511  O OE1 . GLN C 1 67  ? 15.973  -20.878  -43.767 1.00 129.51 ? 146 GLN C OE1 1 
ATOM   2512  N NE2 . GLN C 1 67  ? 17.758  -19.590  -43.240 1.00 127.97 ? 146 GLN C NE2 1 
ATOM   2513  N N   . LEU C 1 68  ? 15.476  -15.007  -45.670 1.00 118.59 ? 147 LEU C N   1 
ATOM   2514  C CA  . LEU C 1 68  ? 15.984  -13.651  -45.470 1.00 122.50 ? 147 LEU C CA  1 
ATOM   2515  C C   . LEU C 1 68  ? 15.633  -13.162  -44.079 1.00 125.17 ? 147 LEU C C   1 
ATOM   2516  O O   . LEU C 1 68  ? 14.468  -12.854  -43.830 1.00 138.00 ? 147 LEU C O   1 
ATOM   2517  C CB  . LEU C 1 68  ? 15.369  -12.723  -46.522 1.00 123.04 ? 147 LEU C CB  1 
ATOM   2518  C CG  . LEU C 1 68  ? 15.570  -11.220  -46.326 1.00 125.21 ? 147 LEU C CG  1 
ATOM   2519  C CD1 . LEU C 1 68  ? 17.065  -10.929  -46.373 1.00 129.76 ? 147 LEU C CD1 1 
ATOM   2520  C CD2 . LEU C 1 68  ? 14.800  -10.411  -47.363 1.00 129.52 ? 147 LEU C CD2 1 
ATOM   2521  N N   . GLU C 1 69  ? 16.617  -13.104  -43.172 1.00 121.47 ? 148 GLU C N   1 
ATOM   2522  C CA  . GLU C 1 69  ? 16.387  -12.521  -41.830 1.00 117.59 ? 148 GLU C CA  1 
ATOM   2523  C C   . GLU C 1 69  ? 17.048  -11.154  -41.776 1.00 115.48 ? 148 GLU C C   1 
ATOM   2524  O O   . GLU C 1 69  ? 18.114  -10.944  -42.368 1.00 113.64 ? 148 GLU C O   1 
ATOM   2525  C CB  . GLU C 1 69  ? 16.902  -13.411  -40.695 1.00 115.93 ? 148 GLU C CB  1 
ATOM   2526  N N   . LEU C 1 70  ? 16.391  -10.229  -41.082 1.00 111.29 ? 149 LEU C N   1 
ATOM   2527  C CA  . LEU C 1 70  ? 16.859  -8.858   -40.938 1.00 114.00 ? 149 LEU C CA  1 
ATOM   2528  C C   . LEU C 1 70  ? 16.796  -8.483   -39.463 1.00 120.47 ? 149 LEU C C   1 
ATOM   2529  O O   . LEU C 1 70  ? 15.972  -9.023   -38.731 1.00 125.38 ? 149 LEU C O   1 
ATOM   2530  C CB  . LEU C 1 70  ? 15.961  -7.939   -41.750 1.00 112.41 ? 149 LEU C CB  1 
ATOM   2531  C CG  . LEU C 1 70  ? 15.967  -8.222   -43.251 1.00 114.71 ? 149 LEU C CG  1 
ATOM   2532  C CD1 . LEU C 1 70  ? 14.615  -7.949   -43.905 1.00 119.26 ? 149 LEU C CD1 1 
ATOM   2533  C CD2 . LEU C 1 70  ? 17.058  -7.393   -43.897 1.00 117.26 ? 149 LEU C CD2 1 
ATOM   2534  N N   . ARG C 1 71  ? 17.668  -7.569   -39.029 1.00 122.94 ? 150 ARG C N   1 
ATOM   2535  C CA  . ARG C 1 71  ? 17.708  -7.121   -37.625 1.00 122.61 ? 150 ARG C CA  1 
ATOM   2536  C C   . ARG C 1 71  ? 17.777  -5.602   -37.521 1.00 125.91 ? 150 ARG C C   1 
ATOM   2537  O O   . ARG C 1 71  ? 18.550  -4.965   -38.238 1.00 132.42 ? 150 ARG C O   1 
ATOM   2538  C CB  . ARG C 1 71  ? 18.922  -7.725   -36.926 1.00 121.03 ? 150 ARG C CB  1 
ATOM   2539  N N   . ARG C 1 72  ? 16.960  -5.023   -36.643 1.00 125.02 ? 151 ARG C N   1 
ATOM   2540  C CA  . ARG C 1 72  ? 17.030  -3.589   -36.372 1.00 126.57 ? 151 ARG C CA  1 
ATOM   2541  C C   . ARG C 1 72  ? 18.310  -3.327   -35.581 1.00 130.53 ? 151 ARG C C   1 
ATOM   2542  O O   . ARG C 1 72  ? 18.521  -3.942   -34.541 1.00 129.63 ? 151 ARG C O   1 
ATOM   2543  C CB  . ARG C 1 72  ? 15.823  -3.116   -35.566 1.00 125.68 ? 151 ARG C CB  1 
ATOM   2544  C CG  . ARG C 1 72  ? 15.661  -1.606   -35.534 1.00 126.42 ? 151 ARG C CG  1 
ATOM   2545  C CD  . ARG C 1 72  ? 14.626  -1.163   -34.508 1.00 128.08 ? 151 ARG C CD  1 
ATOM   2546  N NE  . ARG C 1 72  ? 13.311  -1.788   -34.693 1.00 129.27 ? 151 ARG C NE  1 
ATOM   2547  C CZ  . ARG C 1 72  ? 12.415  -1.449   -35.632 1.00 129.12 ? 151 ARG C CZ  1 
ATOM   2548  N NH1 . ARG C 1 72  ? 12.667  -0.496   -36.531 1.00 128.93 ? 151 ARG C NH1 1 
ATOM   2549  N NH2 . ARG C 1 72  ? 11.249  -2.086   -35.686 1.00 129.09 ? 151 ARG C NH2 1 
ATOM   2550  N N   . VAL C 1 73  ? 19.158  -2.440   -36.101 1.00 131.31 ? 152 VAL C N   1 
ATOM   2551  C CA  . VAL C 1 73  ? 20.444  -2.096   -35.480 1.00 132.15 ? 152 VAL C CA  1 
ATOM   2552  C C   . VAL C 1 73  ? 20.480  -0.696   -34.872 1.00 135.31 ? 152 VAL C C   1 
ATOM   2553  O O   . VAL C 1 73  ? 21.413  -0.380   -34.149 1.00 142.77 ? 152 VAL C O   1 
ATOM   2554  C CB  . VAL C 1 73  ? 21.633  -2.237   -36.467 1.00 133.83 ? 152 VAL C CB  1 
ATOM   2555  C CG1 . VAL C 1 73  ? 21.790  -3.677   -36.921 1.00 133.66 ? 152 VAL C CG1 1 
ATOM   2556  C CG2 . VAL C 1 73  ? 21.492  -1.314   -37.672 1.00 133.77 ? 152 VAL C CG2 1 
ATOM   2557  N N   . VAL C 1 74  ? 19.505  0.150    -35.184 1.00 135.37 ? 153 VAL C N   1 
ATOM   2558  C CA  . VAL C 1 74  ? 19.387  1.458    -34.548 1.00 136.40 ? 153 VAL C CA  1 
ATOM   2559  C C   . VAL C 1 74  ? 18.057  1.476    -33.824 1.00 141.06 ? 153 VAL C C   1 
ATOM   2560  O O   . VAL C 1 74  ? 17.006  1.612    -34.451 1.00 145.71 ? 153 VAL C O   1 
ATOM   2561  C CB  . VAL C 1 74  ? 19.452  2.599    -35.582 1.00 136.03 ? 153 VAL C CB  1 
ATOM   2562  C CG1 . VAL C 1 74  ? 19.228  3.951    -34.912 1.00 134.15 ? 153 VAL C CG1 1 
ATOM   2563  C CG2 . VAL C 1 74  ? 20.794  2.570    -36.304 1.00 137.34 ? 153 VAL C CG2 1 
ATOM   2564  N N   . ALA C 1 75  ? 18.111  1.327    -32.503 1.00 146.20 ? 154 ALA C N   1 
ATOM   2565  C CA  . ALA C 1 75  ? 16.906  1.273    -31.672 1.00 147.13 ? 154 ALA C CA  1 
ATOM   2566  C C   . ALA C 1 75  ? 15.975  2.443    -31.954 1.00 146.14 ? 154 ALA C C   1 
ATOM   2567  O O   . ALA C 1 75  ? 16.431  3.581    -32.109 1.00 142.37 ? 154 ALA C O   1 
ATOM   2568  C CB  . ALA C 1 75  ? 17.273  1.251    -30.196 1.00 147.99 ? 154 ALA C CB  1 
ATOM   2569  N N   . GLY C 1 76  ? 14.680  2.143    -32.050 1.00 145.61 ? 155 GLY C N   1 
ATOM   2570  C CA  . GLY C 1 76  ? 13.661  3.173    -32.226 1.00 146.47 ? 155 GLY C CA  1 
ATOM   2571  C C   . GLY C 1 76  ? 13.596  3.821    -33.597 1.00 143.04 ? 155 GLY C C   1 
ATOM   2572  O O   . GLY C 1 76  ? 12.975  4.872    -33.743 1.00 151.04 ? 155 GLY C O   1 
ATOM   2573  N N   . GLU C 1 77  ? 14.210  3.206    -34.598 1.00 138.18 ? 156 GLU C N   1 
ATOM   2574  C CA  . GLU C 1 77  ? 14.285  3.812    -35.920 1.00 140.64 ? 156 GLU C CA  1 
ATOM   2575  C C   . GLU C 1 77  ? 14.177  2.750    -36.998 1.00 138.81 ? 156 GLU C C   1 
ATOM   2576  O O   . GLU C 1 77  ? 14.485  1.584    -36.766 1.00 137.36 ? 156 GLU C O   1 
ATOM   2577  C CB  . GLU C 1 77  ? 15.603  4.580    -36.086 1.00 140.47 ? 156 GLU C CB  1 
ATOM   2578  N N   . GLY C 1 78  ? 13.718  3.167    -38.175 1.00 135.38 ? 157 GLY C N   1 
ATOM   2579  C CA  . GLY C 1 78  ? 13.742  2.330    -39.365 1.00 127.42 ? 157 GLY C CA  1 
ATOM   2580  C C   . GLY C 1 78  ? 12.423  1.660    -39.638 1.00 125.45 ? 157 GLY C C   1 
ATOM   2581  O O   . GLY C 1 78  ? 11.829  1.064    -38.743 1.00 125.80 ? 157 GLY C O   1 
ATOM   2582  N N   . SER C 1 79  ? 11.980  1.746    -40.886 1.00 125.95 ? 158 SER C N   1 
ATOM   2583  C CA  . SER C 1 79  ? 10.745  1.110    -41.327 1.00 130.62 ? 158 SER C CA  1 
ATOM   2584  C C   . SER C 1 79  ? 10.791  0.898    -42.821 1.00 132.19 ? 158 SER C C   1 
ATOM   2585  O O   . SER C 1 79  ? 11.700  1.390    -43.491 1.00 146.21 ? 158 SER C O   1 
ATOM   2586  C CB  . SER C 1 79  ? 9.548   1.991    -40.977 1.00 136.20 ? 158 SER C CB  1 
ATOM   2587  O OG  . SER C 1 79  ? 9.684   3.271    -41.557 1.00 140.22 ? 158 SER C OG  1 
ATOM   2588  N N   . GLY C 1 80  ? 9.818   0.160    -43.341 1.00 130.55 ? 159 GLY C N   1 
ATOM   2589  C CA  . GLY C 1 80  ? 9.712   -0.073   -44.787 1.00 129.89 ? 159 GLY C CA  1 
ATOM   2590  C C   . GLY C 1 80  ? 9.753   -1.539   -45.181 1.00 126.86 ? 159 GLY C C   1 
ATOM   2591  O O   . GLY C 1 80  ? 9.123   -2.379   -44.540 1.00 127.19 ? 159 GLY C O   1 
ATOM   2592  N N   . SER C 1 81  ? 10.508  -1.843   -46.230 1.00 126.51 ? 160 SER C N   1 
ATOM   2593  C CA  . SER C 1 81  ? 10.435  -3.143   -46.865 1.00 128.68 ? 160 SER C CA  1 
ATOM   2594  C C   . SER C 1 81  ? 11.746  -3.524   -47.545 1.00 124.93 ? 160 SER C C   1 
ATOM   2595  O O   . SER C 1 81  ? 12.485  -2.667   -47.984 1.00 127.47 ? 160 SER C O   1 
ATOM   2596  C CB  . SER C 1 81  ? 9.296   -3.112   -47.880 1.00 135.00 ? 160 SER C CB  1 
ATOM   2597  O OG  . SER C 1 81  ? 9.549   -3.982   -48.958 1.00 142.68 ? 160 SER C OG  1 
ATOM   2598  N N   . VAL C 1 82  ? 12.002  -4.821   -47.649 1.00 120.81 ? 161 VAL C N   1 
ATOM   2599  C CA  . VAL C 1 82  ? 13.222  -5.360   -48.246 1.00 118.20 ? 161 VAL C CA  1 
ATOM   2600  C C   . VAL C 1 82  ? 12.835  -6.571   -49.061 1.00 118.14 ? 161 VAL C C   1 
ATOM   2601  O O   . VAL C 1 82  ? 12.000  -7.357   -48.617 1.00 120.56 ? 161 VAL C O   1 
ATOM   2602  C CB  . VAL C 1 82  ? 14.221  -5.816   -47.163 1.00 117.50 ? 161 VAL C CB  1 
ATOM   2603  C CG1 . VAL C 1 82  ? 15.455  -6.481   -47.767 1.00 114.49 ? 161 VAL C CG1 1 
ATOM   2604  C CG2 . VAL C 1 82  ? 14.606  -4.646   -46.280 1.00 118.45 ? 161 VAL C CG2 1 
ATOM   2605  N N   . SER C 1 83  ? 13.476  -6.744   -50.215 1.00 120.31 ? 162 SER C N   1 
ATOM   2606  C CA  . SER C 1 83  ? 13.065  -7.748   -51.196 1.00 120.59 ? 162 SER C CA  1 
ATOM   2607  C C   . SER C 1 83  ? 14.244  -8.490   -51.791 1.00 115.25 ? 162 SER C C   1 
ATOM   2608  O O   . SER C 1 83  ? 15.192  -7.868   -52.220 1.00 116.76 ? 162 SER C O   1 
ATOM   2609  C CB  . SER C 1 83  ? 12.291  -7.069   -52.329 1.00 126.15 ? 162 SER C CB  1 
ATOM   2610  O OG  . SER C 1 83  ? 11.538  -5.977   -51.830 1.00 136.80 ? 162 SER C OG  1 
ATOM   2611  N N   . LEU C 1 84  ? 14.178  -9.816   -51.816 1.00 113.29 ? 163 LEU C N   1 
ATOM   2612  C CA  . LEU C 1 84  ? 15.058  -10.629  -52.659 1.00 112.80 ? 163 LEU C CA  1 
ATOM   2613  C C   . LEU C 1 84  ? 14.364  -10.980  -53.962 1.00 115.48 ? 163 LEU C C   1 
ATOM   2614  O O   . LEU C 1 84  ? 13.139  -11.055  -54.026 1.00 119.22 ? 163 LEU C O   1 
ATOM   2615  C CB  . LEU C 1 84  ? 15.466  -11.928  -51.962 1.00 108.33 ? 163 LEU C CB  1 
ATOM   2616  C CG  . LEU C 1 84  ? 16.293  -11.863  -50.688 1.00 110.04 ? 163 LEU C CG  1 
ATOM   2617  C CD1 . LEU C 1 84  ? 16.872  -13.230  -50.397 1.00 110.96 ? 163 LEU C CD1 1 
ATOM   2618  C CD2 . LEU C 1 84  ? 17.405  -10.833  -50.809 1.00 111.75 ? 163 LEU C CD2 1 
ATOM   2619  N N   . ALA C 1 85  ? 15.166  -11.209  -54.994 1.00 117.81 ? 164 ALA C N   1 
ATOM   2620  C CA  . ALA C 1 85  ? 14.662  -11.659  -56.283 1.00 117.77 ? 164 ALA C CA  1 
ATOM   2621  C C   . ALA C 1 85  ? 15.718  -12.531  -56.918 1.00 116.26 ? 164 ALA C C   1 
ATOM   2622  O O   . ALA C 1 85  ? 16.847  -12.102  -57.093 1.00 111.87 ? 164 ALA C O   1 
ATOM   2623  C CB  . ALA C 1 85  ? 14.351  -10.480  -57.177 1.00 121.72 ? 164 ALA C CB  1 
ATOM   2624  N N   . LEU C 1 86  ? 15.348  -13.767  -57.234 1.00 118.97 ? 165 LEU C N   1 
ATOM   2625  C CA  . LEU C 1 86  ? 16.228  -14.694  -57.913 1.00 119.32 ? 165 LEU C CA  1 
ATOM   2626  C C   . LEU C 1 86  ? 16.003  -14.508  -59.398 1.00 126.01 ? 165 LEU C C   1 
ATOM   2627  O O   . LEU C 1 86  ? 14.874  -14.657  -59.871 1.00 130.11 ? 165 LEU C O   1 
ATOM   2628  C CB  . LEU C 1 86  ? 15.887  -16.121  -57.523 1.00 118.20 ? 165 LEU C CB  1 
ATOM   2629  C CG  . LEU C 1 86  ? 16.794  -17.203  -58.100 1.00 123.43 ? 165 LEU C CG  1 
ATOM   2630  C CD1 . LEU C 1 86  ? 18.121  -17.238  -57.357 1.00 125.02 ? 165 LEU C CD1 1 
ATOM   2631  C CD2 . LEU C 1 86  ? 16.095  -18.546  -58.065 1.00 124.52 ? 165 LEU C CD2 1 
ATOM   2632  N N   . HIS C 1 87  ? 17.074  -14.173  -60.117 1.00 130.86 ? 166 HIS C N   1 
ATOM   2633  C CA  . HIS C 1 87  ? 17.044  -14.021  -61.573 1.00 137.83 ? 166 HIS C CA  1 
ATOM   2634  C C   . HIS C 1 87  ? 17.891  -15.106  -62.217 1.00 141.80 ? 166 HIS C C   1 
ATOM   2635  O O   . HIS C 1 87  ? 18.987  -15.414  -61.732 1.00 137.86 ? 166 HIS C O   1 
ATOM   2636  C CB  . HIS C 1 87  ? 17.574  -12.654  -61.975 1.00 140.36 ? 166 HIS C CB  1 
ATOM   2637  C CG  . HIS C 1 87  ? 16.698  -11.526  -61.544 1.00 141.28 ? 166 HIS C CG  1 
ATOM   2638  N ND1 . HIS C 1 87  ? 15.374  -11.435  -61.912 1.00 146.57 ? 166 HIS C ND1 1 
ATOM   2639  C CD2 . HIS C 1 87  ? 16.956  -10.437  -60.787 1.00 143.21 ? 166 HIS C CD2 1 
ATOM   2640  C CE1 . HIS C 1 87  ? 14.843  -10.355  -61.369 1.00 149.08 ? 166 HIS C CE1 1 
ATOM   2641  N NE2 . HIS C 1 87  ? 15.782  -9.732   -60.679 1.00 149.50 ? 166 HIS C NE2 1 
ATOM   2642  N N   . LEU C 1 88  ? 17.373  -15.686  -63.301 1.00 148.36 ? 167 LEU C N   1 
ATOM   2643  C CA  . LEU C 1 88  ? 18.084  -16.718  -64.055 1.00 150.82 ? 167 LEU C CA  1 
ATOM   2644  C C   . LEU C 1 88  ? 18.748  -16.128  -65.291 1.00 157.24 ? 167 LEU C C   1 
ATOM   2645  O O   . LEU C 1 88  ? 18.074  -15.504  -66.097 1.00 161.02 ? 167 LEU C O   1 
ATOM   2646  C CB  . LEU C 1 88  ? 17.110  -17.805  -64.495 1.00 147.55 ? 167 LEU C CB  1 
ATOM   2647  C CG  . LEU C 1 88  ? 16.352  -18.518  -63.383 1.00 143.48 ? 167 LEU C CG  1 
ATOM   2648  C CD1 . LEU C 1 88  ? 15.405  -19.531  -64.012 1.00 144.95 ? 167 LEU C CD1 1 
ATOM   2649  C CD2 . LEU C 1 88  ? 17.292  -19.201  -62.400 1.00 140.81 ? 167 LEU C CD2 1 
ATOM   2650  N N   . GLN C 1 89  ? 20.060  -16.316  -65.428 1.00 164.42 ? 168 GLN C N   1 
ATOM   2651  C CA  . GLN C 1 89  ? 20.774  -15.974  -66.654 1.00 170.63 ? 168 GLN C CA  1 
ATOM   2652  C C   . GLN C 1 89  ? 21.317  -17.283  -67.258 1.00 177.60 ? 168 GLN C C   1 
ATOM   2653  O O   . GLN C 1 89  ? 21.975  -18.046  -66.549 1.00 173.97 ? 168 GLN C O   1 
ATOM   2654  C CB  . GLN C 1 89  ? 21.913  -14.991  -66.341 1.00 167.29 ? 168 GLN C CB  1 
ATOM   2655  C CG  . GLN C 1 89  ? 22.618  -14.409  -67.566 1.00 170.87 ? 168 GLN C CG  1 
ATOM   2656  C CD  . GLN C 1 89  ? 21.820  -13.340  -68.307 1.00 172.62 ? 168 GLN C CD  1 
ATOM   2657  O OE1 . GLN C 1 89  ? 20.587  -13.320  -68.292 1.00 169.73 ? 168 GLN C OE1 1 
ATOM   2658  N NE2 . GLN C 1 89  ? 22.536  -12.447  -68.976 1.00 178.55 ? 168 GLN C NE2 1 
ATOM   2659  N N   . PRO C 1 90  ? 21.063  -17.573  -68.546 1.00 187.86 ? 169 PRO C N   1 
ATOM   2660  C CA  . PRO C 1 90  ? 20.387  -16.684  -69.512 1.00 190.73 ? 169 PRO C CA  1 
ATOM   2661  C C   . PRO C 1 90  ? 18.857  -16.648  -69.409 1.00 182.41 ? 169 PRO C C   1 
ATOM   2662  O O   . PRO C 1 90  ? 18.324  -15.591  -69.636 1.00 178.65 ? 169 PRO C O   1 
ATOM   2663  C CB  . PRO C 1 90  ? 20.806  -17.265  -70.865 1.00 194.25 ? 169 PRO C CB  1 
ATOM   2664  C CG  . PRO C 1 90  ? 21.057  -18.712  -70.598 1.00 192.33 ? 169 PRO C CG  1 
ATOM   2665  C CD  . PRO C 1 90  ? 21.561  -18.810  -69.186 1.00 189.14 ? 169 PRO C CD  1 
ATOM   2666  N N   . ALA C 1 97  ? 10.961  -11.097  -65.411 1.00 182.07 ? 176 ALA C N   1 
ATOM   2667  C CA  . ALA C 1 97  ? 10.235  -11.835  -64.376 1.00 180.96 ? 176 ALA C CA  1 
ATOM   2668  C C   . ALA C 1 97  ? 11.181  -12.644  -63.483 1.00 179.50 ? 176 ALA C C   1 
ATOM   2669  O O   . ALA C 1 97  ? 12.026  -13.392  -63.984 1.00 181.98 ? 176 ALA C O   1 
ATOM   2670  C CB  . ALA C 1 97  ? 9.206   -12.759  -65.010 1.00 181.38 ? 176 ALA C CB  1 
ATOM   2671  N N   . ALA C 1 98  ? 11.034  -12.493  -62.164 1.00 173.75 ? 177 ALA C N   1 
ATOM   2672  C CA  . ALA C 1 98  ? 11.880  -13.200  -61.204 1.00 164.84 ? 177 ALA C CA  1 
ATOM   2673  C C   . ALA C 1 98  ? 11.378  -14.627  -60.989 1.00 158.58 ? 177 ALA C C   1 
ATOM   2674  O O   . ALA C 1 98  ? 10.179  -14.856  -60.876 1.00 158.67 ? 177 ALA C O   1 
ATOM   2675  C CB  . ALA C 1 98  ? 11.913  -12.453  -59.892 1.00 164.31 ? 177 ALA C CB  1 
ATOM   2676  N N   . ALA C 1 99  ? 12.309  -15.573  -60.924 1.00 154.09 ? 178 ALA C N   1 
ATOM   2677  C CA  . ALA C 1 99  ? 11.991  -16.997  -60.749 1.00 155.11 ? 178 ALA C CA  1 
ATOM   2678  C C   . ALA C 1 99  ? 11.438  -17.281  -59.363 1.00 156.63 ? 178 ALA C C   1 
ATOM   2679  O O   . ALA C 1 99  ? 10.492  -18.063  -59.199 1.00 166.45 ? 178 ALA C O   1 
ATOM   2680  C CB  . ALA C 1 99  ? 13.231  -17.849  -60.978 1.00 153.22 ? 178 ALA C CB  1 
ATOM   2681  N N   . LEU C 1 100 ? 12.056  -16.637  -58.375 1.00 149.71 ? 179 LEU C N   1 
ATOM   2682  C CA  . LEU C 1 100 ? 11.685  -16.727  -56.972 1.00 141.28 ? 179 LEU C CA  1 
ATOM   2683  C C   . LEU C 1 100 ? 11.756  -15.298  -56.422 1.00 133.22 ? 179 LEU C C   1 
ATOM   2684  O O   . LEU C 1 100 ? 12.666  -14.547  -56.760 1.00 129.54 ? 179 LEU C O   1 
ATOM   2685  C CB  . LEU C 1 100 ? 12.678  -17.638  -56.262 1.00 143.18 ? 179 LEU C CB  1 
ATOM   2686  C CG  . LEU C 1 100 ? 12.295  -18.282  -54.941 1.00 146.43 ? 179 LEU C CG  1 
ATOM   2687  C CD1 . LEU C 1 100 ? 11.169  -19.253  -55.152 1.00 151.11 ? 179 LEU C CD1 1 
ATOM   2688  C CD2 . LEU C 1 100 ? 13.502  -18.983  -54.338 1.00 146.16 ? 179 LEU C CD2 1 
ATOM   2689  N N   . ALA C 1 101 ? 10.787  -14.914  -55.601 1.00 131.99 ? 180 ALA C N   1 
ATOM   2690  C CA  . ALA C 1 101 ? 10.782  -13.561  -55.048 1.00 129.32 ? 180 ALA C CA  1 
ATOM   2691  C C   . ALA C 1 101 ? 10.131  -13.493  -53.668 1.00 128.66 ? 180 ALA C C   1 
ATOM   2692  O O   . ALA C 1 101 ? 9.190   -14.221  -53.359 1.00 127.51 ? 180 ALA C O   1 
ATOM   2693  C CB  . ALA C 1 101 ? 10.113  -12.603  -56.006 1.00 127.97 ? 180 ALA C CB  1 
ATOM   2694  N N   . LEU C 1 102 ? 10.647  -12.581  -52.856 1.00 126.24 ? 181 LEU C N   1 
ATOM   2695  C CA  . LEU C 1 102 ? 10.320  -12.507  -51.445 1.00 125.00 ? 181 LEU C CA  1 
ATOM   2696  C C   . LEU C 1 102 ? 10.332  -11.063  -51.018 1.00 123.46 ? 181 LEU C C   1 
ATOM   2697  O O   . LEU C 1 102 ? 11.182  -10.310  -51.442 1.00 129.45 ? 181 LEU C O   1 
ATOM   2698  C CB  . LEU C 1 102 ? 11.376  -13.244  -50.651 1.00 124.54 ? 181 LEU C CB  1 
ATOM   2699  C CG  . LEU C 1 102 ? 10.934  -14.116  -49.500 1.00 127.13 ? 181 LEU C CG  1 
ATOM   2700  C CD1 . LEU C 1 102 ? 12.146  -14.627  -48.746 1.00 131.43 ? 181 LEU C CD1 1 
ATOM   2701  C CD2 . LEU C 1 102 ? 9.989   -13.397  -48.570 1.00 127.72 ? 181 LEU C CD2 1 
ATOM   2702  N N   . THR C 1 103 ? 9.388   -10.679  -50.181 1.00 123.83 ? 182 THR C N   1 
ATOM   2703  C CA  . THR C 1 103 ? 9.447   -9.361   -49.574 1.00 122.48 ? 182 THR C CA  1 
ATOM   2704  C C   . THR C 1 103 ? 9.149   -9.509   -48.094 1.00 118.84 ? 182 THR C C   1 
ATOM   2705  O O   . THR C 1 103 ? 8.332   -10.346  -47.700 1.00 125.89 ? 182 THR C O   1 
ATOM   2706  C CB  . THR C 1 103 ? 8.487   -8.387   -50.270 1.00 126.23 ? 182 THR C CB  1 
ATOM   2707  O OG1 . THR C 1 103 ? 8.844   -8.293   -51.657 1.00 128.28 ? 182 THR C OG1 1 
ATOM   2708  C CG2 . THR C 1 103 ? 8.549   -7.009   -49.649 1.00 127.16 ? 182 THR C CG2 1 
ATOM   2709  N N   . VAL C 1 104 ? 9.839   -8.709   -47.291 1.00 115.75 ? 183 VAL C N   1 
ATOM   2710  C CA  . VAL C 1 104 ? 9.770   -8.772   -45.846 1.00 117.53 ? 183 VAL C CA  1 
ATOM   2711  C C   . VAL C 1 104 ? 9.474   -7.365   -45.349 1.00 123.91 ? 183 VAL C C   1 
ATOM   2712  O O   . VAL C 1 104 ? 10.183  -6.438   -45.702 1.00 130.19 ? 183 VAL C O   1 
ATOM   2713  C CB  . VAL C 1 104 ? 11.106  -9.279   -45.299 1.00 113.93 ? 183 VAL C CB  1 
ATOM   2714  C CG1 . VAL C 1 104 ? 11.199  -9.108   -43.791 1.00 113.10 ? 183 VAL C CG1 1 
ATOM   2715  C CG2 . VAL C 1 104 ? 11.285  -10.736  -45.660 1.00 112.58 ? 183 VAL C CG2 1 
ATOM   2716  N N   . ASP C 1 105 ? 8.430   -7.210   -44.547 1.00 130.08 ? 184 ASP C N   1 
ATOM   2717  C CA  . ASP C 1 105 ? 8.104   -5.906   -43.993 1.00 139.29 ? 184 ASP C CA  1 
ATOM   2718  C C   . ASP C 1 105 ? 9.002   -5.660   -42.791 1.00 136.90 ? 184 ASP C C   1 
ATOM   2719  O O   . ASP C 1 105 ? 9.243   -6.562   -41.989 1.00 134.62 ? 184 ASP C O   1 
ATOM   2720  C CB  . ASP C 1 105 ? 6.635   -5.819   -43.572 1.00 155.12 ? 184 ASP C CB  1 
ATOM   2721  C CG  . ASP C 1 105 ? 5.666   -5.758   -44.759 1.00 172.29 ? 184 ASP C CG  1 
ATOM   2722  O OD1 . ASP C 1 105 ? 4.554   -5.204   -44.557 1.00 187.83 ? 184 ASP C OD1 1 
ATOM   2723  O OD2 . ASP C 1 105 ? 5.999   -6.256   -45.869 1.00 181.97 ? 184 ASP C OD2 1 
ATOM   2724  N N   . LEU C 1 106 ? 9.523   -4.437   -42.700 1.00 137.06 ? 185 LEU C N   1 
ATOM   2725  C CA  . LEU C 1 106 ? 10.272  -3.980   -41.544 1.00 135.25 ? 185 LEU C CA  1 
ATOM   2726  C C   . LEU C 1 106 ? 9.312   -3.172   -40.667 1.00 136.82 ? 185 LEU C C   1 
ATOM   2727  O O   . LEU C 1 106 ? 8.893   -2.074   -41.044 1.00 136.29 ? 185 LEU C O   1 
ATOM   2728  C CB  . LEU C 1 106 ? 11.447  -3.109   -41.977 1.00 134.53 ? 185 LEU C CB  1 
ATOM   2729  C CG  . LEU C 1 106 ? 12.406  -3.719   -42.995 1.00 133.12 ? 185 LEU C CG  1 
ATOM   2730  C CD1 . LEU C 1 106 ? 13.469  -2.676   -43.285 1.00 140.37 ? 185 LEU C CD1 1 
ATOM   2731  C CD2 . LEU C 1 106 ? 13.022  -5.029   -42.510 1.00 131.82 ? 185 LEU C CD2 1 
ATOM   2732  N N   . PRO C 1 107 ? 8.948   -3.710   -39.495 1.00 138.63 ? 186 PRO C N   1 
ATOM   2733  C CA  . PRO C 1 107 ? 7.952   -3.023   -38.683 1.00 142.62 ? 186 PRO C CA  1 
ATOM   2734  C C   . PRO C 1 107 ? 8.460   -1.696   -38.121 1.00 144.56 ? 186 PRO C C   1 
ATOM   2735  O O   . PRO C 1 107 ? 9.657   -1.553   -37.867 1.00 148.60 ? 186 PRO C O   1 
ATOM   2736  C CB  . PRO C 1 107 ? 7.678   -4.003   -37.559 1.00 145.83 ? 186 PRO C CB  1 
ATOM   2737  C CG  . PRO C 1 107 ? 8.961   -4.780   -37.445 1.00 145.41 ? 186 PRO C CG  1 
ATOM   2738  C CD  . PRO C 1 107 ? 9.494   -4.905   -38.826 1.00 141.39 ? 186 PRO C CD  1 
ATOM   2739  N N   . PRO C 1 108 ? 7.559   -0.724   -37.914 1.00 145.94 ? 187 PRO C N   1 
ATOM   2740  C CA  . PRO C 1 108 ? 8.001   0.586    -37.474 1.00 147.92 ? 187 PRO C CA  1 
ATOM   2741  C C   . PRO C 1 108 ? 8.179   0.606    -35.955 1.00 148.76 ? 187 PRO C C   1 
ATOM   2742  O O   . PRO C 1 108 ? 7.293   0.160    -35.218 1.00 159.08 ? 187 PRO C O   1 
ATOM   2743  C CB  . PRO C 1 108 ? 6.852   1.489    -37.910 1.00 152.02 ? 187 PRO C CB  1 
ATOM   2744  C CG  . PRO C 1 108 ? 5.646   0.625    -37.817 1.00 154.02 ? 187 PRO C CG  1 
ATOM   2745  C CD  . PRO C 1 108 ? 6.095   -0.793   -38.071 1.00 150.32 ? 187 PRO C CD  1 
ATOM   2746  N N   . ALA C 1 109 ? 9.330   1.046    -35.469 1.00 147.93 ? 188 ALA C N   1 
ATOM   2747  C CA  . ALA C 1 109 ? 9.684   0.807    -34.050 1.00 148.80 ? 188 ALA C CA  1 
ATOM   2748  C C   . ALA C 1 109 ? 8.647   1.334    -33.012 1.00 150.10 ? 188 ALA C C   1 
ATOM   2749  O O   . ALA C 1 109 ? 8.543   2.528    -32.746 1.00 152.42 ? 188 ALA C O   1 
ATOM   2750  C CB  . ALA C 1 109 ? 11.049  1.373    -33.774 1.00 149.88 ? 188 ALA C CB  1 
ATOM   2751  N N   . SER C 1 110 ? 7.909   0.403    -32.416 1.00 156.34 ? 189 SER C N   1 
ATOM   2752  C CA  . SER C 1 110 ? 6.804   0.682    -31.485 1.00 161.32 ? 189 SER C CA  1 
ATOM   2753  C C   . SER C 1 110 ? 7.187   0.310    -30.051 1.00 167.68 ? 189 SER C C   1 
ATOM   2754  O O   . SER C 1 110 ? 8.307   -0.137   -29.791 1.00 171.09 ? 189 SER C O   1 
ATOM   2755  C CB  . SER C 1 110 ? 5.552   -0.133   -31.877 1.00 157.23 ? 189 SER C CB  1 
ATOM   2756  N N   . SER C 1 111 ? 6.229   0.415    -29.153 1.00 173.19 ? 190 SER C N   1 
ATOM   2757  C CA  . SER C 1 111 ? 6.475   -0.015   -27.801 1.00 176.26 ? 190 SER C CA  1 
ATOM   2758  C C   . SER C 1 111 ? 6.762   -1.502   -27.920 1.00 175.69 ? 190 SER C C   1 
ATOM   2759  O O   . SER C 1 111 ? 7.651   -2.025   -27.262 1.00 163.95 ? 190 SER C O   1 
ATOM   2760  C CB  . SER C 1 111 ? 5.239   0.202    -26.940 1.00 177.65 ? 190 SER C CB  1 
ATOM   2761  N N   . GLU C 1 112 ? 6.018   -2.176   -28.792 1.00 182.64 ? 191 GLU C N   1 
ATOM   2762  C CA  . GLU C 1 112 ? 6.185   -3.600   -28.988 1.00 182.96 ? 191 GLU C CA  1 
ATOM   2763  C C   . GLU C 1 112 ? 7.590   -3.885   -29.471 1.00 185.33 ? 191 GLU C C   1 
ATOM   2764  O O   . GLU C 1 112 ? 8.222   -4.804   -28.972 1.00 188.23 ? 191 GLU C O   1 
ATOM   2765  C CB  . GLU C 1 112 ? 5.178   -4.107   -30.013 1.00 181.48 ? 191 GLU C CB  1 
ATOM   2766  N N   . ALA C 1 113 ? 8.081   -3.095   -30.424 1.00 186.13 ? 192 ALA C N   1 
ATOM   2767  C CA  . ALA C 1 113 ? 9.453   -3.253   -30.904 1.00 179.56 ? 192 ALA C CA  1 
ATOM   2768  C C   . ALA C 1 113 ? 9.873   -4.667   -31.302 1.00 173.19 ? 192 ALA C C   1 
ATOM   2769  O O   . ALA C 1 113 ? 10.719  -5.248   -30.632 1.00 182.73 ? 192 ALA C O   1 
ATOM   2770  C CB  . ALA C 1 113 ? 10.437  -2.666   -29.902 1.00 181.29 ? 192 ALA C CB  1 
ATOM   2771  N N   . ARG C 1 114 ? 9.312   -5.217   -32.377 1.00 158.70 ? 193 ARG C N   1 
ATOM   2772  C CA  . ARG C 1 114 ? 9.632   -6.593   -32.762 1.00 151.89 ? 193 ARG C CA  1 
ATOM   2773  C C   . ARG C 1 114 ? 11.129  -6.778   -32.974 1.00 145.63 ? 193 ARG C C   1 
ATOM   2774  O O   . ARG C 1 114 ? 11.702  -7.762   -32.531 1.00 151.71 ? 193 ARG C O   1 
ATOM   2775  C CB  . ARG C 1 114 ? 8.879   -6.966   -34.033 1.00 145.26 ? 193 ARG C CB  1 
ATOM   2776  N N   . ASN C 1 115 ? 11.762  -5.828   -33.630 1.00 136.01 ? 194 ASN C N   1 
ATOM   2777  C CA  . ASN C 1 115 ? 13.219  -5.832   -33.774 1.00 135.41 ? 194 ASN C CA  1 
ATOM   2778  C C   . ASN C 1 115 ? 13.829  -6.963   -34.603 1.00 135.23 ? 194 ASN C C   1 
ATOM   2779  O O   . ASN C 1 115 ? 14.976  -7.324   -34.402 1.00 130.68 ? 194 ASN C O   1 
ATOM   2780  C CB  . ASN C 1 115 ? 13.925  -5.684   -32.433 1.00 134.57 ? 194 ASN C CB  1 
ATOM   2781  C CG  . ASN C 1 115 ? 13.720  -4.324   -31.840 1.00 136.38 ? 194 ASN C CG  1 
ATOM   2782  O OD1 . ASN C 1 115 ? 13.203  -3.431   -32.499 1.00 139.54 ? 194 ASN C OD1 1 
ATOM   2783  N ND2 . ASN C 1 115 ? 14.121  -4.153   -30.598 1.00 140.06 ? 194 ASN C ND2 1 
ATOM   2784  N N   . SER C 1 116 ? 13.069  -7.493   -35.551 1.00 136.15 ? 195 SER C N   1 
ATOM   2785  C CA  . SER C 1 116 ? 13.552  -8.536   -36.460 1.00 130.47 ? 195 SER C CA  1 
ATOM   2786  C C   . SER C 1 116 ? 12.525  -8.855   -37.531 1.00 123.74 ? 195 SER C C   1 
ATOM   2787  O O   . SER C 1 116 ? 11.373  -8.487   -37.408 1.00 119.72 ? 195 SER C O   1 
ATOM   2788  C CB  . SER C 1 116 ? 13.888  -9.813   -35.710 1.00 132.82 ? 195 SER C CB  1 
ATOM   2789  O OG  . SER C 1 116 ? 12.737  -10.615  -35.578 1.00 140.81 ? 195 SER C OG  1 
ATOM   2790  N N   . ALA C 1 117 ? 12.930  -9.567   -38.570 1.00 120.23 ? 196 ALA C N   1 
ATOM   2791  C CA  . ALA C 1 117 ? 11.984  -9.909   -39.621 1.00 121.28 ? 196 ALA C CA  1 
ATOM   2792  C C   . ALA C 1 117 ? 12.510  -11.018  -40.509 1.00 116.68 ? 196 ALA C C   1 
ATOM   2793  O O   . ALA C 1 117 ? 13.561  -10.867  -41.100 1.00 114.74 ? 196 ALA C O   1 
ATOM   2794  C CB  . ALA C 1 117 ? 11.669  -8.678   -40.458 1.00 123.98 ? 196 ALA C CB  1 
ATOM   2795  N N   . PHE C 1 118 ? 11.760  -12.128  -40.584 1.00 114.34 ? 197 PHE C N   1 
ATOM   2796  C CA  . PHE C 1 118 ? 12.124  -13.305  -41.381 1.00 109.04 ? 197 PHE C CA  1 
ATOM   2797  C C   . PHE C 1 118 ? 11.266  -13.357  -42.626 1.00 107.87 ? 197 PHE C C   1 
ATOM   2798  O O   . PHE C 1 118 ? 10.270  -12.662  -42.751 1.00 109.57 ? 197 PHE C O   1 
ATOM   2799  C CB  . PHE C 1 118 ? 11.956  -14.614  -40.603 1.00 106.09 ? 197 PHE C CB  1 
ATOM   2800  N N   . GLY C 1 119 ? 11.673  -14.211  -43.543 1.00 111.57 ? 198 GLY C N   1 
ATOM   2801  C CA  . GLY C 1 119 ? 10.977  -14.401  -44.809 1.00 111.85 ? 198 GLY C CA  1 
ATOM   2802  C C   . GLY C 1 119 ? 11.580  -15.605  -45.493 1.00 113.50 ? 198 GLY C C   1 
ATOM   2803  O O   . GLY C 1 119 ? 12.794  -15.687  -45.679 1.00 109.72 ? 198 GLY C O   1 
ATOM   2804  N N   . PHE C 1 120 ? 10.727  -16.557  -45.848 1.00 111.65 ? 199 PHE C N   1 
ATOM   2805  C CA  . PHE C 1 120 ? 11.165  -17.768  -46.527 1.00 109.91 ? 199 PHE C CA  1 
ATOM   2806  C C   . PHE C 1 120 ? 10.283  -17.999  -47.724 1.00 112.91 ? 199 PHE C C   1 
ATOM   2807  O O   . PHE C 1 120 ? 9.075   -17.847  -47.637 1.00 120.52 ? 199 PHE C O   1 
ATOM   2808  C CB  . PHE C 1 120 ? 11.053  -18.968  -45.598 1.00 110.21 ? 199 PHE C CB  1 
ATOM   2809  C CG  . PHE C 1 120 ? 11.375  -20.268  -46.257 1.00 109.84 ? 199 PHE C CG  1 
ATOM   2810  C CD1 . PHE C 1 120 ? 12.658  -20.792  -46.186 1.00 111.99 ? 199 PHE C CD1 1 
ATOM   2811  C CD2 . PHE C 1 120 ? 10.403  -20.963  -46.954 1.00 111.23 ? 199 PHE C CD2 1 
ATOM   2812  C CE1 . PHE C 1 120 ? 12.964  -21.998  -46.797 1.00 113.38 ? 199 PHE C CE1 1 
ATOM   2813  C CE2 . PHE C 1 120 ? 10.705  -22.158  -47.574 1.00 114.23 ? 199 PHE C CE2 1 
ATOM   2814  C CZ  . PHE C 1 120 ? 11.984  -22.684  -47.498 1.00 115.36 ? 199 PHE C CZ  1 
ATOM   2815  N N   . GLN C 1 121 ? 10.892  -18.393  -48.831 1.00 113.25 ? 200 GLN C N   1 
ATOM   2816  C CA  . GLN C 1 121 ? 10.152  -18.884  -49.972 1.00 117.57 ? 200 GLN C CA  1 
ATOM   2817  C C   . GLN C 1 121 ? 10.931  -20.001  -50.634 1.00 118.65 ? 200 GLN C C   1 
ATOM   2818  O O   . GLN C 1 121 ? 12.156  -20.007  -50.623 1.00 120.61 ? 200 GLN C O   1 
ATOM   2819  C CB  . GLN C 1 121 ? 9.881   -17.771  -50.973 1.00 120.58 ? 200 GLN C CB  1 
ATOM   2820  C CG  . GLN C 1 121 ? 9.150   -18.276  -52.202 1.00 126.50 ? 200 GLN C CG  1 
ATOM   2821  C CD  . GLN C 1 121 ? 8.270   -17.254  -52.866 1.00 132.44 ? 200 GLN C CD  1 
ATOM   2822  O OE1 . GLN C 1 121 ? 8.450   -16.923  -54.047 1.00 134.85 ? 200 GLN C OE1 1 
ATOM   2823  N NE2 . GLN C 1 121 ? 7.285   -16.767  -52.125 1.00 139.40 ? 200 GLN C NE2 1 
ATOM   2824  N N   . GLY C 1 122 ? 10.202  -20.961  -51.189 1.00 119.67 ? 201 GLY C N   1 
ATOM   2825  C CA  . GLY C 1 122 ? 10.803  -21.967  -52.039 1.00 120.11 ? 201 GLY C CA  1 
ATOM   2826  C C   . GLY C 1 122 ? 9.788   -22.513  -53.009 1.00 121.80 ? 201 GLY C C   1 
ATOM   2827  O O   . GLY C 1 122 ? 8.589   -22.465  -52.740 1.00 128.30 ? 201 GLY C O   1 
ATOM   2828  N N   . ARG C 1 123 ? 10.270  -22.995  -54.152 1.00 121.74 ? 202 ARG C N   1 
ATOM   2829  C CA  . ARG C 1 123 ? 9.440   -23.724  -55.110 1.00 124.77 ? 202 ARG C CA  1 
ATOM   2830  C C   . ARG C 1 123 ? 10.301  -24.515  -56.072 1.00 125.98 ? 202 ARG C C   1 
ATOM   2831  O O   . ARG C 1 123 ? 11.520  -24.375  -56.081 1.00 125.64 ? 202 ARG C O   1 
ATOM   2832  C CB  . ARG C 1 123 ? 8.533   -22.780  -55.893 1.00 125.51 ? 202 ARG C CB  1 
ATOM   2833  C CG  . ARG C 1 123 ? 9.274   -21.796  -56.756 1.00 126.76 ? 202 ARG C CG  1 
ATOM   2834  C CD  . ARG C 1 123 ? 8.512   -20.477  -56.866 1.00 130.93 ? 202 ARG C CD  1 
ATOM   2835  N NE  . ARG C 1 123 ? 7.510   -20.489  -57.922 1.00 138.52 ? 202 ARG C NE  1 
ATOM   2836  C CZ  . ARG C 1 123 ? 6.664   -19.497  -58.170 1.00 142.02 ? 202 ARG C CZ  1 
ATOM   2837  N NH1 . ARG C 1 123 ? 6.657   -18.390  -57.424 1.00 145.55 ? 202 ARG C NH1 1 
ATOM   2838  N NH2 . ARG C 1 123 ? 5.805   -19.609  -59.183 1.00 145.01 ? 202 ARG C NH2 1 
ATOM   2839  N N   . LEU C 1 124 ? 9.643   -25.347  -56.878 1.00 128.41 ? 203 LEU C N   1 
ATOM   2840  C CA  . LEU C 1 124 ? 10.325  -26.143  -57.889 1.00 129.46 ? 203 LEU C CA  1 
ATOM   2841  C C   . LEU C 1 124 ? 10.628  -25.284  -59.114 1.00 130.20 ? 203 LEU C C   1 
ATOM   2842  O O   . LEU C 1 124 ? 9.744   -24.577  -59.618 1.00 128.13 ? 203 LEU C O   1 
ATOM   2843  C CB  . LEU C 1 124 ? 9.472   -27.341  -58.286 1.00 131.39 ? 203 LEU C CB  1 
ATOM   2844  C CG  . LEU C 1 124 ? 9.148   -28.305  -57.137 1.00 130.52 ? 203 LEU C CG  1 
ATOM   2845  C CD1 . LEU C 1 124 ? 7.974   -29.206  -57.523 1.00 131.41 ? 203 LEU C CD1 1 
ATOM   2846  C CD2 . LEU C 1 124 ? 10.392  -29.103  -56.728 1.00 129.07 ? 203 LEU C CD2 1 
ATOM   2847  N N   . LEU C 1 125 ? 11.881  -25.334  -59.570 1.00 129.86 ? 204 LEU C N   1 
ATOM   2848  C CA  . LEU C 1 125 ? 12.316  -24.621  -60.766 1.00 130.86 ? 204 LEU C CA  1 
ATOM   2849  C C   . LEU C 1 125 ? 12.969  -25.614  -61.702 1.00 132.53 ? 204 LEU C C   1 
ATOM   2850  O O   . LEU C 1 125 ? 13.870  -26.346  -61.287 1.00 129.71 ? 204 LEU C O   1 
ATOM   2851  C CB  . LEU C 1 125 ? 13.350  -23.544  -60.413 1.00 128.84 ? 204 LEU C CB  1 
ATOM   2852  C CG  . LEU C 1 125 ? 12.945  -22.398  -59.495 1.00 124.68 ? 204 LEU C CG  1 
ATOM   2853  C CD1 . LEU C 1 125 ? 14.096  -21.431  -59.369 1.00 121.88 ? 204 LEU C CD1 1 
ATOM   2854  C CD2 . LEU C 1 125 ? 11.708  -21.682  -60.006 1.00 125.77 ? 204 LEU C CD2 1 
ATOM   2855  N N   . HIS C 1 126 ? 12.525  -25.645  -62.956 1.00 139.45 ? 205 HIS C N   1 
ATOM   2856  C CA  . HIS C 1 126 ? 13.222  -26.396  -63.991 1.00 142.71 ? 205 HIS C CA  1 
ATOM   2857  C C   . HIS C 1 126 ? 14.433  -25.557  -64.370 1.00 144.80 ? 205 HIS C C   1 
ATOM   2858  O O   . HIS C 1 126 ? 14.289  -24.428  -64.839 1.00 144.34 ? 205 HIS C O   1 
ATOM   2859  C CB  . HIS C 1 126 ? 12.315  -26.676  -65.202 1.00 145.02 ? 205 HIS C CB  1 
ATOM   2860  N N   . LEU C 1 127 ? 15.624  -26.093  -64.114 1.00 149.83 ? 206 LEU C N   1 
ATOM   2861  C CA  . LEU C 1 127 ? 16.871  -25.411  -64.445 1.00 152.52 ? 206 LEU C CA  1 
ATOM   2862  C C   . LEU C 1 127 ? 17.531  -26.071  -65.652 1.00 160.21 ? 206 LEU C C   1 
ATOM   2863  O O   . LEU C 1 127 ? 17.510  -27.295  -65.805 1.00 160.47 ? 206 LEU C O   1 
ATOM   2864  C CB  . LEU C 1 127 ? 17.822  -25.440  -63.256 1.00 147.25 ? 206 LEU C CB  1 
ATOM   2865  C CG  . LEU C 1 127 ? 17.303  -24.803  -61.959 1.00 142.58 ? 206 LEU C CG  1 
ATOM   2866  C CD1 . LEU C 1 127 ? 18.363  -24.904  -60.861 1.00 139.19 ? 206 LEU C CD1 1 
ATOM   2867  C CD2 . LEU C 1 127 ? 16.887  -23.360  -62.178 1.00 140.06 ? 206 LEU C CD2 1 
ATOM   2868  N N   . SER C 1 128 ? 18.107  -25.243  -66.517 1.00 164.79 ? 207 SER C N   1 
ATOM   2869  C CA  . SER C 1 128 ? 18.837  -25.691  -67.695 1.00 164.84 ? 207 SER C CA  1 
ATOM   2870  C C   . SER C 1 128 ? 20.259  -26.061  -67.300 1.00 161.43 ? 207 SER C C   1 
ATOM   2871  O O   . SER C 1 128 ? 20.736  -25.702  -66.216 1.00 157.04 ? 207 SER C O   1 
ATOM   2872  C CB  . SER C 1 128 ? 18.871  -24.583  -68.741 1.00 169.51 ? 207 SER C CB  1 
ATOM   2873  O OG  . SER C 1 128 ? 17.609  -23.946  -68.832 1.00 175.94 ? 207 SER C OG  1 
ATOM   2874  N N   . ALA C 1 129 ? 20.937  -26.785  -68.186 1.00 164.72 ? 208 ALA C N   1 
ATOM   2875  C CA  . ALA C 1 129 ? 22.348  -27.090  -68.004 1.00 164.35 ? 208 ALA C CA  1 
ATOM   2876  C C   . ALA C 1 129 ? 23.143  -25.787  -68.151 1.00 163.15 ? 208 ALA C C   1 
ATOM   2877  O O   . ALA C 1 129 ? 22.866  -24.991  -69.049 1.00 165.07 ? 208 ALA C O   1 
ATOM   2878  C CB  . ALA C 1 129 ? 22.807  -28.124  -69.019 1.00 163.67 ? 208 ALA C CB  1 
ATOM   2879  N N   . GLY C 1 130 ? 24.099  -25.565  -67.255 1.00 157.55 ? 209 GLY C N   1 
ATOM   2880  C CA  . GLY C 1 130 ? 24.896  -24.334  -67.258 1.00 159.95 ? 209 GLY C CA  1 
ATOM   2881  C C   . GLY C 1 130 ? 24.130  -23.056  -66.933 1.00 162.73 ? 209 GLY C C   1 
ATOM   2882  O O   . GLY C 1 130 ? 24.528  -21.968  -67.359 1.00 165.19 ? 209 GLY C O   1 
ATOM   2883  N N   . GLN C 1 131 ? 23.039  -23.187  -66.176 1.00 165.73 ? 210 GLN C N   1 
ATOM   2884  C CA  . GLN C 1 131 ? 22.225  -22.042  -65.759 1.00 163.12 ? 210 GLN C CA  1 
ATOM   2885  C C   . GLN C 1 131 ? 22.917  -21.317  -64.604 1.00 160.62 ? 210 GLN C C   1 
ATOM   2886  O O   . GLN C 1 131 ? 23.371  -21.956  -63.649 1.00 148.66 ? 210 GLN C O   1 
ATOM   2887  C CB  . GLN C 1 131 ? 20.828  -22.508  -65.323 1.00 160.48 ? 210 GLN C CB  1 
ATOM   2888  C CG  . GLN C 1 131 ? 19.840  -21.384  -65.035 1.00 157.48 ? 210 GLN C CG  1 
ATOM   2889  C CD  . GLN C 1 131 ? 19.012  -20.997  -66.237 1.00 157.76 ? 210 GLN C CD  1 
ATOM   2890  O OE1 . GLN C 1 131 ? 19.260  -19.985  -66.872 1.00 158.70 ? 210 GLN C OE1 1 
ATOM   2891  N NE2 . GLN C 1 131 ? 18.005  -21.795  -66.547 1.00 157.17 ? 210 GLN C NE2 1 
ATOM   2892  N N   . ARG C 1 132 ? 22.979  -19.992  -64.708 1.00 163.21 ? 211 ARG C N   1 
ATOM   2893  C CA  . ARG C 1 132 ? 23.592  -19.134  -63.694 1.00 161.44 ? 211 ARG C CA  1 
ATOM   2894  C C   . ARG C 1 132 ? 22.509  -18.385  -62.890 1.00 158.30 ? 211 ARG C C   1 
ATOM   2895  O O   . ARG C 1 132 ? 21.901  -17.438  -63.392 1.00 161.81 ? 211 ARG C O   1 
ATOM   2896  C CB  . ARG C 1 132 ? 24.559  -18.149  -64.363 1.00 157.78 ? 211 ARG C CB  1 
ATOM   2897  N N   . LEU C 1 133 ? 22.261  -18.837  -61.660 1.00 157.82 ? 212 LEU C N   1 
ATOM   2898  C CA  . LEU C 1 133 ? 21.293  -18.203  -60.752 1.00 153.76 ? 212 LEU C CA  1 
ATOM   2899  C C   . LEU C 1 133 ? 21.989  -17.088  -59.964 1.00 147.55 ? 212 LEU C C   1 
ATOM   2900  O O   . LEU C 1 133 ? 23.097  -17.289  -59.468 1.00 141.63 ? 212 LEU C O   1 
ATOM   2901  C CB  . LEU C 1 133 ? 20.697  -19.235  -59.775 1.00 144.98 ? 212 LEU C CB  1 
ATOM   2902  N N   . GLY C 1 134 ? 21.339  -15.931  -59.863 1.00 141.29 ? 213 GLY C N   1 
ATOM   2903  C CA  . GLY C 1 134 ? 21.830  -14.805  -59.050 1.00 136.66 ? 213 GLY C CA  1 
ATOM   2904  C C   . GLY C 1 134 ? 20.705  -14.101  -58.315 1.00 131.52 ? 213 GLY C C   1 
ATOM   2905  O O   . GLY C 1 134 ? 19.567  -14.079  -58.794 1.00 130.06 ? 213 GLY C O   1 
ATOM   2906  N N   . VAL C 1 135 ? 21.007  -13.513  -57.158 1.00 127.15 ? 214 VAL C N   1 
ATOM   2907  C CA  . VAL C 1 135 ? 19.996  -12.928  -56.271 1.00 128.11 ? 214 VAL C CA  1 
ATOM   2908  C C   . VAL C 1 135 ? 20.208  -11.430  -56.112 1.00 129.76 ? 214 VAL C C   1 
ATOM   2909  O O   . VAL C 1 135 ? 21.324  -10.994  -55.867 1.00 130.52 ? 214 VAL C O   1 
ATOM   2910  C CB  . VAL C 1 135 ? 20.053  -13.568  -54.871 1.00 128.75 ? 214 VAL C CB  1 
ATOM   2911  C CG1 . VAL C 1 135 ? 18.920  -13.057  -53.991 1.00 131.46 ? 214 VAL C CG1 1 
ATOM   2912  C CG2 . VAL C 1 135 ? 19.984  -15.087  -54.970 1.00 127.61 ? 214 VAL C CG2 1 
ATOM   2913  N N   . HIS C 1 136 ? 19.128  -10.656  -56.215 1.00 131.15 ? 215 HIS C N   1 
ATOM   2914  C CA  . HIS C 1 136 ? 19.180  -9.194   -56.148 1.00 132.84 ? 215 HIS C CA  1 
ATOM   2915  C C   . HIS C 1 136 ? 18.344  -8.642   -54.999 1.00 131.49 ? 215 HIS C C   1 
ATOM   2916  O O   . HIS C 1 136 ? 17.169  -8.976   -54.848 1.00 127.30 ? 215 HIS C O   1 
ATOM   2917  C CB  . HIS C 1 136 ? 18.722  -8.586   -57.479 1.00 137.25 ? 215 HIS C CB  1 
ATOM   2918  N N   . LEU C 1 137 ? 18.964  -7.775   -54.209 1.00 135.15 ? 216 LEU C N   1 
ATOM   2919  C CA  . LEU C 1 137 ? 18.347  -7.134   -53.057 1.00 133.45 ? 216 LEU C CA  1 
ATOM   2920  C C   . LEU C 1 137 ? 17.799  -5.772   -53.443 1.00 134.32 ? 216 LEU C C   1 
ATOM   2921  O O   . LEU C 1 137 ? 18.481  -5.003   -54.093 1.00 135.40 ? 216 LEU C O   1 
ATOM   2922  C CB  . LEU C 1 137 ? 19.394  -6.948   -51.967 1.00 131.88 ? 216 LEU C CB  1 
ATOM   2923  C CG  . LEU C 1 137 ? 18.878  -6.408   -50.637 1.00 132.54 ? 216 LEU C CG  1 
ATOM   2924  C CD1 . LEU C 1 137 ? 18.071  -7.488   -49.921 1.00 133.13 ? 216 LEU C CD1 1 
ATOM   2925  C CD2 . LEU C 1 137 ? 20.038  -5.904   -49.786 1.00 134.19 ? 216 LEU C CD2 1 
ATOM   2926  N N   . HIS C 1 138 ? 16.570  -5.482   -53.048 1.00 138.33 ? 217 HIS C N   1 
ATOM   2927  C CA  . HIS C 1 138 ? 15.978  -4.162   -53.230 1.00 147.75 ? 217 HIS C CA  1 
ATOM   2928  C C   . HIS C 1 138 ? 15.306  -3.757   -51.936 1.00 146.08 ? 217 HIS C C   1 
ATOM   2929  O O   . HIS C 1 138 ? 14.752  -4.603   -51.242 1.00 149.84 ? 217 HIS C O   1 
ATOM   2930  C CB  . HIS C 1 138 ? 14.954  -4.168   -54.366 1.00 159.69 ? 217 HIS C CB  1 
ATOM   2931  C CG  . HIS C 1 138 ? 14.393  -2.813   -54.663 1.00 173.10 ? 217 HIS C CG  1 
ATOM   2932  N ND1 . HIS C 1 138 ? 14.972  -1.947   -55.564 1.00 184.59 ? 217 HIS C ND1 1 
ATOM   2933  C CD2 . HIS C 1 138 ? 13.320  -2.164   -54.154 1.00 179.38 ? 217 HIS C CD2 1 
ATOM   2934  C CE1 . HIS C 1 138 ? 14.275  -0.824   -55.605 1.00 188.60 ? 217 HIS C CE1 1 
ATOM   2935  N NE2 . HIS C 1 138 ? 13.269  -0.929   -54.755 1.00 186.42 ? 217 HIS C NE2 1 
ATOM   2936  N N   . THR C 1 139 ? 15.326  -2.467   -51.625 1.00 148.59 ? 218 THR C N   1 
ATOM   2937  C CA  . THR C 1 139 ? 14.830  -1.991   -50.334 1.00 151.55 ? 218 THR C CA  1 
ATOM   2938  C C   . THR C 1 139 ? 14.164  -0.615   -50.415 1.00 150.71 ? 218 THR C C   1 
ATOM   2939  O O   . THR C 1 139 ? 14.797  0.346    -50.824 1.00 146.65 ? 218 THR C O   1 
ATOM   2940  C CB  . THR C 1 139 ? 15.942  -2.022   -49.242 1.00 148.94 ? 218 THR C CB  1 
ATOM   2941  O OG1 . THR C 1 139 ? 15.754  -0.939   -48.309 1.00 144.52 ? 218 THR C OG1 1 
ATOM   2942  C CG2 . THR C 1 139 ? 17.345  -1.929   -49.839 1.00 146.09 ? 218 THR C CG2 1 
ATOM   2943  N N   . GLU C 1 140 ? 12.879  -0.564   -50.040 1.00 156.78 ? 219 GLU C N   1 
ATOM   2944  C CA  . GLU C 1 140 ? 12.138  0.685    -49.823 1.00 160.48 ? 219 GLU C CA  1 
ATOM   2945  C C   . GLU C 1 140 ? 12.575  1.341    -48.505 1.00 161.54 ? 219 GLU C C   1 
ATOM   2946  O O   . GLU C 1 140 ? 12.029  1.056    -47.430 1.00 154.10 ? 219 GLU C O   1 
ATOM   2947  C CB  . GLU C 1 140 ? 10.624  0.431    -49.807 1.00 157.92 ? 219 GLU C CB  1 
ATOM   2948  N N   . ALA C 1 141 ? 13.555  2.235    -48.619 1.00 168.53 ? 220 ALA C N   1 
ATOM   2949  C CA  . ALA C 1 141 ? 14.233  2.841    -47.473 1.00 171.71 ? 220 ALA C CA  1 
ATOM   2950  C C   . ALA C 1 141 ? 13.428  3.949    -46.800 1.00 173.73 ? 220 ALA C C   1 
ATOM   2951  O O   . ALA C 1 141 ? 13.085  4.946    -47.429 1.00 183.34 ? 220 ALA C O   1 
ATOM   2952  C CB  . ALA C 1 141 ? 15.588  3.395    -47.913 1.00 168.77 ? 220 ALA C CB  1 
ATOM   2953  N N   . ARG C 1 142 ? 13.117  3.757    -45.523 1.00 171.23 ? 221 ARG C N   1 
ATOM   2954  C CA  . ARG C 1 142 ? 12.816  4.861    -44.625 1.00 175.41 ? 221 ARG C CA  1 
ATOM   2955  C C   . ARG C 1 142 ? 13.760  4.661    -43.441 1.00 185.35 ? 221 ARG C C   1 
ATOM   2956  O O   . ARG C 1 142 ? 13.392  4.049    -42.434 1.00 190.07 ? 221 ARG C O   1 
ATOM   2957  C CB  . ARG C 1 142 ? 11.350  4.861    -44.202 1.00 172.82 ? 221 ARG C CB  1 
ATOM   2958  N N   . ALA C 1 143 ? 14.987  5.165    -43.603 1.00 188.67 ? 222 ALA C N   1 
ATOM   2959  C CA  . ALA C 1 143 ? 16.130  4.904    -42.716 1.00 185.00 ? 222 ALA C CA  1 
ATOM   2960  C C   . ALA C 1 143 ? 16.698  3.485    -42.879 1.00 186.59 ? 222 ALA C C   1 
ATOM   2961  O O   . ALA C 1 143 ? 16.855  2.748    -41.907 1.00 197.19 ? 222 ALA C O   1 
ATOM   2962  C CB  . ALA C 1 143 ? 15.798  5.224    -41.254 1.00 185.65 ? 222 ALA C CB  1 
ATOM   2963  N N   . ARG C 1 144 ? 17.048  3.133    -44.116 1.00 182.53 ? 223 ARG C N   1 
ATOM   2964  C CA  . ARG C 1 144 ? 17.713  1.851    -44.450 1.00 171.19 ? 223 ARG C CA  1 
ATOM   2965  C C   . ARG C 1 144 ? 18.946  1.538    -43.583 1.00 162.05 ? 223 ARG C C   1 
ATOM   2966  O O   . ARG C 1 144 ? 19.280  0.379    -43.377 1.00 158.47 ? 223 ARG C O   1 
ATOM   2967  C CB  . ARG C 1 144 ? 18.119  1.833    -45.931 1.00 169.16 ? 223 ARG C CB  1 
ATOM   2968  N N   . HIS C 1 145 ? 19.616  2.575    -43.085 1.00 157.44 ? 224 HIS C N   1 
ATOM   2969  C CA  . HIS C 1 145 ? 20.726  2.423    -42.137 1.00 147.01 ? 224 HIS C CA  1 
ATOM   2970  C C   . HIS C 1 145 ? 20.343  1.799    -40.790 1.00 139.43 ? 224 HIS C C   1 
ATOM   2971  O O   . HIS C 1 145 ? 21.205  1.270    -40.093 1.00 133.95 ? 224 HIS C O   1 
ATOM   2972  C CB  . HIS C 1 145 ? 21.380  3.782    -41.881 1.00 149.48 ? 224 HIS C CB  1 
ATOM   2973  N N   . ALA C 1 146 ? 19.072  1.891    -40.413 1.00 136.20 ? 225 ALA C N   1 
ATOM   2974  C CA  . ALA C 1 146 ? 18.587  1.371    -39.127 1.00 133.74 ? 225 ALA C CA  1 
ATOM   2975  C C   . ALA C 1 146 ? 18.387  -0.136   -39.115 1.00 129.90 ? 225 ALA C C   1 
ATOM   2976  O O   . ALA C 1 146 ? 18.182  -0.704   -38.044 1.00 133.43 ? 225 ALA C O   1 
ATOM   2977  C CB  . ALA C 1 146 ? 17.292  2.062    -38.721 1.00 132.99 ? 225 ALA C CB  1 
ATOM   2978  N N   . TRP C 1 147 ? 18.427  -0.781   -40.284 1.00 120.48 ? 226 TRP C N   1 
ATOM   2979  C CA  . TRP C 1 147 ? 18.273  -2.235   -40.388 1.00 117.26 ? 226 TRP C CA  1 
ATOM   2980  C C   . TRP C 1 147 ? 19.466  -2.844   -41.124 1.00 114.72 ? 226 TRP C C   1 
ATOM   2981  O O   . TRP C 1 147 ? 20.046  -2.216   -41.999 1.00 116.88 ? 226 TRP C O   1 
ATOM   2982  C CB  . TRP C 1 147 ? 16.978  -2.560   -41.139 1.00 117.61 ? 226 TRP C CB  1 
ATOM   2983  C CG  . TRP C 1 147 ? 15.720  -2.433   -40.316 1.00 116.85 ? 226 TRP C CG  1 
ATOM   2984  C CD1 . TRP C 1 147 ? 14.988  -1.299   -40.085 1.00 117.37 ? 226 TRP C CD1 1 
ATOM   2985  C CD2 . TRP C 1 147 ? 15.037  -3.488   -39.648 1.00 115.44 ? 226 TRP C CD2 1 
ATOM   2986  N NE1 . TRP C 1 147 ? 13.899  -1.586   -39.294 1.00 115.40 ? 226 TRP C NE1 1 
ATOM   2987  C CE2 . TRP C 1 147 ? 13.903  -2.922   -39.013 1.00 115.45 ? 226 TRP C CE2 1 
ATOM   2988  C CE3 . TRP C 1 147 ? 15.275  -4.860   -39.517 1.00 114.36 ? 226 TRP C CE3 1 
ATOM   2989  C CZ2 . TRP C 1 147 ? 13.012  -3.681   -38.256 1.00 115.04 ? 226 TRP C CZ2 1 
ATOM   2990  C CZ3 . TRP C 1 147 ? 14.401  -5.618   -38.767 1.00 114.31 ? 226 TRP C CZ3 1 
ATOM   2991  C CH2 . TRP C 1 147 ? 13.272  -5.028   -38.142 1.00 115.89 ? 226 TRP C CH2 1 
ATOM   2992  N N   . GLN C 1 148 ? 19.824  -4.068   -40.770 1.00 110.40 ? 227 GLN C N   1 
ATOM   2993  C CA  . GLN C 1 148 ? 20.849  -4.812   -41.496 1.00 108.67 ? 227 GLN C CA  1 
ATOM   2994  C C   . GLN C 1 148 ? 20.389  -6.239   -41.716 1.00 105.10 ? 227 GLN C C   1 
ATOM   2995  O O   . GLN C 1 148 ? 19.521  -6.744   -40.998 1.00 100.45 ? 227 GLN C O   1 
ATOM   2996  C CB  . GLN C 1 148 ? 22.157  -4.824   -40.706 1.00 116.03 ? 227 GLN C CB  1 
ATOM   2997  C CG  . GLN C 1 148 ? 22.728  -3.434   -40.452 1.00 119.33 ? 227 GLN C CG  1 
ATOM   2998  C CD  . GLN C 1 148 ? 24.203  -3.411   -40.042 1.00 122.53 ? 227 GLN C CD  1 
ATOM   2999  O OE1 . GLN C 1 148 ? 24.904  -4.444   -40.001 1.00 119.62 ? 227 GLN C OE1 1 
ATOM   3000  N NE2 . GLN C 1 148 ? 24.697  -2.209   -39.786 1.00 124.66 ? 227 GLN C NE2 1 
ATOM   3001  N N   . LEU C 1 149 ? 20.972  -6.890   -42.715 1.00 109.20 ? 228 LEU C N   1 
ATOM   3002  C CA  . LEU C 1 149 ? 20.804  -8.327   -42.871 1.00 113.05 ? 228 LEU C CA  1 
ATOM   3003  C C   . LEU C 1 149 ? 21.409  -9.011   -41.655 1.00 116.83 ? 228 LEU C C   1 
ATOM   3004  O O   . LEU C 1 149 ? 22.524  -8.677   -41.247 1.00 118.18 ? 228 LEU C O   1 
ATOM   3005  C CB  . LEU C 1 149 ? 21.498  -8.837   -44.124 1.00 110.97 ? 228 LEU C CB  1 
ATOM   3006  C CG  . LEU C 1 149 ? 20.989  -8.312   -45.463 1.00 108.89 ? 228 LEU C CG  1 
ATOM   3007  C CD1 . LEU C 1 149 ? 22.010  -8.594   -46.543 1.00 112.80 ? 228 LEU C CD1 1 
ATOM   3008  C CD2 . LEU C 1 149 ? 19.657  -8.921   -45.839 1.00 107.36 ? 228 LEU C CD2 1 
ATOM   3009  N N   . THR C 1 150 ? 20.660  -9.939   -41.063 1.00 118.45 ? 229 THR C N   1 
ATOM   3010  C CA  . THR C 1 150 ? 21.167  -10.750  -39.964 1.00 125.72 ? 229 THR C CA  1 
ATOM   3011  C C   . THR C 1 150 ? 22.187  -11.716  -40.527 1.00 129.43 ? 229 THR C C   1 
ATOM   3012  O O   . THR C 1 150 ? 21.914  -12.375  -41.534 1.00 132.18 ? 229 THR C O   1 
ATOM   3013  C CB  . THR C 1 150 ? 20.048  -11.540  -39.277 1.00 127.38 ? 229 THR C CB  1 
ATOM   3014  O OG1 . THR C 1 150 ? 19.052  -10.625  -38.784 1.00 136.43 ? 229 THR C OG1 1 
ATOM   3015  C CG2 . THR C 1 150 ? 20.597  -12.360  -38.123 1.00 128.18 ? 229 THR C CG2 1 
ATOM   3016  N N   . GLN C 1 151 ? 23.347  -11.795  -39.881 1.00 132.93 ? 230 GLN C N   1 
ATOM   3017  C CA  . GLN C 1 151 ? 24.517  -12.428  -40.489 1.00 137.81 ? 230 GLN C CA  1 
ATOM   3018  C C   . GLN C 1 151 ? 24.462  -13.936  -40.376 1.00 135.08 ? 230 GLN C C   1 
ATOM   3019  O O   . GLN C 1 151 ? 24.173  -14.460  -39.301 1.00 140.66 ? 230 GLN C O   1 
ATOM   3020  C CB  . GLN C 1 151 ? 25.787  -11.934  -39.825 1.00 147.07 ? 230 GLN C CB  1 
ATOM   3021  C CG  . GLN C 1 151 ? 26.025  -10.455  -40.002 1.00 150.20 ? 230 GLN C CG  1 
ATOM   3022  C CD  . GLN C 1 151 ? 27.419  -10.037  -39.554 1.00 153.62 ? 230 GLN C CD  1 
ATOM   3023  O OE1 . GLN C 1 151 ? 27.566  -8.993   -38.941 1.00 155.14 ? 230 GLN C OE1 1 
ATOM   3024  N NE2 . GLN C 1 151 ? 28.451  -10.830  -39.886 1.00 152.54 ? 230 GLN C NE2 1 
ATOM   3025  N N   . GLY C 1 152 ? 24.744  -14.622  -41.478 1.00 129.43 ? 231 GLY C N   1 
ATOM   3026  C CA  . GLY C 1 152 ? 24.580  -16.073  -41.560 1.00 133.67 ? 231 GLY C CA  1 
ATOM   3027  C C   . GLY C 1 152 ? 23.156  -16.585  -41.746 1.00 137.14 ? 231 GLY C C   1 
ATOM   3028  O O   . GLY C 1 152 ? 22.939  -17.793  -41.813 1.00 141.42 ? 231 GLY C O   1 
ATOM   3029  N N   . ALA C 1 153 ? 22.196  -15.670  -41.853 1.00 138.11 ? 232 ALA C N   1 
ATOM   3030  C CA  . ALA C 1 153 ? 20.763  -15.999  -41.884 1.00 135.15 ? 232 ALA C CA  1 
ATOM   3031  C C   . ALA C 1 153 ? 20.147  -15.890  -43.276 1.00 130.00 ? 232 ALA C C   1 
ATOM   3032  O O   . ALA C 1 153 ? 19.215  -16.631  -43.593 1.00 126.85 ? 232 ALA C O   1 
ATOM   3033  C CB  . ALA C 1 153 ? 20.010  -15.089  -40.934 1.00 137.43 ? 232 ALA C CB  1 
ATOM   3034  N N   . THR C 1 154 ? 20.633  -14.940  -44.080 1.00 126.73 ? 233 THR C N   1 
ATOM   3035  C CA  . THR C 1 154 ? 20.225  -14.808  -45.477 1.00 122.98 ? 233 THR C CA  1 
ATOM   3036  C C   . THR C 1 154 ? 20.891  -15.908  -46.294 1.00 116.85 ? 233 THR C C   1 
ATOM   3037  O O   . THR C 1 154 ? 22.109  -15.953  -46.392 1.00 114.22 ? 233 THR C O   1 
ATOM   3038  C CB  . THR C 1 154 ? 20.598  -13.420  -46.040 1.00 119.96 ? 233 THR C CB  1 
ATOM   3039  O OG1 . THR C 1 154 ? 20.037  -12.403  -45.192 1.00 123.21 ? 233 THR C OG1 1 
ATOM   3040  C CG2 . THR C 1 154 ? 20.080  -13.240  -47.468 1.00 117.97 ? 233 THR C CG2 1 
ATOM   3041  N N   . VAL C 1 155 ? 20.080  -16.788  -46.872 1.00 111.36 ? 234 VAL C N   1 
ATOM   3042  C CA  . VAL C 1 155 ? 20.541  -18.057  -47.423 1.00 111.23 ? 234 VAL C CA  1 
ATOM   3043  C C   . VAL C 1 155 ? 19.808  -18.382  -48.711 1.00 112.74 ? 234 VAL C C   1 
ATOM   3044  O O   . VAL C 1 155 ? 18.607  -18.255  -48.773 1.00 114.06 ? 234 VAL C O   1 
ATOM   3045  C CB  . VAL C 1 155 ? 20.288  -19.188  -46.411 1.00 112.63 ? 234 VAL C CB  1 
ATOM   3046  C CG1 . VAL C 1 155 ? 20.471  -20.568  -47.037 1.00 118.01 ? 234 VAL C CG1 1 
ATOM   3047  C CG2 . VAL C 1 155 ? 21.208  -19.029  -45.209 1.00 113.96 ? 234 VAL C CG2 1 
ATOM   3048  N N   . LEU C 1 156 ? 20.546  -18.801  -49.732 1.00 117.39 ? 235 LEU C N   1 
ATOM   3049  C CA  . LEU C 1 156 ? 19.985  -19.393  -50.944 1.00 114.61 ? 235 LEU C CA  1 
ATOM   3050  C C   . LEU C 1 156 ? 20.375  -20.849  -50.917 1.00 119.25 ? 235 LEU C C   1 
ATOM   3051  O O   . LEU C 1 156 ? 21.539  -21.173  -50.675 1.00 121.42 ? 235 LEU C O   1 
ATOM   3052  C CB  . LEU C 1 156 ? 20.576  -18.749  -52.187 1.00 112.85 ? 235 LEU C CB  1 
ATOM   3053  C CG  . LEU C 1 156 ? 20.302  -19.421  -53.530 1.00 114.68 ? 235 LEU C CG  1 
ATOM   3054  C CD1 . LEU C 1 156 ? 18.827  -19.429  -53.857 1.00 114.51 ? 235 LEU C CD1 1 
ATOM   3055  C CD2 . LEU C 1 156 ? 21.071  -18.715  -54.629 1.00 117.24 ? 235 LEU C CD2 1 
ATOM   3056  N N   . GLY C 1 157 ? 19.415  -21.726  -51.177 1.00 122.06 ? 236 GLY C N   1 
ATOM   3057  C CA  . GLY C 1 157 ? 19.684  -23.148  -51.234 1.00 124.29 ? 236 GLY C CA  1 
ATOM   3058  C C   . GLY C 1 157 ? 18.860  -23.846  -52.289 1.00 125.50 ? 236 GLY C C   1 
ATOM   3059  O O   . GLY C 1 157 ? 17.794  -23.372  -52.682 1.00 120.97 ? 236 GLY C O   1 
ATOM   3060  N N   . LEU C 1 158 ? 19.379  -24.980  -52.753 1.00 131.33 ? 237 LEU C N   1 
ATOM   3061  C CA  . LEU C 1 158 ? 18.639  -25.844  -53.672 1.00 132.59 ? 237 LEU C CA  1 
ATOM   3062  C C   . LEU C 1 158 ? 19.108  -27.286  -53.598 1.00 130.78 ? 237 LEU C C   1 
ATOM   3063  O O   . LEU C 1 158 ? 20.220  -27.562  -53.154 1.00 128.63 ? 237 LEU C O   1 
ATOM   3064  C CB  . LEU C 1 158 ? 18.734  -25.330  -55.105 1.00 134.12 ? 237 LEU C CB  1 
ATOM   3065  C CG  . LEU C 1 158 ? 20.133  -24.988  -55.657 1.00 139.76 ? 237 LEU C CG  1 
ATOM   3066  C CD1 . LEU C 1 158 ? 20.974  -26.229  -55.965 1.00 144.24 ? 237 LEU C CD1 1 
ATOM   3067  C CD2 . LEU C 1 158 ? 20.004  -24.136  -56.909 1.00 144.95 ? 237 LEU C CD2 1 
ATOM   3068  N N   . PHE C 1 159 ? 18.233  -28.193  -54.011 1.00 133.51 ? 238 PHE C N   1 
ATOM   3069  C CA  . PHE C 1 159 ? 18.588  -29.591  -54.177 1.00 136.30 ? 238 PHE C CA  1 
ATOM   3070  C C   . PHE C 1 159 ? 17.764  -30.208  -55.309 1.00 143.44 ? 238 PHE C C   1 
ATOM   3071  O O   . PHE C 1 159 ? 16.618  -29.797  -55.543 1.00 153.54 ? 238 PHE C O   1 
ATOM   3072  C CB  . PHE C 1 159 ? 18.425  -30.379  -52.869 1.00 132.98 ? 238 PHE C CB  1 
ATOM   3073  C CG  . PHE C 1 159 ? 17.069  -30.257  -52.220 1.00 126.31 ? 238 PHE C CG  1 
ATOM   3074  C CD1 . PHE C 1 159 ? 16.028  -31.102  -52.589 1.00 125.30 ? 238 PHE C CD1 1 
ATOM   3075  C CD2 . PHE C 1 159 ? 16.846  -29.334  -51.205 1.00 124.07 ? 238 PHE C CD2 1 
ATOM   3076  C CE1 . PHE C 1 159 ? 14.783  -31.007  -51.981 1.00 126.42 ? 238 PHE C CE1 1 
ATOM   3077  C CE2 . PHE C 1 159 ? 15.606  -29.232  -50.594 1.00 123.34 ? 238 PHE C CE2 1 
ATOM   3078  C CZ  . PHE C 1 159 ? 14.574  -30.075  -50.978 1.00 127.09 ? 238 PHE C CZ  1 
ATOM   3079  N N   . ARG C 1 160 ? 18.366  -31.171  -56.019 1.00 141.42 ? 239 ARG C N   1 
ATOM   3080  C CA  . ARG C 1 160 ? 17.739  -31.772  -57.196 1.00 139.47 ? 239 ARG C CA  1 
ATOM   3081  C C   . ARG C 1 160 ? 16.625  -32.723  -56.776 1.00 141.21 ? 239 ARG C C   1 
ATOM   3082  O O   . ARG C 1 160 ? 16.745  -33.426  -55.773 1.00 140.13 ? 239 ARG C O   1 
ATOM   3083  C CB  . ARG C 1 160 ? 18.777  -32.514  -58.049 1.00 136.69 ? 239 ARG C CB  1 
ATOM   3084  N N   . VAL C 1 161 ? 15.538  -32.710  -57.534 1.00 144.94 ? 240 VAL C N   1 
ATOM   3085  C CA  . VAL C 1 161 ? 14.437  -33.646  -57.362 1.00 152.00 ? 240 VAL C CA  1 
ATOM   3086  C C   . VAL C 1 161 ? 14.429  -34.700  -58.489 1.00 159.24 ? 240 VAL C C   1 
ATOM   3087  O O   . VAL C 1 161 ? 14.215  -35.887  -58.217 1.00 164.28 ? 240 VAL C O   1 
ATOM   3088  C CB  . VAL C 1 161 ? 13.102  -32.880  -57.296 1.00 149.85 ? 240 VAL C CB  1 
ATOM   3089  C CG1 . VAL C 1 161 ? 11.918  -33.832  -57.202 1.00 155.65 ? 240 VAL C CG1 1 
ATOM   3090  C CG2 . VAL C 1 161 ? 13.131  -31.916  -56.123 1.00 148.06 ? 240 VAL C CG2 1 
ATOM   3091  N N   . THR C 1 162 ? 14.636  -34.265  -59.736 1.00 160.55 ? 241 THR C N   1 
ATOM   3092  C CA  . THR C 1 162 ? 14.669  -35.175  -60.878 1.00 163.07 ? 241 THR C CA  1 
ATOM   3093  C C   . THR C 1 162 ? 15.921  -36.056  -60.805 1.00 168.69 ? 241 THR C C   1 
ATOM   3094  O O   . THR C 1 162 ? 17.037  -35.533  -60.603 1.00 184.06 ? 241 THR C O   1 
ATOM   3095  C CB  . THR C 1 162 ? 14.690  -34.426  -62.230 1.00 163.44 ? 241 THR C CB  1 
ATOM   3096  O OG1 . THR C 1 162 ? 13.598  -33.514  -62.297 1.00 162.92 ? 241 THR C OG1 1 
ATOM   3097  C CG2 . THR C 1 162 ? 14.584  -35.402  -63.392 1.00 170.36 ? 241 THR C CG2 1 
ATOM   3098  N N   . PRO C 1 163 ? 15.761  -37.391  -60.966 1.00 165.66 ? 242 PRO C N   1 
ATOM   3099  C CA  . PRO C 1 163 ? 16.948  -38.242  -61.166 1.00 161.90 ? 242 PRO C CA  1 
ATOM   3100  C C   . PRO C 1 163 ? 17.568  -38.079  -62.560 1.00 158.70 ? 242 PRO C C   1 
ATOM   3101  O O   . PRO C 1 163 ? 18.663  -38.576  -62.801 1.00 157.06 ? 242 PRO C O   1 
ATOM   3102  C CB  . PRO C 1 163 ? 16.410  -39.663  -60.976 1.00 163.39 ? 242 PRO C CB  1 
ATOM   3103  C CG  . PRO C 1 163 ? 15.058  -39.505  -60.343 1.00 164.20 ? 242 PRO C CG  1 
ATOM   3104  C CD  . PRO C 1 163 ? 14.533  -38.193  -60.818 1.00 162.57 ? 242 PRO C CD  1 
ATOM   3105  N N   . GLY D 1 11  ? -39.110 -63.014  -0.253  1.00 188.82 ? 90  GLY D N   1 
ATOM   3106  C CA  . GLY D 1 11  ? -38.968 -62.552  -1.670  1.00 182.53 ? 90  GLY D CA  1 
ATOM   3107  C C   . GLY D 1 11  ? -39.907 -63.256  -2.639  1.00 177.19 ? 90  GLY D C   1 
ATOM   3108  O O   . GLY D 1 11  ? -41.013 -63.668  -2.269  1.00 182.53 ? 90  GLY D O   1 
ATOM   3109  N N   . MET D 1 12  ? -39.439 -63.412  -3.877  1.00 165.68 ? 91  MET D N   1 
ATOM   3110  C CA  . MET D 1 12  ? -40.173 -64.095  -4.954  1.00 158.97 ? 91  MET D CA  1 
ATOM   3111  C C   . MET D 1 12  ? -39.235 -65.093  -5.640  1.00 149.86 ? 91  MET D C   1 
ATOM   3112  O O   . MET D 1 12  ? -38.555 -64.768  -6.621  1.00 148.43 ? 91  MET D O   1 
ATOM   3113  C CB  . MET D 1 12  ? -40.710 -63.057  -5.951  1.00 164.19 ? 91  MET D CB  1 
ATOM   3114  C CG  . MET D 1 12  ? -41.472 -63.595  -7.161  1.00 165.85 ? 91  MET D CG  1 
ATOM   3115  S SD  . MET D 1 12  ? -43.051 -64.314  -6.720  1.00 170.64 ? 91  MET D SD  1 
ATOM   3116  C CE  . MET D 1 12  ? -43.824 -64.420  -8.334  1.00 168.22 ? 91  MET D CE  1 
ATOM   3117  N N   . PHE D 1 13  ? -39.203 -66.311  -5.103  1.00 141.98 ? 92  PHE D N   1 
ATOM   3118  C CA  . PHE D 1 13  ? -38.309 -67.356  -5.580  1.00 132.94 ? 92  PHE D CA  1 
ATOM   3119  C C   . PHE D 1 13  ? -38.835 -68.740  -5.262  1.00 128.73 ? 92  PHE D C   1 
ATOM   3120  O O   . PHE D 1 13  ? -39.618 -68.916  -4.339  1.00 129.84 ? 92  PHE D O   1 
ATOM   3121  C CB  . PHE D 1 13  ? -36.934 -67.195  -4.941  1.00 130.04 ? 92  PHE D CB  1 
ATOM   3122  C CG  . PHE D 1 13  ? -36.934 -67.350  -3.448  1.00 129.30 ? 92  PHE D CG  1 
ATOM   3123  C CD1 . PHE D 1 13  ? -36.991 -66.234  -2.627  1.00 131.49 ? 92  PHE D CD1 1 
ATOM   3124  C CD2 . PHE D 1 13  ? -36.866 -68.611  -2.860  1.00 129.19 ? 92  PHE D CD2 1 
ATOM   3125  C CE1 . PHE D 1 13  ? -36.981 -66.367  -1.245  1.00 131.82 ? 92  PHE D CE1 1 
ATOM   3126  C CE2 . PHE D 1 13  ? -36.864 -68.754  -1.480  1.00 130.35 ? 92  PHE D CE2 1 
ATOM   3127  C CZ  . PHE D 1 13  ? -36.918 -67.628  -0.672  1.00 130.78 ? 92  PHE D CZ  1 
ATOM   3128  N N   . ALA D 1 14  ? -38.344 -69.725  -5.999  1.00 127.74 ? 93  ALA D N   1 
ATOM   3129  C CA  . ALA D 1 14  ? -38.739 -71.110  -5.805  1.00 128.68 ? 93  ALA D CA  1 
ATOM   3130  C C   . ALA D 1 14  ? -37.551 -72.038  -6.010  1.00 124.51 ? 93  ALA D C   1 
ATOM   3131  O O   . ALA D 1 14  ? -36.587 -71.680  -6.673  1.00 121.22 ? 93  ALA D O   1 
ATOM   3132  C CB  . ALA D 1 14  ? -39.870 -71.471  -6.756  1.00 129.79 ? 93  ALA D CB  1 
ATOM   3133  N N   . GLN D 1 15  ? -37.636 -73.224  -5.425  1.00 124.48 ? 94  GLN D N   1 
ATOM   3134  C CA  . GLN D 1 15  ? -36.690 -74.301  -5.693  1.00 120.01 ? 94  GLN D CA  1 
ATOM   3135  C C   . GLN D 1 15  ? -37.360 -75.634  -5.407  1.00 120.41 ? 94  GLN D C   1 
ATOM   3136  O O   . GLN D 1 15  ? -37.724 -75.902  -4.273  1.00 124.29 ? 94  GLN D O   1 
ATOM   3137  C CB  . GLN D 1 15  ? -35.422 -74.156  -4.857  1.00 117.73 ? 94  GLN D CB  1 
ATOM   3138  C CG  . GLN D 1 15  ? -34.424 -75.268  -5.097  1.00 116.74 ? 94  GLN D CG  1 
ATOM   3139  C CD  . GLN D 1 15  ? -33.030 -74.940  -4.638  1.00 115.14 ? 94  GLN D CD  1 
ATOM   3140  O OE1 . GLN D 1 15  ? -32.378 -74.063  -5.179  1.00 116.34 ? 94  GLN D OE1 1 
ATOM   3141  N NE2 . GLN D 1 15  ? -32.553 -75.695  -3.664  1.00 112.64 ? 94  GLN D NE2 1 
ATOM   3142  N N   . LEU D 1 16  ? -37.522 -76.454  -6.433  1.00 119.91 ? 95  LEU D N   1 
ATOM   3143  C CA  . LEU D 1 16  ? -38.163 -77.758  -6.306  1.00 122.46 ? 95  LEU D CA  1 
ATOM   3144  C C   . LEU D 1 16  ? -37.143 -78.880  -6.410  1.00 120.23 ? 95  LEU D C   1 
ATOM   3145  O O   . LEU D 1 16  ? -36.078 -78.705  -6.990  1.00 122.42 ? 95  LEU D O   1 
ATOM   3146  C CB  . LEU D 1 16  ? -39.231 -77.929  -7.389  1.00 125.92 ? 95  LEU D CB  1 
ATOM   3147  C CG  . LEU D 1 16  ? -40.243 -76.788  -7.521  1.00 128.16 ? 95  LEU D CG  1 
ATOM   3148  C CD1 . LEU D 1 16  ? -41.287 -77.200  -8.562  1.00 130.89 ? 95  LEU D CD1 1 
ATOM   3149  C CD2 . LEU D 1 16  ? -40.886 -76.466  -6.169  1.00 130.50 ? 95  LEU D CD2 1 
ATOM   3150  N N   . VAL D 1 17  ? -37.489 -80.032  -5.848  1.00 117.37 ? 96  VAL D N   1 
ATOM   3151  C CA  . VAL D 1 17  ? -36.629 -81.197  -5.826  1.00 116.33 ? 96  VAL D CA  1 
ATOM   3152  C C   . VAL D 1 17  ? -37.341 -82.349  -6.492  1.00 111.87 ? 96  VAL D C   1 
ATOM   3153  O O   . VAL D 1 17  ? -38.384 -82.757  -6.037  1.00 111.70 ? 96  VAL D O   1 
ATOM   3154  C CB  . VAL D 1 17  ? -36.286 -81.578  -4.382  1.00 122.62 ? 96  VAL D CB  1 
ATOM   3155  C CG1 . VAL D 1 17  ? -35.480 -82.889  -4.349  1.00 120.45 ? 96  VAL D CG1 1 
ATOM   3156  C CG2 . VAL D 1 17  ? -35.522 -80.439  -3.715  1.00 128.08 ? 96  VAL D CG2 1 
ATOM   3157  N N   . ALA D 1 18  ? -36.779 -82.877  -7.565  1.00 112.87 ? 97  ALA D N   1 
ATOM   3158  C CA  . ALA D 1 18  ? -37.436 -83.935  -8.323  1.00 114.68 ? 97  ALA D CA  1 
ATOM   3159  C C   . ALA D 1 18  ? -37.627 -85.181  -7.479  1.00 115.01 ? 97  ALA D C   1 
ATOM   3160  O O   . ALA D 1 18  ? -36.734 -85.575  -6.734  1.00 116.19 ? 97  ALA D O   1 
ATOM   3161  C CB  . ALA D 1 18  ? -36.648 -84.278  -9.575  1.00 116.40 ? 97  ALA D CB  1 
ATOM   3162  N N   . GLN D 1 19  ? -38.806 -85.785  -7.604  1.00 117.81 ? 98  GLN D N   1 
ATOM   3163  C CA  . GLN D 1 19  ? -39.149 -87.013  -6.903  1.00 121.92 ? 98  GLN D CA  1 
ATOM   3164  C C   . GLN D 1 19  ? -38.596 -88.239  -7.612  1.00 121.16 ? 98  GLN D C   1 
ATOM   3165  O O   . GLN D 1 19  ? -38.351 -89.264  -6.968  1.00 123.95 ? 98  GLN D O   1 
ATOM   3166  C CB  . GLN D 1 19  ? -40.662 -87.177  -6.814  1.00 133.36 ? 98  GLN D CB  1 
ATOM   3167  C CG  . GLN D 1 19  ? -41.420 -86.029  -6.161  1.00 139.84 ? 98  GLN D CG  1 
ATOM   3168  C CD  . GLN D 1 19  ? -42.885 -86.359  -5.980  1.00 144.74 ? 98  GLN D CD  1 
ATOM   3169  O OE1 . GLN D 1 19  ? -43.749 -85.741  -6.594  1.00 150.81 ? 98  GLN D OE1 1 
ATOM   3170  N NE2 . GLN D 1 19  ? -43.169 -87.363  -5.163  1.00 152.97 ? 98  GLN D NE2 1 
ATOM   3171  N N   . ASN D 1 20  ? -38.361 -88.125  -8.915  1.00 120.49 ? 99  ASN D N   1 
ATOM   3172  C CA  . ASN D 1 20  ? -38.136 -89.290  -9.766  1.00 122.21 ? 99  ASN D CA  1 
ATOM   3173  C C   . ASN D 1 20  ? -36.765 -89.866  -9.454  1.00 122.98 ? 99  ASN D C   1 
ATOM   3174  O O   . ASN D 1 20  ? -35.851 -89.113  -9.097  1.00 122.89 ? 99  ASN D O   1 
ATOM   3175  C CB  . ASN D 1 20  ? -38.212 -88.940  -11.253 1.00 120.83 ? 99  ASN D CB  1 
ATOM   3176  C CG  . ASN D 1 20  ? -39.406 -88.058  -11.591 1.00 124.37 ? 99  ASN D CG  1 
ATOM   3177  O OD1 . ASN D 1 20  ? -40.379 -88.530  -12.146 1.00 130.31 ? 99  ASN D OD1 1 
ATOM   3178  N ND2 . ASN D 1 20  ? -39.329 -86.781  -11.262 1.00 128.55 ? 99  ASN D ND2 1 
ATOM   3179  N N   . VAL D 1 21  ? -36.626 -91.188  -9.543  1.00 126.00 ? 100 VAL D N   1 
ATOM   3180  C CA  . VAL D 1 21  ? -35.308 -91.825  -9.424  1.00 120.45 ? 100 VAL D CA  1 
ATOM   3181  C C   . VAL D 1 21  ? -34.931 -92.666  -10.639 1.00 117.04 ? 100 VAL D C   1 
ATOM   3182  O O   . VAL D 1 21  ? -33.777 -92.684  -11.035 1.00 114.67 ? 100 VAL D O   1 
ATOM   3183  C CB  . VAL D 1 21  ? -35.162 -92.639  -8.110  1.00 120.83 ? 100 VAL D CB  1 
ATOM   3184  C CG1 . VAL D 1 21  ? -35.715 -91.843  -6.917  1.00 120.98 ? 100 VAL D CG1 1 
ATOM   3185  C CG2 . VAL D 1 21  ? -35.793 -94.033  -8.224  1.00 125.60 ? 100 VAL D CG2 1 
ATOM   3186  N N   . LEU D 1 22  ? -35.888 -93.370  -11.231 1.00 119.78 ? 101 LEU D N   1 
ATOM   3187  C CA  . LEU D 1 22  ? -35.628 -94.145  -12.446 1.00 120.94 ? 101 LEU D CA  1 
ATOM   3188  C C   . LEU D 1 22  ? -35.675 -93.248  -13.676 1.00 119.89 ? 101 LEU D C   1 
ATOM   3189  O O   . LEU D 1 22  ? -36.525 -92.366  -13.778 1.00 114.15 ? 101 LEU D O   1 
ATOM   3190  C CB  . LEU D 1 22  ? -36.630 -95.286  -12.589 1.00 124.68 ? 101 LEU D CB  1 
ATOM   3191  C CG  . LEU D 1 22  ? -36.633 -96.264  -11.404 1.00 128.37 ? 101 LEU D CG  1 
ATOM   3192  C CD1 . LEU D 1 22  ? -37.448 -97.486  -11.785 1.00 132.05 ? 101 LEU D CD1 1 
ATOM   3193  C CD2 . LEU D 1 22  ? -35.250 -96.722  -10.966 1.00 128.23 ? 101 LEU D CD2 1 
ATOM   3194  N N   . LEU D 1 23  ? -34.751 -93.477  -14.596 1.00 126.67 ? 102 LEU D N   1 
ATOM   3195  C CA  . LEU D 1 23  ? -34.673 -92.689  -15.823 1.00 130.37 ? 102 LEU D CA  1 
ATOM   3196  C C   . LEU D 1 23  ? -35.770 -93.177  -16.769 1.00 126.38 ? 102 LEU D C   1 
ATOM   3197  O O   . LEU D 1 23  ? -35.622 -94.212  -17.412 1.00 125.01 ? 102 LEU D O   1 
ATOM   3198  C CB  . LEU D 1 23  ? -33.274 -92.774  -16.473 1.00 129.29 ? 102 LEU D CB  1 
ATOM   3199  N N   . ILE D 1 24  ? -36.879 -92.446  -16.810 1.00 127.56 ? 103 ILE D N   1 
ATOM   3200  C CA  . ILE D 1 24  ? -38.015 -92.795  -17.646 1.00 138.40 ? 103 ILE D CA  1 
ATOM   3201  C C   . ILE D 1 24  ? -38.468 -91.573  -18.442 1.00 141.87 ? 103 ILE D C   1 
ATOM   3202  O O   . ILE D 1 24  ? -38.833 -90.561  -17.846 1.00 143.24 ? 103 ILE D O   1 
ATOM   3203  C CB  . ILE D 1 24  ? -39.164 -93.349  -16.781 1.00 143.87 ? 103 ILE D CB  1 
ATOM   3204  C CG1 . ILE D 1 24  ? -38.770 -94.737  -16.246 1.00 146.01 ? 103 ILE D CG1 1 
ATOM   3205  C CG2 . ILE D 1 24  ? -40.470 -93.451  -17.567 1.00 149.80 ? 103 ILE D CG2 1 
ATOM   3206  C CD1 . ILE D 1 24  ? -39.554 -95.171  -15.026 1.00 147.72 ? 103 ILE D CD1 1 
ATOM   3207  N N   . ASP D 1 25  ? -38.442 -91.688  -19.774 1.00 144.12 ? 104 ASP D N   1 
ATOM   3208  C CA  . ASP D 1 25  ? -38.895 -90.624  -20.673 1.00 148.64 ? 104 ASP D CA  1 
ATOM   3209  C C   . ASP D 1 25  ? -40.258 -90.109  -20.232 1.00 152.04 ? 104 ASP D C   1 
ATOM   3210  O O   . ASP D 1 25  ? -41.185 -90.900  -20.053 1.00 163.91 ? 104 ASP D O   1 
ATOM   3211  C CB  . ASP D 1 25  ? -39.012 -91.125  -22.132 1.00 154.27 ? 104 ASP D CB  1 
ATOM   3212  C CG  . ASP D 1 25  ? -37.667 -91.329  -22.823 1.00 152.86 ? 104 ASP D CG  1 
ATOM   3213  O OD1 . ASP D 1 25  ? -37.609 -91.914  -23.916 1.00 160.09 ? 104 ASP D OD1 1 
ATOM   3214  O OD2 . ASP D 1 25  ? -36.643 -90.922  -22.287 1.00 154.43 ? 104 ASP D OD2 1 
ATOM   3215  N N   . GLY D 1 26  ? -40.364 -88.795  -20.046 1.00 144.76 ? 105 GLY D N   1 
ATOM   3216  C CA  . GLY D 1 26  ? -41.607 -88.149  -19.617 1.00 142.83 ? 105 GLY D CA  1 
ATOM   3217  C C   . GLY D 1 26  ? -41.346 -87.147  -18.518 1.00 135.23 ? 105 GLY D C   1 
ATOM   3218  O O   . GLY D 1 26  ? -40.273 -87.158  -17.928 1.00 134.46 ? 105 GLY D O   1 
ATOM   3219  N N   . PRO D 1 27  ? -42.344 -86.305  -18.188 1.00 130.41 ? 106 PRO D N   1 
ATOM   3220  C CA  . PRO D 1 27  ? -42.167 -85.188  -17.280 1.00 126.41 ? 106 PRO D CA  1 
ATOM   3221  C C   . PRO D 1 27  ? -41.915 -85.554  -15.810 1.00 123.03 ? 106 PRO D C   1 
ATOM   3222  O O   . PRO D 1 27  ? -42.479 -86.521  -15.296 1.00 117.29 ? 106 PRO D O   1 
ATOM   3223  C CB  . PRO D 1 27  ? -43.467 -84.410  -17.442 1.00 131.94 ? 106 PRO D CB  1 
ATOM   3224  C CG  . PRO D 1 27  ? -44.472 -85.451  -17.714 1.00 137.49 ? 106 PRO D CG  1 
ATOM   3225  C CD  . PRO D 1 27  ? -43.764 -86.515  -18.496 1.00 136.76 ? 106 PRO D CD  1 
ATOM   3226  N N   . LEU D 1 28  ? -41.065 -84.760  -15.165 1.00 124.57 ? 107 LEU D N   1 
ATOM   3227  C CA  . LEU D 1 28  ? -40.609 -85.038  -13.802 1.00 122.78 ? 107 LEU D CA  1 
ATOM   3228  C C   . LEU D 1 28  ? -41.653 -84.515  -12.818 1.00 117.71 ? 107 LEU D C   1 
ATOM   3229  O O   . LEU D 1 28  ? -42.203 -83.405  -12.999 1.00 110.55 ? 107 LEU D O   1 
ATOM   3230  C CB  . LEU D 1 28  ? -39.257 -84.349  -13.522 1.00 117.71 ? 107 LEU D CB  1 
ATOM   3231  N N   . SER D 1 29  ? -41.918 -85.335  -11.812 1.00 115.75 ? 108 SER D N   1 
ATOM   3232  C CA  . SER D 1 29  ? -42.669 -84.933  -10.620 1.00 121.43 ? 108 SER D CA  1 
ATOM   3233  C C   . SER D 1 29  ? -41.764 -84.294  -9.573  1.00 117.10 ? 108 SER D C   1 
ATOM   3234  O O   . SER D 1 29  ? -40.622 -84.695  -9.440  1.00 114.33 ? 108 SER D O   1 
ATOM   3235  C CB  . SER D 1 29  ? -43.350 -86.170  -10.031 1.00 129.03 ? 108 SER D CB  1 
ATOM   3236  O OG  . SER D 1 29  ? -43.645 -87.102  -11.064 1.00 138.98 ? 108 SER D OG  1 
ATOM   3237  N N   . TRP D 1 30  ? -42.310 -83.347  -8.812  1.00 121.12 ? 109 TRP D N   1 
ATOM   3238  C CA  . TRP D 1 30  ? -41.537 -82.473  -7.907  1.00 122.65 ? 109 TRP D CA  1 
ATOM   3239  C C   . TRP D 1 30  ? -42.072 -82.413  -6.478  1.00 126.76 ? 109 TRP D C   1 
ATOM   3240  O O   . TRP D 1 30  ? -43.275 -82.303  -6.272  1.00 135.53 ? 109 TRP D O   1 
ATOM   3241  C CB  . TRP D 1 30  ? -41.544 -81.046  -8.455  1.00 123.74 ? 109 TRP D CB  1 
ATOM   3242  C CG  . TRP D 1 30  ? -40.951 -80.970  -9.791  1.00 124.86 ? 109 TRP D CG  1 
ATOM   3243  C CD1 . TRP D 1 30  ? -41.600 -81.033  -10.976 1.00 126.36 ? 109 TRP D CD1 1 
ATOM   3244  C CD2 . TRP D 1 30  ? -39.566 -80.850  -10.088 1.00 123.57 ? 109 TRP D CD2 1 
ATOM   3245  N NE1 . TRP D 1 30  ? -40.703 -80.951  -12.009 1.00 127.29 ? 109 TRP D NE1 1 
ATOM   3246  C CE2 . TRP D 1 30  ? -39.440 -80.840  -11.491 1.00 122.91 ? 109 TRP D CE2 1 
ATOM   3247  C CE3 . TRP D 1 30  ? -38.415 -80.744  -9.303  1.00 121.21 ? 109 TRP D CE3 1 
ATOM   3248  C CZ2 . TRP D 1 30  ? -38.208 -80.719  -12.134 1.00 117.70 ? 109 TRP D CZ2 1 
ATOM   3249  C CZ3 . TRP D 1 30  ? -37.190 -80.637  -9.930  1.00 118.91 ? 109 TRP D CZ3 1 
ATOM   3250  C CH2 . TRP D 1 30  ? -37.094 -80.620  -11.339 1.00 117.97 ? 109 TRP D CH2 1 
ATOM   3251  N N   . TYR D 1 31  ? -41.176 -82.462  -5.497  1.00 130.55 ? 110 TYR D N   1 
ATOM   3252  C CA  . TYR D 1 31  ? -41.512 -82.129  -4.113  1.00 136.53 ? 110 TYR D CA  1 
ATOM   3253  C C   . TYR D 1 31  ? -41.702 -80.613  -4.012  1.00 142.64 ? 110 TYR D C   1 
ATOM   3254  O O   . TYR D 1 31  ? -40.838 -79.851  -4.442  1.00 139.33 ? 110 TYR D O   1 
ATOM   3255  C CB  . TYR D 1 31  ? -40.412 -82.563  -3.152  1.00 132.90 ? 110 TYR D CB  1 
ATOM   3256  C CG  . TYR D 1 31  ? -40.192 -84.048  -3.096  1.00 132.09 ? 110 TYR D CG  1 
ATOM   3257  C CD1 . TYR D 1 31  ? -41.185 -84.898  -2.635  1.00 134.46 ? 110 TYR D CD1 1 
ATOM   3258  C CD2 . TYR D 1 31  ? -38.981 -84.609  -3.485  1.00 131.89 ? 110 TYR D CD2 1 
ATOM   3259  C CE1 . TYR D 1 31  ? -40.987 -86.265  -2.566  1.00 137.89 ? 110 TYR D CE1 1 
ATOM   3260  C CE2 . TYR D 1 31  ? -38.764 -85.975  -3.426  1.00 133.57 ? 110 TYR D CE2 1 
ATOM   3261  C CZ  . TYR D 1 31  ? -39.769 -86.803  -2.964  1.00 138.98 ? 110 TYR D CZ  1 
ATOM   3262  O OH  . TYR D 1 31  ? -39.557 -88.163  -2.903  1.00 144.42 ? 110 TYR D OH  1 
ATOM   3263  N N   . SER D 1 32  ? -42.840 -80.189  -3.460  1.00 151.02 ? 111 SER D N   1 
ATOM   3264  C CA  . SER D 1 32  ? -43.191 -78.765  -3.323  1.00 149.92 ? 111 SER D CA  1 
ATOM   3265  C C   . SER D 1 32  ? -43.401 -78.275  -1.878  1.00 157.09 ? 111 SER D C   1 
ATOM   3266  O O   . SER D 1 32  ? -43.456 -77.057  -1.657  1.00 154.42 ? 111 SER D O   1 
ATOM   3267  C CB  . SER D 1 32  ? -44.449 -78.479  -4.135  1.00 147.85 ? 111 SER D CB  1 
ATOM   3268  O OG  . SER D 1 32  ? -45.484 -79.381  -3.802  1.00 149.24 ? 111 SER D OG  1 
ATOM   3269  N N   . ASP D 1 33  ? -43.501 -79.194  -0.909  1.00 164.72 ? 112 ASP D N   1 
ATOM   3270  C CA  . ASP D 1 33  ? -43.755 -78.834  0.491   1.00 171.39 ? 112 ASP D CA  1 
ATOM   3271  C C   . ASP D 1 33  ? -42.474 -78.285  1.127   1.00 165.21 ? 112 ASP D C   1 
ATOM   3272  O O   . ASP D 1 33  ? -41.513 -79.033  1.279   1.00 164.75 ? 112 ASP D O   1 
ATOM   3273  C CB  . ASP D 1 33  ? -44.266 -80.072  1.257   1.00 181.52 ? 112 ASP D CB  1 
ATOM   3274  C CG  . ASP D 1 33  ? -44.541 -79.807  2.745   1.00 190.85 ? 112 ASP D CG  1 
ATOM   3275  O OD1 . ASP D 1 33  ? -44.045 -78.818  3.334   1.00 199.70 ? 112 ASP D OD1 1 
ATOM   3276  O OD2 . ASP D 1 33  ? -45.255 -80.640  3.337   1.00 200.35 ? 112 ASP D OD2 1 
ATOM   3277  N N   . PRO D 1 34  ? -42.464 -76.987  1.530   1.00 161.33 ? 113 PRO D N   1 
ATOM   3278  C CA  . PRO D 1 34  ? -41.230 -76.356  2.043   1.00 157.99 ? 113 PRO D CA  1 
ATOM   3279  C C   . PRO D 1 34  ? -40.761 -76.818  3.435   1.00 156.24 ? 113 PRO D C   1 
ATOM   3280  O O   . PRO D 1 34  ? -39.696 -76.393  3.887   1.00 154.54 ? 113 PRO D O   1 
ATOM   3281  C CB  . PRO D 1 34  ? -41.562 -74.863  2.033   1.00 159.55 ? 113 PRO D CB  1 
ATOM   3282  C CG  . PRO D 1 34  ? -43.038 -74.808  2.177   1.00 164.73 ? 113 PRO D CG  1 
ATOM   3283  C CD  . PRO D 1 34  ? -43.609 -76.056  1.567   1.00 163.54 ? 113 PRO D CD  1 
ATOM   3284  N N   . GLY D 1 35  ? -41.536 -77.675  4.099   1.00 157.09 ? 114 GLY D N   1 
ATOM   3285  C CA  . GLY D 1 35  ? -41.035 -78.443  5.238   1.00 158.32 ? 114 GLY D CA  1 
ATOM   3286  C C   . GLY D 1 35  ? -40.005 -79.503  4.871   1.00 154.33 ? 114 GLY D C   1 
ATOM   3287  O O   . GLY D 1 35  ? -39.339 -80.044  5.760   1.00 153.95 ? 114 GLY D O   1 
ATOM   3288  N N   . LEU D 1 36  ? -39.903 -79.825  3.581   1.00 153.02 ? 115 LEU D N   1 
ATOM   3289  C CA  . LEU D 1 36  ? -38.846 -80.697  3.042   1.00 150.44 ? 115 LEU D CA  1 
ATOM   3290  C C   . LEU D 1 36  ? -37.540 -79.946  2.773   1.00 143.54 ? 115 LEU D C   1 
ATOM   3291  O O   . LEU D 1 36  ? -37.545 -78.812  2.276   1.00 138.43 ? 115 LEU D O   1 
ATOM   3292  C CB  . LEU D 1 36  ? -39.301 -81.368  1.739   1.00 151.09 ? 115 LEU D CB  1 
ATOM   3293  C CG  . LEU D 1 36  ? -40.409 -82.431  1.890   1.00 155.05 ? 115 LEU D CG  1 
ATOM   3294  C CD1 . LEU D 1 36  ? -40.979 -82.878  0.551   1.00 155.81 ? 115 LEU D CD1 1 
ATOM   3295  C CD2 . LEU D 1 36  ? -39.895 -83.560  2.758   1.00 154.58 ? 115 LEU D CD2 1 
ATOM   3296  N N   . ALA D 1 37  ? -36.428 -80.603  3.096   1.00 140.33 ? 116 ALA D N   1 
ATOM   3297  C CA  . ALA D 1 37  ? -35.095 -80.014  2.964   1.00 143.16 ? 116 ALA D CA  1 
ATOM   3298  C C   . ALA D 1 37  ? -34.728 -79.813  1.496   1.00 139.80 ? 116 ALA D C   1 
ATOM   3299  O O   . ALA D 1 37  ? -34.777 -80.758  0.705   1.00 142.44 ? 116 ALA D O   1 
ATOM   3300  C CB  . ALA D 1 37  ? -34.059 -80.893  3.644   1.00 146.95 ? 116 ALA D CB  1 
ATOM   3301  N N   . GLY D 1 38  ? -34.371 -78.578  1.144   1.00 135.03 ? 117 GLY D N   1 
ATOM   3302  C CA  . GLY D 1 38  ? -34.055 -78.218  -0.233  1.00 133.04 ? 117 GLY D CA  1 
ATOM   3303  C C   . GLY D 1 38  ? -35.184 -77.480  -0.907  1.00 132.14 ? 117 GLY D C   1 
ATOM   3304  O O   . GLY D 1 38  ? -34.945 -76.527  -1.648  1.00 133.01 ? 117 GLY D O   1 
ATOM   3305  N N   . VAL D 1 39  ? -36.415 -77.894  -0.621  1.00 135.67 ? 118 VAL D N   1 
ATOM   3306  C CA  . VAL D 1 39  ? -37.598 -77.299  -1.241  1.00 133.14 ? 118 VAL D CA  1 
ATOM   3307  C C   . VAL D 1 39  ? -37.914 -75.947  -0.615  1.00 133.10 ? 118 VAL D C   1 
ATOM   3308  O O   . VAL D 1 39  ? -37.820 -75.779  0.598   1.00 131.92 ? 118 VAL D O   1 
ATOM   3309  C CB  . VAL D 1 39  ? -38.834 -78.212  -1.116  1.00 132.46 ? 118 VAL D CB  1 
ATOM   3310  C CG1 . VAL D 1 39  ? -40.058 -77.553  -1.735  1.00 130.05 ? 118 VAL D CG1 1 
ATOM   3311  C CG2 . VAL D 1 39  ? -38.566 -79.564  -1.772  1.00 134.70 ? 118 VAL D CG2 1 
ATOM   3312  N N   . SER D 1 40  ? -38.287 -74.994  -1.460  1.00 137.45 ? 119 SER D N   1 
ATOM   3313  C CA  . SER D 1 40  ? -38.744 -73.682  -1.013  1.00 143.36 ? 119 SER D CA  1 
ATOM   3314  C C   . SER D 1 40  ? -39.604 -73.023  -2.094  1.00 147.18 ? 119 SER D C   1 
ATOM   3315  O O   . SER D 1 40  ? -39.159 -72.874  -3.222  1.00 142.31 ? 119 SER D O   1 
ATOM   3316  C CB  . SER D 1 40  ? -37.561 -72.789  -0.611  1.00 141.04 ? 119 SER D CB  1 
ATOM   3317  O OG  . SER D 1 40  ? -36.404 -73.079  -1.370  1.00 136.50 ? 119 SER D OG  1 
ATOM   3318  N N   . LEU D 1 41  ? -40.844 -72.689  -1.731  1.00 155.26 ? 120 LEU D N   1 
ATOM   3319  C CA  . LEU D 1 41  ? -41.732 -71.837  -2.520  1.00 157.75 ? 120 LEU D CA  1 
ATOM   3320  C C   . LEU D 1 41  ? -42.004 -70.577  -1.706  1.00 163.04 ? 120 LEU D C   1 
ATOM   3321  O O   . LEU D 1 41  ? -42.060 -70.636  -0.475  1.00 170.27 ? 120 LEU D O   1 
ATOM   3322  C CB  . LEU D 1 41  ? -43.055 -72.543  -2.800  1.00 159.21 ? 120 LEU D CB  1 
ATOM   3323  C CG  . LEU D 1 41  ? -43.087 -73.591  -3.898  1.00 157.88 ? 120 LEU D CG  1 
ATOM   3324  C CD1 . LEU D 1 41  ? -44.418 -74.323  -3.845  1.00 163.70 ? 120 LEU D CD1 1 
ATOM   3325  C CD2 . LEU D 1 41  ? -42.894 -72.954  -5.257  1.00 156.81 ? 120 LEU D CD2 1 
ATOM   3326  N N   . THR D 1 42  ? -42.148 -69.446  -2.396  1.00 164.82 ? 121 THR D N   1 
ATOM   3327  C CA  . THR D 1 42  ? -42.534 -68.164  -1.786  1.00 165.83 ? 121 THR D CA  1 
ATOM   3328  C C   . THR D 1 42  ? -43.439 -67.410  -2.749  1.00 163.67 ? 121 THR D C   1 
ATOM   3329  O O   . THR D 1 42  ? -43.723 -67.902  -3.840  1.00 154.13 ? 121 THR D O   1 
ATOM   3330  C CB  . THR D 1 42  ? -41.310 -67.263  -1.451  1.00 168.77 ? 121 THR D CB  1 
ATOM   3331  O OG1 . THR D 1 42  ? -40.659 -66.828  -2.656  1.00 168.80 ? 121 THR D OG1 1 
ATOM   3332  C CG2 . THR D 1 42  ? -40.312 -67.983  -0.548  1.00 170.30 ? 121 THR D CG2 1 
ATOM   3333  N N   . GLY D 1 43  ? -43.890 -66.222  -2.338  1.00 168.06 ? 122 GLY D N   1 
ATOM   3334  C CA  . GLY D 1 43  ? -44.601 -65.287  -3.219  1.00 168.56 ? 122 GLY D CA  1 
ATOM   3335  C C   . GLY D 1 43  ? -45.735 -65.924  -4.002  1.00 167.51 ? 122 GLY D C   1 
ATOM   3336  O O   . GLY D 1 43  ? -46.393 -66.858  -3.523  1.00 172.01 ? 122 GLY D O   1 
ATOM   3337  N N   . GLY D 1 44  ? -45.947 -65.432  -5.218  1.00 160.35 ? 123 GLY D N   1 
ATOM   3338  C CA  . GLY D 1 44  ? -46.930 -66.004  -6.130  1.00 160.37 ? 123 GLY D CA  1 
ATOM   3339  C C   . GLY D 1 44  ? -46.316 -67.096  -6.981  1.00 158.37 ? 123 GLY D C   1 
ATOM   3340  O O   . GLY D 1 44  ? -46.207 -66.951  -8.202  1.00 165.29 ? 123 GLY D O   1 
ATOM   3341  N N   . LEU D 1 45  ? -45.894 -68.179  -6.327  1.00 154.29 ? 124 LEU D N   1 
ATOM   3342  C CA  . LEU D 1 45  ? -45.326 -69.345  -6.992  1.00 147.79 ? 124 LEU D CA  1 
ATOM   3343  C C   . LEU D 1 45  ? -45.933 -70.588  -6.358  1.00 148.24 ? 124 LEU D C   1 
ATOM   3344  O O   . LEU D 1 45  ? -46.040 -70.678  -5.133  1.00 147.58 ? 124 LEU D O   1 
ATOM   3345  C CB  . LEU D 1 45  ? -43.801 -69.361  -6.862  1.00 142.90 ? 124 LEU D CB  1 
ATOM   3346  C CG  . LEU D 1 45  ? -43.038 -68.358  -7.731  1.00 141.43 ? 124 LEU D CG  1 
ATOM   3347  C CD1 . LEU D 1 45  ? -41.687 -68.005  -7.138  1.00 138.29 ? 124 LEU D CD1 1 
ATOM   3348  C CD2 . LEU D 1 45  ? -42.867 -68.899  -9.142  1.00 142.95 ? 124 LEU D CD2 1 
ATOM   3349  N N   . SER D 1 46  ? -46.308 -71.547  -7.199  1.00 147.79 ? 125 SER D N   1 
ATOM   3350  C CA  . SER D 1 46  ? -47.067 -72.708  -6.754  1.00 151.37 ? 125 SER D CA  1 
ATOM   3351  C C   . SER D 1 46  ? -46.875 -73.905  -7.678  1.00 147.85 ? 125 SER D C   1 
ATOM   3352  O O   . SER D 1 46  ? -46.670 -73.740  -8.886  1.00 143.92 ? 125 SER D O   1 
ATOM   3353  C CB  . SER D 1 46  ? -48.550 -72.339  -6.700  1.00 157.29 ? 125 SER D CB  1 
ATOM   3354  O OG  . SER D 1 46  ? -48.952 -71.730  -7.918  1.00 158.47 ? 125 SER D OG  1 
ATOM   3355  N N   . TYR D 1 47  ? -46.978 -75.106  -7.105  1.00 142.73 ? 126 TYR D N   1 
ATOM   3356  C CA  . TYR D 1 47  ? -46.833 -76.348  -7.851  1.00 137.32 ? 126 TYR D CA  1 
ATOM   3357  C C   . TYR D 1 47  ? -48.192 -77.065  -7.986  1.00 138.85 ? 126 TYR D C   1 
ATOM   3358  O O   . TYR D 1 47  ? -48.858 -77.342  -6.981  1.00 134.74 ? 126 TYR D O   1 
ATOM   3359  C CB  . TYR D 1 47  ? -45.809 -77.246  -7.160  1.00 132.51 ? 126 TYR D CB  1 
ATOM   3360  C CG  . TYR D 1 47  ? -45.607 -78.586  -7.837  1.00 128.15 ? 126 TYR D CG  1 
ATOM   3361  C CD1 . TYR D 1 47  ? -45.904 -79.772  -7.183  1.00 127.32 ? 126 TYR D CD1 1 
ATOM   3362  C CD2 . TYR D 1 47  ? -45.136 -78.657  -9.140  1.00 128.24 ? 126 TYR D CD2 1 
ATOM   3363  C CE1 . TYR D 1 47  ? -45.729 -80.995  -7.796  1.00 129.48 ? 126 TYR D CE1 1 
ATOM   3364  C CE2 . TYR D 1 47  ? -44.953 -79.876  -9.773  1.00 129.78 ? 126 TYR D CE2 1 
ATOM   3365  C CZ  . TYR D 1 47  ? -45.252 -81.050  -9.099  1.00 131.41 ? 126 TYR D CZ  1 
ATOM   3366  O OH  . TYR D 1 47  ? -45.068 -82.273  -9.714  1.00 134.76 ? 126 TYR D OH  1 
ATOM   3367  N N   . LYS D 1 48  ? -48.588 -77.348  -9.233  1.00 138.95 ? 127 LYS D N   1 
ATOM   3368  C CA  . LYS D 1 48  ? -49.784 -78.135  -9.530  1.00 142.16 ? 127 LYS D CA  1 
ATOM   3369  C C   . LYS D 1 48  ? -49.435 -79.630  -9.616  1.00 140.44 ? 127 LYS D C   1 
ATOM   3370  O O   . LYS D 1 48  ? -48.909 -80.087  -10.630 1.00 139.06 ? 127 LYS D O   1 
ATOM   3371  C CB  . LYS D 1 48  ? -50.414 -77.656  -10.848 1.00 141.92 ? 127 LYS D CB  1 
ATOM   3372  N N   . GLU D 1 49  ? -49.742 -80.381  -8.560  1.00 142.17 ? 128 GLU D N   1 
ATOM   3373  C CA  . GLU D 1 49  ? -49.419 -81.824  -8.493  1.00 144.38 ? 128 GLU D CA  1 
ATOM   3374  C C   . GLU D 1 49  ? -49.993 -82.669  -9.644  1.00 147.87 ? 128 GLU D C   1 
ATOM   3375  O O   . GLU D 1 49  ? -49.384 -83.658  -10.036 1.00 140.46 ? 128 GLU D O   1 
ATOM   3376  C CB  . GLU D 1 49  ? -49.866 -82.420  -7.149  1.00 146.46 ? 128 GLU D CB  1 
ATOM   3377  N N   . ASP D 1 50  ? -51.155 -82.283  -10.174 1.00 159.19 ? 129 ASP D N   1 
ATOM   3378  C CA  . ASP D 1 50  ? -51.809 -83.039  -11.261 1.00 163.92 ? 129 ASP D CA  1 
ATOM   3379  C C   . ASP D 1 50  ? -51.082 -82.921  -12.605 1.00 157.56 ? 129 ASP D C   1 
ATOM   3380  O O   . ASP D 1 50  ? -50.836 -83.931  -13.263 1.00 153.34 ? 129 ASP D O   1 
ATOM   3381  C CB  . ASP D 1 50  ? -53.311 -82.685  -11.399 1.00 173.95 ? 129 ASP D CB  1 
ATOM   3382  C CG  . ASP D 1 50  ? -53.577 -81.205  -11.689 1.00 176.84 ? 129 ASP D CG  1 
ATOM   3383  O OD1 . ASP D 1 50  ? -52.939 -80.344  -11.055 1.00 174.71 ? 129 ASP D OD1 1 
ATOM   3384  O OD2 . ASP D 1 50  ? -54.453 -80.910  -12.540 1.00 182.35 ? 129 ASP D OD2 1 
ATOM   3385  N N   . THR D 1 51  ? -50.727 -81.697  -12.986 1.00 155.82 ? 130 THR D N   1 
ATOM   3386  C CA  . THR D 1 51  ? -50.055 -81.424  -14.264 1.00 158.17 ? 130 THR D CA  1 
ATOM   3387  C C   . THR D 1 51  ? -48.514 -81.474  -14.182 1.00 160.61 ? 130 THR D C   1 
ATOM   3388  O O   . THR D 1 51  ? -47.833 -81.483  -15.217 1.00 156.04 ? 130 THR D O   1 
ATOM   3389  C CB  . THR D 1 51  ? -50.479 -80.049  -14.808 1.00 159.09 ? 130 THR D CB  1 
ATOM   3390  O OG1 . THR D 1 51  ? -50.409 -79.074  -13.761 1.00 152.71 ? 130 THR D OG1 1 
ATOM   3391  C CG2 . THR D 1 51  ? -51.909 -80.107  -15.330 1.00 167.39 ? 130 THR D CG2 1 
ATOM   3392  N N   . LYS D 1 52  ? -47.981 -81.507  -12.956 1.00 160.51 ? 131 LYS D N   1 
ATOM   3393  C CA  . LYS D 1 52  ? -46.538 -81.516  -12.689 1.00 149.45 ? 131 LYS D CA  1 
ATOM   3394  C C   . LYS D 1 52  ? -45.870 -80.222  -13.172 1.00 146.65 ? 131 LYS D C   1 
ATOM   3395  O O   . LYS D 1 52  ? -44.812 -80.256  -13.794 1.00 153.55 ? 131 LYS D O   1 
ATOM   3396  C CB  . LYS D 1 52  ? -45.865 -82.764  -13.290 1.00 143.25 ? 131 LYS D CB  1 
ATOM   3397  N N   . GLU D 1 53  ? -46.484 -79.090  -12.849 1.00 146.63 ? 132 GLU D N   1 
ATOM   3398  C CA  . GLU D 1 53  ? -46.056 -77.789  -13.357 1.00 150.02 ? 132 GLU D CA  1 
ATOM   3399  C C   . GLU D 1 53  ? -45.878 -76.783  -12.223 1.00 148.33 ? 132 GLU D C   1 
ATOM   3400  O O   . GLU D 1 53  ? -46.677 -76.745  -11.287 1.00 140.51 ? 132 GLU D O   1 
ATOM   3401  C CB  . GLU D 1 53  ? -47.099 -77.250  -14.345 1.00 159.06 ? 132 GLU D CB  1 
ATOM   3402  C CG  . GLU D 1 53  ? -47.289 -78.104  -15.594 1.00 164.18 ? 132 GLU D CG  1 
ATOM   3403  C CD  . GLU D 1 53  ? -48.235 -77.475  -16.613 1.00 173.94 ? 132 GLU D CD  1 
ATOM   3404  O OE1 . GLU D 1 53  ? -49.390 -77.152  -16.249 1.00 185.41 ? 132 GLU D OE1 1 
ATOM   3405  O OE2 . GLU D 1 53  ? -47.817 -77.307  -17.796 1.00 179.06 ? 132 GLU D OE2 1 
ATOM   3406  N N   . LEU D 1 54  ? -44.819 -75.977  -12.316 1.00 148.63 ? 133 LEU D N   1 
ATOM   3407  C CA  . LEU D 1 54  ? -44.639 -74.808  -11.460 1.00 147.80 ? 133 LEU D CA  1 
ATOM   3408  C C   . LEU D 1 54  ? -45.412 -73.667  -12.106 1.00 153.71 ? 133 LEU D C   1 
ATOM   3409  O O   . LEU D 1 54  ? -45.324 -73.493  -13.320 1.00 155.99 ? 133 LEU D O   1 
ATOM   3410  C CB  . LEU D 1 54  ? -43.156 -74.440  -11.346 1.00 141.78 ? 133 LEU D CB  1 
ATOM   3411  C CG  . LEU D 1 54  ? -42.796 -73.268  -10.415 1.00 142.03 ? 133 LEU D CG  1 
ATOM   3412  C CD1 . LEU D 1 54  ? -43.002 -73.646  -8.967  1.00 142.98 ? 133 LEU D CD1 1 
ATOM   3413  C CD2 . LEU D 1 54  ? -41.389 -72.776  -10.636 1.00 143.43 ? 133 LEU D CD2 1 
ATOM   3414  N N   . VAL D 1 55  ? -46.150 -72.892  -11.306 1.00 158.15 ? 134 VAL D N   1 
ATOM   3415  C CA  . VAL D 1 55  ? -47.003 -71.810  -11.819 1.00 159.67 ? 134 VAL D CA  1 
ATOM   3416  C C   . VAL D 1 55  ? -46.589 -70.456  -11.244 1.00 155.81 ? 134 VAL D C   1 
ATOM   3417  O O   . VAL D 1 55  ? -46.655 -70.251  -10.027 1.00 150.16 ? 134 VAL D O   1 
ATOM   3418  C CB  . VAL D 1 55  ? -48.485 -72.057  -11.485 1.00 165.51 ? 134 VAL D CB  1 
ATOM   3419  C CG1 . VAL D 1 55  ? -49.375 -71.135  -12.320 1.00 168.83 ? 134 VAL D CG1 1 
ATOM   3420  C CG2 . VAL D 1 55  ? -48.847 -73.521  -11.712 1.00 169.63 ? 134 VAL D CG2 1 
ATOM   3421  N N   . VAL D 1 56  ? -46.193 -69.538  -12.129 1.00 153.72 ? 135 VAL D N   1 
ATOM   3422  C CA  . VAL D 1 56  ? -45.704 -68.215  -11.740 1.00 155.00 ? 135 VAL D CA  1 
ATOM   3423  C C   . VAL D 1 56  ? -46.838 -67.196  -11.785 1.00 159.78 ? 135 VAL D C   1 
ATOM   3424  O O   . VAL D 1 56  ? -47.470 -67.025  -12.827 1.00 157.12 ? 135 VAL D O   1 
ATOM   3425  C CB  . VAL D 1 56  ? -44.597 -67.731  -12.693 1.00 150.52 ? 135 VAL D CB  1 
ATOM   3426  N N   . ALA D 1 57  ? -47.079 -66.504  -10.670 1.00 163.24 ? 136 ALA D N   1 
ATOM   3427  C CA  . ALA D 1 57  ? -48.159 -65.519  -10.594 1.00 170.94 ? 136 ALA D CA  1 
ATOM   3428  C C   . ALA D 1 57  ? -47.729 -64.173  -11.177 1.00 175.04 ? 136 ALA D C   1 
ATOM   3429  O O   . ALA D 1 57  ? -48.233 -63.758  -12.226 1.00 184.39 ? 136 ALA D O   1 
ATOM   3430  C CB  . ALA D 1 57  ? -48.647 -65.359  -9.159  1.00 174.28 ? 136 ALA D CB  1 
ATOM   3431  N N   . LYS D 1 58  ? -46.791 -63.507  -10.505 1.00 171.04 ? 137 LYS D N   1 
ATOM   3432  C CA  . LYS D 1 58  ? -46.331 -62.183  -10.911 1.00 168.65 ? 137 LYS D CA  1 
ATOM   3433  C C   . LYS D 1 58  ? -45.352 -62.335  -12.066 1.00 160.57 ? 137 LYS D C   1 
ATOM   3434  O O   . LYS D 1 58  ? -44.390 -63.081  -11.958 1.00 158.36 ? 137 LYS D O   1 
ATOM   3435  C CB  . LYS D 1 58  ? -45.660 -61.460  -9.738  1.00 170.98 ? 137 LYS D CB  1 
ATOM   3436  N N   . ALA D 1 59  ? -45.607 -61.635  -13.165 1.00 159.34 ? 138 ALA D N   1 
ATOM   3437  C CA  . ALA D 1 59  ? -44.713 -61.647  -14.326 1.00 156.33 ? 138 ALA D CA  1 
ATOM   3438  C C   . ALA D 1 59  ? -43.395 -60.920  -14.039 1.00 153.24 ? 138 ALA D C   1 
ATOM   3439  O O   . ALA D 1 59  ? -43.219 -60.302  -12.976 1.00 146.79 ? 138 ALA D O   1 
ATOM   3440  C CB  . ALA D 1 59  ? -45.401 -61.026  -15.533 1.00 159.83 ? 138 ALA D CB  1 
ATOM   3441  N N   . GLY D 1 60  ? -42.474 -61.016  -14.998 1.00 154.26 ? 139 GLY D N   1 
ATOM   3442  C CA  . GLY D 1 60  ? -41.157 -60.382  -14.902 1.00 152.72 ? 139 GLY D CA  1 
ATOM   3443  C C   . GLY D 1 60  ? -40.052 -61.218  -15.515 1.00 145.15 ? 139 GLY D C   1 
ATOM   3444  O O   . GLY D 1 60  ? -40.320 -62.165  -16.259 1.00 139.11 ? 139 GLY D O   1 
ATOM   3445  N N   . VAL D 1 61  ? -38.809 -60.846  -15.212 1.00 141.04 ? 140 VAL D N   1 
ATOM   3446  C CA  . VAL D 1 61  ? -37.645 -61.606  -15.635 1.00 139.74 ? 140 VAL D CA  1 
ATOM   3447  C C   . VAL D 1 61  ? -37.059 -62.330  -14.424 1.00 140.77 ? 140 VAL D C   1 
ATOM   3448  O O   . VAL D 1 61  ? -36.880 -61.734  -13.362 1.00 141.38 ? 140 VAL D O   1 
ATOM   3449  C CB  . VAL D 1 61  ? -36.600 -60.697  -16.314 1.00 139.28 ? 140 VAL D CB  1 
ATOM   3450  C CG1 . VAL D 1 61  ? -35.290 -61.441  -16.546 1.00 137.02 ? 140 VAL D CG1 1 
ATOM   3451  C CG2 . VAL D 1 61  ? -37.148 -60.171  -17.639 1.00 140.35 ? 140 VAL D CG2 1 
ATOM   3452  N N   . TYR D 1 62  ? -36.762 -63.616  -14.606 1.00 144.35 ? 141 TYR D N   1 
ATOM   3453  C CA  . TYR D 1 62  ? -36.225 -64.476  -13.552 1.00 141.13 ? 141 TYR D CA  1 
ATOM   3454  C C   . TYR D 1 62  ? -34.953 -65.159  -14.029 1.00 131.45 ? 141 TYR D C   1 
ATOM   3455  O O   . TYR D 1 62  ? -34.827 -65.470  -15.210 1.00 125.04 ? 141 TYR D O   1 
ATOM   3456  C CB  . TYR D 1 62  ? -37.229 -65.568  -13.212 1.00 146.61 ? 141 TYR D CB  1 
ATOM   3457  C CG  . TYR D 1 62  ? -38.524 -65.083  -12.625 1.00 155.81 ? 141 TYR D CG  1 
ATOM   3458  C CD1 . TYR D 1 62  ? -39.476 -64.430  -13.413 1.00 162.36 ? 141 TYR D CD1 1 
ATOM   3459  C CD2 . TYR D 1 62  ? -38.822 -65.312  -11.288 1.00 158.88 ? 141 TYR D CD2 1 
ATOM   3460  C CE1 . TYR D 1 62  ? -40.678 -63.999  -12.869 1.00 165.06 ? 141 TYR D CE1 1 
ATOM   3461  C CE2 . TYR D 1 62  ? -40.019 -64.890  -10.734 1.00 164.87 ? 141 TYR D CE2 1 
ATOM   3462  C CZ  . TYR D 1 62  ? -40.942 -64.236  -11.526 1.00 167.52 ? 141 TYR D CZ  1 
ATOM   3463  O OH  . TYR D 1 62  ? -42.124 -63.825  -10.961 1.00 176.24 ? 141 TYR D OH  1 
ATOM   3464  N N   . TYR D 1 63  ? -34.022 -65.391  -13.107 1.00 125.43 ? 142 TYR D N   1 
ATOM   3465  C CA  . TYR D 1 63  ? -32.900 -66.295  -13.342 1.00 121.49 ? 142 TYR D CA  1 
ATOM   3466  C C   . TYR D 1 63  ? -33.418 -67.671  -12.988 1.00 115.11 ? 142 TYR D C   1 
ATOM   3467  O O   . TYR D 1 63  ? -33.721 -67.935  -11.834 1.00 113.05 ? 142 TYR D O   1 
ATOM   3468  C CB  . TYR D 1 63  ? -31.694 -65.937  -12.471 1.00 124.01 ? 142 TYR D CB  1 
ATOM   3469  C CG  . TYR D 1 63  ? -30.485 -66.836  -12.659 1.00 123.06 ? 142 TYR D CG  1 
ATOM   3470  C CD1 . TYR D 1 63  ? -29.663 -66.715  -13.783 1.00 128.16 ? 142 TYR D CD1 1 
ATOM   3471  C CD2 . TYR D 1 63  ? -30.146 -67.787  -11.700 1.00 121.52 ? 142 TYR D CD2 1 
ATOM   3472  C CE1 . TYR D 1 63  ? -28.541 -67.527  -13.948 1.00 128.81 ? 142 TYR D CE1 1 
ATOM   3473  C CE2 . TYR D 1 63  ? -29.035 -68.601  -11.861 1.00 124.63 ? 142 TYR D CE2 1 
ATOM   3474  C CZ  . TYR D 1 63  ? -28.240 -68.482  -12.985 1.00 127.04 ? 142 TYR D CZ  1 
ATOM   3475  O OH  . TYR D 1 63  ? -27.134 -69.296  -13.109 1.00 125.96 ? 142 TYR D OH  1 
ATOM   3476  N N   . VAL D 1 64  ? -33.549 -68.521  -13.999 1.00 111.99 ? 143 VAL D N   1 
ATOM   3477  C CA  . VAL D 1 64  ? -34.053 -69.875  -13.846 1.00 111.02 ? 143 VAL D CA  1 
ATOM   3478  C C   . VAL D 1 64  ? -32.888 -70.810  -14.089 1.00 111.32 ? 143 VAL D C   1 
ATOM   3479  O O   . VAL D 1 64  ? -32.166 -70.646  -15.068 1.00 116.57 ? 143 VAL D O   1 
ATOM   3480  C CB  . VAL D 1 64  ? -35.149 -70.169  -14.875 1.00 109.63 ? 143 VAL D CB  1 
ATOM   3481  C CG1 . VAL D 1 64  ? -35.754 -71.553  -14.642 1.00 110.27 ? 143 VAL D CG1 1 
ATOM   3482  C CG2 . VAL D 1 64  ? -36.211 -69.078  -14.806 1.00 114.11 ? 143 VAL D CG2 1 
ATOM   3483  N N   . PHE D 1 65  ? -32.715 -71.787  -13.207 1.00 109.33 ? 144 PHE D N   1 
ATOM   3484  C CA  . PHE D 1 65  ? -31.623 -72.739  -13.315 1.00 110.09 ? 144 PHE D CA  1 
ATOM   3485  C C   . PHE D 1 65  ? -32.107 -74.138  -12.979 1.00 109.28 ? 144 PHE D C   1 
ATOM   3486  O O   . PHE D 1 65  ? -32.929 -74.322  -12.081 1.00 106.34 ? 144 PHE D O   1 
ATOM   3487  C CB  . PHE D 1 65  ? -30.471 -72.363  -12.371 1.00 112.55 ? 144 PHE D CB  1 
ATOM   3488  C CG  . PHE D 1 65  ? -30.860 -72.352  -10.920 1.00 114.01 ? 144 PHE D CG  1 
ATOM   3489  C CD1 . PHE D 1 65  ? -30.684 -73.479  -10.132 1.00 115.78 ? 144 PHE D CD1 1 
ATOM   3490  C CD2 . PHE D 1 65  ? -31.433 -71.229  -10.352 1.00 118.23 ? 144 PHE D CD2 1 
ATOM   3491  C CE1 . PHE D 1 65  ? -31.063 -73.479  -8.803  1.00 115.96 ? 144 PHE D CE1 1 
ATOM   3492  C CE2 . PHE D 1 65  ? -31.815 -71.220  -9.021  1.00 120.59 ? 144 PHE D CE2 1 
ATOM   3493  C CZ  . PHE D 1 65  ? -31.627 -72.348  -8.246  1.00 117.80 ? 144 PHE D CZ  1 
ATOM   3494  N N   . PHE D 1 66  ? -31.589 -75.128  -13.692 1.00 108.05 ? 145 PHE D N   1 
ATOM   3495  C CA  . PHE D 1 66  ? -31.734 -76.484  -13.225 1.00 105.02 ? 145 PHE D CA  1 
ATOM   3496  C C   . PHE D 1 66  ? -30.436 -77.282  -13.225 1.00 102.85 ? 145 PHE D C   1 
ATOM   3497  O O   . PHE D 1 66  ? -29.479 -76.955  -13.889 1.00 101.64 ? 145 PHE D O   1 
ATOM   3498  C CB  . PHE D 1 66  ? -32.946 -77.223  -13.835 1.00 104.04 ? 145 PHE D CB  1 
ATOM   3499  C CG  . PHE D 1 66  ? -32.984 -77.315  -15.326 1.00 104.36 ? 145 PHE D CG  1 
ATOM   3500  C CD1 . PHE D 1 66  ? -31.876 -77.127  -16.135 1.00 107.92 ? 145 PHE D CD1 1 
ATOM   3501  C CD2 . PHE D 1 66  ? -34.172 -77.692  -15.919 1.00 107.98 ? 145 PHE D CD2 1 
ATOM   3502  C CE1 . PHE D 1 66  ? -31.973 -77.261  -17.511 1.00 115.01 ? 145 PHE D CE1 1 
ATOM   3503  C CE2 . PHE D 1 66  ? -34.280 -77.829  -17.290 1.00 111.22 ? 145 PHE D CE2 1 
ATOM   3504  C CZ  . PHE D 1 66  ? -33.184 -77.620  -18.089 1.00 114.43 ? 145 PHE D CZ  1 
ATOM   3505  N N   . GLN D 1 67  ? -30.452 -78.316  -12.409 1.00 104.56 ? 146 GLN D N   1 
ATOM   3506  C CA  . GLN D 1 67  ? -29.306 -79.040  -11.940 1.00 103.83 ? 146 GLN D CA  1 
ATOM   3507  C C   . GLN D 1 67  ? -29.712 -80.479  -12.164 1.00 102.82 ? 146 GLN D C   1 
ATOM   3508  O O   . GLN D 1 67  ? -30.881 -80.819  -11.987 1.00 105.17 ? 146 GLN D O   1 
ATOM   3509  C CB  . GLN D 1 67  ? -29.187 -78.728  -10.450 1.00 110.75 ? 146 GLN D CB  1 
ATOM   3510  C CG  . GLN D 1 67  ? -27.832 -78.919  -9.807  1.00 119.30 ? 146 GLN D CG  1 
ATOM   3511  C CD  . GLN D 1 67  ? -27.797 -78.294  -8.408  1.00 127.69 ? 146 GLN D CD  1 
ATOM   3512  O OE1 . GLN D 1 67  ? -27.311 -77.185  -8.219  1.00 135.35 ? 146 GLN D OE1 1 
ATOM   3513  N NE2 . GLN D 1 67  ? -28.335 -79.007  -7.424  1.00 130.53 ? 146 GLN D NE2 1 
ATOM   3514  N N   . LEU D 1 68  ? -28.794 -81.335  -12.566 1.00 104.46 ? 147 LEU D N   1 
ATOM   3515  C CA  . LEU D 1 68  ? -29.138 -82.742  -12.791 1.00 103.97 ? 147 LEU D CA  1 
ATOM   3516  C C   . LEU D 1 68  ? -27.961 -83.627  -12.429 1.00 104.99 ? 147 LEU D C   1 
ATOM   3517  O O   . LEU D 1 68  ? -26.985 -83.664  -13.184 1.00 105.04 ? 147 LEU D O   1 
ATOM   3518  C CB  . LEU D 1 68  ? -29.517 -82.939  -14.260 1.00 103.01 ? 147 LEU D CB  1 
ATOM   3519  C CG  . LEU D 1 68  ? -29.680 -84.380  -14.735 1.00 104.59 ? 147 LEU D CG  1 
ATOM   3520  C CD1 . LEU D 1 68  ? -30.770 -85.067  -13.953 1.00 106.64 ? 147 LEU D CD1 1 
ATOM   3521  C CD2 . LEU D 1 68  ? -29.969 -84.485  -16.223 1.00 104.43 ? 147 LEU D CD2 1 
ATOM   3522  N N   . GLU D 1 69  ? -28.027 -84.324  -11.290 1.00 110.05 ? 148 GLU D N   1 
ATOM   3523  C CA  . GLU D 1 69  ? -26.983 -85.306  -10.933 1.00 118.02 ? 148 GLU D CA  1 
ATOM   3524  C C   . GLU D 1 69  ? -27.525 -86.708  -11.136 1.00 116.79 ? 148 GLU D C   1 
ATOM   3525  O O   . GLU D 1 69  ? -28.700 -86.955  -10.899 1.00 117.48 ? 148 GLU D O   1 
ATOM   3526  C CB  . GLU D 1 69  ? -26.445 -85.135  -9.507  1.00 124.77 ? 148 GLU D CB  1 
ATOM   3527  C CG  . GLU D 1 69  ? -25.048 -85.724  -9.339  1.00 132.70 ? 148 GLU D CG  1 
ATOM   3528  C CD  . GLU D 1 69  ? -24.734 -86.193  -7.922  1.00 143.68 ? 148 GLU D CD  1 
ATOM   3529  O OE1 . GLU D 1 69  ? -24.185 -87.333  -7.775  1.00 149.62 ? 148 GLU D OE1 1 
ATOM   3530  O OE2 . GLU D 1 69  ? -25.029 -85.424  -6.964  1.00 146.70 ? 148 GLU D OE2 1 
ATOM   3531  N N   . LEU D 1 70  ? -26.659 -87.605  -11.595 1.00 117.71 ? 149 LEU D N   1 
ATOM   3532  C CA  . LEU D 1 70  ? -26.999 -88.989  -11.867 1.00 115.24 ? 149 LEU D CA  1 
ATOM   3533  C C   . LEU D 1 70  ? -25.946 -89.882  -11.210 1.00 115.59 ? 149 LEU D C   1 
ATOM   3534  O O   . LEU D 1 70  ? -24.804 -89.470  -11.054 1.00 114.99 ? 149 LEU D O   1 
ATOM   3535  C CB  . LEU D 1 70  ? -27.010 -89.214  -13.370 1.00 114.52 ? 149 LEU D CB  1 
ATOM   3536  C CG  . LEU D 1 70  ? -28.057 -88.372  -14.111 1.00 111.86 ? 149 LEU D CG  1 
ATOM   3537  C CD1 . LEU D 1 70  ? -27.673 -87.957  -15.505 1.00 114.92 ? 149 LEU D CD1 1 
ATOM   3538  C CD2 . LEU D 1 70  ? -29.331 -89.152  -14.202 1.00 115.91 ? 149 LEU D CD2 1 
ATOM   3539  N N   . ARG D 1 71  ? -26.332 -91.097  -10.827 1.00 116.53 ? 150 ARG D N   1 
ATOM   3540  C CA  . ARG D 1 71  ? -25.426 -92.062  -10.184 1.00 114.92 ? 150 ARG D CA  1 
ATOM   3541  C C   . ARG D 1 71  ? -25.533 -93.447  -10.799 1.00 111.76 ? 150 ARG D C   1 
ATOM   3542  O O   . ARG D 1 71  ? -26.628 -93.935  -11.019 1.00 108.65 ? 150 ARG D O   1 
ATOM   3543  C CB  . ARG D 1 71  ? -25.702 -92.146  -8.686  1.00 119.55 ? 150 ARG D CB  1 
ATOM   3544  C CG  . ARG D 1 71  ? -27.155 -92.253  -8.268  1.00 121.83 ? 150 ARG D CG  1 
ATOM   3545  C CD  . ARG D 1 71  ? -27.262 -92.084  -6.762  1.00 130.94 ? 150 ARG D CD  1 
ATOM   3546  N NE  . ARG D 1 71  ? -26.804 -93.266  -6.019  1.00 136.58 ? 150 ARG D NE  1 
ATOM   3547  C CZ  . ARG D 1 71  ? -27.594 -94.241  -5.555  1.00 138.32 ? 150 ARG D CZ  1 
ATOM   3548  N NH1 . ARG D 1 71  ? -28.914 -94.232  -5.747  1.00 143.02 ? 150 ARG D NH1 1 
ATOM   3549  N NH2 . ARG D 1 71  ? -27.062 -95.253  -4.889  1.00 137.62 ? 150 ARG D NH2 1 
ATOM   3550  N N   . ARG D 1 72  ? -24.393 -94.068  -11.091 1.00 113.35 ? 151 ARG D N   1 
ATOM   3551  C CA  . ARG D 1 72  ? -24.375 -95.449  -11.571 1.00 116.25 ? 151 ARG D CA  1 
ATOM   3552  C C   . ARG D 1 72  ? -24.735 -96.349  -10.399 1.00 115.29 ? 151 ARG D C   1 
ATOM   3553  O O   . ARG D 1 72  ? -24.090 -96.286  -9.360  1.00 121.44 ? 151 ARG D O   1 
ATOM   3554  C CB  . ARG D 1 72  ? -23.000 -95.841  -12.115 1.00 118.84 ? 151 ARG D CB  1 
ATOM   3555  C CG  . ARG D 1 72  ? -23.002 -97.119  -12.928 1.00 121.24 ? 151 ARG D CG  1 
ATOM   3556  C CD  . ARG D 1 72  ? -21.590 -97.612  -13.210 1.00 124.63 ? 151 ARG D CD  1 
ATOM   3557  N NE  . ARG D 1 72  ? -20.737 -96.623  -13.883 1.00 120.96 ? 151 ARG D NE  1 
ATOM   3558  C CZ  . ARG D 1 72  ? -20.803 -96.304  -15.181 1.00 119.64 ? 151 ARG D CZ  1 
ATOM   3559  N NH1 . ARG D 1 72  ? -21.707 -96.848  -16.000 1.00 123.42 ? 151 ARG D NH1 1 
ATOM   3560  N NH2 . ARG D 1 72  ? -19.963 -95.402  -15.666 1.00 118.96 ? 151 ARG D NH2 1 
ATOM   3561  N N   . VAL D 1 73  ? -25.781 -97.158  -10.570 1.00 114.44 ? 152 VAL D N   1 
ATOM   3562  C CA  . VAL D 1 73  ? -26.279 -98.066  -9.529  1.00 115.04 ? 152 VAL D CA  1 
ATOM   3563  C C   . VAL D 1 73  ? -26.009 -99.539  -9.821  1.00 116.18 ? 152 VAL D C   1 
ATOM   3564  O O   . VAL D 1 73  ? -26.180 -100.366 -8.940  1.00 119.71 ? 152 VAL D O   1 
ATOM   3565  C CB  . VAL D 1 73  ? -27.794 -97.882  -9.265  1.00 118.71 ? 152 VAL D CB  1 
ATOM   3566  C CG1 . VAL D 1 73  ? -28.081 -96.484  -8.726  1.00 116.07 ? 152 VAL D CG1 1 
ATOM   3567  C CG2 . VAL D 1 73  ? -28.633 -98.174  -10.513 1.00 121.76 ? 152 VAL D CG2 1 
ATOM   3568  N N   . VAL D 1 74  ? -25.621 -99.877  -11.046 1.00 117.23 ? 153 VAL D N   1 
ATOM   3569  C CA  . VAL D 1 74  ? -25.213 -101.235 -11.383 1.00 120.26 ? 153 VAL D CA  1 
ATOM   3570  C C   . VAL D 1 74  ? -23.769 -101.150 -11.839 1.00 121.70 ? 153 VAL D C   1 
ATOM   3571  O O   . VAL D 1 74  ? -23.490 -100.729 -12.965 1.00 122.31 ? 153 VAL D O   1 
ATOM   3572  C CB  . VAL D 1 74  ? -26.094 -101.838 -12.491 1.00 120.99 ? 153 VAL D CB  1 
ATOM   3573  C CG1 . VAL D 1 74  ? -25.589 -103.220 -12.886 1.00 125.06 ? 153 VAL D CG1 1 
ATOM   3574  C CG2 . VAL D 1 74  ? -27.535 -101.913 -12.025 1.00 120.76 ? 153 VAL D CG2 1 
ATOM   3575  N N   . ALA D 1 75  ? -22.857 -101.553 -10.960 1.00 127.29 ? 154 ALA D N   1 
ATOM   3576  C CA  . ALA D 1 75  ? -21.423 -101.486 -11.236 1.00 130.68 ? 154 ALA D CA  1 
ATOM   3577  C C   . ALA D 1 75  ? -21.081 -102.148 -12.566 1.00 128.75 ? 154 ALA D C   1 
ATOM   3578  O O   . ALA D 1 75  ? -21.616 -103.215 -12.891 1.00 131.30 ? 154 ALA D O   1 
ATOM   3579  C CB  . ALA D 1 75  ? -20.632 -102.155 -10.117 1.00 134.62 ? 154 ALA D CB  1 
ATOM   3580  N N   . GLY D 1 76  ? -20.215 -101.492 -13.334 1.00 125.03 ? 155 GLY D N   1 
ATOM   3581  C CA  . GLY D 1 76  ? -19.723 -102.046 -14.588 1.00 127.01 ? 155 GLY D CA  1 
ATOM   3582  C C   . GLY D 1 76  ? -20.707 -102.066 -15.743 1.00 124.41 ? 155 GLY D C   1 
ATOM   3583  O O   . GLY D 1 76  ? -20.478 -102.761 -16.730 1.00 133.09 ? 155 GLY D O   1 
ATOM   3584  N N   . GLU D 1 77  ? -21.787 -101.303 -15.641 1.00 119.54 ? 156 GLU D N   1 
ATOM   3585  C CA  . GLU D 1 77  ? -22.823 -101.318 -16.658 1.00 120.68 ? 156 GLU D CA  1 
ATOM   3586  C C   . GLU D 1 77  ? -23.389 -99.925  -16.861 1.00 120.08 ? 156 GLU D C   1 
ATOM   3587  O O   . GLU D 1 77  ? -23.329 -99.085  -15.960 1.00 119.24 ? 156 GLU D O   1 
ATOM   3588  C CB  . GLU D 1 77  ? -23.941 -102.288 -16.255 1.00 120.32 ? 156 GLU D CB  1 
ATOM   3589  N N   . GLY D 1 78  ? -23.934 -99.692  -18.052 1.00 122.16 ? 157 GLY D N   1 
ATOM   3590  C CA  . GLY D 1 78  ? -24.712 -98.490  -18.330 1.00 124.94 ? 157 GLY D CA  1 
ATOM   3591  C C   . GLY D 1 78  ? -23.921 -97.416  -19.027 1.00 124.76 ? 157 GLY D C   1 
ATOM   3592  O O   . GLY D 1 78  ? -22.819 -97.088  -18.603 1.00 132.37 ? 157 GLY D O   1 
ATOM   3593  N N   . SER D 1 79  ? -24.498 -96.866  -20.090 1.00 120.88 ? 158 SER D N   1 
ATOM   3594  C CA  . SER D 1 79  ? -23.881 -95.788  -20.852 1.00 119.90 ? 158 SER D CA  1 
ATOM   3595  C C   . SER D 1 79  ? -24.944 -95.011  -21.596 1.00 118.73 ? 158 SER D C   1 
ATOM   3596  O O   . SER D 1 79  ? -26.094 -95.421  -21.626 1.00 126.20 ? 158 SER D O   1 
ATOM   3597  C CB  . SER D 1 79  ? -22.881 -96.352  -21.847 1.00 122.20 ? 158 SER D CB  1 
ATOM   3598  O OG  . SER D 1 79  ? -23.505 -97.273  -22.712 1.00 123.24 ? 158 SER D OG  1 
ATOM   3599  N N   . GLY D 1 80  ? -24.557 -93.882  -22.175 1.00 120.10 ? 159 GLY D N   1 
ATOM   3600  C CA  . GLY D 1 80  ? -25.457 -93.062  -22.973 1.00 124.56 ? 159 GLY D CA  1 
ATOM   3601  C C   . GLY D 1 80  ? -25.624 -91.636  -22.488 1.00 122.83 ? 159 GLY D C   1 
ATOM   3602  O O   . GLY D 1 80  ? -24.655 -90.989  -22.106 1.00 130.63 ? 159 GLY D O   1 
ATOM   3603  N N   . SER D 1 81  ? -26.852 -91.136  -22.528 1.00 119.03 ? 160 SER D N   1 
ATOM   3604  C CA  . SER D 1 81  ? -27.112 -89.722  -22.319 1.00 117.02 ? 160 SER D CA  1 
ATOM   3605  C C   . SER D 1 81  ? -28.497 -89.473  -21.718 1.00 114.86 ? 160 SER D C   1 
ATOM   3606  O O   . SER D 1 81  ? -29.405 -90.242  -21.929 1.00 119.15 ? 160 SER D O   1 
ATOM   3607  C CB  . SER D 1 81  ? -26.982 -89.023  -23.660 1.00 119.40 ? 160 SER D CB  1 
ATOM   3608  O OG  . SER D 1 81  ? -27.825 -87.877  -23.724 1.00 125.87 ? 160 SER D OG  1 
ATOM   3609  N N   . VAL D 1 82  ? -28.634 -88.380  -20.987 1.00 109.31 ? 161 VAL D N   1 
ATOM   3610  C CA  . VAL D 1 82  ? -29.871 -88.011  -20.301 1.00 105.41 ? 161 VAL D CA  1 
ATOM   3611  C C   . VAL D 1 82  ? -30.033 -86.515  -20.438 1.00 109.97 ? 161 VAL D C   1 
ATOM   3612  O O   . VAL D 1 82  ? -29.062 -85.781  -20.316 1.00 112.41 ? 161 VAL D O   1 
ATOM   3613  C CB  . VAL D 1 82  ? -29.797 -88.338  -18.794 1.00 105.57 ? 161 VAL D CB  1 
ATOM   3614  C CG1 . VAL D 1 82  ? -31.044 -87.874  -18.059 1.00 102.96 ? 161 VAL D CG1 1 
ATOM   3615  C CG2 . VAL D 1 82  ? -29.557 -89.824  -18.592 1.00 109.37 ? 161 VAL D CG2 1 
ATOM   3616  N N   . SER D 1 83  ? -31.271 -86.065  -20.637 1.00 116.59 ? 162 SER D N   1 
ATOM   3617  C CA  . SER D 1 83  ? -31.559 -84.672  -20.991 1.00 114.70 ? 162 SER D CA  1 
ATOM   3618  C C   . SER D 1 83  ? -32.747 -84.122  -20.233 1.00 113.55 ? 162 SER D C   1 
ATOM   3619  O O   . SER D 1 83  ? -33.775 -84.757  -20.193 1.00 123.05 ? 162 SER D O   1 
ATOM   3620  C CB  . SER D 1 83  ? -31.839 -84.571  -22.489 1.00 116.04 ? 162 SER D CB  1 
ATOM   3621  O OG  . SER D 1 83  ? -31.048 -85.509  -23.209 1.00 120.09 ? 162 SER D OG  1 
ATOM   3622  N N   . LEU D 1 84  ? -32.594 -82.946  -19.634 1.00 114.86 ? 163 LEU D N   1 
ATOM   3623  C CA  . LEU D 1 84  ? -33.732 -82.146  -19.171 1.00 116.26 ? 163 LEU D CA  1 
ATOM   3624  C C   . LEU D 1 84  ? -34.095 -81.104  -20.222 1.00 117.47 ? 163 LEU D C   1 
ATOM   3625  O O   . LEU D 1 84  ? -33.254 -80.664  -21.008 1.00 114.05 ? 163 LEU D O   1 
ATOM   3626  C CB  . LEU D 1 84  ? -33.421 -81.417  -17.869 1.00 114.66 ? 163 LEU D CB  1 
ATOM   3627  C CG  . LEU D 1 84  ? -33.147 -82.232  -16.612 1.00 113.56 ? 163 LEU D CG  1 
ATOM   3628  C CD1 . LEU D 1 84  ? -33.212 -81.330  -15.389 1.00 110.04 ? 163 LEU D CD1 1 
ATOM   3629  C CD2 . LEU D 1 84  ? -34.109 -83.405  -16.481 1.00 115.57 ? 163 LEU D CD2 1 
ATOM   3630  N N   . ALA D 1 85  ? -35.362 -80.716  -20.221 1.00 118.88 ? 164 ALA D N   1 
ATOM   3631  C CA  . ALA D 1 85  ? -35.849 -79.644  -21.073 1.00 117.12 ? 164 ALA D CA  1 
ATOM   3632  C C   . ALA D 1 85  ? -36.964 -78.939  -20.339 1.00 114.89 ? 164 ALA D C   1 
ATOM   3633  O O   . ALA D 1 85  ? -37.929 -79.573  -19.929 1.00 115.51 ? 164 ALA D O   1 
ATOM   3634  C CB  . ALA D 1 85  ? -36.353 -80.197  -22.386 1.00 118.58 ? 164 ALA D CB  1 
ATOM   3635  N N   . LEU D 1 86  ? -36.815 -77.634  -20.155 1.00 114.22 ? 165 LEU D N   1 
ATOM   3636  C CA  . LEU D 1 86  ? -37.841 -76.813  -19.548 1.00 112.33 ? 165 LEU D CA  1 
ATOM   3637  C C   . LEU D 1 86  ? -38.718 -76.306  -20.669 1.00 117.29 ? 165 LEU D C   1 
ATOM   3638  O O   . LEU D 1 86  ? -38.223 -75.642  -21.589 1.00 117.71 ? 165 LEU D O   1 
ATOM   3639  C CB  . LEU D 1 86  ? -37.217 -75.635  -18.824 1.00 109.94 ? 165 LEU D CB  1 
ATOM   3640  C CG  . LEU D 1 86  ? -38.183 -74.746  -18.051 1.00 111.97 ? 165 LEU D CG  1 
ATOM   3641  C CD1 . LEU D 1 86  ? -38.594 -75.423  -16.750 1.00 112.34 ? 165 LEU D CD1 1 
ATOM   3642  C CD2 . LEU D 1 86  ? -37.542 -73.391  -17.791 1.00 113.87 ? 165 LEU D CD2 1 
ATOM   3643  N N   . HIS D 1 87  ? -40.014 -76.633  -20.593 1.00 123.59 ? 166 HIS D N   1 
ATOM   3644  C CA  . HIS D 1 87  ? -41.011 -76.176  -21.555 1.00 124.21 ? 166 HIS D CA  1 
ATOM   3645  C C   . HIS D 1 87  ? -41.988 -75.239  -20.877 1.00 129.38 ? 166 HIS D C   1 
ATOM   3646  O O   . HIS D 1 87  ? -42.407 -75.484  -19.737 1.00 129.04 ? 166 HIS D O   1 
ATOM   3647  C CB  . HIS D 1 87  ? -41.754 -77.363  -22.133 1.00 124.02 ? 166 HIS D CB  1 
ATOM   3648  C CG  . HIS D 1 87  ? -40.909 -78.221  -23.017 1.00 124.24 ? 166 HIS D CG  1 
ATOM   3649  N ND1 . HIS D 1 87  ? -40.251 -77.719  -24.118 1.00 123.94 ? 166 HIS D ND1 1 
ATOM   3650  C CD2 . HIS D 1 87  ? -40.617 -79.541  -22.966 1.00 125.26 ? 166 HIS D CD2 1 
ATOM   3651  C CE1 . HIS D 1 87  ? -39.597 -78.697  -24.718 1.00 125.81 ? 166 HIS D CE1 1 
ATOM   3652  N NE2 . HIS D 1 87  ? -39.805 -79.813  -24.040 1.00 128.30 ? 166 HIS D NE2 1 
ATOM   3653  N N   . LEU D 1 88  ? -42.335 -74.153  -21.575 1.00 137.90 ? 167 LEU D N   1 
ATOM   3654  C CA  . LEU D 1 88  ? -43.286 -73.167  -21.069 1.00 149.42 ? 167 LEU D CA  1 
ATOM   3655  C C   . LEU D 1 88  ? -44.667 -73.389  -21.665 1.00 161.14 ? 167 LEU D C   1 
ATOM   3656  O O   . LEU D 1 88  ? -44.809 -73.421  -22.885 1.00 166.91 ? 167 LEU D O   1 
ATOM   3657  C CB  . LEU D 1 88  ? -42.810 -71.765  -21.441 1.00 146.25 ? 167 LEU D CB  1 
ATOM   3658  C CG  . LEU D 1 88  ? -41.430 -71.365  -20.904 1.00 140.68 ? 167 LEU D CG  1 
ATOM   3659  C CD1 . LEU D 1 88  ? -41.110 -69.966  -21.397 1.00 139.81 ? 167 LEU D CD1 1 
ATOM   3660  C CD2 . LEU D 1 88  ? -41.392 -71.424  -19.372 1.00 139.01 ? 167 LEU D CD2 1 
ATOM   3661  N N   . GLN D 1 89  ? -45.678 -73.552  -20.810 1.00 168.71 ? 168 GLN D N   1 
ATOM   3662  C CA  . GLN D 1 89  ? -47.071 -73.581  -21.241 1.00 185.10 ? 168 GLN D CA  1 
ATOM   3663  C C   . GLN D 1 89  ? -47.769 -72.349  -20.630 1.00 193.45 ? 168 GLN D C   1 
ATOM   3664  O O   . GLN D 1 89  ? -47.676 -72.152  -19.414 1.00 194.45 ? 168 GLN D O   1 
ATOM   3665  C CB  . GLN D 1 89  ? -47.739 -74.886  -20.799 1.00 194.48 ? 168 GLN D CB  1 
ATOM   3666  C CG  . GLN D 1 89  ? -49.148 -75.111  -21.350 1.00 203.82 ? 168 GLN D CG  1 
ATOM   3667  C CD  . GLN D 1 89  ? -49.180 -75.537  -22.816 1.00 209.75 ? 168 GLN D CD  1 
ATOM   3668  O OE1 . GLN D 1 89  ? -48.298 -75.204  -23.613 1.00 212.06 ? 168 GLN D OE1 1 
ATOM   3669  N NE2 . GLN D 1 89  ? -50.215 -76.295  -23.177 1.00 215.74 ? 168 GLN D NE2 1 
ATOM   3670  N N   . PRO D 1 90  ? -48.458 -71.516  -21.427 1.00 206.31 ? 169 PRO D N   1 
ATOM   3671  C CA  . PRO D 1 90  ? -48.738 -71.728  -22.862 1.00 209.00 ? 169 PRO D CA  1 
ATOM   3672  C C   . PRO D 1 90  ? -47.585 -71.364  -23.810 1.00 205.74 ? 169 PRO D C   1 
ATOM   3673  O O   . PRO D 1 90  ? -46.755 -70.491  -23.506 1.00 203.41 ? 169 PRO D O   1 
ATOM   3674  C CB  . PRO D 1 90  ? -49.946 -70.815  -23.114 1.00 218.61 ? 169 PRO D CB  1 
ATOM   3675  C CG  . PRO D 1 90  ? -49.800 -69.715  -22.112 1.00 218.08 ? 169 PRO D CG  1 
ATOM   3676  C CD  . PRO D 1 90  ? -49.155 -70.325  -20.897 1.00 214.78 ? 169 PRO D CD  1 
ATOM   3677  N N   . LEU D 1 91  ? -47.554 -72.026  -24.970 1.00 205.96 ? 170 LEU D N   1 
ATOM   3678  C CA  . LEU D 1 91  ? -46.439 -71.902  -25.920 1.00 203.05 ? 170 LEU D CA  1 
ATOM   3679  C C   . LEU D 1 91  ? -46.343 -70.490  -26.501 1.00 199.92 ? 170 LEU D C   1 
ATOM   3680  O O   . LEU D 1 91  ? -45.455 -70.206  -27.288 1.00 191.99 ? 170 LEU D O   1 
ATOM   3681  C CB  . LEU D 1 91  ? -46.587 -72.904  -27.071 1.00 202.94 ? 170 LEU D CB  1 
ATOM   3682  N N   . ALA D 1 97  ? -37.031 -75.254  -29.170 1.00 183.28 ? 176 ALA D N   1 
ATOM   3683  C CA  . ALA D 1 97  ? -38.305 -74.848  -28.581 1.00 182.07 ? 176 ALA D CA  1 
ATOM   3684  C C   . ALA D 1 97  ? -38.250 -74.779  -27.054 1.00 174.33 ? 176 ALA D C   1 
ATOM   3685  O O   . ALA D 1 97  ? -39.137 -74.173  -26.436 1.00 180.09 ? 176 ALA D O   1 
ATOM   3686  C CB  . ALA D 1 97  ? -39.418 -75.794  -29.020 1.00 186.48 ? 176 ALA D CB  1 
ATOM   3687  N N   . ALA D 1 98  ? -37.235 -75.404  -26.452 1.00 158.17 ? 177 ALA D N   1 
ATOM   3688  C CA  . ALA D 1 98  ? -37.110 -75.444  -24.996 1.00 147.05 ? 177 ALA D CA  1 
ATOM   3689  C C   . ALA D 1 98  ? -36.485 -74.162  -24.469 1.00 138.80 ? 177 ALA D C   1 
ATOM   3690  O O   . ALA D 1 98  ? -35.534 -73.649  -25.046 1.00 133.12 ? 177 ALA D O   1 
ATOM   3691  C CB  . ALA D 1 98  ? -36.288 -76.646  -24.565 1.00 146.21 ? 177 ALA D CB  1 
ATOM   3692  N N   . ALA D 1 99  ? -37.025 -73.657  -23.362 1.00 136.03 ? 178 ALA D N   1 
ATOM   3693  C CA  . ALA D 1 99  ? -36.554 -72.407  -22.747 1.00 137.15 ? 178 ALA D CA  1 
ATOM   3694  C C   . ALA D 1 99  ? -35.168 -72.575  -22.140 1.00 132.35 ? 178 ALA D C   1 
ATOM   3695  O O   . ALA D 1 99  ? -34.314 -71.690  -22.243 1.00 132.12 ? 178 ALA D O   1 
ATOM   3696  C CB  . ALA D 1 99  ? -37.537 -71.949  -21.677 1.00 140.09 ? 178 ALA D CB  1 
ATOM   3697  N N   . LEU D 1 100 ? -34.991 -73.721  -21.486 1.00 128.55 ? 179 LEU D N   1 
ATOM   3698  C CA  . LEU D 1 100 ? -33.752 -74.112  -20.830 1.00 123.65 ? 179 LEU D CA  1 
ATOM   3699  C C   . LEU D 1 100 ? -33.543 -75.592  -21.165 1.00 121.36 ? 179 LEU D C   1 
ATOM   3700  O O   . LEU D 1 100 ? -34.497 -76.368  -21.171 1.00 119.86 ? 179 LEU D O   1 
ATOM   3701  C CB  . LEU D 1 100 ? -33.911 -73.908  -19.327 1.00 121.95 ? 179 LEU D CB  1 
ATOM   3702  C CG  . LEU D 1 100 ? -32.665 -73.771  -18.466 1.00 124.15 ? 179 LEU D CG  1 
ATOM   3703  C CD1 . LEU D 1 100 ? -31.916 -72.501  -18.830 1.00 124.71 ? 179 LEU D CD1 1 
ATOM   3704  C CD2 . LEU D 1 100 ? -33.039 -73.762  -16.993 1.00 124.52 ? 179 LEU D CD2 1 
ATOM   3705  N N   . ALA D 1 101 ? -32.319 -75.988  -21.476 1.00 124.81 ? 180 ALA D N   1 
ATOM   3706  C CA  . ALA D 1 101 ? -32.048 -77.382  -21.821 1.00 123.97 ? 180 ALA D CA  1 
ATOM   3707  C C   . ALA D 1 101 ? -30.634 -77.827  -21.443 1.00 123.22 ? 180 ALA D C   1 
ATOM   3708  O O   . ALA D 1 101 ? -29.684 -77.051  -21.478 1.00 117.46 ? 180 ALA D O   1 
ATOM   3709  C CB  . ALA D 1 101 ? -32.304 -77.606  -23.298 1.00 123.38 ? 180 ALA D CB  1 
ATOM   3710  N N   . LEU D 1 102 ? -30.520 -79.105  -21.114 1.00 122.73 ? 181 LEU D N   1 
ATOM   3711  C CA  . LEU D 1 102 ? -29.325 -79.662  -20.513 1.00 118.27 ? 181 LEU D CA  1 
ATOM   3712  C C   . LEU D 1 102 ? -29.167 -81.089  -20.966 1.00 115.94 ? 181 LEU D C   1 
ATOM   3713  O O   . LEU D 1 102 ? -30.136 -81.812  -21.053 1.00 118.20 ? 181 LEU D O   1 
ATOM   3714  C CB  . LEU D 1 102 ? -29.483 -79.660  -18.996 1.00 117.48 ? 181 LEU D CB  1 
ATOM   3715  C CG  . LEU D 1 102 ? -28.274 -79.221  -18.184 1.00 118.56 ? 181 LEU D CG  1 
ATOM   3716  C CD1 . LEU D 1 102 ? -28.577 -79.417  -16.707 1.00 122.19 ? 181 LEU D CD1 1 
ATOM   3717  C CD2 . LEU D 1 102 ? -27.029 -79.981  -18.575 1.00 118.67 ? 181 LEU D CD2 1 
ATOM   3718  N N   . THR D 1 103 ? -27.954 -81.513  -21.239 1.00 115.45 ? 182 THR D N   1 
ATOM   3719  C CA  . THR D 1 103 ? -27.696 -82.916  -21.492 1.00 115.83 ? 182 THR D CA  1 
ATOM   3720  C C   . THR D 1 103 ? -26.452 -83.319  -20.723 1.00 114.26 ? 182 THR D C   1 
ATOM   3721  O O   . THR D 1 103 ? -25.519 -82.529  -20.584 1.00 120.42 ? 182 THR D O   1 
ATOM   3722  C CB  . THR D 1 103 ? -27.563 -83.194  -22.999 1.00 118.90 ? 182 THR D CB  1 
ATOM   3723  O OG1 . THR D 1 103 ? -28.780 -82.805  -23.650 1.00 119.71 ? 182 THR D OG1 1 
ATOM   3724  C CG2 . THR D 1 103 ? -27.300 -84.673  -23.272 1.00 119.29 ? 182 THR D CG2 1 
ATOM   3725  N N   . VAL D 1 104 ? -26.471 -84.544  -20.209 1.00 109.12 ? 183 VAL D N   1 
ATOM   3726  C CA  . VAL D 1 104 ? -25.429 -85.074  -19.351 1.00 104.41 ? 183 VAL D CA  1 
ATOM   3727  C C   . VAL D 1 104 ? -25.007 -86.406  -19.935 1.00 110.07 ? 183 VAL D C   1 
ATOM   3728  O O   . VAL D 1 104 ? -25.841 -87.265  -20.166 1.00 107.25 ? 183 VAL D O   1 
ATOM   3729  C CB  . VAL D 1 104 ? -25.982 -85.247  -17.933 1.00 99.82  ? 183 VAL D CB  1 
ATOM   3730  C CG1 . VAL D 1 104 ? -25.040 -86.051  -17.064 1.00 100.58 ? 183 VAL D CG1 1 
ATOM   3731  C CG2 . VAL D 1 104 ? -26.255 -83.871  -17.318 1.00 101.71 ? 183 VAL D CG2 1 
ATOM   3732  N N   . ASP D 1 105 ? -23.718 -86.574  -20.197 1.00 123.38 ? 184 ASP D N   1 
ATOM   3733  C CA  . ASP D 1 105 ? -23.224 -87.844  -20.729 1.00 130.50 ? 184 ASP D CA  1 
ATOM   3734  C C   . ASP D 1 105 ? -23.057 -88.801  -19.562 1.00 125.60 ? 184 ASP D C   1 
ATOM   3735  O O   . ASP D 1 105 ? -22.586 -88.409  -18.494 1.00 119.51 ? 184 ASP D O   1 
ATOM   3736  C CB  . ASP D 1 105 ? -21.889 -87.663  -21.462 1.00 144.45 ? 184 ASP D CB  1 
ATOM   3737  C CG  . ASP D 1 105 ? -22.039 -86.954  -22.816 1.00 158.63 ? 184 ASP D CG  1 
ATOM   3738  O OD1 . ASP D 1 105 ? -21.224 -87.244  -23.733 1.00 175.30 ? 184 ASP D OD1 1 
ATOM   3739  O OD2 . ASP D 1 105 ? -22.954 -86.110  -22.978 1.00 169.50 ? 184 ASP D OD2 1 
ATOM   3740  N N   . LEU D 1 106 ? -23.471 -90.044  -19.767 1.00 128.22 ? 185 LEU D N   1 
ATOM   3741  C CA  . LEU D 1 106 ? -23.233 -91.129  -18.821 1.00 130.81 ? 185 LEU D CA  1 
ATOM   3742  C C   . LEU D 1 106 ? -22.014 -91.910  -19.314 1.00 129.39 ? 185 LEU D C   1 
ATOM   3743  O O   . LEU D 1 106 ? -22.088 -92.596  -20.339 1.00 131.26 ? 185 LEU D O   1 
ATOM   3744  C CB  . LEU D 1 106 ? -24.449 -92.050  -18.734 1.00 133.79 ? 185 LEU D CB  1 
ATOM   3745  N N   . PRO D 1 107 ? -20.885 -91.806  -18.605 1.00 127.68 ? 186 PRO D N   1 
ATOM   3746  C CA  . PRO D 1 107 ? -19.676 -92.446  -19.107 1.00 134.51 ? 186 PRO D CA  1 
ATOM   3747  C C   . PRO D 1 107 ? -19.759 -93.971  -19.092 1.00 141.30 ? 186 PRO D C   1 
ATOM   3748  O O   . PRO D 1 107 ? -20.434 -94.539  -18.237 1.00 143.98 ? 186 PRO D O   1 
ATOM   3749  C CB  . PRO D 1 107 ? -18.602 -91.966  -18.151 1.00 137.24 ? 186 PRO D CB  1 
ATOM   3750  C CG  . PRO D 1 107 ? -19.352 -91.698  -16.875 1.00 131.28 ? 186 PRO D CG  1 
ATOM   3751  C CD  . PRO D 1 107 ? -20.681 -91.186  -17.288 1.00 125.86 ? 186 PRO D CD  1 
ATOM   3752  N N   . PRO D 1 108 ? -19.071 -94.642  -20.027 1.00 150.26 ? 187 PRO D N   1 
ATOM   3753  C CA  . PRO D 1 108 ? -19.196 -96.083  -20.122 1.00 152.67 ? 187 PRO D CA  1 
ATOM   3754  C C   . PRO D 1 108 ? -18.251 -96.764  -19.125 1.00 154.42 ? 187 PRO D C   1 
ATOM   3755  O O   . PRO D 1 108 ? -17.065 -96.417  -19.055 1.00 163.65 ? 187 PRO D O   1 
ATOM   3756  C CB  . PRO D 1 108 ? -18.781 -96.364  -21.561 1.00 157.97 ? 187 PRO D CB  1 
ATOM   3757  C CG  . PRO D 1 108 ? -17.793 -95.306  -21.874 1.00 162.44 ? 187 PRO D CG  1 
ATOM   3758  C CD  . PRO D 1 108 ? -18.146 -94.098  -21.039 1.00 158.67 ? 187 PRO D CD  1 
ATOM   3759  N N   . ALA D 1 109 ? -18.762 -97.672  -18.305 1.00 150.58 ? 188 ALA D N   1 
ATOM   3760  C CA  . ALA D 1 109 ? -17.998 -98.136  -17.134 1.00 154.26 ? 188 ALA D CA  1 
ATOM   3761  C C   . ALA D 1 109 ? -16.572 -98.695  -17.429 1.00 157.91 ? 188 ALA D C   1 
ATOM   3762  O O   . ALA D 1 109 ? -16.409 -99.812  -17.911 1.00 158.84 ? 188 ALA D O   1 
ATOM   3763  C CB  . ALA D 1 109 ? -18.827 -99.131  -16.365 1.00 152.22 ? 188 ALA D CB  1 
ATOM   3764  N N   . SER D 1 110 ? -15.558 -97.899  -17.091 1.00 158.02 ? 189 SER D N   1 
ATOM   3765  C CA  . SER D 1 110 ? -14.151 -98.189  -17.391 1.00 160.22 ? 189 SER D CA  1 
ATOM   3766  C C   . SER D 1 110 ? -13.378 -98.566  -16.123 1.00 167.88 ? 189 SER D C   1 
ATOM   3767  O O   . SER D 1 110 ? -13.940 -98.599  -15.018 1.00 167.28 ? 189 SER D O   1 
ATOM   3768  C CB  . SER D 1 110 ? -13.471 -96.958  -18.026 1.00 157.89 ? 189 SER D CB  1 
ATOM   3769  N N   . SER D 1 111 ? -12.068 -98.833  -16.282 1.00 174.57 ? 190 SER D N   1 
ATOM   3770  C CA  . SER D 1 111 ? -11.150 -99.045  -15.153 1.00 173.66 ? 190 SER D CA  1 
ATOM   3771  C C   . SER D 1 111 ? -11.165 -97.829  -14.235 1.00 175.07 ? 190 SER D C   1 
ATOM   3772  O O   . SER D 1 111 ? -11.570 -97.942  -13.087 1.00 176.80 ? 190 SER D O   1 
ATOM   3773  C CB  . SER D 1 111 ? -9.726  -99.352  -15.634 1.00 174.77 ? 190 SER D CB  1 
ATOM   3774  N N   . GLU D 1 112 ? -10.793 -96.664  -14.771 1.00 177.85 ? 191 GLU D N   1 
ATOM   3775  C CA  . GLU D 1 112 ? -11.176 -95.376  -14.198 1.00 174.05 ? 191 GLU D CA  1 
ATOM   3776  C C   . GLU D 1 112 ? -12.710 -95.361  -14.136 1.00 173.36 ? 191 GLU D C   1 
ATOM   3777  O O   . GLU D 1 112 ? -13.369 -95.006  -15.121 1.00 176.70 ? 191 GLU D O   1 
ATOM   3778  C CB  . GLU D 1 112 ? -10.652 -94.207  -15.042 1.00 172.30 ? 191 GLU D CB  1 
ATOM   3779  N N   . ALA D 1 113 ? -13.246 -95.786  -12.990 1.00 169.91 ? 192 ALA D N   1 
ATOM   3780  C CA  . ALA D 1 113 ? -14.695 -95.919  -12.769 1.00 162.61 ? 192 ALA D CA  1 
ATOM   3781  C C   . ALA D 1 113 ? -15.224 -94.543  -12.388 1.00 152.52 ? 192 ALA D C   1 
ATOM   3782  O O   . ALA D 1 113 ? -14.916 -94.082  -11.287 1.00 144.60 ? 192 ALA D O   1 
ATOM   3783  C CB  . ALA D 1 113 ? -14.970 -96.932  -11.664 1.00 162.80 ? 192 ALA D CB  1 
ATOM   3784  N N   . ARG D 1 114 ? -15.922 -93.872  -13.305 1.00 140.12 ? 193 ARG D N   1 
ATOM   3785  C CA  . ARG D 1 114 ? -16.501 -92.568  -13.069 1.00 135.74 ? 193 ARG D CA  1 
ATOM   3786  C C   . ARG D 1 114 ? -17.990 -92.843  -12.846 1.00 131.90 ? 193 ARG D C   1 
ATOM   3787  O O   . ARG D 1 114 ? -18.764 -92.834  -13.792 1.00 136.00 ? 193 ARG D O   1 
ATOM   3788  C CB  . ARG D 1 114 ? -16.305 -91.666  -14.296 1.00 133.16 ? 193 ARG D CB  1 
ATOM   3789  N N   . ASN D 1 115 ? -18.405 -93.126  -11.617 1.00 124.45 ? 194 ASN D N   1 
ATOM   3790  C CA  . ASN D 1 115 ? -19.813 -93.543  -11.352 1.00 117.79 ? 194 ASN D CA  1 
ATOM   3791  C C   . ASN D 1 115 ? -20.829 -92.425  -11.045 1.00 115.28 ? 194 ASN D C   1 
ATOM   3792  O O   . ASN D 1 115 ? -21.805 -92.652  -10.313 1.00 117.59 ? 194 ASN D O   1 
ATOM   3793  C CB  . ASN D 1 115 ? -19.837 -94.583  -10.241 1.00 116.44 ? 194 ASN D CB  1 
ATOM   3794  C CG  . ASN D 1 115 ? -18.895 -95.725  -10.486 1.00 117.74 ? 194 ASN D CG  1 
ATOM   3795  O OD1 . ASN D 1 115 ? -18.160 -96.088  -9.580  1.00 125.73 ? 194 ASN D OD1 1 
ATOM   3796  N ND2 . ASN D 1 115 ? -18.819 -96.224  -11.714 1.00 113.53 ? 194 ASN D ND2 1 
ATOM   3797  N N   . SER D 1 116 ? -20.657 -91.245  -11.644 1.00 112.19 ? 195 SER D N   1 
ATOM   3798  C CA  . SER D 1 116 ? -21.650 -90.163  -11.490 1.00 112.91 ? 195 SER D CA  1 
ATOM   3799  C C   . SER D 1 116 ? -21.513 -89.104  -12.593 1.00 108.06 ? 195 SER D C   1 
ATOM   3800  O O   . SER D 1 116 ? -20.549 -89.121  -13.370 1.00 103.94 ? 195 SER D O   1 
ATOM   3801  C CB  . SER D 1 116 ? -21.580 -89.516  -10.100 1.00 113.94 ? 195 SER D CB  1 
ATOM   3802  O OG  . SER D 1 116 ? -20.427 -88.725  -9.977  1.00 121.75 ? 195 SER D OG  1 
ATOM   3803  N N   . ALA D 1 117 ? -22.495 -88.206  -12.675 1.00 104.59 ? 196 ALA D N   1 
ATOM   3804  C CA  . ALA D 1 117 ? -22.556 -87.237  -13.758 1.00 105.30 ? 196 ALA D CA  1 
ATOM   3805  C C   . ALA D 1 117 ? -23.441 -86.057  -13.397 1.00 103.91 ? 196 ALA D C   1 
ATOM   3806  O O   . ALA D 1 117 ? -24.601 -86.234  -13.112 1.00 103.11 ? 196 ALA D O   1 
ATOM   3807  C CB  . ALA D 1 117 ? -23.071 -87.916  -15.003 1.00 103.86 ? 196 ALA D CB  1 
ATOM   3808  N N   . PHE D 1 118 ? -22.870 -84.851  -13.427 1.00 109.82 ? 197 PHE D N   1 
ATOM   3809  C CA  . PHE D 1 118 ? -23.551 -83.609  -13.054 1.00 113.67 ? 197 PHE D CA  1 
ATOM   3810  C C   . PHE D 1 118 ? -23.833 -82.813  -14.317 1.00 112.03 ? 197 PHE D C   1 
ATOM   3811  O O   . PHE D 1 118 ? -23.294 -83.091  -15.398 1.00 108.08 ? 197 PHE D O   1 
ATOM   3812  C CB  . PHE D 1 118 ? -22.669 -82.745  -12.129 1.00 122.76 ? 197 PHE D CB  1 
ATOM   3813  C CG  . PHE D 1 118 ? -22.292 -83.418  -10.810 1.00 131.71 ? 197 PHE D CG  1 
ATOM   3814  C CD1 . PHE D 1 118 ? -22.687 -82.846  -9.582  1.00 133.31 ? 197 PHE D CD1 1 
ATOM   3815  C CD2 . PHE D 1 118 ? -21.517 -84.598  -10.773 1.00 132.83 ? 197 PHE D CD2 1 
ATOM   3816  C CE1 . PHE D 1 118 ? -22.331 -83.444  -8.369  1.00 132.14 ? 197 PHE D CE1 1 
ATOM   3817  C CE2 . PHE D 1 118 ? -21.184 -85.191  -9.560  1.00 131.37 ? 197 PHE D CE2 1 
ATOM   3818  C CZ  . PHE D 1 118 ? -21.580 -84.615  -8.360  1.00 130.31 ? 197 PHE D CZ  1 
ATOM   3819  N N   . GLY D 1 119 ? -24.678 -81.807  -14.152 1.00 110.67 ? 198 GLY D N   1 
ATOM   3820  C CA  . GLY D 1 119 ? -25.051 -80.923  -15.234 1.00 105.67 ? 198 GLY D CA  1 
ATOM   3821  C C   . GLY D 1 119 ? -25.835 -79.764  -14.648 1.00 102.25 ? 198 GLY D C   1 
ATOM   3822  O O   . GLY D 1 119 ? -26.822 -79.973  -13.956 1.00 108.37 ? 198 GLY D O   1 
ATOM   3823  N N   . PHE D 1 120 ? -25.391 -78.545  -14.909 1.00 99.44  ? 199 PHE D N   1 
ATOM   3824  C CA  . PHE D 1 120 ? -26.067 -77.348  -14.439 1.00 96.34  ? 199 PHE D CA  1 
ATOM   3825  C C   . PHE D 1 120 ? -26.242 -76.390  -15.590 1.00 97.73  ? 199 PHE D C   1 
ATOM   3826  O O   . PHE D 1 120 ? -25.331 -76.200  -16.372 1.00 100.44 ? 199 PHE D O   1 
ATOM   3827  C CB  . PHE D 1 120 ? -25.246 -76.664  -13.358 1.00 96.38  ? 199 PHE D CB  1 
ATOM   3828  C CG  . PHE D 1 120 ? -25.814 -75.363  -12.898 1.00 97.42  ? 199 PHE D CG  1 
ATOM   3829  C CD1 . PHE D 1 120 ? -26.634 -75.315  -11.789 1.00 99.98  ? 199 PHE D CD1 1 
ATOM   3830  C CD2 . PHE D 1 120 ? -25.538 -74.190  -13.579 1.00 100.75 ? 199 PHE D CD2 1 
ATOM   3831  C CE1 . PHE D 1 120 ? -27.175 -74.117  -11.350 1.00 103.69 ? 199 PHE D CE1 1 
ATOM   3832  C CE2 . PHE D 1 120 ? -26.085 -72.990  -13.158 1.00 105.44 ? 199 PHE D CE2 1 
ATOM   3833  C CZ  . PHE D 1 120 ? -26.901 -72.954  -12.035 1.00 105.45 ? 199 PHE D CZ  1 
ATOM   3834  N N   . GLN D 1 121 ? -27.408 -75.771  -15.667 1.00 100.44 ? 200 GLN D N   1 
ATOM   3835  C CA  . GLN D 1 121 ? -27.629 -74.660  -16.561 1.00 104.98 ? 200 GLN D CA  1 
ATOM   3836  C C   . GLN D 1 121 ? -28.546 -73.647  -15.911 1.00 100.01 ? 200 GLN D C   1 
ATOM   3837  O O   . GLN D 1 121 ? -29.413 -74.007  -15.123 1.00 96.34  ? 200 GLN D O   1 
ATOM   3838  C CB  . GLN D 1 121 ? -28.235 -75.142  -17.876 1.00 114.29 ? 200 GLN D CB  1 
ATOM   3839  C CG  . GLN D 1 121 ? -28.521 -73.988  -18.825 1.00 125.81 ? 200 GLN D CG  1 
ATOM   3840  C CD  . GLN D 1 121 ? -28.425 -74.356  -20.278 1.00 138.31 ? 200 GLN D CD  1 
ATOM   3841  O OE1 . GLN D 1 121 ? -29.406 -74.209  -21.034 1.00 139.41 ? 200 GLN D OE1 1 
ATOM   3842  N NE2 . GLN D 1 121 ? -27.222 -74.824  -20.697 1.00 145.01 ? 200 GLN D NE2 1 
ATOM   3843  N N   . GLY D 1 122 ? -28.328 -72.379  -16.230 1.00 98.48  ? 201 GLY D N   1 
ATOM   3844  C CA  . GLY D 1 122 ? -29.267 -71.339  -15.859 1.00 101.41 ? 201 GLY D CA  1 
ATOM   3845  C C   . GLY D 1 122 ? -29.168 -70.161  -16.799 1.00 102.02 ? 201 GLY D C   1 
ATOM   3846  O O   . GLY D 1 122 ? -28.139 -69.965  -17.417 1.00 99.54  ? 201 GLY D O   1 
ATOM   3847  N N   . ARG D 1 123 ? -30.263 -69.415  -16.928 1.00 104.77 ? 202 ARG D N   1 
ATOM   3848  C CA  . ARG D 1 123 ? -30.272 -68.141  -17.646 1.00 109.35 ? 202 ARG D CA  1 
ATOM   3849  C C   . ARG D 1 123 ? -31.492 -67.321  -17.282 1.00 109.57 ? 202 ARG D C   1 
ATOM   3850  O O   . ARG D 1 123 ? -32.382 -67.805  -16.593 1.00 114.04 ? 202 ARG D O   1 
ATOM   3851  C CB  . ARG D 1 123 ? -30.242 -68.354  -19.161 1.00 116.75 ? 202 ARG D CB  1 
ATOM   3852  C CG  . ARG D 1 123 ? -31.458 -69.075  -19.697 1.00 123.17 ? 202 ARG D CG  1 
ATOM   3853  C CD  . ARG D 1 123 ? -31.116 -69.932  -20.896 1.00 133.52 ? 202 ARG D CD  1 
ATOM   3854  N NE  . ARG D 1 123 ? -31.096 -69.218  -22.156 1.00 139.10 ? 202 ARG D NE  1 
ATOM   3855  C CZ  . ARG D 1 123 ? -30.852 -69.795  -23.330 1.00 148.18 ? 202 ARG D CZ  1 
ATOM   3856  N NH1 . ARG D 1 123 ? -30.576 -71.106  -23.425 1.00 152.08 ? 202 ARG D NH1 1 
ATOM   3857  N NH2 . ARG D 1 123 ? -30.869 -69.053  -24.443 1.00 156.57 ? 202 ARG D NH2 1 
ATOM   3858  N N   . LEU D 1 124 ? -31.517 -66.077  -17.751 1.00 110.80 ? 203 LEU D N   1 
ATOM   3859  C CA  . LEU D 1 124 ? -32.647 -65.184  -17.535 1.00 111.18 ? 203 LEU D CA  1 
ATOM   3860  C C   . LEU D 1 124 ? -33.780 -65.522  -18.507 1.00 113.69 ? 203 LEU D C   1 
ATOM   3861  O O   . LEU D 1 124 ? -33.551 -65.654  -19.709 1.00 112.81 ? 203 LEU D O   1 
ATOM   3862  C CB  . LEU D 1 124 ? -32.224 -63.729  -17.701 1.00 110.79 ? 203 LEU D CB  1 
ATOM   3863  C CG  . LEU D 1 124 ? -31.130 -63.268  -16.740 1.00 109.69 ? 203 LEU D CG  1 
ATOM   3864  C CD1 . LEU D 1 124 ? -30.492 -61.970  -17.207 1.00 109.98 ? 203 LEU D CD1 1 
ATOM   3865  C CD2 . LEU D 1 124 ? -31.679 -63.102  -15.337 1.00 109.53 ? 203 LEU D CD2 1 
ATOM   3866  N N   . LEU D 1 125 ? -34.988 -65.669  -17.972 1.00 116.61 ? 204 LEU D N   1 
ATOM   3867  C CA  . LEU D 1 125 ? -36.186 -65.924  -18.766 1.00 121.77 ? 204 LEU D CA  1 
ATOM   3868  C C   . LEU D 1 125 ? -37.224 -64.875  -18.432 1.00 126.90 ? 204 LEU D C   1 
ATOM   3869  O O   . LEU D 1 125 ? -37.529 -64.676  -17.254 1.00 131.16 ? 204 LEU D O   1 
ATOM   3870  C CB  . LEU D 1 125 ? -36.774 -67.303  -18.435 1.00 120.99 ? 204 LEU D CB  1 
ATOM   3871  C CG  . LEU D 1 125 ? -35.942 -68.544  -18.716 1.00 121.28 ? 204 LEU D CG  1 
ATOM   3872  C CD1 . LEU D 1 125 ? -36.780 -69.771  -18.385 1.00 119.80 ? 204 LEU D CD1 1 
ATOM   3873  C CD2 . LEU D 1 125 ? -35.454 -68.589  -20.159 1.00 122.40 ? 204 LEU D CD2 1 
ATOM   3874  N N   . HIS D 1 126 ? -37.758 -64.211  -19.455 1.00 131.84 ? 205 HIS D N   1 
ATOM   3875  C CA  . HIS D 1 126 ? -38.913 -63.337  -19.258 1.00 143.92 ? 205 HIS D CA  1 
ATOM   3876  C C   . HIS D 1 126 ? -40.119 -64.266  -19.151 1.00 146.10 ? 205 HIS D C   1 
ATOM   3877  O O   . HIS D 1 126 ? -40.425 -64.995  -20.090 1.00 152.41 ? 205 HIS D O   1 
ATOM   3878  C CB  . HIS D 1 126 ? -39.071 -62.324  -20.406 1.00 148.42 ? 205 HIS D CB  1 
ATOM   3879  N N   . LEU D 1 127 ? -40.763 -64.270  -17.988 1.00 142.65 ? 206 LEU D N   1 
ATOM   3880  C CA  . LEU D 1 127 ? -41.941 -65.095  -17.753 1.00 143.31 ? 206 LEU D CA  1 
ATOM   3881  C C   . LEU D 1 127 ? -43.203 -64.241  -17.737 1.00 150.18 ? 206 LEU D C   1 
ATOM   3882  O O   . LEU D 1 127 ? -43.200 -63.116  -17.222 1.00 151.47 ? 206 LEU D O   1 
ATOM   3883  C CB  . LEU D 1 127 ? -41.801 -65.843  -16.427 1.00 143.08 ? 206 LEU D CB  1 
ATOM   3884  C CG  . LEU D 1 127 ? -40.587 -66.766  -16.301 1.00 142.94 ? 206 LEU D CG  1 
ATOM   3885  C CD1 . LEU D 1 127 ? -40.559 -67.440  -14.936 1.00 143.73 ? 206 LEU D CD1 1 
ATOM   3886  C CD2 . LEU D 1 127 ? -40.573 -67.801  -17.426 1.00 142.92 ? 206 LEU D CD2 1 
ATOM   3887  N N   . SER D 1 128 ? -44.276 -64.789  -18.304 1.00 155.28 ? 207 SER D N   1 
ATOM   3888  C CA  . SER D 1 128 ? -45.581 -64.138  -18.323 1.00 160.15 ? 207 SER D CA  1 
ATOM   3889  C C   . SER D 1 128 ? -46.305 -64.398  -17.011 1.00 164.80 ? 207 SER D C   1 
ATOM   3890  O O   . SER D 1 128 ? -45.923 -65.288  -16.243 1.00 164.72 ? 207 SER D O   1 
ATOM   3891  C CB  . SER D 1 128 ? -46.421 -64.677  -19.480 1.00 160.98 ? 207 SER D CB  1 
ATOM   3892  O OG  . SER D 1 128 ? -45.632 -64.827  -20.642 1.00 158.98 ? 207 SER D OG  1 
ATOM   3893  N N   . ALA D 1 129 ? -47.351 -63.614  -16.758 1.00 167.31 ? 208 ALA D N   1 
ATOM   3894  C CA  . ALA D 1 129 ? -48.214 -63.843  -15.602 1.00 165.72 ? 208 ALA D CA  1 
ATOM   3895  C C   . ALA D 1 129 ? -48.983 -65.141  -15.830 1.00 167.55 ? 208 ALA D C   1 
ATOM   3896  O O   . ALA D 1 129 ? -49.471 -65.386  -16.938 1.00 163.89 ? 208 ALA D O   1 
ATOM   3897  C CB  . ALA D 1 129 ? -49.162 -62.677  -15.402 1.00 167.77 ? 208 ALA D CB  1 
ATOM   3898  N N   . GLY D 1 130 ? -49.059 -65.983  -14.800 1.00 171.32 ? 209 GLY D N   1 
ATOM   3899  C CA  . GLY D 1 130 ? -49.731 -67.281  -14.904 1.00 173.63 ? 209 GLY D CA  1 
ATOM   3900  C C   . GLY D 1 130 ? -49.059 -68.289  -15.828 1.00 169.36 ? 209 GLY D C   1 
ATOM   3901  O O   . GLY D 1 130 ? -49.726 -69.176  -16.377 1.00 170.34 ? 209 GLY D O   1 
ATOM   3902  N N   . GLN D 1 131 ? -47.741 -68.160  -15.998 1.00 163.33 ? 210 GLN D N   1 
ATOM   3903  C CA  . GLN D 1 131 ? -46.956 -69.081  -16.822 1.00 156.14 ? 210 GLN D CA  1 
ATOM   3904  C C   . GLN D 1 131 ? -46.713 -70.374  -16.052 1.00 152.53 ? 210 GLN D C   1 
ATOM   3905  O O   . GLN D 1 131 ? -46.328 -70.343  -14.878 1.00 144.45 ? 210 GLN D O   1 
ATOM   3906  C CB  . GLN D 1 131 ? -45.622 -68.444  -17.223 1.00 149.55 ? 210 GLN D CB  1 
ATOM   3907  C CG  . GLN D 1 131 ? -44.812 -69.243  -18.234 1.00 145.91 ? 210 GLN D CG  1 
ATOM   3908  C CD  . GLN D 1 131 ? -45.097 -68.852  -19.669 1.00 145.63 ? 210 GLN D CD  1 
ATOM   3909  O OE1 . GLN D 1 131 ? -45.815 -69.548  -20.389 1.00 147.60 ? 210 GLN D OE1 1 
ATOM   3910  N NE2 . GLN D 1 131 ? -44.526 -67.736  -20.096 1.00 146.33 ? 210 GLN D NE2 1 
ATOM   3911  N N   . ARG D 1 132 ? -46.936 -71.501  -16.729 1.00 154.56 ? 211 ARG D N   1 
ATOM   3912  C CA  . ARG D 1 132 ? -46.755 -72.833  -16.150 1.00 158.23 ? 211 ARG D CA  1 
ATOM   3913  C C   . ARG D 1 132 ? -45.489 -73.493  -16.726 1.00 154.99 ? 211 ARG D C   1 
ATOM   3914  O O   . ARG D 1 132 ? -45.477 -73.931  -17.878 1.00 151.48 ? 211 ARG D O   1 
ATOM   3915  C CB  . ARG D 1 132 ? -47.997 -73.693  -16.414 1.00 165.50 ? 211 ARG D CB  1 
ATOM   3916  N N   . LEU D 1 133 ? -44.420 -73.530  -15.923 1.00 153.48 ? 212 LEU D N   1 
ATOM   3917  C CA  . LEU D 1 133 ? -43.148 -74.155  -16.311 1.00 150.46 ? 212 LEU D CA  1 
ATOM   3918  C C   . LEU D 1 133 ? -43.194 -75.641  -15.949 1.00 146.87 ? 212 LEU D C   1 
ATOM   3919  O O   . LEU D 1 133 ? -43.638 -76.006  -14.855 1.00 148.27 ? 212 LEU D O   1 
ATOM   3920  C CB  . LEU D 1 133 ? -41.965 -73.488  -15.594 1.00 146.98 ? 212 LEU D CB  1 
ATOM   3921  N N   . GLY D 1 134 ? -42.751 -76.491  -16.875 1.00 143.05 ? 213 GLY D N   1 
ATOM   3922  C CA  . GLY D 1 134 ? -42.648 -77.942  -16.650 1.00 143.55 ? 213 GLY D CA  1 
ATOM   3923  C C   . GLY D 1 134 ? -41.372 -78.505  -17.255 1.00 142.01 ? 213 GLY D C   1 
ATOM   3924  O O   . GLY D 1 134 ? -40.885 -77.989  -18.266 1.00 147.69 ? 213 GLY D O   1 
ATOM   3925  N N   . VAL D 1 135 ? -40.844 -79.565  -16.640 1.00 138.14 ? 214 VAL D N   1 
ATOM   3926  C CA  . VAL D 1 135 ? -39.537 -80.117  -17.031 1.00 133.80 ? 214 VAL D CA  1 
ATOM   3927  C C   . VAL D 1 135 ? -39.703 -81.548  -17.535 1.00 130.30 ? 214 VAL D C   1 
ATOM   3928  O O   . VAL D 1 135 ? -40.356 -82.364  -16.875 1.00 131.16 ? 214 VAL D O   1 
ATOM   3929  C CB  . VAL D 1 135 ? -38.559 -80.141  -15.845 1.00 131.97 ? 214 VAL D CB  1 
ATOM   3930  C CG1 . VAL D 1 135 ? -37.183 -80.601  -16.294 1.00 130.71 ? 214 VAL D CG1 1 
ATOM   3931  C CG2 . VAL D 1 135 ? -38.492 -78.778  -15.174 1.00 128.68 ? 214 VAL D CG2 1 
ATOM   3932  N N   . HIS D 1 136 ? -39.080 -81.843  -18.675 1.00 126.10 ? 215 HIS D N   1 
ATOM   3933  C CA  . HIS D 1 136 ? -39.224 -83.143  -19.332 1.00 127.36 ? 215 HIS D CA  1 
ATOM   3934  C C   . HIS D 1 136 ? -37.869 -83.852  -19.471 1.00 123.86 ? 215 HIS D C   1 
ATOM   3935  O O   . HIS D 1 136 ? -36.898 -83.288  -19.977 1.00 110.30 ? 215 HIS D O   1 
ATOM   3936  C CB  . HIS D 1 136 ? -39.881 -82.982  -20.700 1.00 129.99 ? 215 HIS D CB  1 
ATOM   3937  N N   . LEU D 1 137 ? -37.848 -85.106  -19.021 1.00 126.55 ? 216 LEU D N   1 
ATOM   3938  C CA  . LEU D 1 137 ? -36.676 -85.951  -19.049 1.00 124.51 ? 216 LEU D CA  1 
ATOM   3939  C C   . LEU D 1 137 ? -36.677 -86.822  -20.295 1.00 130.38 ? 216 LEU D C   1 
ATOM   3940  O O   . LEU D 1 137 ? -37.686 -87.424  -20.616 1.00 138.12 ? 216 LEU D O   1 
ATOM   3941  C CB  . LEU D 1 137 ? -36.674 -86.850  -17.822 1.00 123.23 ? 216 LEU D CB  1 
ATOM   3942  C CG  . LEU D 1 137 ? -35.447 -87.728  -17.623 1.00 124.58 ? 216 LEU D CG  1 
ATOM   3943  C CD1 . LEU D 1 137 ? -34.296 -86.850  -17.177 1.00 126.91 ? 216 LEU D CD1 1 
ATOM   3944  C CD2 . LEU D 1 137 ? -35.704 -88.767  -16.557 1.00 122.86 ? 216 LEU D CD2 1 
ATOM   3945  N N   . HIS D 1 138 ? -35.548 -86.884  -20.988 1.00 135.08 ? 217 HIS D N   1 
ATOM   3946  C CA  . HIS D 1 138 ? -35.375 -87.781  -22.122 1.00 139.56 ? 217 HIS D CA  1 
ATOM   3947  C C   . HIS D 1 138 ? -34.035 -88.468  -21.981 1.00 132.10 ? 217 HIS D C   1 
ATOM   3948  O O   . HIS D 1 138 ? -33.084 -87.857  -21.516 1.00 132.17 ? 217 HIS D O   1 
ATOM   3949  C CB  . HIS D 1 138 ? -35.437 -87.033  -23.452 1.00 148.59 ? 217 HIS D CB  1 
ATOM   3950  C CG  . HIS D 1 138 ? -35.368 -87.937  -24.646 1.00 160.93 ? 217 HIS D CG  1 
ATOM   3951  N ND1 . HIS D 1 138 ? -36.494 -88.490  -25.223 1.00 168.15 ? 217 HIS D ND1 1 
ATOM   3952  C CD2 . HIS D 1 138 ? -34.311 -88.429  -25.342 1.00 164.49 ? 217 HIS D CD2 1 
ATOM   3953  C CE1 . HIS D 1 138 ? -36.138 -89.251  -26.242 1.00 168.15 ? 217 HIS D CE1 1 
ATOM   3954  N NE2 . HIS D 1 138 ? -34.820 -89.234  -26.332 1.00 168.63 ? 217 HIS D NE2 1 
ATOM   3955  N N   . THR D 1 139 ? -33.952 -89.727  -22.402 1.00 130.79 ? 218 THR D N   1 
ATOM   3956  C CA  . THR D 1 139 ? -32.761 -90.531  -22.161 1.00 130.18 ? 218 THR D CA  1 
ATOM   3957  C C   . THR D 1 139 ? -32.475 -91.532  -23.280 1.00 133.47 ? 218 THR D C   1 
ATOM   3958  O O   . THR D 1 139 ? -33.294 -92.390  -23.561 1.00 133.88 ? 218 THR D O   1 
ATOM   3959  C CB  . THR D 1 139 ? -32.813 -91.234  -20.764 1.00 126.95 ? 218 THR D CB  1 
ATOM   3960  O OG1 . THR D 1 139 ? -32.138 -92.488  -20.811 1.00 128.59 ? 218 THR D OG1 1 
ATOM   3961  C CG2 . THR D 1 139 ? -34.233 -91.456  -20.268 1.00 125.43 ? 218 THR D CG2 1 
ATOM   3962  N N   . GLU D 1 140 ? -31.294 -91.401  -23.898 1.00 140.26 ? 219 GLU D N   1 
ATOM   3963  C CA  . GLU D 1 140 ? -30.727 -92.407  -24.811 1.00 147.56 ? 219 GLU D CA  1 
ATOM   3964  C C   . GLU D 1 140 ? -30.199 -93.609  -24.019 1.00 151.80 ? 219 GLU D C   1 
ATOM   3965  O O   . GLU D 1 140 ? -29.050 -93.640  -23.580 1.00 137.23 ? 219 GLU D O   1 
ATOM   3966  C CB  . GLU D 1 140 ? -29.606 -91.804  -25.664 1.00 150.63 ? 219 GLU D CB  1 
ATOM   3967  N N   . ALA D 1 141 ? -31.066 -94.605  -23.861 1.00 168.36 ? 220 ALA D N   1 
ATOM   3968  C CA  . ALA D 1 141 ? -30.809 -95.769  -22.997 1.00 172.92 ? 220 ALA D CA  1 
ATOM   3969  C C   . ALA D 1 141 ? -29.891 -96.803  -23.645 1.00 170.81 ? 220 ALA D C   1 
ATOM   3970  O O   . ALA D 1 141 ? -30.206 -97.339  -24.716 1.00 183.16 ? 220 ALA D O   1 
ATOM   3971  C CB  . ALA D 1 141 ? -32.127 -96.437  -22.612 1.00 177.77 ? 220 ALA D CB  1 
ATOM   3972  N N   . ARG D 1 142 ? -28.755 -97.061  -23.006 1.00 157.51 ? 221 ARG D N   1 
ATOM   3973  C CA  . ARG D 1 142 ? -28.025 -98.297  -23.211 1.00 156.32 ? 221 ARG D CA  1 
ATOM   3974  C C   . ARG D 1 142 ? -27.823 -98.878  -21.826 1.00 151.46 ? 221 ARG D C   1 
ATOM   3975  O O   . ARG D 1 142 ? -26.803 -98.647  -21.185 1.00 156.35 ? 221 ARG D O   1 
ATOM   3976  C CB  . ARG D 1 142 ? -26.694 -98.064  -23.944 1.00 159.97 ? 221 ARG D CB  1 
ATOM   3977  C CG  . ARG D 1 142 ? -25.938 -99.355  -24.298 1.00 165.17 ? 221 ARG D CG  1 
ATOM   3978  C CD  . ARG D 1 142 ? -26.230 -99.960  -25.671 1.00 171.84 ? 221 ARG D CD  1 
ATOM   3979  N NE  . ARG D 1 142 ? -25.781 -99.082  -26.749 1.00 176.24 ? 221 ARG D NE  1 
ATOM   3980  C CZ  . ARG D 1 142 ? -26.083 -99.221  -28.041 1.00 183.18 ? 221 ARG D CZ  1 
ATOM   3981  N NH1 . ARG D 1 142 ? -26.860 -100.219 -28.481 1.00 187.49 ? 221 ARG D NH1 1 
ATOM   3982  N NH2 . ARG D 1 142 ? -25.597 -98.343  -28.926 1.00 184.61 ? 221 ARG D NH2 1 
ATOM   3983  N N   . ALA D 1 143 ? -28.842 -99.614  -21.373 1.00 149.29 ? 222 ALA D N   1 
ATOM   3984  C CA  . ALA D 1 143 ? -28.990 -100.093 -19.983 1.00 146.45 ? 222 ALA D CA  1 
ATOM   3985  C C   . ALA D 1 143 ? -29.379 -98.961  -19.014 1.00 146.29 ? 222 ALA D C   1 
ATOM   3986  O O   . ALA D 1 143 ? -28.729 -98.751  -17.986 1.00 152.01 ? 222 ALA D O   1 
ATOM   3987  C CB  . ALA D 1 143 ? -27.751 -100.847 -19.508 1.00 143.73 ? 222 ALA D CB  1 
ATOM   3988  N N   . ARG D 1 144 ? -30.468 -98.252  -19.341 1.00 143.83 ? 223 ARG D N   1 
ATOM   3989  C CA  . ARG D 1 144 ? -31.050 -97.205  -18.487 1.00 137.18 ? 223 ARG D CA  1 
ATOM   3990  C C   . ARG D 1 144 ? -31.266 -97.631  -17.021 1.00 136.59 ? 223 ARG D C   1 
ATOM   3991  O O   . ARG D 1 144 ? -31.252 -96.787  -16.125 1.00 143.87 ? 223 ARG D O   1 
ATOM   3992  C CB  . ARG D 1 144 ? -32.399 -96.738  -19.070 1.00 135.72 ? 223 ARG D CB  1 
ATOM   3993  N N   . HIS D 1 145 ? -31.469 -98.927  -16.786 1.00 132.98 ? 224 HIS D N   1 
ATOM   3994  C CA  . HIS D 1 145 ? -31.565 -99.484  -15.437 1.00 130.87 ? 224 HIS D CA  1 
ATOM   3995  C C   . HIS D 1 145 ? -30.296 -99.346  -14.592 1.00 123.66 ? 224 HIS D C   1 
ATOM   3996  O O   . HIS D 1 145 ? -30.369 -99.401  -13.363 1.00 122.63 ? 224 HIS D O   1 
ATOM   3997  C CB  . HIS D 1 145 ? -31.934 -100.976 -15.509 1.00 138.60 ? 224 HIS D CB  1 
ATOM   3998  C CG  . HIS D 1 145 ? -30.775 -101.883 -15.825 1.00 139.44 ? 224 HIS D CG  1 
ATOM   3999  N ND1 . HIS D 1 145 ? -30.380 -102.176 -17.114 1.00 139.99 ? 224 HIS D ND1 1 
ATOM   4000  C CD2 . HIS D 1 145 ? -29.931 -102.564 -15.011 1.00 137.96 ? 224 HIS D CD2 1 
ATOM   4001  C CE1 . HIS D 1 145 ? -29.346 -102.998 -17.078 1.00 138.84 ? 224 HIS D CE1 1 
ATOM   4002  N NE2 . HIS D 1 145 ? -29.047 -103.241 -15.815 1.00 136.90 ? 224 HIS D NE2 1 
ATOM   4003  N N   . ALA D 1 146 ? -29.142 -99.208  -15.247 1.00 122.99 ? 225 ALA D N   1 
ATOM   4004  C CA  . ALA D 1 146 ? -27.853 -99.119  -14.556 1.00 120.86 ? 225 ALA D CA  1 
ATOM   4005  C C   . ALA D 1 146 ? -27.573 -97.756  -13.951 1.00 116.06 ? 225 ALA D C   1 
ATOM   4006  O O   . ALA D 1 146 ? -26.627 -97.626  -13.182 1.00 119.14 ? 225 ALA D O   1 
ATOM   4007  C CB  . ALA D 1 146 ? -26.719 -99.507  -15.494 1.00 119.89 ? 225 ALA D CB  1 
ATOM   4008  N N   . TRP D 1 147 ? -28.366 -96.743  -14.305 1.00 114.16 ? 226 TRP D N   1 
ATOM   4009  C CA  . TRP D 1 147 ? -28.200 -95.384  -13.777 1.00 109.27 ? 226 TRP D CA  1 
ATOM   4010  C C   . TRP D 1 147 ? -29.504 -94.901  -13.144 1.00 105.44 ? 226 TRP D C   1 
ATOM   4011  O O   . TRP D 1 147 ? -30.590 -95.271  -13.578 1.00 110.53 ? 226 TRP D O   1 
ATOM   4012  C CB  . TRP D 1 147 ? -27.788 -94.436  -14.902 1.00 109.88 ? 226 TRP D CB  1 
ATOM   4013  C CG  . TRP D 1 147 ? -26.334 -94.519  -15.300 1.00 112.41 ? 226 TRP D CG  1 
ATOM   4014  C CD1 . TRP D 1 147 ? -25.757 -95.400  -16.183 1.00 114.95 ? 226 TRP D CD1 1 
ATOM   4015  C CD2 . TRP D 1 147 ? -25.285 -93.673  -14.847 1.00 113.42 ? 226 TRP D CD2 1 
ATOM   4016  N NE1 . TRP D 1 147 ? -24.415 -95.151  -16.295 1.00 114.16 ? 226 TRP D NE1 1 
ATOM   4017  C CE2 . TRP D 1 147 ? -24.096 -94.096  -15.483 1.00 114.85 ? 226 TRP D CE2 1 
ATOM   4018  C CE3 . TRP D 1 147 ? -25.230 -92.598  -13.958 1.00 115.28 ? 226 TRP D CE3 1 
ATOM   4019  C CZ2 . TRP D 1 147 ? -22.864 -93.480  -15.255 1.00 114.57 ? 226 TRP D CZ2 1 
ATOM   4020  C CZ3 . TRP D 1 147 ? -24.015 -91.986  -13.719 1.00 116.22 ? 226 TRP D CZ3 1 
ATOM   4021  C CH2 . TRP D 1 147 ? -22.834 -92.434  -14.366 1.00 115.82 ? 226 TRP D CH2 1 
ATOM   4022  N N   . GLN D 1 148 ? -29.391 -94.072  -12.120 1.00 100.04 ? 227 GLN D N   1 
ATOM   4023  C CA  . GLN D 1 148 ? -30.543 -93.427  -11.517 1.00 99.40  ? 227 GLN D CA  1 
ATOM   4024  C C   . GLN D 1 148 ? -30.250 -91.956  -11.290 1.00 100.72 ? 227 GLN D C   1 
ATOM   4025  O O   . GLN D 1 148 ? -29.102 -91.552  -11.188 1.00 97.29  ? 227 GLN D O   1 
ATOM   4026  C CB  . GLN D 1 148 ? -30.909 -94.087  -10.195 1.00 100.28 ? 227 GLN D CB  1 
ATOM   4027  C CG  . GLN D 1 148 ? -31.252 -95.557  -10.317 1.00 106.33 ? 227 GLN D CG  1 
ATOM   4028  C CD  . GLN D 1 148 ? -31.981 -96.138  -9.087  1.00 110.13 ? 227 GLN D CD  1 
ATOM   4029  O OE1 . GLN D 1 148 ? -32.305 -95.434  -8.097  1.00 110.35 ? 227 GLN D OE1 1 
ATOM   4030  N NE2 . GLN D 1 148 ? -32.251 -97.442  -9.158  1.00 109.67 ? 227 GLN D NE2 1 
ATOM   4031  N N   . LEU D 1 149 ? -31.310 -91.155  -11.209 1.00 103.08 ? 228 LEU D N   1 
ATOM   4032  C CA  . LEU D 1 149 ? -31.192 -89.792  -10.724 1.00 100.81 ? 228 LEU D CA  1 
ATOM   4033  C C   . LEU D 1 149 ? -30.724 -89.843  -9.280  1.00 102.87 ? 228 LEU D C   1 
ATOM   4034  O O   . LEU D 1 149 ? -31.265 -90.607  -8.487  1.00 106.24 ? 228 LEU D O   1 
ATOM   4035  C CB  . LEU D 1 149 ? -32.512 -89.064  -10.795 1.00 103.28 ? 228 LEU D CB  1 
ATOM   4036  C CG  . LEU D 1 149 ? -33.114 -88.842  -12.185 1.00 108.67 ? 228 LEU D CG  1 
ATOM   4037  C CD1 . LEU D 1 149 ? -34.587 -88.477  -12.056 1.00 114.00 ? 228 LEU D CD1 1 
ATOM   4038  C CD2 . LEU D 1 149 ? -32.398 -87.775  -12.951 1.00 106.84 ? 228 LEU D CD2 1 
ATOM   4039  N N   . THR D 1 150 ? -29.689 -89.064  -8.959  1.00 103.78 ? 229 THR D N   1 
ATOM   4040  C CA  . THR D 1 150 ? -29.201 -88.951  -7.595  1.00 102.43 ? 229 THR D CA  1 
ATOM   4041  C C   . THR D 1 150 ? -30.223 -88.166  -6.803  1.00 103.65 ? 229 THR D C   1 
ATOM   4042  O O   . THR D 1 150 ? -30.673 -87.117  -7.248  1.00 105.59 ? 229 THR D O   1 
ATOM   4043  C CB  . THR D 1 150 ? -27.855 -88.226  -7.535  1.00 101.14 ? 229 THR D CB  1 
ATOM   4044  O OG1 . THR D 1 150 ? -26.889 -88.931  -8.326  1.00 98.39  ? 229 THR D OG1 1 
ATOM   4045  C CG2 . THR D 1 150 ? -27.358 -88.134  -6.093  1.00 103.22 ? 229 THR D CG2 1 
ATOM   4046  N N   . GLN D 1 151 ? -30.584 -88.678  -5.633  1.00 109.74 ? 230 GLN D N   1 
ATOM   4047  C CA  . GLN D 1 151 ? -31.748 -88.197  -4.901  1.00 118.37 ? 230 GLN D CA  1 
ATOM   4048  C C   . GLN D 1 151 ? -31.475 -86.927  -4.153  1.00 120.08 ? 230 GLN D C   1 
ATOM   4049  O O   . GLN D 1 151 ? -30.478 -86.824  -3.470  1.00 123.20 ? 230 GLN D O   1 
ATOM   4050  C CB  . GLN D 1 151 ? -32.234 -89.268  -3.932  1.00 129.35 ? 230 GLN D CB  1 
ATOM   4051  C CG  . GLN D 1 151 ? -32.773 -90.490  -4.668  1.00 133.47 ? 230 GLN D CG  1 
ATOM   4052  C CD  . GLN D 1 151 ? -33.279 -91.572  -3.786  1.00 134.15 ? 230 GLN D CD  1 
ATOM   4053  O OE1 . GLN D 1 151 ? -32.939 -92.734  -3.980  1.00 135.52 ? 230 GLN D OE1 1 
ATOM   4054  N NE2 . GLN D 1 151 ? -34.032 -91.195  -2.751  1.00 137.55 ? 230 GLN D NE2 1 
ATOM   4055  N N   . GLY D 1 152 ? -32.390 -85.968  -4.282  1.00 127.64 ? 231 GLY D N   1 
ATOM   4056  C CA  . GLY D 1 152 ? -32.211 -84.611  -3.746  1.00 130.44 ? 231 GLY D CA  1 
ATOM   4057  C C   . GLY D 1 152 ? -31.270 -83.700  -4.530  1.00 125.20 ? 231 GLY D C   1 
ATOM   4058  O O   . GLY D 1 152 ? -31.038 -82.568  -4.129  1.00 121.73 ? 231 GLY D O   1 
ATOM   4059  N N   . ALA D 1 153 ? -30.765 -84.191  -5.660  1.00 123.98 ? 232 ALA D N   1 
ATOM   4060  C CA  . ALA D 1 153 ? -29.774 -83.492  -6.475  1.00 125.20 ? 232 ALA D CA  1 
ATOM   4061  C C   . ALA D 1 153 ? -30.357 -82.872  -7.740  1.00 124.36 ? 232 ALA D C   1 
ATOM   4062  O O   . ALA D 1 153 ? -29.865 -81.844  -8.173  1.00 122.96 ? 232 ALA D O   1 
ATOM   4063  C CB  . ALA D 1 153 ? -28.656 -84.455  -6.846  1.00 125.10 ? 232 ALA D CB  1 
ATOM   4064  N N   . THR D 1 154 ? -31.354 -83.517  -8.344  1.00 124.98 ? 233 THR D N   1 
ATOM   4065  C CA  . THR D 1 154 ? -32.050 -82.962  -9.512  1.00 121.84 ? 233 THR D CA  1 
ATOM   4066  C C   . THR D 1 154 ? -33.004 -81.877  -9.039  1.00 114.38 ? 233 THR D C   1 
ATOM   4067  O O   . THR D 1 154 ? -33.935 -82.154  -8.299  1.00 110.57 ? 233 THR D O   1 
ATOM   4068  C CB  . THR D 1 154 ? -32.819 -84.053  -10.285 1.00 126.40 ? 233 THR D CB  1 
ATOM   4069  O OG1 . THR D 1 154 ? -31.922 -85.123  -10.620 1.00 130.78 ? 233 THR D OG1 1 
ATOM   4070  C CG2 . THR D 1 154 ? -33.464 -83.482  -11.556 1.00 125.11 ? 233 THR D CG2 1 
ATOM   4071  N N   . VAL D 1 155 ? -32.756 -80.643  -9.472  1.00 112.23 ? 234 VAL D N   1 
ATOM   4072  C CA  . VAL D 1 155 ? -33.359 -79.453  -8.881  1.00 108.78 ? 234 VAL D CA  1 
ATOM   4073  C C   . VAL D 1 155 ? -33.704 -78.442  -9.957  1.00 104.72 ? 234 VAL D C   1 
ATOM   4074  O O   . VAL D 1 155 ? -32.907 -78.177  -10.823 1.00 104.26 ? 234 VAL D O   1 
ATOM   4075  C CB  . VAL D 1 155 ? -32.378 -78.808  -7.888  1.00 111.25 ? 234 VAL D CB  1 
ATOM   4076  C CG1 . VAL D 1 155 ? -32.821 -77.420  -7.464  1.00 115.56 ? 234 VAL D CG1 1 
ATOM   4077  C CG2 . VAL D 1 155 ? -32.210 -79.699  -6.666  1.00 114.01 ? 234 VAL D CG2 1 
ATOM   4078  N N   . LEU D 1 156 ? -34.904 -77.883  -9.886  1.00 105.66 ? 235 LEU D N   1 
ATOM   4079  C CA  . LEU D 1 156 ? -35.296 -76.710  -10.662 1.00 105.57 ? 235 LEU D CA  1 
ATOM   4080  C C   . LEU D 1 156 ? -35.427 -75.573  -9.677  1.00 107.12 ? 235 LEU D C   1 
ATOM   4081  O O   . LEU D 1 156 ? -36.053 -75.735  -8.639  1.00 109.02 ? 235 LEU D O   1 
ATOM   4082  C CB  . LEU D 1 156 ? -36.647 -76.943  -11.337 1.00 106.93 ? 235 LEU D CB  1 
ATOM   4083  C CG  . LEU D 1 156 ? -37.334 -75.723  -11.964 1.00 107.07 ? 235 LEU D CG  1 
ATOM   4084  C CD1 . LEU D 1 156 ? -36.503 -75.153  -13.099 1.00 107.52 ? 235 LEU D CD1 1 
ATOM   4085  C CD2 . LEU D 1 156 ? -38.701 -76.114  -12.466 1.00 109.09 ? 235 LEU D CD2 1 
ATOM   4086  N N   . GLY D 1 157 ? -34.853 -74.430  -10.006 1.00 109.25 ? 236 GLY D N   1 
ATOM   4087  C CA  . GLY D 1 157 ? -34.957 -73.254  -9.165  1.00 112.11 ? 236 GLY D CA  1 
ATOM   4088  C C   . GLY D 1 157 ? -35.037 -71.975  -9.962  1.00 113.95 ? 236 GLY D C   1 
ATOM   4089  O O   . GLY D 1 157 ? -34.589 -71.912  -11.104 1.00 111.22 ? 236 GLY D O   1 
ATOM   4090  N N   . LEU D 1 158 ? -35.628 -70.955  -9.352  1.00 120.34 ? 237 LEU D N   1 
ATOM   4091  C CA  . LEU D 1 158 ? -35.666 -69.619  -9.931  1.00 122.55 ? 237 LEU D CA  1 
ATOM   4092  C C   . LEU D 1 158 ? -35.838 -68.543  -8.878  1.00 120.45 ? 237 LEU D C   1 
ATOM   4093  O O   . LEU D 1 158 ? -36.310 -68.806  -7.780  1.00 121.54 ? 237 LEU D O   1 
ATOM   4094  C CB  . LEU D 1 158 ? -36.785 -69.517  -10.982 1.00 128.11 ? 237 LEU D CB  1 
ATOM   4095  C CG  . LEU D 1 158 ? -38.189 -69.996  -10.604 1.00 132.42 ? 237 LEU D CG  1 
ATOM   4096  C CD1 . LEU D 1 158 ? -38.900 -69.049  -9.655  1.00 137.65 ? 237 LEU D CD1 1 
ATOM   4097  C CD2 . LEU D 1 158 ? -39.005 -70.138  -11.883 1.00 135.12 ? 237 LEU D CD2 1 
ATOM   4098  N N   . PHE D 1 159 ? -35.436 -67.330  -9.231  1.00 121.59 ? 238 PHE D N   1 
ATOM   4099  C CA  . PHE D 1 159 ? -35.716 -66.152  -8.421  1.00 124.86 ? 238 PHE D CA  1 
ATOM   4100  C C   . PHE D 1 159 ? -35.883 -64.932  -9.317  1.00 128.27 ? 238 PHE D C   1 
ATOM   4101  O O   . PHE D 1 159 ? -35.262 -64.851  -10.379 1.00 125.92 ? 238 PHE D O   1 
ATOM   4102  C CB  . PHE D 1 159 ? -34.632 -65.933  -7.351  1.00 125.00 ? 238 PHE D CB  1 
ATOM   4103  C CG  . PHE D 1 159 ? -33.225 -65.884  -7.877  1.00 124.27 ? 238 PHE D CG  1 
ATOM   4104  C CD1 . PHE D 1 159 ? -32.679 -64.701  -8.355  1.00 122.47 ? 238 PHE D CD1 1 
ATOM   4105  C CD2 . PHE D 1 159 ? -32.422 -67.022  -7.842  1.00 126.27 ? 238 PHE D CD2 1 
ATOM   4106  C CE1 . PHE D 1 159 ? -31.373 -64.654  -8.826  1.00 126.07 ? 238 PHE D CE1 1 
ATOM   4107  C CE2 . PHE D 1 159 ? -31.107 -66.981  -8.311  1.00 126.01 ? 238 PHE D CE2 1 
ATOM   4108  C CZ  . PHE D 1 159 ? -30.584 -65.796  -8.804  1.00 126.59 ? 238 PHE D CZ  1 
ATOM   4109  N N   . ARG D 1 160 ? -36.740 -64.001  -8.889  1.00 135.00 ? 239 ARG D N   1 
ATOM   4110  C CA  . ARG D 1 160 ? -37.063 -62.811  -9.681  1.00 136.85 ? 239 ARG D CA  1 
ATOM   4111  C C   . ARG D 1 160 ? -35.902 -61.827  -9.642  1.00 140.35 ? 239 ARG D C   1 
ATOM   4112  O O   . ARG D 1 160 ? -35.253 -61.658  -8.615  1.00 140.81 ? 239 ARG D O   1 
ATOM   4113  C CB  . ARG D 1 160 ? -38.343 -62.134  -9.177  1.00 136.07 ? 239 ARG D CB  1 
ATOM   4114  N N   . VAL D 1 161 ? -35.640 -61.203  -10.786 1.00 142.58 ? 240 VAL D N   1 
ATOM   4115  C CA  . VAL D 1 161 ? -34.649 -60.144  -10.905 1.00 145.19 ? 240 VAL D CA  1 
ATOM   4116  C C   . VAL D 1 161 ? -35.342 -58.771  -11.060 1.00 154.45 ? 240 VAL D C   1 
ATOM   4117  O O   . VAL D 1 161 ? -34.922 -57.788  -10.450 1.00 156.94 ? 240 VAL D O   1 
ATOM   4118  C CB  . VAL D 1 161 ? -33.708 -60.433  -12.079 1.00 144.03 ? 240 VAL D CB  1 
ATOM   4119  C CG1 . VAL D 1 161 ? -32.701 -59.304  -12.260 1.00 148.65 ? 240 VAL D CG1 1 
ATOM   4120  C CG2 . VAL D 1 161 ? -32.995 -61.751  -11.842 1.00 139.76 ? 240 VAL D CG2 1 
ATOM   4121  N N   . THR D 1 162 ? -36.389 -58.702  -11.885 1.00 162.29 ? 241 THR D N   1 
ATOM   4122  C CA  . THR D 1 162 ? -37.359 -57.593  -11.829 1.00 169.24 ? 241 THR D CA  1 
ATOM   4123  C C   . THR D 1 162 ? -37.949 -57.281  -10.437 1.00 166.98 ? 241 THR D C   1 
ATOM   4124  O O   . THR D 1 162 ? -38.285 -56.165  -10.197 1.00 161.98 ? 241 THR D O   1 
ATOM   4125  C CB  . THR D 1 162 ? -38.562 -57.860  -12.762 1.00 178.25 ? 241 THR D CB  1 
ATOM   4126  O OG1 . THR D 1 162 ? -39.349 -56.668  -12.911 1.00 191.41 ? 241 THR D OG1 1 
ATOM   4127  C CG2 . THR D 1 162 ? -39.465 -59.046  -12.246 1.00 180.16 ? 241 THR D CG2 1 
ATOM   4128  N N   . MET E 1 12  ? 14.598  -42.110  -45.885 1.00 168.52 ? 91  MET E N   1 
ATOM   4129  C CA  . MET E 1 12  ? 15.267  -41.596  -44.656 1.00 169.37 ? 91  MET E CA  1 
ATOM   4130  C C   . MET E 1 12  ? 14.736  -40.196  -44.343 1.00 158.47 ? 91  MET E C   1 
ATOM   4131  O O   . MET E 1 12  ? 15.290  -39.189  -44.787 1.00 146.30 ? 91  MET E O   1 
ATOM   4132  C CB  . MET E 1 12  ? 16.788  -41.596  -44.860 1.00 178.62 ? 91  MET E CB  1 
ATOM   4133  C CG  . MET E 1 12  ? 17.629  -41.080  -43.704 1.00 188.64 ? 91  MET E CG  1 
ATOM   4134  S SD  . MET E 1 12  ? 17.596  -42.161  -42.268 1.00 210.67 ? 91  MET E SD  1 
ATOM   4135  C CE  . MET E 1 12  ? 18.976  -41.516  -41.328 1.00 207.37 ? 91  MET E CE  1 
ATOM   4136  N N   . PHE E 1 13  ? 13.642  -40.158  -43.587 1.00 152.51 ? 92  PHE E N   1 
ATOM   4137  C CA  . PHE E 1 13  ? 12.960  -38.909  -43.256 1.00 147.66 ? 92  PHE E CA  1 
ATOM   4138  C C   . PHE E 1 13  ? 12.163  -39.023  -41.973 1.00 142.01 ? 92  PHE E C   1 
ATOM   4139  O O   . PHE E 1 13  ? 11.779  -40.107  -41.572 1.00 138.95 ? 92  PHE E O   1 
ATOM   4140  C CB  . PHE E 1 13  ? 12.018  -38.514  -44.389 1.00 145.12 ? 92  PHE E CB  1 
ATOM   4141  C CG  . PHE E 1 13  ? 10.911  -39.497  -44.627 1.00 143.15 ? 92  PHE E CG  1 
ATOM   4142  C CD1 . PHE E 1 13  ? 11.029  -40.466  -45.613 1.00 143.49 ? 92  PHE E CD1 1 
ATOM   4143  C CD2 . PHE E 1 13  ? 9.740   -39.452  -43.871 1.00 142.56 ? 92  PHE E CD2 1 
ATOM   4144  C CE1 . PHE E 1 13  ? 10.005  -41.374  -45.843 1.00 143.82 ? 92  PHE E CE1 1 
ATOM   4145  C CE2 . PHE E 1 13  ? 8.715   -40.355  -44.092 1.00 144.78 ? 92  PHE E CE2 1 
ATOM   4146  C CZ  . PHE E 1 13  ? 8.849   -41.318  -45.083 1.00 146.00 ? 92  PHE E CZ  1 
ATOM   4147  N N   . ALA E 1 14  ? 11.869  -37.879  -41.373 1.00 144.33 ? 93  ALA E N   1 
ATOM   4148  C CA  . ALA E 1 14  ? 11.091  -37.826  -40.144 1.00 147.62 ? 93  ALA E CA  1 
ATOM   4149  C C   . ALA E 1 14  ? 10.166  -36.617  -40.146 1.00 142.76 ? 93  ALA E C   1 
ATOM   4150  O O   . ALA E 1 14  ? 10.401  -35.650  -40.865 1.00 138.85 ? 93  ALA E O   1 
ATOM   4151  C CB  . ALA E 1 14  ? 12.016  -37.782  -38.940 1.00 151.24 ? 93  ALA E CB  1 
ATOM   4152  N N   . GLN E 1 15  ? 9.107   -36.700  -39.351 1.00 139.52 ? 94  GLN E N   1 
ATOM   4153  C CA  . GLN E 1 15  ? 8.241   -35.562  -39.082 1.00 140.76 ? 94  GLN E CA  1 
ATOM   4154  C C   . GLN E 1 15  ? 7.559   -35.765  -37.738 1.00 145.84 ? 94  GLN E C   1 
ATOM   4155  O O   . GLN E 1 15  ? 6.792   -36.705  -37.574 1.00 151.48 ? 94  GLN E O   1 
ATOM   4156  C CB  . GLN E 1 15  ? 7.193   -35.392  -40.179 1.00 137.84 ? 94  GLN E CB  1 
ATOM   4157  C CG  . GLN E 1 15  ? 6.253   -34.219  -39.920 1.00 134.10 ? 94  GLN E CG  1 
ATOM   4158  C CD  . GLN E 1 15  ? 5.541   -33.751  -41.170 1.00 132.19 ? 94  GLN E CD  1 
ATOM   4159  O OE1 . GLN E 1 15  ? 6.174   -33.211  -42.085 1.00 131.73 ? 94  GLN E OE1 1 
ATOM   4160  N NE2 . GLN E 1 15  ? 4.229   -33.952  -41.230 1.00 134.43 ? 94  GLN E NE2 1 
ATOM   4161  N N   . LEU E 1 16  ? 7.845   -34.885  -36.785 1.00 147.70 ? 95  LEU E N   1 
ATOM   4162  C CA  . LEU E 1 16  ? 7.277   -34.968  -35.445 1.00 145.91 ? 95  LEU E CA  1 
ATOM   4163  C C   . LEU E 1 16  ? 6.234   -33.874  -35.230 1.00 146.20 ? 95  LEU E C   1 
ATOM   4164  O O   . LEU E 1 16  ? 6.257   -32.839  -35.901 1.00 148.54 ? 95  LEU E O   1 
ATOM   4165  C CB  . LEU E 1 16  ? 8.380   -34.841  -34.401 1.00 142.70 ? 95  LEU E CB  1 
ATOM   4166  N N   . VAL E 1 17  ? 5.334   -34.113  -34.284 1.00 141.61 ? 96  VAL E N   1 
ATOM   4167  C CA  . VAL E 1 17  ? 4.253   -33.195  -33.969 1.00 136.45 ? 96  VAL E CA  1 
ATOM   4168  C C   . VAL E 1 17  ? 4.348   -32.818  -32.508 1.00 137.96 ? 96  VAL E C   1 
ATOM   4169  O O   . VAL E 1 17  ? 4.269   -33.681  -31.650 1.00 141.05 ? 96  VAL E O   1 
ATOM   4170  C CB  . VAL E 1 17  ? 2.896   -33.858  -34.226 1.00 133.18 ? 96  VAL E CB  1 
ATOM   4171  C CG1 . VAL E 1 17  ? 1.754   -32.961  -33.754 1.00 130.59 ? 96  VAL E CG1 1 
ATOM   4172  C CG2 . VAL E 1 17  ? 2.767   -34.194  -35.710 1.00 131.53 ? 96  VAL E CG2 1 
ATOM   4173  N N   . ALA E 1 18  ? 4.516   -31.535  -32.222 1.00 141.94 ? 97  ALA E N   1 
ATOM   4174  C CA  . ALA E 1 18  ? 4.711   -31.093  -30.846 1.00 146.04 ? 97  ALA E CA  1 
ATOM   4175  C C   . ALA E 1 18  ? 3.499   -31.412  -29.980 1.00 146.15 ? 97  ALA E C   1 
ATOM   4176  O O   . ALA E 1 18  ? 2.364   -31.233  -30.411 1.00 150.30 ? 97  ALA E O   1 
ATOM   4177  C CB  . ALA E 1 18  ? 5.005   -29.606  -30.795 1.00 148.62 ? 97  ALA E CB  1 
ATOM   4178  N N   . GLN E 1 19  ? 3.768   -31.884  -28.769 1.00 147.03 ? 98  GLN E N   1 
ATOM   4179  C CA  . GLN E 1 19  ? 2.735   -32.201  -27.789 1.00 149.03 ? 98  GLN E CA  1 
ATOM   4180  C C   . GLN E 1 19  ? 2.258   -30.966  -27.053 1.00 145.66 ? 98  GLN E C   1 
ATOM   4181  O O   . GLN E 1 19  ? 1.118   -30.933  -26.579 1.00 150.51 ? 98  GLN E O   1 
ATOM   4182  C CB  . GLN E 1 19  ? 3.261   -33.181  -26.739 1.00 154.87 ? 98  GLN E CB  1 
ATOM   4183  C CG  . GLN E 1 19  ? 3.817   -34.487  -27.274 1.00 157.00 ? 98  GLN E CG  1 
ATOM   4184  C CD  . GLN E 1 19  ? 4.158   -35.445  -26.152 1.00 162.60 ? 98  GLN E CD  1 
ATOM   4185  O OE1 . GLN E 1 19  ? 5.326   -35.772  -25.936 1.00 164.02 ? 98  GLN E OE1 1 
ATOM   4186  N NE2 . GLN E 1 19  ? 3.149   -35.872  -25.409 1.00 171.58 ? 98  GLN E NE2 1 
ATOM   4187  N N   . ASN E 1 20  ? 3.101   -29.941  -26.991 1.00 141.19 ? 99  ASN E N   1 
ATOM   4188  C CA  . ASN E 1 20  ? 2.902   -28.826  -26.069 1.00 141.57 ? 99  ASN E CA  1 
ATOM   4189  C C   . ASN E 1 20  ? 1.740   -27.985  -26.569 1.00 138.11 ? 99  ASN E C   1 
ATOM   4190  O O   . ASN E 1 20  ? 1.515   -27.903  -27.779 1.00 137.85 ? 99  ASN E O   1 
ATOM   4191  C CB  . ASN E 1 20  ? 4.151   -27.948  -25.957 1.00 140.48 ? 99  ASN E CB  1 
ATOM   4192  C CG  . ASN E 1 20  ? 5.422   -28.758  -25.779 1.00 143.79 ? 99  ASN E CG  1 
ATOM   4193  O OD1 . ASN E 1 20  ? 5.953   -28.866  -24.675 1.00 150.26 ? 99  ASN E OD1 1 
ATOM   4194  N ND2 . ASN E 1 20  ? 5.908   -29.343  -26.867 1.00 146.55 ? 99  ASN E ND2 1 
ATOM   4195  N N   . VAL E 1 21  ? 0.980   -27.407  -25.646 1.00 137.67 ? 100 VAL E N   1 
ATOM   4196  C CA  . VAL E 1 21  ? -0.074  -26.451  -26.017 1.00 138.92 ? 100 VAL E CA  1 
ATOM   4197  C C   . VAL E 1 21  ? 0.092   -25.087  -25.349 1.00 135.83 ? 100 VAL E C   1 
ATOM   4198  O O   . VAL E 1 21  ? -0.164  -24.078  -25.982 1.00 134.39 ? 100 VAL E O   1 
ATOM   4199  C CB  . VAL E 1 21  ? -1.500  -27.021  -25.781 1.00 141.29 ? 100 VAL E CB  1 
ATOM   4200  C CG1 . VAL E 1 21  ? -1.595  -28.459  -26.286 1.00 141.90 ? 100 VAL E CG1 1 
ATOM   4201  C CG2 . VAL E 1 21  ? -1.923  -26.911  -24.314 1.00 145.55 ? 100 VAL E CG2 1 
ATOM   4202  N N   . LEU E 1 22  ? 0.528   -25.055  -24.097 1.00 133.15 ? 101 LEU E N   1 
ATOM   4203  C CA  . LEU E 1 22  ? 0.766   -23.789  -23.407 1.00 128.94 ? 101 LEU E CA  1 
ATOM   4204  C C   . LEU E 1 22  ? 2.136   -23.235  -23.777 1.00 128.18 ? 101 LEU E C   1 
ATOM   4205  O O   . LEU E 1 22  ? 3.118   -23.980  -23.881 1.00 121.96 ? 101 LEU E O   1 
ATOM   4206  C CB  . LEU E 1 22  ? 0.666   -23.962  -21.898 1.00 130.04 ? 101 LEU E CB  1 
ATOM   4207  C CG  . LEU E 1 22  ? -0.643  -24.555  -21.391 1.00 132.35 ? 101 LEU E CG  1 
ATOM   4208  C CD1 . LEU E 1 22  ? -0.656  -24.475  -19.879 1.00 133.08 ? 101 LEU E CD1 1 
ATOM   4209  C CD2 . LEU E 1 22  ? -1.852  -23.830  -21.967 1.00 136.86 ? 101 LEU E CD2 1 
ATOM   4210  N N   . LEU E 1 23  ? 2.196   -21.920  -23.974 1.00 130.80 ? 102 LEU E N   1 
ATOM   4211  C CA  . LEU E 1 23  ? 3.447   -21.247  -24.283 1.00 132.04 ? 102 LEU E CA  1 
ATOM   4212  C C   . LEU E 1 23  ? 4.258   -21.134  -22.993 1.00 134.56 ? 102 LEU E C   1 
ATOM   4213  O O   . LEU E 1 23  ? 4.000   -20.270  -22.168 1.00 132.51 ? 102 LEU E O   1 
ATOM   4214  C CB  . LEU E 1 23  ? 3.203   -19.875  -24.938 1.00 130.82 ? 102 LEU E CB  1 
ATOM   4215  N N   . ILE E 1 24  ? 5.221   -22.033  -22.828 1.00 140.02 ? 103 ILE E N   1 
ATOM   4216  C CA  . ILE E 1 24  ? 6.062   -22.075  -21.634 1.00 142.89 ? 103 ILE E CA  1 
ATOM   4217  C C   . ILE E 1 24  ? 7.520   -22.219  -22.065 1.00 144.23 ? 103 ILE E C   1 
ATOM   4218  O O   . ILE E 1 24  ? 7.868   -23.198  -22.740 1.00 142.36 ? 103 ILE E O   1 
ATOM   4219  C CB  . ILE E 1 24  ? 5.653   -23.245  -20.715 1.00 136.18 ? 103 ILE E CB  1 
ATOM   4220  N N   . ASP E 1 25  ? 8.359   -21.249  -21.679 1.00 147.92 ? 104 ASP E N   1 
ATOM   4221  C CA  . ASP E 1 25  ? 9.793   -21.272  -21.985 1.00 149.92 ? 104 ASP E CA  1 
ATOM   4222  C C   . ASP E 1 25  ? 10.383  -22.626  -21.611 1.00 148.13 ? 104 ASP E C   1 
ATOM   4223  O O   . ASP E 1 25  ? 10.202  -23.078  -20.483 1.00 153.19 ? 104 ASP E O   1 
ATOM   4224  C CB  . ASP E 1 25  ? 10.557  -20.175  -21.210 1.00 157.39 ? 104 ASP E CB  1 
ATOM   4225  C CG  . ASP E 1 25  ? 10.324  -18.763  -21.753 1.00 162.02 ? 104 ASP E CG  1 
ATOM   4226  O OD1 . ASP E 1 25  ? 10.740  -17.788  -21.086 1.00 164.46 ? 104 ASP E OD1 1 
ATOM   4227  O OD2 . ASP E 1 25  ? 9.723   -18.606  -22.824 1.00 166.70 ? 104 ASP E OD2 1 
ATOM   4228  N N   . GLY E 1 26  ? 11.068  -23.263  -22.557 1.00 146.78 ? 105 GLY E N   1 
ATOM   4229  C CA  . GLY E 1 26  ? 11.683  -24.578  -22.346 1.00 150.39 ? 105 GLY E CA  1 
ATOM   4230  C C   . GLY E 1 26  ? 11.396  -25.511  -23.498 1.00 153.09 ? 105 GLY E C   1 
ATOM   4231  O O   . GLY E 1 26  ? 10.533  -25.219  -24.315 1.00 156.46 ? 105 GLY E O   1 
ATOM   4232  N N   . PRO E 1 27  ? 12.099  -26.655  -23.560 1.00 156.84 ? 106 PRO E N   1 
ATOM   4233  C CA  . PRO E 1 27  ? 12.112  -27.509  -24.749 1.00 155.12 ? 106 PRO E CA  1 
ATOM   4234  C C   . PRO E 1 27  ? 10.795  -28.251  -25.023 1.00 152.78 ? 106 PRO E C   1 
ATOM   4235  O O   . PRO E 1 27  ? 10.096  -28.677  -24.092 1.00 149.68 ? 106 PRO E O   1 
ATOM   4236  C CB  . PRO E 1 27  ? 13.236  -28.496  -24.444 1.00 156.37 ? 106 PRO E CB  1 
ATOM   4237  C CG  . PRO E 1 27  ? 13.208  -28.633  -22.967 1.00 159.00 ? 106 PRO E CG  1 
ATOM   4238  C CD  . PRO E 1 27  ? 12.774  -27.301  -22.423 1.00 158.86 ? 106 PRO E CD  1 
ATOM   4239  N N   . LEU E 1 28  ? 10.477  -28.390  -26.308 1.00 151.88 ? 107 LEU E N   1 
ATOM   4240  C CA  . LEU E 1 28  ? 9.214   -28.968  -26.748 1.00 149.98 ? 107 LEU E CA  1 
ATOM   4241  C C   . LEU E 1 28  ? 9.318   -30.484  -26.730 1.00 142.88 ? 107 LEU E C   1 
ATOM   4242  O O   . LEU E 1 28  ? 10.332  -31.060  -27.163 1.00 133.01 ? 107 LEU E O   1 
ATOM   4243  C CB  . LEU E 1 28  ? 8.851   -28.505  -28.170 1.00 149.36 ? 107 LEU E CB  1 
ATOM   4244  N N   . SER E 1 29  ? 8.264   -31.103  -26.198 1.00 138.49 ? 108 SER E N   1 
ATOM   4245  C CA  . SER E 1 29  ? 8.029   -32.532  -26.296 1.00 142.80 ? 108 SER E CA  1 
ATOM   4246  C C   . SER E 1 29  ? 7.294   -32.883  -27.581 1.00 138.75 ? 108 SER E C   1 
ATOM   4247  O O   . SER E 1 29  ? 6.460   -32.112  -28.034 1.00 134.28 ? 108 SER E O   1 
ATOM   4248  C CB  . SER E 1 29  ? 7.215   -32.974  -25.082 1.00 147.85 ? 108 SER E CB  1 
ATOM   4249  O OG  . SER E 1 29  ? 7.534   -32.170  -23.959 1.00 151.77 ? 108 SER E OG  1 
ATOM   4250  N N   . TRP E 1 30  ? 7.572   -34.071  -28.122 1.00 142.95 ? 109 TRP E N   1 
ATOM   4251  C CA  . TRP E 1 30  ? 7.121   -34.487  -29.462 1.00 148.21 ? 109 TRP E CA  1 
ATOM   4252  C C   . TRP E 1 30  ? 6.422   -35.844  -29.500 1.00 151.05 ? 109 TRP E C   1 
ATOM   4253  O O   . TRP E 1 30  ? 6.885   -36.793  -28.876 1.00 152.11 ? 109 TRP E O   1 
ATOM   4254  C CB  . TRP E 1 30  ? 8.332   -34.569  -30.393 1.00 150.79 ? 109 TRP E CB  1 
ATOM   4255  C CG  . TRP E 1 30  ? 9.016   -33.283  -30.521 1.00 152.02 ? 109 TRP E CG  1 
ATOM   4256  C CD1 . TRP E 1 30  ? 10.074  -32.845  -29.789 1.00 156.66 ? 109 TRP E CD1 1 
ATOM   4257  C CD2 . TRP E 1 30  ? 8.665   -32.227  -31.407 1.00 147.67 ? 109 TRP E CD2 1 
ATOM   4258  N NE1 . TRP E 1 30  ? 10.419  -31.573  -30.175 1.00 154.95 ? 109 TRP E NE1 1 
ATOM   4259  C CE2 . TRP E 1 30  ? 9.562   -31.165  -31.160 1.00 148.86 ? 109 TRP E CE2 1 
ATOM   4260  C CE3 . TRP E 1 30  ? 7.675   -32.070  -32.379 1.00 142.76 ? 109 TRP E CE3 1 
ATOM   4261  C CZ2 . TRP E 1 30  ? 9.510   -29.966  -31.870 1.00 146.13 ? 109 TRP E CZ2 1 
ATOM   4262  C CZ3 . TRP E 1 30  ? 7.618   -30.881  -33.084 1.00 143.28 ? 109 TRP E CZ3 1 
ATOM   4263  C CH2 . TRP E 1 30  ? 8.534   -29.842  -32.830 1.00 144.14 ? 109 TRP E CH2 1 
ATOM   4264  N N   . TYR E 1 31  ? 5.328   -35.935  -30.253 1.00 152.37 ? 110 TYR E N   1 
ATOM   4265  C CA  . TYR E 1 31  ? 4.732   -37.225  -30.605 1.00 153.35 ? 110 TYR E CA  1 
ATOM   4266  C C   . TYR E 1 31  ? 5.625   -37.910  -31.635 1.00 154.50 ? 110 TYR E C   1 
ATOM   4267  O O   . TYR E 1 31  ? 5.970   -37.304  -32.644 1.00 150.14 ? 110 TYR E O   1 
ATOM   4268  C CB  . TYR E 1 31  ? 3.329   -37.055  -31.185 1.00 150.39 ? 110 TYR E CB  1 
ATOM   4269  C CG  . TYR E 1 31  ? 2.335   -36.476  -30.223 1.00 151.83 ? 110 TYR E CG  1 
ATOM   4270  C CD1 . TYR E 1 31  ? 1.979   -37.163  -29.070 1.00 152.10 ? 110 TYR E CD1 1 
ATOM   4271  C CD2 . TYR E 1 31  ? 1.731   -35.244  -30.471 1.00 153.79 ? 110 TYR E CD2 1 
ATOM   4272  C CE1 . TYR E 1 31  ? 1.048   -36.640  -28.184 1.00 152.76 ? 110 TYR E CE1 1 
ATOM   4273  C CE2 . TYR E 1 31  ? 0.801   -34.714  -29.589 1.00 155.06 ? 110 TYR E CE2 1 
ATOM   4274  C CZ  . TYR E 1 31  ? 0.461   -35.418  -28.445 1.00 153.21 ? 110 TYR E CZ  1 
ATOM   4275  O OH  . TYR E 1 31  ? -0.451  -34.906  -27.556 1.00 152.86 ? 110 TYR E OH  1 
ATOM   4276  N N   . SER E 1 32  ? 6.003   -39.161  -31.361 1.00 161.59 ? 111 SER E N   1 
ATOM   4277  C CA  . SER E 1 32  ? 6.895   -39.942  -32.238 1.00 163.22 ? 111 SER E CA  1 
ATOM   4278  C C   . SER E 1 32  ? 6.295   -41.239  -32.806 1.00 166.08 ? 111 SER E C   1 
ATOM   4279  O O   . SER E 1 32  ? 6.875   -41.817  -33.728 1.00 168.74 ? 111 SER E O   1 
ATOM   4280  C CB  . SER E 1 32  ? 8.182   -40.268  -31.476 1.00 164.19 ? 111 SER E CB  1 
ATOM   4281  O OG  . SER E 1 32  ? 7.886   -40.873  -30.231 1.00 171.72 ? 111 SER E OG  1 
ATOM   4282  N N   . ASP E 1 33  ? 5.150   -41.684  -32.281 1.00 169.46 ? 112 ASP E N   1 
ATOM   4283  C CA  . ASP E 1 33  ? 4.520   -42.941  -32.712 1.00 172.77 ? 112 ASP E CA  1 
ATOM   4284  C C   . ASP E 1 33  ? 3.831   -42.732  -34.069 1.00 169.42 ? 112 ASP E C   1 
ATOM   4285  O O   . ASP E 1 33  ? 2.861   -41.975  -34.140 1.00 168.68 ? 112 ASP E O   1 
ATOM   4286  C CB  . ASP E 1 33  ? 3.512   -43.407  -31.645 1.00 178.98 ? 112 ASP E CB  1 
ATOM   4287  C CG  . ASP E 1 33  ? 2.784   -44.708  -32.012 1.00 185.61 ? 112 ASP E CG  1 
ATOM   4288  O OD1 . ASP E 1 33  ? 2.722   -45.107  -33.198 1.00 187.02 ? 112 ASP E OD1 1 
ATOM   4289  O OD2 . ASP E 1 33  ? 2.269   -45.360  -31.077 1.00 189.04 ? 112 ASP E OD2 1 
ATOM   4290  N N   . PRO E 1 34  ? 4.302   -43.422  -35.138 1.00 171.08 ? 113 PRO E N   1 
ATOM   4291  C CA  . PRO E 1 34  ? 3.766   -43.191  -36.495 1.00 169.17 ? 113 PRO E CA  1 
ATOM   4292  C C   . PRO E 1 34  ? 2.340   -43.706  -36.757 1.00 167.09 ? 113 PRO E C   1 
ATOM   4293  O O   . PRO E 1 34  ? 1.803   -43.475  -37.843 1.00 169.06 ? 113 PRO E O   1 
ATOM   4294  C CB  . PRO E 1 34  ? 4.784   -43.892  -37.403 1.00 169.15 ? 113 PRO E CB  1 
ATOM   4295  C CG  . PRO E 1 34  ? 5.368   -44.968  -36.554 1.00 172.32 ? 113 PRO E CG  1 
ATOM   4296  C CD  . PRO E 1 34  ? 5.331   -44.481  -35.133 1.00 173.16 ? 113 PRO E CD  1 
ATOM   4297  N N   . GLY E 1 35  ? 1.734   -44.387  -35.783 1.00 164.35 ? 114 GLY E N   1 
ATOM   4298  C CA  . GLY E 1 35  ? 0.290   -44.608  -35.782 1.00 164.57 ? 114 GLY E CA  1 
ATOM   4299  C C   . GLY E 1 35  ? -0.533  -43.346  -35.550 1.00 161.25 ? 114 GLY E C   1 
ATOM   4300  O O   . GLY E 1 35  ? -1.748  -43.361  -35.755 1.00 155.68 ? 114 GLY E O   1 
ATOM   4301  N N   . LEU E 1 36  ? 0.118   -42.274  -35.081 1.00 162.23 ? 115 LEU E N   1 
ATOM   4302  C CA  . LEU E 1 36  ? -0.490  -40.939  -34.981 1.00 161.75 ? 115 LEU E CA  1 
ATOM   4303  C C   . LEU E 1 36  ? -0.452  -40.170  -36.307 1.00 159.53 ? 115 LEU E C   1 
ATOM   4304  O O   . LEU E 1 36  ? 0.551   -40.194  -37.027 1.00 151.53 ? 115 LEU E O   1 
ATOM   4305  C CB  . LEU E 1 36  ? 0.205   -40.108  -33.902 1.00 158.37 ? 115 LEU E CB  1 
ATOM   4306  N N   . ALA E 1 37  ? -1.548  -39.472  -36.598 1.00 160.69 ? 116 ALA E N   1 
ATOM   4307  C CA  . ALA E 1 37  ? -1.700  -38.731  -37.856 1.00 160.34 ? 116 ALA E CA  1 
ATOM   4308  C C   . ALA E 1 37  ? -0.756  -37.532  -37.897 1.00 158.31 ? 116 ALA E C   1 
ATOM   4309  O O   . ALA E 1 37  ? -0.763  -36.702  -36.989 1.00 157.76 ? 116 ALA E O   1 
ATOM   4310  C CB  . ALA E 1 37  ? -3.134  -38.274  -38.037 1.00 163.60 ? 116 ALA E CB  1 
ATOM   4311  N N   . GLY E 1 38  ? 0.056   -37.457  -38.948 1.00 157.35 ? 117 GLY E N   1 
ATOM   4312  C CA  . GLY E 1 38  ? 1.057   -36.403  -39.096 1.00 152.65 ? 117 GLY E CA  1 
ATOM   4313  C C   . GLY E 1 38  ? 2.447   -36.897  -38.770 1.00 148.21 ? 117 GLY E C   1 
ATOM   4314  O O   . GLY E 1 38  ? 3.407   -36.535  -39.460 1.00 144.62 ? 117 GLY E O   1 
ATOM   4315  N N   . VAL E 1 39  ? 2.555   -37.749  -37.753 1.00 150.39 ? 118 VAL E N   1 
ATOM   4316  C CA  . VAL E 1 39  ? 3.848   -38.269  -37.317 1.00 154.09 ? 118 VAL E CA  1 
ATOM   4317  C C   . VAL E 1 39  ? 4.353   -39.347  -38.270 1.00 156.20 ? 118 VAL E C   1 
ATOM   4318  O O   . VAL E 1 39  ? 3.581   -40.188  -38.731 1.00 157.59 ? 118 VAL E O   1 
ATOM   4319  C CB  . VAL E 1 39  ? 3.780   -38.856  -35.890 1.00 155.20 ? 118 VAL E CB  1 
ATOM   4320  C CG1 . VAL E 1 39  ? 5.131   -39.429  -35.472 1.00 153.26 ? 118 VAL E CG1 1 
ATOM   4321  C CG2 . VAL E 1 39  ? 3.321   -37.784  -34.900 1.00 156.10 ? 118 VAL E CG2 1 
ATOM   4322  N N   . SER E 1 40  ? 5.650   -39.308  -38.555 1.00 159.06 ? 119 SER E N   1 
ATOM   4323  C CA  . SER E 1 40  ? 6.310   -40.338  -39.351 1.00 163.11 ? 119 SER E CA  1 
ATOM   4324  C C   . SER E 1 40  ? 7.814   -40.346  -39.077 1.00 162.12 ? 119 SER E C   1 
ATOM   4325  O O   . SER E 1 40  ? 8.471   -39.321  -39.216 1.00 160.89 ? 119 SER E O   1 
ATOM   4326  C CB  . SER E 1 40  ? 6.022   -40.152  -40.853 1.00 164.73 ? 119 SER E CB  1 
ATOM   4327  O OG  . SER E 1 40  ? 5.855   -38.783  -41.189 1.00 168.64 ? 119 SER E OG  1 
ATOM   4328  N N   . LEU E 1 41  ? 8.317   -41.497  -38.628 1.00 163.18 ? 120 LEU E N   1 
ATOM   4329  C CA  . LEU E 1 41  ? 9.749   -41.782  -38.512 1.00 161.29 ? 120 LEU E CA  1 
ATOM   4330  C C   . LEU E 1 41  ? 10.066  -42.934  -39.455 1.00 164.12 ? 120 LEU E C   1 
ATOM   4331  O O   . LEU E 1 41  ? 9.227   -43.811  -39.657 1.00 166.32 ? 120 LEU E O   1 
ATOM   4332  C CB  . LEU E 1 41  ? 10.125  -42.177  -37.086 1.00 154.45 ? 120 LEU E CB  1 
ATOM   4333  N N   . THR E 1 42  ? 11.259  -42.908  -40.047 1.00 170.12 ? 121 THR E N   1 
ATOM   4334  C CA  . THR E 1 42  ? 11.766  -43.993  -40.903 1.00 175.29 ? 121 THR E CA  1 
ATOM   4335  C C   . THR E 1 42  ? 13.265  -44.136  -40.676 1.00 175.91 ? 121 THR E C   1 
ATOM   4336  O O   . THR E 1 42  ? 13.844  -43.395  -39.875 1.00 176.26 ? 121 THR E O   1 
ATOM   4337  C CB  . THR E 1 42  ? 11.523  -43.733  -42.416 1.00 180.30 ? 121 THR E CB  1 
ATOM   4338  O OG1 . THR E 1 42  ? 12.307  -42.619  -42.869 1.00 178.80 ? 121 THR E OG1 1 
ATOM   4339  C CG2 . THR E 1 42  ? 10.040  -43.478  -42.716 1.00 181.69 ? 121 THR E CG2 1 
ATOM   4340  N N   . GLY E 1 43  ? 13.882  -45.100  -41.364 1.00 177.38 ? 122 GLY E N   1 
ATOM   4341  C CA  . GLY E 1 43  ? 15.333  -45.269  -41.386 1.00 176.29 ? 122 GLY E CA  1 
ATOM   4342  C C   . GLY E 1 43  ? 15.980  -45.240  -40.012 1.00 178.32 ? 122 GLY E C   1 
ATOM   4343  O O   . GLY E 1 43  ? 15.381  -45.680  -39.017 1.00 175.67 ? 122 GLY E O   1 
ATOM   4344  N N   . GLY E 1 44  ? 17.194  -44.700  -39.956 1.00 178.68 ? 123 GLY E N   1 
ATOM   4345  C CA  . GLY E 1 44  ? 17.898  -44.509  -38.697 1.00 180.18 ? 123 GLY E CA  1 
ATOM   4346  C C   . GLY E 1 44  ? 17.576  -43.161  -38.084 1.00 178.72 ? 123 GLY E C   1 
ATOM   4347  O O   . GLY E 1 44  ? 18.450  -42.296  -37.980 1.00 175.57 ? 123 GLY E O   1 
ATOM   4348  N N   . LEU E 1 45  ? 16.313  -42.984  -37.706 1.00 179.74 ? 124 LEU E N   1 
ATOM   4349  C CA  . LEU E 1 45  ? 15.836  -41.772  -37.042 1.00 176.08 ? 124 LEU E CA  1 
ATOM   4350  C C   . LEU E 1 45  ? 14.931  -42.186  -35.894 1.00 174.22 ? 124 LEU E C   1 
ATOM   4351  O O   . LEU E 1 45  ? 14.080  -43.064  -36.055 1.00 174.04 ? 124 LEU E O   1 
ATOM   4352  C CB  . LEU E 1 45  ? 15.080  -40.871  -38.023 1.00 171.65 ? 124 LEU E CB  1 
ATOM   4353  C CG  . LEU E 1 45  ? 15.935  -40.110  -39.040 1.00 167.21 ? 124 LEU E CG  1 
ATOM   4354  C CD1 . LEU E 1 45  ? 15.133  -39.772  -40.293 1.00 165.06 ? 124 LEU E CD1 1 
ATOM   4355  C CD2 . LEU E 1 45  ? 16.513  -38.846  -38.394 1.00 163.91 ? 124 LEU E CD2 1 
ATOM   4356  N N   . SER E 1 46  ? 15.115  -41.549  -34.743 1.00 172.54 ? 125 SER E N   1 
ATOM   4357  C CA  . SER E 1 46  ? 14.473  -41.990  -33.506 1.00 177.27 ? 125 SER E CA  1 
ATOM   4358  C C   . SER E 1 46  ? 14.334  -40.852  -32.501 1.00 178.54 ? 125 SER E C   1 
ATOM   4359  O O   . SER E 1 46  ? 15.162  -39.939  -32.467 1.00 183.98 ? 125 SER E O   1 
ATOM   4360  C CB  . SER E 1 46  ? 15.299  -43.115  -32.889 1.00 179.79 ? 125 SER E CB  1 
ATOM   4361  O OG  . SER E 1 46  ? 16.664  -42.737  -32.805 1.00 177.82 ? 125 SER E OG  1 
ATOM   4362  N N   . TYR E 1 47  ? 13.292  -40.930  -31.675 1.00 172.52 ? 126 TYR E N   1 
ATOM   4363  C CA  . TYR E 1 47  ? 13.008  -39.913  -30.669 1.00 164.74 ? 126 TYR E CA  1 
ATOM   4364  C C   . TYR E 1 47  ? 13.269  -40.453  -29.254 1.00 163.76 ? 126 TYR E C   1 
ATOM   4365  O O   . TYR E 1 47  ? 12.713  -41.484  -28.867 1.00 157.27 ? 126 TYR E O   1 
ATOM   4366  C CB  . TYR E 1 47  ? 11.559  -39.438  -30.819 1.00 160.50 ? 126 TYR E CB  1 
ATOM   4367  C CG  . TYR E 1 47  ? 11.151  -38.397  -29.811 1.00 159.04 ? 126 TYR E CG  1 
ATOM   4368  C CD1 . TYR E 1 47  ? 10.140  -38.650  -28.893 1.00 166.47 ? 126 TYR E CD1 1 
ATOM   4369  C CD2 . TYR E 1 47  ? 11.798  -37.165  -29.750 1.00 153.68 ? 126 TYR E CD2 1 
ATOM   4370  C CE1 . TYR E 1 47  ? 9.776   -37.702  -27.949 1.00 169.46 ? 126 TYR E CE1 1 
ATOM   4371  C CE2 . TYR E 1 47  ? 11.434  -36.202  -28.818 1.00 155.06 ? 126 TYR E CE2 1 
ATOM   4372  C CZ  . TYR E 1 47  ? 10.420  -36.480  -27.919 1.00 163.44 ? 126 TYR E CZ  1 
ATOM   4373  O OH  . TYR E 1 47  ? 10.039  -35.544  -26.983 1.00 166.29 ? 126 TYR E OH  1 
ATOM   4374  N N   . LYS E 1 48  ? 14.122  -39.755  -28.501 1.00 165.75 ? 127 LYS E N   1 
ATOM   4375  C CA  . LYS E 1 48  ? 14.388  -40.063  -27.091 1.00 171.95 ? 127 LYS E CA  1 
ATOM   4376  C C   . LYS E 1 48  ? 13.417  -39.286  -26.187 1.00 170.88 ? 127 LYS E C   1 
ATOM   4377  O O   . LYS E 1 48  ? 13.606  -38.091  -25.945 1.00 165.49 ? 127 LYS E O   1 
ATOM   4378  C CB  . LYS E 1 48  ? 15.833  -39.705  -26.728 1.00 175.39 ? 127 LYS E CB  1 
ATOM   4379  C CG  . LYS E 1 48  ? 16.906  -40.507  -27.430 1.00 178.17 ? 127 LYS E CG  1 
ATOM   4380  C CD  . LYS E 1 48  ? 18.285  -39.953  -27.093 1.00 184.13 ? 127 LYS E CD  1 
ATOM   4381  C CE  . LYS E 1 48  ? 18.644  -40.130  -25.619 1.00 191.10 ? 127 LYS E CE  1 
ATOM   4382  N NZ  . LYS E 1 48  ? 20.034  -39.684  -25.331 1.00 196.12 ? 127 LYS E NZ  1 
ATOM   4383  N N   . GLU E 1 49  ? 12.383  -39.971  -25.687 1.00 174.53 ? 128 GLU E N   1 
ATOM   4384  C CA  . GLU E 1 49  ? 11.349  -39.340  -24.844 1.00 177.68 ? 128 GLU E CA  1 
ATOM   4385  C C   . GLU E 1 49  ? 11.881  -38.624  -23.591 1.00 185.42 ? 128 GLU E C   1 
ATOM   4386  O O   . GLU E 1 49  ? 11.295  -37.628  -23.163 1.00 187.90 ? 128 GLU E O   1 
ATOM   4387  C CB  . GLU E 1 49  ? 10.285  -40.366  -24.435 1.00 176.18 ? 128 GLU E CB  1 
ATOM   4388  N N   . ASP E 1 50  ? 12.973  -39.126  -23.011 1.00 193.95 ? 129 ASP E N   1 
ATOM   4389  C CA  . ASP E 1 50  ? 13.543  -38.539  -21.781 1.00 199.71 ? 129 ASP E CA  1 
ATOM   4390  C C   . ASP E 1 50  ? 14.212  -37.182  -22.012 1.00 197.19 ? 129 ASP E C   1 
ATOM   4391  O O   . ASP E 1 50  ? 13.954  -36.230  -21.272 1.00 191.90 ? 129 ASP E O   1 
ATOM   4392  C CB  . ASP E 1 50  ? 14.495  -39.516  -21.047 1.00 207.40 ? 129 ASP E CB  1 
ATOM   4393  C CG  . ASP E 1 50  ? 15.684  -39.979  -21.900 1.00 213.70 ? 129 ASP E CG  1 
ATOM   4394  O OD1 . ASP E 1 50  ? 15.488  -40.296  -23.097 1.00 214.24 ? 129 ASP E OD1 1 
ATOM   4395  O OD2 . ASP E 1 50  ? 16.813  -40.048  -21.358 1.00 218.50 ? 129 ASP E OD2 1 
ATOM   4396  N N   . THR E 1 51  ? 15.044  -37.095  -23.046 1.00 199.47 ? 130 THR E N   1 
ATOM   4397  C CA  . THR E 1 51  ? 15.787  -35.867  -23.373 1.00 199.52 ? 130 THR E CA  1 
ATOM   4398  C C   . THR E 1 51  ? 15.040  -34.922  -24.333 1.00 192.14 ? 130 THR E C   1 
ATOM   4399  O O   . THR E 1 51  ? 15.448  -33.770  -24.512 1.00 182.22 ? 130 THR E O   1 
ATOM   4400  C CB  . THR E 1 51  ? 17.158  -36.220  -23.982 1.00 203.49 ? 130 THR E CB  1 
ATOM   4401  O OG1 . THR E 1 51  ? 16.989  -37.223  -24.991 1.00 206.72 ? 130 THR E OG1 1 
ATOM   4402  C CG2 . THR E 1 51  ? 18.094  -36.752  -22.908 1.00 207.10 ? 130 THR E CG2 1 
ATOM   4403  N N   . LYS E 1 52  ? 13.957  -35.419  -24.937 1.00 188.85 ? 131 LYS E N   1 
ATOM   4404  C CA  . LYS E 1 52  ? 13.146  -34.672  -25.907 1.00 182.34 ? 131 LYS E CA  1 
ATOM   4405  C C   . LYS E 1 52  ? 13.952  -34.336  -27.168 1.00 178.38 ? 131 LYS E C   1 
ATOM   4406  O O   . LYS E 1 52  ? 13.905  -33.213  -27.670 1.00 180.20 ? 131 LYS E O   1 
ATOM   4407  C CB  . LYS E 1 52  ? 12.531  -33.405  -25.281 1.00 182.00 ? 131 LYS E CB  1 
ATOM   4408  C CG  . LYS E 1 52  ? 11.896  -33.609  -23.914 1.00 180.02 ? 131 LYS E CG  1 
ATOM   4409  C CD  . LYS E 1 52  ? 11.100  -32.391  -23.473 1.00 177.47 ? 131 LYS E CD  1 
ATOM   4410  C CE  . LYS E 1 52  ? 11.002  -32.351  -21.952 1.00 180.20 ? 131 LYS E CE  1 
ATOM   4411  N NZ  . LYS E 1 52  ? 10.410  -33.584  -21.346 1.00 182.53 ? 131 LYS E NZ  1 
ATOM   4412  N N   . GLU E 1 53  ? 14.664  -35.336  -27.685 1.00 172.04 ? 132 GLU E N   1 
ATOM   4413  C CA  . GLU E 1 53  ? 15.599  -35.147  -28.785 1.00 166.85 ? 132 GLU E CA  1 
ATOM   4414  C C   . GLU E 1 53  ? 15.334  -36.139  -29.911 1.00 158.75 ? 132 GLU E C   1 
ATOM   4415  O O   . GLU E 1 53  ? 15.055  -37.305  -29.666 1.00 154.46 ? 132 GLU E O   1 
ATOM   4416  C CB  . GLU E 1 53  ? 17.038  -35.308  -28.291 1.00 172.94 ? 132 GLU E CB  1 
ATOM   4417  C CG  . GLU E 1 53  ? 17.469  -34.281  -27.252 1.00 178.43 ? 132 GLU E CG  1 
ATOM   4418  C CD  . GLU E 1 53  ? 18.949  -34.394  -26.873 1.00 185.50 ? 132 GLU E CD  1 
ATOM   4419  O OE1 . GLU E 1 53  ? 19.387  -35.504  -26.472 1.00 191.90 ? 132 GLU E OE1 1 
ATOM   4420  O OE2 . GLU E 1 53  ? 19.678  -33.364  -26.974 1.00 185.96 ? 132 GLU E OE2 1 
ATOM   4421  N N   . LEU E 1 54  ? 15.408  -35.653  -31.146 1.00 156.43 ? 133 LEU E N   1 
ATOM   4422  C CA  . LEU E 1 54  ? 15.416  -36.499  -32.334 1.00 156.05 ? 133 LEU E CA  1 
ATOM   4423  C C   . LEU E 1 54  ? 16.858  -36.920  -32.557 1.00 164.74 ? 133 LEU E C   1 
ATOM   4424  O O   . LEU E 1 54  ? 17.755  -36.083  -32.452 1.00 170.04 ? 133 LEU E O   1 
ATOM   4425  C CB  . LEU E 1 54  ? 14.900  -35.725  -33.556 1.00 145.81 ? 133 LEU E CB  1 
ATOM   4426  C CG  . LEU E 1 54  ? 14.763  -36.488  -34.869 1.00 143.02 ? 133 LEU E CG  1 
ATOM   4427  C CD1 . LEU E 1 54  ? 13.650  -37.526  -34.789 1.00 142.25 ? 133 LEU E CD1 1 
ATOM   4428  C CD2 . LEU E 1 54  ? 14.483  -35.513  -36.004 1.00 140.77 ? 133 LEU E CD2 1 
ATOM   4429  N N   . VAL E 1 55  ? 17.081  -38.202  -32.865 1.00 170.20 ? 134 VAL E N   1 
ATOM   4430  C CA  . VAL E 1 55  ? 18.438  -38.757  -33.003 1.00 173.90 ? 134 VAL E CA  1 
ATOM   4431  C C   . VAL E 1 55  ? 18.659  -39.325  -34.402 1.00 174.94 ? 134 VAL E C   1 
ATOM   4432  O O   . VAL E 1 55  ? 17.971  -40.266  -34.809 1.00 174.19 ? 134 VAL E O   1 
ATOM   4433  C CB  . VAL E 1 55  ? 18.705  -39.866  -31.970 1.00 180.51 ? 134 VAL E CB  1 
ATOM   4434  C CG1 . VAL E 1 55  ? 20.198  -40.168  -31.894 1.00 184.80 ? 134 VAL E CG1 1 
ATOM   4435  C CG2 . VAL E 1 55  ? 18.173  -39.458  -30.604 1.00 182.15 ? 134 VAL E CG2 1 
ATOM   4436  N N   . VAL E 1 56  ? 19.638  -38.761  -35.115 1.00 173.71 ? 135 VAL E N   1 
ATOM   4437  C CA  . VAL E 1 56  ? 19.926  -39.134  -36.504 1.00 172.41 ? 135 VAL E CA  1 
ATOM   4438  C C   . VAL E 1 56  ? 21.040  -40.172  -36.542 1.00 174.29 ? 135 VAL E C   1 
ATOM   4439  O O   . VAL E 1 56  ? 22.129  -39.922  -36.021 1.00 183.36 ? 135 VAL E O   1 
ATOM   4440  C CB  . VAL E 1 56  ? 20.381  -37.916  -37.326 1.00 171.25 ? 135 VAL E CB  1 
ATOM   4441  C CG1 . VAL E 1 56  ? 20.512  -38.286  -38.802 1.00 170.99 ? 135 VAL E CG1 1 
ATOM   4442  C CG2 . VAL E 1 56  ? 19.409  -36.757  -37.139 1.00 172.13 ? 135 VAL E CG2 1 
ATOM   4443  N N   . ALA E 1 57  ? 20.783  -41.316  -37.178 1.00 173.42 ? 136 ALA E N   1 
ATOM   4444  C CA  . ALA E 1 57  ? 21.776  -42.391  -37.255 1.00 175.22 ? 136 ALA E CA  1 
ATOM   4445  C C   . ALA E 1 57  ? 22.775  -42.145  -38.387 1.00 177.35 ? 136 ALA E C   1 
ATOM   4446  O O   . ALA E 1 57  ? 23.956  -41.876  -38.133 1.00 170.98 ? 136 ALA E O   1 
ATOM   4447  C CB  . ALA E 1 57  ? 21.099  -43.745  -37.412 1.00 175.02 ? 136 ALA E CB  1 
ATOM   4448  N N   . LYS E 1 58  ? 22.292  -42.218  -39.628 1.00 179.92 ? 137 LYS E N   1 
ATOM   4449  C CA  . LYS E 1 58  ? 23.139  -42.068  -40.804 1.00 182.05 ? 137 LYS E CA  1 
ATOM   4450  C C   . LYS E 1 58  ? 23.406  -40.587  -41.029 1.00 179.89 ? 137 LYS E C   1 
ATOM   4451  O O   . LYS E 1 58  ? 22.470  -39.797  -41.098 1.00 179.02 ? 137 LYS E O   1 
ATOM   4452  C CB  . LYS E 1 58  ? 22.468  -42.676  -42.040 1.00 181.41 ? 137 LYS E CB  1 
ATOM   4453  N N   . ALA E 1 59  ? 24.680  -40.215  -41.133 1.00 179.19 ? 138 ALA E N   1 
ATOM   4454  C CA  . ALA E 1 59  ? 25.066  -38.831  -41.408 1.00 175.88 ? 138 ALA E CA  1 
ATOM   4455  C C   . ALA E 1 59  ? 24.713  -38.415  -42.842 1.00 173.99 ? 138 ALA E C   1 
ATOM   4456  O O   . ALA E 1 59  ? 24.272  -39.233  -43.660 1.00 169.55 ? 138 ALA E O   1 
ATOM   4457  C CB  . ALA E 1 59  ? 26.554  -38.637  -41.157 1.00 177.27 ? 138 ALA E CB  1 
ATOM   4458  N N   . GLY E 1 60  ? 24.903  -37.127  -43.121 1.00 171.82 ? 139 GLY E N   1 
ATOM   4459  C CA  . GLY E 1 60  ? 24.631  -36.547  -44.439 1.00 167.36 ? 139 GLY E CA  1 
ATOM   4460  C C   . GLY E 1 60  ? 24.079  -35.137  -44.352 1.00 167.21 ? 139 GLY E C   1 
ATOM   4461  O O   . GLY E 1 60  ? 24.143  -34.493  -43.303 1.00 172.30 ? 139 GLY E O   1 
ATOM   4462  N N   . VAL E 1 61  ? 23.547  -34.654  -45.465 1.00 164.45 ? 140 VAL E N   1 
ATOM   4463  C CA  . VAL E 1 61  ? 22.880  -33.366  -45.534 1.00 161.80 ? 140 VAL E CA  1 
ATOM   4464  C C   . VAL E 1 61  ? 21.376  -33.595  -45.655 1.00 156.32 ? 140 VAL E C   1 
ATOM   4465  O O   . VAL E 1 61  ? 20.929  -34.405  -46.460 1.00 155.75 ? 140 VAL E O   1 
ATOM   4466  C CB  . VAL E 1 61  ? 23.421  -32.514  -46.702 1.00 166.87 ? 140 VAL E CB  1 
ATOM   4467  C CG1 . VAL E 1 61  ? 22.568  -31.265  -46.908 1.00 169.27 ? 140 VAL E CG1 1 
ATOM   4468  C CG2 . VAL E 1 61  ? 24.875  -32.128  -46.437 1.00 170.55 ? 140 VAL E CG2 1 
ATOM   4469  N N   . TYR E 1 62  ? 20.609  -32.868  -44.843 1.00 150.60 ? 141 TYR E N   1 
ATOM   4470  C CA  . TYR E 1 62  ? 19.154  -32.973  -44.793 1.00 144.64 ? 141 TYR E CA  1 
ATOM   4471  C C   . TYR E 1 62  ? 18.519  -31.605  -44.973 1.00 139.00 ? 141 TYR E C   1 
ATOM   4472  O O   . TYR E 1 62  ? 19.086  -30.606  -44.539 1.00 141.21 ? 141 TYR E O   1 
ATOM   4473  C CB  . TYR E 1 62  ? 18.721  -33.508  -43.437 1.00 145.63 ? 141 TYR E CB  1 
ATOM   4474  C CG  . TYR E 1 62  ? 19.174  -34.910  -43.127 1.00 151.77 ? 141 TYR E CG  1 
ATOM   4475  C CD1 . TYR E 1 62  ? 20.506  -35.190  -42.829 1.00 155.80 ? 141 TYR E CD1 1 
ATOM   4476  C CD2 . TYR E 1 62  ? 18.258  -35.956  -43.088 1.00 154.85 ? 141 TYR E CD2 1 
ATOM   4477  C CE1 . TYR E 1 62  ? 20.917  -36.482  -42.530 1.00 158.70 ? 141 TYR E CE1 1 
ATOM   4478  C CE2 . TYR E 1 62  ? 18.654  -37.248  -42.786 1.00 158.38 ? 141 TYR E CE2 1 
ATOM   4479  C CZ  . TYR E 1 62  ? 19.984  -37.505  -42.507 1.00 159.73 ? 141 TYR E CZ  1 
ATOM   4480  O OH  . TYR E 1 62  ? 20.366  -38.792  -42.214 1.00 165.56 ? 141 TYR E OH  1 
ATOM   4481  N N   . TYR E 1 63  ? 17.349  -31.568  -45.614 1.00 133.64 ? 142 TYR E N   1 
ATOM   4482  C CA  . TYR E 1 63  ? 16.490  -30.383  -45.583 1.00 131.00 ? 142 TYR E CA  1 
ATOM   4483  C C   . TYR E 1 63  ? 15.663  -30.515  -44.326 1.00 130.47 ? 142 TYR E C   1 
ATOM   4484  O O   . TYR E 1 63  ? 14.854  -31.428  -44.220 1.00 133.46 ? 142 TYR E O   1 
ATOM   4485  C CB  . TYR E 1 63  ? 15.586  -30.306  -46.810 1.00 128.99 ? 142 TYR E CB  1 
ATOM   4486  C CG  . TYR E 1 63  ? 14.666  -29.101  -46.857 1.00 128.41 ? 142 TYR E CG  1 
ATOM   4487  C CD1 . TYR E 1 63  ? 15.148  -27.828  -47.178 1.00 128.49 ? 142 TYR E CD1 1 
ATOM   4488  C CD2 . TYR E 1 63  ? 13.307  -29.237  -46.608 1.00 126.60 ? 142 TYR E CD2 1 
ATOM   4489  C CE1 . TYR E 1 63  ? 14.302  -26.721  -47.219 1.00 127.29 ? 142 TYR E CE1 1 
ATOM   4490  C CE2 . TYR E 1 63  ? 12.446  -28.145  -46.670 1.00 125.96 ? 142 TYR E CE2 1 
ATOM   4491  C CZ  . TYR E 1 63  ? 12.945  -26.888  -46.968 1.00 126.84 ? 142 TYR E CZ  1 
ATOM   4492  O OH  . TYR E 1 63  ? 12.074  -25.819  -47.027 1.00 122.17 ? 142 TYR E OH  1 
ATOM   4493  N N   . VAL E 1 64  ? 15.909  -29.630  -43.369 1.00 129.23 ? 143 VAL E N   1 
ATOM   4494  C CA  . VAL E 1 64  ? 15.220  -29.625  -42.088 1.00 126.13 ? 143 VAL E CA  1 
ATOM   4495  C C   . VAL E 1 64  ? 14.335  -28.402  -42.058 1.00 123.27 ? 143 VAL E C   1 
ATOM   4496  O O   . VAL E 1 64  ? 14.784  -27.316  -42.394 1.00 126.03 ? 143 VAL E O   1 
ATOM   4497  C CB  . VAL E 1 64  ? 16.226  -29.544  -40.930 1.00 124.78 ? 143 VAL E CB  1 
ATOM   4498  C CG1 . VAL E 1 64  ? 15.523  -29.667  -39.590 1.00 122.49 ? 143 VAL E CG1 1 
ATOM   4499  C CG2 . VAL E 1 64  ? 17.293  -30.613  -41.095 1.00 127.24 ? 143 VAL E CG2 1 
ATOM   4500  N N   . PHE E 1 65  ? 13.083  -28.585  -41.656 1.00 118.92 ? 144 PHE E N   1 
ATOM   4501  C CA  . PHE E 1 65  ? 12.115  -27.493  -41.613 1.00 114.65 ? 144 PHE E CA  1 
ATOM   4502  C C   . PHE E 1 65  ? 11.264  -27.589  -40.367 1.00 111.05 ? 144 PHE E C   1 
ATOM   4503  O O   . PHE E 1 65  ? 10.901  -28.684  -39.935 1.00 107.70 ? 144 PHE E O   1 
ATOM   4504  C CB  . PHE E 1 65  ? 11.202  -27.519  -42.852 1.00 116.43 ? 144 PHE E CB  1 
ATOM   4505  C CG  . PHE E 1 65  ? 10.391  -28.778  -42.977 1.00 118.20 ? 144 PHE E CG  1 
ATOM   4506  C CD1 . PHE E 1 65  ? 9.113   -28.847  -42.457 1.00 119.69 ? 144 PHE E CD1 1 
ATOM   4507  C CD2 . PHE E 1 65  ? 10.926  -29.911  -43.582 1.00 117.49 ? 144 PHE E CD2 1 
ATOM   4508  C CE1 . PHE E 1 65  ? 8.380   -30.023  -42.536 1.00 121.77 ? 144 PHE E CE1 1 
ATOM   4509  C CE2 . PHE E 1 65  ? 10.198  -31.081  -43.676 1.00 117.01 ? 144 PHE E CE2 1 
ATOM   4510  C CZ  . PHE E 1 65  ? 8.918   -31.138  -43.160 1.00 119.85 ? 144 PHE E CZ  1 
ATOM   4511  N N   . PHE E 1 66  ? 10.934  -26.449  -39.783 1.00 111.51 ? 145 PHE E N   1 
ATOM   4512  C CA  . PHE E 1 66  ? 9.874   -26.432  -38.803 1.00 110.35 ? 145 PHE E CA  1 
ATOM   4513  C C   . PHE E 1 66  ? 8.842   -25.332  -39.027 1.00 108.96 ? 145 PHE E C   1 
ATOM   4514  O O   . PHE E 1 66  ? 9.065   -24.357  -39.711 1.00 107.82 ? 145 PHE E O   1 
ATOM   4515  C CB  . PHE E 1 66  ? 10.390  -26.530  -37.356 1.00 107.10 ? 145 PHE E CB  1 
ATOM   4516  N N   . GLN E 1 67  ? 7.682   -25.580  -38.449 1.00 113.81 ? 146 GLN E N   1 
ATOM   4517  C CA  . GLN E 1 67  ? 6.442   -24.926  -38.729 1.00 117.68 ? 146 GLN E CA  1 
ATOM   4518  C C   . GLN E 1 67  ? 5.935   -24.569  -37.346 1.00 120.47 ? 146 GLN E C   1 
ATOM   4519  O O   . GLN E 1 67  ? 6.129   -25.334  -36.408 1.00 123.23 ? 146 GLN E O   1 
ATOM   4520  C CB  . GLN E 1 67  ? 5.545   -25.971  -39.384 1.00 123.39 ? 146 GLN E CB  1 
ATOM   4521  C CG  . GLN E 1 67  ? 4.386   -25.447  -40.228 1.00 128.49 ? 146 GLN E CG  1 
ATOM   4522  C CD  . GLN E 1 67  ? 3.762   -26.539  -41.065 1.00 139.07 ? 146 GLN E CD  1 
ATOM   4523  O OE1 . GLN E 1 67  ? 4.051   -26.622  -42.256 1.00 145.31 ? 146 GLN E OE1 1 
ATOM   4524  N NE2 . GLN E 1 67  ? 2.961   -27.430  -40.432 1.00 143.89 ? 146 GLN E NE2 1 
ATOM   4525  N N   . LEU E 1 68  ? 5.314   -23.415  -37.188 1.00 125.93 ? 147 LEU E N   1 
ATOM   4526  C CA  . LEU E 1 68  ? 4.769   -23.035  -35.894 1.00 129.62 ? 147 LEU E CA  1 
ATOM   4527  C C   . LEU E 1 68  ? 3.473   -22.258  -36.069 1.00 130.82 ? 147 LEU E C   1 
ATOM   4528  O O   . LEU E 1 68  ? 3.526   -21.107  -36.481 1.00 134.97 ? 147 LEU E O   1 
ATOM   4529  C CB  . LEU E 1 68  ? 5.803   -22.185  -35.161 1.00 130.75 ? 147 LEU E CB  1 
ATOM   4530  C CG  . LEU E 1 68  ? 5.336   -21.488  -33.876 1.00 132.21 ? 147 LEU E CG  1 
ATOM   4531  C CD1 . LEU E 1 68  ? 4.904   -22.530  -32.875 1.00 134.50 ? 147 LEU E CD1 1 
ATOM   4532  C CD2 . LEU E 1 68  ? 6.426   -20.641  -33.237 1.00 133.14 ? 147 LEU E CD2 1 
ATOM   4533  N N   . GLU E 1 69  ? 2.325   -22.877  -35.775 1.00 127.61 ? 148 GLU E N   1 
ATOM   4534  C CA  . GLU E 1 69  ? 1.038   -22.150  -35.778 1.00 124.04 ? 148 GLU E CA  1 
ATOM   4535  C C   . GLU E 1 69  ? 0.596   -21.908  -34.346 1.00 119.51 ? 148 GLU E C   1 
ATOM   4536  O O   . GLU E 1 69  ? 0.816   -22.749  -33.475 1.00 116.30 ? 148 GLU E O   1 
ATOM   4537  C CB  . GLU E 1 69  ? -0.065  -22.873  -36.564 1.00 122.07 ? 148 GLU E CB  1 
ATOM   4538  N N   . LEU E 1 70  ? -0.005  -20.744  -34.116 1.00 118.33 ? 149 LEU E N   1 
ATOM   4539  C CA  . LEU E 1 70  ? -0.478  -20.335  -32.803 1.00 121.34 ? 149 LEU E CA  1 
ATOM   4540  C C   . LEU E 1 70  ? -1.915  -19.838  -32.938 1.00 123.96 ? 149 LEU E C   1 
ATOM   4541  O O   . LEU E 1 70  ? -2.298  -19.353  -34.002 1.00 123.89 ? 149 LEU E O   1 
ATOM   4542  C CB  . LEU E 1 70  ? 0.414   -19.219  -32.285 1.00 121.22 ? 149 LEU E CB  1 
ATOM   4543  C CG  . LEU E 1 70  ? 1.873   -19.633  -32.084 1.00 119.85 ? 149 LEU E CG  1 
ATOM   4544  C CD1 . LEU E 1 70  ? 2.861   -18.521  -32.307 1.00 119.38 ? 149 LEU E CD1 1 
ATOM   4545  C CD2 . LEU E 1 70  ? 2.054   -20.149  -30.682 1.00 120.99 ? 149 LEU E CD2 1 
ATOM   4546  N N   . ARG E 1 71  ? -2.707  -19.968  -31.871 1.00 124.52 ? 150 ARG E N   1 
ATOM   4547  C CA  . ARG E 1 71  ? -4.112  -19.530  -31.868 1.00 122.84 ? 150 ARG E CA  1 
ATOM   4548  C C   . ARG E 1 71  ? -4.453  -18.720  -30.624 1.00 123.36 ? 150 ARG E C   1 
ATOM   4549  O O   . ARG E 1 71  ? -4.092  -19.108  -29.514 1.00 129.15 ? 150 ARG E O   1 
ATOM   4550  C CB  . ARG E 1 71  ? -5.034  -20.743  -31.943 1.00 118.55 ? 150 ARG E CB  1 
ATOM   4551  N N   . ARG E 1 72  ? -5.133  -17.590  -30.808 1.00 119.70 ? 151 ARG E N   1 
ATOM   4552  C CA  . ARG E 1 72  ? -5.618  -16.796  -29.681 1.00 117.01 ? 151 ARG E CA  1 
ATOM   4553  C C   . ARG E 1 72  ? -6.770  -17.558  -29.041 1.00 118.39 ? 151 ARG E C   1 
ATOM   4554  O O   . ARG E 1 72  ? -7.729  -17.901  -29.726 1.00 119.39 ? 151 ARG E O   1 
ATOM   4555  C CB  . ARG E 1 72  ? -6.096  -15.415  -30.129 1.00 114.60 ? 151 ARG E CB  1 
ATOM   4556  N N   . VAL E 1 73  ? -6.651  -17.835  -27.742 1.00 117.82 ? 152 VAL E N   1 
ATOM   4557  C CA  . VAL E 1 73  ? -7.667  -18.579  -26.980 1.00 115.07 ? 152 VAL E CA  1 
ATOM   4558  C C   . VAL E 1 73  ? -8.444  -17.714  -25.989 1.00 115.75 ? 152 VAL E C   1 
ATOM   4559  O O   . VAL E 1 73  ? -9.443  -18.164  -25.461 1.00 117.64 ? 152 VAL E O   1 
ATOM   4560  C CB  . VAL E 1 73  ? -7.061  -19.785  -26.217 1.00 114.80 ? 152 VAL E CB  1 
ATOM   4561  C CG1 . VAL E 1 73  ? -6.462  -20.793  -27.179 1.00 112.91 ? 152 VAL E CG1 1 
ATOM   4562  C CG2 . VAL E 1 73  ? -6.005  -19.355  -25.205 1.00 114.78 ? 152 VAL E CG2 1 
ATOM   4563  N N   . VAL E 1 74  ? -7.976  -16.501  -25.710 1.00 117.23 ? 153 VAL E N   1 
ATOM   4564  C CA  . VAL E 1 74  ? -8.713  -15.562  -24.878 1.00 122.04 ? 153 VAL E CA  1 
ATOM   4565  C C   . VAL E 1 74  ? -9.005  -14.346  -25.734 1.00 121.35 ? 153 VAL E C   1 
ATOM   4566  O O   . VAL E 1 74  ? -8.125  -13.517  -25.958 1.00 117.30 ? 153 VAL E O   1 
ATOM   4567  C CB  . VAL E 1 74  ? -7.917  -15.155  -23.621 1.00 124.95 ? 153 VAL E CB  1 
ATOM   4568  C CG1 . VAL E 1 74  ? -8.696  -14.126  -22.809 1.00 127.23 ? 153 VAL E CG1 1 
ATOM   4569  C CG2 . VAL E 1 74  ? -7.627  -16.377  -22.769 1.00 126.98 ? 153 VAL E CG2 1 
ATOM   4570  N N   . ALA E 1 75  ? -10.243 -14.247  -26.207 1.00 124.05 ? 154 ALA E N   1 
ATOM   4571  C CA  . ALA E 1 75  ? -10.658 -13.145  -27.081 1.00 125.65 ? 154 ALA E CA  1 
ATOM   4572  C C   . ALA E 1 75  ? -10.303 -11.791  -26.474 1.00 126.16 ? 154 ALA E C   1 
ATOM   4573  O O   . ALA E 1 75  ? -10.471 -11.580  -25.281 1.00 126.60 ? 154 ALA E O   1 
ATOM   4574  C CB  . ALA E 1 75  ? -12.150 -13.216  -27.359 1.00 127.66 ? 154 ALA E CB  1 
ATOM   4575  N N   . GLY E 1 76  ? -9.791  -10.896  -27.310 1.00 127.11 ? 155 GLY E N   1 
ATOM   4576  C CA  . GLY E 1 76  ? -9.467  -9.534   -26.911 1.00 131.33 ? 155 GLY E CA  1 
ATOM   4577  C C   . GLY E 1 76  ? -8.262  -9.368   -25.993 1.00 130.63 ? 155 GLY E C   1 
ATOM   4578  O O   . GLY E 1 76  ? -8.104  -8.324   -25.352 1.00 125.68 ? 155 GLY E O   1 
ATOM   4579  N N   . GLU E 1 77  ? -7.405  -10.381  -25.933 1.00 131.36 ? 156 GLU E N   1 
ATOM   4580  C CA  . GLU E 1 77  ? -6.247  -10.340  -25.064 1.00 136.54 ? 156 GLU E CA  1 
ATOM   4581  C C   . GLU E 1 77  ? -5.055  -11.000  -25.730 1.00 137.69 ? 156 GLU E C   1 
ATOM   4582  O O   . GLU E 1 77  ? -5.213  -11.851  -26.611 1.00 146.23 ? 156 GLU E O   1 
ATOM   4583  C CB  . GLU E 1 77  ? -6.560  -11.049  -23.743 1.00 142.22 ? 156 GLU E CB  1 
ATOM   4584  C CG  . GLU E 1 77  ? -7.353  -10.263  -22.728 1.00 149.58 ? 156 GLU E CG  1 
ATOM   4585  C CD  . GLU E 1 77  ? -7.061  -10.714  -21.297 1.00 149.21 ? 156 GLU E CD  1 
ATOM   4586  O OE1 . GLU E 1 77  ? -7.111  -11.935  -21.039 1.00 152.22 ? 156 GLU E OE1 1 
ATOM   4587  O OE2 . GLU E 1 77  ? -6.760  -9.852   -20.444 1.00 147.32 ? 156 GLU E OE2 1 
ATOM   4588  N N   . GLY E 1 78  ? -3.861  -10.601  -25.304 1.00 137.26 ? 157 GLY E N   1 
ATOM   4589  C CA  . GLY E 1 78  ? -2.631  -11.293  -25.665 1.00 134.01 ? 157 GLY E CA  1 
ATOM   4590  C C   . GLY E 1 78  ? -1.889  -10.654  -26.796 1.00 131.55 ? 157 GLY E C   1 
ATOM   4591  O O   . GLY E 1 78  ? -2.484  -10.348  -27.827 1.00 131.18 ? 157 GLY E O   1 
ATOM   4592  N N   . SER E 1 79  ? -0.590  -10.460  -26.603 1.00 132.03 ? 158 SER E N   1 
ATOM   4593  C CA  . SER E 1 79  ? 0.276   -9.876   -27.625 1.00 134.63 ? 158 SER E CA  1 
ATOM   4594  C C   . SER E 1 79  ? 1.705   -10.280  -27.365 1.00 134.28 ? 158 SER E C   1 
ATOM   4595  O O   . SER E 1 79  ? 2.013   -10.848  -26.316 1.00 133.97 ? 158 SER E O   1 
ATOM   4596  C CB  . SER E 1 79  ? 0.173   -8.357   -27.601 1.00 134.93 ? 158 SER E CB  1 
ATOM   4597  O OG  . SER E 1 79  ? 0.496   -7.849   -26.329 1.00 126.62 ? 158 SER E OG  1 
ATOM   4598  N N   . GLY E 1 80  ? 2.578   -9.995   -28.324 1.00 137.90 ? 159 GLY E N   1 
ATOM   4599  C CA  . GLY E 1 80  ? 4.009   -10.275  -28.176 1.00 139.31 ? 159 GLY E CA  1 
ATOM   4600  C C   . GLY E 1 80  ? 4.574   -11.202  -29.238 1.00 133.97 ? 159 GLY E C   1 
ATOM   4601  O O   . GLY E 1 80  ? 4.261   -11.060  -30.413 1.00 138.94 ? 159 GLY E O   1 
ATOM   4602  N N   . SER E 1 81  ? 5.413   -12.140  -28.817 1.00 127.44 ? 160 SER E N   1 
ATOM   4603  C CA  . SER E 1 81  ? 6.227   -12.903  -29.737 1.00 123.20 ? 160 SER E CA  1 
ATOM   4604  C C   . SER E 1 81  ? 6.574   -14.283  -29.189 1.00 120.36 ? 160 SER E C   1 
ATOM   4605  O O   . SER E 1 81  ? 6.665   -14.467  -27.993 1.00 121.89 ? 160 SER E O   1 
ATOM   4606  C CB  . SER E 1 81  ? 7.498   -12.111  -30.022 1.00 124.04 ? 160 SER E CB  1 
ATOM   4607  O OG  . SER E 1 81  ? 8.583   -12.976  -30.313 1.00 131.74 ? 160 SER E OG  1 
ATOM   4608  N N   . VAL E 1 82  ? 6.783   -15.240  -30.084 1.00 118.81 ? 161 VAL E N   1 
ATOM   4609  C CA  . VAL E 1 82  ? 7.070   -16.630  -29.728 1.00 118.74 ? 161 VAL E CA  1 
ATOM   4610  C C   . VAL E 1 82  ? 8.120   -17.139  -30.691 1.00 121.19 ? 161 VAL E C   1 
ATOM   4611  O O   . VAL E 1 82  ? 8.044   -16.838  -31.885 1.00 117.31 ? 161 VAL E O   1 
ATOM   4612  C CB  . VAL E 1 82  ? 5.810   -17.512  -29.901 1.00 117.60 ? 161 VAL E CB  1 
ATOM   4613  C CG1 . VAL E 1 82  ? 6.134   -18.981  -29.602 1.00 117.72 ? 161 VAL E CG1 1 
ATOM   4614  C CG2 . VAL E 1 82  ? 4.684   -16.998  -29.018 1.00 118.12 ? 161 VAL E CG2 1 
ATOM   4615  N N   . SER E 1 83  ? 9.058   -17.938  -30.189 1.00 124.84 ? 162 SER E N   1 
ATOM   4616  C CA  . SER E 1 83  ? 10.250  -18.322  -30.956 1.00 125.76 ? 162 SER E CA  1 
ATOM   4617  C C   . SER E 1 83  ? 10.595  -19.787  -30.790 1.00 123.24 ? 162 SER E C   1 
ATOM   4618  O O   . SER E 1 83  ? 10.656  -20.267  -29.677 1.00 124.63 ? 162 SER E O   1 
ATOM   4619  C CB  . SER E 1 83  ? 11.448  -17.485  -30.500 1.00 127.53 ? 162 SER E CB  1 
ATOM   4620  O OG  . SER E 1 83  ? 11.030  -16.177  -30.131 1.00 132.84 ? 162 SER E OG  1 
ATOM   4621  N N   . LEU E 1 84  ? 10.808  -20.492  -31.898 1.00 119.27 ? 163 LEU E N   1 
ATOM   4622  C CA  . LEU E 1 84  ? 11.457  -21.806  -31.878 1.00 118.62 ? 163 LEU E CA  1 
ATOM   4623  C C   . LEU E 1 84  ? 12.937  -21.664  -32.181 1.00 126.94 ? 163 LEU E C   1 
ATOM   4624  O O   . LEU E 1 84  ? 13.359  -20.723  -32.858 1.00 135.03 ? 163 LEU E O   1 
ATOM   4625  C CB  . LEU E 1 84  ? 10.843  -22.758  -32.900 1.00 114.74 ? 163 LEU E CB  1 
ATOM   4626  C CG  . LEU E 1 84  ? 9.382   -23.172  -32.747 1.00 114.11 ? 163 LEU E CG  1 
ATOM   4627  C CD1 . LEU E 1 84  ? 9.068   -24.388  -33.594 1.00 116.84 ? 163 LEU E CD1 1 
ATOM   4628  C CD2 . LEU E 1 84  ? 9.075   -23.513  -31.311 1.00 117.24 ? 163 LEU E CD2 1 
ATOM   4629  N N   . ALA E 1 85  ? 13.721  -22.611  -31.682 1.00 132.14 ? 164 ALA E N   1 
ATOM   4630  C CA  . ALA E 1 85  ? 15.153  -22.661  -31.971 1.00 136.66 ? 164 ALA E CA  1 
ATOM   4631  C C   . ALA E 1 85  ? 15.584  -24.105  -31.960 1.00 139.06 ? 164 ALA E C   1 
ATOM   4632  O O   . ALA E 1 85  ? 15.368  -24.798  -30.977 1.00 138.16 ? 164 ALA E O   1 
ATOM   4633  C CB  . ALA E 1 85  ? 15.943  -21.872  -30.936 1.00 137.97 ? 164 ALA E CB  1 
ATOM   4634  N N   . LEU E 1 86  ? 16.166  -24.552  -33.063 1.00 145.31 ? 165 LEU E N   1 
ATOM   4635  C CA  . LEU E 1 86  ? 16.699  -25.898  -33.168 1.00 145.57 ? 165 LEU E CA  1 
ATOM   4636  C C   . LEU E 1 86  ? 18.142  -25.844  -32.731 1.00 148.35 ? 165 LEU E C   1 
ATOM   4637  O O   . LEU E 1 86  ? 18.927  -25.102  -33.321 1.00 151.60 ? 165 LEU E O   1 
ATOM   4638  C CB  . LEU E 1 86  ? 16.616  -26.382  -34.613 1.00 145.08 ? 165 LEU E CB  1 
ATOM   4639  C CG  . LEU E 1 86  ? 17.042  -27.824  -34.849 1.00 147.78 ? 165 LEU E CG  1 
ATOM   4640  C CD1 . LEU E 1 86  ? 15.952  -28.780  -34.376 1.00 150.10 ? 165 LEU E CD1 1 
ATOM   4641  C CD2 . LEU E 1 86  ? 17.313  -28.027  -36.332 1.00 148.45 ? 165 LEU E CD2 1 
ATOM   4642  N N   . HIS E 1 87  ? 18.479  -26.618  -31.706 1.00 150.63 ? 166 HIS E N   1 
ATOM   4643  C CA  . HIS E 1 87  ? 19.847  -26.735  -31.196 1.00 153.44 ? 166 HIS E CA  1 
ATOM   4644  C C   . HIS E 1 87  ? 20.376  -28.139  -31.439 1.00 158.46 ? 166 HIS E C   1 
ATOM   4645  O O   . HIS E 1 87  ? 19.654  -29.113  -31.249 1.00 160.61 ? 166 HIS E O   1 
ATOM   4646  C CB  . HIS E 1 87  ? 19.877  -26.423  -29.703 1.00 149.23 ? 166 HIS E CB  1 
ATOM   4647  C CG  . HIS E 1 87  ? 19.593  -24.994  -29.393 1.00 145.67 ? 166 HIS E CG  1 
ATOM   4648  N ND1 . HIS E 1 87  ? 20.336  -23.963  -29.927 1.00 144.71 ? 166 HIS E ND1 1 
ATOM   4649  C CD2 . HIS E 1 87  ? 18.647  -24.414  -28.617 1.00 146.45 ? 166 HIS E CD2 1 
ATOM   4650  C CE1 . HIS E 1 87  ? 19.869  -22.810  -29.484 1.00 144.27 ? 166 HIS E CE1 1 
ATOM   4651  N NE2 . HIS E 1 87  ? 18.841  -23.055  -28.692 1.00 147.12 ? 166 HIS E NE2 1 
ATOM   4652  N N   . LEU E 1 88  ? 21.639  -28.225  -31.856 1.00 157.38 ? 167 LEU E N   1 
ATOM   4653  C CA  . LEU E 1 88  ? 22.303  -29.500  -32.111 1.00 157.04 ? 167 LEU E CA  1 
ATOM   4654  C C   . LEU E 1 88  ? 23.185  -29.902  -30.940 1.00 159.86 ? 167 LEU E C   1 
ATOM   4655  O O   . LEU E 1 88  ? 24.050  -29.137  -30.544 1.00 155.80 ? 167 LEU E O   1 
ATOM   4656  C CB  . LEU E 1 88  ? 23.168  -29.389  -33.365 1.00 157.91 ? 167 LEU E CB  1 
ATOM   4657  C CG  . LEU E 1 88  ? 22.447  -29.003  -34.650 1.00 158.26 ? 167 LEU E CG  1 
ATOM   4658  C CD1 . LEU E 1 88  ? 23.464  -28.889  -35.772 1.00 159.89 ? 167 LEU E CD1 1 
ATOM   4659  C CD2 . LEU E 1 88  ? 21.366  -30.015  -35.004 1.00 157.31 ? 167 LEU E CD2 1 
ATOM   4660  N N   . GLN E 1 89  ? 22.966  -31.097  -30.398 1.00 169.89 ? 168 GLN E N   1 
ATOM   4661  C CA  . GLN E 1 89  ? 23.870  -31.692  -29.414 1.00 182.50 ? 168 GLN E CA  1 
ATOM   4662  C C   . GLN E 1 89  ? 24.484  -32.955  -30.055 1.00 188.58 ? 168 GLN E C   1 
ATOM   4663  O O   . GLN E 1 89  ? 23.728  -33.806  -30.537 1.00 186.94 ? 168 GLN E O   1 
ATOM   4664  C CB  . GLN E 1 89  ? 23.113  -32.023  -28.122 1.00 185.62 ? 168 GLN E CB  1 
ATOM   4665  C CG  . GLN E 1 89  ? 23.995  -32.476  -26.959 1.00 189.54 ? 168 GLN E CG  1 
ATOM   4666  C CD  . GLN E 1 89  ? 24.772  -31.359  -26.279 1.00 190.19 ? 168 GLN E CD  1 
ATOM   4667  O OE1 . GLN E 1 89  ? 25.098  -30.328  -26.885 1.00 184.87 ? 168 GLN E OE1 1 
ATOM   4668  N NE2 . GLN E 1 89  ? 25.114  -31.585  -25.021 1.00 196.70 ? 168 GLN E NE2 1 
ATOM   4669  N N   . PRO E 1 90  ? 25.817  -33.106  -30.069 1.00 200.98 ? 169 PRO E N   1 
ATOM   4670  C CA  . PRO E 1 90  ? 26.796  -32.217  -29.411 1.00 204.85 ? 169 PRO E CA  1 
ATOM   4671  C C   . PRO E 1 90  ? 27.130  -30.926  -30.178 1.00 201.37 ? 169 PRO E C   1 
ATOM   4672  O O   . PRO E 1 90  ? 27.050  -30.880  -31.414 1.00 198.32 ? 169 PRO E O   1 
ATOM   4673  C CB  . PRO E 1 90  ? 28.042  -33.105  -29.290 1.00 209.06 ? 169 PRO E CB  1 
ATOM   4674  C CG  . PRO E 1 90  ? 27.935  -34.055  -30.437 1.00 209.12 ? 169 PRO E CG  1 
ATOM   4675  C CD  . PRO E 1 90  ? 26.464  -34.299  -30.651 1.00 205.78 ? 169 PRO E CD  1 
ATOM   4676  N N   . ALA E 1 97  ? 24.919  -20.938  -31.062 1.00 159.47 ? 176 ALA E N   1 
ATOM   4677  C CA  . ALA E 1 97  ? 24.243  -20.603  -32.313 1.00 157.46 ? 176 ALA E CA  1 
ATOM   4678  C C   . ALA E 1 97  ? 23.192  -21.650  -32.703 1.00 152.90 ? 176 ALA E C   1 
ATOM   4679  O O   . ALA E 1 97  ? 23.491  -22.848  -32.723 1.00 151.45 ? 176 ALA E O   1 
ATOM   4680  C CB  . ALA E 1 97  ? 25.270  -20.454  -33.426 1.00 159.07 ? 176 ALA E CB  1 
ATOM   4681  N N   . ALA E 1 98  ? 21.982  -21.197  -33.017 1.00 148.88 ? 177 ALA E N   1 
ATOM   4682  C CA  . ALA E 1 98  ? 20.893  -22.101  -33.397 1.00 149.42 ? 177 ALA E CA  1 
ATOM   4683  C C   . ALA E 1 98  ? 21.001  -22.493  -34.865 1.00 145.99 ? 177 ALA E C   1 
ATOM   4684  O O   . ALA E 1 98  ? 21.279  -21.656  -35.712 1.00 144.76 ? 177 ALA E O   1 
ATOM   4685  C CB  . ALA E 1 98  ? 19.541  -21.468  -33.124 1.00 153.01 ? 177 ALA E CB  1 
ATOM   4686  N N   . ALA E 1 99  ? 20.769  -23.772  -35.153 1.00 144.87 ? 178 ALA E N   1 
ATOM   4687  C CA  . ALA E 1 99  ? 20.861  -24.313  -36.515 1.00 145.79 ? 178 ALA E CA  1 
ATOM   4688  C C   . ALA E 1 99  ? 19.742  -23.791  -37.401 1.00 141.48 ? 178 ALA E C   1 
ATOM   4689  O O   . ALA E 1 99  ? 19.954  -23.469  -38.571 1.00 137.90 ? 178 ALA E O   1 
ATOM   4690  C CB  . ALA E 1 99  ? 20.824  -25.835  -36.479 1.00 147.37 ? 178 ALA E CB  1 
ATOM   4691  N N   . LEU E 1 100 ? 18.554  -23.736  -36.811 1.00 138.24 ? 179 LEU E N   1 
ATOM   4692  C CA  . LEU E 1 100 ? 17.332  -23.259  -37.452 1.00 129.07 ? 179 LEU E CA  1 
ATOM   4693  C C   . LEU E 1 100 ? 16.616  -22.407  -36.397 1.00 125.75 ? 179 LEU E C   1 
ATOM   4694  O O   . LEU E 1 100 ? 16.587  -22.769  -35.219 1.00 123.42 ? 179 LEU E O   1 
ATOM   4695  C CB  . LEU E 1 100 ? 16.479  -24.457  -37.867 1.00 117.12 ? 179 LEU E CB  1 
ATOM   4696  N N   . ALA E 1 101 ? 16.057  -21.271  -36.796 1.00 123.93 ? 180 ALA E N   1 
ATOM   4697  C CA  . ALA E 1 101 ? 15.334  -20.427  -35.848 1.00 125.30 ? 180 ALA E CA  1 
ATOM   4698  C C   . ALA E 1 101 ? 14.196  -19.643  -36.494 1.00 124.52 ? 180 ALA E C   1 
ATOM   4699  O O   . ALA E 1 101 ? 14.263  -19.253  -37.660 1.00 127.42 ? 180 ALA E O   1 
ATOM   4700  C CB  . ALA E 1 101 ? 16.307  -19.488  -35.160 1.00 128.94 ? 180 ALA E CB  1 
ATOM   4701  N N   . LEU E 1 102 ? 13.168  -19.387  -35.697 1.00 122.78 ? 181 LEU E N   1 
ATOM   4702  C CA  . LEU E 1 102 ? 11.912  -18.846  -36.180 1.00 123.64 ? 181 LEU E CA  1 
ATOM   4703  C C   . LEU E 1 102 ? 11.314  -17.963  -35.119 1.00 122.13 ? 181 LEU E C   1 
ATOM   4704  O O   . LEU E 1 102 ? 11.377  -18.290  -33.946 1.00 120.43 ? 181 LEU E O   1 
ATOM   4705  C CB  . LEU E 1 102 ? 10.949  -19.996  -36.441 1.00 127.79 ? 181 LEU E CB  1 
ATOM   4706  C CG  . LEU E 1 102 ? 10.127  -19.925  -37.722 1.00 135.96 ? 181 LEU E CG  1 
ATOM   4707  C CD1 . LEU E 1 102 ? 9.119   -21.056  -37.737 1.00 143.94 ? 181 LEU E CD1 1 
ATOM   4708  C CD2 . LEU E 1 102 ? 9.411   -18.599  -37.864 1.00 139.67 ? 181 LEU E CD2 1 
ATOM   4709  N N   . THR E 1 103 ? 10.723  -16.852  -35.513 1.00 124.12 ? 182 THR E N   1 
ATOM   4710  C CA  . THR E 1 103 ? 9.947   -16.061  -34.573 1.00 122.42 ? 182 THR E CA  1 
ATOM   4711  C C   . THR E 1 103 ? 8.642   -15.669  -35.244 1.00 119.38 ? 182 THR E C   1 
ATOM   4712  O O   . THR E 1 103 ? 8.612   -15.415  -36.453 1.00 116.21 ? 182 THR E O   1 
ATOM   4713  C CB  . THR E 1 103 ? 10.742  -14.839  -34.091 1.00 122.41 ? 182 THR E CB  1 
ATOM   4714  O OG1 . THR E 1 103 ? 11.944  -15.288  -33.456 1.00 126.78 ? 182 THR E OG1 1 
ATOM   4715  C CG2 . THR E 1 103 ? 9.945   -14.008  -33.103 1.00 121.80 ? 182 THR E CG2 1 
ATOM   4716  N N   . VAL E 1 104 ? 7.574   -15.645  -34.450 1.00 116.35 ? 183 VAL E N   1 
ATOM   4717  C CA  . VAL E 1 104 ? 6.231   -15.394  -34.927 1.00 115.97 ? 183 VAL E CA  1 
ATOM   4718  C C   . VAL E 1 104 ? 5.644   -14.286  -34.070 1.00 118.38 ? 183 VAL E C   1 
ATOM   4719  O O   . VAL E 1 104 ? 5.650   -14.391  -32.854 1.00 118.25 ? 183 VAL E O   1 
ATOM   4720  C CB  . VAL E 1 104 ? 5.399   -16.675  -34.800 1.00 112.28 ? 183 VAL E CB  1 
ATOM   4721  C CG1 . VAL E 1 104 ? 3.909   -16.400  -35.013 1.00 111.67 ? 183 VAL E CG1 1 
ATOM   4722  C CG2 . VAL E 1 104 ? 5.914   -17.719  -35.788 1.00 112.44 ? 183 VAL E CG2 1 
ATOM   4723  N N   . ASP E 1 105 ? 5.167   -13.214  -34.697 1.00 123.36 ? 184 ASP E N   1 
ATOM   4724  C CA  . ASP E 1 105 ? 4.538   -12.139  -33.952 1.00 131.99 ? 184 ASP E CA  1 
ATOM   4725  C C   . ASP E 1 105 ? 3.112   -12.525  -33.623 1.00 131.11 ? 184 ASP E C   1 
ATOM   4726  O O   . ASP E 1 105 ? 2.425   -13.081  -34.456 1.00 131.30 ? 184 ASP E O   1 
ATOM   4727  C CB  . ASP E 1 105 ? 4.589   -10.810  -34.717 1.00 144.83 ? 184 ASP E CB  1 
ATOM   4728  C CG  . ASP E 1 105 ? 5.997   -10.183  -34.716 1.00 160.16 ? 184 ASP E CG  1 
ATOM   4729  O OD1 . ASP E 1 105 ? 6.110   -8.926   -34.698 1.00 179.16 ? 184 ASP E OD1 1 
ATOM   4730  O OD2 . ASP E 1 105 ? 7.001   -10.931  -34.722 1.00 171.16 ? 184 ASP E OD2 1 
ATOM   4731  N N   . LEU E 1 106 ? 2.699   -12.244  -32.393 1.00 133.94 ? 185 LEU E N   1 
ATOM   4732  C CA  . LEU E 1 106 ? 1.317   -12.397  -31.956 1.00 132.10 ? 185 LEU E CA  1 
ATOM   4733  C C   . LEU E 1 106 ? 0.651   -11.020  -32.038 1.00 128.86 ? 185 LEU E C   1 
ATOM   4734  O O   . LEU E 1 106 ? 0.966   -10.120  -31.252 1.00 133.01 ? 185 LEU E O   1 
ATOM   4735  C CB  . LEU E 1 106 ? 1.255   -12.924  -30.528 1.00 134.68 ? 185 LEU E CB  1 
ATOM   4736  C CG  . LEU E 1 106 ? 2.019   -14.208  -30.250 1.00 139.11 ? 185 LEU E CG  1 
ATOM   4737  C CD1 . LEU E 1 106 ? 1.845   -14.536  -28.777 1.00 141.16 ? 185 LEU E CD1 1 
ATOM   4738  C CD2 . LEU E 1 106 ? 1.565   -15.371  -31.148 1.00 138.89 ? 185 LEU E CD2 1 
ATOM   4739  N N   . PRO E 1 107 ? -0.276  -10.847  -32.990 1.00 123.65 ? 186 PRO E N   1 
ATOM   4740  C CA  . PRO E 1 107 ? -0.879  -9.540   -33.179 1.00 127.90 ? 186 PRO E CA  1 
ATOM   4741  C C   . PRO E 1 107 ? -1.744  -9.107   -31.984 1.00 131.86 ? 186 PRO E C   1 
ATOM   4742  O O   . PRO E 1 107 ? -2.322  -9.946   -31.306 1.00 129.09 ? 186 PRO E O   1 
ATOM   4743  C CB  . PRO E 1 107 ? -1.752  -9.780   -34.413 1.00 129.63 ? 186 PRO E CB  1 
ATOM   4744  C CG  . PRO E 1 107 ? -2.106  -11.207  -34.378 1.00 127.32 ? 186 PRO E CG  1 
ATOM   4745  C CD  . PRO E 1 107 ? -0.887  -11.854  -33.874 1.00 122.47 ? 186 PRO E CD  1 
ATOM   4746  N N   . PRO E 1 108 ? -1.847  -7.798   -31.754 1.00 137.69 ? 187 PRO E N   1 
ATOM   4747  C CA  . PRO E 1 108 ? -2.432  -7.316   -30.539 1.00 141.98 ? 187 PRO E CA  1 
ATOM   4748  C C   . PRO E 1 108 ? -3.946  -7.358   -30.416 1.00 148.42 ? 187 PRO E C   1 
ATOM   4749  O O   . PRO E 1 108 ? -4.377  -7.207   -29.309 1.00 154.71 ? 187 PRO E O   1 
ATOM   4750  C CB  . PRO E 1 108 ? -1.907  -5.889   -30.478 1.00 143.00 ? 187 PRO E CB  1 
ATOM   4751  C CG  . PRO E 1 108 ? -1.956  -5.446   -31.888 1.00 142.86 ? 187 PRO E CG  1 
ATOM   4752  C CD  . PRO E 1 108 ? -1.603  -6.666   -32.668 1.00 140.61 ? 187 PRO E CD  1 
ATOM   4753  N N   . ALA E 1 109 ? -4.717  -7.763   -31.421 1.00 152.18 ? 188 ALA E N   1 
ATOM   4754  C CA  . ALA E 1 109 ? -6.048  -8.370   -31.177 1.00 159.79 ? 188 ALA E CA  1 
ATOM   4755  C C   . ALA E 1 109 ? -7.010  -7.582   -30.281 1.00 153.45 ? 188 ALA E C   1 
ATOM   4756  O O   . ALA E 1 109 ? -7.645  -6.640   -30.756 1.00 155.26 ? 188 ALA E O   1 
ATOM   4757  C CB  . ALA E 1 109 ? -5.946  -9.869   -30.733 1.00 162.68 ? 188 ALA E CB  1 
ATOM   4758  N N   . GLU E 1 112 ? -11.583 -6.082   -34.723 1.00 177.78 ? 191 GLU E N   1 
ATOM   4759  C CA  . GLU E 1 112 ? -11.288 -6.423   -36.155 1.00 181.67 ? 191 GLU E CA  1 
ATOM   4760  C C   . GLU E 1 112 ? -9.970  -7.132   -36.643 1.00 182.28 ? 191 GLU E C   1 
ATOM   4761  O O   . GLU E 1 112 ? -9.546  -6.990   -37.819 1.00 180.97 ? 191 GLU E O   1 
ATOM   4762  C CB  . GLU E 1 112 ? -11.472 -5.130   -36.935 1.00 178.24 ? 191 GLU E CB  1 
ATOM   4763  N N   . ALA E 1 113 ? -9.354  -7.900   -35.752 1.00 181.81 ? 192 ALA E N   1 
ATOM   4764  C CA  . ALA E 1 113 ? -8.036  -8.492   -35.943 1.00 177.73 ? 192 ALA E CA  1 
ATOM   4765  C C   . ALA E 1 113 ? -7.974  -10.043  -36.103 1.00 173.37 ? 192 ALA E C   1 
ATOM   4766  O O   . ALA E 1 113 ? -8.957  -10.765  -35.919 1.00 173.13 ? 192 ALA E O   1 
ATOM   4767  C CB  . ALA E 1 113 ? -7.127  -8.043   -34.812 1.00 178.02 ? 192 ALA E CB  1 
ATOM   4768  N N   . ARG E 1 114 ? -6.777  -10.509  -36.434 1.00 164.93 ? 193 ARG E N   1 
ATOM   4769  C CA  . ARG E 1 114 ? -6.512  -11.905  -36.732 1.00 157.24 ? 193 ARG E CA  1 
ATOM   4770  C C   . ARG E 1 114 ? -6.171  -12.722  -35.450 1.00 147.48 ? 193 ARG E C   1 
ATOM   4771  O O   . ARG E 1 114 ? -5.155  -12.504  -34.751 1.00 145.07 ? 193 ARG E O   1 
ATOM   4772  C CB  . ARG E 1 114 ? -5.405  -11.978  -37.820 1.00 158.95 ? 193 ARG E CB  1 
ATOM   4773  N N   . ASN E 1 115 ? -6.979  -13.741  -35.164 1.00 139.38 ? 194 ASN E N   1 
ATOM   4774  C CA  . ASN E 1 115 ? -6.716  -14.652  -34.020 1.00 133.95 ? 194 ASN E CA  1 
ATOM   4775  C C   . ASN E 1 115 ? -5.796  -15.877  -34.276 1.00 126.30 ? 194 ASN E C   1 
ATOM   4776  O O   . ASN E 1 115 ? -5.987  -16.937  -33.667 1.00 125.21 ? 194 ASN E O   1 
ATOM   4777  C CB  . ASN E 1 115 ? -8.057  -15.111  -33.472 1.00 131.50 ? 194 ASN E CB  1 
ATOM   4778  N N   . SER E 1 116 ? -4.784  -15.728  -35.123 1.00 126.00 ? 195 SER E N   1 
ATOM   4779  C CA  . SER E 1 116 ? -3.811  -16.814  -35.350 1.00 127.28 ? 195 SER E CA  1 
ATOM   4780  C C   . SER E 1 116 ? -2.501  -16.298  -35.974 1.00 127.07 ? 195 SER E C   1 
ATOM   4781  O O   . SER E 1 116 ? -2.415  -15.126  -36.380 1.00 129.68 ? 195 SER E O   1 
ATOM   4782  C CB  . SER E 1 116 ? -4.413  -17.934  -36.208 1.00 127.10 ? 195 SER E CB  1 
ATOM   4783  O OG  . SER E 1 116 ? -4.559  -17.512  -37.557 1.00 129.38 ? 195 SER E OG  1 
ATOM   4784  N N   . ALA E 1 117 ? -1.491  -17.167  -36.036 1.00 120.79 ? 196 ALA E N   1 
ATOM   4785  C CA  . ALA E 1 117 ? -0.154  -16.743  -36.449 1.00 119.68 ? 196 ALA E CA  1 
ATOM   4786  C C   . ALA E 1 117 ? 0.704   -17.920  -36.867 1.00 113.84 ? 196 ALA E C   1 
ATOM   4787  O O   . ALA E 1 117 ? 0.918   -18.810  -36.071 1.00 108.71 ? 196 ALA E O   1 
ATOM   4788  C CB  . ALA E 1 117 ? 0.530   -15.975  -35.316 1.00 124.31 ? 196 ALA E CB  1 
ATOM   4789  N N   . PHE E 1 118 ? 1.200   -17.894  -38.097 1.00 118.99 ? 197 PHE E N   1 
ATOM   4790  C CA  . PHE E 1 118 ? 1.977   -18.996  -38.693 1.00 121.97 ? 197 PHE E CA  1 
ATOM   4791  C C   . PHE E 1 118 ? 3.424   -18.564  -38.805 1.00 114.02 ? 197 PHE E C   1 
ATOM   4792  O O   . PHE E 1 118 ? 3.756   -17.388  -38.678 1.00 112.34 ? 197 PHE E O   1 
ATOM   4793  C CB  . PHE E 1 118 ? 1.476   -19.370  -40.113 1.00 131.31 ? 197 PHE E CB  1 
ATOM   4794  C CG  . PHE E 1 118 ? -0.008  -19.714  -40.202 1.00 140.97 ? 197 PHE E CG  1 
ATOM   4795  C CD1 . PHE E 1 118 ? -0.434  -21.011  -40.549 1.00 148.46 ? 197 PHE E CD1 1 
ATOM   4796  C CD2 . PHE E 1 118 ? -0.989  -18.744  -39.932 1.00 141.10 ? 197 PHE E CD2 1 
ATOM   4797  C CE1 . PHE E 1 118 ? -1.792  -21.320  -40.616 1.00 152.51 ? 197 PHE E CE1 1 
ATOM   4798  C CE2 . PHE E 1 118 ? -2.344  -19.055  -40.005 1.00 144.66 ? 197 PHE E CE2 1 
ATOM   4799  C CZ  . PHE E 1 118 ? -2.746  -20.340  -40.352 1.00 152.01 ? 197 PHE E CZ  1 
ATOM   4800  N N   . GLY E 1 119 ? 4.278   -19.538  -39.072 1.00 109.84 ? 198 GLY E N   1 
ATOM   4801  C CA  . GLY E 1 119 ? 5.704   -19.305  -39.226 1.00 107.25 ? 198 GLY E CA  1 
ATOM   4802  C C   . GLY E 1 119 ? 6.344   -20.578  -39.730 1.00 105.68 ? 198 GLY E C   1 
ATOM   4803  O O   . GLY E 1 119 ? 6.176   -21.636  -39.129 1.00 106.23 ? 198 GLY E O   1 
ATOM   4804  N N   . PHE E 1 120 ? 7.073   -20.474  -40.829 1.00 106.61 ? 199 PHE E N   1 
ATOM   4805  C CA  . PHE E 1 120 ? 7.756   -21.619  -41.415 1.00 108.52 ? 199 PHE E CA  1 
ATOM   4806  C C   . PHE E 1 120 ? 9.184   -21.252  -41.716 1.00 108.03 ? 199 PHE E C   1 
ATOM   4807  O O   . PHE E 1 120 ? 9.441   -20.179  -42.217 1.00 111.02 ? 199 PHE E O   1 
ATOM   4808  C CB  . PHE E 1 120 ? 7.076   -22.033  -42.720 1.00 109.68 ? 199 PHE E CB  1 
ATOM   4809  C CG  . PHE E 1 120 ? 7.776   -23.143  -43.431 1.00 109.11 ? 199 PHE E CG  1 
ATOM   4810  C CD1 . PHE E 1 120 ? 7.396   -24.463  -43.221 1.00 112.34 ? 199 PHE E CD1 1 
ATOM   4811  C CD2 . PHE E 1 120 ? 8.820   -22.879  -44.288 1.00 111.44 ? 199 PHE E CD2 1 
ATOM   4812  C CE1 . PHE E 1 120 ? 8.059   -25.503  -43.843 1.00 114.33 ? 199 PHE E CE1 1 
ATOM   4813  C CE2 . PHE E 1 120 ? 9.476   -23.916  -44.934 1.00 117.10 ? 199 PHE E CE2 1 
ATOM   4814  C CZ  . PHE E 1 120 ? 9.085   -25.231  -44.714 1.00 117.06 ? 199 PHE E CZ  1 
ATOM   4815  N N   . GLN E 1 121 ? 10.102  -22.158  -41.428 1.00 109.93 ? 200 GLN E N   1 
ATOM   4816  C CA  . GLN E 1 121 ? 11.467  -22.046  -41.889 1.00 111.07 ? 200 GLN E CA  1 
ATOM   4817  C C   . GLN E 1 121 ? 12.016  -23.414  -42.223 1.00 108.08 ? 200 GLN E C   1 
ATOM   4818  O O   . GLN E 1 121 ? 11.643  -24.403  -41.609 1.00 95.29  ? 200 GLN E O   1 
ATOM   4819  C CB  . GLN E 1 121 ? 12.345  -21.374  -40.839 1.00 116.38 ? 200 GLN E CB  1 
ATOM   4820  C CG  . GLN E 1 121 ? 13.793  -21.273  -41.295 1.00 126.04 ? 200 GLN E CG  1 
ATOM   4821  C CD  . GLN E 1 121 ? 14.535  -20.092  -40.745 1.00 140.00 ? 200 GLN E CD  1 
ATOM   4822  O OE1 . GLN E 1 121 ? 15.548  -20.247  -40.044 1.00 153.66 ? 200 GLN E OE1 1 
ATOM   4823  N NE2 . GLN E 1 121 ? 14.041  -18.888  -41.053 1.00 150.87 ? 200 GLN E NE2 1 
ATOM   4824  N N   . GLY E 1 122 ? 12.889  -23.467  -43.222 1.00 113.55 ? 201 GLY E N   1 
ATOM   4825  C CA  . GLY E 1 122 ? 13.661  -24.663  -43.497 1.00 113.02 ? 201 GLY E CA  1 
ATOM   4826  C C   . GLY E 1 122 ? 14.961  -24.319  -44.181 1.00 112.09 ? 201 GLY E C   1 
ATOM   4827  O O   . GLY E 1 122 ? 15.050  -23.287  -44.831 1.00 107.79 ? 201 GLY E O   1 
ATOM   4828  N N   . ARG E 1 123 ? 15.971  -25.169  -44.002 1.00 116.16 ? 202 ARG E N   1 
ATOM   4829  C CA  . ARG E 1 123 ? 17.206  -25.102  -44.788 1.00 119.14 ? 202 ARG E CA  1 
ATOM   4830  C C   . ARG E 1 123 ? 17.960  -26.414  -44.732 1.00 116.63 ? 202 ARG E C   1 
ATOM   4831  O O   . ARG E 1 123 ? 17.597  -27.313  -43.987 1.00 108.85 ? 202 ARG E O   1 
ATOM   4832  C CB  . ARG E 1 123 ? 18.103  -23.974  -44.301 1.00 121.32 ? 202 ARG E CB  1 
ATOM   4833  C CG  . ARG E 1 123 ? 18.581  -24.163  -42.884 1.00 125.35 ? 202 ARG E CG  1 
ATOM   4834  C CD  . ARG E 1 123 ? 18.932  -22.829  -42.278 1.00 133.92 ? 202 ARG E CD  1 
ATOM   4835  N NE  . ARG E 1 123 ? 20.345  -22.510  -42.488 1.00 143.18 ? 202 ARG E NE  1 
ATOM   4836  C CZ  . ARG E 1 123 ? 20.981  -21.454  -41.973 1.00 148.11 ? 202 ARG E CZ  1 
ATOM   4837  N NH1 . ARG E 1 123 ? 20.324  -20.565  -41.231 1.00 144.69 ? 202 ARG E NH1 1 
ATOM   4838  N NH2 . ARG E 1 123 ? 22.275  -21.297  -42.223 1.00 152.94 ? 202 ARG E NH2 1 
ATOM   4839  N N   . LEU E 1 124 ? 19.003  -26.515  -45.545 1.00 122.87 ? 203 LEU E N   1 
ATOM   4840  C CA  . LEU E 1 124 ? 19.877  -27.680  -45.564 1.00 125.91 ? 203 LEU E CA  1 
ATOM   4841  C C   . LEU E 1 124 ? 20.850  -27.635  -44.392 1.00 132.21 ? 203 LEU E C   1 
ATOM   4842  O O   . LEU E 1 124 ? 21.497  -26.611  -44.158 1.00 137.68 ? 203 LEU E O   1 
ATOM   4843  C CB  . LEU E 1 124 ? 20.639  -27.762  -46.883 1.00 127.70 ? 203 LEU E CB  1 
ATOM   4844  C CG  . LEU E 1 124 ? 19.749  -27.855  -48.128 1.00 126.84 ? 203 LEU E CG  1 
ATOM   4845  C CD1 . LEU E 1 124 ? 20.493  -27.442  -49.389 1.00 130.84 ? 203 LEU E CD1 1 
ATOM   4846  C CD2 . LEU E 1 124 ? 19.194  -29.249  -48.241 1.00 123.72 ? 203 LEU E CD2 1 
ATOM   4847  N N   . LEU E 1 125 ? 20.932  -28.736  -43.652 1.00 135.01 ? 204 LEU E N   1 
ATOM   4848  C CA  . LEU E 1 125 ? 21.835  -28.868  -42.508 1.00 137.53 ? 204 LEU E CA  1 
ATOM   4849  C C   . LEU E 1 125 ? 22.671  -30.115  -42.707 1.00 140.44 ? 204 LEU E C   1 
ATOM   4850  O O   . LEU E 1 125 ? 22.120  -31.189  -42.940 1.00 138.98 ? 204 LEU E O   1 
ATOM   4851  C CB  . LEU E 1 125 ? 21.047  -29.013  -41.199 1.00 133.39 ? 204 LEU E CB  1 
ATOM   4852  N N   . HIS E 1 126 ? 23.991  -29.976  -42.627 1.00 146.71 ? 205 HIS E N   1 
ATOM   4853  C CA  . HIS E 1 126 ? 24.877  -31.134  -42.595 1.00 149.30 ? 205 HIS E CA  1 
ATOM   4854  C C   . HIS E 1 126 ? 24.785  -31.684  -41.177 1.00 152.24 ? 205 HIS E C   1 
ATOM   4855  O O   . HIS E 1 126 ? 25.125  -30.995  -40.214 1.00 153.16 ? 205 HIS E O   1 
ATOM   4856  C CB  . HIS E 1 126 ? 26.322  -30.761  -42.969 1.00 150.26 ? 205 HIS E CB  1 
ATOM   4857  N N   . LEU E 1 127 ? 24.274  -32.905  -41.050 1.00 153.30 ? 206 LEU E N   1 
ATOM   4858  C CA  . LEU E 1 127 ? 24.144  -33.566  -39.754 1.00 152.01 ? 206 LEU E CA  1 
ATOM   4859  C C   . LEU E 1 127 ? 25.193  -34.664  -39.611 1.00 161.39 ? 206 LEU E C   1 
ATOM   4860  O O   . LEU E 1 127 ? 25.504  -35.378  -40.573 1.00 167.86 ? 206 LEU E O   1 
ATOM   4861  C CB  . LEU E 1 127 ? 22.748  -34.161  -39.602 1.00 144.99 ? 206 LEU E CB  1 
ATOM   4862  C CG  . LEU E 1 127 ? 21.583  -33.168  -39.710 1.00 140.13 ? 206 LEU E CG  1 
ATOM   4863  C CD1 . LEU E 1 127 ? 20.246  -33.876  -39.549 1.00 134.11 ? 206 LEU E CD1 1 
ATOM   4864  C CD2 . LEU E 1 127 ? 21.713  -32.029  -38.710 1.00 139.73 ? 206 LEU E CD2 1 
ATOM   4865  N N   . SER E 1 128 ? 25.741  -34.782  -38.407 1.00 171.43 ? 207 SER E N   1 
ATOM   4866  C CA  . SER E 1 128 ? 26.713  -35.817  -38.070 1.00 178.71 ? 207 SER E CA  1 
ATOM   4867  C C   . SER E 1 128 ? 25.991  -37.111  -37.732 1.00 186.07 ? 207 SER E C   1 
ATOM   4868  O O   . SER E 1 128 ? 24.781  -37.111  -37.481 1.00 194.05 ? 207 SER E O   1 
ATOM   4869  C CB  . SER E 1 128 ? 27.555  -35.378  -36.874 1.00 180.55 ? 207 SER E CB  1 
ATOM   4870  O OG  . SER E 1 128 ? 27.911  -34.012  -36.995 1.00 182.02 ? 207 SER E OG  1 
ATOM   4871  N N   . ALA E 1 129 ? 26.735  -38.211  -37.724 1.00 190.64 ? 208 ALA E N   1 
ATOM   4872  C CA  . ALA E 1 129 ? 26.195  -39.497  -37.284 1.00 186.01 ? 208 ALA E CA  1 
ATOM   4873  C C   . ALA E 1 129 ? 25.938  -39.419  -35.783 1.00 181.61 ? 208 ALA E C   1 
ATOM   4874  O O   . ALA E 1 129 ? 26.766  -38.882  -35.037 1.00 179.59 ? 208 ALA E O   1 
ATOM   4875  C CB  . ALA E 1 129 ? 27.161  -40.624  -37.609 1.00 189.46 ? 208 ALA E CB  1 
ATOM   4876  N N   . GLY E 1 130 ? 24.781  -39.913  -35.348 1.00 181.10 ? 209 GLY E N   1 
ATOM   4877  C CA  . GLY E 1 130 ? 24.394  -39.854  -33.933 1.00 183.23 ? 209 GLY E CA  1 
ATOM   4878  C C   . GLY E 1 130 ? 24.137  -38.458  -33.384 1.00 181.70 ? 209 GLY E C   1 
ATOM   4879  O O   . GLY E 1 130 ? 24.283  -38.230  -32.179 1.00 182.56 ? 209 GLY E O   1 
ATOM   4880  N N   . GLN E 1 131 ? 23.750  -37.527  -34.261 1.00 177.80 ? 210 GLN E N   1 
ATOM   4881  C CA  . GLN E 1 131 ? 23.446  -36.146  -33.867 1.00 173.32 ? 210 GLN E CA  1 
ATOM   4882  C C   . GLN E 1 131 ? 22.050  -36.108  -33.236 1.00 171.02 ? 210 GLN E C   1 
ATOM   4883  O O   . GLN E 1 131 ? 21.094  -36.686  -33.780 1.00 166.17 ? 210 GLN E O   1 
ATOM   4884  C CB  . GLN E 1 131 ? 23.495  -35.217  -35.080 1.00 167.54 ? 210 GLN E CB  1 
ATOM   4885  C CG  . GLN E 1 131 ? 23.345  -33.736  -34.765 1.00 166.63 ? 210 GLN E CG  1 
ATOM   4886  C CD  . GLN E 1 131 ? 24.665  -33.029  -34.554 1.00 166.82 ? 210 GLN E CD  1 
ATOM   4887  O OE1 . GLN E 1 131 ? 25.064  -32.760  -33.421 1.00 168.93 ? 210 GLN E OE1 1 
ATOM   4888  N NE2 . GLN E 1 131 ? 25.356  -32.729  -35.652 1.00 162.37 ? 210 GLN E NE2 1 
ATOM   4889  N N   . ARG E 1 132 ? 21.953  -35.419  -32.098 1.00 171.01 ? 211 ARG E N   1 
ATOM   4890  C CA  . ARG E 1 132 ? 20.700  -35.267  -31.363 1.00 170.02 ? 211 ARG E CA  1 
ATOM   4891  C C   . ARG E 1 132 ? 20.151  -33.838  -31.530 1.00 166.25 ? 211 ARG E C   1 
ATOM   4892  O O   . ARG E 1 132 ? 20.673  -32.890  -30.935 1.00 174.24 ? 211 ARG E O   1 
ATOM   4893  C CB  . ARG E 1 132 ? 20.918  -35.602  -29.882 1.00 169.19 ? 211 ARG E CB  1 
ATOM   4894  N N   . LEU E 1 133 ? 19.115  -33.687  -32.362 1.00 155.67 ? 212 LEU E N   1 
ATOM   4895  C CA  . LEU E 1 133 ? 18.448  -32.396  -32.582 1.00 147.88 ? 212 LEU E CA  1 
ATOM   4896  C C   . LEU E 1 133 ? 17.354  -32.202  -31.529 1.00 140.93 ? 212 LEU E C   1 
ATOM   4897  O O   . LEU E 1 133 ? 16.597  -33.122  -31.255 1.00 133.45 ? 212 LEU E O   1 
ATOM   4898  C CB  . LEU E 1 133 ? 17.846  -32.334  -33.991 1.00 145.81 ? 212 LEU E CB  1 
ATOM   4899  N N   . GLY E 1 134 ? 17.288  -31.007  -30.947 1.00 135.80 ? 213 GLY E N   1 
ATOM   4900  C CA  . GLY E 1 134 ? 16.234  -30.629  -29.989 1.00 136.00 ? 213 GLY E CA  1 
ATOM   4901  C C   . GLY E 1 134 ? 15.740  -29.207  -30.223 1.00 134.41 ? 213 GLY E C   1 
ATOM   4902  O O   . GLY E 1 134 ? 16.503  -28.361  -30.678 1.00 133.02 ? 213 GLY E O   1 
ATOM   4903  N N   . VAL E 1 135 ? 14.468  -28.950  -29.912 1.00 132.60 ? 214 VAL E N   1 
ATOM   4904  C CA  . VAL E 1 135 ? 13.818  -27.677  -30.212 1.00 133.30 ? 214 VAL E CA  1 
ATOM   4905  C C   . VAL E 1 135 ? 13.398  -26.961  -28.937 1.00 136.38 ? 214 VAL E C   1 
ATOM   4906  O O   . VAL E 1 135 ? 12.789  -27.571  -28.070 1.00 140.30 ? 214 VAL E O   1 
ATOM   4907  C CB  . VAL E 1 135 ? 12.560  -27.883  -31.077 1.00 133.17 ? 214 VAL E CB  1 
ATOM   4908  C CG1 . VAL E 1 135 ? 11.957  -26.520  -31.494 1.00 135.77 ? 214 VAL E CG1 1 
ATOM   4909  C CG2 . VAL E 1 135 ? 12.880  -28.753  -32.294 1.00 131.57 ? 214 VAL E CG2 1 
ATOM   4910  N N   . HIS E 1 136 ? 13.700  -25.668  -28.845 1.00 138.62 ? 215 HIS E N   1 
ATOM   4911  C CA  . HIS E 1 136 ? 13.446  -24.871  -27.641 1.00 139.33 ? 215 HIS E CA  1 
ATOM   4912  C C   . HIS E 1 136 ? 12.513  -23.693  -27.923 1.00 136.91 ? 215 HIS E C   1 
ATOM   4913  O O   . HIS E 1 136 ? 12.745  -22.908  -28.856 1.00 132.69 ? 215 HIS E O   1 
ATOM   4914  C CB  . HIS E 1 136 ? 14.762  -24.369  -27.044 1.00 139.68 ? 215 HIS E CB  1 
ATOM   4915  N N   . LEU E 1 137 ? 11.467  -23.585  -27.098 1.00 133.37 ? 216 LEU E N   1 
ATOM   4916  C CA  . LEU E 1 137 ? 10.460  -22.540  -27.231 1.00 131.21 ? 216 LEU E CA  1 
ATOM   4917  C C   . LEU E 1 137 ? 10.788  -21.387  -26.297 1.00 131.61 ? 216 LEU E C   1 
ATOM   4918  O O   . LEU E 1 137 ? 11.085  -21.608  -25.135 1.00 141.64 ? 216 LEU E O   1 
ATOM   4919  C CB  . LEU E 1 137 ? 9.094   -23.098  -26.864 1.00 131.24 ? 216 LEU E CB  1 
ATOM   4920  C CG  . LEU E 1 137 ? 7.908   -22.163  -27.041 1.00 131.60 ? 216 LEU E CG  1 
ATOM   4921  C CD1 . LEU E 1 137 ? 7.600   -21.996  -28.501 1.00 132.03 ? 216 LEU E CD1 1 
ATOM   4922  C CD2 . LEU E 1 137 ? 6.686   -22.718  -26.350 1.00 135.71 ? 216 LEU E CD2 1 
ATOM   4923  N N   . HIS E 1 138 ? 10.727  -20.161  -26.803 1.00 130.25 ? 217 HIS E N   1 
ATOM   4924  C CA  . HIS E 1 138 ? 10.880  -18.967  -25.984 1.00 133.23 ? 217 HIS E CA  1 
ATOM   4925  C C   . HIS E 1 138 ? 9.785   -17.986  -26.356 1.00 135.22 ? 217 HIS E C   1 
ATOM   4926  O O   . HIS E 1 138 ? 9.395   -17.913  -27.517 1.00 141.45 ? 217 HIS E O   1 
ATOM   4927  C CB  . HIS E 1 138 ? 12.245  -18.328  -26.206 1.00 137.86 ? 217 HIS E CB  1 
ATOM   4928  C CG  . HIS E 1 138 ? 12.503  -17.142  -25.325 1.00 144.29 ? 217 HIS E CG  1 
ATOM   4929  N ND1 . HIS E 1 138 ? 13.073  -17.258  -24.074 1.00 147.66 ? 217 HIS E ND1 1 
ATOM   4930  C CD2 . HIS E 1 138 ? 12.231  -15.826  -25.498 1.00 145.22 ? 217 HIS E CD2 1 
ATOM   4931  C CE1 . HIS E 1 138 ? 13.153  -16.061  -23.520 1.00 148.52 ? 217 HIS E CE1 1 
ATOM   4932  N NE2 . HIS E 1 138 ? 12.662  -15.173  -24.369 1.00 147.01 ? 217 HIS E NE2 1 
ATOM   4933  N N   . THR E 1 139 ? 9.307   -17.214  -25.384 1.00 133.63 ? 218 THR E N   1 
ATOM   4934  C CA  . THR E 1 139 ? 8.152   -16.347  -25.604 1.00 131.18 ? 218 THR E CA  1 
ATOM   4935  C C   . THR E 1 139 ? 8.216   -15.045  -24.802 1.00 132.87 ? 218 THR E C   1 
ATOM   4936  O O   . THR E 1 139 ? 8.281   -15.081  -23.577 1.00 128.73 ? 218 THR E O   1 
ATOM   4937  C CB  . THR E 1 139 ? 6.809   -17.103  -25.352 1.00 131.28 ? 218 THR E CB  1 
ATOM   4938  O OG1 . THR E 1 139 ? 5.821   -16.212  -24.827 1.00 133.10 ? 218 THR E OG1 1 
ATOM   4939  C CG2 . THR E 1 139 ? 6.966   -18.275  -24.391 1.00 133.31 ? 218 THR E CG2 1 
ATOM   4940  N N   . GLU E 1 140 ? 8.200   -13.913  -25.515 1.00 138.00 ? 219 GLU E N   1 
ATOM   4941  C CA  . GLU E 1 140 ? 8.005   -12.577  -24.929 1.00 143.40 ? 219 GLU E CA  1 
ATOM   4942  C C   . GLU E 1 140 ? 6.532   -12.373  -24.537 1.00 151.62 ? 219 GLU E C   1 
ATOM   4943  O O   . GLU E 1 140 ? 5.705   -11.930  -25.344 1.00 143.19 ? 219 GLU E O   1 
ATOM   4944  C CB  . GLU E 1 140 ? 8.445   -11.482  -25.905 1.00 138.29 ? 219 GLU E CB  1 
ATOM   4945  N N   . ALA E 1 141 ? 6.232   -12.692  -23.283 1.00 168.75 ? 220 ALA E N   1 
ATOM   4946  C CA  . ALA E 1 141 ? 4.853   -12.729  -22.772 1.00 175.18 ? 220 ALA E CA  1 
ATOM   4947  C C   . ALA E 1 141 ? 4.283   -11.355  -22.449 1.00 171.13 ? 220 ALA E C   1 
ATOM   4948  O O   . ALA E 1 141 ? 4.831   -10.634  -21.622 1.00 174.16 ? 220 ALA E O   1 
ATOM   4949  C CB  . ALA E 1 141 ? 4.773   -13.621  -21.532 1.00 180.45 ? 220 ALA E CB  1 
ATOM   4950  N N   . ARG E 1 142 ? 3.192   -11.001  -23.116 1.00 160.45 ? 221 ARG E N   1 
ATOM   4951  C CA  . ARG E 1 142 ? 2.265   -9.995   -22.604 1.00 154.20 ? 221 ARG E CA  1 
ATOM   4952  C C   . ARG E 1 142 ? 0.902   -10.687  -22.621 1.00 150.43 ? 221 ARG E C   1 
ATOM   4953  O O   . ARG E 1 142 ? 0.145   -10.561  -23.582 1.00 154.23 ? 221 ARG E O   1 
ATOM   4954  C CB  . ARG E 1 142 ? 2.287   -8.728   -23.452 1.00 156.82 ? 221 ARG E CB  1 
ATOM   4955  C CG  . ARG E 1 142 ? 1.428   -7.605   -22.881 1.00 163.93 ? 221 ARG E CG  1 
ATOM   4956  C CD  . ARG E 1 142 ? 2.267   -6.500   -22.248 1.00 169.82 ? 221 ARG E CD  1 
ATOM   4957  N NE  . ARG E 1 142 ? 2.853   -5.637   -23.279 1.00 175.40 ? 221 ARG E NE  1 
ATOM   4958  C CZ  . ARG E 1 142 ? 3.095   -4.317   -23.166 1.00 177.35 ? 221 ARG E CZ  1 
ATOM   4959  N NH1 . ARG E 1 142 ? 2.794   -3.648   -22.052 1.00 181.22 ? 221 ARG E NH1 1 
ATOM   4960  N NH2 . ARG E 1 142 ? 3.625   -3.661   -24.193 1.00 176.30 ? 221 ARG E NH2 1 
ATOM   4961  N N   . ALA E 1 143 ? 0.628   -11.427  -21.551 1.00 148.71 ? 222 ALA E N   1 
ATOM   4962  C CA  . ALA E 1 143 ? -0.523  -12.339  -21.425 1.00 142.43 ? 222 ALA E CA  1 
ATOM   4963  C C   . ALA E 1 143 ? -0.347  -13.628  -22.251 1.00 140.95 ? 222 ALA E C   1 
ATOM   4964  O O   . ALA E 1 143 ? -1.214  -14.000  -23.037 1.00 139.50 ? 222 ALA E O   1 
ATOM   4965  C CB  . ALA E 1 143 ? -1.846  -11.638  -21.738 1.00 136.79 ? 222 ALA E CB  1 
ATOM   4966  N N   . ARG E 1 144 ? 0.776   -14.321  -22.024 1.00 142.15 ? 223 ARG E N   1 
ATOM   4967  C CA  . ARG E 1 144 ? 1.066   -15.623  -22.650 1.00 145.30 ? 223 ARG E CA  1 
ATOM   4968  C C   . ARG E 1 144 ? -0.070  -16.655  -22.521 1.00 145.63 ? 223 ARG E C   1 
ATOM   4969  O O   . ARG E 1 144 ? -0.196  -17.545  -23.354 1.00 149.79 ? 223 ARG E O   1 
ATOM   4970  C CB  . ARG E 1 144 ? 2.365   -16.206  -22.097 1.00 150.41 ? 223 ARG E CB  1 
ATOM   4971  C CG  . ARG E 1 144 ? 2.370   -16.521  -20.613 1.00 162.56 ? 223 ARG E CG  1 
ATOM   4972  C CD  . ARG E 1 144 ? 3.600   -17.326  -20.248 1.00 169.52 ? 223 ARG E CD  1 
ATOM   4973  N NE  . ARG E 1 144 ? 4.798   -16.494  -20.305 1.00 174.60 ? 223 ARG E NE  1 
ATOM   4974  C CZ  . ARG E 1 144 ? 6.011   -16.900  -20.687 1.00 185.60 ? 223 ARG E CZ  1 
ATOM   4975  N NH1 . ARG E 1 144 ? 6.248   -18.160  -21.059 1.00 191.91 ? 223 ARG E NH1 1 
ATOM   4976  N NH2 . ARG E 1 144 ? 7.015   -16.024  -20.700 1.00 190.40 ? 223 ARG E NH2 1 
ATOM   4977  N N   . HIS E 1 145 ? -0.879  -16.534  -21.473 1.00 145.06 ? 224 HIS E N   1 
ATOM   4978  C CA  . HIS E 1 145 ? -2.080  -17.358  -21.292 1.00 143.09 ? 224 HIS E CA  1 
ATOM   4979  C C   . HIS E 1 145 ? -3.151  -17.186  -22.380 1.00 136.41 ? 224 HIS E C   1 
ATOM   4980  O O   . HIS E 1 145 ? -3.985  -18.075  -22.568 1.00 135.94 ? 224 HIS E O   1 
ATOM   4981  C CB  . HIS E 1 145 ? -2.724  -17.057  -19.932 1.00 143.72 ? 224 HIS E CB  1 
ATOM   4982  C CG  . HIS E 1 145 ? -3.562  -15.808  -19.911 1.00 144.40 ? 224 HIS E CG  1 
ATOM   4983  N ND1 . HIS E 1 145 ? -3.041  -14.563  -19.644 1.00 142.79 ? 224 HIS E ND1 1 
ATOM   4984  C CD2 . HIS E 1 145 ? -4.893  -15.620  -20.111 1.00 146.85 ? 224 HIS E CD2 1 
ATOM   4985  C CE1 . HIS E 1 145 ? -4.011  -13.664  -19.681 1.00 143.21 ? 224 HIS E CE1 1 
ATOM   4986  N NE2 . HIS E 1 145 ? -5.142  -14.277  -19.972 1.00 143.11 ? 224 HIS E NE2 1 
ATOM   4987  N N   . ALA E 1 146 ? -3.147  -16.037  -23.061 1.00 131.05 ? 225 ALA E N   1 
ATOM   4988  C CA  . ALA E 1 146 ? -4.144  -15.731  -24.085 1.00 131.41 ? 225 ALA E CA  1 
ATOM   4989  C C   . ALA E 1 146 ? -3.896  -16.424  -25.415 1.00 129.67 ? 225 ALA E C   1 
ATOM   4990  O O   . ALA E 1 146 ? -4.768  -16.398  -26.281 1.00 132.30 ? 225 ALA E O   1 
ATOM   4991  C CB  . ALA E 1 146 ? -4.238  -14.233  -24.307 1.00 130.57 ? 225 ALA E CB  1 
ATOM   4992  N N   . TRP E 1 147 ? -2.711  -17.013  -25.596 1.00 129.34 ? 226 TRP E N   1 
ATOM   4993  C CA  . TRP E 1 147 ? -2.356  -17.713  -26.828 1.00 125.84 ? 226 TRP E CA  1 
ATOM   4994  C C   . TRP E 1 147 ? -1.912  -19.137  -26.520 1.00 124.89 ? 226 TRP E C   1 
ATOM   4995  O O   . TRP E 1 147 ? -1.338  -19.405  -25.463 1.00 132.52 ? 226 TRP E O   1 
ATOM   4996  C CB  . TRP E 1 147 ? -1.221  -16.970  -27.539 1.00 124.29 ? 226 TRP E CB  1 
ATOM   4997  C CG  . TRP E 1 147 ? -1.651  -15.735  -28.297 1.00 125.16 ? 226 TRP E CG  1 
ATOM   4998  C CD1 . TRP E 1 147 ? -1.824  -14.463  -27.799 1.00 125.32 ? 226 TRP E CD1 1 
ATOM   4999  C CD2 . TRP E 1 147 ? -1.950  -15.660  -29.685 1.00 122.22 ? 226 TRP E CD2 1 
ATOM   5000  N NE1 . TRP E 1 147 ? -2.215  -13.614  -28.798 1.00 125.17 ? 226 TRP E NE1 1 
ATOM   5001  C CE2 . TRP E 1 147 ? -2.298  -14.325  -29.969 1.00 123.07 ? 226 TRP E CE2 1 
ATOM   5002  C CE3 . TRP E 1 147 ? -1.950  -16.596  -30.722 1.00 120.93 ? 226 TRP E CE3 1 
ATOM   5003  C CZ2 . TRP E 1 147 ? -2.645  -13.906  -31.254 1.00 125.44 ? 226 TRP E CZ2 1 
ATOM   5004  C CZ3 . TRP E 1 147 ? -2.302  -16.180  -31.997 1.00 123.41 ? 226 TRP E CZ3 1 
ATOM   5005  C CH2 . TRP E 1 147 ? -2.648  -14.846  -32.253 1.00 123.95 ? 226 TRP E CH2 1 
ATOM   5006  N N   . GLN E 1 148 ? -2.182  -20.053  -27.441 1.00 120.71 ? 227 GLN E N   1 
ATOM   5007  C CA  . GLN E 1 148 ? -1.690  -21.412  -27.336 1.00 121.38 ? 227 GLN E CA  1 
ATOM   5008  C C   . GLN E 1 148 ? -1.134  -21.866  -28.667 1.00 122.30 ? 227 GLN E C   1 
ATOM   5009  O O   . GLN E 1 148 ? -1.488  -21.331  -29.717 1.00 122.93 ? 227 GLN E O   1 
ATOM   5010  C CB  . GLN E 1 148 ? -2.813  -22.355  -26.903 1.00 124.84 ? 227 GLN E CB  1 
ATOM   5011  C CG  . GLN E 1 148 ? -3.421  -21.999  -25.548 1.00 127.65 ? 227 GLN E CG  1 
ATOM   5012  C CD  . GLN E 1 148 ? -4.225  -23.105  -24.883 1.00 131.77 ? 227 GLN E CD  1 
ATOM   5013  O OE1 . GLN E 1 148 ? -4.330  -24.236  -25.382 1.00 133.77 ? 227 GLN E OE1 1 
ATOM   5014  N NE2 . GLN E 1 148 ? -4.777  -22.784  -23.722 1.00 129.93 ? 227 GLN E NE2 1 
ATOM   5015  N N   . LEU E 1 149 ? -0.254  -22.863  -28.622 1.00 123.24 ? 228 LEU E N   1 
ATOM   5016  C CA  . LEU E 1 149 ? 0.157   -23.559  -29.832 1.00 121.54 ? 228 LEU E CA  1 
ATOM   5017  C C   . LEU E 1 149 ? -1.066  -24.241  -30.421 1.00 123.87 ? 228 LEU E C   1 
ATOM   5018  O O   . LEU E 1 149 ? -1.817  -24.897  -29.689 1.00 129.79 ? 228 LEU E O   1 
ATOM   5019  C CB  . LEU E 1 149 ? 1.213   -24.607  -29.530 1.00 118.72 ? 228 LEU E CB  1 
ATOM   5020  C CG  . LEU E 1 149 ? 2.559   -24.099  -29.009 1.00 118.00 ? 228 LEU E CG  1 
ATOM   5021  C CD1 . LEU E 1 149 ? 3.346   -25.270  -28.446 1.00 122.16 ? 228 LEU E CD1 1 
ATOM   5022  C CD2 . LEU E 1 149 ? 3.382   -23.419  -30.067 1.00 113.77 ? 228 LEU E CD2 1 
ATOM   5023  N N   . THR E 1 150 ? -1.283  -24.057  -31.724 1.00 124.23 ? 229 THR E N   1 
ATOM   5024  C CA  . THR E 1 150 ? -2.360  -24.733  -32.423 1.00 128.09 ? 229 THR E CA  1 
ATOM   5025  C C   . THR E 1 150 ? -1.988  -26.197  -32.542 1.00 127.79 ? 229 THR E C   1 
ATOM   5026  O O   . THR E 1 150 ? -0.865  -26.513  -32.941 1.00 127.73 ? 229 THR E O   1 
ATOM   5027  C CB  . THR E 1 150 ? -2.578  -24.155  -33.825 1.00 133.56 ? 229 THR E CB  1 
ATOM   5028  O OG1 . THR E 1 150 ? -2.887  -22.762  -33.726 1.00 141.30 ? 229 THR E OG1 1 
ATOM   5029  C CG2 . THR E 1 150 ? -3.719  -24.873  -34.538 1.00 137.57 ? 229 THR E CG2 1 
ATOM   5030  N N   . GLN E 1 151 ? -2.929  -27.076  -32.203 1.00 128.48 ? 230 GLN E N   1 
ATOM   5031  C CA  . GLN E 1 151 ? -2.634  -28.483  -31.998 1.00 130.44 ? 230 GLN E CA  1 
ATOM   5032  C C   . GLN E 1 151 ? -2.513  -29.238  -33.303 1.00 133.16 ? 230 GLN E C   1 
ATOM   5033  O O   . GLN E 1 151 ? -3.359  -29.095  -34.179 1.00 127.51 ? 230 GLN E O   1 
ATOM   5034  C CB  . GLN E 1 151 ? -3.724  -29.130  -31.158 1.00 131.65 ? 230 GLN E CB  1 
ATOM   5035  N N   . GLY E 1 152 ? -1.455  -30.046  -33.410 1.00 137.10 ? 231 GLY E N   1 
ATOM   5036  C CA  . GLY E 1 152 ? -1.109  -30.732  -34.650 1.00 141.00 ? 231 GLY E CA  1 
ATOM   5037  C C   . GLY E 1 152 ? -0.441  -29.883  -35.729 1.00 141.78 ? 231 GLY E C   1 
ATOM   5038  O O   . GLY E 1 152 ? -0.152  -30.383  -36.817 1.00 147.19 ? 231 GLY E O   1 
ATOM   5039  N N   . ALA E 1 153 ? -0.185  -28.614  -35.423 1.00 139.66 ? 232 ALA E N   1 
ATOM   5040  C CA  . ALA E 1 153 ? 0.323   -27.637  -36.389 1.00 136.49 ? 232 ALA E CA  1 
ATOM   5041  C C   . ALA E 1 153 ? 1.798   -27.313  -36.208 1.00 131.32 ? 232 ALA E C   1 
ATOM   5042  O O   . ALA E 1 153 ? 2.477   -27.018  -37.182 1.00 133.58 ? 232 ALA E O   1 
ATOM   5043  C CB  . ALA E 1 153 ? -0.491  -26.359  -36.287 1.00 139.11 ? 232 ALA E CB  1 
ATOM   5044  N N   . THR E 1 154 ? 2.281   -27.310  -34.968 1.00 131.04 ? 233 THR E N   1 
ATOM   5045  C CA  . THR E 1 154 ? 3.707   -27.118  -34.676 1.00 132.77 ? 233 THR E CA  1 
ATOM   5046  C C   . THR E 1 154 ? 4.443   -28.416  -34.998 1.00 129.36 ? 233 THR E C   1 
ATOM   5047  O O   . THR E 1 154 ? 4.191   -29.444  -34.379 1.00 131.43 ? 233 THR E O   1 
ATOM   5048  C CB  . THR E 1 154 ? 3.931   -26.731  -33.204 1.00 141.79 ? 233 THR E CB  1 
ATOM   5049  O OG1 . THR E 1 154 ? 3.139   -25.578  -32.892 1.00 151.52 ? 233 THR E OG1 1 
ATOM   5050  C CG2 . THR E 1 154 ? 5.414   -26.442  -32.925 1.00 142.87 ? 233 THR E CG2 1 
ATOM   5051  N N   . VAL E 1 155 ? 5.347   -28.351  -35.971 1.00 127.69 ? 234 VAL E N   1 
ATOM   5052  C CA  . VAL E 1 155 ? 5.903   -29.538  -36.616 1.00 120.30 ? 234 VAL E CA  1 
ATOM   5053  C C   . VAL E 1 155 ? 7.381   -29.338  -36.902 1.00 117.99 ? 234 VAL E C   1 
ATOM   5054  O O   . VAL E 1 155 ? 7.767   -28.308  -37.408 1.00 113.20 ? 234 VAL E O   1 
ATOM   5055  C CB  . VAL E 1 155 ? 5.174   -29.801  -37.949 1.00 117.58 ? 234 VAL E CB  1 
ATOM   5056  C CG1 . VAL E 1 155 ? 5.894   -30.843  -38.788 1.00 117.15 ? 234 VAL E CG1 1 
ATOM   5057  C CG2 . VAL E 1 155 ? 3.755   -30.250  -37.681 1.00 120.46 ? 234 VAL E CG2 1 
ATOM   5058  N N   . LEU E 1 156 ? 8.186   -30.343  -36.577 1.00 117.62 ? 235 LEU E N   1 
ATOM   5059  C CA  . LEU E 1 156 ? 9.576   -30.425  -37.020 1.00 114.73 ? 235 LEU E CA  1 
ATOM   5060  C C   . LEU E 1 156 ? 9.634   -31.565  -38.005 1.00 114.04 ? 235 LEU E C   1 
ATOM   5061  O O   . LEU E 1 156 ? 9.113   -32.643  -37.733 1.00 105.91 ? 235 LEU E O   1 
ATOM   5062  C CB  . LEU E 1 156 ? 10.494  -30.743  -35.843 1.00 115.31 ? 235 LEU E CB  1 
ATOM   5063  C CG  . LEU E 1 156 ? 11.939  -31.136  -36.165 1.00 116.16 ? 235 LEU E CG  1 
ATOM   5064  C CD1 . LEU E 1 156 ? 12.669  -29.992  -36.833 1.00 113.92 ? 235 LEU E CD1 1 
ATOM   5065  C CD2 . LEU E 1 156 ? 12.648  -31.536  -34.884 1.00 119.98 ? 235 LEU E CD2 1 
ATOM   5066  N N   . GLY E 1 157 ? 10.276  -31.330  -39.142 1.00 117.43 ? 236 GLY E N   1 
ATOM   5067  C CA  . GLY E 1 157 ? 10.429  -32.361  -40.157 1.00 119.27 ? 236 GLY E CA  1 
ATOM   5068  C C   . GLY E 1 157 ? 11.766  -32.271  -40.856 1.00 121.01 ? 236 GLY E C   1 
ATOM   5069  O O   . GLY E 1 157 ? 12.385  -31.208  -40.909 1.00 117.94 ? 236 GLY E O   1 
ATOM   5070  N N   . LEU E 1 158 ? 12.215  -33.407  -41.378 1.00 125.85 ? 237 LEU E N   1 
ATOM   5071  C CA  . LEU E 1 158 ? 13.425  -33.459  -42.195 1.00 128.15 ? 237 LEU E CA  1 
ATOM   5072  C C   . LEU E 1 158 ? 13.429  -34.651  -43.133 1.00 127.84 ? 237 LEU E C   1 
ATOM   5073  O O   . LEU E 1 158 ? 12.729  -35.632  -42.903 1.00 125.91 ? 237 LEU E O   1 
ATOM   5074  C CB  . LEU E 1 158 ? 14.679  -33.478  -41.315 1.00 126.35 ? 237 LEU E CB  1 
ATOM   5075  C CG  . LEU E 1 158 ? 14.749  -34.480  -40.162 1.00 127.37 ? 237 LEU E CG  1 
ATOM   5076  C CD1 . LEU E 1 158 ? 14.988  -35.901  -40.639 1.00 131.96 ? 237 LEU E CD1 1 
ATOM   5077  C CD2 . LEU E 1 158 ? 15.857  -34.052  -39.200 1.00 126.83 ? 237 LEU E CD2 1 
ATOM   5078  N N   . PHE E 1 159 ? 14.210  -34.538  -44.199 1.00 127.78 ? 238 PHE E N   1 
ATOM   5079  C CA  . PHE E 1 159 ? 14.465  -35.657  -45.096 1.00 132.55 ? 238 PHE E CA  1 
ATOM   5080  C C   . PHE E 1 159 ? 15.864  -35.543  -45.687 1.00 138.55 ? 238 PHE E C   1 
ATOM   5081  O O   . PHE E 1 159 ? 16.366  -34.430  -45.886 1.00 141.62 ? 238 PHE E O   1 
ATOM   5082  C CB  . PHE E 1 159 ? 13.390  -35.761  -46.190 1.00 132.00 ? 238 PHE E CB  1 
ATOM   5083  C CG  . PHE E 1 159 ? 13.167  -34.496  -46.980 1.00 133.71 ? 238 PHE E CG  1 
ATOM   5084  C CD1 . PHE E 1 159 ? 13.952  -34.202  -48.091 1.00 136.20 ? 238 PHE E CD1 1 
ATOM   5085  C CD2 . PHE E 1 159 ? 12.141  -33.622  -46.643 1.00 137.50 ? 238 PHE E CD2 1 
ATOM   5086  C CE1 . PHE E 1 159 ? 13.733  -33.046  -48.834 1.00 136.44 ? 238 PHE E CE1 1 
ATOM   5087  C CE2 . PHE E 1 159 ? 11.911  -32.469  -47.386 1.00 137.62 ? 238 PHE E CE2 1 
ATOM   5088  C CZ  . PHE E 1 159 ? 12.706  -32.180  -48.485 1.00 136.79 ? 238 PHE E CZ  1 
ATOM   5089  N N   . ARG E 1 160 ? 16.492  -36.693  -45.944 1.00 142.33 ? 239 ARG E N   1 
ATOM   5090  C CA  . ARG E 1 160 ? 17.875  -36.736  -46.432 1.00 140.80 ? 239 ARG E CA  1 
ATOM   5091  C C   . ARG E 1 160 ? 17.929  -36.334  -47.894 1.00 142.56 ? 239 ARG E C   1 
ATOM   5092  O O   . ARG E 1 160 ? 17.043  -36.677  -48.676 1.00 141.65 ? 239 ARG E O   1 
ATOM   5093  C CB  . ARG E 1 160 ? 18.487  -38.131  -46.253 1.00 138.47 ? 239 ARG E CB  1 
ATOM   5094  N N   . VAL E 1 161 ? 18.961  -35.578  -48.244 1.00 149.01 ? 240 VAL E N   1 
ATOM   5095  C CA  . VAL E 1 161 ? 19.253  -35.221  -49.627 1.00 159.19 ? 240 VAL E CA  1 
ATOM   5096  C C   . VAL E 1 161 ? 20.468  -36.006  -50.151 1.00 170.10 ? 240 VAL E C   1 
ATOM   5097  O O   . VAL E 1 161 ? 20.440  -36.524  -51.270 1.00 176.92 ? 240 VAL E O   1 
ATOM   5098  C CB  . VAL E 1 161 ? 19.464  -33.706  -49.753 1.00 156.68 ? 240 VAL E CB  1 
ATOM   5099  C CG1 . VAL E 1 161 ? 19.781  -33.343  -51.201 1.00 159.56 ? 240 VAL E CG1 1 
ATOM   5100  C CG2 . VAL E 1 161 ? 18.219  -32.965  -49.258 1.00 152.83 ? 240 VAL E CG2 1 
ATOM   5101  N N   . THR E 1 162 ? 21.527  -36.102  -49.347 1.00 176.05 ? 241 THR E N   1 
ATOM   5102  C CA  . THR E 1 162 ? 22.700  -36.916  -49.687 1.00 178.05 ? 241 THR E CA  1 
ATOM   5103  C C   . THR E 1 162 ? 22.319  -38.402  -49.650 1.00 179.89 ? 241 THR E C   1 
ATOM   5104  O O   . THR E 1 162 ? 21.704  -38.861  -48.664 1.00 178.60 ? 241 THR E O   1 
ATOM   5105  C CB  . THR E 1 162 ? 23.874  -36.705  -48.711 1.00 179.00 ? 241 THR E CB  1 
ATOM   5106  O OG1 . THR E 1 162 ? 24.149  -35.307  -48.553 1.00 187.74 ? 241 THR E OG1 1 
ATOM   5107  C CG2 . THR E 1 162 ? 25.110  -37.451  -49.187 1.00 179.96 ? 241 THR E CG2 1 
ATOM   5108  N N   . PRO E 1 163 ? 22.665  -39.167  -50.710 1.00 182.39 ? 242 PRO E N   1 
ATOM   5109  C CA  . PRO E 1 163 ? 22.570  -40.634  -50.605 1.00 178.33 ? 242 PRO E CA  1 
ATOM   5110  C C   . PRO E 1 163 ? 23.661  -41.248  -49.705 1.00 173.43 ? 242 PRO E C   1 
ATOM   5111  O O   . PRO E 1 163 ? 24.881  -41.091  -49.916 1.00 174.21 ? 242 PRO E O   1 
ATOM   5112  C CB  . PRO E 1 163 ? 22.668  -41.116  -52.064 1.00 178.74 ? 242 PRO E CB  1 
ATOM   5113  C CG  . PRO E 1 163 ? 22.559  -39.892  -52.905 1.00 180.85 ? 242 PRO E CG  1 
ATOM   5114  C CD  . PRO E 1 163 ? 23.015  -38.742  -52.075 1.00 181.37 ? 242 PRO E CD  1 
ATOM   5115  N N   . GLY F 1 11  ? 11.177  -38.631  -62.355 1.00 182.92 ? 90  GLY F N   1 
ATOM   5116  C CA  . GLY F 1 11  ? 10.679  -37.920  -61.154 1.00 177.12 ? 90  GLY F CA  1 
ATOM   5117  C C   . GLY F 1 11  ? 9.175   -38.006  -60.948 1.00 172.39 ? 90  GLY F C   1 
ATOM   5118  O O   . GLY F 1 11  ? 8.408   -38.272  -61.874 1.00 171.59 ? 90  GLY F O   1 
ATOM   5119  N N   . MET F 1 12  ? 8.770   -37.750  -59.711 1.00 170.60 ? 91  MET F N   1 
ATOM   5120  C CA  . MET F 1 12  ? 7.357   -37.756  -59.283 1.00 170.27 ? 91  MET F CA  1 
ATOM   5121  C C   . MET F 1 12  ? 7.068   -36.487  -58.473 1.00 161.43 ? 91  MET F C   1 
ATOM   5122  O O   . MET F 1 12  ? 7.203   -36.465  -57.240 1.00 160.15 ? 91  MET F O   1 
ATOM   5123  C CB  . MET F 1 12  ? 7.082   -39.021  -58.452 1.00 178.51 ? 91  MET F CB  1 
ATOM   5124  C CG  . MET F 1 12  ? 5.672   -39.186  -57.904 1.00 182.29 ? 91  MET F CG  1 
ATOM   5125  S SD  . MET F 1 12  ? 4.445   -39.473  -59.192 1.00 194.44 ? 91  MET F SD  1 
ATOM   5126  C CE  . MET F 1 12  ? 3.067   -40.052  -58.205 1.00 184.81 ? 91  MET F CE  1 
ATOM   5127  N N   . PHE F 1 13  ? 6.689   -35.430  -59.186 1.00 150.56 ? 92  PHE F N   1 
ATOM   5128  C CA  . PHE F 1 13  ? 6.455   -34.120  -58.582 1.00 141.38 ? 92  PHE F CA  1 
ATOM   5129  C C   . PHE F 1 13  ? 5.506   -33.277  -59.408 1.00 136.89 ? 92  PHE F C   1 
ATOM   5130  O O   . PHE F 1 13  ? 5.363   -33.486  -60.601 1.00 134.56 ? 92  PHE F O   1 
ATOM   5131  C CB  . PHE F 1 13  ? 7.777   -33.371  -58.437 1.00 136.07 ? 92  PHE F CB  1 
ATOM   5132  C CG  . PHE F 1 13  ? 8.453   -33.075  -59.742 1.00 132.69 ? 92  PHE F CG  1 
ATOM   5133  C CD1 . PHE F 1 13  ? 9.452   -33.908  -60.220 1.00 133.09 ? 92  PHE F CD1 1 
ATOM   5134  C CD2 . PHE F 1 13  ? 8.100   -31.953  -60.491 1.00 131.77 ? 92  PHE F CD2 1 
ATOM   5135  C CE1 . PHE F 1 13  ? 10.085  -33.640  -61.426 1.00 136.01 ? 92  PHE F CE1 1 
ATOM   5136  C CE2 . PHE F 1 13  ? 8.726   -31.678  -61.697 1.00 134.16 ? 92  PHE F CE2 1 
ATOM   5137  C CZ  . PHE F 1 13  ? 9.723   -32.526  -62.165 1.00 135.55 ? 92  PHE F CZ  1 
ATOM   5138  N N   . ALA F 1 14  ? 4.908   -32.285  -58.767 1.00 134.76 ? 93  ALA F N   1 
ATOM   5139  C CA  . ALA F 1 14  ? 3.981   -31.379  -59.427 1.00 132.77 ? 93  ALA F CA  1 
ATOM   5140  C C   . ALA F 1 14  ? 4.142   -29.964  -58.891 1.00 130.80 ? 93  ALA F C   1 
ATOM   5141  O O   . ALA F 1 14  ? 4.636   -29.764  -57.785 1.00 131.45 ? 93  ALA F O   1 
ATOM   5142  C CB  . ALA F 1 14  ? 2.553   -31.859  -59.237 1.00 133.30 ? 93  ALA F CB  1 
ATOM   5143  N N   . GLN F 1 15  ? 3.735   -28.991  -59.693 1.00 129.16 ? 94  GLN F N   1 
ATOM   5144  C CA  . GLN F 1 15  ? 3.624   -27.606  -59.247 1.00 127.33 ? 94  GLN F CA  1 
ATOM   5145  C C   . GLN F 1 15  ? 2.600   -26.894  -60.105 1.00 129.61 ? 94  GLN F C   1 
ATOM   5146  O O   . GLN F 1 15  ? 2.796   -26.762  -61.304 1.00 137.24 ? 94  GLN F O   1 
ATOM   5147  C CB  . GLN F 1 15  ? 4.967   -26.879  -59.314 1.00 127.14 ? 94  GLN F CB  1 
ATOM   5148  C CG  . GLN F 1 15  ? 4.871   -25.416  -58.884 1.00 125.27 ? 94  GLN F CG  1 
ATOM   5149  C CD  . GLN F 1 15  ? 6.204   -24.811  -58.519 1.00 122.03 ? 94  GLN F CD  1 
ATOM   5150  O OE1 . GLN F 1 15  ? 6.833   -25.194  -57.546 1.00 115.24 ? 94  GLN F OE1 1 
ATOM   5151  N NE2 . GLN F 1 15  ? 6.632   -23.846  -59.299 1.00 123.61 ? 94  GLN F NE2 1 
ATOM   5152  N N   . LEU F 1 16  ? 1.506   -26.455  -59.489 1.00 128.36 ? 95  LEU F N   1 
ATOM   5153  C CA  . LEU F 1 16  ? 0.433   -25.769  -60.201 1.00 126.60 ? 95  LEU F CA  1 
ATOM   5154  C C   . LEU F 1 16  ? 0.427   -24.286  -59.868 1.00 122.81 ? 95  LEU F C   1 
ATOM   5155  O O   . LEU F 1 16  ? 0.925   -23.866  -58.817 1.00 122.66 ? 95  LEU F O   1 
ATOM   5156  C CB  . LEU F 1 16  ? -0.908  -26.390  -59.832 1.00 129.58 ? 95  LEU F CB  1 
ATOM   5157  C CG  . LEU F 1 16  ? -1.011  -27.910  -59.970 1.00 130.42 ? 95  LEU F CG  1 
ATOM   5158  C CD1 . LEU F 1 16  ? -2.442  -28.344  -59.687 1.00 133.62 ? 95  LEU F CD1 1 
ATOM   5159  C CD2 . LEU F 1 16  ? -0.555  -28.383  -61.339 1.00 129.80 ? 95  LEU F CD2 1 
ATOM   5160  N N   . VAL F 1 17  ? -0.151  -23.498  -60.765 1.00 122.79 ? 96  VAL F N   1 
ATOM   5161  C CA  . VAL F 1 17  ? -0.220  -22.049  -60.614 1.00 127.73 ? 96  VAL F CA  1 
ATOM   5162  C C   . VAL F 1 17  ? -1.673  -21.633  -60.653 1.00 129.27 ? 96  VAL F C   1 
ATOM   5163  O O   . VAL F 1 17  ? -2.351  -21.873  -61.639 1.00 137.84 ? 96  VAL F O   1 
ATOM   5164  C CB  . VAL F 1 17  ? 0.532   -21.366  -61.762 1.00 130.56 ? 96  VAL F CB  1 
ATOM   5165  C CG1 . VAL F 1 17  ? 0.340   -19.850  -61.697 1.00 131.60 ? 96  VAL F CG1 1 
ATOM   5166  C CG2 . VAL F 1 17  ? 2.009   -21.750  -61.711 1.00 128.88 ? 96  VAL F CG2 1 
ATOM   5167  N N   . ALA F 1 18  ? -2.154  -21.011  -59.589 1.00 128.97 ? 97  ALA F N   1 
ATOM   5168  C CA  . ALA F 1 18  ? -3.566  -20.654  -59.501 1.00 134.44 ? 97  ALA F CA  1 
ATOM   5169  C C   . ALA F 1 18  ? -3.951  -19.665  -60.588 1.00 138.83 ? 97  ALA F C   1 
ATOM   5170  O O   . ALA F 1 18  ? -3.205  -18.728  -60.877 1.00 135.25 ? 97  ALA F O   1 
ATOM   5171  C CB  . ALA F 1 18  ? -3.894  -20.070  -58.136 1.00 136.69 ? 97  ALA F CB  1 
ATOM   5172  N N   . GLN F 1 19  ? -5.121  -19.898  -61.184 1.00 143.52 ? 98  GLN F N   1 
ATOM   5173  C CA  . GLN F 1 19  ? -5.670  -19.027  -62.217 1.00 142.63 ? 98  GLN F CA  1 
ATOM   5174  C C   . GLN F 1 19  ? -6.362  -17.807  -61.614 1.00 138.23 ? 98  GLN F C   1 
ATOM   5175  O O   . GLN F 1 19  ? -6.453  -16.769  -62.264 1.00 140.10 ? 98  GLN F O   1 
ATOM   5176  C CB  . GLN F 1 19  ? -6.692  -19.780  -63.061 1.00 144.22 ? 98  GLN F CB  1 
ATOM   5177  N N   . ASN F 1 20  ? -6.816  -17.931  -60.374 1.00 130.87 ? 99  ASN F N   1 
ATOM   5178  C CA  . ASN F 1 20  ? -7.765  -16.982  -59.799 1.00 133.08 ? 99  ASN F CA  1 
ATOM   5179  C C   . ASN F 1 20  ? -7.050  -15.677  -59.519 1.00 133.03 ? 99  ASN F C   1 
ATOM   5180  O O   . ASN F 1 20  ? -5.858  -15.685  -59.219 1.00 141.59 ? 99  ASN F O   1 
ATOM   5181  C CB  . ASN F 1 20  ? -8.384  -17.510  -58.494 1.00 133.50 ? 99  ASN F CB  1 
ATOM   5182  C CG  . ASN F 1 20  ? -8.846  -18.940  -58.603 1.00 138.85 ? 99  ASN F CG  1 
ATOM   5183  O OD1 . ASN F 1 20  ? -10.033 -19.214  -58.735 1.00 146.91 ? 99  ASN F OD1 1 
ATOM   5184  N ND2 . ASN F 1 20  ? -7.903  -19.865  -58.553 1.00 137.95 ? 99  ASN F ND2 1 
ATOM   5185  N N   . VAL F 1 21  ? -7.759  -14.563  -59.662 1.00 134.05 ? 100 VAL F N   1 
ATOM   5186  C CA  . VAL F 1 21  ? -7.219  -13.256  -59.266 1.00 136.08 ? 100 VAL F CA  1 
ATOM   5187  C C   . VAL F 1 21  ? -8.100  -12.532  -58.252 1.00 138.96 ? 100 VAL F C   1 
ATOM   5188  O O   . VAL F 1 21  ? -7.575  -11.897  -57.345 1.00 140.02 ? 100 VAL F O   1 
ATOM   5189  C CB  . VAL F 1 21  ? -6.899  -12.347  -60.485 1.00 141.84 ? 100 VAL F CB  1 
ATOM   5190  C CG1 . VAL F 1 21  ? -6.204  -13.146  -61.592 1.00 144.04 ? 100 VAL F CG1 1 
ATOM   5191  C CG2 . VAL F 1 21  ? -8.142  -11.660  -61.027 1.00 146.69 ? 100 VAL F CG2 1 
ATOM   5192  N N   . LEU F 1 22  ? -9.418  -12.625  -58.393 1.00 146.48 ? 101 LEU F N   1 
ATOM   5193  C CA  . LEU F 1 22  ? -10.328 -11.993  -57.448 1.00 150.27 ? 101 LEU F CA  1 
ATOM   5194  C C   . LEU F 1 22  ? -10.515 -12.864  -56.213 1.00 149.75 ? 101 LEU F C   1 
ATOM   5195  O O   . LEU F 1 22  ? -10.619 -14.092  -56.310 1.00 148.30 ? 101 LEU F O   1 
ATOM   5196  C CB  . LEU F 1 22  ? -11.680 -11.727  -58.103 1.00 158.21 ? 101 LEU F CB  1 
ATOM   5197  C CG  . LEU F 1 22  ? -11.641 -10.867  -59.358 1.00 163.89 ? 101 LEU F CG  1 
ATOM   5198  C CD1 . LEU F 1 22  ? -13.068 -10.527  -59.745 1.00 169.64 ? 101 LEU F CD1 1 
ATOM   5199  C CD2 . LEU F 1 22  ? -10.832 -9.600   -59.156 1.00 163.08 ? 101 LEU F CD2 1 
ATOM   5200  N N   . LEU F 1 23  ? -10.557 -12.214  -55.055 1.00 150.01 ? 102 LEU F N   1 
ATOM   5201  C CA  . LEU F 1 23  ? -10.735 -12.907  -53.791 1.00 150.97 ? 102 LEU F CA  1 
ATOM   5202  C C   . LEU F 1 23  ? -12.206 -13.290  -53.662 1.00 156.71 ? 102 LEU F C   1 
ATOM   5203  O O   . LEU F 1 23  ? -13.053 -12.453  -53.338 1.00 164.95 ? 102 LEU F O   1 
ATOM   5204  C CB  . LEU F 1 23  ? -10.270 -12.035  -52.607 1.00 147.11 ? 102 LEU F CB  1 
ATOM   5205  C CG  . LEU F 1 23  ? -8.790  -11.647  -52.627 1.00 140.80 ? 102 LEU F CG  1 
ATOM   5206  C CD1 . LEU F 1 23  ? -8.502  -10.657  -51.510 1.00 138.09 ? 102 LEU F CD1 1 
ATOM   5207  C CD2 . LEU F 1 23  ? -7.904  -12.894  -52.554 1.00 138.70 ? 102 LEU F CD2 1 
ATOM   5208  N N   . ILE F 1 24  ? -12.505 -14.554  -53.962 1.00 153.13 ? 103 ILE F N   1 
ATOM   5209  C CA  . ILE F 1 24  ? -13.864 -15.071  -53.883 1.00 156.83 ? 103 ILE F CA  1 
ATOM   5210  C C   . ILE F 1 24  ? -13.852 -16.396  -53.132 1.00 157.24 ? 103 ILE F C   1 
ATOM   5211  O O   . ILE F 1 24  ? -13.190 -17.340  -53.570 1.00 159.66 ? 103 ILE F O   1 
ATOM   5212  C CB  . ILE F 1 24  ? -14.446 -15.251  -55.303 1.00 162.94 ? 103 ILE F CB  1 
ATOM   5213  C CG1 . ILE F 1 24  ? -14.690 -13.882  -55.943 1.00 167.76 ? 103 ILE F CG1 1 
ATOM   5214  C CG2 . ILE F 1 24  ? -15.740 -16.053  -55.284 1.00 166.35 ? 103 ILE F CG2 1 
ATOM   5215  C CD1 . ILE F 1 24  ? -14.722 -13.928  -57.460 1.00 173.22 ? 103 ILE F CD1 1 
ATOM   5216  N N   . ASP F 1 25  ? -14.585 -16.464  -52.015 1.00 157.40 ? 104 ASP F N   1 
ATOM   5217  C CA  . ASP F 1 25  ? -14.712 -17.695  -51.221 1.00 157.02 ? 104 ASP F CA  1 
ATOM   5218  C C   . ASP F 1 25  ? -15.071 -18.862  -52.131 1.00 151.27 ? 104 ASP F C   1 
ATOM   5219  O O   . ASP F 1 25  ? -16.030 -18.768  -52.895 1.00 153.66 ? 104 ASP F O   1 
ATOM   5220  C CB  . ASP F 1 25  ? -15.807 -17.556  -50.142 1.00 165.27 ? 104 ASP F CB  1 
ATOM   5221  C CG  . ASP F 1 25  ? -15.390 -16.676  -48.958 1.00 169.96 ? 104 ASP F CG  1 
ATOM   5222  O OD1 . ASP F 1 25  ? -16.266 -16.347  -48.123 1.00 172.14 ? 104 ASP F OD1 1 
ATOM   5223  O OD2 . ASP F 1 25  ? -14.206 -16.310  -48.847 1.00 176.01 ? 104 ASP F OD2 1 
ATOM   5224  N N   . GLY F 1 26  ? -14.294 -19.940  -52.054 1.00 147.33 ? 105 GLY F N   1 
ATOM   5225  C CA  . GLY F 1 26  ? -14.509 -21.137  -52.881 1.00 149.32 ? 105 GLY F CA  1 
ATOM   5226  C C   . GLY F 1 26  ? -13.213 -21.618  -53.500 1.00 149.35 ? 105 GLY F C   1 
ATOM   5227  O O   . GLY F 1 26  ? -12.224 -20.898  -53.467 1.00 158.15 ? 105 GLY F O   1 
ATOM   5228  N N   . PRO F 1 27  ? -13.224 -22.811  -54.110 1.00 148.79 ? 106 PRO F N   1 
ATOM   5229  C CA  . PRO F 1 27  ? -11.993 -23.500  -54.503 1.00 148.07 ? 106 PRO F CA  1 
ATOM   5230  C C   . PRO F 1 27  ? -11.246 -22.856  -55.687 1.00 143.25 ? 106 PRO F C   1 
ATOM   5231  O O   . PRO F 1 27  ? -11.862 -22.327  -56.621 1.00 137.60 ? 106 PRO F O   1 
ATOM   5232  C CB  . PRO F 1 27  ? -12.482 -24.897  -54.880 1.00 151.18 ? 106 PRO F CB  1 
ATOM   5233  C CG  . PRO F 1 27  ? -13.860 -24.667  -55.393 1.00 155.95 ? 106 PRO F CG  1 
ATOM   5234  C CD  . PRO F 1 27  ? -14.421 -23.487  -54.640 1.00 154.56 ? 106 PRO F CD  1 
ATOM   5235  N N   . LEU F 1 28  ? -9.919  -22.917  -55.625 1.00 141.54 ? 107 LEU F N   1 
ATOM   5236  C CA  . LEU F 1 28  ? -9.056  -22.313  -56.625 1.00 143.82 ? 107 LEU F CA  1 
ATOM   5237  C C   . LEU F 1 28  ? -8.933  -23.226  -57.828 1.00 145.21 ? 107 LEU F C   1 
ATOM   5238  O O   . LEU F 1 28  ? -8.771  -24.440  -57.685 1.00 147.86 ? 107 LEU F O   1 
ATOM   5239  C CB  . LEU F 1 28  ? -7.648  -22.046  -56.061 1.00 145.66 ? 107 LEU F CB  1 
ATOM   5240  C CG  . LEU F 1 28  ? -7.493  -21.127  -54.861 1.00 146.14 ? 107 LEU F CG  1 
ATOM   5241  C CD1 . LEU F 1 28  ? -6.026  -21.138  -54.468 1.00 145.21 ? 107 LEU F CD1 1 
ATOM   5242  C CD2 . LEU F 1 28  ? -7.988  -19.711  -55.151 1.00 146.83 ? 107 LEU F CD2 1 
ATOM   5243  N N   . SER F 1 29  ? -9.046  -22.617  -59.007 1.00 148.56 ? 108 SER F N   1 
ATOM   5244  C CA  . SER F 1 29  ? -8.718  -23.232  -60.284 1.00 153.35 ? 108 SER F CA  1 
ATOM   5245  C C   . SER F 1 29  ? -7.232  -23.074  -60.602 1.00 147.79 ? 108 SER F C   1 
ATOM   5246  O O   . SER F 1 29  ? -6.635  -22.062  -60.255 1.00 143.78 ? 108 SER F O   1 
ATOM   5247  C CB  . SER F 1 29  ? -9.553  -22.562  -61.369 1.00 161.35 ? 108 SER F CB  1 
ATOM   5248  O OG  . SER F 1 29  ? -10.819 -22.185  -60.836 1.00 162.59 ? 108 SER F OG  1 
ATOM   5249  N N   . TRP F 1 30  ? -6.668  -24.064  -61.299 1.00 146.72 ? 109 TRP F N   1 
ATOM   5250  C CA  . TRP F 1 30  ? -5.212  -24.191  -61.501 1.00 146.32 ? 109 TRP F CA  1 
ATOM   5251  C C   . TRP F 1 30  ? -4.798  -24.374  -62.959 1.00 150.24 ? 109 TRP F C   1 
ATOM   5252  O O   . TRP F 1 30  ? -5.418  -25.159  -63.685 1.00 157.78 ? 109 TRP F O   1 
ATOM   5253  C CB  . TRP F 1 30  ? -4.701  -25.402  -60.723 1.00 145.50 ? 109 TRP F CB  1 
ATOM   5254  C CG  . TRP F 1 30  ? -4.954  -25.280  -59.287 1.00 143.79 ? 109 TRP F CG  1 
ATOM   5255  C CD1 . TRP F 1 30  ? -6.020  -25.755  -58.601 1.00 143.62 ? 109 TRP F CD1 1 
ATOM   5256  C CD2 . TRP F 1 30  ? -4.140  -24.596  -58.345 1.00 143.47 ? 109 TRP F CD2 1 
ATOM   5257  N NE1 . TRP F 1 30  ? -5.915  -25.432  -57.275 1.00 144.00 ? 109 TRP F NE1 1 
ATOM   5258  C CE2 . TRP F 1 30  ? -4.763  -24.717  -57.089 1.00 140.96 ? 109 TRP F CE2 1 
ATOM   5259  C CE3 . TRP F 1 30  ? -2.929  -23.901  -58.437 1.00 146.35 ? 109 TRP F CE3 1 
ATOM   5260  C CZ2 . TRP F 1 30  ? -4.228  -24.153  -55.932 1.00 139.28 ? 109 TRP F CZ2 1 
ATOM   5261  C CZ3 . TRP F 1 30  ? -2.393  -23.343  -57.290 1.00 143.87 ? 109 TRP F CZ3 1 
ATOM   5262  C CH2 . TRP F 1 30  ? -3.045  -23.472  -56.050 1.00 140.38 ? 109 TRP F CH2 1 
ATOM   5263  N N   . TYR F 1 31  ? -3.733  -23.677  -63.370 1.00 150.36 ? 110 TYR F N   1 
ATOM   5264  C CA  . TYR F 1 31  ? -3.062  -23.972  -64.634 1.00 150.00 ? 110 TYR F CA  1 
ATOM   5265  C C   . TYR F 1 31  ? -2.290  -25.285  -64.482 1.00 154.96 ? 110 TYR F C   1 
ATOM   5266  O O   . TYR F 1 31  ? -1.520  -25.439  -63.530 1.00 160.59 ? 110 TYR F O   1 
ATOM   5267  C CB  . TYR F 1 31  ? -2.086  -22.864  -65.019 1.00 143.52 ? 110 TYR F CB  1 
ATOM   5268  C CG  . TYR F 1 31  ? -2.727  -21.538  -65.288 1.00 147.61 ? 110 TYR F CG  1 
ATOM   5269  C CD1 . TYR F 1 31  ? -3.600  -21.377  -66.345 1.00 155.03 ? 110 TYR F CD1 1 
ATOM   5270  C CD2 . TYR F 1 31  ? -2.452  -20.428  -64.495 1.00 152.61 ? 110 TYR F CD2 1 
ATOM   5271  C CE1 . TYR F 1 31  ? -4.197  -20.147  -66.610 1.00 162.21 ? 110 TYR F CE1 1 
ATOM   5272  C CE2 . TYR F 1 31  ? -3.039  -19.195  -64.745 1.00 157.72 ? 110 TYR F CE2 1 
ATOM   5273  C CZ  . TYR F 1 31  ? -3.910  -19.061  -65.801 1.00 162.11 ? 110 TYR F CZ  1 
ATOM   5274  O OH  . TYR F 1 31  ? -4.494  -17.844  -66.050 1.00 172.19 ? 110 TYR F OH  1 
ATOM   5275  N N   . SER F 1 32  ? -2.514  -26.224  -65.403 1.00 158.55 ? 111 SER F N   1 
ATOM   5276  C CA  . SER F 1 32  ? -1.881  -27.552  -65.370 1.00 159.05 ? 111 SER F CA  1 
ATOM   5277  C C   . SER F 1 32  ? -1.004  -27.893  -66.589 1.00 160.54 ? 111 SER F C   1 
ATOM   5278  O O   . SER F 1 32  ? -0.248  -28.866  -66.540 1.00 162.96 ? 111 SER F O   1 
ATOM   5279  C CB  . SER F 1 32  ? -2.957  -28.632  -65.193 1.00 163.38 ? 111 SER F CB  1 
ATOM   5280  O OG  . SER F 1 32  ? -3.967  -28.480  -66.175 1.00 168.91 ? 111 SER F OG  1 
ATOM   5281  N N   . ASP F 1 33  ? -1.092  -27.105  -67.662 1.00 162.51 ? 112 ASP F N   1 
ATOM   5282  C CA  . ASP F 1 33  ? -0.339  -27.358  -68.900 1.00 167.56 ? 112 ASP F CA  1 
ATOM   5283  C C   . ASP F 1 33  ? 1.134   -26.953  -68.697 1.00 166.56 ? 112 ASP F C   1 
ATOM   5284  O O   . ASP F 1 33  ? 1.416   -25.766  -68.521 1.00 169.22 ? 112 ASP F O   1 
ATOM   5285  C CB  . ASP F 1 33  ? -0.973  -26.567  -70.058 1.00 172.33 ? 112 ASP F CB  1 
ATOM   5286  C CG  . ASP F 1 33  ? -0.233  -26.726  -71.396 1.00 177.41 ? 112 ASP F CG  1 
ATOM   5287  O OD1 . ASP F 1 33  ? 0.945   -27.154  -71.445 1.00 174.92 ? 112 ASP F OD1 1 
ATOM   5288  O OD2 . ASP F 1 33  ? -0.837  -26.351  -72.416 1.00 184.95 ? 112 ASP F OD2 1 
ATOM   5289  N N   . PRO F 1 34  ? 2.074   -27.929  -68.755 1.00 163.00 ? 113 PRO F N   1 
ATOM   5290  C CA  . PRO F 1 34  ? 3.491   -27.646  -68.462 1.00 160.16 ? 113 PRO F CA  1 
ATOM   5291  C C   . PRO F 1 34  ? 4.251   -26.815  -69.513 1.00 160.02 ? 113 PRO F C   1 
ATOM   5292  O O   . PRO F 1 34  ? 5.415   -26.475  -69.291 1.00 161.54 ? 113 PRO F O   1 
ATOM   5293  C CB  . PRO F 1 34  ? 4.109   -29.041  -68.306 1.00 160.56 ? 113 PRO F CB  1 
ATOM   5294  C CG  . PRO F 1 34  ? 3.256   -29.925  -69.132 1.00 165.24 ? 113 PRO F CG  1 
ATOM   5295  C CD  . PRO F 1 34  ? 1.871   -29.339  -69.139 1.00 165.68 ? 113 PRO F CD  1 
ATOM   5296  N N   . GLY F 1 35  ? 3.607   -26.494  -70.635 1.00 160.95 ? 114 GLY F N   1 
ATOM   5297  C CA  . GLY F 1 35  ? 4.087   -25.439  -71.524 1.00 165.37 ? 114 GLY F CA  1 
ATOM   5298  C C   . GLY F 1 35  ? 3.982   -24.034  -70.938 1.00 165.93 ? 114 GLY F C   1 
ATOM   5299  O O   . GLY F 1 35  ? 4.576   -23.094  -71.485 1.00 161.49 ? 114 GLY F O   1 
ATOM   5300  N N   . LEU F 1 36  ? 3.199   -23.887  -69.858 1.00 166.30 ? 115 LEU F N   1 
ATOM   5301  C CA  . LEU F 1 36  ? 3.125   -22.643  -69.083 1.00 162.91 ? 115 LEU F CA  1 
ATOM   5302  C C   . LEU F 1 36  ? 4.267   -22.519  -68.060 1.00 162.89 ? 115 LEU F C   1 
ATOM   5303  O O   . LEU F 1 36  ? 4.648   -23.495  -67.398 1.00 155.10 ? 115 LEU F O   1 
ATOM   5304  C CB  . LEU F 1 36  ? 1.791   -22.548  -68.342 1.00 153.09 ? 115 LEU F CB  1 
ATOM   5305  N N   . ALA F 1 37  ? 4.782   -21.298  -67.932 1.00 169.29 ? 116 ALA F N   1 
ATOM   5306  C CA  . ALA F 1 37  ? 5.896   -20.992  -67.041 1.00 168.62 ? 116 ALA F CA  1 
ATOM   5307  C C   . ALA F 1 37  ? 5.493   -21.141  -65.579 1.00 167.90 ? 116 ALA F C   1 
ATOM   5308  O O   . ALA F 1 37  ? 4.520   -20.532  -65.134 1.00 168.37 ? 116 ALA F O   1 
ATOM   5309  C CB  . ALA F 1 37  ? 6.404   -19.577  -67.297 1.00 168.53 ? 116 ALA F CB  1 
ATOM   5310  N N   . GLY F 1 38  ? 6.247   -21.956  -64.845 1.00 168.26 ? 117 GLY F N   1 
ATOM   5311  C CA  . GLY F 1 38  ? 5.956   -22.250  -63.445 1.00 164.50 ? 117 GLY F CA  1 
ATOM   5312  C C   . GLY F 1 38  ? 5.310   -23.609  -63.276 1.00 163.18 ? 117 GLY F C   1 
ATOM   5313  O O   . GLY F 1 38  ? 5.632   -24.331  -62.338 1.00 159.01 ? 117 GLY F O   1 
ATOM   5314  N N   . VAL F 1 39  ? 4.420   -23.960  -64.200 1.00 163.59 ? 118 VAL F N   1 
ATOM   5315  C CA  . VAL F 1 39  ? 3.661   -25.200  -64.120 1.00 164.51 ? 118 VAL F CA  1 
ATOM   5316  C C   . VAL F 1 39  ? 4.522   -26.394  -64.511 1.00 167.31 ? 118 VAL F C   1 
ATOM   5317  O O   . VAL F 1 39  ? 5.299   -26.324  -65.459 1.00 176.37 ? 118 VAL F O   1 
ATOM   5318  C CB  . VAL F 1 39  ? 2.407   -25.169  -65.019 1.00 166.50 ? 118 VAL F CB  1 
ATOM   5319  C CG1 . VAL F 1 39  ? 1.653   -26.492  -64.945 1.00 164.97 ? 118 VAL F CG1 1 
ATOM   5320  C CG2 . VAL F 1 39  ? 1.497   -24.012  -64.616 1.00 172.28 ? 118 VAL F CG2 1 
ATOM   5321  N N   . SER F 1 40  ? 4.368   -27.485  -63.764 1.00 164.23 ? 119 SER F N   1 
ATOM   5322  C CA  . SER F 1 40  ? 5.019   -28.754  -64.080 1.00 162.86 ? 119 SER F CA  1 
ATOM   5323  C C   . SER F 1 40  ? 4.271   -29.914  -63.425 1.00 162.53 ? 119 SER F C   1 
ATOM   5324  O O   . SER F 1 40  ? 4.064   -29.905  -62.213 1.00 166.84 ? 119 SER F O   1 
ATOM   5325  C CB  . SER F 1 40  ? 6.494   -28.731  -63.654 1.00 164.10 ? 119 SER F CB  1 
ATOM   5326  O OG  . SER F 1 40  ? 6.705   -27.916  -62.509 1.00 162.76 ? 119 SER F OG  1 
ATOM   5327  N N   . LEU F 1 41  ? 3.824   -30.863  -64.251 1.00 161.89 ? 120 LEU F N   1 
ATOM   5328  C CA  . LEU F 1 41  ? 3.287   -32.155  -63.802 1.00 160.03 ? 120 LEU F CA  1 
ATOM   5329  C C   . LEU F 1 41  ? 4.194   -33.248  -64.336 1.00 163.10 ? 120 LEU F C   1 
ATOM   5330  O O   . LEU F 1 41  ? 4.746   -33.097  -65.432 1.00 175.81 ? 120 LEU F O   1 
ATOM   5331  C CB  . LEU F 1 41  ? 1.867   -32.382  -64.325 1.00 153.12 ? 120 LEU F CB  1 
ATOM   5332  N N   . THR F 1 42  ? 4.376   -34.318  -63.562 1.00 162.48 ? 121 THR F N   1 
ATOM   5333  C CA  . THR F 1 42  ? 5.149   -35.501  -63.983 1.00 166.10 ? 121 THR F CA  1 
ATOM   5334  C C   . THR F 1 42  ? 4.494   -36.756  -63.432 1.00 165.10 ? 121 THR F C   1 
ATOM   5335  O O   . THR F 1 42  ? 3.486   -36.667  -62.748 1.00 167.74 ? 121 THR F O   1 
ATOM   5336  C CB  . THR F 1 42  ? 6.631   -35.462  -63.500 1.00 168.89 ? 121 THR F CB  1 
ATOM   5337  O OG1 . THR F 1 42  ? 6.689   -35.573  -62.071 1.00 164.35 ? 121 THR F OG1 1 
ATOM   5338  C CG2 . THR F 1 42  ? 7.341   -34.192  -63.958 1.00 169.91 ? 121 THR F CG2 1 
ATOM   5339  N N   . GLY F 1 43  ? 5.069   -37.917  -63.742 1.00 165.70 ? 122 GLY F N   1 
ATOM   5340  C CA  . GLY F 1 43  ? 4.679   -39.199  -63.134 1.00 167.91 ? 122 GLY F CA  1 
ATOM   5341  C C   . GLY F 1 43  ? 3.187   -39.451  -63.141 1.00 171.30 ? 122 GLY F C   1 
ATOM   5342  O O   . GLY F 1 43  ? 2.482   -39.035  -64.063 1.00 172.35 ? 122 GLY F O   1 
ATOM   5343  N N   . GLY F 1 44  ? 2.703   -40.118  -62.097 1.00 175.13 ? 123 GLY F N   1 
ATOM   5344  C CA  . GLY F 1 44  ? 1.274   -40.348  -61.911 1.00 177.96 ? 123 GLY F CA  1 
ATOM   5345  C C   . GLY F 1 44  ? 0.638   -39.214  -61.130 1.00 175.10 ? 123 GLY F C   1 
ATOM   5346  O O   . GLY F 1 44  ? 0.167   -39.413  -60.005 1.00 180.08 ? 123 GLY F O   1 
ATOM   5347  N N   . LEU F 1 45  ? 0.644   -38.022  -61.724 1.00 167.38 ? 124 LEU F N   1 
ATOM   5348  C CA  . LEU F 1 45  ? 0.024   -36.834  -61.143 1.00 161.55 ? 124 LEU F CA  1 
ATOM   5349  C C   . LEU F 1 45  ? -0.739  -36.120  -62.251 1.00 163.15 ? 124 LEU F C   1 
ATOM   5350  O O   . LEU F 1 45  ? -0.233  -35.965  -63.366 1.00 168.81 ? 124 LEU F O   1 
ATOM   5351  C CB  . LEU F 1 45  ? 1.074   -35.907  -60.533 1.00 157.00 ? 124 LEU F CB  1 
ATOM   5352  C CG  . LEU F 1 45  ? 1.688   -36.363  -59.208 1.00 154.57 ? 124 LEU F CG  1 
ATOM   5353  C CD1 . LEU F 1 45  ? 3.076   -35.755  -59.004 1.00 156.23 ? 124 LEU F CD1 1 
ATOM   5354  C CD2 . LEU F 1 45  ? 0.780   -36.007  -58.038 1.00 153.94 ? 124 LEU F CD2 1 
ATOM   5355  N N   . SER F 1 46  ? -1.952  -35.680  -61.932 1.00 160.30 ? 125 SER F N   1 
ATOM   5356  C CA  . SER F 1 46  ? -2.871  -35.155  -62.936 1.00 162.41 ? 125 SER F CA  1 
ATOM   5357  C C   . SER F 1 46  ? -3.891  -34.197  -62.333 1.00 154.85 ? 125 SER F C   1 
ATOM   5358  O O   . SER F 1 46  ? -4.280  -34.348  -61.174 1.00 146.39 ? 125 SER F O   1 
ATOM   5359  C CB  . SER F 1 46  ? -3.596  -36.322  -63.604 1.00 174.82 ? 125 SER F CB  1 
ATOM   5360  O OG  . SER F 1 46  ? -4.141  -37.190  -62.621 1.00 179.96 ? 125 SER F OG  1 
ATOM   5361  N N   . TYR F 1 47  ? -4.327  -33.234  -63.141 1.00 156.79 ? 126 TYR F N   1 
ATOM   5362  C CA  . TYR F 1 47  ? -5.288  -32.221  -62.716 1.00 162.71 ? 126 TYR F CA  1 
ATOM   5363  C C   . TYR F 1 47  ? -6.649  -32.445  -63.399 1.00 172.86 ? 126 TYR F C   1 
ATOM   5364  O O   . TYR F 1 47  ? -6.729  -32.496  -64.629 1.00 184.19 ? 126 TYR F O   1 
ATOM   5365  C CB  . TYR F 1 47  ? -4.739  -30.823  -63.030 1.00 159.43 ? 126 TYR F CB  1 
ATOM   5366  C CG  . TYR F 1 47  ? -5.681  -29.707  -62.639 1.00 159.20 ? 126 TYR F CG  1 
ATOM   5367  C CD1 . TYR F 1 47  ? -6.203  -28.844  -63.601 1.00 162.55 ? 126 TYR F CD1 1 
ATOM   5368  C CD2 . TYR F 1 47  ? -6.077  -29.526  -61.312 1.00 157.60 ? 126 TYR F CD2 1 
ATOM   5369  C CE1 . TYR F 1 47  ? -7.074  -27.830  -63.255 1.00 165.09 ? 126 TYR F CE1 1 
ATOM   5370  C CE2 . TYR F 1 47  ? -6.951  -28.513  -60.956 1.00 157.37 ? 126 TYR F CE2 1 
ATOM   5371  C CZ  . TYR F 1 47  ? -7.452  -27.665  -61.932 1.00 161.88 ? 126 TYR F CZ  1 
ATOM   5372  O OH  . TYR F 1 47  ? -8.326  -26.653  -61.599 1.00 158.27 ? 126 TYR F OH  1 
ATOM   5373  N N   . LYS F 1 48  ? -7.703  -32.585  -62.589 1.00 174.14 ? 127 LYS F N   1 
ATOM   5374  C CA  . LYS F 1 48  ? -9.083  -32.691  -63.078 1.00 173.43 ? 127 LYS F CA  1 
ATOM   5375  C C   . LYS F 1 48  ? -9.716  -31.294  -63.165 1.00 171.38 ? 127 LYS F C   1 
ATOM   5376  O O   . LYS F 1 48  ? -10.133 -30.733  -62.151 1.00 168.79 ? 127 LYS F O   1 
ATOM   5377  C CB  . LYS F 1 48  ? -9.911  -33.589  -62.151 1.00 171.61 ? 127 LYS F CB  1 
ATOM   5378  N N   . GLU F 1 49  ? -9.790  -30.739  -64.378 1.00 171.92 ? 128 GLU F N   1 
ATOM   5379  C CA  . GLU F 1 49  ? -10.329 -29.387  -64.604 1.00 172.46 ? 128 GLU F CA  1 
ATOM   5380  C C   . GLU F 1 49  ? -11.759 -29.163  -64.074 1.00 178.77 ? 128 GLU F C   1 
ATOM   5381  O O   . GLU F 1 49  ? -12.089 -28.051  -63.665 1.00 179.50 ? 128 GLU F O   1 
ATOM   5382  C CB  . GLU F 1 49  ? -10.282 -29.030  -66.099 1.00 169.34 ? 128 GLU F CB  1 
ATOM   5383  N N   . ASP F 1 50  ? -12.594 -30.206  -64.086 1.00 183.28 ? 129 ASP F N   1 
ATOM   5384  C CA  . ASP F 1 50  ? -13.994 -30.088  -63.637 1.00 186.92 ? 129 ASP F CA  1 
ATOM   5385  C C   . ASP F 1 50  ? -14.131 -29.915  -62.120 1.00 182.41 ? 129 ASP F C   1 
ATOM   5386  O O   . ASP F 1 50  ? -14.850 -29.023  -61.662 1.00 181.30 ? 129 ASP F O   1 
ATOM   5387  C CB  . ASP F 1 50  ? -14.877 -31.252  -64.148 1.00 198.25 ? 129 ASP F CB  1 
ATOM   5388  C CG  . ASP F 1 50  ? -14.395 -32.640  -63.701 1.00 201.96 ? 129 ASP F CG  1 
ATOM   5389  O OD1 . ASP F 1 50  ? -13.170 -32.899  -63.754 1.00 201.70 ? 129 ASP F OD1 1 
ATOM   5390  O OD2 . ASP F 1 50  ? -15.253 -33.476  -63.326 1.00 205.65 ? 129 ASP F OD2 1 
ATOM   5391  N N   . THR F 1 51  ? -13.424 -30.744  -61.358 1.00 180.69 ? 130 THR F N   1 
ATOM   5392  C CA  . THR F 1 51  ? -13.482 -30.724  -59.889 1.00 177.95 ? 130 THR F CA  1 
ATOM   5393  C C   . THR F 1 51  ? -12.443 -29.793  -59.239 1.00 172.16 ? 130 THR F C   1 
ATOM   5394  O O   . THR F 1 51  ? -12.525 -29.513  -58.039 1.00 169.02 ? 130 THR F O   1 
ATOM   5395  C CB  . THR F 1 51  ? -13.295 -32.148  -59.328 1.00 179.38 ? 130 THR F CB  1 
ATOM   5396  O OG1 . THR F 1 51  ? -12.179 -32.776  -59.978 1.00 184.62 ? 130 THR F OG1 1 
ATOM   5397  C CG2 . THR F 1 51  ? -14.548 -32.976  -59.565 1.00 181.05 ? 130 THR F CG2 1 
ATOM   5398  N N   . LYS F 1 52  ? -11.480 -29.320  -60.038 1.00 172.06 ? 131 LYS F N   1 
ATOM   5399  C CA  . LYS F 1 52  ? -10.394 -28.448  -59.585 1.00 167.77 ? 131 LYS F CA  1 
ATOM   5400  C C   . LYS F 1 52  ? -9.489  -29.158  -58.572 1.00 163.11 ? 131 LYS F C   1 
ATOM   5401  O O   . LYS F 1 52  ? -9.123  -28.592  -57.543 1.00 161.52 ? 131 LYS F O   1 
ATOM   5402  C CB  . LYS F 1 52  ? -10.942 -27.124  -59.027 1.00 170.71 ? 131 LYS F CB  1 
ATOM   5403  C CG  . LYS F 1 52  ? -12.015 -26.448  -59.863 1.00 173.93 ? 131 LYS F CG  1 
ATOM   5404  C CD  . LYS F 1 52  ? -12.353 -25.074  -59.326 1.00 173.65 ? 131 LYS F CD  1 
ATOM   5405  C CE  . LYS F 1 52  ? -13.772 -24.647  -59.670 1.00 180.16 ? 131 LYS F CE  1 
ATOM   5406  N NZ  . LYS F 1 52  ? -14.080 -24.719  -61.127 1.00 184.92 ? 131 LYS F NZ  1 
ATOM   5407  N N   . GLU F 1 53  ? -9.112  -30.392  -58.896 1.00 164.51 ? 132 GLU F N   1 
ATOM   5408  C CA  . GLU F 1 53  ? -8.379  -31.256  -57.980 1.00 166.45 ? 132 GLU F CA  1 
ATOM   5409  C C   . GLU F 1 53  ? -7.126  -31.826  -58.632 1.00 160.07 ? 132 GLU F C   1 
ATOM   5410  O O   . GLU F 1 53  ? -7.153  -32.211  -59.800 1.00 157.95 ? 132 GLU F O   1 
ATOM   5411  C CB  . GLU F 1 53  ? -9.280  -32.409  -57.521 1.00 173.20 ? 132 GLU F CB  1 
ATOM   5412  C CG  . GLU F 1 53  ? -10.506 -31.976  -56.727 1.00 176.17 ? 132 GLU F CG  1 
ATOM   5413  C CD  . GLU F 1 53  ? -11.307 -33.151  -56.174 1.00 183.33 ? 132 GLU F CD  1 
ATOM   5414  O OE1 . GLU F 1 53  ? -11.706 -34.040  -56.968 1.00 187.14 ? 132 GLU F OE1 1 
ATOM   5415  O OE2 . GLU F 1 53  ? -11.551 -33.173  -54.938 1.00 189.04 ? 132 GLU F OE2 1 
ATOM   5416  N N   . LEU F 1 54  ? -6.036  -31.868  -57.868 1.00 154.32 ? 133 LEU F N   1 
ATOM   5417  C CA  . LEU F 1 54  ? -4.831  -32.602  -58.247 1.00 154.66 ? 133 LEU F CA  1 
ATOM   5418  C C   . LEU F 1 54  ? -5.042  -34.042  -57.810 1.00 156.53 ? 133 LEU F C   1 
ATOM   5419  O O   . LEU F 1 54  ? -5.513  -34.273  -56.699 1.00 153.13 ? 133 LEU F O   1 
ATOM   5420  C CB  . LEU F 1 54  ? -3.595  -32.017  -57.550 1.00 146.55 ? 133 LEU F CB  1 
ATOM   5421  N N   . VAL F 1 55  ? -4.690  -35.002  -58.668 1.00 163.53 ? 134 VAL F N   1 
ATOM   5422  C CA  . VAL F 1 55  ? -4.917  -36.431  -58.398 1.00 166.09 ? 134 VAL F CA  1 
ATOM   5423  C C   . VAL F 1 55  ? -3.603  -37.206  -58.387 1.00 167.70 ? 134 VAL F C   1 
ATOM   5424  O O   . VAL F 1 55  ? -2.904  -37.262  -59.405 1.00 170.85 ? 134 VAL F O   1 
ATOM   5425  C CB  . VAL F 1 55  ? -5.856  -37.061  -59.442 1.00 169.28 ? 134 VAL F CB  1 
ATOM   5426  C CG1 . VAL F 1 55  ? -6.354  -38.420  -58.953 1.00 171.57 ? 134 VAL F CG1 1 
ATOM   5427  C CG2 . VAL F 1 55  ? -7.024  -36.122  -59.741 1.00 172.44 ? 134 VAL F CG2 1 
ATOM   5428  N N   . VAL F 1 56  ? -3.291  -37.818  -57.241 1.00 164.93 ? 135 VAL F N   1 
ATOM   5429  C CA  . VAL F 1 56  ? -2.029  -38.537  -57.042 1.00 165.15 ? 135 VAL F CA  1 
ATOM   5430  C C   . VAL F 1 56  ? -2.222  -40.021  -57.319 1.00 168.43 ? 135 VAL F C   1 
ATOM   5431  O O   . VAL F 1 56  ? -3.078  -40.654  -56.697 1.00 174.08 ? 135 VAL F O   1 
ATOM   5432  C CB  . VAL F 1 56  ? -1.527  -38.386  -55.593 1.00 165.21 ? 135 VAL F CB  1 
ATOM   5433  C CG1 . VAL F 1 56  ? -0.135  -38.994  -55.440 1.00 167.55 ? 135 VAL F CG1 1 
ATOM   5434  C CG2 . VAL F 1 56  ? -1.528  -36.921  -55.176 1.00 163.67 ? 135 VAL F CG2 1 
ATOM   5435  N N   . ALA F 1 57  ? -1.417  -40.580  -58.223 1.00 170.30 ? 136 ALA F N   1 
ATOM   5436  C CA  . ALA F 1 57  ? -1.539  -41.996  -58.587 1.00 176.03 ? 136 ALA F CA  1 
ATOM   5437  C C   . ALA F 1 57  ? -0.807  -42.889  -57.583 1.00 180.05 ? 136 ALA F C   1 
ATOM   5438  O O   . ALA F 1 57  ? -1.445  -43.639  -56.832 1.00 178.88 ? 136 ALA F O   1 
ATOM   5439  C CB  . ALA F 1 57  ? -1.029  -42.238  -60.001 1.00 175.45 ? 136 ALA F CB  1 
ATOM   5440  N N   . LYS F 1 58  ? 0.524   -42.789  -57.562 1.00 182.11 ? 137 LYS F N   1 
ATOM   5441  C CA  . LYS F 1 58  ? 1.354   -43.624  -56.703 1.00 181.74 ? 137 LYS F CA  1 
ATOM   5442  C C   . LYS F 1 58  ? 1.318   -43.057  -55.288 1.00 177.51 ? 137 LYS F C   1 
ATOM   5443  O O   . LYS F 1 58  ? 1.588   -41.877  -55.090 1.00 178.12 ? 137 LYS F O   1 
ATOM   5444  C CB  . LYS F 1 58  ? 2.796   -43.662  -57.219 1.00 179.37 ? 137 LYS F CB  1 
ATOM   5445  N N   . ALA F 1 59  ? 0.978   -43.899  -54.315 1.00 172.85 ? 138 ALA F N   1 
ATOM   5446  C CA  . ALA F 1 59  ? 0.961   -43.495  -52.908 1.00 165.48 ? 138 ALA F CA  1 
ATOM   5447  C C   . ALA F 1 59  ? 2.376   -43.272  -52.365 1.00 160.47 ? 138 ALA F C   1 
ATOM   5448  O O   . ALA F 1 59  ? 3.379   -43.543  -53.047 1.00 154.28 ? 138 ALA F O   1 
ATOM   5449  C CB  . ALA F 1 59  ? 0.240   -44.538  -52.064 1.00 169.43 ? 138 ALA F CB  1 
ATOM   5450  N N   . GLY F 1 60  ? 2.438   -42.762  -51.137 1.00 159.81 ? 139 GLY F N   1 
ATOM   5451  C CA  . GLY F 1 60  ? 3.706   -42.487  -50.453 1.00 159.77 ? 139 GLY F CA  1 
ATOM   5452  C C   . GLY F 1 60  ? 3.651   -41.238  -49.596 1.00 152.81 ? 139 GLY F C   1 
ATOM   5453  O O   . GLY F 1 60  ? 2.567   -40.724  -49.300 1.00 156.29 ? 139 GLY F O   1 
ATOM   5454  N N   . VAL F 1 61  ? 4.831   -40.772  -49.188 1.00 145.90 ? 140 VAL F N   1 
ATOM   5455  C CA  . VAL F 1 61  ? 4.951   -39.529  -48.438 1.00 145.17 ? 140 VAL F CA  1 
ATOM   5456  C C   . VAL F 1 61  ? 5.551   -38.460  -49.351 1.00 144.73 ? 140 VAL F C   1 
ATOM   5457  O O   . VAL F 1 61  ? 6.538   -38.708  -50.039 1.00 149.65 ? 140 VAL F O   1 
ATOM   5458  C CB  . VAL F 1 61  ? 5.794   -39.726  -47.161 1.00 147.90 ? 140 VAL F CB  1 
ATOM   5459  C CG1 . VAL F 1 61  ? 6.122   -38.395  -46.507 1.00 149.39 ? 140 VAL F CG1 1 
ATOM   5460  C CG2 . VAL F 1 61  ? 5.054   -40.629  -46.180 1.00 150.11 ? 140 VAL F CG2 1 
ATOM   5461  N N   . TYR F 1 62  ? 4.940   -37.278  -49.339 1.00 141.93 ? 141 TYR F N   1 
ATOM   5462  C CA  . TYR F 1 62  ? 5.353   -36.149  -50.171 1.00 138.63 ? 141 TYR F CA  1 
ATOM   5463  C C   . TYR F 1 62  ? 5.563   -34.912  -49.312 1.00 134.61 ? 141 TYR F C   1 
ATOM   5464  O O   . TYR F 1 62  ? 4.868   -34.729  -48.316 1.00 134.72 ? 141 TYR F O   1 
ATOM   5465  C CB  . TYR F 1 62  ? 4.262   -35.822  -51.183 1.00 138.80 ? 141 TYR F CB  1 
ATOM   5466  C CG  . TYR F 1 62  ? 3.982   -36.903  -52.191 1.00 140.42 ? 141 TYR F CG  1 
ATOM   5467  C CD1 . TYR F 1 62  ? 3.316   -38.078  -51.827 1.00 139.93 ? 141 TYR F CD1 1 
ATOM   5468  C CD2 . TYR F 1 62  ? 4.349   -36.740  -53.523 1.00 142.17 ? 141 TYR F CD2 1 
ATOM   5469  C CE1 . TYR F 1 62  ? 3.050   -39.066  -52.761 1.00 143.73 ? 141 TYR F CE1 1 
ATOM   5470  C CE2 . TYR F 1 62  ? 4.086   -37.719  -54.463 1.00 147.06 ? 141 TYR F CE2 1 
ATOM   5471  C CZ  . TYR F 1 62  ? 3.438   -38.880  -54.081 1.00 148.76 ? 141 TYR F CZ  1 
ATOM   5472  O OH  . TYR F 1 62  ? 3.184   -39.842  -55.030 1.00 156.93 ? 141 TYR F OH  1 
ATOM   5473  N N   . TYR F 1 63  ? 6.516   -34.070  -49.705 1.00 131.82 ? 142 TYR F N   1 
ATOM   5474  C CA  . TYR F 1 63  ? 6.631   -32.717  -49.167 1.00 129.31 ? 142 TYR F CA  1 
ATOM   5475  C C   . TYR F 1 63  ? 5.705   -31.869  -50.017 1.00 126.12 ? 142 TYR F C   1 
ATOM   5476  O O   . TYR F 1 63  ? 5.952   -31.702  -51.204 1.00 125.11 ? 142 TYR F O   1 
ATOM   5477  C CB  . TYR F 1 63  ? 8.068   -32.193  -49.249 1.00 130.30 ? 142 TYR F CB  1 
ATOM   5478  C CG  . TYR F 1 63  ? 8.264   -30.788  -48.711 1.00 131.10 ? 142 TYR F CG  1 
ATOM   5479  C CD1 . TYR F 1 63  ? 8.278   -30.529  -47.333 1.00 134.92 ? 142 TYR F CD1 1 
ATOM   5480  C CD2 . TYR F 1 63  ? 8.451   -29.712  -49.578 1.00 130.30 ? 142 TYR F CD2 1 
ATOM   5481  C CE1 . TYR F 1 63  ? 8.447   -29.233  -46.847 1.00 135.56 ? 142 TYR F CE1 1 
ATOM   5482  C CE2 . TYR F 1 63  ? 8.636   -28.421  -49.088 1.00 130.09 ? 142 TYR F CE2 1 
ATOM   5483  C CZ  . TYR F 1 63  ? 8.630   -28.183  -47.736 1.00 131.16 ? 142 TYR F CZ  1 
ATOM   5484  O OH  . TYR F 1 63  ? 8.805   -26.889  -47.288 1.00 131.03 ? 142 TYR F OH  1 
ATOM   5485  N N   . VAL F 1 64  ? 4.633   -31.386  -49.407 1.00 123.70 ? 143 VAL F N   1 
ATOM   5486  C CA  . VAL F 1 64  ? 3.634   -30.574  -50.080 1.00 121.09 ? 143 VAL F CA  1 
ATOM   5487  C C   . VAL F 1 64  ? 3.736   -29.175  -49.518 1.00 113.29 ? 143 VAL F C   1 
ATOM   5488  O O   . VAL F 1 64  ? 3.794   -29.006  -48.307 1.00 107.47 ? 143 VAL F O   1 
ATOM   5489  C CB  . VAL F 1 64  ? 2.218   -31.117  -49.805 1.00 125.24 ? 143 VAL F CB  1 
ATOM   5490  C CG1 . VAL F 1 64  ? 1.177   -30.349  -50.605 1.00 123.46 ? 143 VAL F CG1 1 
ATOM   5491  C CG2 . VAL F 1 64  ? 2.164   -32.603  -50.120 1.00 127.71 ? 143 VAL F CG2 1 
ATOM   5492  N N   . PHE F 1 65  ? 3.754   -28.183  -50.398 1.00 110.08 ? 144 PHE F N   1 
ATOM   5493  C CA  . PHE F 1 65  ? 3.880   -26.785  -49.986 1.00 113.12 ? 144 PHE F CA  1 
ATOM   5494  C C   . PHE F 1 65  ? 2.962   -25.906  -50.811 1.00 112.68 ? 144 PHE F C   1 
ATOM   5495  O O   . PHE F 1 65  ? 2.789   -26.135  -52.014 1.00 110.01 ? 144 PHE F O   1 
ATOM   5496  C CB  . PHE F 1 65  ? 5.327   -26.294  -50.143 1.00 114.23 ? 144 PHE F CB  1 
ATOM   5497  C CG  . PHE F 1 65  ? 5.830   -26.352  -51.560 1.00 114.31 ? 144 PHE F CG  1 
ATOM   5498  C CD1 . PHE F 1 65  ? 5.727   -25.254  -52.392 1.00 114.79 ? 144 PHE F CD1 1 
ATOM   5499  C CD2 . PHE F 1 65  ? 6.373   -27.525  -52.074 1.00 116.22 ? 144 PHE F CD2 1 
ATOM   5500  C CE1 . PHE F 1 65  ? 6.163   -25.318  -53.705 1.00 117.95 ? 144 PHE F CE1 1 
ATOM   5501  C CE2 . PHE F 1 65  ? 6.816   -27.600  -53.374 1.00 118.40 ? 144 PHE F CE2 1 
ATOM   5502  C CZ  . PHE F 1 65  ? 6.716   -26.491  -54.195 1.00 119.43 ? 144 PHE F CZ  1 
ATOM   5503  N N   . PHE F 1 66  ? 2.379   -24.897  -50.175 1.00 112.43 ? 145 PHE F N   1 
ATOM   5504  C CA  . PHE F 1 66  ? 1.765   -23.841  -50.940 1.00 113.37 ? 145 PHE F CA  1 
ATOM   5505  C C   . PHE F 1 66  ? 2.156   -22.441  -50.491 1.00 115.55 ? 145 PHE F C   1 
ATOM   5506  O O   . PHE F 1 66  ? 2.614   -22.216  -49.386 1.00 119.99 ? 145 PHE F O   1 
ATOM   5507  C CB  . PHE F 1 66  ? 0.253   -24.038  -51.176 1.00 116.54 ? 145 PHE F CB  1 
ATOM   5508  C CG  . PHE F 1 66  ? -0.602  -24.166  -49.953 1.00 117.32 ? 145 PHE F CG  1 
ATOM   5509  C CD1 . PHE F 1 66  ? -0.194  -23.769  -48.684 1.00 117.43 ? 145 PHE F CD1 1 
ATOM   5510  C CD2 . PHE F 1 66  ? -1.897  -24.625  -50.115 1.00 119.64 ? 145 PHE F CD2 1 
ATOM   5511  C CE1 . PHE F 1 66  ? -1.039  -23.881  -47.599 1.00 120.82 ? 145 PHE F CE1 1 
ATOM   5512  C CE2 . PHE F 1 66  ? -2.753  -24.735  -49.042 1.00 123.36 ? 145 PHE F CE2 1 
ATOM   5513  C CZ  . PHE F 1 66  ? -2.317  -24.361  -47.774 1.00 125.54 ? 145 PHE F CZ  1 
ATOM   5514  N N   . GLN F 1 67  ? 1.981   -21.517  -51.420 1.00 120.27 ? 146 GLN F N   1 
ATOM   5515  C CA  . GLN F 1 67  ? 2.560   -20.203  -51.414 1.00 119.25 ? 146 GLN F CA  1 
ATOM   5516  C C   . GLN F 1 67  ? 1.374   -19.323  -51.738 1.00 117.70 ? 146 GLN F C   1 
ATOM   5517  O O   . GLN F 1 67  ? 0.527   -19.713  -52.532 1.00 119.09 ? 146 GLN F O   1 
ATOM   5518  C CB  . GLN F 1 67  ? 3.580   -20.186  -52.554 1.00 126.88 ? 146 GLN F CB  1 
ATOM   5519  C CG  . GLN F 1 67  ? 4.680   -19.161  -52.492 1.00 134.49 ? 146 GLN F CG  1 
ATOM   5520  C CD  . GLN F 1 67  ? 5.775   -19.480  -53.524 1.00 144.13 ? 146 GLN F CD  1 
ATOM   5521  O OE1 . GLN F 1 67  ? 6.806   -20.092  -53.218 1.00 150.21 ? 146 GLN F OE1 1 
ATOM   5522  N NE2 . GLN F 1 67  ? 5.538   -19.086  -54.768 1.00 150.19 ? 146 GLN F NE2 1 
ATOM   5523  N N   . LEU F 1 68  ? 1.279   -18.151  -51.133 1.00 119.31 ? 147 LEU F N   1 
ATOM   5524  C CA  . LEU F 1 68  ? 0.147   -17.263  -51.418 1.00 120.40 ? 147 LEU F CA  1 
ATOM   5525  C C   . LEU F 1 68  ? 0.591   -15.812  -51.344 1.00 121.52 ? 147 LEU F C   1 
ATOM   5526  O O   . LEU F 1 68  ? 0.811   -15.303  -50.243 1.00 121.51 ? 147 LEU F O   1 
ATOM   5527  C CB  . LEU F 1 68  ? -0.963  -17.525  -50.400 1.00 120.51 ? 147 LEU F CB  1 
ATOM   5528  C CG  . LEU F 1 68  ? -2.126  -16.528  -50.381 1.00 122.54 ? 147 LEU F CG  1 
ATOM   5529  C CD1 . LEU F 1 68  ? -2.817  -16.543  -51.728 1.00 124.63 ? 147 LEU F CD1 1 
ATOM   5530  C CD2 . LEU F 1 68  ? -3.103  -16.755  -49.247 1.00 122.91 ? 147 LEU F CD2 1 
ATOM   5531  N N   . GLU F 1 69  ? 0.738   -15.137  -52.485 1.00 122.57 ? 148 GLU F N   1 
ATOM   5532  C CA  . GLU F 1 69  ? 1.045   -13.692  -52.502 1.00 122.26 ? 148 GLU F CA  1 
ATOM   5533  C C   . GLU F 1 69  ? -0.204  -12.922  -52.896 1.00 123.35 ? 148 GLU F C   1 
ATOM   5534  O O   . GLU F 1 69  ? -0.991  -13.399  -53.722 1.00 131.27 ? 148 GLU F O   1 
ATOM   5535  C CB  . GLU F 1 69  ? 2.209   -13.356  -53.452 1.00 118.47 ? 148 GLU F CB  1 
ATOM   5536  N N   . LEU F 1 70  ? -0.378  -11.754  -52.291 1.00 122.05 ? 149 LEU F N   1 
ATOM   5537  C CA  . LEU F 1 70  ? -1.528  -10.895  -52.532 1.00 128.14 ? 149 LEU F CA  1 
ATOM   5538  C C   . LEU F 1 70  ? -1.032  -9.475   -52.779 1.00 135.76 ? 149 LEU F C   1 
ATOM   5539  O O   . LEU F 1 70  ? 0.028   -9.097   -52.269 1.00 136.78 ? 149 LEU F O   1 
ATOM   5540  C CB  . LEU F 1 70  ? -2.433  -10.915  -51.306 1.00 127.91 ? 149 LEU F CB  1 
ATOM   5541  C CG  . LEU F 1 70  ? -3.008  -12.297  -50.979 1.00 127.65 ? 149 LEU F CG  1 
ATOM   5542  C CD1 . LEU F 1 70  ? -3.201  -12.485  -49.483 1.00 127.58 ? 149 LEU F CD1 1 
ATOM   5543  C CD2 . LEU F 1 70  ? -4.321  -12.475  -51.707 1.00 133.20 ? 149 LEU F CD2 1 
ATOM   5544  N N   . ARG F 1 71  ? -1.784  -8.697   -53.563 1.00 144.73 ? 150 ARG F N   1 
ATOM   5545  C CA  . ARG F 1 71  ? -1.416  -7.312   -53.890 1.00 147.59 ? 150 ARG F CA  1 
ATOM   5546  C C   . ARG F 1 71  ? -2.586  -6.354   -53.728 1.00 146.25 ? 150 ARG F C   1 
ATOM   5547  O O   . ARG F 1 71  ? -3.687  -6.650   -54.177 1.00 143.67 ? 150 ARG F O   1 
ATOM   5548  C CB  . ARG F 1 71  ? -0.862  -7.208   -55.305 1.00 154.81 ? 150 ARG F CB  1 
ATOM   5549  C CG  . ARG F 1 71  ? -1.642  -7.938   -56.383 1.00 163.77 ? 150 ARG F CG  1 
ATOM   5550  C CD  . ARG F 1 71  ? -0.835  -7.941   -57.682 1.00 171.75 ? 150 ARG F CD  1 
ATOM   5551  N NE  . ARG F 1 71  ? -0.839  -6.635   -58.346 1.00 179.34 ? 150 ARG F NE  1 
ATOM   5552  C CZ  . ARG F 1 71  ? -1.678  -6.259   -59.320 1.00 185.04 ? 150 ARG F CZ  1 
ATOM   5553  N NH1 . ARG F 1 71  ? -2.617  -7.078   -59.797 1.00 187.18 ? 150 ARG F NH1 1 
ATOM   5554  N NH2 . ARG F 1 71  ? -1.572  -5.041   -59.834 1.00 189.83 ? 150 ARG F NH2 1 
ATOM   5555  N N   . ARG F 1 72  ? -2.352  -5.214   -53.073 1.00 147.59 ? 151 ARG F N   1 
ATOM   5556  C CA  . ARG F 1 72  ? -3.368  -4.171   -52.970 1.00 151.10 ? 151 ARG F CA  1 
ATOM   5557  C C   . ARG F 1 72  ? -3.516  -3.527   -54.339 1.00 153.81 ? 151 ARG F C   1 
ATOM   5558  O O   . ARG F 1 72  ? -2.529  -3.062   -54.903 1.00 151.22 ? 151 ARG F O   1 
ATOM   5559  C CB  . ARG F 1 72  ? -2.977  -3.111   -51.945 1.00 157.24 ? 151 ARG F CB  1 
ATOM   5560  C CG  . ARG F 1 72  ? -4.129  -2.187   -51.546 1.00 161.51 ? 151 ARG F CG  1 
ATOM   5561  C CD  . ARG F 1 72  ? -3.643  -0.978   -50.750 1.00 165.60 ? 151 ARG F CD  1 
ATOM   5562  N NE  . ARG F 1 72  ? -2.879  -1.348   -49.553 1.00 168.73 ? 151 ARG F NE  1 
ATOM   5563  C CZ  . ARG F 1 72  ? -3.396  -1.803   -48.406 1.00 171.42 ? 151 ARG F CZ  1 
ATOM   5564  N NH1 . ARG F 1 72  ? -4.707  -2.014   -48.260 1.00 167.71 ? 151 ARG F NH1 1 
ATOM   5565  N NH2 . ARG F 1 72  ? -2.584  -2.075   -47.396 1.00 174.60 ? 151 ARG F NH2 1 
ATOM   5566  N N   . VAL F 1 73  ? -4.739  -3.530   -54.871 1.00 162.45 ? 152 VAL F N   1 
ATOM   5567  C CA  . VAL F 1 73  ? -5.042  -2.970   -56.198 1.00 165.65 ? 152 VAL F CA  1 
ATOM   5568  C C   . VAL F 1 73  ? -5.847  -1.673   -56.148 1.00 165.67 ? 152 VAL F C   1 
ATOM   5569  O O   . VAL F 1 73  ? -5.973  -1.010   -57.165 1.00 170.77 ? 152 VAL F O   1 
ATOM   5570  C CB  . VAL F 1 73  ? -5.788  -3.984   -57.105 1.00 167.35 ? 152 VAL F CB  1 
ATOM   5571  C CG1 . VAL F 1 73  ? -4.916  -5.202   -57.381 1.00 165.91 ? 152 VAL F CG1 1 
ATOM   5572  C CG2 . VAL F 1 73  ? -7.126  -4.407   -56.510 1.00 166.22 ? 152 VAL F CG2 1 
ATOM   5573  N N   . VAL F 1 74  ? -6.420  -1.330   -54.998 1.00 162.36 ? 153 VAL F N   1 
ATOM   5574  C CA  . VAL F 1 74  ? -7.100  -0.057   -54.825 1.00 166.65 ? 153 VAL F CA  1 
ATOM   5575  C C   . VAL F 1 74  ? -6.364  0.695    -53.737 1.00 163.97 ? 153 VAL F C   1 
ATOM   5576  O O   . VAL F 1 74  ? -6.518  0.388    -52.556 1.00 163.74 ? 153 VAL F O   1 
ATOM   5577  C CB  . VAL F 1 74  ? -8.582  -0.241   -54.448 1.00 172.71 ? 153 VAL F CB  1 
ATOM   5578  C CG1 . VAL F 1 74  ? -9.250  1.103    -54.178 1.00 177.59 ? 153 VAL F CG1 1 
ATOM   5579  C CG2 . VAL F 1 74  ? -9.313  -0.984   -55.553 1.00 173.90 ? 153 VAL F CG2 1 
ATOM   5580  N N   . ALA F 1 75  ? -5.559  1.673    -54.144 1.00 166.02 ? 154 ALA F N   1 
ATOM   5581  C CA  . ALA F 1 75  ? -4.736  2.446    -53.213 1.00 166.64 ? 154 ALA F CA  1 
ATOM   5582  C C   . ALA F 1 75  ? -5.574  3.007    -52.070 1.00 169.45 ? 154 ALA F C   1 
ATOM   5583  O O   . ALA F 1 75  ? -6.694  3.486    -52.286 1.00 173.19 ? 154 ALA F O   1 
ATOM   5584  C CB  . ALA F 1 75  ? -4.032  3.583    -53.937 1.00 166.93 ? 154 ALA F CB  1 
ATOM   5585  N N   . GLY F 1 76  ? -5.035  2.911    -50.857 1.00 168.40 ? 155 GLY F N   1 
ATOM   5586  C CA  . GLY F 1 76  ? -5.679  3.489    -49.679 1.00 167.41 ? 155 GLY F CA  1 
ATOM   5587  C C   . GLY F 1 76  ? -6.908  2.760    -49.169 1.00 167.19 ? 155 GLY F C   1 
ATOM   5588  O O   . GLY F 1 76  ? -7.656  3.318    -48.373 1.00 168.34 ? 155 GLY F O   1 
ATOM   5589  N N   . GLU F 1 77  ? -7.122  1.523    -49.604 1.00 166.44 ? 156 GLU F N   1 
ATOM   5590  C CA  . GLU F 1 77  ? -8.314  0.783    -49.233 1.00 166.90 ? 156 GLU F CA  1 
ATOM   5591  C C   . GLU F 1 77  ? -7.983  -0.686   -49.021 1.00 166.61 ? 156 GLU F C   1 
ATOM   5592  O O   . GLU F 1 77  ? -7.005  -1.200   -49.569 1.00 170.49 ? 156 GLU F O   1 
ATOM   5593  C CB  . GLU F 1 77  ? -9.376  0.930    -50.322 1.00 166.90 ? 156 GLU F CB  1 
ATOM   5594  N N   . GLY F 1 78  ? -8.809  -1.350   -48.217 1.00 165.14 ? 157 GLY F N   1 
ATOM   5595  C CA  . GLY F 1 78  ? -8.770  -2.800   -48.083 1.00 163.73 ? 157 GLY F CA  1 
ATOM   5596  C C   . GLY F 1 78  ? -8.003  -3.259   -46.867 1.00 162.84 ? 157 GLY F C   1 
ATOM   5597  O O   . GLY F 1 78  ? -6.885  -2.804   -46.630 1.00 166.66 ? 157 GLY F O   1 
ATOM   5598  N N   . SER F 1 79  ? -8.606  -4.170   -46.112 1.00 160.50 ? 158 SER F N   1 
ATOM   5599  C CA  . SER F 1 79  ? -7.976  -4.749   -44.930 1.00 160.48 ? 158 SER F CA  1 
ATOM   5600  C C   . SER F 1 79  ? -8.607  -6.092   -44.626 1.00 158.33 ? 158 SER F C   1 
ATOM   5601  O O   . SER F 1 79  ? -9.613  -6.453   -45.234 1.00 160.99 ? 158 SER F O   1 
ATOM   5602  C CB  . SER F 1 79  ? -8.149  -3.824   -43.731 1.00 161.37 ? 158 SER F CB  1 
ATOM   5603  O OG  . SER F 1 79  ? -9.528  -3.575   -43.500 1.00 165.32 ? 158 SER F OG  1 
ATOM   5604  N N   . GLY F 1 80  ? -8.012  -6.826   -43.694 1.00 155.95 ? 159 GLY F N   1 
ATOM   5605  C CA  . GLY F 1 80  ? -8.548  -8.117   -43.266 1.00 156.27 ? 159 GLY F CA  1 
ATOM   5606  C C   . GLY F 1 80  ? -7.600  -9.285   -43.443 1.00 153.22 ? 159 GLY F C   1 
ATOM   5607  O O   . GLY F 1 80  ? -6.408  -9.174   -43.150 1.00 157.80 ? 159 GLY F O   1 
ATOM   5608  N N   . SER F 1 81  ? -8.122  -10.406  -43.936 1.00 145.69 ? 160 SER F N   1 
ATOM   5609  C CA  . SER F 1 81  ? -7.382  -11.655  -43.926 1.00 143.18 ? 160 SER F CA  1 
ATOM   5610  C C   . SER F 1 81  ? -7.818  -12.584  -45.052 1.00 137.19 ? 160 SER F C   1 
ATOM   5611  O O   . SER F 1 81  ? -8.956  -12.533  -45.487 1.00 135.88 ? 160 SER F O   1 
ATOM   5612  C CB  . SER F 1 81  ? -7.603  -12.328  -42.575 1.00 147.98 ? 160 SER F CB  1 
ATOM   5613  O OG  . SER F 1 81  ? -7.541  -13.741  -42.686 1.00 156.83 ? 160 SER F OG  1 
ATOM   5614  N N   . VAL F 1 82  ? -6.906  -13.441  -45.502 1.00 136.36 ? 161 VAL F N   1 
ATOM   5615  C CA  . VAL F 1 82  ? -7.146  -14.371  -46.602 1.00 134.80 ? 161 VAL F CA  1 
ATOM   5616  C C   . VAL F 1 82  ? -6.488  -15.685  -46.238 1.00 133.58 ? 161 VAL F C   1 
ATOM   5617  O O   . VAL F 1 82  ? -5.383  -15.688  -45.698 1.00 131.62 ? 161 VAL F O   1 
ATOM   5618  C CB  . VAL F 1 82  ? -6.504  -13.865  -47.904 1.00 132.44 ? 161 VAL F CB  1 
ATOM   5619  C CG1 . VAL F 1 82  ? -6.640  -14.886  -49.045 1.00 133.55 ? 161 VAL F CG1 1 
ATOM   5620  C CG2 . VAL F 1 82  ? -7.092  -12.517  -48.290 1.00 131.38 ? 161 VAL F CG2 1 
ATOM   5621  N N   . SER F 1 83  ? -7.140  -16.797  -46.583 1.00 133.53 ? 162 SER F N   1 
ATOM   5622  C CA  . SER F 1 83  ? -6.728  -18.122  -46.123 1.00 133.31 ? 162 SER F CA  1 
ATOM   5623  C C   . SER F 1 83  ? -6.791  -19.162  -47.221 1.00 128.36 ? 162 SER F C   1 
ATOM   5624  O O   . SER F 1 83  ? -7.794  -19.254  -47.904 1.00 128.03 ? 162 SER F O   1 
ATOM   5625  C CB  . SER F 1 83  ? -7.639  -18.568  -44.977 1.00 138.28 ? 162 SER F CB  1 
ATOM   5626  O OG  . SER F 1 83  ? -8.040  -17.450  -44.191 1.00 145.34 ? 162 SER F OG  1 
ATOM   5627  N N   . LEU F 1 84  ? -5.721  -19.937  -47.387 1.00 128.95 ? 163 LEU F N   1 
ATOM   5628  C CA  . LEU F 1 84  ? -5.775  -21.182  -48.158 1.00 132.33 ? 163 LEU F CA  1 
ATOM   5629  C C   . LEU F 1 84  ? -5.977  -22.362  -47.214 1.00 136.11 ? 163 LEU F C   1 
ATOM   5630  O O   . LEU F 1 84  ? -5.586  -22.324  -46.041 1.00 137.06 ? 163 LEU F O   1 
ATOM   5631  C CB  . LEU F 1 84  ? -4.482  -21.424  -48.935 1.00 128.86 ? 163 LEU F CB  1 
ATOM   5632  C CG  . LEU F 1 84  ? -4.115  -20.451  -50.057 1.00 126.32 ? 163 LEU F CG  1 
ATOM   5633  C CD1 . LEU F 1 84  ? -3.049  -21.101  -50.945 1.00 127.39 ? 163 LEU F CD1 1 
ATOM   5634  C CD2 . LEU F 1 84  ? -5.313  -20.027  -50.891 1.00 124.65 ? 163 LEU F CD2 1 
ATOM   5635  N N   . ALA F 1 85  ? -6.577  -23.422  -47.744 1.00 136.03 ? 164 ALA F N   1 
ATOM   5636  C CA  . ALA F 1 85  ? -6.729  -24.670  -47.011 1.00 137.68 ? 164 ALA F CA  1 
ATOM   5637  C C   . ALA F 1 85  ? -6.676  -25.803  -48.004 1.00 135.35 ? 164 ALA F C   1 
ATOM   5638  O O   . ALA F 1 85  ? -7.452  -25.820  -48.949 1.00 143.16 ? 164 ALA F O   1 
ATOM   5639  C CB  . ALA F 1 85  ? -8.051  -24.683  -46.262 1.00 139.74 ? 164 ALA F CB  1 
ATOM   5640  N N   . LEU F 1 86  ? -5.758  -26.734  -47.785 1.00 130.78 ? 165 LEU F N   1 
ATOM   5641  C CA  . LEU F 1 86  ? -5.654  -27.924  -48.606 1.00 133.55 ? 165 LEU F CA  1 
ATOM   5642  C C   . LEU F 1 86  ? -6.522  -28.979  -47.947 1.00 136.79 ? 165 LEU F C   1 
ATOM   5643  O O   . LEU F 1 86  ? -6.303  -29.322  -46.783 1.00 134.76 ? 165 LEU F O   1 
ATOM   5644  C CB  . LEU F 1 86  ? -4.215  -28.406  -48.657 1.00 133.82 ? 165 LEU F CB  1 
ATOM   5645  C CG  . LEU F 1 86  ? -3.951  -29.603  -49.566 1.00 135.78 ? 165 LEU F CG  1 
ATOM   5646  C CD1 . LEU F 1 86  ? -3.947  -29.170  -51.026 1.00 134.94 ? 165 LEU F CD1 1 
ATOM   5647  C CD2 . LEU F 1 86  ? -2.626  -30.254  -49.190 1.00 136.44 ? 165 LEU F CD2 1 
ATOM   5648  N N   . HIS F 1 87  ? -7.503  -29.482  -48.698 1.00 140.73 ? 166 HIS F N   1 
ATOM   5649  C CA  . HIS F 1 87  ? -8.386  -30.552  -48.251 1.00 145.29 ? 166 HIS F CA  1 
ATOM   5650  C C   . HIS F 1 87  ? -8.142  -31.801  -49.081 1.00 146.88 ? 166 HIS F C   1 
ATOM   5651  O O   . HIS F 1 87  ? -7.976  -31.716  -50.300 1.00 144.50 ? 166 HIS F O   1 
ATOM   5652  C CB  . HIS F 1 87  ? -9.841  -30.110  -48.385 1.00 151.74 ? 166 HIS F CB  1 
ATOM   5653  C CG  . HIS F 1 87  ? -10.223 -29.035  -47.426 1.00 150.14 ? 166 HIS F CG  1 
ATOM   5654  N ND1 . HIS F 1 87  ? -10.079 -29.179  -46.063 1.00 152.61 ? 166 HIS F ND1 1 
ATOM   5655  C CD2 . HIS F 1 87  ? -10.738 -27.800  -47.624 1.00 149.18 ? 166 HIS F CD2 1 
ATOM   5656  C CE1 . HIS F 1 87  ? -10.506 -28.085  -45.459 1.00 154.19 ? 166 HIS F CE1 1 
ATOM   5657  N NE2 . HIS F 1 87  ? -10.924 -27.237  -46.383 1.00 152.46 ? 166 HIS F NE2 1 
ATOM   5658  N N   . LEU F 1 88  ? -8.155  -32.952  -48.415 1.00 152.34 ? 167 LEU F N   1 
ATOM   5659  C CA  . LEU F 1 88  ? -7.972  -34.248  -49.072 1.00 162.36 ? 167 LEU F CA  1 
ATOM   5660  C C   . LEU F 1 88  ? -9.322  -34.929  -49.277 1.00 171.48 ? 167 LEU F C   1 
ATOM   5661  O O   . LEU F 1 88  ? -10.069 -35.114  -48.321 1.00 174.15 ? 167 LEU F O   1 
ATOM   5662  C CB  . LEU F 1 88  ? -7.107  -35.148  -48.201 1.00 163.14 ? 167 LEU F CB  1 
ATOM   5663  C CG  . LEU F 1 88  ? -5.733  -34.622  -47.813 1.00 160.19 ? 167 LEU F CG  1 
ATOM   5664  C CD1 . LEU F 1 88  ? -5.075  -35.589  -46.851 1.00 161.05 ? 167 LEU F CD1 1 
ATOM   5665  C CD2 . LEU F 1 88  ? -4.884  -34.380  -49.049 1.00 161.39 ? 167 LEU F CD2 1 
ATOM   5666  N N   . GLN F 1 89  ? -9.631  -35.296  -50.519 1.00 182.67 ? 168 GLN F N   1 
ATOM   5667  C CA  . GLN F 1 89  ? -10.787 -36.134  -50.825 1.00 199.00 ? 168 GLN F CA  1 
ATOM   5668  C C   . GLN F 1 89  ? -10.249 -37.466  -51.391 1.00 210.84 ? 168 GLN F C   1 
ATOM   5669  O O   . GLN F 1 89  ? -9.452  -37.434  -52.338 1.00 215.05 ? 168 GLN F O   1 
ATOM   5670  C CB  . GLN F 1 89  ? -11.715 -35.431  -51.821 1.00 200.93 ? 168 GLN F CB  1 
ATOM   5671  C CG  . GLN F 1 89  ? -13.043 -36.133  -52.078 1.00 208.68 ? 168 GLN F CG  1 
ATOM   5672  C CD  . GLN F 1 89  ? -14.061 -35.987  -50.952 1.00 211.88 ? 168 GLN F CD  1 
ATOM   5673  O OE1 . GLN F 1 89  ? -13.715 -35.810  -49.781 1.00 214.69 ? 168 GLN F OE1 1 
ATOM   5674  N NE2 . GLN F 1 89  ? -15.333 -36.096  -51.306 1.00 214.12 ? 168 GLN F NE2 1 
ATOM   5675  N N   . PRO F 1 90  ? -10.774 -38.583  -50.885 1.00 223.80 ? 169 PRO F N   1 
ATOM   5676  C CA  . PRO F 1 90  ? -11.829 -38.534  -49.868 1.00 228.41 ? 169 PRO F CA  1 
ATOM   5677  C C   . PRO F 1 90  ? -11.239 -38.059  -48.562 1.00 229.61 ? 169 PRO F C   1 
ATOM   5678  O O   . PRO F 1 90  ? -10.026 -38.151  -48.393 1.00 230.00 ? 169 PRO F O   1 
ATOM   5679  C CB  . PRO F 1 90  ? -12.266 -39.989  -49.746 1.00 232.63 ? 169 PRO F CB  1 
ATOM   5680  C CG  . PRO F 1 90  ? -11.088 -40.774  -50.201 1.00 232.08 ? 169 PRO F CG  1 
ATOM   5681  C CD  . PRO F 1 90  ? -10.461 -39.959  -51.289 1.00 227.99 ? 169 PRO F CD  1 
ATOM   5682  N N   . LEU F 1 91  ? -12.051 -37.543  -47.650 1.00 230.90 ? 170 LEU F N   1 
ATOM   5683  C CA  . LEU F 1 91  ? -11.458 -37.064  -46.417 1.00 233.65 ? 170 LEU F CA  1 
ATOM   5684  C C   . LEU F 1 91  ? -10.958 -38.224  -45.573 1.00 235.62 ? 170 LEU F C   1 
ATOM   5685  O O   . LEU F 1 91  ? -11.695 -39.151  -45.245 1.00 233.61 ? 170 LEU F O   1 
ATOM   5686  C CB  . LEU F 1 91  ? -12.459 -36.240  -45.614 1.00 236.22 ? 170 LEU F CB  1 
ATOM   5687  C CG  . LEU F 1 91  ? -13.227 -37.035  -44.565 1.00 247.42 ? 170 LEU F CG  1 
ATOM   5688  C CD1 . LEU F 1 91  ? -13.994 -36.117  -43.631 1.00 249.50 ? 170 LEU F CD1 1 
ATOM   5689  C CD2 . LEU F 1 91  ? -14.152 -38.028  -45.244 1.00 251.62 ? 170 LEU F CD2 1 
ATOM   5690  N N   . ARG F 1 92  ? -9.674  -38.171  -45.254 1.00 238.17 ? 171 ARG F N   1 
ATOM   5691  C CA  . ARG F 1 92  ? -9.052  -39.172  -44.413 1.00 239.79 ? 171 ARG F CA  1 
ATOM   5692  C C   . ARG F 1 92  ? -9.591  -39.071  -43.001 1.00 243.78 ? 171 ARG F C   1 
ATOM   5693  O O   . ARG F 1 92  ? -9.841  -40.078  -42.347 1.00 247.58 ? 171 ARG F O   1 
ATOM   5694  C CB  . ARG F 1 92  ? -7.536  -38.996  -44.399 1.00 234.58 ? 171 ARG F CB  1 
ATOM   5695  N N   . SER F 1 93  ? -9.766  -37.835  -42.542 1.00 244.19 ? 172 SER F N   1 
ATOM   5696  C CA  . SER F 1 93  ? -10.233 -37.568  -41.167 1.00 243.16 ? 172 SER F CA  1 
ATOM   5697  C C   . SER F 1 93  ? -11.260 -36.426  -41.114 1.00 243.94 ? 172 SER F C   1 
ATOM   5698  O O   . SER F 1 93  ? -11.246 -35.546  -41.981 1.00 249.36 ? 172 SER F O   1 
ATOM   5699  C CB  . SER F 1 93  ? -9.052  -37.252  -40.242 1.00 237.19 ? 172 SER F CB  1 
ATOM   5700  N N   . ALA F 1 94  ? -12.148 -36.469  -40.109 1.00 237.02 ? 173 ALA F N   1 
ATOM   5701  C CA  . ALA F 1 94  ? -13.139 -35.405  -39.817 1.00 225.08 ? 173 ALA F CA  1 
ATOM   5702  C C   . ALA F 1 94  ? -13.912 -34.910  -41.048 1.00 218.42 ? 173 ALA F C   1 
ATOM   5703  O O   . ALA F 1 94  ? -15.093 -34.567  -40.971 1.00 211.26 ? 173 ALA F O   1 
ATOM   5704  C CB  . ALA F 1 94  ? -12.463 -34.236  -39.102 1.00 218.69 ? 173 ALA F CB  1 
ATOM   5705  N N   . ALA F 1 97  ? -10.717 -31.385  -40.779 1.00 197.53 ? 176 ALA F N   1 
ATOM   5706  C CA  . ALA F 1 97  ? -9.364  -30.871  -40.572 1.00 194.03 ? 176 ALA F CA  1 
ATOM   5707  C C   . ALA F 1 97  ? -8.613  -30.707  -41.898 1.00 191.46 ? 176 ALA F C   1 
ATOM   5708  O O   . ALA F 1 97  ? -8.562  -31.638  -42.710 1.00 204.21 ? 176 ALA F O   1 
ATOM   5709  C CB  . ALA F 1 97  ? -8.596  -31.803  -39.647 1.00 193.53 ? 176 ALA F CB  1 
ATOM   5710  N N   . ALA F 1 98  ? -8.003  -29.539  -42.098 1.00 179.22 ? 177 ALA F N   1 
ATOM   5711  C CA  . ALA F 1 98  ? -7.216  -29.269  -43.304 1.00 172.41 ? 177 ALA F CA  1 
ATOM   5712  C C   . ALA F 1 98  ? -5.817  -29.866  -43.178 1.00 159.17 ? 177 ALA F C   1 
ATOM   5713  O O   . ALA F 1 98  ? -5.191  -29.781  -42.119 1.00 153.45 ? 177 ALA F O   1 
ATOM   5714  C CB  . ALA F 1 98  ? -7.125  -27.772  -43.540 1.00 175.93 ? 177 ALA F CB  1 
ATOM   5715  N N   . ALA F 1 99  ? -5.333  -30.453  -44.267 1.00 152.07 ? 178 ALA F N   1 
ATOM   5716  C CA  . ALA F 1 99  ? -4.008  -31.093  -44.302 1.00 152.67 ? 178 ALA F CA  1 
ATOM   5717  C C   . ALA F 1 99  ? -2.884  -30.072  -44.200 1.00 148.76 ? 178 ALA F C   1 
ATOM   5718  O O   . ALA F 1 99  ? -1.883  -30.296  -43.516 1.00 142.69 ? 178 ALA F O   1 
ATOM   5719  C CB  . ALA F 1 99  ? -3.846  -31.895  -45.585 1.00 152.99 ? 178 ALA F CB  1 
ATOM   5720  N N   . LEU F 1 100 ? -3.075  -28.965  -44.909 1.00 150.62 ? 179 LEU F N   1 
ATOM   5721  C CA  . LEU F 1 100 ? -2.158  -27.838  -44.948 1.00 144.51 ? 179 LEU F CA  1 
ATOM   5722  C C   . LEU F 1 100 ? -3.020  -26.577  -44.890 1.00 137.97 ? 179 LEU F C   1 
ATOM   5723  O O   . LEU F 1 100 ? -4.073  -26.517  -45.526 1.00 135.88 ? 179 LEU F O   1 
ATOM   5724  C CB  . LEU F 1 100 ? -1.358  -27.899  -46.252 1.00 143.54 ? 179 LEU F CB  1 
ATOM   5725  C CG  . LEU F 1 100 ? -0.022  -27.178  -46.315 1.00 145.68 ? 179 LEU F CG  1 
ATOM   5726  C CD1 . LEU F 1 100 ? 0.973   -27.810  -45.325 1.00 147.07 ? 179 LEU F CD1 1 
ATOM   5727  C CD2 . LEU F 1 100 ? 0.498   -27.242  -47.763 1.00 145.96 ? 179 LEU F CD2 1 
ATOM   5728  N N   . ALA F 1 101 ? -2.612  -25.580  -44.120 1.00 132.86 ? 180 ALA F N   1 
ATOM   5729  C CA  . ALA F 1 101 ? -3.410  -24.352  -44.016 1.00 131.44 ? 180 ALA F CA  1 
ATOM   5730  C C   . ALA F 1 101 ? -2.561  -23.119  -43.729 1.00 133.28 ? 180 ALA F C   1 
ATOM   5731  O O   . ALA F 1 101 ? -1.528  -23.185  -43.051 1.00 130.57 ? 180 ALA F O   1 
ATOM   5732  C CB  . ALA F 1 101 ? -4.479  -24.511  -42.953 1.00 132.24 ? 180 ALA F CB  1 
ATOM   5733  N N   . LEU F 1 102 ? -3.026  -21.991  -44.252 1.00 132.92 ? 181 LEU F N   1 
ATOM   5734  C CA  . LEU F 1 102 ? -2.246  -20.768  -44.293 1.00 132.09 ? 181 LEU F CA  1 
ATOM   5735  C C   . LEU F 1 102 ? -3.174  -19.594  -44.160 1.00 129.66 ? 181 LEU F C   1 
ATOM   5736  O O   . LEU F 1 102 ? -4.246  -19.592  -44.733 1.00 133.00 ? 181 LEU F O   1 
ATOM   5737  C CB  . LEU F 1 102 ? -1.549  -20.685  -45.651 1.00 132.40 ? 181 LEU F CB  1 
ATOM   5738  C CG  . LEU F 1 102 ? -0.095  -20.223  -45.635 1.00 132.85 ? 181 LEU F CG  1 
ATOM   5739  C CD1 . LEU F 1 102 ? 0.370   -20.083  -47.082 1.00 133.12 ? 181 LEU F CD1 1 
ATOM   5740  C CD2 . LEU F 1 102 ? 0.075   -18.915  -44.857 1.00 137.21 ? 181 LEU F CD2 1 
ATOM   5741  N N   . THR F 1 103 ? -2.774  -18.584  -43.424 1.00 133.65 ? 182 THR F N   1 
ATOM   5742  C CA  . THR F 1 103 ? -3.529  -17.342  -43.396 1.00 137.47 ? 182 THR F CA  1 
ATOM   5743  C C   . THR F 1 103 ? -2.553  -16.189  -43.507 1.00 135.13 ? 182 THR F C   1 
ATOM   5744  O O   . THR F 1 103 ? -1.439  -16.257  -42.979 1.00 139.21 ? 182 THR F O   1 
ATOM   5745  C CB  . THR F 1 103 ? -4.400  -17.246  -42.129 1.00 142.96 ? 182 THR F CB  1 
ATOM   5746  O OG1 . THR F 1 103 ? -5.300  -18.363  -42.097 1.00 147.37 ? 182 THR F OG1 1 
ATOM   5747  C CG2 . THR F 1 103 ? -5.199  -15.955  -42.096 1.00 141.97 ? 182 THR F CG2 1 
ATOM   5748  N N   . VAL F 1 104 ? -2.978  -15.151  -44.221 1.00 128.73 ? 183 VAL F N   1 
ATOM   5749  C CA  . VAL F 1 104 ? -2.147  -14.004  -44.536 1.00 123.17 ? 183 VAL F CA  1 
ATOM   5750  C C   . VAL F 1 104 ? -2.923  -12.761  -44.151 1.00 120.90 ? 183 VAL F C   1 
ATOM   5751  O O   . VAL F 1 104 ? -4.059  -12.594  -44.568 1.00 116.95 ? 183 VAL F O   1 
ATOM   5752  C CB  . VAL F 1 104 ? -1.841  -14.011  -46.041 1.00 123.66 ? 183 VAL F CB  1 
ATOM   5753  C CG1 . VAL F 1 104 ? -1.214  -12.715  -46.479 1.00 126.38 ? 183 VAL F CG1 1 
ATOM   5754  C CG2 . VAL F 1 104 ? -0.930  -15.191  -46.388 1.00 123.69 ? 183 VAL F CG2 1 
ATOM   5755  N N   . ASP F 1 105 ? -2.335  -11.898  -43.337 1.00 125.29 ? 184 ASP F N   1 
ATOM   5756  C CA  . ASP F 1 105 ? -3.002  -10.661  -42.939 1.00 131.51 ? 184 ASP F CA  1 
ATOM   5757  C C   . ASP F 1 105 ? -2.832  -9.646   -44.055 1.00 132.36 ? 184 ASP F C   1 
ATOM   5758  O O   . ASP F 1 105 ? -1.753  -9.544   -44.653 1.00 139.36 ? 184 ASP F O   1 
ATOM   5759  C CB  . ASP F 1 105 ? -2.408  -10.110  -41.638 1.00 134.42 ? 184 ASP F CB  1 
ATOM   5760  N N   . LEU F 1 106 ? -3.908  -8.931   -44.359 1.00 132.45 ? 185 LEU F N   1 
ATOM   5761  C CA  . LEU F 1 106 ? -3.879  -7.810   -45.289 1.00 133.66 ? 185 LEU F CA  1 
ATOM   5762  C C   . LEU F 1 106 ? -3.777  -6.524   -44.461 1.00 133.31 ? 185 LEU F C   1 
ATOM   5763  O O   . LEU F 1 106 ? -4.745  -6.148   -43.782 1.00 137.57 ? 185 LEU F O   1 
ATOM   5764  C CB  . LEU F 1 106 ? -5.140  -7.784   -46.146 1.00 134.31 ? 185 LEU F CB  1 
ATOM   5765  C CG  . LEU F 1 106 ? -5.475  -9.060   -46.901 1.00 139.34 ? 185 LEU F CG  1 
ATOM   5766  C CD1 . LEU F 1 106 ? -6.763  -8.821   -47.668 1.00 142.80 ? 185 LEU F CD1 1 
ATOM   5767  C CD2 . LEU F 1 106 ? -4.355  -9.498   -47.836 1.00 140.54 ? 185 LEU F CD2 1 
ATOM   5768  N N   . PRO F 1 107 ? -2.627  -5.846   -44.501 1.00 127.80 ? 186 PRO F N   1 
ATOM   5769  C CA  . PRO F 1 107 ? -2.467  -4.673   -43.663 1.00 132.62 ? 186 PRO F CA  1 
ATOM   5770  C C   . PRO F 1 107 ? -3.382  -3.516   -44.060 1.00 139.88 ? 186 PRO F C   1 
ATOM   5771  O O   . PRO F 1 107 ? -3.709  -3.369   -45.236 1.00 142.48 ? 186 PRO F O   1 
ATOM   5772  C CB  . PRO F 1 107 ? -1.010  -4.288   -43.870 1.00 132.02 ? 186 PRO F CB  1 
ATOM   5773  C CG  . PRO F 1 107 ? -0.691  -4.779   -45.247 1.00 129.80 ? 186 PRO F CG  1 
ATOM   5774  C CD  . PRO F 1 107 ? -1.478  -6.053   -45.395 1.00 126.76 ? 186 PRO F CD  1 
ATOM   5775  N N   . PRO F 1 108 ? -3.788  -2.684   -43.089 1.00 149.83 ? 187 PRO F N   1 
ATOM   5776  C CA  . PRO F 1 108 ? -4.733  -1.629   -43.392 1.00 153.13 ? 187 PRO F CA  1 
ATOM   5777  C C   . PRO F 1 108 ? -3.992  -0.401   -43.954 1.00 155.26 ? 187 PRO F C   1 
ATOM   5778  O O   . PRO F 1 108 ? -2.977  0.029    -43.394 1.00 158.76 ? 187 PRO F O   1 
ATOM   5779  C CB  . PRO F 1 108 ? -5.343  -1.325   -42.030 1.00 158.74 ? 187 PRO F CB  1 
ATOM   5780  C CG  . PRO F 1 108 ? -4.241  -1.594   -41.059 1.00 159.56 ? 187 PRO F CG  1 
ATOM   5781  C CD  . PRO F 1 108 ? -3.382  -2.677   -41.668 1.00 156.84 ? 187 PRO F CD  1 
ATOM   5782  N N   . ALA F 1 109 ? -4.630  0.191    -44.943 1.00 157.70 ? 188 ALA F N   1 
ATOM   5783  C CA  . ALA F 1 109 ? -4.070  1.216    -45.793 1.00 163.49 ? 188 ALA F CA  1 
ATOM   5784  C C   . ALA F 1 109 ? -3.574  2.473    -45.149 1.00 169.67 ? 188 ALA F C   1 
ATOM   5785  O O   . ALA F 1 109 ? -2.793  3.192    -45.755 1.00 161.86 ? 188 ALA F O   1 
ATOM   5786  C CB  . ALA F 1 109 ? -5.057  1.552    -46.895 1.00 166.77 ? 188 ALA F CB  1 
ATOM   5787  N N   . SER F 1 110 ? -3.991  2.757    -43.927 1.00 185.29 ? 189 SER F N   1 
ATOM   5788  C CA  . SER F 1 110 ? -3.532  3.980    -43.282 1.00 206.46 ? 189 SER F CA  1 
ATOM   5789  C C   . SER F 1 110 ? -2.007  4.016    -43.164 1.00 221.73 ? 189 SER F C   1 
ATOM   5790  O O   . SER F 1 110 ? -1.394  5.044    -43.437 1.00 227.54 ? 189 SER F O   1 
ATOM   5791  C CB  . SER F 1 110 ? -4.157  4.116    -41.898 1.00 210.49 ? 189 SER F CB  1 
ATOM   5792  N N   . SER F 1 111 ? -1.403  2.855    -42.963 1.00 233.59 ? 190 SER F N   1 
ATOM   5793  C CA  . SER F 1 111 ? 0.043   2.780    -42.868 1.00 234.63 ? 190 SER F CA  1 
ATOM   5794  C C   . SER F 1 111 ? 0.623   3.218    -44.196 1.00 231.93 ? 190 SER F C   1 
ATOM   5795  O O   . SER F 1 111 ? 0.023   3.002    -45.246 1.00 224.16 ? 190 SER F O   1 
ATOM   5796  C CB  . SER F 1 111 ? 0.500   1.353    -42.581 1.00 234.03 ? 190 SER F CB  1 
ATOM   5797  O OG  . SER F 1 111 ? 0.666   0.617    -43.783 1.00 233.26 ? 190 SER F OG  1 
ATOM   5798  N N   . GLU F 1 112 ? 1.774   3.871    -44.141 1.00 226.35 ? 191 GLU F N   1 
ATOM   5799  C CA  . GLU F 1 112 ? 2.415   4.315    -45.357 1.00 222.09 ? 191 GLU F CA  1 
ATOM   5800  C C   . GLU F 1 112 ? 3.021   3.163    -46.134 1.00 219.12 ? 191 GLU F C   1 
ATOM   5801  O O   . GLU F 1 112 ? 3.662   2.288    -45.566 1.00 221.96 ? 191 GLU F O   1 
ATOM   5802  C CB  . GLU F 1 112 ? 3.524   5.317    -45.046 1.00 218.81 ? 191 GLU F CB  1 
ATOM   5803  C CG  . GLU F 1 112 ? 3.031   6.651    -44.534 1.00 220.75 ? 191 GLU F CG  1 
ATOM   5804  C CD  . GLU F 1 112 ? 2.468   6.543    -43.141 1.00 223.22 ? 191 GLU F CD  1 
ATOM   5805  O OE1 . GLU F 1 112 ? 2.385   5.408    -42.634 1.00 221.24 ? 191 GLU F OE1 1 
ATOM   5806  O OE2 . GLU F 1 112 ? 2.117   7.588    -42.557 1.00 225.54 ? 191 GLU F OE2 1 
ATOM   5807  N N   . ALA F 1 113 ? 2.756   3.150    -47.432 1.00 211.90 ? 192 ALA F N   1 
ATOM   5808  C CA  . ALA F 1 113 ? 3.348   2.196    -48.366 1.00 200.50 ? 192 ALA F CA  1 
ATOM   5809  C C   . ALA F 1 113 ? 3.260   0.696    -48.094 1.00 192.79 ? 192 ALA F C   1 
ATOM   5810  O O   . ALA F 1 113 ? 4.223   -0.018   -48.343 1.00 197.10 ? 192 ALA F O   1 
ATOM   5811  C CB  . ALA F 1 113 ? 4.792   2.586    -48.655 1.00 198.45 ? 192 ALA F CB  1 
ATOM   5812  N N   . ARG F 1 114 ? 2.137   0.193    -47.610 1.00 180.23 ? 193 ARG F N   1 
ATOM   5813  C CA  . ARG F 1 114 ? 2.051   -1.246   -47.426 1.00 171.81 ? 193 ARG F CA  1 
ATOM   5814  C C   . ARG F 1 114 ? 1.173   -1.713   -48.571 1.00 168.95 ? 193 ARG F C   1 
ATOM   5815  O O   . ARG F 1 114 ? 0.028   -1.290   -48.687 1.00 171.97 ? 193 ARG F O   1 
ATOM   5816  C CB  . ARG F 1 114 ? 1.420   -1.588   -46.084 1.00 164.61 ? 193 ARG F CB  1 
ATOM   5817  N N   . ASN F 1 115 ? 1.680   -2.584   -49.429 1.00 162.75 ? 194 ASN F N   1 
ATOM   5818  C CA  . ASN F 1 115 ? 0.840   -2.989   -50.548 1.00 157.87 ? 194 ASN F CA  1 
ATOM   5819  C C   . ASN F 1 115 ? 0.858   -4.429   -50.985 1.00 152.76 ? 194 ASN F C   1 
ATOM   5820  O O   . ASN F 1 115 ? 0.430   -4.750   -52.082 1.00 157.43 ? 194 ASN F O   1 
ATOM   5821  C CB  . ASN F 1 115 ? 1.122   -2.090   -51.729 1.00 161.81 ? 194 ASN F CB  1 
ATOM   5822  C CG  . ASN F 1 115 ? 0.649   -0.689   -51.485 1.00 166.85 ? 194 ASN F CG  1 
ATOM   5823  O OD1 . ASN F 1 115 ? -0.320  -0.477   -50.758 1.00 162.11 ? 194 ASN F OD1 1 
ATOM   5824  N ND2 . ASN F 1 115 ? 1.329   0.279    -52.078 1.00 175.44 ? 194 ASN F ND2 1 
ATOM   5825  N N   . SER F 1 116 ? 1.365   -5.300   -50.146 1.00 146.23 ? 195 SER F N   1 
ATOM   5826  C CA  . SER F 1 116 ? 1.426   -6.734   -50.521 1.00 141.58 ? 195 SER F CA  1 
ATOM   5827  C C   . SER F 1 116 ? 1.544   -7.639   -49.293 1.00 137.28 ? 195 SER F C   1 
ATOM   5828  O O   . SER F 1 116 ? 1.747   -7.150   -48.163 1.00 140.53 ? 195 SER F O   1 
ATOM   5829  C CB  . SER F 1 116 ? 2.574   -7.017   -51.507 1.00 142.44 ? 195 SER F CB  1 
ATOM   5830  O OG  . SER F 1 116 ? 3.832   -6.913   -50.850 1.00 143.74 ? 195 SER F OG  1 
ATOM   5831  N N   . ALA F 1 117 ? 1.404   -8.952   -49.504 1.00 128.75 ? 196 ALA F N   1 
ATOM   5832  C CA  . ALA F 1 117 ? 1.381   -9.904   -48.402 1.00 121.33 ? 196 ALA F CA  1 
ATOM   5833  C C   . ALA F 1 117 ? 1.665   -11.318  -48.878 1.00 116.12 ? 196 ALA F C   1 
ATOM   5834  O O   . ALA F 1 117 ? 0.937   -11.830  -49.710 1.00 120.66 ? 196 ALA F O   1 
ATOM   5835  C CB  . ALA F 1 117 ? 0.029   -9.841   -47.720 1.00 115.94 ? 196 ALA F CB  1 
ATOM   5836  N N   . PHE F 1 118 ? 2.703   -11.946  -48.329 1.00 117.06 ? 197 PHE F N   1 
ATOM   5837  C CA  . PHE F 1 118 ? 3.130   -13.305  -48.702 1.00 116.98 ? 197 PHE F CA  1 
ATOM   5838  C C   . PHE F 1 118 ? 2.766   -14.268  -47.595 1.00 117.48 ? 197 PHE F C   1 
ATOM   5839  O O   . PHE F 1 118 ? 2.430   -13.862  -46.481 1.00 118.67 ? 197 PHE F O   1 
ATOM   5840  C CB  . PHE F 1 118 ? 4.651   -13.398  -48.950 1.00 116.29 ? 197 PHE F CB  1 
ATOM   5841  N N   . GLY F 1 119 ? 2.856   -15.549  -47.908 1.00 117.88 ? 198 GLY F N   1 
ATOM   5842  C CA  . GLY F 1 119 ? 2.562   -16.612  -46.970 1.00 112.56 ? 198 GLY F CA  1 
ATOM   5843  C C   . GLY F 1 119 ? 3.004   -17.929  -47.584 1.00 108.65 ? 198 GLY F C   1 
ATOM   5844  O O   . GLY F 1 119 ? 2.602   -18.257  -48.703 1.00 110.19 ? 198 GLY F O   1 
ATOM   5845  N N   . PHE F 1 120 ? 3.849   -18.670  -46.880 1.00 109.92 ? 199 PHE F N   1 
ATOM   5846  C CA  . PHE F 1 120 ? 4.324   -19.965  -47.352 1.00 114.23 ? 199 PHE F CA  1 
ATOM   5847  C C   . PHE F 1 120 ? 4.160   -20.986  -46.256 1.00 113.23 ? 199 PHE F C   1 
ATOM   5848  O O   . PHE F 1 120 ? 4.456   -20.703  -45.110 1.00 121.52 ? 199 PHE F O   1 
ATOM   5849  C CB  . PHE F 1 120 ? 5.799   -19.891  -47.725 1.00 117.51 ? 199 PHE F CB  1 
ATOM   5850  C CG  . PHE F 1 120 ? 6.394   -21.210  -48.109 1.00 117.93 ? 199 PHE F CG  1 
ATOM   5851  C CD1 . PHE F 1 120 ? 6.454   -21.592  -49.436 1.00 118.88 ? 199 PHE F CD1 1 
ATOM   5852  C CD2 . PHE F 1 120 ? 6.879   -22.077  -47.143 1.00 120.69 ? 199 PHE F CD2 1 
ATOM   5853  C CE1 . PHE F 1 120 ? 6.980   -22.816  -49.805 1.00 121.69 ? 199 PHE F CE1 1 
ATOM   5854  C CE2 . PHE F 1 120 ? 7.410   -23.307  -47.504 1.00 123.52 ? 199 PHE F CE2 1 
ATOM   5855  C CZ  . PHE F 1 120 ? 7.472   -23.666  -48.842 1.00 122.15 ? 199 PHE F CZ  1 
ATOM   5856  N N   . GLN F 1 121 ? 3.708   -22.173  -46.621 1.00 115.06 ? 200 GLN F N   1 
ATOM   5857  C CA  . GLN F 1 121 ? 3.724   -23.304  -45.723 1.00 121.44 ? 200 GLN F CA  1 
ATOM   5858  C C   . GLN F 1 121 ? 4.027   -24.573  -46.497 1.00 120.64 ? 200 GLN F C   1 
ATOM   5859  O O   . GLN F 1 121 ? 3.668   -24.695  -47.662 1.00 117.91 ? 200 GLN F O   1 
ATOM   5860  C CB  . GLN F 1 121 ? 2.381   -23.435  -45.014 1.00 130.76 ? 200 GLN F CB  1 
ATOM   5861  C CG  . GLN F 1 121 ? 2.378   -24.622  -44.066 1.00 144.10 ? 200 GLN F CG  1 
ATOM   5862  C CD  . GLN F 1 121 ? 1.441   -24.420  -42.879 1.00 155.70 ? 200 GLN F CD  1 
ATOM   5863  O OE1 . GLN F 1 121 ? 0.492   -25.205  -42.669 1.00 160.52 ? 200 GLN F OE1 1 
ATOM   5864  N NE2 . GLN F 1 121 ? 1.734   -23.386  -42.069 1.00 154.97 ? 200 GLN F NE2 1 
ATOM   5865  N N   . GLY F 1 122 ? 4.711   -25.500  -45.846 1.00 121.86 ? 201 GLY F N   1 
ATOM   5866  C CA  . GLY F 1 122 ? 4.862   -26.839  -46.385 1.00 123.72 ? 201 GLY F CA  1 
ATOM   5867  C C   . GLY F 1 122 ? 5.115   -27.841  -45.291 1.00 127.21 ? 201 GLY F C   1 
ATOM   5868  O O   . GLY F 1 122 ? 5.598   -27.473  -44.225 1.00 124.39 ? 201 GLY F O   1 
ATOM   5869  N N   . ARG F 1 123 ? 4.741   -29.096  -45.538 1.00 128.39 ? 202 ARG F N   1 
ATOM   5870  C CA  . ARG F 1 123 ? 5.095   -30.212  -44.652 1.00 129.75 ? 202 ARG F CA  1 
ATOM   5871  C C   . ARG F 1 123 ? 4.957   -31.541  -45.366 1.00 127.68 ? 202 ARG F C   1 
ATOM   5872  O O   . ARG F 1 123 ? 4.457   -31.592  -46.489 1.00 127.41 ? 202 ARG F O   1 
ATOM   5873  C CB  . ARG F 1 123 ? 4.224   -30.212  -43.401 1.00 136.03 ? 202 ARG F CB  1 
ATOM   5874  C CG  . ARG F 1 123 ? 2.755   -30.417  -43.695 1.00 142.80 ? 202 ARG F CG  1 
ATOM   5875  C CD  . ARG F 1 123 ? 1.874   -29.753  -42.666 1.00 151.14 ? 202 ARG F CD  1 
ATOM   5876  N NE  . ARG F 1 123 ? 1.628   -30.642  -41.526 1.00 157.60 ? 202 ARG F NE  1 
ATOM   5877  C CZ  . ARG F 1 123 ? 0.855   -30.345  -40.482 1.00 168.72 ? 202 ARG F CZ  1 
ATOM   5878  N NH1 . ARG F 1 123 ? 0.261   -29.155  -40.393 1.00 171.78 ? 202 ARG F NH1 1 
ATOM   5879  N NH2 . ARG F 1 123 ? 0.692   -31.247  -39.525 1.00 177.16 ? 202 ARG F NH2 1 
ATOM   5880  N N   . LEU F 1 124 ? 5.395   -32.606  -44.705 1.00 128.26 ? 203 LEU F N   1 
ATOM   5881  C CA  . LEU F 1 124 ? 5.260   -33.960  -45.232 1.00 127.96 ? 203 LEU F CA  1 
ATOM   5882  C C   . LEU F 1 124 ? 3.834   -34.470  -45.020 1.00 129.55 ? 203 LEU F C   1 
ATOM   5883  O O   . LEU F 1 124 ? 3.297   -34.378  -43.919 1.00 130.57 ? 203 LEU F O   1 
ATOM   5884  C CB  . LEU F 1 124 ? 6.257   -34.908  -44.569 1.00 125.41 ? 203 LEU F CB  1 
ATOM   5885  C CG  . LEU F 1 124 ? 7.719   -34.521  -44.747 1.00 126.12 ? 203 LEU F CG  1 
ATOM   5886  C CD1 . LEU F 1 124 ? 8.601   -35.238  -43.731 1.00 126.02 ? 203 LEU F CD1 1 
ATOM   5887  C CD2 . LEU F 1 124 ? 8.176   -34.802  -46.178 1.00 127.64 ? 203 LEU F CD2 1 
ATOM   5888  N N   . LEU F 1 125 ? 3.234   -34.992  -46.087 1.00 132.15 ? 204 LEU F N   1 
ATOM   5889  C CA  . LEU F 1 125 ? 1.901   -35.582  -46.045 1.00 137.23 ? 204 LEU F CA  1 
ATOM   5890  C C   . LEU F 1 125 ? 1.978   -36.990  -46.591 1.00 144.42 ? 204 LEU F C   1 
ATOM   5891  O O   . LEU F 1 125 ? 2.494   -37.192  -47.688 1.00 151.64 ? 204 LEU F O   1 
ATOM   5892  C CB  . LEU F 1 125 ? 0.924   -34.781  -46.906 1.00 136.70 ? 204 LEU F CB  1 
ATOM   5893  C CG  . LEU F 1 125 ? 0.641   -33.326  -46.541 1.00 137.36 ? 204 LEU F CG  1 
ATOM   5894  C CD1 . LEU F 1 125 ? -0.410  -32.760  -47.477 1.00 140.04 ? 204 LEU F CD1 1 
ATOM   5895  C CD2 . LEU F 1 125 ? 0.179   -33.210  -45.092 1.00 138.46 ? 204 LEU F CD2 1 
ATOM   5896  N N   . HIS F 1 126 ? 1.486   -37.961  -45.823 1.00 149.50 ? 205 HIS F N   1 
ATOM   5897  C CA  . HIS F 1 126 ? 1.309   -39.314  -46.338 1.00 160.35 ? 205 HIS F CA  1 
ATOM   5898  C C   . HIS F 1 126 ? 0.055   -39.263  -47.206 1.00 161.02 ? 205 HIS F C   1 
ATOM   5899  O O   . HIS F 1 126 ? -1.028  -38.969  -46.714 1.00 161.74 ? 205 HIS F O   1 
ATOM   5900  C CB  . HIS F 1 126 ? 1.187   -40.339  -45.200 1.00 170.61 ? 205 HIS F CB  1 
ATOM   5901  C CG  . HIS F 1 126 ? 0.595   -41.656  -45.617 1.00 182.84 ? 205 HIS F CG  1 
ATOM   5902  N ND1 . HIS F 1 126 ? 1.042   -42.366  -46.714 1.00 185.11 ? 205 HIS F ND1 1 
ATOM   5903  C CD2 . HIS F 1 126 ? -0.407  -42.392  -45.073 1.00 187.20 ? 205 HIS F CD2 1 
ATOM   5904  C CE1 . HIS F 1 126 ? 0.332   -43.474  -46.834 1.00 190.88 ? 205 HIS F CE1 1 
ATOM   5905  N NE2 . HIS F 1 126 ? -0.549  -43.517  -45.848 1.00 192.35 ? 205 HIS F NE2 1 
ATOM   5906  N N   . LEU F 1 127 ? 0.222   -39.507  -48.501 1.00 167.62 ? 206 LEU F N   1 
ATOM   5907  C CA  . LEU F 1 127 ? -0.888  -39.507  -49.447 1.00 170.63 ? 206 LEU F CA  1 
ATOM   5908  C C   . LEU F 1 127 ? -1.235  -40.931  -49.866 1.00 178.25 ? 206 LEU F C   1 
ATOM   5909  O O   . LEU F 1 127 ? -0.342  -41.771  -50.051 1.00 181.75 ? 206 LEU F O   1 
ATOM   5910  C CB  . LEU F 1 127 ? -0.535  -38.674  -50.679 1.00 168.34 ? 206 LEU F CB  1 
ATOM   5911  C CG  . LEU F 1 127 ? -0.187  -37.206  -50.417 1.00 166.76 ? 206 LEU F CG  1 
ATOM   5912  C CD1 . LEU F 1 127 ? 0.149   -36.494  -51.726 1.00 165.05 ? 206 LEU F CD1 1 
ATOM   5913  C CD2 . LEU F 1 127 ? -1.320  -36.496  -49.682 1.00 165.37 ? 206 LEU F CD2 1 
ATOM   5914  N N   . SER F 1 128 ? -2.538  -41.183  -50.012 1.00 180.25 ? 207 SER F N   1 
ATOM   5915  C CA  . SER F 1 128 ? -3.035  -42.478  -50.469 1.00 183.47 ? 207 SER F CA  1 
ATOM   5916  C C   . SER F 1 128 ? -2.985  -42.542  -51.989 1.00 183.32 ? 207 SER F C   1 
ATOM   5917  O O   . SER F 1 128 ? -2.849  -41.514  -52.658 1.00 180.12 ? 207 SER F O   1 
ATOM   5918  C CB  . SER F 1 128 ? -4.472  -42.689  -49.997 1.00 187.85 ? 207 SER F CB  1 
ATOM   5919  O OG  . SER F 1 128 ? -4.627  -42.242  -48.665 1.00 190.82 ? 207 SER F OG  1 
ATOM   5920  N N   . ALA F 1 129 ? -3.103  -43.753  -52.524 1.00 186.42 ? 208 ALA F N   1 
ATOM   5921  C CA  . ALA F 1 129 ? -3.206  -43.945  -53.966 1.00 188.58 ? 208 ALA F CA  1 
ATOM   5922  C C   . ALA F 1 129 ? -4.551  -43.393  -54.427 1.00 187.31 ? 208 ALA F C   1 
ATOM   5923  O O   . ALA F 1 129 ? -5.574  -43.612  -53.767 1.00 186.20 ? 208 ALA F O   1 
ATOM   5924  C CB  . ALA F 1 129 ? -3.079  -45.419  -54.322 1.00 193.23 ? 208 ALA F CB  1 
ATOM   5925  N N   . GLY F 1 130 ? -4.544  -42.649  -55.533 1.00 185.04 ? 209 GLY F N   1 
ATOM   5926  C CA  . GLY F 1 130 ? -5.764  -42.024  -56.057 1.00 183.02 ? 209 GLY F CA  1 
ATOM   5927  C C   . GLY F 1 130 ? -6.360  -40.928  -55.184 1.00 176.87 ? 209 GLY F C   1 
ATOM   5928  O O   . GLY F 1 130 ? -7.567  -40.676  -55.245 1.00 173.24 ? 209 GLY F O   1 
ATOM   5929  N N   . GLN F 1 131 ? -5.518  -40.274  -54.379 1.00 172.43 ? 210 GLN F N   1 
ATOM   5930  C CA  . GLN F 1 131 ? -5.954  -39.181  -53.503 1.00 167.63 ? 210 GLN F CA  1 
ATOM   5931  C C   . GLN F 1 131 ? -6.109  -37.909  -54.338 1.00 167.61 ? 210 GLN F C   1 
ATOM   5932  O O   . GLN F 1 131 ? -5.229  -37.568  -55.145 1.00 164.99 ? 210 GLN F O   1 
ATOM   5933  C CB  . GLN F 1 131 ? -4.941  -38.952  -52.381 1.00 163.41 ? 210 GLN F CB  1 
ATOM   5934  C CG  . GLN F 1 131 ? -5.377  -37.955  -51.321 1.00 161.34 ? 210 GLN F CG  1 
ATOM   5935  C CD  . GLN F 1 131 ? -6.072  -38.610  -50.145 1.00 164.38 ? 210 GLN F CD  1 
ATOM   5936  O OE1 . GLN F 1 131 ? -7.304  -38.558  -50.026 1.00 170.23 ? 210 GLN F OE1 1 
ATOM   5937  N NE2 . GLN F 1 131 ? -5.285  -39.211  -49.257 1.00 164.15 ? 210 GLN F NE2 1 
ATOM   5938  N N   . ARG F 1 132 ? -7.230  -37.216  -54.128 1.00 169.33 ? 211 ARG F N   1 
ATOM   5939  C CA  . ARG F 1 132 ? -7.543  -35.972  -54.827 1.00 169.95 ? 211 ARG F CA  1 
ATOM   5940  C C   . ARG F 1 132 ? -7.371  -34.767  -53.882 1.00 164.85 ? 211 ARG F C   1 
ATOM   5941  O O   . ARG F 1 132 ? -8.195  -34.543  -52.998 1.00 163.51 ? 211 ARG F O   1 
ATOM   5942  C CB  . ARG F 1 132 ? -8.971  -36.034  -55.389 1.00 174.43 ? 211 ARG F CB  1 
ATOM   5943  N N   . LEU F 1 133 ? -6.283  -34.018  -54.065 1.00 161.43 ? 212 LEU F N   1 
ATOM   5944  C CA  . LEU F 1 133 ? -5.994  -32.810  -53.278 1.00 155.29 ? 212 LEU F CA  1 
ATOM   5945  C C   . LEU F 1 133 ? -6.668  -31.606  -53.940 1.00 147.73 ? 212 LEU F C   1 
ATOM   5946  O O   . LEU F 1 133 ? -6.590  -31.446  -55.156 1.00 140.45 ? 212 LEU F O   1 
ATOM   5947  C CB  . LEU F 1 133 ? -4.481  -32.564  -53.168 1.00 150.29 ? 212 LEU F CB  1 
ATOM   5948  N N   . GLY F 1 134 ? -7.328  -30.775  -53.132 1.00 144.52 ? 213 GLY F N   1 
ATOM   5949  C CA  . GLY F 1 134 ? -7.960  -29.534  -53.600 1.00 145.70 ? 213 GLY F CA  1 
ATOM   5950  C C   . GLY F 1 134 ? -7.746  -28.400  -52.603 1.00 147.40 ? 213 GLY F C   1 
ATOM   5951  O O   . GLY F 1 134 ? -7.651  -28.641  -51.399 1.00 145.93 ? 213 GLY F O   1 
ATOM   5952  N N   . VAL F 1 135 ? -7.678  -27.167  -53.116 1.00 147.63 ? 214 VAL F N   1 
ATOM   5953  C CA  . VAL F 1 135 ? -7.337  -25.998  -52.301 1.00 143.80 ? 214 VAL F CA  1 
ATOM   5954  C C   . VAL F 1 135 ? -8.495  -25.014  -52.271 1.00 144.67 ? 214 VAL F C   1 
ATOM   5955  O O   . VAL F 1 135 ? -9.048  -24.677  -53.320 1.00 147.96 ? 214 VAL F O   1 
ATOM   5956  C CB  . VAL F 1 135 ? -6.105  -25.267  -52.857 1.00 145.52 ? 214 VAL F CB  1 
ATOM   5957  C CG1 . VAL F 1 135 ? -5.683  -24.139  -51.919 1.00 147.13 ? 214 VAL F CG1 1 
ATOM   5958  C CG2 . VAL F 1 135 ? -4.952  -26.245  -53.079 1.00 147.00 ? 214 VAL F CG2 1 
ATOM   5959  N N   . HIS F 1 136 ? -8.835  -24.533  -51.075 1.00 149.56 ? 215 HIS F N   1 
ATOM   5960  C CA  . HIS F 1 136 ? -9.999  -23.658  -50.877 1.00 149.75 ? 215 HIS F CA  1 
ATOM   5961  C C   . HIS F 1 136 ? -9.585  -22.311  -50.284 1.00 141.86 ? 215 HIS F C   1 
ATOM   5962  O O   . HIS F 1 136 ? -8.882  -22.246  -49.267 1.00 139.06 ? 215 HIS F O   1 
ATOM   5963  C CB  . HIS F 1 136 ? -11.018 -24.343  -49.967 1.00 159.56 ? 215 HIS F CB  1 
ATOM   5964  C CG  . HIS F 1 136 ? -12.356 -24.530  -50.591 1.00 172.58 ? 215 HIS F CG  1 
ATOM   5965  N ND1 . HIS F 1 136 ? -12.603 -25.482  -51.555 1.00 174.86 ? 215 HIS F ND1 1 
ATOM   5966  C CD2 . HIS F 1 136 ? -13.525 -23.882  -50.382 1.00 183.55 ? 215 HIS F CD2 1 
ATOM   5967  C CE1 . HIS F 1 136 ? -13.877 -25.419  -51.904 1.00 188.67 ? 215 HIS F CE1 1 
ATOM   5968  N NE2 . HIS F 1 136 ? -14.457 -24.454  -51.210 1.00 190.98 ? 215 HIS F NE2 1 
ATOM   5969  N N   . LEU F 1 137 ? -10.057 -21.246  -50.934 1.00 139.85 ? 216 LEU F N   1 
ATOM   5970  C CA  . LEU F 1 137 ? -9.764  -19.874  -50.538 1.00 142.27 ? 216 LEU F CA  1 
ATOM   5971  C C   . LEU F 1 137 ? -10.891 -19.339  -49.672 1.00 143.85 ? 216 LEU F C   1 
ATOM   5972  O O   . LEU F 1 137 ? -12.055 -19.492  -50.015 1.00 149.12 ? 216 LEU F O   1 
ATOM   5973  C CB  . LEU F 1 137 ? -9.645  -19.005  -51.779 1.00 143.78 ? 216 LEU F CB  1 
ATOM   5974  C CG  . LEU F 1 137 ? -9.226  -17.558  -51.538 1.00 148.52 ? 216 LEU F CG  1 
ATOM   5975  C CD1 . LEU F 1 137 ? -7.754  -17.496  -51.155 1.00 149.63 ? 216 LEU F CD1 1 
ATOM   5976  C CD2 . LEU F 1 137 ? -9.504  -16.697  -52.756 1.00 150.62 ? 216 LEU F CD2 1 
ATOM   5977  N N   . HIS F 1 138 ? -10.546 -18.712  -48.553 1.00 149.83 ? 217 HIS F N   1 
ATOM   5978  C CA  . HIS F 1 138 ? -11.524 -18.040  -47.705 1.00 155.49 ? 217 HIS F CA  1 
ATOM   5979  C C   . HIS F 1 138 ? -10.969 -16.680  -47.333 1.00 153.72 ? 217 HIS F C   1 
ATOM   5980  O O   . HIS F 1 138 ? -9.764  -16.541  -47.144 1.00 159.81 ? 217 HIS F O   1 
ATOM   5981  C CB  . HIS F 1 138 ? -11.814 -18.847  -46.443 1.00 159.54 ? 217 HIS F CB  1 
ATOM   5982  C CG  . HIS F 1 138 ? -12.879 -18.243  -45.582 1.00 166.33 ? 217 HIS F CG  1 
ATOM   5983  N ND1 . HIS F 1 138 ? -14.218 -18.531  -45.736 1.00 176.48 ? 217 HIS F ND1 1 
ATOM   5984  C CD2 . HIS F 1 138 ? -12.802 -17.338  -44.577 1.00 170.68 ? 217 HIS F CD2 1 
ATOM   5985  C CE1 . HIS F 1 138 ? -14.918 -17.835  -44.856 1.00 178.52 ? 217 HIS F CE1 1 
ATOM   5986  N NE2 . HIS F 1 138 ? -14.082 -17.110  -44.136 1.00 173.99 ? 217 HIS F NE2 1 
ATOM   5987  N N   . THR F 1 139 ? -11.846 -15.689  -47.201 1.00 149.54 ? 218 THR F N   1 
ATOM   5988  C CA  . THR F 1 139 ? -11.405 -14.314  -46.990 1.00 149.45 ? 218 THR F CA  1 
ATOM   5989  C C   . THR F 1 139 ? -12.361 -13.511  -46.103 1.00 151.15 ? 218 THR F C   1 
ATOM   5990  O O   . THR F 1 139 ? -13.528 -13.356  -46.437 1.00 148.44 ? 218 THR F O   1 
ATOM   5991  C CB  . THR F 1 139 ? -11.128 -13.581  -48.341 1.00 145.76 ? 218 THR F CB  1 
ATOM   5992  O OG1 . THR F 1 139 ? -11.444 -12.188  -48.226 1.00 146.68 ? 218 THR F OG1 1 
ATOM   5993  C CG2 . THR F 1 139 ? -11.928 -14.175  -49.500 1.00 145.51 ? 218 THR F CG2 1 
ATOM   5994  N N   . GLU F 1 140 ? -11.835 -13.016  -44.974 1.00 156.90 ? 219 GLU F N   1 
ATOM   5995  C CA  . GLU F 1 140 ? -12.513 -12.028  -44.121 1.00 160.77 ? 219 GLU F CA  1 
ATOM   5996  C C   . GLU F 1 140 ? -12.463 -10.639  -44.777 1.00 166.83 ? 219 GLU F C   1 
ATOM   5997  O O   . GLU F 1 140 ? -11.511 -9.871   -44.591 1.00 163.27 ? 219 GLU F O   1 
ATOM   5998  C CB  . GLU F 1 140 ? -11.876 -11.974  -42.729 1.00 159.38 ? 219 GLU F CB  1 
ATOM   5999  N N   . ALA F 1 141 ? -13.516 -10.334  -45.531 1.00 175.99 ? 220 ALA F N   1 
ATOM   6000  C CA  . ALA F 1 141 ? -13.581 -9.137   -46.374 1.00 181.76 ? 220 ALA F CA  1 
ATOM   6001  C C   . ALA F 1 141 ? -13.891 -7.860   -45.600 1.00 181.16 ? 220 ALA F C   1 
ATOM   6002  O O   . ALA F 1 141 ? -14.927 -7.757   -44.956 1.00 186.52 ? 220 ALA F O   1 
ATOM   6003  C CB  . ALA F 1 141 ? -14.620 -9.327   -47.483 1.00 184.37 ? 220 ALA F CB  1 
ATOM   6004  N N   . ARG F 1 142 ? -12.977 -6.899   -45.661 1.00 176.70 ? 221 ARG F N   1 
ATOM   6005  C CA  . ARG F 1 142 ? -13.304 -5.500   -45.433 1.00 177.94 ? 221 ARG F CA  1 
ATOM   6006  C C   . ARG F 1 142 ? -12.789 -4.771   -46.670 1.00 177.94 ? 221 ARG F C   1 
ATOM   6007  O O   . ARG F 1 142 ? -11.663 -4.274   -46.684 1.00 181.65 ? 221 ARG F O   1 
ATOM   6008  C CB  . ARG F 1 142 ? -12.669 -4.984   -44.143 1.00 179.02 ? 221 ARG F CB  1 
ATOM   6009  N N   . ALA F 1 143 ? -13.637 -4.745   -47.698 1.00 176.14 ? 222 ALA F N   1 
ATOM   6010  C CA  . ALA F 1 143 ? -13.302 -4.272   -49.060 1.00 172.39 ? 222 ALA F CA  1 
ATOM   6011  C C   . ALA F 1 143 ? -12.425 -5.282   -49.828 1.00 169.22 ? 222 ALA F C   1 
ATOM   6012  O O   . ALA F 1 143 ? -11.357 -4.934   -50.346 1.00 169.58 ? 222 ALA F O   1 
ATOM   6013  C CB  . ALA F 1 143 ? -12.678 -2.874   -49.049 1.00 168.97 ? 222 ALA F CB  1 
ATOM   6014  N N   . ARG F 1 144 ? -12.913 -6.523   -49.918 1.00 166.25 ? 223 ARG F N   1 
ATOM   6015  C CA  . ARG F 1 144 ? -12.249 -7.605   -50.674 1.00 164.15 ? 223 ARG F CA  1 
ATOM   6016  C C   . ARG F 1 144 ? -11.860 -7.226   -52.115 1.00 164.22 ? 223 ARG F C   1 
ATOM   6017  O O   . ARG F 1 144 ? -10.910 -7.774   -52.670 1.00 163.99 ? 223 ARG F O   1 
ATOM   6018  C CB  . ARG F 1 144 ? -13.132 -8.862   -50.699 1.00 160.88 ? 223 ARG F CB  1 
ATOM   6019  N N   . HIS F 1 145 ? -12.604 -6.298   -52.711 1.00 165.90 ? 224 HIS F N   1 
ATOM   6020  C CA  . HIS F 1 145 ? -12.286 -5.748   -54.032 1.00 166.05 ? 224 HIS F CA  1 
ATOM   6021  C C   . HIS F 1 145 ? -10.954 -4.991   -54.108 1.00 160.01 ? 224 HIS F C   1 
ATOM   6022  O O   . HIS F 1 145 ? -10.400 -4.842   -55.198 1.00 164.82 ? 224 HIS F O   1 
ATOM   6023  C CB  . HIS F 1 145 ? -13.406 -4.797   -54.485 1.00 173.75 ? 224 HIS F CB  1 
ATOM   6024  C CG  . HIS F 1 145 ? -13.338 -3.425   -53.867 1.00 177.30 ? 224 HIS F CG  1 
ATOM   6025  N ND1 . HIS F 1 145 ? -13.913 -3.118   -52.649 1.00 179.61 ? 224 HIS F ND1 1 
ATOM   6026  C CD2 . HIS F 1 145 ? -12.761 -2.279   -54.309 1.00 175.47 ? 224 HIS F CD2 1 
ATOM   6027  C CE1 . HIS F 1 145 ? -13.695 -1.844   -52.371 1.00 178.38 ? 224 HIS F CE1 1 
ATOM   6028  N NE2 . HIS F 1 145 ? -12.998 -1.314   -53.361 1.00 175.29 ? 224 HIS F NE2 1 
ATOM   6029  N N   . ALA F 1 146 ? -10.469 -4.488   -52.968 1.00 151.82 ? 225 ALA F N   1 
ATOM   6030  C CA  . ALA F 1 146 ? -9.234  -3.705   -52.923 1.00 146.94 ? 225 ALA F CA  1 
ATOM   6031  C C   . ALA F 1 146 ? -7.969  -4.545   -52.993 1.00 145.33 ? 225 ALA F C   1 
ATOM   6032  O O   . ALA F 1 146 ? -6.888  -3.985   -53.164 1.00 150.81 ? 225 ALA F O   1 
ATOM   6033  C CB  . ALA F 1 146 ? -9.201  -2.836   -51.674 1.00 144.34 ? 225 ALA F CB  1 
ATOM   6034  N N   . TRP F 1 147 ? -8.089  -5.865   -52.842 1.00 144.21 ? 226 TRP F N   1 
ATOM   6035  C CA  . TRP F 1 147 ? -6.940  -6.774   -52.907 1.00 141.08 ? 226 TRP F CA  1 
ATOM   6036  C C   . TRP F 1 147 ? -7.181  -7.863   -53.947 1.00 137.77 ? 226 TRP F C   1 
ATOM   6037  O O   . TRP F 1 147 ? -8.317  -8.275   -54.173 1.00 137.08 ? 226 TRP F O   1 
ATOM   6038  C CB  . TRP F 1 147 ? -6.711  -7.419   -51.534 1.00 140.19 ? 226 TRP F CB  1 
ATOM   6039  C CG  . TRP F 1 147 ? -6.025  -6.537   -50.524 1.00 137.66 ? 226 TRP F CG  1 
ATOM   6040  C CD1 . TRP F 1 147 ? -6.598  -5.610   -49.700 1.00 137.21 ? 226 TRP F CD1 1 
ATOM   6041  C CD2 . TRP F 1 147 ? -4.633  -6.529   -50.224 1.00 135.79 ? 226 TRP F CD2 1 
ATOM   6042  N NE1 . TRP F 1 147 ? -5.642  -5.013   -48.911 1.00 135.15 ? 226 TRP F NE1 1 
ATOM   6043  C CE2 . TRP F 1 147 ? -4.425  -5.560   -49.211 1.00 135.30 ? 226 TRP F CE2 1 
ATOM   6044  C CE3 . TRP F 1 147 ? -3.533  -7.247   -50.712 1.00 134.49 ? 226 TRP F CE3 1 
ATOM   6045  C CZ2 . TRP F 1 147 ? -3.164  -5.286   -48.685 1.00 136.01 ? 226 TRP F CZ2 1 
ATOM   6046  C CZ3 . TRP F 1 147 ? -2.282  -6.981   -50.196 1.00 132.47 ? 226 TRP F CZ3 1 
ATOM   6047  C CH2 . TRP F 1 147 ? -2.107  -6.010   -49.183 1.00 133.78 ? 226 TRP F CH2 1 
ATOM   6048  N N   . GLN F 1 148 ? -6.111  -8.323   -54.582 1.00 135.43 ? 227 GLN F N   1 
ATOM   6049  C CA  . GLN F 1 148 ? -6.189  -9.452   -55.497 1.00 134.33 ? 227 GLN F CA  1 
ATOM   6050  C C   . GLN F 1 148 ? -5.044  -10.413  -55.232 1.00 129.08 ? 227 GLN F C   1 
ATOM   6051  O O   . GLN F 1 148 ? -4.015  -10.029  -54.677 1.00 124.85 ? 227 GLN F O   1 
ATOM   6052  C CB  . GLN F 1 148 ? -6.123  -8.968   -56.941 1.00 135.43 ? 227 GLN F CB  1 
ATOM   6053  C CG  . GLN F 1 148 ? -7.252  -8.025   -57.325 1.00 140.19 ? 227 GLN F CG  1 
ATOM   6054  C CD  . GLN F 1 148 ? -7.453  -7.846   -58.833 1.00 143.99 ? 227 GLN F CD  1 
ATOM   6055  O OE1 . GLN F 1 148 ? -6.766  -8.443   -59.667 1.00 144.02 ? 227 GLN F OE1 1 
ATOM   6056  N NE2 . GLN F 1 148 ? -8.404  -6.989   -59.182 1.00 149.09 ? 227 GLN F NE2 1 
ATOM   6057  N N   . LEU F 1 149 ? -5.226  -11.662  -55.642 1.00 127.56 ? 228 LEU F N   1 
ATOM   6058  C CA  . LEU F 1 149 ? -4.117  -12.600  -55.698 1.00 130.66 ? 228 LEU F CA  1 
ATOM   6059  C C   . LEU F 1 149 ? -3.101  -12.082  -56.704 1.00 132.66 ? 228 LEU F C   1 
ATOM   6060  O O   . LEU F 1 149 ? -3.474  -11.690  -57.807 1.00 140.39 ? 228 LEU F O   1 
ATOM   6061  C CB  . LEU F 1 149 ? -4.577  -13.985  -56.132 1.00 132.86 ? 228 LEU F CB  1 
ATOM   6062  C CG  . LEU F 1 149 ? -5.550  -14.714  -55.211 1.00 136.51 ? 228 LEU F CG  1 
ATOM   6063  C CD1 . LEU F 1 149 ? -6.156  -15.885  -55.963 1.00 141.31 ? 228 LEU F CD1 1 
ATOM   6064  C CD2 . LEU F 1 149 ? -4.877  -15.218  -53.956 1.00 135.70 ? 228 LEU F CD2 1 
ATOM   6065  N N   . THR F 1 150 ? -1.830  -12.052  -56.306 1.00 129.25 ? 229 THR F N   1 
ATOM   6066  C CA  . THR F 1 150 ? -0.751  -11.685  -57.208 1.00 132.41 ? 229 THR F CA  1 
ATOM   6067  C C   . THR F 1 150 ? -0.569  -12.815  -58.203 1.00 135.12 ? 229 THR F C   1 
ATOM   6068  O O   . THR F 1 150 ? -0.495  -13.976  -57.809 1.00 135.87 ? 229 THR F O   1 
ATOM   6069  C CB  . THR F 1 150 ? 0.565   -11.460  -56.458 1.00 132.60 ? 229 THR F CB  1 
ATOM   6070  O OG1 . THR F 1 150 ? 0.383   -10.421  -55.474 1.00 136.58 ? 229 THR F OG1 1 
ATOM   6071  C CG2 . THR F 1 150 ? 1.675   -11.060  -57.421 1.00 132.70 ? 229 THR F CG2 1 
ATOM   6072  N N   . GLN F 1 151 ? -0.495  -12.467  -59.483 1.00 138.56 ? 230 GLN F N   1 
ATOM   6073  C CA  . GLN F 1 151 ? -0.631  -13.445  -60.556 1.00 140.19 ? 230 GLN F CA  1 
ATOM   6074  C C   . GLN F 1 151 ? 0.646   -14.203  -60.796 1.00 136.50 ? 230 GLN F C   1 
ATOM   6075  O O   . GLN F 1 151 ? 1.714   -13.605  -60.875 1.00 141.74 ? 230 GLN F O   1 
ATOM   6076  C CB  . GLN F 1 151 ? -1.041  -12.756  -61.845 1.00 149.67 ? 230 GLN F CB  1 
ATOM   6077  C CG  . GLN F 1 151 ? -2.404  -12.098  -61.765 1.00 154.92 ? 230 GLN F CG  1 
ATOM   6078  C CD  . GLN F 1 151 ? -2.888  -11.615  -63.113 1.00 160.93 ? 230 GLN F CD  1 
ATOM   6079  O OE1 . GLN F 1 151 ? -3.348  -10.478  -63.244 1.00 171.10 ? 230 GLN F OE1 1 
ATOM   6080  N NE2 . GLN F 1 151 ? -2.762  -12.466  -64.140 1.00 163.92 ? 230 GLN F NE2 1 
ATOM   6081  N N   . GLY F 1 152 ? 0.525   -15.524  -60.917 1.00 133.71 ? 231 GLY F N   1 
ATOM   6082  C CA  . GLY F 1 152 ? 1.679   -16.424  -61.016 1.00 133.84 ? 231 GLY F CA  1 
ATOM   6083  C C   . GLY F 1 152 ? 2.402   -16.712  -59.700 1.00 135.52 ? 231 GLY F C   1 
ATOM   6084  O O   . GLY F 1 152 ? 3.391   -17.438  -59.691 1.00 134.86 ? 231 GLY F O   1 
ATOM   6085  N N   . ALA F 1 153 ? 1.891   -16.165  -58.594 1.00 138.89 ? 232 ALA F N   1 
ATOM   6086  C CA  . ALA F 1 153 ? 2.537   -16.234  -57.289 1.00 142.43 ? 232 ALA F CA  1 
ATOM   6087  C C   . ALA F 1 153 ? 1.886   -17.239  -56.342 1.00 140.67 ? 232 ALA F C   1 
ATOM   6088  O O   . ALA F 1 153 ? 2.575   -17.826  -55.520 1.00 144.26 ? 232 ALA F O   1 
ATOM   6089  C CB  . ALA F 1 153 ? 2.533   -14.855  -56.643 1.00 150.07 ? 232 ALA F CB  1 
ATOM   6090  N N   . THR F 1 154 ? 0.564   -17.389  -56.429 1.00 139.83 ? 233 THR F N   1 
ATOM   6091  C CA  . THR F 1 154 ? -0.164  -18.398  -55.663 1.00 141.40 ? 233 THR F CA  1 
ATOM   6092  C C   . THR F 1 154 ? 0.077   -19.766  -56.287 1.00 133.70 ? 233 THR F C   1 
ATOM   6093  O O   . THR F 1 154 ? -0.299  -20.001  -57.430 1.00 134.56 ? 233 THR F O   1 
ATOM   6094  C CB  . THR F 1 154 ? -1.674  -18.083  -55.619 1.00 148.53 ? 233 THR F CB  1 
ATOM   6095  O OG1 . THR F 1 154 ? -1.866  -16.746  -55.110 1.00 157.78 ? 233 THR F OG1 1 
ATOM   6096  C CG2 . THR F 1 154 ? -2.423  -19.084  -54.728 1.00 148.48 ? 233 THR F CG2 1 
ATOM   6097  N N   . VAL F 1 155 ? 0.712   -20.657  -55.531 1.00 128.00 ? 234 VAL F N   1 
ATOM   6098  C CA  . VAL F 1 155 ? 1.290   -21.888  -56.069 1.00 124.50 ? 234 VAL F CA  1 
ATOM   6099  C C   . VAL F 1 155 ? 1.084   -23.040  -55.100 1.00 123.05 ? 234 VAL F C   1 
ATOM   6100  O O   . VAL F 1 155 ? 1.308   -22.882  -53.917 1.00 127.88 ? 234 VAL F O   1 
ATOM   6101  C CB  . VAL F 1 155 ? 2.801   -21.699  -56.289 1.00 123.87 ? 234 VAL F CB  1 
ATOM   6102  C CG1 . VAL F 1 155 ? 3.511   -23.031  -56.566 1.00 125.98 ? 234 VAL F CG1 1 
ATOM   6103  C CG2 . VAL F 1 155 ? 3.036   -20.732  -57.438 1.00 128.02 ? 234 VAL F CG2 1 
ATOM   6104  N N   . LEU F 1 156 ? 0.652   -24.184  -55.616 1.00 123.84 ? 235 LEU F N   1 
ATOM   6105  C CA  . LEU F 1 156 ? 0.650   -25.443  -54.884 1.00 126.60 ? 235 LEU F CA  1 
ATOM   6106  C C   . LEU F 1 156 ? 1.703   -26.312  -55.531 1.00 126.91 ? 235 LEU F C   1 
ATOM   6107  O O   . LEU F 1 156 ? 1.735   -26.430  -56.753 1.00 130.55 ? 235 LEU F O   1 
ATOM   6108  C CB  . LEU F 1 156 ? -0.699  -26.140  -55.005 1.00 127.52 ? 235 LEU F CB  1 
ATOM   6109  C CG  . LEU F 1 156 ? -0.799  -27.593  -54.538 1.00 128.63 ? 235 LEU F CG  1 
ATOM   6110  C CD1 . LEU F 1 156 ? -0.524  -27.692  -53.046 1.00 130.47 ? 235 LEU F CD1 1 
ATOM   6111  C CD2 . LEU F 1 156 ? -2.178  -28.131  -54.877 1.00 131.65 ? 235 LEU F CD2 1 
ATOM   6112  N N   . GLY F 1 157 ? 2.547   -26.934  -54.722 1.00 123.09 ? 236 GLY F N   1 
ATOM   6113  C CA  . GLY F 1 157 ? 3.569   -27.829  -55.231 1.00 123.96 ? 236 GLY F CA  1 
ATOM   6114  C C   . GLY F 1 157 ? 3.818   -28.999  -54.311 1.00 128.85 ? 236 GLY F C   1 
ATOM   6115  O O   . GLY F 1 157 ? 3.554   -28.922  -53.108 1.00 128.43 ? 236 GLY F O   1 
ATOM   6116  N N   . LEU F 1 158 ? 4.308   -30.093  -54.890 1.00 134.51 ? 237 LEU F N   1 
ATOM   6117  C CA  . LEU F 1 158 ? 4.711   -31.263  -54.120 1.00 134.55 ? 237 LEU F CA  1 
ATOM   6118  C C   . LEU F 1 158 ? 5.736   -32.108  -54.862 1.00 129.14 ? 237 LEU F C   1 
ATOM   6119  O O   . LEU F 1 158 ? 5.843   -32.042  -56.081 1.00 125.23 ? 237 LEU F O   1 
ATOM   6120  C CB  . LEU F 1 158 ? 3.496   -32.114  -53.741 1.00 139.21 ? 237 LEU F CB  1 
ATOM   6121  C CG  . LEU F 1 158 ? 2.504   -32.494  -54.859 1.00 139.94 ? 237 LEU F CG  1 
ATOM   6122  C CD1 . LEU F 1 158 ? 3.046   -33.584  -55.770 1.00 139.30 ? 237 LEU F CD1 1 
ATOM   6123  C CD2 . LEU F 1 158 ? 1.185   -32.936  -54.251 1.00 145.11 ? 237 LEU F CD2 1 
ATOM   6124  N N   . PHE F 1 159 ? 6.491   -32.889  -54.103 1.00 127.40 ? 238 PHE F N   1 
ATOM   6125  C CA  . PHE F 1 159 ? 7.378   -33.899  -54.667 1.00 128.89 ? 238 PHE F CA  1 
ATOM   6126  C C   . PHE F 1 159 ? 7.495   -35.084  -53.716 1.00 133.60 ? 238 PHE F C   1 
ATOM   6127  O O   . PHE F 1 159 ? 7.401   -34.908  -52.495 1.00 136.15 ? 238 PHE F O   1 
ATOM   6128  C CB  . PHE F 1 159 ? 8.756   -33.312  -55.013 1.00 129.04 ? 238 PHE F CB  1 
ATOM   6129  C CG  . PHE F 1 159 ? 9.437   -32.586  -53.883 1.00 127.30 ? 238 PHE F CG  1 
ATOM   6130  C CD1 . PHE F 1 159 ? 10.215  -33.275  -52.962 1.00 128.27 ? 238 PHE F CD1 1 
ATOM   6131  C CD2 . PHE F 1 159 ? 9.345   -31.204  -53.769 1.00 126.02 ? 238 PHE F CD2 1 
ATOM   6132  C CE1 . PHE F 1 159 ? 10.857  -32.609  -51.922 1.00 127.51 ? 238 PHE F CE1 1 
ATOM   6133  C CE2 . PHE F 1 159 ? 9.988   -30.529  -52.741 1.00 127.56 ? 238 PHE F CE2 1 
ATOM   6134  C CZ  . PHE F 1 159 ? 10.745  -31.235  -51.812 1.00 127.81 ? 238 PHE F CZ  1 
ATOM   6135  N N   . ARG F 1 160 ? 7.673   -36.282  -54.280 1.00 137.68 ? 239 ARG F N   1 
ATOM   6136  C CA  . ARG F 1 160 ? 7.717   -37.515  -53.491 1.00 144.07 ? 239 ARG F CA  1 
ATOM   6137  C C   . ARG F 1 160 ? 9.042   -37.617  -52.745 1.00 148.63 ? 239 ARG F C   1 
ATOM   6138  O O   . ARG F 1 160 ? 10.082  -37.257  -53.273 1.00 151.95 ? 239 ARG F O   1 
ATOM   6139  C CB  . ARG F 1 160 ? 7.511   -38.754  -54.376 1.00 141.20 ? 239 ARG F CB  1 
ATOM   6140  N N   . VAL F 1 161 ? 8.974   -38.091  -51.507 1.00 156.33 ? 240 VAL F N   1 
ATOM   6141  C CA  . VAL F 1 161 ? 10.142  -38.363  -50.689 1.00 163.72 ? 240 VAL F CA  1 
ATOM   6142  C C   . VAL F 1 161 ? 10.386  -39.876  -50.555 1.00 168.40 ? 240 VAL F C   1 
ATOM   6143  O O   . VAL F 1 161 ? 11.543  -40.318  -50.623 1.00 172.88 ? 240 VAL F O   1 
ATOM   6144  C CB  . VAL F 1 161 ? 9.974   -37.695  -49.309 1.00 167.37 ? 240 VAL F CB  1 
ATOM   6145  C CG1 . VAL F 1 161 ? 11.118  -38.037  -48.365 1.00 171.21 ? 240 VAL F CG1 1 
ATOM   6146  C CG2 . VAL F 1 161 ? 9.884   -36.192  -49.490 1.00 164.31 ? 240 VAL F CG2 1 
ATOM   6147  N N   . THR F 1 162 ? 9.318   -40.656  -50.353 1.00 170.44 ? 241 THR F N   1 
ATOM   6148  C CA  . THR F 1 162 ? 9.418   -42.110  -50.283 1.00 174.47 ? 241 THR F CA  1 
ATOM   6149  C C   . THR F 1 162 ? 9.822   -42.695  -51.641 1.00 180.65 ? 241 THR F C   1 
ATOM   6150  O O   . THR F 1 162 ? 9.209   -42.338  -52.668 1.00 185.68 ? 241 THR F O   1 
ATOM   6151  C CB  . THR F 1 162 ? 8.088   -42.766  -49.848 1.00 173.09 ? 241 THR F CB  1 
ATOM   6152  O OG1 . THR F 1 162 ? 7.656   -42.197  -48.612 1.00 172.22 ? 241 THR F OG1 1 
ATOM   6153  C CG2 . THR F 1 162 ? 8.266   -44.277  -49.649 1.00 175.69 ? 241 THR F CG2 1 
ATOM   6154  N N   . PRO F 1 163 ? 10.858  -43.572  -51.659 1.00 184.10 ? 242 PRO F N   1 
ATOM   6155  C CA  . PRO F 1 163 ? 11.232  -44.210  -52.926 1.00 186.30 ? 242 PRO F CA  1 
ATOM   6156  C C   . PRO F 1 163 ? 10.274  -45.332  -53.320 1.00 190.95 ? 242 PRO F C   1 
ATOM   6157  O O   . PRO F 1 163 ? 10.352  -45.843  -54.440 1.00 196.87 ? 242 PRO F O   1 
ATOM   6158  C CB  . PRO F 1 163 ? 12.636  -44.779  -52.647 1.00 187.01 ? 242 PRO F CB  1 
ATOM   6159  C CG  . PRO F 1 163 ? 13.128  -44.055  -51.447 1.00 184.00 ? 242 PRO F CG  1 
ATOM   6160  C CD  . PRO F 1 163 ? 11.901  -43.788  -50.636 1.00 182.14 ? 242 PRO F CD  1 
ATOM   6161  N N   . ASP G 2 4   ? -8.419  -40.916  -12.677 1.00 197.89 ? 26  ASP G N   1 
ATOM   6162  C CA  . ASP G 2 4   ? -9.467  -40.901  -11.597 1.00 195.52 ? 26  ASP G CA  1 
ATOM   6163  C C   . ASP G 2 4   ? -8.686  -40.844  -10.282 1.00 191.95 ? 26  ASP G C   1 
ATOM   6164  O O   . ASP G 2 4   ? -7.485  -40.497  -10.309 1.00 198.57 ? 26  ASP G O   1 
ATOM   6165  C CB  . ASP G 2 4   ? -10.403 -42.110  -11.763 1.00 193.68 ? 26  ASP G CB  1 
ATOM   6166  C CG  . ASP G 2 4   ? -11.896 -41.729  -11.737 1.00 195.62 ? 26  ASP G CG  1 
ATOM   6167  O OD1 . ASP G 2 4   ? -12.275 -40.532  -11.726 1.00 195.79 ? 26  ASP G OD1 1 
ATOM   6168  O OD2 . ASP G 2 4   ? -12.675 -42.672  -11.743 1.00 199.04 ? 26  ASP G OD2 1 
ATOM   6169  N N   . PRO G 2 5   ? -9.307  -41.137  -9.121  1.00 181.74 ? 27  PRO G N   1 
ATOM   6170  C CA  . PRO G 2 5   ? -8.501  -41.246  -7.882  1.00 177.62 ? 27  PRO G CA  1 
ATOM   6171  C C   . PRO G 2 5   ? -7.532  -42.436  -7.882  1.00 174.84 ? 27  PRO G C   1 
ATOM   6172  O O   . PRO G 2 5   ? -6.374  -42.293  -7.494  1.00 168.45 ? 27  PRO G O   1 
ATOM   6173  C CB  . PRO G 2 5   ? -9.557  -41.427  -6.775  1.00 175.05 ? 27  PRO G CB  1 
ATOM   6174  C CG  . PRO G 2 5   ? -10.818 -40.905  -7.360  1.00 176.43 ? 27  PRO G CG  1 
ATOM   6175  C CD  . PRO G 2 5   ? -10.743 -41.216  -8.820  1.00 177.23 ? 27  PRO G CD  1 
ATOM   6176  N N   . CYS G 2 6   ? -8.026  -43.588  -8.333  1.00 178.05 ? 28  CYS G N   1 
ATOM   6177  C CA  . CYS G 2 6   ? -7.290  -44.850  -8.285  1.00 181.10 ? 28  CYS G CA  1 
ATOM   6178  C C   . CYS G 2 6   ? -6.039  -44.872  -9.153  1.00 183.99 ? 28  CYS G C   1 
ATOM   6179  O O   . CYS G 2 6   ? -5.023  -45.456  -8.756  1.00 189.82 ? 28  CYS G O   1 
ATOM   6180  C CB  . CYS G 2 6   ? -8.214  -46.009  -8.661  1.00 179.06 ? 28  CYS G CB  1 
ATOM   6181  S SG  . CYS G 2 6   ? -9.693  -46.119  -7.605  1.00 183.80 ? 28  CYS G SG  1 
ATOM   6182  N N   . SER G 2 7   ? -6.104  -44.222  -10.316 1.00 182.82 ? 29  SER G N   1 
ATOM   6183  C CA  . SER G 2 7   ? -4.946  -44.084  -11.215 1.00 180.12 ? 29  SER G CA  1 
ATOM   6184  C C   . SER G 2 7   ? -3.711  -43.506  -10.517 1.00 173.12 ? 29  SER G C   1 
ATOM   6185  O O   . SER G 2 7   ? -2.581  -43.850  -10.854 1.00 168.12 ? 29  SER G O   1 
ATOM   6186  C CB  . SER G 2 7   ? -5.302  -43.209  -12.414 1.00 187.88 ? 29  SER G CB  1 
ATOM   6187  O OG  . SER G 2 7   ? -4.262  -43.232  -13.379 1.00 196.67 ? 29  SER G OG  1 
ATOM   6188  N N   . ASN G 2 8   ? -3.942  -42.621  -9.548  1.00 170.96 ? 30  ASN G N   1 
ATOM   6189  C CA  . ASN G 2 8   ? -2.872  -42.035  -8.721  1.00 174.72 ? 30  ASN G CA  1 
ATOM   6190  C C   . ASN G 2 8   ? -2.019  -43.061  -7.959  1.00 168.71 ? 30  ASN G C   1 
ATOM   6191  O O   . ASN G 2 8   ? -0.827  -42.817  -7.736  1.00 170.87 ? 30  ASN G O   1 
ATOM   6192  C CB  . ASN G 2 8   ? -3.483  -41.035  -7.719  1.00 182.80 ? 30  ASN G CB  1 
ATOM   6193  C CG  . ASN G 2 8   ? -2.457  -40.101  -7.104  1.00 190.84 ? 30  ASN G CG  1 
ATOM   6194  O OD1 . ASN G 2 8   ? -1.670  -39.469  -7.811  1.00 196.77 ? 30  ASN G OD1 1 
ATOM   6195  N ND2 . ASN G 2 8   ? -2.477  -39.995  -5.777  1.00 191.69 ? 30  ASN G ND2 1 
ATOM   6196  N N   . CYS G 2 9   ? -2.630  -44.175  -7.546  1.00 167.26 ? 31  CYS G N   1 
ATOM   6197  C CA  . CYS G 2 9   ? -1.908  -45.232  -6.816  1.00 166.46 ? 31  CYS G CA  1 
ATOM   6198  C C   . CYS G 2 9   ? -0.952  -46.000  -7.726  1.00 166.02 ? 31  CYS G C   1 
ATOM   6199  O O   . CYS G 2 9   ? -1.335  -46.356  -8.832  1.00 164.46 ? 31  CYS G O   1 
ATOM   6200  C CB  . CYS G 2 9   ? -2.880  -46.211  -6.153  1.00 165.50 ? 31  CYS G CB  1 
ATOM   6201  S SG  . CYS G 2 9   ? -4.079  -45.454  -5.030  1.00 171.85 ? 31  CYS G SG  1 
ATOM   6202  N N   . PRO G 2 10  ? 0.289   -46.254  -7.262  1.00 169.12 ? 32  PRO G N   1 
ATOM   6203  C CA  . PRO G 2 10  ? 1.295   -46.941  -8.081  1.00 170.44 ? 32  PRO G CA  1 
ATOM   6204  C C   . PRO G 2 10  ? 1.259   -48.468  -7.949  1.00 164.47 ? 32  PRO G C   1 
ATOM   6205  O O   . PRO G 2 10  ? 0.373   -49.020  -7.299  1.00 168.05 ? 32  PRO G O   1 
ATOM   6206  C CB  . PRO G 2 10  ? 2.605   -46.397  -7.508  1.00 173.98 ? 32  PRO G CB  1 
ATOM   6207  C CG  . PRO G 2 10  ? 2.308   -46.258  -6.055  1.00 171.93 ? 32  PRO G CG  1 
ATOM   6208  C CD  . PRO G 2 10  ? 0.874   -45.799  -5.982  1.00 168.57 ? 32  PRO G CD  1 
ATOM   6209  N N   . ALA G 2 11  ? 2.228   -49.125  -8.586  1.00 155.82 ? 33  ALA G N   1 
ATOM   6210  C CA  . ALA G 2 11  ? 2.488   -50.552  -8.390  1.00 149.41 ? 33  ALA G CA  1 
ATOM   6211  C C   . ALA G 2 11  ? 2.918   -50.820  -6.951  1.00 148.52 ? 33  ALA G C   1 
ATOM   6212  O O   . ALA G 2 11  ? 3.567   -49.978  -6.328  1.00 149.57 ? 33  ALA G O   1 
ATOM   6213  C CB  . ALA G 2 11  ? 3.555   -51.040  -9.360  1.00 148.82 ? 33  ALA G CB  1 
ATOM   6214  N N   . GLY G 2 12  ? 2.548   -51.996  -6.432  1.00 147.58 ? 34  GLY G N   1 
ATOM   6215  C CA  . GLY G 2 12  ? 2.761   -52.353  -5.023  1.00 144.03 ? 34  GLY G CA  1 
ATOM   6216  C C   . GLY G 2 12  ? 1.619   -51.936  -4.090  1.00 141.83 ? 34  GLY G C   1 
ATOM   6217  O O   . GLY G 2 12  ? 1.703   -52.190  -2.887  1.00 140.70 ? 34  GLY G O   1 
ATOM   6218  N N   . THR G 2 13  ? 0.569   -51.309  -4.634  1.00 140.30 ? 35  THR G N   1 
ATOM   6219  C CA  . THR G 2 13  ? -0.583  -50.843  -3.858  1.00 137.37 ? 35  THR G CA  1 
ATOM   6220  C C   . THR G 2 13  ? -1.877  -51.066  -4.635  1.00 130.73 ? 35  THR G C   1 
ATOM   6221  O O   . THR G 2 13  ? -1.842  -51.488  -5.796  1.00 124.28 ? 35  THR G O   1 
ATOM   6222  C CB  . THR G 2 13  ? -0.478  -49.326  -3.545  1.00 145.55 ? 35  THR G CB  1 
ATOM   6223  O OG1 . THR G 2 13  ? -0.395  -48.585  -4.764  1.00 148.39 ? 35  THR G OG1 1 
ATOM   6224  C CG2 . THR G 2 13  ? 0.742   -49.017  -2.690  1.00 150.32 ? 35  THR G CG2 1 
ATOM   6225  N N   . PHE G 2 14  ? -3.010  -50.778  -3.991  1.00 129.05 ? 36  PHE G N   1 
ATOM   6226  C CA  . PHE G 2 14  ? -4.317  -50.783  -4.644  1.00 129.21 ? 36  PHE G CA  1 
ATOM   6227  C C   . PHE G 2 14  ? -5.231  -49.673  -4.121  1.00 133.71 ? 36  PHE G C   1 
ATOM   6228  O O   . PHE G 2 14  ? -5.064  -49.191  -3.006  1.00 129.24 ? 36  PHE G O   1 
ATOM   6229  C CB  . PHE G 2 14  ? -4.991  -52.148  -4.485  1.00 125.60 ? 36  PHE G CB  1 
ATOM   6230  C CG  . PHE G 2 14  ? -5.451  -52.464  -3.082  1.00 121.98 ? 36  PHE G CG  1 
ATOM   6231  C CD1 . PHE G 2 14  ? -6.796  -52.333  -2.724  1.00 117.47 ? 36  PHE G CD1 1 
ATOM   6232  C CD2 . PHE G 2 14  ? -4.543  -52.899  -2.118  1.00 121.14 ? 36  PHE G CD2 1 
ATOM   6233  C CE1 . PHE G 2 14  ? -7.220  -52.619  -1.437  1.00 115.99 ? 36  PHE G CE1 1 
ATOM   6234  C CE2 . PHE G 2 14  ? -4.957  -53.188  -0.830  1.00 118.95 ? 36  PHE G CE2 1 
ATOM   6235  C CZ  . PHE G 2 14  ? -6.298  -53.045  -0.488  1.00 118.91 ? 36  PHE G CZ  1 
ATOM   6236  N N   . CYS G 2 15  ? -6.204  -49.289  -4.946  1.00 140.77 ? 37  CYS G N   1 
ATOM   6237  C CA  . CYS G 2 15  ? -7.185  -48.255  -4.614  1.00 146.78 ? 37  CYS G CA  1 
ATOM   6238  C C   . CYS G 2 15  ? -8.314  -48.836  -3.751  1.00 143.04 ? 37  CYS G C   1 
ATOM   6239  O O   . CYS G 2 15  ? -9.327  -49.316  -4.264  1.00 143.32 ? 37  CYS G O   1 
ATOM   6240  C CB  . CYS G 2 15  ? -7.734  -47.641  -5.900  1.00 155.61 ? 37  CYS G CB  1 
ATOM   6241  S SG  . CYS G 2 15  ? -8.973  -46.339  -5.705  1.00 162.18 ? 37  CYS G SG  1 
ATOM   6242  N N   . ASP G 2 16  ? -8.120  -48.784  -2.435  1.00 137.58 ? 38  ASP G N   1 
ATOM   6243  C CA  . ASP G 2 16  ? -9.005  -49.450  -1.470  1.00 135.82 ? 38  ASP G CA  1 
ATOM   6244  C C   . ASP G 2 16  ? -10.382 -48.766  -1.395  1.00 134.09 ? 38  ASP G C   1 
ATOM   6245  O O   . ASP G 2 16  ? -10.536 -47.731  -0.751  1.00 135.36 ? 38  ASP G O   1 
ATOM   6246  C CB  . ASP G 2 16  ? -8.315  -49.487  -0.093  1.00 137.79 ? 38  ASP G CB  1 
ATOM   6247  C CG  . ASP G 2 16  ? -8.988  -50.428  0.904   1.00 141.43 ? 38  ASP G CG  1 
ATOM   6248  O OD1 . ASP G 2 16  ? -10.134 -50.877  0.678   1.00 152.18 ? 38  ASP G OD1 1 
ATOM   6249  O OD2 . ASP G 2 16  ? -8.357  -50.714  1.945   1.00 142.40 ? 38  ASP G OD2 1 
ATOM   6250  N N   . ASN G 2 17  ? -11.374 -49.364  -2.048  1.00 135.83 ? 39  ASN G N   1 
ATOM   6251  C CA  . ASN G 2 17  ? -12.737 -48.809  -2.106  1.00 137.84 ? 39  ASN G CA  1 
ATOM   6252  C C   . ASN G 2 17  ? -13.540 -48.976  -0.813  1.00 135.38 ? 39  ASN G C   1 
ATOM   6253  O O   . ASN G 2 17  ? -14.574 -48.334  -0.654  1.00 140.47 ? 39  ASN G O   1 
ATOM   6254  C CB  . ASN G 2 17  ? -13.530 -49.409  -3.277  1.00 141.27 ? 39  ASN G CB  1 
ATOM   6255  C CG  . ASN G 2 17  ? -12.906 -49.100  -4.628  1.00 150.98 ? 39  ASN G CG  1 
ATOM   6256  O OD1 . ASN G 2 17  ? -12.357 -48.007  -4.841  1.00 158.26 ? 39  ASN G OD1 1 
ATOM   6257  N ND2 . ASN G 2 17  ? -12.985 -50.065  -5.553  1.00 154.60 ? 39  ASN G ND2 1 
ATOM   6258  N N   . ASN G 2 18  ? -13.086 -49.843  0.091   1.00 135.32 ? 40  ASN G N   1 
ATOM   6259  C CA  . ASN G 2 18  ? -13.690 -49.971  1.419   1.00 136.03 ? 40  ASN G CA  1 
ATOM   6260  C C   . ASN G 2 18  ? -13.230 -48.819  2.337   1.00 139.47 ? 40  ASN G C   1 
ATOM   6261  O O   . ASN G 2 18  ? -14.039 -48.278  3.098   1.00 146.52 ? 40  ASN G O   1 
ATOM   6262  C CB  . ASN G 2 18  ? -13.371 -51.340  2.034   1.00 130.69 ? 40  ASN G CB  1 
ATOM   6263  N N   . ARG G 2 19  ? -11.948 -48.442  2.249   1.00 136.64 ? 41  ARG G N   1 
ATOM   6264  C CA  . ARG G 2 19  ? -11.370 -47.344  3.043   1.00 133.57 ? 41  ARG G CA  1 
ATOM   6265  C C   . ARG G 2 19  ? -11.136 -46.059  2.206   1.00 137.35 ? 41  ARG G C   1 
ATOM   6266  O O   . ARG G 2 19  ? -10.083 -45.420  2.309   1.00 140.49 ? 41  ARG G O   1 
ATOM   6267  C CB  . ARG G 2 19  ? -10.066 -47.813  3.705   1.00 124.53 ? 41  ARG G CB  1 
ATOM   6268  N N   . ASN G 2 20  ? -12.148 -45.686  1.409   1.00 136.89 ? 42  ASN G N   1 
ATOM   6269  C CA  . ASN G 2 20  ? -12.174 -44.438  0.604   1.00 138.63 ? 42  ASN G CA  1 
ATOM   6270  C C   . ASN G 2 20  ? -10.930 -44.156  -0.238  1.00 139.21 ? 42  ASN G C   1 
ATOM   6271  O O   . ASN G 2 20  ? -10.102 -43.333  0.129   1.00 145.58 ? 42  ASN G O   1 
ATOM   6272  C CB  . ASN G 2 20  ? -12.501 -43.204  1.486   1.00 141.57 ? 42  ASN G CB  1 
ATOM   6273  C CG  . ASN G 2 20  ? -13.933 -43.162  1.976   1.00 148.58 ? 42  ASN G CG  1 
ATOM   6274  O OD1 . ASN G 2 20  ? -14.697 -44.106  1.769   1.00 164.63 ? 42  ASN G OD1 1 
ATOM   6275  N ND2 . ASN G 2 20  ? -14.252 -42.145  2.737   1.00 142.75 ? 42  ASN G ND2 1 
ATOM   6276  N N   . GLN G 2 21  ? -10.787 -44.877  -1.348  1.00 139.88 ? 43  GLN G N   1 
ATOM   6277  C CA  . GLN G 2 21  ? -9.800  -44.584  -2.412  1.00 143.26 ? 43  GLN G CA  1 
ATOM   6278  C C   . GLN G 2 21  ? -8.300  -44.512  -2.028  1.00 144.45 ? 43  GLN G C   1 
ATOM   6279  O O   . GLN G 2 21  ? -7.467  -44.232  -2.892  1.00 149.10 ? 43  GLN G O   1 
ATOM   6280  C CB  . GLN G 2 21  ? -10.181 -43.288  -3.134  1.00 151.50 ? 43  GLN G CB  1 
ATOM   6281  C CG  . GLN G 2 21  ? -11.670 -43.100  -3.419  1.00 158.08 ? 43  GLN G CG  1 
ATOM   6282  C CD  . GLN G 2 21  ? -12.274 -44.233  -4.214  1.00 157.79 ? 43  GLN G CD  1 
ATOM   6283  O OE1 . GLN G 2 21  ? -13.250 -44.853  -3.792  1.00 157.73 ? 43  GLN G OE1 1 
ATOM   6284  N NE2 . GLN G 2 21  ? -11.695 -44.512  -5.373  1.00 160.82 ? 43  GLN G NE2 1 
ATOM   6285  N N   . ILE G 2 22  ? -7.957  -44.778  -0.767  1.00 145.87 ? 44  ILE G N   1 
ATOM   6286  C CA  . ILE G 2 22  ? -6.584  -44.612  -0.284  1.00 148.08 ? 44  ILE G CA  1 
ATOM   6287  C C   . ILE G 2 22  ? -5.677  -45.713  -0.833  1.00 152.01 ? 44  ILE G C   1 
ATOM   6288  O O   . ILE G 2 22  ? -6.112  -46.845  -1.025  1.00 157.01 ? 44  ILE G O   1 
ATOM   6289  C CB  . ILE G 2 22  ? -6.519  -44.573  1.268   1.00 150.71 ? 44  ILE G CB  1 
ATOM   6290  C CG1 . ILE G 2 22  ? -5.154  -44.052  1.731   1.00 159.93 ? 44  ILE G CG1 1 
ATOM   6291  C CG2 . ILE G 2 22  ? -6.835  -45.941  1.899   1.00 145.54 ? 44  ILE G CG2 1 
ATOM   6292  C CD1 . ILE G 2 22  ? -5.119  -43.690  3.209   1.00 162.95 ? 44  ILE G CD1 1 
ATOM   6293  N N   . CYS G 2 23  ? -4.421  -45.365  -1.097  1.00 155.17 ? 45  CYS G N   1 
ATOM   6294  C CA  . CYS G 2 23  ? -3.467  -46.301  -1.696  1.00 157.52 ? 45  CYS G CA  1 
ATOM   6295  C C   . CYS G 2 23  ? -2.880  -47.237  -0.637  1.00 154.97 ? 45  CYS G C   1 
ATOM   6296  O O   . CYS G 2 23  ? -1.777  -47.010  -0.127  1.00 153.43 ? 45  CYS G O   1 
ATOM   6297  C CB  . CYS G 2 23  ? -2.363  -45.564  -2.456  1.00 166.43 ? 45  CYS G CB  1 
ATOM   6298  S SG  . CYS G 2 23  ? -2.958  -44.372  -3.678  1.00 185.32 ? 45  CYS G SG  1 
ATOM   6299  N N   . SER G 2 24  ? -3.642  -48.289  -0.315  1.00 149.43 ? 46  SER G N   1 
ATOM   6300  C CA  . SER G 2 24  ? -3.219  -49.310  0.651   1.00 142.90 ? 46  SER G CA  1 
ATOM   6301  C C   . SER G 2 24  ? -2.182  -50.237  0.013   1.00 138.24 ? 46  SER G C   1 
ATOM   6302  O O   . SER G 2 24  ? -2.282  -50.527  -1.181  1.00 126.03 ? 46  SER G O   1 
ATOM   6303  C CB  . SER G 2 24  ? -4.412  -50.145  1.117   1.00 138.04 ? 46  SER G CB  1 
ATOM   6304  O OG  . SER G 2 24  ? -5.462  -49.323  1.602   1.00 135.87 ? 46  SER G OG  1 
ATOM   6305  N N   . PRO G 2 25  ? -1.191  -50.718  0.799   1.00 137.54 ? 47  PRO G N   1 
ATOM   6306  C CA  . PRO G 2 25  ? -0.232  -51.655  0.217   1.00 138.12 ? 47  PRO G CA  1 
ATOM   6307  C C   . PRO G 2 25  ? -0.854  -53.031  -0.007  1.00 138.68 ? 47  PRO G C   1 
ATOM   6308  O O   . PRO G 2 25  ? -1.830  -53.384  0.663   1.00 130.66 ? 47  PRO G O   1 
ATOM   6309  C CB  . PRO G 2 25  ? 0.906   -51.721  1.252   1.00 138.53 ? 47  PRO G CB  1 
ATOM   6310  C CG  . PRO G 2 25  ? 0.491   -50.853  2.389   1.00 140.00 ? 47  PRO G CG  1 
ATOM   6311  C CD  . PRO G 2 25  ? -0.973  -50.570  2.247   1.00 137.95 ? 47  PRO G CD  1 
ATOM   6312  N N   . CYS G 2 26  ? -0.288  -53.784  -0.949  1.00 142.50 ? 48  CYS G N   1 
ATOM   6313  C CA  . CYS G 2 26  ? -0.766  -55.129  -1.252  1.00 140.42 ? 48  CYS G CA  1 
ATOM   6314  C C   . CYS G 2 26  ? -0.623  -56.009  -0.008  1.00 140.25 ? 48  CYS G C   1 
ATOM   6315  O O   . CYS G 2 26  ? 0.453   -56.043  0.588   1.00 141.49 ? 48  CYS G O   1 
ATOM   6316  C CB  . CYS G 2 26  ? 0.004   -55.766  -2.432  1.00 140.28 ? 48  CYS G CB  1 
ATOM   6317  S SG  . CYS G 2 26  ? -0.433  -55.207  -4.104  1.00 149.41 ? 48  CYS G SG  1 
ATOM   6318  N N   . PRO G 2 27  ? -1.705  -56.712  0.392   1.00 137.85 ? 49  PRO G N   1 
ATOM   6319  C CA  . PRO G 2 27  ? -1.614  -57.594  1.564   1.00 140.80 ? 49  PRO G CA  1 
ATOM   6320  C C   . PRO G 2 27  ? -0.678  -58.796  1.336   1.00 147.68 ? 49  PRO G C   1 
ATOM   6321  O O   . PRO G 2 27  ? -0.116  -58.938  0.249   1.00 145.82 ? 49  PRO G O   1 
ATOM   6322  C CB  . PRO G 2 27  ? -3.069  -58.030  1.799   1.00 139.47 ? 49  PRO G CB  1 
ATOM   6323  C CG  . PRO G 2 27  ? -3.787  -57.774  0.517   1.00 132.97 ? 49  PRO G CG  1 
ATOM   6324  C CD  . PRO G 2 27  ? -3.055  -56.703  -0.210  1.00 133.85 ? 49  PRO G CD  1 
ATOM   6325  N N   . PRO G 2 28  ? -0.477  -59.643  2.364   1.00 156.86 ? 50  PRO G N   1 
ATOM   6326  C CA  . PRO G 2 28  ? 0.448   -60.771  2.174   1.00 158.78 ? 50  PRO G CA  1 
ATOM   6327  C C   . PRO G 2 28  ? 0.001   -61.730  1.053   1.00 157.43 ? 50  PRO G C   1 
ATOM   6328  O O   . PRO G 2 28  ? -1.210  -61.948  0.858   1.00 158.92 ? 50  PRO G O   1 
ATOM   6329  C CB  . PRO G 2 28  ? 0.431   -61.480  3.537   1.00 167.23 ? 50  PRO G CB  1 
ATOM   6330  C CG  . PRO G 2 28  ? -0.038  -60.446  4.510   1.00 168.17 ? 50  PRO G CG  1 
ATOM   6331  C CD  . PRO G 2 28  ? -0.990  -59.572  3.747   1.00 162.80 ? 50  PRO G CD  1 
ATOM   6332  N N   . ASN G 2 29  ? 0.985   -62.268  0.333   1.00 151.76 ? 51  ASN G N   1 
ATOM   6333  C CA  . ASN G 2 29  ? 0.774   -63.181  -0.798  1.00 149.56 ? 51  ASN G CA  1 
ATOM   6334  C C   . ASN G 2 29  ? 0.030   -62.535  -1.978  1.00 142.69 ? 51  ASN G C   1 
ATOM   6335  O O   . ASN G 2 29  ? -0.767  -63.191  -2.645  1.00 144.23 ? 51  ASN G O   1 
ATOM   6336  C CB  . ASN G 2 29  ? 0.037   -64.464  -0.372  1.00 152.82 ? 51  ASN G CB  1 
ATOM   6337  C CG  . ASN G 2 29  ? 0.607   -65.076  0.885   1.00 159.08 ? 51  ASN G CG  1 
ATOM   6338  O OD1 . ASN G 2 29  ? 1.821   -65.256  1.005   1.00 166.77 ? 51  ASN G OD1 1 
ATOM   6339  N ND2 . ASN G 2 29  ? -0.271  -65.405  1.834   1.00 165.13 ? 51  ASN G ND2 1 
ATOM   6340  N N   . SER G 2 30  ? 0.308   -61.261  -2.252  1.00 136.86 ? 52  SER G N   1 
ATOM   6341  C CA  . SER G 2 30  ? -0.321  -60.559  -3.372  1.00 128.76 ? 52  SER G CA  1 
ATOM   6342  C C   . SER G 2 30  ? 0.565   -59.484  -3.965  1.00 128.82 ? 52  SER G C   1 
ATOM   6343  O O   . SER G 2 30  ? 1.530   -59.049  -3.342  1.00 136.03 ? 52  SER G O   1 
ATOM   6344  C CB  . SER G 2 30  ? -1.649  -59.953  -2.945  1.00 126.06 ? 52  SER G CB  1 
ATOM   6345  O OG  . SER G 2 30  ? -1.497  -59.064  -1.858  1.00 121.78 ? 52  SER G OG  1 
ATOM   6346  N N   . PHE G 2 31  ? 0.220   -59.058  -5.178  1.00 129.38 ? 53  PHE G N   1 
ATOM   6347  C CA  . PHE G 2 31  ? 1.048   -58.132  -5.945  1.00 129.18 ? 53  PHE G CA  1 
ATOM   6348  C C   . PHE G 2 31  ? 0.232   -57.291  -6.918  1.00 132.16 ? 53  PHE G C   1 
ATOM   6349  O O   . PHE G 2 31  ? -0.951  -57.560  -7.163  1.00 132.50 ? 53  PHE G O   1 
ATOM   6350  C CB  . PHE G 2 31  ? 2.120   -58.921  -6.724  1.00 129.73 ? 53  PHE G CB  1 
ATOM   6351  C CG  . PHE G 2 31  ? 1.596   -59.605  -7.958  1.00 129.99 ? 53  PHE G CG  1 
ATOM   6352  C CD1 . PHE G 2 31  ? 1.784   -59.044  -9.212  1.00 132.54 ? 53  PHE G CD1 1 
ATOM   6353  C CD2 . PHE G 2 31  ? 0.900   -60.805  -7.863  1.00 130.48 ? 53  PHE G CD2 1 
ATOM   6354  C CE1 . PHE G 2 31  ? 1.292   -59.658  -10.354 1.00 135.48 ? 53  PHE G CE1 1 
ATOM   6355  C CE2 . PHE G 2 31  ? 0.407   -61.430  -8.998  1.00 132.47 ? 53  PHE G CE2 1 
ATOM   6356  C CZ  . PHE G 2 31  ? 0.597   -60.850  -10.247 1.00 136.07 ? 53  PHE G CZ  1 
ATOM   6357  N N   . SER G 2 32  ? 0.894   -56.272  -7.466  1.00 138.19 ? 54  SER G N   1 
ATOM   6358  C CA  . SER G 2 32  ? 0.384   -55.500  -8.609  1.00 138.46 ? 54  SER G CA  1 
ATOM   6359  C C   . SER G 2 32  ? 1.562   -54.881  -9.356  1.00 139.47 ? 54  SER G C   1 
ATOM   6360  O O   . SER G 2 32  ? 2.265   -54.043  -8.797  1.00 146.02 ? 54  SER G O   1 
ATOM   6361  C CB  . SER G 2 32  ? -0.595  -54.416  -8.155  1.00 135.82 ? 54  SER G CB  1 
ATOM   6362  O OG  . SER G 2 32  ? -0.042  -53.575  -7.175  1.00 131.92 ? 54  SER G OG  1 
ATOM   6363  N N   . SER G 2 33  ? 1.789   -55.319  -10.598 1.00 141.83 ? 55  SER G N   1 
ATOM   6364  C CA  . SER G 2 33  ? 2.888   -54.804  -11.434 1.00 147.50 ? 55  SER G CA  1 
ATOM   6365  C C   . SER G 2 33  ? 2.484   -53.603  -12.298 1.00 153.58 ? 55  SER G C   1 
ATOM   6366  O O   . SER G 2 33  ? 3.279   -53.132  -13.110 1.00 156.97 ? 55  SER G O   1 
ATOM   6367  C CB  . SER G 2 33  ? 3.467   -55.920  -12.312 1.00 147.31 ? 55  SER G CB  1 
ATOM   6368  O OG  . SER G 2 33  ? 2.489   -56.453  -13.177 1.00 150.56 ? 55  SER G OG  1 
ATOM   6369  N N   . ALA G 2 34  ? 1.243   -53.129  -12.132 1.00 154.87 ? 56  ALA G N   1 
ATOM   6370  C CA  . ALA G 2 34  ? 0.774   -51.890  -12.742 1.00 156.28 ? 56  ALA G CA  1 
ATOM   6371  C C   . ALA G 2 34  ? 0.055   -51.035  -11.693 1.00 154.00 ? 56  ALA G C   1 
ATOM   6372  O O   . ALA G 2 34  ? -0.328  -51.526  -10.625 1.00 155.05 ? 56  ALA G O   1 
ATOM   6373  C CB  . ALA G 2 34  ? -0.146  -52.206  -13.908 1.00 157.57 ? 56  ALA G CB  1 
ATOM   6374  N N   . GLY G 2 35  ? -0.106  -49.755  -12.009 1.00 153.06 ? 57  GLY G N   1 
ATOM   6375  C CA  . GLY G 2 35  ? -0.838  -48.829  -11.156 1.00 151.58 ? 57  GLY G CA  1 
ATOM   6376  C C   . GLY G 2 35  ? -2.323  -48.849  -11.459 1.00 151.09 ? 57  GLY G C   1 
ATOM   6377  O O   . GLY G 2 35  ? -2.776  -49.494  -12.409 1.00 148.34 ? 57  GLY G O   1 
ATOM   6378  N N   . GLY G 2 36  ? -3.088  -48.150  -10.630 1.00 151.75 ? 58  GLY G N   1 
ATOM   6379  C CA  . GLY G 2 36  ? -4.519  -47.971  -10.851 1.00 152.24 ? 58  GLY G CA  1 
ATOM   6380  C C   . GLY G 2 36  ? -5.432  -49.142  -10.554 1.00 151.50 ? 58  GLY G C   1 
ATOM   6381  O O   . GLY G 2 36  ? -6.635  -49.030  -10.784 1.00 151.44 ? 58  GLY G O   1 
ATOM   6382  N N   . GLN G 2 37  ? -4.886  -50.246  -10.031 1.00 150.85 ? 59  GLN G N   1 
ATOM   6383  C CA  . GLN G 2 37  ? -5.680  -51.452  -9.792  1.00 150.98 ? 59  GLN G CA  1 
ATOM   6384  C C   . GLN G 2 37  ? -6.539  -51.313  -8.531  1.00 144.09 ? 59  GLN G C   1 
ATOM   6385  O O   . GLN G 2 37  ? -6.074  -50.801  -7.519  1.00 132.52 ? 59  GLN G O   1 
ATOM   6386  C CB  . GLN G 2 37  ? -4.770  -52.682  -9.704  1.00 155.39 ? 59  GLN G CB  1 
ATOM   6387  C CG  . GLN G 2 37  ? -3.985  -52.990  -10.980 1.00 159.86 ? 59  GLN G CG  1 
ATOM   6388  C CD  . GLN G 2 37  ? -3.147  -54.259  -10.888 1.00 162.33 ? 59  GLN G CD  1 
ATOM   6389  O OE1 . GLN G 2 37  ? -3.402  -55.131  -10.052 1.00 159.60 ? 59  GLN G OE1 1 
ATOM   6390  N NE2 . GLN G 2 37  ? -2.137  -54.366  -11.755 1.00 167.08 ? 59  GLN G NE2 1 
ATOM   6391  N N   . ARG G 2 38  ? -7.796  -51.752  -8.607  1.00 142.60 ? 60  ARG G N   1 
ATOM   6392  C CA  . ARG G 2 38  ? -8.722  -51.707  -7.461  1.00 140.88 ? 60  ARG G CA  1 
ATOM   6393  C C   . ARG G 2 38  ? -8.476  -52.844  -6.463  1.00 137.58 ? 60  ARG G C   1 
ATOM   6394  O O   . ARG G 2 38  ? -8.953  -52.785  -5.331  1.00 140.49 ? 60  ARG G O   1 
ATOM   6395  C CB  . ARG G 2 38  ? -10.175 -51.733  -7.939  1.00 144.07 ? 60  ARG G CB  1 
ATOM   6396  N N   . THR G 2 39  ? -7.756  -53.885  -6.892  1.00 132.58 ? 61  THR G N   1 
ATOM   6397  C CA  . THR G 2 39  ? -7.300  -54.980  -6.017  1.00 128.96 ? 61  THR G CA  1 
ATOM   6398  C C   . THR G 2 39  ? -5.944  -55.502  -6.461  1.00 129.22 ? 61  THR G C   1 
ATOM   6399  O O   . THR G 2 39  ? -5.563  -55.357  -7.623  1.00 130.81 ? 61  THR G O   1 
ATOM   6400  C CB  . THR G 2 39  ? -8.276  -56.178  -6.025  1.00 125.73 ? 61  THR G CB  1 
ATOM   6401  O OG1 . THR G 2 39  ? -8.562  -56.561  -7.371  1.00 121.03 ? 61  THR G OG1 1 
ATOM   6402  C CG2 . THR G 2 39  ? -9.577  -55.849  -5.312  1.00 126.83 ? 61  THR G CG2 1 
ATOM   6403  N N   . CYS G 2 40  ? -5.223  -56.115  -5.527  1.00 130.10 ? 62  CYS G N   1 
ATOM   6404  C CA  . CYS G 2 40  ? -3.967  -56.796  -5.844  1.00 131.45 ? 62  CYS G CA  1 
ATOM   6405  C C   . CYS G 2 40  ? -4.298  -58.230  -6.267  1.00 126.16 ? 62  CYS G C   1 
ATOM   6406  O O   . CYS G 2 40  ? -5.294  -58.809  -5.804  1.00 120.28 ? 62  CYS G O   1 
ATOM   6407  C CB  . CYS G 2 40  ? -3.011  -56.792  -4.651  1.00 136.58 ? 62  CYS G CB  1 
ATOM   6408  S SG  . CYS G 2 40  ? -2.487  -55.145  -4.145  1.00 142.67 ? 62  CYS G SG  1 
ATOM   6409  N N   . ASP G 2 41  ? -3.455  -58.781  -7.144  1.00 122.22 ? 63  ASP G N   1 
ATOM   6410  C CA  . ASP G 2 41  ? -3.628  -60.139  -7.642  1.00 125.64 ? 63  ASP G CA  1 
ATOM   6411  C C   . ASP G 2 41  ? -2.950  -61.121  -6.705  1.00 120.16 ? 63  ASP G C   1 
ATOM   6412  O O   . ASP G 2 41  ? -1.978  -60.762  -6.066  1.00 124.15 ? 63  ASP G O   1 
ATOM   6413  C CB  . ASP G 2 41  ? -3.022  -60.257  -9.040  1.00 131.99 ? 63  ASP G CB  1 
ATOM   6414  C CG  . ASP G 2 41  ? -3.639  -59.292  -10.036 1.00 138.07 ? 63  ASP G CG  1 
ATOM   6415  O OD1 . ASP G 2 41  ? -4.809  -58.875  -9.857  1.00 138.03 ? 63  ASP G OD1 1 
ATOM   6416  O OD2 . ASP G 2 41  ? -2.930  -58.944  -11.008 1.00 146.57 ? 63  ASP G OD2 1 
ATOM   6417  N N   . ILE G 2 42  ? -3.440  -62.359  -6.654  1.00 118.02 ? 64  ILE G N   1 
ATOM   6418  C CA  . ILE G 2 42  ? -2.888  -63.380  -5.746  1.00 117.86 ? 64  ILE G CA  1 
ATOM   6419  C C   . ILE G 2 42  ? -1.542  -63.860  -6.288  1.00 118.59 ? 64  ILE G C   1 
ATOM   6420  O O   . ILE G 2 42  ? -1.402  -64.091  -7.490  1.00 114.28 ? 64  ILE G O   1 
ATOM   6421  C CB  . ILE G 2 42  ? -3.798  -64.625  -5.619  1.00 119.69 ? 64  ILE G CB  1 
ATOM   6422  C CG1 . ILE G 2 42  ? -5.243  -64.268  -5.201  1.00 122.68 ? 64  ILE G CG1 1 
ATOM   6423  C CG2 . ILE G 2 42  ? -3.174  -65.640  -4.658  1.00 118.20 ? 64  ILE G CG2 1 
ATOM   6424  C CD1 . ILE G 2 42  ? -5.401  -63.927  -3.739  1.00 124.86 ? 64  ILE G CD1 1 
ATOM   6425  N N   . CYS G 2 43  ? -0.563  -64.026  -5.397  1.00 125.67 ? 65  CYS G N   1 
ATOM   6426  C CA  . CYS G 2 43  ? 0.770   -64.506  -5.772  1.00 128.02 ? 65  CYS G CA  1 
ATOM   6427  C C   . CYS G 2 43  ? 0.706   -65.963  -6.176  1.00 126.56 ? 65  CYS G C   1 
ATOM   6428  O O   . CYS G 2 43  ? -0.023  -66.748  -5.556  1.00 134.59 ? 65  CYS G O   1 
ATOM   6429  C CB  . CYS G 2 43  ? 1.768   -64.364  -4.614  1.00 136.99 ? 65  CYS G CB  1 
ATOM   6430  S SG  . CYS G 2 43  ? 2.493   -62.699  -4.400  1.00 150.02 ? 65  CYS G SG  1 
ATOM   6431  N N   . ARG G 2 44  ? 1.472   -66.330  -7.204  1.00 124.50 ? 66  ARG G N   1 
ATOM   6432  C CA  . ARG G 2 44  ? 1.526   -67.716  -7.678  1.00 123.07 ? 66  ARG G CA  1 
ATOM   6433  C C   . ARG G 2 44  ? 2.176   -68.587  -6.616  1.00 120.51 ? 66  ARG G C   1 
ATOM   6434  O O   . ARG G 2 44  ? 3.008   -68.115  -5.858  1.00 122.49 ? 66  ARG G O   1 
ATOM   6435  C CB  . ARG G 2 44  ? 2.300   -67.803  -8.991  1.00 126.38 ? 66  ARG G CB  1 
ATOM   6436  C CG  . ARG G 2 44  ? 2.393   -69.191  -9.603  1.00 133.51 ? 66  ARG G CG  1 
ATOM   6437  C CD  . ARG G 2 44  ? 3.217   -69.086  -10.866 1.00 140.36 ? 66  ARG G CD  1 
ATOM   6438  N NE  . ARG G 2 44  ? 2.605   -68.194  -11.854 1.00 145.57 ? 66  ARG G NE  1 
ATOM   6439  C CZ  . ARG G 2 44  ? 3.216   -67.661  -12.923 1.00 147.31 ? 66  ARG G CZ  1 
ATOM   6440  N NH1 . ARG G 2 44  ? 4.500   -67.924  -13.190 1.00 148.04 ? 66  ARG G NH1 1 
ATOM   6441  N NH2 . ARG G 2 44  ? 2.534   -66.871  -13.749 1.00 148.96 ? 66  ARG G NH2 1 
ATOM   6442  N N   . GLN G 2 45  ? 1.761   -69.853  -6.559  1.00 119.29 ? 67  GLN G N   1 
ATOM   6443  C CA  . GLN G 2 45  ? 2.312   -70.836  -5.647  1.00 116.43 ? 67  GLN G CA  1 
ATOM   6444  C C   . GLN G 2 45  ? 3.006   -71.845  -6.525  1.00 116.62 ? 67  GLN G C   1 
ATOM   6445  O O   . GLN G 2 45  ? 2.449   -72.289  -7.534  1.00 124.22 ? 67  GLN G O   1 
ATOM   6446  C CB  . GLN G 2 45  ? 1.192   -71.533  -4.888  1.00 115.22 ? 67  GLN G CB  1 
ATOM   6447  C CG  . GLN G 2 45  ? 1.280   -71.519  -3.356  1.00 121.91 ? 67  GLN G CG  1 
ATOM   6448  C CD  . GLN G 2 45  ? 0.324   -70.526  -2.754  1.00 127.53 ? 67  GLN G CD  1 
ATOM   6449  O OE1 . GLN G 2 45  ? 0.445   -69.344  -3.015  1.00 133.10 ? 67  GLN G OE1 1 
ATOM   6450  N NE2 . GLN G 2 45  ? -0.671  -71.005  -1.993  1.00 132.87 ? 67  GLN G NE2 1 
ATOM   6451  N N   . CYS G 2 46  ? 4.227   -72.213  -6.162  1.00 116.61 ? 68  CYS G N   1 
ATOM   6452  C CA  . CYS G 2 46  ? 4.971   -73.224  -6.896  1.00 117.81 ? 68  CYS G CA  1 
ATOM   6453  C C   . CYS G 2 46  ? 5.153   -74.395  -5.965  1.00 115.57 ? 68  CYS G C   1 
ATOM   6454  O O   . CYS G 2 46  ? 6.091   -74.429  -5.173  1.00 124.03 ? 68  CYS G O   1 
ATOM   6455  C CB  . CYS G 2 46  ? 6.303   -72.661  -7.367  1.00 122.13 ? 68  CYS G CB  1 
ATOM   6456  S SG  . CYS G 2 46  ? 6.128   -71.126  -8.312  1.00 125.87 ? 68  CYS G SG  1 
ATOM   6457  N N   . LYS G 2 47  ? 4.227   -75.343  -6.037  1.00 113.33 ? 69  LYS G N   1 
ATOM   6458  C CA  . LYS G 2 47  ? 4.251   -76.519  -5.174  1.00 110.31 ? 69  LYS G CA  1 
ATOM   6459  C C   . LYS G 2 47  ? 4.164   -77.779  -6.016  1.00 103.53 ? 69  LYS G C   1 
ATOM   6460  O O   . LYS G 2 47  ? 4.077   -77.691  -7.246  1.00 100.14 ? 69  LYS G O   1 
ATOM   6461  C CB  . LYS G 2 47  ? 3.108   -76.422  -4.166  1.00 111.37 ? 69  LYS G CB  1 
ATOM   6462  C CG  . LYS G 2 47  ? 3.105   -75.089  -3.448  1.00 118.87 ? 69  LYS G CG  1 
ATOM   6463  C CD  . LYS G 2 47  ? 2.321   -75.144  -2.145  1.00 129.80 ? 69  LYS G CD  1 
ATOM   6464  C CE  . LYS G 2 47  ? 2.749   -74.025  -1.187  1.00 141.68 ? 69  LYS G CE  1 
ATOM   6465  N NZ  . LYS G 2 47  ? 1.715   -73.805  -0.136  1.00 149.50 ? 69  LYS G NZ  1 
ATOM   6466  N N   . GLY G 2 48  ? 4.224   -78.936  -5.361  1.00 101.28 ? 70  GLY G N   1 
ATOM   6467  C CA  . GLY G 2 48  ? 4.141   -80.229  -6.054  1.00 103.43 ? 70  GLY G CA  1 
ATOM   6468  C C   . GLY G 2 48  ? 5.334   -80.454  -6.957  1.00 102.40 ? 70  GLY G C   1 
ATOM   6469  O O   . GLY G 2 48  ? 6.442   -80.469  -6.490  1.00 108.13 ? 70  GLY G O   1 
ATOM   6470  N N   . VAL G 2 49  ? 5.107   -80.612  -8.251  1.00 103.91 ? 71  VAL G N   1 
ATOM   6471  C CA  . VAL G 2 49  ? 6.208   -80.718  -9.207  1.00 106.89 ? 71  VAL G CA  1 
ATOM   6472  C C   . VAL G 2 49  ? 6.868   -79.385  -9.517  1.00 105.26 ? 71  VAL G C   1 
ATOM   6473  O O   . VAL G 2 49  ? 7.881   -79.369  -10.197 1.00 103.64 ? 71  VAL G O   1 
ATOM   6474  C CB  . VAL G 2 49  ? 5.803   -81.399  -10.538 1.00 113.73 ? 71  VAL G CB  1 
ATOM   6475  C CG1 . VAL G 2 49  ? 5.489   -82.874  -10.287 1.00 122.18 ? 71  VAL G CG1 1 
ATOM   6476  C CG2 . VAL G 2 49  ? 4.644   -80.677  -11.227 1.00 112.68 ? 71  VAL G CG2 1 
ATOM   6477  N N   . PHE G 2 50  ? 6.308   -78.281  -9.036  1.00 107.11 ? 72  PHE G N   1 
ATOM   6478  C CA  . PHE G 2 50  ? 6.914   -76.969  -9.233  1.00 111.23 ? 72  PHE G CA  1 
ATOM   6479  C C   . PHE G 2 50  ? 7.779   -76.558  -8.052  1.00 114.91 ? 72  PHE G C   1 
ATOM   6480  O O   . PHE G 2 50  ? 7.383   -76.739  -6.893  1.00 114.05 ? 72  PHE G O   1 
ATOM   6481  C CB  . PHE G 2 50  ? 5.839   -75.909  -9.467  1.00 114.67 ? 72  PHE G CB  1 
ATOM   6482  C CG  . PHE G 2 50  ? 4.998   -76.163  -10.697 1.00 115.21 ? 72  PHE G CG  1 
ATOM   6483  C CD1 . PHE G 2 50  ? 5.581   -76.118  -11.957 1.00 115.38 ? 72  PHE G CD1 1 
ATOM   6484  C CD2 . PHE G 2 50  ? 3.643   -76.455  -10.602 1.00 111.73 ? 72  PHE G CD2 1 
ATOM   6485  C CE1 . PHE G 2 50  ? 4.829   -76.351  -13.093 1.00 112.43 ? 72  PHE G CE1 1 
ATOM   6486  C CE2 . PHE G 2 50  ? 2.904   -76.698  -11.741 1.00 110.58 ? 72  PHE G CE2 1 
ATOM   6487  C CZ  . PHE G 2 50  ? 3.493   -76.630  -13.002 1.00 109.26 ? 72  PHE G CZ  1 
ATOM   6488  N N   . ARG G 2 51  ? 8.977   -76.051  -8.364  1.00 120.85 ? 73  ARG G N   1 
ATOM   6489  C CA  . ARG G 2 51  ? 9.842   -75.326  -7.426  1.00 121.07 ? 73  ARG G CA  1 
ATOM   6490  C C   . ARG G 2 51  ? 9.736   -73.841  -7.757  1.00 120.92 ? 73  ARG G C   1 
ATOM   6491  O O   . ARG G 2 51  ? 9.502   -73.473  -8.910  1.00 119.59 ? 73  ARG G O   1 
ATOM   6492  C CB  . ARG G 2 51  ? 11.307  -75.761  -7.582  1.00 120.18 ? 73  ARG G CB  1 
ATOM   6493  N N   . THR G 2 52  ? 9.912   -72.986  -6.754  1.00 122.79 ? 74  THR G N   1 
ATOM   6494  C CA  . THR G 2 52  ? 9.951   -71.540  -6.974  1.00 126.12 ? 74  THR G CA  1 
ATOM   6495  C C   . THR G 2 52  ? 11.294  -71.118  -7.596  1.00 132.01 ? 74  THR G C   1 
ATOM   6496  O O   . THR G 2 52  ? 12.353  -71.424  -7.051  1.00 135.05 ? 74  THR G O   1 
ATOM   6497  C CB  . THR G 2 52  ? 9.762   -70.770  -5.655  1.00 125.06 ? 74  THR G CB  1 
ATOM   6498  O OG1 . THR G 2 52  ? 8.656   -71.329  -4.933  1.00 124.43 ? 74  THR G OG1 1 
ATOM   6499  C CG2 . THR G 2 52  ? 9.515   -69.280  -5.908  1.00 124.90 ? 74  THR G CG2 1 
ATOM   6500  N N   . ARG G 2 53  ? 11.242  -70.432  -8.734  1.00 136.83 ? 75  ARG G N   1 
ATOM   6501  C CA  . ARG G 2 53  ? 12.433  -69.856  -9.368  1.00 142.63 ? 75  ARG G CA  1 
ATOM   6502  C C   . ARG G 2 53  ? 12.684  -68.439  -8.862  1.00 142.88 ? 75  ARG G C   1 
ATOM   6503  O O   . ARG G 2 53  ? 13.796  -68.115  -8.473  1.00 149.27 ? 75  ARG G O   1 
ATOM   6504  C CB  . ARG G 2 53  ? 12.279  -69.845  -10.896 1.00 149.84 ? 75  ARG G CB  1 
ATOM   6505  C CG  . ARG G 2 53  ? 13.551  -69.571  -11.661 1.00 159.18 ? 75  ARG G CG  1 
ATOM   6506  C CD  . ARG G 2 53  ? 13.254  -69.678  -13.162 1.00 163.56 ? 75  ARG G CD  1 
ATOM   6507  N NE  . ARG G 2 53  ? 12.494  -68.529  -13.648 1.00 165.40 ? 75  ARG G NE  1 
ATOM   6508  C CZ  . ARG G 2 53  ? 11.821  -68.480  -14.805 1.00 170.20 ? 75  ARG G CZ  1 
ATOM   6509  N NH1 . ARG G 2 53  ? 11.743  -69.543  -15.615 1.00 173.02 ? 75  ARG G NH1 1 
ATOM   6510  N NH2 . ARG G 2 53  ? 11.194  -67.349  -15.148 1.00 171.88 ? 75  ARG G NH2 1 
ATOM   6511  N N   . LYS G 2 54  ? 11.650  -67.603  -8.880  1.00 144.23 ? 76  LYS G N   1 
ATOM   6512  C CA  . LYS G 2 54  ? 11.707  -66.232  -8.355  1.00 145.90 ? 76  LYS G CA  1 
ATOM   6513  C C   . LYS G 2 54  ? 10.608  -66.045  -7.321  1.00 139.31 ? 76  LYS G C   1 
ATOM   6514  O O   . LYS G 2 54  ? 9.477   -66.390  -7.578  1.00 145.47 ? 76  LYS G O   1 
ATOM   6515  C CB  . LYS G 2 54  ? 11.536  -65.212  -9.486  1.00 151.07 ? 76  LYS G CB  1 
ATOM   6516  C CG  . LYS G 2 54  ? 12.006  -63.817  -9.103  1.00 162.03 ? 76  LYS G CG  1 
ATOM   6517  C CD  . LYS G 2 54  ? 11.711  -62.769  -10.166 1.00 171.18 ? 76  LYS G CD  1 
ATOM   6518  C CE  . LYS G 2 54  ? 10.219  -62.472  -10.320 1.00 177.11 ? 76  LYS G CE  1 
ATOM   6519  N NZ  . LYS G 2 54  ? 9.503   -62.211  -9.040  1.00 178.57 ? 76  LYS G NZ  1 
ATOM   6520  N N   . GLU G 2 55  ? 10.943  -65.496  -6.162  1.00 135.00 ? 77  GLU G N   1 
ATOM   6521  C CA  . GLU G 2 55  ? 9.963   -65.292  -5.080  1.00 133.58 ? 77  GLU G CA  1 
ATOM   6522  C C   . GLU G 2 55  ? 9.023   -64.119  -5.416  1.00 135.49 ? 77  GLU G C   1 
ATOM   6523  O O   . GLU G 2 55  ? 9.349   -63.259  -6.203  1.00 141.08 ? 77  GLU G O   1 
ATOM   6524  C CB  . GLU G 2 55  ? 10.679  -65.046  -3.752  1.00 136.53 ? 77  GLU G CB  1 
ATOM   6525  N N   . CYS G 2 56  ? 7.842   -64.123  -4.812  1.00 140.09 ? 78  CYS G N   1 
ATOM   6526  C CA  . CYS G 2 56  ? 6.815   -63.113  -5.085  1.00 144.14 ? 78  CYS G CA  1 
ATOM   6527  C C   . CYS G 2 56  ? 7.031   -61.838  -4.288  1.00 141.88 ? 78  CYS G C   1 
ATOM   6528  O O   . CYS G 2 56  ? 6.879   -61.835  -3.067  1.00 142.74 ? 78  CYS G O   1 
ATOM   6529  C CB  . CYS G 2 56  ? 5.411   -63.657  -4.789  1.00 149.17 ? 78  CYS G CB  1 
ATOM   6530  S SG  . CYS G 2 56  ? 4.125   -62.677  -5.617  1.00 163.21 ? 78  CYS G SG  1 
ATOM   6531  N N   . SER G 2 57  ? 7.372   -60.761  -4.987  1.00 144.53 ? 79  SER G N   1 
ATOM   6532  C CA  . SER G 2 57  ? 7.354   -59.409  -4.394  1.00 148.32 ? 79  SER G CA  1 
ATOM   6533  C C   . SER G 2 57  ? 5.940   -58.832  -4.446  1.00 144.55 ? 79  SER G C   1 
ATOM   6534  O O   . SER G 2 57  ? 5.025   -59.493  -4.921  1.00 146.07 ? 79  SER G O   1 
ATOM   6535  C CB  . SER G 2 57  ? 8.306   -58.491  -5.158  1.00 154.19 ? 79  SER G CB  1 
ATOM   6536  O OG  . SER G 2 57  ? 7.814   -58.229  -6.465  1.00 158.18 ? 79  SER G OG  1 
ATOM   6537  N N   . SER G 2 58  ? 5.769   -57.603  -3.964  1.00 145.70 ? 80  SER G N   1 
ATOM   6538  C CA  . SER G 2 58  ? 4.532   -56.848  -4.182  1.00 148.62 ? 80  SER G CA  1 
ATOM   6539  C C   . SER G 2 58  ? 4.530   -56.133  -5.538  1.00 151.75 ? 80  SER G C   1 
ATOM   6540  O O   . SER G 2 58  ? 3.490   -55.616  -5.964  1.00 149.63 ? 80  SER G O   1 
ATOM   6541  C CB  . SER G 2 58  ? 4.293   -55.838  -3.058  1.00 149.97 ? 80  SER G CB  1 
ATOM   6542  O OG  . SER G 2 58  ? 5.176   -54.730  -3.165  1.00 152.50 ? 80  SER G OG  1 
ATOM   6543  N N   . THR G 2 59  ? 5.689   -56.069  -6.201  1.00 157.30 ? 81  THR G N   1 
ATOM   6544  C CA  . THR G 2 59  ? 5.774   -55.566  -7.573  1.00 156.11 ? 81  THR G CA  1 
ATOM   6545  C C   . THR G 2 59  ? 5.285   -56.640  -8.529  1.00 152.15 ? 81  THR G C   1 
ATOM   6546  O O   . THR G 2 59  ? 4.266   -56.454  -9.178  1.00 153.75 ? 81  THR G O   1 
ATOM   6547  C CB  . THR G 2 59  ? 7.218   -55.170  -7.959  1.00 159.12 ? 81  THR G CB  1 
ATOM   6548  O OG1 . THR G 2 59  ? 7.682   -54.153  -7.068  1.00 167.90 ? 81  THR G OG1 1 
ATOM   6549  C CG2 . THR G 2 59  ? 7.289   -54.656  -9.410  1.00 159.09 ? 81  THR G CG2 1 
ATOM   6550  N N   . SER G 2 60  ? 6.010   -57.759  -8.597  1.00 146.26 ? 82  SER G N   1 
ATOM   6551  C CA  . SER G 2 60  ? 5.769   -58.780  -9.612  1.00 144.57 ? 82  SER G CA  1 
ATOM   6552  C C   . SER G 2 60  ? 5.365   -60.119  -9.004  1.00 138.10 ? 82  SER G C   1 
ATOM   6553  O O   . SER G 2 60  ? 5.600   -60.393  -7.828  1.00 132.71 ? 82  SER G O   1 
ATOM   6554  C CB  . SER G 2 60  ? 7.014   -58.964  -10.488 1.00 148.95 ? 82  SER G CB  1 
ATOM   6555  O OG  . SER G 2 60  ? 8.143   -59.363  -9.712  1.00 154.07 ? 82  SER G OG  1 
ATOM   6556  N N   . ASN G 2 61  ? 4.755   -60.945  -9.843  1.00 135.49 ? 83  ASN G N   1 
ATOM   6557  C CA  . ASN G 2 61  ? 4.361   -62.289  -9.474  1.00 129.49 ? 83  ASN G CA  1 
ATOM   6558  C C   . ASN G 2 61  ? 5.597   -63.187  -9.418  1.00 128.52 ? 83  ASN G C   1 
ATOM   6559  O O   . ASN G 2 61  ? 6.624   -62.900  -10.046 1.00 123.45 ? 83  ASN G O   1 
ATOM   6560  C CB  . ASN G 2 61  ? 3.364   -62.840  -10.508 1.00 126.38 ? 83  ASN G CB  1 
ATOM   6561  C CG  . ASN G 2 61  ? 2.592   -64.045  -10.009 1.00 122.74 ? 83  ASN G CG  1 
ATOM   6562  O OD1 . ASN G 2 61  ? 2.260   -64.154  -8.837  1.00 122.57 ? 83  ASN G OD1 1 
ATOM   6563  N ND2 . ASN G 2 61  ? 2.298   -64.958  -10.912 1.00 124.90 ? 83  ASN G ND2 1 
ATOM   6564  N N   . ALA G 2 62  ? 5.482   -64.282  -8.667  1.00 125.94 ? 84  ALA G N   1 
ATOM   6565  C CA  . ALA G 2 62  ? 6.487   -65.344  -8.664  1.00 124.53 ? 84  ALA G CA  1 
ATOM   6566  C C   . ALA G 2 62  ? 6.561   -66.054  -10.009 1.00 123.91 ? 84  ALA G C   1 
ATOM   6567  O O   . ALA G 2 62  ? 5.697   -65.883  -10.855 1.00 128.08 ? 84  ALA G O   1 
ATOM   6568  C CB  . ALA G 2 62  ? 6.177   -66.346  -7.563  1.00 123.17 ? 84  ALA G CB  1 
ATOM   6569  N N   . GLU G 2 63  ? 7.604   -66.852  -10.195 1.00 125.79 ? 85  GLU G N   1 
ATOM   6570  C CA  . GLU G 2 63  ? 7.748   -67.697  -11.379 1.00 132.59 ? 85  GLU G CA  1 
ATOM   6571  C C   . GLU G 2 63  ? 8.243   -69.062  -10.936 1.00 131.81 ? 85  GLU G C   1 
ATOM   6572  O O   . GLU G 2 63  ? 9.068   -69.141  -10.034 1.00 129.79 ? 85  GLU G O   1 
ATOM   6573  C CB  . GLU G 2 63  ? 8.703   -67.053  -12.379 1.00 143.44 ? 85  GLU G CB  1 
ATOM   6574  C CG  . GLU G 2 63  ? 8.030   -66.014  -13.281 1.00 151.45 ? 85  GLU G CG  1 
ATOM   6575  C CD  . GLU G 2 63  ? 8.959   -64.885  -13.690 1.00 162.37 ? 85  GLU G CD  1 
ATOM   6576  O OE1 . GLU G 2 63  ? 10.085  -65.174  -14.116 1.00 170.03 ? 85  GLU G OE1 1 
ATOM   6577  O OE2 . GLU G 2 63  ? 8.557   -63.679  -13.565 1.00 169.62 ? 85  GLU G OE2 1 
ATOM   6578  N N   . CYS G 2 64  ? 7.742   -70.120  -11.559 1.00 137.06 ? 86  CYS G N   1 
ATOM   6579  C CA  . CYS G 2 64  ? 8.092   -71.481  -11.172 1.00 142.11 ? 86  CYS G CA  1 
ATOM   6580  C C   . CYS G 2 64  ? 9.045   -72.110  -12.178 1.00 145.19 ? 86  CYS G C   1 
ATOM   6581  O O   . CYS G 2 64  ? 9.028   -71.769  -13.361 1.00 149.17 ? 86  CYS G O   1 
ATOM   6582  C CB  . CYS G 2 64  ? 6.833   -72.365  -11.068 1.00 142.96 ? 86  CYS G CB  1 
ATOM   6583  S SG  . CYS G 2 64  ? 5.411   -71.734  -10.120 1.00 147.74 ? 86  CYS G SG  1 
ATOM   6584  N N   . ASP G 2 65  ? 9.875   -73.030  -11.690 1.00 148.09 ? 87  ASP G N   1 
ATOM   6585  C CA  . ASP G 2 65  ? 10.565  -74.019  -12.535 1.00 146.05 ? 87  ASP G CA  1 
ATOM   6586  C C   . ASP G 2 65  ? 10.142  -75.404  -12.071 1.00 137.07 ? 87  ASP G C   1 
ATOM   6587  O O   . ASP G 2 65  ? 9.521   -75.543  -11.020 1.00 134.73 ? 87  ASP G O   1 
ATOM   6588  C CB  . ASP G 2 65  ? 12.104  -73.844  -12.515 1.00 156.12 ? 87  ASP G CB  1 
ATOM   6589  C CG  . ASP G 2 65  ? 12.735  -74.028  -11.111 1.00 166.65 ? 87  ASP G CG  1 
ATOM   6590  O OD1 . ASP G 2 65  ? 12.870  -75.175  -10.640 1.00 173.24 ? 87  ASP G OD1 1 
ATOM   6591  O OD2 . ASP G 2 65  ? 13.145  -73.020  -10.503 1.00 173.09 ? 87  ASP G OD2 1 
ATOM   6592  N N   . CYS G 2 66  ? 10.455  -76.425  -12.851 1.00 128.75 ? 88  CYS G N   1 
ATOM   6593  C CA  . CYS G 2 66  ? 10.145  -77.798  -12.474 1.00 128.51 ? 88  CYS G CA  1 
ATOM   6594  C C   . CYS G 2 66  ? 11.196  -78.346  -11.510 1.00 128.36 ? 88  CYS G C   1 
ATOM   6595  O O   . CYS G 2 66  ? 12.349  -77.947  -11.565 1.00 139.90 ? 88  CYS G O   1 
ATOM   6596  C CB  . CYS G 2 66  ? 10.052  -78.686  -13.704 1.00 128.63 ? 88  CYS G CB  1 
ATOM   6597  S SG  . CYS G 2 66  ? 8.706   -78.249  -14.812 1.00 145.06 ? 88  CYS G SG  1 
ATOM   6598  N N   . THR G 2 67  ? 10.791  -79.254  -10.633 1.00 127.73 ? 89  THR G N   1 
ATOM   6599  C CA  . THR G 2 67  ? 11.735  -79.996  -9.804  1.00 130.45 ? 89  THR G CA  1 
ATOM   6600  C C   . THR G 2 67  ? 12.590  -80.879  -10.716 1.00 133.77 ? 89  THR G C   1 
ATOM   6601  O O   . THR G 2 67  ? 12.143  -81.248  -11.821 1.00 128.43 ? 89  THR G O   1 
ATOM   6602  C CB  . THR G 2 67  ? 11.035  -80.899  -8.771  1.00 132.80 ? 89  THR G CB  1 
ATOM   6603  O OG1 . THR G 2 67  ? 10.074  -81.735  -9.433  1.00 133.33 ? 89  THR G OG1 1 
ATOM   6604  C CG2 . THR G 2 67  ? 10.371  -80.051  -7.696  1.00 133.90 ? 89  THR G CG2 1 
ATOM   6605  N N   . PRO G 2 68  ? 13.801  -81.256  -10.254 1.00 136.26 ? 90  PRO G N   1 
ATOM   6606  C CA  . PRO G 2 68  ? 14.675  -82.013  -11.126 1.00 135.04 ? 90  PRO G CA  1 
ATOM   6607  C C   . PRO G 2 68  ? 14.114  -83.396  -11.432 1.00 129.81 ? 90  PRO G C   1 
ATOM   6608  O O   . PRO G 2 68  ? 13.459  -83.997  -10.589 1.00 121.06 ? 90  PRO G O   1 
ATOM   6609  C CB  . PRO G 2 68  ? 15.987  -82.106  -10.324 1.00 139.41 ? 90  PRO G CB  1 
ATOM   6610  C CG  . PRO G 2 68  ? 15.759  -81.360  -9.050  1.00 140.56 ? 90  PRO G CG  1 
ATOM   6611  C CD  . PRO G 2 68  ? 14.294  -81.286  -8.869  1.00 138.14 ? 90  PRO G CD  1 
ATOM   6612  N N   . GLY G 2 69  ? 14.368  -83.864  -12.645 1.00 132.49 ? 91  GLY G N   1 
ATOM   6613  C CA  . GLY G 2 69  ? 13.737  -85.076  -13.163 1.00 134.13 ? 91  GLY G CA  1 
ATOM   6614  C C   . GLY G 2 69  ? 12.623  -84.752  -14.138 1.00 131.81 ? 91  GLY G C   1 
ATOM   6615  O O   . GLY G 2 69  ? 12.232  -85.618  -14.929 1.00 130.06 ? 91  GLY G O   1 
ATOM   6616  N N   . PHE G 2 70  ? 12.096  -83.527  -14.058 1.00 128.37 ? 92  PHE G N   1 
ATOM   6617  C CA  . PHE G 2 70  ? 11.174  -82.988  -15.053 1.00 125.62 ? 92  PHE G CA  1 
ATOM   6618  C C   . PHE G 2 70  ? 11.769  -81.742  -15.689 1.00 126.87 ? 92  PHE G C   1 
ATOM   6619  O O   . PHE G 2 70  ? 12.779  -81.218  -15.222 1.00 133.31 ? 92  PHE G O   1 
ATOM   6620  C CB  . PHE G 2 70  ? 9.858   -82.585  -14.403 1.00 123.65 ? 92  PHE G CB  1 
ATOM   6621  C CG  . PHE G 2 70  ? 9.186   -83.669  -13.634 1.00 118.45 ? 92  PHE G CG  1 
ATOM   6622  C CD1 . PHE G 2 70  ? 8.202   -84.452  -14.232 1.00 118.17 ? 92  PHE G CD1 1 
ATOM   6623  C CD2 . PHE G 2 70  ? 9.518   -83.888  -12.314 1.00 114.88 ? 92  PHE G CD2 1 
ATOM   6624  C CE1 . PHE G 2 70  ? 7.571   -85.449  -13.524 1.00 116.36 ? 92  PHE G CE1 1 
ATOM   6625  C CE2 . PHE G 2 70  ? 8.856   -84.876  -11.588 1.00 117.32 ? 92  PHE G CE2 1 
ATOM   6626  C CZ  . PHE G 2 70  ? 7.882   -85.652  -12.193 1.00 115.42 ? 92  PHE G CZ  1 
ATOM   6627  N N   . HIS G 2 71  ? 11.109  -81.267  -16.743 1.00 122.84 ? 93  HIS G N   1 
ATOM   6628  C CA  . HIS G 2 71  ? 11.469  -80.021  -17.420 1.00 125.01 ? 93  HIS G CA  1 
ATOM   6629  C C   . HIS G 2 71  ? 10.233  -79.226  -17.834 1.00 122.29 ? 93  HIS G C   1 
ATOM   6630  O O   . HIS G 2 71  ? 9.212   -79.810  -18.164 1.00 116.54 ? 93  HIS G O   1 
ATOM   6631  C CB  . HIS G 2 71  ? 12.327  -80.331  -18.648 1.00 128.49 ? 93  HIS G CB  1 
ATOM   6632  C CG  . HIS G 2 71  ? 11.686  -81.283  -19.607 1.00 129.37 ? 93  HIS G CG  1 
ATOM   6633  N ND1 . HIS G 2 71  ? 10.753  -80.879  -20.536 1.00 132.40 ? 93  HIS G ND1 1 
ATOM   6634  C CD2 . HIS G 2 71  ? 11.847  -82.620  -19.782 1.00 132.61 ? 93  HIS G CD2 1 
ATOM   6635  C CE1 . HIS G 2 71  ? 10.382  -81.926  -21.251 1.00 135.39 ? 93  HIS G CE1 1 
ATOM   6636  N NE2 . HIS G 2 71  ? 11.019  -82.995  -20.806 1.00 133.84 ? 93  HIS G NE2 1 
ATOM   6637  N N   . CYS G 2 72  ? 10.343  -77.898  -17.823 1.00 128.84 ? 94  CYS G N   1 
ATOM   6638  C CA  . CYS G 2 72  ? 9.237   -76.990  -18.189 1.00 133.50 ? 94  CYS G CA  1 
ATOM   6639  C C   . CYS G 2 72  ? 8.690   -77.247  -19.586 1.00 133.97 ? 94  CYS G C   1 
ATOM   6640  O O   . CYS G 2 72  ? 9.351   -77.858  -20.438 1.00 129.55 ? 94  CYS G O   1 
ATOM   6641  C CB  . CYS G 2 72  ? 9.671   -75.524  -18.102 1.00 144.79 ? 94  CYS G CB  1 
ATOM   6642  S SG  . CYS G 2 72  ? 9.780   -74.889  -16.424 1.00 173.82 ? 94  CYS G SG  1 
ATOM   6643  N N   . LEU G 2 73  ? 7.471   -76.758  -19.795 1.00 139.69 ? 95  LEU G N   1 
ATOM   6644  C CA  . LEU G 2 73  ? 6.744   -76.953  -21.047 1.00 135.68 ? 95  LEU G CA  1 
ATOM   6645  C C   . LEU G 2 73  ? 5.672   -75.879  -21.169 1.00 139.91 ? 95  LEU G C   1 
ATOM   6646  O O   . LEU G 2 73  ? 4.965   -75.598  -20.198 1.00 140.56 ? 95  LEU G O   1 
ATOM   6647  C CB  . LEU G 2 73  ? 6.103   -78.351  -21.059 1.00 127.50 ? 95  LEU G CB  1 
ATOM   6648  C CG  . LEU G 2 73  ? 5.871   -79.049  -22.377 1.00 128.38 ? 95  LEU G CG  1 
ATOM   6649  C CD1 . LEU G 2 73  ? 7.175   -79.195  -23.138 1.00 134.41 ? 95  LEU G CD1 1 
ATOM   6650  C CD2 . LEU G 2 73  ? 5.264   -80.414  -22.133 1.00 124.87 ? 95  LEU G CD2 1 
ATOM   6651  N N   . GLY G 2 74  ? 5.568   -75.274  -22.349 1.00 144.53 ? 96  GLY G N   1 
ATOM   6652  C CA  . GLY G 2 74  ? 4.643   -74.153  -22.554 1.00 150.70 ? 96  GLY G CA  1 
ATOM   6653  C C   . GLY G 2 74  ? 5.096   -72.868  -21.878 1.00 150.68 ? 96  GLY G C   1 
ATOM   6654  O O   . GLY G 2 74  ? 6.084   -72.854  -21.137 1.00 146.86 ? 96  GLY G O   1 
ATOM   6655  N N   . ALA G 2 75  ? 4.361   -71.789  -22.132 1.00 153.46 ? 97  ALA G N   1 
ATOM   6656  C CA  . ALA G 2 75  ? 4.722   -70.462  -21.630 1.00 157.42 ? 97  ALA G CA  1 
ATOM   6657  C C   . ALA G 2 75  ? 4.549   -70.366  -20.116 1.00 159.71 ? 97  ALA G C   1 
ATOM   6658  O O   . ALA G 2 75  ? 3.608   -70.937  -19.557 1.00 153.24 ? 97  ALA G O   1 
ATOM   6659  C CB  . ALA G 2 75  ? 3.901   -69.387  -22.326 1.00 158.36 ? 97  ALA G CB  1 
ATOM   6660  N N   . GLY G 2 76  ? 5.476   -69.651  -19.469 1.00 165.98 ? 98  GLY G N   1 
ATOM   6661  C CA  . GLY G 2 76  ? 5.474   -69.449  -18.010 1.00 164.94 ? 98  GLY G CA  1 
ATOM   6662  C C   . GLY G 2 76  ? 5.653   -70.708  -17.174 1.00 164.32 ? 98  GLY G C   1 
ATOM   6663  O O   . GLY G 2 76  ? 5.313   -70.714  -15.986 1.00 166.46 ? 98  GLY G O   1 
ATOM   6664  N N   . CYS G 2 77  ? 6.209   -71.757  -17.786 1.00 162.23 ? 99  CYS G N   1 
ATOM   6665  C CA  . CYS G 2 77  ? 6.263   -73.098  -17.205 1.00 157.35 ? 99  CYS G CA  1 
ATOM   6666  C C   . CYS G 2 77  ? 4.880   -73.543  -16.730 1.00 149.83 ? 99  CYS G C   1 
ATOM   6667  O O   . CYS G 2 77  ? 4.628   -73.709  -15.533 1.00 144.15 ? 99  CYS G O   1 
ATOM   6668  C CB  . CYS G 2 77  ? 7.300   -73.163  -16.095 1.00 164.58 ? 99  CYS G CB  1 
ATOM   6669  S SG  . CYS G 2 77  ? 7.846   -74.838  -15.736 1.00 171.78 ? 99  CYS G SG  1 
ATOM   6670  N N   . SER G 2 78  ? 3.986   -73.705  -17.702 1.00 141.98 ? 100 SER G N   1 
ATOM   6671  C CA  . SER G 2 78  ? 2.592   -74.037  -17.435 1.00 130.76 ? 100 SER G CA  1 
ATOM   6672  C C   . SER G 2 78  ? 2.426   -75.463  -16.944 1.00 124.10 ? 100 SER G C   1 
ATOM   6673  O O   . SER G 2 78  ? 1.558   -75.727  -16.118 1.00 120.77 ? 100 SER G O   1 
ATOM   6674  C CB  . SER G 2 78  ? 1.753   -73.839  -18.693 1.00 134.91 ? 100 SER G CB  1 
ATOM   6675  O OG  . SER G 2 78  ? 2.107   -74.787  -19.694 1.00 139.62 ? 100 SER G OG  1 
ATOM   6676  N N   . MET G 2 79  ? 3.235   -76.388  -17.465 1.00 122.48 ? 101 MET G N   1 
ATOM   6677  C CA  . MET G 2 79  ? 3.321   -77.734  -16.892 1.00 119.97 ? 101 MET G CA  1 
ATOM   6678  C C   . MET G 2 79  ? 4.644   -78.425  -17.149 1.00 120.57 ? 101 MET G C   1 
ATOM   6679  O O   . MET G 2 79  ? 5.388   -78.061  -18.039 1.00 125.11 ? 101 MET G O   1 
ATOM   6680  C CB  . MET G 2 79  ? 2.176   -78.617  -17.374 1.00 115.39 ? 101 MET G CB  1 
ATOM   6681  C CG  . MET G 2 79  ? 2.056   -78.842  -18.850 1.00 116.31 ? 101 MET G CG  1 
ATOM   6682  S SD  . MET G 2 79  ? 0.532   -79.863  -19.017 1.00 119.03 ? 101 MET G SD  1 
ATOM   6683  C CE  . MET G 2 79  ? 0.718   -80.548  -20.654 1.00 118.85 ? 101 MET G CE  1 
ATOM   6684  N N   . CYS G 2 80  ? 4.918   -79.428  -16.323 1.00 123.22 ? 102 CYS G N   1 
ATOM   6685  C CA  . CYS G 2 80  ? 6.176   -80.168  -16.321 1.00 123.66 ? 102 CYS G CA  1 
ATOM   6686  C C   . CYS G 2 80  ? 6.033   -81.472  -17.076 1.00 122.23 ? 102 CYS G C   1 
ATOM   6687  O O   . CYS G 2 80  ? 4.925   -81.993  -17.242 1.00 129.24 ? 102 CYS G O   1 
ATOM   6688  C CB  . CYS G 2 80  ? 6.585   -80.450  -14.876 1.00 126.94 ? 102 CYS G CB  1 
ATOM   6689  S SG  . CYS G 2 80  ? 6.972   -78.953  -13.935 1.00 137.50 ? 102 CYS G SG  1 
ATOM   6690  N N   . GLU G 2 81  ? 7.161   -81.995  -17.538 1.00 117.78 ? 103 GLU G N   1 
ATOM   6691  C CA  . GLU G 2 81  ? 7.209   -83.271  -18.252 1.00 115.41 ? 103 GLU G CA  1 
ATOM   6692  C C   . GLU G 2 81  ? 8.461   -84.007  -17.824 1.00 116.55 ? 103 GLU G C   1 
ATOM   6693  O O   . GLU G 2 81  ? 9.530   -83.406  -17.734 1.00 121.67 ? 103 GLU G O   1 
ATOM   6694  C CB  . GLU G 2 81  ? 7.234   -83.042  -19.750 1.00 116.85 ? 103 GLU G CB  1 
ATOM   6695  C CG  . GLU G 2 81  ? 7.241   -84.317  -20.575 1.00 122.60 ? 103 GLU G CG  1 
ATOM   6696  C CD  . GLU G 2 81  ? 7.084   -84.049  -22.083 1.00 126.13 ? 103 GLU G CD  1 
ATOM   6697  O OE1 . GLU G 2 81  ? 7.567   -83.009  -22.565 1.00 126.55 ? 103 GLU G OE1 1 
ATOM   6698  O OE2 . GLU G 2 81  ? 6.492   -84.871  -22.800 1.00 132.35 ? 103 GLU G OE2 1 
ATOM   6699  N N   . GLN G 2 82  ? 8.318   -85.314  -17.578 1.00 116.57 ? 104 GLN G N   1 
ATOM   6700  C CA  . GLN G 2 82  ? 9.440   -86.133  -17.116 1.00 117.25 ? 104 GLN G CA  1 
ATOM   6701  C C   . GLN G 2 82  ? 10.501  -86.238  -18.227 1.00 121.07 ? 104 GLN G C   1 
ATOM   6702  O O   . GLN G 2 82  ? 10.160  -86.314  -19.400 1.00 117.33 ? 104 GLN G O   1 
ATOM   6703  C CB  . GLN G 2 82  ? 8.959   -87.515  -16.656 1.00 110.37 ? 104 GLN G CB  1 
ATOM   6704  N N   . ASP G 2 83  ? 11.776  -86.228  -17.833 1.00 131.24 ? 105 ASP G N   1 
ATOM   6705  C CA  . ASP G 2 83  ? 12.906  -86.160  -18.783 1.00 136.72 ? 105 ASP G CA  1 
ATOM   6706  C C   . ASP G 2 83  ? 12.872  -87.324  -19.790 1.00 134.34 ? 105 ASP G C   1 
ATOM   6707  O O   . ASP G 2 83  ? 12.474  -88.446  -19.450 1.00 136.96 ? 105 ASP G O   1 
ATOM   6708  C CB  . ASP G 2 83  ? 14.256  -86.156  -18.038 1.00 144.34 ? 105 ASP G CB  1 
ATOM   6709  C CG  . ASP G 2 83  ? 14.449  -84.930  -17.133 1.00 149.98 ? 105 ASP G CG  1 
ATOM   6710  O OD1 . ASP G 2 83  ? 13.839  -83.855  -17.384 1.00 156.75 ? 105 ASP G OD1 1 
ATOM   6711  O OD2 . ASP G 2 83  ? 15.231  -85.050  -16.159 1.00 155.51 ? 105 ASP G OD2 1 
ATOM   6712  N N   . CYS G 2 84  ? 13.292  -87.039  -21.017 1.00 131.37 ? 106 CYS G N   1 
ATOM   6713  C CA  . CYS G 2 84  ? 12.969  -87.886  -22.163 1.00 134.52 ? 106 CYS G CA  1 
ATOM   6714  C C   . CYS G 2 84  ? 13.682  -89.239  -22.152 1.00 126.53 ? 106 CYS G C   1 
ATOM   6715  O O   . CYS G 2 84  ? 14.881  -89.318  -21.977 1.00 124.17 ? 106 CYS G O   1 
ATOM   6716  C CB  . CYS G 2 84  ? 13.241  -87.155  -23.480 1.00 144.37 ? 106 CYS G CB  1 
ATOM   6717  S SG  . CYS G 2 84  ? 12.421  -85.551  -23.649 1.00 162.76 ? 106 CYS G SG  1 
ATOM   6718  N N   . LYS G 2 85  ? 12.905  -90.292  -22.372 1.00 122.68 ? 107 LYS G N   1 
ATOM   6719  C CA  . LYS G 2 85  ? 13.357  -91.673  -22.299 1.00 122.57 ? 107 LYS G CA  1 
ATOM   6720  C C   . LYS G 2 85  ? 14.192  -92.071  -23.538 1.00 123.86 ? 107 LYS G C   1 
ATOM   6721  O O   . LYS G 2 85  ? 14.320  -91.301  -24.510 1.00 113.89 ? 107 LYS G O   1 
ATOM   6722  C CB  . LYS G 2 85  ? 12.135  -92.613  -22.156 1.00 113.95 ? 107 LYS G CB  1 
ATOM   6723  N N   . GLN G 2 86  ? 14.706  -93.309  -23.495 1.00 128.58 ? 108 GLN G N   1 
ATOM   6724  C CA  . GLN G 2 86  ? 15.572  -93.899  -24.518 1.00 126.96 ? 108 GLN G CA  1 
ATOM   6725  C C   . GLN G 2 86  ? 15.344  -93.408  -25.941 1.00 126.22 ? 108 GLN G C   1 
ATOM   6726  O O   . GLN G 2 86  ? 16.201  -92.746  -26.494 1.00 134.06 ? 108 GLN G O   1 
ATOM   6727  C CB  . GLN G 2 86  ? 15.479  -95.445  -24.484 1.00 129.07 ? 108 GLN G CB  1 
ATOM   6728  N N   . GLY G 2 87  ? 14.186  -93.706  -26.523 1.00 124.02 ? 109 GLY G N   1 
ATOM   6729  C CA  . GLY G 2 87  ? 13.959  -93.407  -27.950 1.00 125.21 ? 109 GLY G CA  1 
ATOM   6730  C C   . GLY G 2 87  ? 13.456  -92.023  -28.320 1.00 123.68 ? 109 GLY G C   1 
ATOM   6731  O O   . GLY G 2 87  ? 13.028  -91.827  -29.454 1.00 122.40 ? 109 GLY G O   1 
ATOM   6732  N N   . GLN G 2 88  ? 13.539  -91.055  -27.407 1.00 125.40 ? 110 GLN G N   1 
ATOM   6733  C CA  . GLN G 2 88  ? 12.870  -89.765  -27.571 1.00 125.57 ? 110 GLN G CA  1 
ATOM   6734  C C   . GLN G 2 88  ? 13.866  -88.599  -27.595 1.00 127.27 ? 110 GLN G C   1 
ATOM   6735  O O   . GLN G 2 88  ? 15.017  -88.734  -27.172 1.00 124.16 ? 110 GLN G O   1 
ATOM   6736  C CB  . GLN G 2 88  ? 11.886  -89.559  -26.417 1.00 123.83 ? 110 GLN G CB  1 
ATOM   6737  C CG  . GLN G 2 88  ? 10.785  -90.583  -26.334 1.00 121.68 ? 110 GLN G CG  1 
ATOM   6738  C CD  . GLN G 2 88  ? 9.875   -90.337  -25.159 1.00 123.40 ? 110 GLN G CD  1 
ATOM   6739  O OE1 . GLN G 2 88  ? 10.243  -89.655  -24.186 1.00 119.27 ? 110 GLN G OE1 1 
ATOM   6740  N NE2 . GLN G 2 88  ? 8.680   -90.906  -25.229 1.00 128.02 ? 110 GLN G NE2 1 
ATOM   6741  N N   . GLU G 2 89  ? 13.380  -87.450  -28.077 1.00 130.05 ? 111 GLU G N   1 
ATOM   6742  C CA  . GLU G 2 89  ? 14.129  -86.204  -28.061 1.00 135.19 ? 111 GLU G CA  1 
ATOM   6743  C C   . GLU G 2 89  ? 13.229  -85.076  -27.585 1.00 139.90 ? 111 GLU G C   1 
ATOM   6744  O O   . GLU G 2 89  ? 12.048  -85.044  -27.938 1.00 140.52 ? 111 GLU G O   1 
ATOM   6745  C CB  . GLU G 2 89  ? 14.644  -85.918  -29.477 1.00 139.39 ? 111 GLU G CB  1 
ATOM   6746  N N   . LEU G 2 90  ? 13.807  -84.127  -26.853 1.00 147.65 ? 112 LEU G N   1 
ATOM   6747  C CA  . LEU G 2 90  ? 13.065  -82.991  -26.311 1.00 155.68 ? 112 LEU G CA  1 
ATOM   6748  C C   . LEU G 2 90  ? 12.860  -81.897  -27.360 1.00 163.22 ? 112 LEU G C   1 
ATOM   6749  O O   . LEU G 2 90  ? 13.826  -81.406  -27.936 1.00 163.30 ? 112 LEU G O   1 
ATOM   6750  C CB  . LEU G 2 90  ? 13.795  -82.419  -25.093 1.00 158.49 ? 112 LEU G CB  1 
ATOM   6751  C CG  . LEU G 2 90  ? 12.948  -81.543  -24.139 1.00 164.84 ? 112 LEU G CG  1 
ATOM   6752  C CD1 . LEU G 2 90  ? 13.463  -81.625  -22.729 1.00 167.25 ? 112 LEU G CD1 1 
ATOM   6753  C CD2 . LEU G 2 90  ? 12.940  -80.089  -24.573 1.00 169.48 ? 112 LEU G CD2 1 
ATOM   6754  N N   . THR G 2 91  ? 11.602  -81.512  -27.583 1.00 170.08 ? 113 THR G N   1 
ATOM   6755  C CA  . THR G 2 91  ? 11.233  -80.432  -28.510 1.00 170.24 ? 113 THR G CA  1 
ATOM   6756  C C   . THR G 2 91  ? 10.485  -79.320  -27.758 1.00 173.87 ? 113 THR G C   1 
ATOM   6757  O O   . THR G 2 91  ? 10.268  -79.412  -26.534 1.00 173.98 ? 113 THR G O   1 
ATOM   6758  C CB  . THR G 2 91  ? 10.355  -80.958  -29.682 1.00 169.41 ? 113 THR G CB  1 
ATOM   6759  O OG1 . THR G 2 91  ? 9.004   -81.162  -29.256 1.00 168.58 ? 113 THR G OG1 1 
ATOM   6760  C CG2 . THR G 2 91  ? 10.896  -82.274  -30.232 1.00 168.60 ? 113 THR G CG2 1 
ATOM   6761  N N   . LYS G 2 92  ? 10.094  -78.275  -28.486 1.00 174.65 ? 114 LYS G N   1 
ATOM   6762  C CA  . LYS G 2 92  ? 9.197   -77.243  -27.951 1.00 168.74 ? 114 LYS G CA  1 
ATOM   6763  C C   . LYS G 2 92  ? 7.863   -77.859  -27.506 1.00 167.26 ? 114 LYS G C   1 
ATOM   6764  O O   . LYS G 2 92  ? 7.348   -77.527  -26.435 1.00 163.82 ? 114 LYS G O   1 
ATOM   6765  C CB  . LYS G 2 92  ? 8.954   -76.143  -28.987 1.00 164.42 ? 114 LYS G CB  1 
ATOM   6766  N N   . LYS G 2 93  ? 7.339   -78.779  -28.319 1.00 168.19 ? 115 LYS G N   1 
ATOM   6767  C CA  . LYS G 2 93  ? 6.080   -79.481  -28.027 1.00 170.06 ? 115 LYS G CA  1 
ATOM   6768  C C   . LYS G 2 93  ? 6.196   -80.703  -27.091 1.00 171.55 ? 115 LYS G C   1 
ATOM   6769  O O   . LYS G 2 93  ? 5.197   -81.385  -26.855 1.00 174.01 ? 115 LYS G O   1 
ATOM   6770  C CB  . LYS G 2 93  ? 5.416   -79.908  -29.346 1.00 168.43 ? 115 LYS G CB  1 
ATOM   6771  N N   . GLY G 2 94  ? 7.400   -80.994  -26.586 1.00 174.87 ? 116 GLY G N   1 
ATOM   6772  C CA  . GLY G 2 94  ? 7.628   -82.089  -25.609 1.00 172.88 ? 116 GLY G CA  1 
ATOM   6773  C C   . GLY G 2 94  ? 8.519   -83.195  -26.127 1.00 170.28 ? 116 GLY G C   1 
ATOM   6774  O O   . GLY G 2 94  ? 9.083   -83.095  -27.219 1.00 177.06 ? 116 GLY G O   1 
ATOM   6775  N N   . CYS G 2 95  ? 8.630   -84.274  -25.354 1.00 164.06 ? 117 CYS G N   1 
ATOM   6776  C CA  . CYS G 2 95  ? 9.380   -85.459  -25.760 1.00 161.05 ? 117 CYS G CA  1 
ATOM   6777  C C   . CYS G 2 95  ? 8.631   -86.170  -26.874 1.00 160.29 ? 117 CYS G C   1 
ATOM   6778  O O   . CYS G 2 95  ? 7.695   -86.917  -26.611 1.00 161.43 ? 117 CYS G O   1 
ATOM   6779  C CB  . CYS G 2 95  ? 9.627   -86.438  -24.606 1.00 159.65 ? 117 CYS G CB  1 
ATOM   6780  S SG  . CYS G 2 95  ? 10.446  -85.795  -23.132 1.00 165.86 ? 117 CYS G SG  1 
ATOM   6781  N N   . LYS G 2 96  ? 9.029   -85.901  -28.118 1.00 163.20 ? 118 LYS G N   1 
ATOM   6782  C CA  . LYS G 2 96  ? 8.544   -86.648  -29.271 1.00 162.59 ? 118 LYS G CA  1 
ATOM   6783  C C   . LYS G 2 96  ? 9.565   -87.740  -29.583 1.00 158.36 ? 118 LYS G C   1 
ATOM   6784  O O   . LYS G 2 96  ? 10.766  -87.582  -29.314 1.00 148.68 ? 118 LYS G O   1 
ATOM   6785  C CB  . LYS G 2 96  ? 8.342   -85.730  -30.476 1.00 167.83 ? 118 LYS G CB  1 
ATOM   6786  N N   . ASP G 2 97  ? 9.073   -88.837  -30.158 1.00 160.43 ? 119 ASP G N   1 
ATOM   6787  C CA  . ASP G 2 97  ? 9.921   -89.975  -30.499 1.00 170.21 ? 119 ASP G CA  1 
ATOM   6788  C C   . ASP G 2 97  ? 10.843  -89.628  -31.664 1.00 170.54 ? 119 ASP G C   1 
ATOM   6789  O O   . ASP G 2 97  ? 10.482  -88.811  -32.519 1.00 173.94 ? 119 ASP G O   1 
ATOM   6790  C CB  . ASP G 2 97  ? 9.072   -91.191  -30.896 1.00 179.19 ? 119 ASP G CB  1 
ATOM   6791  C CG  . ASP G 2 97  ? 8.200   -91.707  -29.761 1.00 187.08 ? 119 ASP G CG  1 
ATOM   6792  O OD1 . ASP G 2 97  ? 8.704   -91.874  -28.625 1.00 189.90 ? 119 ASP G OD1 1 
ATOM   6793  O OD2 . ASP G 2 97  ? 7.007   -91.973  -30.027 1.00 194.77 ? 119 ASP G OD2 1 
ATOM   6794  N N   . CYS G 2 98  ? 12.030  -90.248  -31.698 1.00 171.98 ? 120 CYS G N   1 
ATOM   6795  C CA  . CYS G 2 98  ? 12.962  -90.049  -32.806 1.00 168.77 ? 120 CYS G CA  1 
ATOM   6796  C C   . CYS G 2 98  ? 12.293  -90.451  -34.121 1.00 171.64 ? 120 CYS G C   1 
ATOM   6797  O O   . CYS G 2 98  ? 11.582  -91.467  -34.184 1.00 166.06 ? 120 CYS G O   1 
ATOM   6798  C CB  . CYS G 2 98  ? 14.262  -90.852  -32.632 1.00 167.63 ? 120 CYS G CB  1 
ATOM   6799  S SG  . CYS G 2 98  ? 15.570  -90.148  -31.586 1.00 168.58 ? 120 CYS G SG  1 
ATOM   6800  N N   . SER G 2 99  ? 12.526  -89.643  -35.157 1.00 180.40 ? 121 SER G N   1 
ATOM   6801  C CA  . SER G 2 99  ? 11.941  -89.866  -36.473 1.00 182.57 ? 121 SER G CA  1 
ATOM   6802  C C   . SER G 2 99  ? 12.529  -91.112  -37.128 1.00 180.97 ? 121 SER G C   1 
ATOM   6803  O O   . SER G 2 99  ? 13.431  -91.750  -36.568 1.00 186.77 ? 121 SER G O   1 
ATOM   6804  C CB  . SER G 2 99  ? 12.197  -88.647  -37.373 1.00 186.67 ? 121 SER G CB  1 
ATOM   6805  O OG  . SER G 2 99  ? 11.553  -88.773  -38.626 1.00 191.57 ? 121 SER G OG  1 
ATOM   6806  N N   . PHE G 2 100 ? 12.019  -91.467  -38.306 1.00 178.00 ? 122 PHE G N   1 
ATOM   6807  C CA  . PHE G 2 100 ? 12.565  -92.605  -39.034 1.00 176.50 ? 122 PHE G CA  1 
ATOM   6808  C C   . PHE G 2 100 ? 13.994  -92.300  -39.484 1.00 173.65 ? 122 PHE G C   1 
ATOM   6809  O O   . PHE G 2 100 ? 14.301  -91.173  -39.880 1.00 169.65 ? 122 PHE G O   1 
ATOM   6810  C CB  . PHE G 2 100 ? 11.694  -92.983  -40.228 1.00 182.84 ? 122 PHE G CB  1 
ATOM   6811  C CG  . PHE G 2 100 ? 12.036  -94.323  -40.801 1.00 189.44 ? 122 PHE G CG  1 
ATOM   6812  C CD1 . PHE G 2 100 ? 11.445  -95.478  -40.297 1.00 189.76 ? 122 PHE G CD1 1 
ATOM   6813  C CD2 . PHE G 2 100 ? 12.977  -94.439  -41.819 1.00 199.34 ? 122 PHE G CD2 1 
ATOM   6814  C CE1 . PHE G 2 100 ? 11.763  -96.725  -40.819 1.00 192.32 ? 122 PHE G CE1 1 
ATOM   6815  C CE2 . PHE G 2 100 ? 13.300  -95.682  -42.350 1.00 203.01 ? 122 PHE G CE2 1 
ATOM   6816  C CZ  . PHE G 2 100 ? 12.693  -96.828  -41.846 1.00 197.60 ? 122 PHE G CZ  1 
ATOM   6817  N N   . GLY G 2 101 ? 14.862  -93.305  -39.385 1.00 173.58 ? 123 GLY G N   1 
ATOM   6818  C CA  . GLY G 2 101 ? 16.283  -93.166  -39.701 1.00 174.63 ? 123 GLY G CA  1 
ATOM   6819  C C   . GLY G 2 101 ? 17.162  -92.599  -38.591 1.00 173.37 ? 123 GLY G C   1 
ATOM   6820  O O   . GLY G 2 101 ? 18.379  -92.504  -38.769 1.00 173.86 ? 123 GLY G O   1 
ATOM   6821  N N   . THR G 2 102 ? 16.565  -92.235  -37.453 1.00 168.53 ? 124 THR G N   1 
ATOM   6822  C CA  . THR G 2 102 ? 17.294  -91.645  -36.327 1.00 161.63 ? 124 THR G CA  1 
ATOM   6823  C C   . THR G 2 102 ? 17.097  -92.442  -35.045 1.00 151.37 ? 124 THR G C   1 
ATOM   6824  O O   . THR G 2 102 ? 16.145  -93.212  -34.928 1.00 149.03 ? 124 THR G O   1 
ATOM   6825  C CB  . THR G 2 102 ? 16.861  -90.187  -36.082 1.00 164.70 ? 124 THR G CB  1 
ATOM   6826  O OG1 . THR G 2 102 ? 15.447  -90.053  -36.294 1.00 164.25 ? 124 THR G OG1 1 
ATOM   6827  C CG2 . THR G 2 102 ? 17.605  -89.258  -37.011 1.00 170.64 ? 124 THR G CG2 1 
ATOM   6828  N N   . PHE G 2 103 ? 18.008  -92.250  -34.091 1.00 142.14 ? 125 PHE G N   1 
ATOM   6829  C CA  . PHE G 2 103 ? 17.990  -92.986  -32.829 1.00 137.63 ? 125 PHE G CA  1 
ATOM   6830  C C   . PHE G 2 103 ? 18.588  -92.206  -31.675 1.00 134.06 ? 125 PHE G C   1 
ATOM   6831  O O   . PHE G 2 103 ? 19.337  -91.279  -31.876 1.00 134.83 ? 125 PHE G O   1 
ATOM   6832  C CB  . PHE G 2 103 ? 18.747  -94.311  -32.989 1.00 137.89 ? 125 PHE G CB  1 
ATOM   6833  C CG  . PHE G 2 103 ? 20.232  -94.203  -32.798 1.00 138.68 ? 125 PHE G CG  1 
ATOM   6834  C CD1 . PHE G 2 103 ? 20.820  -94.562  -31.586 1.00 141.23 ? 125 PHE G CD1 1 
ATOM   6835  C CD2 . PHE G 2 103 ? 21.047  -93.759  -33.826 1.00 142.49 ? 125 PHE G CD2 1 
ATOM   6836  C CE1 . PHE G 2 103 ? 22.193  -94.488  -31.411 1.00 142.64 ? 125 PHE G CE1 1 
ATOM   6837  C CE2 . PHE G 2 103 ? 22.421  -93.682  -33.662 1.00 145.52 ? 125 PHE G CE2 1 
ATOM   6838  C CZ  . PHE G 2 103 ? 22.992  -94.050  -32.454 1.00 144.21 ? 125 PHE G CZ  1 
ATOM   6839  N N   . ASN G 2 104 ? 18.266  -92.624  -30.461 1.00 135.91 ? 126 ASN G N   1 
ATOM   6840  C CA  . ASN G 2 104 ? 18.880  -92.081  -29.259 1.00 142.89 ? 126 ASN G CA  1 
ATOM   6841  C C   . ASN G 2 104 ? 19.183  -93.218  -28.279 1.00 144.33 ? 126 ASN G C   1 
ATOM   6842  O O   . ASN G 2 104 ? 18.292  -93.970  -27.895 1.00 139.25 ? 126 ASN G O   1 
ATOM   6843  C CB  . ASN G 2 104 ? 17.952  -91.031  -28.648 1.00 148.48 ? 126 ASN G CB  1 
ATOM   6844  C CG  . ASN G 2 104 ? 18.557  -90.323  -27.461 1.00 153.44 ? 126 ASN G CG  1 
ATOM   6845  O OD1 . ASN G 2 104 ? 19.718  -90.513  -27.122 1.00 161.31 ? 126 ASN G OD1 1 
ATOM   6846  N ND2 . ASN G 2 104 ? 17.753  -89.480  -26.824 1.00 157.60 ? 126 ASN G ND2 1 
ATOM   6847  N N   . ASP G 2 105 ? 20.454  -93.343  -27.912 1.00 150.13 ? 127 ASP G N   1 
ATOM   6848  C CA  . ASP G 2 105 ? 20.912  -94.376  -26.982 1.00 146.57 ? 127 ASP G CA  1 
ATOM   6849  C C   . ASP G 2 105 ? 20.551  -93.993  -25.546 1.00 144.93 ? 127 ASP G C   1 
ATOM   6850  O O   . ASP G 2 105 ? 19.845  -94.719  -24.872 1.00 143.90 ? 127 ASP G O   1 
ATOM   6851  C CB  . ASP G 2 105 ? 22.431  -94.577  -27.141 1.00 151.84 ? 127 ASP G CB  1 
ATOM   6852  N N   . GLN G 2 106 ? 21.016  -92.829  -25.108 1.00 151.41 ? 128 GLN G N   1 
ATOM   6853  C CA  . GLN G 2 106 ? 20.963  -92.427  -23.692 1.00 157.87 ? 128 GLN G CA  1 
ATOM   6854  C C   . GLN G 2 106 ? 19.785  -91.491  -23.385 1.00 157.80 ? 128 GLN G C   1 
ATOM   6855  O O   . GLN G 2 106 ? 19.192  -90.903  -24.286 1.00 155.63 ? 128 GLN G O   1 
ATOM   6856  C CB  . GLN G 2 106 ? 22.278  -91.750  -23.307 1.00 167.19 ? 128 GLN G CB  1 
ATOM   6857  C CG  . GLN G 2 106 ? 22.654  -91.871  -21.827 1.00 170.14 ? 128 GLN G CG  1 
ATOM   6858  C CD  . GLN G 2 106 ? 24.138  -91.721  -21.586 1.00 175.19 ? 128 GLN G CD  1 
ATOM   6859  O OE1 . GLN G 2 106 ? 24.768  -90.748  -22.025 1.00 180.27 ? 128 GLN G OE1 1 
ATOM   6860  N NE2 . GLN G 2 106 ? 24.719  -92.672  -20.844 1.00 174.49 ? 128 GLN G NE2 1 
ATOM   6861  N N   . LYS G 2 107 ? 19.463  -91.381  -22.093 1.00 162.93 ? 129 LYS G N   1 
ATOM   6862  C CA  . LYS G 2 107 ? 18.486  -90.406  -21.577 1.00 160.00 ? 129 LYS G CA  1 
ATOM   6863  C C   . LYS G 2 107 ? 19.005  -88.980  -21.749 1.00 162.60 ? 129 LYS G C   1 
ATOM   6864  O O   . LYS G 2 107 ? 20.226  -88.748  -21.806 1.00 158.68 ? 129 LYS G O   1 
ATOM   6865  C CB  . LYS G 2 107 ? 18.177  -90.668  -20.093 1.00 154.38 ? 129 LYS G CB  1 
ATOM   6866  N N   . ARG G 2 108 ? 18.070  -88.034  -21.820 1.00 163.54 ? 130 ARG G N   1 
ATOM   6867  C CA  . ARG G 2 108 ? 18.348  -86.617  -22.103 1.00 160.63 ? 130 ARG G CA  1 
ATOM   6868  C C   . ARG G 2 108 ? 19.359  -86.438  -23.245 1.00 159.26 ? 130 ARG G C   1 
ATOM   6869  O O   . ARG G 2 108 ? 20.358  -85.735  -23.096 1.00 163.08 ? 130 ARG G O   1 
ATOM   6870  C CB  . ARG G 2 108 ? 18.785  -85.873  -20.823 1.00 158.16 ? 130 ARG G CB  1 
ATOM   6871  N N   . GLY G 2 109 ? 19.082  -87.089  -24.376 1.00 158.72 ? 131 GLY G N   1 
ATOM   6872  C CA  . GLY G 2 109 ? 19.967  -87.070  -25.550 1.00 167.08 ? 131 GLY G CA  1 
ATOM   6873  C C   . GLY G 2 109 ? 19.332  -86.462  -26.787 1.00 171.26 ? 131 GLY G C   1 
ATOM   6874  O O   . GLY G 2 109 ? 18.233  -85.897  -26.723 1.00 172.78 ? 131 GLY G O   1 
ATOM   6875  N N   . ILE G 2 110 ? 20.041  -86.592  -27.911 1.00 174.12 ? 132 ILE G N   1 
ATOM   6876  C CA  . ILE G 2 110 ? 19.639  -86.017  -29.202 1.00 175.72 ? 132 ILE G CA  1 
ATOM   6877  C C   . ILE G 2 110 ? 19.526  -87.143  -30.233 1.00 179.39 ? 132 ILE G C   1 
ATOM   6878  O O   . ILE G 2 110 ? 20.251  -88.131  -30.165 1.00 178.55 ? 132 ILE G O   1 
ATOM   6879  C CB  . ILE G 2 110 ? 20.670  -84.958  -29.659 1.00 176.93 ? 132 ILE G CB  1 
ATOM   6880  C CG1 . ILE G 2 110 ? 20.591  -83.724  -28.747 1.00 177.88 ? 132 ILE G CG1 1 
ATOM   6881  C CG2 . ILE G 2 110 ? 20.446  -84.535  -31.110 1.00 177.06 ? 132 ILE G CG2 1 
ATOM   6882  C CD1 . ILE G 2 110 ? 21.817  -82.836  -28.765 1.00 181.18 ? 132 ILE G CD1 1 
ATOM   6883  N N   . CYS G 2 111 ? 18.605  -86.978  -31.186 1.00 183.17 ? 133 CYS G N   1 
ATOM   6884  C CA  . CYS G 2 111 ? 18.402  -87.951  -32.268 1.00 184.29 ? 133 CYS G CA  1 
ATOM   6885  C C   . CYS G 2 111 ? 19.503  -87.886  -33.331 1.00 183.97 ? 133 CYS G C   1 
ATOM   6886  O O   . CYS G 2 111 ? 19.399  -87.122  -34.283 1.00 186.35 ? 133 CYS G O   1 
ATOM   6887  C CB  . CYS G 2 111 ? 17.027  -87.752  -32.932 1.00 185.46 ? 133 CYS G CB  1 
ATOM   6888  S SG  . CYS G 2 111 ? 15.542  -88.116  -31.892 1.00 193.19 ? 133 CYS G SG  1 
ATOM   6889  N N   . ARG G 2 112 ? 20.532  -88.704  -33.156 1.00 177.52 ? 134 ARG G N   1 
ATOM   6890  C CA  . ARG G 2 112 ? 21.548  -88.943  -34.190 1.00 173.74 ? 134 ARG G CA  1 
ATOM   6891  C C   . ARG G 2 112 ? 20.954  -89.876  -35.259 1.00 171.94 ? 134 ARG G C   1 
ATOM   6892  O O   . ARG G 2 112 ? 20.001  -90.595  -34.974 1.00 160.22 ? 134 ARG G O   1 
ATOM   6893  C CB  . ARG G 2 112 ? 22.786  -89.610  -33.573 1.00 170.58 ? 134 ARG G CB  1 
ATOM   6894  C CG  . ARG G 2 112 ? 23.457  -88.799  -32.480 1.00 172.24 ? 134 ARG G CG  1 
ATOM   6895  C CD  . ARG G 2 112 ? 24.572  -89.603  -31.834 1.00 177.34 ? 134 ARG G CD  1 
ATOM   6896  N NE  . ARG G 2 112 ? 24.064  -90.635  -30.929 1.00 181.63 ? 134 ARG G NE  1 
ATOM   6897  C CZ  . ARG G 2 112 ? 24.822  -91.511  -30.258 1.00 187.92 ? 134 ARG G CZ  1 
ATOM   6898  N NH1 . ARG G 2 112 ? 26.155  -91.501  -30.378 1.00 192.89 ? 134 ARG G NH1 1 
ATOM   6899  N NH2 . ARG G 2 112 ? 24.242  -92.405  -29.452 1.00 184.41 ? 134 ARG G NH2 1 
ATOM   6900  N N   . PRO G 2 113 ? 21.507  -89.873  -36.489 1.00 180.28 ? 135 PRO G N   1 
ATOM   6901  C CA  . PRO G 2 113 ? 21.037  -90.792  -37.537 1.00 177.94 ? 135 PRO G CA  1 
ATOM   6902  C C   . PRO G 2 113 ? 21.771  -92.138  -37.495 1.00 174.39 ? 135 PRO G C   1 
ATOM   6903  O O   . PRO G 2 113 ? 22.903  -92.208  -37.005 1.00 169.66 ? 135 PRO G O   1 
ATOM   6904  C CB  . PRO G 2 113 ? 21.371  -90.037  -38.818 1.00 181.54 ? 135 PRO G CB  1 
ATOM   6905  C CG  . PRO G 2 113 ? 22.624  -89.295  -38.474 1.00 185.00 ? 135 PRO G CG  1 
ATOM   6906  C CD  . PRO G 2 113 ? 22.609  -89.025  -36.986 1.00 184.06 ? 135 PRO G CD  1 
ATOM   6907  N N   . TRP G 2 114 ? 21.138  -93.190  -38.018 1.00 176.16 ? 136 TRP G N   1 
ATOM   6908  C CA  . TRP G 2 114 ? 21.730  -94.541  -37.995 1.00 180.61 ? 136 TRP G CA  1 
ATOM   6909  C C   . TRP G 2 114 ? 23.007  -94.565  -38.820 1.00 186.34 ? 136 TRP G C   1 
ATOM   6910  O O   . TRP G 2 114 ? 23.041  -93.975  -39.903 1.00 192.43 ? 136 TRP G O   1 
ATOM   6911  C CB  . TRP G 2 114 ? 20.795  -95.603  -38.584 1.00 180.25 ? 136 TRP G CB  1 
ATOM   6912  C CG  . TRP G 2 114 ? 19.464  -95.755  -37.933 1.00 177.34 ? 136 TRP G CG  1 
ATOM   6913  C CD1 . TRP G 2 114 ? 19.164  -95.585  -36.621 1.00 174.61 ? 136 TRP G CD1 1 
ATOM   6914  C CD2 . TRP G 2 114 ? 18.250  -96.156  -38.576 1.00 181.71 ? 136 TRP G CD2 1 
ATOM   6915  N NE1 . TRP G 2 114 ? 17.828  -95.832  -36.402 1.00 175.01 ? 136 TRP G NE1 1 
ATOM   6916  C CE2 . TRP G 2 114 ? 17.245  -96.185  -37.587 1.00 179.84 ? 136 TRP G CE2 1 
ATOM   6917  C CE3 . TRP G 2 114 ? 17.914  -96.492  -39.895 1.00 187.79 ? 136 TRP G CE3 1 
ATOM   6918  C CZ2 . TRP G 2 114 ? 15.922  -96.532  -37.874 1.00 184.73 ? 136 TRP G CZ2 1 
ATOM   6919  C CZ3 . TRP G 2 114 ? 16.601  -96.838  -40.182 1.00 192.34 ? 136 TRP G CZ3 1 
ATOM   6920  C CH2 . TRP G 2 114 ? 15.619  -96.858  -39.169 1.00 191.58 ? 136 TRP G CH2 1 
ATOM   6921  N N   . THR G 2 115 ? 24.046  -95.238  -38.322 1.00 183.90 ? 137 THR G N   1 
ATOM   6922  C CA  . THR G 2 115 ? 25.286  -95.369  -39.077 1.00 183.44 ? 137 THR G CA  1 
ATOM   6923  C C   . THR G 2 115 ? 24.997  -96.111  -40.370 1.00 184.66 ? 137 THR G C   1 
ATOM   6924  O O   . THR G 2 115 ? 24.478  -97.230  -40.328 1.00 180.94 ? 137 THR G O   1 
ATOM   6925  C CB  . THR G 2 115 ? 26.374  -96.143  -38.306 1.00 179.50 ? 137 THR G CB  1 
ATOM   6926  O OG1 . THR G 2 115 ? 25.779  -97.282  -37.654 1.00 176.89 ? 137 THR G OG1 1 
ATOM   6927  C CG2 . THR G 2 115 ? 27.037  -95.242  -37.268 1.00 180.21 ? 137 THR G CG2 1 
ATOM   6928  N N   . ASN G 2 116 ? 25.286  -95.466  -41.504 1.00 192.68 ? 138 ASN G N   1 
ATOM   6929  C CA  . ASN G 2 116 ? 25.076  -96.078  -42.813 1.00 195.93 ? 138 ASN G CA  1 
ATOM   6930  C C   . ASN G 2 116 ? 26.313  -96.910  -43.157 1.00 198.15 ? 138 ASN G C   1 
ATOM   6931  O O   . ASN G 2 116 ? 27.369  -96.356  -43.478 1.00 193.81 ? 138 ASN G O   1 
ATOM   6932  C CB  . ASN G 2 116 ? 24.823  -95.011  -43.885 1.00 198.93 ? 138 ASN G CB  1 
ATOM   6933  C CG  . ASN G 2 116 ? 24.470  -95.605  -45.242 1.00 202.96 ? 138 ASN G CG  1 
ATOM   6934  O OD1 . ASN G 2 116 ? 24.317  -96.822  -45.400 1.00 203.46 ? 138 ASN G OD1 1 
ATOM   6935  N ND2 . ASN G 2 116 ? 24.348  -94.738  -46.243 1.00 207.61 ? 138 ASN G ND2 1 
ATOM   6936  N N   . CYS G 2 117 ? 26.182  -98.229  -43.093 1.00 204.66 ? 139 CYS G N   1 
ATOM   6937  C CA  . CYS G 2 117 ? 27.311  -99.129  -43.317 1.00 211.70 ? 139 CYS G CA  1 
ATOM   6938  C C   . CYS G 2 117 ? 27.658  -99.222  -44.811 1.00 221.38 ? 139 CYS G C   1 
ATOM   6939  O O   . CYS G 2 117 ? 28.822  -99.425  -45.152 1.00 229.12 ? 139 CYS G O   1 
ATOM   6940  C CB  . CYS G 2 117 ? 27.038  -100.528 -42.725 1.00 206.93 ? 139 CYS G CB  1 
ATOM   6941  S SG  . CYS G 2 117 ? 25.805  -100.656 -41.375 1.00 205.45 ? 139 CYS G SG  1 
ATOM   6942  N N   . SER G 2 118 ? 26.659  -99.060  -45.686 1.00 226.29 ? 140 SER G N   1 
ATOM   6943  C CA  . SER G 2 118 ? 26.881  -98.987  -47.140 1.00 226.59 ? 140 SER G CA  1 
ATOM   6944  C C   . SER G 2 118 ? 27.866  -97.873  -47.514 1.00 226.19 ? 140 SER G C   1 
ATOM   6945  O O   . SER G 2 118 ? 28.817  -98.112  -48.261 1.00 225.89 ? 140 SER G O   1 
ATOM   6946  C CB  . SER G 2 118 ? 25.556  -98.772  -47.882 1.00 224.98 ? 140 SER G CB  1 
ATOM   6947  N N   . LEU G 2 119 ? 27.645  -96.671  -46.968 1.00 224.91 ? 141 LEU G N   1 
ATOM   6948  C CA  . LEU G 2 119 ? 28.563  -95.526  -47.146 1.00 221.68 ? 141 LEU G CA  1 
ATOM   6949  C C   . LEU G 2 119 ? 29.950  -95.767  -46.511 1.00 216.77 ? 141 LEU G C   1 
ATOM   6950  O O   . LEU G 2 119 ? 30.953  -95.229  -46.986 1.00 220.14 ? 141 LEU G O   1 
ATOM   6951  C CB  . LEU G 2 119 ? 27.941  -94.231  -46.585 1.00 215.92 ? 141 LEU G CB  1 
ATOM   6952  N N   . ASP G 2 120 ? 29.992  -96.566  -45.443 1.00 208.68 ? 142 ASP G N   1 
ATOM   6953  C CA  . ASP G 2 120 ? 31.242  -96.937  -44.765 1.00 203.93 ? 142 ASP G CA  1 
ATOM   6954  C C   . ASP G 2 120 ? 31.964  -98.155  -45.365 1.00 201.38 ? 142 ASP G C   1 
ATOM   6955  O O   . ASP G 2 120 ? 33.098  -98.434  -44.961 1.00 196.94 ? 142 ASP G O   1 
ATOM   6956  C CB  . ASP G 2 120 ? 30.969  -97.196  -43.275 1.00 200.22 ? 142 ASP G CB  1 
ATOM   6957  N N   . GLY G 2 121 ? 31.329  -98.876  -46.302 1.00 200.78 ? 143 GLY G N   1 
ATOM   6958  C CA  . GLY G 2 121 ? 31.919  -100.071 -46.934 1.00 203.63 ? 143 GLY G CA  1 
ATOM   6959  C C   . GLY G 2 121 ? 31.267  -101.400 -46.559 1.00 201.59 ? 143 GLY G C   1 
ATOM   6960  O O   . GLY G 2 121 ? 31.048  -102.248 -47.423 1.00 200.57 ? 143 GLY G O   1 
ATOM   6961  N N   . LYS G 2 122 ? 30.949  -101.574 -45.273 1.00 202.64 ? 144 LYS G N   1 
ATOM   6962  C CA  . LYS G 2 122 ? 30.368  -102.820 -44.737 1.00 200.26 ? 144 LYS G CA  1 
ATOM   6963  C C   . LYS G 2 122 ? 28.885  -103.043 -45.127 1.00 202.94 ? 144 LYS G C   1 
ATOM   6964  O O   . LYS G 2 122 ? 28.348  -102.378 -46.038 1.00 199.91 ? 144 LYS G O   1 
ATOM   6965  C CB  . LYS G 2 122 ? 30.530  -102.855 -43.210 1.00 192.36 ? 144 LYS G CB  1 
ATOM   6966  N N   . SER G 2 123 ? 28.243  -104.014 -44.476 1.00 205.57 ? 145 SER G N   1 
ATOM   6967  C CA  . SER G 2 123 ? 26.834  -104.352 -44.742 1.00 203.32 ? 145 SER G CA  1 
ATOM   6968  C C   . SER G 2 123 ? 26.079  -104.651 -43.444 1.00 201.50 ? 145 SER G C   1 
ATOM   6969  O O   . SER G 2 123 ? 26.689  -105.000 -42.436 1.00 206.06 ? 145 SER G O   1 
ATOM   6970  C CB  . SER G 2 123 ? 26.748  -105.543 -45.697 1.00 200.08 ? 145 SER G CB  1 
ATOM   6971  O OG  . SER G 2 123 ? 27.391  -106.689 -45.154 1.00 193.53 ? 145 SER G OG  1 
ATOM   6972  N N   . VAL G 2 124 ? 24.754  -104.512 -43.499 1.00 194.87 ? 146 VAL G N   1 
ATOM   6973  C CA  . VAL G 2 124 ? 23.903  -104.556 -42.296 1.00 188.80 ? 146 VAL G CA  1 
ATOM   6974  C C   . VAL G 2 124 ? 23.562  -105.966 -41.785 1.00 186.62 ? 146 VAL G C   1 
ATOM   6975  O O   . VAL G 2 124 ? 23.275  -106.150 -40.589 1.00 178.94 ? 146 VAL G O   1 
ATOM   6976  C CB  . VAL G 2 124 ? 22.594  -103.736 -42.474 1.00 183.34 ? 146 VAL G CB  1 
ATOM   6977  C CG1 . VAL G 2 124 ? 22.898  -102.245 -42.534 1.00 182.67 ? 146 VAL G CG1 1 
ATOM   6978  C CG2 . VAL G 2 124 ? 21.800  -104.163 -43.705 1.00 182.12 ? 146 VAL G CG2 1 
ATOM   6979  N N   . ASN G 2 127 ? 19.390  -104.331 -38.200 1.00 159.80 ? 149 ASN G N   1 
ATOM   6980  C CA  . ASN G 2 127 ? 18.815  -103.052 -38.641 1.00 171.99 ? 149 ASN G CA  1 
ATOM   6981  C C   . ASN G 2 127 ? 18.653  -102.129 -37.417 1.00 175.18 ? 149 ASN G C   1 
ATOM   6982  O O   . ASN G 2 127 ? 18.837  -102.567 -36.271 1.00 190.35 ? 149 ASN G O   1 
ATOM   6983  C CB  . ASN G 2 127 ? 17.453  -103.273 -39.326 1.00 181.32 ? 149 ASN G CB  1 
ATOM   6984  C CG  . ASN G 2 127 ? 17.130  -102.245 -40.411 1.00 190.33 ? 149 ASN G CG  1 
ATOM   6985  O OD1 . ASN G 2 127 ? 17.332  -101.032 -40.239 1.00 199.58 ? 149 ASN G OD1 1 
ATOM   6986  N ND2 . ASN G 2 127 ? 16.594  -102.742 -41.535 1.00 192.24 ? 149 ASN G ND2 1 
ATOM   6987  N N   . GLY G 2 128 ? 18.331  -100.861 -37.671 1.00 167.37 ? 150 GLY G N   1 
ATOM   6988  C CA  . GLY G 2 128 ? 18.285  -99.864  -36.605 1.00 155.09 ? 150 GLY G CA  1 
ATOM   6989  C C   . GLY G 2 128 ? 16.928  -99.756  -36.000 1.00 145.83 ? 150 GLY G C   1 
ATOM   6990  O O   . GLY G 2 128 ? 16.058  -100.531 -36.328 1.00 147.85 ? 150 GLY G O   1 
ATOM   6991  N N   . THR G 2 129 ? 16.748  -98.775  -35.123 1.00 139.79 ? 151 THR G N   1 
ATOM   6992  C CA  . THR G 2 129 ? 15.475  -98.549  -34.426 1.00 136.89 ? 151 THR G CA  1 
ATOM   6993  C C   . THR G 2 129 ? 15.492  -97.199  -33.696 1.00 135.95 ? 151 THR G C   1 
ATOM   6994  O O   . THR G 2 129 ? 16.521  -96.530  -33.646 1.00 138.45 ? 151 THR G O   1 
ATOM   6995  C CB  . THR G 2 129 ? 15.154  -99.712  -33.434 1.00 137.02 ? 151 THR G CB  1 
ATOM   6996  O OG1 . THR G 2 129 ? 14.017  -99.382  -32.636 1.00 141.96 ? 151 THR G OG1 1 
ATOM   6997  C CG2 . THR G 2 129 ? 16.298  -100.010 -32.484 1.00 138.30 ? 151 THR G CG2 1 
ATOM   6998  N N   . LYS G 2 130 ? 14.351  -96.809  -33.128 1.00 133.76 ? 152 LYS G N   1 
ATOM   6999  C CA  . LYS G 2 130 ? 14.234  -95.539  -32.401 1.00 131.25 ? 152 LYS G CA  1 
ATOM   7000  C C   . LYS G 2 130 ? 15.167  -95.417  -31.191 1.00 134.47 ? 152 LYS G C   1 
ATOM   7001  O O   . LYS G 2 130 ? 15.469  -94.300  -30.799 1.00 135.94 ? 152 LYS G O   1 
ATOM   7002  C CB  . LYS G 2 130 ? 12.782  -95.298  -31.951 1.00 126.60 ? 152 LYS G CB  1 
ATOM   7003  N N   . GLU G 2 131 ? 15.616  -96.530  -30.608 1.00 139.04 ? 153 GLU G N   1 
ATOM   7004  C CA  . GLU G 2 131 ? 16.503  -96.505  -29.424 1.00 142.46 ? 153 GLU G CA  1 
ATOM   7005  C C   . GLU G 2 131 ? 17.840  -97.223  -29.608 1.00 140.65 ? 153 GLU G C   1 
ATOM   7006  O O   . GLU G 2 131 ? 18.515  -97.494  -28.625 1.00 148.78 ? 153 GLU G O   1 
ATOM   7007  C CB  . GLU G 2 131 ? 15.806  -97.079  -28.157 1.00 154.18 ? 153 GLU G CB  1 
ATOM   7008  C CG  . GLU G 2 131 ? 14.280  -97.079  -28.116 1.00 167.92 ? 153 GLU G CG  1 
ATOM   7009  C CD  . GLU G 2 131 ? 13.621  -98.442  -28.290 1.00 179.64 ? 153 GLU G CD  1 
ATOM   7010  O OE1 . GLU G 2 131 ? 14.237  -99.355  -28.894 1.00 191.66 ? 153 GLU G OE1 1 
ATOM   7011  O OE2 . GLU G 2 131 ? 12.465  -98.545  -27.867 1.00 189.79 ? 153 GLU G OE2 1 
ATOM   7012  N N   . ARG G 2 132 ? 18.229  -97.534  -30.842 1.00 137.76 ? 154 ARG G N   1 
ATOM   7013  C CA  . ARG G 2 132 ? 19.481  -98.274  -31.070 1.00 136.55 ? 154 ARG G CA  1 
ATOM   7014  C C   . ARG G 2 132 ? 20.010  -98.092  -32.482 1.00 139.98 ? 154 ARG G C   1 
ATOM   7015  O O   . ARG G 2 132 ? 19.248  -98.088  -33.437 1.00 139.55 ? 154 ARG G O   1 
ATOM   7016  C CB  . ARG G 2 132 ? 19.280  -99.755  -30.774 1.00 129.74 ? 154 ARG G CB  1 
ATOM   7017  N N   . ASP G 2 133 ? 21.322  -97.955  -32.603 1.00 150.15 ? 155 ASP G N   1 
ATOM   7018  C CA  . ASP G 2 133 ? 21.979  -97.845  -33.903 1.00 161.97 ? 155 ASP G CA  1 
ATOM   7019  C C   . ASP G 2 133 ? 21.951  -99.216  -34.598 1.00 162.50 ? 155 ASP G C   1 
ATOM   7020  O O   . ASP G 2 133 ? 21.732  -100.253 -33.967 1.00 166.07 ? 155 ASP G O   1 
ATOM   7021  C CB  . ASP G 2 133 ? 23.444  -97.375  -33.720 1.00 168.58 ? 155 ASP G CB  1 
ATOM   7022  C CG  . ASP G 2 133 ? 24.059  -96.740  -34.981 1.00 172.66 ? 155 ASP G CG  1 
ATOM   7023  O OD1 . ASP G 2 133 ? 23.382  -96.558  -36.005 1.00 176.40 ? 155 ASP G OD1 1 
ATOM   7024  O OD2 . ASP G 2 133 ? 25.249  -96.402  -34.934 1.00 177.48 ? 155 ASP G OD2 1 
ATOM   7025  N N   . VAL G 2 134 ? 22.151  -99.199  -35.907 1.00 164.72 ? 156 VAL G N   1 
ATOM   7026  C CA  . VAL G 2 134 ? 22.357  -100.415 -36.661 1.00 164.34 ? 156 VAL G CA  1 
ATOM   7027  C C   . VAL G 2 134 ? 23.649  -101.095 -36.228 1.00 164.31 ? 156 VAL G C   1 
ATOM   7028  O O   . VAL G 2 134 ? 24.658  -100.421 -35.953 1.00 173.08 ? 156 VAL G O   1 
ATOM   7029  C CB  . VAL G 2 134 ? 22.427  -100.098 -38.181 1.00 169.35 ? 156 VAL G CB  1 
ATOM   7030  N N   . VAL G 2 135 ? 23.602  -102.427 -36.164 1.00 157.38 ? 157 VAL G N   1 
ATOM   7031  C CA  . VAL G 2 135 ? 24.805  -103.260 -36.084 1.00 158.40 ? 157 VAL G CA  1 
ATOM   7032  C C   . VAL G 2 135 ? 25.258  -103.563 -37.517 1.00 159.96 ? 157 VAL G C   1 
ATOM   7033  O O   . VAL G 2 135 ? 24.429  -103.837 -38.370 1.00 155.87 ? 157 VAL G O   1 
ATOM   7034  C CB  . VAL G 2 135 ? 24.496  -104.575 -35.337 1.00 148.91 ? 157 VAL G CB  1 
ATOM   7035  N N   . CYS G 2 136 ? 26.564  -103.505 -37.763 1.00 168.16 ? 158 CYS G N   1 
ATOM   7036  C CA  . CYS G 2 136 ? 27.158  -103.948 -39.055 1.00 174.12 ? 158 CYS G CA  1 
ATOM   7037  C C   . CYS G 2 136 ? 28.395  -104.801 -38.761 1.00 169.36 ? 158 CYS G C   1 
ATOM   7038  O O   . CYS G 2 136 ? 28.716  -105.731 -39.500 1.00 166.39 ? 158 CYS G O   1 
ATOM   7039  C CB  . CYS G 2 136 ? 27.566  -102.759 -39.943 1.00 184.65 ? 158 CYS G CB  1 
ATOM   7040  S SG  . CYS G 2 136 ? 26.794  -101.143 -39.654 1.00 193.21 ? 158 CYS G SG  1 
ATOM   7041  N N   . ASP H 2 4   ? -10.786 -54.045  -49.373 1.00 258.14 ? 26  ASP H N   1 
ATOM   7042  C CA  . ASP H 2 4   ? -9.639  -53.408  -48.683 1.00 248.71 ? 26  ASP H CA  1 
ATOM   7043  C C   . ASP H 2 4   ? -9.349  -54.118  -47.338 1.00 251.71 ? 26  ASP H C   1 
ATOM   7044  O O   . ASP H 2 4   ? -10.289 -54.489  -46.634 1.00 250.01 ? 26  ASP H O   1 
ATOM   7045  C CB  . ASP H 2 4   ? -9.955  -51.921  -48.442 1.00 241.69 ? 26  ASP H CB  1 
ATOM   7046  C CG  . ASP H 2 4   ? -8.742  -51.017  -48.618 1.00 234.48 ? 26  ASP H CG  1 
ATOM   7047  O OD1 . ASP H 2 4   ? -7.930  -51.269  -49.533 1.00 228.23 ? 26  ASP H OD1 1 
ATOM   7048  O OD2 . ASP H 2 4   ? -8.610  -50.024  -47.855 1.00 231.23 ? 26  ASP H OD2 1 
ATOM   7049  N N   . PRO H 2 5   ? -8.054  -54.314  -46.983 1.00 251.93 ? 27  PRO H N   1 
ATOM   7050  C CA  . PRO H 2 5   ? -7.760  -54.845  -45.641 1.00 252.33 ? 27  PRO H CA  1 
ATOM   7051  C C   . PRO H 2 5   ? -8.105  -53.878  -44.505 1.00 247.68 ? 27  PRO H C   1 
ATOM   7052  O O   . PRO H 2 5   ? -8.693  -54.292  -43.500 1.00 238.31 ? 27  PRO H O   1 
ATOM   7053  C CB  . PRO H 2 5   ? -6.246  -55.099  -45.684 1.00 251.29 ? 27  PRO H CB  1 
ATOM   7054  C CG  . PRO H 2 5   ? -5.898  -55.181  -47.125 1.00 249.63 ? 27  PRO H CG  1 
ATOM   7055  C CD  . PRO H 2 5   ? -6.834  -54.236  -47.811 1.00 248.79 ? 27  PRO H CD  1 
ATOM   7056  N N   . CYS H 2 6   ? -7.743  -52.608  -44.687 1.00 249.61 ? 28  CYS H N   1 
ATOM   7057  C CA  . CYS H 2 6   ? -7.882  -51.579  -43.649 1.00 247.70 ? 28  CYS H CA  1 
ATOM   7058  C C   . CYS H 2 6   ? -9.329  -51.282  -43.263 1.00 247.53 ? 28  CYS H C   1 
ATOM   7059  O O   . CYS H 2 6   ? -9.610  -51.037  -42.091 1.00 246.91 ? 28  CYS H O   1 
ATOM   7060  C CB  . CYS H 2 6   ? -7.194  -50.288  -44.101 1.00 243.32 ? 28  CYS H CB  1 
ATOM   7061  S SG  . CYS H 2 6   ? -5.448  -50.491  -44.506 1.00 251.79 ? 28  CYS H SG  1 
ATOM   7062  N N   . SER H 2 7   ? -10.234 -51.319  -44.243 1.00 246.25 ? 29  SER H N   1 
ATOM   7063  C CA  . SER H 2 7   ? -11.673 -51.134  -43.999 1.00 243.87 ? 29  SER H CA  1 
ATOM   7064  C C   . SER H 2 7   ? -12.224 -52.084  -42.925 1.00 244.62 ? 29  SER H C   1 
ATOM   7065  O O   . SER H 2 7   ? -13.140 -51.726  -42.185 1.00 242.58 ? 29  SER H O   1 
ATOM   7066  C CB  . SER H 2 7   ? -12.464 -51.329  -45.292 1.00 244.79 ? 29  SER H CB  1 
ATOM   7067  O OG  . SER H 2 7   ? -13.827 -50.979  -45.112 1.00 244.88 ? 29  SER H OG  1 
ATOM   7068  N N   . ASN H 2 8   ? -11.659 -53.288  -42.853 1.00 244.97 ? 30  ASN H N   1 
ATOM   7069  C CA  . ASN H 2 8   ? -12.013 -54.281  -41.826 1.00 244.46 ? 30  ASN H CA  1 
ATOM   7070  C C   . ASN H 2 8   ? -11.816 -53.800  -40.378 1.00 240.09 ? 30  ASN H C   1 
ATOM   7071  O O   . ASN H 2 8   ? -12.563 -54.219  -39.482 1.00 238.23 ? 30  ASN H O   1 
ATOM   7072  C CB  . ASN H 2 8   ? -11.206 -55.574  -42.044 1.00 246.02 ? 30  ASN H CB  1 
ATOM   7073  C CG  . ASN H 2 8   ? -11.792 -56.771  -41.302 1.00 246.17 ? 30  ASN H CG  1 
ATOM   7074  O OD1 . ASN H 2 8   ? -12.986 -57.059  -41.398 1.00 243.73 ? 30  ASN H OD1 1 
ATOM   7075  N ND2 . ASN H 2 8   ? -10.943 -57.486  -40.574 1.00 245.62 ? 30  ASN H ND2 1 
ATOM   7076  N N   . CYS H 2 9   ? -10.808 -52.956  -40.151 1.00 236.17 ? 31  CYS H N   1 
ATOM   7077  C CA  . CYS H 2 9   ? -10.516 -52.430  -38.809 1.00 233.10 ? 31  CYS H CA  1 
ATOM   7078  C C   . CYS H 2 9   ? -11.571 -51.405  -38.375 1.00 227.11 ? 31  CYS H C   1 
ATOM   7079  O O   . CYS H 2 9   ? -11.948 -50.542  -39.168 1.00 227.28 ? 31  CYS H O   1 
ATOM   7080  C CB  . CYS H 2 9   ? -9.133  -51.783  -38.755 1.00 229.17 ? 31  CYS H CB  1 
ATOM   7081  S SG  . CYS H 2 9   ? -7.778  -52.879  -39.257 1.00 225.67 ? 31  CYS H SG  1 
ATOM   7082  N N   . PRO H 2 10  ? -12.048 -51.498  -37.114 1.00 220.92 ? 32  PRO H N   1 
ATOM   7083  C CA  . PRO H 2 10  ? -13.095 -50.599  -36.623 1.00 216.22 ? 32  PRO H CA  1 
ATOM   7084  C C   . PRO H 2 10  ? -12.552 -49.307  -36.005 1.00 209.62 ? 32  PRO H C   1 
ATOM   7085  O O   . PRO H 2 10  ? -11.346 -49.045  -36.045 1.00 206.36 ? 32  PRO H O   1 
ATOM   7086  C CB  . PRO H 2 10  ? -13.777 -51.449  -35.552 1.00 221.51 ? 32  PRO H CB  1 
ATOM   7087  C CG  . PRO H 2 10  ? -12.641 -52.214  -34.959 1.00 224.39 ? 32  PRO H CG  1 
ATOM   7088  C CD  . PRO H 2 10  ? -11.728 -52.536  -36.113 1.00 224.43 ? 32  PRO H CD  1 
ATOM   7089  N N   . ALA H 2 11  ? -13.459 -48.503  -35.456 1.00 209.38 ? 33  ALA H N   1 
ATOM   7090  C CA  . ALA H 2 11  ? -13.104 -47.353  -34.620 1.00 205.54 ? 33  ALA H CA  1 
ATOM   7091  C C   . ALA H 2 11  ? -12.385 -47.828  -33.351 1.00 204.40 ? 33  ALA H C   1 
ATOM   7092  O O   . ALA H 2 11  ? -12.673 -48.905  -32.835 1.00 210.72 ? 33  ALA H O   1 
ATOM   7093  C CB  . ALA H 2 11  ? -14.355 -46.562  -34.258 1.00 205.97 ? 33  ALA H CB  1 
ATOM   7094  N N   . GLY H 2 12  ? -11.459 -47.009  -32.861 1.00 195.40 ? 34  GLY H N   1 
ATOM   7095  C CA  . GLY H 2 12  ? -10.578 -47.380  -31.747 1.00 193.57 ? 34  GLY H CA  1 
ATOM   7096  C C   . GLY H 2 12  ? -9.281  -48.063  -32.150 1.00 190.98 ? 34  GLY H C   1 
ATOM   7097  O O   . GLY H 2 12  ? -8.466  -48.400  -31.287 1.00 189.60 ? 34  GLY H O   1 
ATOM   7098  N N   . THR H 2 13  ? -9.084  -48.263  -33.455 1.00 193.01 ? 35  THR H N   1 
ATOM   7099  C CA  . THR H 2 13  ? -7.893  -48.928  -34.004 1.00 196.62 ? 35  THR H CA  1 
ATOM   7100  C C   . THR H 2 13  ? -7.458  -48.236  -35.293 1.00 194.05 ? 35  THR H C   1 
ATOM   7101  O O   . THR H 2 13  ? -8.141  -47.329  -35.780 1.00 191.12 ? 35  THR H O   1 
ATOM   7102  C CB  . THR H 2 13  ? -8.172  -50.416  -34.330 1.00 199.33 ? 35  THR H CB  1 
ATOM   7103  O OG1 . THR H 2 13  ? -9.252  -50.513  -35.271 1.00 197.87 ? 35  THR H OG1 1 
ATOM   7104  C CG2 . THR H 2 13  ? -8.528  -51.199  -33.077 1.00 200.99 ? 35  THR H CG2 1 
ATOM   7105  N N   . PHE H 2 14  ? -6.322  -48.671  -35.834 1.00 194.02 ? 36  PHE H N   1 
ATOM   7106  C CA  . PHE H 2 14  ? -5.852  -48.216  -37.148 1.00 195.27 ? 36  PHE H CA  1 
ATOM   7107  C C   . PHE H 2 14  ? -5.179  -49.345  -37.929 1.00 201.19 ? 36  PHE H C   1 
ATOM   7108  O O   . PHE H 2 14  ? -4.678  -50.314  -37.342 1.00 205.12 ? 36  PHE H O   1 
ATOM   7109  C CB  . PHE H 2 14  ? -4.902  -47.016  -37.003 1.00 189.43 ? 36  PHE H CB  1 
ATOM   7110  C CG  . PHE H 2 14  ? -3.567  -47.357  -36.389 1.00 186.24 ? 36  PHE H CG  1 
ATOM   7111  C CD1 . PHE H 2 14  ? -2.434  -47.510  -37.191 1.00 182.36 ? 36  PHE H CD1 1 
ATOM   7112  C CD2 . PHE H 2 14  ? -3.435  -47.512  -35.012 1.00 186.26 ? 36  PHE H CD2 1 
ATOM   7113  C CE1 . PHE H 2 14  ? -1.205  -47.816  -36.637 1.00 183.27 ? 36  PHE H CE1 1 
ATOM   7114  C CE2 . PHE H 2 14  ? -2.203  -47.814  -34.445 1.00 185.84 ? 36  PHE H CE2 1 
ATOM   7115  C CZ  . PHE H 2 14  ? -1.085  -47.972  -35.266 1.00 184.98 ? 36  PHE H CZ  1 
ATOM   7116  N N   . CYS H 2 15  ? -5.167  -49.195  -39.252 1.00 204.89 ? 37  CYS H N   1 
ATOM   7117  C CA  . CYS H 2 15  ? -4.562  -50.177  -40.159 1.00 213.93 ? 37  CYS H CA  1 
ATOM   7118  C C   . CYS H 2 15  ? -3.046  -49.948  -40.246 1.00 211.49 ? 37  CYS H C   1 
ATOM   7119  O O   . CYS H 2 15  ? -2.564  -49.182  -41.093 1.00 209.49 ? 37  CYS H O   1 
ATOM   7120  C CB  . CYS H 2 15  ? -5.222  -50.072  -41.537 1.00 224.69 ? 37  CYS H CB  1 
ATOM   7121  S SG  . CYS H 2 15  ? -4.600  -51.211  -42.795 1.00 249.68 ? 37  CYS H SG  1 
ATOM   7122  N N   . ASP H 2 16  ? -2.309  -50.624  -39.365 1.00 212.78 ? 38  ASP H N   1 
ATOM   7123  C CA  . ASP H 2 16  ? -0.873  -50.396  -39.187 1.00 217.36 ? 38  ASP H CA  1 
ATOM   7124  C C   . ASP H 2 16  ? -0.064  -50.897  -40.399 1.00 221.21 ? 38  ASP H C   1 
ATOM   7125  O O   . ASP H 2 16  ? 0.192   -52.091  -40.534 1.00 222.52 ? 38  ASP H O   1 
ATOM   7126  C CB  . ASP H 2 16  ? -0.410  -51.075  -37.879 1.00 218.77 ? 38  ASP H CB  1 
ATOM   7127  C CG  . ASP H 2 16  ? 0.983   -50.638  -37.425 1.00 222.11 ? 38  ASP H CG  1 
ATOM   7128  O OD1 . ASP H 2 16  ? 1.741   -50.015  -38.213 1.00 227.82 ? 38  ASP H OD1 1 
ATOM   7129  O OD2 . ASP H 2 16  ? 1.323   -50.939  -36.257 1.00 222.57 ? 38  ASP H OD2 1 
ATOM   7130  N N   . ASN H 2 17  ? 0.341   -49.969  -41.265 1.00 230.97 ? 39  ASN H N   1 
ATOM   7131  C CA  . ASN H 2 17  ? 1.082   -50.306  -42.493 1.00 238.99 ? 39  ASN H CA  1 
ATOM   7132  C C   . ASN H 2 17  ? 2.553   -50.661  -42.260 1.00 238.96 ? 39  ASN H C   1 
ATOM   7133  O O   . ASN H 2 17  ? 3.197   -51.195  -43.162 1.00 235.68 ? 39  ASN H O   1 
ATOM   7134  C CB  . ASN H 2 17  ? 0.990   -49.167  -43.519 1.00 241.55 ? 39  ASN H CB  1 
ATOM   7135  C CG  . ASN H 2 17  ? -0.433  -48.902  -43.979 1.00 245.97 ? 39  ASN H CG  1 
ATOM   7136  O OD1 . ASN H 2 17  ? -1.245  -49.824  -44.110 1.00 252.04 ? 39  ASN H OD1 1 
ATOM   7137  N ND2 . ASN H 2 17  ? -0.743  -47.635  -44.235 1.00 243.76 ? 39  ASN H ND2 1 
ATOM   7138  N N   . ASN H 2 18  ? 3.087   -50.351  -41.078 1.00 239.88 ? 40  ASN H N   1 
ATOM   7139  C CA  . ASN H 2 18  ? 4.433   -50.789  -40.698 1.00 238.95 ? 40  ASN H CA  1 
ATOM   7140  C C   . ASN H 2 18  ? 4.428   -52.273  -40.277 1.00 240.87 ? 40  ASN H C   1 
ATOM   7141  O O   . ASN H 2 18  ? 5.349   -53.018  -40.632 1.00 240.39 ? 40  ASN H O   1 
ATOM   7142  C CB  . ASN H 2 18  ? 5.001   -49.900  -39.584 1.00 236.22 ? 40  ASN H CB  1 
ATOM   7143  N N   . ARG H 2 19  ? 3.385   -52.695  -39.549 1.00 237.83 ? 41  ARG H N   1 
ATOM   7144  C CA  . ARG H 2 19  ? 3.226   -54.088  -39.097 1.00 237.64 ? 41  ARG H CA  1 
ATOM   7145  C C   . ARG H 2 19  ? 2.156   -54.863  -39.902 1.00 238.65 ? 41  ARG H C   1 
ATOM   7146  O O   . ARG H 2 19  ? 1.326   -55.579  -39.323 1.00 243.44 ? 41  ARG H O   1 
ATOM   7147  C CB  . ARG H 2 19  ? 2.908   -54.117  -37.595 1.00 233.48 ? 41  ARG H CB  1 
ATOM   7148  N N   . ASN H 2 20  ? 2.201   -54.718  -41.231 1.00 230.50 ? 42  ASN H N   1 
ATOM   7149  C CA  . ASN H 2 20  ? 1.340   -55.437  -42.195 1.00 225.26 ? 42  ASN H CA  1 
ATOM   7150  C C   . ASN H 2 20  ? -0.161  -55.443  -41.882 1.00 224.79 ? 42  ASN H C   1 
ATOM   7151  O O   . ASN H 2 20  ? -0.698  -56.434  -41.383 1.00 231.85 ? 42  ASN H O   1 
ATOM   7152  C CB  . ASN H 2 20  ? 1.853   -56.871  -42.415 1.00 222.79 ? 42  ASN H CB  1 
ATOM   7153  C CG  . ASN H 2 20  ? 3.106   -56.920  -43.284 1.00 217.72 ? 42  ASN H CG  1 
ATOM   7154  O OD1 . ASN H 2 20  ? 3.784   -55.909  -43.494 1.00 210.69 ? 42  ASN H OD1 1 
ATOM   7155  N ND2 . ASN H 2 20  ? 3.414   -58.104  -43.801 1.00 217.85 ? 42  ASN H ND2 1 
ATOM   7156  N N   . GLN H 2 21  ? -0.815  -54.313  -42.148 1.00 218.70 ? 43  GLN H N   1 
ATOM   7157  C CA  . GLN H 2 21  ? -2.289  -54.196  -42.162 1.00 218.88 ? 43  GLN H CA  1 
ATOM   7158  C C   . GLN H 2 21  ? -3.076  -54.585  -40.890 1.00 216.16 ? 43  GLN H C   1 
ATOM   7159  O O   . GLN H 2 21  ? -4.309  -54.529  -40.900 1.00 208.47 ? 43  GLN H O   1 
ATOM   7160  C CB  . GLN H 2 21  ? -2.861  -54.994  -43.349 1.00 223.01 ? 43  GLN H CB  1 
ATOM   7161  C CG  . GLN H 2 21  ? -2.094  -54.880  -44.660 1.00 223.26 ? 43  GLN H CG  1 
ATOM   7162  C CD  . GLN H 2 21  ? -1.921  -53.450  -45.129 1.00 218.74 ? 43  GLN H CD  1 
ATOM   7163  O OE1 . GLN H 2 21  ? -0.803  -52.997  -45.362 1.00 220.90 ? 43  GLN H OE1 1 
ATOM   7164  N NE2 . GLN H 2 21  ? -3.029  -52.733  -45.270 1.00 213.46 ? 43  GLN H NE2 1 
ATOM   7165  N N   . ILE H 2 22  ? -2.386  -54.956  -39.809 1.00 214.05 ? 44  ILE H N   1 
ATOM   7166  C CA  . ILE H 2 22  ? -3.046  -55.457  -38.600 1.00 215.23 ? 44  ILE H CA  1 
ATOM   7167  C C   . ILE H 2 22  ? -3.752  -54.326  -37.855 1.00 212.50 ? 44  ILE H C   1 
ATOM   7168  O O   . ILE H 2 22  ? -3.276  -53.189  -37.851 1.00 212.51 ? 44  ILE H O   1 
ATOM   7169  C CB  . ILE H 2 22  ? -2.051  -56.199  -37.665 1.00 220.05 ? 44  ILE H CB  1 
ATOM   7170  C CG1 . ILE H 2 22  ? -2.808  -56.992  -36.590 1.00 229.67 ? 44  ILE H CG1 1 
ATOM   7171  C CG2 . ILE H 2 22  ? -1.044  -55.249  -37.020 1.00 216.29 ? 44  ILE H CG2 1 
ATOM   7172  C CD1 . ILE H 2 22  ? -1.945  -57.990  -35.844 1.00 235.33 ? 44  ILE H CD1 1 
ATOM   7173  N N   . CYS H 2 23  ? -4.885  -54.645  -37.237 1.00 219.48 ? 45  CYS H N   1 
ATOM   7174  C CA  . CYS H 2 23  ? -5.697  -53.632  -36.551 1.00 224.21 ? 45  CYS H CA  1 
ATOM   7175  C C   . CYS H 2 23  ? -5.134  -53.355  -35.153 1.00 221.89 ? 45  CYS H C   1 
ATOM   7176  O O   . CYS H 2 23  ? -5.614  -53.902  -34.149 1.00 220.75 ? 45  CYS H O   1 
ATOM   7177  C CB  . CYS H 2 23  ? -7.165  -54.068  -36.472 1.00 230.50 ? 45  CYS H CB  1 
ATOM   7178  S SG  . CYS H 2 23  ? -7.913  -54.522  -38.053 1.00 237.95 ? 45  CYS H SG  1 
ATOM   7179  N N   . SER H 2 24  ? -4.106  -52.504  -35.104 1.00 219.29 ? 46  SER H N   1 
ATOM   7180  C CA  . SER H 2 24  ? -3.474  -52.094  -33.847 1.00 215.27 ? 46  SER H CA  1 
ATOM   7181  C C   . SER H 2 24  ? -4.363  -51.085  -33.117 1.00 209.06 ? 46  SER H C   1 
ATOM   7182  O O   . SER H 2 24  ? -5.014  -50.266  -33.773 1.00 205.88 ? 46  SER H O   1 
ATOM   7183  C CB  . SER H 2 24  ? -2.106  -51.451  -34.112 1.00 217.17 ? 46  SER H CB  1 
ATOM   7184  O OG  . SER H 2 24  ? -1.282  -52.281  -34.906 1.00 220.66 ? 46  SER H OG  1 
ATOM   7185  N N   . PRO H 2 25  ? -4.386  -51.124  -31.765 1.00 208.92 ? 47  PRO H N   1 
ATOM   7186  C CA  . PRO H 2 25  ? -5.194  -50.125  -31.055 1.00 207.40 ? 47  PRO H CA  1 
ATOM   7187  C C   . PRO H 2 25  ? -4.540  -48.748  -31.098 1.00 201.30 ? 47  PRO H C   1 
ATOM   7188  O O   . PRO H 2 25  ? -3.317  -48.647  -31.270 1.00 200.15 ? 47  PRO H O   1 
ATOM   7189  C CB  . PRO H 2 25  ? -5.256  -50.662  -29.612 1.00 209.53 ? 47  PRO H CB  1 
ATOM   7190  C CG  . PRO H 2 25  ? -4.428  -51.907  -29.579 1.00 213.52 ? 47  PRO H CG  1 
ATOM   7191  C CD  . PRO H 2 25  ? -3.602  -51.943  -30.826 1.00 210.34 ? 47  PRO H CD  1 
ATOM   7192  N N   . CYS H 2 26  ? -5.356  -47.706  -30.953 1.00 198.14 ? 48  CYS H N   1 
ATOM   7193  C CA  . CYS H 2 26  ? -4.857  -46.330  -30.945 1.00 192.29 ? 48  CYS H CA  1 
ATOM   7194  C C   . CYS H 2 26  ? -3.885  -46.150  -29.776 1.00 190.98 ? 48  CYS H C   1 
ATOM   7195  O O   . CYS H 2 26  ? -4.224  -46.509  -28.647 1.00 196.18 ? 48  CYS H O   1 
ATOM   7196  C CB  . CYS H 2 26  ? -6.003  -45.303  -30.832 1.00 187.38 ? 48  CYS H CB  1 
ATOM   7197  S SG  . CYS H 2 26  ? -6.973  -44.970  -32.331 1.00 178.54 ? 48  CYS H SG  1 
ATOM   7198  N N   . PRO H 2 27  ? -2.680  -45.607  -30.040 1.00 187.39 ? 49  PRO H N   1 
ATOM   7199  C CA  . PRO H 2 27  ? -1.714  -45.390  -28.951 1.00 189.13 ? 49  PRO H CA  1 
ATOM   7200  C C   . PRO H 2 27  ? -2.181  -44.331  -27.940 1.00 188.61 ? 49  PRO H C   1 
ATOM   7201  O O   . PRO H 2 27  ? -3.263  -43.763  -28.106 1.00 181.20 ? 49  PRO H O   1 
ATOM   7202  C CB  . PRO H 2 27  ? -0.431  -44.964  -29.684 1.00 188.20 ? 49  PRO H CB  1 
ATOM   7203  C CG  . PRO H 2 27  ? -0.861  -44.508  -31.033 1.00 184.28 ? 49  PRO H CG  1 
ATOM   7204  C CD  . PRO H 2 27  ? -2.149  -45.196  -31.357 1.00 184.63 ? 49  PRO H CD  1 
ATOM   7205  N N   . PRO H 2 28  ? -1.396  -44.087  -26.873 1.00 198.42 ? 50  PRO H N   1 
ATOM   7206  C CA  . PRO H 2 28  ? -1.850  -43.110  -25.874 1.00 198.20 ? 50  PRO H CA  1 
ATOM   7207  C C   . PRO H 2 28  ? -2.048  -41.703  -26.451 1.00 191.68 ? 50  PRO H C   1 
ATOM   7208  O O   . PRO H 2 28  ? -1.289  -41.279  -27.336 1.00 180.40 ? 50  PRO H O   1 
ATOM   7209  C CB  . PRO H 2 28  ? -0.733  -43.124  -24.820 1.00 202.42 ? 50  PRO H CB  1 
ATOM   7210  C CG  . PRO H 2 28  ? -0.050  -44.436  -24.998 1.00 208.39 ? 50  PRO H CG  1 
ATOM   7211  C CD  . PRO H 2 28  ? -0.136  -44.740  -26.468 1.00 206.18 ? 50  PRO H CD  1 
ATOM   7212  N N   . ASN H 2 29  ? -3.075  -41.011  -25.945 1.00 186.18 ? 51  ASN H N   1 
ATOM   7213  C CA  . ASN H 2 29  ? -3.450  -39.655  -26.382 1.00 175.89 ? 51  ASN H CA  1 
ATOM   7214  C C   . ASN H 2 29  ? -3.901  -39.593  -27.845 1.00 166.84 ? 51  ASN H C   1 
ATOM   7215  O O   . ASN H 2 29  ? -3.619  -38.614  -28.532 1.00 165.77 ? 51  ASN H O   1 
ATOM   7216  C CB  . ASN H 2 29  ? -2.311  -38.649  -26.144 1.00 175.74 ? 51  ASN H CB  1 
ATOM   7217  C CG  . ASN H 2 29  ? -1.703  -38.770  -24.758 1.00 180.26 ? 51  ASN H CG  1 
ATOM   7218  O OD1 . ASN H 2 29  ? -2.419  -38.811  -23.755 1.00 175.75 ? 51  ASN H OD1 1 
ATOM   7219  N ND2 . ASN H 2 29  ? -0.373  -38.829  -24.693 1.00 184.62 ? 51  ASN H ND2 1 
ATOM   7220  N N   . SER H 2 30  ? -4.617  -40.615  -28.316 1.00 161.30 ? 52  SER H N   1 
ATOM   7221  C CA  . SER H 2 30  ? -5.112  -40.631  -29.699 1.00 156.90 ? 52  SER H CA  1 
ATOM   7222  C C   . SER H 2 30  ? -6.414  -41.387  -29.853 1.00 158.39 ? 52  SER H C   1 
ATOM   7223  O O   . SER H 2 30  ? -6.786  -42.170  -28.985 1.00 167.32 ? 52  SER H O   1 
ATOM   7224  C CB  . SER H 2 30  ? -4.058  -41.211  -30.640 1.00 153.84 ? 52  SER H CB  1 
ATOM   7225  O OG  . SER H 2 30  ? -3.685  -42.514  -30.258 1.00 155.68 ? 52  SER H OG  1 
ATOM   7226  N N   . PHE H 2 31  ? -7.090  -41.153  -30.974 1.00 155.74 ? 53  PHE H N   1 
ATOM   7227  C CA  . PHE H 2 31  ? -8.428  -41.693  -31.208 1.00 159.34 ? 53  PHE H CA  1 
ATOM   7228  C C   . PHE H 2 31  ? -8.728  -41.886  -32.692 1.00 161.36 ? 53  PHE H C   1 
ATOM   7229  O O   . PHE H 2 31  ? -7.993  -41.410  -33.558 1.00 163.63 ? 53  PHE H O   1 
ATOM   7230  C CB  . PHE H 2 31  ? -9.483  -40.761  -30.594 1.00 159.83 ? 53  PHE H CB  1 
ATOM   7231  C CG  . PHE H 2 31  ? -9.752  -39.523  -31.408 1.00 161.51 ? 53  PHE H CG  1 
ATOM   7232  C CD1 . PHE H 2 31  ? -10.869 -39.448  -32.242 1.00 164.35 ? 53  PHE H CD1 1 
ATOM   7233  C CD2 . PHE H 2 31  ? -8.883  -38.439  -31.358 1.00 161.62 ? 53  PHE H CD2 1 
ATOM   7234  C CE1 . PHE H 2 31  ? -11.112 -38.311  -33.003 1.00 162.18 ? 53  PHE H CE1 1 
ATOM   7235  C CE2 . PHE H 2 31  ? -9.124  -37.300  -32.116 1.00 158.38 ? 53  PHE H CE2 1 
ATOM   7236  C CZ  . PHE H 2 31  ? -10.236 -37.237  -32.943 1.00 157.17 ? 53  PHE H CZ  1 
ATOM   7237  N N   . SER H 2 32  ? -9.821  -42.593  -32.959 1.00 168.47 ? 54  SER H N   1 
ATOM   7238  C CA  . SER H 2 32  ? -10.418 -42.685  -34.296 1.00 172.37 ? 54  SER H CA  1 
ATOM   7239  C C   . SER H 2 32  ? -11.901 -43.010  -34.157 1.00 179.59 ? 54  SER H C   1 
ATOM   7240  O O   . SER H 2 32  ? -12.252 -44.079  -33.666 1.00 187.54 ? 54  SER H O   1 
ATOM   7241  C CB  . SER H 2 32  ? -9.718  -43.752  -35.150 1.00 171.87 ? 54  SER H CB  1 
ATOM   7242  O OG  . SER H 2 32  ? -9.698  -45.012  -34.498 1.00 167.49 ? 54  SER H OG  1 
ATOM   7243  N N   . SER H 2 33  ? -12.761 -42.068  -34.559 1.00 181.75 ? 55  SER H N   1 
ATOM   7244  C CA  . SER H 2 33  ? -14.219 -42.248  -34.496 1.00 190.03 ? 55  SER H CA  1 
ATOM   7245  C C   . SER H 2 33  ? -14.806 -42.846  -35.786 1.00 188.90 ? 55  SER H C   1 
ATOM   7246  O O   . SER H 2 33  ? -16.030 -42.955  -35.908 1.00 200.45 ? 55  SER H O   1 
ATOM   7247  C CB  . SER H 2 33  ? -14.902 -40.915  -34.165 1.00 192.46 ? 55  SER H CB  1 
ATOM   7248  O OG  . SER H 2 33  ? -14.634 -39.936  -35.160 1.00 190.84 ? 55  SER H OG  1 
ATOM   7249  N N   . ALA H 2 34  ? -13.943 -43.219  -36.732 1.00 180.70 ? 56  ALA H N   1 
ATOM   7250  C CA  . ALA H 2 34  ? -14.339 -43.995  -37.907 1.00 184.25 ? 56  ALA H CA  1 
ATOM   7251  C C   . ALA H 2 34  ? -13.380 -45.169  -38.122 1.00 186.06 ? 56  ALA H C   1 
ATOM   7252  O O   . ALA H 2 34  ? -12.298 -45.208  -37.550 1.00 176.91 ? 56  ALA H O   1 
ATOM   7253  C CB  . ALA H 2 34  ? -14.382 -43.107  -39.140 1.00 180.66 ? 56  ALA H CB  1 
ATOM   7254  N N   . GLY H 2 35  ? -13.774 -46.101  -38.992 1.00 192.15 ? 57  GLY H N   1 
ATOM   7255  C CA  . GLY H 2 35  ? -13.044 -47.358  -39.203 1.00 191.73 ? 57  GLY H CA  1 
ATOM   7256  C C   . GLY H 2 35  ? -11.798 -47.230  -40.056 1.00 185.33 ? 57  GLY H C   1 
ATOM   7257  O O   . GLY H 2 35  ? -11.822 -46.618  -41.121 1.00 181.28 ? 57  GLY H O   1 
ATOM   7258  N N   . GLN H 2 37  ? -8.179  -44.571  -42.429 1.00 30.00  ? 59  GLN H N   1 
ATOM   7259  C CA  . GLN H 2 37  ? -7.993  -45.274  -41.169 1.00 30.00  ? 59  GLN H CA  1 
ATOM   7260  C C   . GLN H 2 37  ? -6.535  -45.672  -40.981 1.00 30.00  ? 59  GLN H C   1 
ATOM   7261  O O   . GLN H 2 37  ? -6.221  -46.536  -40.170 1.00 30.00  ? 59  GLN H O   1 
ATOM   7262  C CB  . GLN H 2 37  ? -8.892  -46.510  -41.104 1.00 30.00  ? 59  GLN H CB  1 
ATOM   7263  N N   . ARG H 2 38  ? -5.644  -45.030  -41.725 1.00 169.55 ? 60  ARG H N   1 
ATOM   7264  C CA  . ARG H 2 38  ? -4.233  -45.359  -41.640 1.00 166.15 ? 60  ARG H CA  1 
ATOM   7265  C C   . ARG H 2 38  ? -3.658  -45.093  -40.263 1.00 162.69 ? 60  ARG H C   1 
ATOM   7266  O O   . ARG H 2 38  ? -2.899  -45.901  -39.748 1.00 159.96 ? 60  ARG H O   1 
ATOM   7267  C CB  . ARG H 2 38  ? -3.448  -44.590  -42.693 1.00 161.12 ? 60  ARG H CB  1 
ATOM   7268  N N   . THR H 2 39  ? -4.013  -43.966  -39.661 1.00 163.44 ? 61  THR H N   1 
ATOM   7269  C CA  . THR H 2 39  ? -3.523  -43.653  -38.324 1.00 167.46 ? 61  THR H CA  1 
ATOM   7270  C C   . THR H 2 39  ? -4.554  -42.944  -37.499 1.00 170.66 ? 61  THR H C   1 
ATOM   7271  O O   . THR H 2 39  ? -5.486  -42.337  -38.010 1.00 175.48 ? 61  THR H O   1 
ATOM   7272  C CB  . THR H 2 39  ? -2.310  -42.719  -38.307 1.00 165.35 ? 61  THR H CB  1 
ATOM   7273  O OG1 . THR H 2 39  ? -2.608  -41.544  -39.065 1.00 162.37 ? 61  THR H OG1 1 
ATOM   7274  C CG2 . THR H 2 39  ? -1.077  -43.406  -38.844 1.00 166.23 ? 61  THR H CG2 1 
ATOM   7275  N N   . CYS H 2 40  ? -4.341  -43.010  -36.201 1.00 169.32 ? 62  CYS H N   1 
ATOM   7276  C CA  . CYS H 2 40  ? -5.225  -42.376  -35.231 1.00 169.59 ? 62  CYS H CA  1 
ATOM   7277  C C   . CYS H 2 40  ? -4.889  -40.894  -35.141 1.00 161.26 ? 62  CYS H C   1 
ATOM   7278  O O   . CYS H 2 40  ? -3.745  -40.499  -35.350 1.00 153.54 ? 62  CYS H O   1 
ATOM   7279  C CB  . CYS H 2 40  ? -5.101  -43.050  -33.856 1.00 176.94 ? 62  CYS H CB  1 
ATOM   7280  S SG  . CYS H 2 40  ? -5.608  -44.799  -33.850 1.00 186.00 ? 62  CYS H SG  1 
ATOM   7281  N N   . ASP H 2 41  ? -5.898  -40.084  -34.833 1.00 160.49 ? 63  ASP H N   1 
ATOM   7282  C CA  . ASP H 2 41  ? -5.745  -38.633  -34.704 1.00 163.42 ? 63  ASP H CA  1 
ATOM   7283  C C   . ASP H 2 41  ? -5.338  -38.286  -33.282 1.00 162.16 ? 63  ASP H C   1 
ATOM   7284  O O   . ASP H 2 41  ? -5.688  -39.011  -32.365 1.00 170.49 ? 63  ASP H O   1 
ATOM   7285  C CB  . ASP H 2 41  ? -7.062  -37.936  -35.033 1.00 166.59 ? 63  ASP H CB  1 
ATOM   7286  C CG  . ASP H 2 41  ? -7.573  -38.268  -36.432 1.00 175.48 ? 63  ASP H CG  1 
ATOM   7287  O OD1 . ASP H 2 41  ? -6.761  -38.588  -37.323 1.00 180.32 ? 63  ASP H OD1 1 
ATOM   7288  O OD2 . ASP H 2 41  ? -8.802  -38.205  -36.640 1.00 189.07 ? 63  ASP H OD2 1 
ATOM   7289  N N   . ILE H 2 42  ? -4.612  -37.180  -33.095 1.00 154.90 ? 64  ILE H N   1 
ATOM   7290  C CA  . ILE H 2 42  ? -4.155  -36.768  -31.758 1.00 150.67 ? 64  ILE H CA  1 
ATOM   7291  C C   . ILE H 2 42  ? -5.318  -36.243  -30.930 1.00 149.45 ? 64  ILE H C   1 
ATOM   7292  O O   . ILE H 2 42  ? -6.139  -35.494  -31.437 1.00 147.65 ? 64  ILE H O   1 
ATOM   7293  C CB  . ILE H 2 42  ? -3.065  -35.672  -31.814 1.00 148.37 ? 64  ILE H CB  1 
ATOM   7294  C CG1 . ILE H 2 42  ? -1.829  -36.135  -32.616 1.00 148.40 ? 64  ILE H CG1 1 
ATOM   7295  C CG2 . ILE H 2 42  ? -2.619  -35.263  -30.413 1.00 148.65 ? 64  ILE H CG2 1 
ATOM   7296  C CD1 . ILE H 2 42  ? -0.932  -37.159  -31.928 1.00 149.86 ? 64  ILE H CD1 1 
ATOM   7297  N N   . CYS H 2 43  ? -5.369  -36.626  -29.658 1.00 154.53 ? 65  CYS H N   1 
ATOM   7298  C CA  . CYS H 2 43  ? -6.424  -36.179  -28.736 1.00 159.29 ? 65  CYS H CA  1 
ATOM   7299  C C   . CYS H 2 43  ? -6.252  -34.701  -28.430 1.00 148.85 ? 65  CYS H C   1 
ATOM   7300  O O   . CYS H 2 43  ? -5.133  -34.233  -28.257 1.00 144.26 ? 65  CYS H O   1 
ATOM   7301  C CB  . CYS H 2 43  ? -6.401  -36.968  -27.417 1.00 173.75 ? 65  CYS H CB  1 
ATOM   7302  S SG  . CYS H 2 43  ? -7.191  -38.596  -27.434 1.00 192.41 ? 65  CYS H SG  1 
ATOM   7303  N N   . ARG H 2 44  ? -7.368  -33.980  -28.346 1.00 147.06 ? 66  ARG H N   1 
ATOM   7304  C CA  . ARG H 2 44  ? -7.351  -32.562  -27.994 1.00 147.59 ? 66  ARG H CA  1 
ATOM   7305  C C   . ARG H 2 44  ? -6.892  -32.395  -26.554 1.00 146.82 ? 66  ARG H C   1 
ATOM   7306  O O   . ARG H 2 44  ? -7.105  -33.277  -25.734 1.00 161.09 ? 66  ARG H O   1 
ATOM   7307  C CB  . ARG H 2 44  ? -8.741  -31.950  -28.187 1.00 150.25 ? 66  ARG H CB  1 
ATOM   7308  C CG  . ARG H 2 44  ? -8.867  -30.460  -27.866 1.00 153.30 ? 66  ARG H CG  1 
ATOM   7309  C CD  . ARG H 2 44  ? -9.849  -29.755  -28.798 1.00 159.51 ? 66  ARG H CD  1 
ATOM   7310  N NE  . ARG H 2 44  ? -11.120 -30.489  -28.915 1.00 172.56 ? 66  ARG H NE  1 
ATOM   7311  C CZ  . ARG H 2 44  ? -12.031 -30.319  -29.880 1.00 182.04 ? 66  ARG H CZ  1 
ATOM   7312  N NH1 . ARG H 2 44  ? -11.852 -29.433  -30.867 1.00 188.69 ? 66  ARG H NH1 1 
ATOM   7313  N NH2 . ARG H 2 44  ? -13.139 -31.061  -29.871 1.00 182.57 ? 66  ARG H NH2 1 
ATOM   7314  N N   . GLN H 2 45  ? -6.249  -31.270  -26.264 1.00 143.30 ? 67  GLN H N   1 
ATOM   7315  C CA  . GLN H 2 45  ? -5.791  -30.935  -24.923 1.00 144.11 ? 67  GLN H CA  1 
ATOM   7316  C C   . GLN H 2 45  ? -6.624  -29.744  -24.498 1.00 147.87 ? 67  GLN H C   1 
ATOM   7317  O O   . GLN H 2 45  ? -6.779  -28.794  -25.269 1.00 153.27 ? 67  GLN H O   1 
ATOM   7318  C CB  . GLN H 2 45  ? -4.325  -30.518  -24.955 1.00 142.79 ? 67  GLN H CB  1 
ATOM   7319  C CG  . GLN H 2 45  ? -3.368  -31.270  -24.038 1.00 146.11 ? 67  GLN H CG  1 
ATOM   7320  C CD  . GLN H 2 45  ? -2.523  -32.251  -24.804 1.00 147.89 ? 67  GLN H CD  1 
ATOM   7321  O OE1 . GLN H 2 45  ? -3.049  -33.147  -25.462 1.00 149.91 ? 67  GLN H OE1 1 
ATOM   7322  N NE2 . GLN H 2 45  ? -1.213  -32.073  -24.747 1.00 152.69 ? 67  GLN H NE2 1 
ATOM   7323  N N   . CYS H 2 46  ? -7.148  -29.789  -23.277 1.00 148.82 ? 68  CYS H N   1 
ATOM   7324  C CA  . CYS H 2 46  ? -7.896  -28.658  -22.745 1.00 145.97 ? 68  CYS H CA  1 
ATOM   7325  C C   . CYS H 2 46  ? -7.118  -28.119  -21.571 1.00 141.97 ? 68  CYS H C   1 
ATOM   7326  O O   . CYS H 2 46  ? -7.279  -28.582  -20.453 1.00 150.48 ? 68  CYS H O   1 
ATOM   7327  C CB  . CYS H 2 46  ? -9.301  -29.083  -22.342 1.00 150.89 ? 68  CYS H CB  1 
ATOM   7328  S SG  . CYS H 2 46  ? -10.199 -29.928  -23.666 1.00 154.53 ? 68  CYS H SG  1 
ATOM   7329  N N   . LYS H 2 47  ? -6.244  -27.156  -21.840 1.00 134.68 ? 69  LYS H N   1 
ATOM   7330  C CA  . LYS H 2 47  ? -5.396  -26.564  -20.813 1.00 135.36 ? 69  LYS H CA  1 
ATOM   7331  C C   . LYS H 2 47  ? -5.531  -25.053  -20.849 1.00 131.88 ? 69  LYS H C   1 
ATOM   7332  O O   . LYS H 2 47  ? -6.281  -24.522  -21.664 1.00 129.64 ? 69  LYS H O   1 
ATOM   7333  C CB  . LYS H 2 47  ? -3.951  -27.022  -21.008 1.00 138.37 ? 69  LYS H CB  1 
ATOM   7334  C CG  . LYS H 2 47  ? -3.856  -28.531  -21.152 1.00 142.76 ? 69  LYS H CG  1 
ATOM   7335  C CD  . LYS H 2 47  ? -2.482  -29.084  -20.848 1.00 149.11 ? 69  LYS H CD  1 
ATOM   7336  C CE  . LYS H 2 47  ? -2.559  -30.580  -20.570 1.00 157.65 ? 69  LYS H CE  1 
ATOM   7337  N NZ  . LYS H 2 47  ? -1.237  -31.266  -20.697 1.00 163.42 ? 69  LYS H NZ  1 
ATOM   7338  N N   . GLY H 2 48  ? -4.837  -24.366  -19.940 1.00 134.12 ? 70  GLY H N   1 
ATOM   7339  C CA  . GLY H 2 48  ? -4.873  -22.898  -19.871 1.00 135.19 ? 70  GLY H CA  1 
ATOM   7340  C C   . GLY H 2 48  ? -6.253  -22.413  -19.465 1.00 135.56 ? 70  GLY H C   1 
ATOM   7341  O O   . GLY H 2 48  ? -6.753  -22.773  -18.404 1.00 138.70 ? 70  GLY H O   1 
ATOM   7342  N N   . VAL H 2 49  ? -6.884  -21.615  -20.317 1.00 133.35 ? 71  VAL H N   1 
ATOM   7343  C CA  . VAL H 2 49  ? -8.263  -21.189  -20.060 1.00 136.45 ? 71  VAL H CA  1 
ATOM   7344  C C   . VAL H 2 49  ? -9.292  -22.264  -20.360 1.00 133.65 ? 71  VAL H C   1 
ATOM   7345  O O   . VAL H 2 49  ? -10.464 -22.061  -20.077 1.00 134.58 ? 71  VAL H O   1 
ATOM   7346  C CB  . VAL H 2 49  ? -8.650  -19.893  -20.816 1.00 138.58 ? 71  VAL H CB  1 
ATOM   7347  C CG1 . VAL H 2 49  ? -7.881  -18.708  -20.233 1.00 144.15 ? 71  VAL H CG1 1 
ATOM   7348  C CG2 . VAL H 2 49  ? -8.453  -20.033  -22.328 1.00 135.90 ? 71  VAL H CG2 1 
ATOM   7349  N N   . PHE H 2 50  ? -8.874  -23.386  -20.941 1.00 133.82 ? 72  PHE H N   1 
ATOM   7350  C CA  . PHE H 2 50  ? -9.788  -24.498  -21.184 1.00 138.50 ? 72  PHE H CA  1 
ATOM   7351  C C   . PHE H 2 50  ? -9.754  -25.526  -20.054 1.00 140.41 ? 72  PHE H C   1 
ATOM   7352  O O   . PHE H 2 50  ? -8.676  -25.894  -19.576 1.00 139.61 ? 72  PHE H O   1 
ATOM   7353  C CB  . PHE H 2 50  ? -9.459  -25.187  -22.505 1.00 138.98 ? 72  PHE H CB  1 
ATOM   7354  C CG  . PHE H 2 50  ? -9.576  -24.288  -23.702 1.00 136.57 ? 72  PHE H CG  1 
ATOM   7355  C CD1 . PHE H 2 50  ? -10.805 -23.786  -24.078 1.00 136.87 ? 72  PHE H CD1 1 
ATOM   7356  C CD2 . PHE H 2 50  ? -8.465  -23.967  -24.468 1.00 136.69 ? 72  PHE H CD2 1 
ATOM   7357  C CE1 . PHE H 2 50  ? -10.932 -22.967  -25.195 1.00 136.81 ? 72  PHE H CE1 1 
ATOM   7358  C CE2 . PHE H 2 50  ? -8.579  -23.148  -25.576 1.00 134.74 ? 72  PHE H CE2 1 
ATOM   7359  C CZ  . PHE H 2 50  ? -9.811  -22.641  -25.941 1.00 135.08 ? 72  PHE H CZ  1 
ATOM   7360  N N   . ARG H 2 51  ? -10.949 -25.951  -19.628 1.00 139.06 ? 73  ARG H N   1 
ATOM   7361  C CA  . ARG H 2 51  ? -11.153 -27.133  -18.791 1.00 140.76 ? 73  ARG H CA  1 
ATOM   7362  C C   . ARG H 2 51  ? -11.678 -28.251  -19.693 1.00 139.72 ? 73  ARG H C   1 
ATOM   7363  O O   . ARG H 2 51  ? -12.355 -27.986  -20.690 1.00 131.83 ? 73  ARG H O   1 
ATOM   7364  C CB  . ARG H 2 51  ? -12.190 -26.868  -17.692 1.00 146.55 ? 73  ARG H CB  1 
ATOM   7365  C CG  . ARG H 2 51  ? -11.845 -25.862  -16.593 1.00 152.08 ? 73  ARG H CG  1 
ATOM   7366  C CD  . ARG H 2 51  ? -12.521 -26.195  -15.249 1.00 159.49 ? 73  ARG H CD  1 
ATOM   7367  N NE  . ARG H 2 51  ? -13.885 -26.742  -15.382 1.00 165.69 ? 73  ARG H NE  1 
ATOM   7368  C CZ  . ARG H 2 51  ? -15.033 -26.048  -15.396 1.00 166.65 ? 73  ARG H CZ  1 
ATOM   7369  N NH1 . ARG H 2 51  ? -16.186 -26.699  -15.535 1.00 168.67 ? 73  ARG H NH1 1 
ATOM   7370  N NH2 . ARG H 2 51  ? -15.061 -24.722  -15.280 1.00 164.37 ? 73  ARG H NH2 1 
ATOM   7371  N N   . THR H 2 52  ? -11.378 -29.496  -19.340 1.00 146.40 ? 74  THR H N   1 
ATOM   7372  C CA  . THR H 2 52  ? -11.935 -30.651  -20.047 1.00 150.99 ? 74  THR H CA  1 
ATOM   7373  C C   . THR H 2 52  ? -13.405 -30.868  -19.656 1.00 158.23 ? 74  THR H C   1 
ATOM   7374  O O   . THR H 2 52  ? -13.720 -30.988  -18.474 1.00 160.96 ? 74  THR H O   1 
ATOM   7375  C CB  . THR H 2 52  ? -11.151 -31.936  -19.723 1.00 153.95 ? 74  THR H CB  1 
ATOM   7376  O OG1 . THR H 2 52  ? -9.750  -31.679  -19.815 1.00 154.36 ? 74  THR H OG1 1 
ATOM   7377  C CG2 . THR H 2 52  ? -11.519 -33.056  -20.681 1.00 155.26 ? 74  THR H CG2 1 
ATOM   7378  N N   . ARG H 2 53  ? -14.292 -30.910  -20.651 1.00 166.44 ? 75  ARG H N   1 
ATOM   7379  C CA  . ARG H 2 53  ? -15.707 -31.237  -20.437 1.00 174.53 ? 75  ARG H CA  1 
ATOM   7380  C C   . ARG H 2 53  ? -15.926 -32.748  -20.554 1.00 181.48 ? 75  ARG H C   1 
ATOM   7381  O O   . ARG H 2 53  ? -16.548 -33.350  -19.680 1.00 190.79 ? 75  ARG H O   1 
ATOM   7382  C CB  . ARG H 2 53  ? -16.593 -30.497  -21.436 1.00 177.07 ? 75  ARG H CB  1 
ATOM   7383  C CG  . ARG H 2 53  ? -18.076 -30.526  -21.078 1.00 182.76 ? 75  ARG H CG  1 
ATOM   7384  C CD  . ARG H 2 53  ? -18.919 -29.791  -22.110 1.00 183.38 ? 75  ARG H CD  1 
ATOM   7385  N NE  . ARG H 2 53  ? -18.923 -30.494  -23.392 1.00 190.00 ? 75  ARG H NE  1 
ATOM   7386  C CZ  . ARG H 2 53  ? -19.438 -30.040  -24.538 1.00 189.86 ? 75  ARG H CZ  1 
ATOM   7387  N NH1 . ARG H 2 53  ? -20.032 -28.849  -24.595 1.00 190.47 ? 75  ARG H NH1 1 
ATOM   7388  N NH2 . ARG H 2 53  ? -19.355 -30.788  -25.635 1.00 188.13 ? 75  ARG H NH2 1 
ATOM   7389  N N   . LYS H 2 54  ? -15.424 -33.345  -21.635 1.00 183.94 ? 76  LYS H N   1 
ATOM   7390  C CA  . LYS H 2 54  ? -15.479 -34.796  -21.845 1.00 187.69 ? 76  LYS H CA  1 
ATOM   7391  C C   . LYS H 2 54  ? -14.070 -35.316  -22.093 1.00 188.11 ? 76  LYS H C   1 
ATOM   7392  O O   . LYS H 2 54  ? -13.343 -34.745  -22.901 1.00 190.78 ? 76  LYS H O   1 
ATOM   7393  C CB  . LYS H 2 54  ? -16.368 -35.125  -23.044 1.00 188.38 ? 76  LYS H CB  1 
ATOM   7394  C CG  . LYS H 2 54  ? -16.796 -36.586  -23.099 1.00 193.54 ? 76  LYS H CG  1 
ATOM   7395  C CD  . LYS H 2 54  ? -17.538 -36.944  -24.377 1.00 196.74 ? 76  LYS H CD  1 
ATOM   7396  C CE  . LYS H 2 54  ? -16.648 -36.902  -25.617 1.00 197.40 ? 76  LYS H CE  1 
ATOM   7397  N NZ  . LYS H 2 54  ? -15.367 -37.644  -25.472 1.00 196.78 ? 76  LYS H NZ  1 
ATOM   7398  N N   . GLU H 2 55  ? -13.688 -36.399  -21.419 1.00 191.19 ? 77  GLU H N   1 
ATOM   7399  C CA  . GLU H 2 55  ? -12.343 -36.967  -21.541 1.00 193.39 ? 77  GLU H CA  1 
ATOM   7400  C C   . GLU H 2 55  ? -12.152 -37.669  -22.889 1.00 183.89 ? 77  GLU H C   1 
ATOM   7401  O O   . GLU H 2 55  ? -13.127 -38.089  -23.514 1.00 175.51 ? 77  GLU H O   1 
ATOM   7402  C CB  . GLU H 2 55  ? -12.091 -37.953  -20.388 1.00 208.33 ? 77  GLU H CB  1 
ATOM   7403  C CG  . GLU H 2 55  ? -10.632 -38.280  -20.094 1.00 219.77 ? 77  GLU H CG  1 
ATOM   7404  C CD  . GLU H 2 55  ? -9.813  -37.073  -19.655 1.00 224.03 ? 77  GLU H CD  1 
ATOM   7405  O OE1 . GLU H 2 55  ? -10.400 -36.096  -19.137 1.00 227.67 ? 77  GLU H OE1 1 
ATOM   7406  O OE2 . GLU H 2 55  ? -8.574  -37.104  -19.828 1.00 228.53 ? 77  GLU H OE2 1 
ATOM   7407  N N   . CYS H 2 56  ? -10.901 -37.783  -23.334 1.00 180.30 ? 78  CYS H N   1 
ATOM   7408  C CA  . CYS H 2 56  ? -10.597 -38.403  -24.629 1.00 183.51 ? 78  CYS H CA  1 
ATOM   7409  C C   . CYS H 2 56  ? -10.539 -39.920  -24.533 1.00 187.01 ? 78  CYS H C   1 
ATOM   7410  O O   . CYS H 2 56  ? -9.624  -40.475  -23.923 1.00 192.88 ? 78  CYS H O   1 
ATOM   7411  C CB  . CYS H 2 56  ? -9.269  -37.895  -25.215 1.00 183.66 ? 78  CYS H CB  1 
ATOM   7412  S SG  . CYS H 2 56  ? -9.160  -38.217  -27.001 1.00 193.96 ? 78  CYS H SG  1 
ATOM   7413  N N   . SER H 2 57  ? -11.515 -40.583  -25.148 1.00 187.33 ? 79  SER H N   1 
ATOM   7414  C CA  . SER H 2 57  ? -11.475 -42.032  -25.348 1.00 191.16 ? 79  SER H CA  1 
ATOM   7415  C C   . SER H 2 57  ? -10.672 -42.345  -26.608 1.00 187.44 ? 79  SER H C   1 
ATOM   7416  O O   . SER H 2 57  ? -10.169 -41.437  -27.266 1.00 182.81 ? 79  SER H O   1 
ATOM   7417  C CB  . SER H 2 57  ? -12.895 -42.576  -25.498 1.00 197.22 ? 79  SER H CB  1 
ATOM   7418  O OG  . SER H 2 57  ? -13.484 -42.132  -26.711 1.00 196.85 ? 79  SER H OG  1 
ATOM   7419  N N   . SER H 2 58  ? -10.555 -43.629  -26.940 1.00 189.40 ? 80  SER H N   1 
ATOM   7420  C CA  . SER H 2 58  ? -10.032 -44.046  -28.245 1.00 189.24 ? 80  SER H CA  1 
ATOM   7421  C C   . SER H 2 58  ? -11.126 -44.037  -29.327 1.00 192.27 ? 80  SER H C   1 
ATOM   7422  O O   . SER H 2 58  ? -10.816 -44.160  -30.508 1.00 196.79 ? 80  SER H O   1 
ATOM   7423  C CB  . SER H 2 58  ? -9.395  -45.433  -28.157 1.00 190.87 ? 80  SER H CB  1 
ATOM   7424  O OG  . SER H 2 58  ? -10.378 -46.442  -28.023 1.00 195.63 ? 80  SER H OG  1 
ATOM   7425  N N   . THR H 2 59  ? -12.393 -43.914  -28.924 1.00 196.43 ? 81  THR H N   1 
ATOM   7426  C CA  . THR H 2 59  ? -13.495 -43.723  -29.863 1.00 199.54 ? 81  THR H CA  1 
ATOM   7427  C C   . THR H 2 59  ? -13.505 -42.279  -30.342 1.00 195.61 ? 81  THR H C   1 
ATOM   7428  O O   . THR H 2 59  ? -13.274 -42.021  -31.521 1.00 199.97 ? 81  THR H O   1 
ATOM   7429  C CB  . THR H 2 59  ? -14.868 -44.047  -29.229 1.00 206.28 ? 81  THR H CB  1 
ATOM   7430  O OG1 . THR H 2 59  ? -14.878 -45.404  -28.778 1.00 214.02 ? 81  THR H OG1 1 
ATOM   7431  C CG2 . THR H 2 59  ? -16.017 -43.829  -30.228 1.00 206.57 ? 81  THR H CG2 1 
ATOM   7432  N N   . SER H 2 60  ? -13.755 -41.346  -29.421 1.00 190.33 ? 82  SER H N   1 
ATOM   7433  C CA  . SER H 2 60  ? -13.991 -39.949  -29.773 1.00 188.28 ? 82  SER H CA  1 
ATOM   7434  C C   . SER H 2 60  ? -12.955 -39.016  -29.164 1.00 183.78 ? 82  SER H C   1 
ATOM   7435  O O   . SER H 2 60  ? -12.267 -39.357  -28.192 1.00 184.36 ? 82  SER H O   1 
ATOM   7436  C CB  . SER H 2 60  ? -15.398 -39.522  -29.337 1.00 191.35 ? 82  SER H CB  1 
ATOM   7437  O OG  . SER H 2 60  ? -15.577 -39.672  -27.942 1.00 189.10 ? 82  SER H OG  1 
ATOM   7438  N N   . ASN H 2 61  ? -12.865 -37.825  -29.751 1.00 174.66 ? 83  ASN H N   1 
ATOM   7439  C CA  . ASN H 2 61  ? -11.984 -36.777  -29.262 1.00 169.96 ? 83  ASN H CA  1 
ATOM   7440  C C   . ASN H 2 61  ? -12.576 -36.164  -27.999 1.00 165.45 ? 83  ASN H C   1 
ATOM   7441  O O   . ASN H 2 61  ? -13.795 -36.245  -27.768 1.00 164.31 ? 83  ASN H O   1 
ATOM   7442  C CB  . ASN H 2 61  ? -11.824 -35.695  -30.340 1.00 167.41 ? 83  ASN H CB  1 
ATOM   7443  C CG  . ASN H 2 61  ? -10.631 -34.783  -30.099 1.00 161.05 ? 83  ASN H CG  1 
ATOM   7444  O OD1 . ASN H 2 61  ? -9.588  -35.208  -29.606 1.00 154.28 ? 83  ASN H OD1 1 
ATOM   7445  N ND2 . ASN H 2 61  ? -10.787 -33.512  -30.451 1.00 157.78 ? 83  ASN H ND2 1 
ATOM   7446  N N   . ALA H 2 62  ? -11.715 -35.544  -27.192 1.00 162.94 ? 84  ALA H N   1 
ATOM   7447  C CA  . ALA H 2 62  ? -12.154 -34.756  -26.038 1.00 167.58 ? 84  ALA H CA  1 
ATOM   7448  C C   . ALA H 2 62  ? -12.921 -33.511  -26.485 1.00 169.38 ? 84  ALA H C   1 
ATOM   7449  O O   . ALA H 2 62  ? -12.917 -33.146  -27.665 1.00 177.35 ? 84  ALA H O   1 
ATOM   7450  C CB  . ALA H 2 62  ? -10.959 -34.339  -25.191 1.00 165.72 ? 84  ALA H CB  1 
ATOM   7451  N N   . GLU H 2 63  ? -13.591 -32.870  -25.533 1.00 166.22 ? 85  GLU H N   1 
ATOM   7452  C CA  . GLU H 2 63  ? -14.260 -31.598  -25.770 1.00 165.19 ? 85  GLU H CA  1 
ATOM   7453  C C   . GLU H 2 63  ? -13.965 -30.686  -24.596 1.00 160.46 ? 85  GLU H C   1 
ATOM   7454  O O   . GLU H 2 63  ? -13.942 -31.144  -23.458 1.00 161.33 ? 85  GLU H O   1 
ATOM   7455  C CB  . GLU H 2 63  ? -15.759 -31.816  -25.947 1.00 173.31 ? 85  GLU H CB  1 
ATOM   7456  C CG  . GLU H 2 63  ? -16.158 -32.240  -27.358 1.00 183.69 ? 85  GLU H CG  1 
ATOM   7457  C CD  . GLU H 2 63  ? -17.330 -33.208  -27.392 1.00 192.06 ? 85  GLU H CD  1 
ATOM   7458  O OE1 . GLU H 2 63  ? -18.306 -33.010  -26.632 1.00 193.19 ? 85  GLU H OE1 1 
ATOM   7459  O OE2 . GLU H 2 63  ? -17.278 -34.155  -28.214 1.00 202.55 ? 85  GLU H OE2 1 
ATOM   7460  N N   . CYS H 2 64  ? -13.725 -29.408  -24.879 1.00 156.39 ? 86  CYS H N   1 
ATOM   7461  C CA  . CYS H 2 64  ? -13.351 -28.455  -23.834 1.00 155.91 ? 86  CYS H CA  1 
ATOM   7462  C C   . CYS H 2 64  ? -14.520 -27.536  -23.501 1.00 151.66 ? 86  CYS H C   1 
ATOM   7463  O O   . CYS H 2 64  ? -15.370 -27.261  -24.356 1.00 145.55 ? 86  CYS H O   1 
ATOM   7464  C CB  . CYS H 2 64  ? -12.154 -27.598  -24.271 1.00 156.48 ? 86  CYS H CB  1 
ATOM   7465  S SG  . CYS H 2 64  ? -10.704 -28.446  -24.964 1.00 162.38 ? 86  CYS H SG  1 
ATOM   7466  N N   . ASP H 2 65  ? -14.546 -27.076  -22.252 1.00 150.82 ? 87  ASP H N   1 
ATOM   7467  C CA  . ASP H 2 65  ? -15.321 -25.892  -21.860 1.00 151.86 ? 87  ASP H CA  1 
ATOM   7468  C C   . ASP H 2 65  ? -14.345 -24.865  -21.307 1.00 142.04 ? 87  ASP H C   1 
ATOM   7469  O O   . ASP H 2 65  ? -13.187 -25.177  -21.047 1.00 136.43 ? 87  ASP H O   1 
ATOM   7470  C CB  . ASP H 2 65  ? -16.450 -26.228  -20.855 1.00 163.67 ? 87  ASP H CB  1 
ATOM   7471  C CG  . ASP H 2 65  ? -15.943 -26.812  -19.519 1.00 169.74 ? 87  ASP H CG  1 
ATOM   7472  O OD1 . ASP H 2 65  ? -15.433 -26.051  -18.672 1.00 170.39 ? 87  ASP H OD1 1 
ATOM   7473  O OD2 . ASP H 2 65  ? -16.098 -28.024  -19.285 1.00 175.12 ? 87  ASP H OD2 1 
ATOM   7474  N N   . CYS H 2 66  ? -14.806 -23.636  -21.145 1.00 141.93 ? 88  CYS H N   1 
ATOM   7475  C CA  . CYS H 2 66  ? -13.968 -22.584  -20.567 1.00 148.36 ? 88  CYS H CA  1 
ATOM   7476  C C   . CYS H 2 66  ? -13.980 -22.675  -19.048 1.00 152.13 ? 88  CYS H C   1 
ATOM   7477  O O   . CYS H 2 66  ? -14.969 -23.125  -18.458 1.00 162.09 ? 88  CYS H O   1 
ATOM   7478  C CB  . CYS H 2 66  ? -14.444 -21.215  -21.010 1.00 148.62 ? 88  CYS H CB  1 
ATOM   7479  S SG  . CYS H 2 66  ? -14.270 -20.950  -22.810 1.00 154.83 ? 88  CYS H SG  1 
ATOM   7480  N N   . THR H 2 67  ? -12.885 -22.255  -18.413 1.00 150.85 ? 89  THR H N   1 
ATOM   7481  C CA  . THR H 2 67  ? -12.856 -22.090  -16.963 1.00 150.79 ? 89  THR H CA  1 
ATOM   7482  C C   . THR H 2 67  ? -13.844 -20.998  -16.558 1.00 147.38 ? 89  THR H C   1 
ATOM   7483  O O   . THR H 2 67  ? -14.159 -20.113  -17.371 1.00 147.80 ? 89  THR H O   1 
ATOM   7484  C CB  . THR H 2 67  ? -11.462 -21.686  -16.443 1.00 153.16 ? 89  THR H CB  1 
ATOM   7485  O OG1 . THR H 2 67  ? -10.989 -20.547  -17.178 1.00 150.16 ? 89  THR H OG1 1 
ATOM   7486  C CG2 . THR H 2 67  ? -10.475 -22.835  -16.576 1.00 157.27 ? 89  THR H CG2 1 
ATOM   7487  N N   . PRO H 2 68  ? -14.333 -21.046  -15.305 1.00 145.47 ? 90  PRO H N   1 
ATOM   7488  C CA  . PRO H 2 68  ? -15.413 -20.129  -14.947 1.00 143.60 ? 90  PRO H CA  1 
ATOM   7489  C C   . PRO H 2 68  ? -14.911 -18.691  -14.906 1.00 139.67 ? 90  PRO H C   1 
ATOM   7490  O O   . PRO H 2 68  ? -13.747 -18.449  -14.549 1.00 144.82 ? 90  PRO H O   1 
ATOM   7491  C CB  . PRO H 2 68  ? -15.843 -20.606  -13.551 1.00 147.75 ? 90  PRO H CB  1 
ATOM   7492  C CG  . PRO H 2 68  ? -14.997 -21.806  -13.232 1.00 150.06 ? 90  PRO H CG  1 
ATOM   7493  C CD  . PRO H 2 68  ? -13.795 -21.728  -14.120 1.00 147.36 ? 90  PRO H CD  1 
ATOM   7494  N N   . GLY H 2 69  ? -15.773 -17.758  -15.291 1.00 131.97 ? 91  GLY H N   1 
ATOM   7495  C CA  . GLY H 2 69  ? -15.363 -16.373  -15.502 1.00 133.63 ? 91  GLY H CA  1 
ATOM   7496  C C   . GLY H 2 69  ? -15.207 -16.042  -16.971 1.00 133.08 ? 91  GLY H C   1 
ATOM   7497  O O   . GLY H 2 69  ? -15.208 -14.863  -17.341 1.00 132.34 ? 91  GLY H O   1 
ATOM   7498  N N   . PHE H 2 70  ? -15.040 -17.077  -17.798 1.00 136.06 ? 92  PHE H N   1 
ATOM   7499  C CA  . PHE H 2 70  ? -15.100 -16.962  -19.257 1.00 135.64 ? 92  PHE H CA  1 
ATOM   7500  C C   . PHE H 2 70  ? -16.230 -17.820  -19.797 1.00 135.67 ? 92  PHE H C   1 
ATOM   7501  O O   . PHE H 2 70  ? -16.807 -18.628  -19.065 1.00 142.35 ? 92  PHE H O   1 
ATOM   7502  C CB  . PHE H 2 70  ? -13.796 -17.450  -19.896 1.00 135.67 ? 92  PHE H CB  1 
ATOM   7503  C CG  . PHE H 2 70  ? -12.573 -16.760  -19.376 1.00 132.51 ? 92  PHE H CG  1 
ATOM   7504  C CD1 . PHE H 2 70  ? -12.034 -15.677  -20.046 1.00 126.66 ? 92  PHE H CD1 1 
ATOM   7505  C CD2 . PHE H 2 70  ? -11.944 -17.215  -18.228 1.00 136.25 ? 92  PHE H CD2 1 
ATOM   7506  C CE1 . PHE H 2 70  ? -10.904 -15.043  -19.574 1.00 127.95 ? 92  PHE H CE1 1 
ATOM   7507  C CE2 . PHE H 2 70  ? -10.834 -16.578  -17.734 1.00 138.61 ? 92  PHE H CE2 1 
ATOM   7508  C CZ  . PHE H 2 70  ? -10.313 -15.481  -18.407 1.00 136.41 ? 92  PHE H CZ  1 
ATOM   7509  N N   . HIS H 2 71  ? -16.514 -17.657  -21.086 1.00 134.44 ? 93  HIS H N   1 
ATOM   7510  C CA  . HIS H 2 71  ? -17.513 -18.467  -21.792 1.00 138.19 ? 93  HIS H CA  1 
ATOM   7511  C C   . HIS H 2 71  ? -17.053 -18.825  -23.202 1.00 137.59 ? 93  HIS H C   1 
ATOM   7512  O O   . HIS H 2 71  ? -16.359 -18.040  -23.843 1.00 132.40 ? 93  HIS H O   1 
ATOM   7513  C CB  . HIS H 2 71  ? -18.845 -17.716  -21.863 1.00 139.15 ? 93  HIS H CB  1 
ATOM   7514  C CG  . HIS H 2 71  ? -18.735 -16.357  -22.478 1.00 138.14 ? 93  HIS H CG  1 
ATOM   7515  N ND1 . HIS H 2 71  ? -18.707 -16.152  -23.841 1.00 135.63 ? 93  HIS H ND1 1 
ATOM   7516  C CD2 . HIS H 2 71  ? -18.655 -15.135  -21.919 1.00 143.62 ? 93  HIS H CD2 1 
ATOM   7517  C CE1 . HIS H 2 71  ? -18.611 -14.862  -24.096 1.00 137.07 ? 93  HIS H CE1 1 
ATOM   7518  N NE2 . HIS H 2 71  ? -18.577 -14.223  -22.943 1.00 138.87 ? 93  HIS H NE2 1 
ATOM   7519  N N   . CYS H 2 72  ? -17.459 -20.005  -23.678 1.00 144.15 ? 94  CYS H N   1 
ATOM   7520  C CA  . CYS H 2 72  ? -17.133 -20.480  -25.031 1.00 149.50 ? 94  CYS H CA  1 
ATOM   7521  C C   . CYS H 2 72  ? -17.576 -19.525  -26.129 1.00 155.72 ? 94  CYS H C   1 
ATOM   7522  O O   . CYS H 2 72  ? -18.445 -18.683  -25.939 1.00 164.90 ? 94  CYS H O   1 
ATOM   7523  C CB  . CYS H 2 72  ? -17.750 -21.852  -25.305 1.00 156.03 ? 94  CYS H CB  1 
ATOM   7524  S SG  . CYS H 2 72  ? -16.935 -23.224  -24.464 1.00 166.33 ? 94  CYS H SG  1 
ATOM   7525  N N   . LEU H 2 73  ? -16.954 -19.673  -27.293 1.00 155.09 ? 95  LEU H N   1 
ATOM   7526  C CA  . LEU H 2 73  ? -17.164 -18.788  -28.440 1.00 152.38 ? 95  LEU H CA  1 
ATOM   7527  C C   . LEU H 2 73  ? -16.729 -19.539  -29.697 1.00 158.63 ? 95  LEU H C   1 
ATOM   7528  O O   . LEU H 2 73  ? -15.675 -20.193  -29.704 1.00 162.34 ? 95  LEU H O   1 
ATOM   7529  C CB  . LEU H 2 73  ? -16.347 -17.517  -28.268 1.00 146.54 ? 95  LEU H CB  1 
ATOM   7530  C CG  . LEU H 2 73  ? -16.881 -16.230  -28.906 1.00 143.36 ? 95  LEU H CG  1 
ATOM   7531  C CD1 . LEU H 2 73  ? -18.258 -15.858  -28.372 1.00 147.24 ? 95  LEU H CD1 1 
ATOM   7532  C CD2 . LEU H 2 73  ? -15.936 -15.072  -28.629 1.00 140.07 ? 95  LEU H CD2 1 
ATOM   7533  N N   . GLY H 2 74  ? -17.552 -19.479  -30.742 1.00 170.70 ? 96  GLY H N   1 
ATOM   7534  C CA  . GLY H 2 74  ? -17.307 -20.253  -31.960 1.00 179.98 ? 96  GLY H CA  1 
ATOM   7535  C C   . GLY H 2 74  ? -17.557 -21.745  -31.789 1.00 187.66 ? 96  GLY H C   1 
ATOM   7536  O O   . GLY H 2 74  ? -17.807 -22.228  -30.676 1.00 196.43 ? 96  GLY H O   1 
ATOM   7537  N N   . ALA H 2 75  ? -17.475 -22.477  -32.898 1.00 190.66 ? 97  ALA H N   1 
ATOM   7538  C CA  . ALA H 2 75  ? -17.779 -23.907  -32.913 1.00 192.38 ? 97  ALA H CA  1 
ATOM   7539  C C   . ALA H 2 75  ? -16.718 -24.715  -32.163 1.00 192.67 ? 97  ALA H C   1 
ATOM   7540  O O   . ALA H 2 75  ? -15.523 -24.393  -32.225 1.00 197.33 ? 97  ALA H O   1 
ATOM   7541  C CB  . ALA H 2 75  ? -17.901 -24.405  -34.347 1.00 193.59 ? 97  ALA H CB  1 
ATOM   7542  N N   . GLY H 2 76  ? -17.175 -25.751  -31.451 1.00 190.01 ? 98  GLY H N   1 
ATOM   7543  C CA  . GLY H 2 76  ? -16.307 -26.643  -30.669 1.00 185.72 ? 98  GLY H CA  1 
ATOM   7544  C C   . GLY H 2 76  ? -15.561 -25.988  -29.513 1.00 180.37 ? 98  GLY H C   1 
ATOM   7545  O O   . GLY H 2 76  ? -14.554 -26.530  -29.038 1.00 180.75 ? 98  GLY H O   1 
ATOM   7546  N N   . CYS H 2 77  ? -16.072 -24.842  -29.051 1.00 172.14 ? 99  CYS H N   1 
ATOM   7547  C CA  . CYS H 2 77  ? -15.382 -23.979  -28.095 1.00 164.72 ? 99  CYS H CA  1 
ATOM   7548  C C   . CYS H 2 77  ? -13.963 -23.670  -28.562 1.00 156.63 ? 99  CYS H C   1 
ATOM   7549  O O   . CYS H 2 77  ? -12.971 -24.089  -27.954 1.00 155.03 ? 99  CYS H O   1 
ATOM   7550  C CB  . CYS H 2 77  ? -15.390 -24.611  -26.689 1.00 167.96 ? 99  CYS H CB  1 
ATOM   7551  S SG  . CYS H 2 77  ? -15.131 -23.372  -25.398 1.00 175.08 ? 99  CYS H SG  1 
ATOM   7552  N N   . SER H 2 78  ? -13.888 -22.951  -29.672 1.00 152.36 ? 100 SER H N   1 
ATOM   7553  C CA  . SER H 2 78  ? -12.618 -22.630  -30.315 1.00 152.52 ? 100 SER H CA  1 
ATOM   7554  C C   . SER H 2 78  ? -11.814 -21.612  -29.510 1.00 146.82 ? 100 SER H C   1 
ATOM   7555  O O   . SER H 2 78  ? -10.591 -21.679  -29.498 1.00 143.30 ? 100 SER H O   1 
ATOM   7556  C CB  . SER H 2 78  ? -12.854 -22.098  -31.724 1.00 155.84 ? 100 SER H CB  1 
ATOM   7557  O OG  . SER H 2 78  ? -13.494 -20.840  -31.686 1.00 159.54 ? 100 SER H OG  1 
ATOM   7558  N N   . MET H 2 79  ? -12.496 -20.657  -28.882 1.00 143.34 ? 101 MET H N   1 
ATOM   7559  C CA  . MET H 2 79  ? -11.845 -19.763  -27.923 1.00 143.16 ? 101 MET H CA  1 
ATOM   7560  C C   . MET H 2 79  ? -12.778 -19.181  -26.874 1.00 136.53 ? 101 MET H C   1 
ATOM   7561  O O   . MET H 2 79  ? -13.982 -19.150  -27.062 1.00 128.88 ? 101 MET H O   1 
ATOM   7562  C CB  . MET H 2 79  ? -11.092 -18.630  -28.624 1.00 147.12 ? 101 MET H CB  1 
ATOM   7563  C CG  . MET H 2 79  ? -11.936 -17.720  -29.499 1.00 143.37 ? 101 MET H CG  1 
ATOM   7564  S SD  . MET H 2 79  ? -11.278 -16.079  -29.660 1.00 142.79 ? 101 MET H SD  1 
ATOM   7565  C CE  . MET H 2 79  ? -12.195 -15.630  -31.135 1.00 148.80 ? 101 MET H CE  1 
ATOM   7566  N N   . CYS H 2 80  ? -12.178 -18.737  -25.774 1.00 136.40 ? 102 CYS H N   1 
ATOM   7567  C CA  . CYS H 2 80  ? -12.897 -18.240  -24.607 1.00 135.24 ? 102 CYS H CA  1 
ATOM   7568  C C   . CYS H 2 80  ? -12.943 -16.723  -24.600 1.00 132.77 ? 102 CYS H C   1 
ATOM   7569  O O   . CYS H 2 80  ? -12.111 -16.072  -25.219 1.00 133.67 ? 102 CYS H O   1 
ATOM   7570  C CB  . CYS H 2 80  ? -12.247 -18.729  -23.319 1.00 137.77 ? 102 CYS H CB  1 
ATOM   7571  S SG  . CYS H 2 80  ? -12.307 -20.527  -23.129 1.00 141.96 ? 102 CYS H SG  1 
ATOM   7572  N N   . GLU H 2 81  ? -13.937 -16.177  -23.901 1.00 131.51 ? 103 GLU H N   1 
ATOM   7573  C CA  . GLU H 2 81  ? -14.095 -14.739  -23.739 1.00 132.05 ? 103 GLU H CA  1 
ATOM   7574  C C   . GLU H 2 81  ? -14.575 -14.443  -22.333 1.00 127.23 ? 103 GLU H C   1 
ATOM   7575  O O   . GLU H 2 81  ? -15.450 -15.140  -21.837 1.00 127.77 ? 103 GLU H O   1 
ATOM   7576  C CB  . GLU H 2 81  ? -15.099 -14.206  -24.756 1.00 134.84 ? 103 GLU H CB  1 
ATOM   7577  C CG  . GLU H 2 81  ? -15.299 -12.698  -24.695 1.00 141.78 ? 103 GLU H CG  1 
ATOM   7578  C CD  . GLU H 2 81  ? -16.180 -12.142  -25.786 1.00 146.93 ? 103 GLU H CD  1 
ATOM   7579  O OE1 . GLU H 2 81  ? -17.104 -12.841  -26.236 1.00 149.80 ? 103 GLU H OE1 1 
ATOM   7580  O OE2 . GLU H 2 81  ? -15.948 -10.972  -26.178 1.00 151.38 ? 103 GLU H OE2 1 
ATOM   7581  N N   . GLN H 2 82  ? -14.024 -13.405  -21.712 1.00 123.63 ? 104 GLN H N   1 
ATOM   7582  C CA  . GLN H 2 82  ? -14.390 -13.039  -20.339 1.00 125.66 ? 104 GLN H CA  1 
ATOM   7583  C C   . GLN H 2 82  ? -15.829 -12.572  -20.274 1.00 128.55 ? 104 GLN H C   1 
ATOM   7584  O O   . GLN H 2 82  ? -16.301 -11.895  -21.206 1.00 136.83 ? 104 GLN H O   1 
ATOM   7585  C CB  . GLN H 2 82  ? -13.436 -11.964  -19.771 1.00 124.50 ? 104 GLN H CB  1 
ATOM   7586  C CG  . GLN H 2 82  ? -13.526 -11.785  -18.266 1.00 123.81 ? 104 GLN H CG  1 
ATOM   7587  C CD  . GLN H 2 82  ? -13.542 -10.338  -17.815 1.00 122.40 ? 104 GLN H CD  1 
ATOM   7588  O OE1 . GLN H 2 82  ? -12.575 -9.604   -18.006 1.00 117.24 ? 104 GLN H OE1 1 
ATOM   7589  N NE2 . GLN H 2 82  ? -14.659 -9.926   -17.213 1.00 127.26 ? 104 GLN H NE2 1 
ATOM   7590  N N   . ASP H 2 83  ? -16.540 -12.931  -19.200 1.00 135.09 ? 105 ASP H N   1 
ATOM   7591  C CA  . ASP H 2 83  ? -17.988 -12.677  -19.070 1.00 138.14 ? 105 ASP H CA  1 
ATOM   7592  C C   . ASP H 2 83  ? -18.313 -11.206  -19.219 1.00 140.92 ? 105 ASP H C   1 
ATOM   7593  O O   . ASP H 2 83  ? -17.537 -10.324  -18.766 1.00 134.97 ? 105 ASP H O   1 
ATOM   7594  C CB  . ASP H 2 83  ? -18.536 -13.202  -17.723 1.00 145.11 ? 105 ASP H CB  1 
ATOM   7595  C CG  . ASP H 2 83  ? -18.405 -14.723  -17.560 1.00 151.51 ? 105 ASP H CG  1 
ATOM   7596  O OD1 . ASP H 2 83  ? -18.353 -15.454  -18.574 1.00 157.92 ? 105 ASP H OD1 1 
ATOM   7597  O OD2 . ASP H 2 83  ? -18.351 -15.176  -16.396 1.00 153.30 ? 105 ASP H OD2 1 
ATOM   7598  N N   . CYS H 2 84  ? -19.474 -10.934  -19.843 1.00 144.22 ? 106 CYS H N   1 
ATOM   7599  C CA  . CYS H 2 84  ? -19.755 -9.598   -20.369 1.00 149.03 ? 106 CYS H CA  1 
ATOM   7600  C C   . CYS H 2 84  ? -19.977 -8.562   -19.302 1.00 153.22 ? 106 CYS H C   1 
ATOM   7601  O O   . CYS H 2 84  ? -20.747 -8.774   -18.375 1.00 162.27 ? 106 CYS H O   1 
ATOM   7602  C CB  . CYS H 2 84  ? -20.949 -9.658   -21.330 1.00 151.09 ? 106 CYS H CB  1 
ATOM   7603  S SG  . CYS H 2 84  ? -20.850 -10.897  -22.687 1.00 159.47 ? 106 CYS H SG  1 
ATOM   7604  N N   . LYS H 2 85  ? -19.311 -7.412   -19.452 1.00 153.19 ? 107 LYS H N   1 
ATOM   7605  C CA  . LYS H 2 85  ? -19.343 -6.336   -18.441 1.00 146.42 ? 107 LYS H CA  1 
ATOM   7606  C C   . LYS H 2 85  ? -20.673 -5.575   -18.448 1.00 139.53 ? 107 LYS H C   1 
ATOM   7607  O O   . LYS H 2 85  ? -21.539 -5.846   -19.289 1.00 127.50 ? 107 LYS H O   1 
ATOM   7608  C CB  . LYS H 2 85  ? -18.176 -5.378   -18.637 1.00 145.80 ? 107 LYS H CB  1 
ATOM   7609  N N   . GLN H 2 86  ? -20.846 -4.696   -17.470 1.00 145.74 ? 108 GLN H N   1 
ATOM   7610  C CA  . GLN H 2 86  ? -22.129 -4.017   -17.160 1.00 148.16 ? 108 GLN H CA  1 
ATOM   7611  C C   . GLN H 2 86  ? -23.034 -3.749   -18.366 1.00 141.36 ? 108 GLN H C   1 
ATOM   7612  O O   . GLN H 2 86  ? -24.098 -4.346   -18.454 1.00 155.79 ? 108 GLN H O   1 
ATOM   7613  C CB  . GLN H 2 86  ? -21.880 -2.713   -16.396 1.00 154.77 ? 108 GLN H CB  1 
ATOM   7614  N N   . GLY H 2 87  ? -22.598 -2.913   -19.301 1.00 132.12 ? 109 GLY H N   1 
ATOM   7615  C CA  . GLY H 2 87  ? -23.452 -2.496   -20.410 1.00 129.18 ? 109 GLY H CA  1 
ATOM   7616  C C   . GLY H 2 87  ? -23.523 -3.386   -21.652 1.00 127.17 ? 109 GLY H C   1 
ATOM   7617  O O   . GLY H 2 87  ? -23.989 -2.932   -22.697 1.00 128.89 ? 109 GLY H O   1 
ATOM   7618  N N   . GLN H 2 88  ? -23.086 -4.633   -21.558 1.00 129.74 ? 110 GLN H N   1 
ATOM   7619  C CA  . GLN H 2 88  ? -22.901 -5.511   -22.725 1.00 129.06 ? 110 GLN H CA  1 
ATOM   7620  C C   . GLN H 2 88  ? -23.766 -6.762   -22.650 1.00 132.29 ? 110 GLN H C   1 
ATOM   7621  O O   . GLN H 2 88  ? -24.234 -7.141   -21.585 1.00 128.46 ? 110 GLN H O   1 
ATOM   7622  C CB  . GLN H 2 88  ? -21.414 -5.927   -22.826 1.00 127.60 ? 110 GLN H CB  1 
ATOM   7623  N N   . GLU H 2 89  ? -23.949 -7.420   -23.789 1.00 138.68 ? 111 GLU H N   1 
ATOM   7624  C CA  . GLU H 2 89  ? -24.742 -8.642   -23.908 1.00 140.12 ? 111 GLU H CA  1 
ATOM   7625  C C   . GLU H 2 89  ? -24.024 -9.634   -24.807 1.00 136.18 ? 111 GLU H C   1 
ATOM   7626  O O   . GLU H 2 89  ? -23.376 -9.260   -25.767 1.00 127.90 ? 111 GLU H O   1 
ATOM   7627  C CB  . GLU H 2 89  ? -26.100 -8.317   -24.514 1.00 147.28 ? 111 GLU H CB  1 
ATOM   7628  C CG  . GLU H 2 89  ? -26.983 -9.519   -24.940 1.00 151.22 ? 111 GLU H CG  1 
ATOM   7629  C CD  . GLU H 2 89  ? -28.174 -9.152   -25.759 1.00 153.88 ? 111 GLU H CD  1 
ATOM   7630  O OE1 . GLU H 2 89  ? -28.003 -8.505   -26.815 1.00 154.04 ? 111 GLU H OE1 1 
ATOM   7631  O OE2 . GLU H 2 89  ? -29.280 -9.519   -25.308 1.00 159.44 ? 111 GLU H OE2 1 
ATOM   7632  N N   . LEU H 2 90  ? -24.151 -10.915  -24.472 1.00 140.10 ? 112 LEU H N   1 
ATOM   7633  C CA  . LEU H 2 90  ? -23.455 -11.989  -25.163 1.00 147.43 ? 112 LEU H CA  1 
ATOM   7634  C C   . LEU H 2 90  ? -24.161 -12.382  -26.457 1.00 150.26 ? 112 LEU H C   1 
ATOM   7635  O O   . LEU H 2 90  ? -25.353 -12.720  -26.447 1.00 150.95 ? 112 LEU H O   1 
ATOM   7636  C CB  . LEU H 2 90  ? -23.363 -13.190  -24.221 1.00 151.83 ? 112 LEU H CB  1 
ATOM   7637  C CG  . LEU H 2 90  ? -22.346 -14.258  -24.539 1.00 155.91 ? 112 LEU H CG  1 
ATOM   7638  C CD1 . LEU H 2 90  ? -21.928 -14.891  -23.200 1.00 160.26 ? 112 LEU H CD1 1 
ATOM   7639  C CD2 . LEU H 2 90  ? -22.811 -15.285  -25.574 1.00 157.67 ? 112 LEU H CD2 1 
ATOM   7640  N N   . THR H 2 91  ? -23.408 -12.357  -27.562 1.00 151.31 ? 113 THR H N   1 
ATOM   7641  C CA  . THR H 2 91  ? -23.922 -12.761  -28.889 1.00 149.74 ? 113 THR H CA  1 
ATOM   7642  C C   . THR H 2 91  ? -23.100 -13.934  -29.436 1.00 154.17 ? 113 THR H C   1 
ATOM   7643  O O   . THR H 2 91  ? -22.164 -14.409  -28.784 1.00 156.00 ? 113 THR H O   1 
ATOM   7644  C CB  . THR H 2 91  ? -23.906 -11.582  -29.901 1.00 145.71 ? 113 THR H CB  1 
ATOM   7645  O OG1 . THR H 2 91  ? -22.578 -11.358  -30.395 1.00 140.32 ? 113 THR H OG1 1 
ATOM   7646  C CG2 . THR H 2 91  ? -24.429 -10.296  -29.250 1.00 146.64 ? 113 THR H CG2 1 
ATOM   7647  N N   . LYS H 2 92  ? -23.460 -14.402  -30.630 1.00 158.64 ? 114 LYS H N   1 
ATOM   7648  C CA  . LYS H 2 92  ? -22.646 -15.371  -31.374 1.00 157.34 ? 114 LYS H CA  1 
ATOM   7649  C C   . LYS H 2 92  ? -21.237 -14.813  -31.634 1.00 155.17 ? 114 LYS H C   1 
ATOM   7650  O O   . LYS H 2 92  ? -20.245 -15.522  -31.471 1.00 147.24 ? 114 LYS H O   1 
ATOM   7651  C CB  . LYS H 2 92  ? -23.323 -15.737  -32.700 1.00 153.74 ? 114 LYS H CB  1 
ATOM   7652  N N   . LYS H 2 93  ? -21.168 -13.533  -32.006 1.00 155.57 ? 115 LYS H N   1 
ATOM   7653  C CA  . LYS H 2 93  ? -19.899 -12.845  -32.271 1.00 153.99 ? 115 LYS H CA  1 
ATOM   7654  C C   . LYS H 2 93  ? -19.176 -12.285  -31.022 1.00 151.87 ? 115 LYS H C   1 
ATOM   7655  O O   . LYS H 2 93  ? -18.115 -11.671  -31.173 1.00 153.63 ? 115 LYS H O   1 
ATOM   7656  C CB  . LYS H 2 93  ? -20.121 -11.710  -33.276 1.00 153.78 ? 115 LYS H CB  1 
ATOM   7657  N N   . GLY H 2 94  ? -19.720 -12.509  -29.817 1.00 152.53 ? 116 GLY H N   1 
ATOM   7658  C CA  . GLY H 2 94  ? -19.106 -12.071  -28.561 1.00 155.14 ? 116 GLY H CA  1 
ATOM   7659  C C   . GLY H 2 94  ? -19.868 -10.965  -27.820 1.00 154.11 ? 116 GLY H C   1 
ATOM   7660  O O   . GLY H 2 94  ? -21.015 -10.666  -28.168 1.00 163.39 ? 116 GLY H O   1 
ATOM   7661  N N   . CYS H 2 95  ? -19.232 -10.414  -26.783 1.00 150.42 ? 117 CYS H N   1 
ATOM   7662  C CA  . CYS H 2 95  ? -19.897 -9.384   -25.960 1.00 152.57 ? 117 CYS H CA  1 
ATOM   7663  C C   . CYS H 2 95  ? -19.969 -8.074   -26.748 1.00 148.04 ? 117 CYS H C   1 
ATOM   7664  O O   . CYS H 2 95  ? -18.991 -7.348   -26.830 1.00 148.18 ? 117 CYS H O   1 
ATOM   7665  C CB  . CYS H 2 95  ? -19.110 -9.145   -24.657 1.00 160.61 ? 117 CYS H CB  1 
ATOM   7666  S SG  . CYS H 2 95  ? -19.013 -10.587  -23.539 1.00 178.84 ? 117 CYS H SG  1 
ATOM   7667  N N   . LYS H 2 96  ? -21.104 -7.813   -27.360 1.00 148.67 ? 118 LYS H N   1 
ATOM   7668  C CA  . LYS H 2 96  ? -21.394 -6.519   -27.999 1.00 147.30 ? 118 LYS H CA  1 
ATOM   7669  C C   . LYS H 2 96  ? -22.196 -5.643   -27.033 1.00 146.60 ? 118 LYS H C   1 
ATOM   7670  O O   . LYS H 2 96  ? -22.893 -6.164   -26.176 1.00 146.44 ? 118 LYS H O   1 
ATOM   7671  C CB  . LYS H 2 96  ? -22.184 -6.739   -29.309 1.00 148.82 ? 118 LYS H CB  1 
ATOM   7672  N N   . ASP H 2 97  ? -22.110 -4.342   -27.189 1.00 149.54 ? 119 ASP H N   1 
ATOM   7673  C CA  . ASP H 2 97  ? -22.756 -3.377   -26.270 1.00 154.24 ? 119 ASP H CA  1 
ATOM   7674  C C   . ASP H 2 97  ? -24.277 -3.388   -26.477 1.00 151.53 ? 119 ASP H C   1 
ATOM   7675  O O   . ASP H 2 97  ? -24.748 -3.636   -27.591 1.00 149.25 ? 119 ASP H O   1 
ATOM   7676  C CB  . ASP H 2 97  ? -22.254 -1.946   -26.528 1.00 160.97 ? 119 ASP H CB  1 
ATOM   7677  C CG  . ASP H 2 97  ? -20.763 -1.779   -26.299 1.00 170.76 ? 119 ASP H CG  1 
ATOM   7678  O OD1 . ASP H 2 97  ? -20.255 -2.230   -25.243 1.00 180.37 ? 119 ASP H OD1 1 
ATOM   7679  O OD2 . ASP H 2 97  ? -20.100 -1.174   -27.175 1.00 176.72 ? 119 ASP H OD2 1 
ATOM   7680  N N   . CYS H 2 98  ? -25.029 -3.119   -25.421 1.00 152.44 ? 120 CYS H N   1 
ATOM   7681  C CA  . CYS H 2 98  ? -26.485 -2.981   -25.533 1.00 152.68 ? 120 CYS H CA  1 
ATOM   7682  C C   . CYS H 2 98  ? -26.864 -1.903   -26.520 1.00 149.40 ? 120 CYS H C   1 
ATOM   7683  O O   . CYS H 2 98  ? -26.260 -0.854   -26.536 1.00 147.12 ? 120 CYS H O   1 
ATOM   7684  C CB  . CYS H 2 98  ? -27.181 -2.719   -24.163 1.00 157.92 ? 120 CYS H CB  1 
ATOM   7685  S SG  . CYS H 2 98  ? -27.491 -4.152   -23.077 1.00 172.48 ? 120 CYS H SG  1 
ATOM   7686  N N   . SER H 2 99  ? -27.863 -2.181   -27.344 1.00 151.91 ? 121 SER H N   1 
ATOM   7687  C CA  . SER H 2 99  ? -28.348 -1.234   -28.363 1.00 151.21 ? 121 SER H CA  1 
ATOM   7688  C C   . SER H 2 99  ? -29.041 -0.043   -27.698 1.00 148.20 ? 121 SER H C   1 
ATOM   7689  O O   . SER H 2 99  ? -29.208 -0.007   -26.476 1.00 147.34 ? 121 SER H O   1 
ATOM   7690  C CB  . SER H 2 99  ? -29.308 -1.937   -29.322 1.00 153.34 ? 121 SER H CB  1 
ATOM   7691  O OG  . SER H 2 99  ? -29.359 -3.332   -29.067 1.00 157.76 ? 121 SER H OG  1 
ATOM   7692  N N   . PHE H 2 100 ? -29.449 0.926    -28.507 1.00 147.92 ? 122 PHE H N   1 
ATOM   7693  C CA  . PHE H 2 100 ? -30.206 2.063    -27.992 1.00 152.40 ? 122 PHE H CA  1 
ATOM   7694  C C   . PHE H 2 100 ? -31.570 1.594    -27.481 1.00 148.74 ? 122 PHE H C   1 
ATOM   7695  O O   . PHE H 2 100 ? -32.205 0.719    -28.087 1.00 151.69 ? 122 PHE H O   1 
ATOM   7696  C CB  . PHE H 2 100 ? -30.380 3.153    -29.049 1.00 158.61 ? 122 PHE H CB  1 
ATOM   7697  C CG  . PHE H 2 100 ? -30.869 4.449    -28.481 1.00 165.73 ? 122 PHE H CG  1 
ATOM   7698  C CD1 . PHE H 2 100 ? -29.970 5.390    -27.987 1.00 168.41 ? 122 PHE H CD1 1 
ATOM   7699  C CD2 . PHE H 2 100 ? -32.235 4.719    -28.398 1.00 171.08 ? 122 PHE H CD2 1 
ATOM   7700  C CE1 . PHE H 2 100 ? -30.424 6.580    -27.432 1.00 173.68 ? 122 PHE H CE1 1 
ATOM   7701  C CE2 . PHE H 2 100 ? -32.694 5.910    -27.848 1.00 174.26 ? 122 PHE H CE2 1 
ATOM   7702  C CZ  . PHE H 2 100 ? -31.787 6.840    -27.372 1.00 174.47 ? 122 PHE H CZ  1 
ATOM   7703  N N   . GLY H 2 101 ? -31.990 2.159    -26.348 1.00 143.19 ? 123 GLY H N   1 
ATOM   7704  C CA  . GLY H 2 101 ? -33.245 1.774    -25.693 1.00 145.86 ? 123 GLY H CA  1 
ATOM   7705  C C   . GLY H 2 101 ? -33.175 0.552    -24.785 1.00 145.68 ? 123 GLY H C   1 
ATOM   7706  O O   . GLY H 2 101 ? -34.178 0.199    -24.153 1.00 146.08 ? 123 GLY H O   1 
ATOM   7707  N N   . THR H 2 102 ? -32.000 -0.088   -24.707 1.00 143.43 ? 124 THR H N   1 
ATOM   7708  C CA  . THR H 2 102 ? -31.812 -1.296   -23.907 1.00 139.69 ? 124 THR H CA  1 
ATOM   7709  C C   . THR H 2 102 ? -30.689 -1.123   -22.893 1.00 133.55 ? 124 THR H C   1 
ATOM   7710  O O   . THR H 2 102 ? -29.838 -0.239   -23.042 1.00 134.06 ? 124 THR H O   1 
ATOM   7711  C CB  . THR H 2 102 ? -31.512 -2.511   -24.788 1.00 142.55 ? 124 THR H CB  1 
ATOM   7712  O OG1 . THR H 2 102 ? -30.663 -2.138   -25.882 1.00 140.65 ? 124 THR H OG1 1 
ATOM   7713  C CG2 . THR H 2 102 ? -32.792 -3.117   -25.318 1.00 148.69 ? 124 THR H CG2 1 
ATOM   7714  N N   . PHE H 2 103 ? -30.707 -1.968   -21.859 1.00 128.09 ? 125 PHE H N   1 
ATOM   7715  C CA  . PHE H 2 103 ? -29.731 -1.888   -20.777 1.00 126.21 ? 125 PHE H CA  1 
ATOM   7716  C C   . PHE H 2 103 ? -29.447 -3.233   -20.138 1.00 123.38 ? 125 PHE H C   1 
ATOM   7717  O O   . PHE H 2 103 ? -30.233 -4.153   -20.244 1.00 128.04 ? 125 PHE H O   1 
ATOM   7718  C CB  . PHE H 2 103 ? -30.224 -0.915   -19.702 1.00 128.34 ? 125 PHE H CB  1 
ATOM   7719  C CG  . PHE H 2 103 ? -31.167 -1.526   -18.694 1.00 127.38 ? 125 PHE H CG  1 
ATOM   7720  C CD1 . PHE H 2 103 ? -30.705 -1.927   -17.447 1.00 126.30 ? 125 PHE H CD1 1 
ATOM   7721  C CD2 . PHE H 2 103 ? -32.510 -1.689   -18.988 1.00 126.17 ? 125 PHE H CD2 1 
ATOM   7722  C CE1 . PHE H 2 103 ? -31.558 -2.488   -16.518 1.00 125.73 ? 125 PHE H CE1 1 
ATOM   7723  C CE2 . PHE H 2 103 ? -33.372 -2.240   -18.061 1.00 127.97 ? 125 PHE H CE2 1 
ATOM   7724  C CZ  . PHE H 2 103 ? -32.888 -2.651   -16.826 1.00 128.32 ? 125 PHE H CZ  1 
ATOM   7725  N N   . ASN H 2 104 ? -28.325 -3.318   -19.437 1.00 122.68 ? 126 ASN H N   1 
ATOM   7726  C CA  . ASN H 2 104 ? -27.997 -4.479   -18.626 1.00 123.90 ? 126 ASN H CA  1 
ATOM   7727  C C   . ASN H 2 104 ? -27.391 -4.012   -17.295 1.00 131.04 ? 126 ASN H C   1 
ATOM   7728  O O   . ASN H 2 104 ? -26.405 -3.289   -17.272 1.00 134.94 ? 126 ASN H O   1 
ATOM   7729  C CB  . ASN H 2 104 ? -27.048 -5.377   -19.397 1.00 121.00 ? 126 ASN H CB  1 
ATOM   7730  C CG  . ASN H 2 104 ? -26.736 -6.672   -18.669 1.00 123.22 ? 126 ASN H CG  1 
ATOM   7731  O OD1 . ASN H 2 104 ? -27.309 -6.981   -17.625 1.00 130.62 ? 126 ASN H OD1 1 
ATOM   7732  N ND2 . ASN H 2 104 ? -25.820 -7.445   -19.230 1.00 129.29 ? 126 ASN H ND2 1 
ATOM   7733  N N   . ASP H 2 105 ? -28.016 -4.417   -16.194 1.00 142.68 ? 127 ASP H N   1 
ATOM   7734  C CA  . ASP H 2 105 ? -27.600 -4.045   -14.852 1.00 149.96 ? 127 ASP H CA  1 
ATOM   7735  C C   . ASP H 2 105 ? -26.386 -4.893   -14.442 1.00 149.22 ? 127 ASP H C   1 
ATOM   7736  O O   . ASP H 2 105 ? -25.327 -4.358   -14.145 1.00 138.56 ? 127 ASP H O   1 
ATOM   7737  C CB  . ASP H 2 105 ? -28.771 -4.247   -13.872 1.00 160.62 ? 127 ASP H CB  1 
ATOM   7738  C CG  . ASP H 2 105 ? -28.429 -3.862   -12.429 1.00 172.63 ? 127 ASP H CG  1 
ATOM   7739  O OD1 . ASP H 2 105 ? -27.756 -2.829   -12.209 1.00 183.67 ? 127 ASP H OD1 1 
ATOM   7740  O OD2 . ASP H 2 105 ? -28.854 -4.593   -11.505 1.00 180.14 ? 127 ASP H OD2 1 
ATOM   7741  N N   . GLN H 2 106 ? -26.551 -6.215   -14.462 1.00 156.99 ? 128 GLN H N   1 
ATOM   7742  C CA  . GLN H 2 106 ? -25.592 -7.137   -13.873 1.00 159.06 ? 128 GLN H CA  1 
ATOM   7743  C C   . GLN H 2 106 ? -24.655 -7.769   -14.919 1.00 151.27 ? 128 GLN H C   1 
ATOM   7744  O O   . GLN H 2 106 ? -24.924 -7.722   -16.128 1.00 143.15 ? 128 GLN H O   1 
ATOM   7745  C CB  . GLN H 2 106 ? -26.334 -8.241   -13.112 1.00 170.28 ? 128 GLN H CB  1 
ATOM   7746  C CG  . GLN H 2 106 ? -25.565 -8.881   -11.952 1.00 180.29 ? 128 GLN H CG  1 
ATOM   7747  C CD  . GLN H 2 106 ? -25.809 -10.384  -11.826 1.00 187.26 ? 128 GLN H CD  1 
ATOM   7748  O OE1 . GLN H 2 106 ? -26.952 -10.811  -11.727 1.00 195.85 ? 128 GLN H OE1 1 
ATOM   7749  N NE2 . GLN H 2 106 ? -24.738 -11.182  -11.805 1.00 187.14 ? 128 GLN H NE2 1 
ATOM   7750  N N   . LYS H 2 107 ? -23.550 -8.349   -14.426 1.00 149.79 ? 129 LYS H N   1 
ATOM   7751  C CA  . LYS H 2 107 ? -22.670 -9.199   -15.201 1.00 143.91 ? 129 LYS H CA  1 
ATOM   7752  C C   . LYS H 2 107 ? -23.349 -10.467  -15.690 1.00 140.26 ? 129 LYS H C   1 
ATOM   7753  O O   . LYS H 2 107 ? -24.281 -10.941  -15.086 1.00 141.66 ? 129 LYS H O   1 
ATOM   7754  C CB  . LYS H 2 107 ? -21.368 -9.528   -14.452 1.00 139.62 ? 129 LYS H CB  1 
ATOM   7755  N N   . ARG H 2 108 ? -22.832 -11.000  -16.804 1.00 139.53 ? 130 ARG H N   1 
ATOM   7756  C CA  . ARG H 2 108 ? -23.398 -12.151  -17.512 1.00 146.52 ? 130 ARG H CA  1 
ATOM   7757  C C   . ARG H 2 108 ? -24.925 -12.066  -17.632 1.00 141.44 ? 130 ARG H C   1 
ATOM   7758  O O   . ARG H 2 108 ? -25.634 -13.004  -17.265 1.00 144.92 ? 130 ARG H O   1 
ATOM   7759  C CB  . ARG H 2 108 ? -22.928 -13.464  -16.877 1.00 153.76 ? 130 ARG H CB  1 
ATOM   7760  C CG  . ARG H 2 108 ? -23.167 -13.682  -15.392 1.00 164.25 ? 130 ARG H CG  1 
ATOM   7761  C CD  . ARG H 2 108 ? -22.334 -14.825  -14.862 1.00 172.10 ? 130 ARG H CD  1 
ATOM   7762  N NE  . ARG H 2 108 ? -22.566 -16.063  -15.591 1.00 182.30 ? 130 ARG H NE  1 
ATOM   7763  C CZ  . ARG H 2 108 ? -21.972 -17.222  -15.308 1.00 197.19 ? 130 ARG H CZ  1 
ATOM   7764  N NH1 . ARG H 2 108 ? -21.108 -17.323  -14.298 1.00 204.53 ? 130 ARG H NH1 1 
ATOM   7765  N NH2 . ARG H 2 108 ? -22.249 -18.299  -16.038 1.00 203.85 ? 130 ARG H NH2 1 
ATOM   7766  N N   . GLY H 2 109 ? -25.407 -10.930  -18.146 1.00 136.75 ? 131 GLY H N   1 
ATOM   7767  C CA  . GLY H 2 109 ? -26.843 -10.673  -18.294 1.00 138.85 ? 131 GLY H CA  1 
ATOM   7768  C C   . GLY H 2 109 ? -27.288 -10.479  -19.735 1.00 140.88 ? 131 GLY H C   1 
ATOM   7769  O O   . GLY H 2 109 ? -26.515 -10.685  -20.670 1.00 144.18 ? 131 GLY H O   1 
ATOM   7770  N N   . ILE H 2 110 ? -28.543 -10.067  -19.896 1.00 145.56 ? 132 ILE H N   1 
ATOM   7771  C CA  . ILE H 2 110 ? -29.201 -9.886   -21.200 1.00 147.96 ? 132 ILE H CA  1 
ATOM   7772  C C   . ILE H 2 110 ? -29.712 -8.442   -21.290 1.00 146.34 ? 132 ILE H C   1 
ATOM   7773  O O   . ILE H 2 110 ? -30.067 -7.836   -20.270 1.00 142.87 ? 132 ILE H O   1 
ATOM   7774  C CB  . ILE H 2 110 ? -30.382 -10.883  -21.330 1.00 153.61 ? 132 ILE H CB  1 
ATOM   7775  C CG1 . ILE H 2 110 ? -29.835 -12.311  -21.490 1.00 157.47 ? 132 ILE H CG1 1 
ATOM   7776  C CG2 . ILE H 2 110 ? -31.307 -10.548  -22.495 1.00 152.26 ? 132 ILE H CG2 1 
ATOM   7777  C CD1 . ILE H 2 110 ? -30.817 -13.413  -21.154 1.00 163.05 ? 132 ILE H CD1 1 
ATOM   7778  N N   . CYS H 2 111 ? -29.761 -7.900   -22.507 1.00 149.48 ? 133 CYS H N   1 
ATOM   7779  C CA  . CYS H 2 111 ? -30.246 -6.546   -22.757 1.00 154.92 ? 133 CYS H CA  1 
ATOM   7780  C C   . CYS H 2 111 ? -31.784 -6.464   -22.681 1.00 151.92 ? 133 CYS H C   1 
ATOM   7781  O O   . CYS H 2 111 ? -32.472 -6.674   -23.689 1.00 156.83 ? 133 CYS H O   1 
ATOM   7782  C CB  . CYS H 2 111 ? -29.806 -6.019   -24.122 1.00 161.02 ? 133 CYS H CB  1 
ATOM   7783  S SG  . CYS H 2 111 ? -28.085 -5.648   -24.355 1.00 181.80 ? 133 CYS H SG  1 
ATOM   7784  N N   . ARG H 2 112 ? -32.298 -6.139   -21.492 1.00 146.49 ? 134 ARG H N   1 
ATOM   7785  C CA  . ARG H 2 112 ? -33.699 -5.758   -21.327 1.00 140.66 ? 134 ARG H CA  1 
ATOM   7786  C C   . ARG H 2 112 ? -33.895 -4.325   -21.857 1.00 141.98 ? 134 ARG H C   1 
ATOM   7787  O O   . ARG H 2 112 ? -32.931 -3.568   -21.939 1.00 139.60 ? 134 ARG H O   1 
ATOM   7788  C CB  . ARG H 2 112 ? -34.099 -5.827   -19.857 1.00 133.25 ? 134 ARG H CB  1 
ATOM   7789  N N   . PRO H 2 113 ? -35.140 -3.942   -22.214 1.00 148.51 ? 135 PRO H N   1 
ATOM   7790  C CA  . PRO H 2 113 ? -35.418 -2.567   -22.638 1.00 150.47 ? 135 PRO H CA  1 
ATOM   7791  C C   . PRO H 2 113 ? -35.756 -1.657   -21.448 1.00 151.08 ? 135 PRO H C   1 
ATOM   7792  O O   . PRO H 2 113 ? -36.214 -2.153   -20.406 1.00 156.00 ? 135 PRO H O   1 
ATOM   7793  C CB  . PRO H 2 113 ? -36.629 -2.737   -23.548 1.00 151.51 ? 135 PRO H CB  1 
ATOM   7794  C CG  . PRO H 2 113 ? -37.370 -3.877   -22.943 1.00 153.02 ? 135 PRO H CG  1 
ATOM   7795  C CD  . PRO H 2 113 ? -36.364 -4.762   -22.254 1.00 151.59 ? 135 PRO H CD  1 
ATOM   7796  N N   . TRP H 2 114 ? -35.543 -0.347   -21.603 1.00 146.43 ? 136 TRP H N   1 
ATOM   7797  C CA  . TRP H 2 114 ? -35.774 0.606    -20.501 1.00 143.94 ? 136 TRP H CA  1 
ATOM   7798  C C   . TRP H 2 114 ? -37.248 0.615    -20.119 1.00 144.21 ? 136 TRP H C   1 
ATOM   7799  O O   . TRP H 2 114 ? -38.108 0.598    -21.012 1.00 145.68 ? 136 TRP H O   1 
ATOM   7800  C CB  . TRP H 2 114 ? -35.405 2.042    -20.894 1.00 144.82 ? 136 TRP H CB  1 
ATOM   7801  C CG  . TRP H 2 114 ? -33.993 2.278    -21.312 1.00 140.14 ? 136 TRP H CG  1 
ATOM   7802  C CD1 . TRP H 2 114 ? -32.888 1.645    -20.843 1.00 137.09 ? 136 TRP H CD1 1 
ATOM   7803  C CD2 . TRP H 2 114 ? -33.533 3.253    -22.252 1.00 139.17 ? 136 TRP H CD2 1 
ATOM   7804  N NE1 . TRP H 2 114 ? -31.761 2.144    -21.449 1.00 137.15 ? 136 TRP H NE1 1 
ATOM   7805  C CE2 . TRP H 2 114 ? -32.130 3.137    -22.315 1.00 139.92 ? 136 TRP H CE2 1 
ATOM   7806  C CE3 . TRP H 2 114 ? -34.172 4.213    -23.047 1.00 140.38 ? 136 TRP H CE3 1 
ATOM   7807  C CZ2 . TRP H 2 114 ? -31.349 3.946    -23.148 1.00 144.13 ? 136 TRP H CZ2 1 
ATOM   7808  C CZ3 . TRP H 2 114 ? -33.397 5.012    -23.885 1.00 141.18 ? 136 TRP H CZ3 1 
ATOM   7809  C CH2 . TRP H 2 114 ? -32.003 4.877    -23.925 1.00 144.71 ? 136 TRP H CH2 1 
ATOM   7810  N N   . THR H 2 115 ? -37.549 0.653    -18.821 1.00 144.44 ? 137 THR H N   1 
ATOM   7811  C CA  . THR H 2 115 ? -38.936 0.744    -18.380 1.00 148.73 ? 137 THR H CA  1 
ATOM   7812  C C   . THR H 2 115 ? -39.502 2.062    -18.896 1.00 150.20 ? 137 THR H C   1 
ATOM   7813  O O   . THR H 2 115 ? -38.944 3.131    -18.618 1.00 150.90 ? 137 THR H O   1 
ATOM   7814  C CB  . THR H 2 115 ? -39.084 0.727    -16.841 1.00 148.60 ? 137 THR H CB  1 
ATOM   7815  O OG1 . THR H 2 115 ? -38.077 1.553    -16.253 1.00 161.85 ? 137 THR H OG1 1 
ATOM   7816  C CG2 . THR H 2 115 ? -38.943 -0.673   -16.303 1.00 148.46 ? 137 THR H CG2 1 
ATOM   7817  N N   . ASN H 2 116 ? -40.599 1.974    -19.651 1.00 151.42 ? 138 ASN H N   1 
ATOM   7818  C CA  . ASN H 2 116 ? -41.352 3.149    -20.068 1.00 153.00 ? 138 ASN H CA  1 
ATOM   7819  C C   . ASN H 2 116 ? -42.286 3.587    -18.934 1.00 151.67 ? 138 ASN H C   1 
ATOM   7820  O O   . ASN H 2 116 ? -43.294 2.934    -18.657 1.00 150.01 ? 138 ASN H O   1 
ATOM   7821  C CB  . ASN H 2 116 ? -42.158 2.835    -21.335 1.00 153.75 ? 138 ASN H CB  1 
ATOM   7822  C CG  . ASN H 2 116 ? -42.849 4.059    -21.918 1.00 155.68 ? 138 ASN H CG  1 
ATOM   7823  O OD1 . ASN H 2 116 ? -42.667 5.189    -21.445 1.00 154.21 ? 138 ASN H OD1 1 
ATOM   7824  N ND2 . ASN H 2 116 ? -43.652 3.833    -22.954 1.00 158.13 ? 138 ASN H ND2 1 
ATOM   7825  N N   . CYS H 2 117 ? -41.940 4.692    -18.280 1.00 152.81 ? 139 CYS H N   1 
ATOM   7826  C CA  . CYS H 2 117 ? -42.703 5.174    -17.130 1.00 156.57 ? 139 CYS H CA  1 
ATOM   7827  C C   . CYS H 2 117 ? -44.019 5.825    -17.569 1.00 156.79 ? 139 CYS H C   1 
ATOM   7828  O O   . CYS H 2 117 ? -44.998 5.778    -16.827 1.00 156.18 ? 139 CYS H O   1 
ATOM   7829  C CB  . CYS H 2 117 ? -41.873 6.137    -16.258 1.00 161.91 ? 139 CYS H CB  1 
ATOM   7830  S SG  . CYS H 2 117 ? -40.085 5.827    -16.194 1.00 163.18 ? 139 CYS H SG  1 
ATOM   7831  N N   . SER H 2 118 ? -44.047 6.412    -18.769 1.00 157.32 ? 140 SER H N   1 
ATOM   7832  C CA  . SER H 2 118 ? -45.288 6.942    -19.368 1.00 155.61 ? 140 SER H CA  1 
ATOM   7833  C C   . SER H 2 118 ? -46.379 5.872    -19.469 1.00 153.60 ? 140 SER H C   1 
ATOM   7834  O O   . SER H 2 118 ? -47.512 6.106    -19.054 1.00 157.14 ? 140 SER H O   1 
ATOM   7835  C CB  . SER H 2 118 ? -45.011 7.539    -20.750 1.00 157.14 ? 140 SER H CB  1 
ATOM   7836  N N   . LEU H 2 119 ? -46.022 4.703    -19.996 1.00 154.44 ? 141 LEU H N   1 
ATOM   7837  C CA  . LEU H 2 119 ? -46.928 3.533    -20.063 1.00 157.09 ? 141 LEU H CA  1 
ATOM   7838  C C   . LEU H 2 119 ? -47.319 2.999    -18.666 1.00 156.75 ? 141 LEU H C   1 
ATOM   7839  O O   . LEU H 2 119 ? -48.407 2.446    -18.493 1.00 158.31 ? 141 LEU H O   1 
ATOM   7840  C CB  . LEU H 2 119 ? -46.311 2.399    -20.911 1.00 152.71 ? 141 LEU H CB  1 
ATOM   7841  N N   . ASP H 2 120 ? -46.426 3.163    -17.689 1.00 155.20 ? 142 ASP H N   1 
ATOM   7842  C CA  . ASP H 2 120 ? -46.675 2.765    -16.297 1.00 152.86 ? 142 ASP H CA  1 
ATOM   7843  C C   . ASP H 2 120 ? -47.400 3.822    -15.442 1.00 150.99 ? 142 ASP H C   1 
ATOM   7844  O O   . ASP H 2 120 ? -47.787 3.510    -14.315 1.00 153.11 ? 142 ASP H O   1 
ATOM   7845  C CB  . ASP H 2 120 ? -45.348 2.383    -15.619 1.00 152.17 ? 142 ASP H CB  1 
ATOM   7846  N N   . GLY H 2 121 ? -47.570 5.048    -15.955 1.00 146.39 ? 143 GLY H N   1 
ATOM   7847  C CA  . GLY H 2 121 ? -48.238 6.144    -15.222 1.00 143.14 ? 143 GLY H CA  1 
ATOM   7848  C C   . GLY H 2 121 ? -47.328 7.291    -14.793 1.00 141.12 ? 143 GLY H C   1 
ATOM   7849  O O   . GLY H 2 121 ? -47.691 8.462    -14.936 1.00 134.14 ? 143 GLY H O   1 
ATOM   7850  N N   . LYS H 2 122 ? -46.140 6.953    -14.282 1.00 143.51 ? 144 LYS H N   1 
ATOM   7851  C CA  . LYS H 2 122 ? -45.162 7.934    -13.766 1.00 143.59 ? 144 LYS H CA  1 
ATOM   7852  C C   . LYS H 2 122 ? -44.453 8.773    -14.865 1.00 144.48 ? 144 LYS H C   1 
ATOM   7853  O O   . LYS H 2 122 ? -44.876 8.792    -16.021 1.00 143.23 ? 144 LYS H O   1 
ATOM   7854  C CB  . LYS H 2 122 ? -44.121 7.195    -12.899 1.00 138.73 ? 144 LYS H CB  1 
ATOM   7855  N N   . SER H 2 123 ? -43.387 9.474    -14.482 1.00 150.61 ? 145 SER H N   1 
ATOM   7856  C CA  . SER H 2 123 ? -42.496 10.159   -15.439 1.00 157.18 ? 145 SER H CA  1 
ATOM   7857  C C   . SER H 2 123 ? -41.033 10.002   -15.033 1.00 154.15 ? 145 SER H C   1 
ATOM   7858  O O   . SER H 2 123 ? -40.736 9.762    -13.854 1.00 149.07 ? 145 SER H O   1 
ATOM   7859  C CB  . SER H 2 123 ? -42.857 11.654   -15.532 1.00 162.28 ? 145 SER H CB  1 
ATOM   7860  O OG  . SER H 2 123 ? -42.770 12.290   -14.263 1.00 167.02 ? 145 SER H OG  1 
ATOM   7861  N N   . VAL H 2 124 ? -40.124 10.170   -15.992 1.00 153.98 ? 146 VAL H N   1 
ATOM   7862  C CA  . VAL H 2 124 ? -38.698 9.923    -15.747 1.00 153.76 ? 146 VAL H CA  1 
ATOM   7863  C C   . VAL H 2 124 ? -38.058 10.982   -14.825 1.00 153.56 ? 146 VAL H C   1 
ATOM   7864  O O   . VAL H 2 124 ? -38.250 12.157   -15.054 1.00 155.49 ? 146 VAL H O   1 
ATOM   7865  C CB  . VAL H 2 124 ? -37.884 9.740    -17.062 1.00 155.14 ? 146 VAL H CB  1 
ATOM   7866  C CG1 . VAL H 2 124 ? -38.381 8.544    -17.852 1.00 154.87 ? 146 VAL H CG1 1 
ATOM   7867  C CG2 . VAL H 2 124 ? -37.943 10.968   -17.964 1.00 159.19 ? 146 VAL H CG2 1 
ATOM   7868  N N   . LEU H 2 125 ? -37.363 10.552   -13.764 1.00 153.03 ? 147 LEU H N   1 
ATOM   7869  C CA  . LEU H 2 125 ? -36.599 11.442   -12.886 1.00 152.55 ? 147 LEU H CA  1 
ATOM   7870  C C   . LEU H 2 125 ? -35.086 11.391   -13.163 1.00 155.17 ? 147 LEU H C   1 
ATOM   7871  O O   . LEU H 2 125 ? -34.315 12.156   -12.614 1.00 162.30 ? 147 LEU H O   1 
ATOM   7872  C CB  . LEU H 2 125 ? -36.879 11.100   -11.407 1.00 148.96 ? 147 LEU H CB  1 
ATOM   7873  N N   . VAL H 2 126 ? -34.663 10.433   -13.989 1.00 150.85 ? 148 VAL H N   1 
ATOM   7874  C CA  . VAL H 2 126 ? -33.278 10.277   -14.436 1.00 145.38 ? 148 VAL H CA  1 
ATOM   7875  C C   . VAL H 2 126 ? -33.341 9.311    -15.643 1.00 147.03 ? 148 VAL H C   1 
ATOM   7876  O O   . VAL H 2 126 ? -34.074 8.310    -15.587 1.00 143.55 ? 148 VAL H O   1 
ATOM   7877  C CB  . VAL H 2 126 ? -32.395 9.706    -13.330 1.00 133.39 ? 148 VAL H CB  1 
ATOM   7878  N N   . ASN H 2 127 ? -32.658 9.650    -16.741 1.00 154.90 ? 149 ASN H N   1 
ATOM   7879  C CA  . ASN H 2 127 ? -32.891 8.972    -18.023 1.00 161.07 ? 149 ASN H CA  1 
ATOM   7880  C C   . ASN H 2 127 ? -32.166 7.629    -18.023 1.00 154.60 ? 149 ASN H C   1 
ATOM   7881  O O   . ASN H 2 127 ? -31.429 7.322    -17.077 1.00 152.44 ? 149 ASN H O   1 
ATOM   7882  C CB  . ASN H 2 127 ? -32.392 9.853    -19.197 1.00 170.88 ? 149 ASN H CB  1 
ATOM   7883  C CG  . ASN H 2 127 ? -33.212 9.677    -20.483 1.00 177.25 ? 149 ASN H CG  1 
ATOM   7884  O OD1 . ASN H 2 127 ? -33.492 8.553    -20.909 1.00 178.66 ? 149 ASN H OD1 1 
ATOM   7885  N ND2 . ASN H 2 127 ? -33.592 10.805   -21.106 1.00 185.73 ? 149 ASN H ND2 1 
ATOM   7886  N N   . GLY H 2 128 ? -32.369 6.822    -19.072 1.00 151.06 ? 150 GLY H N   1 
ATOM   7887  C CA  . GLY H 2 128 ? -31.786 5.493    -19.144 1.00 148.30 ? 150 GLY H CA  1 
ATOM   7888  C C   . GLY H 2 128 ? -30.402 5.552    -19.766 1.00 145.03 ? 150 GLY H C   1 
ATOM   7889  O O   . GLY H 2 128 ? -29.919 6.628    -20.102 1.00 150.62 ? 150 GLY H O   1 
ATOM   7890  N N   . THR H 2 129 ? -29.776 4.390    -19.883 1.00 141.53 ? 151 THR H N   1 
ATOM   7891  C CA  . THR H 2 129 ? -28.418 4.275    -20.415 1.00 138.40 ? 151 THR H CA  1 
ATOM   7892  C C   . THR H 2 129 ? -28.072 2.802    -20.693 1.00 135.32 ? 151 THR H C   1 
ATOM   7893  O O   . THR H 2 129 ? -28.842 1.907    -20.351 1.00 136.62 ? 151 THR H O   1 
ATOM   7894  C CB  . THR H 2 129 ? -27.365 4.920    -19.463 1.00 137.13 ? 151 THR H CB  1 
ATOM   7895  O OG1 . THR H 2 129 ? -26.044 4.634    -19.920 1.00 138.98 ? 151 THR H OG1 1 
ATOM   7896  C CG2 . THR H 2 129 ? -27.482 4.418    -18.037 1.00 138.32 ? 151 THR H CG2 1 
ATOM   7897  N N   . LYS H 2 130 ? -26.915 2.561    -21.304 1.00 133.42 ? 152 LYS H N   1 
ATOM   7898  C CA  . LYS H 2 130 ? -26.471 1.204    -21.630 1.00 131.37 ? 152 LYS H CA  1 
ATOM   7899  C C   . LYS H 2 130 ? -26.307 0.290    -20.410 1.00 126.18 ? 152 LYS H C   1 
ATOM   7900  O O   . LYS H 2 130 ? -26.377 -0.929   -20.576 1.00 125.44 ? 152 LYS H O   1 
ATOM   7901  C CB  . LYS H 2 130 ? -25.154 1.224    -22.431 1.00 133.10 ? 152 LYS H CB  1 
ATOM   7902  N N   . GLU H 2 131 ? -26.070 0.854    -19.213 1.00 123.75 ? 153 GLU H N   1 
ATOM   7903  C CA  . GLU H 2 131 ? -25.884 0.051    -17.998 1.00 130.08 ? 153 GLU H CA  1 
ATOM   7904  C C   . GLU H 2 131 ? -26.869 0.353    -16.863 1.00 129.67 ? 153 GLU H C   1 
ATOM   7905  O O   . GLU H 2 131 ? -26.620 -0.043   -15.718 1.00 127.98 ? 153 GLU H O   1 
ATOM   7906  C CB  . GLU H 2 131 ? -24.454 0.188    -17.436 1.00 138.27 ? 153 GLU H CB  1 
ATOM   7907  C CG  . GLU H 2 131 ? -23.335 0.624    -18.398 1.00 140.89 ? 153 GLU H CG  1 
ATOM   7908  C CD  . GLU H 2 131 ? -22.805 2.020    -18.076 1.00 144.05 ? 153 GLU H CD  1 
ATOM   7909  O OE1 . GLU H 2 131 ? -23.590 2.910    -17.668 1.00 151.44 ? 153 GLU H OE1 1 
ATOM   7910  O OE2 . GLU H 2 131 ? -21.565 2.248    -18.192 1.00 144.66 ? 153 GLU H OE2 1 
ATOM   7911  N N   . ARG H 2 132 ? -27.984 1.019    -17.151 1.00 131.04 ? 154 ARG H N   1 
ATOM   7912  C CA  . ARG H 2 132 ? -28.931 1.375    -16.090 1.00 130.94 ? 154 ARG H CA  1 
ATOM   7913  C C   . ARG H 2 132 ? -30.316 1.686    -16.637 1.00 130.12 ? 154 ARG H C   1 
ATOM   7914  O O   . ARG H 2 132 ? -30.454 2.332    -17.672 1.00 129.57 ? 154 ARG H O   1 
ATOM   7915  C CB  . ARG H 2 132 ? -28.413 2.576    -15.284 1.00 127.58 ? 154 ARG H CB  1 
ATOM   7916  N N   . ASP H 2 133 ? -31.337 1.230    -15.918 1.00 130.12 ? 155 ASP H N   1 
ATOM   7917  C CA  . ASP H 2 133 ? -32.724 1.528    -16.276 1.00 134.51 ? 155 ASP H CA  1 
ATOM   7918  C C   . ASP H 2 133 ? -33.022 2.995    -15.955 1.00 136.02 ? 155 ASP H C   1 
ATOM   7919  O O   . ASP H 2 133 ? -32.304 3.639    -15.196 1.00 129.46 ? 155 ASP H O   1 
ATOM   7920  C CB  . ASP H 2 133 ? -33.685 0.594    -15.500 1.00 136.23 ? 155 ASP H CB  1 
ATOM   7921  C CG  . ASP H 2 133 ? -35.064 0.440    -16.148 1.00 133.93 ? 155 ASP H CG  1 
ATOM   7922  O OD1 . ASP H 2 133 ? -35.316 0.974    -17.264 1.00 135.67 ? 155 ASP H OD1 1 
ATOM   7923  O OD2 . ASP H 2 133 ? -35.917 -0.240   -15.526 1.00 126.47 ? 155 ASP H OD2 1 
ATOM   7924  N N   . VAL H 2 134 ? -34.083 3.516    -16.548 1.00 139.16 ? 156 VAL H N   1 
ATOM   7925  C CA  . VAL H 2 134 ? -34.597 4.822    -16.158 1.00 141.97 ? 156 VAL H CA  1 
ATOM   7926  C C   . VAL H 2 134 ? -35.137 4.760    -14.717 1.00 139.57 ? 156 VAL H C   1 
ATOM   7927  O O   . VAL H 2 134 ? -35.741 3.750    -14.319 1.00 131.99 ? 156 VAL H O   1 
ATOM   7928  C CB  . VAL H 2 134 ? -35.738 5.278    -17.094 1.00 148.31 ? 156 VAL H CB  1 
ATOM   7929  N N   . VAL H 2 135 ? -34.865 5.817    -13.949 1.00 137.64 ? 157 VAL H N   1 
ATOM   7930  C CA  . VAL H 2 135 ? -35.454 5.994    -12.622 1.00 136.25 ? 157 VAL H CA  1 
ATOM   7931  C C   . VAL H 2 135 ? -36.739 6.803    -12.791 1.00 136.72 ? 157 VAL H C   1 
ATOM   7932  O O   . VAL H 2 135 ? -36.754 7.743    -13.577 1.00 129.53 ? 157 VAL H O   1 
ATOM   7933  C CB  . VAL H 2 135 ? -34.495 6.725    -11.663 1.00 131.37 ? 157 VAL H CB  1 
ATOM   7934  N N   . CYS H 2 136 ? -37.818 6.407    -12.106 1.00 143.53 ? 158 CYS H N   1 
ATOM   7935  C CA  . CYS H 2 136 ? -39.109 7.121    -12.174 1.00 148.22 ? 158 CYS H CA  1 
ATOM   7936  C C   . CYS H 2 136 ? -39.699 7.310    -10.785 1.00 147.64 ? 158 CYS H C   1 
ATOM   7937  O O   . CYS H 2 136 ? -40.325 8.336    -10.513 1.00 149.98 ? 158 CYS H O   1 
ATOM   7938  C CB  . CYS H 2 136 ? -40.149 6.429    -13.099 1.00 153.36 ? 158 CYS H CB  1 
ATOM   7939  S SG  . CYS H 2 136 ? -39.542 5.214    -14.307 1.00 164.04 ? 158 CYS H SG  1 
ATOM   7940  N N   . PRO I 2 5   ? 18.813  -25.884  -80.402 1.00 234.54 ? 27  PRO J N   1 
ATOM   7941  C CA  . PRO I 2 5   ? 17.545  -26.055  -81.123 1.00 236.42 ? 27  PRO J CA  1 
ATOM   7942  C C   . PRO I 2 5   ? 16.497  -24.983  -80.806 1.00 234.64 ? 27  PRO J C   1 
ATOM   7943  O O   . PRO I 2 5   ? 15.836  -24.477  -81.714 1.00 235.39 ? 27  PRO J O   1 
ATOM   7944  C CB  . PRO I 2 5   ? 17.054  -27.439  -80.650 1.00 230.95 ? 27  PRO J CB  1 
ATOM   7945  C CG  . PRO I 2 5   ? 18.260  -28.125  -80.116 1.00 228.90 ? 27  PRO J CG  1 
ATOM   7946  C CD  . PRO I 2 5   ? 19.112  -27.038  -79.537 1.00 229.32 ? 27  PRO J CD  1 
ATOM   7947  N N   . CYS I 2 6   ? 16.353  -24.668  -79.523 1.00 229.83 ? 28  CYS J N   1 
ATOM   7948  C CA  . CYS I 2 6   ? 15.289  -23.794  -79.022 1.00 226.98 ? 28  CYS J CA  1 
ATOM   7949  C C   . CYS I 2 6   ? 15.381  -22.359  -79.518 1.00 227.30 ? 28  CYS J C   1 
ATOM   7950  O O   . CYS I 2 6   ? 14.350  -21.735  -79.786 1.00 227.55 ? 28  CYS J O   1 
ATOM   7951  C CB  . CYS I 2 6   ? 15.276  -23.820  -77.489 1.00 223.99 ? 28  CYS J CB  1 
ATOM   7952  S SG  . CYS I 2 6   ? 15.078  -25.491  -76.806 1.00 223.89 ? 28  CYS J SG  1 
ATOM   7953  N N   . SER I 2 7   ? 16.605  -21.847  -79.655 1.00 225.98 ? 29  SER J N   1 
ATOM   7954  C CA  . SER I 2 7   ? 16.847  -20.503  -80.206 1.00 227.44 ? 29  SER J CA  1 
ATOM   7955  C C   . SER I 2 7   ? 16.184  -20.293  -81.572 1.00 233.64 ? 29  SER J C   1 
ATOM   7956  O O   . SER I 2 7   ? 15.764  -19.184  -81.897 1.00 232.65 ? 29  SER J O   1 
ATOM   7957  C CB  . SER I 2 7   ? 18.350  -20.248  -80.336 1.00 228.18 ? 29  SER J CB  1 
ATOM   7958  O OG  . SER I 2 7   ? 18.611  -18.905  -80.703 1.00 229.30 ? 29  SER J OG  1 
ATOM   7959  N N   . ASN I 2 8   ? 16.099  -21.362  -82.364 1.00 240.17 ? 30  ASN J N   1 
ATOM   7960  C CA  . ASN I 2 8   ? 15.418  -21.344  -83.669 1.00 246.36 ? 30  ASN J CA  1 
ATOM   7961  C C   . ASN I 2 8   ? 13.938  -20.935  -83.608 1.00 246.62 ? 30  ASN J C   1 
ATOM   7962  O O   . ASN I 2 8   ? 13.434  -20.324  -84.565 1.00 250.84 ? 30  ASN J O   1 
ATOM   7963  C CB  . ASN I 2 8   ? 15.533  -22.727  -84.337 1.00 248.66 ? 30  ASN J CB  1 
ATOM   7964  C CG  . ASN I 2 8   ? 15.221  -22.696  -85.828 1.00 252.86 ? 30  ASN J CG  1 
ATOM   7965  O OD1 . ASN I 2 8   ? 15.767  -21.882  -86.574 1.00 254.86 ? 30  ASN J OD1 1 
ATOM   7966  N ND2 . ASN I 2 8   ? 14.356  -23.601  -86.270 1.00 252.40 ? 30  ASN J ND2 1 
ATOM   7967  N N   . CYS I 2 9   ? 13.250  -21.286  -82.514 1.00 241.51 ? 31  CYS J N   1 
ATOM   7968  C CA  . CYS I 2 9   ? 11.831  -20.938  -82.348 1.00 239.76 ? 31  CYS J CA  1 
ATOM   7969  C C   . CYS I 2 9   ? 11.647  -19.439  -82.084 1.00 236.44 ? 31  CYS J C   1 
ATOM   7970  O O   . CYS I 2 9   ? 12.384  -18.866  -81.284 1.00 232.83 ? 31  CYS J O   1 
ATOM   7971  C CB  . CYS I 2 9   ? 11.197  -21.728  -81.204 1.00 237.39 ? 31  CYS J CB  1 
ATOM   7972  S SG  . CYS I 2 9   ? 11.329  -23.528  -81.350 1.00 242.62 ? 31  CYS J SG  1 
ATOM   7973  N N   . PRO I 2 10  ? 10.666  -18.800  -82.760 1.00 238.72 ? 32  PRO J N   1 
ATOM   7974  C CA  . PRO I 2 10  ? 10.451  -17.359  -82.626 1.00 237.35 ? 32  PRO J CA  1 
ATOM   7975  C C   . PRO I 2 10  ? 9.496   -16.985  -81.488 1.00 233.30 ? 32  PRO J C   1 
ATOM   7976  O O   . PRO I 2 10  ? 9.072   -17.848  -80.713 1.00 224.63 ? 32  PRO J O   1 
ATOM   7977  C CB  . PRO I 2 10  ? 9.825   -16.998  -83.975 1.00 242.21 ? 32  PRO J CB  1 
ATOM   7978  C CG  . PRO I 2 10  ? 8.991   -18.193  -84.291 1.00 244.93 ? 32  PRO J CG  1 
ATOM   7979  C CD  . PRO I 2 10  ? 9.780   -19.374  -83.796 1.00 243.99 ? 32  PRO J CD  1 
ATOM   7980  N N   . ALA I 2 11  ? 9.179   -15.692  -81.400 1.00 235.28 ? 33  ALA J N   1 
ATOM   7981  C CA  . ALA I 2 11  ? 8.114   -15.191  -80.529 1.00 230.93 ? 33  ALA J CA  1 
ATOM   7982  C C   . ALA I 2 11  ? 6.759   -15.753  -80.973 1.00 229.59 ? 33  ALA J C   1 
ATOM   7983  O O   . ALA I 2 11  ? 6.537   -15.977  -82.166 1.00 239.97 ? 33  ALA J O   1 
ATOM   7984  C CB  . ALA I 2 11  ? 8.084   -13.669  -80.550 1.00 232.02 ? 33  ALA J CB  1 
ATOM   7985  N N   . GLY I 2 12  ? 5.869   -15.972  -80.009 1.00 224.30 ? 34  GLY J N   1 
ATOM   7986  C CA  . GLY I 2 12  ? 4.591   -16.640  -80.252 1.00 223.78 ? 34  GLY J CA  1 
ATOM   7987  C C   . GLY I 2 12  ? 4.606   -18.149  -80.107 1.00 223.51 ? 34  GLY J C   1 
ATOM   7988  O O   . GLY I 2 12  ? 3.568   -18.795  -80.273 1.00 221.33 ? 34  GLY J O   1 
ATOM   7989  N N   . THR I 2 13  ? 5.779   -18.716  -79.806 1.00 222.79 ? 35  THR J N   1 
ATOM   7990  C CA  . THR I 2 13  ? 5.967   -20.167  -79.672 1.00 220.76 ? 35  THR J CA  1 
ATOM   7991  C C   . THR I 2 13  ? 6.917   -20.463  -78.513 1.00 216.16 ? 35  THR J C   1 
ATOM   7992  O O   . THR I 2 13  ? 7.484   -19.541  -77.909 1.00 211.44 ? 35  THR J O   1 
ATOM   7993  C CB  . THR I 2 13  ? 6.571   -20.780  -80.954 1.00 225.92 ? 35  THR J CB  1 
ATOM   7994  O OG1 . THR I 2 13  ? 7.833   -20.158  -81.244 1.00 224.02 ? 35  THR J OG1 1 
ATOM   7995  C CG2 . THR I 2 13  ? 5.636   -20.603  -82.146 1.00 231.08 ? 35  THR J CG2 1 
ATOM   7996  N N   . PHE I 2 14  ? 7.083   -21.752  -78.215 1.00 214.96 ? 36  PHE J N   1 
ATOM   7997  C CA  . PHE I 2 14  ? 8.076   -22.210  -77.240 1.00 212.83 ? 36  PHE J CA  1 
ATOM   7998  C C   . PHE I 2 14  ? 8.715   -23.535  -77.660 1.00 214.89 ? 36  PHE J C   1 
ATOM   7999  O O   . PHE I 2 14  ? 8.129   -24.310  -78.420 1.00 213.98 ? 36  PHE J O   1 
ATOM   8000  C CB  . PHE I 2 14  ? 7.452   -22.336  -75.842 1.00 210.10 ? 36  PHE J CB  1 
ATOM   8001  C CG  . PHE I 2 14  ? 6.460   -23.466  -75.705 1.00 209.73 ? 36  PHE J CG  1 
ATOM   8002  C CD1 . PHE I 2 14  ? 6.828   -24.661  -75.086 1.00 208.31 ? 36  PHE J CD1 1 
ATOM   8003  C CD2 . PHE I 2 14  ? 5.156   -23.334  -76.182 1.00 209.27 ? 36  PHE J CD2 1 
ATOM   8004  C CE1 . PHE I 2 14  ? 5.921   -25.700  -74.954 1.00 204.79 ? 36  PHE J CE1 1 
ATOM   8005  C CE2 . PHE I 2 14  ? 4.252   -24.377  -76.054 1.00 208.84 ? 36  PHE J CE2 1 
ATOM   8006  C CZ  . PHE I 2 14  ? 4.630   -25.557  -75.438 1.00 206.57 ? 36  PHE J CZ  1 
ATOM   8007  N N   . CYS I 2 15  ? 9.918   -23.780  -77.144 1.00 217.69 ? 37  CYS J N   1 
ATOM   8008  C CA  . CYS I 2 15  ? 10.679  -24.999  -77.426 1.00 221.00 ? 37  CYS J CA  1 
ATOM   8009  C C   . CYS I 2 15  ? 10.200  -26.146  -76.527 1.00 213.89 ? 37  CYS J C   1 
ATOM   8010  O O   . CYS I 2 15  ? 10.719  -26.350  -75.431 1.00 208.55 ? 37  CYS J O   1 
ATOM   8011  C CB  . CYS I 2 15  ? 12.174  -24.724  -77.239 1.00 226.41 ? 37  CYS J CB  1 
ATOM   8012  S SG  . CYS I 2 15  ? 13.280  -26.120  -77.550 1.00 230.88 ? 37  CYS J SG  1 
ATOM   8013  N N   . ASP I 2 16  ? 9.215   -26.894  -77.020 1.00 213.90 ? 38  ASP J N   1 
ATOM   8014  C CA  . ASP I 2 16  ? 8.511   -27.914  -76.233 1.00 214.33 ? 38  ASP J CA  1 
ATOM   8015  C C   . ASP I 2 16  ? 9.413   -29.123  -75.936 1.00 213.22 ? 38  ASP J C   1 
ATOM   8016  O O   . ASP I 2 16  ? 9.611   -29.988  -76.788 1.00 220.73 ? 38  ASP J O   1 
ATOM   8017  C CB  . ASP I 2 16  ? 7.230   -28.339  -76.983 1.00 218.73 ? 38  ASP J CB  1 
ATOM   8018  C CG  . ASP I 2 16  ? 6.259   -29.150  -76.120 1.00 215.47 ? 38  ASP J CG  1 
ATOM   8019  O OD1 . ASP I 2 16  ? 6.635   -29.630  -75.023 1.00 203.82 ? 38  ASP J OD1 1 
ATOM   8020  O OD2 . ASP I 2 16  ? 5.099   -29.312  -76.564 1.00 218.67 ? 38  ASP J OD2 1 
ATOM   8021  N N   . ASN I 2 17  ? 9.949   -29.175  -74.714 1.00 209.40 ? 39  ASN J N   1 
ATOM   8022  C CA  . ASN I 2 17  ? 10.867  -30.252  -74.304 1.00 209.33 ? 39  ASN J CA  1 
ATOM   8023  C C   . ASN I 2 17  ? 10.182  -31.584  -74.007 1.00 208.25 ? 39  ASN J C   1 
ATOM   8024  O O   . ASN I 2 17  ? 10.862  -32.604  -73.901 1.00 211.51 ? 39  ASN J O   1 
ATOM   8025  C CB  . ASN I 2 17  ? 11.705  -29.822  -73.093 1.00 207.17 ? 39  ASN J CB  1 
ATOM   8026  C CG  . ASN I 2 17  ? 12.611  -28.638  -73.396 1.00 211.70 ? 39  ASN J CG  1 
ATOM   8027  O OD1 . ASN I 2 17  ? 13.131  -28.493  -74.505 1.00 215.12 ? 39  ASN J OD1 1 
ATOM   8028  N ND2 . ASN I 2 17  ? 12.808  -27.784  -72.402 1.00 214.65 ? 39  ASN J ND2 1 
ATOM   8029  N N   . ASN I 2 18  ? 8.858   -31.582  -73.855 1.00 206.58 ? 40  ASN J N   1 
ATOM   8030  C CA  . ASN I 2 18  ? 8.090   -32.827  -73.736 1.00 207.72 ? 40  ASN J CA  1 
ATOM   8031  C C   . ASN I 2 18  ? 7.907   -33.496  -75.114 1.00 210.99 ? 40  ASN J C   1 
ATOM   8032  O O   . ASN I 2 18  ? 8.010   -34.721  -75.222 1.00 209.23 ? 40  ASN J O   1 
ATOM   8033  C CB  . ASN I 2 18  ? 6.740   -32.568  -73.056 1.00 206.21 ? 40  ASN J CB  1 
ATOM   8034  N N   . ARG I 2 19  ? 7.659   -32.690  -76.152 1.00 213.97 ? 41  ARG J N   1 
ATOM   8035  C CA  . ARG I 2 19  ? 7.486   -33.179  -77.534 1.00 218.58 ? 41  ARG J CA  1 
ATOM   8036  C C   . ARG I 2 19  ? 8.715   -32.893  -78.433 1.00 220.14 ? 41  ARG J C   1 
ATOM   8037  O O   . ARG I 2 19  ? 8.569   -32.446  -79.579 1.00 215.45 ? 41  ARG J O   1 
ATOM   8038  C CB  . ARG I 2 19  ? 6.210   -32.579  -78.145 1.00 219.91 ? 41  ARG J CB  1 
ATOM   8039  N N   . ASN I 2 20  ? 9.909   -33.166  -77.895 1.00 219.82 ? 42  ASN J N   1 
ATOM   8040  C CA  . ASN I 2 20  ? 11.202  -33.056  -78.604 1.00 219.40 ? 42  ASN J CA  1 
ATOM   8041  C C   . ASN I 2 20  ? 11.441  -31.753  -79.377 1.00 215.09 ? 42  ASN J C   1 
ATOM   8042  O O   . ASN I 2 20  ? 11.304  -31.709  -80.596 1.00 216.02 ? 42  ASN J O   1 
ATOM   8043  C CB  . ASN I 2 20  ? 11.423  -34.276  -79.515 1.00 226.31 ? 42  ASN J CB  1 
ATOM   8044  C CG  . ASN I 2 20  ? 11.821  -35.523  -78.733 1.00 230.59 ? 42  ASN J CG  1 
ATOM   8045  O OD1 . ASN I 2 20  ? 11.589  -35.630  -77.528 1.00 233.95 ? 42  ASN J OD1 1 
ATOM   8046  N ND2 . ASN I 2 20  ? 12.489  -36.463  -79.414 1.00 235.95 ? 42  ASN J ND2 1 
ATOM   8047  N N   . GLN I 2 21  ? 11.764  -30.692  -78.640 1.00 210.83 ? 43  GLN J N   1 
ATOM   8048  C CA  . GLN I 2 21  ? 12.277  -29.424  -79.195 1.00 213.26 ? 43  GLN J CA  1 
ATOM   8049  C C   . GLN I 2 21  ? 11.433  -28.682  -80.256 1.00 213.59 ? 43  GLN J C   1 
ATOM   8050  O O   . GLN I 2 21  ? 11.870  -27.642  -80.764 1.00 213.76 ? 43  GLN J O   1 
ATOM   8051  C CB  . GLN I 2 21  ? 13.686  -29.642  -79.756 1.00 219.57 ? 43  GLN J CB  1 
ATOM   8052  N N   . ILE I 2 22  ? 10.239  -29.186  -80.575 1.00 211.01 ? 44  ILE J N   1 
ATOM   8053  C CA  . ILE I 2 22  ? 9.417   -28.621  -81.650 1.00 219.59 ? 44  ILE J CA  1 
ATOM   8054  C C   . ILE I 2 22  ? 8.827   -27.275  -81.233 1.00 221.12 ? 44  ILE J C   1 
ATOM   8055  O O   . ILE I 2 22  ? 8.500   -27.075  -80.063 1.00 226.23 ? 44  ILE J O   1 
ATOM   8056  C CB  . ILE I 2 22  ? 8.303   -29.600  -82.102 1.00 223.17 ? 44  ILE J CB  1 
ATOM   8057  C CG1 . ILE I 2 22  ? 7.695   -29.128  -83.439 1.00 233.67 ? 44  ILE J CG1 1 
ATOM   8058  C CG2 . ILE I 2 22  ? 7.227   -29.780  -81.031 1.00 216.32 ? 44  ILE J CG2 1 
ATOM   8059  C CD1 . ILE I 2 22  ? 6.741   -30.102  -84.082 1.00 237.43 ? 44  ILE J CD1 1 
ATOM   8060  N N   . CYS I 2 23  ? 8.701   -26.360  -82.191 1.00 228.57 ? 45  CYS J N   1 
ATOM   8061  C CA  . CYS I 2 23  ? 8.209   -25.010  -81.905 1.00 233.34 ? 45  CYS J CA  1 
ATOM   8062  C C   . CYS I 2 23  ? 6.677   -25.003  -81.833 1.00 232.47 ? 45  CYS J C   1 
ATOM   8063  O O   . CYS I 2 23  ? 5.995   -24.651  -82.805 1.00 239.29 ? 45  CYS J O   1 
ATOM   8064  C CB  . CYS I 2 23  ? 8.716   -24.002  -82.939 1.00 242.05 ? 45  CYS J CB  1 
ATOM   8065  S SG  . CYS I 2 23  ? 10.509  -23.987  -83.166 1.00 253.59 ? 45  CYS J SG  1 
ATOM   8066  N N   . SER I 2 24  ? 6.153   -25.395  -80.667 1.00 225.35 ? 46  SER J N   1 
ATOM   8067  C CA  . SER I 2 24  ? 4.712   -25.409  -80.409 1.00 218.49 ? 46  SER J CA  1 
ATOM   8068  C C   . SER I 2 24  ? 4.210   -23.980  -80.172 1.00 220.09 ? 46  SER J C   1 
ATOM   8069  O O   . SER I 2 24  ? 4.933   -23.174  -79.580 1.00 221.72 ? 46  SER J O   1 
ATOM   8070  C CB  . SER I 2 24  ? 4.390   -26.262  -79.176 1.00 206.73 ? 46  SER J CB  1 
ATOM   8071  O OG  . SER I 2 24  ? 4.946   -27.549  -79.264 1.00 200.77 ? 46  SER J OG  1 
ATOM   8072  N N   . PRO I 2 25  ? 2.970   -23.665  -80.613 1.00 222.20 ? 47  PRO J N   1 
ATOM   8073  C CA  . PRO I 2 25  ? 2.455   -22.323  -80.335 1.00 221.90 ? 47  PRO J CA  1 
ATOM   8074  C C   . PRO I 2 25  ? 2.077   -22.163  -78.865 1.00 218.49 ? 47  PRO J C   1 
ATOM   8075  O O   . PRO I 2 25  ? 1.798   -23.160  -78.185 1.00 212.26 ? 47  PRO J O   1 
ATOM   8076  C CB  . PRO I 2 25  ? 1.211   -22.208  -81.234 1.00 224.78 ? 47  PRO J CB  1 
ATOM   8077  C CG  . PRO I 2 25  ? 1.064   -23.522  -81.933 1.00 228.41 ? 47  PRO J CG  1 
ATOM   8078  C CD  . PRO I 2 25  ? 1.939   -24.514  -81.232 1.00 224.94 ? 47  PRO J CD  1 
ATOM   8079  N N   . CYS I 2 26  ? 2.091   -20.917  -78.384 1.00 217.96 ? 48  CYS J N   1 
ATOM   8080  C CA  . CYS I 2 26  ? 1.733   -20.625  -76.999 1.00 213.76 ? 48  CYS J CA  1 
ATOM   8081  C C   . CYS I 2 26  ? 0.286   -21.056  -76.750 1.00 210.58 ? 48  CYS J C   1 
ATOM   8082  O O   . CYS I 2 26  ? -0.601  -20.693  -77.529 1.00 209.97 ? 48  CYS J O   1 
ATOM   8083  C CB  . CYS I 2 26  ? 1.891   -19.130  -76.672 1.00 215.81 ? 48  CYS J CB  1 
ATOM   8084  S SG  . CYS I 2 26  ? 3.574   -18.495  -76.398 1.00 213.42 ? 48  CYS J SG  1 
ATOM   8085  N N   . PRO I 2 27  ? 0.040   -21.841  -75.677 1.00 207.53 ? 49  PRO J N   1 
ATOM   8086  C CA  . PRO I 2 27  ? -1.331  -22.272  -75.379 1.00 208.85 ? 49  PRO J CA  1 
ATOM   8087  C C   . PRO I 2 27  ? -2.249  -21.104  -74.976 1.00 211.46 ? 49  PRO J C   1 
ATOM   8088  O O   . PRO I 2 27  ? -1.796  -19.962  -74.918 1.00 209.70 ? 49  PRO J O   1 
ATOM   8089  C CB  . PRO I 2 27  ? -1.151  -23.290  -74.239 1.00 202.16 ? 49  PRO J CB  1 
ATOM   8090  C CG  . PRO I 2 27  ? 0.185   -23.024  -73.660 1.00 199.35 ? 49  PRO J CG  1 
ATOM   8091  C CD  . PRO I 2 27  ? 1.019   -22.380  -74.714 1.00 202.64 ? 49  PRO J CD  1 
ATOM   8092  N N   . PRO I 2 28  ? -3.545  -21.382  -74.723 1.00 217.90 ? 50  PRO J N   1 
ATOM   8093  C CA  . PRO I 2 28  ? -4.442  -20.281  -74.361 1.00 217.73 ? 50  PRO J CA  1 
ATOM   8094  C C   . PRO I 2 28  ? -4.012  -19.546  -73.077 1.00 208.62 ? 50  PRO J C   1 
ATOM   8095  O O   . PRO I 2 28  ? -3.492  -20.169  -72.143 1.00 194.07 ? 50  PRO J O   1 
ATOM   8096  C CB  . PRO I 2 28  ? -5.798  -20.975  -74.167 1.00 224.58 ? 50  PRO J CB  1 
ATOM   8097  C CG  . PRO I 2 28  ? -5.701  -22.237  -74.946 1.00 226.94 ? 50  PRO J CG  1 
ATOM   8098  C CD  . PRO I 2 28  ? -4.268  -22.662  -74.837 1.00 223.04 ? 50  PRO J CD  1 
ATOM   8099  N N   . ASN I 2 29  ? -4.229  -18.230  -73.075 1.00 206.53 ? 51  ASN J N   1 
ATOM   8100  C CA  . ASN I 2 29  ? -3.865  -17.335  -71.971 1.00 200.07 ? 51  ASN J CA  1 
ATOM   8101  C C   . ASN I 2 29  ? -2.355  -17.258  -71.725 1.00 199.10 ? 51  ASN J C   1 
ATOM   8102  O O   . ASN I 2 29  ? -1.933  -17.136  -70.576 1.00 202.08 ? 51  ASN J O   1 
ATOM   8103  C CB  . ASN I 2 29  ? -4.586  -17.720  -70.665 1.00 193.55 ? 51  ASN J CB  1 
ATOM   8104  C CG  . ASN I 2 29  ? -6.063  -17.976  -70.861 1.00 198.35 ? 51  ASN J CG  1 
ATOM   8105  O OD1 . ASN I 2 29  ? -6.768  -17.183  -71.486 1.00 202.54 ? 51  ASN J OD1 1 
ATOM   8106  N ND2 . ASN I 2 29  ? -6.543  -19.092  -70.322 1.00 200.01 ? 51  ASN J ND2 1 
ATOM   8107  N N   . SER I 2 30  ? -1.544  -17.297  -72.781 1.00 202.00 ? 52  SER J N   1 
ATOM   8108  C CA  . SER I 2 30  ? -0.086  -17.203  -72.631 1.00 199.94 ? 52  SER J CA  1 
ATOM   8109  C C   . SER I 2 30  ? 0.595   -16.554  -73.820 1.00 202.86 ? 52  SER J C   1 
ATOM   8110  O O   . SER I 2 30  ? 0.019   -16.459  -74.889 1.00 213.16 ? 52  SER J O   1 
ATOM   8111  C CB  . SER I 2 30  ? 0.515   -18.585  -72.380 1.00 196.56 ? 52  SER J CB  1 
ATOM   8112  O OG  . SER I 2 30  ? 0.197   -19.484  -73.432 1.00 204.56 ? 52  SER J OG  1 
ATOM   8113  N N   . PHE I 2 31  ? 1.833   -16.120  -73.612 1.00 201.14 ? 53  PHE J N   1 
ATOM   8114  C CA  . PHE I 2 31  ? 2.579   -15.348  -74.607 1.00 207.73 ? 53  PHE J CA  1 
ATOM   8115  C C   . PHE I 2 31  ? 4.088   -15.525  -74.483 1.00 208.17 ? 53  PHE J C   1 
ATOM   8116  O O   . PHE I 2 31  ? 4.582   -16.077  -73.505 1.00 210.32 ? 53  PHE J O   1 
ATOM   8117  C CB  . PHE I 2 31  ? 2.232   -13.859  -74.481 1.00 209.35 ? 53  PHE J CB  1 
ATOM   8118  C CG  . PHE I 2 31  ? 2.906   -13.167  -73.327 1.00 207.31 ? 53  PHE J CG  1 
ATOM   8119  C CD1 . PHE I 2 31  ? 4.042   -12.387  -73.535 1.00 209.04 ? 53  PHE J CD1 1 
ATOM   8120  C CD2 . PHE I 2 31  ? 2.418   -13.309  -72.031 1.00 200.23 ? 53  PHE J CD2 1 
ATOM   8121  C CE1 . PHE I 2 31  ? 4.667   -11.750  -72.466 1.00 205.95 ? 53  PHE J CE1 1 
ATOM   8122  C CE2 . PHE I 2 31  ? 3.043   -12.679  -70.965 1.00 195.26 ? 53  PHE J CE2 1 
ATOM   8123  C CZ  . PHE I 2 31  ? 4.171   -11.908  -71.179 1.00 198.55 ? 53  PHE J CZ  1 
ATOM   8124  N N   . SER I 2 32  ? 4.801   -15.048  -75.500 1.00 210.05 ? 54  SER J N   1 
ATOM   8125  C CA  . SER I 2 32  ? 6.258   -14.889  -75.468 1.00 210.57 ? 54  SER J CA  1 
ATOM   8126  C C   . SER I 2 32  ? 6.662   -13.803  -76.463 1.00 214.89 ? 54  SER J C   1 
ATOM   8127  O O   . SER I 2 32  ? 6.472   -13.969  -77.668 1.00 217.32 ? 54  SER J O   1 
ATOM   8128  C CB  . SER I 2 32  ? 6.958   -16.213  -75.814 1.00 208.01 ? 54  SER J CB  1 
ATOM   8129  O OG  . SER I 2 32  ? 6.519   -16.748  -77.049 1.00 205.69 ? 54  SER J OG  1 
ATOM   8130  N N   . SER I 2 33  ? 7.186   -12.687  -75.961 1.00 219.34 ? 55  SER J N   1 
ATOM   8131  C CA  . SER I 2 33  ? 7.633   -11.563  -76.808 1.00 223.48 ? 55  SER J CA  1 
ATOM   8132  C C   . SER I 2 33  ? 9.117   -11.665  -77.201 1.00 228.29 ? 55  SER J C   1 
ATOM   8133  O O   . SER I 2 33  ? 9.654   -10.742  -77.823 1.00 230.66 ? 55  SER J O   1 
ATOM   8134  C CB  . SER I 2 33  ? 7.364   -10.221  -76.114 1.00 223.85 ? 55  SER J CB  1 
ATOM   8135  O OG  . SER I 2 33  ? 8.043   -10.139  -74.878 1.00 225.84 ? 55  SER J OG  1 
ATOM   8136  N N   . ALA I 2 34  ? 9.769   -12.773  -76.837 1.00 230.33 ? 56  ALA J N   1 
ATOM   8137  C CA  . ALA I 2 34  ? 11.106  -13.104  -77.327 1.00 236.09 ? 56  ALA J CA  1 
ATOM   8138  C C   . ALA I 2 34  ? 11.155  -14.555  -77.808 1.00 237.44 ? 56  ALA J C   1 
ATOM   8139  O O   . ALA I 2 34  ? 10.268  -15.354  -77.497 1.00 231.26 ? 56  ALA J O   1 
ATOM   8140  C CB  . ALA I 2 34  ? 12.135  -12.871  -76.232 1.00 234.14 ? 56  ALA J CB  1 
ATOM   8141  N N   . GLY I 2 35  ? 12.236  -14.913  -78.484 1.00 240.24 ? 57  GLY J N   1 
ATOM   8142  C CA  . GLY I 2 35  ? 12.394  -16.260  -78.988 1.00 238.45 ? 57  GLY J CA  1 
ATOM   8143  C C   . GLY I 2 35  ? 13.301  -17.110  -78.130 1.00 229.80 ? 57  GLY J C   1 
ATOM   8144  O O   . GLY I 2 35  ? 14.154  -16.600  -77.410 1.00 224.55 ? 57  GLY J O   1 
ATOM   8145  N N   . GLY I 2 36  ? 13.109  -18.418  -78.212 1.00 226.74 ? 58  GLY J N   1 
ATOM   8146  C CA  . GLY I 2 36  ? 13.914  -19.365  -77.467 1.00 222.71 ? 58  GLY J CA  1 
ATOM   8147  C C   . GLY I 2 36  ? 13.497  -19.727  -76.056 1.00 215.03 ? 58  GLY J C   1 
ATOM   8148  O O   . GLY I 2 36  ? 14.162  -20.529  -75.401 1.00 211.19 ? 58  GLY J O   1 
ATOM   8149  N N   . GLN I 2 37  ? 12.405  -19.151  -75.573 1.00 210.05 ? 59  GLN J N   1 
ATOM   8150  C CA  . GLN I 2 37  ? 11.954  -19.491  -74.235 1.00 202.28 ? 59  GLN J CA  1 
ATOM   8151  C C   . GLN I 2 37  ? 11.445  -20.919  -74.234 1.00 198.11 ? 59  GLN J C   1 
ATOM   8152  O O   . GLN I 2 37  ? 10.769  -21.343  -75.161 1.00 203.41 ? 59  GLN J O   1 
ATOM   8153  C CB  . GLN I 2 37  ? 10.839  -18.557  -73.791 1.00 199.74 ? 59  GLN J CB  1 
ATOM   8154  C CG  . GLN I 2 37  ? 11.264  -17.123  -73.576 1.00 199.46 ? 59  GLN J CG  1 
ATOM   8155  C CD  . GLN I 2 37  ? 10.090  -16.245  -73.208 1.00 199.40 ? 59  GLN J CD  1 
ATOM   8156  O OE1 . GLN I 2 37  ? 8.949   -16.553  -73.542 1.00 192.27 ? 59  GLN J OE1 1 
ATOM   8157  N NE2 . GLN I 2 37  ? 10.362  -15.145  -72.519 1.00 202.12 ? 59  GLN J NE2 1 
ATOM   8158  N N   . ARG I 2 38  ? 11.785  -21.666  -73.198 1.00 189.73 ? 60  ARG J N   1 
ATOM   8159  C CA  . ARG I 2 38  ? 11.325  -23.036  -73.062 1.00 188.65 ? 60  ARG J CA  1 
ATOM   8160  C C   . ARG I 2 38  ? 9.819   -23.115  -72.890 1.00 186.30 ? 60  ARG J C   1 
ATOM   8161  O O   . ARG I 2 38  ? 9.187   -24.077  -73.293 1.00 187.84 ? 60  ARG J O   1 
ATOM   8162  C CB  . ARG I 2 38  ? 12.021  -23.670  -71.869 1.00 188.50 ? 60  ARG J CB  1 
ATOM   8163  N N   . THR I 2 39  ? 9.273   -22.116  -72.215 1.00 181.93 ? 61  THR J N   1 
ATOM   8164  C CA  . THR I 2 39  ? 7.836   -22.022  -71.911 1.00 178.93 ? 61  THR J CA  1 
ATOM   8165  C C   . THR I 2 39  ? 7.308   -20.621  -72.208 1.00 176.11 ? 61  THR J C   1 
ATOM   8166  O O   . THR I 2 39  ? 8.068   -19.652  -72.222 1.00 175.64 ? 61  THR J O   1 
ATOM   8167  C CB  . THR I 2 39  ? 7.525   -22.313  -70.429 1.00 177.76 ? 61  THR J CB  1 
ATOM   8168  O OG1 . THR I 2 39  ? 8.382   -21.524  -69.592 1.00 180.42 ? 61  THR J OG1 1 
ATOM   8169  C CG2 . THR I 2 39  ? 7.700   -23.794  -70.112 1.00 177.25 ? 61  THR J CG2 1 
ATOM   8170  N N   . CYS I 2 40  ? 6.001   -20.531  -72.434 1.00 175.38 ? 62  CYS J N   1 
ATOM   8171  C CA  . CYS I 2 40  ? 5.329   -19.244  -72.581 1.00 178.28 ? 62  CYS J CA  1 
ATOM   8172  C C   . CYS I 2 40  ? 4.935   -18.726  -71.203 1.00 167.16 ? 62  CYS J C   1 
ATOM   8173  O O   . CYS I 2 40  ? 4.685   -19.510  -70.291 1.00 153.07 ? 62  CYS J O   1 
ATOM   8174  C CB  . CYS I 2 40  ? 4.100   -19.383  -73.492 1.00 188.91 ? 62  CYS J CB  1 
ATOM   8175  S SG  . CYS I 2 40  ? 4.481   -19.871  -75.195 1.00 200.10 ? 62  CYS J SG  1 
ATOM   8176  N N   . ASP I 2 41  ? 4.884   -17.410  -71.070 1.00 168.92 ? 63  ASP J N   1 
ATOM   8177  C CA  . ASP I 2 41  ? 4.520   -16.742  -69.816 1.00 170.87 ? 63  ASP J CA  1 
ATOM   8178  C C   . ASP I 2 41  ? 3.013   -16.579  -69.739 1.00 173.51 ? 63  ASP J C   1 
ATOM   8179  O O   . ASP I 2 41  ? 2.370   -16.463  -70.768 1.00 181.56 ? 63  ASP J O   1 
ATOM   8180  C CB  . ASP I 2 41  ? 5.178   -15.358  -69.744 1.00 173.63 ? 63  ASP J CB  1 
ATOM   8181  C CG  . ASP I 2 41  ? 6.695   -15.422  -69.876 1.00 175.73 ? 63  ASP J CG  1 
ATOM   8182  O OD1 . ASP I 2 41  ? 7.293   -16.462  -69.500 1.00 175.43 ? 63  ASP J OD1 1 
ATOM   8183  O OD2 . ASP I 2 41  ? 7.278   -14.420  -70.353 1.00 179.50 ? 63  ASP J OD2 1 
ATOM   8184  N N   . ILE I 2 42  ? 2.458   -16.554  -68.522 1.00 169.80 ? 64  ILE J N   1 
ATOM   8185  C CA  . ILE I 2 42  ? 1.002   -16.434  -68.335 1.00 169.41 ? 64  ILE J CA  1 
ATOM   8186  C C   . ILE I 2 42  ? 0.544   -15.018  -68.661 1.00 173.45 ? 64  ILE J C   1 
ATOM   8187  O O   . ILE I 2 42  ? 1.197   -14.052  -68.265 1.00 173.40 ? 64  ILE J O   1 
ATOM   8188  C CB  . ILE I 2 42  ? 0.561   -16.754  -66.893 1.00 162.34 ? 64  ILE J CB  1 
ATOM   8189  N N   . CYS I 2 43  ? -0.579  -14.897  -69.373 1.00 181.47 ? 65  CYS J N   1 
ATOM   8190  C CA  . CYS I 2 43  ? -1.141  -13.593  -69.740 1.00 191.47 ? 65  CYS J CA  1 
ATOM   8191  C C   . CYS I 2 43  ? -1.684  -12.891  -68.500 1.00 186.61 ? 65  CYS J C   1 
ATOM   8192  O O   . CYS I 2 43  ? -2.268  -13.524  -67.637 1.00 187.56 ? 65  CYS J O   1 
ATOM   8193  C CB  . CYS I 2 43  ? -2.267  -13.734  -70.770 1.00 209.10 ? 65  CYS J CB  1 
ATOM   8194  S SG  . CYS I 2 43  ? -1.781  -13.932  -72.503 1.00 229.84 ? 65  CYS J SG  1 
ATOM   8195  N N   . ARG I 2 44  ? -1.493  -11.578  -68.428 1.00 180.80 ? 66  ARG J N   1 
ATOM   8196  C CA  . ARG I 2 44  ? -2.022  -10.766  -67.331 1.00 174.06 ? 66  ARG J CA  1 
ATOM   8197  C C   . ARG I 2 44  ? -3.546  -10.753  -67.398 1.00 177.35 ? 66  ARG J C   1 
ATOM   8198  O O   . ARG I 2 44  ? -4.123  -10.878  -68.477 1.00 193.35 ? 66  ARG J O   1 
ATOM   8199  C CB  . ARG I 2 44  ? -1.482  -9.337   -67.411 1.00 168.07 ? 66  ARG J CB  1 
ATOM   8200  N N   . GLN I 2 45  ? -4.185  -10.615  -66.248 1.00 172.98 ? 67  GLN J N   1 
ATOM   8201  C CA  . GLN I 2 45  ? -5.638  -10.564  -66.141 1.00 172.83 ? 67  GLN J CA  1 
ATOM   8202  C C   . GLN I 2 45  ? -5.971  -9.157   -65.688 1.00 171.66 ? 67  GLN J C   1 
ATOM   8203  O O   . GLN I 2 45  ? -5.363  -8.662   -64.750 1.00 173.21 ? 67  GLN J O   1 
ATOM   8204  C CB  . GLN I 2 45  ? -6.121  -11.553  -65.082 1.00 175.72 ? 67  GLN J CB  1 
ATOM   8205  C CG  . GLN I 2 45  ? -7.141  -12.586  -65.515 1.00 180.58 ? 67  GLN J CG  1 
ATOM   8206  C CD  . GLN I 2 45  ? -6.550  -13.942  -65.689 1.00 179.52 ? 67  GLN J CD  1 
ATOM   8207  O OE1 . GLN I 2 45  ? -5.671  -14.107  -66.520 1.00 184.45 ? 67  GLN J OE1 1 
ATOM   8208  N NE2 . GLN I 2 45  ? -7.029  -14.917  -64.921 1.00 172.45 ? 67  GLN J NE2 1 
ATOM   8209  N N   . CYS I 2 46  ? -6.940  -8.536   -66.342 1.00 174.37 ? 68  CYS J N   1 
ATOM   8210  C CA  . CYS I 2 46  ? -7.406  -7.219   -65.924 1.00 179.33 ? 68  CYS J CA  1 
ATOM   8211  C C   . CYS I 2 46  ? -8.840  -7.376   -65.481 1.00 176.32 ? 68  CYS J C   1 
ATOM   8212  O O   . CYS I 2 46  ? -9.757  -7.300   -66.285 1.00 180.63 ? 68  CYS J O   1 
ATOM   8213  C CB  . CYS I 2 46  ? -7.281  -6.211   -67.057 1.00 189.99 ? 68  CYS J CB  1 
ATOM   8214  S SG  . CYS I 2 46  ? -5.618  -6.140   -67.763 1.00 203.78 ? 68  CYS J SG  1 
ATOM   8215  N N   . LYS I 2 47  ? -9.025  -7.637   -64.191 1.00 173.14 ? 69  LYS J N   1 
ATOM   8216  C CA  . LYS I 2 47  ? -10.342 -7.855   -63.618 1.00 175.76 ? 69  LYS J CA  1 
ATOM   8217  C C   . LYS I 2 47  ? -10.522 -6.945   -62.413 1.00 171.28 ? 69  LYS J C   1 
ATOM   8218  O O   . LYS I 2 47  ? -9.625  -6.172   -62.075 1.00 160.31 ? 69  LYS J O   1 
ATOM   8219  C CB  . LYS I 2 47  ? -10.497 -9.329   -63.254 1.00 179.52 ? 69  LYS J CB  1 
ATOM   8220  C CG  . LYS I 2 47  ? -10.178 -10.224  -64.434 1.00 182.84 ? 69  LYS J CG  1 
ATOM   8221  C CD  . LYS I 2 47  ? -10.796 -11.608  -64.349 1.00 187.68 ? 69  LYS J CD  1 
ATOM   8222  C CE  . LYS I 2 47  ? -10.744 -12.271  -65.721 1.00 195.19 ? 69  LYS J CE  1 
ATOM   8223  N NZ  . LYS I 2 47  ? -10.920 -13.751  -65.688 1.00 200.70 ? 69  LYS J NZ  1 
ATOM   8224  N N   . GLY I 2 48  ? -11.700 -7.010   -61.788 1.00 175.02 ? 70  GLY J N   1 
ATOM   8225  C CA  . GLY I 2 48  ? -12.015 -6.189   -60.615 1.00 175.12 ? 70  GLY J CA  1 
ATOM   8226  C C   . GLY I 2 48  ? -12.070 -4.718   -60.981 1.00 176.22 ? 70  GLY J C   1 
ATOM   8227  O O   . GLY I 2 48  ? -12.853 -4.324   -61.827 1.00 179.77 ? 70  GLY J O   1 
ATOM   8228  N N   . VAL I 2 49  ? -11.223 -3.908   -60.360 1.00 175.52 ? 71  VAL J N   1 
ATOM   8229  C CA  . VAL I 2 49  ? -11.131 -2.494   -60.728 1.00 178.18 ? 71  VAL J CA  1 
ATOM   8230  C C   . VAL I 2 49  ? -10.354 -2.262   -62.014 1.00 182.55 ? 71  VAL J C   1 
ATOM   8231  O O   . VAL I 2 49  ? -10.314 -1.132   -62.487 1.00 189.69 ? 71  VAL J O   1 
ATOM   8232  C CB  . VAL I 2 49  ? -10.521 -1.616   -59.605 1.00 179.67 ? 71  VAL J CB  1 
ATOM   8233  C CG1 . VAL I 2 49  ? -11.464 -1.552   -58.414 1.00 180.02 ? 71  VAL J CG1 1 
ATOM   8234  C CG2 . VAL I 2 49  ? -9.132  -2.097   -59.181 1.00 176.13 ? 71  VAL J CG2 1 
ATOM   8235  N N   . PHE I 2 50  ? -9.736  -3.298   -62.574 1.00 187.73 ? 72  PHE J N   1 
ATOM   8236  C CA  . PHE I 2 50  ? -9.038  -3.167   -63.848 1.00 197.89 ? 72  PHE J CA  1 
ATOM   8237  C C   . PHE I 2 50  ? -9.921  -3.554   -65.032 1.00 205.94 ? 72  PHE J C   1 
ATOM   8238  O O   . PHE I 2 50  ? -10.632 -4.566   -64.975 1.00 211.47 ? 72  PHE J O   1 
ATOM   8239  C CB  . PHE I 2 50  ? -7.776  -4.029   -63.856 1.00 198.83 ? 72  PHE J CB  1 
ATOM   8240  C CG  . PHE I 2 50  ? -6.772  -3.640   -62.803 1.00 196.45 ? 72  PHE J CG  1 
ATOM   8241  C CD1 . PHE I 2 50  ? -6.155  -2.400   -62.841 1.00 196.91 ? 72  PHE J CD1 1 
ATOM   8242  C CD2 . PHE I 2 50  ? -6.433  -4.512   -61.793 1.00 194.44 ? 72  PHE J CD2 1 
ATOM   8243  C CE1 . PHE I 2 50  ? -5.219  -2.023   -61.903 1.00 192.30 ? 72  PHE J CE1 1 
ATOM   8244  C CE2 . PHE I 2 50  ? -5.480  -4.157   -60.840 1.00 191.58 ? 72  PHE J CE2 1 
ATOM   8245  C CZ  . PHE I 2 50  ? -4.874  -2.897   -60.896 1.00 191.34 ? 72  PHE J CZ  1 
ATOM   8246  N N   . ARG I 2 51  ? -9.881  -2.719   -66.073 1.00 210.28 ? 73  ARG J N   1 
ATOM   8247  C CA  . ARG I 2 51  ? -10.382 -3.046   -67.410 1.00 216.26 ? 73  ARG J CA  1 
ATOM   8248  C C   . ARG I 2 51  ? -9.174  -3.346   -68.298 1.00 213.44 ? 73  ARG J C   1 
ATOM   8249  O O   . ARG I 2 51  ? -8.085  -2.811   -68.080 1.00 207.06 ? 73  ARG J O   1 
ATOM   8250  C CB  . ARG I 2 51  ? -11.141 -1.856   -68.024 1.00 223.63 ? 73  ARG J CB  1 
ATOM   8251  C CG  . ARG I 2 51  ? -12.465 -1.453   -67.411 1.00 226.45 ? 73  ARG J CG  1 
ATOM   8252  C CD  . ARG I 2 51  ? -13.436 -0.839   -68.428 1.00 232.68 ? 73  ARG J CD  1 
ATOM   8253  N NE  . ARG I 2 51  ? -12.786 -0.011   -69.464 1.00 234.79 ? 73  ARG J NE  1 
ATOM   8254  C CZ  . ARG I 2 51  ? -12.568 1.309    -69.414 1.00 231.38 ? 73  ARG J CZ  1 
ATOM   8255  N NH1 . ARG I 2 51  ? -11.964 1.908    -70.439 1.00 231.62 ? 73  ARG J NH1 1 
ATOM   8256  N NH2 . ARG I 2 51  ? -12.940 2.046    -68.369 1.00 227.42 ? 73  ARG J NH2 1 
ATOM   8257  N N   . THR I 2 52  ? -9.369  -4.187   -69.304 1.00 212.90 ? 74  THR J N   1 
ATOM   8258  C CA  . THR I 2 52  ? -8.322  -4.455   -70.298 1.00 211.88 ? 74  THR J CA  1 
ATOM   8259  C C   . THR I 2 52  ? -8.193  -3.283   -71.278 1.00 213.07 ? 74  THR J C   1 
ATOM   8260  O O   . THR I 2 52  ? -9.180  -2.884   -71.897 1.00 208.37 ? 74  THR J O   1 
ATOM   8261  C CB  . THR I 2 52  ? -8.632  -5.734   -71.098 1.00 212.58 ? 74  THR J CB  1 
ATOM   8262  O OG1 . THR I 2 52  ? -9.036  -6.779   -70.204 1.00 207.58 ? 74  THR J OG1 1 
ATOM   8263  C CG2 . THR I 2 52  ? -7.419  -6.183   -71.874 1.00 212.65 ? 74  THR J CG2 1 
ATOM   8264  N N   . ARG I 2 53  ? -6.982  -2.739   -71.410 1.00 214.97 ? 75  ARG J N   1 
ATOM   8265  C CA  . ARG I 2 53  ? -6.691  -1.693   -72.396 1.00 219.58 ? 75  ARG J CA  1 
ATOM   8266  C C   . ARG I 2 53  ? -6.245  -2.300   -73.713 1.00 221.02 ? 75  ARG J C   1 
ATOM   8267  O O   . ARG I 2 53  ? -6.765  -1.933   -74.772 1.00 231.79 ? 75  ARG J O   1 
ATOM   8268  C CB  . ARG I 2 53  ? -5.608  -0.745   -71.876 1.00 222.38 ? 75  ARG J CB  1 
ATOM   8269  C CG  . ARG I 2 53  ? -5.439  0.539    -72.663 1.00 228.35 ? 75  ARG J CG  1 
ATOM   8270  C CD  . ARG I 2 53  ? -4.298  1.358    -72.085 1.00 231.99 ? 75  ARG J CD  1 
ATOM   8271  N NE  . ARG I 2 53  ? -2.988  0.745    -72.323 1.00 236.48 ? 75  ARG J NE  1 
ATOM   8272  C CZ  . ARG I 2 53  ? -1.840  1.153    -71.772 1.00 239.41 ? 75  ARG J CZ  1 
ATOM   8273  N NH1 . ARG I 2 53  ? -1.801  2.177    -70.913 1.00 239.14 ? 75  ARG J NH1 1 
ATOM   8274  N NH2 . ARG I 2 53  ? -0.704  0.533    -72.079 1.00 244.63 ? 75  ARG J NH2 1 
ATOM   8275  N N   . LYS I 2 54  ? -5.288  -3.233   -73.651 1.00 214.73 ? 76  LYS J N   1 
ATOM   8276  C CA  . LYS I 2 54  ? -4.822  -3.970   -74.829 1.00 215.62 ? 76  LYS J CA  1 
ATOM   8277  C C   . LYS I 2 54  ? -4.960  -5.461   -74.530 1.00 213.17 ? 76  LYS J C   1 
ATOM   8278  O O   . LYS I 2 54  ? -4.512  -5.921   -73.469 1.00 215.67 ? 76  LYS J O   1 
ATOM   8279  C CB  . LYS I 2 54  ? -3.374  -3.632   -75.137 1.00 215.96 ? 76  LYS J CB  1 
ATOM   8280  C CG  . LYS I 2 54  ? -2.934  -4.067   -76.533 1.00 224.06 ? 76  LYS J CG  1 
ATOM   8281  C CD  . LYS I 2 54  ? -1.432  -3.903   -76.763 1.00 226.63 ? 76  LYS J CD  1 
ATOM   8282  C CE  . LYS I 2 54  ? -0.587  -4.854   -75.917 1.00 225.92 ? 76  LYS J CE  1 
ATOM   8283  N NZ  . LYS I 2 54  ? -1.040  -6.276   -76.012 1.00 226.95 ? 76  LYS J NZ  1 
ATOM   8284  N N   . GLU I 2 55  ? -5.547  -6.207   -75.473 1.00 215.16 ? 77  GLU J N   1 
ATOM   8285  C CA  . GLU I 2 55  ? -5.789  -7.633   -75.298 1.00 213.38 ? 77  GLU J CA  1 
ATOM   8286  C C   . GLU I 2 55  ? -4.501  -8.435   -75.362 1.00 211.14 ? 77  GLU J C   1 
ATOM   8287  O O   . GLU I 2 55  ? -3.516  -7.982   -75.978 1.00 209.12 ? 77  GLU J O   1 
ATOM   8288  C CB  . GLU I 2 55  ? -6.789  -8.136   -76.349 1.00 219.46 ? 77  GLU J CB  1 
ATOM   8289  C CG  . GLU I 2 55  ? -7.505  -9.445   -76.023 1.00 220.54 ? 77  GLU J CG  1 
ATOM   8290  C CD  . GLU I 2 55  ? -8.378  -9.369   -74.777 1.00 219.16 ? 77  GLU J CD  1 
ATOM   8291  O OE1 . GLU I 2 55  ? -8.827  -8.260   -74.428 1.00 219.49 ? 77  GLU J OE1 1 
ATOM   8292  O OE2 . GLU I 2 55  ? -8.612  -10.420  -74.139 1.00 217.69 ? 77  GLU J OE2 1 
ATOM   8293  N N   . CYS I 2 56  ? -4.490  -9.620   -74.732 1.00 212.79 ? 78  CYS J N   1 
ATOM   8294  C CA  . CYS I 2 56  ? -3.295  -10.461  -74.722 1.00 219.31 ? 78  CYS J CA  1 
ATOM   8295  C C   . CYS I 2 56  ? -3.190  -11.294  -75.996 1.00 222.86 ? 78  CYS J C   1 
ATOM   8296  O O   . CYS I 2 56  ? -3.978  -12.219  -76.213 1.00 226.01 ? 78  CYS J O   1 
ATOM   8297  C CB  . CYS I 2 56  ? -3.253  -11.409  -73.518 1.00 226.20 ? 78  CYS J CB  1 
ATOM   8298  S SG  . CYS I 2 56  ? -1.573  -12.041  -73.217 1.00 242.10 ? 78  CYS J SG  1 
ATOM   8299  N N   . SER I 2 57  ? -2.199  -10.964  -76.828 1.00 229.48 ? 79  SER J N   1 
ATOM   8300  C CA  . SER I 2 57  ? -1.826  -11.774  -77.969 1.00 239.46 ? 79  SER J CA  1 
ATOM   8301  C C   . SER I 2 57  ? -0.863  -12.862  -77.504 1.00 236.72 ? 79  SER J C   1 
ATOM   8302  O O   . SER I 2 57  ? -0.539  -12.943  -76.317 1.00 233.65 ? 79  SER J O   1 
ATOM   8303  C CB  . SER I 2 57  ? -1.142  -10.906  -79.030 1.00 245.43 ? 79  SER J CB  1 
ATOM   8304  O OG  . SER I 2 57  ? 0.122   -10.444  -78.575 1.00 245.45 ? 79  SER J OG  1 
ATOM   8305  N N   . SER I 2 58  ? -0.418  -13.699  -78.441 1.00 239.18 ? 80  SER J N   1 
ATOM   8306  C CA  . SER I 2 58  ? 0.689   -14.627  -78.176 1.00 236.59 ? 80  SER J CA  1 
ATOM   8307  C C   . SER I 2 58  ? 2.055   -13.944  -78.358 1.00 235.78 ? 80  SER J C   1 
ATOM   8308  O O   . SER I 2 58  ? 3.066   -14.517  -77.980 1.00 234.22 ? 80  SER J O   1 
ATOM   8309  C CB  . SER I 2 58  ? 0.591   -15.863  -79.067 1.00 239.60 ? 80  SER J CB  1 
ATOM   8310  O OG  . SER I 2 58  ? 0.918   -15.549  -80.405 1.00 252.89 ? 80  SER J OG  1 
ATOM   8311  N N   . THR I 2 59  ? 2.078   -12.749  -78.949 1.00 238.13 ? 81  THR J N   1 
ATOM   8312  C CA  . THR I 2 59  ? 3.288   -11.931  -79.009 1.00 238.60 ? 81  THR J CA  1 
ATOM   8313  C C   . THR I 2 59  ? 3.534   -11.276  -77.659 1.00 229.94 ? 81  THR J C   1 
ATOM   8314  O O   . THR I 2 59  ? 4.514   -11.586  -77.001 1.00 225.05 ? 81  THR J O   1 
ATOM   8315  C CB  . THR I 2 59  ? 3.197   -10.829  -80.093 1.00 246.51 ? 81  THR J CB  1 
ATOM   8316  O OG1 . THR I 2 59  ? 2.978   -11.432  -81.370 1.00 256.83 ? 81  THR J OG1 1 
ATOM   8317  C CG2 . THR I 2 59  ? 4.478   -9.978   -80.140 1.00 245.96 ? 81  THR J CG2 1 
ATOM   8318  N N   . SER I 2 60  ? 2.628   -10.389  -77.254 1.00 225.52 ? 82  SER J N   1 
ATOM   8319  C CA  . SER I 2 60  ? 2.835   -9.536   -76.083 1.00 220.77 ? 82  SER J CA  1 
ATOM   8320  C C   . SER I 2 60  ? 1.791   -9.774   -74.999 1.00 214.40 ? 82  SER J C   1 
ATOM   8321  O O   . SER I 2 60  ? 0.707   -10.313  -75.254 1.00 211.81 ? 82  SER J O   1 
ATOM   8322  C CB  . SER I 2 60  ? 2.832   -8.058   -76.488 1.00 222.08 ? 82  SER J CB  1 
ATOM   8323  O OG  . SER I 2 60  ? 1.613   -7.691   -77.100 1.00 224.11 ? 82  SER J OG  1 
ATOM   8324  N N   . ASN I 2 61  ? 2.140   -9.354   -73.789 1.00 205.85 ? 83  ASN J N   1 
ATOM   8325  C CA  . ASN I 2 61  ? 1.248   -9.428   -72.643 1.00 201.49 ? 83  ASN J CA  1 
ATOM   8326  C C   . ASN I 2 61  ? 0.168   -8.348   -72.760 1.00 203.05 ? 83  ASN J C   1 
ATOM   8327  O O   . ASN I 2 61  ? 0.362   -7.338   -73.448 1.00 207.51 ? 83  ASN J O   1 
ATOM   8328  C CB  . ASN I 2 61  ? 2.048   -9.224   -71.351 1.00 199.36 ? 83  ASN J CB  1 
ATOM   8329  C CG  . ASN I 2 61  ? 1.314   -9.673   -70.111 1.00 199.11 ? 83  ASN J CG  1 
ATOM   8330  O OD1 . ASN I 2 61  ? 0.571   -10.659  -70.130 1.00 194.04 ? 83  ASN J OD1 1 
ATOM   8331  N ND2 . ASN I 2 61  ? 1.516   -8.940   -69.013 1.00 199.85 ? 83  ASN J ND2 1 
ATOM   8332  N N   . ALA I 2 62  ? -0.952  -8.571   -72.078 1.00 202.58 ? 84  ALA J N   1 
ATOM   8333  C CA  . ALA I 2 62  ? -2.004  -7.551   -71.949 1.00 202.54 ? 84  ALA J CA  1 
ATOM   8334  C C   . ALA I 2 62  ? -1.538  -6.358   -71.124 1.00 196.40 ? 84  ALA J C   1 
ATOM   8335  O O   . ALA I 2 62  ? -0.492  -6.426   -70.476 1.00 192.94 ? 84  ALA J O   1 
ATOM   8336  C CB  . ALA I 2 62  ? -3.263  -8.146   -71.319 1.00 200.02 ? 84  ALA J CB  1 
ATOM   8337  N N   . GLU I 2 63  ? -2.309  -5.278   -71.164 1.00 198.77 ? 85  GLU J N   1 
ATOM   8338  C CA  . GLU I 2 63  ? -2.075  -4.111   -70.325 1.00 203.31 ? 85  GLU J CA  1 
ATOM   8339  C C   . GLU I 2 63  ? -3.427  -3.600   -69.842 1.00 205.00 ? 85  GLU J C   1 
ATOM   8340  O O   . GLU I 2 63  ? -4.416  -3.643   -70.576 1.00 209.63 ? 85  GLU J O   1 
ATOM   8341  C CB  . GLU I 2 63  ? -1.365  -3.023   -71.130 1.00 210.07 ? 85  GLU J CB  1 
ATOM   8342  C CG  . GLU I 2 63  ? 0.145   -3.195   -71.230 1.00 217.73 ? 85  GLU J CG  1 
ATOM   8343  C CD  . GLU I 2 63  ? 0.716   -2.755   -72.573 1.00 234.27 ? 85  GLU J CD  1 
ATOM   8344  O OE1 . GLU I 2 63  ? 0.286   -1.702   -73.107 1.00 253.52 ? 85  GLU J OE1 1 
ATOM   8345  O OE2 . GLU I 2 63  ? 1.613   -3.467   -73.090 1.00 240.02 ? 85  GLU J OE2 1 
ATOM   8346  N N   . CYS I 2 64  ? -3.490  -3.148   -68.589 1.00 202.35 ? 86  CYS J N   1 
ATOM   8347  C CA  . CYS I 2 64  ? -4.751  -2.770   -67.957 1.00 201.35 ? 86  CYS J CA  1 
ATOM   8348  C C   . CYS I 2 64  ? -4.880  -1.260   -67.834 1.00 197.16 ? 86  CYS J C   1 
ATOM   8349  O O   . CYS I 2 64  ? -3.881  -0.555   -67.747 1.00 196.72 ? 86  CYS J O   1 
ATOM   8350  C CB  . CYS I 2 64  ? -4.870  -3.384   -66.555 1.00 203.79 ? 86  CYS J CB  1 
ATOM   8351  S SG  . CYS I 2 64  ? -4.509  -5.158   -66.356 1.00 211.38 ? 86  CYS J SG  1 
ATOM   8352  N N   . ASP I 2 65  ? -6.121  -0.773   -67.850 1.00 195.73 ? 87  ASP J N   1 
ATOM   8353  C CA  . ASP I 2 65  ? -6.469  0.566    -67.361 1.00 196.48 ? 87  ASP J CA  1 
ATOM   8354  C C   . ASP I 2 65  ? -7.483  0.402    -66.237 1.00 197.01 ? 87  ASP J C   1 
ATOM   8355  O O   . ASP I 2 65  ? -8.015  -0.684   -66.040 1.00 192.69 ? 87  ASP J O   1 
ATOM   8356  C CB  . ASP I 2 65  ? -6.997  1.493    -68.488 1.00 199.85 ? 87  ASP J CB  1 
ATOM   8357  C CG  . ASP I 2 65  ? -8.295  0.987    -69.157 1.00 202.51 ? 87  ASP J CG  1 
ATOM   8358  O OD1 . ASP I 2 65  ? -9.385  1.105    -68.566 1.00 197.69 ? 87  ASP J OD1 1 
ATOM   8359  O OD2 . ASP I 2 65  ? -8.235  0.526    -70.298 1.00 207.15 ? 87  ASP J OD2 1 
ATOM   8360  N N   . CYS I 2 66  ? -7.743  1.467    -65.495 1.00 200.32 ? 88  CYS J N   1 
ATOM   8361  C CA  . CYS I 2 66  ? -8.739  1.427    -64.430 1.00 200.33 ? 88  CYS J CA  1 
ATOM   8362  C C   . CYS I 2 66  ? -10.140 1.608    -64.984 1.00 199.50 ? 88  CYS J C   1 
ATOM   8363  O O   . CYS I 2 66  ? -10.317 2.277    -66.002 1.00 209.65 ? 88  CYS J O   1 
ATOM   8364  C CB  . CYS I 2 66  ? -8.448  2.502    -63.388 1.00 203.28 ? 88  CYS J CB  1 
ATOM   8365  S SG  . CYS I 2 66  ? -6.865  2.259    -62.528 1.00 210.54 ? 88  CYS J SG  1 
ATOM   8366  N N   . THR I 2 67  ? -11.130 1.016    -64.323 1.00 194.22 ? 89  THR J N   1 
ATOM   8367  C CA  . THR I 2 67  ? -12.531 1.293    -64.636 1.00 200.21 ? 89  THR J CA  1 
ATOM   8368  C C   . THR I 2 67  ? -12.835 2.753    -64.316 1.00 197.88 ? 89  THR J C   1 
ATOM   8369  O O   . THR I 2 67  ? -12.163 3.349    -63.465 1.00 186.74 ? 89  THR J O   1 
ATOM   8370  C CB  . THR I 2 67  ? -13.503 0.402    -63.837 1.00 204.81 ? 89  THR J CB  1 
ATOM   8371  O OG1 . THR I 2 67  ? -13.196 0.494    -62.444 1.00 211.58 ? 89  THR J OG1 1 
ATOM   8372  C CG2 . THR I 2 67  ? -13.424 -1.040   -64.275 1.00 204.90 ? 89  THR J CG2 1 
ATOM   8373  N N   . PRO I 2 68  ? -13.861 3.328    -64.972 1.00 206.25 ? 90  PRO J N   1 
ATOM   8374  C CA  . PRO I 2 68  ? -14.098 4.754    -64.784 1.00 209.14 ? 90  PRO J CA  1 
ATOM   8375  C C   . PRO I 2 68  ? -14.559 5.055    -63.365 1.00 209.19 ? 90  PRO J C   1 
ATOM   8376  O O   . PRO I 2 68  ? -15.254 4.245    -62.755 1.00 212.33 ? 90  PRO J O   1 
ATOM   8377  C CB  . PRO I 2 68  ? -15.198 5.076    -65.811 1.00 214.74 ? 90  PRO J CB  1 
ATOM   8378  C CG  . PRO I 2 68  ? -15.475 3.798    -66.545 1.00 217.05 ? 90  PRO J CG  1 
ATOM   8379  C CD  . PRO I 2 68  ? -14.993 2.694    -65.670 1.00 211.82 ? 90  PRO J CD  1 
ATOM   8380  N N   . GLY I 2 69  ? -14.154 6.206    -62.851 1.00 209.38 ? 91  GLY J N   1 
ATOM   8381  C CA  . GLY I 2 69  ? -14.334 6.539    -61.439 1.00 208.67 ? 91  GLY J CA  1 
ATOM   8382  C C   . GLY I 2 69  ? -13.048 6.380    -60.653 1.00 202.48 ? 91  GLY J C   1 
ATOM   8383  O O   . GLY I 2 69  ? -12.922 6.943    -59.559 1.00 194.38 ? 91  GLY J O   1 
ATOM   8384  N N   . PHE I 2 70  ? -12.114 5.595    -61.194 1.00 204.38 ? 92  PHE J N   1 
ATOM   8385  C CA  . PHE I 2 70  ? -10.744 5.508    -60.691 1.00 204.17 ? 92  PHE J CA  1 
ATOM   8386  C C   . PHE I 2 70  ? -9.766  5.947    -61.770 1.00 203.53 ? 92  PHE J C   1 
ATOM   8387  O O   . PHE I 2 70  ? -10.146 6.116    -62.927 1.00 214.65 ? 92  PHE J O   1 
ATOM   8388  C CB  . PHE I 2 70  ? -10.394 4.074    -60.304 1.00 202.16 ? 92  PHE J CB  1 
ATOM   8389  C CG  . PHE I 2 70  ? -11.335 3.456    -59.325 1.00 202.25 ? 92  PHE J CG  1 
ATOM   8390  C CD1 . PHE I 2 70  ? -11.050 3.471    -57.968 1.00 199.71 ? 92  PHE J CD1 1 
ATOM   8391  C CD2 . PHE I 2 70  ? -12.498 2.838    -59.763 1.00 202.63 ? 92  PHE J CD2 1 
ATOM   8392  C CE1 . PHE I 2 70  ? -11.917 2.896    -57.059 1.00 201.48 ? 92  PHE J CE1 1 
ATOM   8393  C CE2 . PHE I 2 70  ? -13.369 2.264    -58.857 1.00 201.90 ? 92  PHE J CE2 1 
ATOM   8394  C CZ  . PHE I 2 70  ? -13.081 2.292    -57.506 1.00 202.02 ? 92  PHE J CZ  1 
ATOM   8395  N N   . HIS I 2 71  ? -8.504  6.100    -61.378 1.00 194.39 ? 93  HIS J N   1 
ATOM   8396  C CA  . HIS I 2 71  ? -7.414  6.424    -62.302 1.00 192.59 ? 93  HIS J CA  1 
ATOM   8397  C C   . HIS I 2 71  ? -6.137  5.660    -61.954 1.00 196.53 ? 93  HIS J C   1 
ATOM   8398  O O   . HIS I 2 71  ? -5.871  5.400    -60.781 1.00 192.36 ? 93  HIS J O   1 
ATOM   8399  C CB  . HIS I 2 71  ? -7.139  7.929    -62.276 1.00 189.32 ? 93  HIS J CB  1 
ATOM   8400  C CG  . HIS I 2 71  ? -6.851  8.468    -60.910 1.00 183.24 ? 93  HIS J CG  1 
ATOM   8401  N ND1 . HIS I 2 71  ? -5.610  8.375    -60.323 1.00 178.84 ? 93  HIS J ND1 1 
ATOM   8402  C CD2 . HIS I 2 71  ? -7.646  9.107    -60.018 1.00 182.28 ? 93  HIS J CD2 1 
ATOM   8403  C CE1 . HIS I 2 71  ? -5.652  8.945    -59.133 1.00 178.95 ? 93  HIS J CE1 1 
ATOM   8404  N NE2 . HIS I 2 71  ? -6.877  9.389    -58.920 1.00 181.67 ? 93  HIS J NE2 1 
ATOM   8405  N N   . CYS I 2 72  ? -5.351  5.321    -62.978 1.00 206.34 ? 94  CYS J N   1 
ATOM   8406  C CA  . CYS I 2 72  ? -4.080  4.595    -62.810 1.00 207.88 ? 94  CYS J CA  1 
ATOM   8407  C C   . CYS I 2 72  ? -3.099  5.288    -61.881 1.00 206.37 ? 94  CYS J C   1 
ATOM   8408  O O   . CYS I 2 72  ? -3.196  6.494    -61.631 1.00 210.73 ? 94  CYS J O   1 
ATOM   8409  C CB  . CYS I 2 72  ? -3.390  4.369    -64.163 1.00 210.58 ? 94  CYS J CB  1 
ATOM   8410  S SG  . CYS I 2 72  ? -4.142  3.073    -65.171 1.00 215.05 ? 94  CYS J SG  1 
ATOM   8411  N N   . LEU I 2 73  ? -2.154  4.498    -61.381 1.00 202.06 ? 95  LEU J N   1 
ATOM   8412  C CA  . LEU I 2 73  ? -1.166  4.959    -60.409 1.00 196.42 ? 95  LEU J CA  1 
ATOM   8413  C C   . LEU I 2 73  ? 0.032   4.022    -60.440 1.00 188.69 ? 95  LEU J C   1 
ATOM   8414  O O   . LEU I 2 73  ? -0.136  2.806    -60.469 1.00 185.23 ? 95  LEU J O   1 
ATOM   8415  C CB  . LEU I 2 73  ? -1.791  4.978    -59.005 1.00 197.01 ? 95  LEU J CB  1 
ATOM   8416  C CG  . LEU I 2 73  ? -1.274  5.968    -57.980 1.00 201.43 ? 95  LEU J CG  1 
ATOM   8417  C CD1 . LEU I 2 73  ? -1.410  7.391    -58.495 1.00 205.33 ? 95  LEU J CD1 1 
ATOM   8418  C CD2 . LEU I 2 73  ? -2.057  5.796    -56.687 1.00 203.14 ? 95  LEU J CD2 1 
ATOM   8419  N N   . GLY I 2 74  ? 1.235   4.587    -60.453 1.00 187.39 ? 96  GLY J N   1 
ATOM   8420  C CA  . GLY I 2 74  ? 2.461   3.796    -60.595 1.00 188.83 ? 96  GLY J CA  1 
ATOM   8421  C C   . GLY I 2 74  ? 2.657   3.238    -61.995 1.00 192.17 ? 96  GLY J C   1 
ATOM   8422  O O   . GLY I 2 74  ? 1.781   3.363    -62.856 1.00 200.81 ? 96  GLY J O   1 
ATOM   8423  N N   . ALA I 2 75  ? 3.809   2.609    -62.215 1.00 192.62 ? 97  ALA J N   1 
ATOM   8424  C CA  . ALA I 2 75  ? 4.180   2.100    -63.537 1.00 197.89 ? 97  ALA J CA  1 
ATOM   8425  C C   . ALA I 2 75  ? 3.316   0.905    -63.945 1.00 200.44 ? 97  ALA J C   1 
ATOM   8426  O O   . ALA I 2 75  ? 2.967   0.073    -63.105 1.00 201.24 ? 97  ALA J O   1 
ATOM   8427  C CB  . ALA I 2 75  ? 5.653   1.722    -63.564 1.00 198.55 ? 97  ALA J CB  1 
ATOM   8428  N N   . GLY I 2 76  ? 2.973   0.846    -65.233 1.00 202.92 ? 98  GLY J N   1 
ATOM   8429  C CA  . GLY I 2 76  ? 2.146   -0.226   -65.808 1.00 202.46 ? 98  GLY J CA  1 
ATOM   8430  C C   . GLY I 2 76  ? 0.721   -0.317   -65.274 1.00 201.54 ? 98  GLY J C   1 
ATOM   8431  O O   . GLY I 2 76  ? 0.076   -1.363   -65.401 1.00 204.59 ? 98  GLY J O   1 
ATOM   8432  N N   . CYS I 2 77  ? 0.227   0.787    -64.706 1.00 199.14 ? 99  CYS J N   1 
ATOM   8433  C CA  . CYS I 2 77  ? -1.029  0.822    -63.963 1.00 198.37 ? 99  CYS J CA  1 
ATOM   8434  C C   . CYS I 2 77  ? -1.064  -0.278   -62.897 1.00 193.65 ? 99  CYS J C   1 
ATOM   8435  O O   . CYS I 2 77  ? -1.855  -1.226   -62.968 1.00 191.76 ? 99  CYS J O   1 
ATOM   8436  C CB  . CYS I 2 77  ? -2.221  0.734    -64.914 1.00 205.31 ? 99  CYS J CB  1 
ATOM   8437  S SG  . CYS I 2 77  ? -3.748  1.347    -64.178 1.00 212.88 ? 99  CYS J SG  1 
ATOM   8438  N N   . SER I 2 78  ? -0.170  -0.135   -61.926 1.00 190.74 ? 100 SER J N   1 
ATOM   8439  C CA  . SER I 2 78  ? 0.012   -1.128   -60.877 1.00 185.28 ? 100 SER J CA  1 
ATOM   8440  C C   . SER I 2 78  ? -1.152  -1.150   -59.901 1.00 176.83 ? 100 SER J C   1 
ATOM   8441  O O   . SER I 2 78  ? -1.495  -2.214   -59.393 1.00 177.10 ? 100 SER J O   1 
ATOM   8442  C CB  . SER I 2 78  ? 1.308   -0.862   -60.110 1.00 189.60 ? 100 SER J CB  1 
ATOM   8443  O OG  . SER I 2 78  ? 1.220   0.344    -59.371 1.00 195.82 ? 100 SER J OG  1 
ATOM   8444  N N   . MET I 2 79  ? -1.729  0.016    -59.610 1.00 173.55 ? 101 MET J N   1 
ATOM   8445  C CA  . MET I 2 79  ? -2.992  0.068    -58.867 1.00 177.79 ? 101 MET J CA  1 
ATOM   8446  C C   . MET I 2 79  ? -3.806  1.324    -59.139 1.00 178.81 ? 101 MET J C   1 
ATOM   8447  O O   . MET I 2 79  ? -3.297  2.323    -59.623 1.00 175.08 ? 101 MET J O   1 
ATOM   8448  C CB  . MET I 2 79  ? -2.757  -0.070   -57.365 1.00 179.15 ? 101 MET J CB  1 
ATOM   8449  C CG  . MET I 2 79  ? -1.874  0.969    -56.712 1.00 178.90 ? 101 MET J CG  1 
ATOM   8450  S SD  . MET I 2 79  ? -2.010  0.723    -54.927 1.00 173.48 ? 101 MET J SD  1 
ATOM   8451  C CE  . MET I 2 79  ? -0.649  1.761    -54.408 1.00 175.79 ? 101 MET J CE  1 
ATOM   8452  N N   . CYS I 2 80  ? -5.095  1.227    -58.823 1.00 184.38 ? 102 CYS J N   1 
ATOM   8453  C CA  . CYS I 2 80  ? -6.077  2.265    -59.100 1.00 191.61 ? 102 CYS J CA  1 
ATOM   8454  C C   . CYS I 2 80  ? -6.352  3.099    -57.870 1.00 184.81 ? 102 CYS J C   1 
ATOM   8455  O O   . CYS I 2 80  ? -6.118  2.656    -56.747 1.00 182.24 ? 102 CYS J O   1 
ATOM   8456  C CB  . CYS I 2 80  ? -7.380  1.623    -59.584 1.00 201.68 ? 102 CYS J CB  1 
ATOM   8457  S SG  . CYS I 2 80  ? -7.202  0.751    -61.168 1.00 213.50 ? 102 CYS J SG  1 
ATOM   8458  N N   . GLU I 2 81  ? -6.847  4.314    -58.094 1.00 183.00 ? 103 GLU J N   1 
ATOM   8459  C CA  . GLU I 2 81  ? -7.223  5.224    -57.017 1.00 180.36 ? 103 GLU J CA  1 
ATOM   8460  C C   . GLU I 2 81  ? -8.473  5.973    -57.422 1.00 177.43 ? 103 GLU J C   1 
ATOM   8461  O O   . GLU I 2 81  ? -8.576  6.420    -58.561 1.00 175.23 ? 103 GLU J O   1 
ATOM   8462  C CB  . GLU I 2 81  ? -6.097  6.212    -56.751 1.00 184.00 ? 103 GLU J CB  1 
ATOM   8463  C CG  . GLU I 2 81  ? -6.373  7.182    -55.610 1.00 189.82 ? 103 GLU J CG  1 
ATOM   8464  C CD  . GLU I 2 81  ? -5.149  8.028    -55.255 1.00 195.38 ? 103 GLU J CD  1 
ATOM   8465  O OE1 . GLU I 2 81  ? -4.358  8.364    -56.164 1.00 200.93 ? 103 GLU J OE1 1 
ATOM   8466  O OE2 . GLU I 2 81  ? -4.977  8.386    -54.071 1.00 199.17 ? 103 GLU J OE2 1 
ATOM   8467  N N   . GLN I 2 82  ? -9.409  6.119    -56.484 1.00 174.74 ? 104 GLN J N   1 
ATOM   8468  C CA  . GLN I 2 82  ? -10.680 6.795    -56.759 1.00 178.15 ? 104 GLN J CA  1 
ATOM   8469  C C   . GLN I 2 82  ? -10.439 8.278    -57.048 1.00 182.41 ? 104 GLN J C   1 
ATOM   8470  O O   . GLN I 2 82  ? -9.576  8.892    -56.435 1.00 177.35 ? 104 GLN J O   1 
ATOM   8471  C CB  . GLN I 2 82  ? -11.673 6.605    -55.599 1.00 172.68 ? 104 GLN J CB  1 
ATOM   8472  N N   . ASP I 2 83  ? -11.200 8.836    -57.992 1.00 189.51 ? 105 ASP J N   1 
ATOM   8473  C CA  . ASP I 2 83  ? -10.983 10.211   -58.490 1.00 191.98 ? 105 ASP J CA  1 
ATOM   8474  C C   . ASP I 2 83  ? -11.059 11.239   -57.344 1.00 185.51 ? 105 ASP J C   1 
ATOM   8475  O O   . ASP I 2 83  ? -11.843 11.089   -56.403 1.00 179.88 ? 105 ASP J O   1 
ATOM   8476  C CB  . ASP I 2 83  ? -12.002 10.576   -59.582 1.00 203.33 ? 105 ASP J CB  1 
ATOM   8477  C CG  . ASP I 2 83  ? -11.895 9.693    -60.838 1.00 207.73 ? 105 ASP J CG  1 
ATOM   8478  O OD1 . ASP I 2 83  ? -10.812 9.131    -61.129 1.00 210.05 ? 105 ASP J OD1 1 
ATOM   8479  O OD2 . ASP I 2 83  ? -12.917 9.566    -61.551 1.00 208.29 ? 105 ASP J OD2 1 
ATOM   8480  N N   . CYS I 2 84  ? -10.228 12.274   -57.444 1.00 184.30 ? 106 CYS J N   1 
ATOM   8481  C CA  . CYS I 2 84  ? -9.884  13.107   -56.294 1.00 185.24 ? 106 CYS J CA  1 
ATOM   8482  C C   . CYS I 2 84  ? -11.030 13.987   -55.813 1.00 183.31 ? 106 CYS J C   1 
ATOM   8483  O O   . CYS I 2 84  ? -11.668 14.680   -56.596 1.00 181.79 ? 106 CYS J O   1 
ATOM   8484  C CB  . CYS I 2 84  ? -8.654  13.967   -56.607 1.00 190.33 ? 106 CYS J CB  1 
ATOM   8485  S SG  . CYS I 2 84  ? -7.187  13.051   -57.180 1.00 196.02 ? 106 CYS J SG  1 
ATOM   8486  N N   . LYS I 2 85  ? -11.267 13.960   -54.504 1.00 183.41 ? 107 LYS J N   1 
ATOM   8487  C CA  . LYS I 2 85  ? -12.394 14.650   -53.868 1.00 185.16 ? 107 LYS J CA  1 
ATOM   8488  C C   . LYS I 2 85  ? -12.176 16.167   -53.764 1.00 188.49 ? 107 LYS J C   1 
ATOM   8489  O O   . LYS I 2 85  ? -11.099 16.666   -54.097 1.00 190.49 ? 107 LYS J O   1 
ATOM   8490  C CB  . LYS I 2 85  ? -12.651 14.037   -52.473 1.00 175.95 ? 107 LYS J CB  1 
ATOM   8491  N N   . GLN I 2 86  ? -13.192 16.867   -53.258 1.00 190.65 ? 108 GLN J N   1 
ATOM   8492  C CA  . GLN I 2 86  ? -13.241 18.341   -53.167 1.00 187.83 ? 108 GLN J CA  1 
ATOM   8493  C C   . GLN I 2 86  ? -11.891 19.032   -52.960 1.00 183.38 ? 108 GLN J C   1 
ATOM   8494  O O   . GLN I 2 86  ? -11.425 19.730   -53.842 1.00 178.09 ? 108 GLN J O   1 
ATOM   8495  C CB  . GLN I 2 86  ? -14.215 18.798   -52.061 1.00 188.69 ? 108 GLN J CB  1 
ATOM   8496  N N   . GLY I 2 87  ? -11.248 18.809   -51.818 1.00 178.37 ? 109 GLY J N   1 
ATOM   8497  C CA  . GLY I 2 87  ? -10.025 19.548   -51.477 1.00 175.47 ? 109 GLY J CA  1 
ATOM   8498  C C   . GLY I 2 87  ? -8.695  19.013   -51.987 1.00 170.14 ? 109 GLY J C   1 
ATOM   8499  O O   . GLY I 2 87  ? -7.647  19.462   -51.529 1.00 171.38 ? 109 GLY J O   1 
ATOM   8500  N N   . GLN I 2 88  ? -8.716  18.101   -52.956 1.00 168.33 ? 110 GLN J N   1 
ATOM   8501  C CA  . GLN I 2 88  ? -7.525  17.359   -53.370 1.00 170.12 ? 110 GLN J CA  1 
ATOM   8502  C C   . GLN I 2 88  ? -7.158  17.617   -54.836 1.00 172.65 ? 110 GLN J C   1 
ATOM   8503  O O   . GLN I 2 88  ? -7.980  18.098   -55.624 1.00 178.36 ? 110 GLN J O   1 
ATOM   8504  C CB  . GLN I 2 88  ? -7.770  15.863   -53.162 1.00 172.72 ? 110 GLN J CB  1 
ATOM   8505  N N   . GLU I 2 89  ? -5.916  17.275   -55.173 1.00 170.95 ? 111 GLU J N   1 
ATOM   8506  C CA  . GLU I 2 89  ? -5.405  17.387   -56.538 1.00 175.56 ? 111 GLU J CA  1 
ATOM   8507  C C   . GLU I 2 89  ? -4.606  16.145   -56.876 1.00 171.77 ? 111 GLU J C   1 
ATOM   8508  O O   . GLU I 2 89  ? -3.888  15.618   -56.023 1.00 163.86 ? 111 GLU J O   1 
ATOM   8509  C CB  . GLU I 2 89  ? -4.518  18.627   -56.662 1.00 183.18 ? 111 GLU J CB  1 
ATOM   8510  C CG  . GLU I 2 89  ? -3.771  18.808   -57.973 1.00 192.28 ? 111 GLU J CG  1 
ATOM   8511  C CD  . GLU I 2 89  ? -2.762  19.957   -57.924 1.00 196.06 ? 111 GLU J CD  1 
ATOM   8512  O OE1 . GLU I 2 89  ? -1.853  19.923   -57.056 1.00 194.92 ? 111 GLU J OE1 1 
ATOM   8513  O OE2 . GLU I 2 89  ? -2.851  20.879   -58.763 1.00 196.86 ? 111 GLU J OE2 1 
ATOM   8514  N N   . LEU I 2 90  ? -4.696  15.708   -58.130 1.00 178.44 ? 112 LEU J N   1 
ATOM   8515  C CA  . LEU I 2 90  ? -4.027  14.496   -58.593 1.00 181.79 ? 112 LEU J CA  1 
ATOM   8516  C C   . LEU I 2 90  ? -2.553  14.757   -58.913 1.00 185.39 ? 112 LEU J C   1 
ATOM   8517  O O   . LEU I 2 90  ? -2.236  15.637   -59.714 1.00 192.27 ? 112 LEU J O   1 
ATOM   8518  C CB  . LEU I 2 90  ? -4.742  13.950   -59.830 1.00 185.79 ? 112 LEU J CB  1 
ATOM   8519  C CG  . LEU I 2 90  ? -4.476  12.478   -60.184 1.00 187.06 ? 112 LEU J CG  1 
ATOM   8520  C CD1 . LEU I 2 90  ? -5.679  11.886   -60.886 1.00 190.18 ? 112 LEU J CD1 1 
ATOM   8521  C CD2 . LEU I 2 90  ? -3.245  12.324   -61.066 1.00 187.07 ? 112 LEU J CD2 1 
ATOM   8522  N N   . THR I 2 91  ? -1.666  13.975   -58.295 1.00 184.93 ? 113 THR J N   1 
ATOM   8523  C CA  . THR I 2 91  ? -0.218  14.043   -58.534 1.00 186.82 ? 113 THR J CA  1 
ATOM   8524  C C   . THR I 2 91  ? 0.300   12.694   -59.051 1.00 189.84 ? 113 THR J C   1 
ATOM   8525  O O   . THR I 2 91  ? -0.476  11.735   -59.213 1.00 188.31 ? 113 THR J O   1 
ATOM   8526  C CB  . THR I 2 91  ? 0.557   14.447   -57.246 1.00 185.67 ? 113 THR J CB  1 
ATOM   8527  O OG1 . THR I 2 91  ? 0.678   13.334   -56.353 1.00 174.08 ? 113 THR J OG1 1 
ATOM   8528  C CG2 . THR I 2 91  ? -0.144  15.590   -56.515 1.00 188.61 ? 113 THR J CG2 1 
ATOM   8529  N N   . LYS I 2 92  ? 1.607   12.623   -59.309 1.00 195.49 ? 114 LYS J N   1 
ATOM   8530  C CA  . LYS I 2 92  ? 2.274   11.350   -59.609 1.00 193.08 ? 114 LYS J CA  1 
ATOM   8531  C C   . LYS I 2 92  ? 2.107   10.360   -58.447 1.00 189.53 ? 114 LYS J C   1 
ATOM   8532  O O   . LYS I 2 92  ? 1.823   9.181    -58.667 1.00 187.64 ? 114 LYS J O   1 
ATOM   8533  C CB  . LYS I 2 92  ? 3.761   11.574   -59.905 1.00 188.84 ? 114 LYS J CB  1 
ATOM   8534  N N   . LYS I 2 93  ? 2.249   10.863   -57.219 1.00 185.56 ? 115 LYS J N   1 
ATOM   8535  C CA  . LYS I 2 93  ? 2.096   10.055   -56.001 1.00 182.76 ? 115 LYS J CA  1 
ATOM   8536  C C   . LYS I 2 93  ? 0.648   9.861    -55.505 1.00 184.87 ? 115 LYS J C   1 
ATOM   8537  O O   . LYS I 2 93  ? 0.443   9.256    -54.450 1.00 184.79 ? 115 LYS J O   1 
ATOM   8538  C CB  . LYS I 2 93  ? 2.946   10.665   -54.874 1.00 181.76 ? 115 LYS J CB  1 
ATOM   8539  N N   . GLY I 2 94  ? -0.343  10.386   -56.235 1.00 192.10 ? 116 GLY J N   1 
ATOM   8540  C CA  . GLY I 2 94  ? -1.779  10.204   -55.906 1.00 193.26 ? 116 GLY J CA  1 
ATOM   8541  C C   . GLY I 2 94  ? -2.498  11.488   -55.547 1.00 192.51 ? 116 GLY J C   1 
ATOM   8542  O O   . GLY I 2 94  ? -1.935  12.578   -55.658 1.00 202.88 ? 116 GLY J O   1 
ATOM   8543  N N   . CYS I 2 95  ? -3.744  11.362   -55.098 1.00 187.44 ? 117 CYS J N   1 
ATOM   8544  C CA  . CYS I 2 95  ? -4.538  12.499   -54.643 1.00 189.88 ? 117 CYS J CA  1 
ATOM   8545  C C   . CYS I 2 95  ? -3.968  13.002   -53.323 1.00 188.23 ? 117 CYS J C   1 
ATOM   8546  O O   . CYS I 2 95  ? -4.253  12.441   -52.265 1.00 188.96 ? 117 CYS J O   1 
ATOM   8547  C CB  . CYS I 2 95  ? -6.024  12.165   -54.452 1.00 189.65 ? 117 CYS J CB  1 
ATOM   8548  S SG  . CYS I 2 95  ? -6.901  11.493   -55.880 1.00 194.39 ? 117 CYS J SG  1 
ATOM   8549  N N   . LYS I 2 96  ? -3.138  14.045   -53.400 1.00 190.45 ? 118 LYS J N   1 
ATOM   8550  C CA  . LYS I 2 96  ? -2.687  14.768   -52.221 1.00 186.13 ? 118 LYS J CA  1 
ATOM   8551  C C   . LYS I 2 96  ? -3.595  15.981   -52.038 1.00 181.90 ? 118 LYS J C   1 
ATOM   8552  O O   . LYS I 2 96  ? -4.149  16.513   -53.012 1.00 179.44 ? 118 LYS J O   1 
ATOM   8553  C CB  . LYS I 2 96  ? -1.230  15.202   -52.365 1.00 189.32 ? 118 LYS J CB  1 
ATOM   8554  N N   . ASP I 2 97  ? -3.740  16.419   -50.785 1.00 178.77 ? 119 ASP J N   1 
ATOM   8555  C CA  . ASP I 2 97  ? -4.560  17.583   -50.464 1.00 183.17 ? 119 ASP J CA  1 
ATOM   8556  C C   . ASP I 2 97  ? -3.926  18.861   -50.978 1.00 189.31 ? 119 ASP J C   1 
ATOM   8557  O O   . ASP I 2 97  ? -2.697  18.948   -51.059 1.00 190.31 ? 119 ASP J O   1 
ATOM   8558  C CB  . ASP I 2 97  ? -4.794  17.702   -48.963 1.00 182.71 ? 119 ASP J CB  1 
ATOM   8559  C CG  . ASP I 2 97  ? -5.619  16.522   -48.409 1.00 187.71 ? 119 ASP J CG  1 
ATOM   8560  O OD1 . ASP I 2 97  ? -6.658  16.148   -49.015 1.00 188.03 ? 119 ASP J OD1 1 
ATOM   8561  O OD2 . ASP I 2 97  ? -5.223  15.955   -47.366 1.00 193.55 ? 119 ASP J OD2 1 
ATOM   8562  N N   . CYS I 2 98  ? -4.759  19.852   -51.333 1.00 197.65 ? 120 CYS J N   1 
ATOM   8563  C CA  . CYS I 2 98  ? -4.255  21.149   -51.773 1.00 199.73 ? 120 CYS J CA  1 
ATOM   8564  C C   . CYS I 2 98  ? -3.381  21.763   -50.680 1.00 206.38 ? 120 CYS J C   1 
ATOM   8565  O O   . CYS I 2 98  ? -3.714  21.686   -49.483 1.00 204.78 ? 120 CYS J O   1 
ATOM   8566  C CB  . CYS I 2 98  ? -5.387  22.123   -52.129 1.00 197.92 ? 120 CYS J CB  1 
ATOM   8567  S SG  . CYS I 2 98  ? -6.130  22.000   -53.784 1.00 200.77 ? 120 CYS J SG  1 
ATOM   8568  N N   . SER I 2 99  ? -2.265  22.361   -51.106 1.00 215.53 ? 121 SER J N   1 
ATOM   8569  C CA  . SER I 2 99  ? -1.307  22.971   -50.192 1.00 221.89 ? 121 SER J CA  1 
ATOM   8570  C C   . SER I 2 99  ? -1.897  24.215   -49.535 1.00 227.25 ? 121 SER J C   1 
ATOM   8571  O O   . SER I 2 99  ? -3.026  24.617   -49.850 1.00 230.45 ? 121 SER J O   1 
ATOM   8572  C CB  . SER I 2 99  ? -0.028  23.350   -50.953 1.00 220.67 ? 121 SER J CB  1 
ATOM   8573  O OG  . SER I 2 99  ? 0.972   23.845   -50.083 1.00 222.93 ? 121 SER J OG  1 
ATOM   8574  N N   . PHE I 2 100 ? -1.143  24.822   -48.619 1.00 228.80 ? 122 PHE J N   1 
ATOM   8575  C CA  . PHE I 2 100 ? -1.595  26.054   -47.986 1.00 225.41 ? 122 PHE J CA  1 
ATOM   8576  C C   . PHE I 2 100 ? -1.656  27.180   -49.025 1.00 220.46 ? 122 PHE J C   1 
ATOM   8577  O O   . PHE I 2 100 ? -0.786  27.274   -49.901 1.00 209.16 ? 122 PHE J O   1 
ATOM   8578  C CB  . PHE I 2 100 ? -0.702  26.457   -46.817 1.00 226.19 ? 122 PHE J CB  1 
ATOM   8579  C CG  . PHE I 2 100 ? -1.309  27.523   -45.956 1.00 228.79 ? 122 PHE J CG  1 
ATOM   8580  C CD1 . PHE I 2 100 ? -2.155  27.185   -44.901 1.00 226.38 ? 122 PHE J CD1 1 
ATOM   8581  C CD2 . PHE I 2 100 ? -1.071  28.870   -46.221 1.00 230.71 ? 122 PHE J CD2 1 
ATOM   8582  C CE1 . PHE I 2 100 ? -2.729  28.169   -44.109 1.00 226.62 ? 122 PHE J CE1 1 
ATOM   8583  C CE2 . PHE I 2 100 ? -1.644  29.860   -45.433 1.00 231.44 ? 122 PHE J CE2 1 
ATOM   8584  C CZ  . PHE I 2 100 ? -2.475  29.508   -44.376 1.00 229.76 ? 122 PHE J CZ  1 
ATOM   8585  N N   . GLY I 2 101 ? -2.707  27.997   -48.930 1.00 213.73 ? 123 GLY J N   1 
ATOM   8586  C CA  . GLY I 2 101 ? -2.957  29.071   -49.884 1.00 210.23 ? 123 GLY J CA  1 
ATOM   8587  C C   . GLY I 2 101 ? -3.664  28.677   -51.173 1.00 202.22 ? 123 GLY J C   1 
ATOM   8588  O O   . GLY I 2 101 ? -3.946  29.544   -51.998 1.00 200.76 ? 123 GLY J O   1 
ATOM   8589  N N   . THR I 2 102 ? -3.957  27.391   -51.351 1.00 191.29 ? 124 THR J N   1 
ATOM   8590  C CA  . THR I 2 102 ? -4.605  26.877   -52.566 1.00 181.73 ? 124 THR J CA  1 
ATOM   8591  C C   . THR I 2 102 ? -5.893  26.134   -52.244 1.00 175.69 ? 124 THR J C   1 
ATOM   8592  O O   . THR I 2 102 ? -6.100  25.702   -51.107 1.00 179.82 ? 124 THR J O   1 
ATOM   8593  C CB  . THR I 2 102 ? -3.668  25.941   -53.355 1.00 175.47 ? 124 THR J CB  1 
ATOM   8594  O OG1 . THR I 2 102 ? -2.896  25.149   -52.444 1.00 174.68 ? 124 THR J OG1 1 
ATOM   8595  C CG2 . THR I 2 102 ? -2.740  26.749   -54.229 1.00 175.06 ? 124 THR J CG2 1 
ATOM   8596  N N   . PHE I 2 103 ? -6.752  25.992   -53.252 1.00 166.59 ? 125 PHE J N   1 
ATOM   8597  C CA  . PHE I 2 103 ? -8.057  25.352   -53.083 1.00 158.78 ? 125 PHE J CA  1 
ATOM   8598  C C   . PHE I 2 103 ? -8.551  24.670   -54.345 1.00 160.50 ? 125 PHE J C   1 
ATOM   8599  O O   . PHE I 2 103 ? -8.109  24.978   -55.433 1.00 162.28 ? 125 PHE J O   1 
ATOM   8600  C CB  . PHE I 2 103 ? -9.087  26.391   -52.636 1.00 156.26 ? 125 PHE J CB  1 
ATOM   8601  C CG  . PHE I 2 103 ? -9.712  27.172   -53.766 1.00 153.50 ? 125 PHE J CG  1 
ATOM   8602  C CD1 . PHE I 2 103 ? -10.969 26.831   -54.258 1.00 153.12 ? 125 PHE J CD1 1 
ATOM   8603  C CD2 . PHE I 2 103 ? -9.056  28.254   -54.316 1.00 152.23 ? 125 PHE J CD2 1 
ATOM   8604  C CE1 . PHE I 2 103 ? -11.548 27.554   -55.282 1.00 153.22 ? 125 PHE J CE1 1 
ATOM   8605  C CE2 . PHE I 2 103 ? -9.630  28.983   -55.346 1.00 152.97 ? 125 PHE J CE2 1 
ATOM   8606  C CZ  . PHE I 2 103 ? -10.873 28.637   -55.830 1.00 154.36 ? 125 PHE J CZ  1 
ATOM   8607  N N   . ASN I 2 104 ? -9.504  23.765   -54.179 1.00 167.31 ? 126 ASN J N   1 
ATOM   8608  C CA  . ASN I 2 104 ? -10.190 23.139   -55.299 1.00 172.70 ? 126 ASN J CA  1 
ATOM   8609  C C   . ASN I 2 104 ? -11.688 23.040   -54.984 1.00 173.67 ? 126 ASN J C   1 
ATOM   8610  O O   . ASN I 2 104 ? -12.080 22.452   -53.983 1.00 165.41 ? 126 ASN J O   1 
ATOM   8611  C CB  . ASN I 2 104 ? -9.571  21.775   -55.584 1.00 174.54 ? 126 ASN J CB  1 
ATOM   8612  C CG  . ASN I 2 104 ? -10.145 21.108   -56.811 1.00 180.56 ? 126 ASN J CG  1 
ATOM   8613  O OD1 . ASN I 2 104 ? -10.952 21.689   -57.542 1.00 191.18 ? 126 ASN J OD1 1 
ATOM   8614  N ND2 . ASN I 2 104 ? -9.720  19.867   -57.053 1.00 184.62 ? 126 ASN J ND2 1 
ATOM   8615  N N   . ASP I 2 105 ? -12.505 23.644   -55.847 1.00 177.98 ? 127 ASP J N   1 
ATOM   8616  C CA  . ASP I 2 105 ? -13.955 23.666   -55.693 1.00 181.98 ? 127 ASP J CA  1 
ATOM   8617  C C   . ASP I 2 105 ? -14.540 22.316   -56.113 1.00 182.93 ? 127 ASP J C   1 
ATOM   8618  O O   . ASP I 2 105 ? -15.188 21.646   -55.315 1.00 177.21 ? 127 ASP J O   1 
ATOM   8619  C CB  . ASP I 2 105 ? -14.540 24.811   -56.539 1.00 188.61 ? 127 ASP J CB  1 
ATOM   8620  C CG  . ASP I 2 105 ? -16.064 24.932   -56.435 1.00 199.24 ? 127 ASP J CG  1 
ATOM   8621  O OD1 . ASP I 2 105 ? -16.620 24.796   -55.324 1.00 209.50 ? 127 ASP J OD1 1 
ATOM   8622  O OD2 . ASP I 2 105 ? -16.711 25.187   -57.477 1.00 203.51 ? 127 ASP J OD2 1 
ATOM   8623  N N   . GLN I 2 106 ? -14.276 21.911   -57.354 1.00 188.35 ? 128 GLN J N   1 
ATOM   8624  C CA  . GLN I 2 106 ? -14.945 20.757   -57.964 1.00 195.44 ? 128 GLN J CA  1 
ATOM   8625  C C   . GLN I 2 106 ? -14.101 19.481   -57.923 1.00 192.19 ? 128 GLN J C   1 
ATOM   8626  O O   . GLN I 2 106 ? -12.892 19.535   -57.701 1.00 192.28 ? 128 GLN J O   1 
ATOM   8627  C CB  . GLN I 2 106 ? -15.303 21.097   -59.420 1.00 205.37 ? 128 GLN J CB  1 
ATOM   8628  C CG  . GLN I 2 106 ? -16.513 20.353   -59.990 1.00 212.98 ? 128 GLN J CG  1 
ATOM   8629  C CD  . GLN I 2 106 ? -16.330 19.933   -61.450 1.00 218.00 ? 128 GLN J CD  1 
ATOM   8630  O OE1 . GLN I 2 106 ? -15.948 20.736   -62.304 1.00 220.53 ? 128 GLN J OE1 1 
ATOM   8631  N NE2 . GLN I 2 106 ? -16.575 18.654   -61.729 1.00 219.27 ? 128 GLN J NE2 1 
ATOM   8632  N N   . LYS I 2 107 ? -14.764 18.339   -58.129 1.00 191.43 ? 129 LYS J N   1 
ATOM   8633  C CA  . LYS I 2 107 ? -14.090 17.035   -58.306 1.00 186.88 ? 129 LYS J CA  1 
ATOM   8634  C C   . LYS I 2 107 ? -13.286 17.013   -59.609 1.00 188.43 ? 129 LYS J C   1 
ATOM   8635  O O   . LYS I 2 107 ? -13.596 17.746   -60.555 1.00 195.45 ? 129 LYS J O   1 
ATOM   8636  C CB  . LYS I 2 107 ? -15.110 15.888   -58.301 1.00 182.37 ? 129 LYS J CB  1 
ATOM   8637  N N   . ARG I 2 108 ? -12.268 16.161   -59.643 1.00 183.62 ? 130 ARG J N   1 
ATOM   8638  C CA  . ARG I 2 108 ? -11.300 16.072   -60.750 1.00 182.28 ? 130 ARG J CA  1 
ATOM   8639  C C   . ARG I 2 108 ? -10.842 17.462   -61.239 1.00 181.10 ? 130 ARG J C   1 
ATOM   8640  O O   . ARG I 2 108 ? -10.906 17.770   -62.425 1.00 179.35 ? 130 ARG J O   1 
ATOM   8641  C CB  . ARG I 2 108 ? -11.852 15.216   -61.907 1.00 181.81 ? 130 ARG J CB  1 
ATOM   8642  N N   . GLY I 2 109 ? -10.388 18.286   -60.294 1.00 180.01 ? 131 GLY J N   1 
ATOM   8643  C CA  . GLY I 2 109 ? -9.938  19.652   -60.561 1.00 183.39 ? 131 GLY J CA  1 
ATOM   8644  C C   . GLY I 2 109 ? -8.471  19.893   -60.231 1.00 187.55 ? 131 GLY J C   1 
ATOM   8645  O O   . GLY I 2 109 ? -7.726  18.952   -59.935 1.00 194.40 ? 131 GLY J O   1 
ATOM   8646  N N   . ILE I 2 110 ? -8.070  21.165   -60.276 1.00 191.24 ? 132 ILE J N   1 
ATOM   8647  C CA  . ILE I 2 110 ? -6.689  21.601   -60.052 1.00 195.73 ? 132 ILE J CA  1 
ATOM   8648  C C   . ILE I 2 110 ? -6.650  22.594   -58.891 1.00 196.01 ? 132 ILE J C   1 
ATOM   8649  O O   . ILE I 2 110 ? -7.607  23.346   -58.696 1.00 196.43 ? 132 ILE J O   1 
ATOM   8650  C CB  . ILE I 2 110 ? -6.109  22.246   -61.335 1.00 205.26 ? 132 ILE J CB  1 
ATOM   8651  C CG1 . ILE I 2 110 ? -5.953  21.192   -62.441 1.00 211.10 ? 132 ILE J CG1 1 
ATOM   8652  C CG2 . ILE I 2 110 ? -4.766  22.925   -61.071 1.00 206.45 ? 132 ILE J CG2 1 
ATOM   8653  C CD1 . ILE I 2 110 ? -5.882  21.773   -63.842 1.00 213.45 ? 132 ILE J CD1 1 
ATOM   8654  N N   . CYS I 2 111 ? -5.547  22.590   -58.129 1.00 197.09 ? 133 CYS J N   1 
ATOM   8655  C CA  . CYS I 2 111 ? -5.364  23.533   -57.014 1.00 198.75 ? 133 CYS J CA  1 
ATOM   8656  C C   . CYS I 2 111 ? -5.036  24.952   -57.486 1.00 199.23 ? 133 CYS J C   1 
ATOM   8657  O O   . CYS I 2 111 ? -3.874  25.293   -57.683 1.00 207.62 ? 133 CYS J O   1 
ATOM   8658  C CB  . CYS I 2 111 ? -4.258  23.062   -56.058 1.00 197.51 ? 133 CYS J CB  1 
ATOM   8659  S SG  . CYS I 2 111 ? -4.599  21.578   -55.070 1.00 207.87 ? 133 CYS J SG  1 
ATOM   8660  N N   . ARG I 2 112 ? -6.071  25.772   -57.659 1.00 192.80 ? 134 ARG J N   1 
ATOM   8661  C CA  . ARG I 2 112 ? -5.921  27.214   -57.875 1.00 187.14 ? 134 ARG J CA  1 
ATOM   8662  C C   . ARG I 2 112 ? -5.581  27.884   -56.534 1.00 186.12 ? 134 ARG J C   1 
ATOM   8663  O O   . ARG I 2 112 ? -5.865  27.313   -55.482 1.00 192.64 ? 134 ARG J O   1 
ATOM   8664  C CB  . ARG I 2 112 ? -7.219  27.801   -58.426 1.00 189.47 ? 134 ARG J CB  1 
ATOM   8665  C CG  . ARG I 2 112 ? -7.656  27.215   -59.759 1.00 194.99 ? 134 ARG J CG  1 
ATOM   8666  C CD  . ARG I 2 112 ? -9.042  27.706   -60.143 1.00 200.54 ? 134 ARG J CD  1 
ATOM   8667  N NE  . ARG I 2 112 ? -10.102 27.091   -59.329 1.00 201.85 ? 134 ARG J NE  1 
ATOM   8668  C CZ  . ARG I 2 112 ? -11.398 27.389   -59.410 1.00 207.53 ? 134 ARG J CZ  1 
ATOM   8669  N NH1 . ARG I 2 112 ? -11.841 28.308   -60.271 1.00 211.88 ? 134 ARG J NH1 1 
ATOM   8670  N NH2 . ARG I 2 112 ? -12.269 26.756   -58.628 1.00 210.10 ? 134 ARG J NH2 1 
ATOM   8671  N N   . PRO I 2 113 ? -4.974  29.088   -56.555 1.00 186.12 ? 135 PRO J N   1 
ATOM   8672  C CA  . PRO I 2 113 ? -4.686  29.816   -55.308 1.00 188.25 ? 135 PRO J CA  1 
ATOM   8673  C C   . PRO I 2 113 ? -5.852  30.703   -54.873 1.00 189.20 ? 135 PRO J C   1 
ATOM   8674  O O   . PRO I 2 113 ? -6.657  31.118   -55.719 1.00 192.20 ? 135 PRO J O   1 
ATOM   8675  C CB  . PRO I 2 113 ? -3.475  30.660   -55.685 1.00 190.45 ? 135 PRO J CB  1 
ATOM   8676  C CG  . PRO I 2 113 ? -3.713  30.987   -57.130 1.00 191.78 ? 135 PRO J CG  1 
ATOM   8677  C CD  . PRO I 2 113 ? -4.525  29.858   -57.729 1.00 189.02 ? 135 PRO J CD  1 
ATOM   8678  N N   . TRP I 2 114 ? -5.942  31.007   -53.577 1.00 187.56 ? 136 TRP J N   1 
ATOM   8679  C CA  . TRP I 2 114 ? -7.039  31.834   -53.044 1.00 187.62 ? 136 TRP J CA  1 
ATOM   8680  C C   . TRP I 2 114 ? -6.983  33.219   -53.646 1.00 179.38 ? 136 TRP J C   1 
ATOM   8681  O O   . TRP I 2 114 ? -5.914  33.792   -53.765 1.00 183.04 ? 136 TRP J O   1 
ATOM   8682  C CB  . TRP I 2 114 ? -6.970  32.002   -51.517 1.00 196.12 ? 136 TRP J CB  1 
ATOM   8683  C CG  . TRP I 2 114 ? -7.002  30.752   -50.711 1.00 199.95 ? 136 TRP J CG  1 
ATOM   8684  C CD1 . TRP I 2 114 ? -7.654  29.598   -51.004 1.00 202.15 ? 136 TRP J CD1 1 
ATOM   8685  C CD2 . TRP I 2 114 ? -6.371  30.551   -49.444 1.00 201.93 ? 136 TRP J CD2 1 
ATOM   8686  N NE1 . TRP I 2 114 ? -7.449  28.676   -50.007 1.00 203.57 ? 136 TRP J NE1 1 
ATOM   8687  C CE2 . TRP I 2 114 ? -6.666  29.236   -49.035 1.00 202.81 ? 136 TRP J CE2 1 
ATOM   8688  C CE3 . TRP I 2 114 ? -5.580  31.358   -48.612 1.00 203.31 ? 136 TRP J CE3 1 
ATOM   8689  C CZ2 . TRP I 2 114 ? -6.197  28.700   -47.833 1.00 203.47 ? 136 TRP J CZ2 1 
ATOM   8690  C CZ3 . TRP I 2 114 ? -5.113  30.832   -47.417 1.00 204.34 ? 136 TRP J CZ3 1 
ATOM   8691  C CH2 . TRP I 2 114 ? -5.420  29.510   -47.039 1.00 204.35 ? 136 TRP J CH2 1 
ATOM   8692  N N   . THR I 2 115 ? -8.136  33.778   -53.998 1.00 171.17 ? 137 THR J N   1 
ATOM   8693  C CA  . THR I 2 115 ? -8.204  35.185   -54.415 1.00 173.27 ? 137 THR J CA  1 
ATOM   8694  C C   . THR I 2 115 ? -7.730  36.063   -53.261 1.00 171.66 ? 137 THR J C   1 
ATOM   8695  O O   . THR I 2 115 ? -8.299  35.941   -52.175 1.00 179.84 ? 137 THR J O   1 
ATOM   8696  C CB  . THR I 2 115 ? -9.619  35.609   -54.828 1.00 172.53 ? 137 THR J CB  1 
ATOM   8697  O OG1 . THR I 2 115 ? -10.560 35.104   -53.915 1.00 168.40 ? 137 THR J OG1 1 
ATOM   8698  C CG2 . THR I 2 115 ? -9.998  35.085   -56.184 1.00 174.71 ? 137 THR J CG2 1 
ATOM   8699  N N   . ASN I 2 116 ? -6.669  36.830   -53.473 1.00 169.01 ? 138 ASN J N   1 
ATOM   8700  C CA  . ASN I 2 116 ? -6.008  37.530   -52.364 1.00 169.85 ? 138 ASN J CA  1 
ATOM   8701  C C   . ASN I 2 116 ? -6.652  38.883   -52.182 1.00 176.23 ? 138 ASN J C   1 
ATOM   8702  O O   . ASN I 2 116 ? -6.403  39.784   -52.968 1.00 175.79 ? 138 ASN J O   1 
ATOM   8703  C CB  . ASN I 2 116 ? -4.489  37.634   -52.568 1.00 170.23 ? 138 ASN J CB  1 
ATOM   8704  C CG  . ASN I 2 116 ? -3.769  38.185   -51.360 1.00 172.37 ? 138 ASN J CG  1 
ATOM   8705  O OD1 . ASN I 2 116 ? -4.355  38.411   -50.298 1.00 176.62 ? 138 ASN J OD1 1 
ATOM   8706  N ND2 . ASN I 2 116 ? -2.464  38.423   -51.518 1.00 174.29 ? 138 ASN J ND2 1 
ATOM   8707  N N   . CYS I 2 117 ? -7.466  39.040   -51.143 1.00 184.09 ? 139 CYS J N   1 
ATOM   8708  C CA  . CYS I 2 117 ? -8.200  40.285   -50.911 1.00 188.23 ? 139 CYS J CA  1 
ATOM   8709  C C   . CYS I 2 117 ? -7.271  41.370   -50.357 1.00 190.74 ? 139 CYS J C   1 
ATOM   8710  O O   . CYS I 2 117 ? -7.499  42.552   -50.620 1.00 198.15 ? 139 CYS J O   1 
ATOM   8711  C CB  . CYS I 2 117 ? -9.417  40.066   -50.000 1.00 191.11 ? 139 CYS J CB  1 
ATOM   8712  S SG  . CYS I 2 117 ? -10.130 38.380   -49.909 1.00 190.36 ? 139 CYS J SG  1 
ATOM   8713  N N   . SER I 2 118 ? -6.231  40.976   -49.613 1.00 184.42 ? 140 SER J N   1 
ATOM   8714  C CA  . SER I 2 118 ? -5.188  41.911   -49.146 1.00 180.89 ? 140 SER J CA  1 
ATOM   8715  C C   . SER I 2 118 ? -4.535  42.665   -50.307 1.00 183.44 ? 140 SER J C   1 
ATOM   8716  O O   . SER I 2 118 ? -4.424  43.892   -50.264 1.00 188.73 ? 140 SER J O   1 
ATOM   8717  C CB  . SER I 2 118 ? -4.114  41.172   -48.343 1.00 174.67 ? 140 SER J CB  1 
ATOM   8718  N N   . LEU I 2 119 ? -4.133  41.930   -51.349 1.00 184.52 ? 141 LEU J N   1 
ATOM   8719  C CA  . LEU I 2 119 ? -3.578  42.516   -52.586 1.00 187.44 ? 141 LEU J CA  1 
ATOM   8720  C C   . LEU I 2 119 ? -4.607  43.369   -53.353 1.00 191.74 ? 141 LEU J C   1 
ATOM   8721  O O   . LEU I 2 119 ? -4.233  44.332   -54.041 1.00 196.56 ? 141 LEU J O   1 
ATOM   8722  C CB  . LEU I 2 119 ? -3.004  41.431   -53.511 1.00 182.51 ? 141 LEU J CB  1 
ATOM   8723  N N   . ASP I 2 120 ? -5.895  43.022   -53.230 1.00 187.46 ? 142 ASP J N   1 
ATOM   8724  C CA  . ASP I 2 120 ? -6.993  43.770   -53.855 1.00 187.38 ? 142 ASP J CA  1 
ATOM   8725  C C   . ASP I 2 120 ? -7.512  44.946   -53.010 1.00 188.58 ? 142 ASP J C   1 
ATOM   8726  O O   . ASP I 2 120 ? -8.376  45.703   -53.440 1.00 192.45 ? 142 ASP J O   1 
ATOM   8727  C CB  . ASP I 2 120 ? -8.149  42.819   -54.173 1.00 184.65 ? 142 ASP J CB  1 
ATOM   8728  N N   . VAL I 2 124 ? -11.976 41.641   -46.197 1.00 30.00  ? 146 VAL J N   1 
ATOM   8729  C CA  . VAL I 2 124 ? -11.921 40.189   -46.195 1.00 30.00  ? 146 VAL J CA  1 
ATOM   8730  C C   . VAL I 2 124 ? -13.135 39.613   -45.491 1.00 30.00  ? 146 VAL J C   1 
ATOM   8731  O O   . VAL I 2 124 ? -13.139 39.474   -44.278 1.00 30.00  ? 146 VAL J O   1 
ATOM   8732  C CB  . VAL I 2 124 ? -10.643 39.668   -45.512 1.00 30.00  ? 146 VAL J CB  1 
ATOM   8733  N N   . LEU I 2 125 ? -14.165 39.274   -46.252 1.00 182.61 ? 147 LEU J N   1 
ATOM   8734  C CA  . LEU I 2 125 ? -15.387 38.728   -45.675 1.00 176.53 ? 147 LEU J CA  1 
ATOM   8735  C C   . LEU I 2 125 ? -15.223 37.391   -44.967 1.00 173.19 ? 147 LEU J C   1 
ATOM   8736  O O   . LEU I 2 125 ? -15.832 37.167   -43.941 1.00 177.34 ? 147 LEU J O   1 
ATOM   8737  C CB  . LEU I 2 125 ? -16.475 38.622   -46.735 1.00 174.24 ? 147 LEU J CB  1 
ATOM   8738  N N   . VAL I 2 126 ? -14.427 36.492   -45.521 1.00 170.16 ? 148 VAL J N   1 
ATOM   8739  C CA  . VAL I 2 126 ? -14.227 35.193   -44.894 1.00 173.33 ? 148 VAL J CA  1 
ATOM   8740  C C   . VAL I 2 126 ? -12.893 34.637   -45.340 1.00 174.86 ? 148 VAL J C   1 
ATOM   8741  O O   . VAL I 2 126 ? -12.375 35.060   -46.360 1.00 176.02 ? 148 VAL J O   1 
ATOM   8742  C CB  . VAL I 2 126 ? -15.339 34.213   -45.272 1.00 176.40 ? 148 VAL J CB  1 
ATOM   8743  N N   . ASN I 2 127 ? -12.334 33.680   -44.608 1.00 174.44 ? 149 ASN J N   1 
ATOM   8744  C CA  . ASN I 2 127 ? -11.022 33.179   -44.995 1.00 173.55 ? 149 ASN J CA  1 
ATOM   8745  C C   . ASN I 2 127 ? -11.144 32.031   -45.971 1.00 168.64 ? 149 ASN J C   1 
ATOM   8746  O O   . ASN I 2 127 ? -12.234 31.545   -46.232 1.00 164.02 ? 149 ASN J O   1 
ATOM   8747  C CB  . ASN I 2 127 ? -10.199 32.761   -43.781 1.00 177.20 ? 149 ASN J CB  1 
ATOM   8748  C CG  . ASN I 2 127 ? -8.792  32.345   -44.154 1.00 177.84 ? 149 ASN J CG  1 
ATOM   8749  O OD1 . ASN I 2 127 ? -8.577  31.721   -45.191 1.00 177.00 ? 149 ASN J OD1 1 
ATOM   8750  N ND2 . ASN I 2 127 ? -7.827  32.688   -43.311 1.00 178.60 ? 149 ASN J ND2 1 
ATOM   8751  N N   . GLY I 2 128 ? -10.014 31.560   -46.480 1.00 168.97 ? 150 GLY J N   1 
ATOM   8752  C CA  . GLY I 2 128 ? -10.081 30.495   -47.497 1.00 167.16 ? 150 GLY J CA  1 
ATOM   8753  C C   . GLY I 2 128 ? -9.909  29.149   -46.830 1.00 164.12 ? 150 GLY J C   1 
ATOM   8754  O O   . GLY I 2 128 ? -9.874  29.053   -45.601 1.00 166.51 ? 150 GLY J O   1 
ATOM   8755  N N   . THR I 2 129 ? -9.795  28.102   -47.636 1.00 160.80 ? 151 THR J N   1 
ATOM   8756  C CA  . THR I 2 129 ? -9.635  26.731   -47.138 1.00 158.09 ? 151 THR J CA  1 
ATOM   8757  C C   . THR I 2 129 ? -9.245  25.782   -48.273 1.00 154.59 ? 151 THR J C   1 
ATOM   8758  O O   . THR I 2 129 ? -9.236  26.173   -49.435 1.00 155.09 ? 151 THR J O   1 
ATOM   8759  C CB  . THR I 2 129 ? -10.923 26.222   -46.407 1.00 157.67 ? 151 THR J CB  1 
ATOM   8760  O OG1 . THR I 2 129 ? -10.778 24.841   -46.075 1.00 158.50 ? 151 THR J OG1 1 
ATOM   8761  C CG2 . THR I 2 129 ? -12.170 26.400   -47.232 1.00 157.80 ? 151 THR J CG2 1 
ATOM   8762  N N   . LYS I 2 130 ? -8.928  24.536   -47.934 1.00 155.39 ? 152 LYS J N   1 
ATOM   8763  C CA  . LYS I 2 130 ? -8.541  23.526   -48.931 1.00 154.91 ? 152 LYS J CA  1 
ATOM   8764  C C   . LYS I 2 130 ? -9.624  23.234   -49.979 1.00 159.97 ? 152 LYS J C   1 
ATOM   8765  O O   . LYS I 2 130 ? -9.279  22.778   -51.060 1.00 157.82 ? 152 LYS J O   1 
ATOM   8766  C CB  . LYS I 2 130 ? -8.123  22.215   -48.248 1.00 152.43 ? 152 LYS J CB  1 
ATOM   8767  N N   . GLU I 2 131 ? -10.905 23.482   -49.668 1.00 162.52 ? 153 GLU J N   1 
ATOM   8768  C CA  . GLU I 2 131 ? -12.007 23.221   -50.613 1.00 163.26 ? 153 GLU J CA  1 
ATOM   8769  C C   . GLU I 2 131 ? -12.859 24.445   -50.965 1.00 159.53 ? 153 GLU J C   1 
ATOM   8770  O O   . GLU I 2 131 ? -13.949 24.279   -51.504 1.00 170.59 ? 153 GLU J O   1 
ATOM   8771  C CB  . GLU I 2 131 ? -12.949 22.097   -50.111 1.00 170.44 ? 153 GLU J CB  1 
ATOM   8772  C CG  . GLU I 2 131 ? -12.394 21.093   -49.102 1.00 177.63 ? 153 GLU J CG  1 
ATOM   8773  C CD  . GLU I 2 131 ? -12.978 21.250   -47.695 1.00 189.10 ? 153 GLU J CD  1 
ATOM   8774  O OE1 . GLU I 2 131 ? -13.337 22.379   -47.288 1.00 200.57 ? 153 GLU J OE1 1 
ATOM   8775  O OE2 . GLU I 2 131 ? -13.084 20.230   -46.982 1.00 194.94 ? 153 GLU J OE2 1 
ATOM   8776  N N   . ARG I 2 132 ? -12.386 25.654   -50.688 1.00 150.89 ? 154 ARG J N   1 
ATOM   8777  C CA  . ARG I 2 132 ? -13.188 26.853   -50.959 1.00 151.44 ? 154 ARG J CA  1 
ATOM   8778  C C   . ARG I 2 132 ? -12.344 28.113   -51.037 1.00 149.53 ? 154 ARG J C   1 
ATOM   8779  O O   . ARG I 2 132 ? -11.419 28.299   -50.256 1.00 147.87 ? 154 ARG J O   1 
ATOM   8780  C CB  . ARG I 2 132 ? -14.273 27.025   -49.891 1.00 153.96 ? 154 ARG J CB  1 
ATOM   8781  N N   . ASP I 2 133 ? -12.676 28.986   -51.981 1.00 153.06 ? 155 ASP J N   1 
ATOM   8782  C CA  . ASP I 2 133 ? -11.998 30.273   -52.126 1.00 154.82 ? 155 ASP J CA  1 
ATOM   8783  C C   . ASP I 2 133 ? -12.445 31.193   -50.980 1.00 156.99 ? 155 ASP J C   1 
ATOM   8784  O O   . ASP I 2 133 ? -13.472 30.956   -50.323 1.00 154.82 ? 155 ASP J O   1 
ATOM   8785  C CB  . ASP I 2 133 ? -12.348 30.919   -53.485 1.00 157.40 ? 155 ASP J CB  1 
ATOM   8786  C CG  . ASP I 2 133 ? -11.317 31.973   -53.957 1.00 158.15 ? 155 ASP J CG  1 
ATOM   8787  O OD1 . ASP I 2 133 ? -10.280 32.188   -53.308 1.00 154.72 ? 155 ASP J OD1 1 
ATOM   8788  O OD2 . ASP I 2 133 ? -11.557 32.600   -55.010 1.00 160.75 ? 155 ASP J OD2 1 
ATOM   8789  N N   . VAL I 2 134 ? -11.658 32.231   -50.729 1.00 159.58 ? 156 VAL J N   1 
ATOM   8790  C CA  . VAL I 2 134 ? -12.082 33.279   -49.823 1.00 161.92 ? 156 VAL J CA  1 
ATOM   8791  C C   . VAL I 2 134 ? -13.282 34.027   -50.406 1.00 165.47 ? 156 VAL J C   1 
ATOM   8792  O O   . VAL I 2 134 ? -13.346 34.257   -51.613 1.00 167.79 ? 156 VAL J O   1 
ATOM   8793  C CB  . VAL I 2 134 ? -10.939 34.268   -49.542 1.00 165.79 ? 156 VAL J CB  1 
ATOM   8794  N N   . VAL I 2 135 ? -14.225 34.408   -49.552 1.00 166.52 ? 157 VAL J N   1 
ATOM   8795  C CA  . VAL I 2 135 ? -15.199 35.475   -49.874 1.00 172.12 ? 157 VAL J CA  1 
ATOM   8796  C C   . VAL I 2 135 ? -14.585 36.816   -49.470 1.00 172.67 ? 157 VAL J C   1 
ATOM   8797  O O   . VAL I 2 135 ? -13.997 36.891   -48.401 1.00 174.43 ? 157 VAL J O   1 
ATOM   8798  C CB  . VAL I 2 135 ? -16.540 35.259   -49.155 1.00 173.27 ? 157 VAL J CB  1 
ATOM   8799  N N   . CYS I 2 136 ? -14.698 37.837   -50.320 1.00 173.90 ? 158 CYS J N   1 
ATOM   8800  C CA  . CYS I 2 136 ? -14.245 39.202   -49.984 1.00 176.67 ? 158 CYS J CA  1 
ATOM   8801  C C   . CYS I 2 136 ? -15.294 40.248   -50.331 1.00 174.23 ? 158 CYS J C   1 
ATOM   8802  O O   . CYS I 2 136 ? -15.481 41.225   -49.599 1.00 165.48 ? 158 CYS J O   1 
ATOM   8803  C CB  . CYS I 2 136 ? -12.930 39.581   -50.669 1.00 183.68 ? 158 CYS J CB  1 
ATOM   8804  S SG  . CYS I 2 136 ? -11.790 38.268   -51.140 1.00 194.16 ? 158 CYS J SG  1 
ATOM   8805  N N   . GLN J 2 3   ? -59.645 -58.813  -25.153 1.00 295.08 ? 25  GLN K N   1 
ATOM   8806  C CA  . GLN J 2 3   ? -59.088 -60.056  -24.543 1.00 293.96 ? 25  GLN K CA  1 
ATOM   8807  C C   . GLN J 2 3   ? -57.571 -59.961  -24.332 1.00 296.32 ? 25  GLN K C   1 
ATOM   8808  O O   . GLN J 2 3   ? -57.074 -60.308  -23.257 1.00 296.54 ? 25  GLN K O   1 
ATOM   8809  C CB  . GLN J 2 3   ? -59.439 -61.270  -25.403 1.00 290.22 ? 25  GLN K CB  1 
ATOM   8810  N N   . ASP J 2 4   ? -56.847 -59.502  -25.357 1.00 299.78 ? 26  ASP K N   1 
ATOM   8811  C CA  . ASP J 2 4   ? -55.406 -59.207  -25.240 1.00 298.16 ? 26  ASP K CA  1 
ATOM   8812  C C   . ASP J 2 4   ? -54.976 -58.135  -26.274 1.00 297.98 ? 26  ASP K C   1 
ATOM   8813  O O   . ASP J 2 4   ? -55.440 -58.182  -27.414 1.00 299.00 ? 26  ASP K O   1 
ATOM   8814  C CB  . ASP J 2 4   ? -54.597 -60.502  -25.448 1.00 297.33 ? 26  ASP K CB  1 
ATOM   8815  C CG  . ASP J 2 4   ? -53.374 -60.598  -24.544 1.00 297.19 ? 26  ASP K CG  1 
ATOM   8816  O OD1 . ASP J 2 4   ? -53.464 -60.189  -23.368 1.00 300.84 ? 26  ASP K OD1 1 
ATOM   8817  O OD2 . ASP J 2 4   ? -52.320 -61.116  -24.997 1.00 295.40 ? 26  ASP K OD2 1 
ATOM   8818  N N   . PRO J 2 5   ? -54.099 -57.177  -25.882 1.00 292.70 ? 27  PRO K N   1 
ATOM   8819  C CA  . PRO J 2 5   ? -53.571 -56.246  -26.896 1.00 291.85 ? 27  PRO K CA  1 
ATOM   8820  C C   . PRO J 2 5   ? -52.648 -56.911  -27.921 1.00 288.11 ? 27  PRO K C   1 
ATOM   8821  O O   . PRO J 2 5   ? -52.765 -56.650  -29.120 1.00 287.20 ? 27  PRO K O   1 
ATOM   8822  C CB  . PRO J 2 5   ? -52.786 -55.212  -26.068 1.00 291.09 ? 27  PRO K CB  1 
ATOM   8823  C CG  . PRO J 2 5   ? -53.324 -55.336  -24.683 1.00 290.97 ? 27  PRO K CG  1 
ATOM   8824  C CD  . PRO J 2 5   ? -53.692 -56.783  -24.520 1.00 289.02 ? 27  PRO K CD  1 
ATOM   8825  N N   . CYS J 2 6   ? -51.751 -57.767  -27.433 1.00 282.83 ? 28  CYS K N   1 
ATOM   8826  C CA  . CYS J 2 6   ? -50.709 -58.391  -28.252 1.00 279.06 ? 28  CYS K CA  1 
ATOM   8827  C C   . CYS J 2 6   ? -51.244 -59.325  -29.331 1.00 276.73 ? 28  CYS K C   1 
ATOM   8828  O O   . CYS J 2 6   ? -50.693 -59.370  -30.432 1.00 275.03 ? 28  CYS K O   1 
ATOM   8829  C CB  . CYS J 2 6   ? -49.721 -59.140  -27.354 1.00 275.25 ? 28  CYS K CB  1 
ATOM   8830  S SG  . CYS J 2 6   ? -48.945 -58.082  -26.103 1.00 278.28 ? 28  CYS K SG  1 
ATOM   8831  N N   . SER J 2 7   ? -52.318 -60.050  -29.018 1.00 276.14 ? 29  SER K N   1 
ATOM   8832  C CA  . SER J 2 7   ? -52.989 -60.933  -29.985 1.00 277.30 ? 29  SER K CA  1 
ATOM   8833  C C   . SER J 2 7   ? -53.381 -60.207  -31.278 1.00 283.72 ? 29  SER K C   1 
ATOM   8834  O O   . SER J 2 7   ? -53.381 -60.806  -32.352 1.00 283.05 ? 29  SER K O   1 
ATOM   8835  C CB  . SER J 2 7   ? -54.243 -61.546  -29.359 1.00 275.60 ? 29  SER K CB  1 
ATOM   8836  O OG  . SER J 2 7   ? -54.808 -62.529  -30.208 1.00 275.87 ? 29  SER K OG  1 
ATOM   8837  N N   . ASN J 2 8   ? -53.713 -58.920  -31.164 1.00 288.99 ? 30  ASN K N   1 
ATOM   8838  C CA  . ASN J 2 8   ? -54.026 -58.063  -32.321 1.00 290.34 ? 30  ASN K CA  1 
ATOM   8839  C C   . ASN J 2 8   ? -52.899 -57.968  -33.364 1.00 288.16 ? 30  ASN K C   1 
ATOM   8840  O O   . ASN J 2 8   ? -53.183 -57.815  -34.559 1.00 290.62 ? 30  ASN K O   1 
ATOM   8841  C CB  . ASN J 2 8   ? -54.388 -56.646  -31.834 1.00 294.11 ? 30  ASN K CB  1 
ATOM   8842  C CG  . ASN J 2 8   ? -55.086 -55.806  -32.891 1.00 301.16 ? 30  ASN K CG  1 
ATOM   8843  O OD1 . ASN J 2 8   ? -56.064 -56.237  -33.499 1.00 308.31 ? 30  ASN K OD1 1 
ATOM   8844  N ND2 . ASN J 2 8   ? -54.591 -54.589  -33.099 1.00 300.67 ? 30  ASN K ND2 1 
ATOM   8845  N N   . CYS J 2 9   ? -51.643 -58.024  -32.911 1.00 283.89 ? 31  CYS K N   1 
ATOM   8846  C CA  . CYS J 2 9   ? -50.487 -57.939  -33.814 1.00 280.18 ? 31  CYS K CA  1 
ATOM   8847  C C   . CYS J 2 9   ? -50.327 -59.221  -34.638 1.00 276.23 ? 31  CYS K C   1 
ATOM   8848  O O   . CYS J 2 9   ? -50.437 -60.316  -34.088 1.00 272.94 ? 31  CYS K O   1 
ATOM   8849  C CB  . CYS J 2 9   ? -49.198 -57.670  -33.039 1.00 278.66 ? 31  CYS K CB  1 
ATOM   8850  S SG  . CYS J 2 9   ? -49.245 -56.176  -32.013 1.00 278.68 ? 31  CYS K SG  1 
ATOM   8851  N N   . PRO J 2 10  ? -50.068 -59.087  -35.958 1.00 274.85 ? 32  PRO K N   1 
ATOM   8852  C CA  . PRO J 2 10  ? -49.954 -60.247  -36.841 1.00 271.89 ? 32  PRO K CA  1 
ATOM   8853  C C   . PRO J 2 10  ? -48.534 -60.819  -36.924 1.00 267.16 ? 32  PRO K C   1 
ATOM   8854  O O   . PRO J 2 10  ? -47.632 -60.374  -36.201 1.00 263.04 ? 32  PRO K O   1 
ATOM   8855  C CB  . PRO J 2 10  ? -50.367 -59.667  -38.194 1.00 274.21 ? 32  PRO K CB  1 
ATOM   8856  C CG  . PRO J 2 10  ? -49.817 -58.284  -38.150 1.00 277.66 ? 32  PRO K CG  1 
ATOM   8857  C CD  . PRO J 2 10  ? -49.995 -57.828  -36.729 1.00 278.33 ? 32  PRO K CD  1 
ATOM   8858  N N   . ALA J 2 11  ? -48.358 -61.806  -37.805 1.00 263.68 ? 33  ALA K N   1 
ATOM   8859  C CA  . ALA J 2 11  ? -47.037 -62.307  -38.182 1.00 258.19 ? 33  ALA K CA  1 
ATOM   8860  C C   . ALA J 2 11  ? -46.232 -61.205  -38.877 1.00 259.16 ? 33  ALA K C   1 
ATOM   8861  O O   . ALA J 2 11  ? -46.800 -60.362  -39.573 1.00 265.85 ? 33  ALA K O   1 
ATOM   8862  C CB  . ALA J 2 11  ? -47.171 -63.518  -39.097 1.00 254.31 ? 33  ALA K CB  1 
ATOM   8863  N N   . GLY J 2 12  ? -44.916 -61.226  -38.683 1.00 255.17 ? 34  GLY K N   1 
ATOM   8864  C CA  . GLY J 2 12  ? -44.033 -60.159  -39.155 1.00 254.43 ? 34  GLY K CA  1 
ATOM   8865  C C   . GLY J 2 12  ? -43.805 -59.022  -38.185 1.00 253.28 ? 34  GLY K C   1 
ATOM   8866  O O   . GLY J 2 12  ? -43.056 -58.089  -38.490 1.00 254.98 ? 34  GLY K O   1 
ATOM   8867  N N   . THR J 2 13  ? -44.454 -59.086  -37.019 1.00 251.38 ? 35  THR K N   1 
ATOM   8868  C CA  . THR J 2 13  ? -44.372 -58.040  -35.988 1.00 251.82 ? 35  THR K CA  1 
ATOM   8869  C C   . THR J 2 13  ? -44.328 -58.681  -34.602 1.00 245.80 ? 35  THR K C   1 
ATOM   8870  O O   . THR J 2 13  ? -44.465 -59.903  -34.466 1.00 240.35 ? 35  THR K O   1 
ATOM   8871  C CB  . THR J 2 13  ? -45.594 -57.097  -36.042 1.00 257.14 ? 35  THR K CB  1 
ATOM   8872  O OG1 . THR J 2 13  ? -46.803 -57.855  -35.865 1.00 259.68 ? 35  THR K OG1 1 
ATOM   8873  C CG2 . THR J 2 13  ? -45.658 -56.351  -37.369 1.00 261.24 ? 35  THR K CG2 1 
ATOM   8874  N N   . PHE J 2 14  ? -44.139 -57.843  -33.583 1.00 243.12 ? 36  PHE K N   1 
ATOM   8875  C CA  . PHE J 2 14  ? -44.230 -58.272  -32.185 1.00 241.83 ? 36  PHE K CA  1 
ATOM   8876  C C   . PHE J 2 14  ? -44.861 -57.196  -31.302 1.00 245.74 ? 36  PHE K C   1 
ATOM   8877  O O   . PHE J 2 14  ? -44.824 -56.009  -31.624 1.00 248.18 ? 36  PHE K O   1 
ATOM   8878  C CB  . PHE J 2 14  ? -42.844 -58.674  -31.645 1.00 238.08 ? 36  PHE K CB  1 
ATOM   8879  C CG  . PHE J 2 14  ? -41.896 -57.516  -31.464 1.00 236.26 ? 36  PHE K CG  1 
ATOM   8880  C CD1 . PHE J 2 14  ? -41.668 -56.977  -30.196 1.00 235.85 ? 36  PHE K CD1 1 
ATOM   8881  C CD2 . PHE J 2 14  ? -41.217 -56.972  -32.553 1.00 236.99 ? 36  PHE K CD2 1 
ATOM   8882  C CE1 . PHE J 2 14  ? -40.791 -55.913  -30.025 1.00 235.58 ? 36  PHE K CE1 1 
ATOM   8883  C CE2 . PHE J 2 14  ? -40.347 -55.904  -32.378 1.00 238.15 ? 36  PHE K CE2 1 
ATOM   8884  C CZ  . PHE J 2 14  ? -40.129 -55.379  -31.120 1.00 237.02 ? 36  PHE K CZ  1 
ATOM   8885  N N   . CYS J 2 15  ? -45.425 -57.636  -30.180 1.00 249.59 ? 37  CYS K N   1 
ATOM   8886  C CA  . CYS J 2 15  ? -46.069 -56.751  -29.204 1.00 254.50 ? 37  CYS K CA  1 
ATOM   8887  C C   . CYS J 2 15  ? -45.017 -56.119  -28.282 1.00 253.54 ? 37  CYS K C   1 
ATOM   8888  O O   . CYS J 2 15  ? -44.678 -56.667  -27.231 1.00 252.37 ? 37  CYS K O   1 
ATOM   8889  C CB  . CYS J 2 15  ? -47.106 -57.539  -28.405 1.00 258.77 ? 37  CYS K CB  1 
ATOM   8890  S SG  . CYS J 2 15  ? -48.014 -56.606  -27.153 1.00 266.95 ? 37  CYS K SG  1 
ATOM   8891  N N   . ASP J 2 16  ? -44.512 -54.957  -28.694 1.00 256.13 ? 38  ASP K N   1 
ATOM   8892  C CA  . ASP J 2 16  ? -43.378 -54.301  -28.038 1.00 260.43 ? 38  ASP K CA  1 
ATOM   8893  C C   . ASP J 2 16  ? -43.769 -53.753  -26.652 1.00 263.87 ? 38  ASP K C   1 
ATOM   8894  O O   . ASP J 2 16  ? -44.387 -52.694  -26.542 1.00 273.71 ? 38  ASP K O   1 
ATOM   8895  C CB  . ASP J 2 16  ? -42.840 -53.183  -28.949 1.00 264.77 ? 38  ASP K CB  1 
ATOM   8896  C CG  . ASP J 2 16  ? -41.471 -52.648  -28.521 1.00 265.84 ? 38  ASP K CG  1 
ATOM   8897  O OD1 . ASP J 2 16  ? -41.017 -52.917  -27.389 1.00 262.94 ? 38  ASP K OD1 1 
ATOM   8898  O OD2 . ASP J 2 16  ? -40.849 -51.933  -29.338 1.00 269.79 ? 38  ASP K OD2 1 
ATOM   8899  N N   . ASN J 2 17  ? -43.388 -54.482  -25.601 1.00 260.31 ? 39  ASN K N   1 
ATOM   8900  C CA  . ASN J 2 17  ? -43.728 -54.108  -24.220 1.00 259.39 ? 39  ASN K CA  1 
ATOM   8901  C C   . ASN J 2 17  ? -42.894 -52.952  -23.661 1.00 260.61 ? 39  ASN K C   1 
ATOM   8902  O O   . ASN J 2 17  ? -43.251 -52.392  -22.625 1.00 265.99 ? 39  ASN K O   1 
ATOM   8903  C CB  . ASN J 2 17  ? -43.616 -55.318  -23.283 1.00 256.99 ? 39  ASN K CB  1 
ATOM   8904  C CG  . ASN J 2 17  ? -44.588 -56.434  -23.641 1.00 255.79 ? 39  ASN K CG  1 
ATOM   8905  O OD1 . ASN J 2 17  ? -45.712 -56.184  -24.078 1.00 251.57 ? 39  ASN K OD1 1 
ATOM   8906  N ND2 . ASN J 2 17  ? -44.154 -57.679  -23.453 1.00 256.04 ? 39  ASN K ND2 1 
ATOM   8907  N N   . ASN J 2 18  ? -41.786 -52.609  -24.320 1.00 259.61 ? 40  ASN K N   1 
ATOM   8908  C CA  . ASN J 2 18  ? -41.009 -51.420  -23.961 1.00 261.99 ? 40  ASN K CA  1 
ATOM   8909  C C   . ASN J 2 18  ? -41.686 -50.140  -24.490 1.00 265.42 ? 40  ASN K C   1 
ATOM   8910  O O   . ASN J 2 18  ? -41.721 -49.125  -23.787 1.00 266.71 ? 40  ASN K O   1 
ATOM   8911  C CB  . ASN J 2 18  ? -39.567 -51.537  -24.474 1.00 260.94 ? 40  ASN K CB  1 
ATOM   8912  N N   . ARG J 2 19  ? -42.238 -50.203  -25.708 1.00 264.79 ? 41  ARG K N   1 
ATOM   8913  C CA  . ARG J 2 19  ? -42.943 -49.071  -26.338 1.00 267.87 ? 41  ARG K CA  1 
ATOM   8914  C C   . ARG J 2 19  ? -44.480 -49.249  -26.340 1.00 268.73 ? 41  ARG K C   1 
ATOM   8915  O O   . ARG J 2 19  ? -45.146 -48.995  -27.351 1.00 268.82 ? 41  ARG K O   1 
ATOM   8916  C CB  . ARG J 2 19  ? -42.418 -48.856  -27.764 1.00 269.23 ? 41  ARG K CB  1 
ATOM   8917  N N   . ASN J 2 20  ? -45.023 -49.664  -25.187 1.00 267.37 ? 42  ASN K N   1 
ATOM   8918  C CA  . ASN J 2 20  ? -46.473 -49.805  -24.931 1.00 268.69 ? 42  ASN K CA  1 
ATOM   8919  C C   . ASN J 2 20  ? -47.274 -50.556  -26.003 1.00 266.35 ? 42  ASN K C   1 
ATOM   8920  O O   . ASN J 2 20  ? -47.958 -49.945  -26.826 1.00 263.23 ? 42  ASN K O   1 
ATOM   8921  C CB  . ASN J 2 20  ? -47.114 -48.430  -24.653 1.00 273.75 ? 42  ASN K CB  1 
ATOM   8922  C CG  . ASN J 2 20  ? -46.768 -47.877  -23.279 1.00 273.59 ? 42  ASN K CG  1 
ATOM   8923  O OD1 . ASN J 2 20  ? -45.850 -48.355  -22.606 1.00 271.44 ? 42  ASN K OD1 1 
ATOM   8924  N ND2 . ASN J 2 20  ? -47.489 -46.849  -22.869 1.00 275.30 ? 42  ASN K ND2 1 
ATOM   8925  N N   . GLN J 2 21  ? -47.146 -51.883  -26.003 1.00 264.78 ? 43  GLN K N   1 
ATOM   8926  C CA  . GLN J 2 21  ? -48.018 -52.796  -26.773 1.00 264.51 ? 43  GLN K CA  1 
ATOM   8927  C C   . GLN J 2 21  ? -48.118 -52.608  -28.303 1.00 265.50 ? 43  GLN K C   1 
ATOM   8928  O O   . GLN J 2 21  ? -48.870 -53.340  -28.956 1.00 264.08 ? 43  GLN K O   1 
ATOM   8929  C CB  . GLN J 2 21  ? -49.445 -52.778  -26.187 1.00 264.97 ? 43  GLN K CB  1 
ATOM   8930  C CG  . GLN J 2 21  ? -49.533 -52.765  -24.665 1.00 263.77 ? 43  GLN K CG  1 
ATOM   8931  C CD  . GLN J 2 21  ? -48.799 -53.923  -24.014 1.00 260.81 ? 43  GLN K CD  1 
ATOM   8932  O OE1 . GLN J 2 21  ? -47.935 -53.721  -23.166 1.00 259.85 ? 43  GLN K OE1 1 
ATOM   8933  N NE2 . GLN J 2 21  ? -49.139 -55.144  -24.414 1.00 258.39 ? 43  GLN K NE2 1 
ATOM   8934  N N   . ILE J 2 22  ? -47.369 -51.665  -28.874 1.00 267.10 ? 44  ILE K N   1 
ATOM   8935  C CA  . ILE J 2 22  ? -47.487 -51.332  -30.298 1.00 269.57 ? 44  ILE K CA  1 
ATOM   8936  C C   . ILE J 2 22  ? -46.886 -52.441  -31.162 1.00 265.61 ? 44  ILE K C   1 
ATOM   8937  O O   . ILE J 2 22  ? -45.903 -53.073  -30.773 1.00 260.94 ? 44  ILE K O   1 
ATOM   8938  C CB  . ILE J 2 22  ? -46.842 -49.959  -30.629 1.00 274.56 ? 44  ILE K CB  1 
ATOM   8939  C CG1 . ILE J 2 22  ? -47.278 -49.492  -32.029 1.00 277.81 ? 44  ILE K CG1 1 
ATOM   8940  C CG2 . ILE J 2 22  ? -45.317 -49.992  -30.509 1.00 273.85 ? 44  ILE K CG2 1 
ATOM   8941  C CD1 . ILE J 2 22  ? -46.922 -48.059  -32.351 1.00 281.16 ? 44  ILE K CD1 1 
ATOM   8942  N N   . CYS J 2 23  ? -47.483 -52.667  -32.329 1.00 268.55 ? 45  CYS K N   1 
ATOM   8943  C CA  . CYS J 2 23  ? -47.047 -53.742  -33.222 1.00 269.33 ? 45  CYS K CA  1 
ATOM   8944  C C   . CYS J 2 23  ? -45.833 -53.294  -34.043 1.00 268.34 ? 45  CYS K C   1 
ATOM   8945  O O   . CYS J 2 23  ? -45.962 -52.869  -35.202 1.00 276.55 ? 45  CYS K O   1 
ATOM   8946  C CB  . CYS J 2 23  ? -48.189 -54.193  -34.139 1.00 273.70 ? 45  CYS K CB  1 
ATOM   8947  S SG  . CYS J 2 23  ? -49.718 -54.647  -33.287 1.00 277.93 ? 45  CYS K SG  1 
ATOM   8948  N N   . SER J 2 24  ? -44.652 -53.391  -33.423 1.00 260.82 ? 46  SER K N   1 
ATOM   8949  C CA  . SER J 2 24  ? -43.384 -53.050  -34.073 1.00 257.63 ? 46  SER K CA  1 
ATOM   8950  C C   . SER J 2 24  ? -42.983 -54.161  -35.048 1.00 255.51 ? 46  SER K C   1 
ATOM   8951  O O   . SER J 2 24  ? -43.233 -55.335  -34.764 1.00 252.91 ? 46  SER K O   1 
ATOM   8952  C CB  . SER J 2 24  ? -42.272 -52.873  -33.036 1.00 254.09 ? 46  SER K CB  1 
ATOM   8953  O OG  . SER J 2 24  ? -42.638 -51.955  -32.029 1.00 255.20 ? 46  SER K OG  1 
ATOM   8954  N N   . PRO J 2 25  ? -42.347 -53.804  -36.189 1.00 256.59 ? 47  PRO K N   1 
ATOM   8955  C CA  . PRO J 2 25  ? -41.905 -54.862  -37.098 1.00 254.44 ? 47  PRO K CA  1 
ATOM   8956  C C   . PRO J 2 25  ? -40.694 -55.604  -36.541 1.00 251.48 ? 47  PRO K C   1 
ATOM   8957  O O   . PRO J 2 25  ? -39.949 -55.050  -35.716 1.00 249.09 ? 47  PRO K O   1 
ATOM   8958  C CB  . PRO J 2 25  ? -41.539 -54.110  -38.391 1.00 257.91 ? 47  PRO K CB  1 
ATOM   8959  C CG  . PRO J 2 25  ? -41.742 -52.653  -38.115 1.00 261.50 ? 47  PRO K CG  1 
ATOM   8960  C CD  . PRO J 2 25  ? -41.871 -52.482  -36.635 1.00 260.18 ? 47  PRO K CD  1 
ATOM   8961  N N   . CYS J 2 26  ? -40.516 -56.853  -36.981 1.00 248.10 ? 48  CYS K N   1 
ATOM   8962  C CA  . CYS J 2 26  ? -39.386 -57.667  -36.543 1.00 244.85 ? 48  CYS K CA  1 
ATOM   8963  C C   . CYS J 2 26  ? -38.079 -56.982  -36.957 1.00 243.55 ? 48  CYS K C   1 
ATOM   8964  O O   . CYS J 2 26  ? -37.931 -56.601  -38.120 1.00 247.50 ? 48  CYS K O   1 
ATOM   8965  C CB  . CYS J 2 26  ? -39.440 -59.083  -37.137 1.00 243.90 ? 48  CYS K CB  1 
ATOM   8966  S SG  . CYS J 2 26  ? -40.612 -60.261  -36.393 1.00 242.48 ? 48  CYS K SG  1 
ATOM   8967  N N   . PRO J 2 27  ? -37.134 -56.810  -36.003 1.00 237.75 ? 49  PRO K N   1 
ATOM   8968  C CA  . PRO J 2 27  ? -35.857 -56.173  -36.340 1.00 237.25 ? 49  PRO K CA  1 
ATOM   8969  C C   . PRO J 2 27  ? -35.002 -57.019  -37.306 1.00 237.17 ? 49  PRO K C   1 
ATOM   8970  O O   . PRO J 2 27  ? -35.423 -58.110  -37.695 1.00 234.15 ? 49  PRO K O   1 
ATOM   8971  C CB  . PRO J 2 27  ? -35.182 -55.983  -34.974 1.00 234.06 ? 49  PRO K CB  1 
ATOM   8972  C CG  . PRO J 2 27  ? -35.851 -56.918  -34.052 1.00 232.78 ? 49  PRO K CG  1 
ATOM   8973  C CD  . PRO J 2 27  ? -37.218 -57.175  -34.577 1.00 234.05 ? 49  PRO K CD  1 
ATOM   8974  N N   . PRO J 2 28  ? -33.823 -56.510  -37.711 1.00 239.26 ? 50  PRO K N   1 
ATOM   8975  C CA  . PRO J 2 28  ? -33.014 -57.285  -38.658 1.00 236.81 ? 50  PRO K CA  1 
ATOM   8976  C C   . PRO J 2 28  ? -32.599 -58.660  -38.121 1.00 230.98 ? 50  PRO K C   1 
ATOM   8977  O O   . PRO J 2 28  ? -32.334 -58.807  -36.919 1.00 225.60 ? 50  PRO K O   1 
ATOM   8978  C CB  . PRO J 2 28  ? -31.786 -56.392  -38.895 1.00 240.73 ? 50  PRO K CB  1 
ATOM   8979  C CG  . PRO J 2 28  ? -32.223 -55.014  -38.519 1.00 243.47 ? 50  PRO K CG  1 
ATOM   8980  C CD  . PRO J 2 28  ? -33.217 -55.196  -37.415 1.00 241.64 ? 50  PRO K CD  1 
ATOM   8981  N N   . ASN J 2 29  ? -32.564 -59.643  -39.024 1.00 229.83 ? 51  ASN K N   1 
ATOM   8982  C CA  . ASN J 2 29  ? -32.225 -61.040  -38.714 1.00 226.58 ? 51  ASN K CA  1 
ATOM   8983  C C   . ASN J 2 29  ? -33.223 -61.711  -37.765 1.00 221.51 ? 51  ASN K C   1 
ATOM   8984  O O   . ASN J 2 29  ? -32.817 -62.520  -36.933 1.00 222.66 ? 51  ASN K O   1 
ATOM   8985  C CB  . ASN J 2 29  ? -30.799 -61.159  -38.140 1.00 227.61 ? 51  ASN K CB  1 
ATOM   8986  C CG  . ASN J 2 29  ? -29.776 -60.377  -38.935 1.00 230.05 ? 51  ASN K CG  1 
ATOM   8987  O OD1 . ASN J 2 29  ? -29.722 -60.472  -40.163 1.00 233.57 ? 51  ASN K OD1 1 
ATOM   8988  N ND2 . ASN J 2 29  ? -28.953 -59.598  -38.234 1.00 226.14 ? 51  ASN K ND2 1 
ATOM   8989  N N   . SER J 2 30  ? -34.514 -61.407  -37.895 1.00 217.37 ? 52  SER K N   1 
ATOM   8990  C CA  . SER J 2 30  ? -35.536 -62.024  -37.038 1.00 213.79 ? 52  SER K CA  1 
ATOM   8991  C C   . SER J 2 30  ? -36.879 -62.171  -37.715 1.00 212.87 ? 52  SER K C   1 
ATOM   8992  O O   . SER J 2 30  ? -37.138 -61.529  -38.720 1.00 217.50 ? 52  SER K O   1 
ATOM   8993  C CB  . SER J 2 30  ? -35.692 -61.227  -35.741 1.00 213.74 ? 52  SER K CB  1 
ATOM   8994  O OG  . SER J 2 30  ? -36.039 -59.879  -35.999 1.00 214.57 ? 52  SER K OG  1 
ATOM   8995  N N   . PHE J 2 31  ? -37.732 -63.014  -37.143 1.00 210.65 ? 53  PHE K N   1 
ATOM   8996  C CA  . PHE J 2 31  ? -39.014 -63.374  -37.748 1.00 214.49 ? 53  PHE K CA  1 
ATOM   8997  C C   . PHE J 2 31  ? -40.067 -63.770  -36.716 1.00 216.11 ? 53  PHE K C   1 
ATOM   8998  O O   . PHE J 2 31  ? -39.760 -63.972  -35.544 1.00 215.48 ? 53  PHE K O   1 
ATOM   8999  C CB  . PHE J 2 31  ? -38.817 -64.528  -38.740 1.00 213.53 ? 53  PHE K CB  1 
ATOM   9000  C CG  . PHE J 2 31  ? -38.664 -65.875  -38.086 1.00 210.09 ? 53  PHE K CG  1 
ATOM   9001  C CD1 . PHE J 2 31  ? -39.740 -66.758  -38.018 1.00 209.06 ? 53  PHE K CD1 1 
ATOM   9002  C CD2 . PHE J 2 31  ? -37.451 -66.255  -37.521 1.00 208.62 ? 53  PHE K CD2 1 
ATOM   9003  C CE1 . PHE J 2 31  ? -39.606 -67.995  -37.404 1.00 207.05 ? 53  PHE K CE1 1 
ATOM   9004  C CE2 . PHE J 2 31  ? -37.308 -67.491  -36.911 1.00 206.21 ? 53  PHE K CE2 1 
ATOM   9005  C CZ  . PHE J 2 31  ? -38.387 -68.359  -36.846 1.00 205.60 ? 53  PHE K CZ  1 
ATOM   9006  N N   . SER J 2 32  ? -41.309 -63.873  -37.183 1.00 221.09 ? 54  SER K N   1 
ATOM   9007  C CA  . SER J 2 32  ? -42.413 -64.478  -36.430 1.00 222.70 ? 54  SER K CA  1 
ATOM   9008  C C   . SER J 2 32  ? -43.465 -64.988  -37.412 1.00 228.91 ? 54  SER K C   1 
ATOM   9009  O O   . SER J 2 32  ? -44.074 -64.196  -38.128 1.00 234.26 ? 54  SER K O   1 
ATOM   9010  C CB  . SER J 2 32  ? -43.039 -63.466  -35.461 1.00 224.24 ? 54  SER K CB  1 
ATOM   9011  O OG  . SER J 2 32  ? -43.447 -62.279  -36.128 1.00 225.70 ? 54  SER K OG  1 
ATOM   9012  N N   . SER J 2 33  ? -43.650 -66.308  -37.466 1.00 232.00 ? 55  SER K N   1 
ATOM   9013  C CA  . SER J 2 33  ? -44.631 -66.943  -38.365 1.00 233.00 ? 55  SER K CA  1 
ATOM   9014  C C   . SER J 2 33  ? -46.008 -67.133  -37.714 1.00 232.37 ? 55  SER K C   1 
ATOM   9015  O O   . SER J 2 33  ? -46.894 -67.753  -38.313 1.00 232.60 ? 55  SER K O   1 
ATOM   9016  C CB  . SER J 2 33  ? -44.093 -68.287  -38.877 1.00 232.50 ? 55  SER K CB  1 
ATOM   9017  O OG  . SER J 2 33  ? -43.840 -69.180  -37.806 1.00 231.77 ? 55  SER K OG  1 
ATOM   9018  N N   . ALA J 2 34  ? -46.180 -66.622  -36.493 1.00 230.93 ? 56  ALA K N   1 
ATOM   9019  C CA  . ALA J 2 34  ? -47.486 -66.538  -35.840 1.00 230.52 ? 56  ALA K CA  1 
ATOM   9020  C C   . ALA J 2 34  ? -47.692 -65.142  -35.252 1.00 232.26 ? 56  ALA K C   1 
ATOM   9021  O O   . ALA J 2 34  ? -46.734 -64.368  -35.096 1.00 235.29 ? 56  ALA K O   1 
ATOM   9022  C CB  . ALA J 2 34  ? -47.594 -67.594  -34.751 1.00 227.16 ? 56  ALA K CB  1 
ATOM   9023  N N   . GLY J 2 35  ? -48.947 -64.820  -34.953 1.00 232.81 ? 57  GLY K N   1 
ATOM   9024  C CA  . GLY J 2 35  ? -49.299 -63.550  -34.324 1.00 235.36 ? 57  GLY K CA  1 
ATOM   9025  C C   . GLY J 2 35  ? -49.198 -63.627  -32.813 1.00 234.83 ? 57  GLY K C   1 
ATOM   9026  O O   . GLY J 2 35  ? -48.983 -64.702  -32.245 1.00 235.44 ? 57  GLY K O   1 
ATOM   9027  N N   . GLY J 2 36  ? -49.333 -62.477  -32.165 1.00 236.05 ? 58  GLY K N   1 
ATOM   9028  C CA  . GLY J 2 36  ? -49.400 -62.406  -30.709 1.00 234.09 ? 58  GLY K CA  1 
ATOM   9029  C C   . GLY J 2 36  ? -48.102 -62.577  -29.937 1.00 230.79 ? 58  GLY K C   1 
ATOM   9030  O O   . GLY J 2 36  ? -48.137 -62.575  -28.705 1.00 231.15 ? 58  GLY K O   1 
ATOM   9031  N N   . GLN J 2 37  ? -46.968 -62.709  -30.629 1.00 228.07 ? 59  GLN K N   1 
ATOM   9032  C CA  . GLN J 2 37  ? -45.686 -62.962  -29.967 1.00 225.51 ? 59  GLN K CA  1 
ATOM   9033  C C   . GLN J 2 37  ? -45.128 -61.676  -29.339 1.00 223.69 ? 59  GLN K C   1 
ATOM   9034  O O   . GLN J 2 37  ? -45.202 -60.604  -29.947 1.00 226.90 ? 59  GLN K O   1 
ATOM   9035  C CB  . GLN J 2 37  ? -44.670 -63.560  -30.953 1.00 224.83 ? 59  GLN K CB  1 
ATOM   9036  C CG  . GLN J 2 37  ? -45.082 -64.907  -31.547 1.00 223.06 ? 59  GLN K CG  1 
ATOM   9037  C CD  . GLN J 2 37  ? -44.027 -65.506  -32.479 1.00 222.38 ? 59  GLN K CD  1 
ATOM   9038  O OE1 . GLN J 2 37  ? -42.852 -65.145  -32.434 1.00 223.65 ? 59  GLN K OE1 1 
ATOM   9039  N NE2 . GLN J 2 37  ? -44.449 -66.433  -33.328 1.00 221.29 ? 59  GLN K NE2 1 
ATOM   9040  N N   . ARG J 2 38  ? -44.588 -61.787  -28.123 1.00 218.05 ? 60  ARG K N   1 
ATOM   9041  C CA  . ARG J 2 38  ? -43.985 -60.644  -27.421 1.00 216.47 ? 60  ARG K CA  1 
ATOM   9042  C C   . ARG J 2 38  ? -42.576 -60.310  -27.931 1.00 215.68 ? 60  ARG K C   1 
ATOM   9043  O O   . ARG J 2 38  ? -42.074 -59.216  -27.655 1.00 213.64 ? 60  ARG K O   1 
ATOM   9044  C CB  . ARG J 2 38  ? -43.952 -60.891  -25.910 1.00 213.51 ? 60  ARG K CB  1 
ATOM   9045  N N   . THR J 2 39  ? -41.945 -61.254  -28.637 1.00 217.64 ? 61  THR K N   1 
ATOM   9046  C CA  . THR J 2 39  ? -40.661 -61.029  -29.317 1.00 219.91 ? 61  THR K CA  1 
ATOM   9047  C C   . THR J 2 39  ? -40.576 -61.837  -30.608 1.00 223.86 ? 61  THR K C   1 
ATOM   9048  O O   . THR J 2 39  ? -41.256 -62.857  -30.761 1.00 222.13 ? 61  THR K O   1 
ATOM   9049  C CB  . THR J 2 39  ? -39.453 -61.450  -28.451 1.00 217.11 ? 61  THR K CB  1 
ATOM   9050  O OG1 . THR J 2 39  ? -39.655 -62.779  -27.950 1.00 214.35 ? 61  THR K OG1 1 
ATOM   9051  C CG2 . THR J 2 39  ? -39.243 -60.484  -27.290 1.00 217.33 ? 61  THR K CG2 1 
ATOM   9052  N N   . CYS J 2 40  ? -39.730 -61.376  -31.524 1.00 228.15 ? 62  CYS K N   1 
ATOM   9053  C CA  . CYS J 2 40  ? -39.428 -62.121  -32.741 1.00 228.06 ? 62  CYS K CA  1 
ATOM   9054  C C   . CYS J 2 40  ? -38.292 -63.099  -32.460 1.00 220.75 ? 62  CYS K C   1 
ATOM   9055  O O   . CYS J 2 40  ? -37.445 -62.850  -31.607 1.00 215.28 ? 62  CYS K O   1 
ATOM   9056  C CB  . CYS J 2 40  ? -39.057 -61.161  -33.882 1.00 234.34 ? 62  CYS K CB  1 
ATOM   9057  S SG  . CYS J 2 40  ? -40.400 -60.043  -34.377 1.00 241.64 ? 62  CYS K SG  1 
ATOM   9058  N N   . ASP J 2 41  ? -38.292 -64.210  -33.182 1.00 215.89 ? 63  ASP K N   1 
ATOM   9059  C CA  . ASP J 2 41  ? -37.275 -65.258  -33.043 1.00 213.12 ? 63  ASP K CA  1 
ATOM   9060  C C   . ASP J 2 41  ? -36.095 -64.948  -33.952 1.00 212.66 ? 63  ASP K C   1 
ATOM   9061  O O   . ASP J 2 41  ? -36.282 -64.324  -34.981 1.00 217.08 ? 63  ASP K O   1 
ATOM   9062  C CB  . ASP J 2 41  ? -37.863 -66.617  -33.430 1.00 212.91 ? 63  ASP K CB  1 
ATOM   9063  C CG  . ASP J 2 41  ? -39.101 -66.981  -32.616 1.00 211.96 ? 63  ASP K CG  1 
ATOM   9064  O OD1 . ASP J 2 41  ? -39.224 -66.521  -31.463 1.00 212.78 ? 63  ASP K OD1 1 
ATOM   9065  O OD2 . ASP J 2 41  ? -39.945 -67.741  -33.128 1.00 210.88 ? 63  ASP K OD2 1 
ATOM   9066  N N   . ILE J 2 42  ? -34.894 -65.393  -33.583 1.00 208.66 ? 64  ILE K N   1 
ATOM   9067  C CA  . ILE J 2 42  ? -33.683 -65.125  -34.375 1.00 207.52 ? 64  ILE K CA  1 
ATOM   9068  C C   . ILE J 2 42  ? -33.688 -65.964  -35.652 1.00 209.79 ? 64  ILE K C   1 
ATOM   9069  O O   . ILE J 2 42  ? -34.020 -67.141  -35.613 1.00 209.25 ? 64  ILE K O   1 
ATOM   9070  C CB  . ILE J 2 42  ? -32.379 -65.448  -33.609 1.00 205.16 ? 64  ILE K CB  1 
ATOM   9071  C CG1 . ILE J 2 42  ? -32.282 -64.678  -32.277 1.00 204.54 ? 64  ILE K CG1 1 
ATOM   9072  C CG2 . ILE J 2 42  ? -31.150 -65.155  -34.470 1.00 205.71 ? 64  ILE K CG2 1 
ATOM   9073  C CD1 . ILE J 2 42  ? -31.943 -63.212  -32.396 1.00 205.54 ? 64  ILE K CD1 1 
ATOM   9074  N N   . CYS J 2 43  ? -33.305 -65.352  -36.772 1.00 213.30 ? 65  CYS K N   1 
ATOM   9075  C CA  . CYS J 2 43  ? -33.240 -66.039  -38.067 1.00 215.30 ? 65  CYS K CA  1 
ATOM   9076  C C   . CYS J 2 43  ? -32.103 -67.049  -38.068 1.00 211.53 ? 65  CYS K C   1 
ATOM   9077  O O   . CYS J 2 43  ? -31.033 -66.775  -37.534 1.00 211.64 ? 65  CYS K O   1 
ATOM   9078  C CB  . CYS J 2 43  ? -33.023 -65.051  -39.224 1.00 222.71 ? 65  CYS K CB  1 
ATOM   9079  S SG  . CYS J 2 43  ? -34.486 -64.178  -39.838 1.00 231.80 ? 65  CYS K SG  1 
ATOM   9080  N N   . ARG J 2 44  ? -32.337 -68.208  -38.680 1.00 210.05 ? 66  ARG K N   1 
ATOM   9081  C CA  . ARG J 2 44  ? -31.311 -69.239  -38.812 1.00 209.56 ? 66  ARG K CA  1 
ATOM   9082  C C   . ARG J 2 44  ? -30.195 -68.747  -39.723 1.00 212.44 ? 66  ARG K C   1 
ATOM   9083  O O   . ARG J 2 44  ? -30.439 -67.941  -40.610 1.00 218.74 ? 66  ARG K O   1 
ATOM   9084  C CB  . ARG J 2 44  ? -31.924 -70.530  -39.361 1.00 208.13 ? 66  ARG K CB  1 
ATOM   9085  C CG  . ARG J 2 44  ? -30.966 -71.704  -39.551 1.00 208.74 ? 66  ARG K CG  1 
ATOM   9086  C CD  . ARG J 2 44  ? -31.635 -73.043  -39.247 1.00 209.66 ? 66  ARG K CD  1 
ATOM   9087  N NE  . ARG J 2 44  ? -32.930 -73.174  -39.926 1.00 213.60 ? 66  ARG K NE  1 
ATOM   9088  C CZ  . ARG J 2 44  ? -33.885 -74.060  -39.629 1.00 215.20 ? 66  ARG K CZ  1 
ATOM   9089  N NH1 . ARG J 2 44  ? -33.736 -74.945  -38.640 1.00 213.78 ? 66  ARG K NH1 1 
ATOM   9090  N NH2 . ARG J 2 44  ? -35.020 -74.059  -40.332 1.00 219.13 ? 66  ARG K NH2 1 
ATOM   9091  N N   . GLN J 2 45  ? -28.980 -69.224  -39.487 1.00 212.00 ? 67  GLN K N   1 
ATOM   9092  C CA  . GLN J 2 45  ? -27.819 -68.901  -40.303 1.00 213.04 ? 67  GLN K CA  1 
ATOM   9093  C C   . GLN J 2 45  ? -27.429 -70.194  -40.998 1.00 215.40 ? 67  GLN K C   1 
ATOM   9094  O O   . GLN J 2 45  ? -27.356 -71.233  -40.350 1.00 215.64 ? 67  GLN K O   1 
ATOM   9095  C CB  . GLN J 2 45  ? -26.660 -68.444  -39.421 1.00 211.44 ? 67  GLN K CB  1 
ATOM   9096  C CG  . GLN J 2 45  ? -26.038 -67.090  -39.748 1.00 214.46 ? 67  GLN K CG  1 
ATOM   9097  C CD  . GLN J 2 45  ? -26.473 -66.025  -38.776 1.00 214.80 ? 67  GLN K CD  1 
ATOM   9098  O OE1 . GLN J 2 45  ? -27.665 -65.788  -38.564 1.00 217.93 ? 67  GLN K OE1 1 
ATOM   9099  N NE2 . GLN J 2 45  ? -25.504 -65.386  -38.171 1.00 212.43 ? 67  GLN K NE2 1 
ATOM   9100  N N   . CYS J 2 46  ? -27.169 -70.124  -42.298 1.00 217.14 ? 68  CYS K N   1 
ATOM   9101  C CA  . CYS J 2 46  ? -26.710 -71.285  -43.035 1.00 217.05 ? 68  CYS K CA  1 
ATOM   9102  C C   . CYS J 2 46  ? -25.305 -71.007  -43.513 1.00 218.47 ? 68  CYS K C   1 
ATOM   9103  O O   . CYS J 2 46  ? -25.113 -70.443  -44.570 1.00 225.57 ? 68  CYS K O   1 
ATOM   9104  C CB  . CYS J 2 46  ? -27.651 -71.599  -44.198 1.00 217.73 ? 68  CYS K CB  1 
ATOM   9105  S SG  . CYS J 2 46  ? -29.370 -71.749  -43.704 1.00 216.74 ? 68  CYS K SG  1 
ATOM   9106  N N   . LYS J 2 47  ? -24.325 -71.382  -42.703 1.00 214.66 ? 69  LYS K N   1 
ATOM   9107  C CA  . LYS J 2 47  ? -22.916 -71.141  -43.018 1.00 211.82 ? 69  LYS K CA  1 
ATOM   9108  C C   . LYS J 2 47  ? -22.142 -72.451  -42.894 1.00 208.61 ? 69  LYS K C   1 
ATOM   9109  O O   . LYS J 2 47  ? -22.730 -73.485  -42.577 1.00 204.60 ? 69  LYS K O   1 
ATOM   9110  C CB  . LYS J 2 47  ? -22.354 -70.049  -42.119 1.00 211.92 ? 69  LYS K CB  1 
ATOM   9111  C CG  . LYS J 2 47  ? -23.271 -68.832  -42.076 1.00 214.58 ? 69  LYS K CG  1 
ATOM   9112  C CD  . LYS J 2 47  ? -22.616 -67.523  -41.712 1.00 218.22 ? 69  LYS K CD  1 
ATOM   9113  C CE  . LYS J 2 47  ? -23.475 -66.365  -42.212 1.00 221.02 ? 69  LYS K CE  1 
ATOM   9114  N NZ  . LYS J 2 47  ? -23.165 -65.055  -41.565 1.00 221.52 ? 69  LYS K NZ  1 
ATOM   9115  N N   . GLY J 2 48  ? -20.843 -72.413  -43.184 1.00 207.51 ? 70  GLY K N   1 
ATOM   9116  C CA  . GLY J 2 48  ? -19.984 -73.595  -43.108 1.00 205.51 ? 70  GLY K CA  1 
ATOM   9117  C C   . GLY J 2 48  ? -20.380 -74.637  -44.136 1.00 204.29 ? 70  GLY K C   1 
ATOM   9118  O O   . GLY J 2 48  ? -20.368 -74.359  -45.326 1.00 205.06 ? 70  GLY K O   1 
ATOM   9119  N N   . VAL J 2 49  ? -20.758 -75.830  -43.682 1.00 203.54 ? 71  VAL K N   1 
ATOM   9120  C CA  . VAL J 2 49  ? -21.256 -76.851  -44.601 1.00 206.30 ? 71  VAL K CA  1 
ATOM   9121  C C   . VAL J 2 49  ? -22.690 -76.605  -45.056 1.00 207.27 ? 71  VAL K C   1 
ATOM   9122  O O   . VAL J 2 49  ? -23.189 -77.336  -45.909 1.00 208.26 ? 71  VAL K O   1 
ATOM   9123  C CB  . VAL J 2 49  ? -21.144 -78.290  -44.047 1.00 207.34 ? 71  VAL K CB  1 
ATOM   9124  C CG1 . VAL J 2 49  ? -19.684 -78.692  -43.914 1.00 208.87 ? 71  VAL K CG1 1 
ATOM   9125  C CG2 . VAL J 2 49  ? -21.876 -78.460  -42.721 1.00 207.61 ? 71  VAL K CG2 1 
ATOM   9126  N N   . PHE J 2 50  ? -23.364 -75.613  -44.474 1.00 206.88 ? 72  PHE K N   1 
ATOM   9127  C CA  . PHE J 2 50  ? -24.708 -75.257  -44.916 1.00 207.70 ? 72  PHE K CA  1 
ATOM   9128  C C   . PHE J 2 50  ? -24.695 -74.127  -45.945 1.00 210.87 ? 72  PHE K C   1 
ATOM   9129  O O   . PHE J 2 50  ? -23.987 -73.137  -45.776 1.00 210.47 ? 72  PHE K O   1 
ATOM   9130  C CB  . PHE J 2 50  ? -25.572 -74.852  -43.729 1.00 204.24 ? 72  PHE K CB  1 
ATOM   9131  C CG  . PHE J 2 50  ? -25.747 -75.922  -42.702 1.00 199.00 ? 72  PHE K CG  1 
ATOM   9132  C CD1 . PHE J 2 50  ? -26.406 -77.105  -43.010 1.00 196.92 ? 72  PHE K CD1 1 
ATOM   9133  C CD2 . PHE J 2 50  ? -25.282 -75.732  -41.417 1.00 195.24 ? 72  PHE K CD2 1 
ATOM   9134  C CE1 . PHE J 2 50  ? -26.564 -78.095  -42.046 1.00 194.18 ? 72  PHE K CE1 1 
ATOM   9135  C CE2 . PHE J 2 50  ? -25.452 -76.708  -40.446 1.00 193.83 ? 72  PHE K CE2 1 
ATOM   9136  C CZ  . PHE J 2 50  ? -26.063 -77.894  -40.766 1.00 192.95 ? 72  PHE K CZ  1 
ATOM   9137  N N   . ARG J 2 51  ? -25.481 -74.315  -47.012 1.00 213.35 ? 73  ARG K N   1 
ATOM   9138  C CA  . ARG J 2 51  ? -25.878 -73.249  -47.941 1.00 214.26 ? 73  ARG K CA  1 
ATOM   9139  C C   . ARG J 2 51  ? -27.314 -72.858  -47.617 1.00 213.67 ? 73  ARG K C   1 
ATOM   9140  O O   . ARG J 2 51  ? -28.095 -73.691  -47.155 1.00 212.25 ? 73  ARG K O   1 
ATOM   9141  C CB  . ARG J 2 51  ? -25.805 -73.732  -49.395 1.00 215.52 ? 73  ARG K CB  1 
ATOM   9142  N N   . THR J 2 52  ? -27.665 -71.603  -47.872 1.00 214.85 ? 74  THR K N   1 
ATOM   9143  C CA  . THR J 2 52  ? -29.054 -71.150  -47.726 1.00 216.79 ? 74  THR K CA  1 
ATOM   9144  C C   . THR J 2 52  ? -29.910 -71.655  -48.896 1.00 223.18 ? 74  THR K C   1 
ATOM   9145  O O   . THR J 2 52  ? -29.576 -71.416  -50.058 1.00 224.13 ? 74  THR K O   1 
ATOM   9146  C CB  . THR J 2 52  ? -29.141 -69.615  -47.687 1.00 216.39 ? 74  THR K CB  1 
ATOM   9147  O OG1 . THR J 2 52  ? -28.144 -69.095  -46.812 1.00 212.18 ? 74  THR K OG1 1 
ATOM   9148  C CG2 . THR J 2 52  ? -30.518 -69.160  -47.221 1.00 216.81 ? 74  THR K CG2 1 
ATOM   9149  N N   . ARG J 2 53  ? -31.004 -72.353  -48.584 1.00 227.03 ? 75  ARG K N   1 
ATOM   9150  C CA  . ARG J 2 53  ? -31.980 -72.786  -49.591 1.00 229.92 ? 75  ARG K CA  1 
ATOM   9151  C C   . ARG J 2 53  ? -33.056 -71.708  -49.771 1.00 230.75 ? 75  ARG K C   1 
ATOM   9152  O O   . ARG J 2 53  ? -33.359 -71.320  -50.898 1.00 240.33 ? 75  ARG K O   1 
ATOM   9153  C CB  . ARG J 2 53  ? -32.617 -74.108  -49.192 1.00 232.20 ? 75  ARG K CB  1 
ATOM   9154  C CG  . ARG J 2 53  ? -33.398 -74.774  -50.328 1.00 237.29 ? 75  ARG K CG  1 
ATOM   9155  C CD  . ARG J 2 53  ? -34.141 -76.023  -49.921 1.00 240.00 ? 75  ARG K CD  1 
ATOM   9156  N NE  . ARG J 2 53  ? -35.080 -75.825  -48.809 1.00 241.65 ? 75  ARG K NE  1 
ATOM   9157  C CZ  . ARG J 2 53  ? -35.981 -76.707  -48.393 1.00 243.76 ? 75  ARG K CZ  1 
ATOM   9158  N NH1 . ARG J 2 53  ? -36.155 -77.875  -49.012 1.00 246.00 ? 75  ARG K NH1 1 
ATOM   9159  N NH2 . ARG J 2 53  ? -36.743 -76.397  -47.343 1.00 243.83 ? 75  ARG K NH2 1 
ATOM   9160  N N   . LYS J 2 54  ? -33.639 -71.251  -48.663 1.00 226.02 ? 76  LYS K N   1 
ATOM   9161  C CA  . LYS J 2 54  ? -34.630 -70.179  -48.660 1.00 225.66 ? 76  LYS K CA  1 
ATOM   9162  C C   . LYS J 2 54  ? -34.175 -69.077  -47.720 1.00 221.12 ? 76  LYS K C   1 
ATOM   9163  O O   . LYS J 2 54  ? -33.792 -69.359  -46.585 1.00 221.46 ? 76  LYS K O   1 
ATOM   9164  C CB  . LYS J 2 54  ? -35.986 -70.720  -48.203 1.00 227.93 ? 76  LYS K CB  1 
ATOM   9165  C CG  . LYS J 2 54  ? -37.155 -69.804  -48.543 1.00 232.36 ? 76  LYS K CG  1 
ATOM   9166  C CD  . LYS J 2 54  ? -38.466 -70.292  -47.932 1.00 232.04 ? 76  LYS K CD  1 
ATOM   9167  C CE  . LYS J 2 54  ? -38.505 -70.154  -46.417 1.00 229.24 ? 76  LYS K CE  1 
ATOM   9168  N NZ  . LYS J 2 54  ? -38.064 -68.819  -45.902 1.00 229.72 ? 76  LYS K NZ  1 
ATOM   9169  N N   . GLU J 2 55  ? -34.229 -67.827  -48.177 1.00 221.18 ? 77  GLU K N   1 
ATOM   9170  C CA  . GLU J 2 55  ? -33.771 -66.685  -47.371 1.00 222.88 ? 77  GLU K CA  1 
ATOM   9171  C C   . GLU J 2 55  ? -34.760 -66.373  -46.246 1.00 223.15 ? 77  GLU K C   1 
ATOM   9172  O O   . GLU J 2 55  ? -35.940 -66.720  -46.341 1.00 221.48 ? 77  GLU K O   1 
ATOM   9173  C CB  . GLU J 2 55  ? -33.564 -65.455  -48.256 1.00 225.03 ? 77  GLU K CB  1 
ATOM   9174  N N   . CYS J 2 56  ? -34.275 -65.736  -45.178 1.00 226.54 ? 78  CYS K N   1 
ATOM   9175  C CA  . CYS J 2 56  ? -35.113 -65.434  -44.015 1.00 231.08 ? 78  CYS K CA  1 
ATOM   9176  C C   . CYS J 2 56  ? -35.924 -64.162  -44.218 1.00 236.23 ? 78  CYS K C   1 
ATOM   9177  O O   . CYS J 2 56  ? -35.369 -63.056  -44.258 1.00 239.09 ? 78  CYS K O   1 
ATOM   9178  C CB  . CYS J 2 56  ? -34.276 -65.278  -42.733 1.00 231.10 ? 78  CYS K CB  1 
ATOM   9179  S SG  . CYS J 2 56  ? -35.296 -65.436  -41.239 1.00 232.51 ? 78  CYS K SG  1 
ATOM   9180  N N   . SER J 2 57  ? -37.242 -64.327  -44.334 1.00 238.88 ? 79  SER K N   1 
ATOM   9181  C CA  . SER J 2 57  ? -38.175 -63.202  -44.303 1.00 243.45 ? 79  SER K CA  1 
ATOM   9182  C C   . SER J 2 57  ? -38.495 -62.852  -42.851 1.00 241.69 ? 79  SER K C   1 
ATOM   9183  O O   . SER J 2 57  ? -37.972 -63.481  -41.931 1.00 241.61 ? 79  SER K O   1 
ATOM   9184  C CB  . SER J 2 57  ? -39.463 -63.578  -45.032 1.00 247.64 ? 79  SER K CB  1 
ATOM   9185  O OG  . SER J 2 57  ? -40.185 -64.571  -44.319 1.00 248.40 ? 79  SER K OG  1 
ATOM   9186  N N   . SER J 2 58  ? -39.346 -61.853  -42.651 1.00 241.83 ? 80  SER K N   1 
ATOM   9187  C CA  . SER J 2 58  ? -39.925 -61.582  -41.329 1.00 240.06 ? 80  SER K CA  1 
ATOM   9188  C C   . SER J 2 58  ? -41.150 -62.467  -41.053 1.00 237.23 ? 80  SER K C   1 
ATOM   9189  O O   . SER J 2 58  ? -41.622 -62.514  -39.923 1.00 235.85 ? 80  SER K O   1 
ATOM   9190  C CB  . SER J 2 58  ? -40.298 -60.106  -41.184 1.00 243.79 ? 80  SER K CB  1 
ATOM   9191  O OG  . SER J 2 58  ? -41.439 -59.794  -41.961 1.00 249.44 ? 80  SER K OG  1 
ATOM   9192  N N   . THR J 2 59  ? -41.671 -63.140  -42.080 1.00 237.83 ? 81  THR K N   1 
ATOM   9193  C CA  . THR J 2 59  ? -42.723 -64.140  -41.906 1.00 239.63 ? 81  THR K CA  1 
ATOM   9194  C C   . THR J 2 59  ? -42.119 -65.423  -41.365 1.00 236.56 ? 81  THR K C   1 
ATOM   9195  O O   . THR J 2 59  ? -42.409 -65.814  -40.241 1.00 237.73 ? 81  THR K O   1 
ATOM   9196  C CB  . THR J 2 59  ? -43.459 -64.453  -43.230 1.00 245.14 ? 81  THR K CB  1 
ATOM   9197  O OG1 . THR J 2 59  ? -44.043 -63.253  -43.747 1.00 253.06 ? 81  THR K OG1 1 
ATOM   9198  C CG2 . THR J 2 59  ? -44.554 -65.513  -43.032 1.00 243.93 ? 81  THR K CG2 1 
ATOM   9199  N N   . SER J 2 60  ? -41.258 -66.060  -42.158 1.00 235.80 ? 82  SER K N   1 
ATOM   9200  C CA  . SER J 2 60  ? -40.754 -67.398  -41.850 1.00 232.01 ? 82  SER K CA  1 
ATOM   9201  C C   . SER J 2 60  ? -39.245 -67.419  -41.669 1.00 226.58 ? 82  SER K C   1 
ATOM   9202  O O   . SER J 2 60  ? -38.525 -66.518  -42.121 1.00 223.67 ? 82  SER K O   1 
ATOM   9203  C CB  . SER J 2 60  ? -41.167 -68.385  -42.950 1.00 235.36 ? 82  SER K CB  1 
ATOM   9204  O OG  . SER J 2 60  ? -40.664 -67.993  -44.212 1.00 240.66 ? 82  SER K OG  1 
ATOM   9205  N N   . ASN J 2 61  ? -38.780 -68.473  -41.007 1.00 222.95 ? 83  ASN K N   1 
ATOM   9206  C CA  . ASN J 2 61  ? -37.358 -68.706  -40.802 1.00 221.36 ? 83  ASN K CA  1 
ATOM   9207  C C   . ASN J 2 61  ? -36.731 -69.183  -42.106 1.00 221.22 ? 83  ASN K C   1 
ATOM   9208  O O   . ASN J 2 61  ? -37.428 -69.712  -42.984 1.00 221.37 ? 83  ASN K O   1 
ATOM   9209  C CB  . ASN J 2 61  ? -37.162 -69.769  -39.711 1.00 219.26 ? 83  ASN K CB  1 
ATOM   9210  C CG  . ASN J 2 61  ? -35.753 -69.791  -39.146 1.00 218.88 ? 83  ASN K CG  1 
ATOM   9211  O OD1 . ASN J 2 61  ? -35.097 -68.755  -39.013 1.00 223.15 ? 83  ASN K OD1 1 
ATOM   9212  N ND2 . ASN J 2 61  ? -35.278 -70.983  -38.808 1.00 215.51 ? 83  ASN K ND2 1 
ATOM   9213  N N   . ALA J 2 62  ? -35.416 -68.999  -42.222 1.00 218.79 ? 84  ALA K N   1 
ATOM   9214  C CA  . ALA J 2 62  ? -34.645 -69.551  -43.343 1.00 217.45 ? 84  ALA K CA  1 
ATOM   9215  C C   . ALA J 2 62  ? -34.618 -71.079  -43.274 1.00 214.07 ? 84  ALA K C   1 
ATOM   9216  O O   . ALA J 2 62  ? -34.990 -71.687  -42.252 1.00 210.27 ? 84  ALA K O   1 
ATOM   9217  C CB  . ALA J 2 62  ? -33.220 -69.021  -43.324 1.00 217.21 ? 84  ALA K CB  1 
ATOM   9218  N N   . GLU J 2 63  ? -34.189 -71.697  -44.369 1.00 218.07 ? 85  GLU K N   1 
ATOM   9219  C CA  . GLU J 2 63  ? -33.986 -73.135  -44.413 1.00 223.31 ? 85  GLU K CA  1 
ATOM   9220  C C   . GLU J 2 63  ? -32.671 -73.381  -45.134 1.00 224.24 ? 85  GLU K C   1 
ATOM   9221  O O   . GLU J 2 63  ? -32.351 -72.711  -46.106 1.00 233.38 ? 85  GLU K O   1 
ATOM   9222  C CB  . GLU J 2 63  ? -35.153 -73.818  -45.122 1.00 230.09 ? 85  GLU K CB  1 
ATOM   9223  C CG  . GLU J 2 63  ? -36.350 -74.078  -44.211 1.00 232.12 ? 85  GLU K CG  1 
ATOM   9224  C CD  . GLU J 2 63  ? -37.698 -73.919  -44.912 1.00 236.45 ? 85  GLU K CD  1 
ATOM   9225  O OE1 . GLU J 2 63  ? -37.835 -74.330  -46.084 1.00 237.13 ? 85  GLU K OE1 1 
ATOM   9226  O OE2 . GLU J 2 63  ? -38.632 -73.369  -44.311 1.00 239.76 ? 85  GLU K OE2 1 
ATOM   9227  N N   . CYS J 2 64  ? -31.910 -74.358  -44.632 1.00 218.54 ? 86  CYS K N   1 
ATOM   9228  C CA  . CYS J 2 64  ? -30.596 -74.656  -45.182 1.00 216.59 ? 86  CYS K CA  1 
ATOM   9229  C C   . CYS J 2 64  ? -30.642 -75.931  -46.022 1.00 214.75 ? 86  CYS K C   1 
ATOM   9230  O O   . CYS J 2 64  ? -31.482 -76.802  -45.803 1.00 210.72 ? 86  CYS K O   1 
ATOM   9231  C CB  . CYS J 2 64  ? -29.574 -74.829  -44.062 1.00 215.50 ? 86  CYS K CB  1 
ATOM   9232  S SG  . CYS J 2 64  ? -29.479 -73.547  -42.760 1.00 214.94 ? 86  CYS K SG  1 
ATOM   9233  N N   . ASP J 2 65  ? -29.751 -75.992  -47.010 1.00 218.20 ? 87  ASP K N   1 
ATOM   9234  C CA  . ASP J 2 65  ? -29.363 -77.248  -47.643 1.00 223.58 ? 87  ASP K CA  1 
ATOM   9235  C C   . ASP J 2 65  ? -27.869 -77.429  -47.413 1.00 220.26 ? 87  ASP K C   1 
ATOM   9236  O O   . ASP J 2 65  ? -27.167 -76.496  -47.012 1.00 216.58 ? 87  ASP K O   1 
ATOM   9237  C CB  . ASP J 2 65  ? -29.742 -77.324  -49.141 1.00 233.21 ? 87  ASP K CB  1 
ATOM   9238  C CG  . ASP J 2 65  ? -29.064 -76.259  -50.005 1.00 241.58 ? 87  ASP K CG  1 
ATOM   9239  O OD1 . ASP J 2 65  ? -27.847 -76.398  -50.315 1.00 249.53 ? 87  ASP K OD1 1 
ATOM   9240  O OD2 . ASP J 2 65  ? -29.767 -75.285  -50.415 1.00 247.64 ? 87  ASP K OD2 1 
ATOM   9241  N N   . CYS J 2 66  ? -27.392 -78.649  -47.650 1.00 219.21 ? 88  CYS K N   1 
ATOM   9242  C CA  . CYS J 2 66  ? -25.964 -78.924  -47.512 1.00 219.32 ? 88  CYS K CA  1 
ATOM   9243  C C   . CYS J 2 66  ? -25.228 -78.506  -48.780 1.00 220.34 ? 88  CYS K C   1 
ATOM   9244  O O   . CYS J 2 66  ? -25.800 -78.517  -49.869 1.00 222.41 ? 88  CYS K O   1 
ATOM   9245  C CB  . CYS J 2 66  ? -25.735 -80.395  -47.224 1.00 218.51 ? 88  CYS K CB  1 
ATOM   9246  S SG  . CYS J 2 66  ? -26.415 -80.942  -45.641 1.00 219.18 ? 88  CYS K SG  1 
ATOM   9247  N N   . THR J 2 67  ? -23.956 -78.129  -48.635 1.00 219.82 ? 89  THR K N   1 
ATOM   9248  C CA  . THR J 2 67  ? -23.079 -77.932  -49.783 1.00 221.64 ? 89  THR K CA  1 
ATOM   9249  C C   . THR J 2 67  ? -22.896 -79.264  -50.514 1.00 225.00 ? 89  THR K C   1 
ATOM   9250  O O   . THR J 2 67  ? -23.037 -80.338  -49.904 1.00 224.01 ? 89  THR K O   1 
ATOM   9251  C CB  . THR J 2 67  ? -21.683 -77.419  -49.377 1.00 219.16 ? 89  THR K CB  1 
ATOM   9252  O OG1 . THR J 2 67  ? -21.143 -78.266  -48.352 1.00 217.93 ? 89  THR K OG1 1 
ATOM   9253  C CG2 . THR J 2 67  ? -21.750 -75.979  -48.893 1.00 218.57 ? 89  THR K CG2 1 
ATOM   9254  N N   . PRO J 2 68  ? -22.569 -79.205  -51.818 1.00 228.97 ? 90  PRO K N   1 
ATOM   9255  C CA  . PRO J 2 68  ? -22.549 -80.442  -52.589 1.00 229.35 ? 90  PRO K CA  1 
ATOM   9256  C C   . PRO J 2 68  ? -21.411 -81.347  -52.138 1.00 229.18 ? 90  PRO K C   1 
ATOM   9257  O O   . PRO J 2 68  ? -20.347 -80.857  -51.737 1.00 230.17 ? 90  PRO K O   1 
ATOM   9258  C CB  . PRO J 2 68  ? -22.340 -79.965  -54.036 1.00 232.73 ? 90  PRO K CB  1 
ATOM   9259  C CG  . PRO J 2 68  ? -22.302 -78.467  -53.987 1.00 233.61 ? 90  PRO K CG  1 
ATOM   9260  C CD  . PRO J 2 68  ? -21.977 -78.096  -52.582 1.00 230.88 ? 90  PRO K CD  1 
ATOM   9261  N N   . GLY J 2 69  ? -21.655 -82.653  -52.186 1.00 228.54 ? 91  GLY K N   1 
ATOM   9262  C CA  . GLY J 2 69  ? -20.742 -83.631  -51.602 1.00 227.28 ? 91  GLY K CA  1 
ATOM   9263  C C   . GLY J 2 69  ? -21.247 -84.151  -50.272 1.00 223.82 ? 91  GLY K C   1 
ATOM   9264  O O   . GLY J 2 69  ? -20.800 -85.207  -49.819 1.00 223.89 ? 91  GLY K O   1 
ATOM   9265  N N   . PHE J 2 70  ? -22.152 -83.394  -49.640 1.00 220.88 ? 92  PHE K N   1 
ATOM   9266  C CA  . PHE J 2 70  ? -22.899 -83.847  -48.471 1.00 217.21 ? 92  PHE K CA  1 
ATOM   9267  C C   . PHE J 2 70  ? -24.389 -83.850  -48.778 1.00 214.54 ? 92  PHE K C   1 
ATOM   9268  O O   . PHE J 2 70  ? -24.817 -83.323  -49.804 1.00 214.69 ? 92  PHE K O   1 
ATOM   9269  C CB  . PHE J 2 70  ? -22.670 -82.915  -47.288 1.00 215.69 ? 92  PHE K CB  1 
ATOM   9270  C CG  . PHE J 2 70  ? -21.234 -82.720  -46.927 1.00 216.13 ? 92  PHE K CG  1 
ATOM   9271  C CD1 . PHE J 2 70  ? -20.651 -83.480  -45.928 1.00 215.58 ? 92  PHE K CD1 1 
ATOM   9272  C CD2 . PHE J 2 70  ? -20.476 -81.752  -47.566 1.00 218.16 ? 92  PHE K CD2 1 
ATOM   9273  C CE1 . PHE J 2 70  ? -19.329 -83.295  -45.577 1.00 216.75 ? 92  PHE K CE1 1 
ATOM   9274  C CE2 . PHE J 2 70  ? -19.155 -81.549  -47.211 1.00 218.87 ? 92  PHE K CE2 1 
ATOM   9275  C CZ  . PHE J 2 70  ? -18.579 -82.321  -46.216 1.00 217.66 ? 92  PHE K CZ  1 
ATOM   9276  N N   . HIS J 2 71  ? -25.166 -84.427  -47.864 1.00 211.56 ? 93  HIS K N   1 
ATOM   9277  C CA  . HIS J 2 71  ? -26.626 -84.440  -47.949 1.00 210.37 ? 93  HIS K CA  1 
ATOM   9278  C C   . HIS J 2 71  ? -27.272 -84.224  -46.578 1.00 210.86 ? 93  HIS K C   1 
ATOM   9279  O O   . HIS J 2 71  ? -26.722 -84.655  -45.563 1.00 214.24 ? 93  HIS K O   1 
ATOM   9280  C CB  . HIS J 2 71  ? -27.104 -85.765  -48.536 1.00 208.38 ? 93  HIS K CB  1 
ATOM   9281  C CG  . HIS J 2 71  ? -26.612 -86.971  -47.799 1.00 204.63 ? 93  HIS K CG  1 
ATOM   9282  N ND1 . HIS J 2 71  ? -27.205 -87.432  -46.646 1.00 201.72 ? 93  HIS K ND1 1 
ATOM   9283  C CD2 . HIS J 2 71  ? -25.586 -87.811  -48.054 1.00 204.23 ? 93  HIS K CD2 1 
ATOM   9284  C CE1 . HIS J 2 71  ? -26.566 -88.507  -46.223 1.00 201.30 ? 93  HIS K CE1 1 
ATOM   9285  N NE2 . HIS J 2 71  ? -25.576 -88.758  -47.057 1.00 202.97 ? 93  HIS K NE2 1 
ATOM   9286  N N   . CYS J 2 72  ? -28.439 -83.574  -46.561 1.00 212.28 ? 94  CYS K N   1 
ATOM   9287  C CA  . CYS J 2 72  ? -29.187 -83.314  -45.329 1.00 212.15 ? 94  CYS K CA  1 
ATOM   9288  C C   . CYS J 2 72  ? -29.515 -84.562  -44.519 1.00 211.28 ? 94  CYS K C   1 
ATOM   9289  O O   . CYS J 2 72  ? -29.513 -85.670  -45.043 1.00 208.12 ? 94  CYS K O   1 
ATOM   9290  C CB  . CYS J 2 72  ? -30.492 -82.558  -45.612 1.00 215.46 ? 94  CYS K CB  1 
ATOM   9291  S SG  . CYS J 2 72  ? -30.266 -80.811  -45.967 1.00 219.87 ? 94  CYS K SG  1 
ATOM   9292  N N   . LEU J 2 73  ? -29.800 -84.338  -43.239 1.00 212.88 ? 95  LEU K N   1 
ATOM   9293  C CA  . LEU J 2 73  ? -30.053 -85.412  -42.286 1.00 213.68 ? 95  LEU K CA  1 
ATOM   9294  C C   . LEU J 2 73  ? -30.829 -84.853  -41.102 1.00 215.27 ? 95  LEU K C   1 
ATOM   9295  O O   . LEU J 2 73  ? -30.493 -83.793  -40.590 1.00 213.71 ? 95  LEU K O   1 
ATOM   9296  C CB  . LEU J 2 73  ? -28.717 -86.016  -41.813 1.00 211.58 ? 95  LEU K CB  1 
ATOM   9297  C CG  . LEU J 2 73  ? -28.694 -87.480  -41.391 1.00 210.37 ? 95  LEU K CG  1 
ATOM   9298  C CD1 . LEU J 2 73  ? -29.173 -88.381  -42.516 1.00 211.99 ? 95  LEU K CD1 1 
ATOM   9299  C CD2 . LEU J 2 73  ? -27.292 -87.849  -40.949 1.00 210.17 ? 95  LEU K CD2 1 
ATOM   9300  N N   . GLY J 2 74  ? -31.870 -85.565  -40.677 1.00 218.34 ? 96  GLY K N   1 
ATOM   9301  C CA  . GLY J 2 74  ? -32.764 -85.083  -39.623 1.00 219.99 ? 96  GLY K CA  1 
ATOM   9302  C C   . GLY J 2 74  ? -33.660 -83.936  -40.067 1.00 223.01 ? 96  GLY K C   1 
ATOM   9303  O O   . GLY J 2 74  ? -33.527 -83.423  -41.178 1.00 226.61 ? 96  GLY K O   1 
ATOM   9304  N N   . ALA J 2 75  ? -34.569 -83.532  -39.183 1.00 222.20 ? 97  ALA K N   1 
ATOM   9305  C CA  . ALA J 2 75  ? -35.564 -82.506  -39.499 1.00 222.08 ? 97  ALA K CA  1 
ATOM   9306  C C   . ALA J 2 75  ? -34.926 -81.127  -39.643 1.00 223.94 ? 97  ALA K C   1 
ATOM   9307  O O   . ALA J 2 75  ? -33.995 -80.790  -38.905 1.00 221.47 ? 97  ALA K O   1 
ATOM   9308  C CB  . ALA J 2 75  ? -36.653 -82.476  -38.436 1.00 220.67 ? 97  ALA K CB  1 
ATOM   9309  N N   . GLY J 2 76  ? -35.429 -80.348  -40.606 1.00 230.03 ? 98  GLY K N   1 
ATOM   9310  C CA  . GLY J 2 76  ? -34.937 -78.993  -40.896 1.00 232.87 ? 98  GLY K CA  1 
ATOM   9311  C C   . GLY J 2 76  ? -33.496 -78.906  -41.378 1.00 234.32 ? 98  GLY K C   1 
ATOM   9312  O O   . GLY J 2 76  ? -32.883 -77.835  -41.302 1.00 235.41 ? 98  GLY K O   1 
ATOM   9313  N N   . CYS J 2 77  ? -32.969 -80.018  -41.895 1.00 232.15 ? 99  CYS K N   1 
ATOM   9314  C CA  . CYS J 2 77  ? -31.546 -80.169  -42.203 1.00 226.53 ? 99  CYS K CA  1 
ATOM   9315  C C   . CYS J 2 77  ? -30.684 -79.785  -40.998 1.00 220.23 ? 99  CYS K C   1 
ATOM   9316  O O   . CYS J 2 77  ? -29.951 -78.800  -41.015 1.00 219.04 ? 99  CYS K O   1 
ATOM   9317  C CB  . CYS J 2 77  ? -31.168 -79.391  -43.448 1.00 227.83 ? 99  CYS K CB  1 
ATOM   9318  S SG  . CYS J 2 77  ? -29.636 -80.005  -44.201 1.00 226.80 ? 99  CYS K SG  1 
ATOM   9319  N N   . SER J 2 78  ? -30.814 -80.587  -39.948 1.00 213.90 ? 100 SER K N   1 
ATOM   9320  C CA  . SER J 2 78  ? -30.133 -80.343  -38.685 1.00 211.15 ? 100 SER K CA  1 
ATOM   9321  C C   . SER J 2 78  ? -28.633 -80.589  -38.786 1.00 211.10 ? 100 SER K C   1 
ATOM   9322  O O   . SER J 2 78  ? -27.857 -79.903  -38.135 1.00 211.82 ? 100 SER K O   1 
ATOM   9323  C CB  . SER J 2 78  ? -30.722 -81.221  -37.588 1.00 209.63 ? 100 SER K CB  1 
ATOM   9324  O OG  . SER J 2 78  ? -30.431 -82.583  -37.822 1.00 209.71 ? 100 SER K OG  1 
ATOM   9325  N N   . MET J 2 79  ? -28.231 -81.587  -39.570 1.00 210.98 ? 101 MET K N   1 
ATOM   9326  C CA  . MET J 2 79  ? -26.816 -81.770  -39.907 1.00 209.31 ? 101 MET K CA  1 
ATOM   9327  C C   . MET J 2 79  ? -26.582 -82.474  -41.234 1.00 210.64 ? 101 MET K C   1 
ATOM   9328  O O   . MET J 2 79  ? -27.455 -83.161  -41.744 1.00 213.91 ? 101 MET K O   1 
ATOM   9329  C CB  . MET J 2 79  ? -26.067 -82.489  -38.789 1.00 206.14 ? 101 MET K CB  1 
ATOM   9330  C CG  . MET J 2 79  ? -26.559 -83.868  -38.435 1.00 204.37 ? 101 MET K CG  1 
ATOM   9331  S SD  . MET J 2 79  ? -25.544 -84.515  -37.122 1.00 203.25 ? 101 MET K SD  1 
ATOM   9332  C CE  . MET J 2 79  ? -26.481 -85.988  -36.749 1.00 202.47 ? 101 MET K CE  1 
ATOM   9333  N N   . CYS J 2 80  ? -25.373 -82.296  -41.757 1.00 208.97 ? 102 CYS K N   1 
ATOM   9334  C CA  . CYS J 2 80  ? -24.964 -82.835  -43.049 1.00 209.00 ? 102 CYS K CA  1 
ATOM   9335  C C   . CYS J 2 80  ? -24.170 -84.119  -42.880 1.00 206.87 ? 102 CYS K C   1 
ATOM   9336  O O   . CYS J 2 80  ? -23.598 -84.364  -41.823 1.00 209.09 ? 102 CYS K O   1 
ATOM   9337  C CB  . CYS J 2 80  ? -24.109 -81.795  -43.782 1.00 211.02 ? 102 CYS K CB  1 
ATOM   9338  S SG  . CYS J 2 80  ? -25.031 -80.318  -44.241 1.00 214.41 ? 102 CYS K SG  1 
ATOM   9339  N N   . GLU J 2 81  ? -24.147 -84.923  -43.935 1.00 205.67 ? 103 GLU K N   1 
ATOM   9340  C CA  . GLU J 2 81  ? -23.380 -86.166  -43.965 1.00 206.50 ? 103 GLU K CA  1 
ATOM   9341  C C   . GLU J 2 81  ? -22.793 -86.352  -45.347 1.00 209.15 ? 103 GLU K C   1 
ATOM   9342  O O   . GLU J 2 81  ? -23.478 -86.124  -46.336 1.00 212.26 ? 103 GLU K O   1 
ATOM   9343  C CB  . GLU J 2 81  ? -24.280 -87.349  -43.627 1.00 206.37 ? 103 GLU K CB  1 
ATOM   9344  C CG  . GLU J 2 81  ? -23.560 -88.686  -43.586 1.00 209.03 ? 103 GLU K CG  1 
ATOM   9345  C CD  . GLU J 2 81  ? -24.435 -89.823  -43.079 1.00 211.06 ? 103 GLU K CD  1 
ATOM   9346  O OE1 . GLU J 2 81  ? -25.663 -89.801  -43.328 1.00 212.78 ? 103 GLU K OE1 1 
ATOM   9347  O OE2 . GLU J 2 81  ? -23.892 -90.758  -42.443 1.00 212.07 ? 103 GLU K OE2 1 
ATOM   9348  N N   . GLN J 2 82  ? -21.532 -86.775  -45.407 1.00 212.19 ? 104 GLN K N   1 
ATOM   9349  C CA  . GLN J 2 82  ? -20.828 -86.958  -46.681 1.00 216.14 ? 104 GLN K CA  1 
ATOM   9350  C C   . GLN J 2 82  ? -21.478 -88.095  -47.484 1.00 216.09 ? 104 GLN K C   1 
ATOM   9351  O O   . GLN J 2 82  ? -21.895 -89.097  -46.893 1.00 211.79 ? 104 GLN K O   1 
ATOM   9352  C CB  . GLN J 2 82  ? -19.329 -87.185  -46.474 1.00 219.63 ? 104 GLN K CB  1 
ATOM   9353  C CG  . GLN J 2 82  ? -18.767 -88.517  -45.971 1.00 220.84 ? 104 GLN K CG  1 
ATOM   9354  C CD  . GLN J 2 82  ? -17.354 -88.741  -46.476 1.00 221.80 ? 104 GLN K CD  1 
ATOM   9355  O OE1 . GLN J 2 82  ? -16.409 -87.995  -46.140 1.00 223.02 ? 104 GLN K OE1 1 
ATOM   9356  N NE2 . GLN J 2 82  ? -17.171 -89.809  -47.257 1.00 219.04 ? 104 GLN K NE2 1 
ATOM   9357  N N   . ASP J 2 83  ? -21.557 -87.927  -48.805 1.00 219.47 ? 105 ASP K N   1 
ATOM   9358  C CA  . ASP J 2 83  ? -22.294 -88.857  -49.682 1.00 222.77 ? 105 ASP K CA  1 
ATOM   9359  C C   . ASP J 2 83  ? -21.811 -90.292  -49.553 1.00 223.32 ? 105 ASP K C   1 
ATOM   9360  O O   . ASP J 2 83  ? -20.613 -90.528  -49.397 1.00 220.65 ? 105 ASP K O   1 
ATOM   9361  C CB  . ASP J 2 83  ? -22.243 -88.399  -51.160 1.00 225.90 ? 105 ASP K CB  1 
ATOM   9362  C CG  . ASP J 2 83  ? -22.893 -87.036  -51.407 1.00 226.35 ? 105 ASP K CG  1 
ATOM   9363  O OD1 . ASP J 2 83  ? -23.794 -86.636  -50.649 1.00 224.69 ? 105 ASP K OD1 1 
ATOM   9364  O OD2 . ASP J 2 83  ? -22.499 -86.368  -52.387 1.00 229.21 ? 105 ASP K OD2 1 
ATOM   9365  N N   . CYS J 2 84  ? -22.738 -91.242  -49.643 1.00 227.17 ? 106 CYS K N   1 
ATOM   9366  C CA  . CYS J 2 84  ? -22.460 -92.629  -49.213 1.00 231.94 ? 106 CYS K CA  1 
ATOM   9367  C C   . CYS J 2 84  ? -21.522 -93.360  -50.182 1.00 232.26 ? 106 CYS K C   1 
ATOM   9368  O O   . CYS J 2 84  ? -21.728 -93.332  -51.412 1.00 234.69 ? 106 CYS K O   1 
ATOM   9369  C CB  . CYS J 2 84  ? -23.739 -93.439  -49.051 1.00 237.61 ? 106 CYS K CB  1 
ATOM   9370  S SG  . CYS J 2 84  ? -25.049 -92.668  -48.034 1.00 245.26 ? 106 CYS K SG  1 
ATOM   9371  N N   . LYS J 2 85  ? -20.574 -94.094  -49.624 1.00 231.05 ? 107 LYS K N   1 
ATOM   9372  C CA  . LYS J 2 85  ? -19.648 -94.867  -50.430 1.00 232.24 ? 107 LYS K CA  1 
ATOM   9373  C C   . LYS J 2 85  ? -20.280 -96.202  -50.802 1.00 229.98 ? 107 LYS K C   1 
ATOM   9374  O O   . LYS J 2 85  ? -21.375 -96.524  -50.346 1.00 227.35 ? 107 LYS K O   1 
ATOM   9375  C CB  . LYS J 2 85  ? -18.347 -95.102  -49.667 1.00 230.91 ? 107 LYS K CB  1 
ATOM   9376  N N   . GLY J 2 87  ? -20.554 -99.319  -50.677 1.00 222.21 ? 109 GLY K N   1 
ATOM   9377  C CA  . GLY J 2 87  ? -21.145 -100.480 -50.037 1.00 220.85 ? 109 GLY K CA  1 
ATOM   9378  C C   . GLY J 2 87  ? -22.251 -100.049 -49.105 1.00 219.84 ? 109 GLY K C   1 
ATOM   9379  O O   . GLY J 2 87  ? -22.955 -100.858 -48.510 1.00 217.12 ? 109 GLY K O   1 
ATOM   9380  N N   . GLN J 2 88  ? -22.393 -98.741  -48.991 1.00 222.71 ? 110 GLN K N   1 
ATOM   9381  C CA  . GLN J 2 88  ? -23.407 -98.121  -48.140 1.00 224.44 ? 110 GLN K CA  1 
ATOM   9382  C C   . GLN J 2 88  ? -24.610 -97.592  -48.927 1.00 227.57 ? 110 GLN K C   1 
ATOM   9383  O O   . GLN J 2 88  ? -24.542 -97.412  -50.152 1.00 231.93 ? 110 GLN K O   1 
ATOM   9384  C CB  . GLN J 2 88  ? -22.769 -96.980  -47.374 1.00 222.69 ? 110 GLN K CB  1 
ATOM   9385  N N   . GLU J 2 89  ? -25.707 -97.383  -48.208 1.00 227.31 ? 111 GLU K N   1 
ATOM   9386  C CA  . GLU J 2 89  ? -26.953 -96.874  -48.780 1.00 227.43 ? 111 GLU K CA  1 
ATOM   9387  C C   . GLU J 2 89  ? -27.543 -95.837  -47.839 1.00 226.53 ? 111 GLU K C   1 
ATOM   9388  O O   . GLU J 2 89  ? -27.467 -95.993  -46.617 1.00 222.67 ? 111 GLU K O   1 
ATOM   9389  C CB  . GLU J 2 89  ? -27.947 -98.024  -48.966 1.00 227.05 ? 111 GLU K CB  1 
ATOM   9390  N N   . LEU J 2 90  ? -28.139 -94.795  -48.409 1.00 231.25 ? 112 LEU K N   1 
ATOM   9391  C CA  . LEU J 2 90  ? -28.650 -93.662  -47.637 1.00 233.54 ? 112 LEU K CA  1 
ATOM   9392  C C   . LEU J 2 90  ? -30.033 -93.966  -47.049 1.00 236.05 ? 112 LEU K C   1 
ATOM   9393  O O   . LEU J 2 90  ? -30.957 -94.314  -47.786 1.00 236.57 ? 112 LEU K O   1 
ATOM   9394  C CB  . LEU J 2 90  ? -28.725 -92.415  -48.519 1.00 234.89 ? 112 LEU K CB  1 
ATOM   9395  N N   . THR J 2 91  ? -30.166 -93.820  -45.731 1.00 237.51 ? 113 THR K N   1 
ATOM   9396  C CA  . THR J 2 91  ? -31.433 -94.028  -45.014 1.00 239.11 ? 113 THR K CA  1 
ATOM   9397  C C   . THR J 2 91  ? -31.853 -92.738  -44.288 1.00 242.00 ? 113 THR K C   1 
ATOM   9398  O O   . THR J 2 91  ? -31.156 -91.718  -44.354 1.00 244.69 ? 113 THR K O   1 
ATOM   9399  C CB  . THR J 2 91  ? -31.335 -95.201  -43.994 1.00 235.40 ? 113 THR K CB  1 
ATOM   9400  O OG1 . THR J 2 91  ? -30.638 -94.787  -42.813 1.00 230.94 ? 113 THR K OG1 1 
ATOM   9401  C CG2 . THR J 2 91  ? -30.621 -96.393  -44.593 1.00 235.21 ? 113 THR K CG2 1 
ATOM   9402  N N   . LYS J 2 92  ? -32.992 -92.797  -43.596 1.00 242.12 ? 114 LYS K N   1 
ATOM   9403  C CA  . LYS J 2 92  ? -33.409 -91.726  -42.685 1.00 239.51 ? 114 LYS K CA  1 
ATOM   9404  C C   . LYS J 2 92  ? -32.359 -91.502  -41.587 1.00 236.87 ? 114 LYS K C   1 
ATOM   9405  O O   . LYS J 2 92  ? -32.029 -90.363  -41.266 1.00 234.41 ? 114 LYS K O   1 
ATOM   9406  C CB  . LYS J 2 92  ? -34.772 -92.052  -42.061 1.00 238.52 ? 114 LYS K CB  1 
ATOM   9407  N N   . LYS J 2 93  ? -31.826 -92.597  -41.048 1.00 238.11 ? 115 LYS K N   1 
ATOM   9408  C CA  . LYS J 2 93  ? -30.790 -92.556  -40.005 1.00 240.73 ? 115 LYS K CA  1 
ATOM   9409  C C   . LYS J 2 93  ? -29.341 -92.375  -40.509 1.00 246.53 ? 115 LYS K C   1 
ATOM   9410  O O   . LYS J 2 93  ? -28.412 -92.388  -39.698 1.00 247.81 ? 115 LYS K O   1 
ATOM   9411  C CB  . LYS J 2 93  ? -30.875 -93.824  -39.143 1.00 236.86 ? 115 LYS K CB  1 
ATOM   9412  N N   . GLY J 2 94  ? -29.145 -92.224  -41.826 1.00 250.87 ? 116 GLY K N   1 
ATOM   9413  C CA  . GLY J 2 94  ? -27.813 -91.975  -42.426 1.00 250.68 ? 116 GLY K CA  1 
ATOM   9414  C C   . GLY J 2 94  ? -27.318 -93.095  -43.324 1.00 250.20 ? 116 GLY K C   1 
ATOM   9415  O O   . GLY J 2 94  ? -28.058 -94.039  -43.614 1.00 250.64 ? 116 GLY K O   1 
ATOM   9416  N N   . CYS J 2 95  ? -26.064 -92.988  -43.778 1.00 246.70 ? 117 CYS K N   1 
ATOM   9417  C CA  . CYS J 2 95  ? -25.443 -94.024  -44.598 1.00 244.28 ? 117 CYS K CA  1 
ATOM   9418  C C   . CYS J 2 95  ? -25.178 -95.256  -43.740 1.00 239.10 ? 117 CYS K C   1 
ATOM   9419  O O   . CYS J 2 95  ? -24.195 -95.309  -43.006 1.00 239.32 ? 117 CYS K O   1 
ATOM   9420  C CB  . CYS J 2 95  ? -24.118 -93.555  -45.220 1.00 245.70 ? 117 CYS K CB  1 
ATOM   9421  S SG  . CYS J 2 95  ? -24.157 -92.088  -46.281 1.00 247.10 ? 117 CYS K SG  1 
ATOM   9422  N N   . LYS J 2 96  ? -26.087 -96.225  -43.805 1.00 235.29 ? 118 LYS K N   1 
ATOM   9423  C CA  . LYS J 2 96  ? -25.891 -97.535  -43.193 1.00 232.90 ? 118 LYS K CA  1 
ATOM   9424  C C   . LYS J 2 96  ? -25.380 -98.487  -44.266 1.00 233.63 ? 118 LYS K C   1 
ATOM   9425  O O   . LYS J 2 96  ? -25.650 -98.303  -45.463 1.00 237.18 ? 118 LYS K O   1 
ATOM   9426  C CB  . LYS J 2 96  ? -27.200 -98.059  -42.599 1.00 232.27 ? 118 LYS K CB  1 
ATOM   9427  N N   . ASP J 2 97  ? -24.619 -99.497  -43.840 1.00 231.37 ? 119 ASP K N   1 
ATOM   9428  C CA  . ASP J 2 97  ? -24.038 -100.471 -44.769 1.00 232.33 ? 119 ASP K CA  1 
ATOM   9429  C C   . ASP J 2 97  ? -25.108 -101.372 -45.356 1.00 231.67 ? 119 ASP K C   1 
ATOM   9430  O O   . ASP J 2 97  ? -26.106 -101.639 -44.717 1.00 229.91 ? 119 ASP K O   1 
ATOM   9431  C CB  . ASP J 2 97  ? -22.971 -101.316 -44.073 1.00 232.81 ? 119 ASP K CB  1 
ATOM   9432  C CG  . ASP J 2 97  ? -21.763 -100.492 -43.625 1.00 232.22 ? 119 ASP K CG  1 
ATOM   9433  O OD1 . ASP J 2 97  ? -21.248 -99.657  -44.410 1.00 232.49 ? 119 ASP K OD1 1 
ATOM   9434  O OD2 . ASP J 2 97  ? -21.321 -100.679 -42.473 1.00 230.57 ? 119 ASP K OD2 1 
ATOM   9435  N N   . CYS J 2 98  ? -24.890 -101.842 -46.585 1.00 234.60 ? 120 CYS K N   1 
ATOM   9436  C CA  . CYS J 2 98  ? -25.800 -102.799 -47.231 1.00 238.27 ? 120 CYS K CA  1 
ATOM   9437  C C   . CYS J 2 98  ? -25.906 -104.052 -46.362 1.00 236.44 ? 120 CYS K C   1 
ATOM   9438  O O   . CYS J 2 98  ? -24.910 -104.541 -45.810 1.00 231.89 ? 120 CYS K O   1 
ATOM   9439  C CB  . CYS J 2 98  ? -25.309 -103.205 -48.639 1.00 243.46 ? 120 CYS K CB  1 
ATOM   9440  S SG  . CYS J 2 98  ? -25.693 -102.090 -50.028 1.00 247.10 ? 120 CYS K SG  1 
ATOM   9441  N N   . SER J 2 99  ? -27.131 -104.560 -46.245 1.00 238.68 ? 121 SER K N   1 
ATOM   9442  C CA  . SER J 2 99  ? -27.424 -105.743 -45.439 1.00 240.71 ? 121 SER K CA  1 
ATOM   9443  C C   . SER J 2 99  ? -26.812 -106.993 -46.058 1.00 243.30 ? 121 SER K C   1 
ATOM   9444  O O   . SER J 2 99  ? -26.220 -106.933 -47.141 1.00 247.48 ? 121 SER K O   1 
ATOM   9445  C CB  . SER J 2 99  ? -28.944 -105.917 -45.311 1.00 241.46 ? 121 SER K CB  1 
ATOM   9446  O OG  . SER J 2 99  ? -29.269 -106.984 -44.435 1.00 241.82 ? 121 SER K OG  1 
ATOM   9447  N N   . PHE J 2 100 ? -26.946 -108.126 -45.372 1.00 242.25 ? 122 PHE K N   1 
ATOM   9448  C CA  . PHE J 2 100 ? -26.463 -109.392 -45.921 1.00 241.84 ? 122 PHE K CA  1 
ATOM   9449  C C   . PHE J 2 100 ? -27.283 -109.764 -47.161 1.00 241.32 ? 122 PHE K C   1 
ATOM   9450  O O   . PHE J 2 100 ? -28.498 -109.557 -47.204 1.00 243.14 ? 122 PHE K O   1 
ATOM   9451  C CB  . PHE J 2 100 ? -26.527 -110.512 -44.883 1.00 240.05 ? 122 PHE K CB  1 
ATOM   9452  N N   . GLY J 2 101 ? -26.595 -110.284 -48.171 1.00 238.15 ? 123 GLY K N   1 
ATOM   9453  C CA  . GLY J 2 101 ? -27.198 -110.627 -49.460 1.00 234.90 ? 123 GLY K CA  1 
ATOM   9454  C C   . GLY J 2 101 ? -27.347 -109.485 -50.455 1.00 230.34 ? 123 GLY K C   1 
ATOM   9455  O O   . GLY J 2 101 ? -27.795 -109.714 -51.578 1.00 230.30 ? 123 GLY K O   1 
ATOM   9456  N N   . THR J 2 102 ? -26.969 -108.268 -50.060 1.00 225.31 ? 124 THR K N   1 
ATOM   9457  C CA  . THR J 2 102 ? -27.107 -107.076 -50.904 1.00 224.23 ? 124 THR K CA  1 
ATOM   9458  C C   . THR J 2 102 ? -25.765 -106.378 -51.107 1.00 221.02 ? 124 THR K C   1 
ATOM   9459  O O   . THR J 2 102 ? -24.834 -106.575 -50.326 1.00 223.52 ? 124 THR K O   1 
ATOM   9460  C CB  . THR J 2 102 ? -28.113 -106.074 -50.324 1.00 223.33 ? 124 THR K CB  1 
ATOM   9461  O OG1 . THR J 2 102 ? -28.001 -106.048 -48.894 1.00 221.02 ? 124 THR K OG1 1 
ATOM   9462  C CG2 . THR J 2 102 ? -29.522 -106.474 -50.714 1.00 225.10 ? 124 THR K CG2 1 
ATOM   9463  N N   . PHE J 2 103 ? -25.685 -105.563 -52.160 1.00 215.46 ? 125 PHE K N   1 
ATOM   9464  C CA  . PHE J 2 103 ? -24.451 -104.868 -52.517 1.00 212.15 ? 125 PHE K CA  1 
ATOM   9465  C C   . PHE J 2 103 ? -24.694 -103.550 -53.222 1.00 210.08 ? 125 PHE K C   1 
ATOM   9466  O O   . PHE J 2 103 ? -25.752 -103.327 -53.770 1.00 210.56 ? 125 PHE K O   1 
ATOM   9467  C CB  . PHE J 2 103 ? -23.585 -105.764 -53.413 1.00 214.48 ? 125 PHE K CB  1 
ATOM   9468  C CG  . PHE J 2 103 ? -23.936 -105.704 -54.876 1.00 215.22 ? 125 PHE K CG  1 
ATOM   9469  C CD1 . PHE J 2 103 ? -23.193 -104.920 -55.752 1.00 215.36 ? 125 PHE K CD1 1 
ATOM   9470  C CD2 . PHE J 2 103 ? -24.998 -106.438 -55.380 1.00 215.86 ? 125 PHE K CD2 1 
ATOM   9471  C CE1 . PHE J 2 103 ? -23.507 -104.870 -57.102 1.00 217.07 ? 125 PHE K CE1 1 
ATOM   9472  C CE2 . PHE J 2 103 ? -25.318 -106.390 -56.724 1.00 217.77 ? 125 PHE K CE2 1 
ATOM   9473  C CZ  . PHE J 2 103 ? -24.571 -105.608 -57.584 1.00 218.84 ? 125 PHE K CZ  1 
ATOM   9474  N N   . ASN J 2 104 ? -23.683 -102.694 -53.230 1.00 209.76 ? 126 ASN K N   1 
ATOM   9475  C CA  . ASN J 2 104 ? -23.713 -101.459 -54.004 1.00 211.11 ? 126 ASN K CA  1 
ATOM   9476  C C   . ASN J 2 104 ? -22.339 -101.247 -54.662 1.00 216.52 ? 126 ASN K C   1 
ATOM   9477  O O   . ASN J 2 104 ? -21.312 -101.210 -53.992 1.00 218.11 ? 126 ASN K O   1 
ATOM   9478  C CB  . ASN J 2 104 ? -24.092 -100.300 -53.094 1.00 206.38 ? 126 ASN K CB  1 
ATOM   9479  C CG  . ASN J 2 104 ? -24.243 -98.984  -53.836 1.00 205.52 ? 126 ASN K CG  1 
ATOM   9480  O OD1 . ASN J 2 104 ? -24.186 -98.939  -55.066 1.00 206.21 ? 126 ASN K OD1 1 
ATOM   9481  N ND2 . ASN J 2 104 ? -24.459 -97.902  -53.096 1.00 203.16 ? 126 ASN K ND2 1 
ATOM   9482  N N   . ASP J 2 105 ? -22.347 -101.145 -55.988 1.00 222.43 ? 127 ASP K N   1 
ATOM   9483  C CA  . ASP J 2 105 ? -21.134 -100.966 -56.781 1.00 225.09 ? 127 ASP K CA  1 
ATOM   9484  C C   . ASP J 2 105 ? -20.681 -99.510  -56.705 1.00 221.71 ? 127 ASP K C   1 
ATOM   9485  O O   . ASP J 2 105 ? -19.574 -99.227  -56.271 1.00 219.90 ? 127 ASP K O   1 
ATOM   9486  C CB  . ASP J 2 105 ? -21.408 -101.390 -58.240 1.00 231.57 ? 127 ASP K CB  1 
ATOM   9487  C CG  . ASP J 2 105 ? -20.190 -101.258 -59.152 1.00 235.61 ? 127 ASP K CG  1 
ATOM   9488  O OD1 . ASP J 2 105 ? -19.063 -101.607 -58.730 1.00 236.87 ? 127 ASP K OD1 1 
ATOM   9489  O OD2 . ASP J 2 105 ? -20.375 -100.821 -60.312 1.00 238.87 ? 127 ASP K OD2 1 
ATOM   9490  N N   . GLN J 2 106 ? -21.560 -98.593  -57.098 1.00 220.93 ? 128 GLN K N   1 
ATOM   9491  C CA  . GLN J 2 106 ? -21.203 -97.185  -57.305 1.00 221.27 ? 128 GLN K CA  1 
ATOM   9492  C C   . GLN J 2 106 ? -21.582 -96.290  -56.126 1.00 219.38 ? 128 GLN K C   1 
ATOM   9493  O O   . GLN J 2 106 ? -22.380 -96.675  -55.270 1.00 215.85 ? 128 GLN K O   1 
ATOM   9494  C CB  . GLN J 2 106 ? -21.877 -96.673  -58.584 1.00 222.63 ? 128 GLN K CB  1 
ATOM   9495  N N   . LYS J 2 107 ? -20.982 -95.095  -56.087 1.00 221.78 ? 129 LYS K N   1 
ATOM   9496  C CA  . LYS J 2 107 ? -21.350 -94.035  -55.123 1.00 220.10 ? 129 LYS K CA  1 
ATOM   9497  C C   . LYS J 2 107 ? -22.756 -93.509  -55.421 1.00 220.61 ? 129 LYS K C   1 
ATOM   9498  O O   . LYS J 2 107 ? -23.250 -93.601  -56.551 1.00 221.33 ? 129 LYS K O   1 
ATOM   9499  C CB  . LYS J 2 107 ? -20.341 -92.880  -55.172 1.00 218.92 ? 129 LYS K CB  1 
ATOM   9500  N N   . ARG J 2 108 ? -23.385 -92.954  -54.393 1.00 218.88 ? 130 ARG K N   1 
ATOM   9501  C CA  . ARG J 2 108 ? -24.785 -92.502  -54.412 1.00 218.38 ? 130 ARG K CA  1 
ATOM   9502  C C   . ARG J 2 108 ? -25.708 -93.522  -55.096 1.00 220.68 ? 130 ARG K C   1 
ATOM   9503  O O   . ARG J 2 108 ? -26.459 -93.176  -56.013 1.00 221.89 ? 130 ARG K O   1 
ATOM   9504  C CB  . ARG J 2 108 ? -24.908 -91.102  -55.039 1.00 217.85 ? 130 ARG K CB  1 
ATOM   9505  N N   . GLY J 2 109 ? -25.629 -94.777  -54.644 1.00 222.90 ? 131 GLY K N   1 
ATOM   9506  C CA  . GLY J 2 109 ? -26.409 -95.880  -55.214 1.00 227.16 ? 131 GLY K CA  1 
ATOM   9507  C C   . GLY J 2 109 ? -27.368 -96.528  -54.235 1.00 228.05 ? 131 GLY K C   1 
ATOM   9508  O O   . GLY J 2 109 ? -27.564 -96.042  -53.125 1.00 227.80 ? 131 GLY K O   1 
ATOM   9509  N N   . ILE J 2 110 ? -27.960 -97.639  -54.670 1.00 231.53 ? 132 ILE K N   1 
ATOM   9510  C CA  . ILE J 2 110 ? -28.983 -98.384  -53.920 1.00 232.92 ? 132 ILE K CA  1 
ATOM   9511  C C   . ILE J 2 110 ? -28.503 -99.824  -53.730 1.00 233.83 ? 132 ILE K C   1 
ATOM   9512  O O   . ILE J 2 110 ? -27.793 -100.364 -54.586 1.00 235.38 ? 132 ILE K O   1 
ATOM   9513  C CB  . ILE J 2 110 ? -30.329 -98.357  -54.684 1.00 236.67 ? 132 ILE K CB  1 
ATOM   9514  C CG1 . ILE J 2 110 ? -30.911 -96.934  -54.678 1.00 236.99 ? 132 ILE K CG1 1 
ATOM   9515  C CG2 . ILE J 2 110 ? -31.339 -99.344  -54.096 1.00 236.27 ? 132 ILE K CG2 1 
ATOM   9516  C CD1 . ILE J 2 110 ? -31.939 -96.678  -55.765 1.00 239.07 ? 132 ILE K CD1 1 
ATOM   9517  N N   . CYS J 2 111 ? -28.896 -100.439 -52.612 1.00 234.56 ? 133 CYS K N   1 
ATOM   9518  C CA  . CYS J 2 111 ? -28.536 -101.835 -52.314 1.00 238.15 ? 133 CYS K CA  1 
ATOM   9519  C C   . CYS J 2 111 ? -29.353 -102.833 -53.128 1.00 236.30 ? 133 CYS K C   1 
ATOM   9520  O O   . CYS J 2 111 ? -30.435 -103.242 -52.714 1.00 232.44 ? 133 CYS K O   1 
ATOM   9521  C CB  . CYS J 2 111 ? -28.697 -102.154 -50.817 1.00 241.33 ? 133 CYS K CB  1 
ATOM   9522  S SG  . CYS J 2 111 ? -27.550 -101.297 -49.671 1.00 247.48 ? 133 CYS K SG  1 
ATOM   9523  N N   . ARG J 2 112 ? -28.824 -103.223 -54.286 1.00 239.18 ? 134 ARG K N   1 
ATOM   9524  C CA  . ARG J 2 112 ? -29.359 -104.336 -55.076 1.00 243.71 ? 134 ARG K CA  1 
ATOM   9525  C C   . ARG J 2 112 ? -28.945 -105.659 -54.410 1.00 241.71 ? 134 ARG K C   1 
ATOM   9526  O O   . ARG J 2 112 ? -27.976 -105.682 -53.654 1.00 244.27 ? 134 ARG K O   1 
ATOM   9527  C CB  . ARG J 2 112 ? -28.806 -104.286 -56.500 1.00 250.13 ? 134 ARG K CB  1 
ATOM   9528  C CG  . ARG J 2 112 ? -29.143 -103.020 -57.266 1.00 255.74 ? 134 ARG K CG  1 
ATOM   9529  C CD  . ARG J 2 112 ? -28.403 -102.972 -58.593 1.00 261.64 ? 134 ARG K CD  1 
ATOM   9530  N NE  . ARG J 2 112 ? -26.979 -102.668 -58.432 1.00 264.16 ? 134 ARG K NE  1 
ATOM   9531  C CZ  . ARG J 2 112 ? -26.086 -102.621 -59.426 1.00 267.51 ? 134 ARG K CZ  1 
ATOM   9532  N NH1 . ARG J 2 112 ? -26.450 -102.865 -60.690 1.00 270.56 ? 134 ARG K NH1 1 
ATOM   9533  N NH2 . ARG J 2 112 ? -24.812 -102.328 -59.158 1.00 265.80 ? 134 ARG K NH2 1 
ATOM   9534  N N   . PRO J 2 113 ? -29.666 -106.766 -54.682 1.00 240.65 ? 135 PRO K N   1 
ATOM   9535  C CA  . PRO J 2 113 ? -29.280 -108.076 -54.147 1.00 240.87 ? 135 PRO K CA  1 
ATOM   9536  C C   . PRO J 2 113 ? -28.295 -108.814 -55.069 1.00 242.90 ? 135 PRO K C   1 
ATOM   9537  O O   . PRO J 2 113 ? -28.268 -108.549 -56.272 1.00 247.03 ? 135 PRO K O   1 
ATOM   9538  C CB  . PRO J 2 113 ? -30.611 -108.818 -54.084 1.00 241.66 ? 135 PRO K CB  1 
ATOM   9539  C CG  . PRO J 2 113 ? -31.368 -108.282 -55.249 1.00 243.80 ? 135 PRO K CG  1 
ATOM   9540  C CD  . PRO J 2 113 ? -30.883 -106.874 -55.505 1.00 242.90 ? 135 PRO K CD  1 
ATOM   9541  N N   . TRP J 2 114 ? -27.504 -109.730 -54.505 1.00 239.97 ? 136 TRP K N   1 
ATOM   9542  C CA  . TRP J 2 114 ? -26.484 -110.458 -55.283 1.00 238.45 ? 136 TRP K CA  1 
ATOM   9543  C C   . TRP J 2 114 ? -27.144 -111.305 -56.360 1.00 240.15 ? 136 TRP K C   1 
ATOM   9544  O O   . TRP J 2 114 ? -28.163 -111.940 -56.089 1.00 238.48 ? 136 TRP K O   1 
ATOM   9545  C CB  . TRP J 2 114 ? -25.654 -111.408 -54.412 1.00 235.64 ? 136 TRP K CB  1 
ATOM   9546  C CG  . TRP J 2 114 ? -24.902 -110.794 -53.284 1.00 231.87 ? 136 TRP K CG  1 
ATOM   9547  C CD1 . TRP J 2 114 ? -24.345 -109.557 -53.244 1.00 229.50 ? 136 TRP K CD1 1 
ATOM   9548  C CD2 . TRP J 2 114 ? -24.588 -111.418 -52.036 1.00 229.01 ? 136 TRP K CD2 1 
ATOM   9549  N NE1 . TRP J 2 114 ? -23.719 -109.356 -52.036 1.00 226.17 ? 136 TRP K NE1 1 
ATOM   9550  C CE2 . TRP J 2 114 ? -23.852 -110.486 -51.276 1.00 226.31 ? 136 TRP K CE2 1 
ATOM   9551  C CE3 . TRP J 2 114 ? -24.861 -112.678 -51.483 1.00 228.19 ? 136 TRP K CE3 1 
ATOM   9552  C CZ2 . TRP J 2 114 ? -23.387 -110.769 -49.989 1.00 224.53 ? 136 TRP K CZ2 1 
ATOM   9553  C CZ3 . TRP J 2 114 ? -24.401 -112.962 -50.205 1.00 225.83 ? 136 TRP K CZ3 1 
ATOM   9554  C CH2 . TRP J 2 114 ? -23.671 -112.010 -49.471 1.00 224.61 ? 136 TRP K CH2 1 
ATOM   9555  N N   . THR J 2 115 ? -26.570 -111.321 -57.560 1.00 243.30 ? 137 THR K N   1 
ATOM   9556  C CA  . THR J 2 115 ? -27.107 -112.157 -58.634 1.00 247.39 ? 137 THR K CA  1 
ATOM   9557  C C   . THR J 2 115 ? -27.006 -113.612 -58.207 1.00 248.27 ? 137 THR K C   1 
ATOM   9558  O O   . THR J 2 115 ? -25.921 -114.078 -57.894 1.00 250.09 ? 137 THR K O   1 
ATOM   9559  C CB  . THR J 2 115 ? -26.351 -111.977 -59.967 1.00 250.42 ? 137 THR K CB  1 
ATOM   9560  O OG1 . THR J 2 115 ? -24.946 -111.936 -59.713 1.00 251.54 ? 137 THR K OG1 1 
ATOM   9561  C CG2 . THR J 2 115 ? -26.766 -110.695 -60.656 1.00 251.88 ? 137 THR K CG2 1 
ATOM   9562  N N   . ASN J 2 116 ? -28.146 -114.298 -58.168 1.00 249.80 ? 138 ASN K N   1 
ATOM   9563  C CA  . ASN J 2 116 ? -28.205 -115.709 -57.807 1.00 252.46 ? 138 ASN K CA  1 
ATOM   9564  C C   . ASN J 2 116 ? -27.904 -116.550 -59.054 1.00 256.31 ? 138 ASN K C   1 
ATOM   9565  O O   . ASN J 2 116 ? -28.726 -116.636 -59.965 1.00 257.42 ? 138 ASN K O   1 
ATOM   9566  C CB  . ASN J 2 116 ? -29.593 -116.057 -57.248 1.00 252.62 ? 138 ASN K CB  1 
ATOM   9567  C CG  . ASN J 2 116 ? -29.691 -117.488 -56.736 1.00 254.78 ? 138 ASN K CG  1 
ATOM   9568  O OD1 . ASN J 2 116 ? -28.705 -118.230 -56.698 1.00 256.99 ? 138 ASN K OD1 1 
ATOM   9569  N ND2 . ASN J 2 116 ? -30.897 -117.882 -56.344 1.00 254.42 ? 138 ASN K ND2 1 
ATOM   9570  N N   . CYS J 2 117 ? -26.721 -117.154 -59.086 1.00 257.68 ? 139 CYS K N   1 
ATOM   9571  C CA  . CYS J 2 117 ? -26.277 -117.921 -60.249 1.00 260.49 ? 139 CYS K CA  1 
ATOM   9572  C C   . CYS J 2 117 ? -27.001 -119.274 -60.341 1.00 262.65 ? 139 CYS K C   1 
ATOM   9573  O O   . CYS J 2 117 ? -27.215 -119.775 -61.445 1.00 266.35 ? 139 CYS K O   1 
ATOM   9574  C CB  . CYS J 2 117 ? -24.745 -118.134 -60.229 1.00 259.86 ? 139 CYS K CB  1 
ATOM   9575  S SG  . CYS J 2 117 ? -23.777 -116.745 -59.596 1.00 256.30 ? 139 CYS K SG  1 
ATOM   9576  N N   . SER J 2 118 ? -27.386 -119.844 -59.191 1.00 260.61 ? 140 SER K N   1 
ATOM   9577  C CA  . SER J 2 118 ? -28.206 -121.063 -59.148 1.00 262.28 ? 140 SER K CA  1 
ATOM   9578  C C   . SER J 2 118 ? -29.520 -120.900 -59.922 1.00 265.40 ? 140 SER K C   1 
ATOM   9579  O O   . SER J 2 118 ? -29.864 -121.747 -60.748 1.00 265.89 ? 140 SER K O   1 
ATOM   9580  C CB  . SER J 2 118 ? -28.504 -121.462 -57.699 1.00 258.40 ? 140 SER K CB  1 
ATOM   9581  N N   . LEU J 2 119 ? -30.230 -119.797 -59.664 1.00 268.07 ? 141 LEU K N   1 
ATOM   9582  C CA  . LEU J 2 119 ? -31.462 -119.441 -60.400 1.00 270.06 ? 141 LEU K CA  1 
ATOM   9583  C C   . LEU J 2 119 ? -31.203 -119.150 -61.894 1.00 274.89 ? 141 LEU K C   1 
ATOM   9584  O O   . LEU J 2 119 ? -32.083 -119.368 -62.731 1.00 280.05 ? 141 LEU K O   1 
ATOM   9585  C CB  . LEU J 2 119 ? -32.169 -118.239 -59.741 1.00 264.17 ? 141 LEU K CB  1 
ATOM   9586  N N   . ASP J 2 120 ? -30.005 -118.655 -62.212 1.00 274.61 ? 142 ASP K N   1 
ATOM   9587  C CA  . ASP J 2 120 ? -29.588 -118.383 -63.596 1.00 274.75 ? 142 ASP K CA  1 
ATOM   9588  C C   . ASP J 2 120 ? -28.985 -119.588 -64.337 1.00 275.94 ? 142 ASP K C   1 
ATOM   9589  O O   . ASP J 2 120 ? -28.762 -119.493 -65.547 1.00 278.65 ? 142 ASP K O   1 
ATOM   9590  C CB  . ASP J 2 120 ? -28.581 -117.223 -63.616 1.00 273.08 ? 142 ASP K CB  1 
ATOM   9591  N N   . GLY J 2 121 ? -28.719 -120.700 -63.635 1.00 274.38 ? 143 GLY K N   1 
ATOM   9592  C CA  . GLY J 2 121 ? -28.132 -121.912 -64.240 1.00 275.54 ? 143 GLY K CA  1 
ATOM   9593  C C   . GLY J 2 121 ? -26.701 -122.223 -63.816 1.00 273.18 ? 143 GLY K C   1 
ATOM   9594  O O   . GLY J 2 121 ? -26.370 -123.379 -63.547 1.00 273.00 ? 143 GLY K O   1 
ATOM   9595  N N   . LYS J 2 122 ? -25.856 -121.189 -63.749 1.00 269.45 ? 144 LYS K N   1 
ATOM   9596  C CA  . LYS J 2 122 ? -24.425 -121.325 -63.413 1.00 267.14 ? 144 LYS K CA  1 
ATOM   9597  C C   . LYS J 2 122 ? -24.151 -121.642 -61.921 1.00 262.38 ? 144 LYS K C   1 
ATOM   9598  O O   . LYS J 2 122 ? -25.065 -122.014 -61.165 1.00 260.95 ? 144 LYS K O   1 
ATOM   9599  C CB  . LYS J 2 122 ? -23.677 -120.046 -63.829 1.00 266.03 ? 144 LYS K CB  1 
ATOM   9600  N N   . SER J 2 123 ? -22.882 -121.551 -61.523 1.00 258.90 ? 145 SER K N   1 
ATOM   9601  C CA  . SER J 2 123 ? -22.468 -121.743 -60.123 1.00 253.74 ? 145 SER K CA  1 
ATOM   9602  C C   . SER J 2 123 ? -21.374 -120.746 -59.754 1.00 249.88 ? 145 SER K C   1 
ATOM   9603  O O   . SER J 2 123 ? -20.639 -120.258 -60.617 1.00 251.61 ? 145 SER K O   1 
ATOM   9604  C CB  . SER J 2 123 ? -21.984 -123.174 -59.863 1.00 254.97 ? 145 SER K CB  1 
ATOM   9605  O OG  . SER J 2 123 ? -20.906 -123.513 -60.710 1.00 257.01 ? 145 SER K OG  1 
ATOM   9606  N N   . VAL J 2 124 ? -21.280 -120.437 -58.460 1.00 243.61 ? 146 VAL K N   1 
ATOM   9607  C CA  . VAL J 2 124 ? -20.409 -119.332 -58.005 1.00 239.19 ? 146 VAL K CA  1 
ATOM   9608  C C   . VAL J 2 124 ? -18.922 -119.706 -58.099 1.00 238.13 ? 146 VAL K C   1 
ATOM   9609  O O   . VAL J 2 124 ? -18.546 -120.768 -57.651 1.00 239.15 ? 146 VAL K O   1 
ATOM   9610  C CB  . VAL J 2 124 ? -20.805 -118.811 -56.597 1.00 236.22 ? 146 VAL K CB  1 
ATOM   9611  C CG1 . VAL J 2 124 ? -22.206 -118.181 -56.651 1.00 234.44 ? 146 VAL K CG1 1 
ATOM   9612  C CG2 . VAL J 2 124 ? -20.712 -119.895 -55.521 1.00 235.71 ? 146 VAL K CG2 1 
ATOM   9613  N N   . LEU J 2 125 ? -18.097 -118.839 -58.707 1.00 235.79 ? 147 LEU K N   1 
ATOM   9614  C CA  . LEU J 2 125 ? -16.630 -118.968 -58.669 1.00 234.59 ? 147 LEU K CA  1 
ATOM   9615  C C   . LEU J 2 125 ? -15.981 -118.015 -57.655 1.00 229.78 ? 147 LEU K C   1 
ATOM   9616  O O   . LEU J 2 125 ? -14.791 -118.106 -57.396 1.00 230.29 ? 147 LEU K O   1 
ATOM   9617  C CB  . LEU J 2 125 ? -16.031 -118.733 -60.065 1.00 237.19 ? 147 LEU K CB  1 
ATOM   9618  N N   . VAL J 2 126 ? -16.768 -117.093 -57.095 1.00 225.28 ? 148 VAL K N   1 
ATOM   9619  C CA  . VAL J 2 126 ? -16.325 -116.178 -56.048 1.00 221.39 ? 148 VAL K CA  1 
ATOM   9620  C C   . VAL J 2 126 ? -17.594 -115.568 -55.424 1.00 217.67 ? 148 VAL K C   1 
ATOM   9621  O O   . VAL J 2 126 ? -18.504 -115.205 -56.159 1.00 217.03 ? 148 VAL K O   1 
ATOM   9622  C CB  . VAL J 2 126 ? -15.404 -115.074 -56.626 1.00 221.31 ? 148 VAL K CB  1 
ATOM   9623  N N   . ASN J 2 127 ? -17.663 -115.490 -54.098 1.00 214.77 ? 149 ASN K N   1 
ATOM   9624  C CA  . ASN J 2 127 ? -18.896 -115.096 -53.404 1.00 211.64 ? 149 ASN K CA  1 
ATOM   9625  C C   . ASN J 2 127 ? -19.076 -113.585 -53.482 1.00 208.38 ? 149 ASN K C   1 
ATOM   9626  O O   . ASN J 2 127 ? -18.198 -112.886 -53.977 1.00 210.08 ? 149 ASN K O   1 
ATOM   9627  C CB  . ASN J 2 127 ? -18.841 -115.560 -51.919 1.00 210.80 ? 149 ASN K CB  1 
ATOM   9628  C CG  . ASN J 2 127 ? -20.211 -115.924 -51.343 1.00 210.00 ? 149 ASN K CG  1 
ATOM   9629  O OD1 . ASN J 2 127 ? -21.178 -115.182 -51.496 1.00 209.30 ? 149 ASN K OD1 1 
ATOM   9630  N ND2 . ASN J 2 127 ? -20.289 -117.079 -50.672 1.00 210.64 ? 149 ASN K ND2 1 
ATOM   9631  N N   . GLY J 2 128 ? -20.208 -113.075 -52.996 1.00 204.17 ? 150 GLY K N   1 
ATOM   9632  C CA  . GLY J 2 128 ? -20.517 -111.646 -53.069 1.00 200.96 ? 150 GLY K CA  1 
ATOM   9633  C C   . GLY J 2 128 ? -20.002 -110.934 -51.844 1.00 197.06 ? 150 GLY K C   1 
ATOM   9634  O O   . GLY J 2 128 ? -19.307 -111.523 -51.018 1.00 195.88 ? 150 GLY K O   1 
ATOM   9635  N N   . THR J 2 129 ? -20.365 -109.663 -51.712 1.00 194.07 ? 151 THR K N   1 
ATOM   9636  C CA  . THR J 2 129 ? -19.921 -108.822 -50.594 1.00 190.26 ? 151 THR K CA  1 
ATOM   9637  C C   . THR J 2 129 ? -20.719 -107.510 -50.557 1.00 187.46 ? 151 THR K C   1 
ATOM   9638  O O   . THR J 2 129 ? -21.500 -107.229 -51.460 1.00 187.23 ? 151 THR K O   1 
ATOM   9639  C CB  . THR J 2 129 ? -18.391 -108.545 -50.653 1.00 190.85 ? 151 THR K CB  1 
ATOM   9640  O OG1 . THR J 2 129 ? -18.025 -107.583 -49.661 1.00 188.68 ? 151 THR K OG1 1 
ATOM   9641  C CG2 . THR J 2 129 ? -17.953 -108.009 -52.010 1.00 193.20 ? 151 THR K CG2 1 
ATOM   9642  N N   . LYS J 2 130 ? -20.512 -106.712 -49.513 1.00 184.72 ? 152 LYS K N   1 
ATOM   9643  C CA  . LYS J 2 130 ? -21.205 -105.429 -49.355 1.00 182.99 ? 152 LYS K CA  1 
ATOM   9644  C C   . LYS J 2 130 ? -20.949 -104.431 -50.490 1.00 183.71 ? 152 LYS K C   1 
ATOM   9645  O O   . LYS J 2 130 ? -21.778 -103.548 -50.693 1.00 182.70 ? 152 LYS K O   1 
ATOM   9646  C CB  . LYS J 2 130 ? -20.841 -104.772 -48.009 1.00 180.58 ? 152 LYS K CB  1 
ATOM   9647  N N   . GLU J 2 131 ? -19.822 -104.550 -51.209 1.00 185.29 ? 153 GLU K N   1 
ATOM   9648  C CA  . GLU J 2 131 ? -19.491 -103.622 -52.310 1.00 186.07 ? 153 GLU K CA  1 
ATOM   9649  C C   . GLU J 2 131 ? -19.281 -104.288 -53.670 1.00 188.29 ? 153 GLU K C   1 
ATOM   9650  O O   . GLU J 2 131 ? -18.727 -103.657 -54.569 1.00 189.52 ? 153 GLU K O   1 
ATOM   9651  C CB  . GLU J 2 131 ? -18.234 -102.791 -51.980 1.00 185.71 ? 153 GLU K CB  1 
ATOM   9652  N N   . ARG J 2 132 ? -19.711 -105.537 -53.844 1.00 188.84 ? 154 ARG K N   1 
ATOM   9653  C CA  . ARG J 2 132 ? -19.489 -106.232 -55.113 1.00 191.74 ? 154 ARG K CA  1 
ATOM   9654  C C   . ARG J 2 132 ? -20.443 -107.399 -55.312 1.00 192.08 ? 154 ARG K C   1 
ATOM   9655  O O   . ARG J 2 132 ? -20.726 -108.139 -54.378 1.00 190.39 ? 154 ARG K O   1 
ATOM   9656  C CB  . ARG J 2 132 ? -18.043 -106.725 -55.205 1.00 193.42 ? 154 ARG K CB  1 
ATOM   9657  N N   . ASP J 2 133 ? -20.921 -107.557 -56.543 1.00 194.36 ? 155 ASP K N   1 
ATOM   9658  C CA  . ASP J 2 133 ? -21.785 -108.683 -56.894 1.00 196.17 ? 155 ASP K CA  1 
ATOM   9659  C C   . ASP J 2 133 ? -20.951 -109.968 -56.942 1.00 197.77 ? 155 ASP K C   1 
ATOM   9660  O O   . ASP J 2 133 ? -19.720 -109.922 -57.026 1.00 198.57 ? 155 ASP K O   1 
ATOM   9661  C CB  . ASP J 2 133 ? -22.478 -108.449 -58.248 1.00 198.21 ? 155 ASP K CB  1 
ATOM   9662  N N   . VAL J 2 135 ? -19.258 -113.247 -58.502 1.00 236.34 ? 157 VAL K N   1 
ATOM   9663  C CA  . VAL J 2 135 ? -19.082 -113.752 -59.857 1.00 239.43 ? 157 VAL K CA  1 
ATOM   9664  C C   . VAL J 2 135 ? -19.402 -115.244 -59.907 1.00 241.00 ? 157 VAL K C   1 
ATOM   9665  O O   . VAL J 2 135 ? -19.079 -115.991 -58.992 1.00 239.42 ? 157 VAL K O   1 
ATOM   9666  C CB  . VAL J 2 135 ? -17.645 -113.520 -60.357 1.00 240.57 ? 157 VAL K CB  1 
ATOM   9667  N N   . CYS J 2 136 ? -20.084 -115.646 -60.985 1.00 245.06 ? 158 CYS K N   1 
ATOM   9668  C CA  . CYS J 2 136 ? -20.410 -117.042 -61.259 1.00 249.29 ? 158 CYS K CA  1 
ATOM   9669  C C   . CYS J 2 136 ? -19.311 -117.543 -62.185 1.00 251.27 ? 158 CYS K C   1 
ATOM   9670  O O   . CYS J 2 136 ? -19.190 -118.738 -62.467 1.00 251.75 ? 158 CYS K O   1 
ATOM   9671  C CB  . CYS J 2 136 ? -21.814 -117.175 -61.898 1.00 252.52 ? 158 CYS K CB  1 
ATOM   9672  S SG  . CYS J 2 136 ? -22.989 -115.935 -61.293 1.00 252.72 ? 158 CYS K SG  1 
ATOM   9673  N N   . SER K 2 7   ? 39.218  -38.436  -34.710 1.00 199.08 ? 29  SER L N   1 
ATOM   9674  C CA  . SER K 2 7   ? 39.749  -37.511  -33.651 1.00 205.27 ? 29  SER L CA  1 
ATOM   9675  C C   . SER K 2 7   ? 39.440  -36.045  -34.034 1.00 209.52 ? 29  SER L C   1 
ATOM   9676  O O   . SER K 2 7   ? 38.330  -35.807  -34.553 1.00 208.31 ? 29  SER L O   1 
ATOM   9677  C CB  . SER K 2 7   ? 41.234  -37.824  -33.369 1.00 207.29 ? 29  SER L CB  1 
ATOM   9678  O OG  . SER K 2 7   ? 42.054  -37.321  -34.404 1.00 204.25 ? 29  SER L OG  1 
ATOM   9679  N N   . ASN K 2 8   ? 40.350  -35.099  -33.791 1.00 217.93 ? 30  ASN L N   1 
ATOM   9680  C CA  . ASN K 2 8   ? 40.069  -33.689  -33.980 1.00 219.65 ? 30  ASN L CA  1 
ATOM   9681  C C   . ASN K 2 8   ? 41.358  -32.870  -33.910 1.00 230.07 ? 30  ASN L C   1 
ATOM   9682  O O   . ASN K 2 8   ? 42.268  -33.222  -33.194 1.00 233.46 ? 30  ASN L O   1 
ATOM   9683  C CB  . ASN K 2 8   ? 39.079  -33.224  -32.903 1.00 215.17 ? 30  ASN L CB  1 
ATOM   9684  N N   . CYS K 2 9   ? 41.409  -31.746  -34.624 1.00 235.47 ? 31  CYS L N   1 
ATOM   9685  C CA  . CYS K 2 9   ? 42.488  -30.764  -34.544 1.00 236.03 ? 31  CYS L CA  1 
ATOM   9686  C C   . CYS K 2 9   ? 42.461  -30.035  -33.202 1.00 232.01 ? 31  CYS L C   1 
ATOM   9687  O O   . CYS K 2 9   ? 41.392  -29.615  -32.720 1.00 228.31 ? 31  CYS L O   1 
ATOM   9688  C CB  . CYS K 2 9   ? 42.323  -29.720  -35.668 1.00 236.12 ? 31  CYS L CB  1 
ATOM   9689  S SG  . CYS K 2 9   ? 42.040  -30.336  -37.342 1.00 244.25 ? 31  CYS L SG  1 
ATOM   9690  N N   . ALA K 2 11  ? 42.115  -25.014  -32.298 1.00 200.99 ? 33  ALA L N   1 
ATOM   9691  C CA  . ALA K 2 11  ? 41.543  -23.721  -32.670 1.00 197.62 ? 33  ALA L CA  1 
ATOM   9692  C C   . ALA K 2 11  ? 42.386  -23.067  -33.768 1.00 198.33 ? 33  ALA L C   1 
ATOM   9693  O O   . ALA K 2 11  ? 43.607  -23.236  -33.803 1.00 205.16 ? 33  ALA L O   1 
ATOM   9694  C CB  . ALA K 2 11  ? 41.455  -22.803  -31.457 1.00 197.13 ? 33  ALA L CB  1 
ATOM   9695  N N   . GLY K 2 12  ? 41.725  -22.319  -34.653 1.00 196.96 ? 34  GLY L N   1 
ATOM   9696  C CA  . GLY K 2 12  ? 42.360  -21.742  -35.841 1.00 199.76 ? 34  GLY L CA  1 
ATOM   9697  C C   . GLY K 2 12  ? 42.340  -22.640  -37.075 1.00 205.25 ? 34  GLY L C   1 
ATOM   9698  O O   . GLY K 2 12  ? 42.840  -22.243  -38.132 1.00 211.32 ? 34  GLY L O   1 
ATOM   9699  N N   . THR K 2 13  ? 41.769  -23.843  -36.947 1.00 206.54 ? 35  THR L N   1 
ATOM   9700  C CA  . THR K 2 13  ? 41.699  -24.828  -38.030 1.00 206.58 ? 35  THR L CA  1 
ATOM   9701  C C   . THR K 2 13  ? 40.351  -25.545  -38.001 1.00 202.71 ? 35  THR L C   1 
ATOM   9702  O O   . THR K 2 13  ? 39.547  -25.335  -37.085 1.00 205.54 ? 35  THR L O   1 
ATOM   9703  C CB  . THR K 2 13  ? 42.809  -25.897  -37.900 1.00 213.12 ? 35  THR L CB  1 
ATOM   9704  O OG1 . THR K 2 13  ? 42.694  -26.564  -36.636 1.00 218.05 ? 35  THR L OG1 1 
ATOM   9705  C CG2 . THR K 2 13  ? 44.195  -25.274  -38.010 1.00 218.12 ? 35  THR L CG2 1 
ATOM   9706  N N   . PHE K 2 14  ? 40.116  -26.390  -39.004 1.00 199.15 ? 36  PHE L N   1 
ATOM   9707  C CA  . PHE K 2 14  ? 38.939  -27.265  -39.037 1.00 199.33 ? 36  PHE L CA  1 
ATOM   9708  C C   . PHE K 2 14  ? 39.266  -28.634  -39.640 1.00 215.65 ? 36  PHE L C   1 
ATOM   9709  O O   . PHE K 2 14  ? 40.224  -28.771  -40.413 1.00 227.68 ? 36  PHE L O   1 
ATOM   9710  C CB  . PHE K 2 14  ? 37.783  -26.601  -39.805 1.00 184.13 ? 36  PHE L CB  1 
ATOM   9711  C CG  . PHE K 2 14  ? 38.017  -26.479  -41.288 1.00 176.36 ? 36  PHE L CG  1 
ATOM   9712  C CD1 . PHE K 2 14  ? 37.420  -27.374  -42.180 1.00 173.42 ? 36  PHE L CD1 1 
ATOM   9713  C CD2 . PHE K 2 14  ? 38.821  -25.466  -41.801 1.00 175.40 ? 36  PHE L CD2 1 
ATOM   9714  C CE1 . PHE K 2 14  ? 37.628  -27.264  -43.546 1.00 173.31 ? 36  PHE L CE1 1 
ATOM   9715  C CE2 . PHE K 2 14  ? 39.030  -25.353  -43.174 1.00 174.76 ? 36  PHE L CE2 1 
ATOM   9716  C CZ  . PHE K 2 14  ? 38.434  -26.252  -44.044 1.00 172.27 ? 36  PHE L CZ  1 
ATOM   9717  N N   . CYS K 2 15  ? 38.454  -29.628  -39.283 1.00 221.45 ? 37  CYS L N   1 
ATOM   9718  C CA  . CYS K 2 15  ? 38.610  -31.001  -39.767 1.00 222.34 ? 37  CYS L CA  1 
ATOM   9719  C C   . CYS K 2 15  ? 37.980  -31.151  -41.160 1.00 218.45 ? 37  CYS L C   1 
ATOM   9720  O O   . CYS K 2 15  ? 36.791  -31.472  -41.293 1.00 220.65 ? 37  CYS L O   1 
ATOM   9721  C CB  . CYS K 2 15  ? 37.973  -31.972  -38.766 1.00 225.07 ? 37  CYS L CB  1 
ATOM   9722  S SG  . CYS K 2 15  ? 38.076  -33.727  -39.197 1.00 236.23 ? 37  CYS L SG  1 
ATOM   9723  N N   . ASP K 2 16  ? 38.792  -30.917  -42.189 1.00 214.48 ? 38  ASP L N   1 
ATOM   9724  C CA  . ASP K 2 16  ? 38.320  -30.839  -43.575 1.00 215.69 ? 38  ASP L CA  1 
ATOM   9725  C C   . ASP K 2 16  ? 37.889  -32.220  -44.104 1.00 215.88 ? 38  ASP L C   1 
ATOM   9726  O O   . ASP K 2 16  ? 38.726  -33.038  -44.483 1.00 222.44 ? 38  ASP L O   1 
ATOM   9727  C CB  . ASP K 2 16  ? 39.425  -30.221  -44.455 1.00 218.89 ? 38  ASP L CB  1 
ATOM   9728  C CG  . ASP K 2 16  ? 38.935  -29.794  -45.842 1.00 218.06 ? 38  ASP L CG  1 
ATOM   9729  O OD1 . ASP K 2 16  ? 37.831  -30.187  -46.268 1.00 217.16 ? 38  ASP L OD1 1 
ATOM   9730  O OD2 . ASP K 2 16  ? 39.685  -29.059  -46.521 1.00 215.86 ? 38  ASP L OD2 1 
ATOM   9731  N N   . ASN K 2 17  ? 36.579  -32.459  -44.136 1.00 217.12 ? 39  ASN L N   1 
ATOM   9732  C CA  . ASN K 2 17  ? 36.022  -33.748  -44.574 1.00 220.63 ? 39  ASN L CA  1 
ATOM   9733  C C   . ASN K 2 17  ? 36.053  -33.961  -46.093 1.00 226.65 ? 39  ASN L C   1 
ATOM   9734  O O   . ASN K 2 17  ? 35.856  -35.085  -46.552 1.00 230.60 ? 39  ASN L O   1 
ATOM   9735  C CB  . ASN K 2 17  ? 34.586  -33.931  -44.064 1.00 215.63 ? 39  ASN L CB  1 
ATOM   9736  C CG  . ASN K 2 17  ? 34.498  -33.952  -42.545 1.00 212.94 ? 39  ASN L CG  1 
ATOM   9737  O OD1 . ASN K 2 17  ? 35.385  -34.467  -41.867 1.00 211.02 ? 39  ASN L OD1 1 
ATOM   9738  N ND2 . ASN K 2 17  ? 33.417  -33.390  -42.003 1.00 211.87 ? 39  ASN L ND2 1 
ATOM   9739  N N   . ASN K 2 18  ? 36.275  -32.896  -46.865 1.00 229.21 ? 40  ASN L N   1 
ATOM   9740  C CA  . ASN K 2 18  ? 36.485  -33.017  -48.310 1.00 228.91 ? 40  ASN L CA  1 
ATOM   9741  C C   . ASN K 2 18  ? 37.913  -33.506  -48.622 1.00 227.90 ? 40  ASN L C   1 
ATOM   9742  O O   . ASN K 2 18  ? 38.099  -34.336  -49.517 1.00 225.92 ? 40  ASN L O   1 
ATOM   9743  C CB  . ASN K 2 18  ? 36.187  -31.686  -49.016 1.00 226.57 ? 40  ASN L CB  1 
ATOM   9744  N N   . ARG K 2 19  ? 38.903  -33.010  -47.872 1.00 223.06 ? 41  ARG L N   1 
ATOM   9745  C CA  . ARG K 2 19  ? 40.317  -33.400  -48.031 1.00 224.94 ? 41  ARG L CA  1 
ATOM   9746  C C   . ARG K 2 19  ? 40.807  -34.345  -46.908 1.00 227.60 ? 41  ARG L C   1 
ATOM   9747  O O   . ARG K 2 19  ? 41.903  -34.169  -46.362 1.00 227.31 ? 41  ARG L O   1 
ATOM   9748  C CB  . ARG K 2 19  ? 41.203  -32.150  -48.110 1.00 224.51 ? 41  ARG L CB  1 
ATOM   9749  N N   . ASN K 2 20  ? 39.986  -35.358  -46.595 1.00 228.26 ? 42  ASN L N   1 
ATOM   9750  C CA  . ASN K 2 20  ? 40.287  -36.434  -45.630 1.00 231.70 ? 42  ASN L CA  1 
ATOM   9751  C C   . ASN K 2 20  ? 40.840  -35.983  -44.273 1.00 233.45 ? 42  ASN L C   1 
ATOM   9752  O O   . ASN K 2 20  ? 42.046  -36.063  -44.022 1.00 241.27 ? 42  ASN L O   1 
ATOM   9753  C CB  . ASN K 2 20  ? 41.222  -37.486  -46.264 1.00 232.73 ? 42  ASN L CB  1 
ATOM   9754  C CG  . ASN K 2 20  ? 40.517  -38.382  -47.271 1.00 229.17 ? 42  ASN L CG  1 
ATOM   9755  O OD1 . ASN K 2 20  ? 39.418  -38.087  -47.731 1.00 225.65 ? 42  ASN L OD1 1 
ATOM   9756  N ND2 . ASN K 2 20  ? 41.164  -39.474  -47.631 1.00 232.05 ? 42  ASN L ND2 1 
ATOM   9757  N N   . GLN K 2 21  ? 39.952  -35.472  -43.420 1.00 230.24 ? 43  GLN L N   1 
ATOM   9758  C CA  . GLN K 2 21  ? 40.228  -35.218  -41.990 1.00 229.06 ? 43  GLN L CA  1 
ATOM   9759  C C   . GLN K 2 21  ? 41.412  -34.296  -41.618 1.00 232.21 ? 43  GLN L C   1 
ATOM   9760  O O   . GLN K 2 21  ? 41.677  -34.103  -40.428 1.00 230.11 ? 43  GLN L O   1 
ATOM   9761  C CB  . GLN K 2 21  ? 40.404  -36.557  -41.249 1.00 228.44 ? 43  GLN L CB  1 
ATOM   9762  C CG  . GLN K 2 21  ? 39.428  -37.663  -41.636 1.00 225.49 ? 43  GLN L CG  1 
ATOM   9763  C CD  . GLN K 2 21  ? 37.977  -37.257  -41.481 1.00 221.40 ? 43  GLN L CD  1 
ATOM   9764  O OE1 . GLN K 2 21  ? 37.197  -37.338  -42.429 1.00 217.88 ? 43  GLN L OE1 1 
ATOM   9765  N NE2 . GLN K 2 21  ? 37.608  -36.811  -40.281 1.00 220.56 ? 43  GLN L NE2 1 
ATOM   9766  N N   . ILE K 2 22  ? 42.101  -33.720  -42.605 1.00 233.05 ? 44  ILE L N   1 
ATOM   9767  C CA  . ILE K 2 22  ? 43.312  -32.934  -42.352 1.00 234.48 ? 44  ILE L CA  1 
ATOM   9768  C C   . ILE K 2 22  ? 42.955  -31.589  -41.718 1.00 228.14 ? 44  ILE L C   1 
ATOM   9769  O O   . ILE K 2 22  ? 41.916  -31.005  -42.026 1.00 227.72 ? 44  ILE L O   1 
ATOM   9770  C CB  . ILE K 2 22  ? 44.156  -32.730  -43.636 1.00 238.22 ? 44  ILE L CB  1 
ATOM   9771  C CG1 . ILE K 2 22  ? 45.560  -32.210  -43.270 1.00 243.45 ? 44  ILE L CG1 1 
ATOM   9772  C CG2 . ILE K 2 22  ? 43.466  -31.803  -44.643 1.00 233.85 ? 44  ILE L CG2 1 
ATOM   9773  C CD1 . ILE K 2 22  ? 46.545  -32.225  -44.420 1.00 243.11 ? 44  ILE L CD1 1 
ATOM   9774  N N   . CYS K 2 23  ? 43.815  -31.105  -40.819 1.00 224.30 ? 45  CYS L N   1 
ATOM   9775  C CA  . CYS K 2 23  ? 43.614  -29.845  -40.141 1.00 223.27 ? 45  CYS L CA  1 
ATOM   9776  C C   . CYS K 2 23  ? 43.957  -28.646  -41.013 1.00 219.67 ? 45  CYS L C   1 
ATOM   9777  O O   . CYS K 2 23  ? 45.044  -28.079  -40.904 1.00 222.77 ? 45  CYS L O   1 
ATOM   9778  C CB  . CYS K 2 23  ? 44.422  -29.848  -38.824 1.00 228.72 ? 45  CYS L CB  1 
ATOM   9779  S SG  . CYS K 2 23  ? 43.828  -31.129  -37.671 1.00 235.36 ? 45  CYS L SG  1 
ATOM   9780  N N   . SER K 2 24  ? 43.010  -28.273  -41.869 1.00 211.89 ? 46  SER L N   1 
ATOM   9781  C CA  . SER K 2 24  ? 43.153  -27.103  -42.754 1.00 206.62 ? 46  SER L CA  1 
ATOM   9782  C C   . SER K 2 24  ? 42.953  -25.816  -41.948 1.00 202.20 ? 46  SER L C   1 
ATOM   9783  O O   . SER K 2 24  ? 42.126  -25.798  -41.033 1.00 196.10 ? 46  SER L O   1 
ATOM   9784  C CB  . SER K 2 24  ? 42.134  -27.143  -43.892 1.00 200.68 ? 46  SER L CB  1 
ATOM   9785  O OG  . SER K 2 24  ? 42.185  -28.379  -44.586 1.00 198.35 ? 46  SER L OG  1 
ATOM   9786  N N   . PRO K 2 25  ? 43.692  -24.734  -42.286 1.00 200.65 ? 47  PRO L N   1 
ATOM   9787  C CA  . PRO K 2 25  ? 43.467  -23.483  -41.563 1.00 201.16 ? 47  PRO L CA  1 
ATOM   9788  C C   . PRO K 2 25  ? 42.148  -22.831  -41.973 1.00 200.08 ? 47  PRO L C   1 
ATOM   9789  O O   . PRO K 2 25  ? 41.648  -23.084  -43.081 1.00 191.43 ? 47  PRO L O   1 
ATOM   9790  C CB  . PRO K 2 25  ? 44.663  -22.601  -41.966 1.00 202.15 ? 47  PRO L CB  1 
ATOM   9791  C CG  . PRO K 2 25  ? 45.473  -23.392  -42.934 1.00 203.53 ? 47  PRO L CG  1 
ATOM   9792  C CD  . PRO K 2 25  ? 44.637  -24.541  -43.397 1.00 202.87 ? 47  PRO L CD  1 
ATOM   9793  N N   . CYS K 2 26  ? 41.596  -22.010  -41.077 1.00 200.26 ? 48  CYS L N   1 
ATOM   9794  C CA  . CYS K 2 26  ? 40.349  -21.303  -41.348 1.00 194.64 ? 48  CYS L CA  1 
ATOM   9795  C C   . CYS K 2 26  ? 40.538  -20.386  -42.559 1.00 191.82 ? 48  CYS L C   1 
ATOM   9796  O O   . CYS K 2 26  ? 41.505  -19.619  -42.596 1.00 192.68 ? 48  CYS L O   1 
ATOM   9797  C CB  . CYS K 2 26  ? 39.886  -20.470  -40.132 1.00 196.55 ? 48  CYS L CB  1 
ATOM   9798  S SG  . CYS K 2 26  ? 39.103  -21.370  -38.760 1.00 200.86 ? 48  CYS L SG  1 
ATOM   9799  N N   . PRO K 2 27  ? 39.627  -20.467  -43.553 1.00 187.28 ? 49  PRO L N   1 
ATOM   9800  C CA  . PRO K 2 27  ? 39.746  -19.597  -44.733 1.00 189.58 ? 49  PRO L CA  1 
ATOM   9801  C C   . PRO K 2 27  ? 39.537  -18.107  -44.401 1.00 190.20 ? 49  PRO L C   1 
ATOM   9802  O O   . PRO K 2 27  ? 39.287  -17.768  -43.240 1.00 190.21 ? 49  PRO L O   1 
ATOM   9803  C CB  . PRO K 2 27  ? 38.666  -20.133  -45.688 1.00 184.16 ? 49  PRO L CB  1 
ATOM   9804  C CG  . PRO K 2 27  ? 37.724  -20.910  -44.845 1.00 180.10 ? 49  PRO L CG  1 
ATOM   9805  C CD  . PRO K 2 27  ? 38.470  -21.377  -43.640 1.00 182.09 ? 49  PRO L CD  1 
ATOM   9806  N N   . PRO K 2 28  ? 39.669  -17.213  -45.400 1.00 191.98 ? 50  PRO L N   1 
ATOM   9807  C CA  . PRO K 2 28  ? 39.511  -15.788  -45.094 1.00 193.97 ? 50  PRO L CA  1 
ATOM   9808  C C   . PRO K 2 28  ? 38.124  -15.438  -44.533 1.00 196.45 ? 50  PRO L C   1 
ATOM   9809  O O   . PRO K 2 28  ? 37.119  -16.029  -44.947 1.00 192.07 ? 50  PRO L O   1 
ATOM   9810  C CB  . PRO K 2 28  ? 39.753  -15.099  -46.446 1.00 191.14 ? 50  PRO L CB  1 
ATOM   9811  C CG  . PRO K 2 28  ? 40.540  -16.076  -47.242 1.00 192.84 ? 50  PRO L CG  1 
ATOM   9812  C CD  . PRO K 2 28  ? 40.060  -17.431  -46.804 1.00 193.82 ? 50  PRO L CD  1 
ATOM   9813  N N   . ASN K 2 29  ? 38.107  -14.487  -43.594 1.00 196.72 ? 51  ASN L N   1 
ATOM   9814  C CA  . ASN K 2 29  ? 36.892  -14.023  -42.909 1.00 191.40 ? 51  ASN L CA  1 
ATOM   9815  C C   . ASN K 2 29  ? 36.211  -15.114  -42.071 1.00 183.77 ? 51  ASN L C   1 
ATOM   9816  O O   . ASN K 2 29  ? 34.982  -15.162  -42.004 1.00 185.95 ? 51  ASN L O   1 
ATOM   9817  C CB  . ASN K 2 29  ? 35.876  -13.429  -43.904 1.00 193.50 ? 51  ASN L CB  1 
ATOM   9818  C CG  . ASN K 2 29  ? 36.505  -12.465  -44.885 1.00 196.60 ? 51  ASN L CG  1 
ATOM   9819  O OD1 . ASN K 2 29  ? 37.257  -11.568  -44.499 1.00 203.23 ? 51  ASN L OD1 1 
ATOM   9820  N ND2 . ASN K 2 29  ? 36.197  -12.643  -46.165 1.00 197.89 ? 51  ASN L ND2 1 
ATOM   9821  N N   . SER K 2 30  ? 36.997  -15.971  -41.418 1.00 174.78 ? 52  SER L N   1 
ATOM   9822  C CA  . SER K 2 30  ? 36.433  -17.033  -40.577 1.00 167.40 ? 52  SER L CA  1 
ATOM   9823  C C   . SER K 2 30  ? 37.327  -17.404  -39.411 1.00 166.18 ? 52  SER L C   1 
ATOM   9824  O O   . SER K 2 30  ? 38.514  -17.084  -39.408 1.00 171.92 ? 52  SER L O   1 
ATOM   9825  C CB  . SER K 2 30  ? 36.132  -18.275  -41.412 1.00 164.66 ? 52  SER L CB  1 
ATOM   9826  O OG  . SER K 2 30  ? 37.286  -18.754  -42.067 1.00 164.59 ? 52  SER L OG  1 
ATOM   9827  N N   . PHE K 2 31  ? 36.746  -18.091  -38.431 1.00 163.85 ? 53  PHE L N   1 
ATOM   9828  C CA  . PHE K 2 31  ? 37.432  -18.398  -37.179 1.00 167.32 ? 53  PHE L CA  1 
ATOM   9829  C C   . PHE K 2 31  ? 36.906  -19.672  -36.522 1.00 171.45 ? 53  PHE L C   1 
ATOM   9830  O O   . PHE K 2 31  ? 35.868  -20.211  -36.916 1.00 174.36 ? 53  PHE L O   1 
ATOM   9831  C CB  . PHE K 2 31  ? 37.282  -17.218  -36.198 1.00 165.30 ? 53  PHE L CB  1 
ATOM   9832  C CG  . PHE K 2 31  ? 35.936  -17.149  -35.532 1.00 165.38 ? 53  PHE L CG  1 
ATOM   9833  C CD1 . PHE K 2 31  ? 35.754  -17.626  -34.237 1.00 165.15 ? 53  PHE L CD1 1 
ATOM   9834  C CD2 . PHE K 2 31  ? 34.840  -16.622  -36.207 1.00 170.32 ? 53  PHE L CD2 1 
ATOM   9835  C CE1 . PHE K 2 31  ? 34.514  -17.578  -33.623 1.00 167.60 ? 53  PHE L CE1 1 
ATOM   9836  C CE2 . PHE K 2 31  ? 33.591  -16.564  -35.602 1.00 170.86 ? 53  PHE L CE2 1 
ATOM   9837  C CZ  . PHE K 2 31  ? 33.427  -17.049  -34.309 1.00 171.13 ? 53  PHE L CZ  1 
ATOM   9838  N N   . SER K 2 32  ? 37.646  -20.133  -35.515 1.00 176.11 ? 54  SER L N   1 
ATOM   9839  C CA  . SER K 2 32  ? 37.194  -21.184  -34.596 1.00 178.00 ? 54  SER L CA  1 
ATOM   9840  C C   . SER K 2 32  ? 37.940  -21.041  -33.270 1.00 184.47 ? 54  SER L C   1 
ATOM   9841  O O   . SER K 2 32  ? 39.158  -21.200  -33.234 1.00 188.02 ? 54  SER L O   1 
ATOM   9842  C CB  . SER K 2 32  ? 37.421  -22.578  -35.189 1.00 177.40 ? 54  SER L CB  1 
ATOM   9843  O OG  . SER K 2 32  ? 38.770  -22.769  -35.580 1.00 182.32 ? 54  SER L OG  1 
ATOM   9844  N N   . SER K 2 33  ? 37.213  -20.711  -32.200 1.00 189.16 ? 55  SER L N   1 
ATOM   9845  C CA  . SER K 2 33  ? 37.803  -20.542  -30.858 1.00 192.06 ? 55  SER L CA  1 
ATOM   9846  C C   . SER K 2 33  ? 37.798  -21.830  -30.028 1.00 197.16 ? 55  SER L C   1 
ATOM   9847  O O   . SER K 2 33  ? 38.166  -21.809  -28.850 1.00 204.71 ? 55  SER L O   1 
ATOM   9848  C CB  . SER K 2 33  ? 37.098  -19.413  -30.092 1.00 189.68 ? 55  SER L CB  1 
ATOM   9849  O OG  . SER K 2 33  ? 35.725  -19.690  -29.931 1.00 194.73 ? 55  SER L OG  1 
ATOM   9850  N N   . ALA K 2 34  ? 37.367  -22.938  -30.633 1.00 196.25 ? 56  ALA L N   1 
ATOM   9851  C CA  . ALA K 2 34  ? 37.487  -24.272  -30.043 1.00 198.20 ? 56  ALA L CA  1 
ATOM   9852  C C   . ALA K 2 34  ? 38.048  -25.249  -31.075 1.00 201.37 ? 56  ALA L C   1 
ATOM   9853  O O   . ALA K 2 34  ? 38.054  -24.970  -32.282 1.00 202.37 ? 56  ALA L O   1 
ATOM   9854  C CB  . ALA K 2 34  ? 36.135  -24.744  -29.537 1.00 198.20 ? 56  ALA L CB  1 
ATOM   9855  N N   . GLY K 2 35  ? 38.541  -26.383  -30.582 1.00 206.85 ? 57  GLY L N   1 
ATOM   9856  C CA  . GLY K 2 35  ? 39.054  -27.450  -31.434 1.00 209.48 ? 57  GLY L CA  1 
ATOM   9857  C C   . GLY K 2 35  ? 37.950  -28.386  -31.883 1.00 209.06 ? 57  GLY L C   1 
ATOM   9858  O O   . GLY K 2 35  ? 36.809  -28.290  -31.417 1.00 208.90 ? 57  GLY L O   1 
ATOM   9859  N N   . GLY K 2 36  ? 38.298  -29.278  -32.811 1.00 206.36 ? 58  GLY L N   1 
ATOM   9860  C CA  . GLY K 2 36  ? 37.389  -30.333  -33.251 1.00 201.22 ? 58  GLY L CA  1 
ATOM   9861  C C   . GLY K 2 36  ? 36.226  -29.953  -34.149 1.00 194.22 ? 58  GLY L C   1 
ATOM   9862  O O   . GLY K 2 36  ? 35.399  -30.802  -34.462 1.00 191.10 ? 58  GLY L O   1 
ATOM   9863  N N   . GLN K 2 37  ? 36.166  -28.694  -34.586 1.00 190.36 ? 59  GLN L N   1 
ATOM   9864  C CA  . GLN K 2 37  ? 35.057  -28.217  -35.424 1.00 188.98 ? 59  GLN L CA  1 
ATOM   9865  C C   . GLN K 2 37  ? 35.222  -28.695  -36.873 1.00 189.32 ? 59  GLN L C   1 
ATOM   9866  O O   . GLN K 2 37  ? 36.337  -28.675  -37.409 1.00 195.29 ? 59  GLN L O   1 
ATOM   9867  C CB  . GLN K 2 37  ? 34.955  -26.688  -35.366 1.00 186.05 ? 59  GLN L CB  1 
ATOM   9868  C CG  . GLN K 2 37  ? 34.675  -26.120  -33.972 1.00 183.70 ? 59  GLN L CG  1 
ATOM   9869  C CD  . GLN K 2 37  ? 34.516  -24.598  -33.962 1.00 180.03 ? 59  GLN L CD  1 
ATOM   9870  O OE1 . GLN K 2 37  ? 34.253  -23.971  -34.997 1.00 179.38 ? 59  GLN L OE1 1 
ATOM   9871  N NE2 . GLN K 2 37  ? 34.671  -23.998  -32.787 1.00 173.87 ? 59  GLN L NE2 1 
ATOM   9872  N N   . ARG K 2 38  ? 34.124  -29.135  -37.490 1.00 181.45 ? 60  ARG L N   1 
ATOM   9873  C CA  . ARG K 2 38  ? 34.138  -29.594  -38.891 1.00 174.84 ? 60  ARG L CA  1 
ATOM   9874  C C   . ARG K 2 38  ? 34.147  -28.432  -39.897 1.00 170.02 ? 60  ARG L C   1 
ATOM   9875  O O   . ARG K 2 38  ? 34.458  -28.645  -41.073 1.00 161.05 ? 60  ARG L O   1 
ATOM   9876  C CB  . ARG K 2 38  ? 32.952  -30.521  -39.177 1.00 168.79 ? 60  ARG L CB  1 
ATOM   9877  N N   . THR K 2 39  ? 33.783  -27.230  -39.436 1.00 169.27 ? 61  THR L N   1 
ATOM   9878  C CA  . THR K 2 39  ? 33.886  -25.996  -40.226 1.00 168.31 ? 61  THR L CA  1 
ATOM   9879  C C   . THR K 2 39  ? 34.213  -24.801  -39.336 1.00 165.74 ? 61  THR L C   1 
ATOM   9880  O O   . THR K 2 39  ? 33.942  -24.819  -38.131 1.00 162.48 ? 61  THR L O   1 
ATOM   9881  C CB  . THR K 2 39  ? 32.567  -25.658  -40.956 1.00 169.02 ? 61  THR L CB  1 
ATOM   9882  O OG1 . THR K 2 39  ? 31.472  -25.704  -40.033 1.00 169.75 ? 61  THR L OG1 1 
ATOM   9883  C CG2 . THR K 2 39  ? 32.324  -26.616  -42.120 1.00 171.01 ? 61  THR L CG2 1 
ATOM   9884  N N   . CYS K 2 40  ? 34.788  -23.767  -39.942 1.00 165.52 ? 62  CYS L N   1 
ATOM   9885  C CA  . CYS K 2 40  ? 35.024  -22.502  -39.254 1.00 171.33 ? 62  CYS L CA  1 
ATOM   9886  C C   . CYS K 2 40  ? 33.775  -21.633  -39.372 1.00 167.45 ? 62  CYS L C   1 
ATOM   9887  O O   . CYS K 2 40  ? 33.028  -21.737  -40.348 1.00 165.50 ? 62  CYS L O   1 
ATOM   9888  C CB  . CYS K 2 40  ? 36.246  -21.782  -39.839 1.00 180.72 ? 62  CYS L CB  1 
ATOM   9889  S SG  . CYS K 2 40  ? 37.804  -22.691  -39.634 1.00 194.22 ? 62  CYS L SG  1 
ATOM   9890  N N   . ASP K 2 41  ? 33.558  -20.788  -38.368 1.00 163.56 ? 63  ASP L N   1 
ATOM   9891  C CA  . ASP K 2 41  ? 32.407  -19.883  -38.328 1.00 162.10 ? 63  ASP L CA  1 
ATOM   9892  C C   . ASP K 2 41  ? 32.746  -18.585  -39.046 1.00 159.03 ? 63  ASP L C   1 
ATOM   9893  O O   . ASP K 2 41  ? 33.901  -18.201  -39.068 1.00 160.42 ? 63  ASP L O   1 
ATOM   9894  C CB  . ASP K 2 41  ? 32.036  -19.580  -36.876 1.00 164.11 ? 63  ASP L CB  1 
ATOM   9895  C CG  . ASP K 2 41  ? 31.721  -20.829  -36.070 1.00 172.43 ? 63  ASP L CG  1 
ATOM   9896  O OD1 . ASP K 2 41  ? 31.293  -21.848  -36.657 1.00 181.40 ? 63  ASP L OD1 1 
ATOM   9897  O OD2 . ASP K 2 41  ? 31.897  -20.791  -34.835 1.00 175.01 ? 63  ASP L OD2 1 
ATOM   9898  N N   . ILE K 2 42  ? 31.745  -17.908  -39.600 1.00 159.22 ? 64  ILE L N   1 
ATOM   9899  C CA  . ILE K 2 42  ? 31.961  -16.662  -40.355 1.00 159.21 ? 64  ILE L CA  1 
ATOM   9900  C C   . ILE K 2 42  ? 32.292  -15.522  -39.379 1.00 162.72 ? 64  ILE L C   1 
ATOM   9901  O O   . ILE K 2 42  ? 31.652  -15.397  -38.339 1.00 160.91 ? 64  ILE L O   1 
ATOM   9902  C CB  . ILE K 2 42  ? 30.710  -16.215  -41.158 1.00 157.03 ? 64  ILE L CB  1 
ATOM   9903  C CG1 . ILE K 2 42  ? 30.162  -17.320  -42.076 1.00 155.05 ? 64  ILE L CG1 1 
ATOM   9904  C CG2 . ILE K 2 42  ? 31.011  -14.923  -41.929 1.00 155.73 ? 64  ILE L CG2 1 
ATOM   9905  C CD1 . ILE K 2 42  ? 30.939  -17.510  -43.345 1.00 156.44 ? 64  ILE L CD1 1 
ATOM   9906  N N   . CYS K 2 43  ? 33.272  -14.694  -39.737 1.00 169.91 ? 65  CYS L N   1 
ATOM   9907  C CA  . CYS K 2 43  ? 33.675  -13.548  -38.914 1.00 173.10 ? 65  CYS L CA  1 
ATOM   9908  C C   . CYS K 2 43  ? 32.586  -12.483  -38.926 1.00 168.01 ? 65  CYS L C   1 
ATOM   9909  O O   . CYS K 2 43  ? 31.978  -12.233  -39.965 1.00 165.69 ? 65  CYS L O   1 
ATOM   9910  C CB  . CYS K 2 43  ? 34.989  -12.918  -39.420 1.00 183.19 ? 65  CYS L CB  1 
ATOM   9911  S SG  . CYS K 2 43  ? 36.523  -13.745  -38.906 1.00 195.33 ? 65  CYS L SG  1 
ATOM   9912  N N   . ARG K 2 44  ? 32.358  -11.855  -37.776 1.00 165.98 ? 66  ARG L N   1 
ATOM   9913  C CA  . ARG K 2 44  ? 31.377  -10.775  -37.665 1.00 165.18 ? 66  ARG L CA  1 
ATOM   9914  C C   . ARG K 2 44  ? 31.851  -9.566   -38.458 1.00 159.25 ? 66  ARG L C   1 
ATOM   9915  O O   . ARG K 2 44  ? 33.047  -9.367   -38.617 1.00 160.14 ? 66  ARG L O   1 
ATOM   9916  C CB  . ARG K 2 44  ? 31.165  -10.402  -36.192 1.00 173.58 ? 66  ARG L CB  1 
ATOM   9917  C CG  . ARG K 2 44  ? 30.171  -9.282   -35.911 1.00 183.40 ? 66  ARG L CG  1 
ATOM   9918  C CD  . ARG K 2 44  ? 29.364  -9.530   -34.637 1.00 194.22 ? 66  ARG L CD  1 
ATOM   9919  N NE  . ARG K 2 44  ? 30.229  -9.884   -33.507 1.00 206.59 ? 66  ARG L NE  1 
ATOM   9920  C CZ  . ARG K 2 44  ? 29.840  -10.465  -32.368 1.00 216.81 ? 66  ARG L CZ  1 
ATOM   9921  N NH1 . ARG K 2 44  ? 28.567  -10.811  -32.161 1.00 221.41 ? 66  ARG L NH1 1 
ATOM   9922  N NH2 . ARG K 2 44  ? 30.750  -10.728  -31.426 1.00 219.89 ? 66  ARG L NH2 1 
ATOM   9923  N N   . GLN K 2 45  ? 30.913  -8.779   -38.959 1.00 154.49 ? 67  GLN L N   1 
ATOM   9924  C CA  . GLN K 2 45  ? 31.202  -7.549   -39.691 1.00 154.16 ? 67  GLN L CA  1 
ATOM   9925  C C   . GLN K 2 45  ? 30.674  -6.425   -38.815 1.00 153.52 ? 67  GLN L C   1 
ATOM   9926  O O   . GLN K 2 45  ? 29.543  -6.514   -38.319 1.00 155.24 ? 67  GLN L O   1 
ATOM   9927  C CB  . GLN K 2 45  ? 30.436  -7.528   -41.011 1.00 155.81 ? 67  GLN L CB  1 
ATOM   9928  C CG  . GLN K 2 45  ? 31.258  -7.326   -42.282 1.00 155.47 ? 67  GLN L CG  1 
ATOM   9929  C CD  . GLN K 2 45  ? 31.395  -8.628   -43.048 1.00 151.96 ? 67  GLN L CD  1 
ATOM   9930  O OE1 . GLN K 2 45  ? 31.924  -9.606   -42.518 1.00 162.78 ? 67  GLN L OE1 1 
ATOM   9931  N NE2 . GLN K 2 45  ? 30.885  -8.666   -44.273 1.00 145.35 ? 67  GLN L NE2 1 
ATOM   9932  N N   . CYS K 2 46  ? 31.459  -5.375   -38.636 1.00 148.01 ? 68  CYS L N   1 
ATOM   9933  C CA  . CYS K 2 46  ? 31.006  -4.213   -37.889 1.00 146.64 ? 68  CYS L CA  1 
ATOM   9934  C C   . CYS K 2 46  ? 30.945  -3.048   -38.851 1.00 137.17 ? 68  CYS L C   1 
ATOM   9935  O O   . CYS K 2 46  ? 31.940  -2.367   -39.063 1.00 132.63 ? 68  CYS L O   1 
ATOM   9936  C CB  . CYS K 2 46  ? 31.939  -3.919   -36.715 1.00 158.50 ? 68  CYS L CB  1 
ATOM   9937  S SG  . CYS K 2 46  ? 32.185  -5.346   -35.645 1.00 172.99 ? 68  CYS L SG  1 
ATOM   9938  N N   . LYS K 2 47  ? 29.782  -2.852   -39.457 1.00 133.33 ? 69  LYS L N   1 
ATOM   9939  C CA  . LYS K 2 47  ? 29.591  -1.787   -40.435 1.00 137.38 ? 69  LYS L CA  1 
ATOM   9940  C C   . LYS K 2 47  ? 28.388  -0.936   -40.063 1.00 135.10 ? 69  LYS L C   1 
ATOM   9941  O O   . LYS K 2 47  ? 27.744  -1.208   -39.060 1.00 137.93 ? 69  LYS L O   1 
ATOM   9942  C CB  . LYS K 2 47  ? 29.462  -2.391   -41.835 1.00 139.35 ? 69  LYS L CB  1 
ATOM   9943  C CG  . LYS K 2 47  ? 30.583  -3.375   -42.127 1.00 139.65 ? 69  LYS L CG  1 
ATOM   9944  C CD  . LYS K 2 47  ? 30.750  -3.625   -43.614 1.00 144.24 ? 69  LYS L CD  1 
ATOM   9945  C CE  . LYS K 2 47  ? 32.116  -4.214   -43.936 1.00 149.53 ? 69  LYS L CE  1 
ATOM   9946  N NZ  . LYS K 2 47  ? 32.130  -4.866   -45.279 1.00 153.13 ? 69  LYS L NZ  1 
ATOM   9947  N N   . GLY K 2 48  ? 28.118  0.108    -40.845 1.00 131.98 ? 70  GLY L N   1 
ATOM   9948  C CA  . GLY K 2 48  ? 26.986  1.004    -40.602 1.00 127.72 ? 70  GLY L CA  1 
ATOM   9949  C C   . GLY K 2 48  ? 27.158  1.772    -39.304 1.00 122.51 ? 70  GLY L C   1 
ATOM   9950  O O   . GLY K 2 48  ? 28.134  2.501    -39.141 1.00 125.90 ? 70  GLY L O   1 
ATOM   9951  N N   . VAL K 2 49  ? 26.233  1.592    -38.362 1.00 117.49 ? 71  VAL L N   1 
ATOM   9952  C CA  . VAL K 2 49  ? 26.381  2.207    -37.049 1.00 122.15 ? 71  VAL L CA  1 
ATOM   9953  C C   . VAL K 2 49  ? 27.386  1.497    -36.153 1.00 123.47 ? 71  VAL L C   1 
ATOM   9954  O O   . VAL K 2 49  ? 27.673  1.976    -35.059 1.00 126.63 ? 71  VAL L O   1 
ATOM   9955  C CB  . VAL K 2 49  ? 25.042  2.353    -36.289 1.00 126.06 ? 71  VAL L CB  1 
ATOM   9956  C CG1 . VAL K 2 49  ? 24.154  3.382    -36.991 1.00 126.91 ? 71  VAL L CG1 1 
ATOM   9957  C CG2 . VAL K 2 49  ? 24.335  1.003    -36.097 1.00 126.89 ? 71  VAL L CG2 1 
ATOM   9958  N N   . PHE K 2 50  ? 27.896  0.345    -36.587 1.00 126.70 ? 72  PHE L N   1 
ATOM   9959  C CA  . PHE K 2 50  ? 28.927  -0.360   -35.835 1.00 130.57 ? 72  PHE L CA  1 
ATOM   9960  C C   . PHE K 2 50  ? 30.330  -0.009   -36.320 1.00 136.15 ? 72  PHE L C   1 
ATOM   9961  O O   . PHE K 2 50  ? 30.584  0.028    -37.522 1.00 130.50 ? 72  PHE L O   1 
ATOM   9962  C CB  . PHE K 2 50  ? 28.726  -1.869   -35.916 1.00 130.99 ? 72  PHE L CB  1 
ATOM   9963  C CG  . PHE K 2 50  ? 27.419  -2.338   -35.363 1.00 131.07 ? 72  PHE L CG  1 
ATOM   9964  C CD1 . PHE K 2 50  ? 27.124  -2.196   -34.019 1.00 135.72 ? 72  PHE L CD1 1 
ATOM   9965  C CD2 . PHE K 2 50  ? 26.473  -2.938   -36.191 1.00 135.11 ? 72  PHE L CD2 1 
ATOM   9966  C CE1 . PHE K 2 50  ? 25.894  -2.620   -33.523 1.00 141.40 ? 72  PHE L CE1 1 
ATOM   9967  C CE2 . PHE K 2 50  ? 25.258  -3.359   -35.693 1.00 136.58 ? 72  PHE L CE2 1 
ATOM   9968  C CZ  . PHE K 2 50  ? 24.975  -3.207   -34.374 1.00 136.53 ? 72  PHE L CZ  1 
ATOM   9969  N N   . ARG K 2 51  ? 31.215  0.264    -35.351 1.00 148.21 ? 73  ARG L N   1 
ATOM   9970  C CA  . ARG K 2 51  ? 32.665  0.317    -35.552 1.00 150.87 ? 73  ARG L CA  1 
ATOM   9971  C C   . ARG K 2 51  ? 33.255  -0.973   -34.991 1.00 150.46 ? 73  ARG L C   1 
ATOM   9972  O O   . ARG K 2 51  ? 32.712  -1.546   -34.047 1.00 146.67 ? 73  ARG L O   1 
ATOM   9973  C CB  . ARG K 2 51  ? 33.280  1.513    -34.813 1.00 151.79 ? 73  ARG L CB  1 
ATOM   9974  N N   . THR K 2 52  ? 34.372  -1.415   -35.563 1.00 155.20 ? 74  THR L N   1 
ATOM   9975  C CA  . THR K 2 52  ? 35.103  -2.565   -35.035 1.00 162.86 ? 74  THR L CA  1 
ATOM   9976  C C   . THR K 2 52  ? 35.876  -2.177   -33.767 1.00 173.67 ? 74  THR L C   1 
ATOM   9977  O O   . THR K 2 52  ? 36.667  -1.230   -33.786 1.00 176.58 ? 74  THR L O   1 
ATOM   9978  C CB  . THR K 2 52  ? 36.108  -3.111   -36.068 1.00 162.53 ? 74  THR L CB  1 
ATOM   9979  O OG1 . THR K 2 52  ? 35.468  -3.223   -37.344 1.00 163.83 ? 74  THR L OG1 1 
ATOM   9980  C CG2 . THR K 2 52  ? 36.650  -4.476   -35.645 1.00 161.31 ? 74  THR L CG2 1 
ATOM   9981  N N   . ARG K 2 53  ? 35.642  -2.903   -32.673 1.00 182.74 ? 75  ARG L N   1 
ATOM   9982  C CA  . ARG K 2 53  ? 36.408  -2.730   -31.434 1.00 188.45 ? 75  ARG L CA  1 
ATOM   9983  C C   . ARG K 2 53  ? 37.640  -3.652   -31.442 1.00 186.60 ? 75  ARG L C   1 
ATOM   9984  O O   . ARG K 2 53  ? 38.744  -3.205   -31.172 1.00 190.18 ? 75  ARG L O   1 
ATOM   9985  C CB  . ARG K 2 53  ? 35.533  -3.021   -30.215 1.00 197.48 ? 75  ARG L CB  1 
ATOM   9986  C CG  . ARG K 2 53  ? 36.159  -2.545   -28.905 1.00 210.26 ? 75  ARG L CG  1 
ATOM   9987  C CD  . ARG K 2 53  ? 35.325  -2.950   -27.703 1.00 223.21 ? 75  ARG L CD  1 
ATOM   9988  N NE  . ARG K 2 53  ? 35.317  -4.405   -27.510 1.00 230.68 ? 75  ARG L NE  1 
ATOM   9989  C CZ  . ARG K 2 53  ? 34.558  -5.061   -26.626 1.00 232.68 ? 75  ARG L CZ  1 
ATOM   9990  N NH1 . ARG K 2 53  ? 33.710  -4.417   -25.823 1.00 241.71 ? 75  ARG L NH1 1 
ATOM   9991  N NH2 . ARG K 2 53  ? 34.641  -6.379   -26.543 1.00 226.23 ? 75  ARG L NH2 1 
ATOM   9992  N N   . LYS K 2 54  ? 37.427  -4.933   -31.728 1.00 184.09 ? 76  LYS L N   1 
ATOM   9993  C CA  . LYS K 2 54  ? 38.498  -5.925   -31.845 1.00 179.58 ? 76  LYS L CA  1 
ATOM   9994  C C   . LYS K 2 54  ? 38.422  -6.606   -33.205 1.00 180.79 ? 76  LYS L C   1 
ATOM   9995  O O   . LYS K 2 54  ? 37.356  -7.022   -33.620 1.00 179.41 ? 76  LYS L O   1 
ATOM   9996  C CB  . LYS K 2 54  ? 38.361  -6.974   -30.740 1.00 174.40 ? 76  LYS L CB  1 
ATOM   9997  N N   . GLU K 2 55  ? 39.548  -6.718   -33.897 1.00 187.26 ? 77  GLU L N   1 
ATOM   9998  C CA  . GLU K 2 55  ? 39.594  -7.304   -35.244 1.00 192.93 ? 77  GLU L CA  1 
ATOM   9999  C C   . GLU K 2 55  ? 39.418  -8.830   -35.194 1.00 197.49 ? 77  GLU L C   1 
ATOM   10000 O O   . GLU K 2 55  ? 39.686  -9.452   -34.167 1.00 199.08 ? 77  GLU L O   1 
ATOM   10001 C CB  . GLU K 2 55  ? 40.932  -6.948   -35.915 1.00 195.67 ? 77  GLU L CB  1 
ATOM   10002 C CG  . GLU K 2 55  ? 40.969  -7.072   -37.431 1.00 198.17 ? 77  GLU L CG  1 
ATOM   10003 C CD  . GLU K 2 55  ? 40.009  -6.134   -38.141 1.00 200.81 ? 77  GLU L CD  1 
ATOM   10004 O OE1 . GLU K 2 55  ? 39.632  -5.085   -37.561 1.00 206.13 ? 77  GLU L OE1 1 
ATOM   10005 O OE2 . GLU K 2 55  ? 39.632  -6.440   -39.294 1.00 204.94 ? 77  GLU L OE2 1 
ATOM   10006 N N   . CYS K 2 56  ? 38.965  -9.417   -36.295 1.00 205.65 ? 78  CYS L N   1 
ATOM   10007 C CA  . CYS K 2 56  ? 38.730  -10.868  -36.356 1.00 212.61 ? 78  CYS L CA  1 
ATOM   10008 C C   . CYS K 2 56  ? 40.000  -11.644  -36.661 1.00 220.23 ? 78  CYS L C   1 
ATOM   10009 O O   . CYS K 2 56  ? 40.513  -11.575  -37.772 1.00 228.47 ? 78  CYS L O   1 
ATOM   10010 C CB  . CYS K 2 56  ? 37.651  -11.246  -37.391 1.00 213.39 ? 78  CYS L CB  1 
ATOM   10011 S SG  . CYS K 2 56  ? 36.972  -12.901  -37.076 1.00 217.65 ? 78  CYS L SG  1 
ATOM   10012 N N   . SER K 2 57  ? 40.490  -12.388  -35.678 1.00 220.69 ? 79  SER L N   1 
ATOM   10013 C CA  . SER K 2 57  ? 41.558  -13.376  -35.891 1.00 216.59 ? 79  SER L CA  1 
ATOM   10014 C C   . SER K 2 57  ? 40.945  -14.690  -36.372 1.00 210.48 ? 79  SER L C   1 
ATOM   10015 O O   . SER K 2 57  ? 39.730  -14.783  -36.538 1.00 211.52 ? 79  SER L O   1 
ATOM   10016 C CB  . SER K 2 57  ? 42.319  -13.614  -34.588 1.00 218.49 ? 79  SER L CB  1 
ATOM   10017 O OG  . SER K 2 57  ? 41.495  -14.270  -33.636 1.00 220.10 ? 79  SER L OG  1 
ATOM   10018 N N   . SER K 2 58  ? 41.782  -15.701  -36.590 1.00 206.59 ? 80  SER L N   1 
ATOM   10019 C CA  . SER K 2 58  ? 41.305  -17.072  -36.802 1.00 204.36 ? 80  SER L CA  1 
ATOM   10020 C C   . SER K 2 58  ? 41.043  -17.799  -35.474 1.00 204.70 ? 80  SER L C   1 
ATOM   10021 O O   . SER K 2 58  ? 40.452  -18.879  -35.468 1.00 203.86 ? 80  SER L O   1 
ATOM   10022 C CB  . SER K 2 58  ? 42.291  -17.875  -37.651 1.00 203.81 ? 80  SER L CB  1 
ATOM   10023 O OG  . SER K 2 58  ? 43.450  -18.208  -36.910 1.00 209.39 ? 80  SER L OG  1 
ATOM   10024 N N   . THR K 2 59  ? 41.500  -17.225  -34.360 1.00 208.38 ? 81  THR L N   1 
ATOM   10025 C CA  . THR K 2 59  ? 41.165  -17.730  -33.028 1.00 212.34 ? 81  THR L CA  1 
ATOM   10026 C C   . THR K 2 59  ? 39.753  -17.302  -32.667 1.00 209.14 ? 81  THR L C   1 
ATOM   10027 O O   . THR K 2 59  ? 38.875  -18.143  -32.539 1.00 215.85 ? 81  THR L O   1 
ATOM   10028 C CB  . THR K 2 59  ? 42.139  -17.212  -31.944 1.00 218.34 ? 81  THR L CB  1 
ATOM   10029 O OG1 . THR K 2 59  ? 43.474  -17.613  -32.268 1.00 221.97 ? 81  THR L OG1 1 
ATOM   10030 C CG2 . THR K 2 59  ? 41.766  -17.755  -30.554 1.00 218.72 ? 81  THR L CG2 1 
ATOM   10031 N N   . SER K 2 60  ? 39.540  -15.995  -32.529 1.00 201.93 ? 82  SER L N   1 
ATOM   10032 C CA  . SER K 2 60  ? 38.286  -15.459  -32.000 1.00 197.41 ? 82  SER L CA  1 
ATOM   10033 C C   . SER K 2 60  ? 37.555  -14.583  -33.012 1.00 189.69 ? 82  SER L C   1 
ATOM   10034 O O   . SER K 2 60  ? 38.138  -14.084  -33.974 1.00 188.99 ? 82  SER L O   1 
ATOM   10035 C CB  . SER K 2 60  ? 38.547  -14.666  -30.715 1.00 199.12 ? 82  SER L CB  1 
ATOM   10036 O OG  . SER K 2 60  ? 39.434  -13.587  -30.944 1.00 200.51 ? 82  SER L OG  1 
ATOM   10037 N N   . ASN K 2 61  ? 36.264  -14.405  -32.759 1.00 179.36 ? 83  ASN L N   1 
ATOM   10038 C CA  . ASN K 2 61  ? 35.418  -13.542  -33.567 1.00 171.77 ? 83  ASN L CA  1 
ATOM   10039 C C   . ASN K 2 61  ? 35.726  -12.083  -33.247 1.00 169.70 ? 83  ASN L C   1 
ATOM   10040 O O   . ASN K 2 61  ? 36.250  -11.767  -32.175 1.00 171.76 ? 83  ASN L O   1 
ATOM   10041 C CB  . ASN K 2 61  ? 33.941  -13.839  -33.264 1.00 169.43 ? 83  ASN L CB  1 
ATOM   10042 C CG  . ASN K 2 61  ? 32.996  -13.299  -34.327 1.00 166.35 ? 83  ASN L CG  1 
ATOM   10043 O OD1 . ASN K 2 61  ? 33.310  -13.276  -35.515 1.00 166.51 ? 83  ASN L OD1 1 
ATOM   10044 N ND2 . ASN K 2 61  ? 31.824  -12.866  -33.898 1.00 165.05 ? 83  ASN L ND2 1 
ATOM   10045 N N   . ALA K 2 62  ? 35.396  -11.198  -34.182 1.00 166.69 ? 84  ALA L N   1 
ATOM   10046 C CA  . ALA K 2 62  ? 35.444  -9.749   -33.947 1.00 165.44 ? 84  ALA L CA  1 
ATOM   10047 C C   . ALA K 2 62  ? 34.405  -9.320   -32.909 1.00 169.98 ? 84  ALA L C   1 
ATOM   10048 O O   . ALA K 2 62  ? 33.519  -10.084  -32.550 1.00 176.07 ? 84  ALA L O   1 
ATOM   10049 C CB  . ALA K 2 62  ? 35.228  -8.993   -35.246 1.00 160.61 ? 84  ALA L CB  1 
ATOM   10050 N N   . GLU K 2 63  ? 34.539  -8.094   -32.428 1.00 171.14 ? 85  GLU L N   1 
ATOM   10051 C CA  . GLU K 2 63  ? 33.571  -7.495   -31.512 1.00 172.27 ? 85  GLU L CA  1 
ATOM   10052 C C   . GLU K 2 63  ? 33.353  -6.056   -31.941 1.00 169.28 ? 85  GLU L C   1 
ATOM   10053 O O   . GLU K 2 63  ? 34.303  -5.382   -32.329 1.00 159.29 ? 85  GLU L O   1 
ATOM   10054 C CB  . GLU K 2 63  ? 34.075  -7.575   -30.065 1.00 180.42 ? 85  GLU L CB  1 
ATOM   10055 C CG  . GLU K 2 63  ? 33.813  -8.919   -29.398 1.00 187.92 ? 85  GLU L CG  1 
ATOM   10056 C CD  . GLU K 2 63  ? 34.935  -9.388   -28.477 1.00 199.58 ? 85  GLU L CD  1 
ATOM   10057 O OE1 . GLU K 2 63  ? 35.561  -8.543   -27.780 1.00 207.20 ? 85  GLU L OE1 1 
ATOM   10058 O OE2 . GLU K 2 63  ? 35.169  -10.598  -28.424 1.00 206.22 ? 85  GLU L OE2 1 
ATOM   10059 N N   . CYS K 2 64  ? 32.109  -5.595   -31.889 1.00 174.29 ? 86  CYS L N   1 
ATOM   10060 C CA  . CYS K 2 64  ? 31.762  -4.256   -32.363 1.00 179.93 ? 86  CYS L CA  1 
ATOM   10061 C C   . CYS K 2 64  ? 31.503  -3.313   -31.195 1.00 180.56 ? 86  CYS L C   1 
ATOM   10062 O O   . CYS K 2 64  ? 31.097  -3.750   -30.117 1.00 177.89 ? 86  CYS L O   1 
ATOM   10063 C CB  . CYS K 2 64  ? 30.511  -4.288   -33.256 1.00 181.72 ? 86  CYS L CB  1 
ATOM   10064 S SG  . CYS K 2 64  ? 30.444  -5.521   -34.598 1.00 189.52 ? 86  CYS L SG  1 
ATOM   10065 N N   . ASP K 2 65  ? 31.762  -2.029   -31.418 1.00 182.15 ? 87  ASP L N   1 
ATOM   10066 C CA  . ASP K 2 65  ? 31.198  -0.951   -30.594 1.00 179.68 ? 87  ASP L CA  1 
ATOM   10067 C C   . ASP K 2 65  ? 30.364  -0.055   -31.509 1.00 171.19 ? 87  ASP L C   1 
ATOM   10068 O O   . ASP K 2 65  ? 30.443  -0.153   -32.734 1.00 163.97 ? 87  ASP L O   1 
ATOM   10069 C CB  . ASP K 2 65  ? 32.285  -0.149   -29.830 1.00 182.73 ? 87  ASP L CB  1 
ATOM   10070 C CG  . ASP K 2 65  ? 33.294  0.562    -30.750 1.00 182.88 ? 87  ASP L CG  1 
ATOM   10071 O OD1 . ASP K 2 65  ? 32.947  1.619    -31.343 1.00 178.91 ? 87  ASP L OD1 1 
ATOM   10072 O OD2 . ASP K 2 65  ? 34.468  0.059    -30.845 1.00 180.27 ? 87  ASP L OD2 1 
ATOM   10073 N N   . CYS K 2 66  ? 29.555  0.798    -30.898 1.00 169.78 ? 88  CYS L N   1 
ATOM   10074 C CA  . CYS K 2 66  ? 28.756  1.754    -31.646 1.00 173.12 ? 88  CYS L CA  1 
ATOM   10075 C C   . CYS K 2 66  ? 29.577  2.970    -32.031 1.00 168.49 ? 88  CYS L C   1 
ATOM   10076 O O   . CYS K 2 66  ? 30.508  3.336    -31.336 1.00 178.23 ? 88  CYS L O   1 
ATOM   10077 C CB  . CYS K 2 66  ? 27.527  2.199    -30.795 1.00 182.01 ? 88  CYS L CB  1 
ATOM   10078 S SG  . CYS K 2 66  ? 26.358  0.857    -30.504 1.00 194.39 ? 88  CYS L SG  1 
ATOM   10079 N N   . THR K 2 67  ? 29.219  3.593    -33.149 1.00 163.56 ? 89  THR L N   1 
ATOM   10080 C CA  . THR K 2 67  ? 29.760  4.910    -33.500 1.00 165.30 ? 89  THR L CA  1 
ATOM   10081 C C   . THR K 2 67  ? 29.309  5.939    -32.455 1.00 163.50 ? 89  THR L C   1 
ATOM   10082 O O   . THR K 2 67  ? 28.277  5.762    -31.798 1.00 154.31 ? 89  THR L O   1 
ATOM   10083 C CB  . THR K 2 67  ? 29.296  5.391    -34.884 1.00 165.92 ? 89  THR L CB  1 
ATOM   10084 O OG1 . THR K 2 67  ? 27.878  5.288    -34.966 1.00 170.18 ? 89  THR L OG1 1 
ATOM   10085 C CG2 . THR K 2 67  ? 29.928  4.578    -36.000 1.00 163.57 ? 89  THR L CG2 1 
ATOM   10086 N N   . PRO K 2 68  ? 30.078  7.028    -32.307 1.00 167.10 ? 90  PRO L N   1 
ATOM   10087 C CA  . PRO K 2 68  ? 29.769  7.969    -31.236 1.00 169.67 ? 90  PRO L CA  1 
ATOM   10088 C C   . PRO K 2 68  ? 28.454  8.686    -31.491 1.00 162.96 ? 90  PRO L C   1 
ATOM   10089 O O   . PRO K 2 68  ? 28.110  8.951    -32.641 1.00 153.57 ? 90  PRO L O   1 
ATOM   10090 C CB  . PRO K 2 68  ? 30.957  8.948    -31.258 1.00 175.37 ? 90  PRO L CB  1 
ATOM   10091 C CG  . PRO K 2 68  ? 31.888  8.460    -32.324 1.00 173.91 ? 90  PRO L CG  1 
ATOM   10092 C CD  . PRO K 2 68  ? 31.082  7.599    -33.225 1.00 168.65 ? 90  PRO L CD  1 
ATOM   10093 N N   . GLY K 2 69  ? 27.730  8.981    -30.410 1.00 162.90 ? 91  GLY L N   1 
ATOM   10094 C CA  . GLY K 2 69  ? 26.370  9.498    -30.499 1.00 164.98 ? 91  GLY L CA  1 
ATOM   10095 C C   . GLY K 2 69  ? 25.327  8.422    -30.233 1.00 167.41 ? 91  GLY L C   1 
ATOM   10096 O O   . GLY K 2 69  ? 24.163  8.732    -29.950 1.00 166.07 ? 91  GLY L O   1 
ATOM   10097 N N   . PHE K 2 70  ? 25.756  7.153    -30.352 1.00 167.90 ? 92  PHE L N   1 
ATOM   10098 C CA  . PHE K 2 70  ? 24.978  6.004    -29.929 1.00 166.54 ? 92  PHE L CA  1 
ATOM   10099 C C   . PHE K 2 70  ? 25.730  5.247    -28.844 1.00 164.23 ? 92  PHE L C   1 
ATOM   10100 O O   . PHE K 2 70  ? 26.907  5.508    -28.596 1.00 162.92 ? 92  PHE L O   1 
ATOM   10101 C CB  . PHE K 2 70  ? 24.744  5.049    -31.090 1.00 167.69 ? 92  PHE L CB  1 
ATOM   10102 C CG  . PHE K 2 70  ? 24.101  5.680    -32.285 1.00 170.22 ? 92  PHE L CG  1 
ATOM   10103 C CD1 . PHE K 2 70  ? 22.728  5.610    -32.469 1.00 173.83 ? 92  PHE L CD1 1 
ATOM   10104 C CD2 . PHE K 2 70  ? 24.867  6.329    -33.239 1.00 170.39 ? 92  PHE L CD2 1 
ATOM   10105 C CE1 . PHE K 2 70  ? 22.132  6.178    -33.576 1.00 178.96 ? 92  PHE L CE1 1 
ATOM   10106 C CE2 . PHE K 2 70  ? 24.278  6.907    -34.343 1.00 173.84 ? 92  PHE L CE2 1 
ATOM   10107 C CZ  . PHE K 2 70  ? 22.912  6.826    -34.518 1.00 179.06 ? 92  PHE L CZ  1 
ATOM   10108 N N   . HIS K 2 71  ? 25.034  4.294    -28.225 1.00 163.96 ? 93  HIS L N   1 
ATOM   10109 C CA  . HIS K 2 71  ? 25.617  3.407    -27.220 1.00 163.05 ? 93  HIS L CA  1 
ATOM   10110 C C   . HIS K 2 71  ? 25.115  1.973    -27.392 1.00 160.39 ? 93  HIS L C   1 
ATOM   10111 O O   . HIS K 2 71  ? 23.962  1.763    -27.781 1.00 152.58 ? 93  HIS L O   1 
ATOM   10112 C CB  . HIS K 2 71  ? 25.291  3.911    -25.820 1.00 164.53 ? 93  HIS L CB  1 
ATOM   10113 C CG  . HIS K 2 71  ? 23.831  4.097    -25.558 1.00 162.75 ? 93  HIS L CG  1 
ATOM   10114 N ND1 . HIS K 2 71  ? 22.996  3.053    -25.227 1.00 164.44 ? 93  HIS L ND1 1 
ATOM   10115 C CD2 . HIS K 2 71  ? 23.052  5.210    -25.586 1.00 156.83 ? 93  HIS L CD2 1 
ATOM   10116 C CE1 . HIS K 2 71  ? 21.762  3.510    -25.065 1.00 160.61 ? 93  HIS L CE1 1 
ATOM   10117 N NE2 . HIS K 2 71  ? 21.769  4.817    -25.277 1.00 156.47 ? 93  HIS L NE2 1 
ATOM   10118 N N   . CYS K 2 72  ? 25.982  1.003    -27.075 1.00 160.42 ? 94  CYS L N   1 
ATOM   10119 C CA  . CYS K 2 72  ? 25.642  -0.426   -27.165 1.00 164.86 ? 94  CYS L CA  1 
ATOM   10120 C C   . CYS K 2 72  ? 24.424  -0.811   -26.341 1.00 165.03 ? 94  CYS L C   1 
ATOM   10121 O O   . CYS K 2 72  ? 24.035  -0.098   -25.406 1.00 168.52 ? 94  CYS L O   1 
ATOM   10122 C CB  . CYS K 2 72  ? 26.816  -1.307   -26.735 1.00 172.16 ? 94  CYS L CB  1 
ATOM   10123 S SG  . CYS K 2 72  ? 28.133  -1.448   -27.962 1.00 194.27 ? 94  CYS L SG  1 
ATOM   10124 N N   . LEU K 2 73  ? 23.836  -1.948   -26.704 1.00 164.96 ? 95  LEU L N   1 
ATOM   10125 C CA  . LEU K 2 73  ? 22.597  -2.422   -26.094 1.00 163.57 ? 95  LEU L CA  1 
ATOM   10126 C C   . LEU K 2 73  ? 22.475  -3.919   -26.334 1.00 164.24 ? 95  LEU L C   1 
ATOM   10127 O O   . LEU K 2 73  ? 22.709  -4.386   -27.442 1.00 171.38 ? 95  LEU L O   1 
ATOM   10128 C CB  . LEU K 2 73  ? 21.395  -1.681   -26.701 1.00 163.17 ? 95  LEU L CB  1 
ATOM   10129 C CG  . LEU K 2 73  ? 20.145  -1.493   -25.871 1.00 164.60 ? 95  LEU L CG  1 
ATOM   10130 C CD1 . LEU K 2 73  ? 20.466  -0.735   -24.600 1.00 168.95 ? 95  LEU L CD1 1 
ATOM   10131 C CD2 . LEU K 2 73  ? 19.089  -0.792   -26.714 1.00 160.76 ? 95  LEU L CD2 1 
ATOM   10132 N N   . GLY K 2 74  ? 22.121  -4.668   -25.294 1.00 165.83 ? 96  GLY L N   1 
ATOM   10133 C CA  . GLY K 2 74  ? 22.090  -6.132   -25.364 1.00 168.00 ? 96  GLY L CA  1 
ATOM   10134 C C   . GLY K 2 74  ? 23.476  -6.762   -25.425 1.00 168.35 ? 96  GLY L C   1 
ATOM   10135 O O   . GLY K 2 74  ? 24.491  -6.063   -25.522 1.00 171.11 ? 96  GLY L O   1 
ATOM   10136 N N   . ALA K 2 75  ? 23.510  -8.090   -25.383 1.00 167.13 ? 97  ALA L N   1 
ATOM   10137 C CA  . ALA K 2 75  ? 24.769  -8.836   -25.337 1.00 167.91 ? 97  ALA L CA  1 
ATOM   10138 C C   . ALA K 2 75  ? 25.526  -8.748   -26.661 1.00 166.44 ? 97  ALA L C   1 
ATOM   10139 O O   . ALA K 2 75  ? 24.913  -8.755   -27.730 1.00 155.90 ? 97  ALA L O   1 
ATOM   10140 C CB  . ALA K 2 75  ? 24.512  -10.292  -24.970 1.00 171.34 ? 97  ALA L CB  1 
ATOM   10141 N N   . GLY K 2 76  ? 26.855  -8.652   -26.570 1.00 171.69 ? 98  GLY L N   1 
ATOM   10142 C CA  . GLY K 2 76  ? 27.747  -8.555   -27.735 1.00 172.53 ? 98  GLY L CA  1 
ATOM   10143 C C   . GLY K 2 76  ? 27.573  -7.313   -28.595 1.00 172.91 ? 98  GLY L C   1 
ATOM   10144 O O   . GLY K 2 76  ? 27.987  -7.302   -29.762 1.00 173.41 ? 98  GLY L O   1 
ATOM   10145 N N   . CYS K 2 77  ? 26.985  -6.264   -28.012 1.00 175.15 ? 99  CYS L N   1 
ATOM   10146 C CA  . CYS K 2 77  ? 26.549  -5.072   -28.743 1.00 171.42 ? 99  CYS L CA  1 
ATOM   10147 C C   . CYS K 2 77  ? 25.684  -5.454   -29.944 1.00 161.79 ? 99  CYS L C   1 
ATOM   10148 O O   . CYS K 2 77  ? 26.061  -5.267   -31.098 1.00 155.55 ? 99  CYS L O   1 
ATOM   10149 C CB  . CYS K 2 77  ? 27.747  -4.220   -29.148 1.00 177.77 ? 99  CYS L CB  1 
ATOM   10150 S SG  . CYS K 2 77  ? 27.300  -2.512   -29.500 1.00 189.74 ? 99  CYS L SG  1 
ATOM   10151 N N   . SER K 2 78  ? 24.524  -6.022   -29.633 1.00 156.75 ? 100 SER L N   1 
ATOM   10152 C CA  . SER K 2 78  ? 23.602  -6.533   -30.644 1.00 151.12 ? 100 SER L CA  1 
ATOM   10153 C C   . SER K 2 78  ? 22.934  -5.414   -31.427 1.00 141.66 ? 100 SER L C   1 
ATOM   10154 O O   . SER K 2 78  ? 22.665  -5.574   -32.606 1.00 138.56 ? 100 SER L O   1 
ATOM   10155 C CB  . SER K 2 78  ? 22.533  -7.408   -29.994 1.00 153.42 ? 100 SER L CB  1 
ATOM   10156 O OG  . SER K 2 78  ? 21.675  -6.631   -29.175 1.00 159.91 ? 100 SER L OG  1 
ATOM   10157 N N   . MET K 2 79  ? 22.632  -4.301   -30.760 1.00 138.24 ? 101 MET L N   1 
ATOM   10158 C CA  . MET K 2 79  ? 22.206  -3.085   -31.450 1.00 136.43 ? 101 MET L CA  1 
ATOM   10159 C C   . MET K 2 79  ? 22.523  -1.801   -30.717 1.00 132.80 ? 101 MET L C   1 
ATOM   10160 O O   . MET K 2 79  ? 22.731  -1.802   -29.517 1.00 137.49 ? 101 MET L O   1 
ATOM   10161 C CB  . MET K 2 79  ? 20.728  -3.139   -31.809 1.00 139.59 ? 101 MET L CB  1 
ATOM   10162 C CG  . MET K 2 79  ? 19.766  -3.275   -30.649 1.00 140.32 ? 101 MET L CG  1 
ATOM   10163 S SD  . MET K 2 79  ? 18.177  -2.477   -31.022 1.00 145.52 ? 101 MET L SD  1 
ATOM   10164 C CE  . MET K 2 79  ? 17.037  -3.575   -30.173 1.00 147.36 ? 101 MET L CE  1 
ATOM   10165 N N   . CYS K 2 80  ? 22.542  -0.713   -31.475 1.00 140.09 ? 102 CYS L N   1 
ATOM   10166 C CA  . CYS K 2 80  ? 22.885  0.616    -30.979 1.00 150.04 ? 102 CYS L CA  1 
ATOM   10167 C C   . CYS K 2 80  ? 21.638  1.430    -30.697 1.00 152.61 ? 102 CYS L C   1 
ATOM   10168 O O   . CYS K 2 80  ? 20.573  1.153    -31.255 1.00 157.39 ? 102 CYS L O   1 
ATOM   10169 C CB  . CYS K 2 80  ? 23.748  1.348    -32.009 1.00 156.65 ? 102 CYS L CB  1 
ATOM   10170 S SG  . CYS K 2 80  ? 25.348  0.577    -32.283 1.00 168.24 ? 102 CYS L SG  1 
ATOM   10171 N N   . GLU K 2 81  ? 21.777  2.418    -29.822 1.00 153.06 ? 103 GLU L N   1 
ATOM   10172 C CA  . GLU K 2 81  ? 20.694  3.329    -29.486 1.00 154.05 ? 103 GLU L CA  1 
ATOM   10173 C C   . GLU K 2 81  ? 21.243  4.722    -29.287 1.00 151.92 ? 103 GLU L C   1 
ATOM   10174 O O   . GLU K 2 81  ? 22.293  4.887    -28.671 1.00 148.52 ? 103 GLU L O   1 
ATOM   10175 C CB  . GLU K 2 81  ? 20.015  2.872    -28.202 1.00 158.14 ? 103 GLU L CB  1 
ATOM   10176 C CG  . GLU K 2 81  ? 18.825  3.734    -27.776 1.00 161.95 ? 103 GLU L CG  1 
ATOM   10177 C CD  . GLU K 2 81  ? 18.065  3.155    -26.614 1.00 167.33 ? 103 GLU L CD  1 
ATOM   10178 O OE1 . GLU K 2 81  ? 18.694  2.518    -25.741 1.00 168.72 ? 103 GLU L OE1 1 
ATOM   10179 O OE2 . GLU K 2 81  ? 16.826  3.353    -26.553 1.00 173.73 ? 103 GLU L OE2 1 
ATOM   10180 N N   . GLN K 2 82  ? 20.537  5.722    -29.810 1.00 154.74 ? 104 GLN L N   1 
ATOM   10181 C CA  . GLN K 2 82  ? 20.987  7.108    -29.741 1.00 156.77 ? 104 GLN L CA  1 
ATOM   10182 C C   . GLN K 2 82  ? 20.966  7.602    -28.281 1.00 158.09 ? 104 GLN L C   1 
ATOM   10183 O O   . GLN K 2 82  ? 20.090  7.232    -27.519 1.00 156.92 ? 104 GLN L O   1 
ATOM   10184 C CB  . GLN K 2 82  ? 20.127  8.006    -30.644 1.00 158.56 ? 104 GLN L CB  1 
ATOM   10185 C CG  . GLN K 2 82  ? 20.721  9.380    -30.890 1.00 163.02 ? 104 GLN L CG  1 
ATOM   10186 C CD  . GLN K 2 82  ? 20.542  9.853    -32.336 1.00 163.15 ? 104 GLN L CD  1 
ATOM   10187 O OE1 . GLN K 2 82  ? 19.424  10.047   -32.813 1.00 162.77 ? 104 GLN L OE1 1 
ATOM   10188 N NE2 . GLN K 2 82  ? 21.657  10.040   -33.033 1.00 166.92 ? 104 GLN L NE2 1 
ATOM   10189 N N   . ASP K 2 83  ? 21.961  8.412    -27.917 1.00 162.20 ? 105 ASP L N   1 
ATOM   10190 C CA  . ASP K 2 83  ? 22.186  8.830    -26.516 1.00 166.06 ? 105 ASP L CA  1 
ATOM   10191 C C   . ASP K 2 83  ? 20.924  9.534    -25.909 1.00 157.06 ? 105 ASP L C   1 
ATOM   10192 O O   . ASP K 2 83  ? 20.220  10.253   -26.608 1.00 144.99 ? 105 ASP L O   1 
ATOM   10193 C CB  . ASP K 2 83  ? 23.399  9.745    -26.400 1.00 174.14 ? 105 ASP L CB  1 
ATOM   10194 C CG  . ASP K 2 83  ? 24.729  9.051    -26.827 1.00 177.90 ? 105 ASP L CG  1 
ATOM   10195 O OD1 . ASP K 2 83  ? 24.851  7.798    -26.746 1.00 172.47 ? 105 ASP L OD1 1 
ATOM   10196 O OD2 . ASP K 2 83  ? 25.690  9.759    -27.235 1.00 181.11 ? 105 ASP L OD2 1 
ATOM   10197 N N   . CYS K 2 84  ? 20.669  9.288    -24.630 1.00 152.34 ? 106 CYS L N   1 
ATOM   10198 C CA  . CYS K 2 84  ? 19.365  9.564    -24.038 1.00 150.04 ? 106 CYS L CA  1 
ATOM   10199 C C   . CYS K 2 84  ? 19.039  11.072   -23.888 1.00 141.47 ? 106 CYS L C   1 
ATOM   10200 O O   . CYS K 2 84  ? 19.831  11.826   -23.368 1.00 139.78 ? 106 CYS L O   1 
ATOM   10201 C CB  . CYS K 2 84  ? 19.195  8.880    -22.674 1.00 154.76 ? 106 CYS L CB  1 
ATOM   10202 S SG  . CYS K 2 84  ? 19.446  7.129    -22.604 1.00 165.78 ? 106 CYS L SG  1 
ATOM   10203 N N   . LYS K 2 85  ? 17.848  11.440   -24.311 1.00 135.53 ? 107 LYS L N   1 
ATOM   10204 C CA  . LYS K 2 85  ? 17.342  12.797   -24.273 1.00 132.15 ? 107 LYS L CA  1 
ATOM   10205 C C   . LYS K 2 85  ? 16.979  13.298   -22.854 1.00 131.23 ? 107 LYS L C   1 
ATOM   10206 O O   . LYS K 2 85  ? 16.928  12.525   -21.895 1.00 127.97 ? 107 LYS L O   1 
ATOM   10207 C CB  . LYS K 2 85  ? 16.109  12.923   -25.223 1.00 125.28 ? 107 LYS L CB  1 
ATOM   10208 N N   . GLN K 2 86  ? 16.629  14.585   -22.794 1.00 133.26 ? 108 GLN L N   1 
ATOM   10209 C CA  . GLN K 2 86  ? 16.233  15.303   -21.572 1.00 130.65 ? 108 GLN L CA  1 
ATOM   10210 C C   . GLN K 2 86  ? 15.532  14.463   -20.513 1.00 129.23 ? 108 GLN L C   1 
ATOM   10211 O O   . GLN K 2 86  ? 16.066  14.254   -19.447 1.00 136.31 ? 108 GLN L O   1 
ATOM   10212 C CB  . GLN K 2 86  ? 15.337  16.529   -21.909 1.00 135.92 ? 108 GLN L CB  1 
ATOM   10213 N N   . GLY K 2 87  ? 14.340  13.960   -20.800 1.00 127.60 ? 109 GLY L N   1 
ATOM   10214 C CA  . GLY K 2 87  ? 13.534  13.272   -19.773 1.00 130.14 ? 109 GLY L CA  1 
ATOM   10215 C C   . GLY K 2 87  ? 13.771  11.787   -19.563 1.00 130.81 ? 109 GLY L C   1 
ATOM   10216 O O   . GLY K 2 87  ? 12.966  11.131   -18.898 1.00 129.99 ? 109 GLY L O   1 
ATOM   10217 N N   . GLN K 2 88  ? 14.889  11.255   -20.059 1.00 134.01 ? 110 GLN L N   1 
ATOM   10218 C CA  . GLN K 2 88  ? 15.136  9.822    -20.087 1.00 139.68 ? 110 GLN L CA  1 
ATOM   10219 C C   . GLN K 2 88  ? 16.350  9.421    -19.249 1.00 141.12 ? 110 GLN L C   1 
ATOM   10220 O O   . GLN K 2 88  ? 17.202  10.252   -18.927 1.00 140.52 ? 110 GLN L O   1 
ATOM   10221 C CB  . GLN K 2 88  ? 15.348  9.369    -21.530 1.00 143.34 ? 110 GLN L CB  1 
ATOM   10222 C CG  . GLN K 2 88  ? 14.177  9.624    -22.453 1.00 145.17 ? 110 GLN L CG  1 
ATOM   10223 C CD  . GLN K 2 88  ? 14.453  9.115    -23.856 1.00 148.45 ? 110 GLN L CD  1 
ATOM   10224 O OE1 . GLN K 2 88  ? 15.606  9.008    -24.280 1.00 146.23 ? 110 GLN L OE1 1 
ATOM   10225 N NE2 . GLN K 2 88  ? 13.389  8.776    -24.583 1.00 152.82 ? 110 GLN L NE2 1 
ATOM   10226 N N   . GLU K 2 89  ? 16.406  8.131    -18.914 1.00 142.10 ? 111 GLU L N   1 
ATOM   10227 C CA  . GLU K 2 89  ? 17.559  7.540    -18.236 1.00 145.78 ? 111 GLU L CA  1 
ATOM   10228 C C   . GLU K 2 89  ? 17.940  6.245    -18.927 1.00 148.55 ? 111 GLU L C   1 
ATOM   10229 O O   . GLU K 2 89  ? 17.055  5.482    -19.319 1.00 155.24 ? 111 GLU L O   1 
ATOM   10230 C CB  . GLU K 2 89  ? 17.207  7.303    -16.776 1.00 152.72 ? 111 GLU L CB  1 
ATOM   10231 C CG  . GLU K 2 89  ? 18.169  6.503    -15.927 1.00 161.32 ? 111 GLU L CG  1 
ATOM   10232 C CD  . GLU K 2 89  ? 17.548  6.156    -14.547 1.00 164.09 ? 111 GLU L CD  1 
ATOM   10233 O OE1 . GLU K 2 89  ? 16.500  5.471    -14.518 1.00 163.96 ? 111 GLU L OE1 1 
ATOM   10234 O OE2 . GLU K 2 89  ? 18.112  6.518    -13.486 1.00 168.54 ? 111 GLU L OE2 1 
ATOM   10235 N N   . LEU K 2 90  ? 19.244  5.986    -19.002 1.00 144.99 ? 112 LEU L N   1 
ATOM   10236 C CA  . LEU K 2 90  ? 19.763  4.789    -19.680 1.00 142.70 ? 112 LEU L CA  1 
ATOM   10237 C C   . LEU K 2 90  ? 19.687  3.566    -18.747 1.00 144.81 ? 112 LEU L C   1 
ATOM   10238 O O   . LEU K 2 90  ? 20.226  3.599    -17.643 1.00 146.25 ? 112 LEU L O   1 
ATOM   10239 C CB  . LEU K 2 90  ? 21.203  5.007    -20.125 1.00 143.66 ? 112 LEU L CB  1 
ATOM   10240 C CG  . LEU K 2 90  ? 21.724  4.055    -21.225 1.00 147.84 ? 112 LEU L CG  1 
ATOM   10241 C CD1 . LEU K 2 90  ? 22.805  4.731    -22.081 1.00 149.96 ? 112 LEU L CD1 1 
ATOM   10242 C CD2 . LEU K 2 90  ? 22.300  2.771    -20.632 1.00 150.23 ? 112 LEU L CD2 1 
ATOM   10243 N N   . THR K 2 91  ? 19.033  2.501    -19.203 1.00 150.04 ? 113 THR L N   1 
ATOM   10244 C CA  . THR K 2 91  ? 18.906  1.241    -18.471 1.00 158.37 ? 113 THR L CA  1 
ATOM   10245 C C   . THR K 2 91  ? 19.517  0.082    -19.279 1.00 166.00 ? 113 THR L C   1 
ATOM   10246 O O   . THR K 2 91  ? 20.023  0.284    -20.389 1.00 166.35 ? 113 THR L O   1 
ATOM   10247 C CB  . THR K 2 91  ? 17.418  0.918    -18.130 1.00 157.27 ? 113 THR L CB  1 
ATOM   10248 O OG1 . THR K 2 91  ? 16.733  0.411    -19.281 1.00 155.91 ? 113 THR L OG1 1 
ATOM   10249 C CG2 . THR K 2 91  ? 16.691  2.141    -17.626 1.00 157.50 ? 113 THR L CG2 1 
ATOM   10250 N N   . LYS K 2 92  ? 19.457  -1.127   -18.713 1.00 170.25 ? 114 LYS L N   1 
ATOM   10251 C CA  . LYS K 2 92  ? 19.801  -2.349   -19.445 1.00 167.97 ? 114 LYS L CA  1 
ATOM   10252 C C   . LYS K 2 92  ? 18.909  -2.514   -20.683 1.00 165.65 ? 114 LYS L C   1 
ATOM   10253 O O   . LYS K 2 92  ? 19.395  -2.854   -21.762 1.00 163.89 ? 114 LYS L O   1 
ATOM   10254 C CB  . LYS K 2 92  ? 19.673  -3.575   -18.534 1.00 169.08 ? 114 LYS L CB  1 
ATOM   10255 N N   . LYS K 2 93  ? 17.616  -2.236   -20.520 1.00 167.46 ? 115 LYS L N   1 
ATOM   10256 C CA  . LYS K 2 93  ? 16.631  -2.323   -21.609 1.00 171.13 ? 115 LYS L CA  1 
ATOM   10257 C C   . LYS K 2 93  ? 16.545  -1.083   -22.527 1.00 173.31 ? 115 LYS L C   1 
ATOM   10258 O O   . LYS K 2 93  ? 15.691  -1.044   -23.417 1.00 178.99 ? 115 LYS L O   1 
ATOM   10259 C CB  . LYS K 2 93  ? 15.242  -2.622   -21.023 1.00 169.26 ? 115 LYS L CB  1 
ATOM   10260 N N   . GLY K 2 94  ? 17.389  -0.069   -22.299 1.00 173.11 ? 116 GLY L N   1 
ATOM   10261 C CA  . GLY K 2 94  ? 17.453  1.140    -23.150 1.00 170.04 ? 116 GLY L CA  1 
ATOM   10262 C C   . GLY K 2 94  ? 17.074  2.419    -22.442 1.00 168.34 ? 116 GLY L C   1 
ATOM   10263 O O   . GLY K 2 94  ? 16.824  2.420    -21.233 1.00 175.98 ? 116 GLY L O   1 
ATOM   10264 N N   . CYS K 2 95  ? 17.028  3.533    -23.176 1.00 159.36 ? 117 CYS L N   1 
ATOM   10265 C CA  . CYS K 2 95  ? 16.558  4.808    -22.671 1.00 154.55 ? 117 CYS L CA  1 
ATOM   10266 C C   . CYS K 2 95  ? 15.067  4.727    -22.409 1.00 150.49 ? 117 CYS L C   1 
ATOM   10267 O O   . CYS K 2 95  ? 14.259  4.862    -23.330 1.00 157.12 ? 117 CYS L O   1 
ATOM   10268 C CB  . CYS K 2 95  ? 16.831  5.986    -23.625 1.00 156.11 ? 117 CYS L CB  1 
ATOM   10269 S SG  . CYS K 2 95  ? 18.510  6.251    -24.222 1.00 165.44 ? 117 CYS L SG  1 
ATOM   10270 N N   . LYS K 2 96  ? 14.707  4.467    -21.143 1.00 146.12 ? 118 LYS L N   1 
ATOM   10271 C CA  . LYS K 2 96  ? 13.328  4.556    -20.697 1.00 145.45 ? 118 LYS L CA  1 
ATOM   10272 C C   . LYS K 2 96  ? 13.133  5.941    -20.088 1.00 142.08 ? 118 LYS L C   1 
ATOM   10273 O O   . LYS K 2 96  ? 14.077  6.539    -19.541 1.00 135.54 ? 118 LYS L O   1 
ATOM   10274 C CB  . LYS K 2 96  ? 12.997  3.466    -19.690 1.00 141.63 ? 118 LYS L CB  1 
ATOM   10275 N N   . ASP K 2 97  ? 11.889  6.442    -20.189 1.00 145.27 ? 119 ASP L N   1 
ATOM   10276 C CA  . ASP K 2 97  ? 11.530  7.725    -19.619 1.00 148.59 ? 119 ASP L CA  1 
ATOM   10277 C C   . ASP K 2 97  ? 11.560  7.684    -18.101 1.00 143.20 ? 119 ASP L C   1 
ATOM   10278 O O   . ASP K 2 97  ? 11.301  6.633    -17.503 1.00 144.51 ? 119 ASP L O   1 
ATOM   10279 C CB  . ASP K 2 97  ? 10.120  8.143    -20.067 1.00 159.04 ? 119 ASP L CB  1 
ATOM   10280 C CG  . ASP K 2 97  ? 10.011  8.391    -21.562 1.00 166.60 ? 119 ASP L CG  1 
ATOM   10281 O OD1 . ASP K 2 97  ? 10.880  9.088    -22.127 1.00 170.12 ? 119 ASP L OD1 1 
ATOM   10282 O OD2 . ASP K 2 97  ? 9.030   7.901    -22.153 1.00 175.21 ? 119 ASP L OD2 1 
ATOM   10283 N N   . CYS K 2 98  ? 11.873  8.831    -17.476 1.00 142.64 ? 120 CYS L N   1 
ATOM   10284 C CA  . CYS K 2 98  ? 11.872  8.911    -16.011 1.00 144.84 ? 120 CYS L CA  1 
ATOM   10285 C C   . CYS K 2 98  ? 10.473  8.577    -15.487 1.00 142.27 ? 120 CYS L C   1 
ATOM   10286 O O   . CYS K 2 98  ? 9.465   9.003    -16.061 1.00 138.62 ? 120 CYS L O   1 
ATOM   10287 C CB  . CYS K 2 98  ? 12.300  10.283   -15.507 1.00 148.41 ? 120 CYS L CB  1 
ATOM   10288 S SG  . CYS K 2 98  ? 14.082  10.634   -15.394 1.00 154.69 ? 120 CYS L SG  1 
ATOM   10289 N N   . SER K 2 99  ? 10.430  7.807    -14.399 1.00 146.18 ? 121 SER L N   1 
ATOM   10290 C CA  . SER K 2 99  ? 9.179   7.377    -13.787 1.00 152.91 ? 121 SER L CA  1 
ATOM   10291 C C   . SER K 2 99  ? 8.452   8.557    -13.148 1.00 155.65 ? 121 SER L C   1 
ATOM   10292 O O   . SER K 2 99  ? 8.965   9.681    -13.147 1.00 160.86 ? 121 SER L O   1 
ATOM   10293 C CB  . SER K 2 99  ? 9.456   6.308    -12.723 1.00 156.86 ? 121 SER L CB  1 
ATOM   10294 O OG  . SER K 2 99  ? 8.255   5.784    -12.184 1.00 163.01 ? 121 SER L OG  1 
ATOM   10295 N N   . PHE K 2 100 ? 7.256   8.310    -12.616 1.00 154.93 ? 122 PHE L N   1 
ATOM   10296 C CA  . PHE K 2 100 ? 6.521   9.359    -11.920 1.00 154.62 ? 122 PHE L CA  1 
ATOM   10297 C C   . PHE K 2 100 ? 7.270   9.761    -10.646 1.00 153.15 ? 122 PHE L C   1 
ATOM   10298 O O   . PHE K 2 100 ? 7.836   8.907    -9.951  1.00 152.75 ? 122 PHE L O   1 
ATOM   10299 C CB  . PHE K 2 100 ? 5.096   8.933    -11.587 1.00 159.76 ? 122 PHE L CB  1 
ATOM   10300 C CG  . PHE K 2 100 ? 4.223   10.075   -11.159 1.00 162.29 ? 122 PHE L CG  1 
ATOM   10301 C CD1 . PHE K 2 100 ? 3.529   10.823   -12.102 1.00 164.41 ? 122 PHE L CD1 1 
ATOM   10302 C CD2 . PHE K 2 100 ? 4.120   10.428   -9.814  1.00 164.60 ? 122 PHE L CD2 1 
ATOM   10303 C CE1 . PHE K 2 100 ? 2.723   11.888   -11.711 1.00 168.33 ? 122 PHE L CE1 1 
ATOM   10304 C CE2 . PHE K 2 100 ? 3.326   11.492   -9.414  1.00 168.11 ? 122 PHE L CE2 1 
ATOM   10305 C CZ  . PHE K 2 100 ? 2.625   12.225   -10.364 1.00 170.11 ? 122 PHE L CZ  1 
ATOM   10306 N N   . GLY K 2 101 ? 7.291   11.068   -10.376 1.00 148.57 ? 123 GLY L N   1 
ATOM   10307 C CA  . GLY K 2 101 ? 8.022   11.635   -9.246  1.00 143.13 ? 123 GLY L CA  1 
ATOM   10308 C C   . GLY K 2 101 ? 9.505   11.889   -9.468  1.00 137.48 ? 123 GLY L C   1 
ATOM   10309 O O   . GLY K 2 101 ? 10.169  12.414   -8.577  1.00 137.27 ? 123 GLY L O   1 
ATOM   10310 N N   . THR K 2 102 ? 10.026  11.535   -10.643 1.00 134.57 ? 124 THR L N   1 
ATOM   10311 C CA  . THR K 2 102 ? 11.448  11.689   -10.966 1.00 135.13 ? 124 THR L CA  1 
ATOM   10312 C C   . THR K 2 102 ? 11.656  12.531   -12.215 1.00 136.52 ? 124 THR L C   1 
ATOM   10313 O O   . THR K 2 102 ? 10.738  12.680   -13.024 1.00 144.65 ? 124 THR L O   1 
ATOM   10314 C CB  . THR K 2 102 ? 12.139  10.322   -11.161 1.00 133.97 ? 124 THR L CB  1 
ATOM   10315 O OG1 . THR K 2 102 ? 11.249  9.421    -11.819 1.00 131.79 ? 124 THR L OG1 1 
ATOM   10316 C CG2 . THR K 2 102 ? 12.526  9.742    -9.821  1.00 136.13 ? 124 THR L CG2 1 
ATOM   10317 N N   . PHE K 2 103 ? 12.866  13.072   -12.365 1.00 130.40 ? 125 PHE L N   1 
ATOM   10318 C CA  . PHE K 2 103 ? 13.195  13.950   -13.485 1.00 124.75 ? 125 PHE L CA  1 
ATOM   10319 C C   . PHE K 2 103 ? 14.660  13.897   -13.875 1.00 127.25 ? 125 PHE L C   1 
ATOM   10320 O O   . PHE K 2 103 ? 15.498  13.490   -13.090 1.00 135.92 ? 125 PHE L O   1 
ATOM   10321 C CB  . PHE K 2 103 ? 12.826  15.392   -13.142 1.00 120.95 ? 125 PHE L CB  1 
ATOM   10322 C CG  . PHE K 2 103 ? 13.881  16.135   -12.356 1.00 115.00 ? 125 PHE L CG  1 
ATOM   10323 C CD1 . PHE K 2 103 ? 14.747  17.015   -12.995 1.00 110.96 ? 125 PHE L CD1 1 
ATOM   10324 C CD2 . PHE K 2 103 ? 13.991  15.967   -10.981 1.00 113.89 ? 125 PHE L CD2 1 
ATOM   10325 C CE1 . PHE K 2 103 ? 15.706  17.700   -12.281 1.00 111.59 ? 125 PHE L CE1 1 
ATOM   10326 C CE2 . PHE K 2 103 ? 14.945  16.657   -10.261 1.00 113.00 ? 125 PHE L CE2 1 
ATOM   10327 C CZ  . PHE K 2 103 ? 15.806  17.522   -10.911 1.00 111.69 ? 125 PHE L CZ  1 
ATOM   10328 N N   . ASN K 2 104 ? 14.955  14.349   -15.087 1.00 129.22 ? 126 ASN L N   1 
ATOM   10329 C CA  . ASN K 2 104 ? 16.319  14.513   -15.547 1.00 129.66 ? 126 ASN L CA  1 
ATOM   10330 C C   . ASN K 2 104 ? 16.451  15.822   -16.326 1.00 133.42 ? 126 ASN L C   1 
ATOM   10331 O O   . ASN K 2 104 ? 15.753  16.040   -17.306 1.00 132.38 ? 126 ASN L O   1 
ATOM   10332 C CB  . ASN K 2 104 ? 16.731  13.304   -16.386 1.00 126.65 ? 126 ASN L CB  1 
ATOM   10333 C CG  . ASN K 2 104 ? 18.183  13.331   -16.790 1.00 126.27 ? 126 ASN L CG  1 
ATOM   10334 O OD1 . ASN K 2 104 ? 18.954  14.188   -16.378 1.00 127.64 ? 126 ASN L OD1 1 
ATOM   10335 N ND2 . ASN K 2 104 ? 18.558  12.376   -17.605 1.00 130.14 ? 126 ASN L ND2 1 
ATOM   10336 N N   . ASP K 2 105 ? 17.342  16.691   -15.857 1.00 143.34 ? 127 ASP L N   1 
ATOM   10337 C CA  . ASP K 2 105 ? 17.589  17.993   -16.460 1.00 148.24 ? 127 ASP L CA  1 
ATOM   10338 C C   . ASP K 2 105 ? 18.448  17.833   -17.707 1.00 145.19 ? 127 ASP L C   1 
ATOM   10339 O O   . ASP K 2 105 ? 18.025  18.216   -18.797 1.00 150.51 ? 127 ASP L O   1 
ATOM   10340 C CB  . ASP K 2 105 ? 18.268  18.913   -15.427 1.00 161.14 ? 127 ASP L CB  1 
ATOM   10341 C CG  . ASP K 2 105 ? 18.542  20.321   -15.954 1.00 178.45 ? 127 ASP L CG  1 
ATOM   10342 O OD1 . ASP K 2 105 ? 17.669  20.898   -16.637 1.00 196.26 ? 127 ASP L OD1 1 
ATOM   10343 O OD2 . ASP K 2 105 ? 19.634  20.865   -15.664 1.00 196.05 ? 127 ASP L OD2 1 
ATOM   10344 N N   . GLN K 2 106 ? 19.627  17.240   -17.555 1.00 145.51 ? 128 GLN L N   1 
ATOM   10345 C CA  . GLN K 2 106 ? 20.631  17.191   -18.637 1.00 148.88 ? 128 GLN L CA  1 
ATOM   10346 C C   . GLN K 2 106 ? 20.632  15.877   -19.414 1.00 143.80 ? 128 GLN L C   1 
ATOM   10347 O O   . GLN K 2 106 ? 20.097  14.890   -18.953 1.00 132.89 ? 128 GLN L O   1 
ATOM   10348 C CB  . GLN K 2 106 ? 22.029  17.453   -18.053 1.00 154.20 ? 128 GLN L CB  1 
ATOM   10349 N N   . LYS K 2 107 ? 21.229  15.903   -20.603 1.00 144.54 ? 129 LYS L N   1 
ATOM   10350 C CA  . LYS K 2 107 ? 21.461  14.702   -21.442 1.00 146.37 ? 129 LYS L CA  1 
ATOM   10351 C C   . LYS K 2 107 ? 22.474  13.776   -20.747 1.00 145.03 ? 129 LYS L C   1 
ATOM   10352 O O   . LYS K 2 107 ? 23.322  14.229   -19.930 1.00 135.65 ? 129 LYS L O   1 
ATOM   10353 C CB  . LYS K 2 107 ? 22.044  15.126   -22.808 1.00 147.95 ? 129 LYS L CB  1 
ATOM   10354 N N   . ARG K 2 108 ? 22.369  12.486   -21.088 1.00 150.52 ? 130 ARG L N   1 
ATOM   10355 C CA  . ARG K 2 108 ? 23.157  11.421   -20.448 1.00 152.66 ? 130 ARG L CA  1 
ATOM   10356 C C   . ARG K 2 108 ? 23.235  11.561   -18.920 1.00 154.14 ? 130 ARG L C   1 
ATOM   10357 O O   . ARG K 2 108 ? 24.308  11.538   -18.342 1.00 168.36 ? 130 ARG L O   1 
ATOM   10358 C CB  . ARG K 2 108 ? 24.560  11.316   -21.089 1.00 152.63 ? 130 ARG L CB  1 
ATOM   10359 N N   . GLY K 2 109 ? 22.076  11.699   -18.290 1.00 145.85 ? 131 GLY L N   1 
ATOM   10360 C CA  . GLY K 2 109 ? 21.948  11.896   -16.834 1.00 144.56 ? 131 GLY L CA  1 
ATOM   10361 C C   . GLY K 2 109 ? 21.184  10.779   -16.134 1.00 146.26 ? 131 GLY L C   1 
ATOM   10362 O O   . GLY K 2 109 ? 20.882  9.735    -16.743 1.00 146.47 ? 131 GLY L O   1 
ATOM   10363 N N   . ILE K 2 110 ? 20.862  11.011   -14.856 1.00 143.87 ? 132 ILE L N   1 
ATOM   10364 C CA  . ILE K 2 110 ? 20.183  10.035   -13.999 1.00 145.00 ? 132 ILE L CA  1 
ATOM   10365 C C   . ILE K 2 110 ? 18.867  10.624   -13.486 1.00 146.95 ? 132 ILE L C   1 
ATOM   10366 O O   . ILE K 2 110 ? 18.778  11.829   -13.277 1.00 149.04 ? 132 ILE L O   1 
ATOM   10367 C CB  . ILE K 2 110 ? 21.095  9.626    -12.819 1.00 146.87 ? 132 ILE L CB  1 
ATOM   10368 C CG1 . ILE K 2 110 ? 22.296  8.825    -13.328 1.00 154.66 ? 132 ILE L CG1 1 
ATOM   10369 C CG2 . ILE K 2 110 ? 20.340  8.812    -11.766 1.00 148.00 ? 132 ILE L CG2 1 
ATOM   10370 C CD1 . ILE K 2 110 ? 23.487  8.831    -12.366 1.00 161.53 ? 132 ILE L CD1 1 
ATOM   10371 N N   . CYS K 2 111 ? 17.864  9.763    -13.295 1.00 147.65 ? 133 CYS L N   1 
ATOM   10372 C CA  . CYS K 2 111 ? 16.558  10.189   -12.759 1.00 147.58 ? 133 CYS L CA  1 
ATOM   10373 C C   . CYS K 2 111 ? 16.590  10.473   -11.265 1.00 145.56 ? 133 CYS L C   1 
ATOM   10374 O O   . CYS K 2 111 ? 16.382  9.575    -10.458 1.00 146.61 ? 133 CYS L O   1 
ATOM   10375 C CB  . CYS K 2 111 ? 15.466  9.139    -13.055 1.00 154.40 ? 133 CYS L CB  1 
ATOM   10376 S SG  . CYS K 2 111 ? 15.007  8.915    -14.810 1.00 165.75 ? 133 CYS L SG  1 
ATOM   10377 N N   . ARG K 2 112 ? 16.848  11.726   -10.906 1.00 145.27 ? 134 ARG L N   1 
ATOM   10378 C CA  . ARG K 2 112 ? 16.695  12.214   -9.528  1.00 146.78 ? 134 ARG L CA  1 
ATOM   10379 C C   . ARG K 2 112 ? 15.203  12.415   -9.237  1.00 142.98 ? 134 ARG L C   1 
ATOM   10380 O O   . ARG K 2 112 ? 14.420  12.567   -10.170 1.00 139.97 ? 134 ARG L O   1 
ATOM   10381 C CB  . ARG K 2 112 ? 17.433  13.544   -9.350  1.00 153.13 ? 134 ARG L CB  1 
ATOM   10382 C CG  . ARG K 2 112 ? 18.924  13.478   -9.621  1.00 164.18 ? 134 ARG L CG  1 
ATOM   10383 C CD  . ARG K 2 112 ? 19.530  14.870   -9.620  1.00 174.02 ? 134 ARG L CD  1 
ATOM   10384 N NE  . ARG K 2 112 ? 19.202  15.624   -10.834 1.00 180.78 ? 134 ARG L NE  1 
ATOM   10385 C CZ  . ARG K 2 112 ? 19.571  16.887   -11.071 1.00 191.58 ? 134 ARG L CZ  1 
ATOM   10386 N NH1 . ARG K 2 112 ? 20.284  17.579   -10.177 1.00 198.12 ? 134 ARG L NH1 1 
ATOM   10387 N NH2 . ARG K 2 112 ? 19.215  17.476   -12.211 1.00 192.07 ? 134 ARG L NH2 1 
ATOM   10388 N N   . PRO K 2 113 ? 14.794  12.419   -7.952  1.00 144.01 ? 135 PRO L N   1 
ATOM   10389 C CA  . PRO K 2 113 ? 13.398  12.693   -7.594  1.00 141.85 ? 135 PRO L CA  1 
ATOM   10390 C C   . PRO K 2 113 ? 13.124  14.195   -7.415  1.00 140.20 ? 135 PRO L C   1 
ATOM   10391 O O   . PRO K 2 113 ? 14.044  14.954   -7.115  1.00 139.82 ? 135 PRO L O   1 
ATOM   10392 C CB  . PRO K 2 113 ? 13.242  11.959   -6.268  1.00 143.73 ? 135 PRO L CB  1 
ATOM   10393 C CG  . PRO K 2 113 ? 14.578  12.078   -5.637  1.00 148.17 ? 135 PRO L CG  1 
ATOM   10394 C CD  . PRO K 2 113 ? 15.602  12.177   -6.744  1.00 147.59 ? 135 PRO L CD  1 
ATOM   10395 N N   . TRP K 2 114 ? 11.867  14.607   -7.590  1.00 140.44 ? 136 TRP L N   1 
ATOM   10396 C CA  . TRP K 2 114 ? 11.492  16.028   -7.491  1.00 139.81 ? 136 TRP L CA  1 
ATOM   10397 C C   . TRP K 2 114 ? 11.750  16.545   -6.078  1.00 143.51 ? 136 TRP L C   1 
ATOM   10398 O O   . TRP K 2 114 ? 11.455  15.843   -5.111  1.00 151.51 ? 136 TRP L O   1 
ATOM   10399 C CB  . TRP K 2 114 ? 10.009  16.265   -7.793  1.00 137.34 ? 136 TRP L CB  1 
ATOM   10400 C CG  . TRP K 2 114 ? 9.525   15.837   -9.134  1.00 134.61 ? 136 TRP L CG  1 
ATOM   10401 C CD1 . TRP K 2 114 ? 10.222  15.839   -10.306 1.00 134.06 ? 136 TRP L CD1 1 
ATOM   10402 C CD2 . TRP K 2 114 ? 8.209   15.375   -9.452  1.00 136.02 ? 136 TRP L CD2 1 
ATOM   10403 N NE1 . TRP K 2 114 ? 9.429   15.381   -11.332 1.00 135.46 ? 136 TRP L NE1 1 
ATOM   10404 C CE2 . TRP K 2 114 ? 8.186   15.093   -10.835 1.00 136.60 ? 136 TRP L CE2 1 
ATOM   10405 C CE3 . TRP K 2 114 ? 7.044   15.171   -8.700  1.00 137.93 ? 136 TRP L CE3 1 
ATOM   10406 C CZ2 . TRP K 2 114 ? 7.043   14.611   -11.480 1.00 137.61 ? 136 TRP L CZ2 1 
ATOM   10407 C CZ3 . TRP K 2 114 ? 5.911   14.693   -9.341  1.00 139.31 ? 136 TRP L CZ3 1 
ATOM   10408 C CH2 . TRP K 2 114 ? 5.918   14.417   -10.718 1.00 137.96 ? 136 TRP L CH2 1 
ATOM   10409 N N   . THR K 2 115 ? 12.288  17.758   -5.966  1.00 142.78 ? 137 THR L N   1 
ATOM   10410 C CA  . THR K 2 115 ? 12.505  18.362   -4.659  1.00 144.69 ? 137 THR L CA  1 
ATOM   10411 C C   . THR K 2 115 ? 11.164  18.524   -3.966  1.00 142.93 ? 137 THR L C   1 
ATOM   10412 O O   . THR K 2 115 ? 10.279  19.153   -4.490  1.00 149.54 ? 137 THR L O   1 
ATOM   10413 C CB  . THR K 2 115 ? 13.190  19.748   -4.744  1.00 144.10 ? 137 THR L CB  1 
ATOM   10414 O OG1 . THR K 2 115 ? 12.587  20.501   -5.818  1.00 144.17 ? 137 THR L OG1 1 
ATOM   10415 C CG2 . THR K 2 115 ? 14.684  19.585   -4.977  1.00 143.62 ? 137 THR L CG2 1 
ATOM   10416 N N   . ASN K 2 116 ? 11.041  17.952   -2.775  1.00 141.20 ? 138 ASN L N   1 
ATOM   10417 C CA  . ASN K 2 116 ? 9.928   18.202   -1.861  1.00 144.79 ? 138 ASN L CA  1 
ATOM   10418 C C   . ASN K 2 116 ? 10.122  19.545   -1.137  1.00 149.27 ? 138 ASN L C   1 
ATOM   10419 O O   . ASN K 2 116 ? 10.981  19.703   -0.275  1.00 151.59 ? 138 ASN L O   1 
ATOM   10420 C CB  . ASN K 2 116 ? 9.860   17.068   -0.831  1.00 146.13 ? 138 ASN L CB  1 
ATOM   10421 C CG  . ASN K 2 116 ? 8.649   17.159   0.098   1.00 146.24 ? 138 ASN L CG  1 
ATOM   10422 O OD1 . ASN K 2 116 ? 7.775   18.004   -0.084  1.00 145.20 ? 138 ASN L OD1 1 
ATOM   10423 N ND2 . ASN K 2 116 ? 8.596   16.283   1.080   1.00 150.10 ? 138 ASN L ND2 1 
ATOM   10424 N N   . CYS K 2 117 ? 9.308   20.526   -1.541  1.00 153.45 ? 139 CYS L N   1 
ATOM   10425 C CA  . CYS K 2 117 ? 9.417   21.885   -1.005  1.00 154.00 ? 139 CYS L CA  1 
ATOM   10426 C C   . CYS K 2 117 ? 8.874   21.977   0.425   1.00 153.58 ? 139 CYS L C   1 
ATOM   10427 O O   . CYS K 2 117 ? 9.358   22.795   1.203   1.00 155.07 ? 139 CYS L O   1 
ATOM   10428 C CB  . CYS K 2 117 ? 8.732   22.899   -1.930  1.00 155.98 ? 139 CYS L CB  1 
ATOM   10429 S SG  . CYS K 2 117 ? 9.229   22.712   -3.644  1.00 156.72 ? 139 CYS L SG  1 
ATOM   10430 N N   . SER K 2 118 ? 7.890   21.140   0.762   1.00 153.49 ? 140 SER L N   1 
ATOM   10431 C CA  . SER K 2 118 ? 7.379   21.031   2.140   1.00 155.94 ? 140 SER L CA  1 
ATOM   10432 C C   . SER K 2 118 ? 8.494   20.700   3.142   1.00 162.37 ? 140 SER L C   1 
ATOM   10433 O O   . SER K 2 118 ? 8.624   21.363   4.169   1.00 154.16 ? 140 SER L O   1 
ATOM   10434 C CB  . SER K 2 118 ? 6.273   19.975   2.229   1.00 153.72 ? 140 SER L CB  1 
ATOM   10435 N N   . LEU K 2 119 ? 9.305   19.688   2.815   1.00 177.18 ? 141 LEU L N   1 
ATOM   10436 C CA  . LEU K 2 119 ? 10.492  19.311   3.616   1.00 183.14 ? 141 LEU L CA  1 
ATOM   10437 C C   . LEU K 2 119 ? 11.570  20.417   3.642   1.00 189.70 ? 141 LEU L C   1 
ATOM   10438 O O   . LEU K 2 119 ? 12.315  20.536   4.618   1.00 198.25 ? 141 LEU L O   1 
ATOM   10439 C CB  . LEU K 2 119 ? 11.099  17.986   3.113   1.00 173.11 ? 141 LEU L CB  1 
ATOM   10440 N N   . ASP K 2 120 ? 11.648  21.206   2.569   1.00 190.20 ? 142 ASP L N   1 
ATOM   10441 C CA  . ASP K 2 120 ? 12.578  22.339   2.468   1.00 186.97 ? 142 ASP L CA  1 
ATOM   10442 C C   . ASP K 2 120 ? 12.056  23.661   3.068   1.00 184.27 ? 142 ASP L C   1 
ATOM   10443 O O   . ASP K 2 120 ? 12.826  24.618   3.162   1.00 187.00 ? 142 ASP L O   1 
ATOM   10444 C CB  . ASP K 2 120 ? 12.966  22.564   0.999   1.00 182.72 ? 142 ASP L CB  1 
ATOM   10445 N N   . GLY K 2 121 ? 10.777  23.724   3.449   1.00 178.62 ? 143 GLY L N   1 
ATOM   10446 C CA  . GLY K 2 121 ? 10.165  24.940   4.027   1.00 175.39 ? 143 GLY L CA  1 
ATOM   10447 C C   . GLY K 2 121 ? 9.118   25.617   3.150   1.00 170.08 ? 143 GLY L C   1 
ATOM   10448 O O   . GLY K 2 121 ? 8.043   25.996   3.637   1.00 164.49 ? 143 GLY L O   1 
ATOM   10449 N N   . LYS K 2 122 ? 9.424   25.753   1.858   1.00 169.54 ? 144 LYS L N   1 
ATOM   10450 C CA  . LYS K 2 122 ? 8.542   26.461   0.895   1.00 165.87 ? 144 LYS L CA  1 
ATOM   10451 C C   . LYS K 2 122 ? 7.276   25.673   0.484   1.00 167.15 ? 144 LYS L C   1 
ATOM   10452 O O   . LYS K 2 122 ? 6.899   24.717   1.137   1.00 170.40 ? 144 LYS L O   1 
ATOM   10453 C CB  . LYS K 2 122 ? 9.349   26.907   -0.334  1.00 157.44 ? 144 LYS L CB  1 
ATOM   10454 N N   . SER K 2 123 ? 6.608   26.123   -0.576  1.00 165.94 ? 145 SER L N   1 
ATOM   10455 C CA  . SER K 2 123 ? 5.514   25.367   -1.223  1.00 166.07 ? 145 SER L CA  1 
ATOM   10456 C C   . SER K 2 123 ? 5.612   25.492   -2.744  1.00 161.75 ? 145 SER L C   1 
ATOM   10457 O O   . SER K 2 123 ? 6.172   26.456   -3.265  1.00 158.74 ? 145 SER L O   1 
ATOM   10458 C CB  . SER K 2 123 ? 4.138   25.832   -0.743  1.00 169.63 ? 145 SER L CB  1 
ATOM   10459 O OG  . SER K 2 123 ? 3.953   27.209   -0.984  1.00 175.18 ? 145 SER L OG  1 
ATOM   10460 N N   . VAL K 2 124 ? 5.248   24.411   -3.401  1.00 163.34 ? 146 VAL L N   1 
ATOM   10461 C CA  . VAL K 2 124 ? 5.435   24.286   -4.823  1.00 168.47 ? 146 VAL L CA  1 
ATOM   10462 C C   . VAL K 2 124 ? 4.711   25.286   -5.674  1.00 172.60 ? 146 VAL L C   1 
ATOM   10463 O O   . VAL K 2 124 ? 3.555   25.600   -5.430  1.00 178.22 ? 146 VAL L O   1 
ATOM   10464 C CB  . VAL K 2 124 ? 5.002   22.896   -5.264  1.00 170.83 ? 146 VAL L CB  1 
ATOM   10465 C CG1 . VAL K 2 124 ? 5.686   21.863   -4.389  1.00 172.03 ? 146 VAL L CG1 1 
ATOM   10466 C CG2 . VAL K 2 124 ? 3.495   22.777   -5.140  1.00 172.97 ? 146 VAL L CG2 1 
ATOM   10467 N N   . LEU K 2 125 ? 5.440   25.826   -6.646  1.00 170.41 ? 147 LEU L N   1 
ATOM   10468 C CA  . LEU K 2 125 ? 4.882   26.769   -7.590  1.00 171.48 ? 147 LEU L CA  1 
ATOM   10469 C C   . LEU K 2 125 ? 4.459   25.994   -8.826  1.00 173.17 ? 147 LEU L C   1 
ATOM   10470 O O   . LEU K 2 125 ? 3.370   26.179   -9.345  1.00 182.35 ? 147 LEU L O   1 
ATOM   10471 C CB  . LEU K 2 125 ? 5.914   27.828   -7.950  1.00 163.02 ? 147 LEU L CB  1 
ATOM   10472 N N   . VAL K 2 126 ? 5.330   25.104   -9.284  1.00 172.32 ? 148 VAL L N   1 
ATOM   10473 C CA  . VAL K 2 126 ? 5.044   24.266   -10.440 1.00 167.88 ? 148 VAL L CA  1 
ATOM   10474 C C   . VAL K 2 126 ? 5.280   22.854   -9.973  1.00 167.14 ? 148 VAL L C   1 
ATOM   10475 O O   . VAL K 2 126 ? 6.273   22.579   -9.314  1.00 173.08 ? 148 VAL L O   1 
ATOM   10476 C CB  . VAL K 2 126 ? 5.952   24.573   -11.630 1.00 160.95 ? 148 VAL L CB  1 
ATOM   10477 N N   . ASN K 2 127 ? 4.388   21.951   -10.344 1.00 30.00  ? 149 ASN L N   1 
ATOM   10478 C CA  . ASN K 2 127 ? 4.470   20.581   -9.864  1.00 30.00  ? 149 ASN L CA  1 
ATOM   10479 C C   . ASN K 2 127 ? 5.720   19.800   -10.232 1.00 30.00  ? 149 ASN L C   1 
ATOM   10480 O O   . ASN K 2 127 ? 6.279   19.115   -9.391  1.00 30.00  ? 149 ASN L O   1 
ATOM   10481 C CB  . ASN K 2 127 ? 3.230   19.800   -10.298 1.00 30.00  ? 149 ASN L CB  1 
ATOM   10482 N N   . GLY K 2 128 ? 6.182   19.908   -11.462 1.00 147.74 ? 150 GLY L N   1 
ATOM   10483 C CA  . GLY K 2 128 ? 7.350   19.150   -11.848 1.00 138.28 ? 150 GLY L CA  1 
ATOM   10484 C C   . GLY K 2 128 ? 7.064   18.399   -13.121 1.00 134.98 ? 150 GLY L C   1 
ATOM   10485 O O   . GLY K 2 128 ? 6.034   18.594   -13.739 1.00 144.41 ? 150 GLY L O   1 
ATOM   10486 N N   . THR K 2 129 ? 7.948   17.503   -13.512 1.00 130.39 ? 151 THR L N   1 
ATOM   10487 C CA  . THR K 2 129 ? 7.721   16.800   -14.780 1.00 132.03 ? 151 THR L CA  1 
ATOM   10488 C C   . THR K 2 129 ? 8.905   15.865   -15.093 1.00 130.41 ? 151 THR L C   1 
ATOM   10489 O O   . THR K 2 129 ? 9.908   15.877   -14.390 1.00 128.51 ? 151 THR L O   1 
ATOM   10490 C CB  . THR K 2 129 ? 7.471   17.795   -15.951 1.00 133.04 ? 151 THR L CB  1 
ATOM   10491 O OG1 . THR K 2 129 ? 7.441   17.093   -17.196 1.00 139.84 ? 151 THR L OG1 1 
ATOM   10492 C CG2 . THR K 2 129 ? 8.560   18.864   -16.053 1.00 132.25 ? 151 THR L CG2 1 
ATOM   10493 N N   . LYS K 2 130 ? 8.777   15.067   -16.149 1.00 128.54 ? 152 LYS L N   1 
ATOM   10494 C CA  . LYS K 2 130 ? 9.836   14.136   -16.559 1.00 126.07 ? 152 LYS L CA  1 
ATOM   10495 C C   . LYS K 2 130 ? 11.171  14.802   -16.915 1.00 124.11 ? 152 LYS L C   1 
ATOM   10496 O O   . LYS K 2 130 ? 12.193  14.141   -16.834 1.00 118.59 ? 152 LYS L O   1 
ATOM   10497 C CB  . LYS K 2 130 ? 9.373   13.259   -17.742 1.00 125.27 ? 152 LYS L CB  1 
ATOM   10498 N N   . GLU K 2 131 ? 11.158  16.082   -17.304 1.00 128.12 ? 153 GLU L N   1 
ATOM   10499 C CA  . GLU K 2 131 ? 12.397  16.802   -17.681 1.00 129.45 ? 153 GLU L CA  1 
ATOM   10500 C C   . GLU K 2 131 ? 12.683  18.061   -16.859 1.00 122.65 ? 153 GLU L C   1 
ATOM   10501 O O   . GLU K 2 131 ? 13.515  18.867   -17.265 1.00 119.78 ? 153 GLU L O   1 
ATOM   10502 C CB  . GLU K 2 131 ? 12.425  17.184   -19.184 1.00 137.95 ? 153 GLU L CB  1 
ATOM   10503 C CG  . GLU K 2 131 ? 11.565  16.369   -20.144 1.00 149.50 ? 153 GLU L CG  1 
ATOM   10504 C CD  . GLU K 2 131 ? 10.347  17.126   -20.685 1.00 163.51 ? 153 GLU L CD  1 
ATOM   10505 O OE1 . GLU K 2 131 ? 9.790   18.011   -19.973 1.00 173.68 ? 153 GLU L OE1 1 
ATOM   10506 O OE2 . GLU K 2 131 ? 9.950   16.832   -21.841 1.00 172.01 ? 153 GLU L OE2 1 
ATOM   10507 N N   . ARG K 2 132 ? 12.033  18.229   -15.710 1.00 118.29 ? 154 ARG L N   1 
ATOM   10508 C CA  . ARG K 2 132 ? 12.235  19.442   -14.910 1.00 118.56 ? 154 ARG L CA  1 
ATOM   10509 C C   . ARG K 2 132 ? 11.814  19.263   -13.463 1.00 119.03 ? 154 ARG L C   1 
ATOM   10510 O O   . ARG K 2 132 ? 10.804  18.642   -13.181 1.00 116.40 ? 154 ARG L O   1 
ATOM   10511 C CB  . ARG K 2 132 ? 11.477  20.624   -15.528 1.00 118.32 ? 154 ARG L CB  1 
ATOM   10512 N N   . ASP K 2 133 ? 12.595  19.822   -12.548 1.00 123.20 ? 155 ASP L N   1 
ATOM   10513 C CA  . ASP K 2 133 ? 12.266  19.792   -11.120 1.00 129.70 ? 155 ASP L CA  1 
ATOM   10514 C C   . ASP K 2 133 ? 11.104  20.754   -10.857 1.00 134.77 ? 155 ASP L C   1 
ATOM   10515 O O   . ASP K 2 133 ? 10.795  21.626   -11.672 1.00 136.54 ? 155 ASP L O   1 
ATOM   10516 C CB  . ASP K 2 133 ? 13.503  20.204   -10.285 1.00 132.13 ? 155 ASP L CB  1 
ATOM   10517 C CG  . ASP K 2 133 ? 13.455  19.731   -8.823  1.00 132.57 ? 155 ASP L CG  1 
ATOM   10518 O OD1 . ASP K 2 133 ? 12.531  19.005   -8.407  1.00 130.27 ? 155 ASP L OD1 1 
ATOM   10519 O OD2 . ASP K 2 133 ? 14.378  20.095   -8.073  1.00 133.79 ? 155 ASP L OD2 1 
ATOM   10520 N N   . VAL K 2 134 ? 10.457  20.579   -9.719  1.00 139.62 ? 156 VAL L N   1 
ATOM   10521 C CA  . VAL K 2 134 ? 9.485   21.542   -9.240  1.00 143.62 ? 156 VAL L CA  1 
ATOM   10522 C C   . VAL K 2 134 ? 10.162  22.873   -8.931  1.00 142.06 ? 156 VAL L C   1 
ATOM   10523 O O   . VAL K 2 134 ? 11.295  22.897   -8.406  1.00 137.32 ? 156 VAL L O   1 
ATOM   10524 C CB  . VAL K 2 134 ? 8.771   21.032   -7.967  1.00 150.28 ? 156 VAL L CB  1 
ATOM   10525 N N   . VAL K 2 135 ? 9.474   23.969   -9.292  1.00 138.89 ? 157 VAL L N   1 
ATOM   10526 C CA  . VAL K 2 135 ? 9.846   25.307   -8.843  1.00 134.69 ? 157 VAL L CA  1 
ATOM   10527 C C   . VAL K 2 135 ? 9.067   25.563   -7.553  1.00 139.73 ? 157 VAL L C   1 
ATOM   10528 O O   . VAL K 2 135 ? 7.871   25.190   -7.452  1.00 135.56 ? 157 VAL L O   1 
ATOM   10529 C CB  . VAL K 2 135 ? 9.476   26.371   -9.873  1.00 124.14 ? 157 VAL L CB  1 
ATOM   10530 N N   . CYS K 2 136 ? 9.745   26.139   -6.535  1.00 145.91 ? 158 CYS L N   1 
ATOM   10531 C CA  . CYS K 2 136 ? 9.089   26.630   -5.321  1.00 152.79 ? 158 CYS L CA  1 
ATOM   10532 C C   . CYS K 2 136 ? 9.448   28.096   -5.020  1.00 153.45 ? 158 CYS L C   1 
ATOM   10533 O O   . CYS K 2 136 ? 8.621   28.808   -4.469  1.00 148.20 ? 158 CYS L O   1 
ATOM   10534 C CB  . CYS K 2 136 ? 9.412   25.689   -4.153  1.00 158.10 ? 158 CYS L CB  1 
ATOM   10535 S SG  . CYS K 2 136 ? 8.282   24.286   -4.325  1.00 171.66 ? 158 CYS L SG  1 
ATOM   10536 N N   . ASP L 2 4   ? -32.294 -71.873  22.548  1.00 324.37 ? 26  ASP I N   1 
ATOM   10537 C CA  . ASP L 2 4   ? -32.880 -71.917  21.185  1.00 315.90 ? 26  ASP I CA  1 
ATOM   10538 C C   . ASP L 2 4   ? -34.321 -72.480  21.230  1.00 311.80 ? 26  ASP I C   1 
ATOM   10539 O O   . ASP L 2 4   ? -34.584 -73.416  21.985  1.00 317.50 ? 26  ASP I O   1 
ATOM   10540 C CB  . ASP L 2 4   ? -31.994 -72.797  20.285  1.00 312.18 ? 26  ASP I CB  1 
ATOM   10541 C CG  . ASP L 2 4   ? -31.879 -72.271  18.861  1.00 307.84 ? 26  ASP I CG  1 
ATOM   10542 O OD1 . ASP L 2 4   ? -31.800 -71.037  18.678  1.00 314.71 ? 26  ASP I OD1 1 
ATOM   10543 O OD2 . ASP L 2 4   ? -31.831 -73.096  17.913  1.00 300.82 ? 26  ASP I OD2 1 
ATOM   10544 N N   . PRO L 2 5   ? -35.258 -71.906  20.433  1.00 301.67 ? 27  PRO I N   1 
ATOM   10545 C CA  . PRO L 2 5   ? -36.592 -72.523  20.347  1.00 296.59 ? 27  PRO I CA  1 
ATOM   10546 C C   . PRO L 2 5   ? -36.594 -73.893  19.659  1.00 289.14 ? 27  PRO I C   1 
ATOM   10547 O O   . PRO L 2 5   ? -37.236 -74.830  20.146  1.00 286.83 ? 27  PRO I O   1 
ATOM   10548 C CB  . PRO L 2 5   ? -37.398 -71.514  19.515  1.00 289.81 ? 27  PRO I CB  1 
ATOM   10549 C CG  . PRO L 2 5   ? -36.661 -70.230  19.631  1.00 293.07 ? 27  PRO I CG  1 
ATOM   10550 C CD  . PRO L 2 5   ? -35.219 -70.611  19.723  1.00 295.71 ? 27  PRO I CD  1 
ATOM   10551 N N   . CYS L 2 6   ? -35.865 -73.991  18.547  1.00 282.03 ? 28  CYS I N   1 
ATOM   10552 C CA  . CYS L 2 6   ? -35.861 -75.181  17.693  1.00 274.33 ? 28  CYS I CA  1 
ATOM   10553 C C   . CYS L 2 6   ? -35.279 -76.420  18.371  1.00 279.06 ? 28  CYS I C   1 
ATOM   10554 O O   . CYS L 2 6   ? -35.771 -77.528  18.147  1.00 285.41 ? 28  CYS I O   1 
ATOM   10555 C CB  . CYS L 2 6   ? -35.095 -74.890  16.400  1.00 264.21 ? 28  CYS I CB  1 
ATOM   10556 S SG  . CYS L 2 6   ? -35.744 -73.483  15.469  1.00 261.29 ? 28  CYS I SG  1 
ATOM   10557 N N   . SER L 2 7   ? -34.251 -76.228  19.200  1.00 281.45 ? 29  SER I N   1 
ATOM   10558 C CA  . SER L 2 7   ? -33.647 -77.316  19.980  1.00 282.98 ? 29  SER I CA  1 
ATOM   10559 C C   . SER L 2 7   ? -34.675 -78.096  20.812  1.00 284.59 ? 29  SER I C   1 
ATOM   10560 O O   . SER L 2 7   ? -34.525 -79.301  21.021  1.00 281.19 ? 29  SER I O   1 
ATOM   10561 C CB  . SER L 2 7   ? -32.564 -76.772  20.911  1.00 289.58 ? 29  SER I CB  1 
ATOM   10562 O OG  . SER L 2 7   ? -31.852 -77.823  21.541  1.00 292.29 ? 29  SER I OG  1 
ATOM   10563 N N   . ASN L 2 8   ? -35.710 -77.398  21.281  1.00 285.24 ? 30  ASN I N   1 
ATOM   10564 C CA  . ASN L 2 8   ? -36.823 -78.015  22.020  1.00 288.27 ? 30  ASN I CA  1 
ATOM   10565 C C   . ASN L 2 8   ? -37.564 -79.127  21.255  1.00 284.71 ? 30  ASN I C   1 
ATOM   10566 O O   . ASN L 2 8   ? -38.064 -80.075  21.875  1.00 293.82 ? 30  ASN I O   1 
ATOM   10567 C CB  . ASN L 2 8   ? -37.832 -76.933  22.445  1.00 287.15 ? 30  ASN I CB  1 
ATOM   10568 C CG  . ASN L 2 8   ? -38.778 -77.403  23.542  1.00 292.81 ? 30  ASN I CG  1 
ATOM   10569 O OD1 . ASN L 2 8   ? -38.351 -77.934  24.569  1.00 295.85 ? 30  ASN I OD1 1 
ATOM   10570 N ND2 . ASN L 2 8   ? -40.072 -77.188  23.335  1.00 293.61 ? 30  ASN I ND2 1 
ATOM   10571 N N   . CYS L 2 9   ? -37.654 -78.991  19.930  1.00 273.78 ? 31  CYS I N   1 
ATOM   10572 C CA  . CYS L 2 9   ? -38.344 -79.985  19.091  1.00 266.18 ? 31  CYS I CA  1 
ATOM   10573 C C   . CYS L 2 9   ? -37.526 -81.278  18.977  1.00 256.67 ? 31  CYS I C   1 
ATOM   10574 O O   . CYS L 2 9   ? -36.314 -81.216  18.772  1.00 254.64 ? 31  CYS I O   1 
ATOM   10575 C CB  . CYS L 2 9   ? -38.615 -79.432  17.694  1.00 265.76 ? 31  CYS I CB  1 
ATOM   10576 S SG  . CYS L 2 9   ? -39.569 -77.892  17.675  1.00 275.58 ? 31  CYS I SG  1 
ATOM   10577 N N   . PRO L 2 10  ? -38.185 -82.448  19.106  1.00 250.05 ? 32  PRO I N   1 
ATOM   10578 C CA  . PRO L 2 10  ? -37.487 -83.736  19.055  1.00 247.80 ? 32  PRO I CA  1 
ATOM   10579 C C   . PRO L 2 10  ? -37.347 -84.309  17.639  1.00 238.82 ? 32  PRO I C   1 
ATOM   10580 O O   . PRO L 2 10  ? -37.705 -83.654  16.658  1.00 230.64 ? 32  PRO I O   1 
ATOM   10581 C CB  . PRO L 2 10  ? -38.396 -84.632  19.896  1.00 251.21 ? 32  PRO I CB  1 
ATOM   10582 C CG  . PRO L 2 10  ? -39.758 -84.134  19.566  1.00 250.34 ? 32  PRO I CG  1 
ATOM   10583 C CD  . PRO L 2 10  ? -39.612 -82.636  19.432  1.00 249.55 ? 32  PRO I CD  1 
ATOM   10584 N N   . ALA L 2 11  ? -36.809 -85.523  17.559  1.00 237.58 ? 33  ALA I N   1 
ATOM   10585 C CA  . ALA L 2 11  ? -36.809 -86.313  16.320  1.00 231.53 ? 33  ALA I CA  1 
ATOM   10586 C C   . ALA L 2 11  ? -38.237 -86.654  15.911  1.00 230.25 ? 33  ALA I C   1 
ATOM   10587 O O   . ALA L 2 11  ? -39.107 -86.833  16.770  1.00 233.56 ? 33  ALA I O   1 
ATOM   10588 C CB  . ALA L 2 11  ? -35.992 -87.585  16.509  1.00 231.40 ? 33  ALA I CB  1 
ATOM   10589 N N   . GLY L 2 12  ? -38.471 -86.738  14.601  1.00 225.19 ? 34  GLY I N   1 
ATOM   10590 C CA  . GLY L 2 12  ? -39.817 -86.921  14.038  1.00 222.60 ? 34  GLY I CA  1 
ATOM   10591 C C   . GLY L 2 12  ? -40.570 -85.611  13.771  1.00 223.08 ? 34  GLY I C   1 
ATOM   10592 O O   . GLY L 2 12  ? -41.709 -85.649  13.301  1.00 222.46 ? 34  GLY I O   1 
ATOM   10593 N N   . THR L 2 13  ? -39.935 -84.470  14.055  1.00 224.84 ? 35  THR I N   1 
ATOM   10594 C CA  . THR L 2 13  ? -40.525 -83.143  13.853  1.00 224.41 ? 35  THR I CA  1 
ATOM   10595 C C   . THR L 2 13  ? -39.469 -82.168  13.336  1.00 219.33 ? 35  THR I C   1 
ATOM   10596 O O   . THR L 2 13  ? -38.291 -82.519  13.242  1.00 217.86 ? 35  THR I O   1 
ATOM   10597 C CB  . THR L 2 13  ? -41.096 -82.565  15.173  1.00 233.68 ? 35  THR I CB  1 
ATOM   10598 O OG1 . THR L 2 13  ? -40.057 -82.481  16.156  1.00 241.16 ? 35  THR I OG1 1 
ATOM   10599 C CG2 . THR L 2 13  ? -42.222 -83.426  15.716  1.00 239.69 ? 35  THR I CG2 1 
ATOM   10600 N N   . PHE L 2 14  ? -39.900 -80.953  13.004  1.00 218.13 ? 36  PHE I N   1 
ATOM   10601 C CA  . PHE L 2 14  ? -38.986 -79.866  12.635  1.00 217.40 ? 36  PHE I CA  1 
ATOM   10602 C C   . PHE L 2 14  ? -39.468 -78.513  13.152  1.00 225.26 ? 36  PHE I C   1 
ATOM   10603 O O   . PHE L 2 14  ? -40.666 -78.320  13.394  1.00 236.30 ? 36  PHE I O   1 
ATOM   10604 C CB  . PHE L 2 14  ? -38.786 -79.812  11.115  1.00 209.42 ? 36  PHE I CB  1 
ATOM   10605 C CG  . PHE L 2 14  ? -40.000 -79.361  10.340  1.00 204.74 ? 36  PHE I CG  1 
ATOM   10606 C CD1 . PHE L 2 14  ? -40.086 -78.066  9.854   1.00 202.52 ? 36  PHE I CD1 1 
ATOM   10607 C CD2 . PHE L 2 14  ? -41.047 -80.242  10.082  1.00 202.34 ? 36  PHE I CD2 1 
ATOM   10608 C CE1 . PHE L 2 14  ? -41.195 -77.644  9.133   1.00 200.65 ? 36  PHE I CE1 1 
ATOM   10609 C CE2 . PHE L 2 14  ? -42.158 -79.839  9.355   1.00 200.77 ? 36  PHE I CE2 1 
ATOM   10610 C CZ  . PHE L 2 14  ? -42.236 -78.528  8.886   1.00 199.59 ? 36  PHE I CZ  1 
ATOM   10611 N N   . CYS L 2 15  ? -38.523 -77.587  13.305  1.00 229.35 ? 37  CYS I N   1 
ATOM   10612 C CA  . CYS L 2 15  ? -38.808 -76.228  13.779  1.00 235.90 ? 37  CYS I CA  1 
ATOM   10613 C C   . CYS L 2 15  ? -39.307 -75.352  12.622  1.00 230.38 ? 37  CYS I C   1 
ATOM   10614 O O   . CYS L 2 15  ? -38.519 -74.707  11.931  1.00 221.23 ? 37  CYS I O   1 
ATOM   10615 C CB  . CYS L 2 15  ? -37.546 -75.645  14.421  1.00 242.03 ? 37  CYS I CB  1 
ATOM   10616 S SG  . CYS L 2 15  ? -37.679 -73.969  15.064  1.00 251.46 ? 37  CYS I SG  1 
ATOM   10617 N N   . ASP L 2 16  ? -40.624 -75.336  12.437  1.00 233.97 ? 38  ASP I N   1 
ATOM   10618 C CA  . A