data_6E5N
# 
_entry.id   6E5N 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.325 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6E5N         
WWPDB D_1000235583 
BMRB  30500        
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        'Structure of a protein complex' 
_pdbx_database_related.db_id          30500 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        6E5N 
_pdbx_database_status.recvd_initial_deposition_date   2018-07-20 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Buel, G.R.'    1 0000-0003-2917-3055 
'Walters, K.J.' 2 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            10 
_citation.language                  ? 
_citation.page_first                4974 
_citation.page_last                 4974 
_citation.title                     
'Clathrin light chain A drives selective myosin VI recruitment to clathrin-coated pits under membrane tension.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-019-12855-6 
_citation.pdbx_database_id_PubMed   31672988 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Biancospino, M.'         1  ?                   
primary 'Buel, G.R.'              2  0000-0003-2917-3055 
primary 'Nino, C.A.'              3  ?                   
primary 'Maspero, E.'             4  ?                   
primary 'Scotto di Perrotolo, R.' 5  ?                   
primary 'Raimondi, A.'            6  0000-0002-4563-386X 
primary 'Redlingshofer, L.'       7  ?                   
primary 'Weber, J.'               8  ?                   
primary 'Brodsky, F.M.'           9  ?                   
primary 'Walters, K.J.'           10 ?                   
primary 'Polo, S.'                11 0000-0001-5536-9399 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Unconventional myosin-VI' 9991.648 1 ? ? ? ? 
2 polymer man 'Clathrin light chain A'   2373.528 1 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Unconventional myosin-6' 
2 Lca                       
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GPLGSRPKMTPEQMAKEMSEFLSRGPAVLATKAAAGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAW
KSKNKKR
;
;GPLGSRPKMTPEQMAKEMSEFLSRGPAVLATKAAAGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAW
KSKNKKR
;
B ? 
2 'polypeptide(L)' no no GPLGSPEFIENDEAFAILDGGAPG                                                                   
GPLGSPEFIENDEAFAILDGGAPG                                                                   A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  PRO n 
1 3  LEU n 
1 4  GLY n 
1 5  SER n 
1 6  ARG n 
1 7  PRO n 
1 8  LYS n 
1 9  MET n 
1 10 THR n 
1 11 PRO n 
1 12 GLU n 
1 13 GLN n 
1 14 MET n 
1 15 ALA n 
1 16 LYS n 
1 17 GLU n 
1 18 MET n 
1 19 SER n 
1 20 GLU n 
1 21 PHE n 
1 22 LEU n 
1 23 SER n 
1 24 ARG n 
1 25 GLY n 
1 26 PRO n 
1 27 ALA n 
1 28 VAL n 
1 29 LEU n 
1 30 ALA n 
1 31 THR n 
1 32 LYS n 
1 33 ALA n 
1 34 ALA n 
1 35 ALA n 
1 36 GLY n 
1 37 THR n 
1 38 LYS n 
1 39 LYS n 
1 40 TYR n 
1 41 ASP n 
1 42 LEU n 
1 43 SER n 
1 44 LYS n 
1 45 TRP n 
1 46 LYS n 
1 47 TYR n 
1 48 ALA n 
1 49 GLU n 
1 50 LEU n 
1 51 ARG n 
1 52 ASP n 
1 53 THR n 
1 54 ILE n 
1 55 ASN n 
1 56 THR n 
1 57 SER n 
1 58 CYS n 
1 59 ASP n 
1 60 ILE n 
1 61 GLU n 
1 62 LEU n 
1 63 LEU n 
1 64 ALA n 
1 65 ALA n 
1 66 CYS n 
1 67 ARG n 
1 68 GLU n 
1 69 GLU n 
1 70 PHE n 
1 71 HIS n 
1 72 ARG n 
1 73 ARG n 
1 74 LEU n 
1 75 LYS n 
1 76 VAL n 
1 77 TYR n 
1 78 HIS n 
1 79 ALA n 
1 80 TRP n 
1 81 LYS n 
1 82 SER n 
1 83 LYS n 
1 84 ASN n 
1 85 LYS n 
1 86 LYS n 
1 87 ARG n 
2 1  GLY n 
2 2  PRO n 
2 3  LEU n 
2 4  GLY n 
2 5  SER n 
2 6  PRO n 
2 7  GLU n 
2 8  PHE n 
2 9  ILE n 
2 10 GLU n 
2 11 ASN n 
2 12 ASP n 
2 13 GLU n 
2 14 ALA n 
2 15 PHE n 
2 16 ALA n 
2 17 ILE n 
2 18 LEU n 
2 19 ASP n 
2 20 GLY n 
2 21 GLY n 
2 22 ALA n 
2 23 PRO n 
2 24 GLY n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 87 Human ? 'MYO6, KIAA0389' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 24 Human ? CLTA             ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 
562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP MYO6_HUMAN Q9UM54 Q9UM54-1 1 
;RPKMTPEQMAKEMSEFLSRGPAVLATKAAAGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNK
KR
;
1041 
2 UNP CLCA_HUMAN P09496 ?        2 IENDEAFAILDGGAPG                                                                      46   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6E5N B 6 ? 87 ? Q9UM54 1041 ? 1122 ? 1050 1131 
2 2 6E5N A 9 ? 24 ? P09496 46   ? 61   ? 46   61   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6E5N GLY B 1 ? UNP Q9UM54 ? ? 'expression tag' 1045 1  
1 6E5N PRO B 2 ? UNP Q9UM54 ? ? 'expression tag' 1046 2  
1 6E5N LEU B 3 ? UNP Q9UM54 ? ? 'expression tag' 1047 3  
1 6E5N GLY B 4 ? UNP Q9UM54 ? ? 'expression tag' 1048 4  
1 6E5N SER B 5 ? UNP Q9UM54 ? ? 'expression tag' 1049 5  
2 6E5N GLY A 1 ? UNP P09496 ? ? 'expression tag' 38   6  
2 6E5N PRO A 2 ? UNP P09496 ? ? 'expression tag' 39   7  
2 6E5N LEU A 3 ? UNP P09496 ? ? 'expression tag' 40   8  
2 6E5N GLY A 4 ? UNP P09496 ? ? 'expression tag' 41   9  
2 6E5N SER A 5 ? UNP P09496 ? ? 'expression tag' 42   10 
2 6E5N PRO A 6 ? UNP P09496 ? ? 'expression tag' 43   11 
2 6E5N GLU A 7 ? UNP P09496 ? ? 'expression tag' 44   12 
2 6E5N PHE A 8 ? UNP P09496 ? ? 'expression tag' 45   13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
1  1 1 '2D 1H-15N HSQC'                1 isotropic 
2  1 1 '3D 1H-15N NOESY'               1 isotropic 
3  1 1 '2D 1H-13C HSQC'                1 isotropic 
4  1 1 '3D 1H-13C NOESY'               1 isotropic 
5  1 2 '2D 1H-15N HSQC'                1 isotropic 
9  1 2 '3D 1H-15N NOESY'               1 isotropic 
8  1 2 '2D 1H-13C HSQC'                1 isotropic 
7  1 2 '3D 1H-13C NOESY'               1 isotropic 
6  1 1 '3D HNCO'                       2 isotropic 
10 1 1 '3D HNCACB'                     1 isotropic 
12 1 2 '3D HNCO'                       1 isotropic 
11 1 2 '3D HNCACB'                     1 isotropic 
13 1 1 'half-filtered 3D 1H-13C NOESY' 1 isotropic 
14 1 2 'half-filtered 3D 1H-13C NOESY' 1 isotropic 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            283.2 
_pdbx_nmr_exptl_sample_conditions.pressure_units         mmHg 
_pdbx_nmr_exptl_sample_conditions.pressure               760 
_pdbx_nmr_exptl_sample_conditions.pH                     6.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         '50 mM NaCl, 20 mM NaPO4' 
_pdbx_nmr_exptl_sample_conditions.details                ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   mM 
_pdbx_nmr_exptl_sample_conditions.label                  Conditions_all 
_pdbx_nmr_exptl_sample_conditions.pH_err                 ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.pressure_err           ? 
_pdbx_nmr_exptl_sample_conditions.temperature_err        ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
_pdbx_nmr_sample_details.label 
_pdbx_nmr_sample_details.type 
_pdbx_nmr_sample_details.details 
1 '0.36 mM [U-13C; U-15N] Myosin VI 1050-1131, 0.36 mM None Clathrin Light Chain Alpha 46-61, 95% H2O/5% D2O' '95% H2O/5% D2O' 
CLCa_13C-15N-Myo6 solution 
;An additional 5 non-native amino acids from the vector are present at the N-terminal end of the Myosin VI construct. These are GPLGS.  An additional 8 non-native amino acids from the vector are present at the N-terminal end of the Clathrin construct. These are GPLGSPEF.  These are intrinsically disordered and not included in the structure calculations.
;
2 '0.4 mM None Myosin VI 1050-1131, 0.4 mM [U-13C; U-15N] Clathrin Light Chain Alpha 46-61, 95% H2O/5% D2O'   '95% H2O/5% D2O' 
Myo6_13C-15N-CLCa solution 
;An additional 5 non-native amino acids from the vector are present at the N-terminal end of the Myosin VI construct. These are GPLGS.  An additional 8 non-native amino acids from the vector are present at the N-terminal end of the Clathrin construct. These are GPLGSPEF. 
 These are intrinsically disordered and not included in the structure calculations.
;
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.details 
1 'AVANCE III' ? Bruker 850 ? 
2 'AVANCE III' ? Bruker 700 ? 
# 
_pdbx_nmr_refine.entry_id           6E5N 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   8 
# 
_pdbx_nmr_ensemble.entry_id                                      6E5N 
_pdbx_nmr_ensemble.conformers_calculated_total_number            300 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.representative_conformer                      ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             6E5N 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
1 collection                  TopSpin      ? 'Bruker Biospin'                                    
2 processing                  NMRPipe      ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 
3 processing                  NMRDraw      ? 'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' 
4 'peak picking'              XEASY        ? 'Bartels et al.'                                    
5 'chemical shift assignment' XEASY        ? 'Bartels et al.'                                    
6 'geometry optimization'     TALOS        ? 'Cornilescu, Delaglio and Bax'                      
7 'structure calculation'     'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore'          
8 refinement                  'X-PLOR NIH' ? 'Schwieters, Kuszewski, Tjandra and Clore'          
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6E5N 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6E5N 
_struct.title                        
'Solution structure of human Myosin VI isoform 3 (1050-1131) in complex with Clathrin light chain a (46-61)' 
_struct.pdbx_descriptor              'Unconventional myosin-VI, Clathrin light chain A' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6E5N 
_struct_keywords.text            'Myosin, Clathrin, Trafficking, Endocytosis, MOTOR PROTEIN' 
_struct_keywords.pdbx_keywords   'MOTOR PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 THR A 10 ? GLY A 25 ? THR B 1054 GLY B 1069 1 ? 16 
HELX_P HELX_P2 AA2 THR A 31 ? ALA A 35 ? THR B 1075 ALA B 1079 5 ? 5  
HELX_P HELX_P3 AA3 LYS A 46 ? SER A 57 ? LYS B 1090 SER B 1101 1 ? 12 
HELX_P HELX_P4 AA4 ASP A 59 ? LYS A 86 ? ASP B 1103 LYS B 1130 1 ? 28 
HELX_P HELX_P5 AA5 GLU B 10 ? LEU B 18 ? GLU A 47   LEU A 55   1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    6E5N 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . ARG A 1 6  ? 6.162   -4.540  15.457  1.00 0.00 ? 1050 ARG B N    1  
ATOM 2     C CA   . ARG A 1 6  ? 5.219   -4.370  14.317  1.00 0.00 ? 1050 ARG B CA   1  
ATOM 3     C C    . ARG A 1 6  ? 3.822   -4.808  14.745  1.00 0.00 ? 1050 ARG B C    1  
ATOM 4     O O    . ARG A 1 6  ? 3.663   -5.537  15.723  1.00 0.00 ? 1050 ARG B O    1  
ATOM 5     C CB   . ARG A 1 6  ? 5.686   -5.220  13.137  1.00 0.00 ? 1050 ARG B CB   1  
ATOM 6     C CG   . ARG A 1 6  ? 6.542   -4.366  12.201  1.00 0.00 ? 1050 ARG B CG   1  
ATOM 7     C CD   . ARG A 1 6  ? 6.833   -5.148  10.921  1.00 0.00 ? 1050 ARG B CD   1  
ATOM 8     N NE   . ARG A 1 6  ? 7.643   -6.320  11.231  1.00 0.00 ? 1050 ARG B NE   1  
ATOM 9     C CZ   . ARG A 1 6  ? 8.973   -6.249  11.354  1.00 0.00 ? 1050 ARG B CZ   1  
ATOM 10    N NH1  . ARG A 1 6  ? 9.607   -5.111  11.217  1.00 0.00 ? 1050 ARG B NH1  1  
ATOM 11    N NH2  . ARG A 1 6  ? 9.652   -7.328  11.628  1.00 0.00 ? 1050 ARG B NH2  1  
ATOM 12    H H    . ARG A 1 6  ? 7.142   -4.516  15.105  1.00 0.00 ? 1050 ARG B H    1  
ATOM 13    H HA   . ARG A 1 6  ? 5.201   -3.329  14.026  1.00 0.00 ? 1050 ARG B HA   1  
ATOM 14    H HB2  . ARG A 1 6  ? 6.270   -6.054  13.501  1.00 0.00 ? 1050 ARG B HB2  1  
ATOM 15    H HB3  . ARG A 1 6  ? 4.826   -5.589  12.598  1.00 0.00 ? 1050 ARG B HB3  1  
ATOM 16    H HG2  . ARG A 1 6  ? 6.012   -3.458  11.957  1.00 0.00 ? 1050 ARG B HG2  1  
ATOM 17    H HG3  . ARG A 1 6  ? 7.473   -4.122  12.689  1.00 0.00 ? 1050 ARG B HG3  1  
ATOM 18    H HD2  . ARG A 1 6  ? 5.901   -5.467  10.478  1.00 0.00 ? 1050 ARG B HD2  1  
ATOM 19    H HD3  . ARG A 1 6  ? 7.360   -4.515  10.223  1.00 0.00 ? 1050 ARG B HD3  1  
ATOM 20    H HE   . ARG A 1 6  ? 7.198   -7.187  11.352  1.00 0.00 ? 1050 ARG B HE   1  
ATOM 21    H HH11 . ARG A 1 6  ? 9.105   -4.274  11.017  1.00 0.00 ? 1050 ARG B HH11 1  
ATOM 22    H HH12 . ARG A 1 6  ? 10.601  -5.083  11.311  1.00 0.00 ? 1050 ARG B HH12 1  
ATOM 23    H HH21 . ARG A 1 6  ? 9.179   -8.202  11.744  1.00 0.00 ? 1050 ARG B HH21 1  
ATOM 24    H HH22 . ARG A 1 6  ? 10.646  -7.283  11.723  1.00 0.00 ? 1050 ARG B HH22 1  
ATOM 25    N N    . PRO A 1 7  ? 2.812   -4.379  14.032  1.00 0.00 ? 1051 PRO B N    1  
ATOM 26    C CA   . PRO A 1 7  ? 1.394   -4.738  14.343  1.00 0.00 ? 1051 PRO B CA   1  
ATOM 27    C C    . PRO A 1 7  ? 1.116   -6.230  14.161  1.00 0.00 ? 1051 PRO B C    1  
ATOM 28    O O    . PRO A 1 7  ? 0.227   -6.788  14.805  1.00 0.00 ? 1051 PRO B O    1  
ATOM 29    C CB   . PRO A 1 7  ? 0.582   -3.905  13.343  1.00 0.00 ? 1051 PRO B CB   1  
ATOM 30    C CG   . PRO A 1 7  ? 1.520   -3.601  12.224  1.00 0.00 ? 1051 PRO B CG   1  
ATOM 31    C CD   . PRO A 1 7  ? 2.907   -3.510  12.848  1.00 0.00 ? 1051 PRO B CD   1  
ATOM 32    H HA   . PRO A 1 7  ? 1.147   -4.432  15.347  1.00 0.00 ? 1051 PRO B HA   1  
ATOM 33    H HB2  . PRO A 1 7  ? -0.261  -4.476  12.981  1.00 0.00 ? 1051 PRO B HB2  1  
ATOM 34    H HB3  . PRO A 1 7  ? 0.246   -2.988  13.803  1.00 0.00 ? 1051 PRO B HB3  1  
ATOM 35    H HG2  . PRO A 1 7  ? 1.490   -4.394  11.489  1.00 0.00 ? 1051 PRO B HG2  1  
ATOM 36    H HG3  . PRO A 1 7  ? 1.263   -2.658  11.770  1.00 0.00 ? 1051 PRO B HG3  1  
ATOM 37    H HD2  . PRO A 1 7  ? 3.656   -3.876  12.161  1.00 0.00 ? 1051 PRO B HD2  1  
ATOM 38    H HD3  . PRO A 1 7  ? 3.126   -2.496  13.147  1.00 0.00 ? 1051 PRO B HD3  1  
ATOM 39    N N    . LYS A 1 8  ? 1.888   -6.870  13.282  1.00 0.00 ? 1052 LYS B N    1  
ATOM 40    C CA   . LYS A 1 8  ? 1.723   -8.296  13.019  1.00 0.00 ? 1052 LYS B CA   1  
ATOM 41    C C    . LYS A 1 8  ? 0.254   -8.634  12.795  1.00 0.00 ? 1052 LYS B C    1  
ATOM 42    O O    . LYS A 1 8  ? -0.223  -9.686  13.223  1.00 0.00 ? 1052 LYS B O    1  
ATOM 43    C CB   . LYS A 1 8  ? 2.271   -9.095  14.197  1.00 0.00 ? 1052 LYS B CB   1  
ATOM 44    C CG   . LYS A 1 8  ? 3.793   -8.959  14.228  1.00 0.00 ? 1052 LYS B CG   1  
ATOM 45    C CD   . LYS A 1 8  ? 4.252   -8.816  15.674  1.00 0.00 ? 1052 LYS B CD   1  
ATOM 46    C CE   . LYS A 1 8  ? 5.779   -8.720  15.726  1.00 0.00 ? 1052 LYS B CE   1  
ATOM 47    N NZ   . LYS A 1 8  ? 6.217   -8.470  17.129  1.00 0.00 ? 1052 LYS B NZ   1  
ATOM 48    H H    . LYS A 1 8  ? 2.582   -6.373  12.808  1.00 0.00 ? 1052 LYS B H    1  
ATOM 49    H HA   . LYS A 1 8  ? 2.283   -8.555  12.133  1.00 0.00 ? 1052 LYS B HA   1  
ATOM 50    H HB2  . LYS A 1 8  ? 1.853   -8.715  15.118  1.00 0.00 ? 1052 LYS B HB2  1  
ATOM 51    H HB3  . LYS A 1 8  ? 2.007   -10.136 14.082  1.00 0.00 ? 1052 LYS B HB3  1  
ATOM 52    H HG2  . LYS A 1 8  ? 4.242   -9.839  13.790  1.00 0.00 ? 1052 LYS B HG2  1  
ATOM 53    H HG3  . LYS A 1 8  ? 4.090   -8.086  13.668  1.00 0.00 ? 1052 LYS B HG3  1  
ATOM 54    H HD2  . LYS A 1 8  ? 3.820   -7.917  16.092  1.00 0.00 ? 1052 LYS B HD2  1  
ATOM 55    H HD3  . LYS A 1 8  ? 3.925   -9.674  16.244  1.00 0.00 ? 1052 LYS B HD3  1  
ATOM 56    H HE2  . LYS A 1 8  ? 6.211   -9.645  15.372  1.00 0.00 ? 1052 LYS B HE2  1  
ATOM 57    H HE3  . LYS A 1 8  ? 6.109   -7.906  15.096  1.00 0.00 ? 1052 LYS B HE3  1  
ATOM 58    H HZ1  . LYS A 1 8  ? 6.962   -9.149  17.385  1.00 0.00 ? 1052 LYS B HZ1  1  
ATOM 59    H HZ2  . LYS A 1 8  ? 5.407   -8.584  17.771  1.00 0.00 ? 1052 LYS B HZ2  1  
ATOM 60    H HZ3  . LYS A 1 8  ? 6.593   -7.503  17.209  1.00 0.00 ? 1052 LYS B HZ3  1  
ATOM 61    N N    . MET A 1 9  ? -0.461  -7.735  12.128  1.00 0.00 ? 1053 MET B N    1  
ATOM 62    C CA   . MET A 1 9  ? -1.877  -7.953  11.861  1.00 0.00 ? 1053 MET B CA   1  
ATOM 63    C C    . MET A 1 9  ? -2.068  -8.788  10.603  1.00 0.00 ? 1053 MET B C    1  
ATOM 64    O O    . MET A 1 9  ? -1.290  -8.687  9.659   1.00 0.00 ? 1053 MET B O    1  
ATOM 65    C CB   . MET A 1 9  ? -2.602  -6.620  11.690  1.00 0.00 ? 1053 MET B CB   1  
ATOM 66    C CG   . MET A 1 9  ? -2.901  -6.015  13.061  1.00 0.00 ? 1053 MET B CG   1  
ATOM 67    S SD   . MET A 1 9  ? -4.311  -4.881  12.930  1.00 0.00 ? 1053 MET B SD   1  
ATOM 68    C CE   . MET A 1 9  ? -3.930  -4.212  11.290  1.00 0.00 ? 1053 MET B CE   1  
ATOM 69    H H    . MET A 1 9  ? -0.030  -6.912  11.813  1.00 0.00 ? 1053 MET B H    1  
ATOM 70    H HA   . MET A 1 9  ? -2.314  -8.477  12.696  1.00 0.00 ? 1053 MET B HA   1  
ATOM 71    H HB2  . MET A 1 9  ? -1.975  -5.942  11.126  1.00 0.00 ? 1053 MET B HB2  1  
ATOM 72    H HB3  . MET A 1 9  ? -3.528  -6.784  11.159  1.00 0.00 ? 1053 MET B HB3  1  
ATOM 73    H HG2  . MET A 1 9  ? -3.138  -6.805  13.758  1.00 0.00 ? 1053 MET B HG2  1  
ATOM 74    H HG3  . MET A 1 9  ? -2.036  -5.474  13.412  1.00 0.00 ? 1053 MET B HG3  1  
ATOM 75    H HE1  . MET A 1 9  ? -2.867  -4.027  11.213  1.00 0.00 ? 1053 MET B HE1  1  
ATOM 76    H HE2  . MET A 1 9  ? -4.466  -3.290  11.140  1.00 0.00 ? 1053 MET B HE2  1  
ATOM 77    H HE3  . MET A 1 9  ? -4.234  -4.921  10.535  1.00 0.00 ? 1053 MET B HE3  1  
ATOM 78    N N    . THR A 1 10 ? -3.109  -9.609  10.594  1.00 0.00 ? 1054 THR B N    1  
ATOM 79    C CA   . THR A 1 10 ? -3.383  -10.451 9.438   1.00 0.00 ? 1054 THR B CA   1  
ATOM 80    C C    . THR A 1 10 ? -3.824  -9.597  8.249   1.00 0.00 ? 1054 THR B C    1  
ATOM 81    O O    . THR A 1 10 ? -4.239  -8.451  8.421   1.00 0.00 ? 1054 THR B O    1  
ATOM 82    C CB   . THR A 1 10 ? -4.471  -11.472 9.782   1.00 0.00 ? 1054 THR B CB   1  
ATOM 83    O OG1  . THR A 1 10 ? -5.696  -10.797 10.015  1.00 0.00 ? 1054 THR B OG1  1  
ATOM 84    C CG2  . THR A 1 10 ? -4.065  -12.248 11.035  1.00 0.00 ? 1054 THR B CG2  1  
ATOM 85    H H    . THR A 1 10 ? -3.703  -9.647  11.375  1.00 0.00 ? 1054 THR B H    1  
ATOM 86    H HA   . THR A 1 10 ? -2.482  -10.977 9.175   1.00 0.00 ? 1054 THR B HA   1  
ATOM 87    H HB   . THR A 1 10 ? -4.592  -12.160 8.964   1.00 0.00 ? 1054 THR B HB   1  
ATOM 88    H HG1  . THR A 1 10 ? -5.921  -10.897 10.943  1.00 0.00 ? 1054 THR B HG1  1  
ATOM 89    H HG21 . THR A 1 10 ? -4.649  -13.153 11.102  1.00 0.00 ? 1054 THR B HG21 1  
ATOM 90    H HG22 . THR A 1 10 ? -4.243  -11.639 11.910  1.00 0.00 ? 1054 THR B HG22 1  
ATOM 91    H HG23 . THR A 1 10 ? -3.017  -12.498 10.978  1.00 0.00 ? 1054 THR B HG23 1  
ATOM 92    N N    . PRO A 1 11 ? -3.725  -10.122 7.051   1.00 0.00 ? 1055 PRO B N    1  
ATOM 93    C CA   . PRO A 1 11 ? -4.117  -9.374  5.817   1.00 0.00 ? 1055 PRO B CA   1  
ATOM 94    C C    . PRO A 1 11 ? -5.526  -8.792  5.928   1.00 0.00 ? 1055 PRO B C    1  
ATOM 95    O O    . PRO A 1 11 ? -5.766  -7.644  5.547   1.00 0.00 ? 1055 PRO B O    1  
ATOM 96    C CB   . PRO A 1 11 ? -4.062  -10.447 4.726   1.00 0.00 ? 1055 PRO B CB   1  
ATOM 97    C CG   . PRO A 1 11 ? -3.085  -11.458 5.221   1.00 0.00 ? 1055 PRO B CG   1  
ATOM 98    C CD   . PRO A 1 11 ? -3.225  -11.473 6.738   1.00 0.00 ? 1055 PRO B CD   1  
ATOM 99    H HA   . PRO A 1 11 ? -3.403  -8.596  5.601   1.00 0.00 ? 1055 PRO B HA   1  
ATOM 100   H HB2  . PRO A 1 11 ? -5.036  -10.896 4.592   1.00 0.00 ? 1055 PRO B HB2  1  
ATOM 101   H HB3  . PRO A 1 11 ? -3.712  -10.022 3.799   1.00 0.00 ? 1055 PRO B HB3  1  
ATOM 102   H HG2  . PRO A 1 11 ? -3.324  -12.432 4.815   1.00 0.00 ? 1055 PRO B HG2  1  
ATOM 103   H HG3  . PRO A 1 11 ? -2.079  -11.175 4.951   1.00 0.00 ? 1055 PRO B HG3  1  
ATOM 104   H HD2  . PRO A 1 11 ? -3.931  -12.231 7.039   1.00 0.00 ? 1055 PRO B HD2  1  
ATOM 105   H HD3  . PRO A 1 11 ? -2.266  -11.637 7.204   1.00 0.00 ? 1055 PRO B HD3  1  
ATOM 106   N N    . GLU A 1 12 ? -6.450  -9.583  6.460   1.00 0.00 ? 1056 GLU B N    1  
ATOM 107   C CA   . GLU A 1 12 ? -7.824  -9.125  6.623   1.00 0.00 ? 1056 GLU B CA   1  
ATOM 108   C C    . GLU A 1 12 ? -7.899  -8.010  7.660   1.00 0.00 ? 1056 GLU B C    1  
ATOM 109   O O    . GLU A 1 12 ? -8.627  -7.034  7.483   1.00 0.00 ? 1056 GLU B O    1  
ATOM 110   C CB   . GLU A 1 12 ? -8.717  -10.290 7.051   1.00 0.00 ? 1056 GLU B CB   1  
ATOM 111   C CG   . GLU A 1 12 ? -8.865  -11.273 5.888   1.00 0.00 ? 1056 GLU B CG   1  
ATOM 112   C CD   . GLU A 1 12 ? -9.595  -12.527 6.355   1.00 0.00 ? 1056 GLU B CD   1  
ATOM 113   O OE1  . GLU A 1 12 ? -9.714  -12.706 7.556   1.00 0.00 ? 1056 GLU B OE1  1  
ATOM 114   O OE2  . GLU A 1 12 ? -10.026 -13.289 5.506   1.00 0.00 ? 1056 GLU B OE2  1  
ATOM 115   H H    . GLU A 1 12 ? -6.204  -10.485 6.755   1.00 0.00 ? 1056 GLU B H    1  
ATOM 116   H HA   . GLU A 1 12 ? -8.177  -8.746  5.675   1.00 0.00 ? 1056 GLU B HA   1  
ATOM 117   H HB2  . GLU A 1 12 ? -8.274  -10.794 7.896   1.00 0.00 ? 1056 GLU B HB2  1  
ATOM 118   H HB3  . GLU A 1 12 ? -9.691  -9.912  7.326   1.00 0.00 ? 1056 GLU B HB3  1  
ATOM 119   H HG2  . GLU A 1 12 ? -9.428  -10.806 5.092   1.00 0.00 ? 1056 GLU B HG2  1  
ATOM 120   H HG3  . GLU A 1 12 ? -7.887  -11.545 5.522   1.00 0.00 ? 1056 GLU B HG3  1  
ATOM 121   N N    . GLN A 1 13 ? -7.144  -8.160  8.748   1.00 0.00 ? 1057 GLN B N    1  
ATOM 122   C CA   . GLN A 1 13 ? -7.142  -7.153  9.807   1.00 0.00 ? 1057 GLN B CA   1  
ATOM 123   C C    . GLN A 1 13 ? -6.607  -5.823  9.293   1.00 0.00 ? 1057 GLN B C    1  
ATOM 124   O O    . GLN A 1 13 ? -7.160  -4.760  9.590   1.00 0.00 ? 1057 GLN B O    1  
ATOM 125   C CB   . GLN A 1 13 ? -6.271  -7.636  10.965  1.00 0.00 ? 1057 GLN B CB   1  
ATOM 126   C CG   . GLN A 1 13 ? -6.980  -8.783  11.684  1.00 0.00 ? 1057 GLN B CG   1  
ATOM 127   C CD   . GLN A 1 13 ? -8.192  -8.259  12.445  1.00 0.00 ? 1057 GLN B CD   1  
ATOM 128   O OE1  . GLN A 1 13 ? -9.329  -8.558  12.083  1.00 0.00 ? 1057 GLN B OE1  1  
ATOM 129   N NE2  . GLN A 1 13 ? -8.013  -7.497  13.489  1.00 0.00 ? 1057 GLN B NE2  1  
ATOM 130   H H    . GLN A 1 13 ? -6.581  -8.959  8.839   1.00 0.00 ? 1057 GLN B H    1  
ATOM 131   H HA   . GLN A 1 13 ? -8.152  -7.015  10.162  1.00 0.00 ? 1057 GLN B HA   1  
ATOM 132   H HB2  . GLN A 1 13 ? -5.323  -7.982  10.582  1.00 0.00 ? 1057 GLN B HB2  1  
ATOM 133   H HB3  . GLN A 1 13 ? -6.108  -6.825  11.657  1.00 0.00 ? 1057 GLN B HB3  1  
ATOM 134   H HG2  . GLN A 1 13 ? -7.308  -9.505  10.951  1.00 0.00 ? 1057 GLN B HG2  1  
ATOM 135   H HG3  . GLN A 1 13 ? -6.296  -9.251  12.373  1.00 0.00 ? 1057 GLN B HG3  1  
ATOM 136   H HE21 . GLN A 1 13 ? -7.106  -7.268  13.778  1.00 0.00 ? 1057 GLN B HE21 1  
ATOM 137   H HE22 . GLN A 1 13 ? -8.787  -7.156  13.983  1.00 0.00 ? 1057 GLN B HE22 1  
ATOM 138   N N    . MET A 1 14 ? -5.534  -5.885  8.517   1.00 0.00 ? 1058 MET B N    1  
ATOM 139   C CA   . MET A 1 14 ? -4.946  -4.674  7.968   1.00 0.00 ? 1058 MET B CA   1  
ATOM 140   C C    . MET A 1 14 ? -5.930  -3.997  7.029   1.00 0.00 ? 1058 MET B C    1  
ATOM 141   O O    . MET A 1 14 ? -6.058  -2.772  7.024   1.00 0.00 ? 1058 MET B O    1  
ATOM 142   C CB   . MET A 1 14 ? -3.645  -4.997  7.224   1.00 0.00 ? 1058 MET B CB   1  
ATOM 143   C CG   . MET A 1 14 ? -2.568  -5.412  8.232   1.00 0.00 ? 1058 MET B CG   1  
ATOM 144   S SD   . MET A 1 14 ? -0.945  -5.436  7.424   1.00 0.00 ? 1058 MET B SD   1  
ATOM 145   C CE   . MET A 1 14 ? -1.188  -6.904  6.397   1.00 0.00 ? 1058 MET B CE   1  
ATOM 146   H H    . MET A 1 14 ? -5.137  -6.756  8.306   1.00 0.00 ? 1058 MET B H    1  
ATOM 147   H HA   . MET A 1 14 ? -4.725  -3.996  8.777   1.00 0.00 ? 1058 MET B HA   1  
ATOM 148   H HB2  . MET A 1 14 ? -3.821  -5.806  6.531   1.00 0.00 ? 1058 MET B HB2  1  
ATOM 149   H HB3  . MET A 1 14 ? -3.311  -4.126  6.683   1.00 0.00 ? 1058 MET B HB3  1  
ATOM 150   H HG2  . MET A 1 14 ? -2.553  -4.710  9.052   1.00 0.00 ? 1058 MET B HG2  1  
ATOM 151   H HG3  . MET A 1 14 ? -2.793  -6.398  8.610   1.00 0.00 ? 1058 MET B HG3  1  
ATOM 152   H HE1  . MET A 1 14 ? -1.216  -7.781  7.028   1.00 0.00 ? 1058 MET B HE1  1  
ATOM 153   H HE2  . MET A 1 14 ? -0.371  -6.991  5.695   1.00 0.00 ? 1058 MET B HE2  1  
ATOM 154   H HE3  . MET A 1 14 ? -2.118  -6.812  5.855   1.00 0.00 ? 1058 MET B HE3  1  
ATOM 155   N N    . ALA A 1 15 ? -6.631  -4.799  6.241   1.00 0.00 ? 1059 ALA B N    1  
ATOM 156   C CA   . ALA A 1 15 ? -7.607  -4.254  5.307   1.00 0.00 ? 1059 ALA B CA   1  
ATOM 157   C C    . ALA A 1 15 ? -8.732  -3.543  6.049   1.00 0.00 ? 1059 ALA B C    1  
ATOM 158   O O    . ALA A 1 15 ? -9.197  -2.485  5.624   1.00 0.00 ? 1059 ALA B O    1  
ATOM 159   C CB   . ALA A 1 15 ? -8.190  -5.369  4.449   1.00 0.00 ? 1059 ALA B CB   1  
ATOM 160   H H    . ALA A 1 15 ? -6.494  -5.772  6.292   1.00 0.00 ? 1059 ALA B H    1  
ATOM 161   H HA   . ALA A 1 15 ? -7.111  -3.545  4.663   1.00 0.00 ? 1059 ALA B HA   1  
ATOM 162   H HB1  . ALA A 1 15 ? -7.491  -5.624  3.668   1.00 0.00 ? 1059 ALA B HB1  1  
ATOM 163   H HB2  . ALA A 1 15 ? -9.117  -5.032  4.010   1.00 0.00 ? 1059 ALA B HB2  1  
ATOM 164   H HB3  . ALA A 1 15 ? -8.377  -6.237  5.063   1.00 0.00 ? 1059 ALA B HB3  1  
ATOM 165   N N    . LYS A 1 16 ? -9.171  -4.134  7.156   1.00 0.00 ? 1060 LYS B N    1  
ATOM 166   C CA   . LYS A 1 16 ? -10.249 -3.551  7.945   1.00 0.00 ? 1060 LYS B CA   1  
ATOM 167   C C    . LYS A 1 16 ? -9.841  -2.183  8.473   1.00 0.00 ? 1060 LYS B C    1  
ATOM 168   O O    . LYS A 1 16 ? -10.631 -1.237  8.446   1.00 0.00 ? 1060 LYS B O    1  
ATOM 169   C CB   . LYS A 1 16 ? -10.590 -4.470  9.118   1.00 0.00 ? 1060 LYS B CB   1  
ATOM 170   C CG   . LYS A 1 16 ? -11.299 -5.723  8.601   1.00 0.00 ? 1060 LYS B CG   1  
ATOM 171   C CD   . LYS A 1 16 ? -11.427 -6.745  9.735   1.00 0.00 ? 1060 LYS B CD   1  
ATOM 172   C CE   . LYS A 1 16 ? -12.351 -6.191  10.821  1.00 0.00 ? 1060 LYS B CE   1  
ATOM 173   N NZ   . LYS A 1 16 ? -12.556 -7.227  11.873  1.00 0.00 ? 1060 LYS B NZ   1  
ATOM 174   H H    . LYS A 1 16 ? -8.767  -4.980  7.443   1.00 0.00 ? 1060 LYS B H    1  
ATOM 175   H HA   . LYS A 1 16 ? -11.123 -3.440  7.322   1.00 0.00 ? 1060 LYS B HA   1  
ATOM 176   H HB2  . LYS A 1 16 ? -9.680  -4.755  9.627   1.00 0.00 ? 1060 LYS B HB2  1  
ATOM 177   H HB3  . LYS A 1 16 ? -11.239 -3.950  9.806   1.00 0.00 ? 1060 LYS B HB3  1  
ATOM 178   H HG2  . LYS A 1 16 ? -12.283 -5.457  8.244   1.00 0.00 ? 1060 LYS B HG2  1  
ATOM 179   H HG3  . LYS A 1 16 ? -10.728 -6.155  7.793   1.00 0.00 ? 1060 LYS B HG3  1  
ATOM 180   H HD2  . LYS A 1 16 ? -11.839 -7.664  9.345   1.00 0.00 ? 1060 LYS B HD2  1  
ATOM 181   H HD3  . LYS A 1 16 ? -10.452 -6.937  10.158  1.00 0.00 ? 1060 LYS B HD3  1  
ATOM 182   H HE2  . LYS A 1 16 ? -11.902 -5.314  11.263  1.00 0.00 ? 1060 LYS B HE2  1  
ATOM 183   H HE3  . LYS A 1 16 ? -13.303 -5.928  10.385  1.00 0.00 ? 1060 LYS B HE3  1  
ATOM 184   H HZ1  . LYS A 1 16 ? -12.442 -6.795  12.813  1.00 0.00 ? 1060 LYS B HZ1  1  
ATOM 185   H HZ2  . LYS A 1 16 ? -11.855 -7.986  11.752  1.00 0.00 ? 1060 LYS B HZ2  1  
ATOM 186   H HZ3  . LYS A 1 16 ? -13.515 -7.621  11.789  1.00 0.00 ? 1060 LYS B HZ3  1  
ATOM 187   N N    . GLU A 1 17 ? -8.606  -2.073  8.947   1.00 0.00 ? 1061 GLU B N    1  
ATOM 188   C CA   . GLU A 1 17 ? -8.126  -0.802  9.465   1.00 0.00 ? 1061 GLU B CA   1  
ATOM 189   C C    . GLU A 1 17 ? -8.073  0.245   8.356   1.00 0.00 ? 1061 GLU B C    1  
ATOM 190   O O    . GLU A 1 17 ? -8.414  1.409   8.573   1.00 0.00 ? 1061 GLU B O    1  
ATOM 191   C CB   . GLU A 1 17 ? -6.737  -0.983  10.074  1.00 0.00 ? 1061 GLU B CB   1  
ATOM 192   C CG   . GLU A 1 17 ? -6.838  -1.806  11.363  1.00 0.00 ? 1061 GLU B CG   1  
ATOM 193   C CD   . GLU A 1 17 ? -7.717  -1.092  12.383  1.00 0.00 ? 1061 GLU B CD   1  
ATOM 194   O OE1  . GLU A 1 17 ? -7.494  0.085   12.605  1.00 0.00 ? 1061 GLU B OE1  1  
ATOM 195   O OE2  . GLU A 1 17 ? -8.600  -1.735  12.927  1.00 0.00 ? 1061 GLU B OE2  1  
ATOM 196   H H    . GLU A 1 17 ? -8.007  -2.859  8.947   1.00 0.00 ? 1061 GLU B H    1  
ATOM 197   H HA   . GLU A 1 17 ? -8.804  -0.460  10.229  1.00 0.00 ? 1061 GLU B HA   1  
ATOM 198   H HB2  . GLU A 1 17 ? -6.104  -1.498  9.367   1.00 0.00 ? 1061 GLU B HB2  1  
ATOM 199   H HB3  . GLU A 1 17 ? -6.316  -0.017  10.298  1.00 0.00 ? 1061 GLU B HB3  1  
ATOM 200   H HG2  . GLU A 1 17 ? -7.263  -2.773  11.137  1.00 0.00 ? 1061 GLU B HG2  1  
ATOM 201   H HG3  . GLU A 1 17 ? -5.853  -1.936  11.776  1.00 0.00 ? 1061 GLU B HG3  1  
ATOM 202   N N    . MET A 1 18 ? -7.642  -0.167  7.167   1.00 0.00 ? 1062 MET B N    1  
ATOM 203   C CA   . MET A 1 18 ? -7.554  0.760   6.045   1.00 0.00 ? 1062 MET B CA   1  
ATOM 204   C C    . MET A 1 18 ? -8.933  1.314   5.697   1.00 0.00 ? 1062 MET B C    1  
ATOM 205   O O    . MET A 1 18 ? -9.085  2.506   5.431   1.00 0.00 ? 1062 MET B O    1  
ATOM 206   C CB   . MET A 1 18 ? -6.976  0.036   4.835   1.00 0.00 ? 1062 MET B CB   1  
ATOM 207   C CG   . MET A 1 18 ? -5.511  -0.297  5.099   1.00 0.00 ? 1062 MET B CG   1  
ATOM 208   S SD   . MET A 1 18 ? -4.905  -1.398  3.800   1.00 0.00 ? 1062 MET B SD   1  
ATOM 209   C CE   . MET A 1 18 ? -3.759  -2.345  4.829   1.00 0.00 ? 1062 MET B CE   1  
ATOM 210   H H    . MET A 1 18 ? -7.375  -1.105  7.042   1.00 0.00 ? 1062 MET B H    1  
ATOM 211   H HA   . MET A 1 18 ? -6.900  1.578   6.312   1.00 0.00 ? 1062 MET B HA   1  
ATOM 212   H HB2  . MET A 1 18 ? -7.528  -0.878  4.667   1.00 0.00 ? 1062 MET B HB2  1  
ATOM 213   H HB3  . MET A 1 18 ? -7.050  0.667   3.963   1.00 0.00 ? 1062 MET B HB3  1  
ATOM 214   H HG2  . MET A 1 18 ? -4.929  0.612   5.100   1.00 0.00 ? 1062 MET B HG2  1  
ATOM 215   H HG3  . MET A 1 18 ? -5.422  -0.781  6.057   1.00 0.00 ? 1062 MET B HG3  1  
ATOM 216   H HE1  . MET A 1 18 ? -4.102  -3.369  4.894   1.00 0.00 ? 1062 MET B HE1  1  
ATOM 217   H HE2  . MET A 1 18 ? -3.725  -1.921  5.819   1.00 0.00 ? 1062 MET B HE2  1  
ATOM 218   H HE3  . MET A 1 18 ? -2.773  -2.315  4.390   1.00 0.00 ? 1062 MET B HE3  1  
ATOM 219   N N    . SER A 1 19 ? -9.936  0.441   5.705   1.00 0.00 ? 1063 SER B N    1  
ATOM 220   C CA   . SER A 1 19 ? -11.301 0.859   5.393   1.00 0.00 ? 1063 SER B CA   1  
ATOM 221   C C    . SER A 1 19 ? -11.801 1.866   6.418   1.00 0.00 ? 1063 SER B C    1  
ATOM 222   O O    . SER A 1 19 ? -12.435 2.863   6.071   1.00 0.00 ? 1063 SER B O    1  
ATOM 223   C CB   . SER A 1 19 ? -12.230 -0.352  5.363   1.00 0.00 ? 1063 SER B CB   1  
ATOM 224   O OG   . SER A 1 19 ? -13.551 0.079   5.064   1.00 0.00 ? 1063 SER B OG   1  
ATOM 225   H H    . SER A 1 19 ? -9.758  -0.496  5.930   1.00 0.00 ? 1063 SER B H    1  
ATOM 226   H HA   . SER A 1 19 ? -11.306 1.323   4.419   1.00 0.00 ? 1063 SER B HA   1  
ATOM 227   H HB2  . SER A 1 19 ? -11.902 -1.041  4.603   1.00 0.00 ? 1063 SER B HB2  1  
ATOM 228   H HB3  . SER A 1 19 ? -12.209 -0.846  6.326   1.00 0.00 ? 1063 SER B HB3  1  
ATOM 229   H HG   . SER A 1 19 ? -13.501 0.717   4.348   1.00 0.00 ? 1063 SER B HG   1  
ATOM 230   N N    . GLU A 1 20 ? -11.516 1.601   7.687   1.00 0.00 ? 1064 GLU B N    1  
ATOM 231   C CA   . GLU A 1 20 ? -11.949 2.491   8.755   1.00 0.00 ? 1064 GLU B CA   1  
ATOM 232   C C    . GLU A 1 20 ? -11.336 3.878   8.589   1.00 0.00 ? 1064 GLU B C    1  
ATOM 233   O O    . GLU A 1 20 ? -12.006 4.890   8.792   1.00 0.00 ? 1064 GLU B O    1  
ATOM 234   C CB   . GLU A 1 20 ? -11.530 1.917   10.106  1.00 0.00 ? 1064 GLU B CB   1  
ATOM 235   C CG   . GLU A 1 20 ? -12.378 0.686   10.431  1.00 0.00 ? 1064 GLU B CG   1  
ATOM 236   C CD   . GLU A 1 20 ? -11.845 -0.007  11.681  1.00 0.00 ? 1064 GLU B CD   1  
ATOM 237   O OE1  . GLU A 1 20 ? -10.707 0.250   12.038  1.00 0.00 ? 1064 GLU B OE1  1  
ATOM 238   O OE2  . GLU A 1 20 ? -12.585 -0.781  12.268  1.00 0.00 ? 1064 GLU B OE2  1  
ATOM 239   H H    . GLU A 1 20 ? -11.010 0.790   7.910   1.00 0.00 ? 1064 GLU B H    1  
ATOM 240   H HA   . GLU A 1 20 ? -13.026 2.577   8.731   1.00 0.00 ? 1064 GLU B HA   1  
ATOM 241   H HB2  . GLU A 1 20 ? -10.486 1.637   10.061  1.00 0.00 ? 1064 GLU B HB2  1  
ATOM 242   H HB3  . GLU A 1 20 ? -11.670 2.664   10.873  1.00 0.00 ? 1064 GLU B HB3  1  
ATOM 243   H HG2  . GLU A 1 20 ? -13.401 0.990   10.598  1.00 0.00 ? 1064 GLU B HG2  1  
ATOM 244   H HG3  . GLU A 1 20 ? -12.341 -0.002  9.600   1.00 0.00 ? 1064 GLU B HG3  1  
ATOM 245   N N    . PHE A 1 21 ? -10.064 3.923   8.212   1.00 0.00 ? 1065 PHE B N    1  
ATOM 246   C CA   . PHE A 1 21 ? -9.389  5.199   8.022   1.00 0.00 ? 1065 PHE B CA   1  
ATOM 247   C C    . PHE A 1 21 ? -9.987  5.946   6.840   1.00 0.00 ? 1065 PHE B C    1  
ATOM 248   O O    . PHE A 1 21 ? -10.169 7.164   6.886   1.00 0.00 ? 1065 PHE B O    1  
ATOM 249   C CB   . PHE A 1 21 ? -7.893  4.971   7.787   1.00 0.00 ? 1065 PHE B CB   1  
ATOM 250   C CG   . PHE A 1 21 ? -7.207  4.712   9.109   1.00 0.00 ? 1065 PHE B CG   1  
ATOM 251   C CD1  . PHE A 1 21 ? -6.622  3.465   9.368   1.00 0.00 ? 1065 PHE B CD1  1  
ATOM 252   C CD2  . PHE A 1 21 ? -7.158  5.722   10.078  1.00 0.00 ? 1065 PHE B CD2  1  
ATOM 253   C CE1  . PHE A 1 21 ? -5.986  3.231   10.594  1.00 0.00 ? 1065 PHE B CE1  1  
ATOM 254   C CE2  . PHE A 1 21 ? -6.524  5.486   11.304  1.00 0.00 ? 1065 PHE B CE2  1  
ATOM 255   C CZ   . PHE A 1 21 ? -5.938  4.242   11.562  1.00 0.00 ? 1065 PHE B CZ   1  
ATOM 256   H H    . PHE A 1 21 ? -9.574  3.088   8.052   1.00 0.00 ? 1065 PHE B H    1  
ATOM 257   H HA   . PHE A 1 21 ? -9.514  5.796   8.912   1.00 0.00 ? 1065 PHE B HA   1  
ATOM 258   H HB2  . PHE A 1 21 ? -7.759  4.117   7.140   1.00 0.00 ? 1065 PHE B HB2  1  
ATOM 259   H HB3  . PHE A 1 21 ? -7.463  5.846   7.324   1.00 0.00 ? 1065 PHE B HB3  1  
ATOM 260   H HD1  . PHE A 1 21 ? -6.659  2.687   8.621   1.00 0.00 ? 1065 PHE B HD1  1  
ATOM 261   H HD2  . PHE A 1 21 ? -7.610  6.682   9.881   1.00 0.00 ? 1065 PHE B HD2  1  
ATOM 262   H HE1  . PHE A 1 21 ? -5.535  2.271   10.793  1.00 0.00 ? 1065 PHE B HE1  1  
ATOM 263   H HE2  . PHE A 1 21 ? -6.486  6.265   12.052  1.00 0.00 ? 1065 PHE B HE2  1  
ATOM 264   H HZ   . PHE A 1 21 ? -5.448  4.060   12.507  1.00 0.00 ? 1065 PHE B HZ   1  
ATOM 265   N N    . LEU A 1 22 ? -10.294 5.207   5.784   1.00 0.00 ? 1066 LEU B N    1  
ATOM 266   C CA   . LEU A 1 22 ? -10.873 5.804   4.587   1.00 0.00 ? 1066 LEU B CA   1  
ATOM 267   C C    . LEU A 1 22 ? -12.264 6.363   4.882   1.00 0.00 ? 1066 LEU B C    1  
ATOM 268   O O    . LEU A 1 22 ? -12.626 7.440   4.407   1.00 0.00 ? 1066 LEU B O    1  
ATOM 269   C CB   . LEU A 1 22 ? -10.963 4.753   3.477   1.00 0.00 ? 1066 LEU B CB   1  
ATOM 270   C CG   . LEU A 1 22 ? -9.554  4.392   2.999   1.00 0.00 ? 1066 LEU B CG   1  
ATOM 271   C CD1  . LEU A 1 22 ? -9.623  3.162   2.096   1.00 0.00 ? 1066 LEU B CD1  1  
ATOM 272   C CD2  . LEU A 1 22 ? -8.958  5.565   2.216   1.00 0.00 ? 1066 LEU B CD2  1  
ATOM 273   H H    . LEU A 1 22 ? -10.129 4.239   5.810   1.00 0.00 ? 1066 LEU B H    1  
ATOM 274   H HA   . LEU A 1 22 ? -10.236 6.609   4.255   1.00 0.00 ? 1066 LEU B HA   1  
ATOM 275   H HB2  . LEU A 1 22 ? -11.454 3.868   3.860   1.00 0.00 ? 1066 LEU B HB2  1  
ATOM 276   H HB3  . LEU A 1 22 ? -11.531 5.150   2.649   1.00 0.00 ? 1066 LEU B HB3  1  
ATOM 277   H HG   . LEU A 1 22 ? -8.930  4.174   3.854   1.00 0.00 ? 1066 LEU B HG   1  
ATOM 278   H HD11 . LEU A 1 22 ? -9.892  2.297   2.687   1.00 0.00 ? 1066 LEU B HD11 1  
ATOM 279   H HD12 . LEU A 1 22 ? -8.659  2.997   1.636   1.00 0.00 ? 1066 LEU B HD12 1  
ATOM 280   H HD13 . LEU A 1 22 ? -10.366 3.319   1.329   1.00 0.00 ? 1066 LEU B HD13 1  
ATOM 281   H HD21 . LEU A 1 22 ? -8.297  6.129   2.859   1.00 0.00 ? 1066 LEU B HD21 1  
ATOM 282   H HD22 . LEU A 1 22 ? -9.752  6.206   1.866   1.00 0.00 ? 1066 LEU B HD22 1  
ATOM 283   H HD23 . LEU A 1 22 ? -8.400  5.186   1.371   1.00 0.00 ? 1066 LEU B HD23 1  
ATOM 284   N N    . SER A 1 23 ? -13.034 5.621   5.672   1.00 0.00 ? 1067 SER B N    1  
ATOM 285   C CA   . SER A 1 23 ? -14.382 6.041   6.034   1.00 0.00 ? 1067 SER B CA   1  
ATOM 286   C C    . SER A 1 23 ? -14.334 7.253   6.951   1.00 0.00 ? 1067 SER B C    1  
ATOM 287   O O    . SER A 1 23 ? -15.135 8.178   6.819   1.00 0.00 ? 1067 SER B O    1  
ATOM 288   C CB   . SER A 1 23 ? -15.129 4.893   6.719   1.00 0.00 ? 1067 SER B CB   1  
ATOM 289   O OG   . SER A 1 23 ? -15.310 3.831   5.789   1.00 0.00 ? 1067 SER B OG   1  
ATOM 290   H H    . SER A 1 23 ? -12.685 4.779   6.024   1.00 0.00 ? 1067 SER B H    1  
ATOM 291   H HA   . SER A 1 23 ? -14.913 6.311   5.134   1.00 0.00 ? 1067 SER B HA   1  
ATOM 292   H HB2  . SER A 1 23 ? -14.556 4.535   7.558   1.00 0.00 ? 1067 SER B HB2  1  
ATOM 293   H HB3  . SER A 1 23 ? -16.090 5.248   7.067   1.00 0.00 ? 1067 SER B HB3  1  
ATOM 294   H HG   . SER A 1 23 ? -16.147 3.971   5.340   1.00 0.00 ? 1067 SER B HG   1  
ATOM 295   N N    . ARG A 1 24 ? -13.381 7.243   7.876   1.00 0.00 ? 1068 ARG B N    1  
ATOM 296   C CA   . ARG A 1 24 ? -13.223 8.344   8.804   1.00 0.00 ? 1068 ARG B CA   1  
ATOM 297   C C    . ARG A 1 24 ? -12.929 9.642   8.062   1.00 0.00 ? 1068 ARG B C    1  
ATOM 298   O O    . ARG A 1 24 ? -13.501 10.687  8.373   1.00 0.00 ? 1068 ARG B O    1  
ATOM 299   C CB   . ARG A 1 24 ? -12.087 8.030   9.781   1.00 0.00 ? 1068 ARG B CB   1  
ATOM 300   C CG   . ARG A 1 24 ? -11.385 9.327   10.164  1.00 0.00 ? 1068 ARG B CG   1  
ATOM 301   C CD   . ARG A 1 24 ? -10.476 9.087   11.368  1.00 0.00 ? 1068 ARG B CD   1  
ATOM 302   N NE   . ARG A 1 24 ? -9.643  10.259  11.627  1.00 0.00 ? 1068 ARG B NE   1  
ATOM 303   C CZ   . ARG A 1 24 ? -8.886  10.351  12.724  1.00 0.00 ? 1068 ARG B CZ   1  
ATOM 304   N NH1  . ARG A 1 24 ? -8.869  9.384   13.609  1.00 0.00 ? 1068 ARG B NH1  1  
ATOM 305   N NH2  . ARG A 1 24 ? -8.155  11.413  12.921  1.00 0.00 ? 1068 ARG B NH2  1  
ATOM 306   H H    . ARG A 1 24 ? -12.765 6.485   7.930   1.00 0.00 ? 1068 ARG B H    1  
ATOM 307   H HA   . ARG A 1 24 ? -14.135 8.463   9.366   1.00 0.00 ? 1068 ARG B HA   1  
ATOM 308   H HB2  . ARG A 1 24 ? -12.492 7.561   10.667  1.00 0.00 ? 1068 ARG B HB2  1  
ATOM 309   H HB3  . ARG A 1 24 ? -11.378 7.363   9.310   1.00 0.00 ? 1068 ARG B HB3  1  
ATOM 310   H HG2  . ARG A 1 24 ? -10.789 9.660   9.326   1.00 0.00 ? 1068 ARG B HG2  1  
ATOM 311   H HG3  . ARG A 1 24 ? -12.122 10.076  10.408  1.00 0.00 ? 1068 ARG B HG3  1  
ATOM 312   H HD2  . ARG A 1 24 ? -11.081 8.886   12.238  1.00 0.00 ? 1068 ARG B HD2  1  
ATOM 313   H HD3  . ARG A 1 24 ? -9.842  8.235   11.171  1.00 0.00 ? 1068 ARG B HD3  1  
ATOM 314   H HE   . ARG A 1 24 ? -9.640  10.997  10.979  1.00 0.00 ? 1068 ARG B HE   1  
ATOM 315   H HH11 . ARG A 1 24 ? -9.422  8.564   13.473  1.00 0.00 ? 1068 ARG B HH11 1  
ATOM 316   H HH12 . ARG A 1 24 ? -8.296  9.468   14.424  1.00 0.00 ? 1068 ARG B HH12 1  
ATOM 317   H HH21 . ARG A 1 24 ? -8.161  12.157  12.252  1.00 0.00 ? 1068 ARG B HH21 1  
ATOM 318   H HH22 . ARG A 1 24 ? -7.586  11.483  13.741  1.00 0.00 ? 1068 ARG B HH22 1  
ATOM 319   N N    . GLY A 1 25 ? -12.030 9.573   7.088   1.00 0.00 ? 1069 GLY B N    1  
ATOM 320   C CA   . GLY A 1 25 ? -11.666 10.754  6.320   1.00 0.00 ? 1069 GLY B CA   1  
ATOM 321   C C    . GLY A 1 25 ? -11.726 10.466  4.823   1.00 0.00 ? 1069 GLY B C    1  
ATOM 322   O O    . GLY A 1 25 ? -10.696 10.301  4.173   1.00 0.00 ? 1069 GLY B O    1  
ATOM 323   H H    . GLY A 1 25 ? -11.601 8.714   6.890   1.00 0.00 ? 1069 GLY B H    1  
ATOM 324   H HA2  . GLY A 1 25 ? -12.347 11.557  6.560   1.00 0.00 ? 1069 GLY B HA2  1  
ATOM 325   H HA3  . GLY A 1 25 ? -10.662 11.048  6.582   1.00 0.00 ? 1069 GLY B HA3  1  
ATOM 326   N N    . PRO A 1 26 ? -12.909 10.408  4.273   1.00 0.00 ? 1070 PRO B N    1  
ATOM 327   C CA   . PRO A 1 26 ? -13.112 10.134  2.817   1.00 0.00 ? 1070 PRO B CA   1  
ATOM 328   C C    . PRO A 1 26 ? -12.427 11.180  1.939   1.00 0.00 ? 1070 PRO B C    1  
ATOM 329   O O    . PRO A 1 26 ? -12.387 12.361  2.285   1.00 0.00 ? 1070 PRO B O    1  
ATOM 330   C CB   . PRO A 1 26 ? -14.635 10.193  2.642   1.00 0.00 ? 1070 PRO B CB   1  
ATOM 331   C CG   . PRO A 1 26 ? -15.193 9.972   4.008   1.00 0.00 ? 1070 PRO B CG   1  
ATOM 332   C CD   . PRO A 1 26 ? -14.189 10.590  4.971   1.00 0.00 ? 1070 PRO B CD   1  
ATOM 333   H HA   . PRO A 1 26 ? -12.759 9.148   2.567   1.00 0.00 ? 1070 PRO B HA   1  
ATOM 334   H HB2  . PRO A 1 26 ? -14.931 11.162  2.263   1.00 0.00 ? 1070 PRO B HB2  1  
ATOM 335   H HB3  . PRO A 1 26 ? -14.967 9.412   1.977   1.00 0.00 ? 1070 PRO B HB3  1  
ATOM 336   H HG2  . PRO A 1 26 ? -16.154 10.462  4.099   1.00 0.00 ? 1070 PRO B HG2  1  
ATOM 337   H HG3  . PRO A 1 26 ? -15.289 8.917   4.208   1.00 0.00 ? 1070 PRO B HG3  1  
ATOM 338   H HD2  . PRO A 1 26 ? -14.402 11.643  5.119   1.00 0.00 ? 1070 PRO B HD2  1  
ATOM 339   H HD3  . PRO A 1 26 ? -14.182 10.063  5.909   1.00 0.00 ? 1070 PRO B HD3  1  
ATOM 340   N N    . ALA A 1 27 ? -11.891 10.742  0.806   1.00 0.00 ? 1071 ALA B N    1  
ATOM 341   C CA   . ALA A 1 27 ? -11.214 11.655  -0.108  1.00 0.00 ? 1071 ALA B CA   1  
ATOM 342   C C    . ALA A 1 27 ? -11.682 11.424  -1.540  1.00 0.00 ? 1071 ALA B C    1  
ATOM 343   O O    . ALA A 1 27 ? -11.201 10.518  -2.222  1.00 0.00 ? 1071 ALA B O    1  
ATOM 344   C CB   . ALA A 1 27 ? -9.703  11.449  -0.023  1.00 0.00 ? 1071 ALA B CB   1  
ATOM 345   H H    . ALA A 1 27 ? -11.952 9.790   0.579   1.00 0.00 ? 1071 ALA B H    1  
ATOM 346   H HA   . ALA A 1 27 ? -11.443 12.671  0.177   1.00 0.00 ? 1071 ALA B HA   1  
ATOM 347   H HB1  . ALA A 1 27 ? -9.288  12.124  0.712   1.00 0.00 ? 1071 ALA B HB1  1  
ATOM 348   H HB2  . ALA A 1 27 ? -9.258  11.648  -0.986  1.00 0.00 ? 1071 ALA B HB2  1  
ATOM 349   H HB3  . ALA A 1 27 ? -9.495  10.431  0.266   1.00 0.00 ? 1071 ALA B HB3  1  
ATOM 350   N N    . VAL A 1 28 ? -12.621 12.248  -1.990  1.00 0.00 ? 1072 VAL B N    1  
ATOM 351   C CA   . VAL A 1 28 ? -13.146 12.121  -3.344  1.00 0.00 ? 1072 VAL B CA   1  
ATOM 352   C C    . VAL A 1 28 ? -12.061 12.442  -4.364  1.00 0.00 ? 1072 VAL B C    1  
ATOM 353   O O    . VAL A 1 28 ? -11.940 11.768  -5.386  1.00 0.00 ? 1072 VAL B O    1  
ATOM 354   C CB   . VAL A 1 28 ? -14.336 13.064  -3.542  1.00 0.00 ? 1072 VAL B CB   1  
ATOM 355   C CG1  . VAL A 1 28 ? -14.791 13.025  -5.003  1.00 0.00 ? 1072 VAL B CG1  1  
ATOM 356   C CG2  . VAL A 1 28 ? -15.487 12.621  -2.637  1.00 0.00 ? 1072 VAL B CG2  1  
ATOM 357   H H    . VAL A 1 28 ? -12.968 12.950  -1.401  1.00 0.00 ? 1072 VAL B H    1  
ATOM 358   H HA   . VAL A 1 28 ? -13.478 11.106  -3.496  1.00 0.00 ? 1072 VAL B HA   1  
ATOM 359   H HB   . VAL A 1 28 ? -14.043 14.071  -3.284  1.00 0.00 ? 1072 VAL B HB   1  
ATOM 360   H HG11 . VAL A 1 28 ? -14.002 13.390  -5.639  1.00 0.00 ? 1072 VAL B HG11 1  
ATOM 361   H HG12 . VAL A 1 28 ? -15.666 13.646  -5.125  1.00 0.00 ? 1072 VAL B HG12 1  
ATOM 362   H HG13 . VAL A 1 28 ? -15.032 12.008  -5.278  1.00 0.00 ? 1072 VAL B HG13 1  
ATOM 363   H HG21 . VAL A 1 28 ? -16.131 13.462  -2.434  1.00 0.00 ? 1072 VAL B HG21 1  
ATOM 364   H HG22 . VAL A 1 28 ? -15.087 12.240  -1.708  1.00 0.00 ? 1072 VAL B HG22 1  
ATOM 365   H HG23 . VAL A 1 28 ? -16.053 11.844  -3.128  1.00 0.00 ? 1072 VAL B HG23 1  
ATOM 366   N N    . LEU A 1 29 ? -11.284 13.485  -4.077  1.00 0.00 ? 1073 LEU B N    1  
ATOM 367   C CA   . LEU A 1 29 ? -10.205 13.908  -4.967  1.00 0.00 ? 1073 LEU B CA   1  
ATOM 368   C C    . LEU A 1 29 ? -10.758 14.367  -6.316  1.00 0.00 ? 1073 LEU B C    1  
ATOM 369   O O    . LEU A 1 29 ? -10.037 14.405  -7.313  1.00 0.00 ? 1073 LEU B O    1  
ATOM 370   C CB   . LEU A 1 29 ? -9.231  12.755  -5.184  1.00 0.00 ? 1073 LEU B CB   1  
ATOM 371   C CG   . LEU A 1 29 ? -8.790  12.198  -3.828  1.00 0.00 ? 1073 LEU B CG   1  
ATOM 372   C CD1  . LEU A 1 29 ? -7.853  11.011  -4.040  1.00 0.00 ? 1073 LEU B CD1  1  
ATOM 373   C CD2  . LEU A 1 29 ? -8.058  13.287  -3.041  1.00 0.00 ? 1073 LEU B CD2  1  
ATOM 374   H H    . LEU A 1 29 ? -11.442 13.982  -3.247  1.00 0.00 ? 1073 LEU B H    1  
ATOM 375   H HA   . LEU A 1 29 ? -9.677  14.732  -4.509  1.00 0.00 ? 1073 LEU B HA   1  
ATOM 376   H HB2  . LEU A 1 29 ? -9.713  11.982  -5.759  1.00 0.00 ? 1073 LEU B HB2  1  
ATOM 377   H HB3  . LEU A 1 29 ? -8.368  13.116  -5.720  1.00 0.00 ? 1073 LEU B HB3  1  
ATOM 378   H HG   . LEU A 1 29 ? -9.657  11.873  -3.273  1.00 0.00 ? 1073 LEU B HG   1  
ATOM 379   H HD11 . LEU A 1 29 ? -8.380  10.094  -3.821  1.00 0.00 ? 1073 LEU B HD11 1  
ATOM 380   H HD12 . LEU A 1 29 ? -7.003  11.102  -3.380  1.00 0.00 ? 1073 LEU B HD12 1  
ATOM 381   H HD13 . LEU A 1 29 ? -7.515  10.995  -5.065  1.00 0.00 ? 1073 LEU B HD13 1  
ATOM 382   H HD21 . LEU A 1 29 ? -7.367  13.800  -3.693  1.00 0.00 ? 1073 LEU B HD21 1  
ATOM 383   H HD22 . LEU A 1 29 ? -7.516  12.836  -2.223  1.00 0.00 ? 1073 LEU B HD22 1  
ATOM 384   H HD23 . LEU A 1 29 ? -8.776  13.993  -2.651  1.00 0.00 ? 1073 LEU B HD23 1  
ATOM 385   N N    . ALA A 1 30 ? -12.039 14.717  -6.333  1.00 0.00 ? 1074 ALA B N    1  
ATOM 386   C CA   . ALA A 1 30 ? -12.687 15.178  -7.558  1.00 0.00 ? 1074 ALA B CA   1  
ATOM 387   C C    . ALA A 1 30 ? -12.067 16.488  -8.031  1.00 0.00 ? 1074 ALA B C    1  
ATOM 388   O O    . ALA A 1 30 ? -12.104 16.813  -9.218  1.00 0.00 ? 1074 ALA B O    1  
ATOM 389   C CB   . ALA A 1 30 ? -14.186 15.373  -7.322  1.00 0.00 ? 1074 ALA B CB   1  
ATOM 390   H H    . ALA A 1 30 ? -12.557 14.668  -5.508  1.00 0.00 ? 1074 ALA B H    1  
ATOM 391   H HA   . ALA A 1 30 ? -12.550 14.433  -8.327  1.00 0.00 ? 1074 ALA B HA   1  
ATOM 392   H HB1  . ALA A 1 30 ? -14.544 16.190  -7.930  1.00 0.00 ? 1074 ALA B HB1  1  
ATOM 393   H HB2  . ALA A 1 30 ? -14.360 15.595  -6.279  1.00 0.00 ? 1074 ALA B HB2  1  
ATOM 394   H HB3  . ALA A 1 30 ? -14.712 14.469  -7.589  1.00 0.00 ? 1074 ALA B HB3  1  
ATOM 395   N N    . THR A 1 31 ? -11.498 17.236  -7.093  1.00 0.00 ? 1075 THR B N    1  
ATOM 396   C CA   . THR A 1 31 ? -10.874 18.511  -7.417  1.00 0.00 ? 1075 THR B CA   1  
ATOM 397   C C    . THR A 1 31 ? -9.489  18.298  -8.014  1.00 0.00 ? 1075 THR B C    1  
ATOM 398   O O    . THR A 1 31 ? -8.928  17.203  -7.949  1.00 0.00 ? 1075 THR B O    1  
ATOM 399   C CB   . THR A 1 31 ? -10.759 19.377  -6.161  1.00 0.00 ? 1075 THR B CB   1  
ATOM 400   O OG1  . THR A 1 31 ? -9.967  18.704  -5.189  1.00 0.00 ? 1075 THR B OG1  1  
ATOM 401   C CG2  . THR A 1 31 ? -12.154 19.645  -5.599  1.00 0.00 ? 1075 THR B CG2  1  
ATOM 402   H H    . THR A 1 31 ? -11.499 16.927  -6.164  1.00 0.00 ? 1075 THR B H    1  
ATOM 403   H HA   . THR A 1 31 ? -11.488 19.027  -8.138  1.00 0.00 ? 1075 THR B HA   1  
ATOM 404   H HB   . THR A 1 31 ? -10.293 20.316  -6.415  1.00 0.00 ? 1075 THR B HB   1  
ATOM 405   H HG1  . THR A 1 31 ? -9.539  17.960  -5.618  1.00 0.00 ? 1075 THR B HG1  1  
ATOM 406   H HG21 . THR A 1 31 ? -12.704 20.261  -6.295  1.00 0.00 ? 1075 THR B HG21 1  
ATOM 407   H HG22 . THR A 1 31 ? -12.068 20.159  -4.652  1.00 0.00 ? 1075 THR B HG22 1  
ATOM 408   H HG23 . THR A 1 31 ? -12.672 18.709  -5.457  1.00 0.00 ? 1075 THR B HG23 1  
ATOM 409   N N    . LYS A 1 32 ? -8.944  19.361  -8.585  1.00 0.00 ? 1076 LYS B N    1  
ATOM 410   C CA   . LYS A 1 32 ? -7.615  19.301  -9.186  1.00 0.00 ? 1076 LYS B CA   1  
ATOM 411   C C    . LYS A 1 32 ? -6.551  19.011  -8.130  1.00 0.00 ? 1076 LYS B C    1  
ATOM 412   O O    . LYS A 1 32 ? -5.402  18.723  -8.464  1.00 0.00 ? 1076 LYS B O    1  
ATOM 413   C CB   . LYS A 1 32 ? -7.286  20.615  -9.894  1.00 0.00 ? 1076 LYS B CB   1  
ATOM 414   C CG   . LYS A 1 32 ? -7.114  21.727  -8.859  1.00 0.00 ? 1076 LYS B CG   1  
ATOM 415   C CD   . LYS A 1 32 ? -6.926  23.065  -9.575  1.00 0.00 ? 1076 LYS B CD   1  
ATOM 416   C CE   . LYS A 1 32 ? -5.559  23.093  -10.262 1.00 0.00 ? 1076 LYS B CE   1  
ATOM 417   N NZ   . LYS A 1 32 ? -5.354  24.423  -10.902 1.00 0.00 ? 1076 LYS B NZ   1  
ATOM 418   H H    . LYS A 1 32 ? -9.443  20.205  -8.593  1.00 0.00 ? 1076 LYS B H    1  
ATOM 419   H HA   . LYS A 1 32 ? -7.604  18.505  -9.914  1.00 0.00 ? 1076 LYS B HA   1  
ATOM 420   H HB2  . LYS A 1 32 ? -6.367  20.498  -10.451 1.00 0.00 ? 1076 LYS B HB2  1  
ATOM 421   H HB3  . LYS A 1 32 ? -8.087  20.873  -10.570 1.00 0.00 ? 1076 LYS B HB3  1  
ATOM 422   H HG2  . LYS A 1 32 ? -7.992  21.772  -8.231  1.00 0.00 ? 1076 LYS B HG2  1  
ATOM 423   H HG3  . LYS A 1 32 ? -6.246  21.522  -8.250  1.00 0.00 ? 1076 LYS B HG3  1  
ATOM 424   H HD2  . LYS A 1 32 ? -7.704  23.189  -10.312 1.00 0.00 ? 1076 LYS B HD2  1  
ATOM 425   H HD3  . LYS A 1 32 ? -6.982  23.868  -8.854  1.00 0.00 ? 1076 LYS B HD3  1  
ATOM 426   H HE2  . LYS A 1 32 ? -4.783  22.923  -9.530  1.00 0.00 ? 1076 LYS B HE2  1  
ATOM 427   H HE3  . LYS A 1 32 ? -5.518  22.322  -11.017 1.00 0.00 ? 1076 LYS B HE3  1  
ATOM 428   H HZ1  . LYS A 1 32 ? -5.033  25.107  -10.187 1.00 0.00 ? 1076 LYS B HZ1  1  
ATOM 429   H HZ2  . LYS A 1 32 ? -6.251  24.749  -11.318 1.00 0.00 ? 1076 LYS B HZ2  1  
ATOM 430   H HZ3  . LYS A 1 32 ? -4.635  24.342  -11.648 1.00 0.00 ? 1076 LYS B HZ3  1  
ATOM 431   N N    . ALA A 1 33 ? -6.932  19.102  -6.855  1.00 0.00 ? 1077 ALA B N    1  
ATOM 432   C CA   . ALA A 1 33 ? -5.997  18.860  -5.763  1.00 0.00 ? 1077 ALA B CA   1  
ATOM 433   C C    . ALA A 1 33 ? -5.366  17.478  -5.895  1.00 0.00 ? 1077 ALA B C    1  
ATOM 434   O O    . ALA A 1 33 ? -4.258  17.244  -5.415  1.00 0.00 ? 1077 ALA B O    1  
ATOM 435   C CB   . ALA A 1 33 ? -6.735  18.959  -4.428  1.00 0.00 ? 1077 ALA B CB   1  
ATOM 436   H H    . ALA A 1 33 ? -7.857  19.346  -6.644  1.00 0.00 ? 1077 ALA B H    1  
ATOM 437   H HA   . ALA A 1 33 ? -5.219  19.608  -5.790  1.00 0.00 ? 1077 ALA B HA   1  
ATOM 438   H HB1  . ALA A 1 33 ? -6.039  18.802  -3.616  1.00 0.00 ? 1077 ALA B HB1  1  
ATOM 439   H HB2  . ALA A 1 33 ? -7.508  18.205  -4.389  1.00 0.00 ? 1077 ALA B HB2  1  
ATOM 440   H HB3  . ALA A 1 33 ? -7.183  19.938  -4.334  1.00 0.00 ? 1077 ALA B HB3  1  
ATOM 441   N N    . ALA A 1 34 ? -6.073  16.565  -6.552  1.00 0.00 ? 1078 ALA B N    1  
ATOM 442   C CA   . ALA A 1 34 ? -5.563  15.212  -6.742  1.00 0.00 ? 1078 ALA B CA   1  
ATOM 443   C C    . ALA A 1 34 ? -4.247  15.242  -7.522  1.00 0.00 ? 1078 ALA B C    1  
ATOM 444   O O    . ALA A 1 34 ? -3.311  14.492  -7.222  1.00 0.00 ? 1078 ALA B O    1  
ATOM 445   C CB   . ALA A 1 34 ? -6.591  14.374  -7.506  1.00 0.00 ? 1078 ALA B CB   1  
ATOM 446   H H    . ALA A 1 34 ? -6.952  16.806  -6.917  1.00 0.00 ? 1078 ALA B H    1  
ATOM 447   H HA   . ALA A 1 34 ? -5.390  14.762  -5.776  1.00 0.00 ? 1078 ALA B HA   1  
ATOM 448   H HB1  . ALA A 1 34 ? -6.233  14.195  -8.510  1.00 0.00 ? 1078 ALA B HB1  1  
ATOM 449   H HB2  . ALA A 1 34 ? -7.528  14.907  -7.548  1.00 0.00 ? 1078 ALA B HB2  1  
ATOM 450   H HB3  . ALA A 1 34 ? -6.734  13.431  -7.001  1.00 0.00 ? 1078 ALA B HB3  1  
ATOM 451   N N    . ALA A 1 35 ? -4.180  16.117  -8.521  1.00 0.00 ? 1079 ALA B N    1  
ATOM 452   C CA   . ALA A 1 35 ? -2.974  16.241  -9.330  1.00 0.00 ? 1079 ALA B CA   1  
ATOM 453   C C    . ALA A 1 35 ? -1.840  16.835  -8.504  1.00 0.00 ? 1079 ALA B C    1  
ATOM 454   O O    . ALA A 1 35 ? -2.035  17.804  -7.771  1.00 0.00 ? 1079 ALA B O    1  
ATOM 455   C CB   . ALA A 1 35 ? -3.246  17.132  -10.544 1.00 0.00 ? 1079 ALA B CB   1  
ATOM 456   H H    . ALA A 1 35 ? -4.949  16.692  -8.711  1.00 0.00 ? 1079 ALA B H    1  
ATOM 457   H HA   . ALA A 1 35 ? -2.682  15.260  -9.675  1.00 0.00 ? 1079 ALA B HA   1  
ATOM 458   H HB1  . ALA A 1 35 ? -3.643  16.532  -11.349 1.00 0.00 ? 1079 ALA B HB1  1  
ATOM 459   H HB2  . ALA A 1 35 ? -2.323  17.597  -10.863 1.00 0.00 ? 1079 ALA B HB2  1  
ATOM 460   H HB3  . ALA A 1 35 ? -3.961  17.896  -10.277 1.00 0.00 ? 1079 ALA B HB3  1  
ATOM 461   N N    . GLY A 1 36 ? -0.659  16.243  -8.623  1.00 0.00 ? 1080 GLY B N    1  
ATOM 462   C CA   . GLY A 1 36 ? 0.498   16.716  -7.878  1.00 0.00 ? 1080 GLY B CA   1  
ATOM 463   C C    . GLY A 1 36 ? 0.598   16.018  -6.522  1.00 0.00 ? 1080 GLY B C    1  
ATOM 464   O O    . GLY A 1 36 ? 1.611   16.132  -5.833  1.00 0.00 ? 1080 GLY B O    1  
ATOM 465   H H    . GLY A 1 36 ? -0.565  15.470  -9.216  1.00 0.00 ? 1080 GLY B H    1  
ATOM 466   H HA2  . GLY A 1 36 ? 1.393   16.516  -8.447  1.00 0.00 ? 1080 GLY B HA2  1  
ATOM 467   H HA3  . GLY A 1 36 ? 0.408   17.779  -7.719  1.00 0.00 ? 1080 GLY B HA3  1  
ATOM 468   N N    . THR A 1 37 ? -0.455  15.292  -6.147  1.00 0.00 ? 1081 THR B N    1  
ATOM 469   C CA   . THR A 1 37 ? -0.467  14.584  -4.880  1.00 0.00 ? 1081 THR B CA   1  
ATOM 470   C C    . THR A 1 37 ? -0.255  13.093  -5.102  1.00 0.00 ? 1081 THR B C    1  
ATOM 471   O O    . THR A 1 37 ? 0.473   12.438  -4.355  1.00 0.00 ? 1081 THR B O    1  
ATOM 472   C CB   . THR A 1 37 ? -1.796  14.817  -4.169  1.00 0.00 ? 1081 THR B CB   1  
ATOM 473   O OG1  . THR A 1 37 ? -1.735  16.035  -3.440  1.00 0.00 ? 1081 THR B OG1  1  
ATOM 474   C CG2  . THR A 1 37 ? -2.073  13.654  -3.223  1.00 0.00 ? 1081 THR B CG2  1  
ATOM 475   H H    . THR A 1 37 ? -1.236  15.231  -6.730  1.00 0.00 ? 1081 THR B H    1  
ATOM 476   H HA   . THR A 1 37 ? 0.327   14.962  -4.264  1.00 0.00 ? 1081 THR B HA   1  
ATOM 477   H HB   . THR A 1 37 ? -2.588  14.875  -4.900  1.00 0.00 ? 1081 THR B HB   1  
ATOM 478   H HG1  . THR A 1 37 ? -0.865  16.419  -3.579  1.00 0.00 ? 1081 THR B HG1  1  
ATOM 479   H HG21 . THR A 1 37 ? -2.451  12.817  -3.790  1.00 0.00 ? 1081 THR B HG21 1  
ATOM 480   H HG22 . THR A 1 37 ? -2.804  13.952  -2.487  1.00 0.00 ? 1081 THR B HG22 1  
ATOM 481   H HG23 . THR A 1 37 ? -1.157  13.369  -2.728  1.00 0.00 ? 1081 THR B HG23 1  
ATOM 482   N N    . LYS A 1 38 ? -0.891  12.565  -6.136  1.00 0.00 ? 1082 LYS B N    1  
ATOM 483   C CA   . LYS A 1 38 ? -0.762  11.149  -6.453  1.00 0.00 ? 1082 LYS B CA   1  
ATOM 484   C C    . LYS A 1 38 ? 0.678   10.799  -6.827  1.00 0.00 ? 1082 LYS B C    1  
ATOM 485   O O    . LYS A 1 38 ? 1.081   9.638   -6.755  1.00 0.00 ? 1082 LYS B O    1  
ATOM 486   C CB   . LYS A 1 38 ? -1.677  10.794  -7.616  1.00 0.00 ? 1082 LYS B CB   1  
ATOM 487   C CG   . LYS A 1 38 ? -3.141  10.886  -7.172  1.00 0.00 ? 1082 LYS B CG   1  
ATOM 488   C CD   . LYS A 1 38 ? -4.063  10.533  -8.342  1.00 0.00 ? 1082 LYS B CD   1  
ATOM 489   C CE   . LYS A 1 38 ? -5.521  10.624  -7.887  1.00 0.00 ? 1082 LYS B CE   1  
ATOM 490   N NZ   . LYS A 1 38 ? -6.421  10.289  -9.026  1.00 0.00 ? 1082 LYS B NZ   1  
ATOM 491   H H    . LYS A 1 38 ? -1.460  13.140  -6.699  1.00 0.00 ? 1082 LYS B H    1  
ATOM 492   H HA   . LYS A 1 38 ? -1.053  10.567  -5.591  1.00 0.00 ? 1082 LYS B HA   1  
ATOM 493   H HB2  . LYS A 1 38 ? -1.499  11.487  -8.425  1.00 0.00 ? 1082 LYS B HB2  1  
ATOM 494   H HB3  . LYS A 1 38 ? -1.463  9.792   -7.943  1.00 0.00 ? 1082 LYS B HB3  1  
ATOM 495   H HG2  . LYS A 1 38 ? -3.312  10.196  -6.360  1.00 0.00 ? 1082 LYS B HG2  1  
ATOM 496   H HG3  . LYS A 1 38 ? -3.354  11.892  -6.839  1.00 0.00 ? 1082 LYS B HG3  1  
ATOM 497   H HD2  . LYS A 1 38 ? -3.893  11.224  -9.156  1.00 0.00 ? 1082 LYS B HD2  1  
ATOM 498   H HD3  . LYS A 1 38 ? -3.854  9.527   -8.675  1.00 0.00 ? 1082 LYS B HD3  1  
ATOM 499   H HE2  . LYS A 1 38 ? -5.691  9.928   -7.078  1.00 0.00 ? 1082 LYS B HE2  1  
ATOM 500   H HE3  . LYS A 1 38 ? -5.730  11.628  -7.548  1.00 0.00 ? 1082 LYS B HE3  1  
ATOM 501   H HZ1  . LYS A 1 38 ? -6.920  9.400   -8.823  1.00 0.00 ? 1082 LYS B HZ1  1  
ATOM 502   H HZ2  . LYS A 1 38 ? -5.856  10.179  -9.893  1.00 0.00 ? 1082 LYS B HZ2  1  
ATOM 503   H HZ3  . LYS A 1 38 ? -7.116  11.052  -9.157  1.00 0.00 ? 1082 LYS B HZ3  1  
ATOM 504   N N    . LYS A 1 39 ? 1.446   11.804  -7.236  1.00 0.00 ? 1083 LYS B N    1  
ATOM 505   C CA   . LYS A 1 39 ? 2.834   11.586  -7.631  1.00 0.00 ? 1083 LYS B CA   1  
ATOM 506   C C    . LYS A 1 39 ? 3.639   11.036  -6.455  1.00 0.00 ? 1083 LYS B C    1  
ATOM 507   O O    . LYS A 1 39 ? 4.670   10.392  -6.643  1.00 0.00 ? 1083 LYS B O    1  
ATOM 508   C CB   . LYS A 1 39 ? 3.441   12.912  -8.077  1.00 0.00 ? 1083 LYS B CB   1  
ATOM 509   C CG   . LYS A 1 39 ? 2.674   13.437  -9.284  1.00 0.00 ? 1083 LYS B CG   1  
ATOM 510   C CD   . LYS A 1 39 ? 3.178   14.834  -9.634  1.00 0.00 ? 1083 LYS B CD   1  
ATOM 511   C CE   . LYS A 1 39 ? 2.253   15.442  -10.679 1.00 0.00 ? 1083 LYS B CE   1  
ATOM 512   N NZ   . LYS A 1 39 ? 2.714   16.822  -11.021 1.00 0.00 ? 1083 LYS B NZ   1  
ATOM 513   H H    . LYS A 1 39 ? 1.073   12.710  -7.283  1.00 0.00 ? 1083 LYS B H    1  
ATOM 514   H HA   . LYS A 1 39 ? 2.871   10.886  -8.451  1.00 0.00 ? 1083 LYS B HA   1  
ATOM 515   H HB2  . LYS A 1 39 ? 3.378   13.627  -7.269  1.00 0.00 ? 1083 LYS B HB2  1  
ATOM 516   H HB3  . LYS A 1 39 ? 4.476   12.764  -8.346  1.00 0.00 ? 1083 LYS B HB3  1  
ATOM 517   H HG2  . LYS A 1 39 ? 2.830   12.776  -10.126 1.00 0.00 ? 1083 LYS B HG2  1  
ATOM 518   H HG3  . LYS A 1 39 ? 1.620   13.483  -9.054  1.00 0.00 ? 1083 LYS B HG3  1  
ATOM 519   H HD2  . LYS A 1 39 ? 3.176   15.448  -8.745  1.00 0.00 ? 1083 LYS B HD2  1  
ATOM 520   H HD3  . LYS A 1 39 ? 4.179   14.770  -10.031 1.00 0.00 ? 1083 LYS B HD3  1  
ATOM 521   H HE2  . LYS A 1 39 ? 2.260   14.826  -11.563 1.00 0.00 ? 1083 LYS B HE2  1  
ATOM 522   H HE3  . LYS A 1 39 ? 1.252   15.483  -10.275 1.00 0.00 ? 1083 LYS B HE3  1  
ATOM 523   H HZ1  . LYS A 1 39 ? 3.753   16.854  -11.021 1.00 0.00 ? 1083 LYS B HZ1  1  
ATOM 524   H HZ2  . LYS A 1 39 ? 2.347   17.494  -10.315 1.00 0.00 ? 1083 LYS B HZ2  1  
ATOM 525   H HZ3  . LYS A 1 39 ? 2.361   17.084  -11.963 1.00 0.00 ? 1083 LYS B HZ3  1  
ATOM 526   N N    . TYR A 1 40 ? 3.162   11.304  -5.241  1.00 0.00 ? 1084 TYR B N    1  
ATOM 527   C CA   . TYR A 1 40 ? 3.854   10.838  -4.044  1.00 0.00 ? 1084 TYR B CA   1  
ATOM 528   C C    . TYR A 1 40 ? 3.916   9.316   -4.030  1.00 0.00 ? 1084 TYR B C    1  
ATOM 529   O O    . TYR A 1 40 ? 2.931   8.637   -4.317  1.00 0.00 ? 1084 TYR B O    1  
ATOM 530   C CB   . TYR A 1 40 ? 3.125   11.332  -2.788  1.00 0.00 ? 1084 TYR B CB   1  
ATOM 531   C CG   . TYR A 1 40 ? 3.009   12.840  -2.822  1.00 0.00 ? 1084 TYR B CG   1  
ATOM 532   C CD1  . TYR A 1 40 ? 1.959   13.472  -2.143  1.00 0.00 ? 1084 TYR B CD1  1  
ATOM 533   C CD2  . TYR A 1 40 ? 3.939   13.607  -3.538  1.00 0.00 ? 1084 TYR B CD2  1  
ATOM 534   C CE1  . TYR A 1 40 ? 1.840   14.866  -2.182  1.00 0.00 ? 1084 TYR B CE1  1  
ATOM 535   C CE2  . TYR A 1 40 ? 3.818   14.998  -3.575  1.00 0.00 ? 1084 TYR B CE2  1  
ATOM 536   C CZ   . TYR A 1 40 ? 2.770   15.629  -2.898  1.00 0.00 ? 1084 TYR B CZ   1  
ATOM 537   O OH   . TYR A 1 40 ? 2.653   17.004  -2.938  1.00 0.00 ? 1084 TYR B OH   1  
ATOM 538   H H    . TYR A 1 40 ? 2.339   11.830  -5.151  1.00 0.00 ? 1084 TYR B H    1  
ATOM 539   H HA   . TYR A 1 40 ? 4.860   11.223  -4.040  1.00 0.00 ? 1084 TYR B HA   1  
ATOM 540   H HB2  . TYR A 1 40 ? 2.137   10.898  -2.753  1.00 0.00 ? 1084 TYR B HB2  1  
ATOM 541   H HB3  . TYR A 1 40 ? 3.680   11.036  -1.910  1.00 0.00 ? 1084 TYR B HB3  1  
ATOM 542   H HD1  . TYR A 1 40 ? 1.244   12.883  -1.590  1.00 0.00 ? 1084 TYR B HD1  1  
ATOM 543   H HD2  . TYR A 1 40 ? 4.749   13.125  -4.062  1.00 0.00 ? 1084 TYR B HD2  1  
ATOM 544   H HE1  . TYR A 1 40 ? 1.026   15.349  -1.663  1.00 0.00 ? 1084 TYR B HE1  1  
ATOM 545   H HE2  . TYR A 1 40 ? 4.530   15.582  -4.131  1.00 0.00 ? 1084 TYR B HE2  1  
ATOM 546   H HH   . TYR A 1 40 ? 2.093   17.277  -2.208  1.00 0.00 ? 1084 TYR B HH   1  
ATOM 547   N N    . ASP A 1 41 ? 5.089   8.795   -3.695  1.00 0.00 ? 1085 ASP B N    1  
ATOM 548   C CA   . ASP A 1 41 ? 5.290   7.350   -3.648  1.00 0.00 ? 1085 ASP B CA   1  
ATOM 549   C C    . ASP A 1 41 ? 5.096   6.833   -2.229  1.00 0.00 ? 1085 ASP B C    1  
ATOM 550   O O    . ASP A 1 41 ? 5.954   7.016   -1.366  1.00 0.00 ? 1085 ASP B O    1  
ATOM 551   C CB   . ASP A 1 41 ? 6.700   6.998   -4.132  1.00 0.00 ? 1085 ASP B CB   1  
ATOM 552   C CG   . ASP A 1 41 ? 6.812   7.234   -5.634  1.00 0.00 ? 1085 ASP B CG   1  
ATOM 553   O OD1  . ASP A 1 41 ? 5.781   7.380   -6.269  1.00 0.00 ? 1085 ASP B OD1  1  
ATOM 554   O OD2  . ASP A 1 41 ? 7.928   7.266   -6.128  1.00 0.00 ? 1085 ASP B OD2  1  
ATOM 555   H H    . ASP A 1 41 ? 5.831   9.396   -3.478  1.00 0.00 ? 1085 ASP B H    1  
ATOM 556   H HA   . ASP A 1 41 ? 4.569   6.875   -4.295  1.00 0.00 ? 1085 ASP B HA   1  
ATOM 557   H HB2  . ASP A 1 41 ? 7.422   7.616   -3.617  1.00 0.00 ? 1085 ASP B HB2  1  
ATOM 558   H HB3  . ASP A 1 41 ? 6.901   5.959   -3.918  1.00 0.00 ? 1085 ASP B HB3  1  
ATOM 559   N N    . LEU A 1 42 ? 3.960   6.186   -1.998  1.00 0.00 ? 1086 LEU B N    1  
ATOM 560   C CA   . LEU A 1 42 ? 3.652   5.647   -0.679  1.00 0.00 ? 1086 LEU B CA   1  
ATOM 561   C C    . LEU A 1 42 ? 3.495   4.128   -0.742  1.00 0.00 ? 1086 LEU B C    1  
ATOM 562   O O    . LEU A 1 42 ? 3.445   3.460   0.289   1.00 0.00 ? 1086 LEU B O    1  
ATOM 563   C CB   . LEU A 1 42 ? 2.359   6.263   -0.154  1.00 0.00 ? 1086 LEU B CB   1  
ATOM 564   C CG   . LEU A 1 42 ? 2.391   7.777   -0.371  1.00 0.00 ? 1086 LEU B CG   1  
ATOM 565   C CD1  . LEU A 1 42 ? 1.086   8.397   0.122   1.00 0.00 ? 1086 LEU B CD1  1  
ATOM 566   C CD2  . LEU A 1 42 ? 3.566   8.388   0.395   1.00 0.00 ? 1086 LEU B CD2  1  
ATOM 567   H H    . LEU A 1 42 ? 3.314   6.075   -2.726  1.00 0.00 ? 1086 LEU B H    1  
ATOM 568   H HA   . LEU A 1 42 ? 4.457   5.891   -0.002  1.00 0.00 ? 1086 LEU B HA   1  
ATOM 569   H HB2  . LEU A 1 42 ? 1.518   5.838   -0.683  1.00 0.00 ? 1086 LEU B HB2  1  
ATOM 570   H HB3  . LEU A 1 42 ? 2.268   6.055   0.901   1.00 0.00 ? 1086 LEU B HB3  1  
ATOM 571   H HG   . LEU A 1 42 ? 2.505   7.979   -1.425  1.00 0.00 ? 1086 LEU B HG   1  
ATOM 572   H HD11 . LEU A 1 42 ? 0.547   7.676   0.722   1.00 0.00 ? 1086 LEU B HD11 1  
ATOM 573   H HD12 . LEU A 1 42 ? 0.483   8.685   -0.726  1.00 0.00 ? 1086 LEU B HD12 1  
ATOM 574   H HD13 . LEU A 1 42 ? 1.306   9.269   0.720   1.00 0.00 ? 1086 LEU B HD13 1  
ATOM 575   H HD21 . LEU A 1 42 ? 3.995   7.648   1.052   1.00 0.00 ? 1086 LEU B HD21 1  
ATOM 576   H HD22 . LEU A 1 42 ? 3.217   9.228   0.975   1.00 0.00 ? 1086 LEU B HD22 1  
ATOM 577   H HD23 . LEU A 1 42 ? 4.314   8.724   -0.309  1.00 0.00 ? 1086 LEU B HD23 1  
ATOM 578   N N    . SER A 1 43 ? 3.422   3.587   -1.958  1.00 0.00 ? 1087 SER B N    1  
ATOM 579   C CA   . SER A 1 43 ? 3.273   2.149   -2.138  1.00 0.00 ? 1087 SER B CA   1  
ATOM 580   C C    . SER A 1 43 ? 4.489   1.418   -1.578  1.00 0.00 ? 1087 SER B C    1  
ATOM 581   O O    . SER A 1 43 ? 4.441   0.215   -1.322  1.00 0.00 ? 1087 SER B O    1  
ATOM 582   C CB   . SER A 1 43 ? 3.116   1.824   -3.623  1.00 0.00 ? 1087 SER B CB   1  
ATOM 583   O OG   . SER A 1 43 ? 4.332   2.118   -4.296  1.00 0.00 ? 1087 SER B OG   1  
ATOM 584   H H    . SER A 1 43 ? 3.468   4.161   -2.747  1.00 0.00 ? 1087 SER B H    1  
ATOM 585   H HA   . SER A 1 43 ? 2.392   1.816   -1.611  1.00 0.00 ? 1087 SER B HA   1  
ATOM 586   H HB2  . SER A 1 43 ? 2.882   0.781   -3.746  1.00 0.00 ? 1087 SER B HB2  1  
ATOM 587   H HB3  . SER A 1 43 ? 2.313   2.422   -4.036  1.00 0.00 ? 1087 SER B HB3  1  
ATOM 588   H HG   . SER A 1 43 ? 4.945   2.478   -3.652  1.00 0.00 ? 1087 SER B HG   1  
ATOM 589   N N    . LYS A 1 44 ? 5.577   2.155   -1.385  1.00 0.00 ? 1088 LYS B N    1  
ATOM 590   C CA   . LYS A 1 44 ? 6.794   1.561   -0.844  1.00 0.00 ? 1088 LYS B CA   1  
ATOM 591   C C    . LYS A 1 44 ? 6.821   1.670   0.680   1.00 0.00 ? 1088 LYS B C    1  
ATOM 592   O O    . LYS A 1 44 ? 7.702   1.106   1.334   1.00 0.00 ? 1088 LYS B O    1  
ATOM 593   C CB   . LYS A 1 44 ? 8.022   2.258   -1.429  1.00 0.00 ? 1088 LYS B CB   1  
ATOM 594   C CG   . LYS A 1 44 ? 8.057   2.036   -2.941  1.00 0.00 ? 1088 LYS B CG   1  
ATOM 595   C CD   . LYS A 1 44 ? 9.355   2.603   -3.515  1.00 0.00 ? 1088 LYS B CD   1  
ATOM 596   C CE   . LYS A 1 44 ? 9.323   4.131   -3.440  1.00 0.00 ? 1088 LYS B CE   1  
ATOM 597   N NZ   . LYS A 1 44 ? 10.534  4.683   -4.111  1.00 0.00 ? 1088 LYS B NZ   1  
ATOM 598   H H    . LYS A 1 44 ? 5.559   3.114   -1.600  1.00 0.00 ? 1088 LYS B H    1  
ATOM 599   H HA   . LYS A 1 44 ? 6.823   0.518   -1.120  1.00 0.00 ? 1088 LYS B HA   1  
ATOM 600   H HB2  . LYS A 1 44 ? 7.969   3.317   -1.218  1.00 0.00 ? 1088 LYS B HB2  1  
ATOM 601   H HB3  . LYS A 1 44 ? 8.915   1.847   -0.985  1.00 0.00 ? 1088 LYS B HB3  1  
ATOM 602   H HG2  . LYS A 1 44 ? 8.001   0.977   -3.147  1.00 0.00 ? 1088 LYS B HG2  1  
ATOM 603   H HG3  . LYS A 1 44 ? 7.216   2.536   -3.395  1.00 0.00 ? 1088 LYS B HG3  1  
ATOM 604   H HD2  . LYS A 1 44 ? 10.193  2.233   -2.942  1.00 0.00 ? 1088 LYS B HD2  1  
ATOM 605   H HD3  . LYS A 1 44 ? 9.457   2.297   -4.544  1.00 0.00 ? 1088 LYS B HD3  1  
ATOM 606   H HE2  . LYS A 1 44 ? 8.437   4.498   -3.936  1.00 0.00 ? 1088 LYS B HE2  1  
ATOM 607   H HE3  . LYS A 1 44 ? 9.311   4.441   -2.406  1.00 0.00 ? 1088 LYS B HE3  1  
ATOM 608   H HZ1  . LYS A 1 44 ? 11.263  3.944   -4.175  1.00 0.00 ? 1088 LYS B HZ1  1  
ATOM 609   H HZ2  . LYS A 1 44 ? 10.901  5.486   -3.558  1.00 0.00 ? 1088 LYS B HZ2  1  
ATOM 610   H HZ3  . LYS A 1 44 ? 10.284  5.005   -5.067  1.00 0.00 ? 1088 LYS B HZ3  1  
ATOM 611   N N    . TRP A 1 45 ? 5.859   2.398   1.245   1.00 0.00 ? 1089 TRP B N    1  
ATOM 612   C CA   . TRP A 1 45 ? 5.792   2.574   2.687   1.00 0.00 ? 1089 TRP B CA   1  
ATOM 613   C C    . TRP A 1 45 ? 5.014   1.437   3.327   1.00 0.00 ? 1089 TRP B C    1  
ATOM 614   O O    . TRP A 1 45 ? 3.931   1.076   2.872   1.00 0.00 ? 1089 TRP B O    1  
ATOM 615   C CB   . TRP A 1 45 ? 5.112   3.905   3.022   1.00 0.00 ? 1089 TRP B CB   1  
ATOM 616   C CG   . TRP A 1 45 ? 6.048   5.032   2.739   1.00 0.00 ? 1089 TRP B CG   1  
ATOM 617   C CD1  . TRP A 1 45 ? 6.798   5.153   1.623   1.00 0.00 ? 1089 TRP B CD1  1  
ATOM 618   C CD2  . TRP A 1 45 ? 6.347   6.200   3.562   1.00 0.00 ? 1089 TRP B CD2  1  
ATOM 619   N NE1  . TRP A 1 45 ? 7.540   6.309   1.707   1.00 0.00 ? 1089 TRP B NE1  1  
ATOM 620   C CE2  . TRP A 1 45 ? 7.297   6.994   2.878   1.00 0.00 ? 1089 TRP B CE2  1  
ATOM 621   C CE3  . TRP A 1 45 ? 5.891   6.645   4.818   1.00 0.00 ? 1089 TRP B CE3  1  
ATOM 622   C CZ2  . TRP A 1 45 ? 7.781   8.184   3.420   1.00 0.00 ? 1089 TRP B CZ2  1  
ATOM 623   C CZ3  . TRP A 1 45 ? 6.377   7.845   5.364   1.00 0.00 ? 1089 TRP B CZ3  1  
ATOM 624   C CH2  . TRP A 1 45 ? 7.320   8.612   4.666   1.00 0.00 ? 1089 TRP B CH2  1  
ATOM 625   H H    . TRP A 1 45 ? 5.185   2.830   0.683   1.00 0.00 ? 1089 TRP B H    1  
ATOM 626   H HA   . TRP A 1 45 ? 6.794   2.585   3.089   1.00 0.00 ? 1089 TRP B HA   1  
ATOM 627   H HB2  . TRP A 1 45 ? 4.227   4.015   2.414   1.00 0.00 ? 1089 TRP B HB2  1  
ATOM 628   H HB3  . TRP A 1 45 ? 4.837   3.916   4.066   1.00 0.00 ? 1089 TRP B HB3  1  
ATOM 629   H HD1  . TRP A 1 45 ? 6.817   4.451   0.801   1.00 0.00 ? 1089 TRP B HD1  1  
ATOM 630   H HE1  . TRP A 1 45 ? 8.164   6.621   1.029   1.00 0.00 ? 1089 TRP B HE1  1  
ATOM 631   H HE3  . TRP A 1 45 ? 5.161   6.060   5.369   1.00 0.00 ? 1089 TRP B HE3  1  
ATOM 632   H HZ2  . TRP A 1 45 ? 8.506   8.773   2.878   1.00 0.00 ? 1089 TRP B HZ2  1  
ATOM 633   H HZ3  . TRP A 1 45 ? 6.027   8.180   6.326   1.00 0.00 ? 1089 TRP B HZ3  1  
ATOM 634   H HH2  . TRP A 1 45 ? 7.687   9.534   5.091   1.00 0.00 ? 1089 TRP B HH2  1  
ATOM 635   N N    . LYS A 1 46 ? 5.569   0.890   4.393   1.00 0.00 ? 1090 LYS B N    1  
ATOM 636   C CA   . LYS A 1 46 ? 4.917   -0.205  5.103   1.00 0.00 ? 1090 LYS B CA   1  
ATOM 637   C C    . LYS A 1 46 ? 3.585   0.244   5.683   1.00 0.00 ? 1090 LYS B C    1  
ATOM 638   O O    . LYS A 1 46 ? 3.338   1.438   5.856   1.00 0.00 ? 1090 LYS B O    1  
ATOM 639   C CB   . LYS A 1 46 ? 5.810   -0.710  6.236   1.00 0.00 ? 1090 LYS B CB   1  
ATOM 640   C CG   . LYS A 1 46 ? 7.095   -1.312  5.673   1.00 0.00 ? 1090 LYS B CG   1  
ATOM 641   C CD   . LYS A 1 46 ? 6.780   -2.629  4.958   1.00 0.00 ? 1090 LYS B CD   1  
ATOM 642   C CE   . LYS A 1 46 ? 8.081   -3.300  4.509   1.00 0.00 ? 1090 LYS B CE   1  
ATOM 643   N NZ   . LYS A 1 46 ? 7.765   -4.592  3.833   1.00 0.00 ? 1090 LYS B NZ   1  
ATOM 644   H H    . LYS A 1 46 ? 6.431   1.231   4.711   1.00 0.00 ? 1090 LYS B H    1  
ATOM 645   H HA   . LYS A 1 46 ? 4.737   -1.012  4.412   1.00 0.00 ? 1090 LYS B HA   1  
ATOM 646   H HB2  . LYS A 1 46 ? 6.059   0.115   6.887   1.00 0.00 ? 1090 LYS B HB2  1  
ATOM 647   H HB3  . LYS A 1 46 ? 5.281   -1.463  6.799   1.00 0.00 ? 1090 LYS B HB3  1  
ATOM 648   H HG2  . LYS A 1 46 ? 7.539   -0.618  4.976   1.00 0.00 ? 1090 LYS B HG2  1  
ATOM 649   H HG3  . LYS A 1 46 ? 7.779   -1.500  6.484   1.00 0.00 ? 1090 LYS B HG3  1  
ATOM 650   H HD2  . LYS A 1 46 ? 6.249   -3.284  5.635   1.00 0.00 ? 1090 LYS B HD2  1  
ATOM 651   H HD3  . LYS A 1 46 ? 6.167   -2.432  4.095   1.00 0.00 ? 1090 LYS B HD3  1  
ATOM 652   H HE2  . LYS A 1 46 ? 8.600   -2.651  3.815   1.00 0.00 ? 1090 LYS B HE2  1  
ATOM 653   H HE3  . LYS A 1 46 ? 8.708   -3.487  5.369   1.00 0.00 ? 1090 LYS B HE3  1  
ATOM 654   H HZ1  . LYS A 1 46 ? 6.755   -4.617  3.586   1.00 0.00 ? 1090 LYS B HZ1  1  
ATOM 655   H HZ2  . LYS A 1 46 ? 7.985   -5.381  4.477   1.00 0.00 ? 1090 LYS B HZ2  1  
ATOM 656   H HZ3  . LYS A 1 46 ? 8.334   -4.682  2.967   1.00 0.00 ? 1090 LYS B HZ3  1  
ATOM 657   N N    . TYR A 1 47 ? 2.731   -0.727  5.987   1.00 0.00 ? 1091 TYR B N    1  
ATOM 658   C CA   . TYR A 1 47 ? 1.428   -0.431  6.555   1.00 0.00 ? 1091 TYR B CA   1  
ATOM 659   C C    . TYR A 1 47 ? 1.590   0.365   7.836   1.00 0.00 ? 1091 TYR B C    1  
ATOM 660   O O    . TYR A 1 47 ? 0.916   1.375   8.040   1.00 0.00 ? 1091 TYR B O    1  
ATOM 661   C CB   . TYR A 1 47 ? 0.669   -1.730  6.845   1.00 0.00 ? 1091 TYR B CB   1  
ATOM 662   C CG   . TYR A 1 47 ? -0.562  -1.425  7.668   1.00 0.00 ? 1091 TYR B CG   1  
ATOM 663   C CD1  . TYR A 1 47 ? -1.669  -0.805  7.077   1.00 0.00 ? 1091 TYR B CD1  1  
ATOM 664   C CD2  . TYR A 1 47 ? -0.591  -1.763  9.026   1.00 0.00 ? 1091 TYR B CD2  1  
ATOM 665   C CE1  . TYR A 1 47 ? -2.804  -0.520  7.847   1.00 0.00 ? 1091 TYR B CE1  1  
ATOM 666   C CE2  . TYR A 1 47 ? -1.724  -1.479  9.794   1.00 0.00 ? 1091 TYR B CE2  1  
ATOM 667   C CZ   . TYR A 1 47 ? -2.830  -0.859  9.205   1.00 0.00 ? 1091 TYR B CZ   1  
ATOM 668   O OH   . TYR A 1 47 ? -3.945  -0.576  9.966   1.00 0.00 ? 1091 TYR B OH   1  
ATOM 669   H H    . TYR A 1 47 ? 2.986   -1.660  5.828   1.00 0.00 ? 1091 TYR B H    1  
ATOM 670   H HA   . TYR A 1 47 ? 0.863   0.154   5.846   1.00 0.00 ? 1091 TYR B HA   1  
ATOM 671   H HB2  . TYR A 1 47 ? 0.374   -2.191  5.914   1.00 0.00 ? 1091 TYR B HB2  1  
ATOM 672   H HB3  . TYR A 1 47 ? 1.307   -2.407  7.395   1.00 0.00 ? 1091 TYR B HB3  1  
ATOM 673   H HD1  . TYR A 1 47 ? -1.649  -0.544  6.029   1.00 0.00 ? 1091 TYR B HD1  1  
ATOM 674   H HD2  . TYR A 1 47 ? 0.264   -2.244  9.481   1.00 0.00 ? 1091 TYR B HD2  1  
ATOM 675   H HE1  . TYR A 1 47 ? -3.659  -0.041  7.393   1.00 0.00 ? 1091 TYR B HE1  1  
ATOM 676   H HE2  . TYR A 1 47 ? -1.746  -1.741  10.843  1.00 0.00 ? 1091 TYR B HE2  1  
ATOM 677   H HH   . TYR A 1 47 ? -3.681  -0.558  10.888  1.00 0.00 ? 1091 TYR B HH   1  
ATOM 678   N N    . ALA A 1 48 ? 2.488   -0.093  8.697   1.00 0.00 ? 1092 ALA B N    1  
ATOM 679   C CA   . ALA A 1 48 ? 2.726   0.598   9.958   1.00 0.00 ? 1092 ALA B CA   1  
ATOM 680   C C    . ALA A 1 48 ? 3.253   2.009   9.708   1.00 0.00 ? 1092 ALA B C    1  
ATOM 681   O O    . ALA A 1 48 ? 2.880   2.956   10.403  1.00 0.00 ? 1092 ALA B O    1  
ATOM 682   C CB   . ALA A 1 48 ? 3.723   -0.185  10.810  1.00 0.00 ? 1092 ALA B CB   1  
ATOM 683   H H    . ALA A 1 48 ? 3.009   -0.902  8.473   1.00 0.00 ? 1092 ALA B H    1  
ATOM 684   H HA   . ALA A 1 48 ? 1.791   0.668   10.493  1.00 0.00 ? 1092 ALA B HA   1  
ATOM 685   H HB1  . ALA A 1 48 ? 4.671   -0.248  10.294  1.00 0.00 ? 1092 ALA B HB1  1  
ATOM 686   H HB2  . ALA A 1 48 ? 3.343   -1.180  10.984  1.00 0.00 ? 1092 ALA B HB2  1  
ATOM 687   H HB3  . ALA A 1 48 ? 3.861   0.318   11.756  1.00 0.00 ? 1092 ALA B HB3  1  
ATOM 688   N N    . GLU A 1 49 ? 4.126   2.134   8.715   1.00 0.00 ? 1093 GLU B N    1  
ATOM 689   C CA   . GLU A 1 49 ? 4.710   3.425   8.377   1.00 0.00 ? 1093 GLU B CA   1  
ATOM 690   C C    . GLU A 1 49 ? 3.636   4.398   7.908   1.00 0.00 ? 1093 GLU B C    1  
ATOM 691   O O    . GLU A 1 49 ? 3.627   5.558   8.312   1.00 0.00 ? 1093 GLU B O    1  
ATOM 692   C CB   . GLU A 1 49 ? 5.760   3.257   7.273   1.00 0.00 ? 1093 GLU B CB   1  
ATOM 693   C CG   . GLU A 1 49 ? 6.987   2.533   7.834   1.00 0.00 ? 1093 GLU B CG   1  
ATOM 694   C CD   . GLU A 1 49 ? 7.983   2.248   6.714   1.00 0.00 ? 1093 GLU B CD   1  
ATOM 695   O OE1  . GLU A 1 49 ? 7.615   2.420   5.563   1.00 0.00 ? 1093 GLU B OE1  1  
ATOM 696   O OE2  . GLU A 1 49 ? 9.097   1.863   7.023   1.00 0.00 ? 1093 GLU B OE2  1  
ATOM 697   H H    . GLU A 1 49 ? 4.378   1.344   8.203   1.00 0.00 ? 1093 GLU B H    1  
ATOM 698   H HA   . GLU A 1 49 ? 5.190   3.832   9.254   1.00 0.00 ? 1093 GLU B HA   1  
ATOM 699   H HB2  . GLU A 1 49 ? 5.341   2.678   6.462   1.00 0.00 ? 1093 GLU B HB2  1  
ATOM 700   H HB3  . GLU A 1 49 ? 6.054   4.228   6.905   1.00 0.00 ? 1093 GLU B HB3  1  
ATOM 701   H HG2  . GLU A 1 49 ? 7.458   3.154   8.583   1.00 0.00 ? 1093 GLU B HG2  1  
ATOM 702   H HG3  . GLU A 1 49 ? 6.679   1.602   8.285   1.00 0.00 ? 1093 GLU B HG3  1  
ATOM 703   N N    . LEU A 1 50 ? 2.723   3.921   7.069   1.00 0.00 ? 1094 LEU B N    1  
ATOM 704   C CA   . LEU A 1 50 ? 1.650   4.770   6.577   1.00 0.00 ? 1094 LEU B CA   1  
ATOM 705   C C    . LEU A 1 50 ? 0.740   5.192   7.716   1.00 0.00 ? 1094 LEU B C    1  
ATOM 706   O O    . LEU A 1 50 ? 0.293   6.336   7.772   1.00 0.00 ? 1094 LEU B O    1  
ATOM 707   C CB   . LEU A 1 50 ? 0.841   4.025   5.513   1.00 0.00 ? 1094 LEU B CB   1  
ATOM 708   C CG   . LEU A 1 50 ? 1.672   3.908   4.238   1.00 0.00 ? 1094 LEU B CG   1  
ATOM 709   C CD1  . LEU A 1 50 ? 1.013   2.904   3.287   1.00 0.00 ? 1094 LEU B CD1  1  
ATOM 710   C CD2  . LEU A 1 50 ? 1.740   5.274   3.549   1.00 0.00 ? 1094 LEU B CD2  1  
ATOM 711   H H    . LEU A 1 50 ? 2.765   2.985   6.782   1.00 0.00 ? 1094 LEU B H    1  
ATOM 712   H HA   . LEU A 1 50 ? 2.083   5.651   6.133   1.00 0.00 ? 1094 LEU B HA   1  
ATOM 713   H HB2  . LEU A 1 50 ? 0.597   3.036   5.875   1.00 0.00 ? 1094 LEU B HB2  1  
ATOM 714   H HB3  . LEU A 1 50 ? -0.067  4.567   5.301   1.00 0.00 ? 1094 LEU B HB3  1  
ATOM 715   H HG   . LEU A 1 50 ? 2.670   3.579   4.491   1.00 0.00 ? 1094 LEU B HG   1  
ATOM 716   H HD11 . LEU A 1 50 ? 0.273   3.413   2.684   1.00 0.00 ? 1094 LEU B HD11 1  
ATOM 717   H HD12 . LEU A 1 50 ? 0.533   2.124   3.861   1.00 0.00 ? 1094 LEU B HD12 1  
ATOM 718   H HD13 . LEU A 1 50 ? 1.763   2.469   2.643   1.00 0.00 ? 1094 LEU B HD13 1  
ATOM 719   H HD21 . LEU A 1 50 ? 1.131   5.256   2.657   1.00 0.00 ? 1094 LEU B HD21 1  
ATOM 720   H HD22 . LEU A 1 50 ? 2.762   5.493   3.283   1.00 0.00 ? 1094 LEU B HD22 1  
ATOM 721   H HD23 . LEU A 1 50 ? 1.371   6.035   4.221   1.00 0.00 ? 1094 LEU B HD23 1  
ATOM 722   N N    . ARG A 1 51 ? 0.469   4.267   8.625   1.00 0.00 ? 1095 ARG B N    1  
ATOM 723   C CA   . ARG A 1 51 ? -0.389  4.568   9.753   1.00 0.00 ? 1095 ARG B CA   1  
ATOM 724   C C    . ARG A 1 51 ? 0.207   5.700   10.579  1.00 0.00 ? 1095 ARG B C    1  
ATOM 725   O O    . ARG A 1 51 ? -0.482  6.661   10.929  1.00 0.00 ? 1095 ARG B O    1  
ATOM 726   C CB   . ARG A 1 51 ? -0.540  3.319   10.619  1.00 0.00 ? 1095 ARG B CB   1  
ATOM 727   C CG   . ARG A 1 51 ? -1.558  3.591   11.728  1.00 0.00 ? 1095 ARG B CG   1  
ATOM 728   C CD   . ARG A 1 51 ? -1.559  2.428   12.718  1.00 0.00 ? 1095 ARG B CD   1  
ATOM 729   N NE   . ARG A 1 51 ? -0.323  2.419   13.492  1.00 0.00 ? 1095 ARG B NE   1  
ATOM 730   C CZ   . ARG A 1 51 ? -0.014  1.404   14.303  1.00 0.00 ? 1095 ARG B CZ   1  
ATOM 731   N NH1  . ARG A 1 51 ? -0.815  0.374   14.427  1.00 0.00 ? 1095 ARG B NH1  1  
ATOM 732   N NH2  . ARG A 1 51 ? 1.099   1.438   14.981  1.00 0.00 ? 1095 ARG B NH2  1  
ATOM 733   H H    . ARG A 1 51 ? 0.850   3.368   8.536   1.00 0.00 ? 1095 ARG B H    1  
ATOM 734   H HA   . ARG A 1 51 ? -1.359  4.865   9.389   1.00 0.00 ? 1095 ARG B HA   1  
ATOM 735   H HB2  . ARG A 1 51 ? -0.882  2.499   10.004  1.00 0.00 ? 1095 ARG B HB2  1  
ATOM 736   H HB3  . ARG A 1 51 ? 0.416   3.065   11.056  1.00 0.00 ? 1095 ARG B HB3  1  
ATOM 737   H HG2  . ARG A 1 51 ? -1.297  4.504   12.241  1.00 0.00 ? 1095 ARG B HG2  1  
ATOM 738   H HG3  . ARG A 1 51 ? -2.542  3.690   11.294  1.00 0.00 ? 1095 ARG B HG3  1  
ATOM 739   H HD2  . ARG A 1 51 ? -2.399  2.532   13.387  1.00 0.00 ? 1095 ARG B HD2  1  
ATOM 740   H HD3  . ARG A 1 51 ? -1.647  1.500   12.172  1.00 0.00 ? 1095 ARG B HD3  1  
ATOM 741   H HE   . ARG A 1 51 ? 0.292   3.179   13.419  1.00 0.00 ? 1095 ARG B HE   1  
ATOM 742   H HH11 . ARG A 1 51 ? -1.671  0.335   13.915  1.00 0.00 ? 1095 ARG B HH11 1  
ATOM 743   H HH12 . ARG A 1 51 ? -0.566  -0.379  15.037  1.00 0.00 ? 1095 ARG B HH12 1  
ATOM 744   H HH21 . ARG A 1 51 ? 1.714   2.221   14.894  1.00 0.00 ? 1095 ARG B HH21 1  
ATOM 745   H HH22 . ARG A 1 51 ? 1.336   0.679   15.588  1.00 0.00 ? 1095 ARG B HH22 1  
ATOM 746   N N    . ASP A 1 52 ? 1.497   5.586   10.870  1.00 0.00 ? 1096 ASP B N    1  
ATOM 747   C CA   . ASP A 1 52 ? 2.189   6.610   11.638  1.00 0.00 ? 1096 ASP B CA   1  
ATOM 748   C C    . ASP A 1 52 ? 2.267   7.905   10.841  1.00 0.00 ? 1096 ASP B C    1  
ATOM 749   O O    . ASP A 1 52 ? 2.111   8.993   11.394  1.00 0.00 ? 1096 ASP B O    1  
ATOM 750   C CB   . ASP A 1 52 ? 3.599   6.141   12.008  1.00 0.00 ? 1096 ASP B CB   1  
ATOM 751   C CG   . ASP A 1 52 ? 4.236   7.117   12.994  1.00 0.00 ? 1096 ASP B CG   1  
ATOM 752   O OD1  . ASP A 1 52 ? 3.675   8.182   13.192  1.00 0.00 ? 1096 ASP B OD1  1  
ATOM 753   O OD2  . ASP A 1 52 ? 5.276   6.785   13.539  1.00 0.00 ? 1096 ASP B OD2  1  
ATOM 754   H H    . ASP A 1 52 ? 1.994   4.805   10.552  1.00 0.00 ? 1096 ASP B H    1  
ATOM 755   H HA   . ASP A 1 52 ? 1.634   6.794   12.544  1.00 0.00 ? 1096 ASP B HA   1  
ATOM 756   H HB2  . ASP A 1 52 ? 3.543   5.161   12.458  1.00 0.00 ? 1096 ASP B HB2  1  
ATOM 757   H HB3  . ASP A 1 52 ? 4.206   6.090   11.114  1.00 0.00 ? 1096 ASP B HB3  1  
ATOM 758   N N    . THR A 1 53 ? 2.515   7.785   9.536   1.00 0.00 ? 1097 THR B N    1  
ATOM 759   C CA   . THR A 1 53 ? 2.619   8.960   8.691   1.00 0.00 ? 1097 THR B CA   1  
ATOM 760   C C    . THR A 1 53 ? 1.319   9.749   8.703   1.00 0.00 ? 1097 THR B C    1  
ATOM 761   O O    . THR A 1 53 ? 1.328   10.968  8.816   1.00 0.00 ? 1097 THR B O    1  
ATOM 762   C CB   . THR A 1 53 ? 2.944   8.537   7.264   1.00 0.00 ? 1097 THR B CB   1  
ATOM 763   O OG1  . THR A 1 53 ? 4.177   7.840   7.259   1.00 0.00 ? 1097 THR B OG1  1  
ATOM 764   C CG2  . THR A 1 53 ? 3.047   9.775   6.375   1.00 0.00 ? 1097 THR B CG2  1  
ATOM 765   H H    . THR A 1 53 ? 2.637   6.893   9.137   1.00 0.00 ? 1097 THR B H    1  
ATOM 766   H HA   . THR A 1 53 ? 3.418   9.591   9.057   1.00 0.00 ? 1097 THR B HA   1  
ATOM 767   H HB   . THR A 1 53 ? 2.164   7.893   6.892   1.00 0.00 ? 1097 THR B HB   1  
ATOM 768   H HG1  . THR A 1 53 ? 4.048   7.008   6.796   1.00 0.00 ? 1097 THR B HG1  1  
ATOM 769   H HG21 . THR A 1 53 ? 2.955   10.664  6.987   1.00 0.00 ? 1097 THR B HG21 1  
ATOM 770   H HG22 . THR A 1 53 ? 2.255   9.758   5.641   1.00 0.00 ? 1097 THR B HG22 1  
ATOM 771   H HG23 . THR A 1 53 ? 4.004   9.780   5.874   1.00 0.00 ? 1097 THR B HG23 1  
ATOM 772   N N    . ILE A 1 54 ? 0.199   9.050   8.579   1.00 0.00 ? 1098 ILE B N    1  
ATOM 773   C CA   . ILE A 1 54 ? -1.103  9.710   8.577   1.00 0.00 ? 1098 ILE B CA   1  
ATOM 774   C C    . ILE A 1 54 ? -1.351  10.429  9.901   1.00 0.00 ? 1098 ILE B C    1  
ATOM 775   O O    . ILE A 1 54 ? -1.776  11.584  9.921   1.00 0.00 ? 1098 ILE B O    1  
ATOM 776   C CB   . ILE A 1 54 ? -2.203  8.676   8.346   1.00 0.00 ? 1098 ILE B CB   1  
ATOM 777   C CG1  . ILE A 1 54 ? -2.090  8.136   6.923   1.00 0.00 ? 1098 ILE B CG1  1  
ATOM 778   C CG2  . ILE A 1 54 ? -3.569  9.335   8.534   1.00 0.00 ? 1098 ILE B CG2  1  
ATOM 779   C CD1  . ILE A 1 54 ? -2.990  6.909   6.766   1.00 0.00 ? 1098 ILE B CD1  1  
ATOM 780   H H    . ILE A 1 54 ? 0.246   8.075   8.488   1.00 0.00 ? 1098 ILE B H    1  
ATOM 781   H HA   . ILE A 1 54 ? -1.128  10.431  7.774   1.00 0.00 ? 1098 ILE B HA   1  
ATOM 782   H HB   . ILE A 1 54 ? -2.090  7.867   9.052   1.00 0.00 ? 1098 ILE B HB   1  
ATOM 783   H HG12 . ILE A 1 54 ? -2.395  8.901   6.226   1.00 0.00 ? 1098 ILE B HG12 1  
ATOM 784   H HG13 . ILE A 1 54 ? -1.067  7.859   6.728   1.00 0.00 ? 1098 ILE B HG13 1  
ATOM 785   H HG21 . ILE A 1 54 ? -3.971  9.060   9.497   1.00 0.00 ? 1098 ILE B HG21 1  
ATOM 786   H HG22 . ILE A 1 54 ? -4.238  9.000   7.754   1.00 0.00 ? 1098 ILE B HG22 1  
ATOM 787   H HG23 . ILE A 1 54 ? -3.462  10.408  8.479   1.00 0.00 ? 1098 ILE B HG23 1  
ATOM 788   H HD11 . ILE A 1 54 ? -3.203  6.492   7.740   1.00 0.00 ? 1098 ILE B HD11 1  
ATOM 789   H HD12 . ILE A 1 54 ? -2.486  6.170   6.161   1.00 0.00 ? 1098 ILE B HD12 1  
ATOM 790   H HD13 . ILE A 1 54 ? -3.914  7.197   6.288   1.00 0.00 ? 1098 ILE B HD13 1  
ATOM 791   N N    . ASN A 1 55 ? -1.082  9.738   11.005  1.00 0.00 ? 1099 ASN B N    1  
ATOM 792   C CA   . ASN A 1 55 ? -1.283  10.320  12.331  1.00 0.00 ? 1099 ASN B CA   1  
ATOM 793   C C    . ASN A 1 55 ? -0.394  11.542  12.530  1.00 0.00 ? 1099 ASN B C    1  
ATOM 794   O O    . ASN A 1 55 ? -0.808  12.529  13.138  1.00 0.00 ? 1099 ASN B O    1  
ATOM 795   C CB   . ASN A 1 55 ? -0.979  9.278   13.404  1.00 0.00 ? 1099 ASN B CB   1  
ATOM 796   C CG   . ASN A 1 55 ? -2.186  8.366   13.592  1.00 0.00 ? 1099 ASN B CG   1  
ATOM 797   O OD1  . ASN A 1 55 ? -2.921  8.503   14.569  1.00 0.00 ? 1099 ASN B OD1  1  
ATOM 798   N ND2  . ASN A 1 55 ? -2.465  7.469   12.683  1.00 0.00 ? 1099 ASN B ND2  1  
ATOM 799   H H    . ASN A 1 55 ? -0.741  8.820   10.929  1.00 0.00 ? 1099 ASN B H    1  
ATOM 800   H HA   . ASN A 1 55 ? -2.315  10.622  12.427  1.00 0.00 ? 1099 ASN B HA   1  
ATOM 801   H HB2  . ASN A 1 55 ? -0.125  8.689   13.102  1.00 0.00 ? 1099 ASN B HB2  1  
ATOM 802   H HB3  . ASN A 1 55 ? -0.760  9.778   14.336  1.00 0.00 ? 1099 ASN B HB3  1  
ATOM 803   H HD21 . ASN A 1 55 ? -1.904  7.390   11.882  1.00 0.00 ? 1099 ASN B HD21 1  
ATOM 804   H HD22 . ASN A 1 55 ? -3.232  6.872   12.804  1.00 0.00 ? 1099 ASN B HD22 1  
ATOM 805   N N    . THR A 1 56 ? 0.826   11.469  12.015  1.00 0.00 ? 1100 THR B N    1  
ATOM 806   C CA   . THR A 1 56 ? 1.762   12.579  12.141  1.00 0.00 ? 1100 THR B CA   1  
ATOM 807   C C    . THR A 1 56 ? 1.644   13.536  10.957  1.00 0.00 ? 1100 THR B C    1  
ATOM 808   O O    . THR A 1 56 ? 2.345   14.546  10.899  1.00 0.00 ? 1100 THR B O    1  
ATOM 809   C CB   . THR A 1 56 ? 3.190   12.041  12.229  1.00 0.00 ? 1100 THR B CB   1  
ATOM 810   O OG1  . THR A 1 56 ? 3.487   11.294  11.057  1.00 0.00 ? 1100 THR B OG1  1  
ATOM 811   C CG2  . THR A 1 56 ? 3.318   11.144  13.456  1.00 0.00 ? 1100 THR B CG2  1  
ATOM 812   H H    . THR A 1 56 ? 1.101   10.658  11.535  1.00 0.00 ? 1100 THR B H    1  
ATOM 813   H HA   . THR A 1 56 ? 1.541   13.119  13.047  1.00 0.00 ? 1100 THR B HA   1  
ATOM 814   H HB   . THR A 1 56 ? 3.880   12.864  12.317  1.00 0.00 ? 1100 THR B HB   1  
ATOM 815   H HG1  . THR A 1 56 ? 3.712   11.913  10.359  1.00 0.00 ? 1100 THR B HG1  1  
ATOM 816   H HG21 . THR A 1 56 ? 4.307   10.713  13.486  1.00 0.00 ? 1100 THR B HG21 1  
ATOM 817   H HG22 . THR A 1 56 ? 2.582   10.355  13.403  1.00 0.00 ? 1100 THR B HG22 1  
ATOM 818   H HG23 . THR A 1 56 ? 3.152   11.730  14.348  1.00 0.00 ? 1100 THR B HG23 1  
ATOM 819   N N    . SER A 1 57 ? 0.773   13.213  10.005  1.00 0.00 ? 1101 SER B N    1  
ATOM 820   C CA   . SER A 1 57 ? 0.604   14.052  8.834   1.00 0.00 ? 1101 SER B CA   1  
ATOM 821   C C    . SER A 1 57 ? 0.012   15.397  9.221   1.00 0.00 ? 1101 SER B C    1  
ATOM 822   O O    . SER A 1 57 ? -1.031  15.469  9.872   1.00 0.00 ? 1101 SER B O    1  
ATOM 823   C CB   . SER A 1 57 ? -0.323  13.359  7.840   1.00 0.00 ? 1101 SER B CB   1  
ATOM 824   O OG   . SER A 1 57 ? -0.507  14.199  6.714   1.00 0.00 ? 1101 SER B OG   1  
ATOM 825   H H    . SER A 1 57 ? 0.245   12.393  10.081  1.00 0.00 ? 1101 SER B H    1  
ATOM 826   H HA   . SER A 1 57 ? 1.563   14.209  8.364   1.00 0.00 ? 1101 SER B HA   1  
ATOM 827   H HB2  . SER A 1 57 ? 0.111   12.427  7.524   1.00 0.00 ? 1101 SER B HB2  1  
ATOM 828   H HB3  . SER A 1 57 ? -1.273  13.165  8.317   1.00 0.00 ? 1101 SER B HB3  1  
ATOM 829   H HG   . SER A 1 57 ? -1.003  14.970  6.996   1.00 0.00 ? 1101 SER B HG   1  
ATOM 830   N N    . CYS A 1 58 ? 0.681   16.458  8.801   1.00 0.00 ? 1102 CYS B N    1  
ATOM 831   C CA   . CYS A 1 58 ? 0.217   17.807  9.086   1.00 0.00 ? 1102 CYS B CA   1  
ATOM 832   C C    . CYS A 1 58 ? -0.213  18.519  7.801   1.00 0.00 ? 1102 CYS B C    1  
ATOM 833   O O    . CYS A 1 58 ? -0.578  19.694  7.831   1.00 0.00 ? 1102 CYS B O    1  
ATOM 834   C CB   . CYS A 1 58 ? 1.327   18.606  9.771   1.00 0.00 ? 1102 CYS B CB   1  
ATOM 835   S SG   . CYS A 1 58 ? 1.731   17.831  11.357  1.00 0.00 ? 1102 CYS B SG   1  
ATOM 836   H H    . CYS A 1 58 ? 1.498   16.328  8.279   1.00 0.00 ? 1102 CYS B H    1  
ATOM 837   H HA   . CYS A 1 58 ? -0.631  17.750  9.752   1.00 0.00 ? 1102 CYS B HA   1  
ATOM 838   H HB2  . CYS A 1 58 ? 2.205   18.620  9.143   1.00 0.00 ? 1102 CYS B HB2  1  
ATOM 839   H HB3  . CYS A 1 58 ? 0.988   19.616  9.942   1.00 0.00 ? 1102 CYS B HB3  1  
ATOM 840   H HG   . CYS A 1 58 ? 1.122   17.101  11.495  1.00 0.00 ? 1102 CYS B HG   1  
ATOM 841   N N    . ASP A 1 59 ? -0.165  17.808  6.672   1.00 0.00 ? 1103 ASP B N    1  
ATOM 842   C CA   . ASP A 1 59 ? -0.549  18.394  5.394   1.00 0.00 ? 1103 ASP B CA   1  
ATOM 843   C C    . ASP A 1 59 ? -1.728  17.633  4.790   1.00 0.00 ? 1103 ASP B C    1  
ATOM 844   O O    . ASP A 1 59 ? -1.752  16.404  4.801   1.00 0.00 ? 1103 ASP B O    1  
ATOM 845   C CB   . ASP A 1 59 ? 0.641   18.344  4.432   1.00 0.00 ? 1103 ASP B CB   1  
ATOM 846   C CG   . ASP A 1 59 ? 1.711   19.339  4.869   1.00 0.00 ? 1103 ASP B CG   1  
ATOM 847   O OD1  . ASP A 1 59 ? 1.412   20.171  5.709   1.00 0.00 ? 1103 ASP B OD1  1  
ATOM 848   O OD2  . ASP A 1 59 ? 2.816   19.255  4.356   1.00 0.00 ? 1103 ASP B OD2  1  
ATOM 849   H H    . ASP A 1 59 ? 0.132   16.876  6.696   1.00 0.00 ? 1103 ASP B H    1  
ATOM 850   H HA   . ASP A 1 59 ? -0.832  19.425  5.546   1.00 0.00 ? 1103 ASP B HA   1  
ATOM 851   H HB2  . ASP A 1 59 ? 1.058   17.348  4.437   1.00 0.00 ? 1103 ASP B HB2  1  
ATOM 852   H HB3  . ASP A 1 59 ? 0.308   18.589  3.434   1.00 0.00 ? 1103 ASP B HB3  1  
ATOM 853   N N    . ILE A 1 60 ? -2.697  18.366  4.256   1.00 0.00 ? 1104 ILE B N    1  
ATOM 854   C CA   . ILE A 1 60 ? -3.858  17.751  3.643   1.00 0.00 ? 1104 ILE B CA   1  
ATOM 855   C C    . ILE A 1 60 ? -3.468  16.939  2.411   1.00 0.00 ? 1104 ILE B C    1  
ATOM 856   O O    . ILE A 1 60 ? -4.042  15.883  2.139   1.00 0.00 ? 1104 ILE B O    1  
ATOM 857   C CB   . ILE A 1 60 ? -4.848  18.843  3.252   1.00 0.00 ? 1104 ILE B CB   1  
ATOM 858   C CG1  . ILE A 1 60 ? -6.071  18.190  2.635   1.00 0.00 ? 1104 ILE B CG1  1  
ATOM 859   C CG2  . ILE A 1 60 ? -4.203  19.793  2.239   1.00 0.00 ? 1104 ILE B CG2  1  
ATOM 860   C CD1  . ILE A 1 60 ? -7.185  19.224  2.465   1.00 0.00 ? 1104 ILE B CD1  1  
ATOM 861   H H    . ILE A 1 60 ? -2.629  19.338  4.264   1.00 0.00 ? 1104 ILE B H    1  
ATOM 862   H HA   . ILE A 1 60 ? -4.330  17.097  4.359   1.00 0.00 ? 1104 ILE B HA   1  
ATOM 863   H HB   . ILE A 1 60 ? -5.139  19.398  4.131   1.00 0.00 ? 1104 ILE B HB   1  
ATOM 864   H HG12 . ILE A 1 60 ? -5.804  17.784  1.672   1.00 0.00 ? 1104 ILE B HG12 1  
ATOM 865   H HG13 . ILE A 1 60 ? -6.411  17.398  3.279   1.00 0.00 ? 1104 ILE B HG13 1  
ATOM 866   H HG21 . ILE A 1 60 ? -4.235  19.346  1.257   1.00 0.00 ? 1104 ILE B HG21 1  
ATOM 867   H HG22 . ILE A 1 60 ? -3.176  19.978  2.518   1.00 0.00 ? 1104 ILE B HG22 1  
ATOM 868   H HG23 . ILE A 1 60 ? -4.747  20.726  2.227   1.00 0.00 ? 1104 ILE B HG23 1  
ATOM 869   H HD11 . ILE A 1 60 ? -6.806  20.071  1.909   1.00 0.00 ? 1104 ILE B HD11 1  
ATOM 870   H HD12 . ILE A 1 60 ? -7.524  19.552  3.435   1.00 0.00 ? 1104 ILE B HD12 1  
ATOM 871   H HD13 . ILE A 1 60 ? -8.007  18.780  1.925   1.00 0.00 ? 1104 ILE B HD13 1  
ATOM 872   N N    . GLU A 1 61 ? -2.487  17.438  1.671   1.00 0.00 ? 1105 GLU B N    1  
ATOM 873   C CA   . GLU A 1 61 ? -2.024  16.758  0.466   1.00 0.00 ? 1105 GLU B CA   1  
ATOM 874   C C    . GLU A 1 61 ? -1.462  15.383  0.815   1.00 0.00 ? 1105 GLU B C    1  
ATOM 875   O O    . GLU A 1 61 ? -1.749  14.393  0.144   1.00 0.00 ? 1105 GLU B O    1  
ATOM 876   C CB   . GLU A 1 61 ? -0.937  17.597  -0.219  1.00 0.00 ? 1105 GLU B CB   1  
ATOM 877   C CG   . GLU A 1 61 ? -1.559  18.853  -0.835  1.00 0.00 ? 1105 GLU B CG   1  
ATOM 878   C CD   . GLU A 1 61 ? -0.465  19.781  -1.354  1.00 0.00 ? 1105 GLU B CD   1  
ATOM 879   O OE1  . GLU A 1 61 ? 0.692   19.522  -1.060  1.00 0.00 ? 1105 GLU B OE1  1  
ATOM 880   O OE2  . GLU A 1 61 ? -0.797  20.738  -2.032  1.00 0.00 ? 1105 GLU B OE2  1  
ATOM 881   H H    . GLU A 1 61 ? -2.073  18.276  1.938   1.00 0.00 ? 1105 GLU B H    1  
ATOM 882   H HA   . GLU A 1 61 ? -2.854  16.637  -0.212  1.00 0.00 ? 1105 GLU B HA   1  
ATOM 883   H HB2  . GLU A 1 61 ? -0.193  17.886  0.510   1.00 0.00 ? 1105 GLU B HB2  1  
ATOM 884   H HB3  . GLU A 1 61 ? -0.469  17.011  -0.997  1.00 0.00 ? 1105 GLU B HB3  1  
ATOM 885   H HG2  . GLU A 1 61 ? -2.203  18.568  -1.654  1.00 0.00 ? 1105 GLU B HG2  1  
ATOM 886   H HG3  . GLU A 1 61 ? -2.141  19.370  -0.087  1.00 0.00 ? 1105 GLU B HG3  1  
ATOM 887   N N    . LEU A 1 62 ? -0.672  15.326  1.879   1.00 0.00 ? 1106 LEU B N    1  
ATOM 888   C CA   . LEU A 1 62 ? -0.092  14.065  2.309   1.00 0.00 ? 1106 LEU B CA   1  
ATOM 889   C C    . LEU A 1 62 ? -1.186  13.110  2.771   1.00 0.00 ? 1106 LEU B C    1  
ATOM 890   O O    . LEU A 1 62 ? -1.129  11.907  2.513   1.00 0.00 ? 1106 LEU B O    1  
ATOM 891   C CB   . LEU A 1 62 ? 0.904   14.306  3.441   1.00 0.00 ? 1106 LEU B CB   1  
ATOM 892   C CG   . LEU A 1 62 ? 1.593   12.992  3.788   1.00 0.00 ? 1106 LEU B CG   1  
ATOM 893   C CD1  . LEU A 1 62 ? 3.066   13.255  4.108   1.00 0.00 ? 1106 LEU B CD1  1  
ATOM 894   C CD2  . LEU A 1 62 ? 0.913   12.377  5.008   1.00 0.00 ? 1106 LEU B CD2  1  
ATOM 895   H H    . LEU A 1 62 ? -0.479  16.139  2.387   1.00 0.00 ? 1106 LEU B H    1  
ATOM 896   H HA   . LEU A 1 62 ? 0.430   13.621  1.475   1.00 0.00 ? 1106 LEU B HA   1  
ATOM 897   H HB2  . LEU A 1 62 ? 1.642   15.031  3.125   1.00 0.00 ? 1106 LEU B HB2  1  
ATOM 898   H HB3  . LEU A 1 62 ? 0.383   14.679  4.310   1.00 0.00 ? 1106 LEU B HB3  1  
ATOM 899   H HG   . LEU A 1 62 ? 1.515   12.315  2.947   1.00 0.00 ? 1106 LEU B HG   1  
ATOM 900   H HD11 . LEU A 1 62 ? 3.448   14.021  3.451   1.00 0.00 ? 1106 LEU B HD11 1  
ATOM 901   H HD12 . LEU A 1 62 ? 3.634   12.346  3.973   1.00 0.00 ? 1106 LEU B HD12 1  
ATOM 902   H HD13 . LEU A 1 62 ? 3.157   13.585  5.133   1.00 0.00 ? 1106 LEU B HD13 1  
ATOM 903   H HD21 . LEU A 1 62 ? 0.985   11.302  4.958   1.00 0.00 ? 1106 LEU B HD21 1  
ATOM 904   H HD22 . LEU A 1 62 ? -0.128  12.669  5.022   1.00 0.00 ? 1106 LEU B HD22 1  
ATOM 905   H HD23 . LEU A 1 62 ? 1.399   12.730  5.904   1.00 0.00 ? 1106 LEU B HD23 1  
ATOM 906   N N    . LEU A 1 63 ? -2.179  13.656  3.465   1.00 0.00 ? 1107 LEU B N    1  
ATOM 907   C CA   . LEU A 1 63 ? -3.283  12.851  3.971   1.00 0.00 ? 1107 LEU B CA   1  
ATOM 908   C C    . LEU A 1 63 ? -4.014  12.190  2.811   1.00 0.00 ? 1107 LEU B C    1  
ATOM 909   O O    . LEU A 1 63 ? -4.346  11.005  2.863   1.00 0.00 ? 1107 LEU B O    1  
ATOM 910   C CB   . LEU A 1 63 ? -4.256  13.749  4.748   1.00 0.00 ? 1107 LEU B CB   1  
ATOM 911   C CG   . LEU A 1 63 ? -3.598  14.206  6.051   1.00 0.00 ? 1107 LEU B CG   1  
ATOM 912   C CD1  . LEU A 1 63 ? -4.401  15.359  6.655   1.00 0.00 ? 1107 LEU B CD1  1  
ATOM 913   C CD2  . LEU A 1 63 ? -3.563  13.041  7.041   1.00 0.00 ? 1107 LEU B CD2  1  
ATOM 914   H H    . LEU A 1 63 ? -2.164  14.618  3.642   1.00 0.00 ? 1107 LEU B H    1  
ATOM 915   H HA   . LEU A 1 63 ? -2.896  12.090  4.630   1.00 0.00 ? 1107 LEU B HA   1  
ATOM 916   H HB2  . LEU A 1 63 ? -4.507  14.612  4.147   1.00 0.00 ? 1107 LEU B HB2  1  
ATOM 917   H HB3  . LEU A 1 63 ? -5.155  13.195  4.975   1.00 0.00 ? 1107 LEU B HB3  1  
ATOM 918   H HG   . LEU A 1 63 ? -2.594  14.537  5.847   1.00 0.00 ? 1107 LEU B HG   1  
ATOM 919   H HD11 . LEU A 1 63 ? -4.029  16.296  6.264   1.00 0.00 ? 1107 LEU B HD11 1  
ATOM 920   H HD12 . LEU A 1 63 ? -4.292  15.347  7.730   1.00 0.00 ? 1107 LEU B HD12 1  
ATOM 921   H HD13 . LEU A 1 63 ? -5.443  15.248  6.397   1.00 0.00 ? 1107 LEU B HD13 1  
ATOM 922   H HD21 . LEU A 1 63 ? -2.747  12.380  6.792   1.00 0.00 ? 1107 LEU B HD21 1  
ATOM 923   H HD22 . LEU A 1 63 ? -4.495  12.496  6.991   1.00 0.00 ? 1107 LEU B HD22 1  
ATOM 924   H HD23 . LEU A 1 63 ? -3.424  13.423  8.042   1.00 0.00 ? 1107 LEU B HD23 1  
ATOM 925   N N    . ALA A 1 64 ? -4.236  12.962  1.760   1.00 0.00 ? 1108 ALA B N    1  
ATOM 926   C CA   . ALA A 1 64 ? -4.900  12.448  0.575   1.00 0.00 ? 1108 ALA B CA   1  
ATOM 927   C C    . ALA A 1 64 ? -4.049  11.367  -0.083  1.00 0.00 ? 1108 ALA B C    1  
ATOM 928   O O    . ALA A 1 64 ? -4.572  10.379  -0.598  1.00 0.00 ? 1108 ALA B O    1  
ATOM 929   C CB   . ALA A 1 64 ? -5.163  13.586  -0.420  1.00 0.00 ? 1108 ALA B CB   1  
ATOM 930   H H    . ALA A 1 64 ? -3.934  13.893  1.776   1.00 0.00 ? 1108 ALA B H    1  
ATOM 931   H HA   . ALA A 1 64 ? -5.844  12.017  0.867   1.00 0.00 ? 1108 ALA B HA   1  
ATOM 932   H HB1  . ALA A 1 64 ? -4.607  14.467  -0.121  1.00 0.00 ? 1108 ALA B HB1  1  
ATOM 933   H HB2  . ALA A 1 64 ? -6.219  13.813  -0.435  1.00 0.00 ? 1108 ALA B HB2  1  
ATOM 934   H HB3  . ALA A 1 64 ? -4.850  13.279  -1.409  1.00 0.00 ? 1108 ALA B HB3  1  
ATOM 935   N N    . ALA A 1 65 ? -2.737  11.569  -0.071  1.00 0.00 ? 1109 ALA B N    1  
ATOM 936   C CA   . ALA A 1 65 ? -1.821  10.617  -0.679  1.00 0.00 ? 1109 ALA B CA   1  
ATOM 937   C C    . ALA A 1 65 ? -1.909  9.263   0.014   1.00 0.00 ? 1109 ALA B C    1  
ATOM 938   O O    . ALA A 1 65 ? -1.939  8.219   -0.637  1.00 0.00 ? 1109 ALA B O    1  
ATOM 939   C CB   . ALA A 1 65 ? -0.388  11.156  -0.589  1.00 0.00 ? 1109 ALA B CB   1  
ATOM 940   H H    . ALA A 1 65 ? -2.376  12.370  0.359   1.00 0.00 ? 1109 ALA B H    1  
ATOM 941   H HA   . ALA A 1 65 ? -2.079  10.495  -1.720  1.00 0.00 ? 1109 ALA B HA   1  
ATOM 942   H HB1  . ALA A 1 65 ? -0.398  12.226  -0.745  1.00 0.00 ? 1109 ALA B HB1  1  
ATOM 943   H HB2  . ALA A 1 65 ? 0.225   10.688  -1.347  1.00 0.00 ? 1109 ALA B HB2  1  
ATOM 944   H HB3  . ALA A 1 65 ? 0.018   10.941  0.387   1.00 0.00 ? 1109 ALA B HB3  1  
ATOM 945   N N    . CYS A 1 66 ? -1.955  9.293   1.337   1.00 0.00 ? 1110 CYS B N    1  
ATOM 946   C CA   . CYS A 1 66 ? -2.043  8.063   2.109   1.00 0.00 ? 1110 CYS B CA   1  
ATOM 947   C C    . CYS A 1 66 ? -3.373  7.377   1.851   1.00 0.00 ? 1110 CYS B C    1  
ATOM 948   O O    . CYS A 1 66 ? -3.440  6.155   1.725   1.00 0.00 ? 1110 CYS B O    1  
ATOM 949   C CB   . CYS A 1 66 ? -1.894  8.382   3.593   1.00 0.00 ? 1110 CYS B CB   1  
ATOM 950   S SG   . CYS A 1 66 ? -0.201  8.936   3.853   1.00 0.00 ? 1110 CYS B SG   1  
ATOM 951   H H    . CYS A 1 66 ? -1.926  10.155  1.802   1.00 0.00 ? 1110 CYS B H    1  
ATOM 952   H HA   . CYS A 1 66 ? -1.244  7.404   1.810   1.00 0.00 ? 1110 CYS B HA   1  
ATOM 953   H HB2  . CYS A 1 66 ? -2.587  9.161   3.875   1.00 0.00 ? 1110 CYS B HB2  1  
ATOM 954   H HB3  . CYS A 1 66 ? -2.082  7.492   4.179   1.00 0.00 ? 1110 CYS B HB3  1  
ATOM 955   H HG   . CYS A 1 66 ? 0.075   9.368   3.038   1.00 0.00 ? 1110 CYS B HG   1  
ATOM 956   N N    . ARG A 1 67 ? -4.427  8.179   1.767   1.00 0.00 ? 1111 ARG B N    1  
ATOM 957   C CA   . ARG A 1 67 ? -5.756  7.648   1.513   1.00 0.00 ? 1111 ARG B CA   1  
ATOM 958   C C    . ARG A 1 67 ? -5.795  6.946   0.166   1.00 0.00 ? 1111 ARG B C    1  
ATOM 959   O O    . ARG A 1 67 ? -6.384  5.874   0.028   1.00 0.00 ? 1111 ARG B O    1  
ATOM 960   C CB   . ARG A 1 67 ? -6.771  8.790   1.538   1.00 0.00 ? 1111 ARG B CB   1  
ATOM 961   C CG   . ARG A 1 67 ? -6.970  9.263   2.979   1.00 0.00 ? 1111 ARG B CG   1  
ATOM 962   C CD   . ARG A 1 67 ? -7.808  10.541  2.973   1.00 0.00 ? 1111 ARG B CD   1  
ATOM 963   N NE   . ARG A 1 67 ? -8.074  10.985  4.337   1.00 0.00 ? 1111 ARG B NE   1  
ATOM 964   C CZ   . ARG A 1 67 ? -8.621  12.177  4.593   1.00 0.00 ? 1111 ARG B CZ   1  
ATOM 965   N NH1  . ARG A 1 67 ? -8.941  12.993  3.618   1.00 0.00 ? 1111 ARG B NH1  1  
ATOM 966   N NH2  . ARG A 1 67 ? -8.839  12.537  5.829   1.00 0.00 ? 1111 ARG B NH2  1  
ATOM 967   H H    . ARG A 1 67 ? -4.308  9.146   1.872   1.00 0.00 ? 1111 ARG B H    1  
ATOM 968   H HA   . ARG A 1 67 ? -6.005  6.940   2.287   1.00 0.00 ? 1111 ARG B HA   1  
ATOM 969   H HB2  . ARG A 1 67 ? -6.395  9.616   0.939   1.00 0.00 ? 1111 ARG B HB2  1  
ATOM 970   H HB3  . ARG A 1 67 ? -7.714  8.450   1.136   1.00 0.00 ? 1111 ARG B HB3  1  
ATOM 971   H HG2  . ARG A 1 67 ? -7.483  8.496   3.543   1.00 0.00 ? 1111 ARG B HG2  1  
ATOM 972   H HG3  . ARG A 1 67 ? -6.012  9.464   3.431   1.00 0.00 ? 1111 ARG B HG3  1  
ATOM 973   H HD2  . ARG A 1 67 ? -7.271  11.311  2.443   1.00 0.00 ? 1111 ARG B HD2  1  
ATOM 974   H HD3  . ARG A 1 67 ? -8.743  10.346  2.468   1.00 0.00 ? 1111 ARG B HD3  1  
ATOM 975   H HE   . ARG A 1 67 ? -7.848  10.393  5.086   1.00 0.00 ? 1111 ARG B HE   1  
ATOM 976   H HH11 . ARG A 1 67 ? -8.780  12.732  2.669   1.00 0.00 ? 1111 ARG B HH11 1  
ATOM 977   H HH12 . ARG A 1 67 ? -9.348  13.881  3.827   1.00 0.00 ? 1111 ARG B HH12 1  
ATOM 978   H HH21 . ARG A 1 67 ? -8.598  11.922  6.579   1.00 0.00 ? 1111 ARG B HH21 1  
ATOM 979   H HH22 . ARG A 1 67 ? -9.247  13.430  6.024   1.00 0.00 ? 1111 ARG B HH22 1  
ATOM 980   N N    . GLU A 1 68 ? -5.148  7.549   -0.820  1.00 0.00 ? 1112 GLU B N    1  
ATOM 981   C CA   . GLU A 1 68 ? -5.095  6.966   -2.152  1.00 0.00 ? 1112 GLU B CA   1  
ATOM 982   C C    . GLU A 1 68 ? -4.346  5.640   -2.127  1.00 0.00 ? 1112 GLU B C    1  
ATOM 983   O O    . GLU A 1 68 ? -4.763  4.674   -2.766  1.00 0.00 ? 1112 GLU B O    1  
ATOM 984   C CB   . GLU A 1 68 ? -4.385  7.917   -3.107  1.00 0.00 ? 1112 GLU B CB   1  
ATOM 985   C CG   . GLU A 1 68 ? -5.274  9.130   -3.371  1.00 0.00 ? 1112 GLU B CG   1  
ATOM 986   C CD   . GLU A 1 68 ? -4.480  10.208  -4.104  1.00 0.00 ? 1112 GLU B CD   1  
ATOM 987   O OE1  . GLU A 1 68 ? -3.262  10.146  -4.067  1.00 0.00 ? 1112 GLU B OE1  1  
ATOM 988   O OE2  . GLU A 1 68 ? -5.101  11.081  -4.689  1.00 0.00 ? 1112 GLU B OE2  1  
ATOM 989   H H    . GLU A 1 68 ? -4.691  8.400   -0.646  1.00 0.00 ? 1112 GLU B H    1  
ATOM 990   H HA   . GLU A 1 68 ? -6.100  6.799   -2.506  1.00 0.00 ? 1112 GLU B HA   1  
ATOM 991   H HB2  . GLU A 1 68 ? -3.451  8.237   -2.666  1.00 0.00 ? 1112 GLU B HB2  1  
ATOM 992   H HB3  . GLU A 1 68 ? -4.187  7.407   -4.038  1.00 0.00 ? 1112 GLU B HB3  1  
ATOM 993   H HG2  . GLU A 1 68 ? -6.115  8.830   -3.980  1.00 0.00 ? 1112 GLU B HG2  1  
ATOM 994   H HG3  . GLU A 1 68 ? -5.632  9.521   -2.434  1.00 0.00 ? 1112 GLU B HG3  1  
ATOM 995   N N    . GLU A 1 69 ? -3.237  5.596   -1.387  1.00 0.00 ? 1113 GLU B N    1  
ATOM 996   C CA   . GLU A 1 69 ? -2.454  4.375   -1.301  1.00 0.00 ? 1113 GLU B CA   1  
ATOM 997   C C    . GLU A 1 69 ? -3.267  3.271   -0.641  1.00 0.00 ? 1113 GLU B C    1  
ATOM 998   O O    . GLU A 1 69 ? -3.223  2.117   -1.062  1.00 0.00 ? 1113 GLU B O    1  
ATOM 999   C CB   . GLU A 1 69 ? -1.173  4.629   -0.504  1.00 0.00 ? 1113 GLU B CB   1  
ATOM 1000  C CG   . GLU A 1 69 ? -0.355  3.340   -0.423  1.00 0.00 ? 1113 GLU B CG   1  
ATOM 1001  C CD   . GLU A 1 69 ? 0.010   2.864   -1.825  1.00 0.00 ? 1113 GLU B CD   1  
ATOM 1002  O OE1  . GLU A 1 69 ? 0.135   3.705   -2.702  1.00 0.00 ? 1113 GLU B OE1  1  
ATOM 1003  O OE2  . GLU A 1 69 ? 0.143   1.666   -2.006  1.00 0.00 ? 1113 GLU B OE2  1  
ATOM 1004  H H    . GLU A 1 69 ? -2.943  6.396   -0.891  1.00 0.00 ? 1113 GLU B H    1  
ATOM 1005  H HA   . GLU A 1 69 ? -2.186  4.059   -2.298  1.00 0.00 ? 1113 GLU B HA   1  
ATOM 1006  H HB2  . GLU A 1 69 ? -0.592  5.395   -0.997  1.00 0.00 ? 1113 GLU B HB2  1  
ATOM 1007  H HB3  . GLU A 1 69 ? -1.427  4.956   0.493   1.00 0.00 ? 1113 GLU B HB3  1  
ATOM 1008  H HG2  . GLU A 1 69 ? 0.551   3.526   0.137   1.00 0.00 ? 1113 GLU B HG2  1  
ATOM 1009  H HG3  . GLU A 1 69 ? -0.934  2.576   0.075   1.00 0.00 ? 1113 GLU B HG3  1  
ATOM 1010  N N    . PHE A 1 70 ? -4.007  3.635   0.394   1.00 0.00 ? 1114 PHE B N    1  
ATOM 1011  C CA   . PHE A 1 70 ? -4.824  2.666   1.109   1.00 0.00 ? 1114 PHE B CA   1  
ATOM 1012  C C    . PHE A 1 70 ? -5.902  2.090   0.196   1.00 0.00 ? 1114 PHE B C    1  
ATOM 1013  O O    . PHE A 1 70 ? -6.134  0.886   0.187   1.00 0.00 ? 1114 PHE B O    1  
ATOM 1014  C CB   . PHE A 1 70 ? -5.483  3.327   2.322   1.00 0.00 ? 1114 PHE B CB   1  
ATOM 1015  C CG   . PHE A 1 70 ? -4.538  3.297   3.508   1.00 0.00 ? 1114 PHE B CG   1  
ATOM 1016  C CD1  . PHE A 1 70 ? -3.150  3.349   3.312   1.00 0.00 ? 1114 PHE B CD1  1  
ATOM 1017  C CD2  . PHE A 1 70 ? -5.054  3.208   4.808   1.00 0.00 ? 1114 PHE B CD2  1  
ATOM 1018  C CE1  . PHE A 1 70 ? -2.282  3.312   4.414   1.00 0.00 ? 1114 PHE B CE1  1  
ATOM 1019  C CE2  . PHE A 1 70 ? -4.186  3.172   5.908   1.00 0.00 ? 1114 PHE B CE2  1  
ATOM 1020  C CZ   . PHE A 1 70 ? -2.801  3.223   5.711   1.00 0.00 ? 1114 PHE B CZ   1  
ATOM 1021  H H    . PHE A 1 70 ? -4.003  4.569   0.681   1.00 0.00 ? 1114 PHE B H    1  
ATOM 1022  H HA   . PHE A 1 70 ? -4.195  1.860   1.450   1.00 0.00 ? 1114 PHE B HA   1  
ATOM 1023  H HB2  . PHE A 1 70 ? -5.725  4.353   2.082   1.00 0.00 ? 1114 PHE B HB2  1  
ATOM 1024  H HB3  . PHE A 1 70 ? -6.387  2.793   2.570   1.00 0.00 ? 1114 PHE B HB3  1  
ATOM 1025  H HD1  . PHE A 1 70 ? -2.747  3.417   2.311   1.00 0.00 ? 1114 PHE B HD1  1  
ATOM 1026  H HD2  . PHE A 1 70 ? -6.122  3.170   4.963   1.00 0.00 ? 1114 PHE B HD2  1  
ATOM 1027  H HE1  . PHE A 1 70 ? -1.211  3.350   4.265   1.00 0.00 ? 1114 PHE B HE1  1  
ATOM 1028  H HE2  . PHE A 1 70 ? -4.585  3.103   6.909   1.00 0.00 ? 1114 PHE B HE2  1  
ATOM 1029  H HZ   . PHE A 1 70 ? -2.133  3.192   6.559   1.00 0.00 ? 1114 PHE B HZ   1  
ATOM 1030  N N    . HIS A 1 71 ? -6.556  2.952   -0.572  1.00 0.00 ? 1115 HIS B N    1  
ATOM 1031  C CA   . HIS A 1 71 ? -7.599  2.509   -1.479  1.00 0.00 ? 1115 HIS B CA   1  
ATOM 1032  C C    . HIS A 1 71 ? -7.027  1.557   -2.526  1.00 0.00 ? 1115 HIS B C    1  
ATOM 1033  O O    . HIS A 1 71 ? -7.592  0.495   -2.789  1.00 0.00 ? 1115 HIS B O    1  
ATOM 1034  C CB   . HIS A 1 71 ? -8.220  3.723   -2.170  1.00 0.00 ? 1115 HIS B CB   1  
ATOM 1035  C CG   . HIS A 1 71 ? -9.441  3.290   -2.917  1.00 0.00 ? 1115 HIS B CG   1  
ATOM 1036  N ND1  . HIS A 1 71 ? -10.057 4.085   -3.872  1.00 0.00 ? 1115 HIS B ND1  1  
ATOM 1037  C CD2  . HIS A 1 71 ? -10.180 2.143   -2.845  1.00 0.00 ? 1115 HIS B CD2  1  
ATOM 1038  C CE1  . HIS A 1 71 ? -11.123 3.405   -4.333  1.00 0.00 ? 1115 HIS B CE1  1  
ATOM 1039  N NE2  . HIS A 1 71 ? -11.245 2.213   -3.740  1.00 0.00 ? 1115 HIS B NE2  1  
ATOM 1040  H H    . HIS A 1 71 ? -6.336  3.901   -0.530  1.00 0.00 ? 1115 HIS B H    1  
ATOM 1041  H HA   . HIS A 1 71 ? -8.364  1.997   -0.914  1.00 0.00 ? 1115 HIS B HA   1  
ATOM 1042  H HB2  . HIS A 1 71 ? -8.492  4.460   -1.429  1.00 0.00 ? 1115 HIS B HB2  1  
ATOM 1043  H HB3  . HIS A 1 71 ? -7.507  4.147   -2.860  1.00 0.00 ? 1115 HIS B HB3  1  
ATOM 1044  H HD1  . HIS A 1 71 ? -9.770  4.978   -4.157  1.00 0.00 ? 1115 HIS B HD1  1  
ATOM 1045  H HD2  . HIS A 1 71 ? -9.965  1.316   -2.187  1.00 0.00 ? 1115 HIS B HD2  1  
ATOM 1046  H HE1  . HIS A 1 71 ? -11.800 3.778   -5.087  1.00 0.00 ? 1115 HIS B HE1  1  
ATOM 1047  N N    . ARG A 1 72 ? -5.900  1.942   -3.119  1.00 0.00 ? 1116 ARG B N    1  
ATOM 1048  C CA   . ARG A 1 72 ? -5.266  1.114   -4.139  1.00 0.00 ? 1116 ARG B CA   1  
ATOM 1049  C C    . ARG A 1 72 ? -4.815  -0.216  -3.548  1.00 0.00 ? 1116 ARG B C    1  
ATOM 1050  O O    . ARG A 1 72 ? -4.999  -1.272  -4.155  1.00 0.00 ? 1116 ARG B O    1  
ATOM 1051  C CB   . ARG A 1 72 ? -4.057  1.849   -4.723  1.00 0.00 ? 1116 ARG B CB   1  
ATOM 1052  C CG   . ARG A 1 72 ? -4.516  3.094   -5.488  1.00 0.00 ? 1116 ARG B CG   1  
ATOM 1053  C CD   . ARG A 1 72 ? -5.242  2.669   -6.766  1.00 0.00 ? 1116 ARG B CD   1  
ATOM 1054  N NE   . ARG A 1 72 ? -5.494  3.823   -7.619  1.00 0.00 ? 1116 ARG B NE   1  
ATOM 1055  C CZ   . ARG A 1 72 ? -6.147  3.703   -8.775  1.00 0.00 ? 1116 ARG B CZ   1  
ATOM 1056  N NH1  . ARG A 1 72 ? -6.587  2.536   -9.180  1.00 0.00 ? 1116 ARG B NH1  1  
ATOM 1057  N NH2  . ARG A 1 72 ? -6.350  4.757   -9.515  1.00 0.00 ? 1116 ARG B NH2  1  
ATOM 1058  H H    . ARG A 1 72 ? -5.491  2.796   -2.869  1.00 0.00 ? 1116 ARG B H    1  
ATOM 1059  H HA   . ARG A 1 72 ? -5.975  0.922   -4.927  1.00 0.00 ? 1116 ARG B HA   1  
ATOM 1060  H HB2  . ARG A 1 72 ? -3.397  2.144   -3.918  1.00 0.00 ? 1116 ARG B HB2  1  
ATOM 1061  H HB3  . ARG A 1 72 ? -3.530  1.190   -5.395  1.00 0.00 ? 1116 ARG B HB3  1  
ATOM 1062  H HG2  . ARG A 1 72 ? -5.185  3.672   -4.867  1.00 0.00 ? 1116 ARG B HG2  1  
ATOM 1063  H HG3  . ARG A 1 72 ? -3.657  3.693   -5.747  1.00 0.00 ? 1116 ARG B HG3  1  
ATOM 1064  H HD2  . ARG A 1 72 ? -4.634  1.959   -7.301  1.00 0.00 ? 1116 ARG B HD2  1  
ATOM 1065  H HD3  . ARG A 1 72 ? -6.182  2.209   -6.505  1.00 0.00 ? 1116 ARG B HD3  1  
ATOM 1066  H HE   . ARG A 1 72 ? -5.175  4.707   -7.337  1.00 0.00 ? 1116 ARG B HE   1  
ATOM 1067  H HH11 . ARG A 1 72 ? -6.440  1.719   -8.627  1.00 0.00 ? 1116 ARG B HH11 1  
ATOM 1068  H HH12 . ARG A 1 72 ? -7.074  2.463   -10.051 1.00 0.00 ? 1116 ARG B HH12 1  
ATOM 1069  H HH21 . ARG A 1 72 ? -6.018  5.649   -9.214  1.00 0.00 ? 1116 ARG B HH21 1  
ATOM 1070  H HH22 . ARG A 1 72 ? -6.838  4.672   -10.382 1.00 0.00 ? 1116 ARG B HH22 1  
ATOM 1071  N N    . ARG A 1 73 ? -4.236  -0.160  -2.354  1.00 0.00 ? 1117 ARG B N    1  
ATOM 1072  C CA   . ARG A 1 73 ? -3.779  -1.369  -1.689  1.00 0.00 ? 1117 ARG B CA   1  
ATOM 1073  C C    . ARG A 1 73 ? -4.953  -2.281  -1.369  1.00 0.00 ? 1117 ARG B C    1  
ATOM 1074  O O    . ARG A 1 73 ? -4.880  -3.495  -1.565  1.00 0.00 ? 1117 ARG B O    1  
ATOM 1075  C CB   . ARG A 1 73 ? -3.023  -1.010  -0.410  1.00 0.00 ? 1117 ARG B CB   1  
ATOM 1076  C CG   . ARG A 1 73 ? -1.620  -0.519  -0.771  1.00 0.00 ? 1117 ARG B CG   1  
ATOM 1077  C CD   . ARG A 1 73 ? -0.803  -0.372  0.511   1.00 0.00 ? 1117 ARG B CD   1  
ATOM 1078  N NE   . ARG A 1 73 ? 0.599   -0.124  0.202   1.00 0.00 ? 1117 ARG B NE   1  
ATOM 1079  C CZ   . ARG A 1 73 ? 1.552   -0.297  1.118   1.00 0.00 ? 1117 ARG B CZ   1  
ATOM 1080  N NH1  . ARG A 1 73 ? 1.259   -0.689  2.334   1.00 0.00 ? 1117 ARG B NH1  1  
ATOM 1081  N NH2  . ARG A 1 73 ? 2.792   -0.082  0.792   1.00 0.00 ? 1117 ARG B NH2  1  
ATOM 1082  H H    . ARG A 1 73 ? -4.125  0.706   -1.911  1.00 0.00 ? 1117 ARG B H    1  
ATOM 1083  H HA   . ARG A 1 73 ? -3.106  -1.892  -2.350  1.00 0.00 ? 1117 ARG B HA   1  
ATOM 1084  H HB2  . ARG A 1 73 ? -3.553  -0.222  0.115   1.00 0.00 ? 1117 ARG B HB2  1  
ATOM 1085  H HB3  . ARG A 1 73 ? -2.946  -1.881  0.225   1.00 0.00 ? 1117 ARG B HB3  1  
ATOM 1086  H HG2  . ARG A 1 73 ? -1.145  -1.236  -1.426  1.00 0.00 ? 1117 ARG B HG2  1  
ATOM 1087  H HG3  . ARG A 1 73 ? -1.687  0.435   -1.268  1.00 0.00 ? 1117 ARG B HG3  1  
ATOM 1088  H HD2  . ARG A 1 73 ? -1.190  0.455   1.085   1.00 0.00 ? 1117 ARG B HD2  1  
ATOM 1089  H HD3  . ARG A 1 73 ? -0.889  -1.278  1.092   1.00 0.00 ? 1117 ARG B HD3  1  
ATOM 1090  H HE   . ARG A 1 73 ? 0.850   0.185   -0.697  1.00 0.00 ? 1117 ARG B HE   1  
ATOM 1091  H HH11 . ARG A 1 73 ? 0.313   -0.865  2.595   1.00 0.00 ? 1117 ARG B HH11 1  
ATOM 1092  H HH12 . ARG A 1 73 ? 1.990   -0.815  3.005   1.00 0.00 ? 1117 ARG B HH12 1  
ATOM 1093  H HH21 . ARG A 1 73 ? 3.021   0.208   -0.133  1.00 0.00 ? 1117 ARG B HH21 1  
ATOM 1094  H HH22 . ARG A 1 73 ? 3.516   -0.211  1.470   1.00 0.00 ? 1117 ARG B HH22 1  
ATOM 1095  N N    . LEU A 1 74 ? -6.043  -1.693  -0.893  1.00 0.00 ? 1118 LEU B N    1  
ATOM 1096  C CA   . LEU A 1 74 ? -7.231  -2.471  -0.569  1.00 0.00 ? 1118 LEU B CA   1  
ATOM 1097  C C    . LEU A 1 74 ? -7.811  -3.120  -1.822  1.00 0.00 ? 1118 LEU B C    1  
ATOM 1098  O O    . LEU A 1 74 ? -8.251  -4.268  -1.786  1.00 0.00 ? 1118 LEU B O    1  
ATOM 1099  C CB   . LEU A 1 74 ? -8.280  -1.570  0.081   1.00 0.00 ? 1118 LEU B CB   1  
ATOM 1100  C CG   . LEU A 1 74 ? -7.827  -1.195  1.492   1.00 0.00 ? 1118 LEU B CG   1  
ATOM 1101  C CD1  . LEU A 1 74 ? -8.700  -0.057  2.023   1.00 0.00 ? 1118 LEU B CD1  1  
ATOM 1102  C CD2  . LEU A 1 74 ? -7.974  -2.413  2.405   1.00 0.00 ? 1118 LEU B CD2  1  
ATOM 1103  H H    . LEU A 1 74 ? -6.054  -0.722  -0.765  1.00 0.00 ? 1118 LEU B H    1  
ATOM 1104  H HA   . LEU A 1 74 ? -6.958  -3.247  0.128   1.00 0.00 ? 1118 LEU B HA   1  
ATOM 1105  H HB2  . LEU A 1 74 ? -8.400  -0.674  -0.511  1.00 0.00 ? 1118 LEU B HB2  1  
ATOM 1106  H HB3  . LEU A 1 74 ? -9.221  -2.095  0.135   1.00 0.00 ? 1118 LEU B HB3  1  
ATOM 1107  H HG   . LEU A 1 74 ? -6.793  -0.882  1.472   1.00 0.00 ? 1118 LEU B HG   1  
ATOM 1108  H HD11 . LEU A 1 74 ? -9.618  -0.015  1.457   1.00 0.00 ? 1118 LEU B HD11 1  
ATOM 1109  H HD12 . LEU A 1 74 ? -8.172  0.880   1.920   1.00 0.00 ? 1118 LEU B HD12 1  
ATOM 1110  H HD13 . LEU A 1 74 ? -8.924  -0.230  3.064   1.00 0.00 ? 1118 LEU B HD13 1  
ATOM 1111  H HD21 . LEU A 1 74 ? -8.496  -2.126  3.306   1.00 0.00 ? 1118 LEU B HD21 1  
ATOM 1112  H HD22 . LEU A 1 74 ? -6.997  -2.793  2.661   1.00 0.00 ? 1118 LEU B HD22 1  
ATOM 1113  H HD23 . LEU A 1 74 ? -8.537  -3.179  1.893   1.00 0.00 ? 1118 LEU B HD23 1  
ATOM 1114  N N    . LYS A 1 75 ? -7.813  -2.381  -2.926  1.00 0.00 ? 1119 LYS B N    1  
ATOM 1115  C CA   . LYS A 1 75 ? -8.348  -2.899  -4.173  1.00 0.00 ? 1119 LYS B CA   1  
ATOM 1116  C C    . LYS A 1 75 ? -7.567  -4.128  -4.622  1.00 0.00 ? 1119 LYS B C    1  
ATOM 1117  O O    . LYS A 1 75 ? -8.149  -5.138  -5.016  1.00 0.00 ? 1119 LYS B O    1  
ATOM 1118  C CB   . LYS A 1 75 ? -8.259  -1.821  -5.250  1.00 0.00 ? 1119 LYS B CB   1  
ATOM 1119  C CG   . LYS A 1 75 ? -8.875  -2.329  -6.555  1.00 0.00 ? 1119 LYS B CG   1  
ATOM 1120  C CD   . LYS A 1 75 ? -10.380 -2.537  -6.363  1.00 0.00 ? 1119 LYS B CD   1  
ATOM 1121  C CE   . LYS A 1 75 ? -11.013 -2.901  -7.697  1.00 0.00 ? 1119 LYS B CE   1  
ATOM 1122  N NZ   . LYS A 1 75 ? -12.478 -3.111  -7.510  1.00 0.00 ? 1119 LYS B NZ   1  
ATOM 1123  H H    . LYS A 1 75 ? -7.457  -1.471  -2.903  1.00 0.00 ? 1119 LYS B H    1  
ATOM 1124  H HA   . LYS A 1 75 ? -9.380  -3.167  -4.023  1.00 0.00 ? 1119 LYS B HA   1  
ATOM 1125  H HB2  . LYS A 1 75 ? -8.790  -0.940  -4.921  1.00 0.00 ? 1119 LYS B HB2  1  
ATOM 1126  H HB3  . LYS A 1 75 ? -7.222  -1.574  -5.420  1.00 0.00 ? 1119 LYS B HB3  1  
ATOM 1127  H HG2  . LYS A 1 75 ? -8.711  -1.602  -7.338  1.00 0.00 ? 1119 LYS B HG2  1  
ATOM 1128  H HG3  . LYS A 1 75 ? -8.417  -3.266  -6.833  1.00 0.00 ? 1119 LYS B HG3  1  
ATOM 1129  H HD2  . LYS A 1 75 ? -10.549 -3.338  -5.661  1.00 0.00 ? 1119 LYS B HD2  1  
ATOM 1130  H HD3  . LYS A 1 75 ? -10.826 -1.628  -5.989  1.00 0.00 ? 1119 LYS B HD3  1  
ATOM 1131  H HE2  . LYS A 1 75 ? -10.846 -2.100  -8.400  1.00 0.00 ? 1119 LYS B HE2  1  
ATOM 1132  H HE3  . LYS A 1 75 ? -10.563 -3.808  -8.068  1.00 0.00 ? 1119 LYS B HE3  1  
ATOM 1133  H HZ1  . LYS A 1 75 ? -12.885 -2.290  -7.015  1.00 0.00 ? 1119 LYS B HZ1  1  
ATOM 1134  H HZ2  . LYS A 1 75 ? -12.634 -3.970  -6.943  1.00 0.00 ? 1119 LYS B HZ2  1  
ATOM 1135  H HZ3  . LYS A 1 75 ? -12.936 -3.216  -8.436  1.00 0.00 ? 1119 LYS B HZ3  1  
ATOM 1136  N N    . VAL A 1 76 ? -6.244  -4.033  -4.558  1.00 0.00 ? 1120 VAL B N    1  
ATOM 1137  C CA   . VAL A 1 76 ? -5.391  -5.141  -4.961  1.00 0.00 ? 1120 VAL B CA   1  
ATOM 1138  C C    . VAL A 1 76 ? -5.637  -6.343  -4.060  1.00 0.00 ? 1120 VAL B C    1  
ATOM 1139  O O    . VAL A 1 76 ? -5.679  -7.484  -4.520  1.00 0.00 ? 1120 VAL B O    1  
ATOM 1140  C CB   . VAL A 1 76 ? -3.921  -4.727  -4.885  1.00 0.00 ? 1120 VAL B CB   1  
ATOM 1141  C CG1  . VAL A 1 76 ? -3.035  -5.953  -5.106  1.00 0.00 ? 1120 VAL B CG1  1  
ATOM 1142  C CG2  . VAL A 1 76 ? -3.629  -3.683  -5.965  1.00 0.00 ? 1120 VAL B CG2  1  
ATOM 1143  H H    . VAL A 1 76 ? -5.832  -3.205  -4.233  1.00 0.00 ? 1120 VAL B H    1  
ATOM 1144  H HA   . VAL A 1 76 ? -5.626  -5.411  -5.978  1.00 0.00 ? 1120 VAL B HA   1  
ATOM 1145  H HB   . VAL A 1 76 ? -3.714  -4.306  -3.911  1.00 0.00 ? 1120 VAL B HB   1  
ATOM 1146  H HG11 . VAL A 1 76 ? -3.145  -6.634  -4.275  1.00 0.00 ? 1120 VAL B HG11 1  
ATOM 1147  H HG12 . VAL A 1 76 ? -2.004  -5.642  -5.179  1.00 0.00 ? 1120 VAL B HG12 1  
ATOM 1148  H HG13 . VAL A 1 76 ? -3.328  -6.449  -6.021  1.00 0.00 ? 1120 VAL B HG13 1  
ATOM 1149  H HG21 . VAL A 1 76 ? -2.606  -3.348  -5.877  1.00 0.00 ? 1120 VAL B HG21 1  
ATOM 1150  H HG22 . VAL A 1 76 ? -4.296  -2.843  -5.843  1.00 0.00 ? 1120 VAL B HG22 1  
ATOM 1151  H HG23 . VAL A 1 76 ? -3.779  -4.122  -6.942  1.00 0.00 ? 1120 VAL B HG23 1  
ATOM 1152  N N    . TYR A 1 77 ? -5.788  -6.074  -2.769  1.00 0.00 ? 1121 TYR B N    1  
ATOM 1153  C CA   . TYR A 1 77 ? -6.023  -7.136  -1.798  1.00 0.00 ? 1121 TYR B CA   1  
ATOM 1154  C C    . TYR A 1 77 ? -7.290  -7.902  -2.148  1.00 0.00 ? 1121 TYR B C    1  
ATOM 1155  O O    . TYR A 1 77 ? -7.301  -9.132  -2.159  1.00 0.00 ? 1121 TYR B O    1  
ATOM 1156  C CB   . TYR A 1 77 ? -6.148  -6.548  -0.393  1.00 0.00 ? 1121 TYR B CB   1  
ATOM 1157  C CG   . TYR A 1 77 ? -6.428  -7.658  0.594   1.00 0.00 ? 1121 TYR B CG   1  
ATOM 1158  C CD1  . TYR A 1 77 ? -5.398  -8.517  0.988   1.00 0.00 ? 1121 TYR B CD1  1  
ATOM 1159  C CD2  . TYR A 1 77 ? -7.717  -7.822  1.117   1.00 0.00 ? 1121 TYR B CD2  1  
ATOM 1160  C CE1  . TYR A 1 77 ? -5.653  -9.542  1.906   1.00 0.00 ? 1121 TYR B CE1  1  
ATOM 1161  C CE2  . TYR A 1 77 ? -7.972  -8.848  2.035   1.00 0.00 ? 1121 TYR B CE2  1  
ATOM 1162  C CZ   . TYR A 1 77 ? -6.940  -9.709  2.430   1.00 0.00 ? 1121 TYR B CZ   1  
ATOM 1163  O OH   . TYR A 1 77 ? -7.192  -10.718 3.336   1.00 0.00 ? 1121 TYR B OH   1  
ATOM 1164  H H    . TYR A 1 77 ? -5.743  -5.143  -2.464  1.00 0.00 ? 1121 TYR B H    1  
ATOM 1165  H HA   . TYR A 1 77 ? -5.187  -7.819  -1.818  1.00 0.00 ? 1121 TYR B HA   1  
ATOM 1166  H HB2  . TYR A 1 77 ? -5.227  -6.052  -0.126  1.00 0.00 ? 1121 TYR B HB2  1  
ATOM 1167  H HB3  . TYR A 1 77 ? -6.961  -5.836  -0.371  1.00 0.00 ? 1121 TYR B HB3  1  
ATOM 1168  H HD1  . TYR A 1 77 ? -4.403  -8.390  0.584   1.00 0.00 ? 1121 TYR B HD1  1  
ATOM 1169  H HD2  . TYR A 1 77 ? -8.513  -7.159  0.814   1.00 0.00 ? 1121 TYR B HD2  1  
ATOM 1170  H HE1  . TYR A 1 77 ? -4.858  -10.207 2.210   1.00 0.00 ? 1121 TYR B HE1  1  
ATOM 1171  H HE2  . TYR A 1 77 ? -8.966  -8.976  2.440   1.00 0.00 ? 1121 TYR B HE2  1  
ATOM 1172  H HH   . TYR A 1 77 ? -7.053  -10.366 4.218   1.00 0.00 ? 1121 TYR B HH   1  
ATOM 1173  N N    . HIS A 1 78 ? -8.355  -7.166  -2.434  1.00 0.00 ? 1122 HIS B N    1  
ATOM 1174  C CA   . HIS A 1 78 ? -9.622  -7.791  -2.784  1.00 0.00 ? 1122 HIS B CA   1  
ATOM 1175  C C    . HIS A 1 78 ? -9.467  -8.630  -4.047  1.00 0.00 ? 1122 HIS B C    1  
ATOM 1176  O O    . HIS A 1 78 ? -9.976  -9.747  -4.129  1.00 0.00 ? 1122 HIS B O    1  
ATOM 1177  C CB   . HIS A 1 78 ? -10.688 -6.718  -3.006  1.00 0.00 ? 1122 HIS B CB   1  
ATOM 1178  C CG   . HIS A 1 78 ? -11.160 -6.191  -1.678  1.00 0.00 ? 1122 HIS B CG   1  
ATOM 1179  N ND1  . HIS A 1 78 ? -11.919 -6.959  -0.809  1.00 0.00 ? 1122 HIS B ND1  1  
ATOM 1180  C CD2  . HIS A 1 78 ? -10.997 -4.976  -1.060  1.00 0.00 ? 1122 HIS B CD2  1  
ATOM 1181  C CE1  . HIS A 1 78 ? -12.182 -6.205  0.274   1.00 0.00 ? 1122 HIS B CE1  1  
ATOM 1182  N NE2  . HIS A 1 78 ? -11.642 -4.987  0.173   1.00 0.00 ? 1122 HIS B NE2  1  
ATOM 1183  H H    . HIS A 1 78 ? -8.286  -6.188  -2.413  1.00 0.00 ? 1122 HIS B H    1  
ATOM 1184  H HA   . HIS A 1 78 ? -9.935  -8.433  -1.973  1.00 0.00 ? 1122 HIS B HA   1  
ATOM 1185  H HB2  . HIS A 1 78 ? -10.263 -5.907  -3.582  1.00 0.00 ? 1122 HIS B HB2  1  
ATOM 1186  H HB3  . HIS A 1 78 ? -11.523 -7.143  -3.543  1.00 0.00 ? 1122 HIS B HB3  1  
ATOM 1187  H HD1  . HIS A 1 78 ? -12.214 -7.882  -0.957  1.00 0.00 ? 1122 HIS B HD1  1  
ATOM 1188  H HD2  . HIS A 1 78 ? -10.452 -4.139  -1.470  1.00 0.00 ? 1122 HIS B HD2  1  
ATOM 1189  H HE1  . HIS A 1 78 ? -12.756 -6.544  1.123   1.00 0.00 ? 1122 HIS B HE1  1  
ATOM 1190  N N    . ALA A 1 79 ? -8.754  -8.090  -5.028  1.00 0.00 ? 1123 ALA B N    1  
ATOM 1191  C CA   . ALA A 1 79 ? -8.536  -8.812  -6.273  1.00 0.00 ? 1123 ALA B CA   1  
ATOM 1192  C C    . ALA A 1 79 ? -7.753  -10.103 -6.024  1.00 0.00 ? 1123 ALA B C    1  
ATOM 1193  O O    . ALA A 1 79 ? -8.078  -11.153 -6.578  1.00 0.00 ? 1123 ALA B O    1  
ATOM 1194  C CB   . ALA A 1 79 ? -7.771  -7.924  -7.258  1.00 0.00 ? 1123 ALA B CB   1  
ATOM 1195  H H    . ALA A 1 79 ? -8.366  -7.198  -4.910  1.00 0.00 ? 1123 ALA B H    1  
ATOM 1196  H HA   . ALA A 1 79 ? -9.494  -9.062  -6.702  1.00 0.00 ? 1123 ALA B HA   1  
ATOM 1197  H HB1  . ALA A 1 79 ? -7.776  -6.905  -6.901  1.00 0.00 ? 1123 ALA B HB1  1  
ATOM 1198  H HB2  . ALA A 1 79 ? -8.247  -7.968  -8.227  1.00 0.00 ? 1123 ALA B HB2  1  
ATOM 1199  H HB3  . ALA A 1 79 ? -6.752  -8.273  -7.341  1.00 0.00 ? 1123 ALA B HB3  1  
ATOM 1200  N N    . TRP A 1 80 ? -6.724  -10.027 -5.181  1.00 0.00 ? 1124 TRP B N    1  
ATOM 1201  C CA   . TRP A 1 80 ? -5.918  -11.191 -4.871  1.00 0.00 ? 1124 TRP B CA   1  
ATOM 1202  C C    . TRP A 1 80 ? -6.774  -12.280 -4.233  1.00 0.00 ? 1124 TRP B C    1  
ATOM 1203  O O    . TRP A 1 80 ? -6.691  -13.454 -4.605  1.00 0.00 ? 1124 TRP B O    1  
ATOM 1204  C CB   . TRP A 1 80 ? -4.790  -10.778 -3.929  1.00 0.00 ? 1124 TRP B CB   1  
ATOM 1205  C CG   . TRP A 1 80 ? -4.005  -11.977 -3.561  1.00 0.00 ? 1124 TRP B CG   1  
ATOM 1206  C CD1  . TRP A 1 80 ? -3.106  -12.566 -4.362  1.00 0.00 ? 1124 TRP B CD1  1  
ATOM 1207  C CD2  . TRP A 1 80 ? -4.006  -12.720 -2.316  1.00 0.00 ? 1124 TRP B CD2  1  
ATOM 1208  N NE1  . TRP A 1 80 ? -2.567  -13.655 -3.704  1.00 0.00 ? 1124 TRP B NE1  1  
ATOM 1209  C CE2  . TRP A 1 80 ? -3.088  -13.788 -2.429  1.00 0.00 ? 1124 TRP B CE2  1  
ATOM 1210  C CE3  . TRP A 1 80 ? -4.715  -12.571 -1.118  1.00 0.00 ? 1124 TRP B CE3  1  
ATOM 1211  C CZ2  . TRP A 1 80 ? -2.881  -14.683 -1.378  1.00 0.00 ? 1124 TRP B CZ2  1  
ATOM 1212  C CZ3  . TRP A 1 80 ? -4.510  -13.464 -0.057  1.00 0.00 ? 1124 TRP B CZ3  1  
ATOM 1213  C CH2  . TRP A 1 80 ? -3.594  -14.520 -0.185  1.00 0.00 ? 1124 TRP B CH2  1  
ATOM 1214  H H    . TRP A 1 80 ? -6.502  -9.176  -4.757  1.00 0.00 ? 1124 TRP B H    1  
ATOM 1215  H HA   . TRP A 1 80 ? -5.487  -11.573 -5.784  1.00 0.00 ? 1124 TRP B HA   1  
ATOM 1216  H HB2  . TRP A 1 80 ? -4.146  -10.067 -4.426  1.00 0.00 ? 1124 TRP B HB2  1  
ATOM 1217  H HB3  . TRP A 1 80 ? -5.203  -10.329 -3.038  1.00 0.00 ? 1124 TRP B HB3  1  
ATOM 1218  H HD1  . TRP A 1 80 ? -2.870  -12.248 -5.365  1.00 0.00 ? 1124 TRP B HD1  1  
ATOM 1219  H HE1  . TRP A 1 80 ? -1.894  -14.260 -4.075  1.00 0.00 ? 1124 TRP B HE1  1  
ATOM 1220  H HE3  . TRP A 1 80 ? -5.422  -11.758 -1.014  1.00 0.00 ? 1124 TRP B HE3  1  
ATOM 1221  H HZ2  . TRP A 1 80 ? -2.176  -15.496 -1.483  1.00 0.00 ? 1124 TRP B HZ2  1  
ATOM 1222  H HZ3  . TRP A 1 80 ? -5.058  -13.333 0.862   1.00 0.00 ? 1124 TRP B HZ3  1  
ATOM 1223  H HH2  . TRP A 1 80 ? -3.440  -15.206 0.635   1.00 0.00 ? 1124 TRP B HH2  1  
ATOM 1224  N N    . LYS A 1 81 ? -7.602  -11.877 -3.281  1.00 0.00 ? 1125 LYS B N    1  
ATOM 1225  C CA   . LYS A 1 81 ? -8.487  -12.811 -2.598  1.00 0.00 ? 1125 LYS B CA   1  
ATOM 1226  C C    . LYS A 1 81 ? -9.439  -13.446 -3.589  1.00 0.00 ? 1125 LYS B C    1  
ATOM 1227  O O    . LYS A 1 81 ? -9.764  -14.617 -3.479  1.00 0.00 ? 1125 LYS B O    1  
ATOM 1228  C CB   . LYS A 1 81 ? -9.282  -12.085 -1.505  1.00 0.00 ? 1125 LYS B CB   1  
ATOM 1229  C CG   . LYS A 1 81 ? -8.360  -11.748 -0.331  1.00 0.00 ? 1125 LYS B CG   1  
ATOM 1230  C CD   . LYS A 1 81 ? -8.088  -13.021 0.469   1.00 0.00 ? 1125 LYS B CD   1  
ATOM 1231  C CE   . LYS A 1 81 ? -9.029  -13.078 1.679   1.00 0.00 ? 1125 LYS B CE   1  
ATOM 1232  N NZ   . LYS A 1 81 ? -8.670  -14.243 2.539   1.00 0.00 ? 1125 LYS B NZ   1  
ATOM 1233  H H    . LYS A 1 81 ? -7.625  -10.927 -3.038  1.00 0.00 ? 1125 LYS B H    1  
ATOM 1234  H HA   . LYS A 1 81 ? -7.900  -13.594 -2.156  1.00 0.00 ? 1125 LYS B HA   1  
ATOM 1235  H HB2  . LYS A 1 81 ? -9.697  -11.173 -1.907  1.00 0.00 ? 1125 LYS B HB2  1  
ATOM 1236  H HB3  . LYS A 1 81 ? -10.080 -12.723 -1.160  1.00 0.00 ? 1125 LYS B HB3  1  
ATOM 1237  H HG2  . LYS A 1 81 ? -7.427  -11.348 -0.703  1.00 0.00 ? 1125 LYS B HG2  1  
ATOM 1238  H HG3  . LYS A 1 81 ? -8.839  -11.021 0.307   1.00 0.00 ? 1125 LYS B HG3  1  
ATOM 1239  H HD2  . LYS A 1 81 ? -8.265  -13.877 -0.164  1.00 0.00 ? 1125 LYS B HD2  1  
ATOM 1240  H HD3  . LYS A 1 81 ? -7.065  -13.023 0.807   1.00 0.00 ? 1125 LYS B HD3  1  
ATOM 1241  H HE2  . LYS A 1 81 ? -8.935  -12.167 2.252   1.00 0.00 ? 1125 LYS B HE2  1  
ATOM 1242  H HE3  . LYS A 1 81 ? -10.047 -13.184 1.338   1.00 0.00 ? 1125 LYS B HE3  1  
ATOM 1243  H HZ1  . LYS A 1 81 ? -9.485  -14.886 2.609   1.00 0.00 ? 1125 LYS B HZ1  1  
ATOM 1244  H HZ2  . LYS A 1 81 ? -8.411  -13.905 3.489   1.00 0.00 ? 1125 LYS B HZ2  1  
ATOM 1245  H HZ3  . LYS A 1 81 ? -7.866  -14.751 2.119   1.00 0.00 ? 1125 LYS B HZ3  1  
ATOM 1246  N N    . SER A 1 82 ? -9.873  -12.664 -4.551  1.00 0.00 ? 1126 SER B N    1  
ATOM 1247  C CA   . SER A 1 82 ? -10.784 -13.164 -5.567  1.00 0.00 ? 1126 SER B CA   1  
ATOM 1248  C C    . SER A 1 82 ? -10.132 -14.304 -6.338  1.00 0.00 ? 1126 SER B C    1  
ATOM 1249  O O    . SER A 1 82 ? -10.779 -15.293 -6.659  1.00 0.00 ? 1126 SER B O    1  
ATOM 1250  C CB   . SER A 1 82 ? -11.177 -12.049 -6.536  1.00 0.00 ? 1126 SER B CB   1  
ATOM 1251  O OG   . SER A 1 82 ? -12.075 -12.571 -7.510  1.00 0.00 ? 1126 SER B OG   1  
ATOM 1252  H H    . SER A 1 82 ? -9.569  -11.741 -4.581  1.00 0.00 ? 1126 SER B H    1  
ATOM 1253  H HA   . SER A 1 82 ? -11.675 -13.536 -5.084  1.00 0.00 ? 1126 SER B HA   1  
ATOM 1254  H HB2  . SER A 1 82 ? -11.661 -11.253 -5.996  1.00 0.00 ? 1126 SER B HB2  1  
ATOM 1255  H HB3  . SER A 1 82 ? -10.289 -11.667 -7.019  1.00 0.00 ? 1126 SER B HB3  1  
ATOM 1256  H HG   . SER A 1 82 ? -12.538 -13.316 -7.120  1.00 0.00 ? 1126 SER B HG   1  
ATOM 1257  N N    . LYS A 1 83 ? -8.848  -14.153 -6.649  1.00 0.00 ? 1127 LYS B N    1  
ATOM 1258  C CA   . LYS A 1 83 ? -8.134  -15.185 -7.396  1.00 0.00 ? 1127 LYS B CA   1  
ATOM 1259  C C    . LYS A 1 83 ? -8.037  -16.476 -6.582  1.00 0.00 ? 1127 LYS B C    1  
ATOM 1260  O O    . LYS A 1 83 ? -8.283  -17.567 -7.093  1.00 0.00 ? 1127 LYS B O    1  
ATOM 1261  C CB   . LYS A 1 83 ? -6.725  -14.698 -7.703  1.00 0.00 ? 1127 LYS B CB   1  
ATOM 1262  C CG   . LYS A 1 83 ? -6.795  -13.461 -8.587  1.00 0.00 ? 1127 LYS B CG   1  
ATOM 1263  C CD   . LYS A 1 83 ? -5.381  -12.943 -8.847  1.00 0.00 ? 1127 LYS B CD   1  
ATOM 1264  C CE   . LYS A 1 83 ? -5.472  -11.552 -9.464  1.00 0.00 ? 1127 LYS B CE   1  
ATOM 1265  N NZ   . LYS A 1 83 ? -4.104  -11.028 -9.743  1.00 0.00 ? 1127 LYS B NZ   1  
ATOM 1266  H H    . LYS A 1 83 ? -8.376  -13.332 -6.380  1.00 0.00 ? 1127 LYS B H    1  
ATOM 1267  H HA   . LYS A 1 83 ? -8.649  -15.382 -8.325  1.00 0.00 ? 1127 LYS B HA   1  
ATOM 1268  H HB2  . LYS A 1 83 ? -6.229  -14.448 -6.776  1.00 0.00 ? 1127 LYS B HB2  1  
ATOM 1269  H HB3  . LYS A 1 83 ? -6.175  -15.475 -8.212  1.00 0.00 ? 1127 LYS B HB3  1  
ATOM 1270  H HG2  . LYS A 1 83 ? -7.268  -13.713 -9.525  1.00 0.00 ? 1127 LYS B HG2  1  
ATOM 1271  H HG3  . LYS A 1 83 ? -7.369  -12.698 -8.090  1.00 0.00 ? 1127 LYS B HG3  1  
ATOM 1272  H HD2  . LYS A 1 83 ? -4.835  -12.893 -7.917  1.00 0.00 ? 1127 LYS B HD2  1  
ATOM 1273  H HD3  . LYS A 1 83 ? -4.873  -13.605 -9.532  1.00 0.00 ? 1127 LYS B HD3  1  
ATOM 1274  H HE2  . LYS A 1 83 ? -6.036  -11.602 -10.382 1.00 0.00 ? 1127 LYS B HE2  1  
ATOM 1275  H HE3  . LYS A 1 83 ? -5.973  -10.897 -8.768  1.00 0.00 ? 1127 LYS B HE3  1  
ATOM 1276  H HZ1  . LYS A 1 83 ? -3.867  -11.187 -10.742 1.00 0.00 ? 1127 LYS B HZ1  1  
ATOM 1277  H HZ2  . LYS A 1 83 ? -3.414  -11.523 -9.138  1.00 0.00 ? 1127 LYS B HZ2  1  
ATOM 1278  H HZ3  . LYS A 1 83 ? -4.076  -10.009 -9.539  1.00 0.00 ? 1127 LYS B HZ3  1  
ATOM 1279  N N    . ASN A 1 84 ? -7.664  -16.342 -5.313  1.00 0.00 ? 1128 ASN B N    1  
ATOM 1280  C CA   . ASN A 1 84 ? -7.526  -17.511 -4.437  1.00 0.00 ? 1128 ASN B CA   1  
ATOM 1281  C C    . ASN A 1 84 ? -8.887  -18.125 -4.101  1.00 0.00 ? 1128 ASN B C    1  
ATOM 1282  O O    . ASN A 1 84 ? -9.032  -19.346 -4.037  1.00 0.00 ? 1128 ASN B O    1  
ATOM 1283  C CB   . ASN A 1 84 ? -6.826  -17.103 -3.141  1.00 0.00 ? 1128 ASN B CB   1  
ATOM 1284  C CG   . ASN A 1 84 ? -5.349  -16.860 -3.414  1.00 0.00 ? 1128 ASN B CG   1  
ATOM 1285  O OD1  . ASN A 1 84 ? -4.541  -17.787 -3.340  1.00 0.00 ? 1128 ASN B OD1  1  
ATOM 1286  N ND2  . ASN A 1 84 ? -4.949  -15.670 -3.767  1.00 0.00 ? 1128 ASN B ND2  1  
ATOM 1287  H H    . ASN A 1 84 ? -7.469  -15.443 -4.963  1.00 0.00 ? 1128 ASN B H    1  
ATOM 1288  H HA   . ASN A 1 84 ? -6.920  -18.253 -4.939  1.00 0.00 ? 1128 ASN B HA   1  
ATOM 1289  H HB2  . ASN A 1 84 ? -7.277  -16.200 -2.756  1.00 0.00 ? 1128 ASN B HB2  1  
ATOM 1290  H HB3  . ASN A 1 84 ? -6.929  -17.896 -2.414  1.00 0.00 ? 1128 ASN B HB3  1  
ATOM 1291  H HD21 . ASN A 1 84 ? -5.602  -14.942 -3.858  1.00 0.00 ? 1128 ASN B HD21 1  
ATOM 1292  H HD22 . ASN A 1 84 ? -4.002  -15.503 -3.948  1.00 0.00 ? 1128 ASN B HD22 1  
ATOM 1293  N N    . LYS A 1 85 ? -9.877  -17.266 -3.883  1.00 0.00 ? 1129 LYS B N    1  
ATOM 1294  C CA   . LYS A 1 85 ? -11.226 -17.715 -3.546  1.00 0.00 ? 1129 LYS B CA   1  
ATOM 1295  C C    . LYS A 1 85 ? -11.902 -18.326 -4.758  1.00 0.00 ? 1129 LYS B C    1  
ATOM 1296  O O    . LYS A 1 85 ? -12.594 -19.341 -4.666  1.00 0.00 ? 1129 LYS B O    1  
ATOM 1297  C CB   . LYS A 1 85 ? -12.050 -16.525 -3.036  1.00 0.00 ? 1129 LYS B CB   1  
ATOM 1298  C CG   . LYS A 1 85 ? -11.512 -16.056 -1.678  1.00 0.00 ? 1129 LYS B CG   1  
ATOM 1299  C CD   . LYS A 1 85 ? -11.840 -17.100 -0.614  1.00 0.00 ? 1129 LYS B CD   1  
ATOM 1300  C CE   . LYS A 1 85 ? -11.473 -16.554 0.770   1.00 0.00 ? 1129 LYS B CE   1  
ATOM 1301  N NZ   . LYS A 1 85 ? -11.809 -17.568 1.811   1.00 0.00 ? 1129 LYS B NZ   1  
ATOM 1302  H H    . LYS A 1 85 ? -9.699  -16.313 -3.956  1.00 0.00 ? 1129 LYS B H    1  
ATOM 1303  H HA   . LYS A 1 85 ? -11.166 -18.460 -2.772  1.00 0.00 ? 1129 LYS B HA   1  
ATOM 1304  H HB2  . LYS A 1 85 ? -11.983 -15.715 -3.748  1.00 0.00 ? 1129 LYS B HB2  1  
ATOM 1305  H HB3  . LYS A 1 85 ? -13.082 -16.822 -2.927  1.00 0.00 ? 1129 LYS B HB3  1  
ATOM 1306  H HG2  . LYS A 1 85 ? -10.442 -15.930 -1.737  1.00 0.00 ? 1129 LYS B HG2  1  
ATOM 1307  H HG3  . LYS A 1 85 ? -11.972 -15.115 -1.412  1.00 0.00 ? 1129 LYS B HG3  1  
ATOM 1308  H HD2  . LYS A 1 85 ? -12.893 -17.329 -0.650  1.00 0.00 ? 1129 LYS B HD2  1  
ATOM 1309  H HD3  . LYS A 1 85 ? -11.270 -17.995 -0.805  1.00 0.00 ? 1129 LYS B HD3  1  
ATOM 1310  H HE2  . LYS A 1 85 ? -10.415 -16.341 0.804   1.00 0.00 ? 1129 LYS B HE2  1  
ATOM 1311  H HE3  . LYS A 1 85 ? -12.029 -15.647 0.958   1.00 0.00 ? 1129 LYS B HE3  1  
ATOM 1312  H HZ1  . LYS A 1 85 ? -10.935 -17.909 2.258   1.00 0.00 ? 1129 LYS B HZ1  1  
ATOM 1313  H HZ2  . LYS A 1 85 ? -12.310 -18.366 1.369   1.00 0.00 ? 1129 LYS B HZ2  1  
ATOM 1314  H HZ3  . LYS A 1 85 ? -12.417 -17.133 2.534   1.00 0.00 ? 1129 LYS B HZ3  1  
ATOM 1315  N N    . LYS A 1 86 ? -11.684 -17.689 -5.894  1.00 0.00 ? 1130 LYS B N    1  
ATOM 1316  C CA   . LYS A 1 86 ? -12.260 -18.156 -7.151  1.00 0.00 ? 1130 LYS B CA   1  
ATOM 1317  C C    . LYS A 1 86 ? -11.256 -18.060 -8.291  1.00 0.00 ? 1130 LYS B C    1  
ATOM 1318  O O    . LYS A 1 86 ? -10.407 -17.170 -8.316  1.00 0.00 ? 1130 LYS B O    1  
ATOM 1319  C CB   . LYS A 1 86 ? -13.513 -17.350 -7.505  1.00 0.00 ? 1130 LYS B CB   1  
ATOM 1320  C CG   . LYS A 1 86 ? -14.640 -17.694 -6.531  1.00 0.00 ? 1130 LYS B CG   1  
ATOM 1321  C CD   . LYS A 1 86 ? -15.891 -16.895 -6.896  1.00 0.00 ? 1130 LYS B CD   1  
ATOM 1322  C CE   . LYS A 1 86 ? -17.023 -17.274 -5.947  1.00 0.00 ? 1130 LYS B CE   1  
ATOM 1323  N NZ   . LYS A 1 86 ? -18.248 -16.492 -6.291  1.00 0.00 ? 1130 LYS B NZ   1  
ATOM 1324  H H    . LYS A 1 86 ? -11.118 -16.888 -5.881  1.00 0.00 ? 1130 LYS B H    1  
ATOM 1325  H HA   . LYS A 1 86 ? -12.542 -19.190 -7.033  1.00 0.00 ? 1130 LYS B HA   1  
ATOM 1326  H HB2  . LYS A 1 86 ? -13.295 -16.296 -7.446  1.00 0.00 ? 1130 LYS B HB2  1  
ATOM 1327  H HB3  . LYS A 1 86 ? -13.825 -17.598 -8.507  1.00 0.00 ? 1130 LYS B HB3  1  
ATOM 1328  H HG2  . LYS A 1 86 ? -14.857 -18.751 -6.587  1.00 0.00 ? 1130 LYS B HG2  1  
ATOM 1329  H HG3  . LYS A 1 86 ? -14.336 -17.443 -5.524  1.00 0.00 ? 1130 LYS B HG3  1  
ATOM 1330  H HD2  . LYS A 1 86 ? -15.682 -15.838 -6.806  1.00 0.00 ? 1130 LYS B HD2  1  
ATOM 1331  H HD3  . LYS A 1 86 ? -16.183 -17.121 -7.910  1.00 0.00 ? 1130 LYS B HD3  1  
ATOM 1332  H HE2  . LYS A 1 86 ? -17.227 -18.331 -6.044  1.00 0.00 ? 1130 LYS B HE2  1  
ATOM 1333  H HE3  . LYS A 1 86 ? -16.729 -17.055 -4.932  1.00 0.00 ? 1130 LYS B HE3  1  
ATOM 1334  H HZ1  . LYS A 1 86 ? -18.971 -17.133 -6.679  1.00 0.00 ? 1130 LYS B HZ1  1  
ATOM 1335  H HZ2  . LYS A 1 86 ? -18.010 -15.769 -7.001  1.00 0.00 ? 1130 LYS B HZ2  1  
ATOM 1336  H HZ3  . LYS A 1 86 ? -18.619 -16.033 -5.437  1.00 0.00 ? 1130 LYS B HZ3  1  
ATOM 1337  N N    . ARG A 1 87 ? -11.378 -18.981 -9.234  1.00 0.00 ? 1131 ARG B N    1  
ATOM 1338  C CA   . ARG A 1 87 ? -10.490 -19.009 -10.395 1.00 0.00 ? 1131 ARG B CA   1  
ATOM 1339  C C    . ARG A 1 87 ? -9.046  -19.230 -9.958  1.00 0.00 ? 1131 ARG B C    1  
ATOM 1340  O O    . ARG A 1 87 ? -8.661  -20.377 -9.803  1.00 0.00 ? 1131 ARG B O    1  
ATOM 1341  C CB   . ARG A 1 87 ? -10.586 -17.689 -11.162 1.00 0.00 ? 1131 ARG B CB   1  
ATOM 1342  C CG   . ARG A 1 87 ? -12.054 -17.353 -11.403 1.00 0.00 ? 1131 ARG B CG   1  
ATOM 1343  C CD   . ARG A 1 87 ? -12.160 -16.149 -12.340 1.00 0.00 ? 1131 ARG B CD   1  
ATOM 1344  N NE   . ARG A 1 87 ? -13.563 -15.814 -12.559 1.00 0.00 ? 1131 ARG B NE   1  
ATOM 1345  C CZ   . ARG A 1 87 ? -14.263 -15.106 -11.667 1.00 0.00 ? 1131 ARG B CZ   1  
ATOM 1346  N NH1  . ARG A 1 87 ? -13.715 -14.700 -10.548 1.00 0.00 ? 1131 ARG B NH1  1  
ATOM 1347  N NH2  . ARG A 1 87 ? -15.512 -14.820 -11.907 1.00 0.00 ? 1131 ARG B NH2  1  
ATOM 1348  O OXT  . ARG A 1 87 ? -8.345  -18.246 -9.783  1.00 0.00 ? 1131 ARG B OXT  1  
ATOM 1349  H H    . ARG A 1 87 ? -12.087 -19.654 -9.150  1.00 0.00 ? 1131 ARG B H    1  
ATOM 1350  H HA   . ARG A 1 87 ? -10.789 -19.816 -11.049 1.00 0.00 ? 1131 ARG B HA   1  
ATOM 1351  H HB2  . ARG A 1 87 ? -10.125 -16.902 -10.584 1.00 0.00 ? 1131 ARG B HB2  1  
ATOM 1352  H HB3  . ARG A 1 87 ? -10.078 -17.783 -12.111 1.00 0.00 ? 1131 ARG B HB3  1  
ATOM 1353  H HG2  . ARG A 1 87 ? -12.549 -18.204 -11.847 1.00 0.00 ? 1131 ARG B HG2  1  
ATOM 1354  H HG3  . ARG A 1 87 ? -12.524 -17.113 -10.459 1.00 0.00 ? 1131 ARG B HG3  1  
ATOM 1355  H HD2  . ARG A 1 87 ? -11.653 -15.304 -11.902 1.00 0.00 ? 1131 ARG B HD2  1  
ATOM 1356  H HD3  . ARG A 1 87 ? -11.697 -16.393 -13.287 1.00 0.00 ? 1131 ARG B HD3  1  
ATOM 1357  H HE   . ARG A 1 87 ? -14.001 -16.111 -13.384 1.00 0.00 ? 1131 ARG B HE   1  
ATOM 1358  H HH11 . ARG A 1 87 ? -12.762 -14.914 -10.344 1.00 0.00 ? 1131 ARG B HH11 1  
ATOM 1359  H HH12 . ARG A 1 87 ? -14.255 -14.173 -9.892  1.00 0.00 ? 1131 ARG B HH12 1  
ATOM 1360  H HH21 . ARG A 1 87 ? -15.941 -15.129 -12.756 1.00 0.00 ? 1131 ARG B HH21 1  
ATOM 1361  H HH22 . ARG A 1 87 ? -16.041 -14.294 -11.242 1.00 0.00 ? 1131 ARG B HH22 1  
ATOM 1362  N N    . ILE B 2 9  ? 3.237   -18.729 1.742   1.00 0.00 ? 46   ILE A N    1  
ATOM 1363  C CA   . ILE B 2 9  ? 3.240   -18.407 0.287   1.00 0.00 ? 46   ILE A CA   1  
ATOM 1364  C C    . ILE B 2 9  ? 2.108   -17.432 -0.022  1.00 0.00 ? 46   ILE A C    1  
ATOM 1365  O O    . ILE B 2 9  ? 2.337   -16.240 -0.232  1.00 0.00 ? 46   ILE A O    1  
ATOM 1366  C CB   . ILE B 2 9  ? 3.056   -19.697 -0.518  1.00 0.00 ? 46   ILE A CB   1  
ATOM 1367  C CG1  . ILE B 2 9  ? 4.326   -20.547 -0.415  1.00 0.00 ? 46   ILE A CG1  1  
ATOM 1368  C CG2  . ILE B 2 9  ? 2.792   -19.347 -1.985  1.00 0.00 ? 46   ILE A CG2  1  
ATOM 1369  C CD1  . ILE B 2 9  ? 4.046   -21.952 -0.954  1.00 0.00 ? 46   ILE A CD1  1  
ATOM 1370  H H    . ILE B 2 9  ? 4.163   -19.117 2.014   1.00 0.00 ? 46   ILE A H    1  
ATOM 1371  H HA   . ILE B 2 9  ? 4.182   -17.952 0.024   1.00 0.00 ? 46   ILE A HA   1  
ATOM 1372  H HB   . ILE B 2 9  ? 2.216   -20.249 -0.124  1.00 0.00 ? 46   ILE A HB   1  
ATOM 1373  H HG12 . ILE B 2 9  ? 5.114   -20.089 -0.996  1.00 0.00 ? 46   ILE A HG12 1  
ATOM 1374  H HG13 . ILE B 2 9  ? 4.632   -20.615 0.618   1.00 0.00 ? 46   ILE A HG13 1  
ATOM 1375  H HG21 . ILE B 2 9  ? 1.757   -19.063 -2.106  1.00 0.00 ? 46   ILE A HG21 1  
ATOM 1376  H HG22 . ILE B 2 9  ? 3.006   -20.204 -2.604  1.00 0.00 ? 46   ILE A HG22 1  
ATOM 1377  H HG23 . ILE B 2 9  ? 3.427   -18.524 -2.278  1.00 0.00 ? 46   ILE A HG23 1  
ATOM 1378  H HD11 . ILE B 2 9  ? 4.221   -22.679 -0.174  1.00 0.00 ? 46   ILE A HD11 1  
ATOM 1379  H HD12 . ILE B 2 9  ? 4.701   -22.155 -1.790  1.00 0.00 ? 46   ILE A HD12 1  
ATOM 1380  H HD13 . ILE B 2 9  ? 3.018   -22.015 -1.280  1.00 0.00 ? 46   ILE A HD13 1  
ATOM 1381  N N    . GLU B 2 10 ? 0.887   -17.945 -0.053  1.00 0.00 ? 47   GLU A N    1  
ATOM 1382  C CA   . GLU B 2 10 ? -0.269  -17.108 -0.345  1.00 0.00 ? 47   GLU A CA   1  
ATOM 1383  C C    . GLU B 2 10 ? -0.427  -16.019 0.712   1.00 0.00 ? 47   GLU A C    1  
ATOM 1384  O O    . GLU B 2 10 ? -0.707  -14.864 0.395   1.00 0.00 ? 47   GLU A O    1  
ATOM 1385  C CB   . GLU B 2 10 ? -1.533  -17.966 -0.373  1.00 0.00 ? 47   GLU A CB   1  
ATOM 1386  C CG   . GLU B 2 10 ? -1.507  -18.876 -1.603  1.00 0.00 ? 47   GLU A CG   1  
ATOM 1387  C CD   . GLU B 2 10 ? -2.708  -19.818 -1.586  1.00 0.00 ? 47   GLU A CD   1  
ATOM 1388  O OE1  . GLU B 2 10 ? -3.394  -19.856 -0.577  1.00 0.00 ? 47   GLU A OE1  1  
ATOM 1389  O OE2  . GLU B 2 10 ? -2.924  -20.488 -2.582  1.00 0.00 ? 47   GLU A OE2  1  
ATOM 1390  H H    . GLU B 2 10 ? 0.760   -18.903 0.117   1.00 0.00 ? 47   GLU A H    1  
ATOM 1391  H HA   . GLU B 2 10 ? -0.137  -16.645 -1.312  1.00 0.00 ? 47   GLU A HA   1  
ATOM 1392  H HB2  . GLU B 2 10 ? -1.571  -18.570 0.523   1.00 0.00 ? 47   GLU A HB2  1  
ATOM 1393  H HB3  . GLU B 2 10 ? -2.400  -17.327 -0.415  1.00 0.00 ? 47   GLU A HB3  1  
ATOM 1394  H HG2  . GLU B 2 10 ? -1.541  -18.269 -2.495  1.00 0.00 ? 47   GLU A HG2  1  
ATOM 1395  H HG3  . GLU B 2 10 ? -0.597  -19.456 -1.597  1.00 0.00 ? 47   GLU A HG3  1  
ATOM 1396  N N    . ASN B 2 11 ? -0.237  -16.395 1.970   1.00 0.00 ? 48   ASN A N    1  
ATOM 1397  C CA   . ASN B 2 11 ? -0.361  -15.437 3.058   1.00 0.00 ? 48   ASN A CA   1  
ATOM 1398  C C    . ASN B 2 11 ? 0.669   -14.328 2.899   1.00 0.00 ? 48   ASN A C    1  
ATOM 1399  O O    . ASN B 2 11 ? 0.378   -13.156 3.133   1.00 0.00 ? 48   ASN A O    1  
ATOM 1400  C CB   . ASN B 2 11 ? -0.159  -16.140 4.403   1.00 0.00 ? 48   ASN A CB   1  
ATOM 1401  C CG   . ASN B 2 11 ? -1.350  -17.046 4.697   1.00 0.00 ? 48   ASN A CG   1  
ATOM 1402  O OD1  . ASN B 2 11 ? -1.177  -18.232 4.977   1.00 0.00 ? 48   ASN A OD1  1  
ATOM 1403  N ND2  . ASN B 2 11 ? -2.557  -16.554 4.641   1.00 0.00 ? 48   ASN A ND2  1  
ATOM 1404  H H    . ASN B 2 11 ? -0.012  -17.327 2.171   1.00 0.00 ? 48   ASN A H    1  
ATOM 1405  H HA   . ASN B 2 11 ? -1.349  -15.004 3.033   1.00 0.00 ? 48   ASN A HA   1  
ATOM 1406  H HB2  . ASN B 2 11 ? 0.742   -16.734 4.366   1.00 0.00 ? 48   ASN A HB2  1  
ATOM 1407  H HB3  . ASN B 2 11 ? -0.071  -15.402 5.186   1.00 0.00 ? 48   ASN A HB3  1  
ATOM 1408  H HD21 . ASN B 2 11 ? -2.691  -15.611 4.409   1.00 0.00 ? 48   ASN A HD21 1  
ATOM 1409  H HD22 . ASN B 2 11 ? -3.328  -17.127 4.830   1.00 0.00 ? 48   ASN A HD22 1  
ATOM 1410  N N    . ASP B 2 12 ? 1.871   -14.709 2.490   1.00 0.00 ? 49   ASP A N    1  
ATOM 1411  C CA   . ASP B 2 12 ? 2.933   -13.733 2.294   1.00 0.00 ? 49   ASP A CA   1  
ATOM 1412  C C    . ASP B 2 12 ? 2.546   -12.737 1.206   1.00 0.00 ? 49   ASP A C    1  
ATOM 1413  O O    . ASP B 2 12 ? 2.817   -11.541 1.323   1.00 0.00 ? 49   ASP A O    1  
ATOM 1414  C CB   . ASP B 2 12 ? 4.235   -14.442 1.911   1.00 0.00 ? 49   ASP A CB   1  
ATOM 1415  C CG   . ASP B 2 12 ? 4.799   -15.188 3.116   1.00 0.00 ? 49   ASP A CG   1  
ATOM 1416  O OD1  . ASP B 2 12 ? 4.347   -14.925 4.217   1.00 0.00 ? 49   ASP A OD1  1  
ATOM 1417  O OD2  . ASP B 2 12 ? 5.673   -16.018 2.920   1.00 0.00 ? 49   ASP A OD2  1  
ATOM 1418  H H    . ASP B 2 12 ? 2.041   -15.657 2.307   1.00 0.00 ? 49   ASP A H    1  
ATOM 1419  H HA   . ASP B 2 12 ? 3.086   -13.196 3.217   1.00 0.00 ? 49   ASP A HA   1  
ATOM 1420  H HB2  . ASP B 2 12 ? 4.037   -15.147 1.114   1.00 0.00 ? 49   ASP A HB2  1  
ATOM 1421  H HB3  . ASP B 2 12 ? 4.955   -13.714 1.573   1.00 0.00 ? 49   ASP A HB3  1  
ATOM 1422  N N    . GLU B 2 13 ? 1.915   -13.237 0.150   1.00 0.00 ? 50   GLU A N    1  
ATOM 1423  C CA   . GLU B 2 13 ? 1.497   -12.375 -0.947  1.00 0.00 ? 50   GLU A CA   1  
ATOM 1424  C C    . GLU B 2 13 ? 0.490   -11.333 -0.469  1.00 0.00 ? 50   GLU A C    1  
ATOM 1425  O O    . GLU B 2 13 ? 0.588   -10.153 -0.815  1.00 0.00 ? 50   GLU A O    1  
ATOM 1426  C CB   . GLU B 2 13 ? 0.858   -13.215 -2.054  1.00 0.00 ? 50   GLU A CB   1  
ATOM 1427  C CG   . GLU B 2 13 ? 1.931   -14.067 -2.735  1.00 0.00 ? 50   GLU A CG   1  
ATOM 1428  C CD   . GLU B 2 13 ? 1.307   -14.893 -3.855  1.00 0.00 ? 50   GLU A CD   1  
ATOM 1429  O OE1  . GLU B 2 13 ? 0.094   -14.872 -3.975  1.00 0.00 ? 50   GLU A OE1  1  
ATOM 1430  O OE2  . GLU B 2 13 ? 2.053   -15.534 -4.577  1.00 0.00 ? 50   GLU A OE2  1  
ATOM 1431  H H    . GLU B 2 13 ? 1.728   -14.200 0.110   1.00 0.00 ? 50   GLU A H    1  
ATOM 1432  H HA   . GLU B 2 13 ? 2.362   -11.872 -1.349  1.00 0.00 ? 50   GLU A HA   1  
ATOM 1433  H HB2  . GLU B 2 13 ? 0.105   -13.860 -1.624  1.00 0.00 ? 50   GLU A HB2  1  
ATOM 1434  H HB3  . GLU B 2 13 ? 0.400   -12.564 -2.782  1.00 0.00 ? 50   GLU A HB3  1  
ATOM 1435  H HG2  . GLU B 2 13 ? 2.695   -13.423 -3.145  1.00 0.00 ? 50   GLU A HG2  1  
ATOM 1436  H HG3  . GLU B 2 13 ? 2.374   -14.731 -2.008  1.00 0.00 ? 50   GLU A HG3  1  
ATOM 1437  N N    . ALA B 2 14 ? -0.472  -11.771 0.336   1.00 0.00 ? 51   ALA A N    1  
ATOM 1438  C CA   . ALA B 2 14 ? -1.483  -10.862 0.859   1.00 0.00 ? 51   ALA A CA   1  
ATOM 1439  C C    . ALA B 2 14 ? -0.837  -9.801  1.741   1.00 0.00 ? 51   ALA A C    1  
ATOM 1440  O O    . ALA B 2 14 ? -1.213  -8.630  1.696   1.00 0.00 ? 51   ALA A O    1  
ATOM 1441  C CB   . ALA B 2 14 ? -2.523  -11.637 1.660   1.00 0.00 ? 51   ALA A CB   1  
ATOM 1442  H H    . ALA B 2 14 ? -0.499  -12.721 0.584   1.00 0.00 ? 51   ALA A H    1  
ATOM 1443  H HA   . ALA B 2 14 ? -1.974  -10.374 0.030   1.00 0.00 ? 51   ALA A HA   1  
ATOM 1444  H HB1  . ALA B 2 14 ? -2.469  -11.342 2.696   1.00 0.00 ? 51   ALA A HB1  1  
ATOM 1445  H HB2  . ALA B 2 14 ? -2.326  -12.696 1.576   1.00 0.00 ? 51   ALA A HB2  1  
ATOM 1446  H HB3  . ALA B 2 14 ? -3.508  -11.421 1.274   1.00 0.00 ? 51   ALA A HB3  1  
ATOM 1447  N N    . PHE B 2 15 ? 0.141   -10.220 2.538   1.00 0.00 ? 52   PHE A N    1  
ATOM 1448  C CA   . PHE B 2 15 ? 0.832   -9.291  3.419   1.00 0.00 ? 52   PHE A CA   1  
ATOM 1449  C C    . PHE B 2 15 ? 1.519   -8.198  2.611   1.00 0.00 ? 52   PHE A C    1  
ATOM 1450  O O    . PHE B 2 15 ? 1.435   -7.023  2.957   1.00 0.00 ? 52   PHE A O    1  
ATOM 1451  C CB   . PHE B 2 15 ? 1.875   -10.033 4.258   1.00 0.00 ? 52   PHE A CB   1  
ATOM 1452  C CG   . PHE B 2 15 ? 1.283   -10.412 5.593   1.00 0.00 ? 52   PHE A CG   1  
ATOM 1453  C CD1  . PHE B 2 15 ? 0.863   -11.728 5.831   1.00 0.00 ? 52   PHE A CD1  1  
ATOM 1454  C CD2  . PHE B 2 15 ? 1.160   -9.447  6.600   1.00 0.00 ? 52   PHE A CD2  1  
ATOM 1455  C CE1  . PHE B 2 15 ? 0.320   -12.075 7.074   1.00 0.00 ? 52   PHE A CE1  1  
ATOM 1456  C CE2  . PHE B 2 15 ? 0.618   -9.795  7.840   1.00 0.00 ? 52   PHE A CE2  1  
ATOM 1457  C CZ   . PHE B 2 15 ? 0.198   -11.107 8.078   1.00 0.00 ? 52   PHE A CZ   1  
ATOM 1458  H H    . PHE B 2 15 ? 0.400   -11.164 2.530   1.00 0.00 ? 52   PHE A H    1  
ATOM 1459  H HA   . PHE B 2 15 ? 0.113   -8.836  4.083   1.00 0.00 ? 52   PHE A HA   1  
ATOM 1460  H HB2  . PHE B 2 15 ? 2.185   -10.927 3.735   1.00 0.00 ? 52   PHE A HB2  1  
ATOM 1461  H HB3  . PHE B 2 15 ? 2.733   -9.394  4.414   1.00 0.00 ? 52   PHE A HB3  1  
ATOM 1462  H HD1  . PHE B 2 15 ? 0.959   -12.472 5.058   1.00 0.00 ? 52   PHE A HD1  1  
ATOM 1463  H HD2  . PHE B 2 15 ? 1.481   -8.431  6.419   1.00 0.00 ? 52   PHE A HD2  1  
ATOM 1464  H HE1  . PHE B 2 15 ? -0.005  -13.088 7.257   1.00 0.00 ? 52   PHE A HE1  1  
ATOM 1465  H HE2  . PHE B 2 15 ? 0.527   -9.050  8.617   1.00 0.00 ? 52   PHE A HE2  1  
ATOM 1466  H HZ   . PHE B 2 15 ? -0.221  -11.375 9.037   1.00 0.00 ? 52   PHE A HZ   1  
ATOM 1467  N N    . ALA B 2 16 ? 2.185   -8.587  1.531   1.00 0.00 ? 53   ALA A N    1  
ATOM 1468  C CA   . ALA B 2 16 ? 2.873   -7.617  0.687   1.00 0.00 ? 53   ALA A CA   1  
ATOM 1469  C C    . ALA B 2 16 ? 1.881   -6.620  0.092   1.00 0.00 ? 53   ALA A C    1  
ATOM 1470  O O    . ALA B 2 16 ? 2.157   -5.424  0.016   1.00 0.00 ? 53   ALA A O    1  
ATOM 1471  C CB   . ALA B 2 16 ? 3.612   -8.340  -0.436  1.00 0.00 ? 53   ALA A CB   1  
ATOM 1472  H H    . ALA B 2 16 ? 2.213   -9.539  1.298   1.00 0.00 ? 53   ALA A H    1  
ATOM 1473  H HA   . ALA B 2 16 ? 3.591   -7.079  1.289   1.00 0.00 ? 53   ALA A HA   1  
ATOM 1474  H HB1  . ALA B 2 16 ? 4.312   -7.662  -0.901  1.00 0.00 ? 53   ALA A HB1  1  
ATOM 1475  H HB2  . ALA B 2 16 ? 2.901   -8.684  -1.172  1.00 0.00 ? 53   ALA A HB2  1  
ATOM 1476  H HB3  . ALA B 2 16 ? 4.146   -9.186  -0.028  1.00 0.00 ? 53   ALA A HB3  1  
ATOM 1477  N N    . ILE B 2 17 ? 0.724   -7.115  -0.327  1.00 0.00 ? 54   ILE A N    1  
ATOM 1478  C CA   . ILE B 2 17 ? -0.294  -6.253  -0.909  1.00 0.00 ? 54   ILE A CA   1  
ATOM 1479  C C    . ILE B 2 17 ? -0.728  -5.181  0.086   1.00 0.00 ? 54   ILE A C    1  
ATOM 1480  O O    . ILE B 2 17 ? -0.936  -4.026  -0.280  1.00 0.00 ? 54   ILE A O    1  
ATOM 1481  C CB   . ILE B 2 17 ? -1.504  -7.087  -1.323  1.00 0.00 ? 54   ILE A CB   1  
ATOM 1482  C CG1  . ILE B 2 17 ? -1.132  -7.973  -2.517  1.00 0.00 ? 54   ILE A CG1  1  
ATOM 1483  C CG2  . ILE B 2 17 ? -2.653  -6.160  -1.708  1.00 0.00 ? 54   ILE A CG2  1  
ATOM 1484  C CD1  . ILE B 2 17 ? -2.256  -8.975  -2.777  1.00 0.00 ? 54   ILE A CD1  1  
ATOM 1485  H H    . ILE B 2 17 ? 0.548   -8.076  -0.248  1.00 0.00 ? 54   ILE A H    1  
ATOM 1486  H HA   . ILE B 2 17 ? 0.111   -5.771  -1.782  1.00 0.00 ? 54   ILE A HA   1  
ATOM 1487  H HB   . ILE B 2 17 ? -1.805  -7.710  -0.495  1.00 0.00 ? 54   ILE A HB   1  
ATOM 1488  H HG12 . ILE B 2 17 ? -0.994  -7.357  -3.392  1.00 0.00 ? 54   ILE A HG12 1  
ATOM 1489  H HG13 . ILE B 2 17 ? -0.218  -8.506  -2.302  1.00 0.00 ? 54   ILE A HG13 1  
ATOM 1490  H HG21 . ILE B 2 17 ? -2.293  -5.409  -2.395  1.00 0.00 ? 54   ILE A HG21 1  
ATOM 1491  H HG22 . ILE B 2 17 ? -3.038  -5.682  -0.819  1.00 0.00 ? 54   ILE A HG22 1  
ATOM 1492  H HG23 . ILE B 2 17 ? -3.437  -6.734  -2.175  1.00 0.00 ? 54   ILE A HG23 1  
ATOM 1493  H HD11 . ILE B 2 17 ? -1.981  -9.621  -3.597  1.00 0.00 ? 54   ILE A HD11 1  
ATOM 1494  H HD12 . ILE B 2 17 ? -3.162  -8.440  -3.026  1.00 0.00 ? 54   ILE A HD12 1  
ATOM 1495  H HD13 . ILE B 2 17 ? -2.422  -9.568  -1.890  1.00 0.00 ? 54   ILE A HD13 1  
ATOM 1496  N N    . LEU B 2 18 ? -0.879  -5.576  1.341   1.00 0.00 ? 55   LEU A N    1  
ATOM 1497  C CA   . LEU B 2 18 ? -1.310  -4.644  2.375   1.00 0.00 ? 55   LEU A CA   1  
ATOM 1498  C C    . LEU B 2 18 ? -0.135  -4.177  3.237   1.00 0.00 ? 55   LEU A C    1  
ATOM 1499  O O    . LEU B 2 18 ? -0.318  -3.799  4.393   1.00 0.00 ? 55   LEU A O    1  
ATOM 1500  C CB   . LEU B 2 18 ? -2.369  -5.310  3.251   1.00 0.00 ? 55   LEU A CB   1  
ATOM 1501  C CG   . LEU B 2 18 ? -3.571  -5.709  2.384   1.00 0.00 ? 55   LEU A CG   1  
ATOM 1502  C CD1  . LEU B 2 18 ? -4.592  -6.459  3.238   1.00 0.00 ? 55   LEU A CD1  1  
ATOM 1503  C CD2  . LEU B 2 18 ? -4.230  -4.454  1.802   1.00 0.00 ? 55   LEU A CD2  1  
ATOM 1504  H H    . LEU B 2 18 ? -0.710  -6.513  1.575   1.00 0.00 ? 55   LEU A H    1  
ATOM 1505  H HA   . LEU B 2 18 ? -1.747  -3.780  1.901   1.00 0.00 ? 55   LEU A HA   1  
ATOM 1506  H HB2  . LEU B 2 18 ? -1.950  -6.190  3.714   1.00 0.00 ? 55   LEU A HB2  1  
ATOM 1507  H HB3  . LEU B 2 18 ? -2.690  -4.620  4.014   1.00 0.00 ? 55   LEU A HB3  1  
ATOM 1508  H HG   . LEU B 2 18 ? -3.235  -6.348  1.579   1.00 0.00 ? 55   LEU A HG   1  
ATOM 1509  H HD11 . LEU B 2 18 ? -4.527  -6.118  4.258   1.00 0.00 ? 55   LEU A HD11 1  
ATOM 1510  H HD12 . LEU B 2 18 ? -4.383  -7.518  3.199   1.00 0.00 ? 55   LEU A HD12 1  
ATOM 1511  H HD13 . LEU B 2 18 ? -5.584  -6.273  2.856   1.00 0.00 ? 55   LEU A HD13 1  
ATOM 1512  H HD21 . LEU B 2 18 ? -3.876  -3.582  2.332   1.00 0.00 ? 55   LEU A HD21 1  
ATOM 1513  H HD22 . LEU B 2 18 ? -5.302  -4.528  1.906   1.00 0.00 ? 55   LEU A HD22 1  
ATOM 1514  H HD23 . LEU B 2 18 ? -3.975  -4.365  0.755   1.00 0.00 ? 55   LEU A HD23 1  
ATOM 1515  N N    . ASP B 2 19 ? 1.072   -4.198  2.673   1.00 0.00 ? 56   ASP A N    1  
ATOM 1516  C CA   . ASP B 2 19 ? 2.252   -3.758  3.416   1.00 0.00 ? 56   ASP A CA   1  
ATOM 1517  C C    . ASP B 2 19 ? 3.278   -3.149  2.471   1.00 0.00 ? 56   ASP A C    1  
ATOM 1518  O O    . ASP B 2 19 ? 3.617   -1.970  2.577   1.00 0.00 ? 56   ASP A O    1  
ATOM 1519  C CB   . ASP B 2 19 ? 2.876   -4.943  4.149   1.00 0.00 ? 56   ASP A CB   1  
ATOM 1520  C CG   . ASP B 2 19 ? 3.879   -4.450  5.184   1.00 0.00 ? 56   ASP A CG   1  
ATOM 1521  O OD1  . ASP B 2 19 ? 3.889   -3.262  5.451   1.00 0.00 ? 56   ASP A OD1  1  
ATOM 1522  O OD2  . ASP B 2 19 ? 4.623   -5.271  5.693   1.00 0.00 ? 56   ASP A OD2  1  
ATOM 1523  H H    . ASP B 2 19 ? 1.170   -4.507  1.746   1.00 0.00 ? 56   ASP A H    1  
ATOM 1524  H HA   . ASP B 2 19 ? 1.955   -3.015  4.140   1.00 0.00 ? 56   ASP A HA   1  
ATOM 1525  H HB2  . ASP B 2 19 ? 2.098   -5.506  4.644   1.00 0.00 ? 56   ASP A HB2  1  
ATOM 1526  H HB3  . ASP B 2 19 ? 3.380   -5.579  3.437   1.00 0.00 ? 56   ASP A HB3  1  
ATOM 1527  N N    . GLY B 2 20 ? 3.753   -3.960  1.537   1.00 0.00 ? 57   GLY A N    1  
ATOM 1528  C CA   . GLY B 2 20 ? 4.729   -3.492  0.561   1.00 0.00 ? 57   GLY A CA   1  
ATOM 1529  C C    . GLY B 2 20 ? 4.040   -2.876  -0.659  1.00 0.00 ? 57   GLY A C    1  
ATOM 1530  O O    . GLY B 2 20 ? 4.706   -2.371  -1.565  1.00 0.00 ? 57   GLY A O    1  
ATOM 1531  H H    . GLY B 2 20 ? 3.434   -4.887  1.500   1.00 0.00 ? 57   GLY A H    1  
ATOM 1532  H HA2  . GLY B 2 20 ? 5.363   -2.749  1.023   1.00 0.00 ? 57   GLY A HA2  1  
ATOM 1533  H HA3  . GLY B 2 20 ? 5.336   -4.327  0.238   1.00 0.00 ? 57   GLY A HA3  1  
ATOM 1534  N N    . GLY B 2 21 ? 2.706   -2.921  -0.682  1.00 0.00 ? 58   GLY A N    1  
ATOM 1535  C CA   . GLY B 2 21 ? 1.953   -2.365  -1.800  1.00 0.00 ? 58   GLY A CA   1  
ATOM 1536  C C    . GLY B 2 21 ? 2.155   -3.205  -3.055  1.00 0.00 ? 58   GLY A C    1  
ATOM 1537  O O    . GLY B 2 21 ? 1.970   -2.723  -4.173  1.00 0.00 ? 58   GLY A O    1  
ATOM 1538  H H    . GLY B 2 21 ? 2.221   -3.336  0.059   1.00 0.00 ? 58   GLY A H    1  
ATOM 1539  H HA2  . GLY B 2 21 ? 0.902   -2.348  -1.548  1.00 0.00 ? 58   GLY A HA2  1  
ATOM 1540  H HA3  . GLY B 2 21 ? 2.289   -1.358  -1.993  1.00 0.00 ? 58   GLY A HA3  1  
ATOM 1541  N N    . ALA B 2 22 ? 2.545   -4.463  -2.865  1.00 0.00 ? 59   ALA A N    1  
ATOM 1542  C CA   . ALA B 2 22 ? 2.783   -5.355  -3.995  1.00 0.00 ? 59   ALA A CA   1  
ATOM 1543  C C    . ALA B 2 22 ? 1.467   -5.766  -4.651  1.00 0.00 ? 59   ALA A C    1  
ATOM 1544  O O    . ALA B 2 22 ? 0.409   -5.689  -4.034  1.00 0.00 ? 59   ALA A O    1  
ATOM 1545  C CB   . ALA B 2 22 ? 3.516   -6.607  -3.528  1.00 0.00 ? 59   ALA A CB   1  
ATOM 1546  H H    . ALA B 2 22 ? 2.684   -4.792  -1.953  1.00 0.00 ? 59   ALA A H    1  
ATOM 1547  H HA   . ALA B 2 22 ? 3.396   -4.839  -4.716  1.00 0.00 ? 59   ALA A HA   1  
ATOM 1548  H HB1  . ALA B 2 22 ? 4.286   -6.858  -4.241  1.00 0.00 ? 59   ALA A HB1  1  
ATOM 1549  H HB2  . ALA B 2 22 ? 2.813   -7.424  -3.454  1.00 0.00 ? 59   ALA A HB2  1  
ATOM 1550  H HB3  . ALA B 2 22 ? 3.961   -6.427  -2.560  1.00 0.00 ? 59   ALA A HB3  1  
ATOM 1551  N N    . PRO B 2 23 ? 1.516   -6.199  -5.880  1.00 0.00 ? 60   PRO A N    1  
ATOM 1552  C CA   . PRO B 2 23 ? 0.299   -6.636  -6.621  1.00 0.00 ? 60   PRO A CA   1  
ATOM 1553  C C    . PRO B 2 23 ? -0.243  -7.967  -6.108  1.00 0.00 ? 60   PRO A C    1  
ATOM 1554  O O    . PRO B 2 23 ? -1.423  -8.273  -6.272  1.00 0.00 ? 60   PRO A O    1  
ATOM 1555  C CB   . PRO B 2 23 ? 0.781   -6.754  -8.067  1.00 0.00 ? 60   PRO A CB   1  
ATOM 1556  C CG   . PRO B 2 23 ? 2.245   -7.028  -7.968  1.00 0.00 ? 60   PRO A CG   1  
ATOM 1557  C CD   . PRO B 2 23 ? 2.732   -6.327  -6.701  1.00 0.00 ? 60   PRO A CD   1  
ATOM 1558  H HA   . PRO B 2 23 ? -0.460  -5.878  -6.552  1.00 0.00 ? 60   PRO A HA   1  
ATOM 1559  H HB2  . PRO B 2 23 ? 0.278   -7.571  -8.565  1.00 0.00 ? 60   PRO A HB2  1  
ATOM 1560  H HB3  . PRO B 2 23 ? 0.614   -5.829  -8.598  1.00 0.00 ? 60   PRO A HB3  1  
ATOM 1561  H HG2  . PRO B 2 23 ? 2.417   -8.093  -7.896  1.00 0.00 ? 60   PRO A HG2  1  
ATOM 1562  H HG3  . PRO B 2 23 ? 2.759   -6.624  -8.826  1.00 0.00 ? 60   PRO A HG3  1  
ATOM 1563  H HD2  . PRO B 2 23 ? 3.471   -6.932  -6.196  1.00 0.00 ? 60   PRO A HD2  1  
ATOM 1564  H HD3  . PRO B 2 23 ? 3.130   -5.350  -6.934  1.00 0.00 ? 60   PRO A HD3  1  
ATOM 1565  N N    . GLY B 2 24 ? 0.631   -8.753  -5.489  1.00 0.00 ? 61   GLY A N    1  
ATOM 1566  C CA   . GLY B 2 24 ? 0.235   -10.052 -4.959  1.00 0.00 ? 61   GLY A CA   1  
ATOM 1567  C C    . GLY B 2 24 ? 1.108   -11.162 -5.536  1.00 0.00 ? 61   GLY A C    1  
ATOM 1568  O O    . GLY B 2 24 ? 1.500   -11.044 -6.683  1.00 0.00 ? 61   GLY A O    1  
ATOM 1569  O OXT  . GLY B 2 24 ? 1.372   -12.114 -4.819  1.00 0.00 ? 61   GLY A OXT  1  
ATOM 1570  H H    . GLY B 2 24 ? 1.559   -8.456  -5.391  1.00 0.00 ? 61   GLY A H    1  
ATOM 1571  H HA2  . GLY B 2 24 ? 0.334   -10.041 -3.883  1.00 0.00 ? 61   GLY A HA2  1  
ATOM 1572  H HA3  . GLY B 2 24 ? -0.796  -10.242 -5.219  1.00 0.00 ? 61   GLY A HA3  1  
ATOM 1573  N N    . ARG A 1 6  ? 6.076   -6.892  7.828   1.00 0.00 ? 1050 ARG B N    2  
ATOM 1574  C CA   . ARG A 1 6  ? 5.606   -8.121  8.529   1.00 0.00 ? 1050 ARG B CA   2  
ATOM 1575  C C    . ARG A 1 6  ? 4.766   -7.726  9.739   1.00 0.00 ? 1050 ARG B C    2  
ATOM 1576  O O    . ARG A 1 6  ? 5.151   -7.968  10.882  1.00 0.00 ? 1050 ARG B O    2  
ATOM 1577  C CB   . ARG A 1 6  ? 6.815   -8.944  8.985   1.00 0.00 ? 1050 ARG B CB   2  
ATOM 1578  C CG   . ARG A 1 6  ? 6.402   -10.412 9.128   1.00 0.00 ? 1050 ARG B CG   2  
ATOM 1579  C CD   . ARG A 1 6  ? 7.624   -11.254 9.497   1.00 0.00 ? 1050 ARG B CD   2  
ATOM 1580  N NE   . ARG A 1 6  ? 8.584   -11.267 8.399   1.00 0.00 ? 1050 ARG B NE   2  
ATOM 1581  C CZ   . ARG A 1 6  ? 9.777   -11.854 8.516   1.00 0.00 ? 1050 ARG B CZ   2  
ATOM 1582  N NH1  . ARG A 1 6  ? 10.126  -12.446 9.630   1.00 0.00 ? 1050 ARG B NH1  2  
ATOM 1583  N NH2  . ARG A 1 6  ? 10.604  -11.834 7.509   1.00 0.00 ? 1050 ARG B NH2  2  
ATOM 1584  H H    . ARG A 1 6  ? 6.009   -6.078  8.472   1.00 0.00 ? 1050 ARG B H    2  
ATOM 1585  H HA   . ARG A 1 6  ? 5.006   -8.710  7.853   1.00 0.00 ? 1050 ARG B HA   2  
ATOM 1586  H HB2  . ARG A 1 6  ? 7.605   -8.860  8.254   1.00 0.00 ? 1050 ARG B HB2  2  
ATOM 1587  H HB3  . ARG A 1 6  ? 7.164   -8.576  9.938   1.00 0.00 ? 1050 ARG B HB3  2  
ATOM 1588  H HG2  . ARG A 1 6  ? 5.654   -10.501 9.904   1.00 0.00 ? 1050 ARG B HG2  2  
ATOM 1589  H HG3  . ARG A 1 6  ? 5.994   -10.763 8.193   1.00 0.00 ? 1050 ARG B HG3  2  
ATOM 1590  H HD2  . ARG A 1 6  ? 8.094   -10.837 10.374  1.00 0.00 ? 1050 ARG B HD2  2  
ATOM 1591  H HD3  . ARG A 1 6  ? 7.307   -12.266 9.710   1.00 0.00 ? 1050 ARG B HD3  2  
ATOM 1592  H HE   . ARG A 1 6  ? 8.348   -10.832 7.553   1.00 0.00 ? 1050 ARG B HE   2  
ATOM 1593  H HH11 . ARG A 1 6  ? 9.502   -12.467 10.409  1.00 0.00 ? 1050 ARG B HH11 2  
ATOM 1594  H HH12 . ARG A 1 6  ? 11.024  -12.880 9.700   1.00 0.00 ? 1050 ARG B HH12 2  
ATOM 1595  H HH21 . ARG A 1 6  ? 10.344  -11.382 6.655   1.00 0.00 ? 1050 ARG B HH21 2  
ATOM 1596  H HH22 . ARG A 1 6  ? 11.499  -12.271 7.588   1.00 0.00 ? 1050 ARG B HH22 2  
ATOM 1597  N N    . PRO A 1 7  ? 3.631   -7.128  9.502   1.00 0.00 ? 1051 PRO B N    2  
ATOM 1598  C CA   . PRO A 1 7  ? 2.709   -6.690  10.581  1.00 0.00 ? 1051 PRO B CA   2  
ATOM 1599  C C    . PRO A 1 7  ? 2.049   -7.869  11.274  1.00 0.00 ? 1051 PRO B C    2  
ATOM 1600  O O    . PRO A 1 7  ? 1.746   -8.887  10.652  1.00 0.00 ? 1051 PRO B O    2  
ATOM 1601  C CB   . PRO A 1 7  ? 1.674   -5.835  9.851   1.00 0.00 ? 1051 PRO B CB   2  
ATOM 1602  C CG   . PRO A 1 7  ? 1.677   -6.345  8.453   1.00 0.00 ? 1051 PRO B CG   2  
ATOM 1603  C CD   . PRO A 1 7  ? 3.104   -6.809  8.176   1.00 0.00 ? 1051 PRO B CD   2  
ATOM 1604  H HA   . PRO A 1 7  ? 3.235   -6.081  11.300  1.00 0.00 ? 1051 PRO B HA   2  
ATOM 1605  H HB2  . PRO A 1 7  ? 0.697   -5.963  10.299  1.00 0.00 ? 1051 PRO B HB2  2  
ATOM 1606  H HB3  . PRO A 1 7  ? 1.963   -4.796  9.866   1.00 0.00 ? 1051 PRO B HB3  2  
ATOM 1607  H HG2  . PRO A 1 7  ? 0.986   -7.173  8.357   1.00 0.00 ? 1051 PRO B HG2  2  
ATOM 1608  H HG3  . PRO A 1 7  ? 1.415   -5.556  7.768   1.00 0.00 ? 1051 PRO B HG3  2  
ATOM 1609  H HD2  . PRO A 1 7  ? 3.100   -7.686  7.550   1.00 0.00 ? 1051 PRO B HD2  2  
ATOM 1610  H HD3  . PRO A 1 7  ? 3.679   -6.017  7.731   1.00 0.00 ? 1051 PRO B HD3  2  
ATOM 1611  N N    . LYS A 1 8  ? 1.839   -7.715  12.565  1.00 0.00 ? 1052 LYS B N    2  
ATOM 1612  C CA   . LYS A 1 8  ? 1.220   -8.759  13.367  1.00 0.00 ? 1052 LYS B CA   2  
ATOM 1613  C C    . LYS A 1 8  ? -0.223  -9.003  12.939  1.00 0.00 ? 1052 LYS B C    2  
ATOM 1614  O O    . LYS A 1 8  ? -0.747  -10.105 13.103  1.00 0.00 ? 1052 LYS B O    2  
ATOM 1615  C CB   . LYS A 1 8  ? 1.255   -8.349  14.834  1.00 0.00 ? 1052 LYS B CB   2  
ATOM 1616  C CG   . LYS A 1 8  ? 0.347   -7.137  15.043  1.00 0.00 ? 1052 LYS B CG   2  
ATOM 1617  C CD   . LYS A 1 8  ? 0.419   -6.707  16.503  1.00 0.00 ? 1052 LYS B CD   2  
ATOM 1618  C CE   . LYS A 1 8  ? -0.502  -5.510  16.734  1.00 0.00 ? 1052 LYS B CE   2  
ATOM 1619  N NZ   . LYS A 1 8  ? -0.437  -5.108  18.167  1.00 0.00 ? 1052 LYS B NZ   2  
ATOM 1620  H H    . LYS A 1 8  ? 2.111   -6.877  12.988  1.00 0.00 ? 1052 LYS B H    2  
ATOM 1621  H HA   . LYS A 1 8  ? 1.782   -9.672  13.247  1.00 0.00 ? 1052 LYS B HA   2  
ATOM 1622  H HB2  . LYS A 1 8  ? 0.910   -9.170  15.447  1.00 0.00 ? 1052 LYS B HB2  2  
ATOM 1623  H HB3  . LYS A 1 8  ? 2.266   -8.091  15.114  1.00 0.00 ? 1052 LYS B HB3  2  
ATOM 1624  H HG2  . LYS A 1 8  ? 0.675   -6.327  14.406  1.00 0.00 ? 1052 LYS B HG2  2  
ATOM 1625  H HG3  . LYS A 1 8  ? -0.671  -7.398  14.798  1.00 0.00 ? 1052 LYS B HG3  2  
ATOM 1626  H HD2  . LYS A 1 8  ? 0.116   -7.527  17.135  1.00 0.00 ? 1052 LYS B HD2  2  
ATOM 1627  H HD3  . LYS A 1 8  ? 1.435   -6.426  16.739  1.00 0.00 ? 1052 LYS B HD3  2  
ATOM 1628  H HE2  . LYS A 1 8  ? -0.186  -4.685  16.114  1.00 0.00 ? 1052 LYS B HE2  2  
ATOM 1629  H HE3  . LYS A 1 8  ? -1.517  -5.783  16.481  1.00 0.00 ? 1052 LYS B HE3  2  
ATOM 1630  H HZ1  . LYS A 1 8  ? -1.382  -5.192  18.593  1.00 0.00 ? 1052 LYS B HZ1  2  
ATOM 1631  H HZ2  . LYS A 1 8  ? -0.110  -4.124  18.237  1.00 0.00 ? 1052 LYS B HZ2  2  
ATOM 1632  H HZ3  . LYS A 1 8  ? 0.223   -5.732  18.672  1.00 0.00 ? 1052 LYS B HZ3  2  
ATOM 1633  N N    . MET A 1 9  ? -0.870  -7.971  12.402  1.00 0.00 ? 1053 MET B N    2  
ATOM 1634  C CA   . MET A 1 9  ? -2.256  -8.108  11.974  1.00 0.00 ? 1053 MET B CA   2  
ATOM 1635  C C    . MET A 1 9  ? -2.334  -8.920  10.691  1.00 0.00 ? 1053 MET B C    2  
ATOM 1636  O O    . MET A 1 9  ? -1.487  -8.792  9.810   1.00 0.00 ? 1053 MET B O    2  
ATOM 1637  C CB   . MET A 1 9  ? -2.895  -6.733  11.745  1.00 0.00 ? 1053 MET B CB   2  
ATOM 1638  C CG   . MET A 1 9  ? -2.805  -5.898  13.022  1.00 0.00 ? 1053 MET B CG   2  
ATOM 1639  S SD   . MET A 1 9  ? -4.129  -4.658  13.028  1.00 0.00 ? 1053 MET B SD   2  
ATOM 1640  C CE   . MET A 1 9  ? -4.054  -4.234  11.272  1.00 0.00 ? 1053 MET B CE   2  
ATOM 1641  H H    . MET A 1 9  ? -0.411  -7.110  12.299  1.00 0.00 ? 1053 MET B H    2  
ATOM 1642  H HA   . MET A 1 9  ? -2.808  -8.621  12.747  1.00 0.00 ? 1053 MET B HA   2  
ATOM 1643  H HB2  . MET A 1 9  ? -2.375  -6.225  10.946  1.00 0.00 ? 1053 MET B HB2  2  
ATOM 1644  H HB3  . MET A 1 9  ? -3.933  -6.860  11.474  1.00 0.00 ? 1053 MET B HB3  2  
ATOM 1645  H HG2  . MET A 1 9  ? -2.912  -6.542  13.881  1.00 0.00 ? 1053 MET B HG2  2  
ATOM 1646  H HG3  . MET A 1 9  ? -1.847  -5.400  13.061  1.00 0.00 ? 1053 MET B HG3  2  
ATOM 1647  H HE1  . MET A 1 9  ? -3.021  -4.196  10.959  1.00 0.00 ? 1053 MET B HE1  2  
ATOM 1648  H HE2  . MET A 1 9  ? -4.515  -3.274  11.104  1.00 0.00 ? 1053 MET B HE2  2  
ATOM 1649  H HE3  . MET A 1 9  ? -4.584  -4.986  10.699  1.00 0.00 ? 1053 MET B HE3  2  
ATOM 1650  N N    . THR A 1 10 ? -3.360  -9.753  10.593  1.00 0.00 ? 1054 THR B N    2  
ATOM 1651  C CA   . THR A 1 10 ? -3.548  -10.583 9.414   1.00 0.00 ? 1054 THR B CA   2  
ATOM 1652  C C    . THR A 1 10 ? -3.980  -9.714  8.239   1.00 0.00 ? 1054 THR B C    2  
ATOM 1653  O O    . THR A 1 10 ? -4.420  -8.579  8.430   1.00 0.00 ? 1054 THR B O    2  
ATOM 1654  C CB   . THR A 1 10 ? -4.605  -11.651 9.703   1.00 0.00 ? 1054 THR B CB   2  
ATOM 1655  O OG1  . THR A 1 10 ? -5.870  -11.028 9.870   1.00 0.00 ? 1054 THR B OG1  2  
ATOM 1656  C CG2  . THR A 1 10 ? -4.228  -12.399 10.984  1.00 0.00 ? 1054 THR B CG2  2  
ATOM 1657  H H    . THR A 1 10 ? -4.005  -9.809  11.329  1.00 0.00 ? 1054 THR B H    2  
ATOM 1658  H HA   . THR A 1 10 ? -2.616  -11.065 9.171   1.00 0.00 ? 1054 THR B HA   2  
ATOM 1659  H HB   . THR A 1 10 ? -4.650  -12.349 8.885   1.00 0.00 ? 1054 THR B HB   2  
ATOM 1660  H HG1  . THR A 1 10 ? -6.385  -11.559 10.480  1.00 0.00 ? 1054 THR B HG1  2  
ATOM 1661  H HG21 . THR A 1 10 ? -4.179  -11.702 11.808  1.00 0.00 ? 1054 THR B HG21 2  
ATOM 1662  H HG22 . THR A 1 10 ? -3.266  -12.870 10.855  1.00 0.00 ? 1054 THR B HG22 2  
ATOM 1663  H HG23 . THR A 1 10 ? -4.973  -13.153 11.193  1.00 0.00 ? 1054 THR B HG23 2  
ATOM 1664  N N    . PRO A 1 11 ? -3.852  -10.201 7.036   1.00 0.00 ? 1055 PRO B N    2  
ATOM 1665  C CA   . PRO A 1 11 ? -4.232  -9.420  5.823   1.00 0.00 ? 1055 PRO B CA   2  
ATOM 1666  C C    . PRO A 1 11 ? -5.651  -8.874  5.926   1.00 0.00 ? 1055 PRO B C    2  
ATOM 1667  O O    . PRO A 1 11 ? -5.907  -7.714  5.599   1.00 0.00 ? 1055 PRO B O    2  
ATOM 1668  C CB   . PRO A 1 11 ? -4.126  -10.453 4.700   1.00 0.00 ? 1055 PRO B CB   2  
ATOM 1669  C CG   . PRO A 1 11 ? -3.100  -11.418 5.183   1.00 0.00 ? 1055 PRO B CG   2  
ATOM 1670  C CD   . PRO A 1 11 ? -3.333  -11.535 6.685   1.00 0.00 ? 1055 PRO B CD   2  
ATOM 1671  H HA   . PRO A 1 11 ? -3.531  -8.622  5.651   1.00 0.00 ? 1055 PRO B HA   2  
ATOM 1672  H HB2  . PRO A 1 11 ? -5.078  -10.949 4.554   1.00 0.00 ? 1055 PRO B HB2  2  
ATOM 1673  H HB3  . PRO A 1 11 ? -3.797  -9.985  3.786   1.00 0.00 ? 1055 PRO B HB3  2  
ATOM 1674  H HG2  . PRO A 1 11 ? -3.234  -12.377 4.700   1.00 0.00 ? 1055 PRO B HG2  2  
ATOM 1675  H HG3  . PRO A 1 11 ? -2.109  -11.037 4.995   1.00 0.00 ? 1055 PRO B HG3  2  
ATOM 1676  H HD2  . PRO A 1 11 ? -4.066  -12.303 6.895   1.00 0.00 ? 1055 PRO B HD2  2  
ATOM 1677  H HD3  . PRO A 1 11 ? -2.408  -11.729 7.205   1.00 0.00 ? 1055 PRO B HD3  2  
ATOM 1678  N N    . GLU A 1 12 ? -6.566  -9.713  6.399   1.00 0.00 ? 1056 GLU B N    2  
ATOM 1679  C CA   . GLU A 1 12 ? -7.950  -9.295  6.554   1.00 0.00 ? 1056 GLU B CA   2  
ATOM 1680  C C    . GLU A 1 12 ? -8.062  -8.198  7.606   1.00 0.00 ? 1056 GLU B C    2  
ATOM 1681  O O    . GLU A 1 12 ? -8.807  -7.235  7.433   1.00 0.00 ? 1056 GLU B O    2  
ATOM 1682  C CB   . GLU A 1 12 ? -8.816  -10.488 6.960   1.00 0.00 ? 1056 GLU B CB   2  
ATOM 1683  C CG   . GLU A 1 12 ? -8.930  -11.457 5.783   1.00 0.00 ? 1056 GLU B CG   2  
ATOM 1684  C CD   . GLU A 1 12 ? -9.701  -12.702 6.206   1.00 0.00 ? 1056 GLU B CD   2  
ATOM 1685  O OE1  . GLU A 1 12 ? -9.947  -12.847 7.392   1.00 0.00 ? 1056 GLU B OE1  2  
ATOM 1686  O OE2  . GLU A 1 12 ? -10.035 -13.491 5.339   1.00 0.00 ? 1056 GLU B OE2  2  
ATOM 1687  H H    . GLU A 1 12 ? -6.303  -10.621 6.656   1.00 0.00 ? 1056 GLU B H    2  
ATOM 1688  H HA   . GLU A 1 12 ? -8.308  -8.913  5.610   1.00 0.00 ? 1056 GLU B HA   2  
ATOM 1689  H HB2  . GLU A 1 12 ? -8.361  -10.992 7.801   1.00 0.00 ? 1056 GLU B HB2  2  
ATOM 1690  H HB3  . GLU A 1 12 ? -9.800  -10.142 7.236   1.00 0.00 ? 1056 GLU B HB3  2  
ATOM 1691  H HG2  . GLU A 1 12 ? -9.449  -10.972 4.969   1.00 0.00 ? 1056 GLU B HG2  2  
ATOM 1692  H HG3  . GLU A 1 12 ? -7.941  -11.744 5.456   1.00 0.00 ? 1056 GLU B HG3  2  
ATOM 1693  N N    . GLN A 1 13 ? -7.317  -8.347  8.697   1.00 0.00 ? 1057 GLN B N    2  
ATOM 1694  C CA   . GLN A 1 13 ? -7.352  -7.350  9.761   1.00 0.00 ? 1057 GLN B CA   2  
ATOM 1695  C C    . GLN A 1 13 ? -6.820  -6.014  9.275   1.00 0.00 ? 1057 GLN B C    2  
ATOM 1696  O O    . GLN A 1 13 ? -7.371  -4.964  9.609   1.00 0.00 ? 1057 GLN B O    2  
ATOM 1697  C CB   . GLN A 1 13 ? -6.534  -7.817  10.960  1.00 0.00 ? 1057 GLN B CB   2  
ATOM 1698  C CG   . GLN A 1 13 ? -7.272  -8.951  11.665  1.00 0.00 ? 1057 GLN B CG   2  
ATOM 1699  C CD   . GLN A 1 13 ? -6.448  -9.440  12.849  1.00 0.00 ? 1057 GLN B CD   2  
ATOM 1700  O OE1  . GLN A 1 13 ? -6.054  -10.605 12.895  1.00 0.00 ? 1057 GLN B OE1  2  
ATOM 1701  N NE2  . GLN A 1 13 ? -6.150  -8.606  13.806  1.00 0.00 ? 1057 GLN B NE2  2  
ATOM 1702  H H    . GLN A 1 13 ? -6.734  -9.132  8.786   1.00 0.00 ? 1057 GLN B H    2  
ATOM 1703  H HA   . GLN A 1 13 ? -8.377  -7.220  10.075  1.00 0.00 ? 1057 GLN B HA   2  
ATOM 1704  H HB2  . GLN A 1 13 ? -5.569  -8.168  10.624  1.00 0.00 ? 1057 GLN B HB2  2  
ATOM 1705  H HB3  . GLN A 1 13 ? -6.401  -6.996  11.648  1.00 0.00 ? 1057 GLN B HB3  2  
ATOM 1706  H HG2  . GLN A 1 13 ? -8.228  -8.589  12.015  1.00 0.00 ? 1057 GLN B HG2  2  
ATOM 1707  H HG3  . GLN A 1 13 ? -7.427  -9.763  10.973  1.00 0.00 ? 1057 GLN B HG3  2  
ATOM 1708  H HE21 . GLN A 1 13 ? -6.453  -7.674  13.759  1.00 0.00 ? 1057 GLN B HE21 2  
ATOM 1709  H HE22 . GLN A 1 13 ? -5.619  -8.910  14.573  1.00 0.00 ? 1057 GLN B HE22 2  
ATOM 1710  N N    . MET A 1 14 ? -5.750  -6.046  8.492   1.00 0.00 ? 1058 MET B N    2  
ATOM 1711  C CA   . MET A 1 14 ? -5.181  -4.810  7.986   1.00 0.00 ? 1058 MET B CA   2  
ATOM 1712  C C    . MET A 1 14 ? -6.183  -4.108  7.086   1.00 0.00 ? 1058 MET B C    2  
ATOM 1713  O O    . MET A 1 14 ? -6.328  -2.889  7.140   1.00 0.00 ? 1058 MET B O    2  
ATOM 1714  C CB   . MET A 1 14 ? -3.889  -5.077  7.212   1.00 0.00 ? 1058 MET B CB   2  
ATOM 1715  C CG   . MET A 1 14 ? -2.793  -5.525  8.178   1.00 0.00 ? 1058 MET B CG   2  
ATOM 1716  S SD   . MET A 1 14 ? -1.190  -5.490  7.338   1.00 0.00 ? 1058 MET B SD   2  
ATOM 1717  C CE   . MET A 1 14 ? -1.428  -6.921  6.260   1.00 0.00 ? 1058 MET B CE   2  
ATOM 1718  H H    . MET A 1 14 ? -5.342  -6.907  8.255   1.00 0.00 ? 1058 MET B H    2  
ATOM 1719  H HA   . MET A 1 14 ? -4.958  -4.165  8.820   1.00 0.00 ? 1058 MET B HA   2  
ATOM 1720  H HB2  . MET A 1 14 ? -4.063  -5.847  6.476   1.00 0.00 ? 1058 MET B HB2  2  
ATOM 1721  H HB3  . MET A 1 14 ? -3.575  -4.172  6.717   1.00 0.00 ? 1058 MET B HB3  2  
ATOM 1722  H HG2  . MET A 1 14 ? -2.767  -4.858  9.024   1.00 0.00 ? 1058 MET B HG2  2  
ATOM 1723  H HG3  . MET A 1 14 ? -3.000  -6.529  8.517   1.00 0.00 ? 1058 MET B HG3  2  
ATOM 1724  H HE1  . MET A 1 14 ? -1.402  -7.823  6.855   1.00 0.00 ? 1058 MET B HE1  2  
ATOM 1725  H HE2  . MET A 1 14 ? -0.637  -6.953  5.526   1.00 0.00 ? 1058 MET B HE2  2  
ATOM 1726  H HE3  . MET A 1 14 ? -2.381  -6.839  5.758   1.00 0.00 ? 1058 MET B HE3  2  
ATOM 1727  N N    . ALA A 1 15 ? -6.881  -4.879  6.262   1.00 0.00 ? 1059 ALA B N    2  
ATOM 1728  C CA   . ALA A 1 15 ? -7.865  -4.292  5.364   1.00 0.00 ? 1059 ALA B CA   2  
ATOM 1729  C C    . ALA A 1 15 ? -8.982  -3.623  6.155   1.00 0.00 ? 1059 ALA B C    2  
ATOM 1730  O O    . ALA A 1 15 ? -9.439  -2.536  5.800   1.00 0.00 ? 1059 ALA B O    2  
ATOM 1731  C CB   . ALA A 1 15 ? -8.461  -5.360  4.451   1.00 0.00 ? 1059 ALA B CB   2  
ATOM 1732  H H    . ALA A 1 15 ? -6.736  -5.852  6.261   1.00 0.00 ? 1059 ALA B H    2  
ATOM 1733  H HA   . ALA A 1 15 ? -7.377  -3.548  4.756   1.00 0.00 ? 1059 ALA B HA   2  
ATOM 1734  H HB1  . ALA A 1 15 ? -9.357  -4.973  3.989   1.00 0.00 ? 1059 ALA B HB1  2  
ATOM 1735  H HB2  . ALA A 1 15 ? -8.704  -6.236  5.032   1.00 0.00 ? 1059 ALA B HB2  2  
ATOM 1736  H HB3  . ALA A 1 15 ? -7.745  -5.621  3.686   1.00 0.00 ? 1059 ALA B HB3  2  
ATOM 1737  N N    . LYS A 1 16 ? -9.423  -4.279  7.223   1.00 0.00 ? 1060 LYS B N    2  
ATOM 1738  C CA   . LYS A 1 16 ? -10.492 -3.731  8.043   1.00 0.00 ? 1060 LYS B CA   2  
ATOM 1739  C C    . LYS A 1 16 ? -10.066 -2.411  8.673   1.00 0.00 ? 1060 LYS B C    2  
ATOM 1740  O O    . LYS A 1 16 ? -10.844 -1.456  8.716   1.00 0.00 ? 1060 LYS B O    2  
ATOM 1741  C CB   . LYS A 1 16 ? -10.873 -4.724  9.144   1.00 0.00 ? 1060 LYS B CB   2  
ATOM 1742  C CG   . LYS A 1 16 ? -11.575 -5.935  8.525   1.00 0.00 ? 1060 LYS B CG   2  
ATOM 1743  C CD   . LYS A 1 16 ? -11.931 -6.934  9.628   1.00 0.00 ? 1060 LYS B CD   2  
ATOM 1744  C CE   . LYS A 1 16 ? -12.639 -8.144  9.019   1.00 0.00 ? 1060 LYS B CE   2  
ATOM 1745  N NZ   . LYS A 1 16 ? -12.968 -9.120  10.094  1.00 0.00 ? 1060 LYS B NZ   2  
ATOM 1746  H H    . LYS A 1 16 ? -9.026  -5.145  7.458   1.00 0.00 ? 1060 LYS B H    2  
ATOM 1747  H HA   . LYS A 1 16 ? -11.355 -3.557  7.421   1.00 0.00 ? 1060 LYS B HA   2  
ATOM 1748  H HB2  . LYS A 1 16 ? -9.982  -5.049  9.660   1.00 0.00 ? 1060 LYS B HB2  2  
ATOM 1749  H HB3  . LYS A 1 16 ? -11.541 -4.245  9.844   1.00 0.00 ? 1060 LYS B HB3  2  
ATOM 1750  H HG2  . LYS A 1 16 ? -12.476 -5.614  8.025   1.00 0.00 ? 1060 LYS B HG2  2  
ATOM 1751  H HG3  . LYS A 1 16 ? -10.916 -6.410  7.814   1.00 0.00 ? 1060 LYS B HG3  2  
ATOM 1752  H HD2  . LYS A 1 16 ? -11.027 -7.257  10.126  1.00 0.00 ? 1060 LYS B HD2  2  
ATOM 1753  H HD3  . LYS A 1 16 ? -12.585 -6.460  10.344  1.00 0.00 ? 1060 LYS B HD3  2  
ATOM 1754  H HE2  . LYS A 1 16 ? -13.549 -7.822  8.533   1.00 0.00 ? 1060 LYS B HE2  2  
ATOM 1755  H HE3  . LYS A 1 16 ? -11.990 -8.612  8.292   1.00 0.00 ? 1060 LYS B HE3  2  
ATOM 1756  H HZ1  . LYS A 1 16 ? -13.940 -9.465  9.966   1.00 0.00 ? 1060 LYS B HZ1  2  
ATOM 1757  H HZ2  . LYS A 1 16 ? -12.883 -8.654  11.022  1.00 0.00 ? 1060 LYS B HZ2  2  
ATOM 1758  H HZ3  . LYS A 1 16 ? -12.309 -9.923  10.047  1.00 0.00 ? 1060 LYS B HZ3  2  
ATOM 1759  N N    . GLU A 1 17 ? -8.830  -2.353  9.155   1.00 0.00 ? 1061 GLU B N    2  
ATOM 1760  C CA   . GLU A 1 17 ? -8.341  -1.129  9.772   1.00 0.00 ? 1061 GLU B CA   2  
ATOM 1761  C C    . GLU A 1 17 ? -8.269  0.002   8.744   1.00 0.00 ? 1061 GLU B C    2  
ATOM 1762  O O    . GLU A 1 17 ? -8.606  1.146   9.052   1.00 0.00 ? 1061 GLU B O    2  
ATOM 1763  C CB   . GLU A 1 17 ? -6.965  -1.368  10.406  1.00 0.00 ? 1061 GLU B CB   2  
ATOM 1764  C CG   . GLU A 1 17 ? -7.108  -2.280  11.634  1.00 0.00 ? 1061 GLU B CG   2  
ATOM 1765  C CD   . GLU A 1 17 ? -8.017  -1.631  12.675  1.00 0.00 ? 1061 GLU B CD   2  
ATOM 1766  O OE1  . GLU A 1 17 ? -7.798  -0.472  12.982  1.00 0.00 ? 1061 GLU B OE1  2  
ATOM 1767  O OE2  . GLU A 1 17 ? -8.917  -2.304  13.150  1.00 0.00 ? 1061 GLU B OE2  2  
ATOM 1768  H H    . GLU A 1 17 ? -8.240  -3.138  9.097   1.00 0.00 ? 1061 GLU B H    2  
ATOM 1769  H HA   . GLU A 1 17 ? -9.033  -0.836  10.546  1.00 0.00 ? 1061 GLU B HA   2  
ATOM 1770  H HB2  . GLU A 1 17 ? -6.313  -1.838  9.683   1.00 0.00 ? 1061 GLU B HB2  2  
ATOM 1771  H HB3  . GLU A 1 17 ? -6.542  -0.424  10.711  1.00 0.00 ? 1061 GLU B HB3  2  
ATOM 1772  H HG2  . GLU A 1 17 ? -7.531  -3.226  11.331  1.00 0.00 ? 1061 GLU B HG2  2  
ATOM 1773  H HG3  . GLU A 1 17 ? -6.136  -2.448  12.071  1.00 0.00 ? 1061 GLU B HG3  2  
ATOM 1774  N N    . MET A 1 18 ? -7.836  -0.317  7.523   1.00 0.00 ? 1062 MET B N    2  
ATOM 1775  C CA   . MET A 1 18 ? -7.741  0.702   6.480   1.00 0.00 ? 1062 MET B CA   2  
ATOM 1776  C C    . MET A 1 18 ? -9.117  1.267   6.156   1.00 0.00 ? 1062 MET B C    2  
ATOM 1777  O O    . MET A 1 18 ? -9.276  2.472   5.982   1.00 0.00 ? 1062 MET B O    2  
ATOM 1778  C CB   . MET A 1 18 ? -7.148  0.095   5.213   1.00 0.00 ? 1062 MET B CB   2  
ATOM 1779  C CG   . MET A 1 18 ? -5.695  -0.284  5.470   1.00 0.00 ? 1062 MET B CG   2  
ATOM 1780  S SD   . MET A 1 18 ? -5.078  -1.253  4.074   1.00 0.00 ? 1062 MET B SD   2  
ATOM 1781  C CE   . MET A 1 18 ? -3.883  -2.239  5.003   1.00 0.00 ? 1062 MET B CE   2  
ATOM 1782  H H    . MET A 1 18 ? -7.578  -1.246  7.319   1.00 0.00 ? 1062 MET B H    2  
ATOM 1783  H HA   . MET A 1 18 ? -7.099  1.500   6.823   1.00 0.00 ? 1062 MET B HA   2  
ATOM 1784  H HB2  . MET A 1 18 ? -7.709  -0.785  4.941   1.00 0.00 ? 1062 MET B HB2  2  
ATOM 1785  H HB3  . MET A 1 18 ? -7.193  0.817   4.412   1.00 0.00 ? 1062 MET B HB3  2  
ATOM 1786  H HG2  . MET A 1 18 ? -5.103  0.613   5.576   1.00 0.00 ? 1062 MET B HG2  2  
ATOM 1787  H HG3  . MET A 1 18 ? -5.632  -0.864  6.374   1.00 0.00 ? 1062 MET B HG3  2  
ATOM 1788  H HE1  . MET A 1 18 ? -2.888  -2.053  4.624   1.00 0.00 ? 1062 MET B HE1  2  
ATOM 1789  H HE2  . MET A 1 18 ? -4.119  -3.284  4.894   1.00 0.00 ? 1062 MET B HE2  2  
ATOM 1790  H HE3  . MET A 1 18 ? -3.932  -1.971  6.050   1.00 0.00 ? 1062 MET B HE3  2  
ATOM 1791  N N    . SER A 1 19 ? -10.109 0.389   6.082   1.00 0.00 ? 1063 SER B N    2  
ATOM 1792  C CA   . SER A 1 19 ? -11.466 0.822   5.777   1.00 0.00 ? 1063 SER B CA   2  
ATOM 1793  C C    . SER A 1 19 ? -11.969 1.776   6.850   1.00 0.00 ? 1063 SER B C    2  
ATOM 1794  O O    . SER A 1 19 ? -12.608 2.783   6.548   1.00 0.00 ? 1063 SER B O    2  
ATOM 1795  C CB   . SER A 1 19 ? -12.401 -0.385  5.682   1.00 0.00 ? 1063 SER B CB   2  
ATOM 1796  O OG   . SER A 1 19 ? -13.716 0.066   5.385   1.00 0.00 ? 1063 SER B OG   2  
ATOM 1797  H H    . SER A 1 19 ? -9.929  -0.563  6.235   1.00 0.00 ? 1063 SER B H    2  
ATOM 1798  H HA   . SER A 1 19 ? -11.463 1.335   4.828   1.00 0.00 ? 1063 SER B HA   2  
ATOM 1799  H HB2  . SER A 1 19 ? -12.066 -1.040  4.896   1.00 0.00 ? 1063 SER B HB2  2  
ATOM 1800  H HB3  . SER A 1 19 ? -12.396 -0.919  6.621   1.00 0.00 ? 1063 SER B HB3  2  
ATOM 1801  H HG   . SER A 1 19 ? -13.731 0.360   4.471   1.00 0.00 ? 1063 SER B HG   2  
ATOM 1802  N N    . GLU A 1 20 ? -11.687 1.445   8.104   1.00 0.00 ? 1064 GLU B N    2  
ATOM 1803  C CA   . GLU A 1 20 ? -12.128 2.274   9.216   1.00 0.00 ? 1064 GLU B CA   2  
ATOM 1804  C C    . GLU A 1 20 ? -11.535 3.678   9.134   1.00 0.00 ? 1064 GLU B C    2  
ATOM 1805  O O    . GLU A 1 20 ? -12.236 4.666   9.353   1.00 0.00 ? 1064 GLU B O    2  
ATOM 1806  C CB   . GLU A 1 20 ? -11.695 1.631   10.531  1.00 0.00 ? 1064 GLU B CB   2  
ATOM 1807  C CG   . GLU A 1 20 ? -12.507 0.360   10.783  1.00 0.00 ? 1064 GLU B CG   2  
ATOM 1808  C CD   . GLU A 1 20 ? -11.970 -0.362  12.015  1.00 0.00 ? 1064 GLU B CD   2  
ATOM 1809  O OE1  . GLU A 1 20 ? -10.906 0.014   12.478  1.00 0.00 ? 1064 GLU B OE1  2  
ATOM 1810  O OE2  . GLU A 1 20 ? -12.630 -1.278  12.476  1.00 0.00 ? 1064 GLU B OE2  2  
ATOM 1811  H H    . GLU A 1 20 ? -11.182 0.623   8.284   1.00 0.00 ? 1064 GLU B H    2  
ATOM 1812  H HA   . GLU A 1 20 ? -13.204 2.344   9.200   1.00 0.00 ? 1064 GLU B HA   2  
ATOM 1813  H HB2  . GLU A 1 20 ? -10.645 1.383   10.474  1.00 0.00 ? 1064 GLU B HB2  2  
ATOM 1814  H HB3  . GLU A 1 20 ? -11.856 2.327   11.340  1.00 0.00 ? 1064 GLU B HB3  2  
ATOM 1815  H HG2  . GLU A 1 20 ? -13.543 0.620   10.942  1.00 0.00 ? 1064 GLU B HG2  2  
ATOM 1816  H HG3  . GLU A 1 20 ? -12.429 -0.291  9.926   1.00 0.00 ? 1064 GLU B HG3  2  
ATOM 1817  N N    . PHE A 1 21 ? -10.245 3.772   8.817   1.00 0.00 ? 1065 PHE B N    2  
ATOM 1818  C CA   . PHE A 1 21 ? -9.600  5.080   8.718   1.00 0.00 ? 1065 PHE B CA   2  
ATOM 1819  C C    . PHE A 1 21 ? -10.112 5.840   7.501   1.00 0.00 ? 1065 PHE B C    2  
ATOM 1820  O O    . PHE A 1 21 ? -10.334 7.054   7.554   1.00 0.00 ? 1065 PHE B O    2  
ATOM 1821  C CB   . PHE A 1 21 ? -8.082  4.914   8.618   1.00 0.00 ? 1065 PHE B CB   2  
ATOM 1822  C CG   . PHE A 1 21 ? -7.531  4.527   9.970   1.00 0.00 ? 1065 PHE B CG   2  
ATOM 1823  C CD1  . PHE A 1 21 ? -7.012  3.243   10.172  1.00 0.00 ? 1065 PHE B CD1  2  
ATOM 1824  C CD2  . PHE A 1 21 ? -7.546  5.451   11.020  1.00 0.00 ? 1065 PHE B CD2  2  
ATOM 1825  C CE1  . PHE A 1 21 ? -6.506  2.885   11.430  1.00 0.00 ? 1065 PHE B CE1  2  
ATOM 1826  C CE2  . PHE A 1 21 ? -7.042  5.094   12.276  1.00 0.00 ? 1065 PHE B CE2  2  
ATOM 1827  C CZ   . PHE A 1 21 ? -6.522  3.810   12.480  1.00 0.00 ? 1065 PHE B CZ   2  
ATOM 1828  H H    . PHE A 1 21 ? -9.724  2.956   8.646   1.00 0.00 ? 1065 PHE B H    2  
ATOM 1829  H HA   . PHE A 1 21 ? -9.829  5.648   9.608   1.00 0.00 ? 1065 PHE B HA   2  
ATOM 1830  H HB2  . PHE A 1 21 ? -7.852  4.141   7.899   1.00 0.00 ? 1065 PHE B HB2  2  
ATOM 1831  H HB3  . PHE A 1 21 ? -7.638  5.845   8.302   1.00 0.00 ? 1065 PHE B HB3  2  
ATOM 1832  H HD1  . PHE A 1 21 ? -6.997  2.531   9.362   1.00 0.00 ? 1065 PHE B HD1  2  
ATOM 1833  H HD2  . PHE A 1 21 ? -7.947  6.442   10.861  1.00 0.00 ? 1065 PHE B HD2  2  
ATOM 1834  H HE1  . PHE A 1 21 ? -6.107  1.894   11.587  1.00 0.00 ? 1065 PHE B HE1  2  
ATOM 1835  H HE2  . PHE A 1 21 ? -7.054  5.808   13.085  1.00 0.00 ? 1065 PHE B HE2  2  
ATOM 1836  H HZ   . PHE A 1 21 ? -6.134  3.533   13.450  1.00 0.00 ? 1065 PHE B HZ   2  
ATOM 1837  N N    . LEU A 1 22 ? -10.296 5.109   6.409   1.00 0.00 ? 1066 LEU B N    2  
ATOM 1838  C CA   . LEU A 1 22 ? -10.779 5.703   5.169   1.00 0.00 ? 1066 LEU B CA   2  
ATOM 1839  C C    . LEU A 1 22 ? -12.193 6.246   5.344   1.00 0.00 ? 1066 LEU B C    2  
ATOM 1840  O O    . LEU A 1 22 ? -12.526 7.312   4.834   1.00 0.00 ? 1066 LEU B O    2  
ATOM 1841  C CB   . LEU A 1 22 ? -10.760 4.650   4.059   1.00 0.00 ? 1066 LEU B CB   2  
ATOM 1842  C CG   . LEU A 1 22 ? -9.312  4.335   3.679   1.00 0.00 ? 1066 LEU B CG   2  
ATOM 1843  C CD1  . LEU A 1 22 ? -9.278  3.073   2.817   1.00 0.00 ? 1066 LEU B CD1  2  
ATOM 1844  C CD2  . LEU A 1 22 ? -8.724  5.505   2.884   1.00 0.00 ? 1066 LEU B CD2  2  
ATOM 1845  H H    . LEU A 1 22 ? -10.102 4.149   6.440   1.00 0.00 ? 1066 LEU B H    2  
ATOM 1846  H HA   . LEU A 1 22 ? -10.125 6.514   4.891   1.00 0.00 ? 1066 LEU B HA   2  
ATOM 1847  H HB2  . LEU A 1 22 ? -11.247 3.751   4.409   1.00 0.00 ? 1066 LEU B HB2  2  
ATOM 1848  H HB3  . LEU A 1 22 ? -11.283 5.029   3.194   1.00 0.00 ? 1066 LEU B HB3  2  
ATOM 1849  H HG   . LEU A 1 22 ? -8.729  4.178   4.575   1.00 0.00 ? 1066 LEU B HG   2  
ATOM 1850  H HD11 . LEU A 1 22 ? -9.120  2.210   3.450   1.00 0.00 ? 1066 LEU B HD11 2  
ATOM 1851  H HD12 . LEU A 1 22 ? -8.471  3.147   2.102   1.00 0.00 ? 1066 LEU B HD12 2  
ATOM 1852  H HD13 . LEU A 1 22 ? -10.216 2.968   2.294   1.00 0.00 ? 1066 LEU B HD13 2  
ATOM 1853  H HD21 . LEU A 1 22 ? -8.181  6.157   3.553   1.00 0.00 ? 1066 LEU B HD21 2  
ATOM 1854  H HD22 . LEU A 1 22 ? -9.523  6.057   2.413   1.00 0.00 ? 1066 LEU B HD22 2  
ATOM 1855  H HD23 . LEU A 1 22 ? -8.053  5.125   2.127   1.00 0.00 ? 1066 LEU B HD23 2  
ATOM 1856  N N    . SER A 1 23 ? -13.020 5.504   6.070   1.00 0.00 ? 1067 SER B N    2  
ATOM 1857  C CA   . SER A 1 23 ? -14.396 5.920   6.313   1.00 0.00 ? 1067 SER B CA   2  
ATOM 1858  C C    . SER A 1 23 ? -14.429 7.130   7.238   1.00 0.00 ? 1067 SER B C    2  
ATOM 1859  O O    . SER A 1 23 ? -15.229 8.048   7.053   1.00 0.00 ? 1067 SER B O    2  
ATOM 1860  C CB   . SER A 1 23 ? -15.191 4.771   6.931   1.00 0.00 ? 1067 SER B CB   2  
ATOM 1861  O OG   . SER A 1 23 ? -15.292 3.714   5.986   1.00 0.00 ? 1067 SER B OG   2  
ATOM 1862  H H    . SER A 1 23 ? -12.698 4.669   6.458   1.00 0.00 ? 1067 SER B H    2  
ATOM 1863  H HA   . SER A 1 23 ? -14.848 6.191   5.370   1.00 0.00 ? 1067 SER B HA   2  
ATOM 1864  H HB2  . SER A 1 23 ? -14.686 4.413   7.812   1.00 0.00 ? 1067 SER B HB2  2  
ATOM 1865  H HB3  . SER A 1 23 ? -16.178 5.124   7.201   1.00 0.00 ? 1067 SER B HB3  2  
ATOM 1866  H HG   . SER A 1 23 ? -15.927 3.076   6.320   1.00 0.00 ? 1067 SER B HG   2  
ATOM 1867  N N    . ARG A 1 24 ? -13.551 7.121   8.236   1.00 0.00 ? 1068 ARG B N    2  
ATOM 1868  C CA   . ARG A 1 24 ? -13.478 8.210   9.191   1.00 0.00 ? 1068 ARG B CA   2  
ATOM 1869  C C    . ARG A 1 24 ? -13.220 9.546   8.497   1.00 0.00 ? 1068 ARG B C    2  
ATOM 1870  O O    . ARG A 1 24 ? -13.918 10.528  8.752   1.00 0.00 ? 1068 ARG B O    2  
ATOM 1871  C CB   . ARG A 1 24 ? -12.361 7.916   10.198  1.00 0.00 ? 1068 ARG B CB   2  
ATOM 1872  C CG   . ARG A 1 24 ? -11.683 9.221   10.597  1.00 0.00 ? 1068 ARG B CG   2  
ATOM 1873  C CD   . ARG A 1 24 ? -10.764 8.997   11.793  1.00 0.00 ? 1068 ARG B CD   2  
ATOM 1874  N NE   . ARG A 1 24 ? -9.717  10.014  11.796  1.00 0.00 ? 1068 ARG B NE   2  
ATOM 1875  C CZ   . ARG A 1 24 ? -8.613  9.891   11.055  1.00 0.00 ? 1068 ARG B CZ   2  
ATOM 1876  N NH1  . ARG A 1 24 ? -8.438  8.852   10.278  1.00 0.00 ? 1068 ARG B NH1  2  
ATOM 1877  N NH2  . ARG A 1 24 ? -7.696  10.818  11.102  1.00 0.00 ? 1068 ARG B NH2  2  
ATOM 1878  H H    . ARG A 1 24 ? -12.939 6.365   8.331   1.00 0.00 ? 1068 ARG B H    2  
ATOM 1879  H HA   . ARG A 1 24 ? -14.415 8.269   9.724   1.00 0.00 ? 1068 ARG B HA   2  
ATOM 1880  H HB2  . ARG A 1 24 ? -12.781 7.445   11.074  1.00 0.00 ? 1068 ARG B HB2  2  
ATOM 1881  H HB3  . ARG A 1 24 ? -11.634 7.257   9.747   1.00 0.00 ? 1068 ARG B HB3  2  
ATOM 1882  H HG2  . ARG A 1 24 ? -11.093 9.577   9.767   1.00 0.00 ? 1068 ARG B HG2  2  
ATOM 1883  H HG3  . ARG A 1 24 ? -12.433 9.954   10.851  1.00 0.00 ? 1068 ARG B HG3  2  
ATOM 1884  H HD2  . ARG A 1 24 ? -11.338 9.073   12.704  1.00 0.00 ? 1068 ARG B HD2  2  
ATOM 1885  H HD3  . ARG A 1 24 ? -10.320 8.016   11.730  1.00 0.00 ? 1068 ARG B HD3  2  
ATOM 1886  H HE   . ARG A 1 24 ? -9.834  10.816  12.343  1.00 0.00 ? 1068 ARG B HE   2  
ATOM 1887  H HH11 . ARG A 1 24 ? -9.132  8.136   10.226  1.00 0.00 ? 1068 ARG B HH11 2  
ATOM 1888  H HH12 . ARG A 1 24 ? -7.603  8.778   9.732   1.00 0.00 ? 1068 ARG B HH12 2  
ATOM 1889  H HH21 . ARG A 1 24 ? -7.822  11.618  11.691  1.00 0.00 ? 1068 ARG B HH21 2  
ATOM 1890  H HH22 . ARG A 1 24 ? -6.867  10.730  10.549  1.00 0.00 ? 1068 ARG B HH22 2  
ATOM 1891  N N    . GLY A 1 25 ? -12.211 9.586   7.630   1.00 0.00 ? 1069 GLY B N    2  
ATOM 1892  C CA   . GLY A 1 25 ? -11.882 10.826  6.931   1.00 0.00 ? 1069 GLY B CA   2  
ATOM 1893  C C    . GLY A 1 25 ? -12.484 10.844  5.523   1.00 0.00 ? 1069 GLY B C    2  
ATOM 1894  O O    . GLY A 1 25 ? -12.645 9.793   4.906   1.00 0.00 ? 1069 GLY B O    2  
ATOM 1895  H H    . GLY A 1 25 ? -11.675 8.779   7.470   1.00 0.00 ? 1069 GLY B H    2  
ATOM 1896  H HA2  . GLY A 1 25 ? -12.269 11.654  7.503   1.00 0.00 ? 1069 GLY B HA2  2  
ATOM 1897  H HA3  . GLY A 1 25 ? -10.808 10.916  6.857   1.00 0.00 ? 1069 GLY B HA3  2  
ATOM 1898  N N    . PRO A 1 26 ? -12.817 12.002  4.998   1.00 0.00 ? 1070 PRO B N    2  
ATOM 1899  C CA   . PRO A 1 26 ? -13.405 12.118  3.635   1.00 0.00 ? 1070 PRO B CA   2  
ATOM 1900  C C    . PRO A 1 26 ? -12.344 12.038  2.545   1.00 0.00 ? 1070 PRO B C    2  
ATOM 1901  O O    . PRO A 1 26 ? -11.833 13.054  2.074   1.00 0.00 ? 1070 PRO B O    2  
ATOM 1902  C CB   . PRO A 1 26 ? -14.075 13.478  3.648   1.00 0.00 ? 1070 PRO B CB   2  
ATOM 1903  C CG   . PRO A 1 26 ? -13.277 14.300  4.608   1.00 0.00 ? 1070 PRO B CG   2  
ATOM 1904  C CD   . PRO A 1 26 ? -12.676 13.328  5.633   1.00 0.00 ? 1070 PRO B CD   2  
ATOM 1905  H HA   . PRO A 1 26 ? -14.149 11.352  3.487   1.00 0.00 ? 1070 PRO B HA   2  
ATOM 1906  H HB2  . PRO A 1 26 ? -14.045 13.908  2.660   1.00 0.00 ? 1070 PRO B HB2  2  
ATOM 1907  H HB3  . PRO A 1 26 ? -15.093 13.390  3.992   1.00 0.00 ? 1070 PRO B HB3  2  
ATOM 1908  H HG2  . PRO A 1 26 ? -12.490 14.821  4.079   1.00 0.00 ? 1070 PRO B HG2  2  
ATOM 1909  H HG3  . PRO A 1 26 ? -13.917 15.009  5.110   1.00 0.00 ? 1070 PRO B HG3  2  
ATOM 1910  H HD2  . PRO A 1 26 ? -11.634 13.560  5.809   1.00 0.00 ? 1070 PRO B HD2  2  
ATOM 1911  H HD3  . PRO A 1 26 ? -13.233 13.358  6.558   1.00 0.00 ? 1070 PRO B HD3  2  
ATOM 1912  N N    . ALA A 1 27 ? -12.023 10.816  2.163   1.00 0.00 ? 1071 ALA B N    2  
ATOM 1913  C CA   . ALA A 1 27 ? -11.019 10.570  1.133   1.00 0.00 ? 1071 ALA B CA   2  
ATOM 1914  C C    . ALA A 1 27 ? -11.433 11.184  -0.196  1.00 0.00 ? 1071 ALA B C    2  
ATOM 1915  O O    . ALA A 1 27 ? -10.603 11.712  -0.934  1.00 0.00 ? 1071 ALA B O    2  
ATOM 1916  C CB   . ALA A 1 27 ? -10.805 9.065   0.960   1.00 0.00 ? 1071 ALA B CB   2  
ATOM 1917  H H    . ALA A 1 27 ? -12.473 10.061  2.588   1.00 0.00 ? 1071 ALA B H    2  
ATOM 1918  H HA   . ALA A 1 27 ? -10.092 11.019  1.443   1.00 0.00 ? 1071 ALA B HA   2  
ATOM 1919  H HB1  . ALA A 1 27 ? -10.313 8.669   1.837   1.00 0.00 ? 1071 ALA B HB1  2  
ATOM 1920  H HB2  . ALA A 1 27 ? -10.190 8.888   0.091   1.00 0.00 ? 1071 ALA B HB2  2  
ATOM 1921  H HB3  . ALA A 1 27 ? -11.759 8.578   0.832   1.00 0.00 ? 1071 ALA B HB3  2  
ATOM 1922  N N    . VAL A 1 28 ? -12.720 11.103  -0.501  1.00 0.00 ? 1072 VAL B N    2  
ATOM 1923  C CA   . VAL A 1 28 ? -13.235 11.642  -1.751  1.00 0.00 ? 1072 VAL B CA   2  
ATOM 1924  C C    . VAL A 1 28 ? -12.957 13.137  -1.852  1.00 0.00 ? 1072 VAL B C    2  
ATOM 1925  O O    . VAL A 1 28 ? -12.487 13.623  -2.879  1.00 0.00 ? 1072 VAL B O    2  
ATOM 1926  C CB   . VAL A 1 28 ? -14.739 11.405  -1.812  1.00 0.00 ? 1072 VAL B CB   2  
ATOM 1927  C CG1  . VAL A 1 28 ? -15.337 12.178  -2.986  1.00 0.00 ? 1072 VAL B CG1  2  
ATOM 1928  C CG2  . VAL A 1 28 ? -15.017 9.911   -1.992  1.00 0.00 ? 1072 VAL B CG2  2  
ATOM 1929  H H    . VAL A 1 28 ? -13.335 10.664  0.123   1.00 0.00 ? 1072 VAL B H    2  
ATOM 1930  H HA   . VAL A 1 28 ? -12.765 11.136  -2.578  1.00 0.00 ? 1072 VAL B HA   2  
ATOM 1931  H HB   . VAL A 1 28 ? -15.187 11.745  -0.889  1.00 0.00 ? 1072 VAL B HB   2  
ATOM 1932  H HG11 . VAL A 1 28 ? -16.357 11.859  -3.147  1.00 0.00 ? 1072 VAL B HG11 2  
ATOM 1933  H HG12 . VAL A 1 28 ? -14.756 11.988  -3.877  1.00 0.00 ? 1072 VAL B HG12 2  
ATOM 1934  H HG13 . VAL A 1 28 ? -15.322 13.236  -2.766  1.00 0.00 ? 1072 VAL B HG13 2  
ATOM 1935  H HG21 . VAL A 1 28 ? -15.071 9.679   -3.045  1.00 0.00 ? 1072 VAL B HG21 2  
ATOM 1936  H HG22 . VAL A 1 28 ? -15.953 9.659   -1.518  1.00 0.00 ? 1072 VAL B HG22 2  
ATOM 1937  H HG23 . VAL A 1 28 ? -14.219 9.341   -1.539  1.00 0.00 ? 1072 VAL B HG23 2  
ATOM 1938  N N    . LEU A 1 29 ? -13.248 13.857  -0.779  1.00 0.00 ? 1073 LEU B N    2  
ATOM 1939  C CA   . LEU A 1 29 ? -13.024 15.297  -0.753  1.00 0.00 ? 1073 LEU B CA   2  
ATOM 1940  C C    . LEU A 1 29 ? -11.536 15.617  -0.871  1.00 0.00 ? 1073 LEU B C    2  
ATOM 1941  O O    . LEU A 1 29 ? -11.145 16.559  -1.560  1.00 0.00 ? 1073 LEU B O    2  
ATOM 1942  C CB   . LEU A 1 29 ? -13.551 15.875  0.557   1.00 0.00 ? 1073 LEU B CB   2  
ATOM 1943  C CG   . LEU A 1 29 ? -15.079 15.802  0.582   1.00 0.00 ? 1073 LEU B CG   2  
ATOM 1944  C CD1  . LEU A 1 29 ? -15.582 16.159  1.985   1.00 0.00 ? 1073 LEU B CD1  2  
ATOM 1945  C CD2  . LEU A 1 29 ? -15.657 16.796  -0.428  1.00 0.00 ? 1073 LEU B CD2  2  
ATOM 1946  H H    . LEU A 1 29 ? -13.617 13.412  0.011   1.00 0.00 ? 1073 LEU B H    2  
ATOM 1947  H HA   . LEU A 1 29 ? -13.550 15.753  -1.577  1.00 0.00 ? 1073 LEU B HA   2  
ATOM 1948  H HB2  . LEU A 1 29 ? -13.149 15.306  1.383   1.00 0.00 ? 1073 LEU B HB2  2  
ATOM 1949  H HB3  . LEU A 1 29 ? -13.239 16.904  0.646   1.00 0.00 ? 1073 LEU B HB3  2  
ATOM 1950  H HG   . LEU A 1 29 ? -15.397 14.801  0.330   1.00 0.00 ? 1073 LEU B HG   2  
ATOM 1951  H HD11 . LEU A 1 29 ? -15.905 17.188  2.000   1.00 0.00 ? 1073 LEU B HD11 2  
ATOM 1952  H HD12 . LEU A 1 29 ? -14.783 16.020  2.698   1.00 0.00 ? 1073 LEU B HD12 2  
ATOM 1953  H HD13 . LEU A 1 29 ? -16.411 15.516  2.243   1.00 0.00 ? 1073 LEU B HD13 2  
ATOM 1954  H HD21 . LEU A 1 29 ? -14.960 17.607  -0.575  1.00 0.00 ? 1073 LEU B HD21 2  
ATOM 1955  H HD22 . LEU A 1 29 ? -16.591 17.187  -0.054  1.00 0.00 ? 1073 LEU B HD22 2  
ATOM 1956  H HD23 . LEU A 1 29 ? -15.828 16.293  -1.369  1.00 0.00 ? 1073 LEU B HD23 2  
ATOM 1957  N N    . ALA A 1 30 ? -10.715 14.826  -0.188  1.00 0.00 ? 1074 ALA B N    2  
ATOM 1958  C CA   . ALA A 1 30 ? -9.274  15.033  -0.213  1.00 0.00 ? 1074 ALA B CA   2  
ATOM 1959  C C    . ALA A 1 30 ? -8.746  14.844  -1.616  1.00 0.00 ? 1074 ALA B C    2  
ATOM 1960  O O    . ALA A 1 30 ? -7.897  15.601  -2.089  1.00 0.00 ? 1074 ALA B O    2  
ATOM 1961  C CB   . ALA A 1 30 ? -8.587  14.018  0.699   1.00 0.00 ? 1074 ALA B CB   2  
ATOM 1962  H H    . ALA A 1 30 ? -11.086 14.090  0.337   1.00 0.00 ? 1074 ALA B H    2  
ATOM 1963  H HA   . ALA A 1 30 ? -9.046  16.029  0.129   1.00 0.00 ? 1074 ALA B HA   2  
ATOM 1964  H HB1  . ALA A 1 30 ? -8.193  13.209  0.096   1.00 0.00 ? 1074 ALA B HB1  2  
ATOM 1965  H HB2  . ALA A 1 30 ? -9.303  13.626  1.404   1.00 0.00 ? 1074 ALA B HB2  2  
ATOM 1966  H HB3  . ALA A 1 30 ? -7.780  14.499  1.230   1.00 0.00 ? 1074 ALA B HB3  2  
ATOM 1967  N N    . THR A 1 31 ? -9.250  13.813  -2.265  1.00 0.00 ? 1075 THR B N    2  
ATOM 1968  C CA   . THR A 1 31 ? -8.828  13.496  -3.611  1.00 0.00 ? 1075 THR B CA   2  
ATOM 1969  C C    . THR A 1 31 ? -9.192  14.622  -4.570  1.00 0.00 ? 1075 THR B C    2  
ATOM 1970  O O    . THR A 1 31 ? -8.373  15.043  -5.388  1.00 0.00 ? 1075 THR B O    2  
ATOM 1971  C CB   . THR A 1 31 ? -9.491  12.200  -4.058  1.00 0.00 ? 1075 THR B CB   2  
ATOM 1972  O OG1  . THR A 1 31 ? -9.112  11.148  -3.181  1.00 0.00 ? 1075 THR B OG1  2  
ATOM 1973  C CG2  . THR A 1 31 ? -9.029  11.877  -5.465  1.00 0.00 ? 1075 THR B CG2  2  
ATOM 1974  H H    . THR A 1 31 ? -9.918  13.248  -1.821  1.00 0.00 ? 1075 THR B H    2  
ATOM 1975  H HA   . THR A 1 31 ? -7.758  13.360  -3.620  1.00 0.00 ? 1075 THR B HA   2  
ATOM 1976  H HB   . THR A 1 31 ? -10.563 12.314  -4.048  1.00 0.00 ? 1075 THR B HB   2  
ATOM 1977  H HG1  . THR A 1 31 ? -8.970  10.359  -3.709  1.00 0.00 ? 1075 THR B HG1  2  
ATOM 1978  H HG21 . THR A 1 31 ? -7.952  11.863  -5.489  1.00 0.00 ? 1075 THR B HG21 2  
ATOM 1979  H HG22 . THR A 1 31 ? -9.397  12.633  -6.142  1.00 0.00 ? 1075 THR B HG22 2  
ATOM 1980  H HG23 . THR A 1 31 ? -9.411  10.911  -5.755  1.00 0.00 ? 1075 THR B HG23 2  
ATOM 1981  N N    . LYS A 1 32 ? -10.422 15.107  -4.464  1.00 0.00 ? 1076 LYS B N    2  
ATOM 1982  C CA   . LYS A 1 32 ? -10.881 16.185  -5.327  1.00 0.00 ? 1076 LYS B CA   2  
ATOM 1983  C C    . LYS A 1 32 ? -10.067 17.451  -5.088  1.00 0.00 ? 1076 LYS B C    2  
ATOM 1984  O O    . LYS A 1 32 ? -9.722  18.169  -6.026  1.00 0.00 ? 1076 LYS B O    2  
ATOM 1985  C CB   . LYS A 1 32 ? -12.355 16.467  -5.064  1.00 0.00 ? 1076 LYS B CB   2  
ATOM 1986  C CG   . LYS A 1 32 ? -13.182 15.300  -5.596  1.00 0.00 ? 1076 LYS B CG   2  
ATOM 1987  C CD   . LYS A 1 32 ? -14.655 15.524  -5.276  1.00 0.00 ? 1076 LYS B CD   2  
ATOM 1988  C CE   . LYS A 1 32 ? -15.458 14.342  -5.809  1.00 0.00 ? 1076 LYS B CE   2  
ATOM 1989  N NZ   . LYS A 1 32 ? -15.485 14.388  -7.298  1.00 0.00 ? 1076 LYS B NZ   2  
ATOM 1990  H H    . LYS A 1 32 ? -11.032 14.732  -3.793  1.00 0.00 ? 1076 LYS B H    2  
ATOM 1991  H HA   . LYS A 1 32 ? -10.768 15.878  -6.356  1.00 0.00 ? 1076 LYS B HA   2  
ATOM 1992  H HB2  . LYS A 1 32 ? -12.520 16.575  -4.001  1.00 0.00 ? 1076 LYS B HB2  2  
ATOM 1993  H HB3  . LYS A 1 32 ? -12.648 17.374  -5.571  1.00 0.00 ? 1076 LYS B HB3  2  
ATOM 1994  H HG2  . LYS A 1 32 ? -13.052 15.225  -6.666  1.00 0.00 ? 1076 LYS B HG2  2  
ATOM 1995  H HG3  . LYS A 1 32 ? -12.849 14.384  -5.130  1.00 0.00 ? 1076 LYS B HG3  2  
ATOM 1996  H HD2  . LYS A 1 32 ? -14.786 15.602  -4.207  1.00 0.00 ? 1076 LYS B HD2  2  
ATOM 1997  H HD3  . LYS A 1 32 ? -14.995 16.432  -5.752  1.00 0.00 ? 1076 LYS B HD3  2  
ATOM 1998  H HE2  . LYS A 1 32 ? -14.985 13.425  -5.490  1.00 0.00 ? 1076 LYS B HE2  2  
ATOM 1999  H HE3  . LYS A 1 32 ? -16.465 14.383  -5.426  1.00 0.00 ? 1076 LYS B HE3  2  
ATOM 2000  H HZ1  . LYS A 1 32 ? -16.472 14.387  -7.627  1.00 0.00 ? 1076 LYS B HZ1  2  
ATOM 2001  H HZ2  . LYS A 1 32 ? -14.991 13.558  -7.681  1.00 0.00 ? 1076 LYS B HZ2  2  
ATOM 2002  H HZ3  . LYS A 1 32 ? -15.015 15.255  -7.627  1.00 0.00 ? 1076 LYS B HZ3  2  
ATOM 2003  N N    . ALA A 1 33 ? -9.775  17.724  -3.821  1.00 0.00 ? 1077 ALA B N    2  
ATOM 2004  C CA   . ALA A 1 33 ? -9.013  18.912  -3.456  1.00 0.00 ? 1077 ALA B CA   2  
ATOM 2005  C C    . ALA A 1 33 ? -7.611  18.881  -4.060  1.00 0.00 ? 1077 ALA B C    2  
ATOM 2006  O O    . ALA A 1 33 ? -7.130  19.891  -4.573  1.00 0.00 ? 1077 ALA B O    2  
ATOM 2007  C CB   . ALA A 1 33 ? -8.913  19.010  -1.933  1.00 0.00 ? 1077 ALA B CB   2  
ATOM 2008  H H    . ALA A 1 33 ? -10.086 17.117  -3.116  1.00 0.00 ? 1077 ALA B H    2  
ATOM 2009  H HA   . ALA A 1 33 ? -9.532  19.784  -3.824  1.00 0.00 ? 1077 ALA B HA   2  
ATOM 2010  H HB1  . ALA A 1 33 ? -9.685  19.669  -1.563  1.00 0.00 ? 1077 ALA B HB1  2  
ATOM 2011  H HB2  . ALA A 1 33 ? -7.944  19.401  -1.659  1.00 0.00 ? 1077 ALA B HB2  2  
ATOM 2012  H HB3  . ALA A 1 33 ? -9.040  18.028  -1.501  1.00 0.00 ? 1077 ALA B HB3  2  
ATOM 2013  N N    . ALA A 1 34 ? -6.964  17.715  -3.996  1.00 0.00 ? 1078 ALA B N    2  
ATOM 2014  C CA   . ALA A 1 34 ? -5.615  17.554  -4.534  1.00 0.00 ? 1078 ALA B CA   2  
ATOM 2015  C C    . ALA A 1 34 ? -5.050  16.194  -4.138  1.00 0.00 ? 1078 ALA B C    2  
ATOM 2016  O O    . ALA A 1 34 ? -4.743  15.959  -2.969  1.00 0.00 ? 1078 ALA B O    2  
ATOM 2017  C CB   . ALA A 1 34 ? -4.692  18.653  -4.001  1.00 0.00 ? 1078 ALA B CB   2  
ATOM 2018  H H    . ALA A 1 34 ? -7.403  16.947  -3.577  1.00 0.00 ? 1078 ALA B H    2  
ATOM 2019  H HA   . ALA A 1 34 ? -5.654  17.620  -5.611  1.00 0.00 ? 1078 ALA B HA   2  
ATOM 2020  H HB1  . ALA A 1 34 ? -3.723  18.233  -3.777  1.00 0.00 ? 1078 ALA B HB1  2  
ATOM 2021  H HB2  . ALA A 1 34 ? -5.119  19.077  -3.104  1.00 0.00 ? 1078 ALA B HB2  2  
ATOM 2022  H HB3  . ALA A 1 34 ? -4.585  19.426  -4.748  1.00 0.00 ? 1078 ALA B HB3  2  
ATOM 2023  N N    . ALA A 1 35 ? -4.913  15.303  -5.111  1.00 0.00 ? 1079 ALA B N    2  
ATOM 2024  C CA   . ALA A 1 35 ? -4.382  13.973  -4.836  1.00 0.00 ? 1079 ALA B CA   2  
ATOM 2025  C C    . ALA A 1 35 ? -2.942  14.065  -4.338  1.00 0.00 ? 1079 ALA B C    2  
ATOM 2026  O O    . ALA A 1 35 ? -2.685  13.974  -3.138  1.00 0.00 ? 1079 ALA B O    2  
ATOM 2027  C CB   . ALA A 1 35 ? -4.437  13.117  -6.102  1.00 0.00 ? 1079 ALA B CB   2  
ATOM 2028  H H    . ALA A 1 35 ? -5.174  15.543  -6.024  1.00 0.00 ? 1079 ALA B H    2  
ATOM 2029  H HA   . ALA A 1 35 ? -4.985  13.506  -4.074  1.00 0.00 ? 1079 ALA B HA   2  
ATOM 2030  H HB1  . ALA A 1 35 ? -5.436  12.725  -6.229  1.00 0.00 ? 1079 ALA B HB1  2  
ATOM 2031  H HB2  . ALA A 1 35 ? -3.737  12.298  -6.016  1.00 0.00 ? 1079 ALA B HB2  2  
ATOM 2032  H HB3  . ALA A 1 35 ? -4.177  13.723  -6.959  1.00 0.00 ? 1079 ALA B HB3  2  
ATOM 2033  N N    . GLY A 1 36 ? -2.009  14.245  -5.265  1.00 0.00 ? 1080 GLY B N    2  
ATOM 2034  C CA   . GLY A 1 36 ? -0.598  14.349  -4.908  1.00 0.00 ? 1080 GLY B CA   2  
ATOM 2035  C C    . GLY A 1 36 ? 0.029   12.972  -4.711  1.00 0.00 ? 1080 GLY B C    2  
ATOM 2036  O O    . GLY A 1 36 ? 1.203   12.859  -4.366  1.00 0.00 ? 1080 GLY B O    2  
ATOM 2037  H H    . GLY A 1 36 ? -2.271  14.304  -6.206  1.00 0.00 ? 1080 GLY B H    2  
ATOM 2038  H HA2  . GLY A 1 36 ? -0.071  14.869  -5.695  1.00 0.00 ? 1080 GLY B HA2  2  
ATOM 2039  H HA3  . GLY A 1 36 ? -0.506  14.912  -3.990  1.00 0.00 ? 1080 GLY B HA3  2  
ATOM 2040  N N    . THR A 1 37 ? -0.753  11.925  -4.938  1.00 0.00 ? 1081 THR B N    2  
ATOM 2041  C CA   . THR A 1 37 ? -0.263  10.571  -4.782  1.00 0.00 ? 1081 THR B CA   2  
ATOM 2042  C C    . THR A 1 37 ? 0.889   10.301  -5.741  1.00 0.00 ? 1081 THR B C    2  
ATOM 2043  O O    . THR A 1 37 ? 1.872   9.660   -5.382  1.00 0.00 ? 1081 THR B O    2  
ATOM 2044  C CB   . THR A 1 37 ? -1.399  9.591   -5.045  1.00 0.00 ? 1081 THR B CB   2  
ATOM 2045  O OG1  . THR A 1 37 ? -2.427  9.798   -4.087  1.00 0.00 ? 1081 THR B OG1  2  
ATOM 2046  C CG2  . THR A 1 37 ? -0.874  8.170   -4.939  1.00 0.00 ? 1081 THR B CG2  2  
ATOM 2047  H H    . THR A 1 37 ? -1.678  12.059  -5.217  1.00 0.00 ? 1081 THR B H    2  
ATOM 2048  H HA   . THR A 1 37 ? 0.085   10.437  -3.770  1.00 0.00 ? 1081 THR B HA   2  
ATOM 2049  H HB   . THR A 1 37 ? -1.792  9.753   -6.037  1.00 0.00 ? 1081 THR B HB   2  
ATOM 2050  H HG1  . THR A 1 37 ? -2.521  10.743  -3.953  1.00 0.00 ? 1081 THR B HG1  2  
ATOM 2051  H HG21 . THR A 1 37 ? -0.838  7.728   -5.922  1.00 0.00 ? 1081 THR B HG21 2  
ATOM 2052  H HG22 . THR A 1 37 ? -1.529  7.592   -4.306  1.00 0.00 ? 1081 THR B HG22 2  
ATOM 2053  H HG23 . THR A 1 37 ? 0.117   8.187   -4.516  1.00 0.00 ? 1081 THR B HG23 2  
ATOM 2054  N N    . LYS A 1 38 ? 0.758   10.790  -6.961  1.00 0.00 ? 1082 LYS B N    2  
ATOM 2055  C CA   . LYS A 1 38 ? 1.797   10.588  -7.958  1.00 0.00 ? 1082 LYS B CA   2  
ATOM 2056  C C    . LYS A 1 38 ? 3.104   11.214  -7.499  1.00 0.00 ? 1082 LYS B C    2  
ATOM 2057  O O    . LYS A 1 38 ? 4.171   10.615  -7.627  1.00 0.00 ? 1082 LYS B O    2  
ATOM 2058  C CB   . LYS A 1 38 ? 1.366   11.242  -9.263  1.00 0.00 ? 1082 LYS B CB   2  
ATOM 2059  C CG   . LYS A 1 38 ? 0.210   10.449  -9.877  1.00 0.00 ? 1082 LYS B CG   2  
ATOM 2060  C CD   . LYS A 1 38 ? 0.738   9.134   -10.461 1.00 0.00 ? 1082 LYS B CD   2  
ATOM 2061  C CE   . LYS A 1 38 ? -0.387  8.417   -11.212 1.00 0.00 ? 1082 LYS B CE   2  
ATOM 2062  N NZ   . LYS A 1 38 ? -0.818  9.247   -12.370 1.00 0.00 ? 1082 LYS B NZ   2  
ATOM 2063  H H    . LYS A 1 38 ? -0.049  11.294  -7.196  1.00 0.00 ? 1082 LYS B H    2  
ATOM 2064  H HA   . LYS A 1 38 ? 1.944   9.535   -8.116  1.00 0.00 ? 1082 LYS B HA   2  
ATOM 2065  H HB2  . LYS A 1 38 ? 1.042   12.254  -9.058  1.00 0.00 ? 1082 LYS B HB2  2  
ATOM 2066  H HB3  . LYS A 1 38 ? 2.197   11.260  -9.950  1.00 0.00 ? 1082 LYS B HB3  2  
ATOM 2067  H HG2  . LYS A 1 38 ? -0.519  10.235  -9.109  1.00 0.00 ? 1082 LYS B HG2  2  
ATOM 2068  H HG3  . LYS A 1 38 ? -0.249  11.031  -10.660 1.00 0.00 ? 1082 LYS B HG3  2  
ATOM 2069  H HD2  . LYS A 1 38 ? 1.548   9.342   -11.144 1.00 0.00 ? 1082 LYS B HD2  2  
ATOM 2070  H HD3  . LYS A 1 38 ? 1.092   8.498   -9.665  1.00 0.00 ? 1082 LYS B HD3  2  
ATOM 2071  H HE2  . LYS A 1 38 ? -0.031  7.461   -11.566 1.00 0.00 ? 1082 LYS B HE2  2  
ATOM 2072  H HE3  . LYS A 1 38 ? -1.225  8.264   -10.545 1.00 0.00 ? 1082 LYS B HE3  2  
ATOM 2073  H HZ1  . LYS A 1 38 ? -0.728  8.695   -13.246 1.00 0.00 ? 1082 LYS B HZ1  2  
ATOM 2074  H HZ2  . LYS A 1 38 ? -0.217  10.095  -12.431 1.00 0.00 ? 1082 LYS B HZ2  2  
ATOM 2075  H HZ3  . LYS A 1 38 ? -1.810  9.533   -12.242 1.00 0.00 ? 1082 LYS B HZ3  2  
ATOM 2076  N N    . LYS A 1 39 ? 3.010   12.417  -6.957  1.00 0.00 ? 1083 LYS B N    2  
ATOM 2077  C CA   . LYS A 1 39 ? 4.185   13.115  -6.470  1.00 0.00 ? 1083 LYS B CA   2  
ATOM 2078  C C    . LYS A 1 39 ? 4.789   12.383  -5.276  1.00 0.00 ? 1083 LYS B C    2  
ATOM 2079  O O    . LYS A 1 39 ? 6.010   12.329  -5.124  1.00 0.00 ? 1083 LYS B O    2  
ATOM 2080  C CB   . LYS A 1 39 ? 3.816   14.544  -6.079  1.00 0.00 ? 1083 LYS B CB   2  
ATOM 2081  C CG   . LYS A 1 39 ? 3.504   15.347  -7.343  1.00 0.00 ? 1083 LYS B CG   2  
ATOM 2082  C CD   . LYS A 1 39 ? 2.930   16.710  -6.956  1.00 0.00 ? 1083 LYS B CD   2  
ATOM 2083  C CE   . LYS A 1 39 ? 4.014   17.552  -6.281  1.00 0.00 ? 1083 LYS B CE   2  
ATOM 2084  N NZ   . LYS A 1 39 ? 3.465   18.896  -5.947  1.00 0.00 ? 1083 LYS B NZ   2  
ATOM 2085  H H    . LYS A 1 39 ? 2.129   12.843  -6.876  1.00 0.00 ? 1083 LYS B H    2  
ATOM 2086  H HA   . LYS A 1 39 ? 4.918   13.150  -7.262  1.00 0.00 ? 1083 LYS B HA   2  
ATOM 2087  H HB2  . LYS A 1 39 ? 2.949   14.531  -5.435  1.00 0.00 ? 1083 LYS B HB2  2  
ATOM 2088  H HB3  . LYS A 1 39 ? 4.645   15.001  -5.560  1.00 0.00 ? 1083 LYS B HB3  2  
ATOM 2089  H HG2  . LYS A 1 39 ? 4.409   15.485  -7.915  1.00 0.00 ? 1083 LYS B HG2  2  
ATOM 2090  H HG3  . LYS A 1 39 ? 2.780   14.812  -7.940  1.00 0.00 ? 1083 LYS B HG3  2  
ATOM 2091  H HD2  . LYS A 1 39 ? 2.579   17.217  -7.843  1.00 0.00 ? 1083 LYS B HD2  2  
ATOM 2092  H HD3  . LYS A 1 39 ? 2.107   16.570  -6.272  1.00 0.00 ? 1083 LYS B HD3  2  
ATOM 2093  H HE2  . LYS A 1 39 ? 4.343   17.063  -5.377  1.00 0.00 ? 1083 LYS B HE2  2  
ATOM 2094  H HE3  . LYS A 1 39 ? 4.854   17.664  -6.954  1.00 0.00 ? 1083 LYS B HE3  2  
ATOM 2095  H HZ1  . LYS A 1 39 ? 4.184   19.623  -6.138  1.00 0.00 ? 1083 LYS B HZ1  2  
ATOM 2096  H HZ2  . LYS A 1 39 ? 3.204   18.920  -4.940  1.00 0.00 ? 1083 LYS B HZ2  2  
ATOM 2097  H HZ3  . LYS A 1 39 ? 2.624   19.082  -6.527  1.00 0.00 ? 1083 LYS B HZ3  2  
ATOM 2098  N N    . TYR A 1 40 ? 3.926   11.836  -4.419  1.00 0.00 ? 1084 TYR B N    2  
ATOM 2099  C CA   . TYR A 1 40 ? 4.404   11.133  -3.232  1.00 0.00 ? 1084 TYR B CA   2  
ATOM 2100  C C    . TYR A 1 40 ? 4.182   9.643   -3.369  1.00 0.00 ? 1084 TYR B C    2  
ATOM 2101  O O    . TYR A 1 40 ? 3.057   9.154   -3.259  1.00 0.00 ? 1084 TYR B O    2  
ATOM 2102  C CB   . TYR A 1 40 ? 3.680   11.643  -1.987  1.00 0.00 ? 1084 TYR B CB   2  
ATOM 2103  C CG   . TYR A 1 40 ? 3.507   13.129  -2.121  1.00 0.00 ? 1084 TYR B CG   2  
ATOM 2104  C CD1  . TYR A 1 40 ? 2.256   13.711  -1.911  1.00 0.00 ? 1084 TYR B CD1  2  
ATOM 2105  C CD2  . TYR A 1 40 ? 4.596   13.921  -2.490  1.00 0.00 ? 1084 TYR B CD2  2  
ATOM 2106  C CE1  . TYR A 1 40 ? 2.092   15.088  -2.072  1.00 0.00 ? 1084 TYR B CE1  2  
ATOM 2107  C CE2  . TYR A 1 40 ? 4.439   15.294  -2.648  1.00 0.00 ? 1084 TYR B CE2  2  
ATOM 2108  C CZ   . TYR A 1 40 ? 3.185   15.883  -2.441  1.00 0.00 ? 1084 TYR B CZ   2  
ATOM 2109  O OH   . TYR A 1 40 ? 3.024   17.243  -2.602  1.00 0.00 ? 1084 TYR B OH   2  
ATOM 2110  H H    . TYR A 1 40 ? 2.962   11.916  -4.581  1.00 0.00 ? 1084 TYR B H    2  
ATOM 2111  H HA   . TYR A 1 40 ? 5.460   11.319  -3.117  1.00 0.00 ? 1084 TYR B HA   2  
ATOM 2112  H HB2  . TYR A 1 40 ? 2.713   11.167  -1.907  1.00 0.00 ? 1084 TYR B HB2  2  
ATOM 2113  H HB3  . TYR A 1 40 ? 4.268   11.424  -1.109  1.00 0.00 ? 1084 TYR B HB3  2  
ATOM 2114  H HD1  . TYR A 1 40 ? 1.414   13.096  -1.625  1.00 0.00 ? 1084 TYR B HD1  2  
ATOM 2115  H HD2  . TYR A 1 40 ? 5.565   13.468  -2.649  1.00 0.00 ? 1084 TYR B HD2  2  
ATOM 2116  H HE1  . TYR A 1 40 ? 1.125   15.535  -1.915  1.00 0.00 ? 1084 TYR B HE1  2  
ATOM 2117  H HE2  . TYR A 1 40 ? 5.282   15.896  -2.938  1.00 0.00 ? 1084 TYR B HE2  2  
ATOM 2118  H HH   . TYR A 1 40 ? 2.203   17.499  -2.174  1.00 0.00 ? 1084 TYR B HH   2  
ATOM 2119  N N    . ASP A 1 41 ? 5.265   8.929   -3.599  1.00 0.00 ? 1085 ASP B N    2  
ATOM 2120  C CA   . ASP A 1 41 ? 5.184   7.483   -3.745  1.00 0.00 ? 1085 ASP B CA   2  
ATOM 2121  C C    . ASP A 1 41 ? 5.174   6.832   -2.370  1.00 0.00 ? 1085 ASP B C    2  
ATOM 2122  O O    . ASP A 1 41 ? 6.219   6.631   -1.753  1.00 0.00 ? 1085 ASP B O    2  
ATOM 2123  C CB   . ASP A 1 41 ? 6.373   6.965   -4.556  1.00 0.00 ? 1085 ASP B CB   2  
ATOM 2124  C CG   . ASP A 1 41 ? 6.248   5.458   -4.765  1.00 0.00 ? 1085 ASP B CG   2  
ATOM 2125  O OD1  . ASP A 1 41 ? 5.281   4.890   -4.286  1.00 0.00 ? 1085 ASP B OD1  2  
ATOM 2126  O OD2  . ASP A 1 41 ? 7.124   4.895   -5.400  1.00 0.00 ? 1085 ASP B OD2  2  
ATOM 2127  H H    . ASP A 1 41 ? 6.128   9.386   -3.665  1.00 0.00 ? 1085 ASP B H    2  
ATOM 2128  H HA   . ASP A 1 41 ? 4.269   7.232   -4.259  1.00 0.00 ? 1085 ASP B HA   2  
ATOM 2129  H HB2  . ASP A 1 41 ? 6.391   7.458   -5.518  1.00 0.00 ? 1085 ASP B HB2  2  
ATOM 2130  H HB3  . ASP A 1 41 ? 7.289   7.178   -4.027  1.00 0.00 ? 1085 ASP B HB3  2  
ATOM 2131  N N    . LEU A 1 42 ? 3.976   6.515   -1.898  1.00 0.00 ? 1086 LEU B N    2  
ATOM 2132  C CA   . LEU A 1 42 ? 3.818   5.897   -0.591  1.00 0.00 ? 1086 LEU B CA   2  
ATOM 2133  C C    . LEU A 1 42 ? 3.466   4.419   -0.728  1.00 0.00 ? 1086 LEU B C    2  
ATOM 2134  O O    . LEU A 1 42 ? 3.245   3.734   0.268   1.00 0.00 ? 1086 LEU B O    2  
ATOM 2135  C CB   . LEU A 1 42 ? 2.714   6.620   0.178   1.00 0.00 ? 1086 LEU B CB   2  
ATOM 2136  C CG   . LEU A 1 42 ? 2.987   8.125   0.140   1.00 0.00 ? 1086 LEU B CG   2  
ATOM 2137  C CD1  . LEU A 1 42 ? 1.885   8.870   0.891   1.00 0.00 ? 1086 LEU B CD1  2  
ATOM 2138  C CD2  . LEU A 1 42 ? 4.339   8.429   0.788   1.00 0.00 ? 1086 LEU B CD2  2  
ATOM 2139  H H    . LEU A 1 42 ? 3.182   6.709   -2.436  1.00 0.00 ? 1086 LEU B H    2  
ATOM 2140  H HA   . LEU A 1 42 ? 4.744   5.988   -0.044  1.00 0.00 ? 1086 LEU B HA   2  
ATOM 2141  H HB2  . LEU A 1 42 ? 1.758   6.412   -0.278  1.00 0.00 ? 1086 LEU B HB2  2  
ATOM 2142  H HB3  . LEU A 1 42 ? 2.707   6.283   1.203   1.00 0.00 ? 1086 LEU B HB3  2  
ATOM 2143  H HG   . LEU A 1 42 ? 3.001   8.451   -0.887  1.00 0.00 ? 1086 LEU B HG   2  
ATOM 2144  H HD11 . LEU A 1 42 ? 0.929   8.415   0.675   1.00 0.00 ? 1086 LEU B HD11 2  
ATOM 2145  H HD12 . LEU A 1 42 ? 1.872   9.904   0.572   1.00 0.00 ? 1086 LEU B HD12 2  
ATOM 2146  H HD13 . LEU A 1 42 ? 2.077   8.824   1.952   1.00 0.00 ? 1086 LEU B HD13 2  
ATOM 2147  H HD21 . LEU A 1 42 ? 4.606   7.627   1.459   1.00 0.00 ? 1086 LEU B HD21 2  
ATOM 2148  H HD22 . LEU A 1 42 ? 4.271   9.355   1.339   1.00 0.00 ? 1086 LEU B HD22 2  
ATOM 2149  H HD23 . LEU A 1 42 ? 5.090   8.523   0.017   1.00 0.00 ? 1086 LEU B HD23 2  
ATOM 2150  N N    . SER A 1 43 ? 3.429   3.926   -1.965  1.00 0.00 ? 1087 SER B N    2  
ATOM 2151  C CA   . SER A 1 43 ? 3.114   2.524   -2.202  1.00 0.00 ? 1087 SER B CA   2  
ATOM 2152  C C    . SER A 1 43 ? 4.245   1.636   -1.696  1.00 0.00 ? 1087 SER B C    2  
ATOM 2153  O O    . SER A 1 43 ? 4.100   0.416   -1.616  1.00 0.00 ? 1087 SER B O    2  
ATOM 2154  C CB   . SER A 1 43 ? 2.891   2.281   -3.696  1.00 0.00 ? 1087 SER B CB   2  
ATOM 2155  O OG   . SER A 1 43 ? 4.105   2.509   -4.394  1.00 0.00 ? 1087 SER B OG   2  
ATOM 2156  H H    . SER A 1 43 ? 3.624   4.506   -2.727  1.00 0.00 ? 1087 SER B H    2  
ATOM 2157  H HA   . SER A 1 43 ? 2.215   2.274   -1.667  1.00 0.00 ? 1087 SER B HA   2  
ATOM 2158  H HB2  . SER A 1 43 ? 2.577   1.264   -3.854  1.00 0.00 ? 1087 SER B HB2  2  
ATOM 2159  H HB3  . SER A 1 43 ? 2.122   2.952   -4.058  1.00 0.00 ? 1087 SER B HB3  2  
ATOM 2160  H HG   . SER A 1 43 ? 4.789   2.686   -3.745  1.00 0.00 ? 1087 SER B HG   2  
ATOM 2161  N N    . LYS A 1 44 ? 5.370   2.251   -1.353  1.00 0.00 ? 1088 LYS B N    2  
ATOM 2162  C CA   . LYS A 1 44 ? 6.507   1.495   -0.846  1.00 0.00 ? 1088 LYS B CA   2  
ATOM 2163  C C    . LYS A 1 44 ? 6.558   1.539   0.683   1.00 0.00 ? 1088 LYS B C    2  
ATOM 2164  O O    . LYS A 1 44 ? 7.339   0.817   1.303   1.00 0.00 ? 1088 LYS B O    2  
ATOM 2165  C CB   . LYS A 1 44 ? 7.805   2.062   -1.416  1.00 0.00 ? 1088 LYS B CB   2  
ATOM 2166  C CG   . LYS A 1 44 ? 7.839   1.828   -2.928  1.00 0.00 ? 1088 LYS B CG   2  
ATOM 2167  C CD   . LYS A 1 44 ? 9.025   2.578   -3.535  1.00 0.00 ? 1088 LYS B CD   2  
ATOM 2168  C CE   . LYS A 1 44 ? 10.330  1.996   -2.991  1.00 0.00 ? 1088 LYS B CE   2  
ATOM 2169  N NZ   . LYS A 1 44 ? 11.485  2.668   -3.649  1.00 0.00 ? 1088 LYS B NZ   2  
ATOM 2170  H H    . LYS A 1 44 ? 5.435   3.229   -1.431  1.00 0.00 ? 1088 LYS B H    2  
ATOM 2171  H HA   . LYS A 1 44 ? 6.409   0.467   -1.161  1.00 0.00 ? 1088 LYS B HA   2  
ATOM 2172  H HB2  . LYS A 1 44 ? 7.857   3.121   -1.210  1.00 0.00 ? 1088 LYS B HB2  2  
ATOM 2173  H HB3  . LYS A 1 44 ? 8.643   1.561   -0.957  1.00 0.00 ? 1088 LYS B HB3  2  
ATOM 2174  H HG2  . LYS A 1 44 ? 7.940   0.770   -3.125  1.00 0.00 ? 1088 LYS B HG2  2  
ATOM 2175  H HG3  . LYS A 1 44 ? 6.922   2.190   -3.369  1.00 0.00 ? 1088 LYS B HG3  2  
ATOM 2176  H HD2  . LYS A 1 44 ? 9.003   2.474   -4.610  1.00 0.00 ? 1088 LYS B HD2  2  
ATOM 2177  H HD3  . LYS A 1 44 ? 8.963   3.623   -3.271  1.00 0.00 ? 1088 LYS B HD3  2  
ATOM 2178  H HE2  . LYS A 1 44 ? 10.379  2.159   -1.924  1.00 0.00 ? 1088 LYS B HE2  2  
ATOM 2179  H HE3  . LYS A 1 44 ? 10.363  0.936   -3.195  1.00 0.00 ? 1088 LYS B HE3  2  
ATOM 2180  H HZ1  . LYS A 1 44 ? 12.370  2.218   -3.339  1.00 0.00 ? 1088 LYS B HZ1  2  
ATOM 2181  H HZ2  . LYS A 1 44 ? 11.497  3.675   -3.386  1.00 0.00 ? 1088 LYS B HZ2  2  
ATOM 2182  H HZ3  . LYS A 1 44 ? 11.397  2.580   -4.681  1.00 0.00 ? 1088 LYS B HZ3  2  
ATOM 2183  N N    . TRP A 1 45 ? 5.728   2.391   1.287   1.00 0.00 ? 1089 TRP B N    2  
ATOM 2184  C CA   . TRP A 1 45 ? 5.704   2.514   2.740   1.00 0.00 ? 1089 TRP B CA   2  
ATOM 2185  C C    . TRP A 1 45 ? 4.854   1.422   3.362   1.00 0.00 ? 1089 TRP B C    2  
ATOM 2186  O O    . TRP A 1 45 ? 3.758   1.129   2.893   1.00 0.00 ? 1089 TRP B O    2  
ATOM 2187  C CB   . TRP A 1 45 ? 5.143   3.878   3.153   1.00 0.00 ? 1089 TRP B CB   2  
ATOM 2188  C CG   . TRP A 1 45 ? 6.167   4.936   2.906   1.00 0.00 ? 1089 TRP B CG   2  
ATOM 2189  C CD1  . TRP A 1 45 ? 6.987   4.981   1.836   1.00 0.00 ? 1089 TRP B CD1  2  
ATOM 2190  C CD2  . TRP A 1 45 ? 6.499   6.094   3.726   1.00 0.00 ? 1089 TRP B CD2  2  
ATOM 2191  N NE1  . TRP A 1 45 ? 7.798   6.089   1.940   1.00 0.00 ? 1089 TRP B NE1  2  
ATOM 2192  C CE2  . TRP A 1 45 ? 7.538   6.810   3.085   1.00 0.00 ? 1089 TRP B CE2  2  
ATOM 2193  C CE3  . TRP A 1 45 ? 6.006   6.593   4.949   1.00 0.00 ? 1089 TRP B CE3  2  
ATOM 2194  C CZ2  . TRP A 1 45 ? 8.071   7.977   3.635   1.00 0.00 ? 1089 TRP B CZ2  2  
ATOM 2195  C CZ3  . TRP A 1 45 ? 6.544   7.767   5.504   1.00 0.00 ? 1089 TRP B CZ3  2  
ATOM 2196  C CH2  . TRP A 1 45 ? 7.573   8.458   4.846   1.00 0.00 ? 1089 TRP B CH2  2  
ATOM 2197  H H    . TRP A 1 45 ? 5.129   2.946   0.749   1.00 0.00 ? 1089 TRP B H    2  
ATOM 2198  H HA   . TRP A 1 45 ? 6.712   2.428   3.115   1.00 0.00 ? 1089 TRP B HA   2  
ATOM 2199  H HB2  . TRP A 1 45 ? 4.258   4.093   2.576   1.00 0.00 ? 1089 TRP B HB2  2  
ATOM 2200  H HB3  . TRP A 1 45 ? 4.892   3.859   4.204   1.00 0.00 ? 1089 TRP B HB3  2  
ATOM 2201  H HD1  . TRP A 1 45 ? 7.004   4.266   1.026   1.00 0.00 ? 1089 TRP B HD1  2  
ATOM 2202  H HE1  . TRP A 1 45 ? 8.480   6.346   1.289   1.00 0.00 ? 1089 TRP B HE1  2  
ATOM 2203  H HE3  . TRP A 1 45 ? 5.213   6.067   5.468   1.00 0.00 ? 1089 TRP B HE3  2  
ATOM 2204  H HZ2  . TRP A 1 45 ? 8.864   8.503   3.125   1.00 0.00 ? 1089 TRP B HZ2  2  
ATOM 2205  H HZ3  . TRP A 1 45 ? 6.160   8.143   6.441   1.00 0.00 ? 1089 TRP B HZ3  2  
ATOM 2206  H HH2  . TRP A 1 45 ? 7.978   9.360   5.277   1.00 0.00 ? 1089 TRP B HH2  2  
ATOM 2207  N N    . LYS A 1 46 ? 5.358   0.833   4.432   1.00 0.00 ? 1090 LYS B N    2  
ATOM 2208  C CA   . LYS A 1 46 ? 4.626   -0.220  5.117   1.00 0.00 ? 1090 LYS B CA   2  
ATOM 2209  C C    . LYS A 1 46 ? 3.318   0.304   5.675   1.00 0.00 ? 1090 LYS B C    2  
ATOM 2210  O O    . LYS A 1 46 ? 3.145   1.507   5.859   1.00 0.00 ? 1090 LYS B O    2  
ATOM 2211  C CB   . LYS A 1 46 ? 5.473   -0.781  6.249   1.00 0.00 ? 1090 LYS B CB   2  
ATOM 2212  C CG   . LYS A 1 46 ? 6.624   -1.569  5.646   1.00 0.00 ? 1090 LYS B CG   2  
ATOM 2213  C CD   . LYS A 1 46 ? 7.510   -2.101  6.761   1.00 0.00 ? 1090 LYS B CD   2  
ATOM 2214  C CE   . LYS A 1 46 ? 8.660   -2.909  6.159   1.00 0.00 ? 1090 LYS B CE   2  
ATOM 2215  N NZ   . LYS A 1 46 ? 9.532   -3.421  7.253   1.00 0.00 ? 1090 LYS B NZ   2  
ATOM 2216  H H    . LYS A 1 46 ? 6.237   1.114   4.772   1.00 0.00 ? 1090 LYS B H    2  
ATOM 2217  H HA   . LYS A 1 46 ? 4.418   -1.011  4.418   1.00 0.00 ? 1090 LYS B HA   2  
ATOM 2218  H HB2  . LYS A 1 46 ? 5.861   0.030   6.847   1.00 0.00 ? 1090 LYS B HB2  2  
ATOM 2219  H HB3  . LYS A 1 46 ? 4.873   -1.434  6.863   1.00 0.00 ? 1090 LYS B HB3  2  
ATOM 2220  H HG2  . LYS A 1 46 ? 6.224   -2.394  5.075   1.00 0.00 ? 1090 LYS B HG2  2  
ATOM 2221  H HG3  . LYS A 1 46 ? 7.199   -0.926  5.001   1.00 0.00 ? 1090 LYS B HG3  2  
ATOM 2222  H HD2  . LYS A 1 46 ? 7.906   -1.268  7.323   1.00 0.00 ? 1090 LYS B HD2  2  
ATOM 2223  H HD3  . LYS A 1 46 ? 6.927   -2.733  7.412   1.00 0.00 ? 1090 LYS B HD3  2  
ATOM 2224  H HE2  . LYS A 1 46 ? 8.260   -3.740  5.597   1.00 0.00 ? 1090 LYS B HE2  2  
ATOM 2225  H HE3  . LYS A 1 46 ? 9.239   -2.275  5.502   1.00 0.00 ? 1090 LYS B HE3  2  
ATOM 2226  H HZ1  . LYS A 1 46 ? 10.516  -3.471  6.918   1.00 0.00 ? 1090 LYS B HZ1  2  
ATOM 2227  H HZ2  . LYS A 1 46 ? 9.212   -4.370  7.534   1.00 0.00 ? 1090 LYS B HZ2  2  
ATOM 2228  H HZ3  . LYS A 1 46 ? 9.479   -2.780  8.070   1.00 0.00 ? 1090 LYS B HZ3  2  
ATOM 2229  N N    . TYR A 1 47 ? 2.399   -0.611  5.947   1.00 0.00 ? 1091 TYR B N    2  
ATOM 2230  C CA   . TYR A 1 47 ? 1.111   -0.230  6.493   1.00 0.00 ? 1091 TYR B CA   2  
ATOM 2231  C C    . TYR A 1 47 ? 1.312   0.538   7.785   1.00 0.00 ? 1091 TYR B C    2  
ATOM 2232  O O    . TYR A 1 47 ? 0.720   1.596   7.992   1.00 0.00 ? 1091 TYR B O    2  
ATOM 2233  C CB   . TYR A 1 47 ? 0.269   -1.476  6.766   1.00 0.00 ? 1091 TYR B CB   2  
ATOM 2234  C CG   . TYR A 1 47 ? -0.962  -1.088  7.549   1.00 0.00 ? 1091 TYR B CG   2  
ATOM 2235  C CD1  . TYR A 1 47 ? -2.010  -0.408  6.919   1.00 0.00 ? 1091 TYR B CD1  2  
ATOM 2236  C CD2  . TYR A 1 47 ? -1.054  -1.412  8.908   1.00 0.00 ? 1091 TYR B CD2  2  
ATOM 2237  C CE1  . TYR A 1 47 ? -3.150  -0.049  7.649   1.00 0.00 ? 1091 TYR B CE1  2  
ATOM 2238  C CE2  . TYR A 1 47 ? -2.194  -1.056  9.637   1.00 0.00 ? 1091 TYR B CE2  2  
ATOM 2239  C CZ   . TYR A 1 47 ? -3.242  -0.374  9.008   1.00 0.00 ? 1091 TYR B CZ   2  
ATOM 2240  O OH   . TYR A 1 47 ? -4.366  -0.021  9.727   1.00 0.00 ? 1091 TYR B OH   2  
ATOM 2241  H H    . TYR A 1 47 ? 2.596   -1.557  5.783   1.00 0.00 ? 1091 TYR B H    2  
ATOM 2242  H HA   . TYR A 1 47 ? 0.593   0.396   5.782   1.00 0.00 ? 1091 TYR B HA   2  
ATOM 2243  H HB2  . TYR A 1 47 ? -0.028  -1.920  5.830   1.00 0.00 ? 1091 TYR B HB2  2  
ATOM 2244  H HB3  . TYR A 1 47 ? 0.848   -2.186  7.336   1.00 0.00 ? 1091 TYR B HB3  2  
ATOM 2245  H HD1  . TYR A 1 47 ? -1.938  -0.156  5.871   1.00 0.00 ? 1091 TYR B HD1  2  
ATOM 2246  H HD2  . TYR A 1 47 ? -0.245  -1.938  9.393   1.00 0.00 ? 1091 TYR B HD2  2  
ATOM 2247  H HE1  . TYR A 1 47 ? -3.959  0.476   7.164   1.00 0.00 ? 1091 TYR B HE1  2  
ATOM 2248  H HE2  . TYR A 1 47 ? -2.264  -1.306  10.685  1.00 0.00 ? 1091 TYR B HE2  2  
ATOM 2249  H HH   . TYR A 1 47 ? -4.217  -0.264  10.645  1.00 0.00 ? 1091 TYR B HH   2  
ATOM 2250  N N    . ALA A 1 48 ? 2.163   0.004   8.649   1.00 0.00 ? 1092 ALA B N    2  
ATOM 2251  C CA   . ALA A 1 48 ? 2.441   0.660   9.918   1.00 0.00 ? 1092 ALA B CA   2  
ATOM 2252  C C    . ALA A 1 48 ? 3.056   2.037   9.682   1.00 0.00 ? 1092 ALA B C    2  
ATOM 2253  O O    . ALA A 1 48 ? 2.742   2.997   10.386  1.00 0.00 ? 1092 ALA B O    2  
ATOM 2254  C CB   . ALA A 1 48 ? 3.395   -0.191  10.757  1.00 0.00 ? 1092 ALA B CB   2  
ATOM 2255  H H    . ALA A 1 48 ? 2.619   -0.842  8.422   1.00 0.00 ? 1092 ALA B H    2  
ATOM 2256  H HA   . ALA A 1 48 ? 1.514   0.780   10.460  1.00 0.00 ? 1092 ALA B HA   2  
ATOM 2257  H HB1  . ALA A 1 48 ? 4.362   -0.226  10.278  1.00 0.00 ? 1092 ALA B HB1  2  
ATOM 2258  H HB2  . ALA A 1 48 ? 3.002   -1.193  10.846  1.00 0.00 ? 1092 ALA B HB2  2  
ATOM 2259  H HB3  . ALA A 1 48 ? 3.497   0.244   11.741  1.00 0.00 ? 1092 ALA B HB3  2  
ATOM 2260  N N    . GLU A 1 49 ? 3.938   2.122   8.690   1.00 0.00 ? 1093 GLU B N    2  
ATOM 2261  C CA   . GLU A 1 49 ? 4.600   3.384   8.374   1.00 0.00 ? 1093 GLU B CA   2  
ATOM 2262  C C    . GLU A 1 49 ? 3.591   4.427   7.907   1.00 0.00 ? 1093 GLU B C    2  
ATOM 2263  O O    . GLU A 1 49 ? 3.650   5.585   8.323   1.00 0.00 ? 1093 GLU B O    2  
ATOM 2264  C CB   . GLU A 1 49 ? 5.649   3.164   7.280   1.00 0.00 ? 1093 GLU B CB   2  
ATOM 2265  C CG   . GLU A 1 49 ? 6.795   2.311   7.829   1.00 0.00 ? 1093 GLU B CG   2  
ATOM 2266  C CD   . GLU A 1 49 ? 7.600   3.111   8.848   1.00 0.00 ? 1093 GLU B CD   2  
ATOM 2267  O OE1  . GLU A 1 49 ? 7.469   4.324   8.857   1.00 0.00 ? 1093 GLU B OE1  2  
ATOM 2268  O OE2  . GLU A 1 49 ? 8.336   2.498   9.604   1.00 0.00 ? 1093 GLU B OE2  2  
ATOM 2269  H H    . GLU A 1 49 ? 4.149   1.325   8.168   1.00 0.00 ? 1093 GLU B H    2  
ATOM 2270  H HA   . GLU A 1 49 ? 5.096   3.749   9.260   1.00 0.00 ? 1093 GLU B HA   2  
ATOM 2271  H HB2  . GLU A 1 49 ? 5.193   2.660   6.440   1.00 0.00 ? 1093 GLU B HB2  2  
ATOM 2272  H HB3  . GLU A 1 49 ? 6.037   4.119   6.958   1.00 0.00 ? 1093 GLU B HB3  2  
ATOM 2273  H HG2  . GLU A 1 49 ? 6.389   1.432   8.306   1.00 0.00 ? 1093 GLU B HG2  2  
ATOM 2274  H HG3  . GLU A 1 49 ? 7.441   2.013   7.018   1.00 0.00 ? 1093 GLU B HG3  2  
ATOM 2275  N N    . LEU A 1 50 ? 2.658   4.020   7.054   1.00 0.00 ? 1094 LEU B N    2  
ATOM 2276  C CA   . LEU A 1 50 ? 1.646   4.943   6.567   1.00 0.00 ? 1094 LEU B CA   2  
ATOM 2277  C C    . LEU A 1 50 ? 0.744   5.379   7.705   1.00 0.00 ? 1094 LEU B C    2  
ATOM 2278  O O    . LEU A 1 50 ? 0.359   6.542   7.793   1.00 0.00 ? 1094 LEU B O    2  
ATOM 2279  C CB   . LEU A 1 50 ? 0.826   4.292   5.456   1.00 0.00 ? 1094 LEU B CB   2  
ATOM 2280  C CG   . LEU A 1 50 ? 1.694   4.191   4.204   1.00 0.00 ? 1094 LEU B CG   2  
ATOM 2281  C CD1  . LEU A 1 50 ? 1.046   3.238   3.197   1.00 0.00 ? 1094 LEU B CD1  2  
ATOM 2282  C CD2  . LEU A 1 50 ? 1.819   5.580   3.572   1.00 0.00 ? 1094 LEU B CD2  2  
ATOM 2283  H H    . LEU A 1 50 ? 2.643   3.086   6.757   1.00 0.00 ? 1094 LEU B H    2  
ATOM 2284  H HA   . LEU A 1 50 ? 2.140   5.815   6.169   1.00 0.00 ? 1094 LEU B HA   2  
ATOM 2285  H HB2  . LEU A 1 50 ? 0.516   3.303   5.765   1.00 0.00 ? 1094 LEU B HB2  2  
ATOM 2286  H HB3  . LEU A 1 50 ? -0.043  4.895   5.244   1.00 0.00 ? 1094 LEU B HB3  2  
ATOM 2287  H HG   . LEU A 1 50 ? 2.674   3.829   4.476   1.00 0.00 ? 1094 LEU B HG   2  
ATOM 2288  H HD11 . LEU A 1 50 ? 0.355   3.787   2.573   1.00 0.00 ? 1094 LEU B HD11 2  
ATOM 2289  H HD12 . LEU A 1 50 ? 0.515   2.462   3.728   1.00 0.00 ? 1094 LEU B HD12 2  
ATOM 2290  H HD13 . LEU A 1 50 ? 1.813   2.793   2.581   1.00 0.00 ? 1094 LEU B HD13 2  
ATOM 2291  H HD21 . LEU A 1 50 ? 1.220   5.622   2.672   1.00 0.00 ? 1094 LEU B HD21 2  
ATOM 2292  H HD22 . LEU A 1 50 ? 2.852   5.773   3.328   1.00 0.00 ? 1094 LEU B HD22 2  
ATOM 2293  H HD23 . LEU A 1 50 ? 1.468   6.327   4.271   1.00 0.00 ? 1094 LEU B HD23 2  
ATOM 2294  N N    . ARG A 1 51 ? 0.416   4.441   8.578   1.00 0.00 ? 1095 ARG B N    2  
ATOM 2295  C CA   . ARG A 1 51 ? -0.437  4.750   9.707   1.00 0.00 ? 1095 ARG B CA   2  
ATOM 2296  C C    . ARG A 1 51 ? 0.205   5.836   10.556  1.00 0.00 ? 1095 ARG B C    2  
ATOM 2297  O O    . ARG A 1 51 ? -0.436  6.827   10.909  1.00 0.00 ? 1095 ARG B O    2  
ATOM 2298  C CB   . ARG A 1 51 ? -0.629  3.495   10.550  1.00 0.00 ? 1095 ARG B CB   2  
ATOM 2299  C CG   . ARG A 1 51 ? -1.625  3.787   11.670  1.00 0.00 ? 1095 ARG B CG   2  
ATOM 2300  C CD   . ARG A 1 51 ? -1.762  2.552   12.556  1.00 0.00 ? 1095 ARG B CD   2  
ATOM 2301  N NE   . ARG A 1 51 ? -0.536  2.341   13.315  1.00 0.00 ? 1095 ARG B NE   2  
ATOM 2302  C CZ   . ARG A 1 51 ? -0.355  1.258   14.069  1.00 0.00 ? 1095 ARG B CZ   2  
ATOM 2303  N NH1  . ARG A 1 51 ? -1.278  0.335   14.149  1.00 0.00 ? 1095 ARG B NH1  2  
ATOM 2304  N NH2  . ARG A 1 51 ? 0.756   1.119   14.738  1.00 0.00 ? 1095 ARG B NH2  2  
ATOM 2305  H H    . ARG A 1 51 ? 0.754   3.527   8.462   1.00 0.00 ? 1095 ARG B H    2  
ATOM 2306  H HA   . ARG A 1 51 ? -1.397  5.092   9.350   1.00 0.00 ? 1095 ARG B HA   2  
ATOM 2307  H HB2  . ARG A 1 51 ? -1.004  2.697   9.924   1.00 0.00 ? 1095 ARG B HB2  2  
ATOM 2308  H HB3  . ARG A 1 51 ? 0.321   3.201   10.976  1.00 0.00 ? 1095 ARG B HB3  2  
ATOM 2309  H HG2  . ARG A 1 51 ? -1.269  4.620   12.261  1.00 0.00 ? 1095 ARG B HG2  2  
ATOM 2310  H HG3  . ARG A 1 51 ? -2.586  4.032   11.243  1.00 0.00 ? 1095 ARG B HG3  2  
ATOM 2311  H HD2  . ARG A 1 51 ? -2.587  2.690   13.239  1.00 0.00 ? 1095 ARG B HD2  2  
ATOM 2312  H HD3  . ARG A 1 51 ? -1.953  1.691   11.933  1.00 0.00 ? 1095 ARG B HD3  2  
ATOM 2313  H HE   . ARG A 1 51 ? 0.174   3.016   13.270  1.00 0.00 ? 1095 ARG B HE   2  
ATOM 2314  H HH11 . ARG A 1 51 ? -2.134  0.430   13.643  1.00 0.00 ? 1095 ARG B HH11 2  
ATOM 2315  H HH12 . ARG A 1 51 ? -1.126  -0.472  14.720  1.00 0.00 ? 1095 ARG B HH12 2  
ATOM 2316  H HH21 . ARG A 1 51 ? 1.464   1.824   14.682  1.00 0.00 ? 1095 ARG B HH21 2  
ATOM 2317  H HH22 . ARG A 1 51 ? 0.899   0.310   15.307  1.00 0.00 ? 1095 ARG B HH22 2  
ATOM 2318  N N    . ASP A 1 52 ? 1.484   5.653   10.864  1.00 0.00 ? 1096 ASP B N    2  
ATOM 2319  C CA   . ASP A 1 52 ? 2.208   6.634   11.658  1.00 0.00 ? 1096 ASP B CA   2  
ATOM 2320  C C    . ASP A 1 52 ? 2.314   7.949   10.895  1.00 0.00 ? 1096 ASP B C    2  
ATOM 2321  O O    . ASP A 1 52 ? 2.190   9.025   11.479  1.00 0.00 ? 1096 ASP B O    2  
ATOM 2322  C CB   . ASP A 1 52 ? 3.607   6.119   12.004  1.00 0.00 ? 1096 ASP B CB   2  
ATOM 2323  C CG   . ASP A 1 52 ? 4.264   7.046   13.020  1.00 0.00 ? 1096 ASP B CG   2  
ATOM 2324  O OD1  . ASP A 1 52 ? 3.733   8.123   13.241  1.00 0.00 ? 1096 ASP B OD1  2  
ATOM 2325  O OD2  . ASP A 1 52 ? 5.285   6.664   13.570  1.00 0.00 ? 1096 ASP B OD2  2  
ATOM 2326  H H    . ASP A 1 52 ? 1.948   4.852   10.544  1.00 0.00 ? 1096 ASP B H    2  
ATOM 2327  H HA   . ASP A 1 52 ? 1.665   6.806   12.575  1.00 0.00 ? 1096 ASP B HA   2  
ATOM 2328  H HB2  . ASP A 1 52 ? 3.530   5.124   12.420  1.00 0.00 ? 1096 ASP B HB2  2  
ATOM 2329  H HB3  . ASP A 1 52 ? 4.209   6.088   11.109  1.00 0.00 ? 1096 ASP B HB3  2  
ATOM 2330  N N    . THR A 1 53 ? 2.548   7.861   9.588   1.00 0.00 ? 1097 THR B N    2  
ATOM 2331  C CA   . THR A 1 53 ? 2.670   9.064   8.776   1.00 0.00 ? 1097 THR B CA   2  
ATOM 2332  C C    . THR A 1 53 ? 1.385   9.884   8.832   1.00 0.00 ? 1097 THR B C    2  
ATOM 2333  O O    . THR A 1 53 ? 1.422   11.104  8.969   1.00 0.00 ? 1097 THR B O    2  
ATOM 2334  C CB   . THR A 1 53 ? 2.974   8.691   7.326   1.00 0.00 ? 1097 THR B CB   2  
ATOM 2335  O OG1  . THR A 1 53 ? 4.197   7.969   7.273   1.00 0.00 ? 1097 THR B OG1  2  
ATOM 2336  C CG2  . THR A 1 53 ? 3.097   9.967   6.495   1.00 0.00 ? 1097 THR B CG2  2  
ATOM 2337  H H    . THR A 1 53 ? 2.644   6.978   9.159   1.00 0.00 ? 1097 THR B H    2  
ATOM 2338  H HA   . THR A 1 53 ? 3.485   9.658   9.158   1.00 0.00 ? 1097 THR B HA   2  
ATOM 2339  H HB   . THR A 1 53 ? 2.175   8.083   6.931   1.00 0.00 ? 1097 THR B HB   2  
ATOM 2340  H HG1  . THR A 1 53 ? 4.630   8.055   8.126   1.00 0.00 ? 1097 THR B HG1  2  
ATOM 2341  H HG21 . THR A 1 53 ? 3.016   10.828  7.145   1.00 0.00 ? 1097 THR B HG21 2  
ATOM 2342  H HG22 . THR A 1 53 ? 2.307   9.996   5.759   1.00 0.00 ? 1097 THR B HG22 2  
ATOM 2343  H HG23 . THR A 1 53 ? 4.055   9.982   5.996   1.00 0.00 ? 1097 THR B HG23 2  
ATOM 2344  N N    . ILE A 1 54 ? 0.247   9.211   8.721   1.00 0.00 ? 1098 ILE B N    2  
ATOM 2345  C CA   . ILE A 1 54 ? -1.037  9.901   8.755   1.00 0.00 ? 1098 ILE B CA   2  
ATOM 2346  C C    . ILE A 1 54 ? -1.241  10.613  10.089  1.00 0.00 ? 1098 ILE B C    2  
ATOM 2347  O O    . ILE A 1 54 ? -1.629  11.779  10.129  1.00 0.00 ? 1098 ILE B O    2  
ATOM 2348  C CB   . ILE A 1 54 ? -2.166  8.892   8.541   1.00 0.00 ? 1098 ILE B CB   2  
ATOM 2349  C CG1  . ILE A 1 54 ? -2.090  8.368   7.111   1.00 0.00 ? 1098 ILE B CG1  2  
ATOM 2350  C CG2  . ILE A 1 54 ? -3.519  9.572   8.763   1.00 0.00 ? 1098 ILE B CG2  2  
ATOM 2351  C CD1  . ILE A 1 54 ? -3.021  7.166   6.951   1.00 0.00 ? 1098 ILE B CD1  2  
ATOM 2352  H H    . ILE A 1 54 ? 0.270   8.239   8.608   1.00 0.00 ? 1098 ILE B H    2  
ATOM 2353  H HA   . ILE A 1 54 ? -1.068  10.629  7.960   1.00 0.00 ? 1098 ILE B HA   2  
ATOM 2354  H HB   . ILE A 1 54 ? -2.055  8.072   9.236   1.00 0.00 ? 1098 ILE B HB   2  
ATOM 2355  H HG12 . ILE A 1 54 ? -2.386  9.148   6.428   1.00 0.00 ? 1098 ILE B HG12 2  
ATOM 2356  H HG13 . ILE A 1 54 ? -1.078  8.067   6.898   1.00 0.00 ? 1098 ILE B HG13 2  
ATOM 2357  H HG21 . ILE A 1 54 ? -3.922  9.270   9.718   1.00 0.00 ? 1098 ILE B HG21 2  
ATOM 2358  H HG22 . ILE A 1 54 ? -4.200  9.283   7.977   1.00 0.00 ? 1098 ILE B HG22 2  
ATOM 2359  H HG23 . ILE A 1 54 ? -3.390  10.644  8.750   1.00 0.00 ? 1098 ILE B HG23 2  
ATOM 2360  H HD11 . ILE A 1 54 ? -4.039  7.472   7.135   1.00 0.00 ? 1098 ILE B HD11 2  
ATOM 2361  H HD12 . ILE A 1 54 ? -2.742  6.397   7.656   1.00 0.00 ? 1098 ILE B HD12 2  
ATOM 2362  H HD13 . ILE A 1 54 ? -2.938  6.780   5.946   1.00 0.00 ? 1098 ILE B HD13 2  
ATOM 2363  N N    . ASN A 1 55 ? -0.977  9.903   11.176  1.00 0.00 ? 1099 ASN B N    2  
ATOM 2364  C CA   . ASN A 1 55 ? -1.144  10.472  12.508  1.00 0.00 ? 1099 ASN B CA   2  
ATOM 2365  C C    . ASN A 1 55 ? -0.217  11.663  12.720  1.00 0.00 ? 1099 ASN B C    2  
ATOM 2366  O O    . ASN A 1 55 ? -0.602  12.655  13.339  1.00 0.00 ? 1099 ASN B O    2  
ATOM 2367  C CB   . ASN A 1 55 ? -0.867  9.397   13.555  1.00 0.00 ? 1099 ASN B CB   2  
ATOM 2368  C CG   . ASN A 1 55 ? -2.098  8.511   13.704  1.00 0.00 ? 1099 ASN B CG   2  
ATOM 2369  O OD1  . ASN A 1 55 ? -2.892  8.701   14.625  1.00 0.00 ? 1099 ASN B OD1  2  
ATOM 2370  N ND2  . ASN A 1 55 ? -2.331  7.580   12.818  1.00 0.00 ? 1099 ASN B ND2  2  
ATOM 2371  H H    . ASN A 1 55 ? -0.668  8.974   11.082  1.00 0.00 ? 1099 ASN B H    2  
ATOM 2372  H HA   . ASN A 1 55 ? -2.164  10.804  12.616  1.00 0.00 ? 1099 ASN B HA   2  
ATOM 2373  H HB2  . ASN A 1 55 ? -0.026  8.797   13.241  1.00 0.00 ? 1099 ASN B HB2  2  
ATOM 2374  H HB3  . ASN A 1 55 ? -0.644  9.864   14.502  1.00 0.00 ? 1099 ASN B HB3  2  
ATOM 2375  H HD21 . ASN A 1 55 ? -1.721  7.458   12.063  1.00 0.00 ? 1099 ASN B HD21 2  
ATOM 2376  H HD22 . ASN A 1 55 ? -3.118  7.004   12.910  1.00 0.00 ? 1099 ASN B HD22 2  
ATOM 2377  N N    . THR A 1 56 ? 1.002   11.563  12.207  1.00 0.00 ? 1100 THR B N    2  
ATOM 2378  C CA   . THR A 1 56 ? 1.966   12.648  12.354  1.00 0.00 ? 1100 THR B CA   2  
ATOM 2379  C C    . THR A 1 56 ? 1.884   13.633  11.188  1.00 0.00 ? 1100 THR B C    2  
ATOM 2380  O O    . THR A 1 56 ? 2.631   14.611  11.149  1.00 0.00 ? 1100 THR B O    2  
ATOM 2381  C CB   . THR A 1 56 ? 3.387   12.087  12.458  1.00 0.00 ? 1100 THR B CB   2  
ATOM 2382  O OG1  . THR A 1 56 ? 4.267   13.115  12.892  1.00 0.00 ? 1100 THR B OG1  2  
ATOM 2383  C CG2  . THR A 1 56 ? 3.833   11.575  11.091  1.00 0.00 ? 1100 THR B CG2  2  
ATOM 2384  H H    . THR A 1 56 ? 1.257   10.751  11.717  1.00 0.00 ? 1100 THR B H    2  
ATOM 2385  H HA   . THR A 1 56 ? 1.743   13.180  13.268  1.00 0.00 ? 1100 THR B HA   2  
ATOM 2386  H HB   . THR A 1 56 ? 3.405   11.274  13.167  1.00 0.00 ? 1100 THR B HB   2  
ATOM 2387  H HG1  . THR A 1 56 ? 3.733   13.845  13.216  1.00 0.00 ? 1100 THR B HG1  2  
ATOM 2388  H HG21 . THR A 1 56 ? 4.117   12.411  10.468  1.00 0.00 ? 1100 THR B HG21 2  
ATOM 2389  H HG22 . THR A 1 56 ? 3.020   11.042  10.626  1.00 0.00 ? 1100 THR B HG22 2  
ATOM 2390  H HG23 . THR A 1 56 ? 4.678   10.913  11.211  1.00 0.00 ? 1100 THR B HG23 2  
ATOM 2391  N N    . SER A 1 57 ? 0.995   13.372  10.228  1.00 0.00 ? 1101 SER B N    2  
ATOM 2392  C CA   . SER A 1 57 ? 0.876   14.250  9.080   1.00 0.00 ? 1101 SER B CA   2  
ATOM 2393  C C    . SER A 1 57 ? 0.436   15.639  9.507   1.00 0.00 ? 1101 SER B C    2  
ATOM 2394  O O    . SER A 1 57 ? -0.250  15.810  10.517  1.00 0.00 ? 1101 SER B O    2  
ATOM 2395  C CB   . SER A 1 57 ? -0.152  13.691  8.100   1.00 0.00 ? 1101 SER B CB   2  
ATOM 2396  O OG   . SER A 1 57 ? -1.448  13.807  8.674   1.00 0.00 ? 1101 SER B OG   2  
ATOM 2397  H H    . SER A 1 57 ? 0.428   12.578  10.282  1.00 0.00 ? 1101 SER B H    2  
ATOM 2398  H HA   . SER A 1 57 ? 1.831   14.317  8.583   1.00 0.00 ? 1101 SER B HA   2  
ATOM 2399  H HB2  . SER A 1 57 ? -0.120  14.254  7.181   1.00 0.00 ? 1101 SER B HB2  2  
ATOM 2400  H HB3  . SER A 1 57 ? 0.071   12.654  7.893   1.00 0.00 ? 1101 SER B HB3  2  
ATOM 2401  H HG   . SER A 1 57 ? -1.991  14.333  8.080   1.00 0.00 ? 1101 SER B HG   2  
ATOM 2402  N N    . CYS A 1 58 ? 0.827   16.618  8.714   1.00 0.00 ? 1102 CYS B N    2  
ATOM 2403  C CA   . CYS A 1 58 ? 0.473   17.999  8.978   1.00 0.00 ? 1102 CYS B CA   2  
ATOM 2404  C C    . CYS A 1 58 ? -0.116  18.639  7.720   1.00 0.00 ? 1102 CYS B C    2  
ATOM 2405  O O    . CYS A 1 58 ? -0.559  19.789  7.752   1.00 0.00 ? 1102 CYS B O    2  
ATOM 2406  C CB   . CYS A 1 58 ? 1.713   18.774  9.427   1.00 0.00 ? 1102 CYS B CB   2  
ATOM 2407  S SG   . CYS A 1 58 ? 2.838   18.984  8.025   1.00 0.00 ? 1102 CYS B SG   2  
ATOM 2408  H H    . CYS A 1 58 ? 1.362   16.406  7.922   1.00 0.00 ? 1102 CYS B H    2  
ATOM 2409  H HA   . CYS A 1 58 ? -0.264  18.028  9.767   1.00 0.00 ? 1102 CYS B HA   2  
ATOM 2410  H HB2  . CYS A 1 58 ? 1.418   19.744  9.800   1.00 0.00 ? 1102 CYS B HB2  2  
ATOM 2411  H HB3  . CYS A 1 58 ? 2.214   18.225  10.211  1.00 0.00 ? 1102 CYS B HB3  2  
ATOM 2412  H HG   . CYS A 1 58 ? 3.313   18.159  7.900   1.00 0.00 ? 1102 CYS B HG   2  
ATOM 2413  N N    . ASP A 1 59 ? -0.116  17.894  6.611   1.00 0.00 ? 1103 ASP B N    2  
ATOM 2414  C CA   . ASP A 1 59 ? -0.649  18.416  5.357   1.00 0.00 ? 1103 ASP B CA   2  
ATOM 2415  C C    . ASP A 1 59 ? -1.706  17.482  4.773   1.00 0.00 ? 1103 ASP B C    2  
ATOM 2416  O O    . ASP A 1 59 ? -1.571  16.254  4.822   1.00 0.00 ? 1103 ASP B O    2  
ATOM 2417  C CB   . ASP A 1 59 ? 0.487   18.604  4.349   1.00 0.00 ? 1103 ASP B CB   2  
ATOM 2418  C CG   . ASP A 1 59 ? 1.373   19.767  4.778   1.00 0.00 ? 1103 ASP B CG   2  
ATOM 2419  O OD1  . ASP A 1 59 ? 0.952   20.520  5.641   1.00 0.00 ? 1103 ASP B OD1  2  
ATOM 2420  O OD2  . ASP A 1 59 ? 2.461   19.888  4.240   1.00 0.00 ? 1103 ASP B OD2  2  
ATOM 2421  H H    . ASP A 1 59 ? 0.250   16.982  6.635   1.00 0.00 ? 1103 ASP B H    2  
ATOM 2422  H HA   . ASP A 1 59 ? -1.102  19.376  5.546   1.00 0.00 ? 1103 ASP B HA   2  
ATOM 2423  H HB2  . ASP A 1 59 ? 1.076   17.701  4.300   1.00 0.00 ? 1103 ASP B HB2  2  
ATOM 2424  H HB3  . ASP A 1 59 ? 0.069   18.813  3.375   1.00 0.00 ? 1103 ASP B HB3  2  
ATOM 2425  N N    . ILE A 1 60 ? -2.757  18.072  4.213   1.00 0.00 ? 1104 ILE B N    2  
ATOM 2426  C CA   . ILE A 1 60 ? -3.830  17.295  3.615   1.00 0.00 ? 1104 ILE B CA   2  
ATOM 2427  C C    . ILE A 1 60 ? -3.346  16.586  2.352   1.00 0.00 ? 1104 ILE B C    2  
ATOM 2428  O O    . ILE A 1 60 ? -3.894  15.556  1.961   1.00 0.00 ? 1104 ILE B O    2  
ATOM 2429  C CB   . ILE A 1 60 ? -5.006  18.217  3.275   1.00 0.00 ? 1104 ILE B CB   2  
ATOM 2430  C CG1  . ILE A 1 60 ? -4.553  19.292  2.280   1.00 0.00 ? 1104 ILE B CG1  2  
ATOM 2431  C CG2  . ILE A 1 60 ? -5.514  18.894  4.551   1.00 0.00 ? 1104 ILE B CG2  2  
ATOM 2432  C CD1  . ILE A 1 60 ? -5.770  20.077  1.790   1.00 0.00 ? 1104 ILE B CD1  2  
ATOM 2433  H H    . ILE A 1 60 ? -2.808  19.050  4.197   1.00 0.00 ? 1104 ILE B H    2  
ATOM 2434  H HA   . ILE A 1 60 ? -4.165  16.554  4.324   1.00 0.00 ? 1104 ILE B HA   2  
ATOM 2435  H HB   . ILE A 1 60 ? -5.801  17.634  2.837   1.00 0.00 ? 1104 ILE B HB   2  
ATOM 2436  H HG12 . ILE A 1 60 ? -3.861  19.964  2.768   1.00 0.00 ? 1104 ILE B HG12 2  
ATOM 2437  H HG13 . ILE A 1 60 ? -4.067  18.825  1.438   1.00 0.00 ? 1104 ILE B HG13 2  
ATOM 2438  H HG21 . ILE A 1 60 ? -6.566  18.685  4.674   1.00 0.00 ? 1104 ILE B HG21 2  
ATOM 2439  H HG22 . ILE A 1 60 ? -5.364  19.960  4.474   1.00 0.00 ? 1104 ILE B HG22 2  
ATOM 2440  H HG23 . ILE A 1 60 ? -4.968  18.513  5.400   1.00 0.00 ? 1104 ILE B HG23 2  
ATOM 2441  H HD11 . ILE A 1 60 ? -6.136  20.710  2.586   1.00 0.00 ? 1104 ILE B HD11 2  
ATOM 2442  H HD12 . ILE A 1 60 ? -6.548  19.389  1.491   1.00 0.00 ? 1104 ILE B HD12 2  
ATOM 2443  H HD13 . ILE A 1 60 ? -5.488  20.689  0.944   1.00 0.00 ? 1104 ILE B HD13 2  
ATOM 2444  N N    . GLU A 1 61 ? -2.320  17.144  1.723   1.00 0.00 ? 1105 GLU B N    2  
ATOM 2445  C CA   . GLU A 1 61 ? -1.774  16.554  0.505   1.00 0.00 ? 1105 GLU B CA   2  
ATOM 2446  C C    . GLU A 1 61 ? -1.209  15.170  0.794   1.00 0.00 ? 1105 GLU B C    2  
ATOM 2447  O O    . GLU A 1 61 ? -1.476  14.207  0.070   1.00 0.00 ? 1105 GLU B O    2  
ATOM 2448  C CB   . GLU A 1 61 ? -0.661  17.448  -0.047  1.00 0.00 ? 1105 GLU B CB   2  
ATOM 2449  C CG   . GLU A 1 61 ? -1.266  18.741  -0.600  1.00 0.00 ? 1105 GLU B CG   2  
ATOM 2450  C CD   . GLU A 1 61 ? -0.155  19.721  -0.962  1.00 0.00 ? 1105 GLU B CD   2  
ATOM 2451  O OE1  . GLU A 1 61 ? 0.970   19.490  -0.549  1.00 0.00 ? 1105 GLU B OE1  2  
ATOM 2452  O OE2  . GLU A 1 61 ? -0.445  20.686  -1.650  1.00 0.00 ? 1105 GLU B OE2  2  
ATOM 2453  H H    . GLU A 1 61 ? -1.920  17.959  2.083   1.00 0.00 ? 1105 GLU B H    2  
ATOM 2454  H HA   . GLU A 1 61 ? -2.557  16.471  -0.233  1.00 0.00 ? 1105 GLU B HA   2  
ATOM 2455  H HB2  . GLU A 1 61 ? 0.035   17.686  0.745   1.00 0.00 ? 1105 GLU B HB2  2  
ATOM 2456  H HB3  . GLU A 1 61 ? -0.141  16.929  -0.837  1.00 0.00 ? 1105 GLU B HB3  2  
ATOM 2457  H HG2  . GLU A 1 61 ? -1.848  18.515  -1.480  1.00 0.00 ? 1105 GLU B HG2  2  
ATOM 2458  H HG3  . GLU A 1 61 ? -1.905  19.187  0.149   1.00 0.00 ? 1105 GLU B HG3  2  
ATOM 2459  N N    . LEU A 1 62 ? -0.441  15.071  1.870   1.00 0.00 ? 1106 LEU B N    2  
ATOM 2460  C CA   . LEU A 1 62 ? 0.143   13.800  2.254   1.00 0.00 ? 1106 LEU B CA   2  
ATOM 2461  C C    . LEU A 1 62 ? -0.951  12.831  2.672   1.00 0.00 ? 1106 LEU B C    2  
ATOM 2462  O O    . LEU A 1 62 ? -0.911  11.645  2.346   1.00 0.00 ? 1106 LEU B O    2  
ATOM 2463  C CB   . LEU A 1 62 ? 1.111   13.993  3.418   1.00 0.00 ? 1106 LEU B CB   2  
ATOM 2464  C CG   . LEU A 1 62 ? 1.733   12.647  3.790   1.00 0.00 ? 1106 LEU B CG   2  
ATOM 2465  C CD1  . LEU A 1 62 ? 2.591   12.144  2.628   1.00 0.00 ? 1106 LEU B CD1  2  
ATOM 2466  C CD2  . LEU A 1 62 ? 2.603   12.815  5.037   1.00 0.00 ? 1106 LEU B CD2  2  
ATOM 2467  H H    . LEU A 1 62 ? -0.269  15.864  2.418   1.00 0.00 ? 1106 LEU B H    2  
ATOM 2468  H HA   . LEU A 1 62 ? 0.677   13.391  1.411   1.00 0.00 ? 1106 LEU B HA   2  
ATOM 2469  H HB2  . LEU A 1 62 ? 1.889   14.685  3.129   1.00 0.00 ? 1106 LEU B HB2  2  
ATOM 2470  H HB3  . LEU A 1 62 ? 0.577   14.387  4.269   1.00 0.00 ? 1106 LEU B HB3  2  
ATOM 2471  H HG   . LEU A 1 62 ? 0.947   11.930  3.985   1.00 0.00 ? 1106 LEU B HG   2  
ATOM 2472  H HD11 . LEU A 1 62 ? 2.716   12.940  1.906   1.00 0.00 ? 1106 LEU B HD11 2  
ATOM 2473  H HD12 . LEU A 1 62 ? 2.102   11.305  2.157   1.00 0.00 ? 1106 LEU B HD12 2  
ATOM 2474  H HD13 . LEU A 1 62 ? 3.558   11.839  2.998   1.00 0.00 ? 1106 LEU B HD13 2  
ATOM 2475  H HD21 . LEU A 1 62 ? 3.511   12.244  4.921   1.00 0.00 ? 1106 LEU B HD21 2  
ATOM 2476  H HD22 . LEU A 1 62 ? 2.063   12.464  5.902   1.00 0.00 ? 1106 LEU B HD22 2  
ATOM 2477  H HD23 . LEU A 1 62 ? 2.847   13.860  5.163   1.00 0.00 ? 1106 LEU B HD23 2  
ATOM 2478  N N    . LEU A 1 63 ? -1.919  13.351  3.412   1.00 0.00 ? 1107 LEU B N    2  
ATOM 2479  C CA   . LEU A 1 63 ? -3.020  12.530  3.891   1.00 0.00 ? 1107 LEU B CA   2  
ATOM 2480  C C    . LEU A 1 63 ? -3.766  11.938  2.711   1.00 0.00 ? 1107 LEU B C    2  
ATOM 2481  O O    . LEU A 1 63 ? -4.127  10.763  2.710   1.00 0.00 ? 1107 LEU B O    2  
ATOM 2482  C CB   . LEU A 1 63 ? -3.975  13.394  4.711   1.00 0.00 ? 1107 LEU B CB   2  
ATOM 2483  C CG   . LEU A 1 63 ? -3.309  13.772  6.030   1.00 0.00 ? 1107 LEU B CG   2  
ATOM 2484  C CD1  . LEU A 1 63 ? -4.124  14.872  6.712   1.00 0.00 ? 1107 LEU B CD1  2  
ATOM 2485  C CD2  . LEU A 1 63 ? -3.259  12.538  6.932   1.00 0.00 ? 1107 LEU B CD2  2  
ATOM 2486  H H    . LEU A 1 63 ? -1.885  14.304  3.647   1.00 0.00 ? 1107 LEU B H    2  
ATOM 2487  H HA   . LEU A 1 63 ? -2.636  11.734  4.510   1.00 0.00 ? 1107 LEU B HA   2  
ATOM 2488  H HB2  . LEU A 1 63 ? -4.214  14.291  4.156   1.00 0.00 ? 1107 LEU B HB2  2  
ATOM 2489  H HB3  . LEU A 1 63 ? -4.881  12.841  4.910   1.00 0.00 ? 1107 LEU B HB3  2  
ATOM 2490  H HG   . LEU A 1 63 ? -2.307  14.126  5.842   1.00 0.00 ? 1107 LEU B HG   2  
ATOM 2491  H HD11 . LEU A 1 63 ? -3.901  15.823  6.249   1.00 0.00 ? 1107 LEU B HD11 2  
ATOM 2492  H HD12 . LEU A 1 63 ? -3.867  14.914  7.760   1.00 0.00 ? 1107 LEU B HD12 2  
ATOM 2493  H HD13 . LEU A 1 63 ? -5.176  14.658  6.607   1.00 0.00 ? 1107 LEU B HD13 2  
ATOM 2494  H HD21 . LEU A 1 63 ? -3.848  11.747  6.492   1.00 0.00 ? 1107 LEU B HD21 2  
ATOM 2495  H HD22 . LEU A 1 63 ? -3.659  12.786  7.905   1.00 0.00 ? 1107 LEU B HD22 2  
ATOM 2496  H HD23 . LEU A 1 63 ? -2.236  12.208  7.035   1.00 0.00 ? 1107 LEU B HD23 2  
ATOM 2497  N N    . ALA A 1 64 ? -3.972  12.761  1.699   1.00 0.00 ? 1108 ALA B N    2  
ATOM 2498  C CA   . ALA A 1 64 ? -4.655  12.320  0.501   1.00 0.00 ? 1108 ALA B CA   2  
ATOM 2499  C C    . ALA A 1 64 ? -3.865  11.209  -0.179  1.00 0.00 ? 1108 ALA B C    2  
ATOM 2500  O O    . ALA A 1 64 ? -4.441  10.263  -0.712  1.00 0.00 ? 1108 ALA B O    2  
ATOM 2501  C CB   . ALA A 1 64 ? -4.818  13.497  -0.462  1.00 0.00 ? 1108 ALA B CB   2  
ATOM 2502  H H    . ALA A 1 64 ? -3.646  13.682  1.755   1.00 0.00 ? 1108 ALA B H    2  
ATOM 2503  H HA   . ALA A 1 64 ? -5.631  11.948  0.768   1.00 0.00 ? 1108 ALA B HA   2  
ATOM 2504  H HB1  . ALA A 1 64 ? -4.484  13.204  -1.447  1.00 0.00 ? 1108 ALA B HB1  2  
ATOM 2505  H HB2  . ALA A 1 64 ? -4.226  14.332  -0.114  1.00 0.00 ? 1108 ALA B HB2  2  
ATOM 2506  H HB3  . ALA A 1 64 ? -5.858  13.786  -0.505  1.00 0.00 ? 1108 ALA B HB3  2  
ATOM 2507  N N    . ALA A 1 65 ? -2.540  11.337  -0.166  1.00 0.00 ? 1109 ALA B N    2  
ATOM 2508  C CA   . ALA A 1 65 ? -1.682  10.345  -0.799  1.00 0.00 ? 1109 ALA B CA   2  
ATOM 2509  C C    . ALA A 1 65 ? -1.825  8.990   -0.121  1.00 0.00 ? 1109 ALA B C    2  
ATOM 2510  O O    . ALA A 1 65 ? -1.915  7.955   -0.781  1.00 0.00 ? 1109 ALA B O    2  
ATOM 2511  C CB   . ALA A 1 65 ? -0.224  10.807  -0.722  1.00 0.00 ? 1109 ALA B CB   2  
ATOM 2512  H H    . ALA A 1 65 ? -2.133  12.112  0.282   1.00 0.00 ? 1109 ALA B H    2  
ATOM 2513  H HA   . ALA A 1 65 ? -1.962  10.250  -1.837  1.00 0.00 ? 1109 ALA B HA   2  
ATOM 2514  H HB1  . ALA A 1 65 ? -0.012  11.158  0.277   1.00 0.00 ? 1109 ALA B HB1  2  
ATOM 2515  H HB2  . ALA A 1 65 ? -0.064  11.609  -1.428  1.00 0.00 ? 1109 ALA B HB2  2  
ATOM 2516  H HB3  . ALA A 1 65 ? 0.431   9.983   -0.965  1.00 0.00 ? 1109 ALA B HB3  2  
ATOM 2517  N N    . CYS A 1 66 ? -1.841  9.007   1.203   1.00 0.00 ? 1110 CYS B N    2  
ATOM 2518  C CA   . CYS A 1 66 ? -1.965  7.782   1.978   1.00 0.00 ? 1110 CYS B CA   2  
ATOM 2519  C C    . CYS A 1 66 ? -3.342  7.165   1.788   1.00 0.00 ? 1110 CYS B C    2  
ATOM 2520  O O    . CYS A 1 66 ? -3.481  5.949   1.661   1.00 0.00 ? 1110 CYS B O    2  
ATOM 2521  C CB   . CYS A 1 66 ? -1.729  8.102   3.446   1.00 0.00 ? 1110 CYS B CB   2  
ATOM 2522  S SG   . CYS A 1 66 ? 0.000   8.570   3.634   1.00 0.00 ? 1110 CYS B SG   2  
ATOM 2523  H H    . CYS A 1 66 ? -1.761  9.863   1.670   1.00 0.00 ? 1110 CYS B H    2  
ATOM 2524  H HA   . CYS A 1 66 ? -1.215  7.078   1.649   1.00 0.00 ? 1110 CYS B HA   2  
ATOM 2525  H HB2  . CYS A 1 66 ? -2.368  8.919   3.749   1.00 0.00 ? 1110 CYS B HB2  2  
ATOM 2526  H HB3  . CYS A 1 66 ? -1.938  7.231   4.049   1.00 0.00 ? 1110 CYS B HB3  2  
ATOM 2527  H HG   . CYS A 1 66 ? 0.277   8.970   2.799   1.00 0.00 ? 1110 CYS B HG   2  
ATOM 2528  N N    . ARG A 1 67 ? -4.354  8.019   1.762   1.00 0.00 ? 1111 ARG B N    2  
ATOM 2529  C CA   . ARG A 1 67 ? -5.720  7.561   1.579   1.00 0.00 ? 1111 ARG B CA   2  
ATOM 2530  C C    . ARG A 1 67 ? -5.862  6.865   0.233   1.00 0.00 ? 1111 ARG B C    2  
ATOM 2531  O O    . ARG A 1 67 ? -6.462  5.794   0.132   1.00 0.00 ? 1111 ARG B O    2  
ATOM 2532  C CB   . ARG A 1 67 ? -6.656  8.764   1.648   1.00 0.00 ? 1111 ARG B CB   2  
ATOM 2533  C CG   . ARG A 1 67 ? -6.764  9.238   3.098   1.00 0.00 ? 1111 ARG B CG   2  
ATOM 2534  C CD   . ARG A 1 67 ? -7.533  10.556  3.145   1.00 0.00 ? 1111 ARG B CD   2  
ATOM 2535  N NE   . ARG A 1 67 ? -7.741  10.970  4.531   1.00 0.00 ? 1111 ARG B NE   2  
ATOM 2536  C CZ   . ARG A 1 67 ? -8.243  12.166  4.836   1.00 0.00 ? 1111 ARG B CZ   2  
ATOM 2537  N NH1  . ARG A 1 67 ? -8.568  13.018  3.896   1.00 0.00 ? 1111 ARG B NH1  2  
ATOM 2538  N NH2  . ARG A 1 67 ? -8.415  12.492  6.088   1.00 0.00 ? 1111 ARG B NH2  2  
ATOM 2539  H H    . ARG A 1 67 ? -4.178  8.977   1.864   1.00 0.00 ? 1111 ARG B H    2  
ATOM 2540  H HA   . ARG A 1 67 ? -5.975  6.869   2.368   1.00 0.00 ? 1111 ARG B HA   2  
ATOM 2541  H HB2  . ARG A 1 67 ? -6.249  9.567   1.038   1.00 0.00 ? 1111 ARG B HB2  2  
ATOM 2542  H HB3  . ARG A 1 67 ? -7.634  8.490   1.282   1.00 0.00 ? 1111 ARG B HB3  2  
ATOM 2543  H HG2  . ARG A 1 67 ? -7.288  8.493   3.680   1.00 0.00 ? 1111 ARG B HG2  2  
ATOM 2544  H HG3  . ARG A 1 67 ? -5.776  9.383   3.505   1.00 0.00 ? 1111 ARG B HG3  2  
ATOM 2545  H HD2  . ARG A 1 67 ? -6.970  11.317  2.627   1.00 0.00 ? 1111 ARG B HD2  2  
ATOM 2546  H HD3  . ARG A 1 67 ? -8.489  10.427  2.661   1.00 0.00 ? 1111 ARG B HD3  2  
ATOM 2547  H HE   . ARG A 1 67 ? -7.506  10.353  5.254   1.00 0.00 ? 1111 ARG B HE   2  
ATOM 2548  H HH11 . ARG A 1 67 ? -8.442  12.781  2.935   1.00 0.00 ? 1111 ARG B HH11 2  
ATOM 2549  H HH12 . ARG A 1 67 ? -8.942  13.911  4.143   1.00 0.00 ? 1111 ARG B HH12 2  
ATOM 2550  H HH21 . ARG A 1 67 ? -8.170  11.846  6.812   1.00 0.00 ? 1111 ARG B HH21 2  
ATOM 2551  H HH22 . ARG A 1 67 ? -8.792  13.388  6.324   1.00 0.00 ? 1111 ARG B HH22 2  
ATOM 2552  N N    . GLU A 1 68 ? -5.282  7.469   -0.792  1.00 0.00 ? 1112 GLU B N    2  
ATOM 2553  C CA   . GLU A 1 68 ? -5.329  6.886   -2.125  1.00 0.00 ? 1112 GLU B CA   2  
ATOM 2554  C C    . GLU A 1 68 ? -4.556  5.576   -2.157  1.00 0.00 ? 1112 GLU B C    2  
ATOM 2555  O O    . GLU A 1 68 ? -4.987  4.609   -2.784  1.00 0.00 ? 1112 GLU B O    2  
ATOM 2556  C CB   . GLU A 1 68 ? -4.741  7.852   -3.147  1.00 0.00 ? 1112 GLU B CB   2  
ATOM 2557  C CG   . GLU A 1 68 ? -5.697  9.028   -3.340  1.00 0.00 ? 1112 GLU B CG   2  
ATOM 2558  C CD   . GLU A 1 68 ? -5.146  9.992   -4.386  1.00 0.00 ? 1112 GLU B CD   2  
ATOM 2559  O OE1  . GLU A 1 68 ? -4.571  9.519   -5.353  1.00 0.00 ? 1112 GLU B OE1  2  
ATOM 2560  O OE2  . GLU A 1 68 ? -5.309  11.187  -4.205  1.00 0.00 ? 1112 GLU B OE2  2  
ATOM 2561  H H    . GLU A 1 68 ? -4.806  8.311   -0.647  1.00 0.00 ? 1112 GLU B H    2  
ATOM 2562  H HA   . GLU A 1 68 ? -6.359  6.689   -2.384  1.00 0.00 ? 1112 GLU B HA   2  
ATOM 2563  H HB2  . GLU A 1 68 ? -3.786  8.212   -2.789  1.00 0.00 ? 1112 GLU B HB2  2  
ATOM 2564  H HB3  . GLU A 1 68 ? -4.603  7.341   -4.087  1.00 0.00 ? 1112 GLU B HB3  2  
ATOM 2565  H HG2  . GLU A 1 68 ? -6.658  8.656   -3.665  1.00 0.00 ? 1112 GLU B HG2  2  
ATOM 2566  H HG3  . GLU A 1 68 ? -5.815  9.547   -2.401  1.00 0.00 ? 1112 GLU B HG3  2  
ATOM 2567  N N    . GLU A 1 69 ? -3.412  5.542   -1.473  1.00 0.00 ? 1113 GLU B N    2  
ATOM 2568  C CA   . GLU A 1 69 ? -2.616  4.329   -1.444  1.00 0.00 ? 1113 GLU B CA   2  
ATOM 2569  C C    . GLU A 1 69 ? -3.399  3.207   -0.787  1.00 0.00 ? 1113 GLU B C    2  
ATOM 2570  O O    . GLU A 1 69 ? -3.356  2.063   -1.232  1.00 0.00 ? 1113 GLU B O    2  
ATOM 2571  C CB   . GLU A 1 69 ? -1.309  4.568   -0.685  1.00 0.00 ? 1113 GLU B CB   2  
ATOM 2572  C CG   . GLU A 1 69 ? -0.510  3.265   -0.628  1.00 0.00 ? 1113 GLU B CG   2  
ATOM 2573  C CD   . GLU A 1 69 ? -0.195  2.782   -2.040  1.00 0.00 ? 1113 GLU B CD   2  
ATOM 2574  O OE1  . GLU A 1 69 ? -0.198  3.604   -2.942  1.00 0.00 ? 1113 GLU B OE1  2  
ATOM 2575  O OE2  . GLU A 1 69 ? 0.046   1.596   -2.198  1.00 0.00 ? 1113 GLU B OE2  2  
ATOM 2576  H H    . GLU A 1 69 ? -3.104  6.338   -0.979  1.00 0.00 ? 1113 GLU B H    2  
ATOM 2577  H HA   . GLU A 1 69 ? -2.383  4.045   -2.457  1.00 0.00 ? 1113 GLU B HA   2  
ATOM 2578  H HB2  . GLU A 1 69 ? -0.732  5.325   -1.195  1.00 0.00 ? 1113 GLU B HB2  2  
ATOM 2579  H HB3  . GLU A 1 69 ? -1.531  4.899   0.319   1.00 0.00 ? 1113 GLU B HB3  2  
ATOM 2580  H HG2  . GLU A 1 69 ? 0.414   3.439   -0.096  1.00 0.00 ? 1113 GLU B HG2  2  
ATOM 2581  H HG3  . GLU A 1 69 ? -1.082  2.511   -0.110  1.00 0.00 ? 1113 GLU B HG3  2  
ATOM 2582  N N    . PHE A 1 70 ? -4.113  3.547   0.276   1.00 0.00 ? 1114 PHE B N    2  
ATOM 2583  C CA   . PHE A 1 70 ? -4.904  2.559   0.991   1.00 0.00 ? 1114 PHE B CA   2  
ATOM 2584  C C    . PHE A 1 70 ? -5.994  1.994   0.085   1.00 0.00 ? 1114 PHE B C    2  
ATOM 2585  O O    . PHE A 1 70 ? -6.255  0.796   0.102   1.00 0.00 ? 1114 PHE B O    2  
ATOM 2586  C CB   . PHE A 1 70 ? -5.549  3.187   2.229   1.00 0.00 ? 1114 PHE B CB   2  
ATOM 2587  C CG   . PHE A 1 70 ? -4.579  3.168   3.396   1.00 0.00 ? 1114 PHE B CG   2  
ATOM 2588  C CD1  . PHE A 1 70 ? -3.194  3.232   3.173   1.00 0.00 ? 1114 PHE B CD1  2  
ATOM 2589  C CD2  . PHE A 1 70 ? -5.071  3.087   4.704   1.00 0.00 ? 1114 PHE B CD2  2  
ATOM 2590  C CE1  . PHE A 1 70 ? -2.308  3.216   4.263   1.00 0.00 ? 1114 PHE B CE1  2  
ATOM 2591  C CE2  . PHE A 1 70 ? -4.185  3.071   5.788   1.00 0.00 ? 1114 PHE B CE2  2  
ATOM 2592  C CZ   . PHE A 1 70 ? -2.806  3.136   5.568   1.00 0.00 ? 1114 PHE B CZ   2  
ATOM 2593  H H    . PHE A 1 70 ? -4.108  4.475   0.580   1.00 0.00 ? 1114 PHE B H    2  
ATOM 2594  H HA   . PHE A 1 70 ? -4.260  1.751   1.304   1.00 0.00 ? 1114 PHE B HA   2  
ATOM 2595  H HB2  . PHE A 1 70 ? -5.824  4.208   2.011   1.00 0.00 ? 1114 PHE B HB2  2  
ATOM 2596  H HB3  . PHE A 1 70 ? -6.434  2.626   2.492   1.00 0.00 ? 1114 PHE B HB3  2  
ATOM 2597  H HD1  . PHE A 1 70 ? -2.811  3.293   2.165   1.00 0.00 ? 1114 PHE B HD1  2  
ATOM 2598  H HD2  . PHE A 1 70 ? -6.136  3.039   4.877   1.00 0.00 ? 1114 PHE B HD2  2  
ATOM 2599  H HE1  . PHE A 1 70 ? -1.241  3.266   4.096   1.00 0.00 ? 1114 PHE B HE1  2  
ATOM 2600  H HE2  . PHE A 1 70 ? -4.568  3.010   6.796   1.00 0.00 ? 1114 PHE B HE2  2  
ATOM 2601  H HZ   . PHE A 1 70 ? -2.123  3.124   6.405   1.00 0.00 ? 1114 PHE B HZ   2  
ATOM 2602  N N    . HIS A 1 71 ? -6.625  2.856   -0.710  1.00 0.00 ? 1115 HIS B N    2  
ATOM 2603  C CA   . HIS A 1 71 ? -7.678  2.400   -1.612  1.00 0.00 ? 1115 HIS B CA   2  
ATOM 2604  C C    . HIS A 1 71 ? -7.119  1.425   -2.645  1.00 0.00 ? 1115 HIS B C    2  
ATOM 2605  O O    . HIS A 1 71 ? -7.733  0.402   -2.937  1.00 0.00 ? 1115 HIS B O    2  
ATOM 2606  C CB   . HIS A 1 71 ? -8.315  3.591   -2.332  1.00 0.00 ? 1115 HIS B CB   2  
ATOM 2607  C CG   . HIS A 1 71 ? -9.168  4.368   -1.367  1.00 0.00 ? 1115 HIS B CG   2  
ATOM 2608  N ND1  . HIS A 1 71 ? -9.576  5.668   -1.619  1.00 0.00 ? 1115 HIS B ND1  2  
ATOM 2609  C CD2  . HIS A 1 71 ? -9.708  4.035   -0.148  1.00 0.00 ? 1115 HIS B CD2  2  
ATOM 2610  C CE1  . HIS A 1 71 ? -10.326 6.068   -0.576  1.00 0.00 ? 1115 HIS B CE1  2  
ATOM 2611  N NE2  . HIS A 1 71 ? -10.438 5.111   0.349   1.00 0.00 ? 1115 HIS B NE2  2  
ATOM 2612  H H    . HIS A 1 71 ? -6.381  3.807   -0.689  1.00 0.00 ? 1115 HIS B H    2  
ATOM 2613  H HA   . HIS A 1 71 ? -8.439  1.897   -1.034  1.00 0.00 ? 1115 HIS B HA   2  
ATOM 2614  H HB2  . HIS A 1 71 ? -7.539  4.232   -2.723  1.00 0.00 ? 1115 HIS B HB2  2  
ATOM 2615  H HB3  . HIS A 1 71 ? -8.930  3.232   -3.145  1.00 0.00 ? 1115 HIS B HB3  2  
ATOM 2616  H HD1  . HIS A 1 71 ? -9.357  6.200   -2.413  1.00 0.00 ? 1115 HIS B HD1  2  
ATOM 2617  H HD2  . HIS A 1 71 ? -9.588  3.083   0.347   1.00 0.00 ? 1115 HIS B HD2  2  
ATOM 2618  H HE1  . HIS A 1 71 ? -10.780 7.045   -0.495  1.00 0.00 ? 1115 HIS B HE1  2  
ATOM 2619  N N    . ARG A 1 72 ? -5.949  1.745   -3.186  1.00 0.00 ? 1116 ARG B N    2  
ATOM 2620  C CA   . ARG A 1 72 ? -5.322  0.879   -4.180  1.00 0.00 ? 1116 ARG B CA   2  
ATOM 2621  C C    . ARG A 1 72 ? -4.884  -0.431  -3.546  1.00 0.00 ? 1116 ARG B C    2  
ATOM 2622  O O    . ARG A 1 72 ? -5.090  -1.506  -4.112  1.00 0.00 ? 1116 ARG B O    2  
ATOM 2623  C CB   . ARG A 1 72 ? -4.120  1.589   -4.803  1.00 0.00 ? 1116 ARG B CB   2  
ATOM 2624  C CG   . ARG A 1 72 ? -4.562  2.326   -6.070  1.00 0.00 ? 1116 ARG B CG   2  
ATOM 2625  C CD   . ARG A 1 72 ? -5.796  3.179   -5.768  1.00 0.00 ? 1116 ARG B CD   2  
ATOM 2626  N NE   . ARG A 1 72 ? -6.030  4.124   -6.855  1.00 0.00 ? 1116 ARG B NE   2  
ATOM 2627  C CZ   . ARG A 1 72 ? -7.132  4.874   -6.912  1.00 0.00 ? 1116 ARG B CZ   2  
ATOM 2628  N NH1  . ARG A 1 72 ? -8.047  4.792   -5.980  1.00 0.00 ? 1116 ARG B NH1  2  
ATOM 2629  N NH2  . ARG A 1 72 ? -7.298  5.698   -7.908  1.00 0.00 ? 1116 ARG B NH2  2  
ATOM 2630  H H    . ARG A 1 72 ? -5.497  2.572   -2.912  1.00 0.00 ? 1116 ARG B H    2  
ATOM 2631  H HA   . ARG A 1 72 ? -6.039  0.664   -4.958  1.00 0.00 ? 1116 ARG B HA   2  
ATOM 2632  H HB2  . ARG A 1 72 ? -3.714  2.298   -4.096  1.00 0.00 ? 1116 ARG B HB2  2  
ATOM 2633  H HB3  . ARG A 1 72 ? -3.363  0.861   -5.058  1.00 0.00 ? 1116 ARG B HB3  2  
ATOM 2634  H HG2  . ARG A 1 72 ? -3.759  2.965   -6.411  1.00 0.00 ? 1116 ARG B HG2  2  
ATOM 2635  H HG3  . ARG A 1 72 ? -4.801  1.608   -6.840  1.00 0.00 ? 1116 ARG B HG3  2  
ATOM 2636  H HD2  . ARG A 1 72 ? -6.658  2.533   -5.668  1.00 0.00 ? 1116 ARG B HD2  2  
ATOM 2637  H HD3  . ARG A 1 72 ? -5.642  3.717   -4.845  1.00 0.00 ? 1116 ARG B HD3  2  
ATOM 2638  H HE   . ARG A 1 72 ? -5.360  4.211   -7.565  1.00 0.00 ? 1116 ARG B HE   2  
ATOM 2639  H HH11 . ARG A 1 72 ? -7.933  4.165   -5.212  1.00 0.00 ? 1116 ARG B HH11 2  
ATOM 2640  H HH12 . ARG A 1 72 ? -8.866  5.363   -6.037  1.00 0.00 ? 1116 ARG B HH12 2  
ATOM 2641  H HH21 . ARG A 1 72 ? -6.604  5.764   -8.624  1.00 0.00 ? 1116 ARG B HH21 2  
ATOM 2642  H HH22 . ARG A 1 72 ? -8.122  6.264   -7.958  1.00 0.00 ? 1116 ARG B HH22 2  
ATOM 2643  N N    . ARG A 1 73 ? -4.290  -0.337  -2.365  1.00 0.00 ? 1117 ARG B N    2  
ATOM 2644  C CA   . ARG A 1 73 ? -3.840  -1.522  -1.660  1.00 0.00 ? 1117 ARG B CA   2  
ATOM 2645  C C    . ARG A 1 73 ? -5.021  -2.419  -1.299  1.00 0.00 ? 1117 ARG B C    2  
ATOM 2646  O O    . ARG A 1 73 ? -4.950  -3.640  -1.442  1.00 0.00 ? 1117 ARG B O    2  
ATOM 2647  C CB   . ARG A 1 73 ? -3.072  -1.117  -0.399  1.00 0.00 ? 1117 ARG B CB   2  
ATOM 2648  C CG   . ARG A 1 73 ? -1.686  -0.595  -0.790  1.00 0.00 ? 1117 ARG B CG   2  
ATOM 2649  C CD   . ARG A 1 73 ? -0.868  -0.357  0.480   1.00 0.00 ? 1117 ARG B CD   2  
ATOM 2650  N NE   . ARG A 1 73 ? 0.525   -0.061  0.154   1.00 0.00 ? 1117 ARG B NE   2  
ATOM 2651  C CZ   . ARG A 1 73 ? 1.485   -0.170  1.071   1.00 0.00 ? 1117 ARG B CZ   2  
ATOM 2652  N NH1  . ARG A 1 73 ? 1.201   -0.503  2.305   1.00 0.00 ? 1117 ARG B NH1  2  
ATOM 2653  N NH2  . ARG A 1 73 ? 2.723   0.041   0.732   1.00 0.00 ? 1117 ARG B NH2  2  
ATOM 2654  H H    . ARG A 1 73 ? -4.161  0.544   -1.960  1.00 0.00 ? 1117 ARG B H    2  
ATOM 2655  H HA   . ARG A 1 73 ? -3.173  -2.075  -2.305  1.00 0.00 ? 1117 ARG B HA   2  
ATOM 2656  H HB2  . ARG A 1 73 ? -3.615  -0.332  0.117   1.00 0.00 ? 1117 ARG B HB2  2  
ATOM 2657  H HB3  . ARG A 1 73 ? -2.964  -1.970  0.251   1.00 0.00 ? 1117 ARG B HB3  2  
ATOM 2658  H HG2  . ARG A 1 73 ? -1.187  -1.325  -1.412  1.00 0.00 ? 1117 ARG B HG2  2  
ATOM 2659  H HG3  . ARG A 1 73 ? -1.787  0.332   -1.331  1.00 0.00 ? 1117 ARG B HG3  2  
ATOM 2660  H HD2  . ARG A 1 73 ? -1.286  0.474   1.023   1.00 0.00 ? 1117 ARG B HD2  2  
ATOM 2661  H HD3  . ARG A 1 73 ? -0.909  -1.243  1.099   1.00 0.00 ? 1117 ARG B HD3  2  
ATOM 2662  H HE   . ARG A 1 73 ? 0.759   0.233   -0.755  1.00 0.00 ? 1117 ARG B HE   2  
ATOM 2663  H HH11 . ARG A 1 73 ? 0.257   -0.683  2.577   1.00 0.00 ? 1117 ARG B HH11 2  
ATOM 2664  H HH12 . ARG A 1 73 ? 1.935   -0.579  2.980   1.00 0.00 ? 1117 ARG B HH12 2  
ATOM 2665  H HH21 . ARG A 1 73 ? 2.946   0.282   -0.209  1.00 0.00 ? 1117 ARG B HH21 2  
ATOM 2666  H HH22 . ARG A 1 73 ? 3.449   -0.047  1.415   1.00 0.00 ? 1117 ARG B HH22 2  
ATOM 2667  N N    . LEU A 1 74 ? -6.113  -1.810  -0.846  1.00 0.00 ? 1118 LEU B N    2  
ATOM 2668  C CA   . LEU A 1 74 ? -7.305  -2.570  -0.490  1.00 0.00 ? 1118 LEU B CA   2  
ATOM 2669  C C    . LEU A 1 74 ? -7.901  -3.247  -1.720  1.00 0.00 ? 1118 LEU B C    2  
ATOM 2670  O O    . LEU A 1 74 ? -8.322  -4.402  -1.661  1.00 0.00 ? 1118 LEU B O    2  
ATOM 2671  C CB   . LEU A 1 74 ? -8.344  -1.643  0.149   1.00 0.00 ? 1118 LEU B CB   2  
ATOM 2672  C CG   . LEU A 1 74 ? -7.868  -1.232  1.544   1.00 0.00 ? 1118 LEU B CG   2  
ATOM 2673  C CD1  . LEU A 1 74 ? -8.728  -0.077  2.062   1.00 0.00 ? 1118 LEU B CD1  2  
ATOM 2674  C CD2  . LEU A 1 74 ? -8.010  -2.427  2.488   1.00 0.00 ? 1118 LEU B CD2  2  
ATOM 2675  H H    . LEU A 1 74 ? -6.121  -0.835  -0.764  1.00 0.00 ? 1118 LEU B H    2  
ATOM 2676  H HA   . LEU A 1 74 ? -7.033  -3.329  0.227   1.00 0.00 ? 1118 LEU B HA   2  
ATOM 2677  H HB2  . LEU A 1 74 ? -8.465  -0.763  -0.466  1.00 0.00 ? 1118 LEU B HB2  2  
ATOM 2678  H HB3  . LEU A 1 74 ? -9.288  -2.161  0.230   1.00 0.00 ? 1118 LEU B HB3  2  
ATOM 2679  H HG   . LEU A 1 74 ? -6.834  -0.926  1.500   1.00 0.00 ? 1118 LEU B HG   2  
ATOM 2680  H HD11 . LEU A 1 74 ? -8.818  -0.150  3.135   1.00 0.00 ? 1118 LEU B HD11 2  
ATOM 2681  H HD12 . LEU A 1 74 ? -9.708  -0.125  1.612   1.00 0.00 ? 1118 LEU B HD12 2  
ATOM 2682  H HD13 . LEU A 1 74 ? -8.259  0.861   1.804   1.00 0.00 ? 1118 LEU B HD13 2  
ATOM 2683  H HD21 . LEU A 1 74 ? -8.728  -3.124  2.083   1.00 0.00 ? 1118 LEU B HD21 2  
ATOM 2684  H HD22 . LEU A 1 74 ? -8.347  -2.086  3.455   1.00 0.00 ? 1118 LEU B HD22 2  
ATOM 2685  H HD23 . LEU A 1 74 ? -7.054  -2.918  2.595   1.00 0.00 ? 1118 LEU B HD23 2  
ATOM 2686  N N    . LYS A 1 75 ? -7.927  -2.521  -2.835  1.00 0.00 ? 1119 LYS B N    2  
ATOM 2687  C CA   . LYS A 1 75 ? -8.467  -3.069  -4.074  1.00 0.00 ? 1119 LYS B CA   2  
ATOM 2688  C C    . LYS A 1 75 ? -7.644  -4.263  -4.532  1.00 0.00 ? 1119 LYS B C    2  
ATOM 2689  O O    . LYS A 1 75 ? -8.192  -5.284  -4.951  1.00 0.00 ? 1119 LYS B O    2  
ATOM 2690  C CB   . LYS A 1 75 ? -8.440  -1.999  -5.163  1.00 0.00 ? 1119 LYS B CB   2  
ATOM 2691  C CG   . LYS A 1 75 ? -9.520  -0.944  -4.895  1.00 0.00 ? 1119 LYS B CG   2  
ATOM 2692  C CD   . LYS A 1 75 ? -10.897 -1.475  -5.308  1.00 0.00 ? 1119 LYS B CD   2  
ATOM 2693  C CE   . LYS A 1 75 ? -10.988 -1.546  -6.834  1.00 0.00 ? 1119 LYS B CE   2  
ATOM 2694  N NZ   . LYS A 1 75 ? -12.399 -1.815  -7.234  1.00 0.00 ? 1119 LYS B NZ   2  
ATOM 2695  H H    . LYS A 1 75 ? -7.575  -1.608  -2.825  1.00 0.00 ? 1119 LYS B H    2  
ATOM 2696  H HA   . LYS A 1 75 ? -9.484  -3.382  -3.909  1.00 0.00 ? 1119 LYS B HA   2  
ATOM 2697  H HB2  . LYS A 1 75 ? -7.469  -1.525  -5.167  1.00 0.00 ? 1119 LYS B HB2  2  
ATOM 2698  H HB3  . LYS A 1 75 ? -8.615  -2.460  -6.120  1.00 0.00 ? 1119 LYS B HB3  2  
ATOM 2699  H HG2  . LYS A 1 75 ? -9.532  -0.705  -3.843  1.00 0.00 ? 1119 LYS B HG2  2  
ATOM 2700  H HG3  . LYS A 1 75 ? -9.297  -0.053  -5.462  1.00 0.00 ? 1119 LYS B HG3  2  
ATOM 2701  H HD2  . LYS A 1 75 ? -11.046 -2.459  -4.894  1.00 0.00 ? 1119 LYS B HD2  2  
ATOM 2702  H HD3  . LYS A 1 75 ? -11.663 -0.810  -4.937  1.00 0.00 ? 1119 LYS B HD3  2  
ATOM 2703  H HE2  . LYS A 1 75 ? -10.665 -0.607  -7.260  1.00 0.00 ? 1119 LYS B HE2  2  
ATOM 2704  H HE3  . LYS A 1 75 ? -10.358 -2.343  -7.198  1.00 0.00 ? 1119 LYS B HE3  2  
ATOM 2705  H HZ1  . LYS A 1 75 ? -12.497 -2.811  -7.510  1.00 0.00 ? 1119 LYS B HZ1  2  
ATOM 2706  H HZ2  . LYS A 1 75 ? -12.654 -1.204  -8.037  1.00 0.00 ? 1119 LYS B HZ2  2  
ATOM 2707  H HZ3  . LYS A 1 75 ? -13.031 -1.615  -6.432  1.00 0.00 ? 1119 LYS B HZ3  2  
ATOM 2708  N N    . VAL A 1 76 ? -6.327  -4.132  -4.444  1.00 0.00 ? 1120 VAL B N    2  
ATOM 2709  C CA   . VAL A 1 76 ? -5.441  -5.214  -4.849  1.00 0.00 ? 1120 VAL B CA   2  
ATOM 2710  C C    . VAL A 1 76 ? -5.657  -6.424  -3.953  1.00 0.00 ? 1120 VAL B C    2  
ATOM 2711  O O    . VAL A 1 76 ? -5.697  -7.559  -4.423  1.00 0.00 ? 1120 VAL B O    2  
ATOM 2712  C CB   . VAL A 1 76 ? -3.983  -4.762  -4.767  1.00 0.00 ? 1120 VAL B CB   2  
ATOM 2713  C CG1  . VAL A 1 76 ? -3.060  -5.959  -5.003  1.00 0.00 ? 1120 VAL B CG1  2  
ATOM 2714  C CG2  . VAL A 1 76 ? -3.723  -3.699  -5.836  1.00 0.00 ? 1120 VAL B CG2  2  
ATOM 2715  H H    . VAL A 1 76 ? -5.943  -3.295  -4.102  1.00 0.00 ? 1120 VAL B H    2  
ATOM 2716  H HA   . VAL A 1 76 ? -5.666  -5.487  -5.869  1.00 0.00 ? 1120 VAL B HA   2  
ATOM 2717  H HB   . VAL A 1 76 ? -3.790  -4.346  -3.789  1.00 0.00 ? 1120 VAL B HB   2  
ATOM 2718  H HG11 . VAL A 1 76 ? -2.037  -5.622  -5.043  1.00 0.00 ? 1120 VAL B HG11 2  
ATOM 2719  H HG12 . VAL A 1 76 ? -3.319  -6.433  -5.940  1.00 0.00 ? 1120 VAL B HG12 2  
ATOM 2720  H HG13 . VAL A 1 76 ? -3.172  -6.670  -4.199  1.00 0.00 ? 1120 VAL B HG13 2  
ATOM 2721  H HG21 . VAL A 1 76 ? -3.299  -2.819  -5.373  1.00 0.00 ? 1120 VAL B HG21 2  
ATOM 2722  H HG22 . VAL A 1 76 ? -4.652  -3.441  -6.320  1.00 0.00 ? 1120 VAL B HG22 2  
ATOM 2723  H HG23 . VAL A 1 76 ? -3.030  -4.089  -6.569  1.00 0.00 ? 1120 VAL B HG23 2  
ATOM 2724  N N    . TYR A 1 77 ? -5.789  -6.167  -2.659  1.00 0.00 ? 1121 TYR B N    2  
ATOM 2725  C CA   . TYR A 1 77 ? -5.996  -7.237  -1.689  1.00 0.00 ? 1121 TYR B CA   2  
ATOM 2726  C C    . TYR A 1 77 ? -7.263  -8.014  -2.018  1.00 0.00 ? 1121 TYR B C    2  
ATOM 2727  O O    . TYR A 1 77 ? -7.259  -9.245  -2.050  1.00 0.00 ? 1121 TYR B O    2  
ATOM 2728  C CB   . TYR A 1 77 ? -6.101  -6.649  -0.282  1.00 0.00 ? 1121 TYR B CB   2  
ATOM 2729  C CG   . TYR A 1 77 ? -6.417  -7.745  0.706   1.00 0.00 ? 1121 TYR B CG   2  
ATOM 2730  C CD1  . TYR A 1 77 ? -5.426  -8.661  1.075   1.00 0.00 ? 1121 TYR B CD1  2  
ATOM 2731  C CD2  . TYR A 1 77 ? -7.699  -7.839  1.262   1.00 0.00 ? 1121 TYR B CD2  2  
ATOM 2732  C CE1  . TYR A 1 77 ? -5.717  -9.673  1.999   1.00 0.00 ? 1121 TYR B CE1  2  
ATOM 2733  C CE2  . TYR A 1 77 ? -7.989  -8.850  2.185   1.00 0.00 ? 1121 TYR B CE2  2  
ATOM 2734  C CZ   . TYR A 1 77 ? -6.999  -9.767  2.553   1.00 0.00 ? 1121 TYR B CZ   2  
ATOM 2735  O OH   . TYR A 1 77 ? -7.285  -10.761 3.467   1.00 0.00 ? 1121 TYR B OH   2  
ATOM 2736  H H    . TYR A 1 77 ? -5.744  -5.237  -2.347  1.00 0.00 ? 1121 TYR B H    2  
ATOM 2737  H HA   . TYR A 1 77 ? -5.154  -7.911  -1.724  1.00 0.00 ? 1121 TYR B HA   2  
ATOM 2738  H HB2  . TYR A 1 77 ? -5.162  -6.184  -0.016  1.00 0.00 ? 1121 TYR B HB2  2  
ATOM 2739  H HB3  . TYR A 1 77 ? -6.887  -5.908  -0.259  1.00 0.00 ? 1121 TYR B HB3  2  
ATOM 2740  H HD1  . TYR A 1 77 ? -4.437  -8.590  0.648   1.00 0.00 ? 1121 TYR B HD1  2  
ATOM 2741  H HD2  . TYR A 1 77 ? -8.465  -7.131  0.977   1.00 0.00 ? 1121 TYR B HD2  2  
ATOM 2742  H HE1  . TYR A 1 77 ? -4.954  -10.382 2.282   1.00 0.00 ? 1121 TYR B HE1  2  
ATOM 2743  H HE2  . TYR A 1 77 ? -8.979  -8.923  2.611   1.00 0.00 ? 1121 TYR B HE2  2  
ATOM 2744  H HH   . TYR A 1 77 ? -8.227  -10.942 3.423   1.00 0.00 ? 1121 TYR B HH   2  
ATOM 2745  N N    . HIS A 1 78 ? -8.345  -7.287  -2.263  1.00 0.00 ? 1122 HIS B N    2  
ATOM 2746  C CA   . HIS A 1 78 ? -9.615  -7.919  -2.593  1.00 0.00 ? 1122 HIS B CA   2  
ATOM 2747  C C    . HIS A 1 78 ? -9.479  -8.745  -3.867  1.00 0.00 ? 1122 HIS B C    2  
ATOM 2748  O O    . HIS A 1 78 ? -9.929  -9.888  -3.931  1.00 0.00 ? 1122 HIS B O    2  
ATOM 2749  C CB   . HIS A 1 78 ? -10.702 -6.860  -2.781  1.00 0.00 ? 1122 HIS B CB   2  
ATOM 2750  C CG   . HIS A 1 78 ? -12.014 -7.537  -3.068  1.00 0.00 ? 1122 HIS B CG   2  
ATOM 2751  N ND1  . HIS A 1 78 ? -13.077 -6.872  -3.656  1.00 0.00 ? 1122 HIS B ND1  2  
ATOM 2752  C CD2  . HIS A 1 78 ? -12.450 -8.822  -2.853  1.00 0.00 ? 1122 HIS B CD2  2  
ATOM 2753  C CE1  . HIS A 1 78 ? -14.091 -7.750  -3.773  1.00 0.00 ? 1122 HIS B CE1  2  
ATOM 2754  N NE2  . HIS A 1 78 ? -13.761 -8.953  -3.299  1.00 0.00 ? 1122 HIS B NE2  2  
ATOM 2755  H H    . HIS A 1 78 ? -8.286  -6.309  -2.229  1.00 0.00 ? 1122 HIS B H    2  
ATOM 2756  H HA   . HIS A 1 78 ? -9.902  -8.573  -1.782  1.00 0.00 ? 1122 HIS B HA   2  
ATOM 2757  H HB2  . HIS A 1 78 ? -10.790 -6.269  -1.882  1.00 0.00 ? 1122 HIS B HB2  2  
ATOM 2758  H HB3  . HIS A 1 78 ? -10.441 -6.219  -3.610  1.00 0.00 ? 1122 HIS B HB3  2  
ATOM 2759  H HD1  . HIS A 1 78 ? -13.089 -5.933  -3.937  1.00 0.00 ? 1122 HIS B HD1  2  
ATOM 2760  H HD2  . HIS A 1 78 ? -11.863 -9.611  -2.406  1.00 0.00 ? 1122 HIS B HD2  2  
ATOM 2761  H HE1  . HIS A 1 78 ? -15.054 -7.508  -4.200  1.00 0.00 ? 1122 HIS B HE1  2  
ATOM 2762  N N    . ALA A 1 79 ? -8.855  -8.155  -4.883  1.00 0.00 ? 1123 ALA B N    2  
ATOM 2763  C CA   . ALA A 1 79 ? -8.670  -8.848  -6.152  1.00 0.00 ? 1123 ALA B CA   2  
ATOM 2764  C C    . ALA A 1 79 ? -7.835  -10.112 -5.965  1.00 0.00 ? 1123 ALA B C    2  
ATOM 2765  O O    . ALA A 1 79 ? -8.128  -11.150 -6.552  1.00 0.00 ? 1123 ALA B O    2  
ATOM 2766  C CB   . ALA A 1 79 ? -7.976  -7.923  -7.153  1.00 0.00 ? 1123 ALA B CB   2  
ATOM 2767  H H    . ALA A 1 79 ? -8.519  -7.239  -4.779  1.00 0.00 ? 1123 ALA B H    2  
ATOM 2768  H HA   . ALA A 1 79 ? -9.637  -9.123  -6.547  1.00 0.00 ? 1123 ALA B HA   2  
ATOM 2769  H HB1  . ALA A 1 79 ? -8.395  -6.932  -7.079  1.00 0.00 ? 1123 ALA B HB1  2  
ATOM 2770  H HB2  . ALA A 1 79 ? -8.122  -8.302  -8.155  1.00 0.00 ? 1123 ALA B HB2  2  
ATOM 2771  H HB3  . ALA A 1 79 ? -6.918  -7.884  -6.935  1.00 0.00 ? 1123 ALA B HB3  2  
ATOM 2772  N N    . TRP A 1 80 ? -6.795  -10.021 -5.146  1.00 0.00 ? 1124 TRP B N    2  
ATOM 2773  C CA   . TRP A 1 80 ? -5.934  -11.158 -4.898  1.00 0.00 ? 1124 TRP B CA   2  
ATOM 2774  C C    . TRP A 1 80 ? -6.736  -12.313 -4.300  1.00 0.00 ? 1124 TRP B C    2  
ATOM 2775  O O    . TRP A 1 80 ? -6.621  -13.456 -4.745  1.00 0.00 ? 1124 TRP B O    2  
ATOM 2776  C CB   . TRP A 1 80 ? -4.816  -10.725 -3.958  1.00 0.00 ? 1124 TRP B CB   2  
ATOM 2777  C CG   . TRP A 1 80 ? -3.963  -11.890 -3.640  1.00 0.00 ? 1124 TRP B CG   2  
ATOM 2778  C CD1  . TRP A 1 80 ? -3.039  -12.408 -4.466  1.00 0.00 ? 1124 TRP B CD1  2  
ATOM 2779  C CD2  . TRP A 1 80 ? -3.915  -12.661 -2.419  1.00 0.00 ? 1124 TRP B CD2  2  
ATOM 2780  N NE1  . TRP A 1 80 ? -2.435  -13.486 -3.838  1.00 0.00 ? 1124 TRP B NE1  2  
ATOM 2781  C CE2  . TRP A 1 80 ? -2.944  -13.677 -2.565  1.00 0.00 ? 1124 TRP B CE2  2  
ATOM 2782  C CE3  . TRP A 1 80 ? -4.624  -12.580 -1.216  1.00 0.00 ? 1124 TRP B CE3  2  
ATOM 2783  C CZ2  . TRP A 1 80 ? -2.685  -14.587 -1.539  1.00 0.00 ? 1124 TRP B CZ2  2  
ATOM 2784  C CZ3  . TRP A 1 80 ? -4.366  -13.487 -0.181  1.00 0.00 ? 1124 TRP B CZ3  2  
ATOM 2785  C CH2  . TRP A 1 80 ? -3.399  -14.490 -0.340  1.00 0.00 ? 1124 TRP B CH2  2  
ATOM 2786  H H    . TRP A 1 80 ? -6.598  -9.178  -4.701  1.00 0.00 ? 1124 TRP B H    2  
ATOM 2787  H HA   . TRP A 1 80 ? -5.500  -11.480 -5.832  1.00 0.00 ? 1124 TRP B HA   2  
ATOM 2788  H HB2  . TRP A 1 80 ? -4.218  -9.963  -4.436  1.00 0.00 ? 1124 TRP B HB2  2  
ATOM 2789  H HB3  . TRP A 1 80 ? -5.242  -10.332 -3.047  1.00 0.00 ? 1124 TRP B HB3  2  
ATOM 2790  H HD1  . TRP A 1 80 ? -2.827  -12.051 -5.461  1.00 0.00 ? 1124 TRP B HD1  2  
ATOM 2791  H HE1  . TRP A 1 80 ? -1.733  -14.046 -4.225  1.00 0.00 ? 1124 TRP B HE1  2  
ATOM 2792  H HE3  . TRP A 1 80 ? -5.372  -11.810 -1.087  1.00 0.00 ? 1124 TRP B HE3  2  
ATOM 2793  H HZ2  . TRP A 1 80 ? -1.941  -15.357 -1.666  1.00 0.00 ? 1124 TRP B HZ2  2  
ATOM 2794  H HZ3  . TRP A 1 80 ? -4.910  -13.411 0.745   1.00 0.00 ? 1124 TRP B HZ3  2  
ATOM 2795  H HH2  . TRP A 1 80 ? -3.206  -15.187 0.461   1.00 0.00 ? 1124 TRP B HH2  2  
ATOM 2796  N N    . LYS A 1 81 ? -7.568  -12.001 -3.313  1.00 0.00 ? 1125 LYS B N    2  
ATOM 2797  C CA   . LYS A 1 81 ? -8.415  -13.014 -2.682  1.00 0.00 ? 1125 LYS B CA   2  
ATOM 2798  C C    . LYS A 1 81 ? -9.365  -13.604 -3.697  1.00 0.00 ? 1125 LYS B C    2  
ATOM 2799  O O    . LYS A 1 81 ? -9.657  -14.790 -3.666  1.00 0.00 ? 1125 LYS B O    2  
ATOM 2800  C CB   . LYS A 1 81 ? -9.228  -12.403 -1.540  1.00 0.00 ? 1125 LYS B CB   2  
ATOM 2801  C CG   . LYS A 1 81 ? -8.327  -12.063 -0.353  1.00 0.00 ? 1125 LYS B CG   2  
ATOM 2802  C CD   . LYS A 1 81 ? -7.816  -13.359 0.269   1.00 0.00 ? 1125 LYS B CD   2  
ATOM 2803  C CE   . LYS A 1 81 ? -7.167  -13.062 1.620   1.00 0.00 ? 1125 LYS B CE   2  
ATOM 2804  N NZ   . LYS A 1 81 ? -6.649  -14.329 2.208   1.00 0.00 ? 1125 LYS B NZ   2  
ATOM 2805  H H    . LYS A 1 81 ? -7.631  -11.071 -3.014  1.00 0.00 ? 1125 LYS B H    2  
ATOM 2806  H HA   . LYS A 1 81 ? -7.801  -13.811 -2.303  1.00 0.00 ? 1125 LYS B HA   2  
ATOM 2807  H HB2  . LYS A 1 81 ? -9.710  -11.502 -1.891  1.00 0.00 ? 1125 LYS B HB2  2  
ATOM 2808  H HB3  . LYS A 1 81 ? -9.983  -13.108 -1.223  1.00 0.00 ? 1125 LYS B HB3  2  
ATOM 2809  H HG2  . LYS A 1 81 ? -7.490  -11.468 -0.692  1.00 0.00 ? 1125 LYS B HG2  2  
ATOM 2810  H HG3  . LYS A 1 81 ? -8.891  -11.509 0.383   1.00 0.00 ? 1125 LYS B HG3  2  
ATOM 2811  H HD2  . LYS A 1 81 ? -8.642  -14.041 0.405   1.00 0.00 ? 1125 LYS B HD2  2  
ATOM 2812  H HD3  . LYS A 1 81 ? -7.086  -13.806 -0.385  1.00 0.00 ? 1125 LYS B HD3  2  
ATOM 2813  H HE2  . LYS A 1 81 ? -6.354  -12.365 1.484   1.00 0.00 ? 1125 LYS B HE2  2  
ATOM 2814  H HE3  . LYS A 1 81 ? -7.902  -12.635 2.283   1.00 0.00 ? 1125 LYS B HE3  2  
ATOM 2815  H HZ1  . LYS A 1 81 ? -6.617  -15.065 1.476   1.00 0.00 ? 1125 LYS B HZ1  2  
ATOM 2816  H HZ2  . LYS A 1 81 ? -7.275  -14.635 2.980   1.00 0.00 ? 1125 LYS B HZ2  2  
ATOM 2817  H HZ3  . LYS A 1 81 ? -5.691  -14.174 2.581   1.00 0.00 ? 1125 LYS B HZ3  2  
ATOM 2818  N N    . SER A 1 82 ? -9.849  -12.768 -4.586  1.00 0.00 ? 1126 SER B N    2  
ATOM 2819  C CA   . SER A 1 82 ? -10.777 -13.222 -5.607  1.00 0.00 ? 1126 SER B CA   2  
ATOM 2820  C C    . SER A 1 82 ? -10.120 -14.297 -6.462  1.00 0.00 ? 1126 SER B C    2  
ATOM 2821  O O    . SER A 1 82 ? -10.738 -15.304 -6.789  1.00 0.00 ? 1126 SER B O    2  
ATOM 2822  C CB   . SER A 1 82 ? -11.208 -12.051 -6.488  1.00 0.00 ? 1126 SER B CB   2  
ATOM 2823  O OG   . SER A 1 82 ? -12.106 -12.521 -7.483  1.00 0.00 ? 1126 SER B OG   2  
ATOM 2824  H H    . SER A 1 82 ? -9.581  -11.832 -4.553  1.00 0.00 ? 1126 SER B H    2  
ATOM 2825  H HA   . SER A 1 82 ? -11.649 -13.639 -5.128  1.00 0.00 ? 1126 SER B HA   2  
ATOM 2826  H HB2  . SER A 1 82 ? -11.704 -11.306 -5.886  1.00 0.00 ? 1126 SER B HB2  2  
ATOM 2827  H HB3  . SER A 1 82 ? -10.338 -11.611 -6.954  1.00 0.00 ? 1126 SER B HB3  2  
ATOM 2828  H HG   . SER A 1 82 ? -11.590 -12.966 -8.159  1.00 0.00 ? 1126 SER B HG   2  
ATOM 2829  N N    . LYS A 1 83 ? -8.863  -14.071 -6.825  1.00 0.00 ? 1127 LYS B N    2  
ATOM 2830  C CA   . LYS A 1 83 ? -8.128  -15.028 -7.649  1.00 0.00 ? 1127 LYS B CA   2  
ATOM 2831  C C    . LYS A 1 83 ? -7.916  -16.345 -6.909  1.00 0.00 ? 1127 LYS B C    2  
ATOM 2832  O O    . LYS A 1 83 ? -8.101  -17.424 -7.466  1.00 0.00 ? 1127 LYS B O    2  
ATOM 2833  C CB   . LYS A 1 83 ? -6.761  -14.444 -7.980  1.00 0.00 ? 1127 LYS B CB   2  
ATOM 2834  C CG   . LYS A 1 83 ? -6.940  -13.196 -8.828  1.00 0.00 ? 1127 LYS B CG   2  
ATOM 2835  C CD   . LYS A 1 83 ? -5.577  -12.579 -9.116  1.00 0.00 ? 1127 LYS B CD   2  
ATOM 2836  C CE   . LYS A 1 83 ? -5.778  -11.178 -9.678  1.00 0.00 ? 1127 LYS B CE   2  
ATOM 2837  N NZ   . LYS A 1 83 ? -6.512  -11.256 -10.973 1.00 0.00 ? 1127 LYS B NZ   2  
ATOM 2838  H H    . LYS A 1 83 ? -8.420  -13.244 -6.538  1.00 0.00 ? 1127 LYS B H    2  
ATOM 2839  H HA   . LYS A 1 83 ? -8.668  -15.208 -8.564  1.00 0.00 ? 1127 LYS B HA   2  
ATOM 2840  H HB2  . LYS A 1 83 ? -6.253  -14.187 -7.061  1.00 0.00 ? 1127 LYS B HB2  2  
ATOM 2841  H HB3  . LYS A 1 83 ? -6.178  -15.171 -8.527  1.00 0.00 ? 1127 LYS B HB3  2  
ATOM 2842  H HG2  . LYS A 1 83 ? -7.422  -13.457 -9.757  1.00 0.00 ? 1127 LYS B HG2  2  
ATOM 2843  H HG3  . LYS A 1 83 ? -7.547  -12.486 -8.293  1.00 0.00 ? 1127 LYS B HG3  2  
ATOM 2844  H HD2  . LYS A 1 83 ? -5.002  -12.527 -8.202  1.00 0.00 ? 1127 LYS B HD2  2  
ATOM 2845  H HD3  . LYS A 1 83 ? -5.052  -13.185 -9.839  1.00 0.00 ? 1127 LYS B HD3  2  
ATOM 2846  H HE2  . LYS A 1 83 ? -6.355  -10.597 -8.972  1.00 0.00 ? 1127 LYS B HE2  2  
ATOM 2847  H HE3  . LYS A 1 83 ? -4.818  -10.710 -9.831  1.00 0.00 ? 1127 LYS B HE3  2  
ATOM 2848  H HZ1  . LYS A 1 83 ? -6.331  -10.394 -11.527 1.00 0.00 ? 1127 LYS B HZ1  2  
ATOM 2849  H HZ2  . LYS A 1 83 ? -7.533  -11.340 -10.787 1.00 0.00 ? 1127 LYS B HZ2  2  
ATOM 2850  H HZ3  . LYS A 1 83 ? -6.187  -12.083 -11.508 1.00 0.00 ? 1127 LYS B HZ3  2  
ATOM 2851  N N    . ASN A 1 84 ? -7.501  -16.247 -5.656  1.00 0.00 ? 1128 ASN B N    2  
ATOM 2852  C CA   . ASN A 1 84 ? -7.241  -17.441 -4.855  1.00 0.00 ? 1128 ASN B CA   2  
ATOM 2853  C C    . ASN A 1 84 ? -8.530  -18.184 -4.516  1.00 0.00 ? 1128 ASN B C    2  
ATOM 2854  O O    . ASN A 1 84 ? -8.576  -19.413 -4.546  1.00 0.00 ? 1128 ASN B O    2  
ATOM 2855  C CB   . ASN A 1 84 ? -6.527  -17.033 -3.569  1.00 0.00 ? 1128 ASN B CB   2  
ATOM 2856  C CG   . ASN A 1 84 ? -5.073  -16.704 -3.880  1.00 0.00 ? 1128 ASN B CG   2  
ATOM 2857  O OD1  . ASN A 1 84 ? -4.231  -17.599 -3.936  1.00 0.00 ? 1128 ASN B OD1  2  
ATOM 2858  N ND2  . ASN A 1 84 ? -4.734  -15.468 -4.128  1.00 0.00 ? 1128 ASN B ND2  2  
ATOM 2859  H H    . ASN A 1 84 ? -7.350  -15.353 -5.270  1.00 0.00 ? 1128 ASN B H    2  
ATOM 2860  H HA   . ASN A 1 84 ? -6.597  -18.101 -5.412  1.00 0.00 ? 1128 ASN B HA   2  
ATOM 2861  H HB2  . ASN A 1 84 ? -7.012  -16.165 -3.148  1.00 0.00 ? 1128 ASN B HB2  2  
ATOM 2862  H HB3  . ASN A 1 84 ? -6.566  -17.847 -2.861  1.00 0.00 ? 1128 ASN B HB3  2  
ATOM 2863  H HD21 . ASN A 1 84 ? -5.412  -14.760 -4.115  1.00 0.00 ? 1128 ASN B HD21 2  
ATOM 2864  H HD22 . ASN A 1 84 ? -3.802  -15.248 -4.331  1.00 0.00 ? 1128 ASN B HD22 2  
ATOM 2865  N N    . LYS A 1 85 ? -9.573  -17.426 -4.205  1.00 0.00 ? 1129 LYS B N    2  
ATOM 2866  C CA   . LYS A 1 85 ? -10.868 -18.007 -3.872  1.00 0.00 ? 1129 LYS B CA   2  
ATOM 2867  C C    . LYS A 1 85 ? -11.530 -18.576 -5.112  1.00 0.00 ? 1129 LYS B C    2  
ATOM 2868  O O    . LYS A 1 85 ? -12.147 -19.640 -5.076  1.00 0.00 ? 1129 LYS B O    2  
ATOM 2869  C CB   . LYS A 1 85 ? -11.764 -16.933 -3.264  1.00 0.00 ? 1129 LYS B CB   2  
ATOM 2870  C CG   . LYS A 1 85 ? -11.240 -16.560 -1.879  1.00 0.00 ? 1129 LYS B CG   2  
ATOM 2871  C CD   . LYS A 1 85 ? -12.112 -15.453 -1.294  1.00 0.00 ? 1129 LYS B CD   2  
ATOM 2872  C CE   . LYS A 1 85 ? -11.599 -15.086 0.099   1.00 0.00 ? 1129 LYS B CE   2  
ATOM 2873  N NZ   . LYS A 1 85 ? -12.443 -13.996 0.668   1.00 0.00 ? 1129 LYS B NZ   2  
ATOM 2874  H H    . LYS A 1 85 ? -9.474  -16.458 -4.214  1.00 0.00 ? 1129 LYS B H    2  
ATOM 2875  H HA   . LYS A 1 85 ? -10.727 -18.797 -3.151  1.00 0.00 ? 1129 LYS B HA   2  
ATOM 2876  H HB2  . LYS A 1 85 ? -11.760 -16.059 -3.898  1.00 0.00 ? 1129 LYS B HB2  2  
ATOM 2877  H HB3  . LYS A 1 85 ? -12.771 -17.310 -3.175  1.00 0.00 ? 1129 LYS B HB3  2  
ATOM 2878  H HG2  . LYS A 1 85 ? -11.276 -17.428 -1.236  1.00 0.00 ? 1129 LYS B HG2  2  
ATOM 2879  H HG3  . LYS A 1 85 ? -10.222 -16.213 -1.958  1.00 0.00 ? 1129 LYS B HG3  2  
ATOM 2880  H HD2  . LYS A 1 85 ? -12.064 -14.586 -1.940  1.00 0.00 ? 1129 LYS B HD2  2  
ATOM 2881  H HD3  . LYS A 1 85 ? -13.131 -15.797 -1.225  1.00 0.00 ? 1129 LYS B HD3  2  
ATOM 2882  H HE2  . LYS A 1 85 ? -11.650 -15.953 0.741   1.00 0.00 ? 1129 LYS B HE2  2  
ATOM 2883  H HE3  . LYS A 1 85 ? -10.576 -14.750 0.028   1.00 0.00 ? 1129 LYS B HE3  2  
ATOM 2884  H HZ1  . LYS A 1 85 ? -12.291 -13.943 1.696   1.00 0.00 ? 1129 LYS B HZ1  2  
ATOM 2885  H HZ2  . LYS A 1 85 ? -13.445 -14.199 0.476   1.00 0.00 ? 1129 LYS B HZ2  2  
ATOM 2886  H HZ3  . LYS A 1 85 ? -12.180 -13.090 0.233   1.00 0.00 ? 1129 LYS B HZ3  2  
ATOM 2887  N N    . LYS A 1 86 ? -11.402 -17.840 -6.204  1.00 0.00 ? 1130 LYS B N    2  
ATOM 2888  C CA   . LYS A 1 86 ? -11.999 -18.255 -7.472  1.00 0.00 ? 1130 LYS B CA   2  
ATOM 2889  C C    . LYS A 1 86 ? -10.985 -18.179 -8.609  1.00 0.00 ? 1130 LYS B C    2  
ATOM 2890  O O    . LYS A 1 86 ? -10.233 -17.210 -8.720  1.00 0.00 ? 1130 LYS B O    2  
ATOM 2891  C CB   . LYS A 1 86 ? -13.196 -17.357 -7.792  1.00 0.00 ? 1130 LYS B CB   2  
ATOM 2892  C CG   . LYS A 1 86 ? -14.278 -17.554 -6.726  1.00 0.00 ? 1130 LYS B CG   2  
ATOM 2893  C CD   . LYS A 1 86 ? -15.392 -16.522 -6.918  1.00 0.00 ? 1130 LYS B CD   2  
ATOM 2894  C CE   . LYS A 1 86 ? -16.144 -16.806 -8.220  1.00 0.00 ? 1130 LYS B CE   2  
ATOM 2895  N NZ   . LYS A 1 86 ? -17.267 -15.837 -8.363  1.00 0.00 ? 1130 LYS B NZ   2  
ATOM 2896  H H    . LYS A 1 86 ? -10.902 -16.993 -6.148  1.00 0.00 ? 1130 LYS B H    2  
ATOM 2897  H HA   . LYS A 1 86 ? -12.345 -19.274 -7.379  1.00 0.00 ? 1130 LYS B HA   2  
ATOM 2898  H HB2  . LYS A 1 86 ? -12.879 -16.324 -7.799  1.00 0.00 ? 1130 LYS B HB2  2  
ATOM 2899  H HB3  . LYS A 1 86 ? -13.596 -17.619 -8.760  1.00 0.00 ? 1130 LYS B HB3  2  
ATOM 2900  H HG2  . LYS A 1 86 ? -14.690 -18.549 -6.812  1.00 0.00 ? 1130 LYS B HG2  2  
ATOM 2901  H HG3  . LYS A 1 86 ? -13.841 -17.429 -5.745  1.00 0.00 ? 1130 LYS B HG3  2  
ATOM 2902  H HD2  . LYS A 1 86 ? -16.079 -16.576 -6.088  1.00 0.00 ? 1130 LYS B HD2  2  
ATOM 2903  H HD3  . LYS A 1 86 ? -14.962 -15.532 -6.965  1.00 0.00 ? 1130 LYS B HD3  2  
ATOM 2904  H HE2  . LYS A 1 86 ? -15.469 -16.702 -9.058  1.00 0.00 ? 1130 LYS B HE2  2  
ATOM 2905  H HE3  . LYS A 1 86 ? -16.537 -17.813 -8.198  1.00 0.00 ? 1130 LYS B HE3  2  
ATOM 2906  H HZ1  . LYS A 1 86 ? -17.688 -15.655 -7.431  1.00 0.00 ? 1130 LYS B HZ1  2  
ATOM 2907  H HZ2  . LYS A 1 86 ? -17.989 -16.234 -8.999  1.00 0.00 ? 1130 LYS B HZ2  2  
ATOM 2908  H HZ3  . LYS A 1 86 ? -16.908 -14.946 -8.760  1.00 0.00 ? 1130 LYS B HZ3  2  
ATOM 2909  N N    . ARG A 1 87 ? -10.980 -19.200 -9.458  1.00 0.00 ? 1131 ARG B N    2  
ATOM 2910  C CA   . ARG A 1 87 ? -10.061 -19.240 -10.593 1.00 0.00 ? 1131 ARG B CA   2  
ATOM 2911  C C    . ARG A 1 87 ? -10.358 -20.444 -11.481 1.00 0.00 ? 1131 ARG B C    2  
ATOM 2912  O O    . ARG A 1 87 ? -10.940 -21.394 -10.984 1.00 0.00 ? 1131 ARG B O    2  
ATOM 2913  C CB   . ARG A 1 87 ? -8.615  -19.313 -10.093 1.00 0.00 ? 1131 ARG B CB   2  
ATOM 2914  C CG   . ARG A 1 87 ? -8.424  -20.581 -9.260  1.00 0.00 ? 1131 ARG B CG   2  
ATOM 2915  C CD   . ARG A 1 87 ? -6.991  -20.636 -8.725  1.00 0.00 ? 1131 ARG B CD   2  
ATOM 2916  N NE   . ARG A 1 87 ? -6.798  -21.840 -7.921  1.00 0.00 ? 1131 ARG B NE   2  
ATOM 2917  C CZ   . ARG A 1 87 ? -5.635  -22.111 -7.327  1.00 0.00 ? 1131 ARG B CZ   2  
ATOM 2918  N NH1  . ARG A 1 87 ? -4.616  -21.298 -7.443  1.00 0.00 ? 1131 ARG B NH1  2  
ATOM 2919  N NH2  . ARG A 1 87 ? -5.511  -23.201 -6.620  1.00 0.00 ? 1131 ARG B NH2  2  
ATOM 2920  O OXT  . ARG A 1 87 ? -10.003 -20.397 -12.648 1.00 0.00 ? 1131 ARG B OXT  2  
ATOM 2921  H H    . ARG A 1 87 ? -11.609 -19.939 -9.323  1.00 0.00 ? 1131 ARG B H    2  
ATOM 2922  H HA   . ARG A 1 87 ? -10.183 -18.340 -11.173 1.00 0.00 ? 1131 ARG B HA   2  
ATOM 2923  H HB2  . ARG A 1 87 ? -7.943  -19.333 -10.940 1.00 0.00 ? 1131 ARG B HB2  2  
ATOM 2924  H HB3  . ARG A 1 87 ? -8.401  -18.450 -9.485  1.00 0.00 ? 1131 ARG B HB3  2  
ATOM 2925  H HG2  . ARG A 1 87 ? -9.118  -20.576 -8.433  1.00 0.00 ? 1131 ARG B HG2  2  
ATOM 2926  H HG3  . ARG A 1 87 ? -8.608  -21.447 -9.878  1.00 0.00 ? 1131 ARG B HG3  2  
ATOM 2927  H HD2  . ARG A 1 87 ? -6.298  -20.646 -9.553  1.00 0.00 ? 1131 ARG B HD2  2  
ATOM 2928  H HD3  . ARG A 1 87 ? -6.803  -19.762 -8.115  1.00 0.00 ? 1131 ARG B HD3  2  
ATOM 2929  H HE   . ARG A 1 87 ? -7.545  -22.466 -7.813  1.00 0.00 ? 1131 ARG B HE   2  
ATOM 2930  H HH11 . ARG A 1 87 ? -4.697  -20.460 -7.982  1.00 0.00 ? 1131 ARG B HH11 2  
ATOM 2931  H HH12 . ARG A 1 87 ? -3.751  -21.516 -6.992  1.00 0.00 ? 1131 ARG B HH12 2  
ATOM 2932  H HH21 . ARG A 1 87 ? -6.285  -23.828 -6.527  1.00 0.00 ? 1131 ARG B HH21 2  
ATOM 2933  H HH22 . ARG A 1 87 ? -4.641  -23.412 -6.172  1.00 0.00 ? 1131 ARG B HH22 2  
ATOM 2934  N N    . ILE B 2 9  ? 3.309   -18.665 1.679   1.00 0.00 ? 46   ILE A N    2  
ATOM 2935  C CA   . ILE B 2 9  ? 3.404   -18.217 0.260   1.00 0.00 ? 46   ILE A CA   2  
ATOM 2936  C C    . ILE B 2 9  ? 2.246   -17.277 -0.050  1.00 0.00 ? 46   ILE A C    2  
ATOM 2937  O O    . ILE B 2 9  ? 2.440   -16.081 -0.271  1.00 0.00 ? 46   ILE A O    2  
ATOM 2938  C CB   . ILE B 2 9  ? 3.351   -19.439 -0.661  1.00 0.00 ? 46   ILE A CB   2  
ATOM 2939  C CG1  . ILE B 2 9  ? 4.650   -20.237 -0.519  1.00 0.00 ? 46   ILE A CG1  2  
ATOM 2940  C CG2  . ILE B 2 9  ? 3.186   -18.980 -2.111  1.00 0.00 ? 46   ILE A CG2  2  
ATOM 2941  C CD1  . ILE B 2 9  ? 4.495   -21.596 -1.205  1.00 0.00 ? 46   ILE A CD1  2  
ATOM 2942  H H    . ILE B 2 9  ? 4.243   -18.593 2.129   1.00 0.00 ? 46   ILE A H    2  
ATOM 2943  H HA   . ILE B 2 9  ? 4.336   -17.697 0.111   1.00 0.00 ? 46   ILE A HA   2  
ATOM 2944  H HB   . ILE B 2 9  ? 2.512   -20.062 -0.384  1.00 0.00 ? 46   ILE A HB   2  
ATOM 2945  H HG12 . ILE B 2 9  ? 5.460   -19.690 -0.981  1.00 0.00 ? 46   ILE A HG12 2  
ATOM 2946  H HG13 . ILE B 2 9  ? 4.868   -20.387 0.527   1.00 0.00 ? 46   ILE A HG13 2  
ATOM 2947  H HG21 . ILE B 2 9  ? 2.170   -18.650 -2.271  1.00 0.00 ? 46   ILE A HG21 2  
ATOM 2948  H HG22 . ILE B 2 9  ? 3.405   -19.802 -2.776  1.00 0.00 ? 46   ILE A HG22 2  
ATOM 2949  H HG23 . ILE B 2 9  ? 3.865   -18.166 -2.310  1.00 0.00 ? 46   ILE A HG23 2  
ATOM 2950  H HD11 . ILE B 2 9  ? 3.474   -21.935 -1.108  1.00 0.00 ? 46   ILE A HD11 2  
ATOM 2951  H HD12 . ILE B 2 9  ? 5.157   -22.312 -0.739  1.00 0.00 ? 46   ILE A HD12 2  
ATOM 2952  H HD13 . ILE B 2 9  ? 4.745   -21.503 -2.251  1.00 0.00 ? 46   ILE A HD13 2  
ATOM 2953  N N    . GLU B 2 10 ? 1.039   -17.825 -0.071  1.00 0.00 ? 47   GLU A N    2  
ATOM 2954  C CA   . GLU B 2 10 ? -0.144  -17.028 -0.361  1.00 0.00 ? 47   GLU A CA   2  
ATOM 2955  C C    . GLU B 2 10 ? -0.332  -15.941 0.692   1.00 0.00 ? 47   GLU A C    2  
ATOM 2956  O O    . GLU B 2 10 ? -0.644  -14.794 0.373   1.00 0.00 ? 47   GLU A O    2  
ATOM 2957  C CB   . GLU B 2 10 ? -1.375  -17.931 -0.371  1.00 0.00 ? 47   GLU A CB   2  
ATOM 2958  C CG   . GLU B 2 10 ? -1.329  -18.841 -1.598  1.00 0.00 ? 47   GLU A CG   2  
ATOM 2959  C CD   . GLU B 2 10 ? -2.434  -19.888 -1.510  1.00 0.00 ? 47   GLU A CD   2  
ATOM 2960  O OE1  . GLU B 2 10 ? -2.974  -20.062 -0.430  1.00 0.00 ? 47   GLU A OE1  2  
ATOM 2961  O OE2  . GLU B 2 10 ? -2.724  -20.501 -2.524  1.00 0.00 ? 47   GLU A OE2  2  
ATOM 2962  H H    . GLU B 2 10 ? 0.945   -18.783 0.109   1.00 0.00 ? 47   GLU A H    2  
ATOM 2963  H HA   . GLU B 2 10 ? -0.036  -16.569 -1.331  1.00 0.00 ? 47   GLU A HA   2  
ATOM 2964  H HB2  . GLU B 2 10 ? -1.383  -18.532 0.527   1.00 0.00 ? 47   GLU A HB2  2  
ATOM 2965  H HB3  . GLU B 2 10 ? -2.266  -17.324 -0.407  1.00 0.00 ? 47   GLU A HB3  2  
ATOM 2966  H HG2  . GLU B 2 10 ? -1.465  -18.248 -2.489  1.00 0.00 ? 47   GLU A HG2  2  
ATOM 2967  H HG3  . GLU B 2 10 ? -0.370  -19.336 -1.639  1.00 0.00 ? 47   GLU A HG3  2  
ATOM 2968  N N    . ASN B 2 11 ? -0.133  -16.305 1.951   1.00 0.00 ? 48   ASN A N    2  
ATOM 2969  C CA   . ASN B 2 11 ? -0.284  -15.346 3.030   1.00 0.00 ? 48   ASN A CA   2  
ATOM 2970  C C    . ASN B 2 11 ? 0.720   -14.219 2.870   1.00 0.00 ? 48   ASN A C    2  
ATOM 2971  O O    . ASN B 2 11 ? 0.407   -13.052 3.104   1.00 0.00 ? 48   ASN A O    2  
ATOM 2972  C CB   . ASN B 2 11 ? -0.079  -16.036 4.380   1.00 0.00 ? 48   ASN A CB   2  
ATOM 2973  C CG   . ASN B 2 11 ? -1.246  -16.977 4.654   1.00 0.00 ? 48   ASN A CG   2  
ATOM 2974  O OD1  . ASN B 2 11 ? -1.038  -18.143 4.989   1.00 0.00 ? 48   ASN A OD1  2  
ATOM 2975  N ND2  . ASN B 2 11 ? -2.467  -16.542 4.510   1.00 0.00 ? 48   ASN A ND2  2  
ATOM 2976  H H    . ASN B 2 11 ? 0.121   -17.230 2.153   1.00 0.00 ? 48   ASN A H    2  
ATOM 2977  H HA   . ASN B 2 11 ? -1.281  -14.934 2.997   1.00 0.00 ? 48   ASN A HA   2  
ATOM 2978  H HB2  . ASN B 2 11 ? 0.843   -16.599 4.358   1.00 0.00 ? 48   ASN A HB2  2  
ATOM 2979  H HB3  . ASN B 2 11 ? -0.027  -15.292 5.160   1.00 0.00 ? 48   ASN A HB3  2  
ATOM 2980  H HD21 . ASN B 2 11 ? -2.626  -15.616 4.227   1.00 0.00 ? 48   ASN A HD21 2  
ATOM 2981  H HD22 . ASN B 2 11 ? -3.223  -17.138 4.683   1.00 0.00 ? 48   ASN A HD22 2  
ATOM 2982  N N    . ASP B 2 12 ? 1.929   -14.575 2.463   1.00 0.00 ? 49   ASP A N    2  
ATOM 2983  C CA   . ASP B 2 12 ? 2.974   -13.581 2.266   1.00 0.00 ? 49   ASP A CA   2  
ATOM 2984  C C    . ASP B 2 12 ? 2.571   -12.592 1.181   1.00 0.00 ? 49   ASP A C    2  
ATOM 2985  O O    . ASP B 2 12 ? 2.809   -11.391 1.305   1.00 0.00 ? 49   ASP A O    2  
ATOM 2986  C CB   . ASP B 2 12 ? 4.284   -14.267 1.875   1.00 0.00 ? 49   ASP A CB   2  
ATOM 2987  C CG   . ASP B 2 12 ? 4.865   -15.007 3.075   1.00 0.00 ? 49   ASP A CG   2  
ATOM 2988  O OD1  . ASP B 2 12 ? 4.396   -14.769 4.177   1.00 0.00 ? 49   ASP A OD1  2  
ATOM 2989  O OD2  . ASP B 2 12 ? 5.768   -15.801 2.876   1.00 0.00 ? 49   ASP A OD2  2  
ATOM 2990  H H    . ASP B 2 12 ? 2.117   -15.521 2.282   1.00 0.00 ? 49   ASP A H    2  
ATOM 2991  H HA   . ASP B 2 12 ? 3.123   -13.043 3.191   1.00 0.00 ? 49   ASP A HA   2  
ATOM 2992  H HB2  . ASP B 2 12 ? 4.093   -14.970 1.078   1.00 0.00 ? 49   ASP A HB2  2  
ATOM 2993  H HB3  . ASP B 2 12 ? 4.990   -13.523 1.538   1.00 0.00 ? 49   ASP A HB3  2  
ATOM 2994  N N    . GLU B 2 13 ? 1.959   -13.099 0.115   1.00 0.00 ? 50   GLU A N    2  
ATOM 2995  C CA   . GLU B 2 13 ? 1.532   -12.237 -0.979  1.00 0.00 ? 50   GLU A CA   2  
ATOM 2996  C C    . GLU B 2 13 ? 0.502   -11.228 -0.490  1.00 0.00 ? 50   GLU A C    2  
ATOM 2997  O O    . GLU B 2 13 ? 0.562   -10.046 -0.828  1.00 0.00 ? 50   GLU A O    2  
ATOM 2998  C CB   . GLU B 2 13 ? 0.919   -13.077 -2.101  1.00 0.00 ? 50   GLU A CB   2  
ATOM 2999  C CG   . GLU B 2 13 ? 2.012   -13.901 -2.782  1.00 0.00 ? 50   GLU A CG   2  
ATOM 3000  C CD   . GLU B 2 13 ? 1.391   -14.815 -3.832  1.00 0.00 ? 50   GLU A CD   2  
ATOM 3001  O OE1  . GLU B 2 13 ? 0.173   -14.887 -3.882  1.00 0.00 ? 50   GLU A OE1  2  
ATOM 3002  O OE2  . GLU B 2 13 ? 2.140   -15.433 -4.571  1.00 0.00 ? 50   GLU A OE2  2  
ATOM 3003  H H    . GLU B 2 13 ? 1.795   -14.066 0.065   1.00 0.00 ? 50   GLU A H    2  
ATOM 3004  H HA   . GLU B 2 13 ? 2.390   -11.707 -1.368  1.00 0.00 ? 50   GLU A HA   2  
ATOM 3005  H HB2  . GLU B 2 13 ? 0.173   -13.739 -1.685  1.00 0.00 ? 50   GLU A HB2  2  
ATOM 3006  H HB3  . GLU B 2 13 ? 0.458   -12.424 -2.827  1.00 0.00 ? 50   GLU A HB3  2  
ATOM 3007  H HG2  . GLU B 2 13 ? 2.719   -13.237 -3.258  1.00 0.00 ? 50   GLU A HG2  2  
ATOM 3008  H HG3  . GLU B 2 13 ? 2.523   -14.500 -2.044  1.00 0.00 ? 50   GLU A HG3  2  
ATOM 3009  N N    . ALA B 2 14 ? -0.443  -11.698 0.317   1.00 0.00 ? 51   ALA A N    2  
ATOM 3010  C CA   . ALA B 2 14 ? -1.474  -10.818 0.848   1.00 0.00 ? 51   ALA A CA   2  
ATOM 3011  C C    . ALA B 2 14 ? -0.861  -9.745  1.744   1.00 0.00 ? 51   ALA A C    2  
ATOM 3012  O O    . ALA B 2 14 ? -1.265  -8.584  1.696   1.00 0.00 ? 51   ALA A O    2  
ATOM 3013  C CB   . ALA B 2 14 ? -2.503  -11.627 1.633   1.00 0.00 ? 51   ALA A CB   2  
ATOM 3014  H H    . ALA B 2 14 ? -0.443  -12.651 0.559   1.00 0.00 ? 51   ALA A H    2  
ATOM 3015  H HA   . ALA B 2 14 ? -1.974  -10.335 0.022   1.00 0.00 ? 51   ALA A HA   2  
ATOM 3016  H HB1  . ALA B 2 14 ? -2.299  -12.680 1.519   1.00 0.00 ? 51   ALA A HB1  2  
ATOM 3017  H HB2  . ALA B 2 14 ? -3.493  -11.408 1.257   1.00 0.00 ? 51   ALA A HB2  2  
ATOM 3018  H HB3  . ALA B 2 14 ? -2.447  -11.359 2.674   1.00 0.00 ? 51   ALA A HB3  2  
ATOM 3019  N N    . PHE B 2 15 ? 0.123   -10.135 2.555   1.00 0.00 ? 52   PHE A N    2  
ATOM 3020  C CA   . PHE B 2 15 ? 0.780   -9.179  3.444   1.00 0.00 ? 52   PHE A CA   2  
ATOM 3021  C C    . PHE B 2 15 ? 1.469   -8.086  2.637   1.00 0.00 ? 52   PHE A C    2  
ATOM 3022  O O    . PHE B 2 15 ? 1.387   -6.907  2.980   1.00 0.00 ? 52   PHE A O    2  
ATOM 3023  C CB   . PHE B 2 15 ? 1.818   -9.883  4.325   1.00 0.00 ? 52   PHE A CB   2  
ATOM 3024  C CG   . PHE B 2 15 ? 1.193   -10.310 5.634   1.00 0.00 ? 52   PHE A CG   2  
ATOM 3025  C CD1  . PHE B 2 15 ? 0.815   -11.643 5.835   1.00 0.00 ? 52   PHE A CD1  2  
ATOM 3026  C CD2  . PHE B 2 15 ? 1.005   -9.369  6.654   1.00 0.00 ? 52   PHE A CD2  2  
ATOM 3027  C CE1  . PHE B 2 15 ? 0.251   -12.035 7.057   1.00 0.00 ? 52   PHE A CE1  2  
ATOM 3028  C CE2  . PHE B 2 15 ? 0.439   -9.759  7.875   1.00 0.00 ? 52   PHE A CE2  2  
ATOM 3029  C CZ   . PHE B 2 15 ? 0.063   -11.093 8.076   1.00 0.00 ? 52   PHE A CZ   2  
ATOM 3030  H H    . PHE B 2 15 ? 0.411   -11.071 2.552   1.00 0.00 ? 52   PHE A H    2  
ATOM 3031  H HA   . PHE B 2 15 ? 0.034   -8.726  4.080   1.00 0.00 ? 52   PHE A HA   2  
ATOM 3032  H HB2  . PHE B 2 15 ? 2.194   -10.754 3.807   1.00 0.00 ? 52   PHE A HB2  2  
ATOM 3033  H HB3  . PHE B 2 15 ? 2.635   -9.205  4.524   1.00 0.00 ? 52   PHE A HB3  2  
ATOM 3034  H HD1  . PHE B 2 15 ? 0.961   -12.369 5.051   1.00 0.00 ? 52   PHE A HD1  2  
ATOM 3035  H HD2  . PHE B 2 15 ? 1.295   -8.341  6.500   1.00 0.00 ? 52   PHE A HD2  2  
ATOM 3036  H HE1  . PHE B 2 15 ? -0.041  -13.063 7.212   1.00 0.00 ? 52   PHE A HE1  2  
ATOM 3037  H HE2  . PHE B 2 15 ? 0.296   -9.033  8.663   1.00 0.00 ? 52   PHE A HE2  2  
ATOM 3038  H HZ   . PHE B 2 15 ? -0.373  -11.395 9.017   1.00 0.00 ? 52   PHE A HZ   2  
ATOM 3039  N N    . ALA B 2 16 ? 2.145   -8.479  1.563   1.00 0.00 ? 53   ALA A N    2  
ATOM 3040  C CA   . ALA B 2 16 ? 2.842   -7.516  0.719   1.00 0.00 ? 53   ALA A CA   2  
ATOM 3041  C C    . ALA B 2 16 ? 1.853   -6.528  0.112   1.00 0.00 ? 53   ALA A C    2  
ATOM 3042  O O    . ALA B 2 16 ? 2.122   -5.334  0.025   1.00 0.00 ? 53   ALA A O    2  
ATOM 3043  C CB   . ALA B 2 16 ? 3.595   -8.241  -0.396  1.00 0.00 ? 53   ALA A CB   2  
ATOM 3044  H H    . ALA B 2 16 ? 2.175   -9.432  1.334   1.00 0.00 ? 53   ALA A H    2  
ATOM 3045  H HA   . ALA B 2 16 ? 3.553   -6.970  1.323   1.00 0.00 ? 53   ALA A HA   2  
ATOM 3046  H HB1  . ALA B 2 16 ? 4.218   -9.011  0.033   1.00 0.00 ? 53   ALA A HB1  2  
ATOM 3047  H HB2  . ALA B 2 16 ? 4.213   -7.535  -0.928  1.00 0.00 ? 53   ALA A HB2  2  
ATOM 3048  H HB3  . ALA B 2 16 ? 2.886   -8.686  -1.077  1.00 0.00 ? 53   ALA A HB3  2  
ATOM 3049  N N    . ILE B 2 17 ? 0.703   -7.036  -0.302  1.00 0.00 ? 54   ILE A N    2  
ATOM 3050  C CA   . ILE B 2 17 ? -0.317  -6.190  -0.890  1.00 0.00 ? 54   ILE A CA   2  
ATOM 3051  C C    . ILE B 2 17 ? -0.763  -5.121  0.098   1.00 0.00 ? 54   ILE A C    2  
ATOM 3052  O O    . ILE B 2 17 ? -0.954  -3.962  -0.268  1.00 0.00 ? 54   ILE A O    2  
ATOM 3053  C CB   . ILE B 2 17 ? -1.515  -7.042  -1.307  1.00 0.00 ? 54   ILE A CB   2  
ATOM 3054  C CG1  . ILE B 2 17 ? -1.128  -7.918  -2.502  1.00 0.00 ? 54   ILE A CG1  2  
ATOM 3055  C CG2  . ILE B 2 17 ? -2.680  -6.135  -1.691  1.00 0.00 ? 54   ILE A CG2  2  
ATOM 3056  C CD1  . ILE B 2 17 ? -2.232  -8.941  -2.762  1.00 0.00 ? 54   ILE A CD1  2  
ATOM 3057  H H    . ILE B 2 17 ? 0.536   -7.998  -0.215  1.00 0.00 ? 54   ILE A H    2  
ATOM 3058  H HA   . ILE B 2 17 ? 0.088   -5.707  -1.762  1.00 0.00 ? 54   ILE A HA   2  
ATOM 3059  H HB   . ILE B 2 17 ? -1.809  -7.672  -0.480  1.00 0.00 ? 54   ILE A HB   2  
ATOM 3060  H HG12 . ILE B 2 17 ? -1.000  -7.297  -3.376  1.00 0.00 ? 54   ILE A HG12 2  
ATOM 3061  H HG13 . ILE B 2 17 ? -0.204  -8.434  -2.287  1.00 0.00 ? 54   ILE A HG13 2  
ATOM 3062  H HG21 . ILE B 2 17 ? -3.055  -5.636  -0.812  1.00 0.00 ? 54   ILE A HG21 2  
ATOM 3063  H HG22 . ILE B 2 17 ? -3.468  -6.731  -2.127  1.00 0.00 ? 54   ILE A HG22 2  
ATOM 3064  H HG23 . ILE B 2 17 ? -2.342  -5.403  -2.408  1.00 0.00 ? 54   ILE A HG23 2  
ATOM 3065  H HD11 . ILE B 2 17 ? -1.797  -9.924  -2.862  1.00 0.00 ? 54   ILE A HD11 2  
ATOM 3066  H HD12 . ILE B 2 17 ? -2.753  -8.681  -3.673  1.00 0.00 ? 54   ILE A HD12 2  
ATOM 3067  H HD13 . ILE B 2 17 ? -2.929  -8.937  -1.937  1.00 0.00 ? 54   ILE A HD13 2  
ATOM 3068  N N    . LEU B 2 18 ? -0.948  -5.523  1.345   1.00 0.00 ? 55   LEU A N    2  
ATOM 3069  C CA   . LEU B 2 18 ? -1.398  -4.598  2.376   1.00 0.00 ? 55   LEU A CA   2  
ATOM 3070  C C    . LEU B 2 18 ? -0.237  -4.068  3.215   1.00 0.00 ? 55   LEU A C    2  
ATOM 3071  O O    . LEU B 2 18 ? -0.449  -3.567  4.316   1.00 0.00 ? 55   LEU A O    2  
ATOM 3072  C CB   . LEU B 2 18 ? -2.416  -5.296  3.280   1.00 0.00 ? 55   LEU A CB   2  
ATOM 3073  C CG   . LEU B 2 18 ? -3.621  -5.742  2.445   1.00 0.00 ? 55   LEU A CG   2  
ATOM 3074  C CD1  . LEU B 2 18 ? -4.584  -6.545  3.319   1.00 0.00 ? 55   LEU A CD1  2  
ATOM 3075  C CD2  . LEU B 2 18 ? -4.349  -4.512  1.896   1.00 0.00 ? 55   LEU A CD2  2  
ATOM 3076  H H    . LEU B 2 18 ? -0.792  -6.463  1.574   1.00 0.00 ? 55   LEU A H    2  
ATOM 3077  H HA   . LEU B 2 18 ? -1.878  -3.760  1.899   1.00 0.00 ? 55   LEU A HA   2  
ATOM 3078  H HB2  . LEU B 2 18 ? -1.956  -6.160  3.739   1.00 0.00 ? 55   LEU A HB2  2  
ATOM 3079  H HB3  . LEU B 2 18 ? -2.745  -4.614  4.047   1.00 0.00 ? 55   LEU A HB3  2  
ATOM 3080  H HG   . LEU B 2 18 ? -3.283  -6.358  1.624   1.00 0.00 ? 55   LEU A HG   2  
ATOM 3081  H HD11 . LEU B 2 18 ? -4.335  -7.593  3.260   1.00 0.00 ? 55   LEU A HD11 2  
ATOM 3082  H HD12 . LEU B 2 18 ? -5.595  -6.395  2.972   1.00 0.00 ? 55   LEU A HD12 2  
ATOM 3083  H HD13 . LEU B 2 18 ? -4.503  -6.213  4.344   1.00 0.00 ? 55   LEU A HD13 2  
ATOM 3084  H HD21 . LEU B 2 18 ? -3.802  -4.117  1.051   1.00 0.00 ? 55   LEU A HD21 2  
ATOM 3085  H HD22 . LEU B 2 18 ? -4.414  -3.758  2.667   1.00 0.00 ? 55   LEU A HD22 2  
ATOM 3086  H HD23 . LEU B 2 18 ? -5.343  -4.792  1.581   1.00 0.00 ? 55   LEU A HD23 2  
ATOM 3087  N N    . ASP B 2 19 ? 0.985   -4.169  2.698   1.00 0.00 ? 56   ASP A N    2  
ATOM 3088  C CA   . ASP B 2 19 ? 2.145   -3.671  3.435   1.00 0.00 ? 56   ASP A CA   2  
ATOM 3089  C C    . ASP B 2 19 ? 3.178   -3.078  2.481   1.00 0.00 ? 56   ASP A C    2  
ATOM 3090  O O    . ASP B 2 19 ? 3.484   -1.888  2.537   1.00 0.00 ? 56   ASP A O    2  
ATOM 3091  C CB   . ASP B 2 19 ? 2.785   -4.809  4.234   1.00 0.00 ? 56   ASP A CB   2  
ATOM 3092  C CG   . ASP B 2 19 ? 3.783   -4.249  5.243   1.00 0.00 ? 56   ASP A CG   2  
ATOM 3093  O OD1  . ASP B 2 19 ? 3.755   -3.052  5.473   1.00 0.00 ? 56   ASP A OD1  2  
ATOM 3094  O OD2  . ASP B 2 19 ? 4.560   -5.027  5.772   1.00 0.00 ? 56   ASP A OD2  2  
ATOM 3095  H H    . ASP B 2 19 ? 1.109   -4.570  1.810   1.00 0.00 ? 56   ASP A H    2  
ATOM 3096  H HA   . ASP B 2 19 ? 1.823   -2.903  4.121   1.00 0.00 ? 56   ASP A HA   2  
ATOM 3097  H HB2  . ASP B 2 19 ? 2.015   -5.354  4.757   1.00 0.00 ? 56   ASP A HB2  2  
ATOM 3098  H HB3  . ASP B 2 19 ? 3.300   -5.475  3.558   1.00 0.00 ? 56   ASP A HB3  2  
ATOM 3099  N N    . GLY B 2 20 ? 3.702   -3.915  1.601   1.00 0.00 ? 57   GLY A N    2  
ATOM 3100  C CA   . GLY B 2 20 ? 4.697   -3.464  0.635   1.00 0.00 ? 57   GLY A CA   2  
ATOM 3101  C C    . GLY B 2 20 ? 4.046   -2.792  -0.574  1.00 0.00 ? 57   GLY A C    2  
ATOM 3102  O O    . GLY B 2 20 ? 4.739   -2.245  -1.432  1.00 0.00 ? 57   GLY A O    2  
ATOM 3103  H H    . GLY B 2 20 ? 3.414   -4.854  1.598   1.00 0.00 ? 57   GLY A H    2  
ATOM 3104  H HA2  . GLY B 2 20 ? 5.361   -2.760  1.117   1.00 0.00 ? 57   GLY A HA2  2  
ATOM 3105  H HA3  . GLY B 2 20 ? 5.270   -4.314  0.298   1.00 0.00 ? 57   GLY A HA3  2  
ATOM 3106  N N    . GLY B 2 21 ? 2.716   -2.840  -0.650  1.00 0.00 ? 58   GLY A N    2  
ATOM 3107  C CA   . GLY B 2 21 ? 2.007   -2.240  -1.775  1.00 0.00 ? 58   GLY A CA   2  
ATOM 3108  C C    . GLY B 2 21 ? 2.196   -3.074  -3.041  1.00 0.00 ? 58   GLY A C    2  
ATOM 3109  O O    . GLY B 2 21 ? 2.009   -2.581  -4.153  1.00 0.00 ? 58   GLY A O    2  
ATOM 3110  H H    . GLY B 2 21 ? 2.205   -3.294  0.052   1.00 0.00 ? 58   GLY A H    2  
ATOM 3111  H HA2  . GLY B 2 21 ? 0.954   -2.179  -1.538  1.00 0.00 ? 58   GLY A HA2  2  
ATOM 3112  H HA3  . GLY B 2 21 ? 2.391   -1.246  -1.946  1.00 0.00 ? 58   GLY A HA3  2  
ATOM 3113  N N    . ALA B 2 22 ? 2.575   -4.338  -2.861  1.00 0.00 ? 59   ALA A N    2  
ATOM 3114  C CA   . ALA B 2 22 ? 2.798   -5.233  -3.991  1.00 0.00 ? 59   ALA A CA   2  
ATOM 3115  C C    . ALA B 2 22 ? 1.475   -5.668  -4.616  1.00 0.00 ? 59   ALA A C    2  
ATOM 3116  O O    . ALA B 2 22 ? 0.429   -5.598  -3.979  1.00 0.00 ? 59   ALA A O    2  
ATOM 3117  C CB   . ALA B 2 22 ? 3.560   -6.469  -3.524  1.00 0.00 ? 59   ALA A CB   2  
ATOM 3118  H H    . ALA B 2 22 ? 2.713   -4.675  -1.950  1.00 0.00 ? 59   ALA A H    2  
ATOM 3119  H HA   . ALA B 2 22 ? 3.389   -4.716  -4.730  1.00 0.00 ? 59   ALA A HA   2  
ATOM 3120  H HB1  . ALA B 2 22 ? 4.024   -6.264  -2.571  1.00 0.00 ? 59   ALA A HB1  2  
ATOM 3121  H HB2  . ALA B 2 22 ? 4.319   -6.720  -4.249  1.00 0.00 ? 59   ALA A HB2  2  
ATOM 3122  H HB3  . ALA B 2 22 ? 2.873   -7.295  -3.417  1.00 0.00 ? 59   ALA A HB3  2  
ATOM 3123  N N    . PRO B 2 23 ? 1.500   -6.115  -5.843  1.00 0.00 ? 60   PRO A N    2  
ATOM 3124  C CA   . PRO B 2 23 ? 0.270   -6.574  -6.549  1.00 0.00 ? 60   PRO A CA   2  
ATOM 3125  C C    . PRO B 2 23 ? -0.238  -7.914  -6.017  1.00 0.00 ? 60   PRO A C    2  
ATOM 3126  O O    . PRO B 2 23 ? -1.405  -8.260  -6.195  1.00 0.00 ? 60   PRO A O    2  
ATOM 3127  C CB   . PRO B 2 23 ? 0.713   -6.688  -8.007  1.00 0.00 ? 60   PRO A CB   2  
ATOM 3128  C CG   . PRO B 2 23 ? 2.177   -6.963  -7.942  1.00 0.00 ? 60   PRO A CG   2  
ATOM 3129  C CD   . PRO B 2 23 ? 2.694   -6.238  -6.698  1.00 0.00 ? 60   PRO A CD   2  
ATOM 3130  H HA   . PRO B 2 23 ? -0.502  -5.831  -6.460  1.00 0.00 ? 60   PRO A HA   2  
ATOM 3131  H HB2  . PRO B 2 23 ? 0.194   -7.501  -8.496  1.00 0.00 ? 60   PRO A HB2  2  
ATOM 3132  H HB3  . PRO B 2 23 ? 0.535   -5.758  -8.528  1.00 0.00 ? 60   PRO A HB3  2  
ATOM 3133  H HG2  . PRO B 2 23 ? 2.349   -8.028  -7.855  1.00 0.00 ? 60   PRO A HG2  2  
ATOM 3134  H HG3  . PRO B 2 23 ? 2.669   -6.575  -8.819  1.00 0.00 ? 60   PRO A HG3  2  
ATOM 3135  H HD2  . PRO B 2 23 ? 3.459   -6.827  -6.206  1.00 0.00 ? 60   PRO A HD2  2  
ATOM 3136  H HD3  . PRO B 2 23 ? 3.071   -5.261  -6.955  1.00 0.00 ? 60   PRO A HD3  2  
ATOM 3137  N N    . GLY B 2 24 ? 0.647   -8.663  -5.365  1.00 0.00 ? 61   GLY A N    2  
ATOM 3138  C CA   . GLY B 2 24 ? 0.274   -9.961  -4.814  1.00 0.00 ? 61   GLY A CA   2  
ATOM 3139  C C    . GLY B 2 24 ? 0.737   -11.094 -5.724  1.00 0.00 ? 61   GLY A C    2  
ATOM 3140  O O    . GLY B 2 24 ? -0.108  -11.856 -6.166  1.00 0.00 ? 61   GLY A O    2  
ATOM 3141  O OXT  . GLY B 2 24 ? 1.928   -11.185 -5.965  1.00 0.00 ? 61   GLY A OXT  2  
ATOM 3142  H H    . GLY B 2 24 ? 1.564   -8.337  -5.253  1.00 0.00 ? 61   GLY A H    2  
ATOM 3143  H HA2  . GLY B 2 24 ? 0.730   -10.078 -3.842  1.00 0.00 ? 61   GLY A HA2  2  
ATOM 3144  H HA3  . GLY B 2 24 ? -0.800  -10.009 -4.713  1.00 0.00 ? 61   GLY A HA3  2  
ATOM 3145  N N    . ARG A 1 6  ? 6.147   -5.024  8.344   1.00 0.00 ? 1050 ARG B N    3  
ATOM 3146  C CA   . ARG A 1 6  ? 6.001   -6.267  9.152   1.00 0.00 ? 1050 ARG B CA   3  
ATOM 3147  C C    . ARG A 1 6  ? 4.817   -6.121  10.105  1.00 0.00 ? 1050 ARG B C    3  
ATOM 3148  O O    . ARG A 1 6  ? 4.985   -6.099  11.324  1.00 0.00 ? 1050 ARG B O    3  
ATOM 3149  C CB   . ARG A 1 6  ? 7.288   -6.500  9.948   1.00 0.00 ? 1050 ARG B CB   3  
ATOM 3150  C CG   . ARG A 1 6  ? 8.263   -7.348  9.125   1.00 0.00 ? 1050 ARG B CG   3  
ATOM 3151  C CD   . ARG A 1 6  ? 7.801   -8.805  9.134   1.00 0.00 ? 1050 ARG B CD   3  
ATOM 3152  N NE   . ARG A 1 6  ? 8.788   -9.656  8.480   1.00 0.00 ? 1050 ARG B NE   3  
ATOM 3153  C CZ   . ARG A 1 6  ? 8.586   -10.966 8.329   1.00 0.00 ? 1050 ARG B CZ   3  
ATOM 3154  N NH1  . ARG A 1 6  ? 7.485   -11.530 8.767   1.00 0.00 ? 1050 ARG B NH1  3  
ATOM 3155  N NH2  . ARG A 1 6  ? 9.491   -11.696 7.741   1.00 0.00 ? 1050 ARG B NH2  3  
ATOM 3156  H H    . ARG A 1 6  ? 7.153   -4.776  8.269   1.00 0.00 ? 1050 ARG B H    3  
ATOM 3157  H HA   . ARG A 1 6  ? 5.828   -7.102  8.492   1.00 0.00 ? 1050 ARG B HA   3  
ATOM 3158  H HB2  . ARG A 1 6  ? 7.744   -5.549  10.181  1.00 0.00 ? 1050 ARG B HB2  3  
ATOM 3159  H HB3  . ARG A 1 6  ? 7.053   -7.019  10.866  1.00 0.00 ? 1050 ARG B HB3  3  
ATOM 3160  H HG2  . ARG A 1 6  ? 8.286   -6.983  8.109   1.00 0.00 ? 1050 ARG B HG2  3  
ATOM 3161  H HG3  . ARG A 1 6  ? 9.250   -7.281  9.555   1.00 0.00 ? 1050 ARG B HG3  3  
ATOM 3162  H HD2  . ARG A 1 6  ? 7.673   -9.133  10.154  1.00 0.00 ? 1050 ARG B HD2  3  
ATOM 3163  H HD3  . ARG A 1 6  ? 6.859   -8.885  8.614   1.00 0.00 ? 1050 ARG B HD3  3  
ATOM 3164  H HE   . ARG A 1 6  ? 9.618   -9.257  8.144   1.00 0.00 ? 1050 ARG B HE   3  
ATOM 3165  H HH11 . ARG A 1 6  ? 6.783   -10.985 9.220   1.00 0.00 ? 1050 ARG B HH11 3  
ATOM 3166  H HH12 . ARG A 1 6  ? 7.349   -12.513 8.645   1.00 0.00 ? 1050 ARG B HH12 3  
ATOM 3167  H HH21 . ARG A 1 6  ? 10.333  -11.275 7.403   1.00 0.00 ? 1050 ARG B HH21 3  
ATOM 3168  H HH22 . ARG A 1 6  ? 9.345   -12.678 7.625   1.00 0.00 ? 1050 ARG B HH22 3  
ATOM 3169  N N    . PRO A 1 7  ? 3.633   -6.026  9.567   1.00 0.00 ? 1051 PRO B N    3  
ATOM 3170  C CA   . PRO A 1 7  ? 2.389   -5.880  10.370  1.00 0.00 ? 1051 PRO B CA   3  
ATOM 3171  C C    . PRO A 1 7  ? 2.031   -7.169  11.098  1.00 0.00 ? 1051 PRO B C    3  
ATOM 3172  O O    . PRO A 1 7  ? 2.057   -8.255  10.521  1.00 0.00 ? 1051 PRO B O    3  
ATOM 3173  C CB   . PRO A 1 7  ? 1.324   -5.529  9.330   1.00 0.00 ? 1051 PRO B CB   3  
ATOM 3174  C CG   . PRO A 1 7  ? 1.833   -6.097  8.052   1.00 0.00 ? 1051 PRO B CG   3  
ATOM 3175  C CD   . PRO A 1 7  ? 3.355   -6.046  8.133   1.00 0.00 ? 1051 PRO B CD   3  
ATOM 3176  H HA   . PRO A 1 7  ? 2.489   -5.067  11.071  1.00 0.00 ? 1051 PRO B HA   3  
ATOM 3177  H HB2  . PRO A 1 7  ? 0.379   -5.985  9.594   1.00 0.00 ? 1051 PRO B HB2  3  
ATOM 3178  H HB3  . PRO A 1 7  ? 1.216   -4.460  9.243   1.00 0.00 ? 1051 PRO B HB3  3  
ATOM 3179  H HG2  . PRO A 1 7  ? 1.498   -7.119  7.945   1.00 0.00 ? 1051 PRO B HG2  3  
ATOM 3180  H HG3  . PRO A 1 7  ? 1.495   -5.502  7.220   1.00 0.00 ? 1051 PRO B HG3  3  
ATOM 3181  H HD2  . PRO A 1 7  ? 3.784   -6.925  7.682   1.00 0.00 ? 1051 PRO B HD2  3  
ATOM 3182  H HD3  . PRO A 1 7  ? 3.730   -5.151  7.671   1.00 0.00 ? 1051 PRO B HD3  3  
ATOM 3183  N N    . LYS A 1 8  ? 1.699   -7.029  12.370  1.00 0.00 ? 1052 LYS B N    3  
ATOM 3184  C CA   . LYS A 1 8  ? 1.328   -8.181  13.192  1.00 0.00 ? 1052 LYS B CA   3  
ATOM 3185  C C    . LYS A 1 8  ? -0.080  -8.661  12.854  1.00 0.00 ? 1052 LYS B C    3  
ATOM 3186  O O    . LYS A 1 8  ? -0.400  -9.839  13.014  1.00 0.00 ? 1052 LYS B O    3  
ATOM 3187  C CB   . LYS A 1 8  ? 1.396   -7.809  14.674  1.00 0.00 ? 1052 LYS B CB   3  
ATOM 3188  C CG   . LYS A 1 8  ? 0.304   -6.788  14.995  1.00 0.00 ? 1052 LYS B CG   3  
ATOM 3189  C CD   . LYS A 1 8  ? 0.428   -6.361  16.458  1.00 0.00 ? 1052 LYS B CD   3  
ATOM 3190  C CE   . LYS A 1 8  ? -0.670  -5.348  16.797  1.00 0.00 ? 1052 LYS B CE   3  
ATOM 3191  N NZ   . LYS A 1 8  ? -0.541  -4.924  18.223  1.00 0.00 ? 1052 LYS B NZ   3  
ATOM 3192  H H    . LYS A 1 8  ? 1.701   -6.134  12.761  1.00 0.00 ? 1052 LYS B H    3  
ATOM 3193  H HA   . LYS A 1 8  ? 2.025   -8.982  13.004  1.00 0.00 ? 1052 LYS B HA   3  
ATOM 3194  H HB2  . LYS A 1 8  ? 1.245   -8.696  15.271  1.00 0.00 ? 1052 LYS B HB2  3  
ATOM 3195  H HB3  . LYS A 1 8  ? 2.363   -7.383  14.896  1.00 0.00 ? 1052 LYS B HB3  3  
ATOM 3196  H HG2  . LYS A 1 8  ? 0.418   -5.927  14.351  1.00 0.00 ? 1052 LYS B HG2  3  
ATOM 3197  H HG3  . LYS A 1 8  ? -0.666  -7.232  14.832  1.00 0.00 ? 1052 LYS B HG3  3  
ATOM 3198  H HD2  . LYS A 1 8  ? 0.331   -7.228  17.095  1.00 0.00 ? 1052 LYS B HD2  3  
ATOM 3199  H HD3  . LYS A 1 8  ? 1.394   -5.907  16.612  1.00 0.00 ? 1052 LYS B HD3  3  
ATOM 3200  H HE2  . LYS A 1 8  ? -0.575  -4.486  16.155  1.00 0.00 ? 1052 LYS B HE2  3  
ATOM 3201  H HE3  . LYS A 1 8  ? -1.639  -5.804  16.645  1.00 0.00 ? 1052 LYS B HE3  3  
ATOM 3202  H HZ1  . LYS A 1 8  ? 0.139   -5.541  18.709  1.00 0.00 ? 1052 LYS B HZ1  3  
ATOM 3203  H HZ2  . LYS A 1 8  ? -1.469  -4.993  18.690  1.00 0.00 ? 1052 LYS B HZ2  3  
ATOM 3204  H HZ3  . LYS A 1 8  ? -0.204  -3.942  18.262  1.00 0.00 ? 1052 LYS B HZ3  3  
ATOM 3205  N N    . MET A 1 9  ? -0.920  -7.737  12.402  1.00 0.00 ? 1053 MET B N    3  
ATOM 3206  C CA   . MET A 1 9  ? -2.300  -8.071  12.063  1.00 0.00 ? 1053 MET B CA   3  
ATOM 3207  C C    . MET A 1 9  ? -2.354  -8.879  10.773  1.00 0.00 ? 1053 MET B C    3  
ATOM 3208  O O    . MET A 1 9  ? -1.485  -8.750  9.911   1.00 0.00 ? 1053 MET B O    3  
ATOM 3209  C CB   . MET A 1 9  ? -3.121  -6.799  11.888  1.00 0.00 ? 1053 MET B CB   3  
ATOM 3210  C CG   . MET A 1 9  ? -2.763  -5.790  12.981  1.00 0.00 ? 1053 MET B CG   3  
ATOM 3211  S SD   . MET A 1 9  ? -4.069  -4.540  13.094  1.00 0.00 ? 1053 MET B SD   3  
ATOM 3212  C CE   . MET A 1 9  ? -4.058  -4.021  11.358  1.00 0.00 ? 1053 MET B CE   3  
ATOM 3213  H H    . MET A 1 9  ? -0.612  -6.812  12.308  1.00 0.00 ? 1053 MET B H    3  
ATOM 3214  H HA   . MET A 1 9  ? -2.729  -8.655  12.862  1.00 0.00 ? 1053 MET B HA   3  
ATOM 3215  H HB2  . MET A 1 9  ? -2.909  -6.373  10.921  1.00 0.00 ? 1053 MET B HB2  3  
ATOM 3216  H HB3  . MET A 1 9  ? -4.171  -7.038  11.954  1.00 0.00 ? 1053 MET B HB3  3  
ATOM 3217  H HG2  . MET A 1 9  ? -2.670  -6.302  13.928  1.00 0.00 ? 1053 MET B HG2  3  
ATOM 3218  H HG3  . MET A 1 9  ? -1.824  -5.311  12.739  1.00 0.00 ? 1053 MET B HG3  3  
ATOM 3219  H HE1  . MET A 1 9  ? -4.900  -4.472  10.840  1.00 0.00 ? 1053 MET B HE1  3  
ATOM 3220  H HE2  . MET A 1 9  ? -3.140  -4.336  10.891  1.00 0.00 ? 1053 MET B HE2  3  
ATOM 3221  H HE3  . MET A 1 9  ? -4.132  -2.946  11.303  1.00 0.00 ? 1053 MET B HE3  3  
ATOM 3222  N N    . THR A 1 10 ? -3.382  -9.710  10.647  1.00 0.00 ? 1054 THR B N    3  
ATOM 3223  C CA   . THR A 1 10 ? -3.544  -10.537 9.456   1.00 0.00 ? 1054 THR B CA   3  
ATOM 3224  C C    . THR A 1 10 ? -3.938  -9.676  8.261   1.00 0.00 ? 1054 THR B C    3  
ATOM 3225  O O    . THR A 1 10 ? -4.376  -8.538  8.426   1.00 0.00 ? 1054 THR B O    3  
ATOM 3226  C CB   . THR A 1 10 ? -4.610  -11.606 9.704   1.00 0.00 ? 1054 THR B CB   3  
ATOM 3227  O OG1  . THR A 1 10 ? -5.877  -10.985 9.839   1.00 0.00 ? 1054 THR B OG1  3  
ATOM 3228  C CG2  . THR A 1 10 ? -4.277  -12.378 10.981  1.00 0.00 ? 1054 THR B CG2  3  
ATOM 3229  H H    . THR A 1 10 ? -4.045  -9.767  11.368  1.00 0.00 ? 1054 THR B H    3  
ATOM 3230  H HA   . THR A 1 10 ? -2.604  -11.023 9.244   1.00 0.00 ? 1054 THR B HA   3  
ATOM 3231  H HB   . THR A 1 10 ? -4.634  -12.291 8.877   1.00 0.00 ? 1054 THR B HB   3  
ATOM 3232  H HG1  . THR A 1 10 ? -6.317  -11.371 10.600  1.00 0.00 ? 1054 THR B HG1  3  
ATOM 3233  H HG21 . THR A 1 10 ? -4.834  -13.304 10.997  1.00 0.00 ? 1054 THR B HG21 3  
ATOM 3234  H HG22 . THR A 1 10 ? -4.541  -11.784 11.844  1.00 0.00 ? 1054 THR B HG22 3  
ATOM 3235  H HG23 . THR A 1 10 ? -3.220  -12.597 11.004  1.00 0.00 ? 1054 THR B HG23 3  
ATOM 3236  N N    . PRO A 1 11 ? -3.780  -10.186 7.067   1.00 0.00 ? 1055 PRO B N    3  
ATOM 3237  C CA   . PRO A 1 11 ? -4.127  -9.432  5.825   1.00 0.00 ? 1055 PRO B CA   3  
ATOM 3238  C C    . PRO A 1 11 ? -5.553  -8.882  5.879   1.00 0.00 ? 1055 PRO B C    3  
ATOM 3239  O O    . PRO A 1 11 ? -5.808  -7.744  5.478   1.00 0.00 ? 1055 PRO B O    3  
ATOM 3240  C CB   . PRO A 1 11 ? -3.988  -10.488 4.722   1.00 0.00 ? 1055 PRO B CB   3  
ATOM 3241  C CG   . PRO A 1 11 ? -3.029  -11.494 5.263   1.00 0.00 ? 1055 PRO B CG   3  
ATOM 3242  C CD   . PRO A 1 11 ? -3.253  -11.529 6.765   1.00 0.00 ? 1055 PRO B CD   3  
ATOM 3243  H HA   . PRO A 1 11 ? -3.422  -8.635  5.657   1.00 0.00 ? 1055 PRO B HA   3  
ATOM 3244  H HB2  . PRO A 1 11 ? -4.946  -10.949 4.519   1.00 0.00 ? 1055 PRO B HB2  3  
ATOM 3245  H HB3  . PRO A 1 11 ? -3.586  -10.043 3.825   1.00 0.00 ? 1055 PRO B HB3  3  
ATOM 3246  H HG2  . PRO A 1 11 ? -3.235  -12.467 4.834   1.00 0.00 ? 1055 PRO B HG2  3  
ATOM 3247  H HG3  . PRO A 1 11 ? -2.013  -11.200 5.051   1.00 0.00 ? 1055 PRO B HG3  3  
ATOM 3248  H HD2  . PRO A 1 11 ? -3.971  -12.293 7.011   1.00 0.00 ? 1055 PRO B HD2  3  
ATOM 3249  H HD3  . PRO A 1 11 ? -2.323  -11.691 7.284   1.00 0.00 ? 1055 PRO B HD3  3  
ATOM 3250  N N    . GLU A 1 12 ? -6.478  -9.694  6.385   1.00 0.00 ? 1056 GLU B N    3  
ATOM 3251  C CA   . GLU A 1 12 ? -7.868  -9.271  6.492   1.00 0.00 ? 1056 GLU B CA   3  
ATOM 3252  C C    . GLU A 1 12 ? -8.006  -8.151  7.515   1.00 0.00 ? 1056 GLU B C    3  
ATOM 3253  O O    . GLU A 1 12 ? -8.748  -7.191  7.303   1.00 0.00 ? 1056 GLU B O    3  
ATOM 3254  C CB   . GLU A 1 12 ? -8.748  -10.452 6.899   1.00 0.00 ? 1056 GLU B CB   3  
ATOM 3255  C CG   . GLU A 1 12 ? -8.828  -11.450 5.740   1.00 0.00 ? 1056 GLU B CG   3  
ATOM 3256  C CD   . GLU A 1 12 ? -9.570  -12.705 6.186   1.00 0.00 ? 1056 GLU B CD   3  
ATOM 3257  O OE1  . GLU A 1 12 ? -9.785  -12.849 7.379   1.00 0.00 ? 1056 GLU B OE1  3  
ATOM 3258  O OE2  . GLU A 1 12 ? -9.914  -13.501 5.330   1.00 0.00 ? 1056 GLU B OE2  3  
ATOM 3259  H H    . GLU A 1 12 ? -6.220  -10.586 6.696   1.00 0.00 ? 1056 GLU B H    3  
ATOM 3260  H HA   . GLU A 1 12 ? -8.196  -8.907  5.530   1.00 0.00 ? 1056 GLU B HA   3  
ATOM 3261  H HB2  . GLU A 1 12 ? -8.323  -10.938 7.765   1.00 0.00 ? 1056 GLU B HB2  3  
ATOM 3262  H HB3  . GLU A 1 12 ? -9.740  -10.097 7.135   1.00 0.00 ? 1056 GLU B HB3  3  
ATOM 3263  H HG2  . GLU A 1 12 ? -9.354  -10.997 4.912   1.00 0.00 ? 1056 GLU B HG2  3  
ATOM 3264  H HG3  . GLU A 1 12 ? -7.831  -11.718 5.430   1.00 0.00 ? 1056 GLU B HG3  3  
ATOM 3265  N N    . GLN A 1 13 ? -7.285  -8.280  8.625   1.00 0.00 ? 1057 GLN B N    3  
ATOM 3266  C CA   . GLN A 1 13 ? -7.335  -7.268  9.673   1.00 0.00 ? 1057 GLN B CA   3  
ATOM 3267  C C    . GLN A 1 13 ? -6.816  -5.938  9.159   1.00 0.00 ? 1057 GLN B C    3  
ATOM 3268  O O    . GLN A 1 13 ? -7.379  -4.884  9.455   1.00 0.00 ? 1057 GLN B O    3  
ATOM 3269  C CB   . GLN A 1 13 ? -6.501  -7.712  10.876  1.00 0.00 ? 1057 GLN B CB   3  
ATOM 3270  C CG   . GLN A 1 13 ? -7.231  -8.828  11.616  1.00 0.00 ? 1057 GLN B CG   3  
ATOM 3271  C CD   . GLN A 1 13 ? -6.429  -9.247  12.845  1.00 0.00 ? 1057 GLN B CD   3  
ATOM 3272  O OE1  . GLN A 1 13 ? -6.015  -10.402 12.959  1.00 0.00 ? 1057 GLN B OE1  3  
ATOM 3273  N NE2  . GLN A 1 13 ? -6.174  -8.364  13.772  1.00 0.00 ? 1057 GLN B NE2  3  
ATOM 3274  H H    . GLN A 1 13 ? -6.706  -9.065  8.738   1.00 0.00 ? 1057 GLN B H    3  
ATOM 3275  H HA   . GLN A 1 13 ? -8.360  -7.144  9.989   1.00 0.00 ? 1057 GLN B HA   3  
ATOM 3276  H HB2  . GLN A 1 13 ? -5.541  -8.074  10.534  1.00 0.00 ? 1057 GLN B HB2  3  
ATOM 3277  H HB3  . GLN A 1 13 ? -6.354  -6.876  11.544  1.00 0.00 ? 1057 GLN B HB3  3  
ATOM 3278  H HG2  . GLN A 1 13 ? -8.204  -8.475  11.923  1.00 0.00 ? 1057 GLN B HG2  3  
ATOM 3279  H HG3  . GLN A 1 13 ? -7.350  -9.674  10.958  1.00 0.00 ? 1057 GLN B HG3  3  
ATOM 3280  H HE21 . GLN A 1 13 ? -6.496  -7.442  13.673  1.00 0.00 ? 1057 GLN B HE21 3  
ATOM 3281  H HE22 . GLN A 1 13 ? -5.663  -8.621  14.568  1.00 0.00 ? 1057 GLN B HE22 3  
ATOM 3282  N N    . MET A 1 14 ? -5.738  -5.989  8.387   1.00 0.00 ? 1058 MET B N    3  
ATOM 3283  C CA   . MET A 1 14 ? -5.163  -4.773  7.842   1.00 0.00 ? 1058 MET B CA   3  
ATOM 3284  C C    . MET A 1 14 ? -6.149  -4.093  6.906   1.00 0.00 ? 1058 MET B C    3  
ATOM 3285  O O    . MET A 1 14 ? -6.292  -2.873  6.921   1.00 0.00 ? 1058 MET B O    3  
ATOM 3286  C CB   . MET A 1 14 ? -3.872  -5.085  7.083   1.00 0.00 ? 1058 MET B CB   3  
ATOM 3287  C CG   . MET A 1 14 ? -2.785  -5.494  8.076   1.00 0.00 ? 1058 MET B CG   3  
ATOM 3288  S SD   . MET A 1 14 ? -1.174  -5.486  7.250   1.00 0.00 ? 1058 MET B SD   3  
ATOM 3289  C CE   . MET A 1 14 ? -1.407  -6.947  6.213   1.00 0.00 ? 1058 MET B CE   3  
ATOM 3290  H H    . MET A 1 14 ? -5.329  -6.856  8.181   1.00 0.00 ? 1058 MET B H    3  
ATOM 3291  H HA   . MET A 1 14 ? -4.934  -4.101  8.655   1.00 0.00 ? 1058 MET B HA   3  
ATOM 3292  H HB2  . MET A 1 14 ? -4.050  -5.896  6.392   1.00 0.00 ? 1058 MET B HB2  3  
ATOM 3293  H HB3  . MET A 1 14 ? -3.551  -4.211  6.539   1.00 0.00 ? 1058 MET B HB3  3  
ATOM 3294  H HG2  . MET A 1 14 ? -2.770  -4.797  8.899   1.00 0.00 ? 1058 MET B HG2  3  
ATOM 3295  H HG3  . MET A 1 14 ? -2.993  -6.487  8.446   1.00 0.00 ? 1058 MET B HG3  3  
ATOM 3296  H HE1  . MET A 1 14 ? -2.332  -6.851  5.664   1.00 0.00 ? 1058 MET B HE1  3  
ATOM 3297  H HE2  . MET A 1 14 ? -1.447  -7.827  6.833   1.00 0.00 ? 1058 MET B HE2  3  
ATOM 3298  H HE3  . MET A 1 14 ? -0.577  -7.030  5.521   1.00 0.00 ? 1058 MET B HE3  3  
ATOM 3299  N N    . ALA A 1 15 ? -6.832  -4.888  6.092   1.00 0.00 ? 1059 ALA B N    3  
ATOM 3300  C CA   . ALA A 1 15 ? -7.805  -4.335  5.156   1.00 0.00 ? 1059 ALA B CA   3  
ATOM 3301  C C    . ALA A 1 15 ? -8.944  -3.650  5.899   1.00 0.00 ? 1059 ALA B C    3  
ATOM 3302  O O    . ALA A 1 15 ? -9.405  -2.579  5.500   1.00 0.00 ? 1059 ALA B O    3  
ATOM 3303  C CB   . ALA A 1 15 ? -8.367  -5.443  4.273   1.00 0.00 ? 1059 ALA B CB   3  
ATOM 3304  H H    . ALA A 1 15 ? -6.684  -5.860  6.123   1.00 0.00 ? 1059 ALA B H    3  
ATOM 3305  H HA   . ALA A 1 15 ? -7.309  -3.610  4.529   1.00 0.00 ? 1059 ALA B HA   3  
ATOM 3306  H HB1  . ALA A 1 15 ? -7.654  -5.677  3.496   1.00 0.00 ? 1059 ALA B HB1  3  
ATOM 3307  H HB2  . ALA A 1 15 ? -9.291  -5.108  3.827   1.00 0.00 ? 1059 ALA B HB2  3  
ATOM 3308  H HB3  . ALA A 1 15 ? -8.550  -6.321  4.873   1.00 0.00 ? 1059 ALA B HB3  3  
ATOM 3309  N N    . LYS A 1 16 ? -9.397  -4.273  6.981   1.00 0.00 ? 1060 LYS B N    3  
ATOM 3310  C CA   . LYS A 1 16 ? -10.484 -3.712  7.770   1.00 0.00 ? 1060 LYS B CA   3  
ATOM 3311  C C    . LYS A 1 16 ? -10.072 -2.377  8.373   1.00 0.00 ? 1060 LYS B C    3  
ATOM 3312  O O    . LYS A 1 16 ? -10.856 -1.427  8.387   1.00 0.00 ? 1060 LYS B O    3  
ATOM 3313  C CB   . LYS A 1 16 ? -10.871 -4.682  8.889   1.00 0.00 ? 1060 LYS B CB   3  
ATOM 3314  C CG   . LYS A 1 16 ? -11.557 -5.911  8.287   1.00 0.00 ? 1060 LYS B CG   3  
ATOM 3315  C CD   . LYS A 1 16 ? -11.916 -6.892  9.404   1.00 0.00 ? 1060 LYS B CD   3  
ATOM 3316  C CE   . LYS A 1 16 ? -12.588 -8.127  8.802   1.00 0.00 ? 1060 LYS B CE   3  
ATOM 3317  N NZ   . LYS A 1 16 ? -13.873 -7.729  8.159   1.00 0.00 ? 1060 LYS B NZ   3  
ATOM 3318  H H    . LYS A 1 16 ? -8.994  -5.124  7.252   1.00 0.00 ? 1060 LYS B H    3  
ATOM 3319  H HA   . LYS A 1 16 ? -11.338 -3.560  7.132   1.00 0.00 ? 1060 LYS B HA   3  
ATOM 3320  H HB2  . LYS A 1 16 ? -9.982  -4.990  9.420   1.00 0.00 ? 1060 LYS B HB2  3  
ATOM 3321  H HB3  . LYS A 1 16 ? -11.548 -4.192  9.571   1.00 0.00 ? 1060 LYS B HB3  3  
ATOM 3322  H HG2  . LYS A 1 16 ? -12.456 -5.604  7.772   1.00 0.00 ? 1060 LYS B HG2  3  
ATOM 3323  H HG3  . LYS A 1 16 ? -10.889 -6.390  7.589   1.00 0.00 ? 1060 LYS B HG3  3  
ATOM 3324  H HD2  . LYS A 1 16 ? -11.017 -7.189  9.924   1.00 0.00 ? 1060 LYS B HD2  3  
ATOM 3325  H HD3  . LYS A 1 16 ? -12.593 -6.416  10.097  1.00 0.00 ? 1060 LYS B HD3  3  
ATOM 3326  H HE2  . LYS A 1 16 ? -11.937 -8.568  8.063   1.00 0.00 ? 1060 LYS B HE2  3  
ATOM 3327  H HE3  . LYS A 1 16 ? -12.785 -8.846  9.584   1.00 0.00 ? 1060 LYS B HE3  3  
ATOM 3328  H HZ1  . LYS A 1 16 ? -13.678 -7.092  7.362   1.00 0.00 ? 1060 LYS B HZ1  3  
ATOM 3329  H HZ2  . LYS A 1 16 ? -14.471 -7.238  8.855   1.00 0.00 ? 1060 LYS B HZ2  3  
ATOM 3330  H HZ3  . LYS A 1 16 ? -14.366 -8.576  7.812   1.00 0.00 ? 1060 LYS B HZ3  3  
ATOM 3331  N N    . GLU A 1 17 ? -8.841  -2.303  8.867   1.00 0.00 ? 1061 GLU B N    3  
ATOM 3332  C CA   . GLU A 1 17 ? -8.354  -1.068  9.461   1.00 0.00 ? 1061 GLU B CA   3  
ATOM 3333  C C    . GLU A 1 17 ? -8.293  0.040   8.415   1.00 0.00 ? 1061 GLU B C    3  
ATOM 3334  O O    . GLU A 1 17 ? -8.650  1.186   8.693   1.00 0.00 ? 1061 GLU B O    3  
ATOM 3335  C CB   . GLU A 1 17 ? -6.963  -1.296  10.052  1.00 0.00 ? 1061 GLU B CB   3  
ATOM 3336  C CG   . GLU A 1 17 ? -7.063  -2.205  11.283  1.00 0.00 ? 1061 GLU B CG   3  
ATOM 3337  C CD   . GLU A 1 17 ? -7.933  -1.554  12.352  1.00 0.00 ? 1061 GLU B CD   3  
ATOM 3338  O OE1  . GLU A 1 17 ? -7.708  -0.389  12.638  1.00 0.00 ? 1061 GLU B OE1  3  
ATOM 3339  O OE2  . GLU A 1 17 ? -8.810  -2.226  12.866  1.00 0.00 ? 1061 GLU B OE2  3  
ATOM 3340  H H    . GLU A 1 17 ? -8.249  -3.089  8.834   1.00 0.00 ? 1061 GLU B H    3  
ATOM 3341  H HA   . GLU A 1 17 ? -9.027  -0.768  10.247  1.00 0.00 ? 1061 GLU B HA   3  
ATOM 3342  H HB2  . GLU A 1 17 ? -6.333  -1.765  9.310   1.00 0.00 ? 1061 GLU B HB2  3  
ATOM 3343  H HB3  . GLU A 1 17 ? -6.536  -0.349  10.341  1.00 0.00 ? 1061 GLU B HB3  3  
ATOM 3344  H HG2  . GLU A 1 17 ? -7.498  -3.153  10.996  1.00 0.00 ? 1061 GLU B HG2  3  
ATOM 3345  H HG3  . GLU A 1 17 ? -6.078  -2.373  11.684  1.00 0.00 ? 1061 GLU B HG3  3  
ATOM 3346  N N    . MET A 1 18 ? -7.842  -0.303  7.210   1.00 0.00 ? 1062 MET B N    3  
ATOM 3347  C CA   . MET A 1 18 ? -7.743  0.686   6.144   1.00 0.00 ? 1062 MET B CA   3  
ATOM 3348  C C    . MET A 1 18 ? -9.120  1.233   5.790   1.00 0.00 ? 1062 MET B C    3  
ATOM 3349  O O    . MET A 1 18 ? -9.286  2.433   5.576   1.00 0.00 ? 1062 MET B O    3  
ATOM 3350  C CB   . MET A 1 18 ? -7.117  0.045   4.908   1.00 0.00 ? 1062 MET B CB   3  
ATOM 3351  C CG   . MET A 1 18 ? -5.654  -0.280  5.196   1.00 0.00 ? 1062 MET B CG   3  
ATOM 3352  S SD   . MET A 1 18 ? -4.973  -1.235  3.820   1.00 0.00 ? 1062 MET B SD   3  
ATOM 3353  C CE   . MET A 1 18 ? -3.878  -2.296  4.796   1.00 0.00 ? 1062 MET B CE   3  
ATOM 3354  H H    . MET A 1 18 ? -7.566  -1.232  7.037   1.00 0.00 ? 1062 MET B H    3  
ATOM 3355  H HA   . MET A 1 18 ? -7.113  1.497   6.473   1.00 0.00 ? 1062 MET B HA   3  
ATOM 3356  H HB2  . MET A 1 18 ? -7.648  -0.866  4.669   1.00 0.00 ? 1062 MET B HB2  3  
ATOM 3357  H HB3  . MET A 1 18 ? -7.177  0.729   4.075   1.00 0.00 ? 1062 MET B HB3  3  
ATOM 3358  H HG2  . MET A 1 18 ? -5.099  0.641   5.308   1.00 0.00 ? 1062 MET B HG2  3  
ATOM 3359  H HG3  . MET A 1 18 ? -5.587  -0.852  6.107   1.00 0.00 ? 1062 MET B HG3  3  
ATOM 3360  H HE1  . MET A 1 18 ? -2.873  -2.235  4.402   1.00 0.00 ? 1062 MET B HE1  3  
ATOM 3361  H HE2  . MET A 1 18 ? -4.224  -3.316  4.739   1.00 0.00 ? 1062 MET B HE2  3  
ATOM 3362  H HE3  . MET A 1 18 ? -3.888  -1.975  5.828   1.00 0.00 ? 1062 MET B HE3  3  
ATOM 3363  N N    . SER A 1 19 ? -10.109 0.346   5.728   1.00 0.00 ? 1063 SER B N    3  
ATOM 3364  C CA   . SER A 1 19 ? -11.468 0.758   5.398   1.00 0.00 ? 1063 SER B CA   3  
ATOM 3365  C C    . SER A 1 19 ? -12.019 1.695   6.466   1.00 0.00 ? 1063 SER B C    3  
ATOM 3366  O O    . SER A 1 19 ? -12.689 2.679   6.155   1.00 0.00 ? 1063 SER B O    3  
ATOM 3367  C CB   . SER A 1 19 ? -12.372 -0.466  5.275   1.00 0.00 ? 1063 SER B CB   3  
ATOM 3368  O OG   . SER A 1 19 ? -11.952 -1.247  4.165   1.00 0.00 ? 1063 SER B OG   3  
ATOM 3369  H H    . SER A 1 19 ? -9.921  -0.600  5.908   1.00 0.00 ? 1063 SER B H    3  
ATOM 3370  H HA   . SER A 1 19 ? -11.455 1.277   4.452   1.00 0.00 ? 1063 SER B HA   3  
ATOM 3371  H HB2  . SER A 1 19 ? -12.304 -1.059  6.173   1.00 0.00 ? 1063 SER B HB2  3  
ATOM 3372  H HB3  . SER A 1 19 ? -13.395 -0.144  5.136   1.00 0.00 ? 1063 SER B HB3  3  
ATOM 3373  H HG   . SER A 1 19 ? -11.511 -2.030  4.503   1.00 0.00 ? 1063 SER B HG   3  
ATOM 3374  N N    . GLU A 1 20 ? -11.737 1.381   7.724   1.00 0.00 ? 1064 GLU B N    3  
ATOM 3375  C CA   . GLU A 1 20 ? -12.213 2.205   8.827   1.00 0.00 ? 1064 GLU B CA   3  
ATOM 3376  C C    . GLU A 1 20 ? -11.637 3.612   8.747   1.00 0.00 ? 1064 GLU B C    3  
ATOM 3377  O O    . GLU A 1 20 ? -12.347 4.591   8.977   1.00 0.00 ? 1064 GLU B O    3  
ATOM 3378  C CB   . GLU A 1 20 ? -11.803 1.573   10.154  1.00 0.00 ? 1064 GLU B CB   3  
ATOM 3379  C CG   . GLU A 1 20 ? -12.626 0.304   10.400  1.00 0.00 ? 1064 GLU B CG   3  
ATOM 3380  C CD   . GLU A 1 20 ? -12.087 -0.444  11.615  1.00 0.00 ? 1064 GLU B CD   3  
ATOM 3381  O OE1  . GLU A 1 20 ? -10.978 -0.146  12.027  1.00 0.00 ? 1064 GLU B OE1  3  
ATOM 3382  O OE2  . GLU A 1 20 ? -12.793 -1.304  12.118  1.00 0.00 ? 1064 GLU B OE2  3  
ATOM 3383  H H    . GLU A 1 20 ? -11.199 0.584   7.914   1.00 0.00 ? 1064 GLU B H    3  
ATOM 3384  H HA   . GLU A 1 20 ? -13.291 2.261   8.785   1.00 0.00 ? 1064 GLU B HA   3  
ATOM 3385  H HB2  . GLU A 1 20 ? -10.754 1.320   10.115  1.00 0.00 ? 1064 GLU B HB2  3  
ATOM 3386  H HB3  . GLU A 1 20 ? -11.978 2.275   10.954  1.00 0.00 ? 1064 GLU B HB3  3  
ATOM 3387  H HG2  . GLU A 1 20 ? -13.657 0.576   10.576  1.00 0.00 ? 1064 GLU B HG2  3  
ATOM 3388  H HG3  . GLU A 1 20 ? -12.568 -0.334  9.531   1.00 0.00 ? 1064 GLU B HG3  3  
ATOM 3389  N N    . PHE A 1 21 ? -10.351 3.708   8.417   1.00 0.00 ? 1065 PHE B N    3  
ATOM 3390  C CA   . PHE A 1 21 ? -9.694  5.005   8.314   1.00 0.00 ? 1065 PHE B CA   3  
ATOM 3391  C C    . PHE A 1 21 ? -10.260 5.797   7.141   1.00 0.00 ? 1065 PHE B C    3  
ATOM 3392  O O    . PHE A 1 21 ? -10.459 7.009   7.229   1.00 0.00 ? 1065 PHE B O    3  
ATOM 3393  C CB   . PHE A 1 21 ? -8.185  4.816   8.124   1.00 0.00 ? 1065 PHE B CB   3  
ATOM 3394  C CG   . PHE A 1 21 ? -7.543  4.487   9.451   1.00 0.00 ? 1065 PHE B CG   3  
ATOM 3395  C CD1  . PHE A 1 21 ? -6.951  3.235   9.655   1.00 0.00 ? 1065 PHE B CD1  3  
ATOM 3396  C CD2  . PHE A 1 21 ? -7.539  5.438   10.478  1.00 0.00 ? 1065 PHE B CD2  3  
ATOM 3397  C CE1  . PHE A 1 21 ? -6.355  2.933   10.887  1.00 0.00 ? 1065 PHE B CE1  3  
ATOM 3398  C CE2  . PHE A 1 21 ? -6.944  5.137   11.709  1.00 0.00 ? 1065 PHE B CE2  3  
ATOM 3399  C CZ   . PHE A 1 21 ? -6.351  3.884   11.914  1.00 0.00 ? 1065 PHE B CZ   3  
ATOM 3400  H H    . PHE A 1 21 ? -9.835  2.892   8.235   1.00 0.00 ? 1065 PHE B H    3  
ATOM 3401  H HA   . PHE A 1 21 ? -9.862  5.558   9.225   1.00 0.00 ? 1065 PHE B HA   3  
ATOM 3402  H HB2  . PHE A 1 21 ? -8.013  4.004   7.431   1.00 0.00 ? 1065 PHE B HB2  3  
ATOM 3403  H HB3  . PHE A 1 21 ? -7.754  5.723   7.730   1.00 0.00 ? 1065 PHE B HB3  3  
ATOM 3404  H HD1  . PHE A 1 21 ? -6.952  2.501   8.864   1.00 0.00 ? 1065 PHE B HD1  3  
ATOM 3405  H HD2  . PHE A 1 21 ? -7.997  6.404   10.321  1.00 0.00 ? 1065 PHE B HD2  3  
ATOM 3406  H HE1  . PHE A 1 21 ? -5.899  1.966   11.045  1.00 0.00 ? 1065 PHE B HE1  3  
ATOM 3407  H HE2  . PHE A 1 21 ? -6.939  5.869   12.502  1.00 0.00 ? 1065 PHE B HE2  3  
ATOM 3408  H HZ   . PHE A 1 21 ? -5.892  3.652   12.863  1.00 0.00 ? 1065 PHE B HZ   3  
ATOM 3409  N N    . LEU A 1 22 ? -10.517 5.105   6.045   1.00 0.00 ? 1066 LEU B N    3  
ATOM 3410  C CA   . LEU A 1 22 ? -11.059 5.756   4.861   1.00 0.00 ? 1066 LEU B CA   3  
ATOM 3411  C C    . LEU A 1 22 ? -12.494 6.214   5.106   1.00 0.00 ? 1066 LEU B C    3  
ATOM 3412  O O    . LEU A 1 22 ? -12.899 7.286   4.659   1.00 0.00 ? 1066 LEU B O    3  
ATOM 3413  C CB   . LEU A 1 22 ? -11.017 4.794   3.675   1.00 0.00 ? 1066 LEU B CB   3  
ATOM 3414  C CG   . LEU A 1 22 ? -9.560  4.529   3.285   1.00 0.00 ? 1066 LEU B CG   3  
ATOM 3415  C CD1  . LEU A 1 22 ? -9.509  3.403   2.253   1.00 0.00 ? 1066 LEU B CD1  3  
ATOM 3416  C CD2  . LEU A 1 22 ? -8.942  5.796   2.684   1.00 0.00 ? 1066 LEU B CD2  3  
ATOM 3417  H H    . LEU A 1 22 ? -10.338 4.139   6.033   1.00 0.00 ? 1066 LEU B H    3  
ATOM 3418  H HA   . LEU A 1 22 ? -10.456 6.620   4.632   1.00 0.00 ? 1066 LEU B HA   3  
ATOM 3419  H HB2  . LEU A 1 22 ? -11.492 3.863   3.952   1.00 0.00 ? 1066 LEU B HB2  3  
ATOM 3420  H HB3  . LEU A 1 22 ? -11.540 5.232   2.839   1.00 0.00 ? 1066 LEU B HB3  3  
ATOM 3421  H HG   . LEU A 1 22 ? -9.002  4.236   4.161   1.00 0.00 ? 1066 LEU B HG   3  
ATOM 3422  H HD11 . LEU A 1 22 ? -9.829  2.480   2.715   1.00 0.00 ? 1066 LEU B HD11 3  
ATOM 3423  H HD12 . LEU A 1 22 ? -8.498  3.293   1.892   1.00 0.00 ? 1066 LEU B HD12 3  
ATOM 3424  H HD13 . LEU A 1 22 ? -10.164 3.639   1.428   1.00 0.00 ? 1066 LEU B HD13 3  
ATOM 3425  H HD21 . LEU A 1 22 ? -9.676  6.301   2.072   1.00 0.00 ? 1066 LEU B HD21 3  
ATOM 3426  H HD22 . LEU A 1 22 ? -8.089  5.531   2.079   1.00 0.00 ? 1066 LEU B HD22 3  
ATOM 3427  H HD23 . LEU A 1 22 ? -8.627  6.452   3.482   1.00 0.00 ? 1066 LEU B HD23 3  
ATOM 3428  N N    . SER A 1 23 ? -13.262 5.389   5.814   1.00 0.00 ? 1067 SER B N    3  
ATOM 3429  C CA   . SER A 1 23 ? -14.653 5.719   6.104   1.00 0.00 ? 1067 SER B CA   3  
ATOM 3430  C C    . SER A 1 23 ? -14.749 6.978   6.958   1.00 0.00 ? 1067 SER B C    3  
ATOM 3431  O O    . SER A 1 23 ? -15.563 7.861   6.689   1.00 0.00 ? 1067 SER B O    3  
ATOM 3432  C CB   . SER A 1 23 ? -15.316 4.555   6.840   1.00 0.00 ? 1067 SER B CB   3  
ATOM 3433  O OG   . SER A 1 23 ? -15.363 3.423   5.984   1.00 0.00 ? 1067 SER B OG   3  
ATOM 3434  H H    . SER A 1 23 ? -12.889 4.547   6.142   1.00 0.00 ? 1067 SER B H    3  
ATOM 3435  H HA   . SER A 1 23 ? -15.177 5.883   5.174   1.00 0.00 ? 1067 SER B HA   3  
ATOM 3436  H HB2  . SER A 1 23 ? -14.742 4.311   7.719   1.00 0.00 ? 1067 SER B HB2  3  
ATOM 3437  H HB3  . SER A 1 23 ? -16.316 4.840   7.134   1.00 0.00 ? 1067 SER B HB3  3  
ATOM 3438  H HG   . SER A 1 23 ? -15.936 3.633   5.243   1.00 0.00 ? 1067 SER B HG   3  
ATOM 3439  N N    . ARG A 1 24 ? -13.912 7.058   7.988   1.00 0.00 ? 1068 ARG B N    3  
ATOM 3440  C CA   . ARG A 1 24 ? -13.914 8.217   8.870   1.00 0.00 ? 1068 ARG B CA   3  
ATOM 3441  C C    . ARG A 1 24 ? -13.306 9.422   8.169   1.00 0.00 ? 1068 ARG B C    3  
ATOM 3442  O O    . ARG A 1 24 ? -13.636 10.566  8.478   1.00 0.00 ? 1068 ARG B O    3  
ATOM 3443  C CB   . ARG A 1 24 ? -13.126 7.907   10.143  1.00 0.00 ? 1068 ARG B CB   3  
ATOM 3444  C CG   . ARG A 1 24 ? -11.670 7.621   9.779   1.00 0.00 ? 1068 ARG B CG   3  
ATOM 3445  C CD   . ARG A 1 24 ? -10.867 7.353   11.048  1.00 0.00 ? 1068 ARG B CD   3  
ATOM 3446  N NE   . ARG A 1 24 ? -10.758 8.566   11.848  1.00 0.00 ? 1068 ARG B NE   3  
ATOM 3447  C CZ   . ARG A 1 24 ? -10.180 8.556   13.050  1.00 0.00 ? 1068 ARG B CZ   3  
ATOM 3448  N NH1  . ARG A 1 24 ? -9.692  7.447   13.549  1.00 0.00 ? 1068 ARG B NH1  3  
ATOM 3449  N NH2  . ARG A 1 24 ? -10.100 9.661   13.736  1.00 0.00 ? 1068 ARG B NH2  3  
ATOM 3450  H H    . ARG A 1 24 ? -13.279 6.325   8.157   1.00 0.00 ? 1068 ARG B H    3  
ATOM 3451  H HA   . ARG A 1 24 ? -14.933 8.449   9.141   1.00 0.00 ? 1068 ARG B HA   3  
ATOM 3452  H HB2  . ARG A 1 24 ? -13.172 8.754   10.813  1.00 0.00 ? 1068 ARG B HB2  3  
ATOM 3453  H HB3  . ARG A 1 24 ? -13.549 7.041   10.626  1.00 0.00 ? 1068 ARG B HB3  3  
ATOM 3454  H HG2  . ARG A 1 24 ? -11.627 6.752   9.143   1.00 0.00 ? 1068 ARG B HG2  3  
ATOM 3455  H HG3  . ARG A 1 24 ? -11.248 8.468   9.260   1.00 0.00 ? 1068 ARG B HG3  3  
ATOM 3456  H HD2  . ARG A 1 24 ? -11.362 6.591   11.629  1.00 0.00 ? 1068 ARG B HD2  3  
ATOM 3457  H HD3  . ARG A 1 24 ? -9.879  7.012   10.778  1.00 0.00 ? 1068 ARG B HD3  3  
ATOM 3458  H HE   . ARG A 1 24 ? -11.117 9.409   11.495  1.00 0.00 ? 1068 ARG B HE   3  
ATOM 3459  H HH11 . ARG A 1 24 ? -9.746  6.592   13.035  1.00 0.00 ? 1068 ARG B HH11 3  
ATOM 3460  H HH12 . ARG A 1 24 ? -9.261  7.455   14.452  1.00 0.00 ? 1068 ARG B HH12 3  
ATOM 3461  H HH21 . ARG A 1 24 ? -10.469 10.512  13.362  1.00 0.00 ? 1068 ARG B HH21 3  
ATOM 3462  H HH22 . ARG A 1 24 ? -9.667  9.658   14.639  1.00 0.00 ? 1068 ARG B HH22 3  
ATOM 3463  N N    . GLY A 1 25 ? -12.406 9.159   7.226   1.00 0.00 ? 1069 GLY B N    3  
ATOM 3464  C CA   . GLY A 1 25 ? -11.754 10.235  6.499   1.00 0.00 ? 1069 GLY B CA   3  
ATOM 3465  C C    . GLY A 1 25 ? -12.530 10.596  5.231   1.00 0.00 ? 1069 GLY B C    3  
ATOM 3466  O O    . GLY A 1 25 ? -13.281 9.777   4.698   1.00 0.00 ? 1069 GLY B O    3  
ATOM 3467  H H    . GLY A 1 25 ? -12.173 8.228   7.024   1.00 0.00 ? 1069 GLY B H    3  
ATOM 3468  H HA2  . GLY A 1 25 ? -11.696 11.096  7.147   1.00 0.00 ? 1069 GLY B HA2  3  
ATOM 3469  H HA3  . GLY A 1 25 ? -10.757 9.924   6.230   1.00 0.00 ? 1069 GLY B HA3  3  
ATOM 3470  N N    . PRO A 1 26 ? -12.359 11.797  4.736   1.00 0.00 ? 1070 PRO B N    3  
ATOM 3471  C CA   . PRO A 1 26 ? -13.053 12.272  3.502   1.00 0.00 ? 1070 PRO B CA   3  
ATOM 3472  C C    . PRO A 1 26 ? -12.481 11.637  2.238   1.00 0.00 ? 1070 PRO B C    3  
ATOM 3473  O O    . PRO A 1 26 ? -11.307 11.268  2.193   1.00 0.00 ? 1070 PRO B O    3  
ATOM 3474  C CB   . PRO A 1 26 ? -12.819 13.782  3.518   1.00 0.00 ? 1070 PRO B CB   3  
ATOM 3475  C CG   . PRO A 1 26 ? -11.557 13.976  4.289   1.00 0.00 ? 1070 PRO B CG   3  
ATOM 3476  C CD   . PRO A 1 26 ? -11.485 12.837  5.303   1.00 0.00 ? 1070 PRO B CD   3  
ATOM 3477  H HA   . PRO A 1 26 ? -14.109 12.072  3.569   1.00 0.00 ? 1070 PRO B HA   3  
ATOM 3478  H HB2  . PRO A 1 26 ? -12.705 14.153  2.510   1.00 0.00 ? 1070 PRO B HB2  3  
ATOM 3479  H HB3  . PRO A 1 26 ? -13.634 14.283  4.016   1.00 0.00 ? 1070 PRO B HB3  3  
ATOM 3480  H HG2  . PRO A 1 26 ? -10.705 13.937  3.623   1.00 0.00 ? 1070 PRO B HG2  3  
ATOM 3481  H HG3  . PRO A 1 26 ? -11.581 14.921  4.808   1.00 0.00 ? 1070 PRO B HG3  3  
ATOM 3482  H HD2  . PRO A 1 26 ? -10.470 12.476  5.390   1.00 0.00 ? 1070 PRO B HD2  3  
ATOM 3483  H HD3  . PRO A 1 26 ? -11.858 13.159  6.262   1.00 0.00 ? 1070 PRO B HD3  3  
ATOM 3484  N N    . ALA A 1 27 ? -13.316 11.514  1.212   1.00 0.00 ? 1071 ALA B N    3  
ATOM 3485  C CA   . ALA A 1 27 ? -12.878 10.927  -0.048  1.00 0.00 ? 1071 ALA B CA   3  
ATOM 3486  C C    . ALA A 1 27 ? -12.541 12.024  -1.055  1.00 0.00 ? 1071 ALA B C    3  
ATOM 3487  O O    . ALA A 1 27 ? -13.434 12.604  -1.673  1.00 0.00 ? 1071 ALA B O    3  
ATOM 3488  C CB   . ALA A 1 27 ? -13.981 10.030  -0.616  1.00 0.00 ? 1071 ALA B CB   3  
ATOM 3489  H H    . ALA A 1 27 ? -14.241 11.826  1.302   1.00 0.00 ? 1071 ALA B H    3  
ATOM 3490  H HA   . ALA A 1 27 ? -11.997 10.329  0.129   1.00 0.00 ? 1071 ALA B HA   3  
ATOM 3491  H HB1  . ALA A 1 27 ? -13.878 9.034   -0.214  1.00 0.00 ? 1071 ALA B HB1  3  
ATOM 3492  H HB2  . ALA A 1 27 ? -13.896 9.994   -1.692  1.00 0.00 ? 1071 ALA B HB2  3  
ATOM 3493  H HB3  . ALA A 1 27 ? -14.945 10.431  -0.344  1.00 0.00 ? 1071 ALA B HB3  3  
ATOM 3494  N N    . VAL A 1 28 ? -11.250 12.302  -1.219  1.00 0.00 ? 1072 VAL B N    3  
ATOM 3495  C CA   . VAL A 1 28 ? -10.814 13.326  -2.154  1.00 0.00 ? 1072 VAL B CA   3  
ATOM 3496  C C    . VAL A 1 28 ? -9.362  13.089  -2.551  1.00 0.00 ? 1072 VAL B C    3  
ATOM 3497  O O    . VAL A 1 28 ? -8.508  12.847  -1.699  1.00 0.00 ? 1072 VAL B O    3  
ATOM 3498  C CB   . VAL A 1 28 ? -10.954 14.708  -1.513  1.00 0.00 ? 1072 VAL B CB   3  
ATOM 3499  C CG1  . VAL A 1 28 ? -10.028 14.808  -0.298  1.00 0.00 ? 1072 VAL B CG1  3  
ATOM 3500  C CG2  . VAL A 1 28 ? -10.571 15.782  -2.533  1.00 0.00 ? 1072 VAL B CG2  3  
ATOM 3501  H H    . VAL A 1 28 ? -10.578 11.809  -0.708  1.00 0.00 ? 1072 VAL B H    3  
ATOM 3502  H HA   . VAL A 1 28 ? -11.434 13.285  -3.037  1.00 0.00 ? 1072 VAL B HA   3  
ATOM 3503  H HB   . VAL A 1 28 ? -11.976 14.857  -1.198  1.00 0.00 ? 1072 VAL B HB   3  
ATOM 3504  H HG11 . VAL A 1 28 ? -9.013  14.968  -0.630  1.00 0.00 ? 1072 VAL B HG11 3  
ATOM 3505  H HG12 . VAL A 1 28 ? -10.081 13.892  0.272   1.00 0.00 ? 1072 VAL B HG12 3  
ATOM 3506  H HG13 . VAL A 1 28 ? -10.338 15.636  0.323   1.00 0.00 ? 1072 VAL B HG13 3  
ATOM 3507  H HG21 . VAL A 1 28 ? -11.246 16.620  -2.444  1.00 0.00 ? 1072 VAL B HG21 3  
ATOM 3508  H HG22 . VAL A 1 28 ? -10.636 15.372  -3.530  1.00 0.00 ? 1072 VAL B HG22 3  
ATOM 3509  H HG23 . VAL A 1 28 ? -9.560  16.114  -2.346  1.00 0.00 ? 1072 VAL B HG23 3  
ATOM 3510  N N    . LEU A 1 29 ? -9.088  13.165  -3.844  1.00 0.00 ? 1073 LEU B N    3  
ATOM 3511  C CA   . LEU A 1 29 ? -7.735  12.964  -4.342  1.00 0.00 ? 1073 LEU B CA   3  
ATOM 3512  C C    . LEU A 1 29 ? -6.795  14.037  -3.800  1.00 0.00 ? 1073 LEU B C    3  
ATOM 3513  O O    . LEU A 1 29 ? -5.646  13.755  -3.458  1.00 0.00 ? 1073 LEU B O    3  
ATOM 3514  C CB   . LEU A 1 29 ? -7.738  13.010  -5.866  1.00 0.00 ? 1073 LEU B CB   3  
ATOM 3515  C CG   . LEU A 1 29 ? -8.412  11.757  -6.426  1.00 0.00 ? 1073 LEU B CG   3  
ATOM 3516  C CD1  . LEU A 1 29 ? -8.652  11.932  -7.929  1.00 0.00 ? 1073 LEU B CD1  3  
ATOM 3517  C CD2  . LEU A 1 29 ? -7.499  10.549  -6.202  1.00 0.00 ? 1073 LEU B CD2  3  
ATOM 3518  H H    . LEU A 1 29 ? -9.809  13.367  -4.477  1.00 0.00 ? 1073 LEU B H    3  
ATOM 3519  H HA   . LEU A 1 29 ? -7.383  11.995  -4.021  1.00 0.00 ? 1073 LEU B HA   3  
ATOM 3520  H HB2  . LEU A 1 29 ? -8.283  13.884  -6.188  1.00 0.00 ? 1073 LEU B HB2  3  
ATOM 3521  H HB3  . LEU A 1 29 ? -6.724  13.064  -6.223  1.00 0.00 ? 1073 LEU B HB3  3  
ATOM 3522  H HG   . LEU A 1 29 ? -9.355  11.596  -5.925  1.00 0.00 ? 1073 LEU B HG   3  
ATOM 3523  H HD11 . LEU A 1 29 ? -7.916  12.612  -8.335  1.00 0.00 ? 1073 LEU B HD11 3  
ATOM 3524  H HD12 . LEU A 1 29 ? -9.641  12.333  -8.092  1.00 0.00 ? 1073 LEU B HD12 3  
ATOM 3525  H HD13 . LEU A 1 29 ? -8.566  10.975  -8.421  1.00 0.00 ? 1073 LEU B HD13 3  
ATOM 3526  H HD21 . LEU A 1 29 ? -7.778  9.756   -6.878  1.00 0.00 ? 1073 LEU B HD21 3  
ATOM 3527  H HD22 . LEU A 1 29 ? -7.596  10.208  -5.183  1.00 0.00 ? 1073 LEU B HD22 3  
ATOM 3528  H HD23 . LEU A 1 29 ? -6.473  10.836  -6.389  1.00 0.00 ? 1073 LEU B HD23 3  
ATOM 3529  N N    . ALA A 1 30 ? -7.290  15.268  -3.729  1.00 0.00 ? 1074 ALA B N    3  
ATOM 3530  C CA   . ALA A 1 30 ? -6.485  16.378  -3.234  1.00 0.00 ? 1074 ALA B CA   3  
ATOM 3531  C C    . ALA A 1 30 ? -5.302  16.640  -4.162  1.00 0.00 ? 1074 ALA B C    3  
ATOM 3532  O O    . ALA A 1 30 ? -4.302  17.233  -3.756  1.00 0.00 ? 1074 ALA B O    3  
ATOM 3533  C CB   . ALA A 1 30 ? -5.970  16.057  -1.830  1.00 0.00 ? 1074 ALA B CB   3  
ATOM 3534  H H    . ALA A 1 30 ? -8.211  15.434  -4.019  1.00 0.00 ? 1074 ALA B H    3  
ATOM 3535  H HA   . ALA A 1 30 ? -7.098  17.264  -3.187  1.00 0.00 ? 1074 ALA B HA   3  
ATOM 3536  H HB1  . ALA A 1 30 ? -6.599  15.303  -1.381  1.00 0.00 ? 1074 ALA B HB1  3  
ATOM 3537  H HB2  . ALA A 1 30 ? -5.993  16.951  -1.224  1.00 0.00 ? 1074 ALA B HB2  3  
ATOM 3538  H HB3  . ALA A 1 30 ? -4.955  15.690  -1.891  1.00 0.00 ? 1074 ALA B HB3  3  
ATOM 3539  N N    . THR A 1 31 ? -5.426  16.200  -5.411  1.00 0.00 ? 1075 THR B N    3  
ATOM 3540  C CA   . THR A 1 31 ? -4.365  16.396  -6.388  1.00 0.00 ? 1075 THR B CA   3  
ATOM 3541  C C    . THR A 1 31 ? -4.952  16.798  -7.736  1.00 0.00 ? 1075 THR B C    3  
ATOM 3542  O O    . THR A 1 31 ? -5.866  16.150  -8.244  1.00 0.00 ? 1075 THR B O    3  
ATOM 3543  C CB   . THR A 1 31 ? -3.552  15.111  -6.548  1.00 0.00 ? 1075 THR B CB   3  
ATOM 3544  O OG1  . THR A 1 31 ? -4.171  14.065  -5.811  1.00 0.00 ? 1075 THR B OG1  3  
ATOM 3545  C CG2  . THR A 1 31 ? -2.131  15.332  -6.027  1.00 0.00 ? 1075 THR B CG2  3  
ATOM 3546  H H    . THR A 1 31 ? -6.245  15.737  -5.682  1.00 0.00 ? 1075 THR B H    3  
ATOM 3547  H HA   . THR A 1 31 ? -3.710  17.183  -6.042  1.00 0.00 ? 1075 THR B HA   3  
ATOM 3548  H HB   . THR A 1 31 ? -3.508  14.840  -7.591  1.00 0.00 ? 1075 THR B HB   3  
ATOM 3549  H HG1  . THR A 1 31 ? -4.649  13.509  -6.431  1.00 0.00 ? 1075 THR B HG1  3  
ATOM 3550  H HG21 . THR A 1 31 ? -2.166  15.554  -4.969  1.00 0.00 ? 1075 THR B HG21 3  
ATOM 3551  H HG22 . THR A 1 31 ? -1.679  16.159  -6.553  1.00 0.00 ? 1075 THR B HG22 3  
ATOM 3552  H HG23 . THR A 1 31 ? -1.545  14.439  -6.188  1.00 0.00 ? 1075 THR B HG23 3  
ATOM 3553  N N    . LYS A 1 32 ? -4.416  17.865  -8.311  1.00 0.00 ? 1076 LYS B N    3  
ATOM 3554  C CA   . LYS A 1 32 ? -4.886  18.343  -9.606  1.00 0.00 ? 1076 LYS B CA   3  
ATOM 3555  C C    . LYS A 1 32 ? -4.054  17.742  -10.737 1.00 0.00 ? 1076 LYS B C    3  
ATOM 3556  O O    . LYS A 1 32 ? -4.279  18.043  -11.909 1.00 0.00 ? 1076 LYS B O    3  
ATOM 3557  C CB   . LYS A 1 32 ? -4.795  19.868  -9.659  1.00 0.00 ? 1076 LYS B CB   3  
ATOM 3558  C CG   . LYS A 1 32 ? -5.622  20.480  -8.522  1.00 0.00 ? 1076 LYS B CG   3  
ATOM 3559  C CD   . LYS A 1 32 ? -7.106  20.173  -8.733  1.00 0.00 ? 1076 LYS B CD   3  
ATOM 3560  C CE   . LYS A 1 32 ? -7.932  20.882  -7.662  1.00 0.00 ? 1076 LYS B CE   3  
ATOM 3561  N NZ   . LYS A 1 32 ? -9.375  20.579  -7.874  1.00 0.00 ? 1076 LYS B NZ   3  
ATOM 3562  H H    . LYS A 1 32 ? -3.686  18.339  -7.860  1.00 0.00 ? 1076 LYS B H    3  
ATOM 3563  H HA   . LYS A 1 32 ? -5.914  18.048  -9.738  1.00 0.00 ? 1076 LYS B HA   3  
ATOM 3564  H HB2  . LYS A 1 32 ? -3.762  20.171  -9.556  1.00 0.00 ? 1076 LYS B HB2  3  
ATOM 3565  H HB3  . LYS A 1 32 ? -5.180  20.219  -10.606 1.00 0.00 ? 1076 LYS B HB3  3  
ATOM 3566  H HG2  . LYS A 1 32 ? -5.299  20.059  -7.580  1.00 0.00 ? 1076 LYS B HG2  3  
ATOM 3567  H HG3  . LYS A 1 32 ? -5.476  21.548  -8.504  1.00 0.00 ? 1076 LYS B HG3  3  
ATOM 3568  H HD2  . LYS A 1 32 ? -7.411  20.513  -9.711  1.00 0.00 ? 1076 LYS B HD2  3  
ATOM 3569  H HD3  . LYS A 1 32 ? -7.270  19.108  -8.656  1.00 0.00 ? 1076 LYS B HD3  3  
ATOM 3570  H HE2  . LYS A 1 32 ? -7.629  20.537  -6.685  1.00 0.00 ? 1076 LYS B HE2  3  
ATOM 3571  H HE3  . LYS A 1 32 ? -7.773  21.949  -7.734  1.00 0.00 ? 1076 LYS B HE3  3  
ATOM 3572  H HZ1  . LYS A 1 32 ? -9.500  20.120  -8.799  1.00 0.00 ? 1076 LYS B HZ1  3  
ATOM 3573  H HZ2  . LYS A 1 32 ? -9.923  21.463  -7.848  1.00 0.00 ? 1076 LYS B HZ2  3  
ATOM 3574  H HZ3  . LYS A 1 32 ? -9.708  19.940  -7.126  1.00 0.00 ? 1076 LYS B HZ3  3  
ATOM 3575  N N    . ALA A 1 33 ? -3.091  16.892  -10.383 1.00 0.00 ? 1077 ALA B N    3  
ATOM 3576  C CA   . ALA A 1 33 ? -2.239  16.266  -11.381 1.00 0.00 ? 1077 ALA B CA   3  
ATOM 3577  C C    . ALA A 1 33 ? -1.579  15.020  -10.801 1.00 0.00 ? 1077 ALA B C    3  
ATOM 3578  O O    . ALA A 1 33 ? -1.378  14.919  -9.591  1.00 0.00 ? 1077 ALA B O    3  
ATOM 3579  C CB   . ALA A 1 33 ? -1.164  17.251  -11.842 1.00 0.00 ? 1077 ALA B CB   3  
ATOM 3580  H H    . ALA A 1 33 ? -2.951  16.679  -9.438  1.00 0.00 ? 1077 ALA B H    3  
ATOM 3581  H HA   . ALA A 1 33 ? -2.842  15.982  -12.232 1.00 0.00 ? 1077 ALA B HA   3  
ATOM 3582  H HB1  . ALA A 1 33 ? -1.339  18.213  -11.381 1.00 0.00 ? 1077 ALA B HB1  3  
ATOM 3583  H HB2  . ALA A 1 33 ? -1.205  17.354  -12.916 1.00 0.00 ? 1077 ALA B HB2  3  
ATOM 3584  H HB3  . ALA A 1 33 ? -0.191  16.884  -11.550 1.00 0.00 ? 1077 ALA B HB3  3  
ATOM 3585  N N    . ALA A 1 34 ? -1.237  14.081  -11.673 1.00 0.00 ? 1078 ALA B N    3  
ATOM 3586  C CA   . ALA A 1 34 ? -0.589  12.845  -11.247 1.00 0.00 ? 1078 ALA B CA   3  
ATOM 3587  C C    . ALA A 1 34 ? 0.778   13.139  -10.631 1.00 0.00 ? 1078 ALA B C    3  
ATOM 3588  O O    . ALA A 1 34 ? 1.326   12.323  -9.890  1.00 0.00 ? 1078 ALA B O    3  
ATOM 3589  C CB   . ALA A 1 34 ? -0.420  11.901  -12.437 1.00 0.00 ? 1078 ALA B CB   3  
ATOM 3590  H H    . ALA A 1 34 ? -1.420  14.222  -12.625 1.00 0.00 ? 1078 ALA B H    3  
ATOM 3591  H HA   . ALA A 1 34 ? -1.209  12.363  -10.505 1.00 0.00 ? 1078 ALA B HA   3  
ATOM 3592  H HB1  . ALA A 1 34 ? 0.445   11.274  -12.278 1.00 0.00 ? 1078 ALA B HB1  3  
ATOM 3593  H HB2  . ALA A 1 34 ? -0.286  12.479  -13.339 1.00 0.00 ? 1078 ALA B HB2  3  
ATOM 3594  H HB3  . ALA A 1 34 ? -1.300  11.284  -12.533 1.00 0.00 ? 1078 ALA B HB3  3  
ATOM 3595  N N    . ALA A 1 35 ? 1.325   14.308  -10.946 1.00 0.00 ? 1079 ALA B N    3  
ATOM 3596  C CA   . ALA A 1 35 ? 2.628   14.697  -10.423 1.00 0.00 ? 1079 ALA B CA   3  
ATOM 3597  C C    . ALA A 1 35 ? 2.608   14.726  -8.897  1.00 0.00 ? 1079 ALA B C    3  
ATOM 3598  O O    . ALA A 1 35 ? 3.584   14.354  -8.245  1.00 0.00 ? 1079 ALA B O    3  
ATOM 3599  C CB   . ALA A 1 35 ? 3.009   16.080  -10.957 1.00 0.00 ? 1079 ALA B CB   3  
ATOM 3600  H H    . ALA A 1 35 ? 0.849   14.921  -11.544 1.00 0.00 ? 1079 ALA B H    3  
ATOM 3601  H HA   . ALA A 1 35 ? 3.365   13.981  -10.751 1.00 0.00 ? 1079 ALA B HA   3  
ATOM 3602  H HB1  . ALA A 1 35 ? 2.482   16.837  -10.396 1.00 0.00 ? 1079 ALA B HB1  3  
ATOM 3603  H HB2  . ALA A 1 35 ? 2.740   16.150  -11.999 1.00 0.00 ? 1079 ALA B HB2  3  
ATOM 3604  H HB3  . ALA A 1 35 ? 4.074   16.227  -10.848 1.00 0.00 ? 1079 ALA B HB3  3  
ATOM 3605  N N    . GLY A 1 36 ? 1.493   15.171  -8.333  1.00 0.00 ? 1080 GLY B N    3  
ATOM 3606  C CA   . GLY A 1 36 ? 1.357   15.245  -6.885  1.00 0.00 ? 1080 GLY B CA   3  
ATOM 3607  C C    . GLY A 1 36 ? 1.439   13.859  -6.258  1.00 0.00 ? 1080 GLY B C    3  
ATOM 3608  O O    . GLY A 1 36 ? 2.046   13.673  -5.204  1.00 0.00 ? 1080 GLY B O    3  
ATOM 3609  H H    . GLY A 1 36 ? 0.746   15.445  -8.898  1.00 0.00 ? 1080 GLY B H    3  
ATOM 3610  H HA2  . GLY A 1 36 ? 2.150   15.863  -6.487  1.00 0.00 ? 1080 GLY B HA2  3  
ATOM 3611  H HA3  . GLY A 1 36 ? 0.404   15.688  -6.640  1.00 0.00 ? 1080 GLY B HA3  3  
ATOM 3612  N N    . THR A 1 37 ? 0.819   12.886  -6.916  1.00 0.00 ? 1081 THR B N    3  
ATOM 3613  C CA   . THR A 1 37 ? 0.821   11.523  -6.422  1.00 0.00 ? 1081 THR B CA   3  
ATOM 3614  C C    . THR A 1 37 ? 2.233   10.963  -6.396  1.00 0.00 ? 1081 THR B C    3  
ATOM 3615  O O    . THR A 1 37 ? 2.625   10.278  -5.453  1.00 0.00 ? 1081 THR B O    3  
ATOM 3616  C CB   . THR A 1 37 ? -0.075  10.656  -7.303  1.00 0.00 ? 1081 THR B CB   3  
ATOM 3617  O OG1  . THR A 1 37 ? -1.414  11.128  -7.234  1.00 0.00 ? 1081 THR B OG1  3  
ATOM 3618  C CG2  . THR A 1 37 ? -0.010  9.222   -6.813  1.00 0.00 ? 1081 THR B CG2  3  
ATOM 3619  H H    . THR A 1 37 ? 0.355   13.089  -7.754  1.00 0.00 ? 1081 THR B H    3  
ATOM 3620  H HA   . THR A 1 37 ? 0.428   11.519  -5.417  1.00 0.00 ? 1081 THR B HA   3  
ATOM 3621  H HB   . THR A 1 37 ? 0.269   10.699  -8.324  1.00 0.00 ? 1081 THR B HB   3  
ATOM 3622  H HG1  . THR A 1 37 ? -1.821  10.995  -8.093  1.00 0.00 ? 1081 THR B HG1  3  
ATOM 3623  H HG21 . THR A 1 37 ? 0.977   8.831   -6.998  1.00 0.00 ? 1081 THR B HG21 3  
ATOM 3624  H HG22 . THR A 1 37 ? -0.740  8.629   -7.341  1.00 0.00 ? 1081 THR B HG22 3  
ATOM 3625  H HG23 . THR A 1 37 ? -0.217  9.196   -5.756  1.00 0.00 ? 1081 THR B HG23 3  
ATOM 3626  N N    . LYS A 1 38 ? 2.992   11.256  -7.441  1.00 0.00 ? 1082 LYS B N    3  
ATOM 3627  C CA   . LYS A 1 38 ? 4.362   10.774  -7.533  1.00 0.00 ? 1082 LYS B CA   3  
ATOM 3628  C C    . LYS A 1 38 ? 5.204   11.306  -6.378  1.00 0.00 ? 1082 LYS B C    3  
ATOM 3629  O O    . LYS A 1 38 ? 6.001   10.575  -5.785  1.00 0.00 ? 1082 LYS B O    3  
ATOM 3630  C CB   . LYS A 1 38 ? 4.968   11.242  -8.849  1.00 0.00 ? 1082 LYS B CB   3  
ATOM 3631  C CG   . LYS A 1 38 ? 4.348   10.457  -10.011 1.00 0.00 ? 1082 LYS B CG   3  
ATOM 3632  C CD   . LYS A 1 38 ? 4.743   11.099  -11.345 1.00 0.00 ? 1082 LYS B CD   3  
ATOM 3633  C CE   . LYS A 1 38 ? 6.260   11.038  -11.517 1.00 0.00 ? 1082 LYS B CE   3  
ATOM 3634  N NZ   . LYS A 1 38 ? 6.636   11.604  -12.846 1.00 0.00 ? 1082 LYS B NZ   3  
ATOM 3635  H H    . LYS A 1 38 ? 2.622   11.807  -8.164  1.00 0.00 ? 1082 LYS B H    3  
ATOM 3636  H HA   . LYS A 1 38 ? 4.363   9.696   -7.507  1.00 0.00 ? 1082 LYS B HA   3  
ATOM 3637  H HB2  . LYS A 1 38 ? 4.770   12.297  -8.972  1.00 0.00 ? 1082 LYS B HB2  3  
ATOM 3638  H HB3  . LYS A 1 38 ? 6.034   11.074  -8.829  1.00 0.00 ? 1082 LYS B HB3  3  
ATOM 3639  H HG2  . LYS A 1 38 ? 4.702   9.435   -9.985  1.00 0.00 ? 1082 LYS B HG2  3  
ATOM 3640  H HG3  . LYS A 1 38 ? 3.272   10.465  -9.915  1.00 0.00 ? 1082 LYS B HG3  3  
ATOM 3641  H HD2  . LYS A 1 38 ? 4.268   10.564  -12.156 1.00 0.00 ? 1082 LYS B HD2  3  
ATOM 3642  H HD3  . LYS A 1 38 ? 4.422   12.129  -11.358 1.00 0.00 ? 1082 LYS B HD3  3  
ATOM 3643  H HE2  . LYS A 1 38 ? 6.732   11.615  -10.736 1.00 0.00 ? 1082 LYS B HE2  3  
ATOM 3644  H HE3  . LYS A 1 38 ? 6.589   10.013  -11.455 1.00 0.00 ? 1082 LYS B HE3  3  
ATOM 3645  H HZ1  . LYS A 1 38 ? 7.056   12.545  -12.716 1.00 0.00 ? 1082 LYS B HZ1  3  
ATOM 3646  H HZ2  . LYS A 1 38 ? 5.786   11.682  -13.442 1.00 0.00 ? 1082 LYS B HZ2  3  
ATOM 3647  H HZ3  . LYS A 1 38 ? 7.327   10.980  -13.307 1.00 0.00 ? 1082 LYS B HZ3  3  
ATOM 3648  N N    . LYS A 1 39 ? 5.011   12.575  -6.056  1.00 0.00 ? 1083 LYS B N    3  
ATOM 3649  C CA   . LYS A 1 39 ? 5.751   13.195  -4.968  1.00 0.00 ? 1083 LYS B CA   3  
ATOM 3650  C C    . LYS A 1 39 ? 5.437   12.495  -3.653  1.00 0.00 ? 1083 LYS B C    3  
ATOM 3651  O O    . LYS A 1 39 ? 6.307   12.345  -2.794  1.00 0.00 ? 1083 LYS B O    3  
ATOM 3652  C CB   . LYS A 1 39 ? 5.390   14.680  -4.867  1.00 0.00 ? 1083 LYS B CB   3  
ATOM 3653  C CG   . LYS A 1 39 ? 5.981   15.432  -6.062  1.00 0.00 ? 1083 LYS B CG   3  
ATOM 3654  C CD   . LYS A 1 39 ? 5.412   16.852  -6.106  1.00 0.00 ? 1083 LYS B CD   3  
ATOM 3655  C CE   . LYS A 1 39 ? 5.906   17.645  -4.894  1.00 0.00 ? 1083 LYS B CE   3  
ATOM 3656  N NZ   . LYS A 1 39 ? 5.392   19.043  -4.973  1.00 0.00 ? 1083 LYS B NZ   3  
ATOM 3657  H H    . LYS A 1 39 ? 4.358   13.106  -6.558  1.00 0.00 ? 1083 LYS B H    3  
ATOM 3658  H HA   . LYS A 1 39 ? 6.808   13.107  -5.168  1.00 0.00 ? 1083 LYS B HA   3  
ATOM 3659  H HB2  . LYS A 1 39 ? 4.316   14.792  -4.863  1.00 0.00 ? 1083 LYS B HB2  3  
ATOM 3660  H HB3  . LYS A 1 39 ? 5.797   15.088  -3.953  1.00 0.00 ? 1083 LYS B HB3  3  
ATOM 3661  H HG2  . LYS A 1 39 ? 7.057   15.478  -5.961  1.00 0.00 ? 1083 LYS B HG2  3  
ATOM 3662  H HG3  . LYS A 1 39 ? 5.727   14.915  -6.974  1.00 0.00 ? 1083 LYS B HG3  3  
ATOM 3663  H HD2  . LYS A 1 39 ? 5.737   17.340  -7.014  1.00 0.00 ? 1083 LYS B HD2  3  
ATOM 3664  H HD3  . LYS A 1 39 ? 4.335   16.805  -6.089  1.00 0.00 ? 1083 LYS B HD3  3  
ATOM 3665  H HE2  . LYS A 1 39 ? 5.546   17.180  -3.989  1.00 0.00 ? 1083 LYS B HE2  3  
ATOM 3666  H HE3  . LYS A 1 39 ? 6.986   17.657  -4.887  1.00 0.00 ? 1083 LYS B HE3  3  
ATOM 3667  H HZ1  . LYS A 1 39 ? 4.600   19.159  -4.311  1.00 0.00 ? 1083 LYS B HZ1  3  
ATOM 3668  H HZ2  . LYS A 1 39 ? 5.067   19.236  -5.943  1.00 0.00 ? 1083 LYS B HZ2  3  
ATOM 3669  H HZ3  . LYS A 1 39 ? 6.153   19.706  -4.723  1.00 0.00 ? 1083 LYS B HZ3  3  
ATOM 3670  N N    . TYR A 1 40 ? 4.183   12.081  -3.491  1.00 0.00 ? 1084 TYR B N    3  
ATOM 3671  C CA   . TYR A 1 40 ? 3.764   11.416  -2.267  1.00 0.00 ? 1084 TYR B CA   3  
ATOM 3672  C C    . TYR A 1 40 ? 3.483   9.947   -2.542  1.00 0.00 ? 1084 TYR B C    3  
ATOM 3673  O O    . TYR A 1 40 ? 2.554   9.366   -1.983  1.00 0.00 ? 1084 TYR B O    3  
ATOM 3674  C CB   . TYR A 1 40 ? 2.504   12.085  -1.710  1.00 0.00 ? 1084 TYR B CB   3  
ATOM 3675  C CG   . TYR A 1 40 ? 2.566   13.572  -1.957  1.00 0.00 ? 1084 TYR B CG   3  
ATOM 3676  C CD1  . TYR A 1 40 ? 1.459   14.234  -2.498  1.00 0.00 ? 1084 TYR B CD1  3  
ATOM 3677  C CD2  . TYR A 1 40 ? 3.729   14.287  -1.657  1.00 0.00 ? 1084 TYR B CD2  3  
ATOM 3678  C CE1  . TYR A 1 40 ? 1.516   15.609  -2.741  1.00 0.00 ? 1084 TYR B CE1  3  
ATOM 3679  C CE2  . TYR A 1 40 ? 3.787   15.659  -1.901  1.00 0.00 ? 1084 TYR B CE2  3  
ATOM 3680  C CZ   . TYR A 1 40 ? 2.682   16.323  -2.444  1.00 0.00 ? 1084 TYR B CZ   3  
ATOM 3681  O OH   . TYR A 1 40 ? 2.740   17.682  -2.678  1.00 0.00 ? 1084 TYR B OH   3  
ATOM 3682  H H    . TYR A 1 40 ? 3.529   12.230  -4.199  1.00 0.00 ? 1084 TYR B H    3  
ATOM 3683  H HA   . TYR A 1 40 ? 4.555   11.495  -1.536  1.00 0.00 ? 1084 TYR B HA   3  
ATOM 3684  H HB2  . TYR A 1 40 ? 1.633   11.675  -2.202  1.00 0.00 ? 1084 TYR B HB2  3  
ATOM 3685  H HB3  . TYR A 1 40 ? 2.439   11.900  -0.649  1.00 0.00 ? 1084 TYR B HB3  3  
ATOM 3686  H HD1  . TYR A 1 40 ? 0.560   13.681  -2.730  1.00 0.00 ? 1084 TYR B HD1  3  
ATOM 3687  H HD2  . TYR A 1 40 ? 4.583   13.775  -1.238  1.00 0.00 ? 1084 TYR B HD2  3  
ATOM 3688  H HE1  . TYR A 1 40 ? 0.662   16.116  -3.158  1.00 0.00 ? 1084 TYR B HE1  3  
ATOM 3689  H HE2  . TYR A 1 40 ? 4.689   16.200  -1.679  1.00 0.00 ? 1084 TYR B HE2  3  
ATOM 3690  H HH   . TYR A 1 40 ? 2.462   17.841  -3.583  1.00 0.00 ? 1084 TYR B HH   3  
ATOM 3691  N N    . ASP A 1 41 ? 4.291   9.354   -3.412  1.00 0.00 ? 1085 ASP B N    3  
ATOM 3692  C CA   . ASP A 1 41 ? 4.116   7.945   -3.753  1.00 0.00 ? 1085 ASP B CA   3  
ATOM 3693  C C    . ASP A 1 41 ? 4.613   7.069   -2.612  1.00 0.00 ? 1085 ASP B C    3  
ATOM 3694  O O    . ASP A 1 41 ? 5.773   6.656   -2.590  1.00 0.00 ? 1085 ASP B O    3  
ATOM 3695  C CB   . ASP A 1 41 ? 4.897   7.609   -5.023  1.00 0.00 ? 1085 ASP B CB   3  
ATOM 3696  C CG   . ASP A 1 41 ? 4.654   6.156   -5.423  1.00 0.00 ? 1085 ASP B CG   3  
ATOM 3697  O OD1  . ASP A 1 41 ? 3.542   5.852   -5.828  1.00 0.00 ? 1085 ASP B OD1  3  
ATOM 3698  O OD2  . ASP A 1 41 ? 5.579   5.369   -5.317  1.00 0.00 ? 1085 ASP B OD2  3  
ATOM 3699  H H    . ASP A 1 41 ? 5.012   9.878   -3.832  1.00 0.00 ? 1085 ASP B H    3  
ATOM 3700  H HA   . ASP A 1 41 ? 3.067   7.749   -3.920  1.00 0.00 ? 1085 ASP B HA   3  
ATOM 3701  H HB2  . ASP A 1 41 ? 4.581   8.261   -5.824  1.00 0.00 ? 1085 ASP B HB2  3  
ATOM 3702  H HB3  . ASP A 1 41 ? 5.952   7.753   -4.841  1.00 0.00 ? 1085 ASP B HB3  3  
ATOM 3703  N N    . LEU A 1 42 ? 3.727   6.801   -1.661  1.00 0.00 ? 1086 LEU B N    3  
ATOM 3704  C CA   . LEU A 1 42 ? 4.079   5.988   -0.503  1.00 0.00 ? 1086 LEU B CA   3  
ATOM 3705  C C    . LEU A 1 42 ? 3.609   4.551   -0.691  1.00 0.00 ? 1086 LEU B C    3  
ATOM 3706  O O    . LEU A 1 42 ? 3.423   3.821   0.280   1.00 0.00 ? 1086 LEU B O    3  
ATOM 3707  C CB   . LEU A 1 42 ? 3.455   6.575   0.768   1.00 0.00 ? 1086 LEU B CB   3  
ATOM 3708  C CG   . LEU A 1 42 ? 3.668   8.094   0.810   1.00 0.00 ? 1086 LEU B CG   3  
ATOM 3709  C CD1  . LEU A 1 42 ? 2.312   8.799   0.763   1.00 0.00 ? 1086 LEU B CD1  3  
ATOM 3710  C CD2  . LEU A 1 42 ? 4.392   8.466   2.106   1.00 0.00 ? 1086 LEU B CD2  3  
ATOM 3711  H H    . LEU A 1 42 ? 2.821   7.167   -1.731  1.00 0.00 ? 1086 LEU B H    3  
ATOM 3712  H HA   . LEU A 1 42 ? 5.153   5.990   -0.391  1.00 0.00 ? 1086 LEU B HA   3  
ATOM 3713  H HB2  . LEU A 1 42 ? 2.396   6.361   0.778   1.00 0.00 ? 1086 LEU B HB2  3  
ATOM 3714  H HB3  . LEU A 1 42 ? 3.919   6.127   1.633   1.00 0.00 ? 1086 LEU B HB3  3  
ATOM 3715  H HG   . LEU A 1 42 ? 4.264   8.409   -0.038  1.00 0.00 ? 1086 LEU B HG   3  
ATOM 3716  H HD11 . LEU A 1 42 ? 1.624   8.220   0.165   1.00 0.00 ? 1086 LEU B HD11 3  
ATOM 3717  H HD12 . LEU A 1 42 ? 2.434   9.780   0.323   1.00 0.00 ? 1086 LEU B HD12 3  
ATOM 3718  H HD13 . LEU A 1 42 ? 1.923   8.900   1.766   1.00 0.00 ? 1086 LEU B HD13 3  
ATOM 3719  H HD21 . LEU A 1 42 ? 3.969   7.907   2.928   1.00 0.00 ? 1086 LEU B HD21 3  
ATOM 3720  H HD22 . LEU A 1 42 ? 4.277   9.525   2.293   1.00 0.00 ? 1086 LEU B HD22 3  
ATOM 3721  H HD23 . LEU A 1 42 ? 5.440   8.229   2.011   1.00 0.00 ? 1086 LEU B HD23 3  
ATOM 3722  N N    . SER A 1 43 ? 3.432   4.153   -1.945  1.00 0.00 ? 1087 SER B N    3  
ATOM 3723  C CA   . SER A 1 43 ? 2.991   2.798   -2.256  1.00 0.00 ? 1087 SER B CA   3  
ATOM 3724  C C    . SER A 1 43 ? 4.002   1.772   -1.745  1.00 0.00 ? 1087 SER B C    3  
ATOM 3725  O O    . SER A 1 43 ? 3.687   0.590   -1.613  1.00 0.00 ? 1087 SER B O    3  
ATOM 3726  C CB   . SER A 1 43 ? 2.815   2.643   -3.766  1.00 0.00 ? 1087 SER B CB   3  
ATOM 3727  O OG   . SER A 1 43 ? 4.070   2.827   -4.401  1.00 0.00 ? 1087 SER B OG   3  
ATOM 3728  H H    . SER A 1 43 ? 3.605   4.781   -2.676  1.00 0.00 ? 1087 SER B H    3  
ATOM 3729  H HA   . SER A 1 43 ? 2.042   2.621   -1.779  1.00 0.00 ? 1087 SER B HA   3  
ATOM 3730  H HB2  . SER A 1 43 ? 2.446   1.656   -3.986  1.00 0.00 ? 1087 SER B HB2  3  
ATOM 3731  H HB3  . SER A 1 43 ? 2.106   3.379   -4.120  1.00 0.00 ? 1087 SER B HB3  3  
ATOM 3732  H HG   . SER A 1 43 ? 4.733   2.377   -3.877  1.00 0.00 ? 1087 SER B HG   3  
ATOM 3733  N N    . LYS A 1 44 ? 5.218   2.230   -1.468  1.00 0.00 ? 1088 LYS B N    3  
ATOM 3734  C CA   . LYS A 1 44 ? 6.265   1.344   -0.970  1.00 0.00 ? 1088 LYS B CA   3  
ATOM 3735  C C    . LYS A 1 44 ? 6.332   1.386   0.558   1.00 0.00 ? 1088 LYS B C    3  
ATOM 3736  O O    . LYS A 1 44 ? 6.984   0.547   1.180   1.00 0.00 ? 1088 LYS B O    3  
ATOM 3737  C CB   . LYS A 1 44 ? 7.614   1.767   -1.548  1.00 0.00 ? 1088 LYS B CB   3  
ATOM 3738  C CG   . LYS A 1 44 ? 7.594   1.584   -3.066  1.00 0.00 ? 1088 LYS B CG   3  
ATOM 3739  C CD   . LYS A 1 44 ? 8.857   2.195   -3.672  1.00 0.00 ? 1088 LYS B CD   3  
ATOM 3740  C CE   . LYS A 1 44 ? 10.080  1.401   -3.213  1.00 0.00 ? 1088 LYS B CE   3  
ATOM 3741  N NZ   . LYS A 1 44 ? 11.300  1.945   -3.873  1.00 0.00 ? 1088 LYS B NZ   3  
ATOM 3742  H H    . LYS A 1 44 ? 5.415   3.179   -1.595  1.00 0.00 ? 1088 LYS B H    3  
ATOM 3743  H HA   . LYS A 1 44 ? 6.052   0.334   -1.285  1.00 0.00 ? 1088 LYS B HA   3  
ATOM 3744  H HB2  . LYS A 1 44 ? 7.798   2.805   -1.309  1.00 0.00 ? 1088 LYS B HB2  3  
ATOM 3745  H HB3  . LYS A 1 44 ? 8.393   1.153   -1.123  1.00 0.00 ? 1088 LYS B HB3  3  
ATOM 3746  H HG2  . LYS A 1 44 ? 7.554   0.529   -3.299  1.00 0.00 ? 1088 LYS B HG2  3  
ATOM 3747  H HG3  . LYS A 1 44 ? 6.725   2.077   -3.476  1.00 0.00 ? 1088 LYS B HG3  3  
ATOM 3748  H HD2  . LYS A 1 44 ? 8.790   2.163   -4.751  1.00 0.00 ? 1088 LYS B HD2  3  
ATOM 3749  H HD3  . LYS A 1 44 ? 8.953   3.219   -3.347  1.00 0.00 ? 1088 LYS B HD3  3  
ATOM 3750  H HE2  . LYS A 1 44 ? 10.180  1.487   -2.142  1.00 0.00 ? 1088 LYS B HE2  3  
ATOM 3751  H HE3  . LYS A 1 44 ? 9.957   0.362   -3.482  1.00 0.00 ? 1088 LYS B HE3  3  
ATOM 3752  H HZ1  . LYS A 1 44 ? 11.318  1.649   -4.870  1.00 0.00 ? 1088 LYS B HZ1  3  
ATOM 3753  H HZ2  . LYS A 1 44 ? 12.147  1.582   -3.388  1.00 0.00 ? 1088 LYS B HZ2  3  
ATOM 3754  H HZ3  . LYS A 1 44 ? 11.289  2.983   -3.823  1.00 0.00 ? 1088 LYS B HZ3  3  
ATOM 3755  N N    . TRP A 1 45 ? 5.657   2.365   1.157   1.00 0.00 ? 1089 TRP B N    3  
ATOM 3756  C CA   . TRP A 1 45 ? 5.658   2.498   2.610   1.00 0.00 ? 1089 TRP B CA   3  
ATOM 3757  C C    . TRP A 1 45 ? 4.815   1.403   3.249   1.00 0.00 ? 1089 TRP B C    3  
ATOM 3758  O O    . TRP A 1 45 ? 3.706   1.123   2.804   1.00 0.00 ? 1089 TRP B O    3  
ATOM 3759  C CB   . TRP A 1 45 ? 5.099   3.865   3.014   1.00 0.00 ? 1089 TRP B CB   3  
ATOM 3760  C CG   . TRP A 1 45 ? 6.132   4.917   2.782   1.00 0.00 ? 1089 TRP B CG   3  
ATOM 3761  C CD1  . TRP A 1 45 ? 6.983   4.949   1.733   1.00 0.00 ? 1089 TRP B CD1  3  
ATOM 3762  C CD2  . TRP A 1 45 ? 6.443   6.081   3.601   1.00 0.00 ? 1089 TRP B CD2  3  
ATOM 3763  N NE1  . TRP A 1 45 ? 7.797   6.059   1.854   1.00 0.00 ? 1089 TRP B NE1  3  
ATOM 3764  C CE2  . TRP A 1 45 ? 7.503   6.789   2.988   1.00 0.00 ? 1089 TRP B CE2  3  
ATOM 3765  C CE3  . TRP A 1 45 ? 5.914   6.587   4.806   1.00 0.00 ? 1089 TRP B CE3  3  
ATOM 3766  C CZ2  . TRP A 1 45 ? 8.020   7.959   3.545   1.00 0.00 ? 1089 TRP B CZ2  3  
ATOM 3767  C CZ3  . TRP A 1 45 ? 6.436   7.767   5.367   1.00 0.00 ? 1089 TRP B CZ3  3  
ATOM 3768  C CH2  . TRP A 1 45 ? 7.485   8.449   4.739   1.00 0.00 ? 1089 TRP B CH2  3  
ATOM 3769  H H    . TRP A 1 45 ? 5.156   3.007   0.618   1.00 0.00 ? 1089 TRP B H    3  
ATOM 3770  H HA   . TRP A 1 45 ? 6.673   2.417   2.972   1.00 0.00 ? 1089 TRP B HA   3  
ATOM 3771  H HB2  . TRP A 1 45 ? 4.226   4.085   2.420   1.00 0.00 ? 1089 TRP B HB2  3  
ATOM 3772  H HB3  . TRP A 1 45 ? 4.828   3.852   4.060   1.00 0.00 ? 1089 TRP B HB3  3  
ATOM 3773  H HD1  . TRP A 1 45 ? 7.021   4.229   0.931   1.00 0.00 ? 1089 TRP B HD1  3  
ATOM 3774  H HE1  . TRP A 1 45 ? 8.500   6.311   1.226   1.00 0.00 ? 1089 TRP B HE1  3  
ATOM 3775  H HE3  . TRP A 1 45 ? 5.103   6.069   5.305   1.00 0.00 ? 1089 TRP B HE3  3  
ATOM 3776  H HZ2  . TRP A 1 45 ? 8.828   8.483   3.057   1.00 0.00 ? 1089 TRP B HZ2  3  
ATOM 3777  H HZ3  . TRP A 1 45 ? 6.028   8.149   6.288   1.00 0.00 ? 1089 TRP B HZ3  3  
ATOM 3778  H HH2  . TRP A 1 45 ? 7.877   9.355   5.175   1.00 0.00 ? 1089 TRP B HH2  3  
ATOM 3779  N N    . LYS A 1 46 ? 5.345   0.791   4.303   1.00 0.00 ? 1090 LYS B N    3  
ATOM 3780  C CA   . LYS A 1 46 ? 4.626   -0.270  4.997   1.00 0.00 ? 1090 LYS B CA   3  
ATOM 3781  C C    . LYS A 1 46 ? 3.344   0.263   5.621   1.00 0.00 ? 1090 LYS B C    3  
ATOM 3782  O O    . LYS A 1 46 ? 3.194   1.466   5.825   1.00 0.00 ? 1090 LYS B O    3  
ATOM 3783  C CB   . LYS A 1 46 ? 5.511   -0.874  6.081   1.00 0.00 ? 1090 LYS B CB   3  
ATOM 3784  C CG   . LYS A 1 46 ? 6.654   -1.641  5.425   1.00 0.00 ? 1090 LYS B CG   3  
ATOM 3785  C CD   . LYS A 1 46 ? 7.566   -2.217  6.507   1.00 0.00 ? 1090 LYS B CD   3  
ATOM 3786  C CE   . LYS A 1 46 ? 8.718   -2.998  5.859   1.00 0.00 ? 1090 LYS B CE   3  
ATOM 3787  N NZ   . LYS A 1 46 ? 9.603   -3.561  6.922   1.00 0.00 ? 1090 LYS B NZ   3  
ATOM 3788  H H    . LYS A 1 46 ? 6.238   1.059   4.621   1.00 0.00 ? 1090 LYS B H    3  
ATOM 3789  H HA   . LYS A 1 46 ? 4.374   -1.041  4.287   1.00 0.00 ? 1090 LYS B HA   3  
ATOM 3790  H HB2  . LYS A 1 46 ? 5.913   -0.087  6.700   1.00 0.00 ? 1090 LYS B HB2  3  
ATOM 3791  H HB3  . LYS A 1 46 ? 4.929   -1.550  6.688   1.00 0.00 ? 1090 LYS B HB3  3  
ATOM 3792  H HG2  . LYS A 1 46 ? 6.244   -2.444  4.833   1.00 0.00 ? 1090 LYS B HG2  3  
ATOM 3793  H HG3  . LYS A 1 46 ? 7.218   -0.974  4.796   1.00 0.00 ? 1090 LYS B HG3  3  
ATOM 3794  H HD2  . LYS A 1 46 ? 7.965   -1.405  7.096   1.00 0.00 ? 1090 LYS B HD2  3  
ATOM 3795  H HD3  . LYS A 1 46 ? 6.994   -2.877  7.140   1.00 0.00 ? 1090 LYS B HD3  3  
ATOM 3796  H HE2  . LYS A 1 46 ? 8.317   -3.805  5.263   1.00 0.00 ? 1090 LYS B HE2  3  
ATOM 3797  H HE3  . LYS A 1 46 ? 9.292   -2.334  5.229   1.00 0.00 ? 1090 LYS B HE3  3  
ATOM 3798  H HZ1  . LYS A 1 46 ? 9.912   -4.515  6.647   1.00 0.00 ? 1090 LYS B HZ1  3  
ATOM 3799  H HZ2  . LYS A 1 46 ? 9.080   -3.610  7.820   1.00 0.00 ? 1090 LYS B HZ2  3  
ATOM 3800  H HZ3  . LYS A 1 46 ? 10.438  -2.953  7.038   1.00 0.00 ? 1090 LYS B HZ3  3  
ATOM 3801  N N    . TYR A 1 47 ? 2.423   -0.646  5.920   1.00 0.00 ? 1091 TYR B N    3  
ATOM 3802  C CA   . TYR A 1 47 ? 1.157   -0.262  6.524   1.00 0.00 ? 1091 TYR B CA   3  
ATOM 3803  C C    . TYR A 1 47 ? 1.414   0.495   7.816   1.00 0.00 ? 1091 TYR B C    3  
ATOM 3804  O O    . TYR A 1 47 ? 0.821   1.546   8.061   1.00 0.00 ? 1091 TYR B O    3  
ATOM 3805  C CB   . TYR A 1 47 ? 0.310   -1.507  6.813   1.00 0.00 ? 1091 TYR B CB   3  
ATOM 3806  C CG   . TYR A 1 47 ? -0.918  -1.111  7.597   1.00 0.00 ? 1091 TYR B CG   3  
ATOM 3807  C CD1  . TYR A 1 47 ? -1.991  -0.480  6.953   1.00 0.00 ? 1091 TYR B CD1  3  
ATOM 3808  C CD2  . TYR A 1 47 ? -0.986  -1.379  8.970   1.00 0.00 ? 1091 TYR B CD2  3  
ATOM 3809  C CE1  . TYR A 1 47 ? -3.128  -0.115  7.683   1.00 0.00 ? 1091 TYR B CE1  3  
ATOM 3810  C CE2  . TYR A 1 47 ? -2.124  -1.015  9.699   1.00 0.00 ? 1091 TYR B CE2  3  
ATOM 3811  C CZ   . TYR A 1 47 ? -3.194  -0.382  9.056   1.00 0.00 ? 1091 TYR B CZ   3  
ATOM 3812  O OH   . TYR A 1 47 ? -4.317  -0.021  9.775   1.00 0.00 ? 1091 TYR B OH   3  
ATOM 3813  H H    . TYR A 1 47 ? 2.601   -1.592  5.732   1.00 0.00 ? 1091 TYR B H    3  
ATOM 3814  H HA   . TYR A 1 47 ? 0.619   0.375   5.839   1.00 0.00 ? 1091 TYR B HA   3  
ATOM 3815  H HB2  . TYR A 1 47 ? 0.011   -1.964  5.881   1.00 0.00 ? 1091 TYR B HB2  3  
ATOM 3816  H HB3  . TYR A 1 47 ? 0.892   -2.212  7.388   1.00 0.00 ? 1091 TYR B HB3  3  
ATOM 3817  H HD1  . TYR A 1 47 ? -1.938  -0.274  5.894   1.00 0.00 ? 1091 TYR B HD1  3  
ATOM 3818  H HD2  . TYR A 1 47 ? -0.161  -1.867  9.467   1.00 0.00 ? 1091 TYR B HD2  3  
ATOM 3819  H HE1  . TYR A 1 47 ? -3.954  0.373   7.187   1.00 0.00 ? 1091 TYR B HE1  3  
ATOM 3820  H HE2  . TYR A 1 47 ? -2.175  -1.219  10.757  1.00 0.00 ? 1091 TYR B HE2  3  
ATOM 3821  H HH   . TYR A 1 47 ? -4.258  0.918   9.965   1.00 0.00 ? 1091 TYR B HH   3  
ATOM 3822  N N    . ALA A 1 48 ? 2.302   -0.040  8.638   1.00 0.00 ? 1092 ALA B N    3  
ATOM 3823  C CA   . ALA A 1 48 ? 2.631   0.608   9.905   1.00 0.00 ? 1092 ALA B CA   3  
ATOM 3824  C C    . ALA A 1 48 ? 3.243   1.988   9.667   1.00 0.00 ? 1092 ALA B C    3  
ATOM 3825  O O    . ALA A 1 48 ? 2.954   2.943   10.397  1.00 0.00 ? 1092 ALA B O    3  
ATOM 3826  C CB   . ALA A 1 48 ? 3.607   -0.257  10.704  1.00 0.00 ? 1092 ALA B CB   3  
ATOM 3827  H H    . ALA A 1 48 ? 2.753   -0.883  8.385   1.00 0.00 ? 1092 ALA B H    3  
ATOM 3828  H HA   . ALA A 1 48 ? 1.723   0.724   10.478  1.00 0.00 ? 1092 ALA B HA   3  
ATOM 3829  H HB1  . ALA A 1 48 ? 3.173   -0.496  11.665  1.00 0.00 ? 1092 ALA B HB1  3  
ATOM 3830  H HB2  . ALA A 1 48 ? 4.529   0.284   10.851  1.00 0.00 ? 1092 ALA B HB2  3  
ATOM 3831  H HB3  . ALA A 1 48 ? 3.804   -1.171  10.164  1.00 0.00 ? 1092 ALA B HB3  3  
ATOM 3832  N N    . GLU A 1 49 ? 4.092   2.086   8.650   1.00 0.00 ? 1093 GLU B N    3  
ATOM 3833  C CA   . GLU A 1 49 ? 4.744   3.349   8.327   1.00 0.00 ? 1093 GLU B CA   3  
ATOM 3834  C C    . GLU A 1 49 ? 3.714   4.398   7.921   1.00 0.00 ? 1093 GLU B C    3  
ATOM 3835  O O    . GLU A 1 49 ? 3.780   5.548   8.358   1.00 0.00 ? 1093 GLU B O    3  
ATOM 3836  C CB   . GLU A 1 49 ? 5.742   3.140   7.183   1.00 0.00 ? 1093 GLU B CB   3  
ATOM 3837  C CG   . GLU A 1 49 ? 6.902   2.262   7.666   1.00 0.00 ? 1093 GLU B CG   3  
ATOM 3838  C CD   . GLU A 1 49 ? 7.710   2.998   8.729   1.00 0.00 ? 1093 GLU B CD   3  
ATOM 3839  O OE1  . GLU A 1 49 ? 7.688   4.217   8.723   1.00 0.00 ? 1093 GLU B OE1  3  
ATOM 3840  O OE2  . GLU A 1 49 ? 8.335   2.329   9.536   1.00 0.00 ? 1093 GLU B OE2  3  
ATOM 3841  H H    . GLU A 1 49 ? 4.282   1.298   8.106   1.00 0.00 ? 1093 GLU B H    3  
ATOM 3842  H HA   . GLU A 1 49 ? 5.281   3.702   9.196   1.00 0.00 ? 1093 GLU B HA   3  
ATOM 3843  H HB2  . GLU A 1 49 ? 5.244   2.654   6.356   1.00 0.00 ? 1093 GLU B HB2  3  
ATOM 3844  H HB3  . GLU A 1 49 ? 6.129   4.095   6.860   1.00 0.00 ? 1093 GLU B HB3  3  
ATOM 3845  H HG2  . GLU A 1 49 ? 6.507   1.349   8.086   1.00 0.00 ? 1093 GLU B HG2  3  
ATOM 3846  H HG3  . GLU A 1 49 ? 7.544   2.025   6.830   1.00 0.00 ? 1093 GLU B HG3  3  
ATOM 3847  N N    . LEU A 1 50 ? 2.748   3.995   7.100   1.00 0.00 ? 1094 LEU B N    3  
ATOM 3848  C CA   . LEU A 1 50 ? 1.705   4.905   6.669   1.00 0.00 ? 1094 LEU B CA   3  
ATOM 3849  C C    . LEU A 1 50 ? 0.856   5.336   7.854   1.00 0.00 ? 1094 LEU B C    3  
ATOM 3850  O O    . LEU A 1 50 ? 0.445   6.489   7.944   1.00 0.00 ? 1094 LEU B O    3  
ATOM 3851  C CB   . LEU A 1 50 ? 0.833   4.235   5.604   1.00 0.00 ? 1094 LEU B CB   3  
ATOM 3852  C CG   . LEU A 1 50 ? 1.627   4.129   4.303   1.00 0.00 ? 1094 LEU B CG   3  
ATOM 3853  C CD1  . LEU A 1 50 ? 0.924   3.158   3.350   1.00 0.00 ? 1094 LEU B CD1  3  
ATOM 3854  C CD2  . LEU A 1 50 ? 1.702   5.508   3.641   1.00 0.00 ? 1094 LEU B CD2  3  
ATOM 3855  H H    . LEU A 1 50 ? 2.729   3.065   6.789   1.00 0.00 ? 1094 LEU B H    3  
ATOM 3856  H HA   . LEU A 1 50 ? 2.167   5.782   6.239   1.00 0.00 ? 1094 LEU B HA   3  
ATOM 3857  H HB2  . LEU A 1 50 ? 0.552   3.245   5.938   1.00 0.00 ? 1094 LEU B HB2  3  
ATOM 3858  H HB3  . LEU A 1 50 ? -0.057  4.825   5.435   1.00 0.00 ? 1094 LEU B HB3  3  
ATOM 3859  H HG   . LEU A 1 50 ? 2.625   3.774   4.522   1.00 0.00 ? 1094 LEU B HG   3  
ATOM 3860  H HD11 . LEU A 1 50 ? 0.126   3.676   2.837   1.00 0.00 ? 1094 LEU B HD11 3  
ATOM 3861  H HD12 . LEU A 1 50 ? 0.513   2.334   3.915   1.00 0.00 ? 1094 LEU B HD12 3  
ATOM 3862  H HD13 . LEU A 1 50 ? 1.634   2.782   2.630   1.00 0.00 ? 1094 LEU B HD13 3  
ATOM 3863  H HD21 . LEU A 1 50 ? 1.423   6.268   4.359   1.00 0.00 ? 1094 LEU B HD21 3  
ATOM 3864  H HD22 . LEU A 1 50 ? 1.024   5.539   2.802   1.00 0.00 ? 1094 LEU B HD22 3  
ATOM 3865  H HD23 . LEU A 1 50 ? 2.710   5.689   3.299   1.00 0.00 ? 1094 LEU B HD23 3  
ATOM 3866  N N    . ARG A 1 51 ? 0.599   4.404   8.762   1.00 0.00 ? 1095 ARG B N    3  
ATOM 3867  C CA   . ARG A 1 51 ? -0.202  4.710   9.931   1.00 0.00 ? 1095 ARG B CA   3  
ATOM 3868  C C    . ARG A 1 51 ? 0.435   5.847   10.723  1.00 0.00 ? 1095 ARG B C    3  
ATOM 3869  O O    . ARG A 1 51 ? -0.235  6.816   11.094  1.00 0.00 ? 1095 ARG B O    3  
ATOM 3870  C CB   . ARG A 1 51 ? -0.305  3.463   10.812  1.00 0.00 ? 1095 ARG B CB   3  
ATOM 3871  C CG   . ARG A 1 51 ? -1.198  3.761   12.016  1.00 0.00 ? 1095 ARG B CG   3  
ATOM 3872  C CD   . ARG A 1 51 ? -1.236  2.545   12.939  1.00 0.00 ? 1095 ARG B CD   3  
ATOM 3873  N NE   . ARG A 1 51 ? 0.056   2.359   13.590  1.00 0.00 ? 1095 ARG B NE   3  
ATOM 3874  C CZ   . ARG A 1 51 ? 0.307   1.289   14.348  1.00 0.00 ? 1095 ARG B CZ   3  
ATOM 3875  N NH1  . ARG A 1 51 ? -0.605  0.366   14.528  1.00 0.00 ? 1095 ARG B NH1  3  
ATOM 3876  N NH2  . ARG A 1 51 ? 1.473   1.161   14.921  1.00 0.00 ? 1095 ARG B NH2  3  
ATOM 3877  H H    . ARG A 1 51 ? 0.949   3.496   8.642   1.00 0.00 ? 1095 ARG B H    3  
ATOM 3878  H HA   . ARG A 1 51 ? -1.190  5.004   9.616   1.00 0.00 ? 1095 ARG B HA   3  
ATOM 3879  H HB2  . ARG A 1 51 ? -0.731  2.653   10.235  1.00 0.00 ? 1095 ARG B HB2  3  
ATOM 3880  H HB3  . ARG A 1 51 ? 0.681   3.178   11.154  1.00 0.00 ? 1095 ARG B HB3  3  
ATOM 3881  H HG2  . ARG A 1 51 ? -0.807  4.611   12.554  1.00 0.00 ? 1095 ARG B HG2  3  
ATOM 3882  H HG3  . ARG A 1 51 ? -2.200  3.980   11.676  1.00 0.00 ? 1095 ARG B HG3  3  
ATOM 3883  H HD2  . ARG A 1 51 ? -1.995  2.691   13.690  1.00 0.00 ? 1095 ARG B HD2  3  
ATOM 3884  H HD3  . ARG A 1 51 ? -1.472  1.667   12.356  1.00 0.00 ? 1095 ARG B HD3  3  
ATOM 3885  H HE   . ARG A 1 51 ? 0.756   3.038   13.471  1.00 0.00 ? 1095 ARG B HE   3  
ATOM 3886  H HH11 . ARG A 1 51 ? -1.504  0.452   14.098  1.00 0.00 ? 1095 ARG B HH11 3  
ATOM 3887  H HH12 . ARG A 1 51 ? -0.402  -0.431  15.099  1.00 0.00 ? 1095 ARG B HH12 3  
ATOM 3888  H HH21 . ARG A 1 51 ? 2.174   1.862   14.791  1.00 0.00 ? 1095 ARG B HH21 3  
ATOM 3889  H HH22 . ARG A 1 51 ? 1.664   0.361   15.489  1.00 0.00 ? 1095 ARG B HH22 3  
ATOM 3890  N N    . ASP A 1 52 ? 1.736   5.730   10.957  1.00 0.00 ? 1096 ASP B N    3  
ATOM 3891  C CA   . ASP A 1 52 ? 2.462   6.758   11.684  1.00 0.00 ? 1096 ASP B CA   3  
ATOM 3892  C C    . ASP A 1 52 ? 2.462   8.054   10.886  1.00 0.00 ? 1096 ASP B C    3  
ATOM 3893  O O    . ASP A 1 52 ? 2.326   9.138   11.451  1.00 0.00 ? 1096 ASP B O    3  
ATOM 3894  C CB   . ASP A 1 52 ? 3.902   6.310   11.955  1.00 0.00 ? 1096 ASP B CB   3  
ATOM 3895  C CG   . ASP A 1 52 ? 4.590   7.299   12.895  1.00 0.00 ? 1096 ASP B CG   3  
ATOM 3896  O OD1  . ASP A 1 52 ? 4.009   8.340   13.155  1.00 0.00 ? 1096 ASP B OD1  3  
ATOM 3897  O OD2  . ASP A 1 52 ? 5.685   6.999   13.342  1.00 0.00 ? 1096 ASP B OD2  3  
ATOM 3898  H H    . ASP A 1 52 ? 2.218   4.942   10.626  1.00 0.00 ? 1096 ASP B H    3  
ATOM 3899  H HA   . ASP A 1 52 ? 1.967   6.930   12.627  1.00 0.00 ? 1096 ASP B HA   3  
ATOM 3900  H HB2  . ASP A 1 52 ? 3.892   5.331   12.412  1.00 0.00 ? 1096 ASP B HB2  3  
ATOM 3901  H HB3  . ASP A 1 52 ? 4.447   6.264   11.025  1.00 0.00 ? 1096 ASP B HB3  3  
ATOM 3902  N N    . THR A 1 53 ? 2.614   7.935   9.567   1.00 0.00 ? 1097 THR B N    3  
ATOM 3903  C CA   . THR A 1 53 ? 2.625   9.109   8.708   1.00 0.00 ? 1097 THR B CA   3  
ATOM 3904  C C    . THR A 1 53 ? 1.308   9.868   8.828   1.00 0.00 ? 1097 THR B C    3  
ATOM 3905  O O    . THR A 1 53 ? 1.296   11.091  8.894   1.00 0.00 ? 1097 THR B O    3  
ATOM 3906  C CB   . THR A 1 53 ? 2.843   8.688   7.258   1.00 0.00 ? 1097 THR B CB   3  
ATOM 3907  O OG1  . THR A 1 53 ? 4.099   8.037   7.147   1.00 0.00 ? 1097 THR B OG1  3  
ATOM 3908  C CG2  . THR A 1 53 ? 2.823   9.925   6.358   1.00 0.00 ? 1097 THR B CG2  3  
ATOM 3909  H H    . THR A 1 53 ? 2.721   7.043   9.160   1.00 0.00 ? 1097 THR B H    3  
ATOM 3910  H HA   . THR A 1 53 ? 3.432   9.756   9.010   1.00 0.00 ? 1097 THR B HA   3  
ATOM 3911  H HB   . THR A 1 53 ? 2.059   8.014   6.955   1.00 0.00 ? 1097 THR B HB   3  
ATOM 3912  H HG1  . THR A 1 53 ? 4.695   8.430   7.790   1.00 0.00 ? 1097 THR B HG1  3  
ATOM 3913  H HG21 . THR A 1 53 ? 3.213   10.772  6.903   1.00 0.00 ? 1097 THR B HG21 3  
ATOM 3914  H HG22 . THR A 1 53 ? 1.808   10.128  6.053   1.00 0.00 ? 1097 THR B HG22 3  
ATOM 3915  H HG23 . THR A 1 53 ? 3.433   9.745   5.485   1.00 0.00 ? 1097 THR B HG23 3  
ATOM 3916  N N    . ILE A 1 54 ? 0.202   9.135   8.853   1.00 0.00 ? 1098 ILE B N    3  
ATOM 3917  C CA   . ILE A 1 54 ? -1.111  9.763   8.968   1.00 0.00 ? 1098 ILE B CA   3  
ATOM 3918  C C    . ILE A 1 54 ? -1.223  10.555  10.268  1.00 0.00 ? 1098 ILE B C    3  
ATOM 3919  O O    . ILE A 1 54 ? -1.665  11.703  10.270  1.00 0.00 ? 1098 ILE B O    3  
ATOM 3920  C CB   . ILE A 1 54 ? -2.200  8.692   8.941   1.00 0.00 ? 1098 ILE B CB   3  
ATOM 3921  C CG1  . ILE A 1 54 ? -2.262  8.083   7.546   1.00 0.00 ? 1098 ILE B CG1  3  
ATOM 3922  C CG2  . ILE A 1 54 ? -3.551  9.325   9.285   1.00 0.00 ? 1098 ILE B CG2  3  
ATOM 3923  C CD1  . ILE A 1 54 ? -3.124  6.817   7.566   1.00 0.00 ? 1098 ILE B CD1  3  
ATOM 3924  H H    . ILE A 1 54 ? 0.269   8.159   8.791   1.00 0.00 ? 1098 ILE B H    3  
ATOM 3925  H HA   . ILE A 1 54 ? -1.257  10.432  8.133   1.00 0.00 ? 1098 ILE B HA   3  
ATOM 3926  H HB   . ILE A 1 54 ? -1.967  7.923   9.662   1.00 0.00 ? 1098 ILE B HB   3  
ATOM 3927  H HG12 . ILE A 1 54 ? -2.696  8.798   6.867   1.00 0.00 ? 1098 ILE B HG12 3  
ATOM 3928  H HG13 . ILE A 1 54 ? -1.266  7.833   7.222   1.00 0.00 ? 1098 ILE B HG13 3  
ATOM 3929  H HG21 . ILE A 1 54 ? -3.559  10.354  8.956   1.00 0.00 ? 1098 ILE B HG21 3  
ATOM 3930  H HG22 . ILE A 1 54 ? -3.701  9.287   10.352  1.00 0.00 ? 1098 ILE B HG22 3  
ATOM 3931  H HG23 . ILE A 1 54 ? -4.341  8.782   8.789   1.00 0.00 ? 1098 ILE B HG23 3  
ATOM 3932  H HD11 . ILE A 1 54 ? -3.443  6.615   8.580   1.00 0.00 ? 1098 ILE B HD11 3  
ATOM 3933  H HD12 . ILE A 1 54 ? -2.546  5.983   7.199   1.00 0.00 ? 1098 ILE B HD12 3  
ATOM 3934  H HD13 . ILE A 1 54 ? -3.989  6.960   6.937   1.00 0.00 ? 1098 ILE B HD13 3  
ATOM 3935  N N    . ASN A 1 55 ? -0.816  9.935   11.371  1.00 0.00 ? 1099 ASN B N    3  
ATOM 3936  C CA   . ASN A 1 55 ? -0.876  10.594  12.674  1.00 0.00 ? 1099 ASN B CA   3  
ATOM 3937  C C    . ASN A 1 55 ? 0.015   11.831  12.702  1.00 0.00 ? 1099 ASN B C    3  
ATOM 3938  O O    . ASN A 1 55 ? -0.330  12.844  13.307  1.00 0.00 ? 1099 ASN B O    3  
ATOM 3939  C CB   . ASN A 1 55 ? -0.445  9.621   13.768  1.00 0.00 ? 1099 ASN B CB   3  
ATOM 3940  C CG   . ASN A 1 55 ? -1.589  8.666   14.086  1.00 0.00 ? 1099 ASN B CG   3  
ATOM 3941  O OD1  . ASN A 1 55 ? -2.350  8.897   15.027  1.00 0.00 ? 1099 ASN B OD1  3  
ATOM 3942  N ND2  . ASN A 1 55 ? -1.789  7.624   13.324  1.00 0.00 ? 1099 ASN B ND2  3  
ATOM 3943  H H    . ASN A 1 55 ? -0.467  9.016   11.308  1.00 0.00 ? 1099 ASN B H    3  
ATOM 3944  H HA   . ASN A 1 55 ? -1.896  10.897  12.865  1.00 0.00 ? 1099 ASN B HA   3  
ATOM 3945  H HB2  . ASN A 1 55 ? 0.414   9.058   13.431  1.00 0.00 ? 1099 ASN B HB2  3  
ATOM 3946  H HB3  . ASN A 1 55 ? -0.184  10.175  14.659  1.00 0.00 ? 1099 ASN B HB3  3  
ATOM 3947  H HD21 . ASN A 1 55 ? -1.207  7.465   12.549  1.00 0.00 ? 1099 ASN B HD21 3  
ATOM 3948  H HD22 . ASN A 1 55 ? -2.516  7.000   13.527  1.00 0.00 ? 1099 ASN B HD22 3  
ATOM 3949  N N    . THR A 1 56 ? 1.165   11.737  12.047  1.00 0.00 ? 1100 THR B N    3  
ATOM 3950  C CA   . THR A 1 56 ? 2.101   12.852  12.007  1.00 0.00 ? 1100 THR B CA   3  
ATOM 3951  C C    . THR A 1 56 ? 1.818   13.761  10.811  1.00 0.00 ? 1100 THR B C    3  
ATOM 3952  O O    . THR A 1 56 ? 2.495   14.772  10.618  1.00 0.00 ? 1100 THR B O    3  
ATOM 3953  C CB   . THR A 1 56 ? 3.535   12.321  11.918  1.00 0.00 ? 1100 THR B CB   3  
ATOM 3954  O OG1  . THR A 1 56 ? 3.702   11.608  10.702  1.00 0.00 ? 1100 THR B OG1  3  
ATOM 3955  C CG2  . THR A 1 56 ? 3.803   11.388  13.097  1.00 0.00 ? 1100 THR B CG2  3  
ATOM 3956  H H    . THR A 1 56 ? 1.389   10.900  11.583  1.00 0.00 ? 1100 THR B H    3  
ATOM 3957  H HA   . THR A 1 56 ? 2.000   13.426  12.913  1.00 0.00 ? 1100 THR B HA   3  
ATOM 3958  H HB   . THR A 1 56 ? 4.229   13.146  11.954  1.00 0.00 ? 1100 THR B HB   3  
ATOM 3959  H HG1  . THR A 1 56 ? 3.564   12.221  9.977   1.00 0.00 ? 1100 THR B HG1  3  
ATOM 3960  H HG21 . THR A 1 56 ? 3.827   11.960  14.011  1.00 0.00 ? 1100 THR B HG21 3  
ATOM 3961  H HG22 . THR A 1 56 ? 4.753   10.893  12.954  1.00 0.00 ? 1100 THR B HG22 3  
ATOM 3962  H HG23 . THR A 1 56 ? 3.020   10.647  13.156  1.00 0.00 ? 1100 THR B HG23 3  
ATOM 3963  N N    . SER A 1 57 ? 0.827   13.395  9.998   1.00 0.00 ? 1101 SER B N    3  
ATOM 3964  C CA   . SER A 1 57 ? 0.489   14.181  8.828   1.00 0.00 ? 1101 SER B CA   3  
ATOM 3965  C C    . SER A 1 57 ? -0.062  15.537  9.242   1.00 0.00 ? 1101 SER B C    3  
ATOM 3966  O O    . SER A 1 57 ? -0.983  15.626  10.055  1.00 0.00 ? 1101 SER B O    3  
ATOM 3967  C CB   . SER A 1 57 ? -0.552  13.438  7.999   1.00 0.00 ? 1101 SER B CB   3  
ATOM 3968  O OG   . SER A 1 57 ? -0.868  14.206  6.850   1.00 0.00 ? 1101 SER B OG   3  
ATOM 3969  H H    . SER A 1 57 ? 0.320   12.578  10.179  1.00 0.00 ? 1101 SER B H    3  
ATOM 3970  H HA   . SER A 1 57 ? 1.375   14.327  8.228   1.00 0.00 ? 1101 SER B HA   3  
ATOM 3971  H HB2  . SER A 1 57 ? -0.160  12.484  7.692   1.00 0.00 ? 1101 SER B HB2  3  
ATOM 3972  H HB3  . SER A 1 57 ? -1.440  13.283  8.597   1.00 0.00 ? 1101 SER B HB3  3  
ATOM 3973  H HG   . SER A 1 57 ? -1.035  13.599  6.125   1.00 0.00 ? 1101 SER B HG   3  
ATOM 3974  N N    . CYS A 1 58 ? 0.505   16.586  8.672   1.00 0.00 ? 1102 CYS B N    3  
ATOM 3975  C CA   . CYS A 1 58 ? 0.066   17.942  8.976   1.00 0.00 ? 1102 CYS B CA   3  
ATOM 3976  C C    . CYS A 1 58 ? -0.341  18.674  7.701   1.00 0.00 ? 1102 CYS B C    3  
ATOM 3977  O O    . CYS A 1 58 ? -0.352  19.903  7.658   1.00 0.00 ? 1102 CYS B O    3  
ATOM 3978  C CB   . CYS A 1 58 ? 1.186   18.712  9.677   1.00 0.00 ? 1102 CYS B CB   3  
ATOM 3979  S SG   . CYS A 1 58 ? 1.611   17.877  11.226  1.00 0.00 ? 1102 CYS B SG   3  
ATOM 3980  H H    . CYS A 1 58 ? 1.230   16.444  8.031   1.00 0.00 ? 1102 CYS B H    3  
ATOM 3981  H HA   . CYS A 1 58 ? -0.787  17.892  9.636   1.00 0.00 ? 1102 CYS B HA   3  
ATOM 3982  H HB2  . CYS A 1 58 ? 2.056   18.750  9.038   1.00 0.00 ? 1102 CYS B HB2  3  
ATOM 3983  H HB3  . CYS A 1 58 ? 0.852   19.716  9.890   1.00 0.00 ? 1102 CYS B HB3  3  
ATOM 3984  H HG   . CYS A 1 58 ? 0.836   17.894  11.793  1.00 0.00 ? 1102 CYS B HG   3  
ATOM 3985  N N    . ASP A 1 59 ? -0.673  17.911  6.662   1.00 0.00 ? 1103 ASP B N    3  
ATOM 3986  C CA   . ASP A 1 59 ? -1.077  18.507  5.393   1.00 0.00 ? 1103 ASP B CA   3  
ATOM 3987  C C    . ASP A 1 59 ? -2.089  17.619  4.681   1.00 0.00 ? 1103 ASP B C    3  
ATOM 3988  O O    . ASP A 1 59 ? -2.091  16.402  4.857   1.00 0.00 ? 1103 ASP B O    3  
ATOM 3989  C CB   . ASP A 1 59 ? 0.146   18.705  4.494   1.00 0.00 ? 1103 ASP B CB   3  
ATOM 3990  C CG   . ASP A 1 59 ? -0.167  19.710  3.389   1.00 0.00 ? 1103 ASP B CG   3  
ATOM 3991  O OD1  . ASP A 1 59 ? -1.121  20.453  3.543   1.00 0.00 ? 1103 ASP B OD1  3  
ATOM 3992  O OD2  . ASP A 1 59 ? 0.552   19.718  2.403   1.00 0.00 ? 1103 ASP B OD2  3  
ATOM 3993  H H    . ASP A 1 59 ? -0.646  16.933  6.751   1.00 0.00 ? 1103 ASP B H    3  
ATOM 3994  H HA   . ASP A 1 59 ? -1.528  19.470  5.585   1.00 0.00 ? 1103 ASP B HA   3  
ATOM 3995  H HB2  . ASP A 1 59 ? 0.971   19.070  5.088   1.00 0.00 ? 1103 ASP B HB2  3  
ATOM 3996  H HB3  . ASP A 1 59 ? 0.418   17.758  4.049   1.00 0.00 ? 1103 ASP B HB3  3  
ATOM 3997  N N    . ILE A 1 60 ? -2.946  18.230  3.873   1.00 0.00 ? 1104 ILE B N    3  
ATOM 3998  C CA   . ILE A 1 60 ? -3.953  17.479  3.141   1.00 0.00 ? 1104 ILE B CA   3  
ATOM 3999  C C    . ILE A 1 60 ? -3.316  16.654  2.025   1.00 0.00 ? 1104 ILE B C    3  
ATOM 4000  O O    . ILE A 1 60 ? -3.839  15.611  1.637   1.00 0.00 ? 1104 ILE B O    3  
ATOM 4001  C CB   . ILE A 1 60 ? -4.985  18.443  2.549   1.00 0.00 ? 1104 ILE B CB   3  
ATOM 4002  C CG1  . ILE A 1 60 ? -4.285  19.436  1.613   1.00 0.00 ? 1104 ILE B CG1  3  
ATOM 4003  C CG2  . ILE A 1 60 ? -5.683  19.210  3.675   1.00 0.00 ? 1104 ILE B CG2  3  
ATOM 4004  C CD1  . ILE A 1 60 ? -5.332  20.297  0.903   1.00 0.00 ? 1104 ILE B CD1  3  
ATOM 4005  H H    . ILE A 1 60 ? -2.899  19.202  3.766   1.00 0.00 ? 1104 ILE B H    3  
ATOM 4006  H HA   . ILE A 1 60 ? -4.455  16.811  3.825   1.00 0.00 ? 1104 ILE B HA   3  
ATOM 4007  H HB   . ILE A 1 60 ? -5.719  17.881  1.993   1.00 0.00 ? 1104 ILE B HB   3  
ATOM 4008  H HG12 . ILE A 1 60 ? -3.625  20.071  2.186   1.00 0.00 ? 1104 ILE B HG12 3  
ATOM 4009  H HG13 . ILE A 1 60 ? -3.713  18.893  0.877   1.00 0.00 ? 1104 ILE B HG13 3  
ATOM 4010  H HG21 . ILE A 1 60 ? -6.614  19.617  3.308   1.00 0.00 ? 1104 ILE B HG21 3  
ATOM 4011  H HG22 . ILE A 1 60 ? -5.046  20.014  4.013   1.00 0.00 ? 1104 ILE B HG22 3  
ATOM 4012  H HG23 . ILE A 1 60 ? -5.883  18.538  4.497   1.00 0.00 ? 1104 ILE B HG23 3  
ATOM 4013  H HD11 . ILE A 1 60 ? -4.998  20.509  -0.102  1.00 0.00 ? 1104 ILE B HD11 3  
ATOM 4014  H HD12 . ILE A 1 60 ? -5.460  21.224  1.443   1.00 0.00 ? 1104 ILE B HD12 3  
ATOM 4015  H HD13 . ILE A 1 60 ? -6.271  19.766  0.867   1.00 0.00 ? 1104 ILE B HD13 3  
ATOM 4016  N N    . GLU A 1 61 ? -2.183  17.126  1.514   1.00 0.00 ? 1105 GLU B N    3  
ATOM 4017  C CA   . GLU A 1 61 ? -1.493  16.424  0.446   1.00 0.00 ? 1105 GLU B CA   3  
ATOM 4018  C C    . GLU A 1 61 ? -1.028  15.052  0.921   1.00 0.00 ? 1105 GLU B C    3  
ATOM 4019  O O    . GLU A 1 61 ? -1.221  14.047  0.237   1.00 0.00 ? 1105 GLU B O    3  
ATOM 4020  C CB   . GLU A 1 61 ? -0.282  17.251  -0.006  1.00 0.00 ? 1105 GLU B CB   3  
ATOM 4021  C CG   . GLU A 1 61 ? -0.758  18.507  -0.742  1.00 0.00 ? 1105 GLU B CG   3  
ATOM 4022  C CD   . GLU A 1 61 ? 0.432   19.398  -1.081  1.00 0.00 ? 1105 GLU B CD   3  
ATOM 4023  O OE1  . GLU A 1 61 ? 1.510   19.135  -0.572  1.00 0.00 ? 1105 GLU B OE1  3  
ATOM 4024  O OE2  . GLU A 1 61 ? 0.250   20.331  -1.847  1.00 0.00 ? 1105 GLU B OE2  3  
ATOM 4025  H H    . GLU A 1 61 ? -1.809  17.954  1.859   1.00 0.00 ? 1105 GLU B H    3  
ATOM 4026  H HA   . GLU A 1 61 ? -2.165  16.301  -0.390  1.00 0.00 ? 1105 GLU B HA   3  
ATOM 4027  H HB2  . GLU A 1 61 ? 0.297   17.539  0.859   1.00 0.00 ? 1105 GLU B HB2  3  
ATOM 4028  H HB3  . GLU A 1 61 ? 0.331   16.660  -0.667  1.00 0.00 ? 1105 GLU B HB3  3  
ATOM 4029  H HG2  . GLU A 1 61 ? -1.263  18.220  -1.652  1.00 0.00 ? 1105 GLU B HG2  3  
ATOM 4030  H HG3  . GLU A 1 61 ? -1.444  19.054  -0.110  1.00 0.00 ? 1105 GLU B HG3  3  
ATOM 4031  N N    . LEU A 1 62 ? -0.428  15.015  2.102   1.00 0.00 ? 1106 LEU B N    3  
ATOM 4032  C CA   . LEU A 1 62 ? 0.047   13.760  2.658   1.00 0.00 ? 1106 LEU B CA   3  
ATOM 4033  C C    . LEU A 1 62 ? -1.133  12.853  2.998   1.00 0.00 ? 1106 LEU B C    3  
ATOM 4034  O O    . LEU A 1 62 ? -1.082  11.641  2.783   1.00 0.00 ? 1106 LEU B O    3  
ATOM 4035  C CB   . LEU A 1 62 ? 0.879   14.022  3.915   1.00 0.00 ? 1106 LEU B CB   3  
ATOM 4036  C CG   . LEU A 1 62 ? 1.424   12.699  4.453   1.00 0.00 ? 1106 LEU B CG   3  
ATOM 4037  C CD1  . LEU A 1 62 ? 2.426   12.114  3.457   1.00 0.00 ? 1106 LEU B CD1  3  
ATOM 4038  C CD2  . LEU A 1 62 ? 2.121   12.945  5.791   1.00 0.00 ? 1106 LEU B CD2  3  
ATOM 4039  H H    . LEU A 1 62 ? -0.305  15.843  2.611   1.00 0.00 ? 1106 LEU B H    3  
ATOM 4040  H HA   . LEU A 1 62 ? 0.666   13.270  1.924   1.00 0.00 ? 1106 LEU B HA   3  
ATOM 4041  H HB2  . LEU A 1 62 ? 1.704   14.679  3.671   1.00 0.00 ? 1106 LEU B HB2  3  
ATOM 4042  H HB3  . LEU A 1 62 ? 0.260   14.488  4.668   1.00 0.00 ? 1106 LEU B HB3  3  
ATOM 4043  H HG   . LEU A 1 62 ? 0.606   12.005  4.586   1.00 0.00 ? 1106 LEU B HG   3  
ATOM 4044  H HD11 . LEU A 1 62 ? 3.331   11.836  3.977   1.00 0.00 ? 1106 LEU B HD11 3  
ATOM 4045  H HD12 . LEU A 1 62 ? 2.654   12.854  2.702   1.00 0.00 ? 1106 LEU B HD12 3  
ATOM 4046  H HD13 . LEU A 1 62 ? 1.997   11.242  2.988   1.00 0.00 ? 1106 LEU B HD13 3  
ATOM 4047  H HD21 . LEU A 1 62 ? 1.591   12.427  6.575   1.00 0.00 ? 1106 LEU B HD21 3  
ATOM 4048  H HD22 . LEU A 1 62 ? 2.130   14.004  6.003   1.00 0.00 ? 1106 LEU B HD22 3  
ATOM 4049  H HD23 . LEU A 1 62 ? 3.137   12.579  5.742   1.00 0.00 ? 1106 LEU B HD23 3  
ATOM 4050  N N    . LEU A 1 63 ? -2.189  13.454  3.540   1.00 0.00 ? 1107 LEU B N    3  
ATOM 4051  C CA   . LEU A 1 63 ? -3.378  12.700  3.923   1.00 0.00 ? 1107 LEU B CA   3  
ATOM 4052  C C    . LEU A 1 63 ? -3.986  12.040  2.695   1.00 0.00 ? 1107 LEU B C    3  
ATOM 4053  O O    . LEU A 1 63 ? -4.421  10.892  2.741   1.00 0.00 ? 1107 LEU B O    3  
ATOM 4054  C CB   . LEU A 1 63 ? -4.405  13.645  4.557   1.00 0.00 ? 1107 LEU B CB   3  
ATOM 4055  C CG   . LEU A 1 63 ? -3.879  14.141  5.907   1.00 0.00 ? 1107 LEU B CG   3  
ATOM 4056  C CD1  . LEU A 1 63 ? -4.732  15.315  6.388   1.00 0.00 ? 1107 LEU B CD1  3  
ATOM 4057  C CD2  . LEU A 1 63 ? -3.944  13.012  6.937   1.00 0.00 ? 1107 LEU B CD2  3  
ATOM 4058  H H    . LEU A 1 63 ? -2.161  14.420  3.692   1.00 0.00 ? 1107 LEU B H    3  
ATOM 4059  H HA   . LEU A 1 63 ? -3.104  11.942  4.638   1.00 0.00 ? 1107 LEU B HA   3  
ATOM 4060  H HB2  . LEU A 1 63 ? -4.574  14.489  3.904   1.00 0.00 ? 1107 LEU B HB2  3  
ATOM 4061  H HB3  . LEU A 1 63 ? -5.334  13.116  4.711   1.00 0.00 ? 1107 LEU B HB3  3  
ATOM 4062  H HG   . LEU A 1 63 ? -2.858  14.466  5.792   1.00 0.00 ? 1107 LEU B HG   3  
ATOM 4063  H HD11 . LEU A 1 63 ? -5.773  15.110  6.193   1.00 0.00 ? 1107 LEU B HD11 3  
ATOM 4064  H HD12 . LEU A 1 63 ? -4.435  16.212  5.859   1.00 0.00 ? 1107 LEU B HD12 3  
ATOM 4065  H HD13 . LEU A 1 63 ? -4.582  15.457  7.449   1.00 0.00 ? 1107 LEU B HD13 3  
ATOM 4066  H HD21 . LEU A 1 63 ? -2.940  12.706  7.196   1.00 0.00 ? 1107 LEU B HD21 3  
ATOM 4067  H HD22 . LEU A 1 63 ? -4.480  12.173  6.519   1.00 0.00 ? 1107 LEU B HD22 3  
ATOM 4068  H HD23 . LEU A 1 63 ? -4.453  13.361  7.823   1.00 0.00 ? 1107 LEU B HD23 3  
ATOM 4069  N N    . ALA A 1 64 ? -4.001  12.766  1.592   1.00 0.00 ? 1108 ALA B N    3  
ATOM 4070  C CA   . ALA A 1 64 ? -4.538  12.232  0.356   1.00 0.00 ? 1108 ALA B CA   3  
ATOM 4071  C C    . ALA A 1 64 ? -3.618  11.148  -0.197  1.00 0.00 ? 1108 ALA B C    3  
ATOM 4072  O O    . ALA A 1 64 ? -4.074  10.199  -0.829  1.00 0.00 ? 1108 ALA B O    3  
ATOM 4073  C CB   . ALA A 1 64 ? -4.711  13.349  -0.673  1.00 0.00 ? 1108 ALA B CB   3  
ATOM 4074  H H    . ALA A 1 64 ? -3.634  13.674  1.606   1.00 0.00 ? 1108 ALA B H    3  
ATOM 4075  H HA   . ALA A 1 64 ? -5.503  11.794  0.557   1.00 0.00 ? 1108 ALA B HA   3  
ATOM 4076  H HB1  . ALA A 1 64 ? -5.759  13.458  -0.908  1.00 0.00 ? 1108 ALA B HB1  3  
ATOM 4077  H HB2  . ALA A 1 64 ? -4.165  13.102  -1.572  1.00 0.00 ? 1108 ALA B HB2  3  
ATOM 4078  H HB3  . ALA A 1 64 ? -4.333  14.279  -0.264  1.00 0.00 ? 1108 ALA B HB3  3  
ATOM 4079  N N    . ALA A 1 65 ? -2.316  11.309  0.034   1.00 0.00 ? 1109 ALA B N    3  
ATOM 4080  C CA   . ALA A 1 65 ? -1.341  10.345  -0.459  1.00 0.00 ? 1109 ALA B CA   3  
ATOM 4081  C C    . ALA A 1 65 ? -1.530  8.978   0.190   1.00 0.00 ? 1109 ALA B C    3  
ATOM 4082  O O    . ALA A 1 65 ? -1.579  7.954   -0.494  1.00 0.00 ? 1109 ALA B O    3  
ATOM 4083  C CB   . ALA A 1 65 ? 0.066   10.852  -0.169  1.00 0.00 ? 1109 ALA B CB   3  
ATOM 4084  H H    . ALA A 1 65 ? -2.008  12.088  0.547   1.00 0.00 ? 1109 ALA B H    3  
ATOM 4085  H HA   . ALA A 1 65 ? -1.459  10.243  -1.528  1.00 0.00 ? 1109 ALA B HA   3  
ATOM 4086  H HB1  . ALA A 1 65 ? 0.306   10.676  0.869   1.00 0.00 ? 1109 ALA B HB1  3  
ATOM 4087  H HB2  . ALA A 1 65 ? 0.115   11.911  -0.372  1.00 0.00 ? 1109 ALA B HB2  3  
ATOM 4088  H HB3  . ALA A 1 65 ? 0.775   10.332  -0.798  1.00 0.00 ? 1109 ALA B HB3  3  
ATOM 4089  N N    . CYS A 1 66 ? -1.646  8.969   1.512   1.00 0.00 ? 1110 CYS B N    3  
ATOM 4090  C CA   . CYS A 1 66 ? -1.833  7.723   2.243   1.00 0.00 ? 1110 CYS B CA   3  
ATOM 4091  C C    . CYS A 1 66 ? -3.233  7.165   2.004   1.00 0.00 ? 1110 CYS B C    3  
ATOM 4092  O O    . CYS A 1 66 ? -3.406  5.963   1.819   1.00 0.00 ? 1110 CYS B O    3  
ATOM 4093  C CB   . CYS A 1 66 ? -1.609  7.956   3.738   1.00 0.00 ? 1110 CYS B CB   3  
ATOM 4094  S SG   . CYS A 1 66 ? -2.641  9.330   4.286   1.00 0.00 ? 1110 CYS B SG   3  
ATOM 4095  H H    . CYS A 1 66 ? -1.605  9.818   2.003   1.00 0.00 ? 1110 CYS B H    3  
ATOM 4096  H HA   . CYS A 1 66 ? -1.109  7.003   1.893   1.00 0.00 ? 1110 CYS B HA   3  
ATOM 4097  H HB2  . CYS A 1 66 ? -1.876  7.065   4.288   1.00 0.00 ? 1110 CYS B HB2  3  
ATOM 4098  H HB3  . CYS A 1 66 ? -0.572  8.193   3.917   1.00 0.00 ? 1110 CYS B HB3  3  
ATOM 4099  H HG   . CYS A 1 66 ? -2.959  9.788   3.503   1.00 0.00 ? 1110 CYS B HG   3  
ATOM 4100  N N    . ARG A 1 67 ? -4.228  8.047   1.995   1.00 0.00 ? 1111 ARG B N    3  
ATOM 4101  C CA   . ARG A 1 67 ? -5.601  7.625   1.765   1.00 0.00 ? 1111 ARG B CA   3  
ATOM 4102  C C    . ARG A 1 67 ? -5.737  6.994   0.385   1.00 0.00 ? 1111 ARG B C    3  
ATOM 4103  O O    . ARG A 1 67 ? -6.397  5.965   0.222   1.00 0.00 ? 1111 ARG B O    3  
ATOM 4104  C CB   . ARG A 1 67 ? -6.522  8.837   1.882   1.00 0.00 ? 1111 ARG B CB   3  
ATOM 4105  C CG   . ARG A 1 67 ? -6.644  9.251   3.351   1.00 0.00 ? 1111 ARG B CG   3  
ATOM 4106  C CD   . ARG A 1 67 ? -7.319  10.618  3.431   1.00 0.00 ? 1111 ARG B CD   3  
ATOM 4107  N NE   . ARG A 1 67 ? -7.495  11.022  4.822   1.00 0.00 ? 1111 ARG B NE   3  
ATOM 4108  C CZ   . ARG A 1 67 ? -7.859  12.264  5.148   1.00 0.00 ? 1111 ARG B CZ   3  
ATOM 4109  N NH1  . ARG A 1 67 ? -8.073  13.167  4.221   1.00 0.00 ? 1111 ARG B NH1  3  
ATOM 4110  N NH2  . ARG A 1 67 ? -8.000  12.588  6.404   1.00 0.00 ? 1111 ARG B NH2  3  
ATOM 4111  H H    . ARG A 1 67 ? -4.036  8.997   2.141   1.00 0.00 ? 1111 ARG B H    3  
ATOM 4112  H HA   . ARG A 1 67 ? -5.877  6.900   2.516   1.00 0.00 ? 1111 ARG B HA   3  
ATOM 4113  H HB2  . ARG A 1 67 ? -6.102  9.660   1.312   1.00 0.00 ? 1111 ARG B HB2  3  
ATOM 4114  H HB3  . ARG A 1 67 ? -7.499  8.591   1.495   1.00 0.00 ? 1111 ARG B HB3  3  
ATOM 4115  H HG2  . ARG A 1 67 ? -7.243  8.521   3.879   1.00 0.00 ? 1111 ARG B HG2  3  
ATOM 4116  H HG3  . ARG A 1 67 ? -5.665  9.303   3.800   1.00 0.00 ? 1111 ARG B HG3  3  
ATOM 4117  H HD2  . ARG A 1 67 ? -6.708  11.346  2.924   1.00 0.00 ? 1111 ARG B HD2  3  
ATOM 4118  H HD3  . ARG A 1 67 ? -8.284  10.564  2.947   1.00 0.00 ? 1111 ARG B HD3  3  
ATOM 4119  H HE   . ARG A 1 67 ? -7.340  10.366  5.535   1.00 0.00 ? 1111 ARG B HE   3  
ATOM 4120  H HH11 . ARG A 1 67 ? -7.964  12.935  3.255   1.00 0.00 ? 1111 ARG B HH11 3  
ATOM 4121  H HH12 . ARG A 1 67 ? -8.343  14.093  4.482   1.00 0.00 ? 1111 ARG B HH12 3  
ATOM 4122  H HH21 . ARG A 1 67 ? -7.836  11.909  7.118   1.00 0.00 ? 1111 ARG B HH21 3  
ATOM 4123  H HH22 . ARG A 1 67 ? -8.272  13.519  6.652   1.00 0.00 ? 1111 ARG B HH22 3  
ATOM 4124  N N    . GLU A 1 68 ? -5.098  7.610   -0.601  1.00 0.00 ? 1112 GLU B N    3  
ATOM 4125  C CA   . GLU A 1 68 ? -5.140  7.092   -1.959  1.00 0.00 ? 1112 GLU B CA   3  
ATOM 4126  C C    . GLU A 1 68 ? -4.474  5.726   -2.020  1.00 0.00 ? 1112 GLU B C    3  
ATOM 4127  O O    . GLU A 1 68 ? -4.984  4.804   -2.657  1.00 0.00 ? 1112 GLU B O    3  
ATOM 4128  C CB   . GLU A 1 68 ? -4.428  8.051   -2.909  1.00 0.00 ? 1112 GLU B CB   3  
ATOM 4129  C CG   . GLU A 1 68 ? -4.534  7.526   -4.344  1.00 0.00 ? 1112 GLU B CG   3  
ATOM 4130  C CD   . GLU A 1 68 ? -3.856  8.492   -5.308  1.00 0.00 ? 1112 GLU B CD   3  
ATOM 4131  O OE1  . GLU A 1 68 ? -3.324  9.488   -4.843  1.00 0.00 ? 1112 GLU B OE1  3  
ATOM 4132  O OE2  . GLU A 1 68 ? -3.878  8.225   -6.499  1.00 0.00 ? 1112 GLU B OE2  3  
ATOM 4133  H H    . GLU A 1 68 ? -4.582  8.420   -0.409  1.00 0.00 ? 1112 GLU B H    3  
ATOM 4134  H HA   . GLU A 1 68 ? -6.171  6.997   -2.266  1.00 0.00 ? 1112 GLU B HA   3  
ATOM 4135  H HB2  . GLU A 1 68 ? -4.886  9.027   -2.843  1.00 0.00 ? 1112 GLU B HB2  3  
ATOM 4136  H HB3  . GLU A 1 68 ? -3.388  8.120   -2.628  1.00 0.00 ? 1112 GLU B HB3  3  
ATOM 4137  H HG2  . GLU A 1 68 ? -4.056  6.560   -4.407  1.00 0.00 ? 1112 GLU B HG2  3  
ATOM 4138  H HG3  . GLU A 1 68 ? -5.576  7.427   -4.611  1.00 0.00 ? 1112 GLU B HG3  3  
ATOM 4139  N N    . GLU A 1 69 ? -3.330  5.601   -1.349  1.00 0.00 ? 1113 GLU B N    3  
ATOM 4140  C CA   . GLU A 1 69 ? -2.607  4.338   -1.330  1.00 0.00 ? 1113 GLU B CA   3  
ATOM 4141  C C    . GLU A 1 69 ? -3.455  3.251   -0.684  1.00 0.00 ? 1113 GLU B C    3  
ATOM 4142  O O    . GLU A 1 69 ? -3.485  2.120   -1.153  1.00 0.00 ? 1113 GLU B O    3  
ATOM 4143  C CB   . GLU A 1 69 ? -1.301  4.491   -0.549  1.00 0.00 ? 1113 GLU B CB   3  
ATOM 4144  C CG   . GLU A 1 69 ? -0.550  3.157   -0.535  1.00 0.00 ? 1113 GLU B CG   3  
ATOM 4145  C CD   . GLU A 1 69 ? 0.736   3.292   0.268   1.00 0.00 ? 1113 GLU B CD   3  
ATOM 4146  O OE1  . GLU A 1 69 ? 0.998   4.381   0.752   1.00 0.00 ? 1113 GLU B OE1  3  
ATOM 4147  O OE2  . GLU A 1 69 ? 1.438   2.303   0.391   1.00 0.00 ? 1113 GLU B OE2  3  
ATOM 4148  H H    . GLU A 1 69 ? -2.966  6.369   -0.854  1.00 0.00 ? 1113 GLU B H    3  
ATOM 4149  H HA   . GLU A 1 69 ? -2.378  4.049   -2.342  1.00 0.00 ? 1113 GLU B HA   3  
ATOM 4150  H HB2  . GLU A 1 69 ? -0.687  5.243   -1.025  1.00 0.00 ? 1113 GLU B HB2  3  
ATOM 4151  H HB3  . GLU A 1 69 ? -1.517  4.791   0.465   1.00 0.00 ? 1113 GLU B HB3  3  
ATOM 4152  H HG2  . GLU A 1 69 ? -1.173  2.398   -0.086  1.00 0.00 ? 1113 GLU B HG2  3  
ATOM 4153  H HG3  . GLU A 1 69 ? -0.308  2.871   -1.547  1.00 0.00 ? 1113 GLU B HG3  3  
ATOM 4154  N N    . PHE A 1 70 ? -4.133  3.606   0.397   1.00 0.00 ? 1114 PHE B N    3  
ATOM 4155  C CA   . PHE A 1 70 ? -4.967  2.644   1.107   1.00 0.00 ? 1114 PHE B CA   3  
ATOM 4156  C C    . PHE A 1 70 ? -6.062  2.107   0.191   1.00 0.00 ? 1114 PHE B C    3  
ATOM 4157  O O    . PHE A 1 70 ? -6.317  0.906   0.160   1.00 0.00 ? 1114 PHE B O    3  
ATOM 4158  C CB   . PHE A 1 70 ? -5.610  3.309   2.325   1.00 0.00 ? 1114 PHE B CB   3  
ATOM 4159  C CG   . PHE A 1 70 ? -4.664  3.266   3.508   1.00 0.00 ? 1114 PHE B CG   3  
ATOM 4160  C CD1  . PHE A 1 70 ? -3.276  3.263   3.304   1.00 0.00 ? 1114 PHE B CD1  3  
ATOM 4161  C CD2  . PHE A 1 70 ? -5.176  3.222   4.812   1.00 0.00 ? 1114 PHE B CD2  3  
ATOM 4162  C CE1  . PHE A 1 70 ? -2.405  3.216   4.405   1.00 0.00 ? 1114 PHE B CE1  3  
ATOM 4163  C CE2  . PHE A 1 70 ? -4.306  3.178   5.908   1.00 0.00 ? 1114 PHE B CE2  3  
ATOM 4164  C CZ   . PHE A 1 70 ? -2.922  3.173   5.703   1.00 0.00 ? 1114 PHE B CZ   3  
ATOM 4165  H H    . PHE A 1 70 ? -4.065  4.524   0.727   1.00 0.00 ? 1114 PHE B H    3  
ATOM 4166  H HA   . PHE A 1 70 ? -4.356  1.820   1.436   1.00 0.00 ? 1114 PHE B HA   3  
ATOM 4167  H HB2  . PHE A 1 70 ? -5.842  4.336   2.088   1.00 0.00 ? 1114 PHE B HB2  3  
ATOM 4168  H HB3  . PHE A 1 70 ? -6.521  2.784   2.574   1.00 0.00 ? 1114 PHE B HB3  3  
ATOM 4169  H HD1  . PHE A 1 70 ? -2.878  3.297   2.301   1.00 0.00 ? 1114 PHE B HD1  3  
ATOM 4170  H HD2  . PHE A 1 70 ? -6.245  3.226   4.973   1.00 0.00 ? 1114 PHE B HD2  3  
ATOM 4171  H HE1  . PHE A 1 70 ? -1.335  3.214   4.255   1.00 0.00 ? 1114 PHE B HE1  3  
ATOM 4172  H HE2  . PHE A 1 70 ? -4.701  3.143   6.912   1.00 0.00 ? 1114 PHE B HE2  3  
ATOM 4173  H HZ   . PHE A 1 70 ? -2.250  3.135   6.549   1.00 0.00 ? 1114 PHE B HZ   3  
ATOM 4174  N N    . HIS A 1 71 ? -6.700  2.997   -0.559  1.00 0.00 ? 1115 HIS B N    3  
ATOM 4175  C CA   . HIS A 1 71 ? -7.756  2.588   -1.467  1.00 0.00 ? 1115 HIS B CA   3  
ATOM 4176  C C    . HIS A 1 71 ? -7.211  1.619   -2.515  1.00 0.00 ? 1115 HIS B C    3  
ATOM 4177  O O    . HIS A 1 71 ? -7.808  0.577   -2.782  1.00 0.00 ? 1115 HIS B O    3  
ATOM 4178  C CB   . HIS A 1 71 ? -8.337  3.823   -2.158  1.00 0.00 ? 1115 HIS B CB   3  
ATOM 4179  C CG   . HIS A 1 71 ? -9.523  3.418   -2.976  1.00 0.00 ? 1115 HIS B CG   3  
ATOM 4180  N ND1  . HIS A 1 71 ? -10.107 4.256   -3.914  1.00 0.00 ? 1115 HIS B ND1  3  
ATOM 4181  C CD2  . HIS A 1 71 ? -10.248 2.263   -2.997  1.00 0.00 ? 1115 HIS B CD2  3  
ATOM 4182  C CE1  . HIS A 1 71 ? -11.143 3.592   -4.458  1.00 0.00 ? 1115 HIS B CE1  3  
ATOM 4183  N NE2  . HIS A 1 71 ? -11.275 2.369   -3.935  1.00 0.00 ? 1115 HIS B NE2  3  
ATOM 4184  H H    . HIS A 1 71 ? -6.460  3.942   -0.503  1.00 0.00 ? 1115 HIS B H    3  
ATOM 4185  H HA   . HIS A 1 71 ? -8.538  2.098   -0.908  1.00 0.00 ? 1115 HIS B HA   3  
ATOM 4186  H HB2  . HIS A 1 71 ? -8.640  4.544   -1.414  1.00 0.00 ? 1115 HIS B HB2  3  
ATOM 4187  H HB3  . HIS A 1 71 ? -7.588  4.260   -2.802  1.00 0.00 ? 1115 HIS B HB3  3  
ATOM 4188  H HD1  . HIS A 1 71 ? -9.818  5.166   -4.139  1.00 0.00 ? 1115 HIS B HD1  3  
ATOM 4189  H HD2  . HIS A 1 71 ? -10.049 1.403   -2.378  1.00 0.00 ? 1115 HIS B HD2  3  
ATOM 4190  H HE1  . HIS A 1 71 ? -11.789 3.998   -5.222  1.00 0.00 ? 1115 HIS B HE1  3  
ATOM 4191  N N    . ARG A 1 72 ? -6.071  1.970   -3.107  1.00 0.00 ? 1116 ARG B N    3  
ATOM 4192  C CA   . ARG A 1 72 ? -5.463  1.123   -4.128  1.00 0.00 ? 1116 ARG B CA   3  
ATOM 4193  C C    . ARG A 1 72 ? -5.026  -0.214  -3.538  1.00 0.00 ? 1116 ARG B C    3  
ATOM 4194  O O    . ARG A 1 72 ? -5.215  -1.267  -4.150  1.00 0.00 ? 1116 ARG B O    3  
ATOM 4195  C CB   . ARG A 1 72 ? -4.253  1.836   -4.730  1.00 0.00 ? 1116 ARG B CB   3  
ATOM 4196  C CG   . ARG A 1 72 ? -4.713  3.080   -5.496  1.00 0.00 ? 1116 ARG B CG   3  
ATOM 4197  C CD   . ARG A 1 72 ? -5.434  2.667   -6.779  1.00 0.00 ? 1116 ARG B CD   3  
ATOM 4198  N NE   . ARG A 1 72 ? -5.741  3.846   -7.577  1.00 0.00 ? 1116 ARG B NE   3  
ATOM 4199  C CZ   . ARG A 1 72 ? -4.812  4.443   -8.325  1.00 0.00 ? 1116 ARG B CZ   3  
ATOM 4200  N NH1  . ARG A 1 72 ? -3.580  3.992   -8.356  1.00 0.00 ? 1116 ARG B NH1  3  
ATOM 4201  N NH2  . ARG A 1 72 ? -5.130  5.489   -9.035  1.00 0.00 ? 1116 ARG B NH2  3  
ATOM 4202  H H    . ARG A 1 72 ? -5.636  2.812   -2.854  1.00 0.00 ? 1116 ARG B H    3  
ATOM 4203  H HA   . ARG A 1 72 ? -6.184  0.938   -4.907  1.00 0.00 ? 1116 ARG B HA   3  
ATOM 4204  H HB2  . ARG A 1 72 ? -3.579  2.128   -3.939  1.00 0.00 ? 1116 ARG B HB2  3  
ATOM 4205  H HB3  . ARG A 1 72 ? -3.745  1.168   -5.408  1.00 0.00 ? 1116 ARG B HB3  3  
ATOM 4206  H HG2  . ARG A 1 72 ? -5.387  3.652   -4.874  1.00 0.00 ? 1116 ARG B HG2  3  
ATOM 4207  H HG3  . ARG A 1 72 ? -3.856  3.683   -5.746  1.00 0.00 ? 1116 ARG B HG3  3  
ATOM 4208  H HD2  . ARG A 1 72 ? -4.803  2.003   -7.350  1.00 0.00 ? 1116 ARG B HD2  3  
ATOM 4209  H HD3  . ARG A 1 72 ? -6.354  2.155   -6.531  1.00 0.00 ? 1116 ARG B HD3  3  
ATOM 4210  H HE   . ARG A 1 72 ? -6.652  4.207   -7.567  1.00 0.00 ? 1116 ARG B HE   3  
ATOM 4211  H HH11 . ARG A 1 72 ? -3.319  3.193   -7.815  1.00 0.00 ? 1116 ARG B HH11 3  
ATOM 4212  H HH12 . ARG A 1 72 ? -2.896  4.453   -8.921  1.00 0.00 ? 1116 ARG B HH12 3  
ATOM 4213  H HH21 . ARG A 1 72 ? -6.065  5.841   -9.016  1.00 0.00 ? 1116 ARG B HH21 3  
ATOM 4214  H HH22 . ARG A 1 72 ? -4.436  5.941   -9.596  1.00 0.00 ? 1116 ARG B HH22 3  
ATOM 4215  N N    . ARG A 1 73 ? -4.450  -0.167  -2.343  1.00 0.00 ? 1117 ARG B N    3  
ATOM 4216  C CA   . ARG A 1 73 ? -4.002  -1.380  -1.677  1.00 0.00 ? 1117 ARG B CA   3  
ATOM 4217  C C    . ARG A 1 73 ? -5.180  -2.292  -1.367  1.00 0.00 ? 1117 ARG B C    3  
ATOM 4218  O O    . ARG A 1 73 ? -5.101  -3.505  -1.553  1.00 0.00 ? 1117 ARG B O    3  
ATOM 4219  C CB   . ARG A 1 73 ? -3.257  -1.029  -0.390  1.00 0.00 ? 1117 ARG B CB   3  
ATOM 4220  C CG   . ARG A 1 73 ? -1.858  -0.512  -0.736  1.00 0.00 ? 1117 ARG B CG   3  
ATOM 4221  C CD   . ARG A 1 73 ? -1.034  -0.431  0.548   1.00 0.00 ? 1117 ARG B CD   3  
ATOM 4222  N NE   . ARG A 1 73 ? 0.357   -0.089  0.257   1.00 0.00 ? 1117 ARG B NE   3  
ATOM 4223  C CZ   . ARG A 1 73 ? 1.347   -0.431  1.082   1.00 0.00 ? 1117 ARG B CZ   3  
ATOM 4224  N NH1  . ARG A 1 73 ? 1.116   -1.077  2.199   1.00 0.00 ? 1117 ARG B NH1  3  
ATOM 4225  N NH2  . ARG A 1 73 ? 2.565   -0.109  0.772   1.00 0.00 ? 1117 ARG B NH2  3  
ATOM 4226  H H    . ARG A 1 73 ? -4.334  0.696   -1.900  1.00 0.00 ? 1117 ARG B H    3  
ATOM 4227  H HA   . ARG A 1 73 ? -3.324  -1.904  -2.334  1.00 0.00 ? 1117 ARG B HA   3  
ATOM 4228  H HB2  . ARG A 1 73 ? -3.802  -0.256  0.143   1.00 0.00 ? 1117 ARG B HB2  3  
ATOM 4229  H HB3  . ARG A 1 73 ? -3.172  -1.906  0.233   1.00 0.00 ? 1117 ARG B HB3  3  
ATOM 4230  H HG2  . ARG A 1 73 ? -1.384  -1.194  -1.428  1.00 0.00 ? 1117 ARG B HG2  3  
ATOM 4231  H HG3  . ARG A 1 73 ? -1.928  0.465   -1.182  1.00 0.00 ? 1117 ARG B HG3  3  
ATOM 4232  H HD2  . ARG A 1 73 ? -1.457  0.322   1.192   1.00 0.00 ? 1117 ARG B HD2  3  
ATOM 4233  H HD3  . ARG A 1 73 ? -1.072  -1.388  1.046   1.00 0.00 ? 1117 ARG B HD3  3  
ATOM 4234  H HE   . ARG A 1 73 ? 0.574   0.434   -0.551  1.00 0.00 ? 1117 ARG B HE   3  
ATOM 4235  H HH11 . ARG A 1 73 ? 0.185   -1.327  2.457   1.00 0.00 ? 1117 ARG B HH11 3  
ATOM 4236  H HH12 . ARG A 1 73 ? 1.879   -1.325  2.796   1.00 0.00 ? 1117 ARG B HH12 3  
ATOM 4237  H HH21 . ARG A 1 73 ? 2.746   0.388   -0.072  1.00 0.00 ? 1117 ARG B HH21 3  
ATOM 4238  H HH22 . ARG A 1 73 ? 3.319   -0.360  1.378   1.00 0.00 ? 1117 ARG B HH22 3  
ATOM 4239  N N    . LEU A 1 74 ? -6.276  -1.704  -0.904  1.00 0.00 ? 1118 LEU B N    3  
ATOM 4240  C CA   . LEU A 1 74 ? -7.463  -2.484  -0.587  1.00 0.00 ? 1118 LEU B CA   3  
ATOM 4241  C C    . LEU A 1 74 ? -8.014  -3.157  -1.839  1.00 0.00 ? 1118 LEU B C    3  
ATOM 4242  O O    . LEU A 1 74 ? -8.442  -4.312  -1.795  1.00 0.00 ? 1118 LEU B O    3  
ATOM 4243  C CB   . LEU A 1 74 ? -8.528  -1.576  0.025   1.00 0.00 ? 1118 LEU B CB   3  
ATOM 4244  C CG   . LEU A 1 74 ? -8.100  -1.165  1.435   1.00 0.00 ? 1118 LEU B CG   3  
ATOM 4245  C CD1  . LEU A 1 74 ? -9.002  -0.033  1.933   1.00 0.00 ? 1118 LEU B CD1  3  
ATOM 4246  C CD2  . LEU A 1 74 ? -8.235  -2.365  2.374   1.00 0.00 ? 1118 LEU B CD2  3  
ATOM 4247  H H    . LEU A 1 74 ? -6.288  -0.730  -0.779  1.00 0.00 ? 1118 LEU B H    3  
ATOM 4248  H HA   . LEU A 1 74 ? -7.198  -3.246  0.131   1.00 0.00 ? 1118 LEU B HA   3  
ATOM 4249  H HB2  . LEU A 1 74 ? -8.643  -0.695  -0.587  1.00 0.00 ? 1118 LEU B HB2  3  
ATOM 4250  H HB3  . LEU A 1 74 ? -9.467  -2.106  0.076   1.00 0.00 ? 1118 LEU B HB3  3  
ATOM 4251  H HG   . LEU A 1 74 ? -7.074  -0.833  1.422   1.00 0.00 ? 1118 LEU B HG   3  
ATOM 4252  H HD11 . LEU A 1 74 ? -9.246  -0.197  2.972   1.00 0.00 ? 1118 LEU B HD11 3  
ATOM 4253  H HD12 . LEU A 1 74 ? -9.909  -0.012  1.349   1.00 0.00 ? 1118 LEU B HD12 3  
ATOM 4254  H HD13 . LEU A 1 74 ? -8.484  0.911   1.830   1.00 0.00 ? 1118 LEU B HD13 3  
ATOM 4255  H HD21 . LEU A 1 74 ? -7.254  -2.746  2.613   1.00 0.00 ? 1118 LEU B HD21 3  
ATOM 4256  H HD22 . LEU A 1 74 ? -8.813  -3.138  1.887   1.00 0.00 ? 1118 LEU B HD22 3  
ATOM 4257  H HD23 . LEU A 1 74 ? -8.735  -2.058  3.281   1.00 0.00 ? 1118 LEU B HD23 3  
ATOM 4258  N N    . LYS A 1 75 ? -8.007  -2.433  -2.952  1.00 0.00 ? 1119 LYS B N    3  
ATOM 4259  C CA   . LYS A 1 75 ? -8.513  -2.978  -4.201  1.00 0.00 ? 1119 LYS B CA   3  
ATOM 4260  C C    . LYS A 1 75 ? -7.697  -4.194  -4.623  1.00 0.00 ? 1119 LYS B C    3  
ATOM 4261  O O    . LYS A 1 75 ? -8.250  -5.217  -5.029  1.00 0.00 ? 1119 LYS B O    3  
ATOM 4262  C CB   . LYS A 1 75 ? -8.440  -1.912  -5.294  1.00 0.00 ? 1119 LYS B CB   3  
ATOM 4263  C CG   . LYS A 1 75 ? -9.131  -2.420  -6.562  1.00 0.00 ? 1119 LYS B CG   3  
ATOM 4264  C CD   . LYS A 1 75 ? -10.649 -2.307  -6.398  1.00 0.00 ? 1119 LYS B CD   3  
ATOM 4265  C CE   . LYS A 1 75 ? -11.337 -3.159  -7.459  1.00 0.00 ? 1119 LYS B CE   3  
ATOM 4266  N NZ   . LYS A 1 75 ? -11.062 -2.594  -8.809  1.00 0.00 ? 1119 LYS B NZ   3  
ATOM 4267  H H    . LYS A 1 75 ? -7.660  -1.518  -2.934  1.00 0.00 ? 1119 LYS B H    3  
ATOM 4268  H HA   . LYS A 1 75 ? -9.540  -3.273  -4.062  1.00 0.00 ? 1119 LYS B HA   3  
ATOM 4269  H HB2  . LYS A 1 75 ? -8.930  -1.011  -4.952  1.00 0.00 ? 1119 LYS B HB2  3  
ATOM 4270  H HB3  . LYS A 1 75 ? -7.405  -1.698  -5.513  1.00 0.00 ? 1119 LYS B HB3  3  
ATOM 4271  H HG2  . LYS A 1 75 ? -8.815  -1.823  -7.406  1.00 0.00 ? 1119 LYS B HG2  3  
ATOM 4272  H HG3  . LYS A 1 75 ? -8.864  -3.452  -6.731  1.00 0.00 ? 1119 LYS B HG3  3  
ATOM 4273  H HD2  . LYS A 1 75 ? -10.936 -2.656  -5.419  1.00 0.00 ? 1119 LYS B HD2  3  
ATOM 4274  H HD3  . LYS A 1 75 ? -10.949 -1.278  -6.516  1.00 0.00 ? 1119 LYS B HD3  3  
ATOM 4275  H HE2  . LYS A 1 75 ? -10.959 -4.168  -7.405  1.00 0.00 ? 1119 LYS B HE2  3  
ATOM 4276  H HE3  . LYS A 1 75 ? -12.401 -3.161  -7.278  1.00 0.00 ? 1119 LYS B HE3  3  
ATOM 4277  H HZ1  . LYS A 1 75 ? -10.124 -2.906  -9.131  1.00 0.00 ? 1119 LYS B HZ1  3  
ATOM 4278  H HZ2  . LYS A 1 75 ? -11.085 -1.555  -8.762  1.00 0.00 ? 1119 LYS B HZ2  3  
ATOM 4279  H HZ3  . LYS A 1 75 ? -11.783 -2.927  -9.479  1.00 0.00 ? 1119 LYS B HZ3  3  
ATOM 4280  N N    . VAL A 1 76 ? -6.376  -4.078  -4.524  1.00 0.00 ? 1120 VAL B N    3  
ATOM 4281  C CA   . VAL A 1 76 ? -5.495  -5.174  -4.898  1.00 0.00 ? 1120 VAL B CA   3  
ATOM 4282  C C    . VAL A 1 76 ? -5.727  -6.370  -3.985  1.00 0.00 ? 1120 VAL B C    3  
ATOM 4283  O O    . VAL A 1 76 ? -5.732  -7.517  -4.431  1.00 0.00 ? 1120 VAL B O    3  
ATOM 4284  C CB   . VAL A 1 76 ? -4.033  -4.727  -4.807  1.00 0.00 ? 1120 VAL B CB   3  
ATOM 4285  C CG1  . VAL A 1 76 ? -3.112  -5.935  -5.010  1.00 0.00 ? 1120 VAL B CG1  3  
ATOM 4286  C CG2  . VAL A 1 76 ? -3.751  -3.687  -5.892  1.00 0.00 ? 1120 VAL B CG2  3  
ATOM 4287  H H    . VAL A 1 76 ? -5.987  -3.244  -4.192  1.00 0.00 ? 1120 VAL B H    3  
ATOM 4288  H HA   . VAL A 1 76 ? -5.708  -5.463  -5.917  1.00 0.00 ? 1120 VAL B HA   3  
ATOM 4289  H HB   . VAL A 1 76 ? -3.850  -4.296  -3.833  1.00 0.00 ? 1120 VAL B HB   3  
ATOM 4290  H HG11 . VAL A 1 76 ? -3.249  -6.636  -4.202  1.00 0.00 ? 1120 VAL B HG11 3  
ATOM 4291  H HG12 . VAL A 1 76 ? -2.086  -5.604  -5.028  1.00 0.00 ? 1120 VAL B HG12 3  
ATOM 4292  H HG13 . VAL A 1 76 ? -3.352  -6.415  -5.947  1.00 0.00 ? 1120 VAL B HG13 3  
ATOM 4293  H HG21 . VAL A 1 76 ? -4.597  -3.022  -5.981  1.00 0.00 ? 1120 VAL B HG21 3  
ATOM 4294  H HG22 . VAL A 1 76 ? -3.585  -4.187  -6.834  1.00 0.00 ? 1120 VAL B HG22 3  
ATOM 4295  H HG23 . VAL A 1 76 ? -2.872  -3.118  -5.627  1.00 0.00 ? 1120 VAL B HG23 3  
ATOM 4296  N N    . TYR A 1 77 ? -5.910  -6.090  -2.701  1.00 0.00 ? 1121 TYR B N    3  
ATOM 4297  C CA   . TYR A 1 77 ? -6.132  -7.147  -1.720  1.00 0.00 ? 1121 TYR B CA   3  
ATOM 4298  C C    . TYR A 1 77 ? -7.370  -7.955  -2.080  1.00 0.00 ? 1121 TYR B C    3  
ATOM 4299  O O    . TYR A 1 77 ? -7.342  -9.187  -2.082  1.00 0.00 ? 1121 TYR B O    3  
ATOM 4300  C CB   . TYR A 1 77 ? -6.295  -6.544  -0.324  1.00 0.00 ? 1121 TYR B CB   3  
ATOM 4301  C CG   . TYR A 1 77 ? -6.554  -7.645  0.675   1.00 0.00 ? 1121 TYR B CG   3  
ATOM 4302  C CD1  . TYR A 1 77 ? -5.502  -8.471  1.091   1.00 0.00 ? 1121 TYR B CD1  3  
ATOM 4303  C CD2  . TYR A 1 77 ? -7.841  -7.840  1.187   1.00 0.00 ? 1121 TYR B CD2  3  
ATOM 4304  C CE1  . TYR A 1 77 ? -5.739  -9.491  2.019   1.00 0.00 ? 1121 TYR B CE1  3  
ATOM 4305  C CE2  . TYR A 1 77 ? -8.077  -8.860  2.116   1.00 0.00 ? 1121 TYR B CE2  3  
ATOM 4306  C CZ   . TYR A 1 77 ? -7.026  -9.685  2.531   1.00 0.00 ? 1121 TYR B CZ   3  
ATOM 4307  O OH   . TYR A 1 77 ? -7.260  -10.690 3.444   1.00 0.00 ? 1121 TYR B OH   3  
ATOM 4308  H H    . TYR A 1 77 ? -5.895  -5.154  -2.408  1.00 0.00 ? 1121 TYR B H    3  
ATOM 4309  H HA   . TYR A 1 77 ? -5.277  -7.807  -1.716  1.00 0.00 ? 1121 TYR B HA   3  
ATOM 4310  H HB2  . TYR A 1 77 ? -5.395  -6.015  -0.053  1.00 0.00 ? 1121 TYR B HB2  3  
ATOM 4311  H HB3  . TYR A 1 77 ? -7.130  -5.857  -0.323  1.00 0.00 ? 1121 TYR B HB3  3  
ATOM 4312  H HD1  . TYR A 1 77 ? -4.508  -8.321  0.696   1.00 0.00 ? 1121 TYR B HD1  3  
ATOM 4313  H HD2  . TYR A 1 77 ? -8.652  -7.203  0.868   1.00 0.00 ? 1121 TYR B HD2  3  
ATOM 4314  H HE1  . TYR A 1 77 ? -4.928  -10.128 2.339   1.00 0.00 ? 1121 TYR B HE1  3  
ATOM 4315  H HE2  . TYR A 1 77 ? -9.070  -9.011  2.511   1.00 0.00 ? 1121 TYR B HE2  3  
ATOM 4316  H HH   . TYR A 1 77 ? -6.857  -10.434 4.275   1.00 0.00 ? 1121 TYR B HH   3  
ATOM 4317  N N    . HIS A 1 78 ? -8.452  -7.254  -2.388  1.00 0.00 ? 1122 HIS B N    3  
ATOM 4318  C CA   . HIS A 1 78 ? -9.694  -7.920  -2.753  1.00 0.00 ? 1122 HIS B CA   3  
ATOM 4319  C C    . HIS A 1 78 ? -9.504  -8.739  -4.025  1.00 0.00 ? 1122 HIS B C    3  
ATOM 4320  O O    . HIS A 1 78 ? -9.988  -9.865  -4.130  1.00 0.00 ? 1122 HIS B O    3  
ATOM 4321  C CB   . HIS A 1 78 ? -10.796 -6.881  -2.968  1.00 0.00 ? 1122 HIS B CB   3  
ATOM 4322  C CG   . HIS A 1 78 ? -11.246 -6.342  -1.637  1.00 0.00 ? 1122 HIS B CG   3  
ATOM 4323  N ND1  . HIS A 1 78 ? -12.134 -5.283  -1.533  1.00 0.00 ? 1122 HIS B ND1  3  
ATOM 4324  C CD2  . HIS A 1 78 ? -10.941 -6.708  -0.350  1.00 0.00 ? 1122 HIS B CD2  3  
ATOM 4325  C CE1  . HIS A 1 78 ? -12.332 -5.050  -0.221  1.00 0.00 ? 1122 HIS B CE1  3  
ATOM 4326  N NE2  . HIS A 1 78 ? -11.630 -5.890  0.543   1.00 0.00 ? 1122 HIS B NE2  3  
ATOM 4327  H H    . HIS A 1 78 ? -8.412  -6.275  -2.375  1.00 0.00 ? 1122 HIS B H    3  
ATOM 4328  H HA   . HIS A 1 78 ? -9.989  -8.581  -1.951  1.00 0.00 ? 1122 HIS B HA   3  
ATOM 4329  H HB2  . HIS A 1 78 ? -10.409 -6.073  -3.571  1.00 0.00 ? 1122 HIS B HB2  3  
ATOM 4330  H HB3  . HIS A 1 78 ? -11.632 -7.341  -3.472  1.00 0.00 ? 1122 HIS B HB3  3  
ATOM 4331  H HD1  . HIS A 1 78 ? -12.544 -4.795  -2.276  1.00 0.00 ? 1122 HIS B HD1  3  
ATOM 4332  H HD2  . HIS A 1 78 ? -10.273 -7.508  -0.071  1.00 0.00 ? 1122 HIS B HD2  3  
ATOM 4333  H HE1  . HIS A 1 78 ? -12.981 -4.278  0.165   1.00 0.00 ? 1122 HIS B HE1  3  
ATOM 4334  N N    . ALA A 1 79 ? -8.788  -8.170  -4.988  1.00 0.00 ? 1123 ALA B N    3  
ATOM 4335  C CA   . ALA A 1 79 ? -8.534  -8.865  -6.243  1.00 0.00 ? 1123 ALA B CA   3  
ATOM 4336  C C    . ALA A 1 79 ? -7.721  -10.137 -6.003  1.00 0.00 ? 1123 ALA B C    3  
ATOM 4337  O O    . ALA A 1 79 ? -7.995  -11.179 -6.601  1.00 0.00 ? 1123 ALA B O    3  
ATOM 4338  C CB   . ALA A 1 79 ? -7.781  -7.946  -7.206  1.00 0.00 ? 1123 ALA B CB   3  
ATOM 4339  H H    . ALA A 1 79 ? -8.421  -7.272  -4.851  1.00 0.00 ? 1123 ALA B H    3  
ATOM 4340  H HA   . ALA A 1 79 ? -9.481  -9.134  -6.689  1.00 0.00 ? 1123 ALA B HA   3  
ATOM 4341  H HB1  . ALA A 1 79 ? -6.763  -7.825  -6.867  1.00 0.00 ? 1123 ALA B HB1  3  
ATOM 4342  H HB2  . ALA A 1 79 ? -8.268  -6.982  -7.238  1.00 0.00 ? 1123 ALA B HB2  3  
ATOM 4343  H HB3  . ALA A 1 79 ? -7.782  -8.381  -8.195  1.00 0.00 ? 1123 ALA B HB3  3  
ATOM 4344  N N    . TRP A 1 80 ? -6.722  -10.055 -5.123  1.00 0.00 ? 1124 TRP B N    3  
ATOM 4345  C CA   . TRP A 1 80 ? -5.890  -11.200 -4.822  1.00 0.00 ? 1124 TRP B CA   3  
ATOM 4346  C C    . TRP A 1 80 ? -6.733  -12.331 -4.253  1.00 0.00 ? 1124 TRP B C    3  
ATOM 4347  O O    . TRP A 1 80 ? -6.603  -13.484 -4.666  1.00 0.00 ? 1124 TRP B O    3  
ATOM 4348  C CB   . TRP A 1 80 ? -4.808  -10.788 -3.824  1.00 0.00 ? 1124 TRP B CB   3  
ATOM 4349  C CG   . TRP A 1 80 ? -4.015  -11.984 -3.445  1.00 0.00 ? 1124 TRP B CG   3  
ATOM 4350  C CD1  . TRP A 1 80 ? -3.096  -12.568 -4.231  1.00 0.00 ? 1124 TRP B CD1  3  
ATOM 4351  C CD2  . TRP A 1 80 ? -4.022  -12.723 -2.197  1.00 0.00 ? 1124 TRP B CD2  3  
ATOM 4352  N NE1  . TRP A 1 80 ? -2.554  -13.650 -3.560  1.00 0.00 ? 1124 TRP B NE1  3  
ATOM 4353  C CE2  . TRP A 1 80 ? -3.091  -13.783 -2.294  1.00 0.00 ? 1124 TRP B CE2  3  
ATOM 4354  C CE3  . TRP A 1 80 ? -4.748  -12.581 -1.008  1.00 0.00 ? 1124 TRP B CE3  3  
ATOM 4355  C CZ2  . TRP A 1 80 ? -2.889  -14.675 -1.239  1.00 0.00 ? 1124 TRP B CZ2  3  
ATOM 4356  C CZ3  . TRP A 1 80 ? -4.545  -13.471 0.058   1.00 0.00 ? 1124 TRP B CZ3  3  
ATOM 4357  C CH2  . TRP A 1 80 ? -3.618  -14.518 -0.057  1.00 0.00 ? 1124 TRP B CH2  3  
ATOM 4358  H H    . TRP A 1 80 ? -6.538  -9.211  -4.669  1.00 0.00 ? 1124 TRP B H    3  
ATOM 4359  H HA   . TRP A 1 80 ? -5.414  -11.540 -5.729  1.00 0.00 ? 1124 TRP B HA   3  
ATOM 4360  H HB2  . TRP A 1 80 ? -4.159  -10.057 -4.282  1.00 0.00 ? 1124 TRP B HB2  3  
ATOM 4361  H HB3  . TRP A 1 80 ? -5.268  -10.363 -2.945  1.00 0.00 ? 1124 TRP B HB3  3  
ATOM 4362  H HD1  . TRP A 1 80 ? -2.850  -12.250 -5.231  1.00 0.00 ? 1124 TRP B HD1  3  
ATOM 4363  H HE1  . TRP A 1 80 ? -1.866  -14.254 -3.917  1.00 0.00 ? 1124 TRP B HE1  3  
ATOM 4364  H HE3  . TRP A 1 80 ? -5.465  -11.776 -0.912  1.00 0.00 ? 1124 TRP B HE3  3  
ATOM 4365  H HZ2  . TRP A 1 80 ? -2.175  -15.482 -1.335  1.00 0.00 ? 1124 TRP B HZ2  3  
ATOM 4366  H HZ3  . TRP A 1 80 ? -5.099  -13.344 0.971   1.00 0.00 ? 1124 TRP B HZ3  3  
ATOM 4367  H HH2  . TRP A 1 80 ? -3.466  -15.199 0.766   1.00 0.00 ? 1124 TRP B HH2  3  
ATOM 4368  N N    . LYS A 1 81 ? -7.605  -11.990 -3.311  1.00 0.00 ? 1125 LYS B N    3  
ATOM 4369  C CA   . LYS A 1 81 ? -8.482  -12.980 -2.699  1.00 0.00 ? 1125 LYS B CA   3  
ATOM 4370  C C    . LYS A 1 81 ? -9.393  -13.601 -3.739  1.00 0.00 ? 1125 LYS B C    3  
ATOM 4371  O O    . LYS A 1 81 ? -9.656  -14.796 -3.707  1.00 0.00 ? 1125 LYS B O    3  
ATOM 4372  C CB   . LYS A 1 81 ? -9.326  -12.326 -1.605  1.00 0.00 ? 1125 LYS B CB   3  
ATOM 4373  C CG   . LYS A 1 81 ? -8.447  -11.962 -0.406  1.00 0.00 ? 1125 LYS B CG   3  
ATOM 4374  C CD   . LYS A 1 81 ? -8.008  -13.243 0.298   1.00 0.00 ? 1125 LYS B CD   3  
ATOM 4375  C CE   . LYS A 1 81 ? -7.387  -12.892 1.653   1.00 0.00 ? 1125 LYS B CE   3  
ATOM 4376  N NZ   . LYS A 1 81 ? -6.872  -14.130 2.306   1.00 0.00 ? 1125 LYS B NZ   3  
ATOM 4377  H H    . LYS A 1 81 ? -7.662  -11.052 -3.028  1.00 0.00 ? 1125 LYS B H    3  
ATOM 4378  H HA   . LYS A 1 81 ? -7.887  -13.762 -2.267  1.00 0.00 ? 1125 LYS B HA   3  
ATOM 4379  H HB2  . LYS A 1 81 ? -9.787  -11.430 -1.996  1.00 0.00 ? 1125 LYS B HB2  3  
ATOM 4380  H HB3  . LYS A 1 81 ? -10.093 -13.015 -1.287  1.00 0.00 ? 1125 LYS B HB3  3  
ATOM 4381  H HG2  . LYS A 1 81 ? -7.574  -11.423 -0.749  1.00 0.00 ? 1125 LYS B HG2  3  
ATOM 4382  H HG3  . LYS A 1 81 ? -9.004  -11.345 0.282   1.00 0.00 ? 1125 LYS B HG3  3  
ATOM 4383  H HD2  . LYS A 1 81 ? -8.867  -13.879 0.444   1.00 0.00 ? 1125 LYS B HD2  3  
ATOM 4384  H HD3  . LYS A 1 81 ? -7.279  -13.752 -0.310  1.00 0.00 ? 1125 LYS B HD3  3  
ATOM 4385  H HE2  . LYS A 1 81 ? -6.576  -12.194 1.509   1.00 0.00 ? 1125 LYS B HE2  3  
ATOM 4386  H HE3  . LYS A 1 81 ? -8.142  -12.443 2.282   1.00 0.00 ? 1125 LYS B HE3  3  
ATOM 4387  H HZ1  . LYS A 1 81 ? -7.648  -14.607 2.807   1.00 0.00 ? 1125 LYS B HZ1  3  
ATOM 4388  H HZ2  . LYS A 1 81 ? -6.123  -13.877 2.984   1.00 0.00 ? 1125 LYS B HZ2  3  
ATOM 4389  H HZ3  . LYS A 1 81 ? -6.483  -14.769 1.583   1.00 0.00 ? 1125 LYS B HZ3  3  
ATOM 4390  N N    . SER A 1 82 ? -9.867  -12.779 -4.657  1.00 0.00 ? 1126 SER B N    3  
ATOM 4391  C CA   . SER A 1 82 ? -10.750 -13.262 -5.714  1.00 0.00 ? 1126 SER B CA   3  
ATOM 4392  C C    . SER A 1 82 ? -10.019 -14.273 -6.590  1.00 0.00 ? 1126 SER B C    3  
ATOM 4393  O O    . SER A 1 82 ? -10.589 -15.275 -7.002  1.00 0.00 ? 1126 SER B O    3  
ATOM 4394  C CB   . SER A 1 82 ? -11.232 -12.098 -6.576  1.00 0.00 ? 1126 SER B CB   3  
ATOM 4395  O OG   . SER A 1 82 ? -12.040 -11.233 -5.791  1.00 0.00 ? 1126 SER B OG   3  
ATOM 4396  H H    . SER A 1 82 ? -9.616  -11.837 -4.625  1.00 0.00 ? 1126 SER B H    3  
ATOM 4397  H HA   . SER A 1 82 ? -11.605 -13.744 -5.265  1.00 0.00 ? 1126 SER B HA   3  
ATOM 4398  H HB2  . SER A 1 82 ? -10.385 -11.550 -6.952  1.00 0.00 ? 1126 SER B HB2  3  
ATOM 4399  H HB3  . SER A 1 82 ? -11.805 -12.485 -7.409  1.00 0.00 ? 1126 SER B HB3  3  
ATOM 4400  H HG   . SER A 1 82 ? -12.939 -11.570 -5.809  1.00 0.00 ? 1126 SER B HG   3  
ATOM 4401  N N    . LYS A 1 83 ? -8.755  -14.001 -6.889  1.00 0.00 ? 1127 LYS B N    3  
ATOM 4402  C CA   . LYS A 1 83 ? -7.980  -14.910 -7.727  1.00 0.00 ? 1127 LYS B CA   3  
ATOM 4403  C C    . LYS A 1 83 ? -7.765  -16.254 -7.031  1.00 0.00 ? 1127 LYS B C    3  
ATOM 4404  O O    . LYS A 1 83 ? -7.926  -17.313 -7.636  1.00 0.00 ? 1127 LYS B O    3  
ATOM 4405  C CB   . LYS A 1 83 ? -6.625  -14.285 -8.028  1.00 0.00 ? 1127 LYS B CB   3  
ATOM 4406  C CG   . LYS A 1 83 ? -6.812  -13.101 -8.969  1.00 0.00 ? 1127 LYS B CG   3  
ATOM 4407  C CD   . LYS A 1 83 ? -5.479  -12.374 -9.152  1.00 0.00 ? 1127 LYS B CD   3  
ATOM 4408  C CE   . LYS A 1 83 ? -4.528  -13.231 -9.991  1.00 0.00 ? 1127 LYS B CE   3  
ATOM 4409  N NZ   . LYS A 1 83 ? -5.114  -13.441 -11.346 1.00 0.00 ? 1127 LYS B NZ   3  
ATOM 4410  H H    . LYS A 1 83 ? -8.341  -13.181 -6.546  1.00 0.00 ? 1127 LYS B H    3  
ATOM 4411  H HA   . LYS A 1 83 ? -8.503  -15.071 -8.656  1.00 0.00 ? 1127 LYS B HA   3  
ATOM 4412  H HB2  . LYS A 1 83 ? -6.182  -13.944 -7.103  1.00 0.00 ? 1127 LYS B HB2  3  
ATOM 4413  H HB3  . LYS A 1 83 ? -5.985  -15.018 -8.489  1.00 0.00 ? 1127 LYS B HB3  3  
ATOM 4414  H HG2  . LYS A 1 83 ? -7.166  -13.456 -9.927  1.00 0.00 ? 1127 LYS B HG2  3  
ATOM 4415  H HG3  . LYS A 1 83 ? -7.536  -12.421 -8.548  1.00 0.00 ? 1127 LYS B HG3  3  
ATOM 4416  H HD2  . LYS A 1 83 ? -5.650  -11.431 -9.650  1.00 0.00 ? 1127 LYS B HD2  3  
ATOM 4417  H HD3  . LYS A 1 83 ? -5.036  -12.194 -8.183  1.00 0.00 ? 1127 LYS B HD3  3  
ATOM 4418  H HE2  . LYS A 1 83 ? -3.578  -12.725 -10.086 1.00 0.00 ? 1127 LYS B HE2  3  
ATOM 4419  H HE3  . LYS A 1 83 ? -4.378  -14.186 -9.509  1.00 0.00 ? 1127 LYS B HE3  3  
ATOM 4420  H HZ1  . LYS A 1 83 ? -5.781  -14.240 -11.315 1.00 0.00 ? 1127 LYS B HZ1  3  
ATOM 4421  H HZ2  . LYS A 1 83 ? -4.353  -13.651 -12.024 1.00 0.00 ? 1127 LYS B HZ2  3  
ATOM 4422  H HZ3  . LYS A 1 83 ? -5.618  -12.583 -11.643 1.00 0.00 ? 1127 LYS B HZ3  3  
ATOM 4423  N N    . ASN A 1 84 ? -7.392  -16.198 -5.755  1.00 0.00 ? 1128 ASN B N    3  
ATOM 4424  C CA   . ASN A 1 84 ? -7.148  -17.414 -4.977  1.00 0.00 ? 1128 ASN B CA   3  
ATOM 4425  C C    . ASN A 1 84 ? -8.450  -18.154 -4.671  1.00 0.00 ? 1128 ASN B C    3  
ATOM 4426  O O    . ASN A 1 84 ? -8.495  -19.384 -4.681  1.00 0.00 ? 1128 ASN B O    3  
ATOM 4427  C CB   . ASN A 1 84 ? -6.449  -17.056 -3.669  1.00 0.00 ? 1128 ASN B CB   3  
ATOM 4428  C CG   . ASN A 1 84 ? -4.978  -16.765 -3.936  1.00 0.00 ? 1128 ASN B CG   3  
ATOM 4429  O OD1  . ASN A 1 84 ? -4.135  -17.652 -3.805  1.00 0.00 ? 1128 ASN B OD1  3  
ATOM 4430  N ND2  . ASN A 1 84 ? -4.623  -15.578 -4.347  1.00 0.00 ? 1128 ASN B ND2  3  
ATOM 4431  H H    . ASN A 1 84 ? -7.276  -15.321 -5.329  1.00 0.00 ? 1128 ASN B H    3  
ATOM 4432  H HA   . ASN A 1 84 ? -6.504  -18.067 -5.545  1.00 0.00 ? 1128 ASN B HA   3  
ATOM 4433  H HB2  . ASN A 1 84 ? -6.919  -16.185 -3.235  1.00 0.00 ? 1128 ASN B HB2  3  
ATOM 4434  H HB3  . ASN A 1 84 ? -6.529  -17.887 -2.983  1.00 0.00 ? 1128 ASN B HB3  3  
ATOM 4435  H HD21 . ASN A 1 84 ? -5.300  -14.881 -4.484  1.00 0.00 ? 1128 ASN B HD21 3  
ATOM 4436  H HD22 . ASN A 1 84 ? -3.678  -15.383 -4.520  1.00 0.00 ? 1128 ASN B HD22 3  
ATOM 4437  N N    . LYS A 1 85 ? -9.502  -17.395 -4.389  1.00 0.00 ? 1129 LYS B N    3  
ATOM 4438  C CA   . LYS A 1 85 ? -10.796 -17.982 -4.062  1.00 0.00 ? 1129 LYS B CA   3  
ATOM 4439  C C    . LYS A 1 85 ? -11.586 -18.289 -5.327  1.00 0.00 ? 1129 LYS B C    3  
ATOM 4440  O O    . LYS A 1 85 ? -11.815 -19.450 -5.663  1.00 0.00 ? 1129 LYS B O    3  
ATOM 4441  C CB   . LYS A 1 85 ? -11.595 -17.014 -3.182  1.00 0.00 ? 1129 LYS B CB   3  
ATOM 4442  C CG   . LYS A 1 85 ? -10.951 -16.922 -1.796  1.00 0.00 ? 1129 LYS B CG   3  
ATOM 4443  C CD   . LYS A 1 85 ? -11.749 -15.946 -0.925  1.00 0.00 ? 1129 LYS B CD   3  
ATOM 4444  C CE   . LYS A 1 85 ? -11.112 -15.862 0.465   1.00 0.00 ? 1129 LYS B CE   3  
ATOM 4445  N NZ   . LYS A 1 85 ? -11.221 -17.186 1.142   1.00 0.00 ? 1129 LYS B NZ   3  
ATOM 4446  H H    . LYS A 1 85 ? -9.401  -16.422 -4.392  1.00 0.00 ? 1129 LYS B H    3  
ATOM 4447  H HA   . LYS A 1 85 ? -10.639 -18.899 -3.516  1.00 0.00 ? 1129 LYS B HA   3  
ATOM 4448  H HB2  . LYS A 1 85 ? -11.603 -16.035 -3.641  1.00 0.00 ? 1129 LYS B HB2  3  
ATOM 4449  H HB3  . LYS A 1 85 ? -12.608 -17.371 -3.084  1.00 0.00 ? 1129 LYS B HB3  3  
ATOM 4450  H HG2  . LYS A 1 85 ? -10.949 -17.898 -1.335  1.00 0.00 ? 1129 LYS B HG2  3  
ATOM 4451  H HG3  . LYS A 1 85 ? -9.936  -16.565 -1.892  1.00 0.00 ? 1129 LYS B HG3  3  
ATOM 4452  H HD2  . LYS A 1 85 ? -11.746 -14.968 -1.382  1.00 0.00 ? 1129 LYS B HD2  3  
ATOM 4453  H HD3  . LYS A 1 85 ? -12.766 -16.297 -0.831  1.00 0.00 ? 1129 LYS B HD3  3  
ATOM 4454  H HE2  . LYS A 1 85 ? -10.072 -15.594 0.369   1.00 0.00 ? 1129 LYS B HE2  3  
ATOM 4455  H HE3  . LYS A 1 85 ? -11.625 -15.115 1.053   1.00 0.00 ? 1129 LYS B HE3  3  
ATOM 4456  H HZ1  . LYS A 1 85 ? -11.276 -17.046 2.170   1.00 0.00 ? 1129 LYS B HZ1  3  
ATOM 4457  H HZ2  . LYS A 1 85 ? -10.385 -17.761 0.913   1.00 0.00 ? 1129 LYS B HZ2  3  
ATOM 4458  H HZ3  . LYS A 1 85 ? -12.078 -17.674 0.815   1.00 0.00 ? 1129 LYS B HZ3  3  
ATOM 4459  N N    . LYS A 1 86 ? -11.988 -17.239 -6.027  1.00 0.00 ? 1130 LYS B N    3  
ATOM 4460  C CA   . LYS A 1 86 ? -12.747 -17.402 -7.263  1.00 0.00 ? 1130 LYS B CA   3  
ATOM 4461  C C    . LYS A 1 86 ? -11.828 -17.840 -8.397  1.00 0.00 ? 1130 LYS B C    3  
ATOM 4462  O O    . LYS A 1 86 ? -10.770 -17.249 -8.615  1.00 0.00 ? 1130 LYS B O    3  
ATOM 4463  C CB   . LYS A 1 86 ? -13.435 -16.088 -7.642  1.00 0.00 ? 1130 LYS B CB   3  
ATOM 4464  C CG   . LYS A 1 86 ? -14.377 -16.330 -8.821  1.00 0.00 ? 1130 LYS B CG   3  
ATOM 4465  C CD   . LYS A 1 86 ? -15.198 -15.067 -9.078  1.00 0.00 ? 1130 LYS B CD   3  
ATOM 4466  C CE   . LYS A 1 86 ? -14.297 -13.978 -9.667  1.00 0.00 ? 1130 LYS B CE   3  
ATOM 4467  N NZ   . LYS A 1 86 ? -15.119 -12.777 -9.994  1.00 0.00 ? 1130 LYS B NZ   3  
ATOM 4468  H H    . LYS A 1 86 ? -11.764 -16.336 -5.708  1.00 0.00 ? 1130 LYS B H    3  
ATOM 4469  H HA   . LYS A 1 86 ? -13.501 -18.159 -7.112  1.00 0.00 ? 1130 LYS B HA   3  
ATOM 4470  H HB2  . LYS A 1 86 ? -14.000 -15.721 -6.797  1.00 0.00 ? 1130 LYS B HB2  3  
ATOM 4471  H HB3  . LYS A 1 86 ? -12.692 -15.358 -7.921  1.00 0.00 ? 1130 LYS B HB3  3  
ATOM 4472  H HG2  . LYS A 1 86 ? -13.798 -16.572 -9.701  1.00 0.00 ? 1130 LYS B HG2  3  
ATOM 4473  H HG3  . LYS A 1 86 ? -15.041 -17.149 -8.591  1.00 0.00 ? 1130 LYS B HG3  3  
ATOM 4474  H HD2  . LYS A 1 86 ? -15.996 -15.291 -9.771  1.00 0.00 ? 1130 LYS B HD2  3  
ATOM 4475  H HD3  . LYS A 1 86 ? -15.614 -14.719 -8.145  1.00 0.00 ? 1130 LYS B HD3  3  
ATOM 4476  H HE2  . LYS A 1 86 ? -13.539 -13.710 -8.946  1.00 0.00 ? 1130 LYS B HE2  3  
ATOM 4477  H HE3  . LYS A 1 86 ? -13.826 -14.347 -10.566 1.00 0.00 ? 1130 LYS B HE3  3  
ATOM 4478  H HZ1  . LYS A 1 86 ? -16.121 -13.048 -10.053 1.00 0.00 ? 1130 LYS B HZ1  3  
ATOM 4479  H HZ2  . LYS A 1 86 ? -14.811 -12.386 -10.908 1.00 0.00 ? 1130 LYS B HZ2  3  
ATOM 4480  H HZ3  . LYS A 1 86 ? -14.999 -12.062 -9.250  1.00 0.00 ? 1130 LYS B HZ3  3  
ATOM 4481  N N    . ARG A 1 87 ? -12.237 -18.880 -9.114  1.00 0.00 ? 1131 ARG B N    3  
ATOM 4482  C CA   . ARG A 1 87 ? -11.441 -19.393 -10.224 1.00 0.00 ? 1131 ARG B CA   3  
ATOM 4483  C C    . ARG A 1 87 ? -12.153 -20.562 -10.901 1.00 0.00 ? 1131 ARG B C    3  
ATOM 4484  O O    . ARG A 1 87 ? -13.364 -20.647 -10.776 1.00 0.00 ? 1131 ARG B O    3  
ATOM 4485  C CB   . ARG A 1 87 ? -10.071 -19.856 -9.719  1.00 0.00 ? 1131 ARG B CB   3  
ATOM 4486  C CG   . ARG A 1 87 ? -10.254 -20.803 -8.532  1.00 0.00 ? 1131 ARG B CG   3  
ATOM 4487  C CD   . ARG A 1 87 ? -8.889  -21.181 -7.960  1.00 0.00 ? 1131 ARG B CD   3  
ATOM 4488  N NE   . ARG A 1 87 ? -8.127  -21.929 -8.951  1.00 0.00 ? 1131 ARG B NE   3  
ATOM 4489  C CZ   . ARG A 1 87 ? -8.341  -23.231 -9.159  1.00 0.00 ? 1131 ARG B CZ   3  
ATOM 4490  N NH1  . ARG A 1 87 ? -9.261  -23.879 -8.484  1.00 0.00 ? 1131 ARG B NH1  3  
ATOM 4491  N NH2  . ARG A 1 87 ? -7.629  -23.869 -10.047 1.00 0.00 ? 1131 ARG B NH2  3  
ATOM 4492  O OXT  . ARG A 1 87 ? -11.478 -21.356 -11.535 1.00 0.00 ? 1131 ARG B OXT  3  
ATOM 4493  H H    . ARG A 1 87 ? -13.089 -19.310 -8.891  1.00 0.00 ? 1131 ARG B H    3  
ATOM 4494  H HA   . ARG A 1 87 ? -11.298 -18.605 -10.948 1.00 0.00 ? 1131 ARG B HA   3  
ATOM 4495  H HB2  . ARG A 1 87 ? -9.549  -20.369 -10.515 1.00 0.00 ? 1131 ARG B HB2  3  
ATOM 4496  H HB3  . ARG A 1 87 ? -9.494  -18.998 -9.408  1.00 0.00 ? 1131 ARG B HB3  3  
ATOM 4497  H HG2  . ARG A 1 87 ? -10.842 -20.322 -7.767  1.00 0.00 ? 1131 ARG B HG2  3  
ATOM 4498  H HG3  . ARG A 1 87 ? -10.758 -21.699 -8.863  1.00 0.00 ? 1131 ARG B HG3  3  
ATOM 4499  H HD2  . ARG A 1 87 ? -8.350  -20.281 -7.700  1.00 0.00 ? 1131 ARG B HD2  3  
ATOM 4500  H HD3  . ARG A 1 87 ? -9.023  -21.783 -7.074  1.00 0.00 ? 1131 ARG B HD3  3  
ATOM 4501  H HE   . ARG A 1 87 ? -7.438  -21.467 -9.474  1.00 0.00 ? 1131 ARG B HE   3  
ATOM 4502  H HH11 . ARG A 1 87 ? -9.818  -23.404 -7.806  1.00 0.00 ? 1131 ARG B HH11 3  
ATOM 4503  H HH12 . ARG A 1 87 ? -9.408  -24.853 -8.655  1.00 0.00 ? 1131 ARG B HH12 3  
ATOM 4504  H HH21 . ARG A 1 87 ? -6.930  -23.383 -10.570 1.00 0.00 ? 1131 ARG B HH21 3  
ATOM 4505  H HH22 . ARG A 1 87 ? -7.789  -24.843 -10.208 1.00 0.00 ? 1131 ARG B HH22 3  
ATOM 4506  N N    . ILE B 2 9  ? 4.259   -18.243 -0.486  1.00 0.00 ? 46   ILE A N    3  
ATOM 4507  C CA   . ILE B 2 9  ? 3.151   -18.440 0.489   1.00 0.00 ? 46   ILE A CA   3  
ATOM 4508  C C    . ILE B 2 9  ? 2.022   -17.460 0.175   1.00 0.00 ? 46   ILE A C    3  
ATOM 4509  O O    . ILE B 2 9  ? 2.260   -16.277 -0.072  1.00 0.00 ? 46   ILE A O    3  
ATOM 4510  C CB   . ILE B 2 9  ? 3.675   -18.198 1.906   1.00 0.00 ? 46   ILE A CB   3  
ATOM 4511  C CG1  . ILE B 2 9  ? 4.791   -19.202 2.210   1.00 0.00 ? 46   ILE A CG1  3  
ATOM 4512  C CG2  . ILE B 2 9  ? 2.535   -18.389 2.908   1.00 0.00 ? 46   ILE A CG2  3  
ATOM 4513  C CD1  . ILE B 2 9  ? 5.497   -18.804 3.509   1.00 0.00 ? 46   ILE A CD1  3  
ATOM 4514  H H    . ILE B 2 9  ? 3.897   -17.752 -1.328  1.00 0.00 ? 46   ILE A H    3  
ATOM 4515  H HA   . ILE B 2 9  ? 2.779   -19.451 0.411   1.00 0.00 ? 46   ILE A HA   3  
ATOM 4516  H HB   . ILE B 2 9  ? 4.060   -17.191 1.981   1.00 0.00 ? 46   ILE A HB   3  
ATOM 4517  H HG12 . ILE B 2 9  ? 4.367   -20.189 2.319   1.00 0.00 ? 46   ILE A HG12 3  
ATOM 4518  H HG13 . ILE B 2 9  ? 5.506   -19.202 1.401   1.00 0.00 ? 46   ILE A HG13 3  
ATOM 4519  H HG21 . ILE B 2 9  ? 2.828   -19.113 3.652   1.00 0.00 ? 46   ILE A HG21 3  
ATOM 4520  H HG22 . ILE B 2 9  ? 1.654   -18.738 2.390   1.00 0.00 ? 46   ILE A HG22 3  
ATOM 4521  H HG23 . ILE B 2 9  ? 2.319   -17.446 3.389   1.00 0.00 ? 46   ILE A HG23 3  
ATOM 4522  H HD11 . ILE B 2 9  ? 5.683   -19.686 4.103   1.00 0.00 ? 46   ILE A HD11 3  
ATOM 4523  H HD12 . ILE B 2 9  ? 4.874   -18.119 4.064   1.00 0.00 ? 46   ILE A HD12 3  
ATOM 4524  H HD13 . ILE B 2 9  ? 6.436   -18.324 3.275   1.00 0.00 ? 46   ILE A HD13 3  
ATOM 4525  N N    . GLU B 2 10 ? 0.792   -17.959 0.185   1.00 0.00 ? 47   GLU A N    3  
ATOM 4526  C CA   . GLU B 2 10 ? -0.360  -17.116 -0.107  1.00 0.00 ? 47   GLU A CA   3  
ATOM 4527  C C    . GLU B 2 10 ? -0.486  -15.999 0.926   1.00 0.00 ? 47   GLU A C    3  
ATOM 4528  O O    . GLU B 2 10 ? -0.764  -14.849 0.584   1.00 0.00 ? 47   GLU A O    3  
ATOM 4529  C CB   . GLU B 2 10 ? -1.631  -17.962 -0.087  1.00 0.00 ? 47   GLU A CB   3  
ATOM 4530  C CG   . GLU B 2 10 ? -1.640  -18.903 -1.292  1.00 0.00 ? 47   GLU A CG   3  
ATOM 4531  C CD   . GLU B 2 10 ? -2.816  -19.869 -1.197  1.00 0.00 ? 47   GLU A CD   3  
ATOM 4532  O OE1  . GLU B 2 10 ? -3.438  -19.914 -0.148  1.00 0.00 ? 47   GLU A OE1  3  
ATOM 4533  O OE2  . GLU B 2 10 ? -3.077  -20.553 -2.172  1.00 0.00 ? 47   GLU A OE2  3  
ATOM 4534  H H    . GLU B 2 10 ? 0.656   -18.908 0.384   1.00 0.00 ? 47   GLU A H    3  
ATOM 4535  H HA   . GLU B 2 10 ? -0.243  -16.681 -1.088  1.00 0.00 ? 47   GLU A HA   3  
ATOM 4536  H HB2  . GLU B 2 10 ? -1.659  -18.540 0.824   1.00 0.00 ? 47   GLU A HB2  3  
ATOM 4537  H HB3  . GLU B 2 10 ? -2.493  -17.314 -0.130  1.00 0.00 ? 47   GLU A HB3  3  
ATOM 4538  H HG2  . GLU B 2 10 ? -1.725  -18.322 -2.199  1.00 0.00 ? 47   GLU A HG2  3  
ATOM 4539  H HG3  . GLU B 2 10 ? -0.716  -19.464 -1.311  1.00 0.00 ? 47   GLU A HG3  3  
ATOM 4540  N N    . ASN B 2 11 ? -0.273  -16.342 2.189   1.00 0.00 ? 48   ASN A N    3  
ATOM 4541  C CA   . ASN B 2 11 ? -0.369  -15.357 3.256   1.00 0.00 ? 48   ASN A CA   3  
ATOM 4542  C C    . ASN B 2 11 ? 0.664   -14.258 3.052   1.00 0.00 ? 48   ASN A C    3  
ATOM 4543  O O    . ASN B 2 11 ? 0.386   -13.080 3.270   1.00 0.00 ? 48   ASN A O    3  
ATOM 4544  C CB   . ASN B 2 11 ? -0.139  -16.026 4.611   1.00 0.00 ? 48   ASN A CB   3  
ATOM 4545  C CG   . ASN B 2 11 ? -1.314  -16.940 4.947   1.00 0.00 ? 48   ASN A CG   3  
ATOM 4546  O OD1  . ASN B 2 11 ? -1.115  -18.102 5.300   1.00 0.00 ? 48   ASN A OD1  3  
ATOM 4547  N ND2  . ASN B 2 11 ? -2.530  -16.485 4.844   1.00 0.00 ? 48   ASN A ND2  3  
ATOM 4548  H H    . ASN B 2 11 ? -0.054  -17.272 2.409   1.00 0.00 ? 48   ASN A H    3  
ATOM 4549  H HA   . ASN B 2 11 ? -1.356  -14.918 3.245   1.00 0.00 ? 48   ASN A HA   3  
ATOM 4550  H HB2  . ASN B 2 11 ? 0.768   -16.610 4.572   1.00 0.00 ? 48   ASN A HB2  3  
ATOM 4551  H HB3  . ASN B 2 11 ? -0.047  -15.269 5.376   1.00 0.00 ? 48   ASN A HB3  3  
ATOM 4552  H HD21 . ASN B 2 11 ? -2.686  -15.563 4.551   1.00 0.00 ? 48   ASN A HD21 3  
ATOM 4553  H HD22 . ASN B 2 11 ? -3.290  -17.064 5.059   1.00 0.00 ? 48   ASN A HD22 3  
ATOM 4554  N N    . ASP B 2 12 ? 1.857   -14.652 2.628   1.00 0.00 ? 49   ASP A N    3  
ATOM 4555  C CA   . ASP B 2 12 ? 2.925   -13.687 2.392   1.00 0.00 ? 49   ASP A CA   3  
ATOM 4556  C C    . ASP B 2 12 ? 2.542   -12.717 1.279   1.00 0.00 ? 49   ASP A C    3  
ATOM 4557  O O    . ASP B 2 12 ? 2.811   -11.519 1.369   1.00 0.00 ? 49   ASP A O    3  
ATOM 4558  C CB   . ASP B 2 12 ? 4.219   -14.414 2.022   1.00 0.00 ? 49   ASP A CB   3  
ATOM 4559  C CG   . ASP B 2 12 ? 4.800   -15.106 3.249   1.00 0.00 ? 49   ASP A CG   3  
ATOM 4560  O OD1  . ASP B 2 12 ? 4.354   -14.800 4.343   1.00 0.00 ? 49   ASP A OD1  3  
ATOM 4561  O OD2  . ASP B 2 12 ? 5.681   -15.932 3.079   1.00 0.00 ? 49   ASP A OD2  3  
ATOM 4562  H H    . ASP B 2 12 ? 2.018   -15.607 2.463   1.00 0.00 ? 49   ASP A H    3  
ATOM 4563  H HA   . ASP B 2 12 ? 3.090   -13.124 3.300   1.00 0.00 ? 49   ASP A HA   3  
ATOM 4564  H HB2  . ASP B 2 12 ? 4.008   -15.150 1.260   1.00 0.00 ? 49   ASP A HB2  3  
ATOM 4565  H HB3  . ASP B 2 12 ? 4.935   -13.700 1.640   1.00 0.00 ? 49   ASP A HB3  3  
ATOM 4566  N N    . GLU B 2 13 ? 1.917   -13.242 0.232   1.00 0.00 ? 50   GLU A N    3  
ATOM 4567  C CA   . GLU B 2 13 ? 1.508   -12.405 -0.889  1.00 0.00 ? 50   GLU A CA   3  
ATOM 4568  C C    . GLU B 2 13 ? 0.481   -11.368 -0.437  1.00 0.00 ? 50   GLU A C    3  
ATOM 4569  O O    . GLU B 2 13 ? 0.549   -10.196 -0.816  1.00 0.00 ? 50   GLU A O    3  
ATOM 4570  C CB   . GLU B 2 13 ? 0.900   -13.279 -1.986  1.00 0.00 ? 50   GLU A CB   3  
ATOM 4571  C CG   . GLU B 2 13 ? 1.990   -14.152 -2.613  1.00 0.00 ? 50   GLU A CG   3  
ATOM 4572  C CD   . GLU B 2 13 ? 1.375   -15.083 -3.651  1.00 0.00 ? 50   GLU A CD   3  
ATOM 4573  O OE1  . GLU B 2 13 ? 0.157   -15.101 -3.758  1.00 0.00 ? 50   GLU A OE1  3  
ATOM 4574  O OE2  . GLU B 2 13 ? 2.128   -15.769 -4.322  1.00 0.00 ? 50   GLU A OE2  3  
ATOM 4575  H H    . GLU B 2 13 ? 1.732   -14.205 0.211   1.00 0.00 ? 50   GLU A H    3  
ATOM 4576  H HA   . GLU B 2 13 ? 2.374   -11.896 -1.284  1.00 0.00 ? 50   GLU A HA   3  
ATOM 4577  H HB2  . GLU B 2 13 ? 0.135   -13.911 -1.558  1.00 0.00 ? 50   GLU A HB2  3  
ATOM 4578  H HB3  . GLU B 2 13 ? 0.463   -12.651 -2.747  1.00 0.00 ? 50   GLU A HB3  3  
ATOM 4579  H HG2  . GLU B 2 13 ? 2.728   -13.521 -3.087  1.00 0.00 ? 50   GLU A HG2  3  
ATOM 4580  H HG3  . GLU B 2 13 ? 2.465   -14.740 -1.841  1.00 0.00 ? 50   GLU A HG3  3  
ATOM 4581  N N    . ALA B 2 14 ? -0.467  -11.807 0.384   1.00 0.00 ? 51   ALA A N    3  
ATOM 4582  C CA   . ALA B 2 14 ? -1.499  -10.909 0.887   1.00 0.00 ? 51   ALA A CA   3  
ATOM 4583  C C    . ALA B 2 14 ? -0.879  -9.814  1.747   1.00 0.00 ? 51   ALA A C    3  
ATOM 4584  O O    . ALA B 2 14 ? -1.274  -8.651  1.670   1.00 0.00 ? 51   ALA A O    3  
ATOM 4585  C CB   . ALA B 2 14 ? -2.525  -11.691 1.704   1.00 0.00 ? 51   ALA A CB   3  
ATOM 4586  H H    . ALA B 2 14 ? -0.472  -12.749 0.659   1.00 0.00 ? 51   ALA A H    3  
ATOM 4587  H HA   . ALA B 2 14 ? -2.001  -10.449 0.048   1.00 0.00 ? 51   ALA A HA   3  
ATOM 4588  H HB1  . ALA B 2 14 ? -3.518  -11.335 1.470   1.00 0.00 ? 51   ALA A HB1  3  
ATOM 4589  H HB2  . ALA B 2 14 ? -2.329  -11.549 2.755   1.00 0.00 ? 51   ALA A HB2  3  
ATOM 4590  H HB3  . ALA B 2 14 ? -2.452  -12.739 1.465   1.00 0.00 ? 51   ALA A HB3  3  
ATOM 4591  N N    . PHE B 2 15 ? 0.100   -10.194 2.564   1.00 0.00 ? 52   PHE A N    3  
ATOM 4592  C CA   . PHE B 2 15 ? 0.770   -9.231  3.426   1.00 0.00 ? 52   PHE A CA   3  
ATOM 4593  C C    . PHE B 2 15 ? 1.460   -8.158  2.595   1.00 0.00 ? 52   PHE A C    3  
ATOM 4594  O O    . PHE B 2 15 ? 1.380   -6.974  2.912   1.00 0.00 ? 52   PHE A O    3  
ATOM 4595  C CB   . PHE B 2 15 ? 1.802   -9.937  4.306   1.00 0.00 ? 52   PHE A CB   3  
ATOM 4596  C CG   . PHE B 2 15 ? 1.185   -10.294 5.637   1.00 0.00 ? 52   PHE A CG   3  
ATOM 4597  C CD1  . PHE B 2 15 ? 0.862   -11.624 5.928   1.00 0.00 ? 52   PHE A CD1  3  
ATOM 4598  C CD2  . PHE B 2 15 ? 0.939   -9.290  6.584   1.00 0.00 ? 52   PHE A CD2  3  
ATOM 4599  C CE1  . PHE B 2 15 ? 0.295   -11.951 7.167   1.00 0.00 ? 52   PHE A CE1  3  
ATOM 4600  C CE2  . PHE B 2 15 ? 0.372   -9.616  7.823   1.00 0.00 ? 52   PHE A CE2  3  
ATOM 4601  C CZ   . PHE B 2 15 ? 0.050   -10.947 8.113   1.00 0.00 ? 52   PHE A CZ   3  
ATOM 4602  H H    . PHE B 2 15 ? 0.376   -11.135 2.583   1.00 0.00 ? 52   PHE A H    3  
ATOM 4603  H HA   . PHE B 2 15 ? 0.036   -8.761  4.061   1.00 0.00 ? 52   PHE A HA   3  
ATOM 4604  H HB2  . PHE B 2 15 ? 2.136   -10.839 3.812   1.00 0.00 ? 52   PHE A HB2  3  
ATOM 4605  H HB3  . PHE B 2 15 ? 2.648   -9.284  4.467   1.00 0.00 ? 52   PHE A HB3  3  
ATOM 4606  H HD1  . PHE B 2 15 ? 1.051   -12.398 5.201   1.00 0.00 ? 52   PHE A HD1  3  
ATOM 4607  H HD2  . PHE B 2 15 ? 1.185   -8.261  6.360   1.00 0.00 ? 52   PHE A HD2  3  
ATOM 4608  H HE1  . PHE B 2 15 ? 0.045   -12.976 7.390   1.00 0.00 ? 52   PHE A HE1  3  
ATOM 4609  H HE2  . PHE B 2 15 ? 0.185   -8.841  8.557   1.00 0.00 ? 52   PHE A HE2  3  
ATOM 4610  H HZ   . PHE B 2 15 ? -0.387  -11.201 9.067   1.00 0.00 ? 52   PHE A HZ   3  
ATOM 4611  N N    . ALA B 2 16 ? 2.128   -8.578  1.528   1.00 0.00 ? 53   ALA A N    3  
ATOM 4612  C CA   . ALA B 2 16 ? 2.822   -7.636  0.659   1.00 0.00 ? 53   ALA A CA   3  
ATOM 4613  C C    . ALA B 2 16 ? 1.832   -6.647  0.052   1.00 0.00 ? 53   ALA A C    3  
ATOM 4614  O O    . ALA B 2 16 ? 2.118   -5.460  -0.064  1.00 0.00 ? 53   ALA A O    3  
ATOM 4615  C CB   . ALA B 2 16 ? 3.543   -8.391  -0.457  1.00 0.00 ? 53   ALA A CB   3  
ATOM 4616  H H    . ALA B 2 16 ? 2.154   -9.537  1.320   1.00 0.00 ? 53   ALA A H    3  
ATOM 4617  H HA   . ALA B 2 16 ? 3.550   -7.091  1.240   1.00 0.00 ? 53   ALA A HA   3  
ATOM 4618  H HB1  . ALA B 2 16 ? 4.198   -7.714  -0.984  1.00 0.00 ? 53   ALA A HB1  3  
ATOM 4619  H HB2  . ALA B 2 16 ? 2.817   -8.799  -1.143  1.00 0.00 ? 53   ALA A HB2  3  
ATOM 4620  H HB3  . ALA B 2 16 ? 4.125   -9.193  -0.028  1.00 0.00 ? 53   ALA A HB3  3  
ATOM 4621  N N    . ILE B 2 17 ? 0.665   -7.142  -0.331  1.00 0.00 ? 54   ILE A N    3  
ATOM 4622  C CA   . ILE B 2 17 ? -0.350  -6.283  -0.918  1.00 0.00 ? 54   ILE A CA   3  
ATOM 4623  C C    . ILE B 2 17 ? -0.761  -5.185  0.059   1.00 0.00 ? 54   ILE A C    3  
ATOM 4624  O O    . ILE B 2 17 ? -0.961  -4.035  -0.332  1.00 0.00 ? 54   ILE A O    3  
ATOM 4625  C CB   . ILE B 2 17 ? -1.571  -7.114  -1.296  1.00 0.00 ? 54   ILE A CB   3  
ATOM 4626  C CG1  . ILE B 2 17 ? -1.224  -8.027  -2.474  1.00 0.00 ? 54   ILE A CG1  3  
ATOM 4627  C CG2  . ILE B 2 17 ? -2.716  -6.188  -1.694  1.00 0.00 ? 54   ILE A CG2  3  
ATOM 4628  C CD1  . ILE B 2 17 ? -2.357  -9.032  -2.684  1.00 0.00 ? 54   ILE A CD1  3  
ATOM 4629  H H    . ILE B 2 17 ? 0.482   -8.100  -0.221  1.00 0.00 ? 54   ILE A H    3  
ATOM 4630  H HA   . ILE B 2 17 ? 0.049   -5.825  -1.808  1.00 0.00 ? 54   ILE A HA   3  
ATOM 4631  H HB   . ILE B 2 17 ? -1.870  -7.715  -0.451  1.00 0.00 ? 54   ILE A HB   3  
ATOM 4632  H HG12 . ILE B 2 17 ? -1.103  -7.431  -3.366  1.00 0.00 ? 54   ILE A HG12 3  
ATOM 4633  H HG13 . ILE B 2 17 ? -0.308  -8.556  -2.264  1.00 0.00 ? 54   ILE A HG13 3  
ATOM 4634  H HG21 . ILE B 2 17 ? -3.072  -5.661  -0.823  1.00 0.00 ? 54   ILE A HG21 3  
ATOM 4635  H HG22 . ILE B 2 17 ? -3.519  -6.773  -2.111  1.00 0.00 ? 54   ILE A HG22 3  
ATOM 4636  H HG23 . ILE B 2 17 ? -2.364  -5.480  -2.428  1.00 0.00 ? 54   ILE A HG23 3  
ATOM 4637  H HD11 . ILE B 2 17 ? -2.034  -9.801  -3.366  1.00 0.00 ? 54   ILE A HD11 3  
ATOM 4638  H HD12 . ILE B 2 17 ? -3.216  -8.520  -3.096  1.00 0.00 ? 54   ILE A HD12 3  
ATOM 4639  H HD13 . ILE B 2 17 ? -2.622  -9.476  -1.737  1.00 0.00 ? 54   ILE A HD13 3  
ATOM 4640  N N    . LEU B 2 18 ? -0.900  -5.550  1.323   1.00 0.00 ? 55   LEU A N    3  
ATOM 4641  C CA   . LEU B 2 18 ? -1.305  -4.593  2.344   1.00 0.00 ? 55   LEU A CA   3  
ATOM 4642  C C    . LEU B 2 18 ? -0.106  -4.125  3.168   1.00 0.00 ? 55   LEU A C    3  
ATOM 4643  O O    . LEU B 2 18 ? -0.257  -3.730  4.323   1.00 0.00 ? 55   LEU A O    3  
ATOM 4644  C CB   . LEU B 2 18 ? -2.351  -5.228  3.257   1.00 0.00 ? 55   LEU A CB   3  
ATOM 4645  C CG   . LEU B 2 18 ? -3.556  -5.672  2.419   1.00 0.00 ? 55   LEU A CG   3  
ATOM 4646  C CD1  . LEU B 2 18 ? -4.567  -6.392  3.313   1.00 0.00 ? 55   LEU A CD1  3  
ATOM 4647  C CD2  . LEU B 2 18 ? -4.227  -4.448  1.788   1.00 0.00 ? 55   LEU A CD2  3  
ATOM 4648  H H    . LEU B 2 18 ? -0.737  -6.484  1.575   1.00 0.00 ? 55   LEU A H    3  
ATOM 4649  H HA   . LEU B 2 18 ? -1.742  -3.733  1.860   1.00 0.00 ? 55   LEU A HA   3  
ATOM 4650  H HB2  . LEU B 2 18 ? -1.919  -6.084  3.755   1.00 0.00 ? 55   LEU A HB2  3  
ATOM 4651  H HB3  . LEU B 2 18 ? -2.672  -4.507  3.993   1.00 0.00 ? 55   LEU A HB3  3  
ATOM 4652  H HG   . LEU B 2 18 ? -3.223  -6.344  1.640   1.00 0.00 ? 55   LEU A HG   3  
ATOM 4653  H HD11 . LEU B 2 18 ? -4.532  -5.973  4.306   1.00 0.00 ? 55   LEU A HD11 3  
ATOM 4654  H HD12 . LEU B 2 18 ? -4.324  -7.444  3.355   1.00 0.00 ? 55   LEU A HD12 3  
ATOM 4655  H HD13 . LEU B 2 18 ? -5.559  -6.270  2.903   1.00 0.00 ? 55   LEU A HD13 3  
ATOM 4656  H HD21 . LEU B 2 18 ? -4.178  -3.616  2.475   1.00 0.00 ? 55   LEU A HD21 3  
ATOM 4657  H HD22 . LEU B 2 18 ? -5.260  -4.676  1.570   1.00 0.00 ? 55   LEU A HD22 3  
ATOM 4658  H HD23 . LEU B 2 18 ? -3.715  -4.189  0.873   1.00 0.00 ? 55   LEU A HD23 3  
ATOM 4659  N N    . ASP B 2 19 ? 1.085   -4.167  2.574   1.00 0.00 ? 56   ASP A N    3  
ATOM 4660  C CA   . ASP B 2 19 ? 2.285   -3.728  3.282   1.00 0.00 ? 56   ASP A CA   3  
ATOM 4661  C C    . ASP B 2 19 ? 3.322   -3.190  2.308   1.00 0.00 ? 56   ASP A C    3  
ATOM 4662  O O    . ASP B 2 19 ? 3.678   -2.014  2.342   1.00 0.00 ? 56   ASP A O    3  
ATOM 4663  C CB   . ASP B 2 19 ? 2.885   -4.903  4.052   1.00 0.00 ? 56   ASP A CB   3  
ATOM 4664  C CG   . ASP B 2 19 ? 3.849   -4.396  5.117   1.00 0.00 ? 56   ASP A CG   3  
ATOM 4665  O OD1  . ASP B 2 19 ? 3.693   -3.261  5.538   1.00 0.00 ? 56   ASP A OD1  3  
ATOM 4666  O OD2  . ASP B 2 19 ? 4.730   -5.148  5.492   1.00 0.00 ? 56   ASP A OD2  3  
ATOM 4667  H H    . ASP B 2 19 ? 1.158   -4.487  1.647   1.00 0.00 ? 56   ASP A H    3  
ATOM 4668  H HA   . ASP B 2 19 ? 2.019   -2.950  3.981   1.00 0.00 ? 56   ASP A HA   3  
ATOM 4669  H HB2  . ASP B 2 19 ? 2.092   -5.464  4.522   1.00 0.00 ? 56   ASP A HB2  3  
ATOM 4670  H HB3  . ASP B 2 19 ? 3.418   -5.542  3.365   1.00 0.00 ? 56   ASP A HB3  3  
ATOM 4671  N N    . GLY B 2 20 ? 3.793   -4.061  1.428   1.00 0.00 ? 57   GLY A N    3  
ATOM 4672  C CA   . GLY B 2 20 ? 4.787   -3.661  0.434   1.00 0.00 ? 57   GLY A CA   3  
ATOM 4673  C C    . GLY B 2 20 ? 4.123   -3.021  -0.788  1.00 0.00 ? 57   GLY A C    3  
ATOM 4674  O O    . GLY B 2 20 ? 4.807   -2.545  -1.695  1.00 0.00 ? 57   GLY A O    3  
ATOM 4675  H H    . GLY B 2 20 ? 3.463   -4.986  1.444   1.00 0.00 ? 57   GLY A H    3  
ATOM 4676  H HA2  . GLY B 2 20 ? 5.466   -2.949  0.883   1.00 0.00 ? 57   GLY A HA2  3  
ATOM 4677  H HA3  . GLY B 2 20 ? 5.344   -4.532  0.119   1.00 0.00 ? 57   GLY A HA3  3  
ATOM 4678  N N    . GLY B 2 21 ? 2.789   -3.018  -0.813  1.00 0.00 ? 58   GLY A N    3  
ATOM 4679  C CA   . GLY B 2 21 ? 2.056   -2.439  -1.931  1.00 0.00 ? 58   GLY A CA   3  
ATOM 4680  C C    . GLY B 2 21 ? 2.229   -3.294  -3.179  1.00 0.00 ? 58   GLY A C    3  
ATOM 4681  O O    . GLY B 2 21 ? 2.059   -2.812  -4.298  1.00 0.00 ? 58   GLY A O    3  
ATOM 4682  H H    . GLY B 2 21 ? 2.290   -3.412  -0.071  1.00 0.00 ? 58   GLY A H    3  
ATOM 4683  H HA2  . GLY B 2 21 ? 1.008   -2.385  -1.677  1.00 0.00 ? 58   GLY A HA2  3  
ATOM 4684  H HA3  . GLY B 2 21 ? 2.429   -1.447  -2.129  1.00 0.00 ? 58   GLY A HA3  3  
ATOM 4685  N N    . ALA B 2 22 ? 2.580   -4.563  -2.981  1.00 0.00 ? 59   ALA A N    3  
ATOM 4686  C CA   . ALA B 2 22 ? 2.783   -5.463  -4.108  1.00 0.00 ? 59   ALA A CA   3  
ATOM 4687  C C    . ALA B 2 22 ? 1.449   -5.889  -4.720  1.00 0.00 ? 59   ALA A C    3  
ATOM 4688  O O    . ALA B 2 22 ? 0.418   -5.862  -4.054  1.00 0.00 ? 59   ALA A O    3  
ATOM 4689  C CB   . ALA B 2 22 ? 3.537   -6.708  -3.652  1.00 0.00 ? 59   ALA A CB   3  
ATOM 4690  H H    . ALA B 2 22 ? 2.710   -4.894  -2.067  1.00 0.00 ? 59   ALA A H    3  
ATOM 4691  H HA   . ALA B 2 22 ? 3.373   -4.950  -4.850  1.00 0.00 ? 59   ALA A HA   3  
ATOM 4692  H HB1  . ALA B 2 22 ? 2.833   -7.511  -3.492  1.00 0.00 ? 59   ALA A HB1  3  
ATOM 4693  H HB2  . ALA B 2 22 ? 4.061   -6.498  -2.732  1.00 0.00 ? 59   ALA A HB2  3  
ATOM 4694  H HB3  . ALA B 2 22 ? 4.246   -6.996  -4.414  1.00 0.00 ? 59   ALA A HB3  3  
ATOM 4695  N N    . PRO B 2 23 ? 1.451   -6.289  -5.964  1.00 0.00 ? 60   PRO A N    3  
ATOM 4696  C CA   . PRO B 2 23 ? 0.215   -6.741  -6.660  1.00 0.00 ? 60   PRO A CA   3  
ATOM 4697  C C    . PRO B 2 23 ? -0.217  -8.139  -6.223  1.00 0.00 ? 60   PRO A C    3  
ATOM 4698  O O    . PRO B 2 23 ? -1.375  -8.522  -6.386  1.00 0.00 ? 60   PRO A O    3  
ATOM 4699  C CB   . PRO B 2 23 ? 0.609   -6.714  -8.137  1.00 0.00 ? 60   PRO A CB   3  
ATOM 4700  C CG   . PRO B 2 23 ? 2.087   -6.922  -8.154  1.00 0.00 ? 60   PRO A CG   3  
ATOM 4701  C CD   . PRO B 2 23 ? 2.629   -6.359  -6.841  1.00 0.00 ? 60   PRO A CD   3  
ATOM 4702  H HA   . PRO B 2 23 ? -0.582  -6.039  -6.484  1.00 0.00 ? 60   PRO A HA   3  
ATOM 4703  H HB2  . PRO B 2 23 ? 0.112   -7.513  -8.671  1.00 0.00 ? 60   PRO A HB2  3  
ATOM 4704  H HB3  . PRO B 2 23 ? 0.366   -5.759  -8.576  1.00 0.00 ? 60   PRO A HB3  3  
ATOM 4705  H HG2  . PRO B 2 23 ? 2.314   -7.977  -8.230  1.00 0.00 ? 60   PRO A HG2  3  
ATOM 4706  H HG3  . PRO B 2 23 ? 2.528   -6.389  -8.983  1.00 0.00 ? 60   PRO A HG3  3  
ATOM 4707  H HD2  . PRO B 2 23 ? 3.373   -7.024  -6.425  1.00 0.00 ? 60   PRO A HD2  3  
ATOM 4708  H HD3  . PRO B 2 23 ? 3.042   -5.374  -6.990  1.00 0.00 ? 60   PRO A HD3  3  
ATOM 4709  N N    . GLY B 2 24 ? 0.727   -8.895  -5.671  1.00 0.00 ? 61   GLY A N    3  
ATOM 4710  C CA   . GLY B 2 24 ? 0.438   -10.250 -5.218  1.00 0.00 ? 61   GLY A CA   3  
ATOM 4711  C C    . GLY B 2 24 ? 1.701   -10.933 -4.705  1.00 0.00 ? 61   GLY A C    3  
ATOM 4712  O O    . GLY B 2 24 ? 1.876   -12.105 -4.995  1.00 0.00 ? 61   GLY A O    3  
ATOM 4713  O OXT  . GLY B 2 24 ? 2.474   -10.274 -4.029  1.00 0.00 ? 61   GLY A OXT  3  
ATOM 4714  H H    . GLY B 2 24 ? 1.632   -8.537  -5.570  1.00 0.00 ? 61   GLY A H    3  
ATOM 4715  H HA2  . GLY B 2 24 ? -0.292  -10.211 -4.424  1.00 0.00 ? 61   GLY A HA2  3  
ATOM 4716  H HA3  . GLY B 2 24 ? 0.038   -10.823 -6.041  1.00 0.00 ? 61   GLY A HA3  3  
ATOM 4717  N N    . ARG A 1 6  ? 6.864   -4.238  10.947  1.00 0.00 ? 1050 ARG B N    4  
ATOM 4718  C CA   . ARG A 1 6  ? 5.823   -4.730  10.002  1.00 0.00 ? 1050 ARG B CA   4  
ATOM 4719  C C    . ARG A 1 6  ? 4.562   -5.091  10.783  1.00 0.00 ? 1050 ARG B C    4  
ATOM 4720  O O    . ARG A 1 6  ? 4.608   -5.287  11.998  1.00 0.00 ? 1050 ARG B O    4  
ATOM 4721  C CB   . ARG A 1 6  ? 6.348   -5.965  9.267   1.00 0.00 ? 1050 ARG B CB   4  
ATOM 4722  C CG   . ARG A 1 6  ? 6.981   -5.543  7.941   1.00 0.00 ? 1050 ARG B CG   4  
ATOM 4723  C CD   . ARG A 1 6  ? 7.655   -6.752  7.288   1.00 0.00 ? 1050 ARG B CD   4  
ATOM 4724  N NE   . ARG A 1 6  ? 8.797   -7.186  8.087   1.00 0.00 ? 1050 ARG B NE   4  
ATOM 4725  C CZ   . ARG A 1 6  ? 9.491   -8.284  7.780   1.00 0.00 ? 1050 ARG B CZ   4  
ATOM 4726  N NH1  . ARG A 1 6  ? 9.163   -9.016  6.745   1.00 0.00 ? 1050 ARG B NH1  4  
ATOM 4727  N NH2  . ARG A 1 6  ? 10.511  -8.630  8.518   1.00 0.00 ? 1050 ARG B NH2  4  
ATOM 4728  H H    . ARG A 1 6  ? 7.461   -5.032  11.250  1.00 0.00 ? 1050 ARG B H    4  
ATOM 4729  H HA   . ARG A 1 6  ? 5.598   -3.954  9.287   1.00 0.00 ? 1050 ARG B HA   4  
ATOM 4730  H HB2  . ARG A 1 6  ? 7.089   -6.459  9.880   1.00 0.00 ? 1050 ARG B HB2  4  
ATOM 4731  H HB3  . ARG A 1 6  ? 5.531   -6.643  9.073   1.00 0.00 ? 1050 ARG B HB3  4  
ATOM 4732  H HG2  . ARG A 1 6  ? 6.217   -5.155  7.283   1.00 0.00 ? 1050 ARG B HG2  4  
ATOM 4733  H HG3  . ARG A 1 6  ? 7.720   -4.777  8.122   1.00 0.00 ? 1050 ARG B HG3  4  
ATOM 4734  H HD2  . ARG A 1 6  ? 6.945   -7.560  7.213   1.00 0.00 ? 1050 ARG B HD2  4  
ATOM 4735  H HD3  . ARG A 1 6  ? 7.991   -6.480  6.297   1.00 0.00 ? 1050 ARG B HD3  4  
ATOM 4736  H HE   . ARG A 1 6  ? 9.061   -6.657  8.868   1.00 0.00 ? 1050 ARG B HE   4  
ATOM 4737  H HH11 . ARG A 1 6  ? 8.386   -8.761  6.172   1.00 0.00 ? 1050 ARG B HH11 4  
ATOM 4738  H HH12 . ARG A 1 6  ? 9.692   -9.835  6.528   1.00 0.00 ? 1050 ARG B HH12 4  
ATOM 4739  H HH21 . ARG A 1 6  ? 10.768  -8.074  9.308   1.00 0.00 ? 1050 ARG B HH21 4  
ATOM 4740  H HH22 . ARG A 1 6  ? 11.036  -9.453  8.292   1.00 0.00 ? 1050 ARG B HH22 4  
ATOM 4741  N N    . PRO A 1 7  ? 3.445   -5.184  10.112  1.00 0.00 ? 1051 PRO B N    4  
ATOM 4742  C CA   . PRO A 1 7  ? 2.148   -5.533  10.752  1.00 0.00 ? 1051 PRO B CA   4  
ATOM 4743  C C    . PRO A 1 7  ? 2.081   -7.000  11.150  1.00 0.00 ? 1051 PRO B C    4  
ATOM 4744  O O    . PRO A 1 7  ? 2.443   -7.889  10.379  1.00 0.00 ? 1051 PRO B O    4  
ATOM 4745  C CB   . PRO A 1 7  ? 1.116   -5.220  9.671   1.00 0.00 ? 1051 PRO B CB   4  
ATOM 4746  C CG   . PRO A 1 7  ? 1.854   -5.376  8.388   1.00 0.00 ? 1051 PRO B CG   4  
ATOM 4747  C CD   . PRO A 1 7  ? 3.295   -4.971  8.670   1.00 0.00 ? 1051 PRO B CD   4  
ATOM 4748  H HA   . PRO A 1 7  ? 1.973   -4.904  11.608  1.00 0.00 ? 1051 PRO B HA   4  
ATOM 4749  H HB2  . PRO A 1 7  ? 0.295   -5.922  9.722   1.00 0.00 ? 1051 PRO B HB2  4  
ATOM 4750  H HB3  . PRO A 1 7  ? 0.758   -4.208  9.771   1.00 0.00 ? 1051 PRO B HB3  4  
ATOM 4751  H HG2  . PRO A 1 7  ? 1.811   -6.406  8.058   1.00 0.00 ? 1051 PRO B HG2  4  
ATOM 4752  H HG3  . PRO A 1 7  ? 1.435   -4.726  7.635   1.00 0.00 ? 1051 PRO B HG3  4  
ATOM 4753  H HD2  . PRO A 1 7  ? 3.977   -5.601  8.124   1.00 0.00 ? 1051 PRO B HD2  4  
ATOM 4754  H HD3  . PRO A 1 7  ? 3.451   -3.934  8.433   1.00 0.00 ? 1051 PRO B HD3  4  
ATOM 4755  N N    . LYS A 1 8  ? 1.608   -7.232  12.356  1.00 0.00 ? 1052 LYS B N    4  
ATOM 4756  C CA   . LYS A 1 8  ? 1.476   -8.584  12.883  1.00 0.00 ? 1052 LYS B CA   4  
ATOM 4757  C C    . LYS A 1 8  ? 0.062   -9.125  12.675  1.00 0.00 ? 1052 LYS B C    4  
ATOM 4758  O O    . LYS A 1 8  ? -0.201  -10.302 12.920  1.00 0.00 ? 1052 LYS B O    4  
ATOM 4759  C CB   . LYS A 1 8  ? 1.790   -8.563  14.371  1.00 0.00 ? 1052 LYS B CB   4  
ATOM 4760  C CG   . LYS A 1 8  ? 3.251   -8.170  14.568  1.00 0.00 ? 1052 LYS B CG   4  
ATOM 4761  C CD   . LYS A 1 8  ? 3.516   -7.988  16.059  1.00 0.00 ? 1052 LYS B CD   4  
ATOM 4762  C CE   . LYS A 1 8  ? 4.988   -7.640  16.282  1.00 0.00 ? 1052 LYS B CE   4  
ATOM 4763  N NZ   . LYS A 1 8  ? 5.305   -6.357  15.590  1.00 0.00 ? 1052 LYS B NZ   4  
ATOM 4764  H H    . LYS A 1 8  ? 1.343   -6.472  12.910  1.00 0.00 ? 1052 LYS B H    4  
ATOM 4765  H HA   . LYS A 1 8  ? 2.182   -9.231  12.384  1.00 0.00 ? 1052 LYS B HA   4  
ATOM 4766  H HB2  . LYS A 1 8  ? 1.153   -7.844  14.864  1.00 0.00 ? 1052 LYS B HB2  4  
ATOM 4767  H HB3  . LYS A 1 8  ? 1.624   -9.544  14.790  1.00 0.00 ? 1052 LYS B HB3  4  
ATOM 4768  H HG2  . LYS A 1 8  ? 3.891   -8.949  14.177  1.00 0.00 ? 1052 LYS B HG2  4  
ATOM 4769  H HG3  . LYS A 1 8  ? 3.450   -7.244  14.052  1.00 0.00 ? 1052 LYS B HG3  4  
ATOM 4770  H HD2  . LYS A 1 8  ? 2.893   -7.186  16.429  1.00 0.00 ? 1052 LYS B HD2  4  
ATOM 4771  H HD3  . LYS A 1 8  ? 3.279   -8.902  16.582  1.00 0.00 ? 1052 LYS B HD3  4  
ATOM 4772  H HE2  . LYS A 1 8  ? 5.176   -7.532  17.341  1.00 0.00 ? 1052 LYS B HE2  4  
ATOM 4773  H HE3  . LYS A 1 8  ? 5.610   -8.428  15.884  1.00 0.00 ? 1052 LYS B HE3  4  
ATOM 4774  H HZ1  . LYS A 1 8  ? 5.798   -6.558  14.699  1.00 0.00 ? 1052 LYS B HZ1  4  
ATOM 4775  H HZ2  . LYS A 1 8  ? 5.913   -5.774  16.201  1.00 0.00 ? 1052 LYS B HZ2  4  
ATOM 4776  H HZ3  . LYS A 1 8  ? 4.422   -5.845  15.388  1.00 0.00 ? 1052 LYS B HZ3  4  
ATOM 4777  N N    . MET A 1 9  ? -0.851  -8.262  12.232  1.00 0.00 ? 1053 MET B N    4  
ATOM 4778  C CA   . MET A 1 9  ? -2.230  -8.679  12.014  1.00 0.00 ? 1053 MET B CA   4  
ATOM 4779  C C    . MET A 1 9  ? -2.355  -9.405  10.681  1.00 0.00 ? 1053 MET B C    4  
ATOM 4780  O O    . MET A 1 9  ? -1.515  -9.251  9.797   1.00 0.00 ? 1053 MET B O    4  
ATOM 4781  C CB   . MET A 1 9  ? -3.156  -7.461  12.008  1.00 0.00 ? 1053 MET B CB   4  
ATOM 4782  C CG   . MET A 1 9  ? -2.741  -6.482  13.108  1.00 0.00 ? 1053 MET B CG   4  
ATOM 4783  S SD   . MET A 1 9  ? -4.022  -5.216  13.299  1.00 0.00 ? 1053 MET B SD   4  
ATOM 4784  C CE   . MET A 1 9  ? -3.937  -4.542  11.619  1.00 0.00 ? 1053 MET B CE   4  
ATOM 4785  H H    . MET A 1 9  ? -0.598  -7.331  12.057  1.00 0.00 ? 1053 MET B H    4  
ATOM 4786  H HA   . MET A 1 9  ? -2.530  -9.343  12.810  1.00 0.00 ? 1053 MET B HA   4  
ATOM 4787  H HB2  . MET A 1 9  ? -3.098  -6.973  11.048  1.00 0.00 ? 1053 MET B HB2  4  
ATOM 4788  H HB3  . MET A 1 9  ? -4.172  -7.784  12.185  1.00 0.00 ? 1053 MET B HB3  4  
ATOM 4789  H HG2  . MET A 1 9  ? -2.618  -7.015  14.041  1.00 0.00 ? 1053 MET B HG2  4  
ATOM 4790  H HG3  . MET A 1 9  ? -1.807  -6.011  12.836  1.00 0.00 ? 1053 MET B HG3  4  
ATOM 4791  H HE1  . MET A 1 9  ? -3.046  -4.908  11.131  1.00 0.00 ? 1053 MET B HE1  4  
ATOM 4792  H HE2  . MET A 1 9  ? -3.901  -3.466  11.664  1.00 0.00 ? 1053 MET B HE2  4  
ATOM 4793  H HE3  . MET A 1 9  ? -4.816  -4.850  11.062  1.00 0.00 ? 1053 MET B HE3  4  
ATOM 4794  N N    . THR A 1 10 ? -3.414  -10.199 10.542  1.00 0.00 ? 1054 THR B N    4  
ATOM 4795  C CA   . THR A 1 10 ? -3.639  -10.943 9.309   1.00 0.00 ? 1054 THR B CA   4  
ATOM 4796  C C    . THR A 1 10 ? -4.034  -9.991  8.182   1.00 0.00 ? 1054 THR B C    4  
ATOM 4797  O O    . THR A 1 10 ? -4.444  -8.859  8.435   1.00 0.00 ? 1054 THR B O    4  
ATOM 4798  C CB   . THR A 1 10 ? -4.743  -11.981 9.526   1.00 0.00 ? 1054 THR B CB   4  
ATOM 4799  O OG1  . THR A 1 10 ? -5.981  -11.318 9.730   1.00 0.00 ? 1054 THR B OG1  4  
ATOM 4800  C CG2  . THR A 1 10 ? -4.410  -12.833 10.749  1.00 0.00 ? 1054 THR B CG2  4  
ATOM 4801  H H    . THR A 1 10 ? -4.052  -10.283 11.281  1.00 0.00 ? 1054 THR B H    4  
ATOM 4802  H HA   . THR A 1 10 ? -2.730  -11.453 9.038   1.00 0.00 ? 1054 THR B HA   4  
ATOM 4803  H HB   . THR A 1 10 ? -4.817  -12.618 8.662   1.00 0.00 ? 1054 THR B HB   4  
ATOM 4804  H HG1  . THR A 1 10 ? -5.796  -10.391 9.896   1.00 0.00 ? 1054 THR B HG1  4  
ATOM 4805  H HG21 . THR A 1 10 ? -3.449  -13.305 10.607  1.00 0.00 ? 1054 THR B HG21 4  
ATOM 4806  H HG22 . THR A 1 10 ? -5.168  -13.591 10.878  1.00 0.00 ? 1054 THR B HG22 4  
ATOM 4807  H HG23 . THR A 1 10 ? -4.375  -12.204 11.628  1.00 0.00 ? 1054 THR B HG23 4  
ATOM 4808  N N    . PRO A 1 11 ? -3.906  -10.416 6.951   1.00 0.00 ? 1055 PRO B N    4  
ATOM 4809  C CA   . PRO A 1 11 ? -4.253  -9.564  5.771   1.00 0.00 ? 1055 PRO B CA   4  
ATOM 4810  C C    . PRO A 1 11 ? -5.657  -8.981  5.883   1.00 0.00 ? 1055 PRO B C    4  
ATOM 4811  O O    . PRO A 1 11 ? -5.878  -7.805  5.591   1.00 0.00 ? 1055 PRO B O    4  
ATOM 4812  C CB   . PRO A 1 11 ? -4.170  -10.544 4.596   1.00 0.00 ? 1055 PRO B CB   4  
ATOM 4813  C CG   . PRO A 1 11 ? -3.203  -11.587 5.040   1.00 0.00 ? 1055 PRO B CG   4  
ATOM 4814  C CD   . PRO A 1 11 ? -3.417  -11.743 6.540   1.00 0.00 ? 1055 PRO B CD   4  
ATOM 4815  H HA   . PRO A 1 11 ? -3.526  -8.782  5.641   1.00 0.00 ? 1055 PRO B HA   4  
ATOM 4816  H HB2  . PRO A 1 11 ? -5.141  -10.982 4.402   1.00 0.00 ? 1055 PRO B HB2  4  
ATOM 4817  H HB3  . PRO A 1 11 ? -3.799  -10.046 3.715   1.00 0.00 ? 1055 PRO B HB3  4  
ATOM 4818  H HG2  . PRO A 1 11 ? -3.408  -12.522 4.531   1.00 0.00 ? 1055 PRO B HG2  4  
ATOM 4819  H HG3  . PRO A 1 11 ? -2.192  -11.268 4.846   1.00 0.00 ? 1055 PRO B HG3  4  
ATOM 4820  H HD2  . PRO A 1 11 ? -4.156  -12.505 6.735   1.00 0.00 ? 1055 PRO B HD2  4  
ATOM 4821  H HD3  . PRO A 1 11 ? -2.489  -11.969 7.035   1.00 0.00 ? 1055 PRO B HD3  4  
ATOM 4822  N N    . GLU A 1 12 ? -6.601  -9.807  6.325   1.00 0.00 ? 1056 GLU B N    4  
ATOM 4823  C CA   . GLU A 1 12 ? -7.977  -9.355  6.486   1.00 0.00 ? 1056 GLU B CA   4  
ATOM 4824  C C    . GLU A 1 12 ? -8.063  -8.294  7.577   1.00 0.00 ? 1056 GLU B C    4  
ATOM 4825  O O    . GLU A 1 12 ? -8.779  -7.303  7.439   1.00 0.00 ? 1056 GLU B O    4  
ATOM 4826  C CB   . GLU A 1 12 ? -8.880  -10.535 6.844   1.00 0.00 ? 1056 GLU B CB   4  
ATOM 4827  C CG   . GLU A 1 12 ? -9.013  -11.459 5.631   1.00 0.00 ? 1056 GLU B CG   4  
ATOM 4828  C CD   . GLU A 1 12 ? -9.783  -12.718 6.016   1.00 0.00 ? 1056 GLU B CD   4  
ATOM 4829  O OE1  . GLU A 1 12 ? -9.983  -12.928 7.202   1.00 0.00 ? 1056 GLU B OE1  4  
ATOM 4830  O OE2  . GLU A 1 12 ? -10.159 -13.454 5.120   1.00 0.00 ? 1056 GLU B OE2  4  
ATOM 4831  H H    . GLU A 1 12 ? -6.367  -10.731 6.554   1.00 0.00 ? 1056 GLU B H    4  
ATOM 4832  H HA   . GLU A 1 12 ? -8.313  -8.926  5.556   1.00 0.00 ? 1056 GLU B HA   4  
ATOM 4833  H HB2  . GLU A 1 12 ? -8.450  -11.082 7.670   1.00 0.00 ? 1056 GLU B HB2  4  
ATOM 4834  H HB3  . GLU A 1 12 ? -9.857  -10.168 7.124   1.00 0.00 ? 1056 GLU B HB3  4  
ATOM 4835  H HG2  . GLU A 1 12 ? -9.542  -10.942 4.843   1.00 0.00 ? 1056 GLU B HG2  4  
ATOM 4836  H HG3  . GLU A 1 12 ? -8.030  -11.735 5.283   1.00 0.00 ? 1056 GLU B HG3  4  
ATOM 4837  N N    . GLN A 1 13 ? -7.321  -8.504  8.662   1.00 0.00 ? 1057 GLN B N    4  
ATOM 4838  C CA   . GLN A 1 13 ? -7.323  -7.547  9.762   1.00 0.00 ? 1057 GLN B CA   4  
ATOM 4839  C C    . GLN A 1 13 ? -6.765  -6.207  9.320   1.00 0.00 ? 1057 GLN B C    4  
ATOM 4840  O O    . GLN A 1 13 ? -7.287  -5.157  9.694   1.00 0.00 ? 1057 GLN B O    4  
ATOM 4841  C CB   . GLN A 1 13 ? -6.500  -8.075  10.934  1.00 0.00 ? 1057 GLN B CB   4  
ATOM 4842  C CG   . GLN A 1 13 ? -7.268  -9.195  11.624  1.00 0.00 ? 1057 GLN B CG   4  
ATOM 4843  C CD   . GLN A 1 13 ? -6.486  -9.684  12.837  1.00 0.00 ? 1057 GLN B CD   4  
ATOM 4844  O OE1  . GLN A 1 13 ? -5.968  -10.801 12.839  1.00 0.00 ? 1057 GLN B OE1  4  
ATOM 4845  N NE2  . GLN A 1 13 ? -6.355  -8.897  13.871  1.00 0.00 ? 1057 GLN B NE2  4  
ATOM 4846  H H    . GLN A 1 13 ? -6.759  -9.307  8.719   1.00 0.00 ? 1057 GLN B H    4  
ATOM 4847  H HA   . GLN A 1 13 ? -8.342  -7.407  10.093  1.00 0.00 ? 1057 GLN B HA   4  
ATOM 4848  H HB2  . GLN A 1 13 ? -5.556  -8.455  10.568  1.00 0.00 ? 1057 GLN B HB2  4  
ATOM 4849  H HB3  . GLN A 1 13 ? -6.319  -7.275  11.637  1.00 0.00 ? 1057 GLN B HB3  4  
ATOM 4850  H HG2  . GLN A 1 13 ? -8.229  -8.822  11.942  1.00 0.00 ? 1057 GLN B HG2  4  
ATOM 4851  H HG3  . GLN A 1 13 ? -7.410  -10.009 10.933  1.00 0.00 ? 1057 GLN B HG3  4  
ATOM 4852  H HE21 . GLN A 1 13 ? -6.758  -8.002  13.859  1.00 0.00 ? 1057 GLN B HE21 4  
ATOM 4853  H HE22 . GLN A 1 13 ? -5.854  -9.200  14.657  1.00 0.00 ? 1057 GLN B HE22 4  
ATOM 4854  N N    . MET A 1 14 ? -5.704  -6.240  8.527   1.00 0.00 ? 1058 MET B N    4  
ATOM 4855  C CA   . MET A 1 14 ? -5.107  -5.002  8.060   1.00 0.00 ? 1058 MET B CA   4  
ATOM 4856  C C    . MET A 1 14 ? -6.093  -4.236  7.196   1.00 0.00 ? 1058 MET B C    4  
ATOM 4857  O O    . MET A 1 14 ? -6.199  -3.015  7.296   1.00 0.00 ? 1058 MET B O    4  
ATOM 4858  C CB   . MET A 1 14 ? -3.835  -5.276  7.260   1.00 0.00 ? 1058 MET B CB   4  
ATOM 4859  C CG   . MET A 1 14 ? -2.745  -5.787  8.202   1.00 0.00 ? 1058 MET B CG   4  
ATOM 4860  S SD   . MET A 1 14 ? -1.133  -5.672  7.386   1.00 0.00 ? 1058 MET B SD   4  
ATOM 4861  C CE   . MET A 1 14 ? -1.346  -6.997  6.177   1.00 0.00 ? 1058 MET B CE   4  
ATOM 4862  H H    . MET A 1 14 ? -5.321  -7.101  8.255   1.00 0.00 ? 1058 MET B H    4  
ATOM 4863  H HA   . MET A 1 14 ? -4.854  -4.397  8.917   1.00 0.00 ? 1058 MET B HA   4  
ATOM 4864  H HB2  . MET A 1 14 ? -4.041  -6.020  6.506   1.00 0.00 ? 1058 MET B HB2  4  
ATOM 4865  H HB3  . MET A 1 14 ? -3.502  -4.366  6.789   1.00 0.00 ? 1058 MET B HB3  4  
ATOM 4866  H HG2  . MET A 1 14 ? -2.737  -5.187  9.097   1.00 0.00 ? 1058 MET B HG2  4  
ATOM 4867  H HG3  . MET A 1 14 ? -2.946  -6.816  8.459   1.00 0.00 ? 1058 MET B HG3  4  
ATOM 4868  H HE1  . MET A 1 14 ? -0.712  -6.799  5.321   1.00 0.00 ? 1058 MET B HE1  4  
ATOM 4869  H HE2  . MET A 1 14 ? -2.374  -7.038  5.860   1.00 0.00 ? 1058 MET B HE2  4  
ATOM 4870  H HE3  . MET A 1 14 ? -1.070  -7.939  6.624   1.00 0.00 ? 1058 MET B HE3  4  
ATOM 4871  N N    . ALA A 1 15 ? -6.818  -4.955  6.349   1.00 0.00 ? 1059 ALA B N    4  
ATOM 4872  C CA   . ALA A 1 15 ? -7.792  -4.312  5.477   1.00 0.00 ? 1059 ALA B CA   4  
ATOM 4873  C C    . ALA A 1 15 ? -8.884  -3.638  6.294   1.00 0.00 ? 1059 ALA B C    4  
ATOM 4874  O O    . ALA A 1 15 ? -9.310  -2.523  5.984   1.00 0.00 ? 1059 ALA B O    4  
ATOM 4875  C CB   . ALA A 1 15 ? -8.423  -5.337  4.541   1.00 0.00 ? 1059 ALA B CB   4  
ATOM 4876  H H    . ALA A 1 15 ? -6.696  -5.931  6.312   1.00 0.00 ? 1059 ALA B H    4  
ATOM 4877  H HA   . ALA A 1 15 ? -7.287  -3.564  4.883   1.00 0.00 ? 1059 ALA B HA   4  
ATOM 4878  H HB1  . ALA A 1 15 ? -8.559  -6.270  5.066   1.00 0.00 ? 1059 ALA B HB1  4  
ATOM 4879  H HB2  . ALA A 1 15 ? -7.777  -5.494  3.689   1.00 0.00 ? 1059 ALA B HB2  4  
ATOM 4880  H HB3  . ALA A 1 15 ? -9.381  -4.971  4.203   1.00 0.00 ? 1059 ALA B HB3  4  
ATOM 4881  N N    . LYS A 1 16 ? -9.339  -4.319  7.341   1.00 0.00 ? 1060 LYS B N    4  
ATOM 4882  C CA   . LYS A 1 16 ? -10.386 -3.769  8.189   1.00 0.00 ? 1060 LYS B CA   4  
ATOM 4883  C C    . LYS A 1 16 ? -9.911  -2.490  8.860   1.00 0.00 ? 1060 LYS B C    4  
ATOM 4884  O O    . LYS A 1 16 ? -10.659 -1.517  8.960   1.00 0.00 ? 1060 LYS B O    4  
ATOM 4885  C CB   . LYS A 1 16 ? -10.787 -4.788  9.256   1.00 0.00 ? 1060 LYS B CB   4  
ATOM 4886  C CG   . LYS A 1 16 ? -11.525 -5.954  8.598   1.00 0.00 ? 1060 LYS B CG   4  
ATOM 4887  C CD   . LYS A 1 16 ? -11.917 -6.976  9.666   1.00 0.00 ? 1060 LYS B CD   4  
ATOM 4888  C CE   . LYS A 1 16 ? -12.661 -8.142  9.012   1.00 0.00 ? 1060 LYS B CE   4  
ATOM 4889  N NZ   . LYS A 1 16 ? -13.030 -9.140  10.056  1.00 0.00 ? 1060 LYS B NZ   4  
ATOM 4890  H H    . LYS A 1 16 ? -8.967  -5.204  7.541   1.00 0.00 ? 1060 LYS B H    4  
ATOM 4891  H HA   . LYS A 1 16 ? -11.248 -3.546  7.580   1.00 0.00 ? 1060 LYS B HA   4  
ATOM 4892  H HB2  . LYS A 1 16 ? -9.901  -5.156  9.753   1.00 0.00 ? 1060 LYS B HB2  4  
ATOM 4893  H HB3  . LYS A 1 16 ? -11.436 -4.315  9.979   1.00 0.00 ? 1060 LYS B HB3  4  
ATOM 4894  H HG2  . LYS A 1 16 ? -12.415 -5.585  8.107   1.00 0.00 ? 1060 LYS B HG2  4  
ATOM 4895  H HG3  . LYS A 1 16 ? -10.881 -6.425  7.871   1.00 0.00 ? 1060 LYS B HG3  4  
ATOM 4896  H HD2  . LYS A 1 16 ? -11.026 -7.345  10.155  1.00 0.00 ? 1060 LYS B HD2  4  
ATOM 4897  H HD3  . LYS A 1 16 ? -12.558 -6.506  10.396  1.00 0.00 ? 1060 LYS B HD3  4  
ATOM 4898  H HE2  . LYS A 1 16 ? -13.555 -7.773  8.533   1.00 0.00 ? 1060 LYS B HE2  4  
ATOM 4899  H HE3  . LYS A 1 16 ? -12.024 -8.609  8.275   1.00 0.00 ? 1060 LYS B HE3  4  
ATOM 4900  H HZ1  . LYS A 1 16 ? -12.264 -9.212  10.754  1.00 0.00 ? 1060 LYS B HZ1  4  
ATOM 4901  H HZ2  . LYS A 1 16 ? -13.181 -10.068 9.608   1.00 0.00 ? 1060 LYS B HZ2  4  
ATOM 4902  H HZ3  . LYS A 1 16 ? -13.902 -8.838  10.532  1.00 0.00 ? 1060 LYS B HZ3  4  
ATOM 4903  N N    . GLU A 1 17 ? -8.663  -2.488  9.318   1.00 0.00 ? 1061 GLU B N    4  
ATOM 4904  C CA   . GLU A 1 17 ? -8.115  -1.311  9.972   1.00 0.00 ? 1061 GLU B CA   4  
ATOM 4905  C C    . GLU A 1 17 ? -8.045  -0.141  8.995   1.00 0.00 ? 1061 GLU B C    4  
ATOM 4906  O O    . GLU A 1 17 ? -8.325  0.999   9.364   1.00 0.00 ? 1061 GLU B O    4  
ATOM 4907  C CB   . GLU A 1 17 ? -6.722  -1.620  10.522  1.00 0.00 ? 1061 GLU B CB   4  
ATOM 4908  C CG   . GLU A 1 17 ? -6.834  -2.597  11.698  1.00 0.00 ? 1061 GLU B CG   4  
ATOM 4909  C CD   . GLU A 1 17 ? -7.664  -1.987  12.823  1.00 0.00 ? 1061 GLU B CD   4  
ATOM 4910  O OE1  . GLU A 1 17 ? -7.393  -0.852  13.182  1.00 0.00 ? 1061 GLU B OE1  4  
ATOM 4911  O OE2  . GLU A 1 17 ? -8.557  -2.661  13.308  1.00 0.00 ? 1061 GLU B OE2  4  
ATOM 4912  H H    . GLU A 1 17 ? -8.102  -3.291  9.215   1.00 0.00 ? 1061 GLU B H    4  
ATOM 4913  H HA   . GLU A 1 17 ? -8.762  -1.037  10.790  1.00 0.00 ? 1061 GLU B HA   4  
ATOM 4914  H HB2  . GLU A 1 17 ? -6.117  -2.061  9.742   1.00 0.00 ? 1061 GLU B HB2  4  
ATOM 4915  H HB3  . GLU A 1 17 ? -6.262  -0.705  10.862  1.00 0.00 ? 1061 GLU B HB3  4  
ATOM 4916  H HG2  . GLU A 1 17 ? -7.306  -3.510  11.362  1.00 0.00 ? 1061 GLU B HG2  4  
ATOM 4917  H HG3  . GLU A 1 17 ? -5.848  -2.825  12.069  1.00 0.00 ? 1061 GLU B HG3  4  
ATOM 4918  N N    . MET A 1 18 ? -7.669  -0.423  7.748   1.00 0.00 ? 1062 MET B N    4  
ATOM 4919  C CA   . MET A 1 18 ? -7.571  0.630   6.745   1.00 0.00 ? 1062 MET B CA   4  
ATOM 4920  C C    . MET A 1 18 ? -8.933  1.273   6.517   1.00 0.00 ? 1062 MET B C    4  
ATOM 4921  O O    . MET A 1 18 ? -9.044  2.494   6.424   1.00 0.00 ? 1062 MET B O    4  
ATOM 4922  C CB   . MET A 1 18 ? -7.066  0.040   5.430   1.00 0.00 ? 1062 MET B CB   4  
ATOM 4923  C CG   . MET A 1 18 ? -5.615  -0.394  5.607   1.00 0.00 ? 1062 MET B CG   4  
ATOM 4924  S SD   . MET A 1 18 ? -5.106  -1.384  4.183   1.00 0.00 ? 1062 MET B SD   4  
ATOM 4925  C CE   . MET A 1 18 ? -3.944  -2.457  5.061   1.00 0.00 ? 1062 MET B CE   4  
ATOM 4926  H H    . MET A 1 18 ? -7.453  -1.351  7.499   1.00 0.00 ? 1062 MET B H    4  
ATOM 4927  H HA   . MET A 1 18 ? -6.877  1.381   7.086   1.00 0.00 ? 1062 MET B HA   4  
ATOM 4928  H HB2  . MET A 1 18 ? -7.670  -0.815  5.162   1.00 0.00 ? 1062 MET B HB2  4  
ATOM 4929  H HB3  . MET A 1 18 ? -7.126  0.786   4.654   1.00 0.00 ? 1062 MET B HB3  4  
ATOM 4930  H HG2  . MET A 1 18 ? -4.986  0.480   5.682   1.00 0.00 ? 1062 MET B HG2  4  
ATOM 4931  H HG3  . MET A 1 18 ? -5.523  -0.978  6.509   1.00 0.00 ? 1062 MET B HG3  4  
ATOM 4932  H HE1  . MET A 1 18 ? -4.284  -3.482  4.993   1.00 0.00 ? 1062 MET B HE1  4  
ATOM 4933  H HE2  . MET A 1 18 ? -3.896  -2.168  6.098   1.00 0.00 ? 1062 MET B HE2  4  
ATOM 4934  H HE3  . MET A 1 18 ? -2.963  -2.368  4.617   1.00 0.00 ? 1062 MET B HE3  4  
ATOM 4935  N N    . SER A 1 19 ? -9.970  0.445   6.438   1.00 0.00 ? 1063 SER B N    4  
ATOM 4936  C CA   . SER A 1 19 ? -11.318 0.957   6.231   1.00 0.00 ? 1063 SER B CA   4  
ATOM 4937  C C    . SER A 1 19 ? -11.749 1.817   7.414   1.00 0.00 ? 1063 SER B C    4  
ATOM 4938  O O    . SER A 1 19 ? -12.365 2.869   7.241   1.00 0.00 ? 1063 SER B O    4  
ATOM 4939  C CB   . SER A 1 19 ? -12.295 -0.203  6.054   1.00 0.00 ? 1063 SER B CB   4  
ATOM 4940  O OG   . SER A 1 19 ? -11.988 -0.896  4.850   1.00 0.00 ? 1063 SER B OG   4  
ATOM 4941  H H    . SER A 1 19 ? -9.826  -0.525  6.525   1.00 0.00 ? 1063 SER B H    4  
ATOM 4942  H HA   . SER A 1 19 ? -11.328 1.561   5.337   1.00 0.00 ? 1063 SER B HA   4  
ATOM 4943  H HB2  . SER A 1 19 ? -12.207 -0.883  6.885   1.00 0.00 ? 1063 SER B HB2  4  
ATOM 4944  H HB3  . SER A 1 19 ? -13.307 0.182   6.011   1.00 0.00 ? 1063 SER B HB3  4  
ATOM 4945  H HG   . SER A 1 19 ? -12.632 -1.599  4.738   1.00 0.00 ? 1063 SER B HG   4  
ATOM 4946  N N    . GLU A 1 20 ? -11.419 1.360   8.618   1.00 0.00 ? 1064 GLU B N    4  
ATOM 4947  C CA   . GLU A 1 20 ? -11.775 2.089   9.830   1.00 0.00 ? 1064 GLU B CA   4  
ATOM 4948  C C    . GLU A 1 20 ? -11.095 3.451   9.875   1.00 0.00 ? 1064 GLU B C    4  
ATOM 4949  O O    . GLU A 1 20 ? -11.709 4.448   10.254  1.00 0.00 ? 1064 GLU B O    4  
ATOM 4950  C CB   . GLU A 1 20 ? -11.351 1.283   11.054  1.00 0.00 ? 1064 GLU B CB   4  
ATOM 4951  C CG   . GLU A 1 20 ? -12.245 0.050   11.193  1.00 0.00 ? 1064 GLU B CG   4  
ATOM 4952  C CD   . GLU A 1 20 ? -11.701 -0.866  12.284  1.00 0.00 ? 1064 GLU B CD   4  
ATOM 4953  O OE1  . GLU A 1 20 ? -10.581 -0.644  12.710  1.00 0.00 ? 1064 GLU B OE1  4  
ATOM 4954  O OE2  . GLU A 1 20 ? -12.412 -1.776  12.675  1.00 0.00 ? 1064 GLU B OE2  4  
ATOM 4955  H H    . GLU A 1 20 ? -10.928 0.516   8.693   1.00 0.00 ? 1064 GLU B H    4  
ATOM 4956  H HA   . GLU A 1 20 ? -12.845 2.227   9.857   1.00 0.00 ? 1064 GLU B HA   4  
ATOM 4957  H HB2  . GLU A 1 20 ? -10.322 0.971   10.934  1.00 0.00 ? 1064 GLU B HB2  4  
ATOM 4958  H HB3  . GLU A 1 20 ? -11.442 1.895   11.937  1.00 0.00 ? 1064 GLU B HB3  4  
ATOM 4959  H HG2  . GLU A 1 20 ? -13.246 0.362   11.452  1.00 0.00 ? 1064 GLU B HG2  4  
ATOM 4960  H HG3  . GLU A 1 20 ? -12.268 -0.484  10.255  1.00 0.00 ? 1064 GLU B HG3  4  
ATOM 4961  N N    . PHE A 1 21 ? -9.822  3.491   9.487   1.00 0.00 ? 1065 PHE B N    4  
ATOM 4962  C CA   . PHE A 1 21 ? -9.081  4.744   9.494   1.00 0.00 ? 1065 PHE B CA   4  
ATOM 4963  C C    . PHE A 1 21 ? -9.646  5.706   8.462   1.00 0.00 ? 1065 PHE B C    4  
ATOM 4964  O O    . PHE A 1 21 ? -9.774  6.903   8.714   1.00 0.00 ? 1065 PHE B O    4  
ATOM 4965  C CB   . PHE A 1 21 ? -7.601  4.485   9.199   1.00 0.00 ? 1065 PHE B CB   4  
ATOM 4966  C CG   . PHE A 1 21 ? -6.907  4.004   10.452  1.00 0.00 ? 1065 PHE B CG   4  
ATOM 4967  C CD1  . PHE A 1 21 ? -6.380  2.708   10.515  1.00 0.00 ? 1065 PHE B CD1  4  
ATOM 4968  C CD2  . PHE A 1 21 ? -6.791  4.860   11.555  1.00 0.00 ? 1065 PHE B CD2  4  
ATOM 4969  C CE1  . PHE A 1 21 ? -5.734  2.270   11.677  1.00 0.00 ? 1065 PHE B CE1  4  
ATOM 4970  C CE2  . PHE A 1 21 ? -6.147  4.422   12.718  1.00 0.00 ? 1065 PHE B CE2  4  
ATOM 4971  C CZ   . PHE A 1 21 ? -5.619  3.125   12.779  1.00 0.00 ? 1065 PHE B CZ   4  
ATOM 4972  H H    . PHE A 1 21 ? -9.382  2.669   9.189   1.00 0.00 ? 1065 PHE B H    4  
ATOM 4973  H HA   . PHE A 1 21 ? -9.165  5.193   10.473  1.00 0.00 ? 1065 PHE B HA   4  
ATOM 4974  H HB2  . PHE A 1 21 ? -7.515  3.729   8.430   1.00 0.00 ? 1065 PHE B HB2  4  
ATOM 4975  H HB3  . PHE A 1 21 ? -7.137  5.398   8.860   1.00 0.00 ? 1065 PHE B HB3  4  
ATOM 4976  H HD1  . PHE A 1 21 ? -6.469  2.048   9.664   1.00 0.00 ? 1065 PHE B HD1  4  
ATOM 4977  H HD2  . PHE A 1 21 ? -7.198  5.859   11.508  1.00 0.00 ? 1065 PHE B HD2  4  
ATOM 4978  H HE1  . PHE A 1 21 ? -5.327  1.270   11.725  1.00 0.00 ? 1065 PHE B HE1  4  
ATOM 4979  H HE2  . PHE A 1 21 ? -6.057  5.081   13.567  1.00 0.00 ? 1065 PHE B HE2  4  
ATOM 4980  H HZ   . PHE A 1 21 ? -5.120  2.788   13.675  1.00 0.00 ? 1065 PHE B HZ   4  
ATOM 4981  N N    . LEU A 1 22 ? -9.987  5.168   7.297   1.00 0.00 ? 1066 LEU B N    4  
ATOM 4982  C CA   . LEU A 1 22 ? -10.543 5.984   6.227   1.00 0.00 ? 1066 LEU B CA   4  
ATOM 4983  C C    . LEU A 1 22 ? -11.904 6.542   6.633   1.00 0.00 ? 1066 LEU B C    4  
ATOM 4984  O O    . LEU A 1 22 ? -12.210 7.706   6.381   1.00 0.00 ? 1066 LEU B O    4  
ATOM 4985  C CB   . LEU A 1 22 ? -10.682 5.135   4.965   1.00 0.00 ? 1066 LEU B CB   4  
ATOM 4986  C CG   . LEU A 1 22 ? -9.289  4.801   4.422   1.00 0.00 ? 1066 LEU B CG   4  
ATOM 4987  C CD1  . LEU A 1 22 ? -9.410  3.715   3.355   1.00 0.00 ? 1066 LEU B CD1  4  
ATOM 4988  C CD2  . LEU A 1 22 ? -8.663  6.055   3.800   1.00 0.00 ? 1066 LEU B CD2  4  
ATOM 4989  H H    . LEU A 1 22 ? -9.863  4.205   7.160   1.00 0.00 ? 1066 LEU B H    4  
ATOM 4990  H HA   . LEU A 1 22 ? -9.871  6.806   6.025   1.00 0.00 ? 1066 LEU B HA   4  
ATOM 4991  H HB2  . LEU A 1 22 ? -11.206 4.220   5.203   1.00 0.00 ? 1066 LEU B HB2  4  
ATOM 4992  H HB3  . LEU A 1 22 ? -11.234 5.685   4.218   1.00 0.00 ? 1066 LEU B HB3  4  
ATOM 4993  H HG   . LEU A 1 22 ? -8.665  4.445   5.229   1.00 0.00 ? 1066 LEU B HG   4  
ATOM 4994  H HD11 . LEU A 1 22 ? -8.614  3.829   2.634   1.00 0.00 ? 1066 LEU B HD11 4  
ATOM 4995  H HD12 . LEU A 1 22 ? -10.364 3.803   2.857   1.00 0.00 ? 1066 LEU B HD12 4  
ATOM 4996  H HD13 . LEU A 1 22 ? -9.336  2.743   3.823   1.00 0.00 ? 1066 LEU B HD13 4  
ATOM 4997  H HD21 . LEU A 1 22 ? -8.238  5.807   2.837   1.00 0.00 ? 1066 LEU B HD21 4  
ATOM 4998  H HD22 . LEU A 1 22 ? -7.883  6.426   4.450   1.00 0.00 ? 1066 LEU B HD22 4  
ATOM 4999  H HD23 . LEU A 1 22 ? -9.420  6.812   3.676   1.00 0.00 ? 1066 LEU B HD23 4  
ATOM 5000  N N    . SER A 1 23 ? -12.715 5.702   7.269   1.00 0.00 ? 1067 SER B N    4  
ATOM 5001  C CA   . SER A 1 23 ? -14.040 6.119   7.717   1.00 0.00 ? 1067 SER B CA   4  
ATOM 5002  C C    . SER A 1 23 ? -13.933 7.211   8.778   1.00 0.00 ? 1067 SER B C    4  
ATOM 5003  O O    . SER A 1 23 ? -14.668 8.197   8.749   1.00 0.00 ? 1067 SER B O    4  
ATOM 5004  C CB   . SER A 1 23 ? -14.801 4.923   8.285   1.00 0.00 ? 1067 SER B CB   4  
ATOM 5005  O OG   . SER A 1 23 ? -16.087 5.348   8.720   1.00 0.00 ? 1067 SER B OG   4  
ATOM 5006  H H    . SER A 1 23 ? -12.415 4.785   7.447   1.00 0.00 ? 1067 SER B H    4  
ATOM 5007  H HA   . SER A 1 23 ? -14.587 6.510   6.872   1.00 0.00 ? 1067 SER B HA   4  
ATOM 5008  H HB2  . SER A 1 23 ? -14.918 4.173   7.520   1.00 0.00 ? 1067 SER B HB2  4  
ATOM 5009  H HB3  . SER A 1 23 ? -14.248 4.505   9.115   1.00 0.00 ? 1067 SER B HB3  4  
ATOM 5010  H HG   . SER A 1 23 ? -16.629 4.567   8.850   1.00 0.00 ? 1067 SER B HG   4  
ATOM 5011  N N    . ARG A 1 24 ? -13.015 7.016   9.722   1.00 0.00 ? 1068 ARG B N    4  
ATOM 5012  C CA   . ARG A 1 24 ? -12.819 7.979   10.802  1.00 0.00 ? 1068 ARG B CA   4  
ATOM 5013  C C    . ARG A 1 24 ? -12.376 9.333   10.260  1.00 0.00 ? 1068 ARG B C    4  
ATOM 5014  O O    . ARG A 1 24 ? -12.810 10.377  10.748  1.00 0.00 ? 1068 ARG B O    4  
ATOM 5015  C CB   . ARG A 1 24 ? -11.759 7.463   11.775  1.00 0.00 ? 1068 ARG B CB   4  
ATOM 5016  C CG   . ARG A 1 24 ? -12.327 6.295   12.582  1.00 0.00 ? 1068 ARG B CG   4  
ATOM 5017  C CD   . ARG A 1 24 ? -13.304 6.826   13.630  1.00 0.00 ? 1068 ARG B CD   4  
ATOM 5018  N NE   . ARG A 1 24 ? -14.677 6.724   13.144  1.00 0.00 ? 1068 ARG B NE   4  
ATOM 5019  C CZ   . ARG A 1 24 ? -15.702 7.243   13.823  1.00 0.00 ? 1068 ARG B CZ   4  
ATOM 5020  N NH1  . ARG A 1 24 ? -15.505 7.872   14.955  1.00 0.00 ? 1068 ARG B NH1  4  
ATOM 5021  N NH2  . ARG A 1 24 ? -16.915 7.119   13.357  1.00 0.00 ? 1068 ARG B NH2  4  
ATOM 5022  H H    . ARG A 1 24 ? -12.463 6.207   9.697   1.00 0.00 ? 1068 ARG B H    4  
ATOM 5023  H HA   . ARG A 1 24 ? -13.748 8.102   11.336  1.00 0.00 ? 1068 ARG B HA   4  
ATOM 5024  H HB2  . ARG A 1 24 ? -10.894 7.130   11.220  1.00 0.00 ? 1068 ARG B HB2  4  
ATOM 5025  H HB3  . ARG A 1 24 ? -11.473 8.257   12.449  1.00 0.00 ? 1068 ARG B HB3  4  
ATOM 5026  H HG2  . ARG A 1 24 ? -12.843 5.617   11.917  1.00 0.00 ? 1068 ARG B HG2  4  
ATOM 5027  H HG3  . ARG A 1 24 ? -11.520 5.771   13.074  1.00 0.00 ? 1068 ARG B HG3  4  
ATOM 5028  H HD2  . ARG A 1 24 ? -13.204 6.249   14.536  1.00 0.00 ? 1068 ARG B HD2  4  
ATOM 5029  H HD3  . ARG A 1 24 ? -13.072 7.860   13.841  1.00 0.00 ? 1068 ARG B HD3  4  
ATOM 5030  H HE   . ARG A 1 24 ? -14.849 6.265   12.296  1.00 0.00 ? 1068 ARG B HE   4  
ATOM 5031  H HH11 . ARG A 1 24 ? -14.582 7.972   15.324  1.00 0.00 ? 1068 ARG B HH11 4  
ATOM 5032  H HH12 . ARG A 1 24 ? -16.282 8.254   15.453  1.00 0.00 ? 1068 ARG B HH12 4  
ATOM 5033  H HH21 . ARG A 1 24 ? -17.074 6.638   12.495  1.00 0.00 ? 1068 ARG B HH21 4  
ATOM 5034  H HH22 . ARG A 1 24 ? -17.686 7.505   13.863  1.00 0.00 ? 1068 ARG B HH22 4  
ATOM 5035  N N    . GLY A 1 25 ? -11.504 9.312   9.260   1.00 0.00 ? 1069 GLY B N    4  
ATOM 5036  C CA   . GLY A 1 25 ? -11.006 10.552  8.681   1.00 0.00 ? 1069 GLY B CA   4  
ATOM 5037  C C    . GLY A 1 25 ? -12.114 11.278  7.907   1.00 0.00 ? 1069 GLY B C    4  
ATOM 5038  O O    . GLY A 1 25 ? -13.016 11.850  8.522   1.00 0.00 ? 1069 GLY B O    4  
ATOM 5039  H H    . GLY A 1 25 ? -11.182 8.453   8.914   1.00 0.00 ? 1069 GLY B H    4  
ATOM 5040  H HA2  . GLY A 1 25 ? -10.659 11.192  9.479   1.00 0.00 ? 1069 GLY B HA2  4  
ATOM 5041  H HA3  . GLY A 1 25 ? -10.181 10.333  8.031   1.00 0.00 ? 1069 GLY B HA3  4  
ATOM 5042  N N    . PRO A 1 26 ? -12.082 11.278  6.593   1.00 0.00 ? 1070 PRO B N    4  
ATOM 5043  C CA   . PRO A 1 26 ? -13.127 11.969  5.778   1.00 0.00 ? 1070 PRO B CA   4  
ATOM 5044  C C    . PRO A 1 26 ? -14.476 11.257  5.838   1.00 0.00 ? 1070 PRO B C    4  
ATOM 5045  O O    . PRO A 1 26 ? -14.542 10.031  5.910   1.00 0.00 ? 1070 PRO B O    4  
ATOM 5046  C CB   . PRO A 1 26 ? -12.554 11.942  4.360   1.00 0.00 ? 1070 PRO B CB   4  
ATOM 5047  C CG   . PRO A 1 26 ? -11.630 10.774  4.331   1.00 0.00 ? 1070 PRO B CG   4  
ATOM 5048  C CD   . PRO A 1 26 ? -11.068 10.632  5.741   1.00 0.00 ? 1070 PRO B CD   4  
ATOM 5049  H HA   . PRO A 1 26 ? -13.232 12.991  6.103   1.00 0.00 ? 1070 PRO B HA   4  
ATOM 5050  H HB2  . PRO A 1 26 ? -13.352 11.810  3.640   1.00 0.00 ? 1070 PRO B HB2  4  
ATOM 5051  H HB3  . PRO A 1 26 ? -12.010 12.851  4.157   1.00 0.00 ? 1070 PRO B HB3  4  
ATOM 5052  H HG2  . PRO A 1 26 ? -12.168 9.880   4.053   1.00 0.00 ? 1070 PRO B HG2  4  
ATOM 5053  H HG3  . PRO A 1 26 ? -10.823 10.955  3.640   1.00 0.00 ? 1070 PRO B HG3  4  
ATOM 5054  H HD2  . PRO A 1 26 ? -10.956 9.589   6.000   1.00 0.00 ? 1070 PRO B HD2  4  
ATOM 5055  H HD3  . PRO A 1 26 ? -10.128 11.148  5.829   1.00 0.00 ? 1070 PRO B HD3  4  
ATOM 5056  N N    . ALA A 1 27 ? -15.552 12.041  5.805   1.00 0.00 ? 1071 ALA B N    4  
ATOM 5057  C CA   . ALA A 1 27 ? -16.899 11.478  5.855   1.00 0.00 ? 1071 ALA B CA   4  
ATOM 5058  C C    . ALA A 1 27 ? -17.162 10.586  4.650   1.00 0.00 ? 1071 ALA B C    4  
ATOM 5059  O O    . ALA A 1 27 ? -17.744 9.510   4.774   1.00 0.00 ? 1071 ALA B O    4  
ATOM 5060  C CB   . ALA A 1 27 ? -17.933 12.600  5.870   1.00 0.00 ? 1071 ALA B CB   4  
ATOM 5061  H H    . ALA A 1 27 ? -15.438 13.012  5.746   1.00 0.00 ? 1071 ALA B H    4  
ATOM 5062  H HA   . ALA A 1 27 ? -17.005 10.895  6.755   1.00 0.00 ? 1071 ALA B HA   4  
ATOM 5063  H HB1  . ALA A 1 27 ? -18.331 12.731  4.873   1.00 0.00 ? 1071 ALA B HB1  4  
ATOM 5064  H HB2  . ALA A 1 27 ? -17.467 13.518  6.196   1.00 0.00 ? 1071 ALA B HB2  4  
ATOM 5065  H HB3  . ALA A 1 27 ? -18.735 12.343  6.545   1.00 0.00 ? 1071 ALA B HB3  4  
ATOM 5066  N N    . VAL A 1 28 ? -16.728 11.044  3.482   1.00 0.00 ? 1072 VAL B N    4  
ATOM 5067  C CA   . VAL A 1 28 ? -16.922 10.285  2.259   1.00 0.00 ? 1072 VAL B CA   4  
ATOM 5068  C C    . VAL A 1 28 ? -15.754 10.500  1.304   1.00 0.00 ? 1072 VAL B C    4  
ATOM 5069  O O    . VAL A 1 28 ? -15.361 11.633  1.025   1.00 0.00 ? 1072 VAL B O    4  
ATOM 5070  C CB   . VAL A 1 28 ? -18.226 10.705  1.579   1.00 0.00 ? 1072 VAL B CB   4  
ATOM 5071  C CG1  . VAL A 1 28 ? -18.134 12.173  1.157   1.00 0.00 ? 1072 VAL B CG1  4  
ATOM 5072  C CG2  . VAL A 1 28 ? -18.459 9.835   0.342   1.00 0.00 ? 1072 VAL B CG2  4  
ATOM 5073  H H    . VAL A 1 28 ? -16.268 11.909  3.443   1.00 0.00 ? 1072 VAL B H    4  
ATOM 5074  H HA   . VAL A 1 28 ? -16.982 9.234   2.506   1.00 0.00 ? 1072 VAL B HA   4  
ATOM 5075  H HB   . VAL A 1 28 ? -19.049 10.581  2.269   1.00 0.00 ? 1072 VAL B HB   4  
ATOM 5076  H HG11 . VAL A 1 28 ? -19.129 12.581  1.057   1.00 0.00 ? 1072 VAL B HG11 4  
ATOM 5077  H HG12 . VAL A 1 28 ? -17.620 12.243  0.209   1.00 0.00 ? 1072 VAL B HG12 4  
ATOM 5078  H HG13 . VAL A 1 28 ? -17.589 12.729  1.905   1.00 0.00 ? 1072 VAL B HG13 4  
ATOM 5079  H HG21 . VAL A 1 28 ? -19.515 9.628   0.241   1.00 0.00 ? 1072 VAL B HG21 4  
ATOM 5080  H HG22 . VAL A 1 28 ? -17.920 8.905   0.449   1.00 0.00 ? 1072 VAL B HG22 4  
ATOM 5081  H HG23 . VAL A 1 28 ? -18.109 10.357  -0.536  1.00 0.00 ? 1072 VAL B HG23 4  
ATOM 5082  N N    . LEU A 1 29 ? -15.213 9.401   0.805   1.00 0.00 ? 1073 LEU B N    4  
ATOM 5083  C CA   . LEU A 1 29 ? -14.092 9.457   -0.130  1.00 0.00 ? 1073 LEU B CA   4  
ATOM 5084  C C    . LEU A 1 29 ? -14.542 9.122   -1.550  1.00 0.00 ? 1073 LEU B C    4  
ATOM 5085  O O    . LEU A 1 29 ? -13.715 8.851   -2.421  1.00 0.00 ? 1073 LEU B O    4  
ATOM 5086  C CB   . LEU A 1 29 ? -13.008 8.477   0.302   1.00 0.00 ? 1073 LEU B CB   4  
ATOM 5087  C CG   . LEU A 1 29 ? -12.336 8.986   1.576   1.00 0.00 ? 1073 LEU B CG   4  
ATOM 5088  C CD1  . LEU A 1 29 ? -11.443 7.888   2.160   1.00 0.00 ? 1073 LEU B CD1  4  
ATOM 5089  C CD2  . LEU A 1 29 ? -11.477 10.206  1.237   1.00 0.00 ? 1073 LEU B CD2  4  
ATOM 5090  H H    . LEU A 1 29 ? -15.579 8.532   1.068   1.00 0.00 ? 1073 LEU B H    4  
ATOM 5091  H HA   . LEU A 1 29 ? -13.684 10.455  -0.122  1.00 0.00 ? 1073 LEU B HA   4  
ATOM 5092  H HB2  . LEU A 1 29 ? -13.456 7.513   0.490   1.00 0.00 ? 1073 LEU B HB2  4  
ATOM 5093  H HB3  . LEU A 1 29 ? -12.274 8.389   -0.482  1.00 0.00 ? 1073 LEU B HB3  4  
ATOM 5094  H HG   . LEU A 1 29 ? -13.091 9.261   2.297   1.00 0.00 ? 1073 LEU B HG   4  
ATOM 5095  H HD11 . LEU A 1 29 ? -10.455 7.961   1.732   1.00 0.00 ? 1073 LEU B HD11 4  
ATOM 5096  H HD12 . LEU A 1 29 ? -11.864 6.921   1.929   1.00 0.00 ? 1073 LEU B HD12 4  
ATOM 5097  H HD13 . LEU A 1 29 ? -11.380 8.007   3.232   1.00 0.00 ? 1073 LEU B HD13 4  
ATOM 5098  H HD21 . LEU A 1 29 ? -11.422 10.322  0.164   1.00 0.00 ? 1073 LEU B HD21 4  
ATOM 5099  H HD22 . LEU A 1 29 ? -10.483 10.070  1.636   1.00 0.00 ? 1073 LEU B HD22 4  
ATOM 5100  H HD23 . LEU A 1 29 ? -11.921 11.090  1.672   1.00 0.00 ? 1073 LEU B HD23 4  
ATOM 5101  N N    . ALA A 1 30 ? -15.848 9.137   -1.775  1.00 0.00 ? 1074 ALA B N    4  
ATOM 5102  C CA   . ALA A 1 30 ? -16.392 8.835   -3.090  1.00 0.00 ? 1074 ALA B CA   4  
ATOM 5103  C C    . ALA A 1 30 ? -15.906 9.854   -4.107  1.00 0.00 ? 1074 ALA B C    4  
ATOM 5104  O O    . ALA A 1 30 ? -15.813 9.568   -5.300  1.00 0.00 ? 1074 ALA B O    4  
ATOM 5105  C CB   . ALA A 1 30 ? -17.917 8.856   -3.040  1.00 0.00 ? 1074 ALA B CB   4  
ATOM 5106  H H    . ALA A 1 30 ? -16.459 9.366   -1.049  1.00 0.00 ? 1074 ALA B H    4  
ATOM 5107  H HA   . ALA A 1 30 ? -16.063 7.852   -3.392  1.00 0.00 ? 1074 ALA B HA   4  
ATOM 5108  H HB1  . ALA A 1 30 ? -18.248 8.641   -2.035  1.00 0.00 ? 1074 ALA B HB1  4  
ATOM 5109  H HB2  . ALA A 1 30 ? -18.312 8.110   -3.716  1.00 0.00 ? 1074 ALA B HB2  4  
ATOM 5110  H HB3  . ALA A 1 30 ? -18.273 9.834   -3.336  1.00 0.00 ? 1074 ALA B HB3  4  
ATOM 5111  N N    . THR A 1 31 ? -15.614 11.052  -3.622  1.00 0.00 ? 1075 THR B N    4  
ATOM 5112  C CA   . THR A 1 31 ? -15.153 12.120  -4.485  1.00 0.00 ? 1075 THR B CA   4  
ATOM 5113  C C    . THR A 1 31 ? -13.779 11.794  -5.056  1.00 0.00 ? 1075 THR B C    4  
ATOM 5114  O O    . THR A 1 31 ? -12.983 11.090  -4.434  1.00 0.00 ? 1075 THR B O    4  
ATOM 5115  C CB   . THR A 1 31 ? -15.085 13.427  -3.704  1.00 0.00 ? 1075 THR B CB   4  
ATOM 5116  O OG1  . THR A 1 31 ? -16.181 13.498  -2.802  1.00 0.00 ? 1075 THR B OG1  4  
ATOM 5117  C CG2  . THR A 1 31 ? -15.166 14.589  -4.684  1.00 0.00 ? 1075 THR B CG2  4  
ATOM 5118  H H    . THR A 1 31 ? -15.715 11.222  -2.665  1.00 0.00 ? 1075 THR B H    4  
ATOM 5119  H HA   . THR A 1 31 ? -15.853 12.238  -5.299  1.00 0.00 ? 1075 THR B HA   4  
ATOM 5120  H HB   . THR A 1 31 ? -14.155 13.481  -3.162  1.00 0.00 ? 1075 THR B HB   4  
ATOM 5121  H HG1  . THR A 1 31 ? -15.873 13.911  -1.992  1.00 0.00 ? 1075 THR B HG1  4  
ATOM 5122  H HG21 . THR A 1 31 ? -15.500 15.472  -4.165  1.00 0.00 ? 1075 THR B HG21 4  
ATOM 5123  H HG22 . THR A 1 31 ? -15.869 14.343  -5.466  1.00 0.00 ? 1075 THR B HG22 4  
ATOM 5124  H HG23 . THR A 1 31 ? -14.192 14.767  -5.115  1.00 0.00 ? 1075 THR B HG23 4  
ATOM 5125  N N    . LYS A 1 32 ? -13.512 12.313  -6.244  1.00 0.00 ? 1076 LYS B N    4  
ATOM 5126  C CA   . LYS A 1 32 ? -12.234 12.082  -6.908  1.00 0.00 ? 1076 LYS B CA   4  
ATOM 5127  C C    . LYS A 1 32 ? -11.236 13.179  -6.542  1.00 0.00 ? 1076 LYS B C    4  
ATOM 5128  O O    . LYS A 1 32 ? -10.224 13.364  -7.219  1.00 0.00 ? 1076 LYS B O    4  
ATOM 5129  C CB   . LYS A 1 32 ? -12.430 12.053  -8.428  1.00 0.00 ? 1076 LYS B CB   4  
ATOM 5130  C CG   . LYS A 1 32 ? -13.475 10.994  -8.809  1.00 0.00 ? 1076 LYS B CG   4  
ATOM 5131  C CD   . LYS A 1 32 ? -12.914 9.579   -8.602  1.00 0.00 ? 1076 LYS B CD   4  
ATOM 5132  C CE   . LYS A 1 32 ? -11.856 9.277   -9.668  1.00 0.00 ? 1076 LYS B CE   4  
ATOM 5133  N NZ   . LYS A 1 32 ? -11.469 7.839   -9.593  1.00 0.00 ? 1076 LYS B NZ   4  
ATOM 5134  H H    . LYS A 1 32 ? -14.191 12.866  -6.683  1.00 0.00 ? 1076 LYS B H    4  
ATOM 5135  H HA   . LYS A 1 32 ? -11.838 11.134  -6.585  1.00 0.00 ? 1076 LYS B HA   4  
ATOM 5136  H HB2  . LYS A 1 32 ? -12.766 13.024  -8.761  1.00 0.00 ? 1076 LYS B HB2  4  
ATOM 5137  H HB3  . LYS A 1 32 ? -11.491 11.819  -8.905  1.00 0.00 ? 1076 LYS B HB3  4  
ATOM 5138  H HG2  . LYS A 1 32 ? -14.354 11.121  -8.196  1.00 0.00 ? 1076 LYS B HG2  4  
ATOM 5139  H HG3  . LYS A 1 32 ? -13.745 11.120  -9.846  1.00 0.00 ? 1076 LYS B HG3  4  
ATOM 5140  H HD2  . LYS A 1 32 ? -12.470 9.503   -7.623  1.00 0.00 ? 1076 LYS B HD2  4  
ATOM 5141  H HD3  . LYS A 1 32 ? -13.716 8.863   -8.684  1.00 0.00 ? 1076 LYS B HD3  4  
ATOM 5142  H HE2  . LYS A 1 32 ? -12.260 9.491   -10.647 1.00 0.00 ? 1076 LYS B HE2  4  
ATOM 5143  H HE3  . LYS A 1 32 ? -10.984 9.892   -9.497  1.00 0.00 ? 1076 LYS B HE3  4  
ATOM 5144  H HZ1  . LYS A 1 32 ? -11.372 7.557   -8.598  1.00 0.00 ? 1076 LYS B HZ1  4  
ATOM 5145  H HZ2  . LYS A 1 32 ? -10.563 7.698   -10.085 1.00 0.00 ? 1076 LYS B HZ2  4  
ATOM 5146  H HZ3  . LYS A 1 32 ? -12.204 7.259   -10.045 1.00 0.00 ? 1076 LYS B HZ3  4  
ATOM 5147  N N    . ALA A 1 33 ? -11.524 13.911  -5.467  1.00 0.00 ? 1077 ALA B N    4  
ATOM 5148  C CA   . ALA A 1 33 ? -10.638 14.982  -5.030  1.00 0.00 ? 1077 ALA B CA   4  
ATOM 5149  C C    . ALA A 1 33 ? -9.269  14.418  -4.664  1.00 0.00 ? 1077 ALA B C    4  
ATOM 5150  O O    . ALA A 1 33 ? -9.166  13.336  -4.086  1.00 0.00 ? 1077 ALA B O    4  
ATOM 5151  C CB   . ALA A 1 33 ? -11.243 15.697  -3.820  1.00 0.00 ? 1077 ALA B CB   4  
ATOM 5152  H H    . ALA A 1 33 ? -12.340 13.725  -4.957  1.00 0.00 ? 1077 ALA B H    4  
ATOM 5153  H HA   . ALA A 1 33 ? -10.522 15.691  -5.835  1.00 0.00 ? 1077 ALA B HA   4  
ATOM 5154  H HB1  . ALA A 1 33 ? -10.696 16.610  -3.632  1.00 0.00 ? 1077 ALA B HB1  4  
ATOM 5155  H HB2  . ALA A 1 33 ? -11.180 15.056  -2.954  1.00 0.00 ? 1077 ALA B HB2  4  
ATOM 5156  H HB3  . ALA A 1 33 ? -12.278 15.932  -4.020  1.00 0.00 ? 1077 ALA B HB3  4  
ATOM 5157  N N    . ALA A 1 34 ? -8.222  15.158  -5.008  1.00 0.00 ? 1078 ALA B N    4  
ATOM 5158  C CA   . ALA A 1 34 ? -6.860  14.724  -4.715  1.00 0.00 ? 1078 ALA B CA   4  
ATOM 5159  C C    . ALA A 1 34 ? -6.537  13.415  -5.438  1.00 0.00 ? 1078 ALA B C    4  
ATOM 5160  O O    . ALA A 1 34 ? -5.615  12.694  -5.058  1.00 0.00 ? 1078 ALA B O    4  
ATOM 5161  C CB   . ALA A 1 34 ? -6.690  14.532  -3.207  1.00 0.00 ? 1078 ALA B CB   4  
ATOM 5162  H H    . ALA A 1 34 ? -8.367  16.010  -5.469  1.00 0.00 ? 1078 ALA B H    4  
ATOM 5163  H HA   . ALA A 1 34 ? -6.172  15.485  -5.048  1.00 0.00 ? 1078 ALA B HA   4  
ATOM 5164  H HB1  . ALA A 1 34 ? -6.015  15.283  -2.824  1.00 0.00 ? 1078 ALA B HB1  4  
ATOM 5165  H HB2  . ALA A 1 34 ? -6.286  13.551  -3.011  1.00 0.00 ? 1078 ALA B HB2  4  
ATOM 5166  H HB3  . ALA A 1 34 ? -7.650  14.630  -2.720  1.00 0.00 ? 1078 ALA B HB3  4  
ATOM 5167  N N    . ALA A 1 35 ? -7.296  13.116  -6.487  1.00 0.00 ? 1079 ALA B N    4  
ATOM 5168  C CA   . ALA A 1 35 ? -7.074  11.900  -7.258  1.00 0.00 ? 1079 ALA B CA   4  
ATOM 5169  C C    . ALA A 1 35 ? -5.700  11.920  -7.928  1.00 0.00 ? 1079 ALA B C    4  
ATOM 5170  O O    . ALA A 1 35 ? -5.023  10.896  -8.013  1.00 0.00 ? 1079 ALA B O    4  
ATOM 5171  C CB   . ALA A 1 35 ? -8.161  11.755  -8.325  1.00 0.00 ? 1079 ALA B CB   4  
ATOM 5172  H H    . ALA A 1 35 ? -8.014  13.726  -6.753  1.00 0.00 ? 1079 ALA B H    4  
ATOM 5173  H HA   . ALA A 1 35 ? -7.127  11.051  -6.596  1.00 0.00 ? 1079 ALA B HA   4  
ATOM 5174  H HB1  . ALA A 1 35 ? -8.363  12.718  -8.768  1.00 0.00 ? 1079 ALA B HB1  4  
ATOM 5175  H HB2  . ALA A 1 35 ? -9.064  11.371  -7.871  1.00 0.00 ? 1079 ALA B HB2  4  
ATOM 5176  H HB3  . ALA A 1 35 ? -7.826  11.069  -9.091  1.00 0.00 ? 1079 ALA B HB3  4  
ATOM 5177  N N    . GLY A 1 36 ? -5.303  13.093  -8.413  1.00 0.00 ? 1080 GLY B N    4  
ATOM 5178  C CA   . GLY A 1 36 ? -4.017  13.243  -9.090  1.00 0.00 ? 1080 GLY B CA   4  
ATOM 5179  C C    . GLY A 1 36 ? -2.960  13.833  -8.164  1.00 0.00 ? 1080 GLY B C    4  
ATOM 5180  O O    . GLY A 1 36 ? -1.901  14.266  -8.618  1.00 0.00 ? 1080 GLY B O    4  
ATOM 5181  H H    . GLY A 1 36 ? -5.886  13.876  -8.316  1.00 0.00 ? 1080 GLY B H    4  
ATOM 5182  H HA2  . GLY A 1 36 ? -3.686  12.272  -9.432  1.00 0.00 ? 1080 GLY B HA2  4  
ATOM 5183  H HA3  . GLY A 1 36 ? -4.141  13.893  -9.944  1.00 0.00 ? 1080 GLY B HA3  4  
ATOM 5184  N N    . THR A 1 37 ? -3.252  13.860  -6.868  1.00 0.00 ? 1081 THR B N    4  
ATOM 5185  C CA   . THR A 1 37 ? -2.320  14.408  -5.899  1.00 0.00 ? 1081 THR B CA   4  
ATOM 5186  C C    . THR A 1 37 ? -1.551  13.293  -5.188  1.00 0.00 ? 1081 THR B C    4  
ATOM 5187  O O    . THR A 1 37 ? -0.888  13.532  -4.178  1.00 0.00 ? 1081 THR B O    4  
ATOM 5188  C CB   . THR A 1 37 ? -3.082  15.250  -4.880  1.00 0.00 ? 1081 THR B CB   4  
ATOM 5189  O OG1  . THR A 1 37 ? -4.053  14.446  -4.228  1.00 0.00 ? 1081 THR B OG1  4  
ATOM 5190  C CG2  . THR A 1 37 ? -3.771  16.416  -5.592  1.00 0.00 ? 1081 THR B CG2  4  
ATOM 5191  H H    . THR A 1 37 ? -4.110  13.509  -6.556  1.00 0.00 ? 1081 THR B H    4  
ATOM 5192  H HA   . THR A 1 37 ? -1.615  15.042  -6.415  1.00 0.00 ? 1081 THR B HA   4  
ATOM 5193  H HB   . THR A 1 37 ? -2.397  15.636  -4.157  1.00 0.00 ? 1081 THR B HB   4  
ATOM 5194  H HG1  . THR A 1 37 ? -3.635  13.620  -3.978  1.00 0.00 ? 1081 THR B HG1  4  
ATOM 5195  H HG21 . THR A 1 37 ? -4.430  16.921  -4.902  1.00 0.00 ? 1081 THR B HG21 4  
ATOM 5196  H HG22 . THR A 1 37 ? -4.343  16.042  -6.429  1.00 0.00 ? 1081 THR B HG22 4  
ATOM 5197  H HG23 . THR A 1 37 ? -3.024  17.108  -5.949  1.00 0.00 ? 1081 THR B HG23 4  
ATOM 5198  N N    . LYS A 1 38 ? -1.644  12.072  -5.719  1.00 0.00 ? 1082 LYS B N    4  
ATOM 5199  C CA   . LYS A 1 38 ? -0.953  10.931  -5.130  1.00 0.00 ? 1082 LYS B CA   4  
ATOM 5200  C C    . LYS A 1 38 ? 0.445   10.775  -5.726  1.00 0.00 ? 1082 LYS B C    4  
ATOM 5201  O O    . LYS A 1 38 ? 0.943   9.660   -5.884  1.00 0.00 ? 1082 LYS B O    4  
ATOM 5202  C CB   . LYS A 1 38 ? -1.755  9.651   -5.373  1.00 0.00 ? 1082 LYS B CB   4  
ATOM 5203  C CG   . LYS A 1 38 ? -1.837  9.371   -6.878  1.00 0.00 ? 1082 LYS B CG   4  
ATOM 5204  C CD   . LYS A 1 38 ? -2.657  8.103   -7.117  1.00 0.00 ? 1082 LYS B CD   4  
ATOM 5205  C CE   . LYS A 1 38 ? -2.736  7.824   -8.619  1.00 0.00 ? 1082 LYS B CE   4  
ATOM 5206  N NZ   . LYS A 1 38 ? -3.530  6.586   -8.853  1.00 0.00 ? 1082 LYS B NZ   4  
ATOM 5207  H H    . LYS A 1 38 ? -2.183  11.938  -6.523  1.00 0.00 ? 1082 LYS B H    4  
ATOM 5208  H HA   . LYS A 1 38 ? -0.862  11.088  -4.067  1.00 0.00 ? 1082 LYS B HA   4  
ATOM 5209  H HB2  . LYS A 1 38 ? -1.269  8.823   -4.878  1.00 0.00 ? 1082 LYS B HB2  4  
ATOM 5210  H HB3  . LYS A 1 38 ? -2.751  9.773   -4.978  1.00 0.00 ? 1082 LYS B HB3  4  
ATOM 5211  H HG2  . LYS A 1 38 ? -2.309  10.206  -7.373  1.00 0.00 ? 1082 LYS B HG2  4  
ATOM 5212  H HG3  . LYS A 1 38 ? -0.843  9.234   -7.272  1.00 0.00 ? 1082 LYS B HG3  4  
ATOM 5213  H HD2  . LYS A 1 38 ? -2.185  7.269   -6.619  1.00 0.00 ? 1082 LYS B HD2  4  
ATOM 5214  H HD3  . LYS A 1 38 ? -3.653  8.240   -6.726  1.00 0.00 ? 1082 LYS B HD3  4  
ATOM 5215  H HE2  . LYS A 1 38 ? -3.212  8.656   -9.115  1.00 0.00 ? 1082 LYS B HE2  4  
ATOM 5216  H HE3  . LYS A 1 38 ? -1.740  7.691   -9.013  1.00 0.00 ? 1082 LYS B HE3  4  
ATOM 5217  H HZ1  . LYS A 1 38 ? -3.020  5.767   -8.466  1.00 0.00 ? 1082 LYS B HZ1  4  
ATOM 5218  H HZ2  . LYS A 1 38 ? -3.673  6.454   -9.876  1.00 0.00 ? 1082 LYS B HZ2  4  
ATOM 5219  H HZ3  . LYS A 1 38 ? -4.454  6.671   -8.383  1.00 0.00 ? 1082 LYS B HZ3  4  
ATOM 5220  N N    . LYS A 1 39 ? 1.073   11.899  -6.055  1.00 0.00 ? 1083 LYS B N    4  
ATOM 5221  C CA   . LYS A 1 39 ? 2.410   11.877  -6.634  1.00 0.00 ? 1083 LYS B CA   4  
ATOM 5222  C C    . LYS A 1 39 ? 3.407   11.270  -5.652  1.00 0.00 ? 1083 LYS B C    4  
ATOM 5223  O O    . LYS A 1 39 ? 4.456   10.764  -6.051  1.00 0.00 ? 1083 LYS B O    4  
ATOM 5224  C CB   . LYS A 1 39 ? 2.843   13.299  -6.987  1.00 0.00 ? 1083 LYS B CB   4  
ATOM 5225  C CG   . LYS A 1 39 ? 2.018   13.801  -8.174  1.00 0.00 ? 1083 LYS B CG   4  
ATOM 5226  C CD   . LYS A 1 39 ? 2.289   15.291  -8.390  1.00 0.00 ? 1083 LYS B CD   4  
ATOM 5227  C CE   . LYS A 1 39 ? 3.735   15.491  -8.847  1.00 0.00 ? 1083 LYS B CE   4  
ATOM 5228  N NZ   . LYS A 1 39 ? 3.970   16.934  -9.138  1.00 0.00 ? 1083 LYS B NZ   4  
ATOM 5229  H H    . LYS A 1 39 ? 0.632   12.761  -5.908  1.00 0.00 ? 1083 LYS B H    4  
ATOM 5230  H HA   . LYS A 1 39 ? 2.396   11.281  -7.533  1.00 0.00 ? 1083 LYS B HA   4  
ATOM 5231  H HB2  . LYS A 1 39 ? 2.683   13.946  -6.137  1.00 0.00 ? 1083 LYS B HB2  4  
ATOM 5232  H HB3  . LYS A 1 39 ? 3.889   13.302  -7.251  1.00 0.00 ? 1083 LYS B HB3  4  
ATOM 5233  H HG2  . LYS A 1 39 ? 2.294   13.251  -9.061  1.00 0.00 ? 1083 LYS B HG2  4  
ATOM 5234  H HG3  . LYS A 1 39 ? 0.968   13.654  -7.970  1.00 0.00 ? 1083 LYS B HG3  4  
ATOM 5235  H HD2  . LYS A 1 39 ? 1.615   15.673  -9.144  1.00 0.00 ? 1083 LYS B HD2  4  
ATOM 5236  H HD3  . LYS A 1 39 ? 2.129   15.821  -7.464  1.00 0.00 ? 1083 LYS B HD3  4  
ATOM 5237  H HE2  . LYS A 1 39 ? 4.408   15.169  -8.068  1.00 0.00 ? 1083 LYS B HE2  4  
ATOM 5238  H HE3  . LYS A 1 39 ? 3.914   14.911  -9.741  1.00 0.00 ? 1083 LYS B HE3  4  
ATOM 5239  H HZ1  . LYS A 1 39 ? 4.160   17.441  -8.250  1.00 0.00 ? 1083 LYS B HZ1  4  
ATOM 5240  H HZ2  . LYS A 1 39 ? 3.124   17.337  -9.593  1.00 0.00 ? 1083 LYS B HZ2  4  
ATOM 5241  H HZ3  . LYS A 1 39 ? 4.785   17.033  -9.773  1.00 0.00 ? 1083 LYS B HZ3  4  
ATOM 5242  N N    . TYR A 1 40 ? 3.076   11.325  -4.363  1.00 0.00 ? 1084 TYR B N    4  
ATOM 5243  C CA   . TYR A 1 40 ? 3.959   10.782  -3.342  1.00 0.00 ? 1084 TYR B CA   4  
ATOM 5244  C C    . TYR A 1 40 ? 4.063   9.267   -3.483  1.00 0.00 ? 1084 TYR B C    4  
ATOM 5245  O O    . TYR A 1 40 ? 3.062   8.582   -3.692  1.00 0.00 ? 1084 TYR B O    4  
ATOM 5246  C CB   . TYR A 1 40 ? 3.413   11.124  -1.953  1.00 0.00 ? 1084 TYR B CB   4  
ATOM 5247  C CG   . TYR A 1 40 ? 3.387   12.622  -1.778  1.00 0.00 ? 1084 TYR B CG   4  
ATOM 5248  C CD1  . TYR A 1 40 ? 2.184   13.321  -1.938  1.00 0.00 ? 1084 TYR B CD1  4  
ATOM 5249  C CD2  . TYR A 1 40 ? 4.562   13.312  -1.458  1.00 0.00 ? 1084 TYR B CD2  4  
ATOM 5250  C CE1  . TYR A 1 40 ? 2.157   14.711  -1.776  1.00 0.00 ? 1084 TYR B CE1  4  
ATOM 5251  C CE2  . TYR A 1 40 ? 4.533   14.701  -1.297  1.00 0.00 ? 1084 TYR B CE2  4  
ATOM 5252  C CZ   . TYR A 1 40 ? 3.331   15.402  -1.457  1.00 0.00 ? 1084 TYR B CZ   4  
ATOM 5253  O OH   . TYR A 1 40 ? 3.304   16.772  -1.298  1.00 0.00 ? 1084 TYR B OH   4  
ATOM 5254  H H    . TYR A 1 40 ? 2.233   11.740  -4.096  1.00 0.00 ? 1084 TYR B H    4  
ATOM 5255  H HA   . TYR A 1 40 ? 4.939   11.218  -3.451  1.00 0.00 ? 1084 TYR B HA   4  
ATOM 5256  H HB2  . TYR A 1 40 ? 2.413   10.731  -1.853  1.00 0.00 ? 1084 TYR B HB2  4  
ATOM 5257  H HB3  . TYR A 1 40 ? 4.049   10.685  -1.199  1.00 0.00 ? 1084 TYR B HB3  4  
ATOM 5258  H HD1  . TYR A 1 40 ? 1.278   12.788  -2.184  1.00 0.00 ? 1084 TYR B HD1  4  
ATOM 5259  H HD2  . TYR A 1 40 ? 5.488   12.771  -1.336  1.00 0.00 ? 1084 TYR B HD2  4  
ATOM 5260  H HE1  . TYR A 1 40 ? 1.227   15.250  -1.900  1.00 0.00 ? 1084 TYR B HE1  4  
ATOM 5261  H HE2  . TYR A 1 40 ? 5.440   15.233  -1.051  1.00 0.00 ? 1084 TYR B HE2  4  
ATOM 5262  H HH   . TYR A 1 40 ? 2.385   17.046  -1.240  1.00 0.00 ? 1084 TYR B HH   4  
ATOM 5263  N N    . ASP A 1 41 ? 5.280   8.755   -3.367  1.00 0.00 ? 1085 ASP B N    4  
ATOM 5264  C CA   . ASP A 1 41 ? 5.509   7.319   -3.482  1.00 0.00 ? 1085 ASP B CA   4  
ATOM 5265  C C    . ASP A 1 41 ? 5.375   6.652   -2.118  1.00 0.00 ? 1085 ASP B C    4  
ATOM 5266  O O    . ASP A 1 41 ? 6.373   6.313   -1.480  1.00 0.00 ? 1085 ASP B O    4  
ATOM 5267  C CB   . ASP A 1 41 ? 6.903   7.054   -4.052  1.00 0.00 ? 1085 ASP B CB   4  
ATOM 5268  C CG   . ASP A 1 41 ? 7.078   5.565   -4.337  1.00 0.00 ? 1085 ASP B CG   4  
ATOM 5269  O OD1  . ASP A 1 41 ? 6.220   4.799   -3.934  1.00 0.00 ? 1085 ASP B OD1  4  
ATOM 5270  O OD2  . ASP A 1 41 ? 8.069   5.214   -4.955  1.00 0.00 ? 1085 ASP B OD2  4  
ATOM 5271  H H    . ASP A 1 41 ? 6.037   9.355   -3.201  1.00 0.00 ? 1085 ASP B H    4  
ATOM 5272  H HA   . ASP A 1 41 ? 4.772   6.901   -4.151  1.00 0.00 ? 1085 ASP B HA   4  
ATOM 5273  H HB2  . ASP A 1 41 ? 7.026   7.611   -4.969  1.00 0.00 ? 1085 ASP B HB2  4  
ATOM 5274  H HB3  . ASP A 1 41 ? 7.649   7.371   -3.337  1.00 0.00 ? 1085 ASP B HB3  4  
ATOM 5275  N N    . LEU A 1 42 ? 4.136   6.465   -1.678  1.00 0.00 ? 1086 LEU B N    4  
ATOM 5276  C CA   . LEU A 1 42 ? 3.879   5.835   -0.388  1.00 0.00 ? 1086 LEU B CA   4  
ATOM 5277  C C    . LEU A 1 42 ? 3.515   4.361   -0.560  1.00 0.00 ? 1086 LEU B C    4  
ATOM 5278  O O    . LEU A 1 42 ? 3.301   3.652   0.422   1.00 0.00 ? 1086 LEU B O    4  
ATOM 5279  C CB   . LEU A 1 42 ? 2.739   6.565   0.315   1.00 0.00 ? 1086 LEU B CB   4  
ATOM 5280  C CG   . LEU A 1 42 ? 3.131   8.028   0.516   1.00 0.00 ? 1086 LEU B CG   4  
ATOM 5281  C CD1  . LEU A 1 42 ? 1.919   8.819   1.011   1.00 0.00 ? 1086 LEU B CD1  4  
ATOM 5282  C CD2  . LEU A 1 42 ? 4.252   8.119   1.553   1.00 0.00 ? 1086 LEU B CD2  4  
ATOM 5283  H H    . LEU A 1 42 ? 3.381   6.752   -2.232  1.00 0.00 ? 1086 LEU B H    4  
ATOM 5284  H HA   . LEU A 1 42 ? 4.767   5.910   0.221   1.00 0.00 ? 1086 LEU B HA   4  
ATOM 5285  H HB2  . LEU A 1 42 ? 1.846   6.508   -0.289  1.00 0.00 ? 1086 LEU B HB2  4  
ATOM 5286  H HB3  . LEU A 1 42 ? 2.558   6.110   1.274   1.00 0.00 ? 1086 LEU B HB3  4  
ATOM 5287  H HG   . LEU A 1 42 ? 3.474   8.435   -0.423  1.00 0.00 ? 1086 LEU B HG   4  
ATOM 5288  H HD11 . LEU A 1 42 ? 1.012   8.310   0.720   1.00 0.00 ? 1086 LEU B HD11 4  
ATOM 5289  H HD12 . LEU A 1 42 ? 1.934   9.808   0.578   1.00 0.00 ? 1086 LEU B HD12 4  
ATOM 5290  H HD13 . LEU A 1 42 ? 1.957   8.898   2.089   1.00 0.00 ? 1086 LEU B HD13 4  
ATOM 5291  H HD21 . LEU A 1 42 ? 4.219   7.252   2.197   1.00 0.00 ? 1086 LEU B HD21 4  
ATOM 5292  H HD22 . LEU A 1 42 ? 4.122   9.013   2.146   1.00 0.00 ? 1086 LEU B HD22 4  
ATOM 5293  H HD23 . LEU A 1 42 ? 5.206   8.157   1.050   1.00 0.00 ? 1086 LEU B HD23 4  
ATOM 5294  N N    . SER A 1 43 ? 3.456   3.901   -1.808  1.00 0.00 ? 1087 SER B N    4  
ATOM 5295  C CA   . SER A 1 43 ? 3.127   2.510   -2.081  1.00 0.00 ? 1087 SER B CA   4  
ATOM 5296  C C    . SER A 1 43 ? 4.248   1.593   -1.600  1.00 0.00 ? 1087 SER B C    4  
ATOM 5297  O O    . SER A 1 43 ? 4.078   0.377   -1.528  1.00 0.00 ? 1087 SER B O    4  
ATOM 5298  C CB   . SER A 1 43 ? 2.905   2.309   -3.579  1.00 0.00 ? 1087 SER B CB   4  
ATOM 5299  O OG   . SER A 1 43 ? 4.127   2.535   -4.268  1.00 0.00 ? 1087 SER B OG   4  
ATOM 5300  H H    . SER A 1 43 ? 3.642   4.502   -2.558  1.00 0.00 ? 1087 SER B H    4  
ATOM 5301  H HA   . SER A 1 43 ? 2.220   2.257   -1.556  1.00 0.00 ? 1087 SER B HA   4  
ATOM 5302  H HB2  . SER A 1 43 ? 2.575   1.301   -3.766  1.00 0.00 ? 1087 SER B HB2  4  
ATOM 5303  H HB3  . SER A 1 43 ? 2.151   3.004   -3.926  1.00 0.00 ? 1087 SER B HB3  4  
ATOM 5304  H HG   . SER A 1 43 ? 4.805   2.715   -3.613  1.00 0.00 ? 1087 SER B HG   4  
ATOM 5305  N N    . LYS A 1 44 ? 5.392   2.183   -1.273  1.00 0.00 ? 1088 LYS B N    4  
ATOM 5306  C CA   . LYS A 1 44 ? 6.525   1.405   -0.788  1.00 0.00 ? 1088 LYS B CA   4  
ATOM 5307  C C    . LYS A 1 44 ? 6.596   1.439   0.740   1.00 0.00 ? 1088 LYS B C    4  
ATOM 5308  O O    . LYS A 1 44 ? 7.385   0.717   1.348   1.00 0.00 ? 1088 LYS B O    4  
ATOM 5309  C CB   . LYS A 1 44 ? 7.820   1.960   -1.375  1.00 0.00 ? 1088 LYS B CB   4  
ATOM 5310  C CG   . LYS A 1 44 ? 7.823   1.742   -2.888  1.00 0.00 ? 1088 LYS B CG   4  
ATOM 5311  C CD   . LYS A 1 44 ? 8.999   2.496   -3.511  1.00 0.00 ? 1088 LYS B CD   4  
ATOM 5312  C CE   . LYS A 1 44 ? 10.313  1.902   -3.002  1.00 0.00 ? 1088 LYS B CE   4  
ATOM 5313  N NZ   . LYS A 1 44 ? 11.456  2.588   -3.666  1.00 0.00 ? 1088 LYS B NZ   4  
ATOM 5314  H H    . LYS A 1 44 ? 5.475   3.158   -1.342  1.00 0.00 ? 1088 LYS B H    4  
ATOM 5315  H HA   . LYS A 1 44 ? 6.409   0.380   -1.108  1.00 0.00 ? 1088 LYS B HA   4  
ATOM 5316  H HB2  . LYS A 1 44 ? 7.889   3.017   -1.159  1.00 0.00 ? 1088 LYS B HB2  4  
ATOM 5317  H HB3  . LYS A 1 44 ? 8.661   1.447   -0.936  1.00 0.00 ? 1088 LYS B HB3  4  
ATOM 5318  H HG2  . LYS A 1 44 ? 7.918   0.687   -3.100  1.00 0.00 ? 1088 LYS B HG2  4  
ATOM 5319  H HG3  . LYS A 1 44 ? 6.899   2.111   -3.307  1.00 0.00 ? 1088 LYS B HG3  4  
ATOM 5320  H HD2  . LYS A 1 44 ? 8.954   2.406   -4.586  1.00 0.00 ? 1088 LYS B HD2  4  
ATOM 5321  H HD3  . LYS A 1 44 ? 8.945   3.538   -3.234  1.00 0.00 ? 1088 LYS B HD3  4  
ATOM 5322  H HE2  . LYS A 1 44 ? 10.382  2.044   -1.933  1.00 0.00 ? 1088 LYS B HE2  4  
ATOM 5323  H HE3  . LYS A 1 44 ? 10.343  0.846   -3.227  1.00 0.00 ? 1088 LYS B HE3  4  
ATOM 5324  H HZ1  . LYS A 1 44 ? 12.323  2.430   -3.117  1.00 0.00 ? 1088 LYS B HZ1  4  
ATOM 5325  H HZ2  . LYS A 1 44 ? 11.261  3.608   -3.725  1.00 0.00 ? 1088 LYS B HZ2  4  
ATOM 5326  H HZ3  . LYS A 1 44 ? 11.581  2.203   -4.625  1.00 0.00 ? 1088 LYS B HZ3  4  
ATOM 5327  N N    . TRP A 1 45 ? 5.768   2.285   1.353   1.00 0.00 ? 1089 TRP B N    4  
ATOM 5328  C CA   . TRP A 1 45 ? 5.752   2.405   2.808   1.00 0.00 ? 1089 TRP B CA   4  
ATOM 5329  C C    . TRP A 1 45 ? 4.930   1.289   3.430   1.00 0.00 ? 1089 TRP B C    4  
ATOM 5330  O O    . TRP A 1 45 ? 3.848   0.956   2.954   1.00 0.00 ? 1089 TRP B O    4  
ATOM 5331  C CB   . TRP A 1 45 ? 5.164   3.756   3.222   1.00 0.00 ? 1089 TRP B CB   4  
ATOM 5332  C CG   . TRP A 1 45 ? 6.167   4.835   2.978   1.00 0.00 ? 1089 TRP B CG   4  
ATOM 5333  C CD1  . TRP A 1 45 ? 6.998   4.896   1.916   1.00 0.00 ? 1089 TRP B CD1  4  
ATOM 5334  C CD2  . TRP A 1 45 ? 6.463   6.005   3.798   1.00 0.00 ? 1089 TRP B CD2  4  
ATOM 5335  N NE1  . TRP A 1 45 ? 7.784   6.024   2.026   1.00 0.00 ? 1089 TRP B NE1  4  
ATOM 5336  C CE2  . TRP A 1 45 ? 7.494   6.743   3.168   1.00 0.00 ? 1089 TRP B CE2  4  
ATOM 5337  C CE3  . TRP A 1 45 ? 5.945   6.491   5.010   1.00 0.00 ? 1089 TRP B CE3  4  
ATOM 5338  C CZ2  . TRP A 1 45 ? 7.991   7.922   3.724   1.00 0.00 ? 1089 TRP B CZ2  4  
ATOM 5339  C CZ3  . TRP A 1 45 ? 6.443   7.678   5.571   1.00 0.00 ? 1089 TRP B CZ3  4  
ATOM 5340  C CH2  . TRP A 1 45 ? 7.464   8.392   4.929   1.00 0.00 ? 1089 TRP B CH2  4  
ATOM 5341  H H    . TRP A 1 45 ? 5.163   2.839   0.825   1.00 0.00 ? 1089 TRP B H    4  
ATOM 5342  H HA   . TRP A 1 45 ? 6.764   2.340   3.174   1.00 0.00 ? 1089 TRP B HA   4  
ATOM 5343  H HB2  . TRP A 1 45 ? 4.275   3.954   2.642   1.00 0.00 ? 1089 TRP B HB2  4  
ATOM 5344  H HB3  . TRP A 1 45 ? 4.911   3.731   4.272   1.00 0.00 ? 1089 TRP B HB3  4  
ATOM 5345  H HD1  . TRP A 1 45 ? 7.042   4.178   1.110   1.00 0.00 ? 1089 TRP B HD1  4  
ATOM 5346  H HE1  . TRP A 1 45 ? 8.464   6.297   1.386   1.00 0.00 ? 1089 TRP B HE1  4  
ATOM 5347  H HE3  . TRP A 1 45 ? 5.158   5.949   5.513   1.00 0.00 ? 1089 TRP B HE3  4  
ATOM 5348  H HZ2  . TRP A 1 45 ? 8.778   8.467   3.225   1.00 0.00 ? 1089 TRP B HZ2  4  
ATOM 5349  H HZ3  . TRP A 1 45 ? 6.039   8.042   6.503   1.00 0.00 ? 1089 TRP B HZ3  4  
ATOM 5350  H HH2  . TRP A 1 45 ? 7.844   9.304   5.366   1.00 0.00 ? 1089 TRP B HH2  4  
ATOM 5351  N N    . LYS A 1 46 ? 5.444   0.725   4.511   1.00 0.00 ? 1090 LYS B N    4  
ATOM 5352  C CA   . LYS A 1 46 ? 4.743   -0.348  5.205   1.00 0.00 ? 1090 LYS B CA   4  
ATOM 5353  C C    . LYS A 1 46 ? 3.423   0.149   5.771   1.00 0.00 ? 1090 LYS B C    4  
ATOM 5354  O O    . LYS A 1 46 ? 3.214   1.354   5.925   1.00 0.00 ? 1090 LYS B O    4  
ATOM 5355  C CB   . LYS A 1 46 ? 5.598   -0.894  6.350   1.00 0.00 ? 1090 LYS B CB   4  
ATOM 5356  C CG   . LYS A 1 46 ? 6.890   -1.494  5.801   1.00 0.00 ? 1090 LYS B CG   4  
ATOM 5357  C CD   . LYS A 1 46 ? 6.578   -2.803  5.073   1.00 0.00 ? 1090 LYS B CD   4  
ATOM 5358  C CE   . LYS A 1 46 ? 7.877   -3.440  4.567   1.00 0.00 ? 1090 LYS B CE   4  
ATOM 5359  N NZ   . LYS A 1 46 ? 8.767   -3.747  5.722   1.00 0.00 ? 1090 LYS B NZ   4  
ATOM 5360  H H    . LYS A 1 46 ? 6.308   1.039   4.852   1.00 0.00 ? 1090 LYS B H    4  
ATOM 5361  H HA   . LYS A 1 46 ? 4.543   -1.143  4.510   1.00 0.00 ? 1090 LYS B HA   4  
ATOM 5362  H HB2  . LYS A 1 46 ? 5.838   -0.092  7.030   1.00 0.00 ? 1090 LYS B HB2  4  
ATOM 5363  H HB3  . LYS A 1 46 ? 5.048   -1.656  6.876   1.00 0.00 ? 1090 LYS B HB3  4  
ATOM 5364  H HG2  . LYS A 1 46 ? 7.346   -0.797  5.115   1.00 0.00 ? 1090 LYS B HG2  4  
ATOM 5365  H HG3  . LYS A 1 46 ? 7.563   -1.690  6.621   1.00 0.00 ? 1090 LYS B HG3  4  
ATOM 5366  H HD2  . LYS A 1 46 ? 6.087   -3.480  5.756   1.00 0.00 ? 1090 LYS B HD2  4  
ATOM 5367  H HD3  . LYS A 1 46 ? 5.931   -2.605  4.237   1.00 0.00 ? 1090 LYS B HD3  4  
ATOM 5368  H HE2  . LYS A 1 46 ? 7.646   -4.355  4.040   1.00 0.00 ? 1090 LYS B HE2  4  
ATOM 5369  H HE3  . LYS A 1 46 ? 8.377   -2.755  3.897   1.00 0.00 ? 1090 LYS B HE3  4  
ATOM 5370  H HZ1  . LYS A 1 46 ? 9.613   -3.146  5.676   1.00 0.00 ? 1090 LYS B HZ1  4  
ATOM 5371  H HZ2  . LYS A 1 46 ? 9.049   -4.748  5.685   1.00 0.00 ? 1090 LYS B HZ2  4  
ATOM 5372  H HZ3  . LYS A 1 46 ? 8.260   -3.560  6.609   1.00 0.00 ? 1090 LYS B HZ3  4  
ATOM 5373  N N    . TYR A 1 47 ? 2.541   -0.787  6.088   1.00 0.00 ? 1091 TYR B N    4  
ATOM 5374  C CA   . TYR A 1 47 ? 1.247   -0.442  6.650   1.00 0.00 ? 1091 TYR B CA   4  
ATOM 5375  C C    . TYR A 1 47 ? 1.441   0.373   7.917   1.00 0.00 ? 1091 TYR B C    4  
ATOM 5376  O O    . TYR A 1 47 ? 0.802   1.405   8.107   1.00 0.00 ? 1091 TYR B O    4  
ATOM 5377  C CB   . TYR A 1 47 ? 0.463   -1.711  6.981   1.00 0.00 ? 1091 TYR B CB   4  
ATOM 5378  C CG   . TYR A 1 47 ? -0.763  -1.353  7.788   1.00 0.00 ? 1091 TYR B CG   4  
ATOM 5379  C CD1  . TYR A 1 47 ? -1.891  -0.813  7.158   1.00 0.00 ? 1091 TYR B CD1  4  
ATOM 5380  C CD2  . TYR A 1 47 ? -0.770  -1.564  9.173   1.00 0.00 ? 1091 TYR B CD2  4  
ATOM 5381  C CE1  . TYR A 1 47 ? -3.024  -0.482  7.913   1.00 0.00 ? 1091 TYR B CE1  4  
ATOM 5382  C CE2  . TYR A 1 47 ? -1.901  -1.234  9.928   1.00 0.00 ? 1091 TYR B CE2  4  
ATOM 5383  C CZ   . TYR A 1 47 ? -3.027  -0.693  9.298   1.00 0.00 ? 1091 TYR B CZ   4  
ATOM 5384  O OH   . TYR A 1 47 ? -4.143  -0.367  10.042  1.00 0.00 ? 1091 TYR B OH   4  
ATOM 5385  H H    . TYR A 1 47 ? 2.767   -1.729  5.946   1.00 0.00 ? 1091 TYR B H    4  
ATOM 5386  H HA   . TYR A 1 47 ? 0.691   0.142   5.932   1.00 0.00 ? 1091 TYR B HA   4  
ATOM 5387  H HB2  . TYR A 1 47 ? 0.162   -2.195  6.063   1.00 0.00 ? 1091 TYR B HB2  4  
ATOM 5388  H HB3  . TYR A 1 47 ? 1.087   -2.382  7.552   1.00 0.00 ? 1091 TYR B HB3  4  
ATOM 5389  H HD1  . TYR A 1 47 ? -1.888  -0.650  6.090   1.00 0.00 ? 1091 TYR B HD1  4  
ATOM 5390  H HD2  . TYR A 1 47 ? 0.100   -1.979  9.660   1.00 0.00 ? 1091 TYR B HD2  4  
ATOM 5391  H HE1  . TYR A 1 47 ? -3.894  -0.065  7.429   1.00 0.00 ? 1091 TYR B HE1  4  
ATOM 5392  H HE2  . TYR A 1 47 ? -1.904  -1.396  10.996  1.00 0.00 ? 1091 TYR B HE2  4  
ATOM 5393  H HH   . TYR A 1 47 ? -3.856  0.159   10.792  1.00 0.00 ? 1091 TYR B HH   4  
ATOM 5394  N N    . ALA A 1 48 ? 2.332   -0.096  8.780   1.00 0.00 ? 1092 ALA B N    4  
ATOM 5395  C CA   . ALA A 1 48 ? 2.598   0.619   10.025  1.00 0.00 ? 1092 ALA B CA   4  
ATOM 5396  C C    . ALA A 1 48 ? 3.154   2.012   9.735   1.00 0.00 ? 1092 ALA B C    4  
ATOM 5397  O O    . ALA A 1 48 ? 2.810   2.984   10.410  1.00 0.00 ? 1092 ALA B O    4  
ATOM 5398  C CB   . ALA A 1 48 ? 3.591   -0.165  10.885  1.00 0.00 ? 1092 ALA B CB   4  
ATOM 5399  H H    . ALA A 1 48 ? 2.827   -0.929  8.572   1.00 0.00 ? 1092 ALA B H    4  
ATOM 5400  H HA   . ALA A 1 48 ? 1.672   0.721   10.570  1.00 0.00 ? 1092 ALA B HA   4  
ATOM 5401  H HB1  . ALA A 1 48 ? 4.087   0.510   11.567  1.00 0.00 ? 1092 ALA B HB1  4  
ATOM 5402  H HB2  . ALA A 1 48 ? 4.325   -0.637  10.248  1.00 0.00 ? 1092 ALA B HB2  4  
ATOM 5403  H HB3  . ALA A 1 48 ? 3.062   -0.920  11.446  1.00 0.00 ? 1092 ALA B HB3  4  
ATOM 5404  N N    . GLU A 1 49 ? 4.021   2.096   8.732   1.00 0.00 ? 1093 GLU B N    4  
ATOM 5405  C CA   . GLU A 1 49 ? 4.632   3.369   8.356   1.00 0.00 ? 1093 GLU B CA   4  
ATOM 5406  C C    . GLU A 1 49 ? 3.575   4.363   7.883   1.00 0.00 ? 1093 GLU B C    4  
ATOM 5407  O O    . GLU A 1 49 ? 3.604   5.532   8.264   1.00 0.00 ? 1093 GLU B O    4  
ATOM 5408  C CB   . GLU A 1 49 ? 5.651   3.143   7.235   1.00 0.00 ? 1093 GLU B CB   4  
ATOM 5409  C CG   . GLU A 1 49 ? 6.871   2.391   7.779   1.00 0.00 ? 1093 GLU B CG   4  
ATOM 5410  C CD   . GLU A 1 49 ? 7.565   3.215   8.858   1.00 0.00 ? 1093 GLU B CD   4  
ATOM 5411  O OE1  . GLU A 1 49 ? 7.798   4.389   8.622   1.00 0.00 ? 1093 GLU B OE1  4  
ATOM 5412  O OE2  . GLU A 1 49 ? 7.857   2.659   9.903   1.00 0.00 ? 1093 GLU B OE2  4  
ATOM 5413  H H    . GLU A 1 49 ? 4.253   1.286   8.238   1.00 0.00 ? 1093 GLU B H    4  
ATOM 5414  H HA   . GLU A 1 49 ? 5.141   3.780   9.213   1.00 0.00 ? 1093 GLU B HA   4  
ATOM 5415  H HB2  . GLU A 1 49 ? 5.194   2.561   6.446   1.00 0.00 ? 1093 GLU B HB2  4  
ATOM 5416  H HB3  . GLU A 1 49 ? 5.967   4.096   6.839   1.00 0.00 ? 1093 GLU B HB3  4  
ATOM 5417  H HG2  . GLU A 1 49 ? 6.550   1.453   8.204   1.00 0.00 ? 1093 GLU B HG2  4  
ATOM 5418  H HG3  . GLU A 1 49 ? 7.564   2.200   6.973   1.00 0.00 ? 1093 GLU B HG3  4  
ATOM 5419  N N    . LEU A 1 50 ? 2.635   3.895   7.070   1.00 0.00 ? 1094 LEU B N    4  
ATOM 5420  C CA   . LEU A 1 50 ? 1.575   4.763   6.580   1.00 0.00 ? 1094 LEU B CA   4  
ATOM 5421  C C    . LEU A 1 50 ? 0.704   5.235   7.728   1.00 0.00 ? 1094 LEU B C    4  
ATOM 5422  O O    . LEU A 1 50 ? 0.282   6.387   7.764   1.00 0.00 ? 1094 LEU B O    4  
ATOM 5423  C CB   . LEU A 1 50 ? 0.727   4.030   5.542   1.00 0.00 ? 1094 LEU B CB   4  
ATOM 5424  C CG   . LEU A 1 50 ? 1.538   3.890   4.255   1.00 0.00 ? 1094 LEU B CG   4  
ATOM 5425  C CD1  . LEU A 1 50 ? 0.868   2.881   3.321   1.00 0.00 ? 1094 LEU B CD1  4  
ATOM 5426  C CD2  . LEU A 1 50 ? 1.601   5.253   3.562   1.00 0.00 ? 1094 LEU B CD2  4  
ATOM 5427  H H    . LEU A 1 50 ? 2.647   2.953   6.802   1.00 0.00 ? 1094 LEU B H    4  
ATOM 5428  H HA   . LEU A 1 50 ? 2.025   5.626   6.114   1.00 0.00 ? 1094 LEU B HA   4  
ATOM 5429  H HB2  . LEU A 1 50 ? 0.466   3.049   5.916   1.00 0.00 ? 1094 LEU B HB2  4  
ATOM 5430  H HB3  . LEU A 1 50 ? -0.170  4.594   5.342   1.00 0.00 ? 1094 LEU B HB3  4  
ATOM 5431  H HG   . LEU A 1 50 ? 2.537   3.561   4.499   1.00 0.00 ? 1094 LEU B HG   4  
ATOM 5432  H HD11 . LEU A 1 50 ? 0.279   2.187   3.902   1.00 0.00 ? 1094 LEU B HD11 4  
ATOM 5433  H HD12 . LEU A 1 50 ? 1.624   2.340   2.772   1.00 0.00 ? 1094 LEU B HD12 4  
ATOM 5434  H HD13 . LEU A 1 50 ? 0.224   3.405   2.629   1.00 0.00 ? 1094 LEU B HD13 4  
ATOM 5435  H HD21 . LEU A 1 50 ? 2.627   5.482   3.312   1.00 0.00 ? 1094 LEU B HD21 4  
ATOM 5436  H HD22 . LEU A 1 50 ? 1.213   6.015   4.227   1.00 0.00 ? 1094 LEU B HD22 4  
ATOM 5437  H HD23 . LEU A 1 50 ? 1.005   5.225   2.659   1.00 0.00 ? 1094 LEU B HD23 4  
ATOM 5438  N N    . ARG A 1 51 ? 0.442   4.337   8.664   1.00 0.00 ? 1095 ARG B N    4  
ATOM 5439  C CA   . ARG A 1 51 ? -0.377  4.678   9.810   1.00 0.00 ? 1095 ARG B CA   4  
ATOM 5440  C C    . ARG A 1 51 ? 0.265   5.825   10.582  1.00 0.00 ? 1095 ARG B C    4  
ATOM 5441  O O    . ARG A 1 51 ? -0.394  6.814   10.911  1.00 0.00 ? 1095 ARG B O    4  
ATOM 5442  C CB   . ARG A 1 51 ? -0.514  3.451   10.713  1.00 0.00 ? 1095 ARG B CB   4  
ATOM 5443  C CG   . ARG A 1 51 ? -1.519  3.748   11.828  1.00 0.00 ? 1095 ARG B CG   4  
ATOM 5444  C CD   . ARG A 1 51 ? -0.779  4.134   13.108  1.00 0.00 ? 1095 ARG B CD   4  
ATOM 5445  N NE   . ARG A 1 51 ? 0.075   3.037   13.547  1.00 0.00 ? 1095 ARG B NE   4  
ATOM 5446  C CZ   . ARG A 1 51 ? -0.429  1.953   14.140  1.00 0.00 ? 1095 ARG B CZ   4  
ATOM 5447  N NH1  . ARG A 1 51 ? -1.718  1.839   14.346  1.00 0.00 ? 1095 ARG B NH1  4  
ATOM 5448  N NH2  . ARG A 1 51 ? 0.371   0.993   14.517  1.00 0.00 ? 1095 ARG B NH2  4  
ATOM 5449  H H    . ARG A 1 51 ? 0.806   3.432   8.583   1.00 0.00 ? 1095 ARG B H    4  
ATOM 5450  H HA   . ARG A 1 51 ? -1.355  4.981   9.470   1.00 0.00 ? 1095 ARG B HA   4  
ATOM 5451  H HB2  . ARG A 1 51 ? -0.855  2.612   10.126  1.00 0.00 ? 1095 ARG B HB2  4  
ATOM 5452  H HB3  . ARG A 1 51 ? 0.450   3.217   11.146  1.00 0.00 ? 1095 ARG B HB3  4  
ATOM 5453  H HG2  . ARG A 1 51 ? -2.158  4.567   11.521  1.00 0.00 ? 1095 ARG B HG2  4  
ATOM 5454  H HG3  . ARG A 1 51 ? -2.121  2.873   12.010  1.00 0.00 ? 1095 ARG B HG3  4  
ATOM 5455  H HD2  . ARG A 1 51 ? -0.169  5.003   12.922  1.00 0.00 ? 1095 ARG B HD2  4  
ATOM 5456  H HD3  . ARG A 1 51 ? -1.498  4.363   13.880  1.00 0.00 ? 1095 ARG B HD3  4  
ATOM 5457  H HE   . ARG A 1 51 ? 1.041   3.099   13.407  1.00 0.00 ? 1095 ARG B HE   4  
ATOM 5458  H HH11 . ARG A 1 51 ? -2.341  2.564   14.061  1.00 0.00 ? 1095 ARG B HH11 4  
ATOM 5459  H HH12 . ARG A 1 51 ? -2.079  1.020   14.789  1.00 0.00 ? 1095 ARG B HH12 4  
ATOM 5460  H HH21 . ARG A 1 51 ? 1.356   1.074   14.362  1.00 0.00 ? 1095 ARG B HH21 4  
ATOM 5461  H HH22 . ARG A 1 51 ? 0.000   0.177   14.960  1.00 0.00 ? 1095 ARG B HH22 4  
ATOM 5462  N N    . ASP A 1 52 ? 1.560   5.696   10.848  1.00 0.00 ? 1096 ASP B N    4  
ATOM 5463  C CA   . ASP A 1 52 ? 2.287   6.735   11.562  1.00 0.00 ? 1096 ASP B CA   4  
ATOM 5464  C C    . ASP A 1 52 ? 2.300   8.017   10.742  1.00 0.00 ? 1096 ASP B C    4  
ATOM 5465  O O    . ASP A 1 52 ? 2.180   9.116   11.285  1.00 0.00 ? 1096 ASP B O    4  
ATOM 5466  C CB   . ASP A 1 52 ? 3.722   6.287   11.841  1.00 0.00 ? 1096 ASP B CB   4  
ATOM 5467  C CG   . ASP A 1 52 ? 4.425   7.317   12.719  1.00 0.00 ? 1096 ASP B CG   4  
ATOM 5468  O OD1  . ASP A 1 52 ? 3.813   8.329   13.019  1.00 0.00 ? 1096 ASP B OD1  4  
ATOM 5469  O OD2  . ASP A 1 52 ? 5.566   7.079   13.079  1.00 0.00 ? 1096 ASP B OD2  4  
ATOM 5470  H H    . ASP A 1 52 ? 2.038   4.895   10.548  1.00 0.00 ? 1096 ASP B H    4  
ATOM 5471  H HA   . ASP A 1 52 ? 1.792   6.927   12.501  1.00 0.00 ? 1096 ASP B HA   4  
ATOM 5472  H HB2  . ASP A 1 52 ? 3.705   5.335   12.348  1.00 0.00 ? 1096 ASP B HB2  4  
ATOM 5473  H HB3  . ASP A 1 52 ? 4.255   6.190   10.908  1.00 0.00 ? 1096 ASP B HB3  4  
ATOM 5474  N N    . THR A 1 53 ? 2.453   7.874   9.429   1.00 0.00 ? 1097 THR B N    4  
ATOM 5475  C CA   . THR A 1 53 ? 2.486   9.036   8.557   1.00 0.00 ? 1097 THR B CA   4  
ATOM 5476  C C    . THR A 1 53 ? 1.184   9.821   8.672   1.00 0.00 ? 1097 THR B C    4  
ATOM 5477  O O    . THR A 1 53 ? 1.196   11.042  8.750   1.00 0.00 ? 1097 THR B O    4  
ATOM 5478  C CB   . THR A 1 53 ? 2.701   8.602   7.107   1.00 0.00 ? 1097 THR B CB   4  
ATOM 5479  O OG1  . THR A 1 53 ? 3.943   7.922   6.997   1.00 0.00 ? 1097 THR B OG1  4  
ATOM 5480  C CG2  . THR A 1 53 ? 2.713   9.838   6.209   1.00 0.00 ? 1097 THR B CG2  4  
ATOM 5481  H H    . THR A 1 53 ? 2.550   6.974   9.039   1.00 0.00 ? 1097 THR B H    4  
ATOM 5482  H HA   . THR A 1 53 ? 3.305   9.674   8.853   1.00 0.00 ? 1097 THR B HA   4  
ATOM 5483  H HB   . THR A 1 53 ? 1.900   7.947   6.801   1.00 0.00 ? 1097 THR B HB   4  
ATOM 5484  H HG1  . THR A 1 53 ? 4.015   7.313   7.736   1.00 0.00 ? 1097 THR B HG1  4  
ATOM 5485  H HG21 . THR A 1 53 ? 3.526   9.761   5.502   1.00 0.00 ? 1097 THR B HG21 4  
ATOM 5486  H HG22 . THR A 1 53 ? 2.844   10.722  6.816   1.00 0.00 ? 1097 THR B HG22 4  
ATOM 5487  H HG23 . THR A 1 53 ? 1.776   9.903   5.675   1.00 0.00 ? 1097 THR B HG23 4  
ATOM 5488  N N    . ILE A 1 54 ? 0.062   9.112   8.675   1.00 0.00 ? 1098 ILE B N    4  
ATOM 5489  C CA   . ILE A 1 54 ? -1.237  9.776   8.778   1.00 0.00 ? 1098 ILE B CA   4  
ATOM 5490  C C    . ILE A 1 54 ? -1.350  10.550  10.089  1.00 0.00 ? 1098 ILE B C    4  
ATOM 5491  O O    . ILE A 1 54 ? -1.743  11.715  10.101  1.00 0.00 ? 1098 ILE B O    4  
ATOM 5492  C CB   . ILE A 1 54 ? -2.351  8.730   8.715   1.00 0.00 ? 1098 ILE B CB   4  
ATOM 5493  C CG1  . ILE A 1 54 ? -2.364  8.104   7.327   1.00 0.00 ? 1098 ILE B CG1  4  
ATOM 5494  C CG2  . ILE A 1 54 ? -3.702  9.397   8.982   1.00 0.00 ? 1098 ILE B CG2  4  
ATOM 5495  C CD1  . ILE A 1 54 ? -3.285  6.884   7.319   1.00 0.00 ? 1098 ILE B CD1  4  
ATOM 5496  H H    . ILE A 1 54 ? 0.103   8.134   8.602   1.00 0.00 ? 1098 ILE B H    4  
ATOM 5497  H HA   . ILE A 1 54 ? -1.353  10.459  7.953   1.00 0.00 ? 1098 ILE B HA   4  
ATOM 5498  H HB   . ILE A 1 54 ? -2.173  7.965   9.457   1.00 0.00 ? 1098 ILE B HB   4  
ATOM 5499  H HG12 . ILE A 1 54 ? -2.714  8.829   6.609   1.00 0.00 ? 1098 ILE B HG12 4  
ATOM 5500  H HG13 . ILE A 1 54 ? -1.365  7.798   7.070   1.00 0.00 ? 1098 ILE B HG13 4  
ATOM 5501  H HG21 . ILE A 1 54 ? -4.494  8.680   8.820   1.00 0.00 ? 1098 ILE B HG21 4  
ATOM 5502  H HG22 . ILE A 1 54 ? -3.831  10.231  8.308   1.00 0.00 ? 1098 ILE B HG22 4  
ATOM 5503  H HG23 . ILE A 1 54 ? -3.738  9.748   10.001  1.00 0.00 ? 1098 ILE B HG23 4  
ATOM 5504  H HD11 . ILE A 1 54 ? -3.284  6.439   6.335   1.00 0.00 ? 1098 ILE B HD11 4  
ATOM 5505  H HD12 . ILE A 1 54 ? -4.289  7.192   7.575   1.00 0.00 ? 1098 ILE B HD12 4  
ATOM 5506  H HD13 . ILE A 1 54 ? -2.934  6.164   8.042   1.00 0.00 ? 1098 ILE B HD13 4  
ATOM 5507  N N    . ASN A 1 55 ? -0.999  9.896   11.191  1.00 0.00 ? 1099 ASN B N    4  
ATOM 5508  C CA   . ASN A 1 55 ? -1.068  10.536  12.503  1.00 0.00 ? 1099 ASN B CA   4  
ATOM 5509  C C    . ASN A 1 55 ? -0.130  11.733  12.584  1.00 0.00 ? 1099 ASN B C    4  
ATOM 5510  O O    . ASN A 1 55 ? -0.461  12.754  13.187  1.00 0.00 ? 1099 ASN B O    4  
ATOM 5511  C CB   . ASN A 1 55 ? -0.716  9.522   13.587  1.00 0.00 ? 1099 ASN B CB   4  
ATOM 5512  C CG   . ASN A 1 55 ? -1.895  8.582   13.807  1.00 0.00 ? 1099 ASN B CG   4  
ATOM 5513  O OD1  . ASN A 1 55 ? -2.779  8.872   14.614  1.00 0.00 ? 1099 ASN B OD1  4  
ATOM 5514  N ND2  . ASN A 1 55 ? -1.981  7.484   13.106  1.00 0.00 ? 1099 ASN B ND2  4  
ATOM 5515  H H    . ASN A 1 55 ? -0.687  8.965   11.123  1.00 0.00 ? 1099 ASN B H    4  
ATOM 5516  H HA   . ASN A 1 55 ? -2.080  10.877  12.667  1.00 0.00 ? 1099 ASN B HA   4  
ATOM 5517  H HB2  . ASN A 1 55 ? 0.148   8.951   13.279  1.00 0.00 ? 1099 ASN B HB2  4  
ATOM 5518  H HB3  . ASN A 1 55 ? -0.495  10.041  14.507  1.00 0.00 ? 1099 ASN B HB3  4  
ATOM 5519  H HD21 . ASN A 1 55 ? -1.294  7.274   12.441  1.00 0.00 ? 1099 ASN B HD21 4  
ATOM 5520  H HD22 . ASN A 1 55 ? -2.738  6.877   13.236  1.00 0.00 ? 1099 ASN B HD22 4  
ATOM 5521  N N    . THR A 1 56 ? 1.041   11.604  11.976  1.00 0.00 ? 1100 THR B N    4  
ATOM 5522  C CA   . THR A 1 56 ? 2.020   12.682  11.992  1.00 0.00 ? 1100 THR B CA   4  
ATOM 5523  C C    . THR A 1 56 ? 1.820   13.624  10.806  1.00 0.00 ? 1100 THR B C    4  
ATOM 5524  O O    . THR A 1 56 ? 2.557   14.599  10.651  1.00 0.00 ? 1100 THR B O    4  
ATOM 5525  C CB   . THR A 1 56 ? 3.431   12.098  11.948  1.00 0.00 ? 1100 THR B CB   4  
ATOM 5526  O OG1  . THR A 1 56 ? 3.594   11.340  10.756  1.00 0.00 ? 1100 THR B OG1  4  
ATOM 5527  C CG2  . THR A 1 56 ? 3.644   11.197  13.163  1.00 0.00 ? 1100 THR B CG2  4  
ATOM 5528  H H    . THR A 1 56 ? 1.253   10.767  11.507  1.00 0.00 ? 1100 THR B H    4  
ATOM 5529  H HA   . THR A 1 56 ? 1.907   13.243  12.905  1.00 0.00 ? 1100 THR B HA   4  
ATOM 5530  H HB   . THR A 1 56 ? 4.155   12.898  11.969  1.00 0.00 ? 1100 THR B HB   4  
ATOM 5531  H HG1  . THR A 1 56 ? 4.166   11.834  10.167  1.00 0.00 ? 1100 THR B HG1  4  
ATOM 5532  H HG21 . THR A 1 56 ? 2.807   10.522  13.262  1.00 0.00 ? 1100 THR B HG21 4  
ATOM 5533  H HG22 . THR A 1 56 ? 3.724   11.806  14.052  1.00 0.00 ? 1100 THR B HG22 4  
ATOM 5534  H HG23 . THR A 1 56 ? 4.553   10.627  13.034  1.00 0.00 ? 1100 THR B HG23 4  
ATOM 5535  N N    . SER A 1 57 ? 0.841   13.320  9.957   1.00 0.00 ? 1101 SER B N    4  
ATOM 5536  C CA   . SER A 1 57 ? 0.588   14.136  8.788   1.00 0.00 ? 1101 SER B CA   4  
ATOM 5537  C C    . SER A 1 57 ? 0.314   15.575  9.190   1.00 0.00 ? 1101 SER B C    4  
ATOM 5538  O O    . SER A 1 57 ? -0.519  15.849  10.054  1.00 0.00 ? 1101 SER B O    4  
ATOM 5539  C CB   . SER A 1 57 ? -0.621  13.592  8.033   1.00 0.00 ? 1101 SER B CB   4  
ATOM 5540  O OG   . SER A 1 57 ? -1.795  13.863  8.786   1.00 0.00 ? 1101 SER B OG   4  
ATOM 5541  H H    . SER A 1 57 ? 0.291   12.526  10.106  1.00 0.00 ? 1101 SER B H    4  
ATOM 5542  H HA   . SER A 1 57 ? 1.448   14.104  8.138   1.00 0.00 ? 1101 SER B HA   4  
ATOM 5543  H HB2  . SER A 1 57 ? -0.695  14.069  7.071   1.00 0.00 ? 1101 SER B HB2  4  
ATOM 5544  H HB3  . SER A 1 57 ? -0.509  12.523  7.896   1.00 0.00 ? 1101 SER B HB3  4  
ATOM 5545  H HG   . SER A 1 57 ? -1.963  14.808  8.745   1.00 0.00 ? 1101 SER B HG   4  
ATOM 5546  N N    . CYS A 1 58 ? 1.013   16.487  8.540   1.00 0.00 ? 1102 CYS B N    4  
ATOM 5547  C CA   . CYS A 1 58 ? 0.839   17.906  8.804   1.00 0.00 ? 1102 CYS B CA   4  
ATOM 5548  C C    . CYS A 1 58 ? 0.280   18.615  7.570   1.00 0.00 ? 1102 CYS B C    4  
ATOM 5549  O O    . CYS A 1 58 ? 0.011   19.817  7.605   1.00 0.00 ? 1102 CYS B O    4  
ATOM 5550  C CB   . CYS A 1 58 ? 2.180   18.527  9.196   1.00 0.00 ? 1102 CYS B CB   4  
ATOM 5551  S SG   . CYS A 1 58 ? 2.783   17.744  10.712  1.00 0.00 ? 1102 CYS B SG   4  
ATOM 5552  H H    . CYS A 1 58 ? 1.651   16.199  7.856   1.00 0.00 ? 1102 CYS B H    4  
ATOM 5553  H HA   . CYS A 1 58 ? 0.145   18.027  9.622   1.00 0.00 ? 1102 CYS B HA   4  
ATOM 5554  H HB2  . CYS A 1 58 ? 2.895   18.371  8.402   1.00 0.00 ? 1102 CYS B HB2  4  
ATOM 5555  H HB3  . CYS A 1 58 ? 2.052   19.587  9.363   1.00 0.00 ? 1102 CYS B HB3  4  
ATOM 5556  H HG   . CYS A 1 58 ? 3.110   18.435  11.294  1.00 0.00 ? 1102 CYS B HG   4  
ATOM 5557  N N    . ASP A 1 59 ? 0.107   17.866  6.478   1.00 0.00 ? 1103 ASP B N    4  
ATOM 5558  C CA   . ASP A 1 59 ? -0.418  18.446  5.245   1.00 0.00 ? 1103 ASP B CA   4  
ATOM 5559  C C    . ASP A 1 59 ? -1.550  17.591  4.679   1.00 0.00 ? 1103 ASP B C    4  
ATOM 5560  O O    . ASP A 1 59 ? -1.509  16.359  4.741   1.00 0.00 ? 1103 ASP B O    4  
ATOM 5561  C CB   . ASP A 1 59 ? 0.701   18.575  4.210   1.00 0.00 ? 1103 ASP B CB   4  
ATOM 5562  C CG   . ASP A 1 59 ? 1.664   19.685  4.619   1.00 0.00 ? 1103 ASP B CG   4  
ATOM 5563  O OD1  . ASP A 1 59 ? 1.312   20.453  5.499   1.00 0.00 ? 1103 ASP B OD1  4  
ATOM 5564  O OD2  . ASP A 1 59 ? 2.740   19.750  4.047   1.00 0.00 ? 1103 ASP B OD2  4  
ATOM 5565  H H    . ASP A 1 59 ? 0.335   16.912  6.499   1.00 0.00 ? 1103 ASP B H    4  
ATOM 5566  H HA   . ASP A 1 59 ? -0.803  19.430  5.462   1.00 0.00 ? 1103 ASP B HA   4  
ATOM 5567  H HB2  . ASP A 1 59 ? 1.239   17.640  4.144   1.00 0.00 ? 1103 ASP B HB2  4  
ATOM 5568  H HB3  . ASP A 1 59 ? 0.273   18.811  3.247   1.00 0.00 ? 1103 ASP B HB3  4  
ATOM 5569  N N    . ILE A 1 60 ? -2.558  18.252  4.119   1.00 0.00 ? 1104 ILE B N    4  
ATOM 5570  C CA   . ILE A 1 60 ? -3.691  17.546  3.540   1.00 0.00 ? 1104 ILE B CA   4  
ATOM 5571  C C    . ILE A 1 60 ? -3.264  16.765  2.300   1.00 0.00 ? 1104 ILE B C    4  
ATOM 5572  O O    . ILE A 1 60 ? -3.875  15.756  1.952   1.00 0.00 ? 1104 ILE B O    4  
ATOM 5573  C CB   . ILE A 1 60 ? -4.790  18.548  3.171   1.00 0.00 ? 1104 ILE B CB   4  
ATOM 5574  C CG1  . ILE A 1 60 ? -4.240  19.568  2.169   1.00 0.00 ? 1104 ILE B CG1  4  
ATOM 5575  C CG2  . ILE A 1 60 ? -5.264  19.276  4.428   1.00 0.00 ? 1104 ILE B CG2  4  
ATOM 5576  C CD1  . ILE A 1 60 ? -5.380  20.462  1.676   1.00 0.00 ? 1104 ILE B CD1  4  
ATOM 5577  H H    . ILE A 1 60 ? -2.538  19.230  4.093   1.00 0.00 ? 1104 ILE B H    4  
ATOM 5578  H HA   . ILE A 1 60 ? -4.084  16.855  4.269   1.00 0.00 ? 1104 ILE B HA   4  
ATOM 5579  H HB   . ILE A 1 60 ? -5.619  18.020  2.729   1.00 0.00 ? 1104 ILE B HB   4  
ATOM 5580  H HG12 . ILE A 1 60 ? -3.486  20.174  2.648   1.00 0.00 ? 1104 ILE B HG12 4  
ATOM 5581  H HG13 . ILE A 1 60 ? -3.807  19.049  1.328   1.00 0.00 ? 1104 ILE B HG13 4  
ATOM 5582  H HG21 . ILE A 1 60 ? -6.343  19.315  4.436   1.00 0.00 ? 1104 ILE B HG21 4  
ATOM 5583  H HG22 . ILE A 1 60 ? -4.868  20.282  4.434   1.00 0.00 ? 1104 ILE B HG22 4  
ATOM 5584  H HG23 . ILE A 1 60 ? -4.917  18.749  5.304   1.00 0.00 ? 1104 ILE B HG23 4  
ATOM 5585  H HD11 . ILE A 1 60 ? -5.104  20.908  0.732   1.00 0.00 ? 1104 ILE B HD11 4  
ATOM 5586  H HD12 . ILE A 1 60 ? -5.565  21.240  2.401   1.00 0.00 ? 1104 ILE B HD12 4  
ATOM 5587  H HD13 . ILE A 1 60 ? -6.273  19.870  1.546   1.00 0.00 ? 1104 ILE B HD13 4  
ATOM 5588  N N    . GLU A 1 61 ? -2.211  17.238  1.643   1.00 0.00 ? 1105 GLU B N    4  
ATOM 5589  C CA   . GLU A 1 61 ? -1.708  16.574  0.445   1.00 0.00 ? 1105 GLU B CA   4  
ATOM 5590  C C    . GLU A 1 61 ? -1.198  15.178  0.781   1.00 0.00 ? 1105 GLU B C    4  
ATOM 5591  O O    . GLU A 1 61 ? -1.495  14.207  0.082   1.00 0.00 ? 1105 GLU B O    4  
ATOM 5592  C CB   . GLU A 1 61 ? -0.569  17.394  -0.168  1.00 0.00 ? 1105 GLU B CB   4  
ATOM 5593  C CG   . GLU A 1 61 ? -1.128  18.684  -0.770  1.00 0.00 ? 1105 GLU B CG   4  
ATOM 5594  C CD   . GLU A 1 61 ? 0.014   19.571  -1.254  1.00 0.00 ? 1105 GLU B CD   4  
ATOM 5595  O OE1  . GLU A 1 61 ? 1.150   19.275  -0.922  1.00 0.00 ? 1105 GLU B OE1  4  
ATOM 5596  O OE2  . GLU A 1 61 ? -0.264  20.533  -1.951  1.00 0.00 ? 1105 GLU B OE2  4  
ATOM 5597  H H    . GLU A 1 61 ? -1.763  18.040  1.971   1.00 0.00 ? 1105 GLU B H    4  
ATOM 5598  H HA   . GLU A 1 61 ? -2.508  16.493  -0.276  1.00 0.00 ? 1105 GLU B HA   4  
ATOM 5599  H HB2  . GLU A 1 61 ? 0.151   17.637  0.602   1.00 0.00 ? 1105 GLU B HB2  4  
ATOM 5600  H HB3  . GLU A 1 61 ? -0.085  16.817  -0.943  1.00 0.00 ? 1105 GLU B HB3  4  
ATOM 5601  H HG2  . GLU A 1 61 ? -1.772  18.440  -1.602  1.00 0.00 ? 1105 GLU B HG2  4  
ATOM 5602  H HG3  . GLU A 1 61 ? -1.697  19.212  -0.019  1.00 0.00 ? 1105 GLU B HG3  4  
ATOM 5603  N N    . LEU A 1 62 ? -0.440  15.081  1.867   1.00 0.00 ? 1106 LEU B N    4  
ATOM 5604  C CA   . LEU A 1 62 ? 0.094   13.799  2.290   1.00 0.00 ? 1106 LEU B CA   4  
ATOM 5605  C C    . LEU A 1 62 ? -1.044  12.876  2.705   1.00 0.00 ? 1106 LEU B C    4  
ATOM 5606  O O    . LEU A 1 62 ? -1.037  11.683  2.399   1.00 0.00 ? 1106 LEU B O    4  
ATOM 5607  C CB   . LEU A 1 62 ? 1.052   13.988  3.465   1.00 0.00 ? 1106 LEU B CB   4  
ATOM 5608  C CG   . LEU A 1 62 ? 1.635   12.633  3.867   1.00 0.00 ? 1106 LEU B CG   4  
ATOM 5609  C CD1  . LEU A 1 62 ? 2.528   12.108  2.744   1.00 0.00 ? 1106 LEU B CD1  4  
ATOM 5610  C CD2  . LEU A 1 62 ? 2.458   12.795  5.145   1.00 0.00 ? 1106 LEU B CD2  4  
ATOM 5611  H H    . LEU A 1 62 ? -0.240  15.881  2.391   1.00 0.00 ? 1106 LEU B H    4  
ATOM 5612  H HA   . LEU A 1 62 ? 0.626   13.352  1.466   1.00 0.00 ? 1106 LEU B HA   4  
ATOM 5613  H HB2  . LEU A 1 62 ? 1.850   14.654  3.173   1.00 0.00 ? 1106 LEU B HB2  4  
ATOM 5614  H HB3  . LEU A 1 62 ? 0.516   14.410  4.301   1.00 0.00 ? 1106 LEU B HB3  4  
ATOM 5615  H HG   . LEU A 1 62 ? 0.827   11.933  4.035   1.00 0.00 ? 1106 LEU B HG   4  
ATOM 5616  H HD11 . LEU A 1 62 ? 2.103   11.202  2.339   1.00 0.00 ? 1106 LEU B HD11 4  
ATOM 5617  H HD12 . LEU A 1 62 ? 3.512   11.901  3.134   1.00 0.00 ? 1106 LEU B HD12 4  
ATOM 5618  H HD13 . LEU A 1 62 ? 2.597   12.852  1.962   1.00 0.00 ? 1106 LEU B HD13 4  
ATOM 5619  H HD21 . LEU A 1 62 ? 3.341   12.177  5.086   1.00 0.00 ? 1106 LEU B HD21 4  
ATOM 5620  H HD22 . LEU A 1 62 ? 1.863   12.498  5.996   1.00 0.00 ? 1106 LEU B HD22 4  
ATOM 5621  H HD23 . LEU A 1 62 ? 2.750   13.831  5.255   1.00 0.00 ? 1106 LEU B HD23 4  
ATOM 5622  N N    . LEU A 1 63 ? -2.014  13.437  3.416   1.00 0.00 ? 1107 LEU B N    4  
ATOM 5623  C CA   . LEU A 1 63 ? -3.154  12.654  3.880   1.00 0.00 ? 1107 LEU B CA   4  
ATOM 5624  C C    . LEU A 1 63 ? -3.900  12.073  2.692   1.00 0.00 ? 1107 LEU B C    4  
ATOM 5625  O O    . LEU A 1 63 ? -4.291  10.908  2.702   1.00 0.00 ? 1107 LEU B O    4  
ATOM 5626  C CB   . LEU A 1 63 ? -4.096  13.553  4.682   1.00 0.00 ? 1107 LEU B CB   4  
ATOM 5627  C CG   . LEU A 1 63 ? -3.452  13.891  6.022   1.00 0.00 ? 1107 LEU B CG   4  
ATOM 5628  C CD1  . LEU A 1 63 ? -4.176  15.081  6.651   1.00 0.00 ? 1107 LEU B CD1  4  
ATOM 5629  C CD2  . LEU A 1 63 ? -3.566  12.680  6.950   1.00 0.00 ? 1107 LEU B CD2  4  
ATOM 5630  H H    . LEU A 1 63 ? -1.957  14.392  3.635   1.00 0.00 ? 1107 LEU B H    4  
ATOM 5631  H HA   . LEU A 1 63 ? -2.804  11.854  4.511   1.00 0.00 ? 1107 LEU B HA   4  
ATOM 5632  H HB2  . LEU A 1 63 ? -4.284  14.463  4.128   1.00 0.00 ? 1107 LEU B HB2  4  
ATOM 5633  H HB3  . LEU A 1 63 ? -5.027  13.034  4.850   1.00 0.00 ? 1107 LEU B HB3  4  
ATOM 5634  H HG   . LEU A 1 63 ? -2.411  14.138  5.871   1.00 0.00 ? 1107 LEU B HG   4  
ATOM 5635  H HD11 . LEU A 1 63 ? -3.864  15.992  6.156   1.00 0.00 ? 1107 LEU B HD11 4  
ATOM 5636  H HD12 . LEU A 1 63 ? -3.928  15.138  7.700   1.00 0.00 ? 1107 LEU B HD12 4  
ATOM 5637  H HD13 . LEU A 1 63 ? -5.242  14.956  6.538   1.00 0.00 ? 1107 LEU B HD13 4  
ATOM 5638  H HD21 . LEU A 1 63 ? -3.835  13.012  7.942   1.00 0.00 ? 1107 LEU B HD21 4  
ATOM 5639  H HD22 . LEU A 1 63 ? -2.618  12.165  6.988   1.00 0.00 ? 1107 LEU B HD22 4  
ATOM 5640  H HD23 . LEU A 1 63 ? -4.326  12.010  6.576   1.00 0.00 ? 1107 LEU B HD23 4  
ATOM 5641  N N    . ALA A 1 64 ? -4.076  12.885  1.665   1.00 0.00 ? 1108 ALA B N    4  
ATOM 5642  C CA   . ALA A 1 64 ? -4.756  12.438  0.466   1.00 0.00 ? 1108 ALA B CA   4  
ATOM 5643  C C    . ALA A 1 64 ? -3.982  11.299  -0.187  1.00 0.00 ? 1108 ALA B C    4  
ATOM 5644  O O    . ALA A 1 64 ? -4.572  10.355  -0.707  1.00 0.00 ? 1108 ALA B O    4  
ATOM 5645  C CB   . ALA A 1 64 ? -4.894  13.600  -0.519  1.00 0.00 ? 1108 ALA B CB   4  
ATOM 5646  H H    . ALA A 1 64 ? -3.731  13.802  1.708   1.00 0.00 ? 1108 ALA B H    4  
ATOM 5647  H HA   . ALA A 1 64 ? -5.741  12.086  0.731   1.00 0.00 ? 1108 ALA B HA   4  
ATOM 5648  H HB1  . ALA A 1 64 ? -5.927  13.911  -0.567  1.00 0.00 ? 1108 ALA B HB1  4  
ATOM 5649  H HB2  . ALA A 1 64 ? -4.568  13.282  -1.499  1.00 0.00 ? 1108 ALA B HB2  4  
ATOM 5650  H HB3  . ALA A 1 64 ? -4.283  14.429  -0.187  1.00 0.00 ? 1108 ALA B HB3  4  
ATOM 5651  N N    . ALA A 1 65 ? -2.656  11.401  -0.162  1.00 0.00 ? 1109 ALA B N    4  
ATOM 5652  C CA   . ALA A 1 65 ? -1.814  10.377  -0.766  1.00 0.00 ? 1109 ALA B CA   4  
ATOM 5653  C C    . ALA A 1 65 ? -1.968  9.046   -0.041  1.00 0.00 ? 1109 ALA B C    4  
ATOM 5654  O O    . ALA A 1 65 ? -2.064  7.993   -0.668  1.00 0.00 ? 1109 ALA B O    4  
ATOM 5655  C CB   . ALA A 1 65 ? -0.351  10.824  -0.723  1.00 0.00 ? 1109 ALA B CB   4  
ATOM 5656  H H    . ALA A 1 65 ? -2.236  12.173  0.277   1.00 0.00 ? 1109 ALA B H    4  
ATOM 5657  H HA   . ALA A 1 65 ? -2.106  10.250  -1.796  1.00 0.00 ? 1109 ALA B HA   4  
ATOM 5658  H HB1  . ALA A 1 65 ? -0.180  11.410  0.171   1.00 0.00 ? 1109 ALA B HB1  4  
ATOM 5659  H HB2  . ALA A 1 65 ? -0.129  11.421  -1.594  1.00 0.00 ? 1109 ALA B HB2  4  
ATOM 5660  H HB3  . ALA A 1 65 ? 0.292   9.956   -0.711  1.00 0.00 ? 1109 ALA B HB3  4  
ATOM 5661  N N    . CYS A 1 66 ? -1.980  9.104   1.281   1.00 0.00 ? 1110 CYS B N    4  
ATOM 5662  C CA   . CYS A 1 66 ? -2.109  7.902   2.089   1.00 0.00 ? 1110 CYS B CA   4  
ATOM 5663  C C    . CYS A 1 66 ? -3.485  7.281   1.904   1.00 0.00 ? 1110 CYS B C    4  
ATOM 5664  O O    . CYS A 1 66 ? -3.622  6.061   1.812   1.00 0.00 ? 1110 CYS B O    4  
ATOM 5665  C CB   . CYS A 1 66 ? -1.884  8.258   3.552   1.00 0.00 ? 1110 CYS B CB   4  
ATOM 5666  S SG   . CYS A 1 66 ? -0.152  8.720   3.749   1.00 0.00 ? 1110 CYS B SG   4  
ATOM 5667  H H    . CYS A 1 66 ? -1.892  9.974   1.725   1.00 0.00 ? 1110 CYS B H    4  
ATOM 5668  H HA   . CYS A 1 66 ? -1.358  7.190   1.784   1.00 0.00 ? 1110 CYS B HA   4  
ATOM 5669  H HB2  . CYS A 1 66 ? -2.519  9.089   3.825   1.00 0.00 ? 1110 CYS B HB2  4  
ATOM 5670  H HB3  . CYS A 1 66 ? -2.106  7.406   4.174   1.00 0.00 ? 1110 CYS B HB3  4  
ATOM 5671  H HG   . CYS A 1 66 ? 0.137   9.109   2.913   1.00 0.00 ? 1110 CYS B HG   4  
ATOM 5672  N N    . ARG A 1 67 ? -4.497  8.131   1.845   1.00 0.00 ? 1111 ARG B N    4  
ATOM 5673  C CA   . ARG A 1 67 ? -5.860  7.665   1.659   1.00 0.00 ? 1111 ARG B CA   4  
ATOM 5674  C C    . ARG A 1 67 ? -5.988  6.935   0.328   1.00 0.00 ? 1111 ARG B C    4  
ATOM 5675  O O    . ARG A 1 67 ? -6.593  5.866   0.243   1.00 0.00 ? 1111 ARG B O    4  
ATOM 5676  C CB   . ARG A 1 67 ? -6.798  8.867   1.682   1.00 0.00 ? 1111 ARG B CB   4  
ATOM 5677  C CG   . ARG A 1 67 ? -6.908  9.399   3.112   1.00 0.00 ? 1111 ARG B CG   4  
ATOM 5678  C CD   . ARG A 1 67 ? -7.655  10.732  3.100   1.00 0.00 ? 1111 ARG B CD   4  
ATOM 5679  N NE   . ARG A 1 67 ? -7.786  11.253  4.456   1.00 0.00 ? 1111 ARG B NE   4  
ATOM 5680  C CZ   . ARG A 1 67 ? -8.224  12.493  4.690   1.00 0.00 ? 1111 ARG B CZ   4  
ATOM 5681  N NH1  . ARG A 1 67 ? -8.554  13.283  3.700   1.00 0.00 ? 1111 ARG B NH1  4  
ATOM 5682  N NH2  . ARG A 1 67 ? -8.326  12.921  5.921   1.00 0.00 ? 1111 ARG B NH2  4  
ATOM 5683  H H    . ARG A 1 67 ? -4.322  9.092   1.921   1.00 0.00 ? 1111 ARG B H    4  
ATOM 5684  H HA   . ARG A 1 67 ? -6.122  6.993   2.462   1.00 0.00 ? 1111 ARG B HA   4  
ATOM 5685  H HB2  . ARG A 1 67 ? -6.391  9.646   1.041   1.00 0.00 ? 1111 ARG B HB2  4  
ATOM 5686  H HB3  . ARG A 1 67 ? -7.775  8.574   1.327   1.00 0.00 ? 1111 ARG B HB3  4  
ATOM 5687  H HG2  . ARG A 1 67 ? -7.450  8.686   3.719   1.00 0.00 ? 1111 ARG B HG2  4  
ATOM 5688  H HG3  . ARG A 1 67 ? -5.922  9.541   3.524   1.00 0.00 ? 1111 ARG B HG3  4  
ATOM 5689  H HD2  . ARG A 1 67 ? -7.109  11.441  2.497   1.00 0.00 ? 1111 ARG B HD2  4  
ATOM 5690  H HD3  . ARG A 1 67 ? -8.637  10.584  2.675   1.00 0.00 ? 1111 ARG B HD3  4  
ATOM 5691  H HE   . ARG A 1 67 ? -7.550  10.679  5.216   1.00 0.00 ? 1111 ARG B HE   4  
ATOM 5692  H HH11 . ARG A 1 67 ? -8.484  12.969  2.756   1.00 0.00 ? 1111 ARG B HH11 4  
ATOM 5693  H HH12 . ARG A 1 67 ? -8.881  14.209  3.892   1.00 0.00 ? 1111 ARG B HH12 4  
ATOM 5694  H HH21 . ARG A 1 67 ? -8.079  12.320  6.680   1.00 0.00 ? 1111 ARG B HH21 4  
ATOM 5695  H HH22 . ARG A 1 67 ? -8.653  13.847  6.101   1.00 0.00 ? 1111 ARG B HH22 4  
ATOM 5696  N N    . GLU A 1 68 ? -5.390  7.513   -0.704  1.00 0.00 ? 1112 GLU B N    4  
ATOM 5697  C CA   . GLU A 1 68 ? -5.416  6.905   -2.028  1.00 0.00 ? 1112 GLU B CA   4  
ATOM 5698  C C    . GLU A 1 68 ? -4.635  5.602   -2.028  1.00 0.00 ? 1112 GLU B C    4  
ATOM 5699  O O    . GLU A 1 68 ? -5.053  4.620   -2.642  1.00 0.00 ? 1112 GLU B O    4  
ATOM 5700  C CB   . GLU A 1 68 ? -4.816  7.860   -3.053  1.00 0.00 ? 1112 GLU B CB   4  
ATOM 5701  C CG   . GLU A 1 68 ? -5.765  9.039   -3.260  1.00 0.00 ? 1112 GLU B CG   4  
ATOM 5702  C CD   . GLU A 1 68 ? -5.131  10.061  -4.197  1.00 0.00 ? 1112 GLU B CD   4  
ATOM 5703  O OE1  . GLU A 1 68 ? -5.344  9.952   -5.393  1.00 0.00 ? 1112 GLU B OE1  4  
ATOM 5704  O OE2  . GLU A 1 68 ? -4.438  10.936  -3.704  1.00 0.00 ? 1112 GLU B OE2  4  
ATOM 5705  H H    . GLU A 1 68 ? -4.913  8.356   -0.571  1.00 0.00 ? 1112 GLU B H    4  
ATOM 5706  H HA   . GLU A 1 68 ? -6.440  6.702   -2.300  1.00 0.00 ? 1112 GLU B HA   4  
ATOM 5707  H HB2  . GLU A 1 68 ? -3.862  8.216   -2.691  1.00 0.00 ? 1112 GLU B HB2  4  
ATOM 5708  H HB3  . GLU A 1 68 ? -4.676  7.341   -3.990  1.00 0.00 ? 1112 GLU B HB3  4  
ATOM 5709  H HG2  . GLU A 1 68 ? -6.688  8.683   -3.690  1.00 0.00 ? 1112 GLU B HG2  4  
ATOM 5710  H HG3  . GLU A 1 68 ? -5.971  9.503   -2.309  1.00 0.00 ? 1112 GLU B HG3  4  
ATOM 5711  N N    . GLU A 1 69 ? -3.498  5.592   -1.333  1.00 0.00 ? 1113 GLU B N    4  
ATOM 5712  C CA   . GLU A 1 69 ? -2.682  4.394   -1.266  1.00 0.00 ? 1113 GLU B CA   4  
ATOM 5713  C C    . GLU A 1 69 ? -3.455  3.272   -0.594  1.00 0.00 ? 1113 GLU B C    4  
ATOM 5714  O O    . GLU A 1 69 ? -3.396  2.122   -1.022  1.00 0.00 ? 1113 GLU B O    4  
ATOM 5715  C CB   . GLU A 1 69 ? -1.394  4.676   -0.492  1.00 0.00 ? 1113 GLU B CB   4  
ATOM 5716  C CG   . GLU A 1 69 ? -0.565  3.394   -0.401  1.00 0.00 ? 1113 GLU B CG   4  
ATOM 5717  C CD   . GLU A 1 69 ? -0.216  2.897   -1.800  1.00 0.00 ? 1113 GLU B CD   4  
ATOM 5718  O OE1  . GLU A 1 69 ? -0.203  3.708   -2.711  1.00 0.00 ? 1113 GLU B OE1  4  
ATOM 5719  O OE2  . GLU A 1 69 ? 0.024   1.710   -1.942  1.00 0.00 ? 1113 GLU B OE2  4  
ATOM 5720  H H    . GLU A 1 69 ? -3.204  6.404   -0.854  1.00 0.00 ? 1113 GLU B H    4  
ATOM 5721  H HA   . GLU A 1 69 ? -2.428  4.091   -2.269  1.00 0.00 ? 1113 GLU B HA   4  
ATOM 5722  H HB2  . GLU A 1 69 ? -0.826  5.439   -1.004  1.00 0.00 ? 1113 GLU B HB2  4  
ATOM 5723  H HB3  . GLU A 1 69 ? -1.638  5.016   0.504   1.00 0.00 ? 1113 GLU B HB3  4  
ATOM 5724  H HG2  . GLU A 1 69 ? 0.347   3.596   0.144   1.00 0.00 ? 1113 GLU B HG2  4  
ATOM 5725  H HG3  . GLU A 1 69 ? -1.129  2.634   0.117   1.00 0.00 ? 1113 GLU B HG3  4  
ATOM 5726  N N    . PHE A 1 70 ? -4.179  3.614   0.462   1.00 0.00 ? 1114 PHE B N    4  
ATOM 5727  C CA   . PHE A 1 70 ? -4.959  2.621   1.186   1.00 0.00 ? 1114 PHE B CA   4  
ATOM 5728  C C    . PHE A 1 70 ? -6.048  2.043   0.292   1.00 0.00 ? 1114 PHE B C    4  
ATOM 5729  O O    . PHE A 1 70 ? -6.276  0.836   0.285   1.00 0.00 ? 1114 PHE B O    4  
ATOM 5730  C CB   . PHE A 1 70 ? -5.603  3.251   2.422   1.00 0.00 ? 1114 PHE B CB   4  
ATOM 5731  C CG   . PHE A 1 70 ? -4.634  3.209   3.583   1.00 0.00 ? 1114 PHE B CG   4  
ATOM 5732  C CD1  . PHE A 1 70 ? -3.260  3.360   3.361   1.00 0.00 ? 1114 PHE B CD1  4  
ATOM 5733  C CD2  . PHE A 1 70 ? -5.115  3.016   4.886   1.00 0.00 ? 1114 PHE B CD2  4  
ATOM 5734  C CE1  . PHE A 1 70 ? -2.368  3.320   4.442   1.00 0.00 ? 1114 PHE B CE1  4  
ATOM 5735  C CE2  . PHE A 1 70 ? -4.222  2.975   5.962   1.00 0.00 ? 1114 PHE B CE2  4  
ATOM 5736  C CZ   . PHE A 1 70 ? -2.850  3.128   5.741   1.00 0.00 ? 1114 PHE B CZ   4  
ATOM 5737  H H    . PHE A 1 70 ? -4.189  4.546   0.756   1.00 0.00 ? 1114 PHE B H    4  
ATOM 5738  H HA   . PHE A 1 70 ? -4.306  1.823   1.502   1.00 0.00 ? 1114 PHE B HA   4  
ATOM 5739  H HB2  . PHE A 1 70 ? -5.865  4.275   2.209   1.00 0.00 ? 1114 PHE B HB2  4  
ATOM 5740  H HB3  . PHE A 1 70 ? -6.495  2.697   2.679   1.00 0.00 ? 1114 PHE B HB3  4  
ATOM 5741  H HD1  . PHE A 1 70 ? -2.888  3.509   2.358   1.00 0.00 ? 1114 PHE B HD1  4  
ATOM 5742  H HD2  . PHE A 1 70 ? -6.174  2.897   5.058   1.00 0.00 ? 1114 PHE B HD2  4  
ATOM 5743  H HE1  . PHE A 1 70 ? -1.309  3.438   4.274   1.00 0.00 ? 1114 PHE B HE1  4  
ATOM 5744  H HE2  . PHE A 1 70 ? -4.592  2.827   6.966   1.00 0.00 ? 1114 PHE B HE2  4  
ATOM 5745  H HZ   . PHE A 1 70 ? -2.161  3.096   6.573   1.00 0.00 ? 1114 PHE B HZ   4  
ATOM 5746  N N    . HIS A 1 71 ? -6.719  2.908   -0.465  1.00 0.00 ? 1115 HIS B N    4  
ATOM 5747  C CA   . HIS A 1 71 ? -7.779  2.451   -1.357  1.00 0.00 ? 1115 HIS B CA   4  
ATOM 5748  C C    . HIS A 1 71 ? -7.222  1.522   -2.428  1.00 0.00 ? 1115 HIS B C    4  
ATOM 5749  O O    . HIS A 1 71 ? -7.804  0.478   -2.722  1.00 0.00 ? 1115 HIS B O    4  
ATOM 5750  C CB   . HIS A 1 71 ? -8.449  3.651   -2.028  1.00 0.00 ? 1115 HIS B CB   4  
ATOM 5751  C CG   . HIS A 1 71 ? -9.290  4.384   -1.021  1.00 0.00 ? 1115 HIS B CG   4  
ATOM 5752  N ND1  . HIS A 1 71 ? -9.826  5.635   -1.274  1.00 0.00 ? 1115 HIS B ND1  4  
ATOM 5753  C CD2  . HIS A 1 71 ? -9.699  4.050   0.245   1.00 0.00 ? 1115 HIS B CD2  4  
ATOM 5754  C CE1  . HIS A 1 71 ? -10.522 6.005   -0.186  1.00 0.00 ? 1115 HIS B CE1  4  
ATOM 5755  N NE2  . HIS A 1 71 ? -10.477 5.075   0.771   1.00 0.00 ? 1115 HIS B NE2  4  
ATOM 5756  H H    . HIS A 1 71 ? -6.497  3.862   -0.425  1.00 0.00 ? 1115 HIS B H    4  
ATOM 5757  H HA   . HIS A 1 71 ? -8.518  1.918   -0.779  1.00 0.00 ? 1115 HIS B HA   4  
ATOM 5758  H HB2  . HIS A 1 71 ? -7.691  4.317   -2.415  1.00 0.00 ? 1115 HIS B HB2  4  
ATOM 5759  H HB3  . HIS A 1 71 ? -9.074  3.309   -2.838  1.00 0.00 ? 1115 HIS B HB3  4  
ATOM 5760  H HD1  . HIS A 1 71 ? -9.716  6.155   -2.097  1.00 0.00 ? 1115 HIS B HD1  4  
ATOM 5761  H HD2  . HIS A 1 71 ? -9.455  3.130   0.757   1.00 0.00 ? 1115 HIS B HD2  4  
ATOM 5762  H HE1  . HIS A 1 71 ? -11.052 6.941   -0.095  1.00 0.00 ? 1115 HIS B HE1  4  
ATOM 5763  N N    . ARG A 1 72 ? -6.086  1.903   -3.003  1.00 0.00 ? 1116 ARG B N    4  
ATOM 5764  C CA   . ARG A 1 72 ? -5.462  1.091   -4.038  1.00 0.00 ? 1116 ARG B CA   4  
ATOM 5765  C C    . ARG A 1 72 ? -4.978  -0.235  -3.461  1.00 0.00 ? 1116 ARG B C    4  
ATOM 5766  O O    . ARG A 1 72 ? -5.151  -1.290  -4.073  1.00 0.00 ? 1116 ARG B O    4  
ATOM 5767  C CB   . ARG A 1 72 ? -4.283  1.851   -4.649  1.00 0.00 ? 1116 ARG B CB   4  
ATOM 5768  C CG   . ARG A 1 72 ? -4.795  3.084   -5.403  1.00 0.00 ? 1116 ARG B CG   4  
ATOM 5769  C CD   . ARG A 1 72 ? -5.522  2.648   -6.679  1.00 0.00 ? 1116 ARG B CD   4  
ATOM 5770  N NE   . ARG A 1 72 ? -5.876  3.812   -7.488  1.00 0.00 ? 1116 ARG B NE   4  
ATOM 5771  C CZ   . ARG A 1 72 ? -6.503  3.683   -8.660  1.00 0.00 ? 1116 ARG B CZ   4  
ATOM 5772  N NH1  . ARG A 1 72 ? -6.818  2.498   -9.122  1.00 0.00 ? 1116 ARG B NH1  4  
ATOM 5773  N NH2  . ARG A 1 72 ? -6.805  4.747   -9.355  1.00 0.00 ? 1116 ARG B NH2  4  
ATOM 5774  H H    . ARG A 1 72 ? -5.662  2.742   -2.725  1.00 0.00 ? 1116 ARG B H    4  
ATOM 5775  H HA   . ARG A 1 72 ? -6.186  0.888   -4.808  1.00 0.00 ? 1116 ARG B HA   4  
ATOM 5776  H HB2  . ARG A 1 72 ? -3.611  2.165   -3.862  1.00 0.00 ? 1116 ARG B HB2  4  
ATOM 5777  H HB3  . ARG A 1 72 ? -3.755  1.206   -5.336  1.00 0.00 ? 1116 ARG B HB3  4  
ATOM 5778  H HG2  . ARG A 1 72 ? -5.479  3.632   -4.772  1.00 0.00 ? 1116 ARG B HG2  4  
ATOM 5779  H HG3  . ARG A 1 72 ? -3.961  3.717   -5.667  1.00 0.00 ? 1116 ARG B HG3  4  
ATOM 5780  H HD2  . ARG A 1 72 ? -4.880  1.999   -7.253  1.00 0.00 ? 1116 ARG B HD2  4  
ATOM 5781  H HD3  . ARG A 1 72 ? -6.422  2.114   -6.416  1.00 0.00 ? 1116 ARG B HD3  4  
ATOM 5782  H HE   . ARG A 1 72 ? -5.649  4.707   -7.162  1.00 0.00 ? 1116 ARG B HE   4  
ATOM 5783  H HH11 . ARG A 1 72 ? -6.593  1.677   -8.602  1.00 0.00 ? 1116 ARG B HH11 4  
ATOM 5784  H HH12 . ARG A 1 72 ? -7.285  2.416   -10.002 1.00 0.00 ? 1116 ARG B HH12 4  
ATOM 5785  H HH21 . ARG A 1 72 ? -6.567  5.655   -9.008  1.00 0.00 ? 1116 ARG B HH21 4  
ATOM 5786  H HH22 . ARG A 1 72 ? -7.273  4.653   -10.233 1.00 0.00 ? 1116 ARG B HH22 4  
ATOM 5787  N N    . ARG A 1 73 ? -4.384  -0.175  -2.275  1.00 0.00 ? 1117 ARG B N    4  
ATOM 5788  C CA   . ARG A 1 73 ? -3.894  -1.379  -1.620  1.00 0.00 ? 1117 ARG B CA   4  
ATOM 5789  C C    . ARG A 1 73 ? -5.040  -2.323  -1.273  1.00 0.00 ? 1117 ARG B C    4  
ATOM 5790  O O    . ARG A 1 73 ? -4.939  -3.535  -1.469  1.00 0.00 ? 1117 ARG B O    4  
ATOM 5791  C CB   . ARG A 1 73 ? -3.120  -1.006  -0.355  1.00 0.00 ? 1117 ARG B CB   4  
ATOM 5792  C CG   . ARG A 1 73 ? -1.729  -0.495  -0.734  1.00 0.00 ? 1117 ARG B CG   4  
ATOM 5793  C CD   . ARG A 1 73 ? -0.901  -0.319  0.536   1.00 0.00 ? 1117 ARG B CD   4  
ATOM 5794  N NE   . ARG A 1 73 ? 0.500   -0.073  0.210   1.00 0.00 ? 1117 ARG B NE   4  
ATOM 5795  C CZ   . ARG A 1 73 ? 1.457   -0.216  1.124   1.00 0.00 ? 1117 ARG B CZ   4  
ATOM 5796  N NH1  . ARG A 1 73 ? 1.164   -0.561  2.355   1.00 0.00 ? 1117 ARG B NH1  4  
ATOM 5797  N NH2  . ARG A 1 73 ? 2.699   -0.023  0.788   1.00 0.00 ? 1117 ARG B NH2  4  
ATOM 5798  H H    . ARG A 1 73 ? -4.283  0.689   -1.830  1.00 0.00 ? 1117 ARG B H    4  
ATOM 5799  H HA   . ARG A 1 73 ? -3.221  -1.886  -2.296  1.00 0.00 ? 1117 ARG B HA   4  
ATOM 5800  H HB2  . ARG A 1 73 ? -3.654  -0.225  0.175   1.00 0.00 ? 1117 ARG B HB2  4  
ATOM 5801  H HB3  . ARG A 1 73 ? -3.024  -1.873  0.280   1.00 0.00 ? 1117 ARG B HB3  4  
ATOM 5802  H HG2  . ARG A 1 73 ? -1.245  -1.209  -1.386  1.00 0.00 ? 1117 ARG B HG2  4  
ATOM 5803  H HG3  . ARG A 1 73 ? -1.816  0.453   -1.240  1.00 0.00 ? 1117 ARG B HG3  4  
ATOM 5804  H HD2  . ARG A 1 73 ? -1.286  0.517   1.097   1.00 0.00 ? 1117 ARG B HD2  4  
ATOM 5805  H HD3  . ARG A 1 73 ? -0.979  -1.215  1.137   1.00 0.00 ? 1117 ARG B HD3  4  
ATOM 5806  H HE   . ARG A 1 73 ? 0.746   0.209   -0.699  1.00 0.00 ? 1117 ARG B HE   4  
ATOM 5807  H HH11 . ARG A 1 73 ? 0.217   -0.723  2.623   1.00 0.00 ? 1117 ARG B HH11 4  
ATOM 5808  H HH12 . ARG A 1 73 ? 1.895   -0.666  3.029   1.00 0.00 ? 1117 ARG B HH12 4  
ATOM 5809  H HH21 . ARG A 1 73 ? 2.924   0.232   -0.148  1.00 0.00 ? 1117 ARG B HH21 4  
ATOM 5810  H HH22 . ARG A 1 73 ? 3.425   -0.130  1.465   1.00 0.00 ? 1117 ARG B HH22 4  
ATOM 5811  N N    . LEU A 1 74 ? -6.135  -1.763  -0.771  1.00 0.00 ? 1118 LEU B N    4  
ATOM 5812  C CA   . LEU A 1 74 ? -7.293  -2.572  -0.416  1.00 0.00 ? 1118 LEU B CA   4  
ATOM 5813  C C    . LEU A 1 74 ? -7.877  -3.242  -1.657  1.00 0.00 ? 1118 LEU B C    4  
ATOM 5814  O O    . LEU A 1 74 ? -8.284  -4.403  -1.613  1.00 0.00 ? 1118 LEU B O    4  
ATOM 5815  C CB   . LEU A 1 74 ? -8.352  -1.694  0.254   1.00 0.00 ? 1118 LEU B CB   4  
ATOM 5816  C CG   . LEU A 1 74 ? -7.872  -1.293  1.651   1.00 0.00 ? 1118 LEU B CG   4  
ATOM 5817  C CD1  . LEU A 1 74 ? -8.765  -0.182  2.202   1.00 0.00 ? 1118 LEU B CD1  4  
ATOM 5818  C CD2  . LEU A 1 74 ? -7.950  -2.506  2.580   1.00 0.00 ? 1118 LEU B CD2  4  
ATOM 5819  H H    . LEU A 1 74 ? -6.166  -0.790  -0.642  1.00 0.00 ? 1118 LEU B H    4  
ATOM 5820  H HA   . LEU A 1 74 ? -6.985  -3.337  0.282   1.00 0.00 ? 1118 LEU B HA   4  
ATOM 5821  H HB2  . LEU A 1 74 ? -8.512  -0.806  -0.342  1.00 0.00 ? 1118 LEU B HB2  4  
ATOM 5822  H HB3  . LEU A 1 74 ? -9.278  -2.243  0.336   1.00 0.00 ? 1118 LEU B HB3  4  
ATOM 5823  H HG   . LEU A 1 74 ? -6.852  -0.945  1.598   1.00 0.00 ? 1118 LEU B HG   4  
ATOM 5824  H HD11 . LEU A 1 74 ? -8.375  0.778   1.895   1.00 0.00 ? 1118 LEU B HD11 4  
ATOM 5825  H HD12 . LEU A 1 74 ? -8.783  -0.235  3.281   1.00 0.00 ? 1118 LEU B HD12 4  
ATOM 5826  H HD13 . LEU A 1 74 ? -9.768  -0.302  1.819   1.00 0.00 ? 1118 LEU B HD13 4  
ATOM 5827  H HD21 . LEU A 1 74 ? -8.684  -3.203  2.201   1.00 0.00 ? 1118 LEU B HD21 4  
ATOM 5828  H HD22 . LEU A 1 74 ? -8.238  -2.183  3.571   1.00 0.00 ? 1118 LEU B HD22 4  
ATOM 5829  H HD23 . LEU A 1 74 ? -6.985  -2.988  2.626   1.00 0.00 ? 1118 LEU B HD23 4  
ATOM 5830  N N    . LYS A 1 75 ? -7.914  -2.502  -2.761  1.00 0.00 ? 1119 LYS B N    4  
ATOM 5831  C CA   . LYS A 1 75 ? -8.449  -3.033  -4.011  1.00 0.00 ? 1119 LYS B CA   4  
ATOM 5832  C C    . LYS A 1 75 ? -7.627  -4.229  -4.481  1.00 0.00 ? 1119 LYS B C    4  
ATOM 5833  O O    . LYS A 1 75 ? -8.178  -5.242  -4.913  1.00 0.00 ? 1119 LYS B O    4  
ATOM 5834  C CB   . LYS A 1 75 ? -8.410  -1.957  -5.092  1.00 0.00 ? 1119 LYS B CB   4  
ATOM 5835  C CG   . LYS A 1 75 ? -9.079  -2.490  -6.364  1.00 0.00 ? 1119 LYS B CG   4  
ATOM 5836  C CD   . LYS A 1 75 ? -8.930  -1.470  -7.492  1.00 0.00 ? 1119 LYS B CD   4  
ATOM 5837  C CE   . LYS A 1 75 ? -7.497  -1.517  -8.025  1.00 0.00 ? 1119 LYS B CE   4  
ATOM 5838  N NZ   . LYS A 1 75 ? -7.373  -0.619  -9.208  1.00 0.00 ? 1119 LYS B NZ   4  
ATOM 5839  H H    . LYS A 1 75 ? -7.577  -1.581  -2.736  1.00 0.00 ? 1119 LYS B H    4  
ATOM 5840  H HA   . LYS A 1 75 ? -9.472  -3.341  -3.858  1.00 0.00 ? 1119 LYS B HA   4  
ATOM 5841  H HB2  . LYS A 1 75 ? -8.936  -1.079  -4.746  1.00 0.00 ? 1119 LYS B HB2  4  
ATOM 5842  H HB3  . LYS A 1 75 ? -7.383  -1.704  -5.306  1.00 0.00 ? 1119 LYS B HB3  4  
ATOM 5843  H HG2  . LYS A 1 75 ? -8.610  -3.418  -6.656  1.00 0.00 ? 1119 LYS B HG2  4  
ATOM 5844  H HG3  . LYS A 1 75 ? -10.128 -2.661  -6.172  1.00 0.00 ? 1119 LYS B HG3  4  
ATOM 5845  H HD2  . LYS A 1 75 ? -9.622  -1.708  -8.288  1.00 0.00 ? 1119 LYS B HD2  4  
ATOM 5846  H HD3  . LYS A 1 75 ? -9.141  -0.480  -7.114  1.00 0.00 ? 1119 LYS B HD3  4  
ATOM 5847  H HE2  . LYS A 1 75 ? -6.815  -1.190  -7.255  1.00 0.00 ? 1119 LYS B HE2  4  
ATOM 5848  H HE3  . LYS A 1 75 ? -7.255  -2.529  -8.314  1.00 0.00 ? 1119 LYS B HE3  4  
ATOM 5849  H HZ1  . LYS A 1 75 ? -6.520  -0.033  -9.111  1.00 0.00 ? 1119 LYS B HZ1  4  
ATOM 5850  H HZ2  . LYS A 1 75 ? -8.211  -0.006  -9.267  1.00 0.00 ? 1119 LYS B HZ2  4  
ATOM 5851  H HZ3  . LYS A 1 75 ? -7.300  -1.192  -10.072 1.00 0.00 ? 1119 LYS B HZ3  4  
ATOM 5852  N N    . VAL A 1 76 ? -6.306  -4.096  -4.405  1.00 0.00 ? 1120 VAL B N    4  
ATOM 5853  C CA   . VAL A 1 76 ? -5.414  -5.162  -4.833  1.00 0.00 ? 1120 VAL B CA   4  
ATOM 5854  C C    . VAL A 1 76 ? -5.648  -6.403  -3.986  1.00 0.00 ? 1120 VAL B C    4  
ATOM 5855  O O    . VAL A 1 76 ? -5.674  -7.522  -4.494  1.00 0.00 ? 1120 VAL B O    4  
ATOM 5856  C CB   . VAL A 1 76 ? -3.957  -4.714  -4.703  1.00 0.00 ? 1120 VAL B CB   4  
ATOM 5857  C CG1  . VAL A 1 76 ? -3.028  -5.902  -4.970  1.00 0.00 ? 1120 VAL B CG1  4  
ATOM 5858  C CG2  . VAL A 1 76 ? -3.673  -3.606  -5.720  1.00 0.00 ? 1120 VAL B CG2  4  
ATOM 5859  H H    . VAL A 1 76 ? -5.924  -3.262  -4.060  1.00 0.00 ? 1120 VAL B H    4  
ATOM 5860  H HA   . VAL A 1 76 ? -5.617  -5.398  -5.868  1.00 0.00 ? 1120 VAL B HA   4  
ATOM 5861  H HB   . VAL A 1 76 ? -3.785  -4.340  -3.705  1.00 0.00 ? 1120 VAL B HB   4  
ATOM 5862  H HG11 . VAL A 1 76 ? -3.276  -6.345  -5.921  1.00 0.00 ? 1120 VAL B HG11 4  
ATOM 5863  H HG12 . VAL A 1 76 ? -3.148  -6.636  -4.187  1.00 0.00 ? 1120 VAL B HG12 4  
ATOM 5864  H HG13 . VAL A 1 76 ? -2.005  -5.560  -4.988  1.00 0.00 ? 1120 VAL B HG13 4  
ATOM 5865  H HG21 . VAL A 1 76 ? -4.602  -3.277  -6.162  1.00 0.00 ? 1120 VAL B HG21 4  
ATOM 5866  H HG22 . VAL A 1 76 ? -3.021  -3.986  -6.493  1.00 0.00 ? 1120 VAL B HG22 4  
ATOM 5867  H HG23 . VAL A 1 76 ? -3.196  -2.775  -5.222  1.00 0.00 ? 1120 VAL B HG23 4  
ATOM 5868  N N    . TYR A 1 77 ? -5.817  -6.192  -2.688  1.00 0.00 ? 1121 TYR B N    4  
ATOM 5869  C CA   . TYR A 1 77 ? -6.049  -7.299  -1.768  1.00 0.00 ? 1121 TYR B CA   4  
ATOM 5870  C C    . TYR A 1 77 ? -7.305  -8.060  -2.167  1.00 0.00 ? 1121 TYR B C    4  
ATOM 5871  O O    . TYR A 1 77 ? -7.307  -9.290  -2.223  1.00 0.00 ? 1121 TYR B O    4  
ATOM 5872  C CB   . TYR A 1 77 ? -6.199  -6.778  -0.338  1.00 0.00 ? 1121 TYR B CB   4  
ATOM 5873  C CG   . TYR A 1 77 ? -6.536  -7.926  0.583   1.00 0.00 ? 1121 TYR B CG   4  
ATOM 5874  C CD1  . TYR A 1 77 ? -5.532  -8.805  1.007   1.00 0.00 ? 1121 TYR B CD1  4  
ATOM 5875  C CD2  . TYR A 1 77 ? -7.856  -8.113  1.014   1.00 0.00 ? 1121 TYR B CD2  4  
ATOM 5876  C CE1  . TYR A 1 77 ? -5.847  -9.870  1.859   1.00 0.00 ? 1121 TYR B CE1  4  
ATOM 5877  C CE2  . TYR A 1 77 ? -8.171  -9.177  1.867   1.00 0.00 ? 1121 TYR B CE2  4  
ATOM 5878  C CZ   . TYR A 1 77 ? -7.166  -10.055 2.290   1.00 0.00 ? 1121 TYR B CZ   4  
ATOM 5879  O OH   . TYR A 1 77 ? -7.478  -11.105 3.131   1.00 0.00 ? 1121 TYR B OH   4  
ATOM 5880  H H    . TYR A 1 77 ? -5.785  -5.272  -2.343  1.00 0.00 ? 1121 TYR B H    4  
ATOM 5881  H HA   . TYR A 1 77 ? -5.205  -7.971  -1.808  1.00 0.00 ? 1121 TYR B HA   4  
ATOM 5882  H HB2  . TYR A 1 77 ? -5.271  -6.322  -0.021  1.00 0.00 ? 1121 TYR B HB2  4  
ATOM 5883  H HB3  . TYR A 1 77 ? -6.990  -6.044  -0.303  1.00 0.00 ? 1121 TYR B HB3  4  
ATOM 5884  H HD1  . TYR A 1 77 ? -4.515  -8.662  0.674   1.00 0.00 ? 1121 TYR B HD1  4  
ATOM 5885  H HD2  . TYR A 1 77 ? -8.631  -7.436  0.688   1.00 0.00 ? 1121 TYR B HD2  4  
ATOM 5886  H HE1  . TYR A 1 77 ? -5.072  -10.549 2.187   1.00 0.00 ? 1121 TYR B HE1  4  
ATOM 5887  H HE2  . TYR A 1 77 ? -9.188  -9.320  2.199   1.00 0.00 ? 1121 TYR B HE2  4  
ATOM 5888  H HH   . TYR A 1 77 ? -6.791  -11.771 3.042   1.00 0.00 ? 1121 TYR B HH   4  
ATOM 5889  N N    . HIS A 1 78 ? -8.373  -7.322  -2.440  1.00 0.00 ? 1122 HIS B N    4  
ATOM 5890  C CA   . HIS A 1 78 ? -9.632  -7.942  -2.827  1.00 0.00 ? 1122 HIS B CA   4  
ATOM 5891  C C    . HIS A 1 78 ? -9.446  -8.768  -4.096  1.00 0.00 ? 1122 HIS B C    4  
ATOM 5892  O O    . HIS A 1 78 ? -9.891  -9.912  -4.172  1.00 0.00 ? 1122 HIS B O    4  
ATOM 5893  C CB   . HIS A 1 78 ? -10.696 -6.866  -3.064  1.00 0.00 ? 1122 HIS B CB   4  
ATOM 5894  C CG   . HIS A 1 78 ? -11.989 -7.514  -3.478  1.00 0.00 ? 1122 HIS B CG   4  
ATOM 5895  N ND1  . HIS A 1 78 ? -12.778 -8.224  -2.586  1.00 0.00 ? 1122 HIS B ND1  4  
ATOM 5896  C CD2  . HIS A 1 78 ? -12.649 -7.562  -4.681  1.00 0.00 ? 1122 HIS B CD2  4  
ATOM 5897  C CE1  . HIS A 1 78 ? -13.856 -8.666  -3.261  1.00 0.00 ? 1122 HIS B CE1  4  
ATOM 5898  N NE2  . HIS A 1 78 ? -13.827 -8.291  -4.542  1.00 0.00 ? 1122 HIS B NE2  4  
ATOM 5899  H H    . HIS A 1 78 ? -8.311  -6.345  -2.377  1.00 0.00 ? 1122 HIS B H    4  
ATOM 5900  H HA   . HIS A 1 78 ? -9.965  -8.591  -2.031  1.00 0.00 ? 1122 HIS B HA   4  
ATOM 5901  H HB2  . HIS A 1 78 ? -10.850 -6.306  -2.153  1.00 0.00 ? 1122 HIS B HB2  4  
ATOM 5902  H HB3  . HIS A 1 78 ? -10.364 -6.198  -3.844  1.00 0.00 ? 1122 HIS B HB3  4  
ATOM 5903  H HD1  . HIS A 1 78 ? -12.587 -8.375  -1.636  1.00 0.00 ? 1122 HIS B HD1  4  
ATOM 5904  H HD2  . HIS A 1 78 ? -12.306 -7.105  -5.598  1.00 0.00 ? 1122 HIS B HD2  4  
ATOM 5905  H HE1  . HIS A 1 78 ? -14.648 -9.252  -2.817  1.00 0.00 ? 1122 HIS B HE1  4  
ATOM 5906  N N    . ALA A 1 79 ? -8.785  -8.182  -5.090  1.00 0.00 ? 1123 ALA B N    4  
ATOM 5907  C CA   . ALA A 1 79 ? -8.550  -8.883  -6.347  1.00 0.00 ? 1123 ALA B CA   4  
ATOM 5908  C C    . ALA A 1 79 ? -7.704  -10.135 -6.120  1.00 0.00 ? 1123 ALA B C    4  
ATOM 5909  O O    . ALA A 1 79 ? -7.967  -11.186 -6.696  1.00 0.00 ? 1123 ALA B O    4  
ATOM 5910  C CB   . ALA A 1 79 ? -7.845  -7.956  -7.338  1.00 0.00 ? 1123 ALA B CB   4  
ATOM 5911  H H    . ALA A 1 79 ? -8.450  -7.268  -4.976  1.00 0.00 ? 1123 ALA B H    4  
ATOM 5912  H HA   . ALA A 1 79 ? -9.501  -9.177  -6.764  1.00 0.00 ? 1123 ALA B HA   4  
ATOM 5913  H HB1  . ALA A 1 79 ? -6.836  -8.306  -7.502  1.00 0.00 ? 1123 ALA B HB1  4  
ATOM 5914  H HB2  . ALA A 1 79 ? -7.818  -6.955  -6.938  1.00 0.00 ? 1123 ALA B HB2  4  
ATOM 5915  H HB3  . ALA A 1 79 ? -8.382  -7.957  -8.274  1.00 0.00 ? 1123 ALA B HB3  4  
ATOM 5916  N N    . TRP A 1 80 ? -6.687  -10.024 -5.274  1.00 0.00 ? 1124 TRP B N    4  
ATOM 5917  C CA   . TRP A 1 80 ? -5.829  -11.150 -4.989  1.00 0.00 ? 1124 TRP B CA   4  
ATOM 5918  C C    . TRP A 1 80 ? -6.638  -12.294 -4.380  1.00 0.00 ? 1124 TRP B C    4  
ATOM 5919  O O    . TRP A 1 80 ? -6.510  -13.445 -4.791  1.00 0.00 ? 1124 TRP B O    4  
ATOM 5920  C CB   . TRP A 1 80 ? -4.726  -10.705 -4.036  1.00 0.00 ? 1124 TRP B CB   4  
ATOM 5921  C CG   . TRP A 1 80 ? -3.886  -11.877 -3.686  1.00 0.00 ? 1124 TRP B CG   4  
ATOM 5922  C CD1  . TRP A 1 80 ? -2.940  -12.407 -4.483  1.00 0.00 ? 1124 TRP B CD1  4  
ATOM 5923  C CD2  . TRP A 1 80 ? -3.885  -12.655 -2.463  1.00 0.00 ? 1124 TRP B CD2  4  
ATOM 5924  N NE1  . TRP A 1 80 ? -2.362  -13.484 -3.832  1.00 0.00 ? 1124 TRP B NE1  4  
ATOM 5925  C CE2  . TRP A 1 80 ? -2.915  -13.674 -2.578  1.00 0.00 ? 1124 TRP B CE2  4  
ATOM 5926  C CE3  . TRP A 1 80 ? -4.636  -12.575 -1.281  1.00 0.00 ? 1124 TRP B CE3  4  
ATOM 5927  C CZ2  . TRP A 1 80 ? -2.694  -14.587 -1.547  1.00 0.00 ? 1124 TRP B CZ2  4  
ATOM 5928  C CZ3  . TRP A 1 80 ? -4.418  -13.489 -0.240  1.00 0.00 ? 1124 TRP B CZ3  4  
ATOM 5929  C CH2  . TRP A 1 80 ? -3.447  -14.495 -0.373  1.00 0.00 ? 1124 TRP B CH2  4  
ATOM 5930  H H    . TRP A 1 80 ? -6.508  -9.173  -4.833  1.00 0.00 ? 1124 TRP B H    4  
ATOM 5931  H HA   . TRP A 1 80 ? -5.378  -11.491 -5.908  1.00 0.00 ? 1124 TRP B HA   4  
ATOM 5932  H HB2  . TRP A 1 80 ? -4.118  -9.954  -4.513  1.00 0.00 ? 1124 TRP B HB2  4  
ATOM 5933  H HB3  . TRP A 1 80 ? -5.168  -10.298 -3.137  1.00 0.00 ? 1124 TRP B HB3  4  
ATOM 5934  H HD1  . TRP A 1 80 ? -2.689  -12.051 -5.469  1.00 0.00 ? 1124 TRP B HD1  4  
ATOM 5935  H HE1  . TRP A 1 80 ? -1.648  -14.051 -4.195  1.00 0.00 ? 1124 TRP B HE1  4  
ATOM 5936  H HE3  . TRP A 1 80 ? -5.386  -11.803 -1.175  1.00 0.00 ? 1124 TRP B HE3  4  
ATOM 5937  H HZ2  . TRP A 1 80 ? -1.945  -15.359 -1.653  1.00 0.00 ? 1124 TRP B HZ2  4  
ATOM 5938  H HZ3  . TRP A 1 80 ? -4.996  -13.415 0.667   1.00 0.00 ? 1124 TRP B HZ3  4  
ATOM 5939  H HH2  . TRP A 1 80 ? -3.281  -15.195 0.432   1.00 0.00 ? 1124 TRP B HH2  4  
ATOM 5940  N N    . LYS A 1 81 ? -7.479  -11.961 -3.408  1.00 0.00 ? 1125 LYS B N    4  
ATOM 5941  C CA   . LYS A 1 81 ? -8.319  -12.958 -2.751  1.00 0.00 ? 1125 LYS B CA   4  
ATOM 5942  C C    . LYS A 1 81 ? -9.284  -13.589 -3.737  1.00 0.00 ? 1125 LYS B C    4  
ATOM 5943  O O    . LYS A 1 81 ? -9.557  -14.782 -3.672  1.00 0.00 ? 1125 LYS B O    4  
ATOM 5944  C CB   . LYS A 1 81 ? -9.112  -12.301 -1.616  1.00 0.00 ? 1125 LYS B CB   4  
ATOM 5945  C CG   . LYS A 1 81 ? -8.170  -11.935 -0.469  1.00 0.00 ? 1125 LYS B CG   4  
ATOM 5946  C CD   . LYS A 1 81 ? -7.788  -13.196 0.301   1.00 0.00 ? 1125 LYS B CD   4  
ATOM 5947  C CE   . LYS A 1 81 ? -8.924  -13.586 1.247   1.00 0.00 ? 1125 LYS B CE   4  
ATOM 5948  N NZ   . LYS A 1 81 ? -8.541  -14.808 2.008   1.00 0.00 ? 1125 LYS B NZ   4  
ATOM 5949  H H    . LYS A 1 81 ? -7.543  -11.023 -3.130  1.00 0.00 ? 1125 LYS B H    4  
ATOM 5950  H HA   . LYS A 1 81 ? -7.698  -13.736 -2.352  1.00 0.00 ? 1125 LYS B HA   4  
ATOM 5951  H HB2  . LYS A 1 81 ? -9.592  -11.408 -1.987  1.00 0.00 ? 1125 LYS B HB2  4  
ATOM 5952  H HB3  . LYS A 1 81 ? -9.862  -12.989 -1.257  1.00 0.00 ? 1125 LYS B HB3  4  
ATOM 5953  H HG2  . LYS A 1 81 ? -7.280  -11.472 -0.870  1.00 0.00 ? 1125 LYS B HG2  4  
ATOM 5954  H HG3  . LYS A 1 81 ? -8.665  -11.245 0.198   1.00 0.00 ? 1125 LYS B HG3  4  
ATOM 5955  H HD2  . LYS A 1 81 ? -7.613  -13.999 -0.397  1.00 0.00 ? 1125 LYS B HD2  4  
ATOM 5956  H HD3  . LYS A 1 81 ? -6.891  -13.012 0.870   1.00 0.00 ? 1125 LYS B HD3  4  
ATOM 5957  H HE2  . LYS A 1 81 ? -9.110  -12.776 1.938   1.00 0.00 ? 1125 LYS B HE2  4  
ATOM 5958  H HE3  . LYS A 1 81 ? -9.818  -13.783 0.675   1.00 0.00 ? 1125 LYS B HE3  4  
ATOM 5959  H HZ1  . LYS A 1 81 ? -8.607  -14.617 3.029   1.00 0.00 ? 1125 LYS B HZ1  4  
ATOM 5960  H HZ2  . LYS A 1 81 ? -7.566  -15.075 1.768   1.00 0.00 ? 1125 LYS B HZ2  4  
ATOM 5961  H HZ3  . LYS A 1 81 ? -9.186  -15.585 1.762   1.00 0.00 ? 1125 LYS B HZ3  4  
ATOM 5962  N N    . SER A 1 82 ? -9.806  -12.779 -4.634  1.00 0.00 ? 1126 SER B N    4  
ATOM 5963  C CA   . SER A 1 82 ? -10.755 -13.273 -5.621  1.00 0.00 ? 1126 SER B CA   4  
ATOM 5964  C C    . SER A 1 82 ? -10.087 -14.316 -6.510  1.00 0.00 ? 1126 SER B C    4  
ATOM 5965  O O    . SER A 1 82 ? -10.705 -15.301 -6.898  1.00 0.00 ? 1126 SER B O    4  
ATOM 5966  C CB   . SER A 1 82 ? -11.284 -12.128 -6.485  1.00 0.00 ? 1126 SER B CB   4  
ATOM 5967  O OG   . SER A 1 82 ? -10.277 -11.717 -7.399  1.00 0.00 ? 1126 SER B OG   4  
ATOM 5968  H H    . SER A 1 82 ? -9.554  -11.839 -4.626  1.00 0.00 ? 1126 SER B H    4  
ATOM 5969  H HA   . SER A 1 82 ? -11.584 -13.728 -5.108  1.00 0.00 ? 1126 SER B HA   4  
ATOM 5970  H HB2  . SER A 1 82 ? -12.148 -12.462 -7.037  1.00 0.00 ? 1126 SER B HB2  4  
ATOM 5971  H HB3  . SER A 1 82 ? -11.567 -11.300 -5.848  1.00 0.00 ? 1126 SER B HB3  4  
ATOM 5972  H HG   . SER A 1 82 ? -10.247 -12.356 -8.114  1.00 0.00 ? 1126 SER B HG   4  
ATOM 5973  N N    . LYS A 1 83 ? -8.814  -14.090 -6.828  1.00 0.00 ? 1127 LYS B N    4  
ATOM 5974  C CA   . LYS A 1 83 ? -8.073  -15.021 -7.673  1.00 0.00 ? 1127 LYS B CA   4  
ATOM 5975  C C    . LYS A 1 83 ? -7.794  -16.335 -6.943  1.00 0.00 ? 1127 LYS B C    4  
ATOM 5976  O O    . LYS A 1 83 ? -7.955  -17.416 -7.501  1.00 0.00 ? 1127 LYS B O    4  
ATOM 5977  C CB   . LYS A 1 83 ? -6.743  -14.387 -8.072  1.00 0.00 ? 1127 LYS B CB   4  
ATOM 5978  C CG   . LYS A 1 83 ? -7.004  -13.203 -8.997  1.00 0.00 ? 1127 LYS B CG   4  
ATOM 5979  C CD   . LYS A 1 83 ? -5.693  -12.466 -9.265  1.00 0.00 ? 1127 LYS B CD   4  
ATOM 5980  C CE   . LYS A 1 83 ? -4.797  -13.323 -10.159 1.00 0.00 ? 1127 LYS B CE   4  
ATOM 5981  N NZ   . LYS A 1 83 ? -3.552  -12.569 -10.477 1.00 0.00 ? 1127 LYS B NZ   4  
ATOM 5982  H H    . LYS A 1 83 ? -8.367  -13.284 -6.490  1.00 0.00 ? 1127 LYS B H    4  
ATOM 5983  H HA   . LYS A 1 83 ? -8.643  -15.224 -8.566  1.00 0.00 ? 1127 LYS B HA   4  
ATOM 5984  H HB2  . LYS A 1 83 ? -6.230  -14.043 -7.185  1.00 0.00 ? 1127 LYS B HB2  4  
ATOM 5985  H HB3  . LYS A 1 83 ? -6.133  -15.114 -8.585  1.00 0.00 ? 1127 LYS B HB3  4  
ATOM 5986  H HG2  . LYS A 1 83 ? -7.416  -13.559 -9.929  1.00 0.00 ? 1127 LYS B HG2  4  
ATOM 5987  H HG3  . LYS A 1 83 ? -7.703  -12.530 -8.528  1.00 0.00 ? 1127 LYS B HG3  4  
ATOM 5988  H HD2  . LYS A 1 83 ? -5.901  -11.525 -9.755  1.00 0.00 ? 1127 LYS B HD2  4  
ATOM 5989  H HD3  . LYS A 1 83 ? -5.189  -12.281 -8.327  1.00 0.00 ? 1127 LYS B HD3  4  
ATOM 5990  H HE2  . LYS A 1 83 ? -4.542  -14.238 -9.644  1.00 0.00 ? 1127 LYS B HE2  4  
ATOM 5991  H HE3  . LYS A 1 83 ? -5.319  -13.557 -11.075 1.00 0.00 ? 1127 LYS B HE3  4  
ATOM 5992  H HZ1  . LYS A 1 83 ? -3.341  -12.658 -11.491 1.00 0.00 ? 1127 LYS B HZ1  4  
ATOM 5993  H HZ2  . LYS A 1 83 ? -2.761  -12.958 -9.922  1.00 0.00 ? 1127 LYS B HZ2  4  
ATOM 5994  H HZ3  . LYS A 1 83 ? -3.684  -11.566 -10.239 1.00 0.00 ? 1127 LYS B HZ3  4  
ATOM 5995  N N    . ASN A 1 84 ? -7.366  -16.227 -5.691  1.00 0.00 ? 1128 ASN B N    4  
ATOM 5996  C CA   . ASN A 1 84 ? -7.055  -17.411 -4.894  1.00 0.00 ? 1128 ASN B CA   4  
ATOM 5997  C C    . ASN A 1 84 ? -8.317  -18.189 -4.540  1.00 0.00 ? 1128 ASN B C    4  
ATOM 5998  O O    . ASN A 1 84 ? -8.319  -19.420 -4.541  1.00 0.00 ? 1128 ASN B O    4  
ATOM 5999  C CB   . ASN A 1 84 ? -6.335  -16.990 -3.614  1.00 0.00 ? 1128 ASN B CB   4  
ATOM 6000  C CG   . ASN A 1 84 ? -4.881  -16.661 -3.926  1.00 0.00 ? 1128 ASN B CG   4  
ATOM 6001  O OD1  . ASN A 1 84 ? -4.009  -17.525 -3.816  1.00 0.00 ? 1128 ASN B OD1  4  
ATOM 6002  N ND2  . ASN A 1 84 ? -4.571  -15.467 -4.351  1.00 0.00 ? 1128 ASN B ND2  4  
ATOM 6003  H H    . ASN A 1 84 ? -7.249  -15.335 -5.299  1.00 0.00 ? 1128 ASN B H    4  
ATOM 6004  H HA   . ASN A 1 84 ? -6.397  -18.052 -5.462  1.00 0.00 ? 1128 ASN B HA   4  
ATOM 6005  H HB2  . ASN A 1 84 ? -6.821  -16.120 -3.200  1.00 0.00 ? 1128 ASN B HB2  4  
ATOM 6006  H HB3  . ASN A 1 84 ? -6.373  -17.798 -2.898  1.00 0.00 ? 1128 ASN B HB3  4  
ATOM 6007  H HD21 . ASN A 1 84 ? -5.271  -14.794 -4.470  1.00 0.00 ? 1128 ASN B HD21 4  
ATOM 6008  H HD22 . ASN A 1 84 ? -3.639  -15.247 -4.557  1.00 0.00 ? 1128 ASN B HD22 4  
ATOM 6009  N N    . LYS A 1 85 ? -9.387  -17.465 -4.239  1.00 0.00 ? 1129 LYS B N    4  
ATOM 6010  C CA   . LYS A 1 85 ? -10.648 -18.102 -3.882  1.00 0.00 ? 1129 LYS B CA   4  
ATOM 6011  C C    . LYS A 1 85 ? -11.386 -18.547 -5.139  1.00 0.00 ? 1129 LYS B C    4  
ATOM 6012  O O    . LYS A 1 85 ? -12.135 -19.522 -5.121  1.00 0.00 ? 1129 LYS B O    4  
ATOM 6013  C CB   . LYS A 1 85 ? -11.515 -17.130 -3.076  1.00 0.00 ? 1129 LYS B CB   4  
ATOM 6014  C CG   . LYS A 1 85 ? -12.188 -16.135 -4.021  1.00 0.00 ? 1129 LYS B CG   4  
ATOM 6015  C CD   . LYS A 1 85 ? -12.846 -15.018 -3.207  1.00 0.00 ? 1129 LYS B CD   4  
ATOM 6016  C CE   . LYS A 1 85 ? -14.025 -15.591 -2.420  1.00 0.00 ? 1129 LYS B CE   4  
ATOM 6017  N NZ   . LYS A 1 85 ? -14.705 -14.494 -1.674  1.00 0.00 ? 1129 LYS B NZ   4  
ATOM 6018  H H    . LYS A 1 85 ? -9.326  -16.487 -4.258  1.00 0.00 ? 1129 LYS B H    4  
ATOM 6019  H HA   . LYS A 1 85 ? -10.441 -18.970 -3.274  1.00 0.00 ? 1129 LYS B HA   4  
ATOM 6020  H HB2  . LYS A 1 85 ? -12.270 -17.683 -2.538  1.00 0.00 ? 1129 LYS B HB2  4  
ATOM 6021  H HB3  . LYS A 1 85 ? -10.894 -16.593 -2.374  1.00 0.00 ? 1129 LYS B HB3  4  
ATOM 6022  H HG2  . LYS A 1 85 ? -11.446 -15.716 -4.684  1.00 0.00 ? 1129 LYS B HG2  4  
ATOM 6023  H HG3  . LYS A 1 85 ? -12.942 -16.641 -4.601  1.00 0.00 ? 1129 LYS B HG3  4  
ATOM 6024  H HD2  . LYS A 1 85 ? -12.124 -14.599 -2.523  1.00 0.00 ? 1129 LYS B HD2  4  
ATOM 6025  H HD3  . LYS A 1 85 ? -13.201 -14.249 -3.874  1.00 0.00 ? 1129 LYS B HD3  4  
ATOM 6026  H HE2  . LYS A 1 85 ? -14.725 -16.049 -3.103  1.00 0.00 ? 1129 LYS B HE2  4  
ATOM 6027  H HE3  . LYS A 1 85 ? -13.667 -16.332 -1.721  1.00 0.00 ? 1129 LYS B HE3  4  
ATOM 6028  H HZ1  . LYS A 1 85 ? -14.888 -13.697 -2.317  1.00 0.00 ? 1129 LYS B HZ1  4  
ATOM 6029  H HZ2  . LYS A 1 85 ? -14.097 -14.177 -0.892  1.00 0.00 ? 1129 LYS B HZ2  4  
ATOM 6030  H HZ3  . LYS A 1 85 ? -15.608 -14.841 -1.293  1.00 0.00 ? 1129 LYS B HZ3  4  
ATOM 6031  N N    . LYS A 1 86 ? -11.168 -17.817 -6.226  1.00 0.00 ? 1130 LYS B N    4  
ATOM 6032  C CA   . LYS A 1 86 ? -11.815 -18.136 -7.496  1.00 0.00 ? 1130 LYS B CA   4  
ATOM 6033  C C    . LYS A 1 86 ? -10.847 -17.977 -8.662  1.00 0.00 ? 1130 LYS B C    4  
ATOM 6034  O O    . LYS A 1 86 ? -10.096 -17.004 -8.728  1.00 0.00 ? 1130 LYS B O    4  
ATOM 6035  C CB   . LYS A 1 86 ? -13.033 -17.234 -7.711  1.00 0.00 ? 1130 LYS B CB   4  
ATOM 6036  C CG   . LYS A 1 86 ? -14.218 -17.774 -6.908  1.00 0.00 ? 1130 LYS B CG   4  
ATOM 6037  C CD   . LYS A 1 86 ? -15.363 -16.758 -6.926  1.00 0.00 ? 1130 LYS B CD   4  
ATOM 6038  C CE   . LYS A 1 86 ? -15.903 -16.613 -8.351  1.00 0.00 ? 1130 LYS B CE   4  
ATOM 6039  N NZ   . LYS A 1 86 ? -17.055 -15.668 -8.349  1.00 0.00 ? 1130 LYS B NZ   4  
ATOM 6040  H H    . LYS A 1 86 ? -10.557 -17.044 -6.170  1.00 0.00 ? 1130 LYS B H    4  
ATOM 6041  H HA   . LYS A 1 86 ? -12.150 -19.162 -7.464  1.00 0.00 ? 1130 LYS B HA   4  
ATOM 6042  H HB2  . LYS A 1 86 ? -12.798 -16.232 -7.378  1.00 0.00 ? 1130 LYS B HB2  4  
ATOM 6043  H HB3  . LYS A 1 86 ? -13.287 -17.215 -8.759  1.00 0.00 ? 1130 LYS B HB3  4  
ATOM 6044  H HG2  . LYS A 1 86 ? -14.554 -18.702 -7.350  1.00 0.00 ? 1130 LYS B HG2  4  
ATOM 6045  H HG3  . LYS A 1 86 ? -13.913 -17.954 -5.888  1.00 0.00 ? 1130 LYS B HG3  4  
ATOM 6046  H HD2  . LYS A 1 86 ? -16.153 -17.098 -6.273  1.00 0.00 ? 1130 LYS B HD2  4  
ATOM 6047  H HD3  . LYS A 1 86 ? -14.998 -15.801 -6.583  1.00 0.00 ? 1130 LYS B HD3  4  
ATOM 6048  H HE2  . LYS A 1 86 ? -15.125 -16.230 -8.995  1.00 0.00 ? 1130 LYS B HE2  4  
ATOM 6049  H HE3  . LYS A 1 86 ? -16.227 -17.577 -8.712  1.00 0.00 ? 1130 LYS B HE3  4  
ATOM 6050  H HZ1  . LYS A 1 86 ? -17.917 -16.171 -8.640  1.00 0.00 ? 1130 LYS B HZ1  4  
ATOM 6051  H HZ2  . LYS A 1 86 ? -16.866 -14.890 -9.016  1.00 0.00 ? 1130 LYS B HZ2  4  
ATOM 6052  H HZ3  . LYS A 1 86 ? -17.187 -15.282 -7.394  1.00 0.00 ? 1130 LYS B HZ3  4  
ATOM 6053  N N    . ARG A 1 87 ? -10.877 -18.933 -9.584  1.00 0.00 ? 1131 ARG B N    4  
ATOM 6054  C CA   . ARG A 1 87 ? -10.000 -18.889 -10.748 1.00 0.00 ? 1131 ARG B CA   4  
ATOM 6055  C C    . ARG A 1 87 ? -10.341 -20.012 -11.722 1.00 0.00 ? 1131 ARG B C    4  
ATOM 6056  O O    . ARG A 1 87 ? -10.105 -19.834 -12.906 1.00 0.00 ? 1131 ARG B O    4  
ATOM 6057  C CB   . ARG A 1 87 ? -8.541  -19.018 -10.306 1.00 0.00 ? 1131 ARG B CB   4  
ATOM 6058  C CG   . ARG A 1 87 ? -8.336  -20.363 -9.605  1.00 0.00 ? 1131 ARG B CG   4  
ATOM 6059  C CD   . ARG A 1 87 ? -6.880  -20.482 -9.151  1.00 0.00 ? 1131 ARG B CD   4  
ATOM 6060  N NE   . ARG A 1 87 ? -6.655  -21.767 -8.494  1.00 0.00 ? 1131 ARG B NE   4  
ATOM 6061  C CZ   . ARG A 1 87 ? -5.457  -22.109 -8.019  1.00 0.00 ? 1131 ARG B CZ   4  
ATOM 6062  N NH1  . ARG A 1 87 ? -4.436  -21.296 -8.128  1.00 0.00 ? 1131 ARG B NH1  4  
ATOM 6063  N NH2  . ARG A 1 87 ? -5.299  -23.270 -7.444  1.00 0.00 ? 1131 ARG B NH2  4  
ATOM 6064  O OXT  . ARG A 1 87 ? -10.831 -21.034 -11.271 1.00 0.00 ? 1131 ARG B OXT  4  
ATOM 6065  H H    . ARG A 1 87 ? -11.502 -19.681 -9.481  1.00 0.00 ? 1131 ARG B H    4  
ATOM 6066  H HA   . ARG A 1 87 ? -10.129 -17.941 -11.248 1.00 0.00 ? 1131 ARG B HA   4  
ATOM 6067  H HB2  . ARG A 1 87 ? -7.898  -18.962 -11.171 1.00 0.00 ? 1131 ARG B HB2  4  
ATOM 6068  H HB3  . ARG A 1 87 ? -8.299  -18.219 -9.625  1.00 0.00 ? 1131 ARG B HB3  4  
ATOM 6069  H HG2  . ARG A 1 87 ? -8.987  -20.424 -8.744  1.00 0.00 ? 1131 ARG B HG2  4  
ATOM 6070  H HG3  . ARG A 1 87 ? -8.565  -21.167 -10.288 1.00 0.00 ? 1131 ARG B HG3  4  
ATOM 6071  H HD2  . ARG A 1 87 ? -6.231  -20.405 -10.009 1.00 0.00 ? 1131 ARG B HD2  4  
ATOM 6072  H HD3  . ARG A 1 87 ? -6.656  -19.681 -8.461  1.00 0.00 ? 1131 ARG B HD3  4  
ATOM 6073  H HE   . ARG A 1 87 ? -7.405  -22.391 -8.399  1.00 0.00 ? 1131 ARG B HE   4  
ATOM 6074  H HH11 . ARG A 1 87 ? -4.543  -20.406 -8.568  1.00 0.00 ? 1131 ARG B HH11 4  
ATOM 6075  H HH12 . ARG A 1 87 ? -3.543  -21.567 -7.769  1.00 0.00 ? 1131 ARG B HH12 4  
ATOM 6076  H HH21 . ARG A 1 87 ? -6.072  -23.897 -7.360  1.00 0.00 ? 1131 ARG B HH21 4  
ATOM 6077  H HH22 . ARG A 1 87 ? -4.402  -23.533 -7.087  1.00 0.00 ? 1131 ARG B HH22 4  
ATOM 6078  N N    . ILE B 2 9  ? 4.666   -17.725 -0.349  1.00 0.00 ? 46   ILE A N    4  
ATOM 6079  C CA   . ILE B 2 9  ? 3.401   -18.290 0.199   1.00 0.00 ? 46   ILE A CA   4  
ATOM 6080  C C    . ILE B 2 9  ? 2.252   -17.334 -0.110  1.00 0.00 ? 46   ILE A C    4  
ATOM 6081  O O    . ILE B 2 9  ? 2.462   -16.137 -0.313  1.00 0.00 ? 46   ILE A O    4  
ATOM 6082  C CB   . ILE B 2 9  ? 3.541   -18.473 1.712   1.00 0.00 ? 46   ILE A CB   4  
ATOM 6083  C CG1  . ILE B 2 9  ? 4.915   -19.078 2.029   1.00 0.00 ? 46   ILE A CG1  4  
ATOM 6084  C CG2  . ILE B 2 9  ? 2.434   -19.398 2.228   1.00 0.00 ? 46   ILE A CG2  4  
ATOM 6085  C CD1  . ILE B 2 9  ? 5.126   -20.365 1.225   1.00 0.00 ? 46   ILE A CD1  4  
ATOM 6086  H H    . ILE B 2 9  ? 5.073   -17.058 0.335   1.00 0.00 ? 46   ILE A H    4  
ATOM 6087  H HA   . ILE B 2 9  ? 3.205   -19.246 -0.263  1.00 0.00 ? 46   ILE A HA   4  
ATOM 6088  H HB   . ILE B 2 9  ? 3.453   -17.510 2.196   1.00 0.00 ? 46   ILE A HB   4  
ATOM 6089  H HG12 . ILE B 2 9  ? 5.686   -18.365 1.774   1.00 0.00 ? 46   ILE A HG12 4  
ATOM 6090  H HG13 . ILE B 2 9  ? 4.970   -19.303 3.084   1.00 0.00 ? 46   ILE A HG13 4  
ATOM 6091  H HG21 . ILE B 2 9  ? 1.952   -19.883 1.392   1.00 0.00 ? 46   ILE A HG21 4  
ATOM 6092  H HG22 . ILE B 2 9  ? 1.708   -18.818 2.777   1.00 0.00 ? 46   ILE A HG22 4  
ATOM 6093  H HG23 . ILE B 2 9  ? 2.864   -20.145 2.878   1.00 0.00 ? 46   ILE A HG23 4  
ATOM 6094  H HD11 . ILE B 2 9  ? 5.783   -20.164 0.392   1.00 0.00 ? 46   ILE A HD11 4  
ATOM 6095  H HD12 . ILE B 2 9  ? 4.179   -20.726 0.856   1.00 0.00 ? 46   ILE A HD12 4  
ATOM 6096  H HD13 . ILE B 2 9  ? 5.574   -21.115 1.859   1.00 0.00 ? 46   ILE A HD13 4  
ATOM 6097  N N    . GLU B 2 10 ? 1.040   -17.870 -0.150  1.00 0.00 ? 47   GLU A N    4  
ATOM 6098  C CA   . GLU B 2 10 ? -0.132  -17.053 -0.445  1.00 0.00 ? 47   GLU A CA   4  
ATOM 6099  C C    . GLU B 2 10 ? -0.317  -15.975 0.616   1.00 0.00 ? 47   GLU A C    4  
ATOM 6100  O O    . GLU B 2 10 ? -0.611  -14.821 0.303   1.00 0.00 ? 47   GLU A O    4  
ATOM 6101  C CB   . GLU B 2 10 ? -1.378  -17.936 -0.484  1.00 0.00 ? 47   GLU A CB   4  
ATOM 6102  C CG   . GLU B 2 10 ? -1.323  -18.843 -1.712  1.00 0.00 ? 47   GLU A CG   4  
ATOM 6103  C CD   . GLU B 2 10 ? -2.525  -19.782 -1.721  1.00 0.00 ? 47   GLU A CD   4  
ATOM 6104  O OE1  . GLU B 2 10 ? -3.253  -19.790 -0.741  1.00 0.00 ? 47   GLU A OE1  4  
ATOM 6105  O OE2  . GLU B 2 10 ? -2.700  -20.479 -2.706  1.00 0.00 ? 47   GLU A OE2  4  
ATOM 6106  H H    . GLU B 2 10 ? 0.930   -18.830 0.015   1.00 0.00 ? 47   GLU A H    4  
ATOM 6107  H HA   . GLU B 2 10 ? -0.004  -16.584 -1.409  1.00 0.00 ? 47   GLU A HA   4  
ATOM 6108  H HB2  . GLU B 2 10 ? -1.416  -18.539 0.413   1.00 0.00 ? 47   GLU A HB2  4  
ATOM 6109  H HB3  . GLU B 2 10 ? -2.259  -17.313 -0.537  1.00 0.00 ? 47   GLU A HB3  4  
ATOM 6110  H HG2  . GLU B 2 10 ? -1.331  -18.237 -2.606  1.00 0.00 ? 47   GLU A HG2  4  
ATOM 6111  H HG3  . GLU B 2 10 ? -0.414  -19.427 -1.682  1.00 0.00 ? 47   GLU A HG3  4  
ATOM 6112  N N    . ASN B 2 11 ? -0.138  -16.352 1.873   1.00 0.00 ? 48   ASN A N    4  
ATOM 6113  C CA   . ASN B 2 11 ? -0.289  -15.402 2.961   1.00 0.00 ? 48   ASN A CA   4  
ATOM 6114  C C    . ASN B 2 11 ? 0.722   -14.275 2.822   1.00 0.00 ? 48   ASN A C    4  
ATOM 6115  O O    . ASN B 2 11 ? 0.408   -13.111 3.066   1.00 0.00 ? 48   ASN A O    4  
ATOM 6116  C CB   . ASN B 2 11 ? -0.093  -16.102 4.306   1.00 0.00 ? 48   ASN A CB   4  
ATOM 6117  C CG   . ASN B 2 11 ? -1.266  -17.033 4.581   1.00 0.00 ? 48   ASN A CG   4  
ATOM 6118  O OD1  . ASN B 2 11 ? -1.072  -18.209 4.888   1.00 0.00 ? 48   ASN A OD1  4  
ATOM 6119  N ND2  . ASN B 2 11 ? -2.483  -16.575 4.476   1.00 0.00 ? 48   ASN A ND2  4  
ATOM 6120  H H    . ASN B 2 11 ? 0.101   -17.283 2.071   1.00 0.00 ? 48   ASN A H    4  
ATOM 6121  H HA   . ASN B 2 11 ? -1.284  -14.986 2.927   1.00 0.00 ? 48   ASN A HA   4  
ATOM 6122  H HB2  . ASN B 2 11 ? 0.822   -16.675 4.281   1.00 0.00 ? 48   ASN A HB2  4  
ATOM 6123  H HB3  . ASN B 2 11 ? -0.031  -15.362 5.091   1.00 0.00 ? 48   ASN A HB3  4  
ATOM 6124  H HD21 . ASN B 2 11 ? -2.634  -15.640 4.221   1.00 0.00 ? 48   ASN A HD21 4  
ATOM 6125  H HD22 . ASN B 2 11 ? -3.246  -17.164 4.650   1.00 0.00 ? 48   ASN A HD22 4  
ATOM 6126  N N    . ASP B 2 12 ? 1.936   -14.628 2.424   1.00 0.00 ? 49   ASP A N    4  
ATOM 6127  C CA   . ASP B 2 12 ? 2.985   -13.630 2.254   1.00 0.00 ? 49   ASP A CA   4  
ATOM 6128  C C    . ASP B 2 12 ? 2.606   -12.626 1.171   1.00 0.00 ? 49   ASP A C    4  
ATOM 6129  O O    . ASP B 2 12 ? 2.843   -11.426 1.313   1.00 0.00 ? 49   ASP A O    4  
ATOM 6130  C CB   . ASP B 2 12 ? 4.302   -14.312 1.886   1.00 0.00 ? 49   ASP A CB   4  
ATOM 6131  C CG   . ASP B 2 12 ? 4.858   -15.055 3.095   1.00 0.00 ? 49   ASP A CG   4  
ATOM 6132  O OD1  . ASP B 2 12 ? 4.363   -14.826 4.185   1.00 0.00 ? 49   ASP A OD1  4  
ATOM 6133  O OD2  . ASP B 2 12 ? 5.775   -15.840 2.913   1.00 0.00 ? 49   ASP A OD2  4  
ATOM 6134  H H    . ASP B 2 12 ? 2.126   -15.572 2.235   1.00 0.00 ? 49   ASP A H    4  
ATOM 6135  H HA   . ASP B 2 12 ? 3.116   -13.102 3.187   1.00 0.00 ? 49   ASP A HA   4  
ATOM 6136  H HB2  . ASP B 2 12 ? 4.129   -15.012 1.083   1.00 0.00 ? 49   ASP A HB2  4  
ATOM 6137  H HB3  . ASP B 2 12 ? 5.013   -13.565 1.565   1.00 0.00 ? 49   ASP A HB3  4  
ATOM 6138  N N    . GLU B 2 13 ? 2.019   -13.124 0.087   1.00 0.00 ? 50   GLU A N    4  
ATOM 6139  C CA   . GLU B 2 13 ? 1.618   -12.253 -1.011  1.00 0.00 ? 50   GLU A CA   4  
ATOM 6140  C C    . GLU B 2 13 ? 0.567   -11.251 -0.543  1.00 0.00 ? 50   GLU A C    4  
ATOM 6141  O O    . GLU B 2 13 ? 0.624   -10.067 -0.883  1.00 0.00 ? 50   GLU A O    4  
ATOM 6142  C CB   . GLU B 2 13 ? 1.043   -13.088 -2.155  1.00 0.00 ? 50   GLU A CB   4  
ATOM 6143  C CG   . GLU B 2 13 ? 2.158   -13.904 -2.809  1.00 0.00 ? 50   GLU A CG   4  
ATOM 6144  C CD   . GLU B 2 13 ? 1.570   -14.807 -3.888  1.00 0.00 ? 50   GLU A CD   4  
ATOM 6145  O OE1  . GLU B 2 13 ? 0.354   -14.866 -3.985  1.00 0.00 ? 50   GLU A OE1  4  
ATOM 6146  O OE2  . GLU B 2 13 ? 2.345   -15.428 -4.597  1.00 0.00 ? 50   GLU A OE2  4  
ATOM 6147  H H    . GLU B 2 13 ? 1.858   -14.091 0.024   1.00 0.00 ? 50   GLU A H    4  
ATOM 6148  H HA   . GLU B 2 13 ? 2.483   -11.716 -1.370  1.00 0.00 ? 50   GLU A HA   4  
ATOM 6149  H HB2  . GLU B 2 13 ? 0.288   -13.757 -1.766  1.00 0.00 ? 50   GLU A HB2  4  
ATOM 6150  H HB3  . GLU B 2 13 ? 0.599   -12.435 -2.890  1.00 0.00 ? 50   GLU A HB3  4  
ATOM 6151  H HG2  . GLU B 2 13 ? 2.879   -13.233 -3.253  1.00 0.00 ? 50   GLU A HG2  4  
ATOM 6152  H HG3  . GLU B 2 13 ? 2.645   -14.510 -2.060  1.00 0.00 ? 50   GLU A HG3  4  
ATOM 6153  N N    . ALA B 2 14 ? -0.389  -11.731 0.245   1.00 0.00 ? 51   ALA A N    4  
ATOM 6154  C CA   . ALA B 2 14 ? -1.440  -10.862 0.755   1.00 0.00 ? 51   ALA A CA   4  
ATOM 6155  C C    . ALA B 2 14 ? -0.850  -9.786  1.659   1.00 0.00 ? 51   ALA A C    4  
ATOM 6156  O O    . ALA B 2 14 ? -1.268  -8.628  1.614   1.00 0.00 ? 51   ALA A O    4  
ATOM 6157  C CB   . ALA B 2 14 ? -2.472  -11.680 1.526   1.00 0.00 ? 51   ALA A CB   4  
ATOM 6158  H H    . ALA B 2 14 ? -0.385  -12.682 0.489   1.00 0.00 ? 51   ALA A H    4  
ATOM 6159  H HA   . ALA B 2 14 ? -1.932  -10.384 -0.080  1.00 0.00 ? 51   ALA A HA   4  
ATOM 6160  H HB1  . ALA B 2 14 ? -2.275  -12.732 1.384   1.00 0.00 ? 51   ALA A HB1  4  
ATOM 6161  H HB2  . ALA B 2 14 ? -3.462  -11.446 1.163   1.00 0.00 ? 51   ALA A HB2  4  
ATOM 6162  H HB3  . ALA B 2 14 ? -2.405  -11.438 2.574   1.00 0.00 ? 51   ALA A HB3  4  
ATOM 6163  N N    . PHE B 2 15 ? 0.124   -10.173 2.477   1.00 0.00 ? 52   PHE A N    4  
ATOM 6164  C CA   . PHE B 2 15 ? 0.763   -9.222  3.380   1.00 0.00 ? 52   PHE A CA   4  
ATOM 6165  C C    . PHE B 2 15 ? 1.436   -8.106  2.591   1.00 0.00 ? 52   PHE A C    4  
ATOM 6166  O O    . PHE B 2 15 ? 1.323   -6.937  2.946   1.00 0.00 ? 52   PHE A O    4  
ATOM 6167  C CB   . PHE B 2 15 ? 1.807   -9.929  4.248   1.00 0.00 ? 52   PHE A CB   4  
ATOM 6168  C CG   . PHE B 2 15 ? 1.205   -10.295 5.585   1.00 0.00 ? 52   PHE A CG   4  
ATOM 6169  C CD1  . PHE B 2 15 ? 0.708   -11.584 5.805   1.00 0.00 ? 52   PHE A CD1  4  
ATOM 6170  C CD2  . PHE B 2 15 ? 1.150   -9.338  6.609   1.00 0.00 ? 52   PHE A CD2  4  
ATOM 6171  C CE1  . PHE B 2 15 ? 0.158   -11.918 7.046   1.00 0.00 ? 52   PHE A CE1  4  
ATOM 6172  C CE2  . PHE B 2 15 ? 0.599   -9.673  7.852   1.00 0.00 ? 52   PHE A CE2  4  
ATOM 6173  C CZ   . PHE B 2 15 ? 0.103   -10.964 8.071   1.00 0.00 ? 52   PHE A CZ   4  
ATOM 6174  H H    . PHE B 2 15 ? 0.419   -11.107 2.471   1.00 0.00 ? 52   PHE A H    4  
ATOM 6175  H HA   . PHE B 2 15 ? 0.011   -8.791  4.023   1.00 0.00 ? 52   PHE A HA   4  
ATOM 6176  H HB2  . PHE B 2 15 ? 2.141   -10.826 3.747   1.00 0.00 ? 52   PHE A HB2  4  
ATOM 6177  H HB3  . PHE B 2 15 ? 2.651   -9.271  4.402   1.00 0.00 ? 52   PHE A HB3  4  
ATOM 6178  H HD1  . PHE B 2 15 ? 0.751   -12.321 5.018   1.00 0.00 ? 52   PHE A HD1  4  
ATOM 6179  H HD2  . PHE B 2 15 ? 1.530   -8.341  6.438   1.00 0.00 ? 52   PHE A HD2  4  
ATOM 6180  H HE1  . PHE B 2 15 ? -0.225  -12.914 7.216   1.00 0.00 ? 52   PHE A HE1  4  
ATOM 6181  H HE2  . PHE B 2 15 ? 0.560   -8.936  8.641   1.00 0.00 ? 52   PHE A HE2  4  
ATOM 6182  H HZ   . PHE B 2 15 ? -0.322  -11.222 9.029   1.00 0.00 ? 52   PHE A HZ   4  
ATOM 6183  N N    . ALA B 2 16 ? 2.125   -8.471  1.517   1.00 0.00 ? 53   ALA A N    4  
ATOM 6184  C CA   . ALA B 2 16 ? 2.804   -7.478  0.689   1.00 0.00 ? 53   ALA A CA   4  
ATOM 6185  C C    . ALA B 2 16 ? 1.796   -6.497  0.109   1.00 0.00 ? 53   ALA A C    4  
ATOM 6186  O O    . ALA B 2 16 ? 2.049   -5.298  0.034   1.00 0.00 ? 53   ALA A O    4  
ATOM 6187  C CB   . ALA B 2 16 ? 3.559   -8.169  -0.443  1.00 0.00 ? 53   ALA A CB   4  
ATOM 6188  H H    . ALA B 2 16 ? 2.178   -9.420  1.273   1.00 0.00 ? 53   ALA A H    4  
ATOM 6189  H HA   . ALA B 2 16 ? 3.509   -6.937  1.302   1.00 0.00 ? 53   ALA A HA   4  
ATOM 6190  H HB1  . ALA B 2 16 ? 4.092   -9.022  -0.054  1.00 0.00 ? 53   ALA A HB1  4  
ATOM 6191  H HB2  . ALA B 2 16 ? 4.263   -7.474  -0.881  1.00 0.00 ? 53   ALA A HB2  4  
ATOM 6192  H HB3  . ALA B 2 16 ? 2.858   -8.494  -1.197  1.00 0.00 ? 53   ALA A HB3  4  
ATOM 6193  N N    . ILE B 2 17 ? 0.649   -7.012  -0.303  1.00 0.00 ? 54   ILE A N    4  
ATOM 6194  C CA   . ILE B 2 17 ? -0.386  -6.171  -0.870  1.00 0.00 ? 54   ILE A CA   4  
ATOM 6195  C C    . ILE B 2 17 ? -0.826  -5.108  0.134   1.00 0.00 ? 54   ILE A C    4  
ATOM 6196  O O    . ILE B 2 17 ? -1.042  -3.952  -0.227  1.00 0.00 ? 54   ILE A O    4  
ATOM 6197  C CB   . ILE B 2 17 ? -1.587  -7.029  -1.258  1.00 0.00 ? 54   ILE A CB   4  
ATOM 6198  C CG1  . ILE B 2 17 ? -1.216  -7.921  -2.442  1.00 0.00 ? 54   ILE A CG1  4  
ATOM 6199  C CG2  . ILE B 2 17 ? -2.754  -6.127  -1.646  1.00 0.00 ? 54   ILE A CG2  4  
ATOM 6200  C CD1  . ILE B 2 17 ? -2.313  -8.963  -2.664  1.00 0.00 ? 54   ILE A CD1  4  
ATOM 6201  H H    . ILE B 2 17 ? 0.496   -7.980  -0.230  1.00 0.00 ? 54   ILE A H    4  
ATOM 6202  H HA   . ILE B 2 17 ? -0.004  -5.685  -1.751  1.00 0.00 ? 54   ILE A HA   4  
ATOM 6203  H HB   . ILE B 2 17 ? -1.874  -7.645  -0.418  1.00 0.00 ? 54   ILE A HB   4  
ATOM 6204  H HG12 . ILE B 2 17 ? -1.113  -7.316  -3.330  1.00 0.00 ? 54   ILE A HG12 4  
ATOM 6205  H HG13 . ILE B 2 17 ? -0.283  -8.422  -2.237  1.00 0.00 ? 54   ILE A HG13 4  
ATOM 6206  H HG21 . ILE B 2 17 ? -3.518  -6.718  -2.124  1.00 0.00 ? 54   ILE A HG21 4  
ATOM 6207  H HG22 . ILE B 2 17 ? -2.406  -5.367  -2.329  1.00 0.00 ? 54   ILE A HG22 4  
ATOM 6208  H HG23 . ILE B 2 17 ? -3.158  -5.661  -0.760  1.00 0.00 ? 54   ILE A HG23 4  
ATOM 6209  H HD11 . ILE B 2 17 ? -1.878  -9.869  -3.058  1.00 0.00 ? 54   ILE A HD11 4  
ATOM 6210  H HD12 . ILE B 2 17 ? -3.038  -8.575  -3.367  1.00 0.00 ? 54   ILE A HD12 4  
ATOM 6211  H HD13 . ILE B 2 17 ? -2.803  -9.176  -1.726  1.00 0.00 ? 54   ILE A HD13 4  
ATOM 6212  N N    . LEU B 2 18 ? -0.970  -5.512  1.389   1.00 0.00 ? 55   LEU A N    4  
ATOM 6213  C CA   . LEU B 2 18 ? -1.401  -4.590  2.435   1.00 0.00 ? 55   LEU A CA   4  
ATOM 6214  C C    . LEU B 2 18 ? -0.225  -4.105  3.279   1.00 0.00 ? 55   LEU A C    4  
ATOM 6215  O O    . LEU B 2 18 ? -0.406  -3.698  4.425   1.00 0.00 ? 55   LEU A O    4  
ATOM 6216  C CB   . LEU B 2 18 ? -2.433  -5.279  3.329   1.00 0.00 ? 55   LEU A CB   4  
ATOM 6217  C CG   . LEU B 2 18 ? -3.649  -5.683  2.491   1.00 0.00 ? 55   LEU A CG   4  
ATOM 6218  C CD1  . LEU B 2 18 ? -4.620  -6.495  3.351   1.00 0.00 ? 55   LEU A CD1  4  
ATOM 6219  C CD2  . LEU B 2 18 ? -4.363  -4.428  1.982   1.00 0.00 ? 55   LEU A CD2  4  
ATOM 6220  H H    . LEU B 2 18 ? -0.790  -6.449  1.616   1.00 0.00 ? 55   LEU A H    4  
ATOM 6221  H HA   . LEU B 2 18 ? -1.865  -3.733  1.971   1.00 0.00 ? 55   LEU A HA   4  
ATOM 6222  H HB2  . LEU B 2 18 ? -1.989  -6.159  3.773   1.00 0.00 ? 55   LEU A HB2  4  
ATOM 6223  H HB3  . LEU B 2 18 ? -2.743  -4.600  4.109   1.00 0.00 ? 55   LEU A HB3  4  
ATOM 6224  H HG   . LEU B 2 18 ? -3.327  -6.281  1.652   1.00 0.00 ? 55   LEU A HG   4  
ATOM 6225  H HD11 . LEU B 2 18 ? -5.543  -6.646  2.809   1.00 0.00 ? 55   LEU A HD11 4  
ATOM 6226  H HD12 . LEU B 2 18 ? -4.825  -5.960  4.267   1.00 0.00 ? 55   LEU A HD12 4  
ATOM 6227  H HD13 . LEU B 2 18 ? -4.180  -7.453  3.586   1.00 0.00 ? 55   LEU A HD13 4  
ATOM 6228  H HD21 . LEU B 2 18 ? -5.428  -4.600  1.966   1.00 0.00 ? 55   LEU A HD21 4  
ATOM 6229  H HD22 . LEU B 2 18 ? -4.021  -4.200  0.984   1.00 0.00 ? 55   LEU A HD22 4  
ATOM 6230  H HD23 . LEU B 2 18 ? -4.143  -3.599  2.637   1.00 0.00 ? 55   LEU A HD23 4  
ATOM 6231  N N    . ASP B 2 19 ? 0.979   -4.150  2.715   1.00 0.00 ? 56   ASP A N    4  
ATOM 6232  C CA   . ASP B 2 19 ? 2.162   -3.701  3.442   1.00 0.00 ? 56   ASP A CA   4  
ATOM 6233  C C    . ASP B 2 19 ? 3.154   -3.034  2.496   1.00 0.00 ? 56   ASP A C    4  
ATOM 6234  O O    . ASP B 2 19 ? 3.463   -1.853  2.632   1.00 0.00 ? 56   ASP A O    4  
ATOM 6235  C CB   . ASP B 2 19 ? 2.835   -4.894  4.125   1.00 0.00 ? 56   ASP A CB   4  
ATOM 6236  C CG   . ASP B 2 19 ? 3.817   -4.412  5.182   1.00 0.00 ? 56   ASP A CG   4  
ATOM 6237  O OD1  . ASP B 2 19 ? 3.807   -3.229  5.479   1.00 0.00 ? 56   ASP A OD1  4  
ATOM 6238  O OD2  . ASP B 2 19 ? 4.568   -5.233  5.679   1.00 0.00 ? 56   ASP A OD2  4  
ATOM 6239  H H    . ASP B 2 19 ? 1.071   -4.484  1.796   1.00 0.00 ? 56   ASP A H    4  
ATOM 6240  H HA   . ASP B 2 19 ? 1.865   -2.990  4.197   1.00 0.00 ? 56   ASP A HA   4  
ATOM 6241  H HB2  . ASP B 2 19 ? 2.079   -5.509  4.592   1.00 0.00 ? 56   ASP A HB2  4  
ATOM 6242  H HB3  . ASP B 2 19 ? 3.364   -5.477  3.385   1.00 0.00 ? 56   ASP A HB3  4  
ATOM 6243  N N    . GLY B 2 20 ? 3.635   -3.797  1.528   1.00 0.00 ? 57   GLY A N    4  
ATOM 6244  C CA   . GLY B 2 20 ? 4.581   -3.267  0.555   1.00 0.00 ? 57   GLY A CA   4  
ATOM 6245  C C    . GLY B 2 20 ? 3.860   -2.679  -0.658  1.00 0.00 ? 57   GLY A C    4  
ATOM 6246  O O    . GLY B 2 20 ? 4.497   -2.145  -1.566  1.00 0.00 ? 57   GLY A O    4  
ATOM 6247  H H    . GLY B 2 20 ? 3.340   -4.732  1.462   1.00 0.00 ? 57   GLY A H    4  
ATOM 6248  H HA2  . GLY B 2 20 ? 5.173   -2.494  1.023   1.00 0.00 ? 57   GLY A HA2  4  
ATOM 6249  H HA3  . GLY B 2 20 ? 5.231   -4.063  0.226   1.00 0.00 ? 57   GLY A HA3  4  
ATOM 6250  N N    . GLY B 2 21 ? 2.531   -2.787  -0.678  1.00 0.00 ? 58   GLY A N    4  
ATOM 6251  C CA   . GLY B 2 21 ? 1.757   -2.266  -1.796  1.00 0.00 ? 58   GLY A CA   4  
ATOM 6252  C C    . GLY B 2 21 ? 2.004   -3.100  -3.051  1.00 0.00 ? 58   GLY A C    4  
ATOM 6253  O O    . GLY B 2 21 ? 1.807   -2.627  -4.168  1.00 0.00 ? 58   GLY A O    4  
ATOM 6254  H H    . GLY B 2 21 ? 2.066   -3.226  0.064   1.00 0.00 ? 58   GLY A H    4  
ATOM 6255  H HA2  . GLY B 2 21 ? 0.705   -2.300  -1.544  1.00 0.00 ? 58   GLY A HA2  4  
ATOM 6256  H HA3  . GLY B 2 21 ? 2.047   -1.245  -1.987  1.00 0.00 ? 58   GLY A HA3  4  
ATOM 6257  N N    . ALA B 2 22 ? 2.452   -4.339  -2.857  1.00 0.00 ? 59   ALA A N    4  
ATOM 6258  C CA   . ALA B 2 22 ? 2.740   -5.226  -3.978  1.00 0.00 ? 59   ALA A CA   4  
ATOM 6259  C C    . ALA B 2 22 ? 1.454   -5.748  -4.614  1.00 0.00 ? 59   ALA A C    4  
ATOM 6260  O O    . ALA B 2 22 ? 0.402   -5.742  -3.983  1.00 0.00 ? 59   ALA A O    4  
ATOM 6261  C CB   . ALA B 2 22 ? 3.577   -6.412  -3.504  1.00 0.00 ? 59   ALA A CB   4  
ATOM 6262  H H    . ALA B 2 22 ? 2.598   -4.663  -1.942  1.00 0.00 ? 59   ALA A H    4  
ATOM 6263  H HA   . ALA B 2 22 ? 3.304   -4.674  -4.711  1.00 0.00 ? 59   ALA A HA   4  
ATOM 6264  H HB1  . ALA B 2 22 ? 4.371   -6.060  -2.862  1.00 0.00 ? 59   ALA A HB1  4  
ATOM 6265  H HB2  . ALA B 2 22 ? 4.000   -6.919  -4.358  1.00 0.00 ? 59   ALA A HB2  4  
ATOM 6266  H HB3  . ALA B 2 22 ? 2.945   -7.096  -2.954  1.00 0.00 ? 59   ALA A HB3  4  
ATOM 6267  N N    . PRO B 2 23 ? 1.513   -6.198  -5.840  1.00 0.00 ? 60   PRO A N    4  
ATOM 6268  C CA   . PRO B 2 23 ? 0.316   -6.741  -6.546  1.00 0.00 ? 60   PRO A CA   4  
ATOM 6269  C C    . PRO B 2 23 ? -0.261  -7.968  -5.848  1.00 0.00 ? 60   PRO A C    4  
ATOM 6270  O O    . PRO B 2 23 ? -1.478  -8.142  -5.778  1.00 0.00 ? 60   PRO A O    4  
ATOM 6271  C CB   . PRO B 2 23 ? 0.846   -7.114  -7.936  1.00 0.00 ? 60   PRO A CB   4  
ATOM 6272  C CG   . PRO B 2 23 ? 2.115   -6.348  -8.094  1.00 0.00 ? 60   PRO A CG   4  
ATOM 6273  C CD   . PRO B 2 23 ? 2.710   -6.244  -6.698  1.00 0.00 ? 60   PRO A CD   4  
ATOM 6274  H HA   . PRO B 2 23 ? -0.436  -5.980  -6.634  1.00 0.00 ? 60   PRO A HA   4  
ATOM 6275  H HB2  . PRO B 2 23 ? 1.037   -8.177  -7.989  1.00 0.00 ? 60   PRO A HB2  4  
ATOM 6276  H HB3  . PRO B 2 23 ? 0.141   -6.821  -8.698  1.00 0.00 ? 60   PRO A HB3  4  
ATOM 6277  H HG2  . PRO B 2 23 ? 2.789   -6.879  -8.752  1.00 0.00 ? 60   PRO A HG2  4  
ATOM 6278  H HG3  . PRO B 2 23 ? 1.911   -5.362  -8.478  1.00 0.00 ? 60   PRO A HG3  4  
ATOM 6279  H HD2  . PRO B 2 23 ? 3.316   -7.113  -6.473  1.00 0.00 ? 60   PRO A HD2  4  
ATOM 6280  H HD3  . PRO B 2 23 ? 3.282   -5.337  -6.599  1.00 0.00 ? 60   PRO A HD3  4  
ATOM 6281  N N    . GLY B 2 24 ? 0.623   -8.821  -5.338  1.00 0.00 ? 61   GLY A N    4  
ATOM 6282  C CA   . GLY B 2 24 ? 0.195   -10.038 -4.656  1.00 0.00 ? 61   GLY A CA   4  
ATOM 6283  C C    . GLY B 2 24 ? 1.056   -11.226 -5.072  1.00 0.00 ? 61   GLY A C    4  
ATOM 6284  O O    . GLY B 2 24 ? 2.253   -11.041 -5.219  1.00 0.00 ? 61   GLY A O    4  
ATOM 6285  O OXT  . GLY B 2 24 ? 0.505   -12.302 -5.237  1.00 0.00 ? 61   GLY A OXT  4  
ATOM 6286  H H    . GLY B 2 24 ? 1.581   -8.634  -5.430  1.00 0.00 ? 61   GLY A H    4  
ATOM 6287  H HA2  . GLY B 2 24 ? 0.278   -9.896  -3.589  1.00 0.00 ? 61   GLY A HA2  4  
ATOM 6288  H HA3  . GLY B 2 24 ? -0.835  -10.242 -4.910  1.00 0.00 ? 61   GLY A HA3  4  
ATOM 6289  N N    . ARG A 1 6  ? 5.060   -3.549  9.307   1.00 0.00 ? 1050 ARG B N    5  
ATOM 6290  C CA   . ARG A 1 6  ? 4.820   -5.013  9.168   1.00 0.00 ? 1050 ARG B CA   5  
ATOM 6291  C C    . ARG A 1 6  ? 4.119   -5.538  10.418  1.00 0.00 ? 1050 ARG B C    5  
ATOM 6292  O O    . ARG A 1 6  ? 4.725   -6.217  11.245  1.00 0.00 ? 1050 ARG B O    5  
ATOM 6293  C CB   . ARG A 1 6  ? 6.159   -5.732  8.979   1.00 0.00 ? 1050 ARG B CB   5  
ATOM 6294  C CG   . ARG A 1 6  ? 5.923   -7.059  8.253   1.00 0.00 ? 1050 ARG B CG   5  
ATOM 6295  C CD   . ARG A 1 6  ? 7.265   -7.731  7.961   1.00 0.00 ? 1050 ARG B CD   5  
ATOM 6296  N NE   . ARG A 1 6  ? 7.915   -8.121  9.208   1.00 0.00 ? 1050 ARG B NE   5  
ATOM 6297  C CZ   . ARG A 1 6  ? 9.147   -8.637  9.227   1.00 0.00 ? 1050 ARG B CZ   5  
ATOM 6298  N NH1  . ARG A 1 6  ? 9.818   -8.811  8.115   1.00 0.00 ? 1050 ARG B NH1  5  
ATOM 6299  N NH2  . ARG A 1 6  ? 9.690   -8.973  10.366  1.00 0.00 ? 1050 ARG B NH2  5  
ATOM 6300  H H    . ARG A 1 6  ? 6.039   -3.329  9.032   1.00 0.00 ? 1050 ARG B H    5  
ATOM 6301  H HA   . ARG A 1 6  ? 4.196   -5.192  8.306   1.00 0.00 ? 1050 ARG B HA   5  
ATOM 6302  H HB2  . ARG A 1 6  ? 6.820   -5.111  8.392   1.00 0.00 ? 1050 ARG B HB2  5  
ATOM 6303  H HB3  . ARG A 1 6  ? 6.605   -5.924  9.943   1.00 0.00 ? 1050 ARG B HB3  5  
ATOM 6304  H HG2  . ARG A 1 6  ? 5.324   -7.707  8.878   1.00 0.00 ? 1050 ARG B HG2  5  
ATOM 6305  H HG3  . ARG A 1 6  ? 5.405   -6.875  7.325   1.00 0.00 ? 1050 ARG B HG3  5  
ATOM 6306  H HD2  . ARG A 1 6  ? 7.099   -8.610  7.357   1.00 0.00 ? 1050 ARG B HD2  5  
ATOM 6307  H HD3  . ARG A 1 6  ? 7.899   -7.041  7.424   1.00 0.00 ? 1050 ARG B HD3  5  
ATOM 6308  H HE   . ARG A 1 6  ? 7.437   -7.999  10.055  1.00 0.00 ? 1050 ARG B HE   5  
ATOM 6309  H HH11 . ARG A 1 6  ? 9.415   -8.558  7.237   1.00 0.00 ? 1050 ARG B HH11 5  
ATOM 6310  H HH12 . ARG A 1 6  ? 10.738  -9.199  8.145   1.00 0.00 ? 1050 ARG B HH12 5  
ATOM 6311  H HH21 . ARG A 1 6  ? 9.183   -8.844  11.219  1.00 0.00 ? 1050 ARG B HH21 5  
ATOM 6312  H HH22 . ARG A 1 6  ? 10.611  -9.361  10.386  1.00 0.00 ? 1050 ARG B HH22 5  
ATOM 6313  N N    . PRO A 1 7  ? 2.857   -5.237  10.563  1.00 0.00 ? 1051 PRO B N    5  
ATOM 6314  C CA   . PRO A 1 7  ? 2.046   -5.681  11.725  1.00 0.00 ? 1051 PRO B CA   5  
ATOM 6315  C C    . PRO A 1 7  ? 1.718   -7.166  11.654  1.00 0.00 ? 1051 PRO B C    5  
ATOM 6316  O O    . PRO A 1 7  ? 1.729   -7.773  10.583  1.00 0.00 ? 1051 PRO B O    5  
ATOM 6317  C CB   . PRO A 1 7  ? 0.777   -4.838  11.624  1.00 0.00 ? 1051 PRO B CB   5  
ATOM 6318  C CG   . PRO A 1 7  ? 0.640   -4.534  10.175  1.00 0.00 ? 1051 PRO B CG   5  
ATOM 6319  C CD   . PRO A 1 7  ? 2.061   -4.436  9.628   1.00 0.00 ? 1051 PRO B CD   5  
ATOM 6320  H HA   . PRO A 1 7  ? 2.556   -5.455  12.646  1.00 0.00 ? 1051 PRO B HA   5  
ATOM 6321  H HB2  . PRO A 1 7  ? -0.077  -5.402  11.974  1.00 0.00 ? 1051 PRO B HB2  5  
ATOM 6322  H HB3  . PRO A 1 7  ? 0.884   -3.924  12.187  1.00 0.00 ? 1051 PRO B HB3  5  
ATOM 6323  H HG2  . PRO A 1 7  ? 0.098   -5.326  9.676   1.00 0.00 ? 1051 PRO B HG2  5  
ATOM 6324  H HG3  . PRO A 1 7  ? 0.134   -3.591  10.036  1.00 0.00 ? 1051 PRO B HG3  5  
ATOM 6325  H HD2  . PRO A 1 7  ? 2.110   -4.856  8.635   1.00 0.00 ? 1051 PRO B HD2  5  
ATOM 6326  H HD3  . PRO A 1 7  ? 2.399   -3.417  9.632   1.00 0.00 ? 1051 PRO B HD3  5  
ATOM 6327  N N    . LYS A 1 8  ? 1.418   -7.731  12.806  1.00 0.00 ? 1052 LYS B N    5  
ATOM 6328  C CA   . LYS A 1 8  ? 1.071   -9.142  12.894  1.00 0.00 ? 1052 LYS B CA   5  
ATOM 6329  C C    . LYS A 1 8  ? -0.395  -9.373  12.521  1.00 0.00 ? 1052 LYS B C    5  
ATOM 6330  O O    . LYS A 1 8  ? -0.857  -10.513 12.487  1.00 0.00 ? 1052 LYS B O    5  
ATOM 6331  C CB   . LYS A 1 8  ? 1.319   -9.630  14.316  1.00 0.00 ? 1052 LYS B CB   5  
ATOM 6332  C CG   . LYS A 1 8  ? 2.819   -9.597  14.603  1.00 0.00 ? 1052 LYS B CG   5  
ATOM 6333  C CD   . LYS A 1 8  ? 3.052   -9.998  16.056  1.00 0.00 ? 1052 LYS B CD   5  
ATOM 6334  C CE   . LYS A 1 8  ? 4.553   -10.010 16.353  1.00 0.00 ? 1052 LYS B CE   5  
ATOM 6335  N NZ   . LYS A 1 8  ? 5.103   -8.635  16.180  1.00 0.00 ? 1052 LYS B NZ   5  
ATOM 6336  H H    . LYS A 1 8  ? 1.424   -7.185  13.616  1.00 0.00 ? 1052 LYS B H    5  
ATOM 6337  H HA   . LYS A 1 8  ? 1.699   -9.704  12.218  1.00 0.00 ? 1052 LYS B HA   5  
ATOM 6338  H HB2  . LYS A 1 8  ? 0.803   -8.988  15.014  1.00 0.00 ? 1052 LYS B HB2  5  
ATOM 6339  H HB3  . LYS A 1 8  ? 0.957   -10.642 14.420  1.00 0.00 ? 1052 LYS B HB3  5  
ATOM 6340  H HG2  . LYS A 1 8  ? 3.325   -10.293 13.949  1.00 0.00 ? 1052 LYS B HG2  5  
ATOM 6341  H HG3  . LYS A 1 8  ? 3.198   -8.601  14.439  1.00 0.00 ? 1052 LYS B HG3  5  
ATOM 6342  H HD2  . LYS A 1 8  ? 2.562   -9.281  16.700  1.00 0.00 ? 1052 LYS B HD2  5  
ATOM 6343  H HD3  . LYS A 1 8  ? 2.643   -10.981 16.230  1.00 0.00 ? 1052 LYS B HD3  5  
ATOM 6344  H HE2  . LYS A 1 8  ? 4.716   -10.336 17.370  1.00 0.00 ? 1052 LYS B HE2  5  
ATOM 6345  H HE3  . LYS A 1 8  ? 5.050   -10.686 15.673  1.00 0.00 ? 1052 LYS B HE3  5  
ATOM 6346  H HZ1  . LYS A 1 8  ? 4.455   -7.946  16.609  1.00 0.00 ? 1052 LYS B HZ1  5  
ATOM 6347  H HZ2  . LYS A 1 8  ? 5.207   -8.431  15.166  1.00 0.00 ? 1052 LYS B HZ2  5  
ATOM 6348  H HZ3  . LYS A 1 8  ? 6.031   -8.572  16.644  1.00 0.00 ? 1052 LYS B HZ3  5  
ATOM 6349  N N    . MET A 1 9  ? -1.122  -8.290  12.248  1.00 0.00 ? 1053 MET B N    5  
ATOM 6350  C CA   . MET A 1 9  ? -2.527  -8.405  11.886  1.00 0.00 ? 1053 MET B CA   5  
ATOM 6351  C C    . MET A 1 9  ? -2.670  -9.154  10.566  1.00 0.00 ? 1053 MET B C    5  
ATOM 6352  O O    . MET A 1 9  ? -1.825  -9.034  9.680   1.00 0.00 ? 1053 MET B O    5  
ATOM 6353  C CB   . MET A 1 9  ? -3.150  -7.017  11.746  1.00 0.00 ? 1053 MET B CB   5  
ATOM 6354  C CG   . MET A 1 9  ? -2.951  -6.224  13.039  1.00 0.00 ? 1053 MET B CG   5  
ATOM 6355  S SD   . MET A 1 9  ? -4.229  -4.944  13.165  1.00 0.00 ? 1053 MET B SD   5  
ATOM 6356  C CE   . MET A 1 9  ? -4.254  -4.467  11.419  1.00 0.00 ? 1053 MET B CE   5  
ATOM 6357  H H    . MET A 1 9  ? -0.711  -7.402  12.290  1.00 0.00 ? 1053 MET B H    5  
ATOM 6358  H HA   . MET A 1 9  ? -3.046  -8.948  12.661  1.00 0.00 ? 1053 MET B HA   5  
ATOM 6359  H HB2  . MET A 1 9  ? -2.676  -6.495  10.928  1.00 0.00 ? 1053 MET B HB2  5  
ATOM 6360  H HB3  . MET A 1 9  ? -4.207  -7.115  11.546  1.00 0.00 ? 1053 MET B HB3  5  
ATOM 6361  H HG2  . MET A 1 9  ? -3.022  -6.890  13.886  1.00 0.00 ? 1053 MET B HG2  5  
ATOM 6362  H HG3  . MET A 1 9  ? -1.974  -5.759  13.028  1.00 0.00 ? 1053 MET B HG3  5  
ATOM 6363  H HE1  . MET A 1 9  ? -4.685  -3.482  11.316  1.00 0.00 ? 1053 MET B HE1  5  
ATOM 6364  H HE2  . MET A 1 9  ? -4.849  -5.171  10.859  1.00 0.00 ? 1053 MET B HE2  5  
ATOM 6365  H HE3  . MET A 1 9  ? -3.243  -4.464  11.036  1.00 0.00 ? 1053 MET B HE3  5  
ATOM 6366  N N    . THR A 1 10 ? -3.742  -9.926  10.445  1.00 0.00 ? 1054 THR B N    5  
ATOM 6367  C CA   . THR A 1 10 ? -3.990  -10.695 9.230   1.00 0.00 ? 1054 THR B CA   5  
ATOM 6368  C C    . THR A 1 10 ? -4.363  -9.759  8.082   1.00 0.00 ? 1054 THR B C    5  
ATOM 6369  O O    . THR A 1 10 ? -4.756  -8.618  8.309   1.00 0.00 ? 1054 THR B O    5  
ATOM 6370  C CB   . THR A 1 10 ? -5.121  -11.693 9.478   1.00 0.00 ? 1054 THR B CB   5  
ATOM 6371  O OG1  . THR A 1 10 ? -6.337  -10.987 9.665   1.00 0.00 ? 1054 THR B OG1  5  
ATOM 6372  C CG2  . THR A 1 10 ? -4.811  -12.515 10.727  1.00 0.00 ? 1054 THR B CG2  5  
ATOM 6373  H H    . THR A 1 10 ? -4.380  -9.981  11.188  1.00 0.00 ? 1054 THR B H    5  
ATOM 6374  H HA   . THR A 1 10 ? -3.094  -11.236 8.969   1.00 0.00 ? 1054 THR B HA   5  
ATOM 6375  H HB   . THR A 1 10 ? -5.216  -12.355 8.633   1.00 0.00 ? 1054 THR B HB   5  
ATOM 6376  H HG1  . THR A 1 10 ? -6.120  -10.062 9.808   1.00 0.00 ? 1054 THR B HG1  5  
ATOM 6377  H HG21 . THR A 1 10 ? -4.944  -13.564 10.510  1.00 0.00 ? 1054 THR B HG21 5  
ATOM 6378  H HG22 . THR A 1 10 ? -5.477  -12.224 11.525  1.00 0.00 ? 1054 THR B HG22 5  
ATOM 6379  H HG23 . THR A 1 10 ? -3.789  -12.338 11.028  1.00 0.00 ? 1054 THR B HG23 5  
ATOM 6380  N N    . PRO A 1 11 ? -4.247  -10.213 6.859   1.00 0.00 ? 1055 PRO B N    5  
ATOM 6381  C CA   . PRO A 1 11 ? -4.584  -9.380  5.666   1.00 0.00 ? 1055 PRO B CA   5  
ATOM 6382  C C    . PRO A 1 11 ? -5.960  -8.739  5.797   1.00 0.00 ? 1055 PRO B C    5  
ATOM 6383  O O    . PRO A 1 11 ? -6.141  -7.561  5.482   1.00 0.00 ? 1055 PRO B O    5  
ATOM 6384  C CB   . PRO A 1 11 ? -4.575  -10.395 4.521   1.00 0.00 ? 1055 PRO B CB   5  
ATOM 6385  C CG   . PRO A 1 11 ? -3.619  -11.448 4.956   1.00 0.00 ? 1055 PRO B CG   5  
ATOM 6386  C CD   . PRO A 1 11 ? -3.776  -11.556 6.469   1.00 0.00 ? 1055 PRO B CD   5  
ATOM 6387  H HA   . PRO A 1 11 ? -3.827  -8.632  5.497   1.00 0.00 ? 1055 PRO B HA   5  
ATOM 6388  H HB2  . PRO A 1 11 ? -5.565  -10.812 4.381   1.00 0.00 ? 1055 PRO B HB2  5  
ATOM 6389  H HB3  . PRO A 1 11 ? -4.228  -9.932  3.609   1.00 0.00 ? 1055 PRO B HB3  5  
ATOM 6390  H HG2  . PRO A 1 11 ? -3.870  -12.392 4.487   1.00 0.00 ? 1055 PRO B HG2  5  
ATOM 6391  H HG3  . PRO A 1 11 ? -2.610  -11.164 4.713   1.00 0.00 ? 1055 PRO B HG3  5  
ATOM 6392  H HD2  . PRO A 1 11 ? -4.505  -12.312 6.715   1.00 0.00 ? 1055 PRO B HD2  5  
ATOM 6393  H HD3  . PRO A 1 11 ? -2.825  -11.769 6.931   1.00 0.00 ? 1055 PRO B HD3  5  
ATOM 6394  N N    . GLU A 1 12 ? -6.926  -9.517  6.276   1.00 0.00 ? 1056 GLU B N    5  
ATOM 6395  C CA   . GLU A 1 12 ? -8.277  -9.003  6.453   1.00 0.00 ? 1056 GLU B CA   5  
ATOM 6396  C C    . GLU A 1 12 ? -8.307  -7.929  7.534   1.00 0.00 ? 1056 GLU B C    5  
ATOM 6397  O O    . GLU A 1 12 ? -8.983  -6.914  7.391   1.00 0.00 ? 1056 GLU B O    5  
ATOM 6398  C CB   . GLU A 1 12 ? -9.226  -10.141 6.836   1.00 0.00 ? 1056 GLU B CB   5  
ATOM 6399  C CG   . GLU A 1 12 ? -9.406  -11.082 5.642   1.00 0.00 ? 1056 GLU B CG   5  
ATOM 6400  C CD   . GLU A 1 12 ? -10.296 -12.257 6.033   1.00 0.00 ? 1056 GLU B CD   5  
ATOM 6401  O OE1  . GLU A 1 12 ? -10.595 -12.382 7.209   1.00 0.00 ? 1056 GLU B OE1  5  
ATOM 6402  O OE2  . GLU A 1 12 ? -10.664 -13.013 5.151   1.00 0.00 ? 1056 GLU B OE2  5  
ATOM 6403  H H    . GLU A 1 12 ? -6.725  -10.445 6.521   1.00 0.00 ? 1056 GLU B H    5  
ATOM 6404  H HA   . GLU A 1 12 ? -8.610  -8.573  5.522   1.00 0.00 ? 1056 GLU B HA   5  
ATOM 6405  H HB2  . GLU A 1 12 ? -8.814  -10.689 7.670   1.00 0.00 ? 1056 GLU B HB2  5  
ATOM 6406  H HB3  . GLU A 1 12 ? -10.186 -9.729  7.114   1.00 0.00 ? 1056 GLU B HB3  5  
ATOM 6407  H HG2  . GLU A 1 12 ? -9.861  -10.542 4.826   1.00 0.00 ? 1056 GLU B HG2  5  
ATOM 6408  H HG3  . GLU A 1 12 ? -8.440  -11.453 5.332   1.00 0.00 ? 1056 GLU B HG3  5  
ATOM 6409  N N    . GLN A 1 13 ? -7.566  -8.158  8.615   1.00 0.00 ? 1057 GLN B N    5  
ATOM 6410  C CA   . GLN A 1 13 ? -7.524  -7.195  9.711   1.00 0.00 ? 1057 GLN B CA   5  
ATOM 6411  C C    . GLN A 1 13 ? -6.948  -5.866  9.248   1.00 0.00 ? 1057 GLN B C    5  
ATOM 6412  O O    . GLN A 1 13 ? -7.461  -4.800  9.594   1.00 0.00 ? 1057 GLN B O    5  
ATOM 6413  C CB   . GLN A 1 13 ? -6.667  -7.753  10.848  1.00 0.00 ? 1057 GLN B CB   5  
ATOM 6414  C CG   . GLN A 1 13 ? -7.414  -8.898  11.523  1.00 0.00 ? 1057 GLN B CG   5  
ATOM 6415  C CD   . GLN A 1 13 ? -8.612  -8.355  12.290  1.00 0.00 ? 1057 GLN B CD   5  
ATOM 6416  O OE1  . GLN A 1 13 ? -9.758  -8.645  11.944  1.00 0.00 ? 1057 GLN B OE1  5  
ATOM 6417  N NE2  . GLN A 1 13 ? -8.412  -7.582  13.319  1.00 0.00 ? 1057 GLN B NE2  5  
ATOM 6418  H H    . GLN A 1 13 ? -7.043  -8.986  8.677   1.00 0.00 ? 1057 GLN B H    5  
ATOM 6419  H HA   . GLN A 1 13 ? -8.526  -7.037  10.078  1.00 0.00 ? 1057 GLN B HA   5  
ATOM 6420  H HB2  . GLN A 1 13 ? -5.730  -8.117  10.447  1.00 0.00 ? 1057 GLN B HB2  5  
ATOM 6421  H HB3  . GLN A 1 13 ? -6.472  -6.974  11.570  1.00 0.00 ? 1057 GLN B HB3  5  
ATOM 6422  H HG2  . GLN A 1 13 ? -7.759  -9.586  10.767  1.00 0.00 ? 1057 GLN B HG2  5  
ATOM 6423  H HG3  . GLN A 1 13 ? -6.752  -9.409  12.203  1.00 0.00 ? 1057 GLN B HG3  5  
ATOM 6424  H HE21 . GLN A 1 13 ? -7.497  -7.357  13.588  1.00 0.00 ? 1057 GLN B HE21 5  
ATOM 6425  H HE22 . GLN A 1 13 ? -9.173  -7.226  13.821  1.00 0.00 ? 1057 GLN B HE22 5  
ATOM 6426  N N    . MET A 1 14 ? -5.885  -5.930  8.455   1.00 0.00 ? 1058 MET B N    5  
ATOM 6427  C CA   . MET A 1 14 ? -5.271  -4.710  7.956   1.00 0.00 ? 1058 MET B CA   5  
ATOM 6428  C C    . MET A 1 14 ? -6.245  -3.970  7.052   1.00 0.00 ? 1058 MET B C    5  
ATOM 6429  O O    . MET A 1 14 ? -6.345  -2.743  7.098   1.00 0.00 ? 1058 MET B O    5  
ATOM 6430  C CB   . MET A 1 14 ? -3.983  -5.017  7.185   1.00 0.00 ? 1058 MET B CB   5  
ATOM 6431  C CG   . MET A 1 14 ? -2.911  -5.510  8.161   1.00 0.00 ? 1058 MET B CG   5  
ATOM 6432  S SD   . MET A 1 14 ? -1.281  -5.484  7.364   1.00 0.00 ? 1058 MET B SD   5  
ATOM 6433  C CE   . MET A 1 14 ? -1.512  -6.868  6.219   1.00 0.00 ? 1058 MET B CE   5  
ATOM 6434  H H    . MET A 1 14 ? -5.517  -6.803  8.200   1.00 0.00 ? 1058 MET B H    5  
ATOM 6435  H HA   . MET A 1 14 ? -5.029  -4.078  8.797   1.00 0.00 ? 1058 MET B HA   5  
ATOM 6436  H HB2  . MET A 1 14 ? -4.184  -5.781  6.449   1.00 0.00 ? 1058 MET B HB2  5  
ATOM 6437  H HB3  . MET A 1 14 ? -3.636  -4.123  6.692   1.00 0.00 ? 1058 MET B HB3  5  
ATOM 6438  H HG2  . MET A 1 14 ? -2.894  -4.870  9.026   1.00 0.00 ? 1058 MET B HG2  5  
ATOM 6439  H HG3  . MET A 1 14 ? -3.145  -6.521  8.468   1.00 0.00 ? 1058 MET B HG3  5  
ATOM 6440  H HE1  . MET A 1 14 ? -1.218  -7.788  6.705   1.00 0.00 ? 1058 MET B HE1  5  
ATOM 6441  H HE2  . MET A 1 14 ? -0.897  -6.715  5.345   1.00 0.00 ? 1058 MET B HE2  5  
ATOM 6442  H HE3  . MET A 1 14 ? -2.549  -6.924  5.922   1.00 0.00 ? 1058 MET B HE3  5  
ATOM 6443  N N    . ALA A 1 15 ? -6.967  -4.724  6.230   1.00 0.00 ? 1059 ALA B N    5  
ATOM 6444  C CA   . ALA A 1 15 ? -7.934  -4.120  5.323   1.00 0.00 ? 1059 ALA B CA   5  
ATOM 6445  C C    . ALA A 1 15 ? -9.038  -3.415  6.102   1.00 0.00 ? 1059 ALA B C    5  
ATOM 6446  O O    . ALA A 1 15 ? -9.476  -2.326  5.731   1.00 0.00 ? 1059 ALA B O    5  
ATOM 6447  C CB   . ALA A 1 15 ? -8.547  -5.184  4.415   1.00 0.00 ? 1059 ALA B CB   5  
ATOM 6448  H H    . ALA A 1 15 ? -6.851  -5.702  6.241   1.00 0.00 ? 1059 ALA B H    5  
ATOM 6449  H HA   . ALA A 1 15 ? -7.426  -3.392  4.708   1.00 0.00 ? 1059 ALA B HA   5  
ATOM 6450  H HB1  . ALA A 1 15 ? -7.883  -5.376  3.586   1.00 0.00 ? 1059 ALA B HB1  5  
ATOM 6451  H HB2  . ALA A 1 15 ? -9.496  -4.830  4.040   1.00 0.00 ? 1059 ALA B HB2  5  
ATOM 6452  H HB3  . ALA A 1 15 ? -8.698  -6.094  4.975   1.00 0.00 ? 1059 ALA B HB3  5  
ATOM 6453  N N    . LYS A 1 16 ? -9.486  -4.041  7.187   1.00 0.00 ? 1060 LYS B N    5  
ATOM 6454  C CA   . LYS A 1 16 ? -10.541 -3.455  8.003   1.00 0.00 ? 1060 LYS B CA   5  
ATOM 6455  C C    . LYS A 1 16 ? -10.096 -2.118  8.579   1.00 0.00 ? 1060 LYS B C    5  
ATOM 6456  O O    . LYS A 1 16 ? -10.865 -1.154  8.593   1.00 0.00 ? 1060 LYS B O    5  
ATOM 6457  C CB   . LYS A 1 16 ? -10.907 -4.404  9.145   1.00 0.00 ? 1060 LYS B CB   5  
ATOM 6458  C CG   . LYS A 1 16 ? -11.660 -5.614  8.587   1.00 0.00 ? 1060 LYS B CG   5  
ATOM 6459  C CD   . LYS A 1 16 ? -11.957 -6.594  9.723   1.00 0.00 ? 1060 LYS B CD   5  
ATOM 6460  C CE   . LYS A 1 16 ? -12.799 -7.755  9.191   1.00 0.00 ? 1060 LYS B CE   5  
ATOM 6461  N NZ   . LYS A 1 16 ? -12.033 -8.488  8.145   1.00 0.00 ? 1060 LYS B NZ   5  
ATOM 6462  H H    . LYS A 1 16 ? -9.104  -4.907  7.438   1.00 0.00 ? 1060 LYS B H    5  
ATOM 6463  H HA   . LYS A 1 16 ? -11.412 -3.298  7.389   1.00 0.00 ? 1060 LYS B HA   5  
ATOM 6464  H HB2  . LYS A 1 16 ? -10.005 -4.737  9.639   1.00 0.00 ? 1060 LYS B HB2  5  
ATOM 6465  H HB3  . LYS A 1 16 ? -11.536 -3.888  9.855   1.00 0.00 ? 1060 LYS B HB3  5  
ATOM 6466  H HG2  . LYS A 1 16 ? -12.587 -5.284  8.143   1.00 0.00 ? 1060 LYS B HG2  5  
ATOM 6467  H HG3  . LYS A 1 16 ? -11.059 -6.101  7.840   1.00 0.00 ? 1060 LYS B HG3  5  
ATOM 6468  H HD2  . LYS A 1 16 ? -11.028 -6.978  10.120  1.00 0.00 ? 1060 LYS B HD2  5  
ATOM 6469  H HD3  . LYS A 1 16 ? -12.500 -6.086  10.504  1.00 0.00 ? 1060 LYS B HD3  5  
ATOM 6470  H HE2  . LYS A 1 16 ? -13.036 -8.428  10.002  1.00 0.00 ? 1060 LYS B HE2  5  
ATOM 6471  H HE3  . LYS A 1 16 ? -13.715 -7.371  8.766   1.00 0.00 ? 1060 LYS B HE3  5  
ATOM 6472  H HZ1  . LYS A 1 16 ? -11.046 -8.595  8.448   1.00 0.00 ? 1060 LYS B HZ1  5  
ATOM 6473  H HZ2  . LYS A 1 16 ? -12.068 -7.954  7.253   1.00 0.00 ? 1060 LYS B HZ2  5  
ATOM 6474  H HZ3  . LYS A 1 16 ? -12.454 -9.429  8.002   1.00 0.00 ? 1060 LYS B HZ3  5  
ATOM 6475  N N    . GLU A 1 17 ? -8.852  -2.050  9.046   1.00 0.00 ? 1061 GLU B N    5  
ATOM 6476  C CA   . GLU A 1 17 ? -8.351  -0.804  9.607   1.00 0.00 ? 1061 GLU B CA   5  
ATOM 6477  C C    . GLU A 1 17 ? -8.314  0.287   8.539   1.00 0.00 ? 1061 GLU B C    5  
ATOM 6478  O O    . GLU A 1 17 ? -8.661  1.440   8.806   1.00 0.00 ? 1061 GLU B O    5  
ATOM 6479  C CB   . GLU A 1 17 ? -6.951  -1.014  10.184  1.00 0.00 ? 1061 GLU B CB   5  
ATOM 6480  C CG   . GLU A 1 17 ? -7.034  -1.885  11.441  1.00 0.00 ? 1061 GLU B CG   5  
ATOM 6481  C CD   . GLU A 1 17 ? -7.896  -1.209  12.502  1.00 0.00 ? 1061 GLU B CD   5  
ATOM 6482  O OE1  . GLU A 1 17 ? -7.664  -0.042  12.769  1.00 0.00 ? 1061 GLU B OE1  5  
ATOM 6483  O OE2  . GLU A 1 17 ? -8.772  -1.871  13.036  1.00 0.00 ? 1061 GLU B OE2  5  
ATOM 6484  H H    . GLU A 1 17 ? -8.268  -2.845  9.016   1.00 0.00 ? 1061 GLU B H    5  
ATOM 6485  H HA   . GLU A 1 17 ? -9.013  -0.488  10.397  1.00 0.00 ? 1061 GLU B HA   5  
ATOM 6486  H HB2  . GLU A 1 17 ? -6.330  -1.504  9.447   1.00 0.00 ? 1061 GLU B HB2  5  
ATOM 6487  H HB3  . GLU A 1 17 ? -6.519  -0.059  10.440  1.00 0.00 ? 1061 GLU B HB3  5  
ATOM 6488  H HG2  . GLU A 1 17 ? -7.466  -2.841  11.185  1.00 0.00 ? 1061 GLU B HG2  5  
ATOM 6489  H HG3  . GLU A 1 17 ? -6.043  -2.037  11.836  1.00 0.00 ? 1061 GLU B HG3  5  
ATOM 6490  N N    . MET A 1 18 ? -7.898  -0.078  7.328   1.00 0.00 ? 1062 MET B N    5  
ATOM 6491  C CA   . MET A 1 18 ? -7.828  0.890   6.243   1.00 0.00 ? 1062 MET B CA   5  
ATOM 6492  C C    . MET A 1 18 ? -9.219  1.418   5.912   1.00 0.00 ? 1062 MET B C    5  
ATOM 6493  O O    . MET A 1 18 ? -9.395  2.605   5.659   1.00 0.00 ? 1062 MET B O    5  
ATOM 6494  C CB   . MET A 1 18 ? -7.236  0.226   5.004   1.00 0.00 ? 1062 MET B CB   5  
ATOM 6495  C CG   . MET A 1 18 ? -5.789  -0.159  5.286   1.00 0.00 ? 1062 MET B CG   5  
ATOM 6496  S SD   . MET A 1 18 ? -5.170  -1.190  3.936   1.00 0.00 ? 1062 MET B SD   5  
ATOM 6497  C CE   . MET A 1 18 ? -3.974  -2.139  4.905   1.00 0.00 ? 1062 MET B CE   5  
ATOM 6498  H H    . MET A 1 18 ? -7.629  -1.009  7.161   1.00 0.00 ? 1062 MET B H    5  
ATOM 6499  H HA   . MET A 1 18 ? -7.195  1.713   6.540   1.00 0.00 ? 1062 MET B HA   5  
ATOM 6500  H HB2  . MET A 1 18 ? -7.807  -0.660  4.763   1.00 0.00 ? 1062 MET B HB2  5  
ATOM 6501  H HB3  . MET A 1 18 ? -7.269  0.915   4.173   1.00 0.00 ? 1062 MET B HB3  5  
ATOM 6502  H HG2  . MET A 1 18 ? -5.188  0.734   5.363   1.00 0.00 ? 1062 MET B HG2  5  
ATOM 6503  H HG3  . MET A 1 18 ? -5.741  -0.707  6.214   1.00 0.00 ? 1062 MET B HG3  5  
ATOM 6504  H HE1  . MET A 1 18 ? -4.082  -3.188  4.679   1.00 0.00 ? 1062 MET B HE1  5  
ATOM 6505  H HE2  . MET A 1 18 ? -4.153  -1.983  5.956   1.00 0.00 ? 1062 MET B HE2  5  
ATOM 6506  H HE3  . MET A 1 18 ? -2.972  -1.816  4.660   1.00 0.00 ? 1062 MET B HE3  5  
ATOM 6507  N N    . SER A 1 19 ? -10.205 0.527   5.919   1.00 0.00 ? 1063 SER B N    5  
ATOM 6508  C CA   . SER A 1 19 ? -11.572 0.927   5.611   1.00 0.00 ? 1063 SER B CA   5  
ATOM 6509  C C    . SER A 1 19 ? -12.066 1.952   6.620   1.00 0.00 ? 1063 SER B C    5  
ATOM 6510  O O    . SER A 1 19 ? -12.721 2.925   6.257   1.00 0.00 ? 1063 SER B O    5  
ATOM 6511  C CB   . SER A 1 19 ? -12.492 -0.293  5.628   1.00 0.00 ? 1063 SER B CB   5  
ATOM 6512  O OG   . SER A 1 19 ? -12.138 -1.162  4.560   1.00 0.00 ? 1063 SER B OG   5  
ATOM 6513  H H    . SER A 1 19 ? -10.011 -0.409  6.132   1.00 0.00 ? 1063 SER B H    5  
ATOM 6514  H HA   . SER A 1 19 ? -11.594 1.367   4.625   1.00 0.00 ? 1063 SER B HA   5  
ATOM 6515  H HB2  . SER A 1 19 ? -12.383 -0.815  6.563   1.00 0.00 ? 1063 SER B HB2  5  
ATOM 6516  H HB3  . SER A 1 19 ? -13.519 0.031   5.516   1.00 0.00 ? 1063 SER B HB3  5  
ATOM 6517  H HG   . SER A 1 19 ? -12.400 -0.743  3.738   1.00 0.00 ? 1063 SER B HG   5  
ATOM 6518  N N    . GLU A 1 20 ? -11.746 1.730   7.888   1.00 0.00 ? 1064 GLU B N    5  
ATOM 6519  C CA   . GLU A 1 20 ? -12.165 2.652   8.936   1.00 0.00 ? 1064 GLU B CA   5  
ATOM 6520  C C    . GLU A 1 20 ? -11.544 4.031   8.733   1.00 0.00 ? 1064 GLU B C    5  
ATOM 6521  O O    . GLU A 1 20 ? -12.217 5.057   8.883   1.00 0.00 ? 1064 GLU B O    5  
ATOM 6522  C CB   . GLU A 1 20 ? -11.738 2.108   10.295  1.00 0.00 ? 1064 GLU B CB   5  
ATOM 6523  C CG   . GLU A 1 20 ? -12.582 0.884   10.650  1.00 0.00 ? 1064 GLU B CG   5  
ATOM 6524  C CD   . GLU A 1 20 ? -12.047 0.239   11.922  1.00 0.00 ? 1064 GLU B CD   5  
ATOM 6525  O OE1  . GLU A 1 20 ? -10.952 0.594   12.328  1.00 0.00 ? 1064 GLU B OE1  5  
ATOM 6526  O OE2  . GLU A 1 20 ? -12.740 -0.599  12.475  1.00 0.00 ? 1064 GLU B OE2  5  
ATOM 6527  H H    . GLU A 1 20 ? -11.219 0.935   8.123   1.00 0.00 ? 1064 GLU B H    5  
ATOM 6528  H HA   . GLU A 1 20 ? -13.240 2.742   8.919   1.00 0.00 ? 1064 GLU B HA   5  
ATOM 6529  H HB2  . GLU A 1 20 ? -10.694 1.825   10.249  1.00 0.00 ? 1064 GLU B HB2  5  
ATOM 6530  H HB3  . GLU A 1 20 ? -11.873 2.869   11.049  1.00 0.00 ? 1064 GLU B HB3  5  
ATOM 6531  H HG2  . GLU A 1 20 ? -13.607 1.188   10.804  1.00 0.00 ? 1064 GLU B HG2  5  
ATOM 6532  H HG3  . GLU A 1 20 ? -12.536 0.171   9.840   1.00 0.00 ? 1064 GLU B HG3  5  
ATOM 6533  N N    . PHE A 1 21 ? -10.259 4.053   8.388   1.00 0.00 ? 1065 PHE B N    5  
ATOM 6534  C CA   . PHE A 1 21 ? -9.566  5.316   8.170   1.00 0.00 ? 1065 PHE B CA   5  
ATOM 6535  C C    . PHE A 1 21 ? -10.128 6.022   6.945   1.00 0.00 ? 1065 PHE B C    5  
ATOM 6536  O O    . PHE A 1 21 ? -10.309 7.238   6.936   1.00 0.00 ? 1065 PHE B O    5  
ATOM 6537  C CB   . PHE A 1 21 ? -8.068  5.070   7.981   1.00 0.00 ? 1065 PHE B CB   5  
ATOM 6538  C CG   . PHE A 1 21 ? -7.435  4.753   9.316   1.00 0.00 ? 1065 PHE B CG   5  
ATOM 6539  C CD1  . PHE A 1 21 ? -6.862  3.495   9.541   1.00 0.00 ? 1065 PHE B CD1  5  
ATOM 6540  C CD2  . PHE A 1 21 ? -7.427  5.715   10.331  1.00 0.00 ? 1065 PHE B CD2  5  
ATOM 6541  C CE1  . PHE A 1 21 ? -6.279  3.202   10.780  1.00 0.00 ? 1065 PHE B CE1  5  
ATOM 6542  C CE2  . PHE A 1 21 ? -6.845  5.423   11.571  1.00 0.00 ? 1065 PHE B CE2  5  
ATOM 6543  C CZ   . PHE A 1 21 ? -6.270  4.167   11.795  1.00 0.00 ? 1065 PHE B CZ   5  
ATOM 6544  H H    . PHE A 1 21 ? -9.772  3.207   8.276   1.00 0.00 ? 1065 PHE B H    5  
ATOM 6545  H HA   . PHE A 1 21 ? -9.709  5.948   9.033   1.00 0.00 ? 1065 PHE B HA   5  
ATOM 6546  H HB2  . PHE A 1 21 ? -7.920  4.239   7.306   1.00 0.00 ? 1065 PHE B HB2  5  
ATOM 6547  H HB3  . PHE A 1 21 ? -7.606  5.954   7.567   1.00 0.00 ? 1065 PHE B HB3  5  
ATOM 6548  H HD1  . PHE A 1 21 ? -6.868  2.752   8.758   1.00 0.00 ? 1065 PHE B HD1  5  
ATOM 6549  H HD2  . PHE A 1 21 ? -7.870  6.684   10.158  1.00 0.00 ? 1065 PHE B HD2  5  
ATOM 6550  H HE1  . PHE A 1 21 ? -5.837  2.233   10.954  1.00 0.00 ? 1065 PHE B HE1  5  
ATOM 6551  H HE2  . PHE A 1 21 ? -6.838  6.167   12.353  1.00 0.00 ? 1065 PHE B HE2  5  
ATOM 6552  H HZ   . PHE A 1 21 ? -5.821  3.940   12.751  1.00 0.00 ? 1065 PHE B HZ   5  
ATOM 6553  N N    . LEU A 1 22 ? -10.406 5.245   5.911   1.00 0.00 ? 1066 LEU B N    5  
ATOM 6554  C CA   . LEU A 1 22 ? -10.955 5.792   4.680   1.00 0.00 ? 1066 LEU B CA   5  
ATOM 6555  C C    . LEU A 1 22 ? -12.372 6.315   4.911   1.00 0.00 ? 1066 LEU B C    5  
ATOM 6556  O O    . LEU A 1 22 ? -12.763 7.343   4.357   1.00 0.00 ? 1066 LEU B O    5  
ATOM 6557  C CB   . LEU A 1 22 ? -10.967 4.709   3.604   1.00 0.00 ? 1066 LEU B CB   5  
ATOM 6558  C CG   . LEU A 1 22 ? -9.527  4.367   3.214   1.00 0.00 ? 1066 LEU B CG   5  
ATOM 6559  C CD1  . LEU A 1 22 ? -9.519  3.115   2.341   1.00 0.00 ? 1066 LEU B CD1  5  
ATOM 6560  C CD2  . LEU A 1 22 ? -8.912  5.530   2.435   1.00 0.00 ? 1066 LEU B CD2  5  
ATOM 6561  H H    . LEU A 1 22 ? -10.245 4.279   5.980   1.00 0.00 ? 1066 LEU B H    5  
ATOM 6562  H HA   . LEU A 1 22 ? -10.331 6.607   4.349   1.00 0.00 ? 1066 LEU B HA   5  
ATOM 6563  H HB2  . LEU A 1 22 ? -11.456 3.825   3.989   1.00 0.00 ? 1066 LEU B HB2  5  
ATOM 6564  H HB3  . LEU A 1 22 ? -11.498 5.067   2.736   1.00 0.00 ? 1066 LEU B HB3  5  
ATOM 6565  H HG   . LEU A 1 22 ? -8.946  4.189   4.104   1.00 0.00 ? 1066 LEU B HG   5  
ATOM 6566  H HD11 . LEU A 1 22 ? -8.723  3.186   1.614   1.00 0.00 ? 1066 LEU B HD11 5  
ATOM 6567  H HD12 . LEU A 1 22 ? -10.467 3.025   1.830   1.00 0.00 ? 1066 LEU B HD12 5  
ATOM 6568  H HD13 . LEU A 1 22 ? -9.362  2.246   2.964   1.00 0.00 ? 1066 LEU B HD13 5  
ATOM 6569  H HD21 . LEU A 1 22 ? -8.565  5.174   1.479   1.00 0.00 ? 1066 LEU B HD21 5  
ATOM 6570  H HD22 . LEU A 1 22 ? -8.082  5.932   2.993   1.00 0.00 ? 1066 LEU B HD22 5  
ATOM 6571  H HD23 . LEU A 1 22 ? -9.656  6.298   2.287   1.00 0.00 ? 1066 LEU B HD23 5  
ATOM 6572  N N    . SER A 1 23 ? -13.135 5.590   5.722   1.00 0.00 ? 1067 SER B N    5  
ATOM 6573  C CA   . SER A 1 23 ? -14.511 5.976   6.012   1.00 0.00 ? 1067 SER B CA   5  
ATOM 6574  C C    . SER A 1 23 ? -14.567 7.343   6.681   1.00 0.00 ? 1067 SER B C    5  
ATOM 6575  O O    . SER A 1 23 ? -15.379 8.190   6.311   1.00 0.00 ? 1067 SER B O    5  
ATOM 6576  C CB   . SER A 1 23 ? -15.153 4.940   6.935   1.00 0.00 ? 1067 SER B CB   5  
ATOM 6577  O OG   . SER A 1 23 ? -15.259 3.698   6.251   1.00 0.00 ? 1067 SER B OG   5  
ATOM 6578  H H    . SER A 1 23 ? -12.771 4.778   6.126   1.00 0.00 ? 1067 SER B H    5  
ATOM 6579  H HA   . SER A 1 23 ? -15.070 6.012   5.088   1.00 0.00 ? 1067 SER B HA   5  
ATOM 6580  H HB2  . SER A 1 23 ? -14.540 4.809   7.811   1.00 0.00 ? 1067 SER B HB2  5  
ATOM 6581  H HB3  . SER A 1 23 ? -16.134 5.284   7.234   1.00 0.00 ? 1067 SER B HB3  5  
ATOM 6582  H HG   . SER A 1 23 ? -16.034 3.738   5.686   1.00 0.00 ? 1067 SER B HG   5  
ATOM 6583  N N    . ARG A 1 24 ? -13.702 7.558   7.668   1.00 0.00 ? 1068 ARG B N    5  
ATOM 6584  C CA   . ARG A 1 24 ? -13.679 8.838   8.365   1.00 0.00 ? 1068 ARG B CA   5  
ATOM 6585  C C    . ARG A 1 24 ? -12.972 9.896   7.522   1.00 0.00 ? 1068 ARG B C    5  
ATOM 6586  O O    . ARG A 1 24 ? -13.261 11.088  7.630   1.00 0.00 ? 1068 ARG B O    5  
ATOM 6587  C CB   . ARG A 1 24 ? -12.979 8.694   9.720   1.00 0.00 ? 1068 ARG B CB   5  
ATOM 6588  C CG   . ARG A 1 24 ? -11.481 8.457   9.516   1.00 0.00 ? 1068 ARG B CG   5  
ATOM 6589  C CD   . ARG A 1 24 ? -10.800 8.341   10.875  1.00 0.00 ? 1068 ARG B CD   5  
ATOM 6590  N NE   . ARG A 1 24 ? -9.351  8.339   10.710  1.00 0.00 ? 1068 ARG B NE   5  
ATOM 6591  C CZ   . ARG A 1 24 ? -8.527  8.457   11.751  1.00 0.00 ? 1068 ARG B CZ   5  
ATOM 6592  N NH1  . ARG A 1 24 ? -8.998  8.569   12.969  1.00 0.00 ? 1068 ARG B NH1  5  
ATOM 6593  N NH2  . ARG A 1 24 ? -7.238  8.468   11.553  1.00 0.00 ? 1068 ARG B NH2  5  
ATOM 6594  H H    . ARG A 1 24 ? -13.071 6.849   7.928   1.00 0.00 ? 1068 ARG B H    5  
ATOM 6595  H HA   . ARG A 1 24 ? -14.697 9.158   8.536   1.00 0.00 ? 1068 ARG B HA   5  
ATOM 6596  H HB2  . ARG A 1 24 ? -13.125 9.597   10.295  1.00 0.00 ? 1068 ARG B HB2  5  
ATOM 6597  H HB3  . ARG A 1 24 ? -13.404 7.857   10.255  1.00 0.00 ? 1068 ARG B HB3  5  
ATOM 6598  H HG2  . ARG A 1 24 ? -11.336 7.542   8.962   1.00 0.00 ? 1068 ARG B HG2  5  
ATOM 6599  H HG3  . ARG A 1 24 ? -11.047 9.281   8.972   1.00 0.00 ? 1068 ARG B HG3  5  
ATOM 6600  H HD2  . ARG A 1 24 ? -11.088 9.177   11.493  1.00 0.00 ? 1068 ARG B HD2  5  
ATOM 6601  H HD3  . ARG A 1 24 ? -11.109 7.421   11.351  1.00 0.00 ? 1068 ARG B HD3  5  
ATOM 6602  H HE   . ARG A 1 24 ? -8.974  8.249   9.810   1.00 0.00 ? 1068 ARG B HE   5  
ATOM 6603  H HH11 . ARG A 1 24 ? -9.984  8.569   13.134  1.00 0.00 ? 1068 ARG B HH11 5  
ATOM 6604  H HH12 . ARG A 1 24 ? -8.368  8.659   13.739  1.00 0.00 ? 1068 ARG B HH12 5  
ATOM 6605  H HH21 . ARG A 1 24 ? -6.875  8.390   10.624  1.00 0.00 ? 1068 ARG B HH21 5  
ATOM 6606  H HH22 . ARG A 1 24 ? -6.614  8.558   12.327  1.00 0.00 ? 1068 ARG B HH22 5  
ATOM 6607  N N    . GLY A 1 25 ? -12.036 9.448   6.691   1.00 0.00 ? 1069 GLY B N    5  
ATOM 6608  C CA   . GLY A 1 25 ? -11.280 10.355  5.836   1.00 0.00 ? 1069 GLY B CA   5  
ATOM 6609  C C    . GLY A 1 25 ? -11.379 9.929   4.374   1.00 0.00 ? 1069 GLY B C    5  
ATOM 6610  O O    . GLY A 1 25 ? -10.457 9.321   3.834   1.00 0.00 ? 1069 GLY B O    5  
ATOM 6611  H H    . GLY A 1 25 ? -11.846 8.488   6.657   1.00 0.00 ? 1069 GLY B H    5  
ATOM 6612  H HA2  . GLY A 1 25 ? -11.666 11.357  5.949   1.00 0.00 ? 1069 GLY B HA2  5  
ATOM 6613  H HA3  . GLY A 1 25 ? -10.244 10.339  6.138   1.00 0.00 ? 1069 GLY B HA3  5  
ATOM 6614  N N    . PRO A 1 26 ? -12.474 10.231  3.732   1.00 0.00 ? 1070 PRO B N    5  
ATOM 6615  C CA   . PRO A 1 26 ? -12.700 9.868   2.298   1.00 0.00 ? 1070 PRO B CA   5  
ATOM 6616  C C    . PRO A 1 26 ? -11.570 10.352  1.395   1.00 0.00 ? 1070 PRO B C    5  
ATOM 6617  O O    . PRO A 1 26 ? -11.159 9.649   0.473   1.00 0.00 ? 1070 PRO B O    5  
ATOM 6618  C CB   . PRO A 1 26 ? -14.011 10.583  1.956   1.00 0.00 ? 1070 PRO B CB   5  
ATOM 6619  C CG   . PRO A 1 26 ? -14.719 10.721  3.259   1.00 0.00 ? 1070 PRO B CG   5  
ATOM 6620  C CD   . PRO A 1 26 ? -13.630 10.948  4.298   1.00 0.00 ? 1070 PRO B CD   5  
ATOM 6621  H HA   . PRO A 1 26 ? -12.832 8.805   2.198   1.00 0.00 ? 1070 PRO B HA   5  
ATOM 6622  H HB2  . PRO A 1 26 ? -13.805 11.555  1.529   1.00 0.00 ? 1070 PRO B HB2  5  
ATOM 6623  H HB3  . PRO A 1 26 ? -14.598 9.987   1.276   1.00 0.00 ? 1070 PRO B HB3  5  
ATOM 6624  H HG2  . PRO A 1 26 ? -15.392 11.566  3.227   1.00 0.00 ? 1070 PRO B HG2  5  
ATOM 6625  H HG3  . PRO A 1 26 ? -15.261 9.817   3.489   1.00 0.00 ? 1070 PRO B HG3  5  
ATOM 6626  H HD2  . PRO A 1 26 ? -13.417 12.003  4.400   1.00 0.00 ? 1070 PRO B HD2  5  
ATOM 6627  H HD3  . PRO A 1 26 ? -13.911 10.517  5.246   1.00 0.00 ? 1070 PRO B HD3  5  
ATOM 6628  N N    . ALA A 1 27 ? -11.073 11.553  1.671   1.00 0.00 ? 1071 ALA B N    5  
ATOM 6629  C CA   . ALA A 1 27 ? -9.987  12.124  0.878   1.00 0.00 ? 1071 ALA B CA   5  
ATOM 6630  C C    . ALA A 1 27 ? -10.280 11.998  -0.611  1.00 0.00 ? 1071 ALA B C    5  
ATOM 6631  O O    . ALA A 1 27 ? -9.667  11.189  -1.309  1.00 0.00 ? 1071 ALA B O    5  
ATOM 6632  C CB   . ALA A 1 27 ? -8.675  11.415  1.197   1.00 0.00 ? 1071 ALA B CB   5  
ATOM 6633  H H    . ALA A 1 27 ? -11.441 12.063  2.422   1.00 0.00 ? 1071 ALA B H    5  
ATOM 6634  H HA   . ALA A 1 27 ? -9.884  13.170  1.128   1.00 0.00 ? 1071 ALA B HA   5  
ATOM 6635  H HB1  . ALA A 1 27 ? -7.987  11.551  0.377   1.00 0.00 ? 1071 ALA B HB1  5  
ATOM 6636  H HB2  . ALA A 1 27 ? -8.860  10.362  1.341   1.00 0.00 ? 1071 ALA B HB2  5  
ATOM 6637  H HB3  . ALA A 1 27 ? -8.250  11.834  2.097   1.00 0.00 ? 1071 ALA B HB3  5  
ATOM 6638  N N    . VAL A 1 28 ? -11.216 12.804  -1.092  1.00 0.00 ? 1072 VAL B N    5  
ATOM 6639  C CA   . VAL A 1 28 ? -11.580 12.779  -2.500  1.00 0.00 ? 1072 VAL B CA   5  
ATOM 6640  C C    . VAL A 1 28 ? -11.324 14.140  -3.132  1.00 0.00 ? 1072 VAL B C    5  
ATOM 6641  O O    . VAL A 1 28 ? -12.203 14.999  -3.163  1.00 0.00 ? 1072 VAL B O    5  
ATOM 6642  C CB   . VAL A 1 28 ? -13.060 12.417  -2.644  1.00 0.00 ? 1072 VAL B CB   5  
ATOM 6643  C CG1  . VAL A 1 28 ? -13.442 12.395  -4.125  1.00 0.00 ? 1072 VAL B CG1  5  
ATOM 6644  C CG2  . VAL A 1 28 ? -13.307 11.034  -2.034  1.00 0.00 ? 1072 VAL B CG2  5  
ATOM 6645  H H    . VAL A 1 28 ? -11.661 13.430  -0.493  1.00 0.00 ? 1072 VAL B H    5  
ATOM 6646  H HA   . VAL A 1 28 ? -10.985 12.034  -3.007  1.00 0.00 ? 1072 VAL B HA   5  
ATOM 6647  H HB   . VAL A 1 28 ? -13.661 13.152  -2.129  1.00 0.00 ? 1072 VAL B HB   5  
ATOM 6648  H HG11 . VAL A 1 28 ? -13.931 13.323  -4.384  1.00 0.00 ? 1072 VAL B HG11 5  
ATOM 6649  H HG12 . VAL A 1 28 ? -14.113 11.570  -4.312  1.00 0.00 ? 1072 VAL B HG12 5  
ATOM 6650  H HG13 . VAL A 1 28 ? -12.553 12.278  -4.725  1.00 0.00 ? 1072 VAL B HG13 5  
ATOM 6651  H HG21 . VAL A 1 28 ? -14.018 11.121  -1.225  1.00 0.00 ? 1072 VAL B HG21 5  
ATOM 6652  H HG22 . VAL A 1 28 ? -12.378 10.636  -1.657  1.00 0.00 ? 1072 VAL B HG22 5  
ATOM 6653  H HG23 . VAL A 1 28 ? -13.702 10.373  -2.791  1.00 0.00 ? 1072 VAL B HG23 5  
ATOM 6654  N N    . LEU A 1 29 ? -10.114 14.320  -3.645  1.00 0.00 ? 1073 LEU B N    5  
ATOM 6655  C CA   . LEU A 1 29 ? -9.745  15.572  -4.287  1.00 0.00 ? 1073 LEU B CA   5  
ATOM 6656  C C    . LEU A 1 29 ? -10.574 15.789  -5.546  1.00 0.00 ? 1073 LEU B C    5  
ATOM 6657  O O    . LEU A 1 29 ? -10.972 16.912  -5.858  1.00 0.00 ? 1073 LEU B O    5  
ATOM 6658  C CB   . LEU A 1 29 ? -8.258  15.555  -4.639  1.00 0.00 ? 1073 LEU B CB   5  
ATOM 6659  C CG   . LEU A 1 29 ? -7.421  15.636  -3.358  1.00 0.00 ? 1073 LEU B CG   5  
ATOM 6660  C CD1  . LEU A 1 29 ? -5.953  15.368  -3.690  1.00 0.00 ? 1073 LEU B CD1  5  
ATOM 6661  C CD2  . LEU A 1 29 ? -7.553  17.035  -2.750  1.00 0.00 ? 1073 LEU B CD2  5  
ATOM 6662  H H    . LEU A 1 29 ? -9.459  13.594  -3.596  1.00 0.00 ? 1073 LEU B H    5  
ATOM 6663  H HA   . LEU A 1 29 ? -9.934  16.386  -3.604  1.00 0.00 ? 1073 LEU B HA   5  
ATOM 6664  H HB2  . LEU A 1 29 ? -8.026  14.638  -5.160  1.00 0.00 ? 1073 LEU B HB2  5  
ATOM 6665  H HB3  . LEU A 1 29 ? -8.026  16.397  -5.271  1.00 0.00 ? 1073 LEU B HB3  5  
ATOM 6666  H HG   . LEU A 1 29 ? -7.773  14.898  -2.652  1.00 0.00 ? 1073 LEU B HG   5  
ATOM 6667  H HD11 . LEU A 1 29 ? -5.389  16.283  -3.593  1.00 0.00 ? 1073 LEU B HD11 5  
ATOM 6668  H HD12 . LEU A 1 29 ? -5.874  15.002  -4.702  1.00 0.00 ? 1073 LEU B HD12 5  
ATOM 6669  H HD13 . LEU A 1 29 ? -5.559  14.630  -3.007  1.00 0.00 ? 1073 LEU B HD13 5  
ATOM 6670  H HD21 . LEU A 1 29 ? -7.584  17.770  -3.540  1.00 0.00 ? 1073 LEU B HD21 5  
ATOM 6671  H HD22 . LEU A 1 29 ? -6.705  17.230  -2.110  1.00 0.00 ? 1073 LEU B HD22 5  
ATOM 6672  H HD23 . LEU A 1 29 ? -8.463  17.091  -2.170  1.00 0.00 ? 1073 LEU B HD23 5  
ATOM 6673  N N    . ALA A 1 30 ? -10.825 14.703  -6.268  1.00 0.00 ? 1074 ALA B N    5  
ATOM 6674  C CA   . ALA A 1 30 ? -11.604 14.781  -7.500  1.00 0.00 ? 1074 ALA B CA   5  
ATOM 6675  C C    . ALA A 1 30 ? -10.886 15.645  -8.532  1.00 0.00 ? 1074 ALA B C    5  
ATOM 6676  O O    . ALA A 1 30 ? -11.512 16.438  -9.235  1.00 0.00 ? 1074 ALA B O    5  
ATOM 6677  C CB   . ALA A 1 30 ? -12.986 15.368  -7.209  1.00 0.00 ? 1074 ALA B CB   5  
ATOM 6678  H H    . ALA A 1 30 ? -10.480 13.836  -5.969  1.00 0.00 ? 1074 ALA B H    5  
ATOM 6679  H HA   . ALA A 1 30 ? -11.725 13.785  -7.901  1.00 0.00 ? 1074 ALA B HA   5  
ATOM 6680  H HB1  . ALA A 1 30 ? -12.985 16.423  -7.446  1.00 0.00 ? 1074 ALA B HB1  5  
ATOM 6681  H HB2  . ALA A 1 30 ? -13.221 15.234  -6.164  1.00 0.00 ? 1074 ALA B HB2  5  
ATOM 6682  H HB3  . ALA A 1 30 ? -13.726 14.864  -7.812  1.00 0.00 ? 1074 ALA B HB3  5  
ATOM 6683  N N    . THR A 1 31 ? -9.570  15.483  -8.615  1.00 0.00 ? 1075 THR B N    5  
ATOM 6684  C CA   . THR A 1 31 ? -8.774  16.250  -9.564  1.00 0.00 ? 1075 THR B CA   5  
ATOM 6685  C C    . THR A 1 31 ? -7.547  15.462  -10.000 1.00 0.00 ? 1075 THR B C    5  
ATOM 6686  O O    . THR A 1 31 ? -7.284  14.370  -9.498  1.00 0.00 ? 1075 THR B O    5  
ATOM 6687  C CB   . THR A 1 31 ? -8.328  17.572  -8.937  1.00 0.00 ? 1075 THR B CB   5  
ATOM 6688  O OG1  . THR A 1 31 ? -7.677  18.366  -9.918  1.00 0.00 ? 1075 THR B OG1  5  
ATOM 6689  C CG2  . THR A 1 31 ? -7.371  17.294  -7.776  1.00 0.00 ? 1075 THR B CG2  5  
ATOM 6690  H H    . THR A 1 31 ? -9.127  14.835  -8.029  1.00 0.00 ? 1075 THR B H    5  
ATOM 6691  H HA   . THR A 1 31 ? -9.377  16.467  -10.432 1.00 0.00 ? 1075 THR B HA   5  
ATOM 6692  H HB   . THR A 1 31 ? -9.190  18.098  -8.567  1.00 0.00 ? 1075 THR B HB   5  
ATOM 6693  H HG1  . THR A 1 31 ? -7.343  19.156  -9.484  1.00 0.00 ? 1075 THR B HG1  5  
ATOM 6694  H HG21 . THR A 1 31 ? -7.590  16.324  -7.353  1.00 0.00 ? 1075 THR B HG21 5  
ATOM 6695  H HG22 . THR A 1 31 ? -7.494  18.054  -7.018  1.00 0.00 ? 1075 THR B HG22 5  
ATOM 6696  H HG23 . THR A 1 31 ? -6.354  17.308  -8.139  1.00 0.00 ? 1075 THR B HG23 5  
ATOM 6697  N N    . LYS A 1 32 ? -6.799  16.028  -10.936 1.00 0.00 ? 1076 LYS B N    5  
ATOM 6698  C CA   . LYS A 1 32 ? -5.595  15.376  -11.438 1.00 0.00 ? 1076 LYS B CA   5  
ATOM 6699  C C    . LYS A 1 32 ? -4.562  15.221  -10.327 1.00 0.00 ? 1076 LYS B C    5  
ATOM 6700  O O    . LYS A 1 32 ? -3.891  14.195  -10.229 1.00 0.00 ? 1076 LYS B O    5  
ATOM 6701  C CB   . LYS A 1 32 ? -4.997  16.193  -12.588 1.00 0.00 ? 1076 LYS B CB   5  
ATOM 6702  C CG   . LYS A 1 32 ? -5.923  16.142  -13.810 1.00 0.00 ? 1076 LYS B CG   5  
ATOM 6703  C CD   . LYS A 1 32 ? -5.899  14.740  -14.431 1.00 0.00 ? 1076 LYS B CD   5  
ATOM 6704  C CE   . LYS A 1 32 ? -6.741  14.732  -15.707 1.00 0.00 ? 1076 LYS B CE   5  
ATOM 6705  N NZ   . LYS A 1 32 ? -6.702  13.373  -16.318 1.00 0.00 ? 1076 LYS B NZ   5  
ATOM 6706  H H    . LYS A 1 32 ? -7.061  16.903  -11.292 1.00 0.00 ? 1076 LYS B H    5  
ATOM 6707  H HA   . LYS A 1 32 ? -5.855  14.398  -11.802 1.00 0.00 ? 1076 LYS B HA   5  
ATOM 6708  H HB2  . LYS A 1 32 ? -4.877  17.218  -12.272 1.00 0.00 ? 1076 LYS B HB2  5  
ATOM 6709  H HB3  . LYS A 1 32 ? -4.034  15.784  -12.854 1.00 0.00 ? 1076 LYS B HB3  5  
ATOM 6710  H HG2  . LYS A 1 32 ? -6.931  16.382  -13.505 1.00 0.00 ? 1076 LYS B HG2  5  
ATOM 6711  H HG3  . LYS A 1 32 ? -5.588  16.861  -14.543 1.00 0.00 ? 1076 LYS B HG3  5  
ATOM 6712  H HD2  . LYS A 1 32 ? -4.881  14.468  -14.669 1.00 0.00 ? 1076 LYS B HD2  5  
ATOM 6713  H HD3  . LYS A 1 32 ? -6.307  14.026  -13.736 1.00 0.00 ? 1076 LYS B HD3  5  
ATOM 6714  H HE2  . LYS A 1 32 ? -7.762  14.990  -15.466 1.00 0.00 ? 1076 LYS B HE2  5  
ATOM 6715  H HE3  . LYS A 1 32 ? -6.343  15.453  -16.405 1.00 0.00 ? 1076 LYS B HE3  5  
ATOM 6716  H HZ1  . LYS A 1 32 ? -5.779  12.934  -16.131 1.00 0.00 ? 1076 LYS B HZ1  5  
ATOM 6717  H HZ2  . LYS A 1 32 ? -6.847  13.452  -17.346 1.00 0.00 ? 1076 LYS B HZ2  5  
ATOM 6718  H HZ3  . LYS A 1 32 ? -7.453  12.785  -15.904 1.00 0.00 ? 1076 LYS B HZ3  5  
ATOM 6719  N N    . ALA A 1 33 ? -4.446  16.244  -9.488  1.00 0.00 ? 1077 ALA B N    5  
ATOM 6720  C CA   . ALA A 1 33 ? -3.495  16.208  -8.382  1.00 0.00 ? 1077 ALA B CA   5  
ATOM 6721  C C    . ALA A 1 33 ? -2.104  15.822  -8.878  1.00 0.00 ? 1077 ALA B C    5  
ATOM 6722  O O    . ALA A 1 33 ? -1.375  15.097  -8.204  1.00 0.00 ? 1077 ALA B O    5  
ATOM 6723  C CB   . ALA A 1 33 ? -3.960  15.201  -7.330  1.00 0.00 ? 1077 ALA B CB   5  
ATOM 6724  H H    . ALA A 1 33 ? -5.011  17.034  -9.613  1.00 0.00 ? 1077 ALA B H    5  
ATOM 6725  H HA   . ALA A 1 33 ? -3.446  17.187  -7.930  1.00 0.00 ? 1077 ALA B HA   5  
ATOM 6726  H HB1  . ALA A 1 33 ? -3.732  15.578  -6.343  1.00 0.00 ? 1077 ALA B HB1  5  
ATOM 6727  H HB2  . ALA A 1 33 ? -3.453  14.261  -7.483  1.00 0.00 ? 1077 ALA B HB2  5  
ATOM 6728  H HB3  . ALA A 1 33 ? -5.027  15.053  -7.422  1.00 0.00 ? 1077 ALA B HB3  5  
ATOM 6729  N N    . ALA A 1 34 ? -1.744  16.310  -10.062 1.00 0.00 ? 1078 ALA B N    5  
ATOM 6730  C CA   . ALA A 1 34 ? -0.436  16.006  -10.635 1.00 0.00 ? 1078 ALA B CA   5  
ATOM 6731  C C    . ALA A 1 34 ? 0.679   16.529  -9.731  1.00 0.00 ? 1078 ALA B C    5  
ATOM 6732  O O    . ALA A 1 34 ? 1.699   15.866  -9.524  1.00 0.00 ? 1078 ALA B O    5  
ATOM 6733  C CB   . ALA A 1 34 ? -0.314  16.643  -12.021 1.00 0.00 ? 1078 ALA B CB   5  
ATOM 6734  H H    . ALA A 1 34 ? -2.365  16.883  -10.557 1.00 0.00 ? 1078 ALA B H    5  
ATOM 6735  H HA   . ALA A 1 34 ? -0.338  14.936  -10.733 1.00 0.00 ? 1078 ALA B HA   5  
ATOM 6736  H HB1  . ALA A 1 34 ? 0.548   16.239  -12.528 1.00 0.00 ? 1078 ALA B HB1  5  
ATOM 6737  H HB2  . ALA A 1 34 ? -0.203  17.713  -11.916 1.00 0.00 ? 1078 ALA B HB2  5  
ATOM 6738  H HB3  . ALA A 1 34 ? -1.204  16.429  -12.594 1.00 0.00 ? 1078 ALA B HB3  5  
ATOM 6739  N N    . ALA A 1 35 ? 0.479   17.720  -9.187  1.00 0.00 ? 1079 ALA B N    5  
ATOM 6740  C CA   . ALA A 1 35 ? 1.476   18.307  -8.308  1.00 0.00 ? 1079 ALA B CA   5  
ATOM 6741  C C    . ALA A 1 35 ? 1.482   17.583  -6.966  1.00 0.00 ? 1079 ALA B C    5  
ATOM 6742  O O    . ALA A 1 35 ? 0.467   17.536  -6.270  1.00 0.00 ? 1079 ALA B O    5  
ATOM 6743  C CB   . ALA A 1 35 ? 1.178   19.792  -8.095  1.00 0.00 ? 1079 ALA B CB   5  
ATOM 6744  H H    . ALA A 1 35 ? -0.350  18.208  -9.377  1.00 0.00 ? 1079 ALA B H    5  
ATOM 6745  H HA   . ALA A 1 35 ? 2.450   18.206  -8.765  1.00 0.00 ? 1079 ALA B HA   5  
ATOM 6746  H HB1  . ALA A 1 35 ? 1.750   20.378  -8.798  1.00 0.00 ? 1079 ALA B HB1  5  
ATOM 6747  H HB2  . ALA A 1 35 ? 1.449   20.071  -7.087  1.00 0.00 ? 1079 ALA B HB2  5  
ATOM 6748  H HB3  . ALA A 1 35 ? 0.125   19.972  -8.247  1.00 0.00 ? 1079 ALA B HB3  5  
ATOM 6749  N N    . GLY A 1 36 ? 2.629   17.014  -6.613  1.00 0.00 ? 1080 GLY B N    5  
ATOM 6750  C CA   . GLY A 1 36 ? 2.756   16.288  -5.359  1.00 0.00 ? 1080 GLY B CA   5  
ATOM 6751  C C    . GLY A 1 36 ? 2.633   14.782  -5.576  1.00 0.00 ? 1080 GLY B C    5  
ATOM 6752  O O    . GLY A 1 36 ? 2.604   14.012  -4.619  1.00 0.00 ? 1080 GLY B O    5  
ATOM 6753  H H    . GLY A 1 36 ? 3.401   17.074  -7.214  1.00 0.00 ? 1080 GLY B H    5  
ATOM 6754  H HA2  . GLY A 1 36 ? 3.719   16.507  -4.920  1.00 0.00 ? 1080 GLY B HA2  5  
ATOM 6755  H HA3  . GLY A 1 36 ? 1.978   16.610  -4.684  1.00 0.00 ? 1080 GLY B HA3  5  
ATOM 6756  N N    . THR A 1 37 ? 2.575   14.356  -6.836  1.00 0.00 ? 1081 THR B N    5  
ATOM 6757  C CA   . THR A 1 37 ? 2.468   12.937  -7.135  1.00 0.00 ? 1081 THR B CA   5  
ATOM 6758  C C    . THR A 1 37 ? 3.682   12.177  -6.612  1.00 0.00 ? 1081 THR B C    5  
ATOM 6759  O O    . THR A 1 37 ? 3.600   10.982  -6.326  1.00 0.00 ? 1081 THR B O    5  
ATOM 6760  C CB   . THR A 1 37 ? 2.347   12.743  -8.646  1.00 0.00 ? 1081 THR B CB   5  
ATOM 6761  O OG1  . THR A 1 37 ? 3.355   13.499  -9.305  1.00 0.00 ? 1081 THR B OG1  5  
ATOM 6762  C CG2  . THR A 1 37 ? 0.961   13.184  -9.114  1.00 0.00 ? 1081 THR B CG2  5  
ATOM 6763  H H    . THR A 1 37 ? 2.610   15.001  -7.576  1.00 0.00 ? 1081 THR B H    5  
ATOM 6764  H HA   . THR A 1 37 ? 1.581   12.546  -6.665  1.00 0.00 ? 1081 THR B HA   5  
ATOM 6765  H HB   . THR A 1 37 ? 2.481   11.705  -8.877  1.00 0.00 ? 1081 THR B HB   5  
ATOM 6766  H HG1  . THR A 1 37 ? 3.685   12.977  -10.039 1.00 0.00 ? 1081 THR B HG1  5  
ATOM 6767  H HG21 . THR A 1 37 ? 0.994   13.419  -10.168 1.00 0.00 ? 1081 THR B HG21 5  
ATOM 6768  H HG22 . THR A 1 37 ? 0.653   14.058  -8.560  1.00 0.00 ? 1081 THR B HG22 5  
ATOM 6769  H HG23 . THR A 1 37 ? 0.254   12.385  -8.945  1.00 0.00 ? 1081 THR B HG23 5  
ATOM 6770  N N    . LYS A 1 38 ? 4.803   12.876  -6.484  1.00 0.00 ? 1082 LYS B N    5  
ATOM 6771  C CA   . LYS A 1 38 ? 6.031   12.260  -5.996  1.00 0.00 ? 1082 LYS B CA   5  
ATOM 6772  C C    . LYS A 1 38 ? 5.849   11.722  -4.579  1.00 0.00 ? 1082 LYS B C    5  
ATOM 6773  O O    . LYS A 1 38 ? 6.315   10.630  -4.257  1.00 0.00 ? 1082 LYS B O    5  
ATOM 6774  C CB   . LYS A 1 38 ? 7.154   13.295  -6.005  1.00 0.00 ? 1082 LYS B CB   5  
ATOM 6775  C CG   . LYS A 1 38 ? 7.568   13.589  -7.449  1.00 0.00 ? 1082 LYS B CG   5  
ATOM 6776  C CD   . LYS A 1 38 ? 8.783   14.521  -7.454  1.00 0.00 ? 1082 LYS B CD   5  
ATOM 6777  C CE   . LYS A 1 38 ? 8.363   15.910  -6.970  1.00 0.00 ? 1082 LYS B CE   5  
ATOM 6778  N NZ   . LYS A 1 38 ? 9.520   16.844  -7.073  1.00 0.00 ? 1082 LYS B NZ   5  
ATOM 6779  H H    . LYS A 1 38 ? 4.806   13.827  -6.728  1.00 0.00 ? 1082 LYS B H    5  
ATOM 6780  H HA   . LYS A 1 38 ? 6.300   11.446  -6.650  1.00 0.00 ? 1082 LYS B HA   5  
ATOM 6781  H HB2  . LYS A 1 38 ? 6.800   14.204  -5.539  1.00 0.00 ? 1082 LYS B HB2  5  
ATOM 6782  H HB3  . LYS A 1 38 ? 8.003   12.913  -5.459  1.00 0.00 ? 1082 LYS B HB3  5  
ATOM 6783  H HG2  . LYS A 1 38 ? 7.821   12.664  -7.946  1.00 0.00 ? 1082 LYS B HG2  5  
ATOM 6784  H HG3  . LYS A 1 38 ? 6.751   14.065  -7.968  1.00 0.00 ? 1082 LYS B HG3  5  
ATOM 6785  H HD2  . LYS A 1 38 ? 9.542   14.123  -6.796  1.00 0.00 ? 1082 LYS B HD2  5  
ATOM 6786  H HD3  . LYS A 1 38 ? 9.177   14.595  -8.457  1.00 0.00 ? 1082 LYS B HD3  5  
ATOM 6787  H HE2  . LYS A 1 38 ? 7.552   16.276  -7.581  1.00 0.00 ? 1082 LYS B HE2  5  
ATOM 6788  H HE3  . LYS A 1 38 ? 8.041   15.851  -5.942  1.00 0.00 ? 1082 LYS B HE3  5  
ATOM 6789  H HZ1  . LYS A 1 38 ? 10.359  16.409  -6.639  1.00 0.00 ? 1082 LYS B HZ1  5  
ATOM 6790  H HZ2  . LYS A 1 38 ? 9.295   17.731  -6.577  1.00 0.00 ? 1082 LYS B HZ2  5  
ATOM 6791  H HZ3  . LYS A 1 38 ? 9.716   17.046  -8.073  1.00 0.00 ? 1082 LYS B HZ3  5  
ATOM 6792  N N    . LYS A 1 39 ? 5.171   12.495  -3.739  1.00 0.00 ? 1083 LYS B N    5  
ATOM 6793  C CA   . LYS A 1 39 ? 4.932   12.091  -2.356  1.00 0.00 ? 1083 LYS B CA   5  
ATOM 6794  C C    . LYS A 1 39 ? 3.734   11.152  -2.280  1.00 0.00 ? 1083 LYS B C    5  
ATOM 6795  O O    . LYS A 1 39 ? 3.606   10.356  -1.350  1.00 0.00 ? 1083 LYS B O    5  
ATOM 6796  C CB   . LYS A 1 39 ? 4.644   13.330  -1.520  1.00 0.00 ? 1083 LYS B CB   5  
ATOM 6797  C CG   . LYS A 1 39 ? 5.837   14.275  -1.606  1.00 0.00 ? 1083 LYS B CG   5  
ATOM 6798  C CD   . LYS A 1 39 ? 5.481   15.593  -0.931  1.00 0.00 ? 1083 LYS B CD   5  
ATOM 6799  C CE   . LYS A 1 39 ? 6.578   16.605  -1.233  1.00 0.00 ? 1083 LYS B CE   5  
ATOM 6800  N NZ   . LYS A 1 39 ? 6.239   17.916  -0.610  1.00 0.00 ? 1083 LYS B NZ   5  
ATOM 6801  H H    . LYS A 1 39 ? 4.826   13.358  -4.052  1.00 0.00 ? 1083 LYS B H    5  
ATOM 6802  H HA   . LYS A 1 39 ? 5.805   11.594  -1.967  1.00 0.00 ? 1083 LYS B HA   5  
ATOM 6803  H HB2  . LYS A 1 39 ? 3.760   13.825  -1.899  1.00 0.00 ? 1083 LYS B HB2  5  
ATOM 6804  H HB3  . LYS A 1 39 ? 4.487   13.044  -0.491  1.00 0.00 ? 1083 LYS B HB3  5  
ATOM 6805  H HG2  . LYS A 1 39 ? 6.685   13.831  -1.106  1.00 0.00 ? 1083 LYS B HG2  5  
ATOM 6806  H HG3  . LYS A 1 39 ? 6.084   14.460  -2.640  1.00 0.00 ? 1083 LYS B HG3  5  
ATOM 6807  H HD2  . LYS A 1 39 ? 4.539   15.950  -1.319  1.00 0.00 ? 1083 LYS B HD2  5  
ATOM 6808  H HD3  . LYS A 1 39 ? 5.407   15.447  0.135   1.00 0.00 ? 1083 LYS B HD3  5  
ATOM 6809  H HE2  . LYS A 1 39 ? 7.515   16.246  -0.838  1.00 0.00 ? 1083 LYS B HE2  5  
ATOM 6810  H HE3  . LYS A 1 39 ? 6.659   16.722  -2.304  1.00 0.00 ? 1083 LYS B HE3  5  
ATOM 6811  H HZ1  . LYS A 1 39 ? 5.918   18.576  -1.346  1.00 0.00 ? 1083 LYS B HZ1  5  
ATOM 6812  H HZ2  . LYS A 1 39 ? 7.081   18.303  -0.137  1.00 0.00 ? 1083 LYS B HZ2  5  
ATOM 6813  H HZ3  . LYS A 1 39 ? 5.479   17.783  0.088   1.00 0.00 ? 1083 LYS B HZ3  5  
ATOM 6814  N N    . TYR A 1 40 ? 2.854   11.271  -3.264  1.00 0.00 ? 1084 TYR B N    5  
ATOM 6815  C CA   . TYR A 1 40 ? 1.645   10.448  -3.318  1.00 0.00 ? 1084 TYR B CA   5  
ATOM 6816  C C    . TYR A 1 40 ? 2.013   8.984   -3.482  1.00 0.00 ? 1084 TYR B C    5  
ATOM 6817  O O    . TYR A 1 40 ? 1.325   8.097   -2.977  1.00 0.00 ? 1084 TYR B O    5  
ATOM 6818  C CB   . TYR A 1 40 ? 0.759   10.891  -4.485  1.00 0.00 ? 1084 TYR B CB   5  
ATOM 6819  C CG   . TYR A 1 40 ? 0.209   12.287  -4.243  1.00 0.00 ? 1084 TYR B CG   5  
ATOM 6820  C CD1  . TYR A 1 40 ? 0.496   12.986  -3.057  1.00 0.00 ? 1084 TYR B CD1  5  
ATOM 6821  C CD2  . TYR A 1 40 ? -0.582  12.893  -5.227  1.00 0.00 ? 1084 TYR B CD2  5  
ATOM 6822  C CE1  . TYR A 1 40 ? -0.001  14.273  -2.865  1.00 0.00 ? 1084 TYR B CE1  5  
ATOM 6823  C CE2  . TYR A 1 40 ? -1.082  14.184  -5.029  1.00 0.00 ? 1084 TYR B CE2  5  
ATOM 6824  C CZ   . TYR A 1 40 ? -0.790  14.875  -3.846  1.00 0.00 ? 1084 TYR B CZ   5  
ATOM 6825  O OH   . TYR A 1 40 ? -1.280  16.150  -3.651  1.00 0.00 ? 1084 TYR B OH   5  
ATOM 6826  H H    . TYR A 1 40 ? 3.011   11.943  -3.962  1.00 0.00 ? 1084 TYR B H    5  
ATOM 6827  H HA   . TYR A 1 40 ? 1.097   10.566  -2.397  1.00 0.00 ? 1084 TYR B HA   5  
ATOM 6828  H HB2  . TYR A 1 40 ? 1.340   10.891  -5.394  1.00 0.00 ? 1084 TYR B HB2  5  
ATOM 6829  H HB3  . TYR A 1 40 ? -0.064  10.198  -4.590  1.00 0.00 ? 1084 TYR B HB3  5  
ATOM 6830  H HD1  . TYR A 1 40 ? 1.101   12.532  -2.292  1.00 0.00 ? 1084 TYR B HD1  5  
ATOM 6831  H HD2  . TYR A 1 40 ? -0.809  12.363  -6.142  1.00 0.00 ? 1084 TYR B HD2  5  
ATOM 6832  H HE1  . TYR A 1 40 ? 0.233   14.803  -1.957  1.00 0.00 ? 1084 TYR B HE1  5  
ATOM 6833  H HE2  . TYR A 1 40 ? -1.687  14.650  -5.790  1.00 0.00 ? 1084 TYR B HE2  5  
ATOM 6834  H HH   . TYR A 1 40 ? -2.047  16.263  -4.216  1.00 0.00 ? 1084 TYR B HH   5  
ATOM 6835  N N    . ASP A 1 41 ? 3.101   8.739   -4.192  1.00 0.00 ? 1085 ASP B N    5  
ATOM 6836  C CA   . ASP A 1 41 ? 3.549   7.367   -4.417  1.00 0.00 ? 1085 ASP B CA   5  
ATOM 6837  C C    . ASP A 1 41 ? 4.120   6.783   -3.125  1.00 0.00 ? 1085 ASP B C    5  
ATOM 6838  O O    . ASP A 1 41 ? 5.335   6.699   -2.946  1.00 0.00 ? 1085 ASP B O    5  
ATOM 6839  C CB   . ASP A 1 41 ? 4.625   7.339   -5.507  1.00 0.00 ? 1085 ASP B CB   5  
ATOM 6840  C CG   . ASP A 1 41 ? 5.005   5.897   -5.835  1.00 0.00 ? 1085 ASP B CG   5  
ATOM 6841  O OD1  . ASP A 1 41 ? 4.501   5.006   -5.170  1.00 0.00 ? 1085 ASP B OD1  5  
ATOM 6842  O OD2  . ASP A 1 41 ? 5.794   5.706   -6.744  1.00 0.00 ? 1085 ASP B OD2  5  
ATOM 6843  H H    . ASP A 1 41 ? 3.604   9.492   -4.573  1.00 0.00 ? 1085 ASP B H    5  
ATOM 6844  H HA   . ASP A 1 41 ? 2.710   6.767   -4.735  1.00 0.00 ? 1085 ASP B HA   5  
ATOM 6845  H HB2  . ASP A 1 41 ? 4.246   7.820   -6.397  1.00 0.00 ? 1085 ASP B HB2  5  
ATOM 6846  H HB3  . ASP A 1 41 ? 5.501   7.868   -5.160  1.00 0.00 ? 1085 ASP B HB3  5  
ATOM 6847  N N    . LEU A 1 42 ? 3.223   6.386   -2.226  1.00 0.00 ? 1086 LEU B N    5  
ATOM 6848  C CA   . LEU A 1 42 ? 3.619   5.814   -0.942  1.00 0.00 ? 1086 LEU B CA   5  
ATOM 6849  C C    . LEU A 1 42 ? 3.453   4.299   -0.958  1.00 0.00 ? 1086 LEU B C    5  
ATOM 6850  O O    . LEU A 1 42 ? 3.402   3.663   0.092   1.00 0.00 ? 1086 LEU B O    5  
ATOM 6851  C CB   . LEU A 1 42 ? 2.764   6.405   0.174   1.00 0.00 ? 1086 LEU B CB   5  
ATOM 6852  C CG   . LEU A 1 42 ? 2.930   7.920   0.176   1.00 0.00 ? 1086 LEU B CG   5  
ATOM 6853  C CD1  . LEU A 1 42 ? 1.946   8.544   1.168   1.00 0.00 ? 1086 LEU B CD1  5  
ATOM 6854  C CD2  . LEU A 1 42 ? 4.359   8.281   0.589   1.00 0.00 ? 1086 LEU B CD2  5  
ATOM 6855  H H    . LEU A 1 42 ? 2.272   6.485   -2.428  1.00 0.00 ? 1086 LEU B H    5  
ATOM 6856  H HA   . LEU A 1 42 ? 4.655   6.051   -0.755  1.00 0.00 ? 1086 LEU B HA   5  
ATOM 6857  H HB2  . LEU A 1 42 ? 1.727   6.152   0.008   1.00 0.00 ? 1086 LEU B HB2  5  
ATOM 6858  H HB3  . LEU A 1 42 ? 3.086   6.009   1.125   1.00 0.00 ? 1086 LEU B HB3  5  
ATOM 6859  H HG   . LEU A 1 42 ? 2.739   8.290   -0.819  1.00 0.00 ? 1086 LEU B HG   5  
ATOM 6860  H HD11 . LEU A 1 42 ? 2.123   8.140   2.153   1.00 0.00 ? 1086 LEU B HD11 5  
ATOM 6861  H HD12 . LEU A 1 42 ? 0.934   8.318   0.863   1.00 0.00 ? 1086 LEU B HD12 5  
ATOM 6862  H HD13 . LEU A 1 42 ? 2.083   9.615   1.186   1.00 0.00 ? 1086 LEU B HD13 5  
ATOM 6863  H HD21 . LEU A 1 42 ? 4.864   8.752   -0.242  1.00 0.00 ? 1086 LEU B HD21 5  
ATOM 6864  H HD22 . LEU A 1 42 ? 4.891   7.386   0.872   1.00 0.00 ? 1086 LEU B HD22 5  
ATOM 6865  H HD23 . LEU A 1 42 ? 4.328   8.961   1.426   1.00 0.00 ? 1086 LEU B HD23 5  
ATOM 6866  N N    . SER A 1 43 ? 3.372   3.728   -2.153  1.00 0.00 ? 1087 SER B N    5  
ATOM 6867  C CA   . SER A 1 43 ? 3.222   2.288   -2.285  1.00 0.00 ? 1087 SER B CA   5  
ATOM 6868  C C    . SER A 1 43 ? 4.426   1.573   -1.685  1.00 0.00 ? 1087 SER B C    5  
ATOM 6869  O O    . SER A 1 43 ? 4.376   0.376   -1.405  1.00 0.00 ? 1087 SER B O    5  
ATOM 6870  C CB   . SER A 1 43 ? 3.068   1.910   -3.759  1.00 0.00 ? 1087 SER B CB   5  
ATOM 6871  O OG   . SER A 1 43 ? 4.248   2.273   -4.464  1.00 0.00 ? 1087 SER B OG   5  
ATOM 6872  H H    . SER A 1 43 ? 3.422   4.283   -2.957  1.00 0.00 ? 1087 SER B H    5  
ATOM 6873  H HA   . SER A 1 43 ? 2.338   1.981   -1.752  1.00 0.00 ? 1087 SER B HA   5  
ATOM 6874  H HB2  . SER A 1 43 ? 2.916   0.848   -3.845  1.00 0.00 ? 1087 SER B HB2  5  
ATOM 6875  H HB3  . SER A 1 43 ? 2.214   2.428   -4.175  1.00 0.00 ? 1087 SER B HB3  5  
ATOM 6876  H HG   . SER A 1 43 ? 5.000   2.102   -3.894  1.00 0.00 ? 1087 SER B HG   5  
ATOM 6877  N N    . LYS A 1 44 ? 5.509   2.315   -1.487  1.00 0.00 ? 1088 LYS B N    5  
ATOM 6878  C CA   . LYS A 1 44 ? 6.719   1.741   -0.910  1.00 0.00 ? 1088 LYS B CA   5  
ATOM 6879  C C    . LYS A 1 44 ? 6.692   1.843   0.617   1.00 0.00 ? 1088 LYS B C    5  
ATOM 6880  O O    . LYS A 1 44 ? 7.527   1.249   1.298   1.00 0.00 ? 1088 LYS B O    5  
ATOM 6881  C CB   . LYS A 1 44 ? 7.949   2.470   -1.447  1.00 0.00 ? 1088 LYS B CB   5  
ATOM 6882  C CG   . LYS A 1 44 ? 8.036   2.271   -2.961  1.00 0.00 ? 1088 LYS B CG   5  
ATOM 6883  C CD   . LYS A 1 44 ? 9.332   2.886   -3.495  1.00 0.00 ? 1088 LYS B CD   5  
ATOM 6884  C CE   . LYS A 1 44 ? 9.279   4.410   -3.363  1.00 0.00 ? 1088 LYS B CE   5  
ATOM 6885  N NZ   . LYS A 1 44 ? 8.124   4.935   -4.145  1.00 0.00 ? 1088 LYS B NZ   5  
ATOM 6886  H H    . LYS A 1 44 ? 5.490   3.270   -1.723  1.00 0.00 ? 1088 LYS B H    5  
ATOM 6887  H HA   . LYS A 1 44 ? 6.782   0.701   -1.192  1.00 0.00 ? 1088 LYS B HA   5  
ATOM 6888  H HB2  . LYS A 1 44 ? 7.863   3.524   -1.224  1.00 0.00 ? 1088 LYS B HB2  5  
ATOM 6889  H HB3  . LYS A 1 44 ? 8.839   2.074   -0.981  1.00 0.00 ? 1088 LYS B HB3  5  
ATOM 6890  H HG2  . LYS A 1 44 ? 8.019   1.214   -3.185  1.00 0.00 ? 1088 LYS B HG2  5  
ATOM 6891  H HG3  . LYS A 1 44 ? 7.193   2.750   -3.434  1.00 0.00 ? 1088 LYS B HG3  5  
ATOM 6892  H HD2  . LYS A 1 44 ? 10.169  2.505   -2.929  1.00 0.00 ? 1088 LYS B HD2  5  
ATOM 6893  H HD3  . LYS A 1 44 ? 9.453   2.621   -4.536  1.00 0.00 ? 1088 LYS B HD3  5  
ATOM 6894  H HE2  . LYS A 1 44 ? 9.167   4.682   -2.325  1.00 0.00 ? 1088 LYS B HE2  5  
ATOM 6895  H HE3  . LYS A 1 44 ? 10.196  4.835   -3.746  1.00 0.00 ? 1088 LYS B HE3  5  
ATOM 6896  H HZ1  . LYS A 1 44 ? 7.363   5.214   -3.493  1.00 0.00 ? 1088 LYS B HZ1  5  
ATOM 6897  H HZ2  . LYS A 1 44 ? 7.778   4.196   -4.789  1.00 0.00 ? 1088 LYS B HZ2  5  
ATOM 6898  H HZ3  . LYS A 1 44 ? 8.426   5.763   -4.695  1.00 0.00 ? 1088 LYS B HZ3  5  
ATOM 6899  N N    . TRP A 1 45 ? 5.733   2.602   1.146   1.00 0.00 ? 1089 TRP B N    5  
ATOM 6900  C CA   . TRP A 1 45 ? 5.615   2.775   2.588   1.00 0.00 ? 1089 TRP B CA   5  
ATOM 6901  C C    . TRP A 1 45 ? 4.800   1.650   3.197   1.00 0.00 ? 1089 TRP B C    5  
ATOM 6902  O O    . TRP A 1 45 ? 3.707   1.336   2.733   1.00 0.00 ? 1089 TRP B O    5  
ATOM 6903  C CB   . TRP A 1 45 ? 4.944   4.114   2.904   1.00 0.00 ? 1089 TRP B CB   5  
ATOM 6904  C CG   . TRP A 1 45 ? 5.906   5.220   2.645   1.00 0.00 ? 1089 TRP B CG   5  
ATOM 6905  C CD1  . TRP A 1 45 ? 6.571   5.399   1.485   1.00 0.00 ? 1089 TRP B CD1  5  
ATOM 6906  C CD2  . TRP A 1 45 ? 6.320   6.304   3.529   1.00 0.00 ? 1089 TRP B CD2  5  
ATOM 6907  N NE1  . TRP A 1 45 ? 7.375   6.509   1.599   1.00 0.00 ? 1089 TRP B NE1  5  
ATOM 6908  C CE2  . TRP A 1 45 ? 7.256   7.108   2.836   1.00 0.00 ? 1089 TRP B CE2  5  
ATOM 6909  C CE3  . TRP A 1 45 ? 5.985   6.667   4.849   1.00 0.00 ? 1089 TRP B CE3  5  
ATOM 6910  C CZ2  . TRP A 1 45 ? 7.841   8.229   3.427   1.00 0.00 ? 1089 TRP B CZ2  5  
ATOM 6911  C CZ3  . TRP A 1 45 ? 6.572   7.797   5.445   1.00 0.00 ? 1089 TRP B CZ3  5  
ATOM 6912  C CH2  . TRP A 1 45 ? 7.496   8.576   4.735   1.00 0.00 ? 1089 TRP B CH2  5  
ATOM 6913  H H    . TRP A 1 45 ? 5.097   3.055   0.560   1.00 0.00 ? 1089 TRP B H    5  
ATOM 6914  H HA   . TRP A 1 45 ? 6.602   2.771   3.024   1.00 0.00 ? 1089 TRP B HA   5  
ATOM 6915  H HB2  . TRP A 1 45 ? 4.073   4.237   2.277   1.00 0.00 ? 1089 TRP B HB2  5  
ATOM 6916  H HB3  . TRP A 1 45 ? 4.645   4.131   3.943   1.00 0.00 ? 1089 TRP B HB3  5  
ATOM 6917  H HD1  . TRP A 1 45 ? 6.493   4.768   0.612   1.00 0.00 ? 1089 TRP B HD1  5  
ATOM 6918  H HE1  . TRP A 1 45 ? 7.960   6.842   0.901   1.00 0.00 ? 1089 TRP B HE1  5  
ATOM 6919  H HE3  . TRP A 1 45 ? 5.272   6.075   5.409   1.00 0.00 ? 1089 TRP B HE3  5  
ATOM 6920  H HZ2  . TRP A 1 45 ? 8.551   8.827   2.876   1.00 0.00 ? 1089 TRP B HZ2  5  
ATOM 6921  H HZ3  . TRP A 1 45 ? 6.312   8.067   6.456   1.00 0.00 ? 1089 TRP B HZ3  5  
ATOM 6922  H HH2  . TRP A 1 45 ? 7.940   9.445   5.199   1.00 0.00 ? 1089 TRP B HH2  5  
ATOM 6923  N N    . LYS A 1 46 ? 5.332   1.058   4.252   1.00 0.00 ? 1090 LYS B N    5  
ATOM 6924  C CA   . LYS A 1 46 ? 4.634   -0.028  4.929   1.00 0.00 ? 1090 LYS B CA   5  
ATOM 6925  C C    . LYS A 1 46 ? 3.317   0.456   5.510   1.00 0.00 ? 1090 LYS B C    5  
ATOM 6926  O O    . LYS A 1 46 ? 3.116   1.653   5.717   1.00 0.00 ? 1090 LYS B O    5  
ATOM 6927  C CB   . LYS A 1 46 ? 5.504   -0.595  6.045   1.00 0.00 ? 1090 LYS B CB   5  
ATOM 6928  C CG   . LYS A 1 46 ? 6.654   -1.375  5.427   1.00 0.00 ? 1090 LYS B CG   5  
ATOM 6929  C CD   . LYS A 1 46 ? 7.579   -1.878  6.530   1.00 0.00 ? 1090 LYS B CD   5  
ATOM 6930  C CE   . LYS A 1 46 ? 8.731   -2.677  5.913   1.00 0.00 ? 1090 LYS B CE   5  
ATOM 6931  N NZ   . LYS A 1 46 ? 9.646   -3.145  6.994   1.00 0.00 ? 1090 LYS B NZ   5  
ATOM 6932  H H    . LYS A 1 46 ? 6.206   1.362   4.586   1.00 0.00 ? 1090 LYS B H    5  
ATOM 6933  H HA   . LYS A 1 46 ? 4.433   -0.810  4.217   1.00 0.00 ? 1090 LYS B HA   5  
ATOM 6934  H HB2  . LYS A 1 46 ? 5.895   0.215   6.642   1.00 0.00 ? 1090 LYS B HB2  5  
ATOM 6935  H HB3  . LYS A 1 46 ? 4.916   -1.252  6.666   1.00 0.00 ? 1090 LYS B HB3  5  
ATOM 6936  H HG2  . LYS A 1 46 ? 6.253   -2.216  4.881   1.00 0.00 ? 1090 LYS B HG2  5  
ATOM 6937  H HG3  . LYS A 1 46 ? 7.204   -0.736  4.757   1.00 0.00 ? 1090 LYS B HG3  5  
ATOM 6938  H HD2  . LYS A 1 46 ? 7.973   -1.030  7.071   1.00 0.00 ? 1090 LYS B HD2  5  
ATOM 6939  H HD3  . LYS A 1 46 ? 7.021   -2.511  7.203   1.00 0.00 ? 1090 LYS B HD3  5  
ATOM 6940  H HE2  . LYS A 1 46 ? 8.337   -3.531  5.381   1.00 0.00 ? 1090 LYS B HE2  5  
ATOM 6941  H HE3  . LYS A 1 46 ? 9.280   -2.046  5.228   1.00 0.00 ? 1090 LYS B HE3  5  
ATOM 6942  H HZ1  . LYS A 1 46 ? 10.621  -2.869  6.767   1.00 0.00 ? 1090 LYS B HZ1  5  
ATOM 6943  H HZ2  . LYS A 1 46 ? 9.587   -4.182  7.073   1.00 0.00 ? 1090 LYS B HZ2  5  
ATOM 6944  H HZ3  . LYS A 1 46 ? 9.365   -2.712  7.897   1.00 0.00 ? 1090 LYS B HZ3  5  
ATOM 6945  N N    . TYR A 1 47 ? 2.418   -0.483  5.774   1.00 0.00 ? 1091 TYR B N    5  
ATOM 6946  C CA   . TYR A 1 47 ? 1.123   -0.141  6.335   1.00 0.00 ? 1091 TYR B CA   5  
ATOM 6947  C C    . TYR A 1 47 ? 1.312   0.604   7.648   1.00 0.00 ? 1091 TYR B C    5  
ATOM 6948  O O    . TYR A 1 47 ? 0.704   1.651   7.875   1.00 0.00 ? 1091 TYR B O    5  
ATOM 6949  C CB   . TYR A 1 47 ? 0.302   -1.407  6.582   1.00 0.00 ? 1091 TYR B CB   5  
ATOM 6950  C CG   . TYR A 1 47 ? -0.934  -1.060  7.378   1.00 0.00 ? 1091 TYR B CG   5  
ATOM 6951  C CD1  . TYR A 1 47 ? -2.023  -0.434  6.758   1.00 0.00 ? 1091 TYR B CD1  5  
ATOM 6952  C CD2  . TYR A 1 47 ? -0.989  -1.364  8.744   1.00 0.00 ? 1091 TYR B CD2  5  
ATOM 6953  C CE1  . TYR A 1 47 ? -3.164  -0.114  7.504   1.00 0.00 ? 1091 TYR B CE1  5  
ATOM 6954  C CE2  . TYR A 1 47 ? -2.130  -1.045  9.489   1.00 0.00 ? 1091 TYR B CE2  5  
ATOM 6955  C CZ   . TYR A 1 47 ? -3.217  -0.420  8.869   1.00 0.00 ? 1091 TYR B CZ   5  
ATOM 6956  O OH   . TYR A 1 47 ? -4.340  -0.103  9.604   1.00 0.00 ? 1091 TYR B OH   5  
ATOM 6957  H H    . TYR A 1 47 ? 2.633   -1.424  5.592   1.00 0.00 ? 1091 TYR B H    5  
ATOM 6958  H HA   . TYR A 1 47 ? 0.592   0.491   5.641   1.00 0.00 ? 1091 TYR B HA   5  
ATOM 6959  H HB2  . TYR A 1 47 ? 0.012   -1.839  5.635   1.00 0.00 ? 1091 TYR B HB2  5  
ATOM 6960  H HB3  . TYR A 1 47 ? 0.896   -2.120  7.135   1.00 0.00 ? 1091 TYR B HB3  5  
ATOM 6961  H HD1  . TYR A 1 47 ? -1.983  -0.199  5.704   1.00 0.00 ? 1091 TYR B HD1  5  
ATOM 6962  H HD2  . TYR A 1 47 ? -0.150  -1.846  9.223   1.00 0.00 ? 1091 TYR B HD2  5  
ATOM 6963  H HE1  . TYR A 1 47 ? -4.004  0.368   7.026   1.00 0.00 ? 1091 TYR B HE1  5  
ATOM 6964  H HE2  . TYR A 1 47 ? -2.171  -1.282  10.542  1.00 0.00 ? 1091 TYR B HE2  5  
ATOM 6965  H HH   . TYR A 1 47 ? -4.130  -0.224  10.534  1.00 0.00 ? 1091 TYR B HH   5  
ATOM 6966  N N    . ALA A 1 48 ? 2.163   0.063   8.508   1.00 0.00 ? 1092 ALA B N    5  
ATOM 6967  C CA   . ALA A 1 48 ? 2.425   0.700   9.797   1.00 0.00 ? 1092 ALA B CA   5  
ATOM 6968  C C    . ALA A 1 48 ? 3.049   2.082   9.600   1.00 0.00 ? 1092 ALA B C    5  
ATOM 6969  O O    . ALA A 1 48 ? 2.722   3.031   10.315  1.00 0.00 ? 1092 ALA B O    5  
ATOM 6970  C CB   . ALA A 1 48 ? 3.362   -0.171  10.635  1.00 0.00 ? 1092 ALA B CB   5  
ATOM 6971  H H    . ALA A 1 48 ? 2.632   -0.773  8.269   1.00 0.00 ? 1092 ALA B H    5  
ATOM 6972  H HA   . ALA A 1 48 ? 1.491   0.813   10.325  1.00 0.00 ? 1092 ALA B HA   5  
ATOM 6973  H HB1  . ALA A 1 48 ? 4.381   0.150   10.486  1.00 0.00 ? 1092 ALA B HB1  5  
ATOM 6974  H HB2  . ALA A 1 48 ? 3.259   -1.202  10.332  1.00 0.00 ? 1092 ALA B HB2  5  
ATOM 6975  H HB3  . ALA A 1 48 ? 3.102   -0.074  11.679  1.00 0.00 ? 1092 ALA B HB3  5  
ATOM 6976  N N    . GLU A 1 49 ? 3.950   2.181   8.630   1.00 0.00 ? 1093 GLU B N    5  
ATOM 6977  C CA   . GLU A 1 49 ? 4.626   3.446   8.345   1.00 0.00 ? 1093 GLU B CA   5  
ATOM 6978  C C    . GLU A 1 49 ? 3.629   4.507   7.898   1.00 0.00 ? 1093 GLU B C    5  
ATOM 6979  O O    . GLU A 1 49 ? 3.706   5.658   8.327   1.00 0.00 ? 1093 GLU B O    5  
ATOM 6980  C CB   . GLU A 1 49 ? 5.676   3.241   7.247   1.00 0.00 ? 1093 GLU B CB   5  
ATOM 6981  C CG   . GLU A 1 49 ? 6.854   2.427   7.796   1.00 0.00 ? 1093 GLU B CG   5  
ATOM 6982  C CD   . GLU A 1 49 ? 7.546   3.190   8.920   1.00 0.00 ? 1093 GLU B CD   5  
ATOM 6983  O OE1  . GLU A 1 49 ? 7.840   4.358   8.724   1.00 0.00 ? 1093 GLU B OE1  5  
ATOM 6984  O OE2  . GLU A 1 49 ? 7.776   2.596   9.960   1.00 0.00 ? 1093 GLU B OE2  5  
ATOM 6985  H H    . GLU A 1 49 ? 4.166   1.391   8.100   1.00 0.00 ? 1093 GLU B H    5  
ATOM 6986  H HA   . GLU A 1 49 ? 5.121   3.788   9.242   1.00 0.00 ? 1093 GLU B HA   5  
ATOM 6987  H HB2  . GLU A 1 49 ? 5.230   2.712   6.419   1.00 0.00 ? 1093 GLU B HB2  5  
ATOM 6988  H HB3  . GLU A 1 49 ? 6.034   4.203   6.910   1.00 0.00 ? 1093 GLU B HB3  5  
ATOM 6989  H HG2  . GLU A 1 49 ? 6.488   1.486   8.178   1.00 0.00 ? 1093 GLU B HG2  5  
ATOM 6990  H HG3  . GLU A 1 49 ? 7.561   2.241   7.002   1.00 0.00 ? 1093 GLU B HG3  5  
ATOM 6991  N N    . LEU A 1 50 ? 2.685   4.121   7.046   1.00 0.00 ? 1094 LEU B N    5  
ATOM 6992  C CA   . LEU A 1 50 ? 1.684   5.061   6.572   1.00 0.00 ? 1094 LEU B CA   5  
ATOM 6993  C C    . LEU A 1 50 ? 0.815   5.522   7.723   1.00 0.00 ? 1094 LEU B C    5  
ATOM 6994  O O    . LEU A 1 50 ? 0.457   6.693   7.806   1.00 0.00 ? 1094 LEU B O    5  
ATOM 6995  C CB   . LEU A 1 50 ? 0.821   4.414   5.492   1.00 0.00 ? 1094 LEU B CB   5  
ATOM 6996  C CG   . LEU A 1 50 ? 1.660   4.250   4.231   1.00 0.00 ? 1094 LEU B CG   5  
ATOM 6997  C CD1  . LEU A 1 50 ? 0.933   3.330   3.247   1.00 0.00 ? 1094 LEU B CD1  5  
ATOM 6998  C CD2  . LEU A 1 50 ? 1.867   5.621   3.583   1.00 0.00 ? 1094 LEU B CD2  5  
ATOM 6999  H H    . LEU A 1 50 ? 2.656   3.190   6.735   1.00 0.00 ? 1094 LEU B H    5  
ATOM 7000  H HA   . LEU A 1 50 ? 2.187   5.918   6.153   1.00 0.00 ? 1094 LEU B HA   5  
ATOM 7001  H HB2  . LEU A 1 50 ? 0.480   3.447   5.832   1.00 0.00 ? 1094 LEU B HB2  5  
ATOM 7002  H HB3  . LEU A 1 50 ? -0.029  5.045   5.279   1.00 0.00 ? 1094 LEU B HB3  5  
ATOM 7003  H HG   . LEU A 1 50 ? 2.618   3.826   4.495   1.00 0.00 ? 1094 LEU B HG   5  
ATOM 7004  H HD11 . LEU A 1 50 ? 0.022   3.806   2.916   1.00 0.00 ? 1094 LEU B HD11 5  
ATOM 7005  H HD12 . LEU A 1 50 ? 0.694   2.398   3.737   1.00 0.00 ? 1094 LEU B HD12 5  
ATOM 7006  H HD13 . LEU A 1 50 ? 1.569   3.138   2.396   1.00 0.00 ? 1094 LEU B HD13 5  
ATOM 7007  H HD21 . LEU A 1 50 ? 1.333   5.659   2.645   1.00 0.00 ? 1094 LEU B HD21 5  
ATOM 7008  H HD22 . LEU A 1 50 ? 2.921   5.779   3.403   1.00 0.00 ? 1094 LEU B HD22 5  
ATOM 7009  H HD23 . LEU A 1 50 ? 1.493   6.392   4.241   1.00 0.00 ? 1094 LEU B HD23 5  
ATOM 7010  N N    . ARG A 1 51 ? 0.485   4.598   8.611   1.00 0.00 ? 1095 ARG B N    5  
ATOM 7011  C CA   . ARG A 1 51 ? -0.338  4.935   9.753   1.00 0.00 ? 1095 ARG B CA   5  
ATOM 7012  C C    . ARG A 1 51 ? 0.345   6.014   10.583  1.00 0.00 ? 1095 ARG B C    5  
ATOM 7013  O O    . ARG A 1 51 ? -0.271  7.018   10.947  1.00 0.00 ? 1095 ARG B O    5  
ATOM 7014  C CB   . ARG A 1 51 ? -0.550  3.688   10.608  1.00 0.00 ? 1095 ARG B CB   5  
ATOM 7015  C CG   . ARG A 1 51 ? -1.513  4.020   11.750  1.00 0.00 ? 1095 ARG B CG   5  
ATOM 7016  C CD   . ARG A 1 51 ? -1.634  2.818   12.682  1.00 0.00 ? 1095 ARG B CD   5  
ATOM 7017  N NE   . ARG A 1 51 ? -0.389  2.625   13.419  1.00 0.00 ? 1095 ARG B NE   5  
ATOM 7018  C CZ   . ARG A 1 51 ? -0.206  1.581   14.230  1.00 0.00 ? 1095 ARG B CZ   5  
ATOM 7019  N NH1  . ARG A 1 51 ? -1.149  0.686   14.395  1.00 0.00 ? 1095 ARG B NH1  5  
ATOM 7020  N NH2  . ARG A 1 51 ? 0.926   1.450   14.867  1.00 0.00 ? 1095 ARG B NH2  5  
ATOM 7021  H H    . ARG A 1 51 ? 0.802   3.676   8.499   1.00 0.00 ? 1095 ARG B H    5  
ATOM 7022  H HA   . ARG A 1 51 ? -1.295  5.298   9.409   1.00 0.00 ? 1095 ARG B HA   5  
ATOM 7023  H HB2  . ARG A 1 51 ? -0.966  2.899   9.997   1.00 0.00 ? 1095 ARG B HB2  5  
ATOM 7024  H HB3  . ARG A 1 51 ? 0.399   3.366   11.014  1.00 0.00 ? 1095 ARG B HB3  5  
ATOM 7025  H HG2  . ARG A 1 51 ? -1.136  4.867   12.304  1.00 0.00 ? 1095 ARG B HG2  5  
ATOM 7026  H HG3  . ARG A 1 51 ? -2.485  4.258   11.345  1.00 0.00 ? 1095 ARG B HG3  5  
ATOM 7027  H HD2  . ARG A 1 51 ? -2.441  2.984   13.379  1.00 0.00 ? 1095 ARG B HD2  5  
ATOM 7028  H HD3  . ARG A 1 51 ? -1.845  1.936   12.093  1.00 0.00 ? 1095 ARG B HD3  5  
ATOM 7029  H HE   . ARG A 1 51 ? 0.330   3.281   13.317  1.00 0.00 ? 1095 ARG B HE   5  
ATOM 7030  H HH11 . ARG A 1 51 ? -2.020  0.774   13.916  1.00 0.00 ? 1095 ARG B HH11 5  
ATOM 7031  H HH12 . ARG A 1 51 ? -0.996  -0.090  15.007  1.00 0.00 ? 1095 ARG B HH12 5  
ATOM 7032  H HH21 . ARG A 1 51 ? 1.651   2.129   14.746  1.00 0.00 ? 1095 ARG B HH21 5  
ATOM 7033  H HH22 . ARG A 1 51 ? 1.070   0.670   15.477  1.00 0.00 ? 1095 ARG B HH22 5  
ATOM 7034  N N    . ASP A 1 52 ? 1.629   5.812   10.864  1.00 0.00 ? 1096 ASP B N    5  
ATOM 7035  C CA   . ASP A 1 52 ? 2.387   6.784   11.635  1.00 0.00 ? 1096 ASP B CA   5  
ATOM 7036  C C    . ASP A 1 52 ? 2.487   8.103   10.877  1.00 0.00 ? 1096 ASP B C    5  
ATOM 7037  O O    . ASP A 1 52 ? 2.388   9.177   11.470  1.00 0.00 ? 1096 ASP B O    5  
ATOM 7038  C CB   . ASP A 1 52 ? 3.788   6.249   11.936  1.00 0.00 ? 1096 ASP B CB   5  
ATOM 7039  C CG   . ASP A 1 52 ? 3.701   5.126   12.963  1.00 0.00 ? 1096 ASP B CG   5  
ATOM 7040  O OD1  . ASP A 1 52 ? 2.652   4.983   13.570  1.00 0.00 ? 1096 ASP B OD1  5  
ATOM 7041  O OD2  . ASP A 1 52 ? 4.685   4.424   13.127  1.00 0.00 ? 1096 ASP B OD2  5  
ATOM 7042  H H    . ASP A 1 52 ? 2.075   5.003   10.535  1.00 0.00 ? 1096 ASP B H    5  
ATOM 7043  H HA   . ASP A 1 52 ? 1.876   6.960   12.569  1.00 0.00 ? 1096 ASP B HA   5  
ATOM 7044  H HB2  . ASP A 1 52 ? 4.229   5.874   11.026  1.00 0.00 ? 1096 ASP B HB2  5  
ATOM 7045  H HB3  . ASP A 1 52 ? 4.400   7.048   12.330  1.00 0.00 ? 1096 ASP B HB3  5  
ATOM 7046  N N    . THR A 1 53 ? 2.684   8.020   9.560   1.00 0.00 ? 1097 THR B N    5  
ATOM 7047  C CA   . THR A 1 53 ? 2.795   9.225   8.751   1.00 0.00 ? 1097 THR B CA   5  
ATOM 7048  C C    . THR A 1 53 ? 1.510   10.041  8.816   1.00 0.00 ? 1097 THR B C    5  
ATOM 7049  O O    . THR A 1 53 ? 1.545   11.261  8.948   1.00 0.00 ? 1097 THR B O    5  
ATOM 7050  C CB   . THR A 1 53 ? 3.092   8.852   7.300   1.00 0.00 ? 1097 THR B CB   5  
ATOM 7051  O OG1  . THR A 1 53 ? 4.328   8.153   7.241   1.00 0.00 ? 1097 THR B OG1  5  
ATOM 7052  C CG2  . THR A 1 53 ? 3.179   10.124  6.459   1.00 0.00 ? 1097 THR B CG2  5  
ATOM 7053  H H    . THR A 1 53 ? 2.758   7.137   9.126   1.00 0.00 ? 1097 THR B H    5  
ATOM 7054  H HA   . THR A 1 53 ? 3.609   9.822   9.126   1.00 0.00 ? 1097 THR B HA   5  
ATOM 7055  H HB   . THR A 1 53 ? 2.302   8.224   6.919   1.00 0.00 ? 1097 THR B HB   5  
ATOM 7056  H HG1  . THR A 1 53 ? 4.484   7.755   8.101   1.00 0.00 ? 1097 THR B HG1  5  
ATOM 7057  H HG21 . THR A 1 53 ? 3.112   10.988  7.104   1.00 0.00 ? 1097 THR B HG21 5  
ATOM 7058  H HG22 . THR A 1 53 ? 2.366   10.141  5.748   1.00 0.00 ? 1097 THR B HG22 5  
ATOM 7059  H HG23 . THR A 1 53 ? 4.119   10.142  5.929   1.00 0.00 ? 1097 THR B HG23 5  
ATOM 7060  N N    . ILE A 1 54 ? 0.377   9.365   8.714   1.00 0.00 ? 1098 ILE B N    5  
ATOM 7061  C CA   . ILE A 1 54 ? -0.911  10.047  8.753   1.00 0.00 ? 1098 ILE B CA   5  
ATOM 7062  C C    . ILE A 1 54 ? -1.111  10.768  10.083  1.00 0.00 ? 1098 ILE B C    5  
ATOM 7063  O O    . ILE A 1 54 ? -1.529  11.925  10.116  1.00 0.00 ? 1098 ILE B O    5  
ATOM 7064  C CB   . ILE A 1 54 ? -2.032  9.031   8.557   1.00 0.00 ? 1098 ILE B CB   5  
ATOM 7065  C CG1  . ILE A 1 54 ? -1.971  8.498   7.128   1.00 0.00 ? 1098 ILE B CG1  5  
ATOM 7066  C CG2  . ILE A 1 54 ? -3.381  9.711   8.794   1.00 0.00 ? 1098 ILE B CG2  5  
ATOM 7067  C CD1  . ILE A 1 54 ? -2.863  7.260   7.001   1.00 0.00 ? 1098 ILE B CD1  5  
ATOM 7068  H H    . ILE A 1 54 ? 0.403   8.392   8.601   1.00 0.00 ? 1098 ILE B H    5  
ATOM 7069  H HA   . ILE A 1 54 ? -0.952  10.770  7.953   1.00 0.00 ? 1098 ILE B HA   5  
ATOM 7070  H HB   . ILE A 1 54 ? -1.908  8.217   9.256   1.00 0.00 ? 1098 ILE B HB   5  
ATOM 7071  H HG12 . ILE A 1 54 ? -2.311  9.261   6.446   1.00 0.00 ? 1098 ILE B HG12 5  
ATOM 7072  H HG13 . ILE A 1 54 ? -0.954  8.232   6.892   1.00 0.00 ? 1098 ILE B HG13 5  
ATOM 7073  H HG21 . ILE A 1 54 ? -3.262  10.780  8.724   1.00 0.00 ? 1098 ILE B HG21 5  
ATOM 7074  H HG22 . ILE A 1 54 ? -3.746  9.452   9.777   1.00 0.00 ? 1098 ILE B HG22 5  
ATOM 7075  H HG23 . ILE A 1 54 ? -4.087  9.378   8.048   1.00 0.00 ? 1098 ILE B HG23 5  
ATOM 7076  H HD11 . ILE A 1 54 ? -3.509  7.370   6.142   1.00 0.00 ? 1098 ILE B HD11 5  
ATOM 7077  H HD12 . ILE A 1 54 ? -3.463  7.155   7.891   1.00 0.00 ? 1098 ILE B HD12 5  
ATOM 7078  H HD13 . ILE A 1 54 ? -2.246  6.383   6.876   1.00 0.00 ? 1098 ILE B HD13 5  
ATOM 7079  N N    . ASN A 1 55 ? -0.812  10.076  11.174  1.00 0.00 ? 1099 ASN B N    5  
ATOM 7080  C CA   . ASN A 1 55 ? -0.975  10.657  12.504  1.00 0.00 ? 1099 ASN B CA   5  
ATOM 7081  C C    . ASN A 1 55 ? -0.093  11.887  12.678  1.00 0.00 ? 1099 ASN B C    5  
ATOM 7082  O O    . ASN A 1 55 ? -0.507  12.877  13.281  1.00 0.00 ? 1099 ASN B O    5  
ATOM 7083  C CB   . ASN A 1 55 ? -0.619  9.614   13.561  1.00 0.00 ? 1099 ASN B CB   5  
ATOM 7084  C CG   . ASN A 1 55 ? -1.803  8.680   13.782  1.00 0.00 ? 1099 ASN B CG   5  
ATOM 7085  O OD1  . ASN A 1 55 ? -2.478  8.765   14.808  1.00 0.00 ? 1099 ASN B OD1  5  
ATOM 7086  N ND2  . ASN A 1 55 ? -2.118  7.815   12.858  1.00 0.00 ? 1099 ASN B ND2  5  
ATOM 7087  H H    . ASN A 1 55 ? -0.483  9.156   11.087  1.00 0.00 ? 1099 ASN B H    5  
ATOM 7088  H HA   . ASN A 1 55 ? -2.007  10.946  12.635  1.00 0.00 ? 1099 ASN B HA   5  
ATOM 7089  H HB2  . ASN A 1 55 ? 0.232   9.042   13.227  1.00 0.00 ? 1099 ASN B HB2  5  
ATOM 7090  H HB3  . ASN A 1 55 ? -0.378  10.113  14.489  1.00 0.00 ? 1099 ASN B HB3  5  
ATOM 7091  H HD21 . ASN A 1 55 ? -1.597  7.770   12.029  1.00 0.00 ? 1099 ASN B HD21 5  
ATOM 7092  H HD22 . ASN A 1 55 ? -2.879  7.211   12.991  1.00 0.00 ? 1099 ASN B HD22 5  
ATOM 7093  N N    . THR A 1 56 ? 1.120   11.825  12.148  1.00 0.00 ? 1100 THR B N    5  
ATOM 7094  C CA   . THR A 1 56 ? 2.038   12.952  12.258  1.00 0.00 ? 1100 THR B CA   5  
ATOM 7095  C C    . THR A 1 56 ? 1.886   13.907  11.073  1.00 0.00 ? 1100 THR B C    5  
ATOM 7096  O O    . THR A 1 56 ? 2.553   14.940  11.018  1.00 0.00 ? 1100 THR B O    5  
ATOM 7097  C CB   . THR A 1 56 ? 3.479   12.444  12.331  1.00 0.00 ? 1100 THR B CB   5  
ATOM 7098  O OG1  . THR A 1 56 ? 4.336   13.511  12.713  1.00 0.00 ? 1100 THR B OG1  5  
ATOM 7099  C CG2  . THR A 1 56 ? 3.904   11.907  10.966  1.00 0.00 ? 1100 THR B CG2  5  
ATOM 7100  H H    . THR A 1 56 ? 1.402   11.015  11.671  1.00 0.00 ? 1100 THR B H    5  
ATOM 7101  H HA   . THR A 1 56 ? 1.819   13.490  13.168  1.00 0.00 ? 1100 THR B HA   5  
ATOM 7102  H HB   . THR A 1 56 ? 3.544   11.651  13.061  1.00 0.00 ? 1100 THR B HB   5  
ATOM 7103  H HG1  . THR A 1 56 ? 5.088   13.514  12.118  1.00 0.00 ? 1100 THR B HG1  5  
ATOM 7104  H HG21 . THR A 1 56 ? 3.151   11.227  10.600  1.00 0.00 ? 1100 THR B HG21 5  
ATOM 7105  H HG22 . THR A 1 56 ? 4.845   11.387  11.060  1.00 0.00 ? 1100 THR B HG22 5  
ATOM 7106  H HG23 . THR A 1 56 ? 4.014   12.729  10.273  1.00 0.00 ? 1100 THR B HG23 5  
ATOM 7107  N N    . SER A 1 57 ? 1.020   13.556  10.120  1.00 0.00 ? 1101 SER B N    5  
ATOM 7108  C CA   . SER A 1 57 ? 0.816   14.389  8.949   1.00 0.00 ? 1101 SER B CA   5  
ATOM 7109  C C    . SER A 1 57 ? 0.200   15.723  9.343   1.00 0.00 ? 1101 SER B C    5  
ATOM 7110  O O    . SER A 1 57 ? -0.762  15.776  10.109  1.00 0.00 ? 1101 SER B O    5  
ATOM 7111  C CB   . SER A 1 57 ? -0.105  13.676  7.960   1.00 0.00 ? 1101 SER B CB   5  
ATOM 7112  O OG   . SER A 1 57 ? -0.319  14.512  6.831   1.00 0.00 ? 1101 SER B OG   5  
ATOM 7113  H H    . SER A 1 57 ? 0.519   12.721  10.197  1.00 0.00 ? 1101 SER B H    5  
ATOM 7114  H HA   . SER A 1 57 ? 1.769   14.567  8.473   1.00 0.00 ? 1101 SER B HA   5  
ATOM 7115  H HB2  . SER A 1 57 ? 0.348   12.753  7.638   1.00 0.00 ? 1101 SER B HB2  5  
ATOM 7116  H HB3  . SER A 1 57 ? -1.049  13.459  8.442   1.00 0.00 ? 1101 SER B HB3  5  
ATOM 7117  H HG   . SER A 1 57 ? -0.661  15.350  7.145   1.00 0.00 ? 1101 SER B HG   5  
ATOM 7118  N N    . CYS A 1 58 ? 0.752   16.794  8.796   1.00 0.00 ? 1102 CYS B N    5  
ATOM 7119  C CA   . CYS A 1 58 ? 0.247   18.130  9.073   1.00 0.00 ? 1102 CYS B CA   5  
ATOM 7120  C C    . CYS A 1 58 ? -0.318  18.761  7.799   1.00 0.00 ? 1102 CYS B C    5  
ATOM 7121  O O    . CYS A 1 58 ? -0.884  19.854  7.839   1.00 0.00 ? 1102 CYS B O    5  
ATOM 7122  C CB   . CYS A 1 58 ? 1.370   19.007  9.627   1.00 0.00 ? 1102 CYS B CB   5  
ATOM 7123  S SG   . CYS A 1 58 ? 1.975   18.300  11.179  1.00 0.00 ? 1102 CYS B SG   5  
ATOM 7124  H H    . CYS A 1 58 ? 1.506   16.683  8.184   1.00 0.00 ? 1102 CYS B H    5  
ATOM 7125  H HA   . CYS A 1 58 ? -0.540  18.062  9.809   1.00 0.00 ? 1102 CYS B HA   5  
ATOM 7126  H HB2  . CYS A 1 58 ? 2.179   19.051  8.912   1.00 0.00 ? 1102 CYS B HB2  5  
ATOM 7127  H HB3  . CYS A 1 58 ? 0.993   20.003  9.808   1.00 0.00 ? 1102 CYS B HB3  5  
ATOM 7128  H HG   . CYS A 1 58 ? 2.415   17.471  10.976  1.00 0.00 ? 1102 CYS B HG   5  
ATOM 7129  N N    . ASP A 1 59 ? -0.159  18.068  6.670   1.00 0.00 ? 1103 ASP B N    5  
ATOM 7130  C CA   . ASP A 1 59 ? -0.654  18.580  5.397   1.00 0.00 ? 1103 ASP B CA   5  
ATOM 7131  C C    . ASP A 1 59 ? -1.765  17.686  4.852   1.00 0.00 ? 1103 ASP B C    5  
ATOM 7132  O O    . ASP A 1 59 ? -1.724  16.464  5.003   1.00 0.00 ? 1103 ASP B O    5  
ATOM 7133  C CB   . ASP A 1 59 ? 0.490   18.657  4.385   1.00 0.00 ? 1103 ASP B CB   5  
ATOM 7134  C CG   . ASP A 1 59 ? 1.457   19.770  4.775   1.00 0.00 ? 1103 ASP B CG   5  
ATOM 7135  O OD1  . ASP A 1 59 ? 1.087   20.586  5.604   1.00 0.00 ? 1103 ASP B OD1  5  
ATOM 7136  O OD2  . ASP A 1 59 ? 2.553   19.790  4.241   1.00 0.00 ? 1103 ASP B OD2  5  
ATOM 7137  H H    . ASP A 1 59 ? 0.299   17.200  6.691   1.00 0.00 ? 1103 ASP B H    5  
ATOM 7138  H HA   . ASP A 1 59 ? -1.049  19.573  5.550   1.00 0.00 ? 1103 ASP B HA   5  
ATOM 7139  H HB2  . ASP A 1 59 ? 1.016   17.714  4.366   1.00 0.00 ? 1103 ASP B HB2  5  
ATOM 7140  H HB3  . ASP A 1 59 ? 0.087   18.862  3.404   1.00 0.00 ? 1103 ASP B HB3  5  
ATOM 7141  N N    . ILE A 1 60 ? -2.755  18.303  4.215   1.00 0.00 ? 1104 ILE B N    5  
ATOM 7142  C CA   . ILE A 1 60 ? -3.869  17.554  3.651   1.00 0.00 ? 1104 ILE B CA   5  
ATOM 7143  C C    . ILE A 1 60 ? -3.410  16.730  2.450   1.00 0.00 ? 1104 ILE B C    5  
ATOM 7144  O O    . ILE A 1 60 ? -3.991  15.690  2.141   1.00 0.00 ? 1104 ILE B O    5  
ATOM 7145  C CB   . ILE A 1 60 ? -4.976  18.521  3.224   1.00 0.00 ? 1104 ILE B CB   5  
ATOM 7146  C CG1  . ILE A 1 60 ? -4.432  19.507  2.183   1.00 0.00 ? 1104 ILE B CG1  5  
ATOM 7147  C CG2  . ILE A 1 60 ? -5.479  19.297  4.441   1.00 0.00 ? 1104 ILE B CG2  5  
ATOM 7148  C CD1  . ILE A 1 60 ? -5.580  20.354  1.632   1.00 0.00 ? 1104 ILE B CD1  5  
ATOM 7149  H H    . ILE A 1 60 ? -2.737  19.277  4.123   1.00 0.00 ? 1104 ILE B H    5  
ATOM 7150  H HA   . ILE A 1 60 ? -4.261  16.888  4.402   1.00 0.00 ? 1104 ILE B HA   5  
ATOM 7151  H HB   . ILE A 1 60 ? -5.792  17.961  2.795   1.00 0.00 ? 1104 ILE B HB   5  
ATOM 7152  H HG12 . ILE A 1 60 ? -3.697  20.149  2.645   1.00 0.00 ? 1104 ILE B HG12 5  
ATOM 7153  H HG13 . ILE A 1 60 ? -3.976  18.961  1.373   1.00 0.00 ? 1104 ILE B HG13 5  
ATOM 7154  H HG21 . ILE A 1 60 ? -5.239  20.343  4.326   1.00 0.00 ? 1104 ILE B HG21 5  
ATOM 7155  H HG22 . ILE A 1 60 ? -5.003  18.914  5.333   1.00 0.00 ? 1104 ILE B HG22 5  
ATOM 7156  H HG23 . ILE A 1 60 ? -6.549  19.180  4.525   1.00 0.00 ? 1104 ILE B HG23 5  
ATOM 7157  H HD11 . ILE A 1 60 ? -5.792  21.161  2.318   1.00 0.00 ? 1104 ILE B HD11 5  
ATOM 7158  H HD12 . ILE A 1 60 ? -6.460  19.738  1.518   1.00 0.00 ? 1104 ILE B HD12 5  
ATOM 7159  H HD13 . ILE A 1 60 ? -5.296  20.761  0.674   1.00 0.00 ? 1104 ILE B HD13 5  
ATOM 7160  N N    . GLU A 1 61 ? -2.365  17.203  1.778   1.00 0.00 ? 1105 GLU B N    5  
ATOM 7161  C CA   . GLU A 1 61 ? -1.835  16.507  0.613   1.00 0.00 ? 1105 GLU B CA   5  
ATOM 7162  C C    . GLU A 1 61 ? -1.287  15.142  1.010   1.00 0.00 ? 1105 GLU B C    5  
ATOM 7163  O O    . GLU A 1 61 ? -1.549  14.136  0.352   1.00 0.00 ? 1105 GLU B O    5  
ATOM 7164  C CB   . GLU A 1 61 ? -0.720  17.342  -0.024  1.00 0.00 ? 1105 GLU B CB   5  
ATOM 7165  C CG   . GLU A 1 61 ? -1.322  18.587  -0.677  1.00 0.00 ? 1105 GLU B CG   5  
ATOM 7166  C CD   . GLU A 1 61 ? -0.211  19.517  -1.154  1.00 0.00 ? 1105 GLU B CD   5  
ATOM 7167  O OE1  . GLU A 1 61 ? 0.924   19.303  -0.759  1.00 0.00 ? 1105 GLU B OE1  5  
ATOM 7168  O OE2  . GLU A 1 61 ? -0.510  20.429  -1.907  1.00 0.00 ? 1105 GLU B OE2  5  
ATOM 7169  H H    . GLU A 1 61 ? -1.946  18.031  2.075   1.00 0.00 ? 1105 GLU B H    5  
ATOM 7170  H HA   . GLU A 1 61 ? -2.627  16.373  -0.109  1.00 0.00 ? 1105 GLU B HA   5  
ATOM 7171  H HB2  . GLU A 1 61 ? -0.014  17.640  0.740   1.00 0.00 ? 1105 GLU B HB2  5  
ATOM 7172  H HB3  . GLU A 1 61 ? -0.212  16.753  -0.774  1.00 0.00 ? 1105 GLU B HB3  5  
ATOM 7173  H HG2  . GLU A 1 61 ? -1.928  18.290  -1.522  1.00 0.00 ? 1105 GLU B HG2  5  
ATOM 7174  H HG3  . GLU A 1 61 ? -1.938  19.107  0.041   1.00 0.00 ? 1105 GLU B HG3  5  
ATOM 7175  N N    . LEU A 1 62 ? -0.533  15.115  2.104   1.00 0.00 ? 1106 LEU B N    5  
ATOM 7176  C CA   . LEU A 1 62 ? 0.036   13.869  2.588   1.00 0.00 ? 1106 LEU B CA   5  
ATOM 7177  C C    . LEU A 1 62 ? -1.072  12.935  3.062   1.00 0.00 ? 1106 LEU B C    5  
ATOM 7178  O O    . LEU A 1 62 ? -1.024  11.725  2.838   1.00 0.00 ? 1106 LEU B O    5  
ATOM 7179  C CB   . LEU A 1 62 ? 0.997   14.146  3.745   1.00 0.00 ? 1106 LEU B CB   5  
ATOM 7180  C CG   . LEU A 1 62 ? 1.616   12.829  4.215   1.00 0.00 ? 1106 LEU B CG   5  
ATOM 7181  C CD1  . LEU A 1 62 ? 2.502   12.255  3.109   1.00 0.00 ? 1106 LEU B CD1  5  
ATOM 7182  C CD2  . LEU A 1 62 ? 2.459   13.084  5.466   1.00 0.00 ? 1106 LEU B CD2  5  
ATOM 7183  H H    . LEU A 1 62 ? -0.363  15.943  2.597   1.00 0.00 ? 1106 LEU B H    5  
ATOM 7184  H HA   . LEU A 1 62 ? 0.577   13.397  1.785   1.00 0.00 ? 1106 LEU B HA   5  
ATOM 7185  H HB2  . LEU A 1 62 ? 1.779   14.815  3.411   1.00 0.00 ? 1106 LEU B HB2  5  
ATOM 7186  H HB3  . LEU A 1 62 ? 0.457   14.601  4.562   1.00 0.00 ? 1106 LEU B HB3  5  
ATOM 7187  H HG   . LEU A 1 62 ? 0.828   12.125  4.443   1.00 0.00 ? 1106 LEU B HG   5  
ATOM 7188  H HD11 . LEU A 1 62 ? 2.627   12.995  2.331   1.00 0.00 ? 1106 LEU B HD11 5  
ATOM 7189  H HD12 . LEU A 1 62 ? 2.035   11.373  2.697   1.00 0.00 ? 1106 LEU B HD12 5  
ATOM 7190  H HD13 . LEU A 1 62 ? 3.467   11.995  3.519   1.00 0.00 ? 1106 LEU B HD13 5  
ATOM 7191  H HD21 . LEU A 1 62 ? 3.433   12.635  5.341   1.00 0.00 ? 1106 LEU B HD21 5  
ATOM 7192  H HD22 . LEU A 1 62 ? 1.969   12.652  6.323   1.00 0.00 ? 1106 LEU B HD22 5  
ATOM 7193  H HD23 . LEU A 1 62 ? 2.570   14.150  5.612   1.00 0.00 ? 1106 LEU B HD23 5  
ATOM 7194  N N    . LEU A 1 63 ? -2.060  13.506  3.737   1.00 0.00 ? 1107 LEU B N    5  
ATOM 7195  C CA   . LEU A 1 63 ? -3.165  12.711  4.255   1.00 0.00 ? 1107 LEU B CA   5  
ATOM 7196  C C    . LEU A 1 63 ? -3.886  12.028  3.101   1.00 0.00 ? 1107 LEU B C    5  
ATOM 7197  O O    . LEU A 1 63 ? -4.188  10.840  3.156   1.00 0.00 ? 1107 LEU B O    5  
ATOM 7198  C CB   . LEU A 1 63 ? -4.139  13.629  4.995   1.00 0.00 ? 1107 LEU B CB   5  
ATOM 7199  C CG   . LEU A 1 63 ? -3.477  14.140  6.275   1.00 0.00 ? 1107 LEU B CG   5  
ATOM 7200  C CD1  . LEU A 1 63 ? -4.322  15.263  6.871   1.00 0.00 ? 1107 LEU B CD1  5  
ATOM 7201  C CD2  . LEU A 1 63 ? -3.369  12.994  7.284   1.00 0.00 ? 1107 LEU B CD2  5  
ATOM 7202  H H    . LEU A 1 63 ? -2.039  14.472  3.899   1.00 0.00 ? 1107 LEU B H    5  
ATOM 7203  H HA   . LEU A 1 63 ? -2.784  11.966  4.937   1.00 0.00 ? 1107 LEU B HA   5  
ATOM 7204  H HB2  . LEU A 1 63 ? -4.398  14.466  4.362   1.00 0.00 ? 1107 LEU B HB2  5  
ATOM 7205  H HB3  . LEU A 1 63 ? -5.032  13.078  5.247   1.00 0.00 ? 1107 LEU B HB3  5  
ATOM 7206  H HG   . LEU A 1 63 ? -2.493  14.515  6.045   1.00 0.00 ? 1107 LEU B HG   5  
ATOM 7207  H HD11 . LEU A 1 63 ? -4.093  16.191  6.363   1.00 0.00 ? 1107 LEU B HD11 5  
ATOM 7208  H HD12 . LEU A 1 63 ? -4.099  15.364  7.923   1.00 0.00 ? 1107 LEU B HD12 5  
ATOM 7209  H HD13 . LEU A 1 63 ? -5.370  15.035  6.745   1.00 0.00 ? 1107 LEU B HD13 5  
ATOM 7210  H HD21 . LEU A 1 63 ? -3.171  13.398  8.265   1.00 0.00 ? 1107 LEU B HD21 5  
ATOM 7211  H HD22 . LEU A 1 63 ? -2.561  12.337  6.995   1.00 0.00 ? 1107 LEU B HD22 5  
ATOM 7212  H HD23 . LEU A 1 63 ? -4.295  12.440  7.302   1.00 0.00 ? 1107 LEU B HD23 5  
ATOM 7213  N N    . ALA A 1 64 ? -4.125  12.788  2.046   1.00 0.00 ? 1108 ALA B N    5  
ATOM 7214  C CA   . ALA A 1 64 ? -4.776  12.264  0.860   1.00 0.00 ? 1108 ALA B CA   5  
ATOM 7215  C C    . ALA A 1 64 ? -3.922  11.178  0.217   1.00 0.00 ? 1108 ALA B C    5  
ATOM 7216  O O    . ALA A 1 64 ? -4.445  10.210  -0.335  1.00 0.00 ? 1108 ALA B O    5  
ATOM 7217  C CB   . ALA A 1 64 ? -5.020  13.395  -0.142  1.00 0.00 ? 1108 ALA B CB   5  
ATOM 7218  H H    . ALA A 1 64 ? -3.838  13.721  2.055   1.00 0.00 ? 1108 ALA B H    5  
ATOM 7219  H HA   . ALA A 1 64 ? -5.727  11.839  1.143   1.00 0.00 ? 1108 ALA B HA   5  
ATOM 7220  H HB1  . ALA A 1 64 ? -4.718  13.074  -1.128  1.00 0.00 ? 1108 ALA B HB1  5  
ATOM 7221  H HB2  . ALA A 1 64 ? -4.445  14.263  0.147   1.00 0.00 ? 1108 ALA B HB2  5  
ATOM 7222  H HB3  . ALA A 1 64 ? -6.072  13.646  -0.152  1.00 0.00 ? 1108 ALA B HB3  5  
ATOM 7223  N N    . ALA A 1 65 ? -2.603  11.355  0.274   1.00 0.00 ? 1109 ALA B N    5  
ATOM 7224  C CA   . ALA A 1 65 ? -1.694  10.392  -0.325  1.00 0.00 ? 1109 ALA B CA   5  
ATOM 7225  C C    . ALA A 1 65 ? -1.841  9.030   0.336   1.00 0.00 ? 1109 ALA B C    5  
ATOM 7226  O O    . ALA A 1 65 ? -1.873  8.000   -0.336  1.00 0.00 ? 1109 ALA B O    5  
ATOM 7227  C CB   . ALA A 1 65 ? -0.251  10.882  -0.177  1.00 0.00 ? 1109 ALA B CB   5  
ATOM 7228  H H    . ALA A 1 65 ? -2.239  12.142  0.729   1.00 0.00 ? 1109 ALA B H    5  
ATOM 7229  H HA   . ALA A 1 65 ? -1.925  10.299  -1.375  1.00 0.00 ? 1109 ALA B HA   5  
ATOM 7230  H HB1  . ALA A 1 65 ? 0.428   10.094  -0.467  1.00 0.00 ? 1109 ALA B HB1  5  
ATOM 7231  H HB2  . ALA A 1 65 ? -0.067  11.156  0.849   1.00 0.00 ? 1109 ALA B HB2  5  
ATOM 7232  H HB3  . ALA A 1 65 ? -0.097  11.740  -0.812  1.00 0.00 ? 1109 ALA B HB3  5  
ATOM 7233  N N    . CYS A 1 66 ? -1.929  9.034   1.656   1.00 0.00 ? 1110 CYS B N    5  
ATOM 7234  C CA   . CYS A 1 66 ? -2.076  7.795   2.400   1.00 0.00 ? 1110 CYS B CA   5  
ATOM 7235  C C    . CYS A 1 66 ? -3.425  7.165   2.110   1.00 0.00 ? 1110 CYS B C    5  
ATOM 7236  O O    . CYS A 1 66 ? -3.542  5.948   1.962   1.00 0.00 ? 1110 CYS B O    5  
ATOM 7237  C CB   . CYS A 1 66 ? -1.939  8.089   3.886   1.00 0.00 ? 1110 CYS B CB   5  
ATOM 7238  S SG   . CYS A 1 66 ? -0.234  8.588   4.185   1.00 0.00 ? 1110 CYS B SG   5  
ATOM 7239  H H    . CYS A 1 66 ? -1.898  9.888   2.141   1.00 0.00 ? 1110 CYS B H    5  
ATOM 7240  H HA   . CYS A 1 66 ? -1.294  7.111   2.105   1.00 0.00 ? 1110 CYS B HA   5  
ATOM 7241  H HB2  . CYS A 1 66 ? -2.609  8.887   4.165   1.00 0.00 ? 1110 CYS B HB2  5  
ATOM 7242  H HB3  . CYS A 1 66 ? -2.162  7.202   4.459   1.00 0.00 ? 1110 CYS B HB3  5  
ATOM 7243  H HG   . CYS A 1 66 ? 0.083   9.015   3.380   1.00 0.00 ? 1110 CYS B HG   5  
ATOM 7244  N N    . ARG A 1 67 ? -4.443  8.008   2.023   1.00 0.00 ? 1111 ARG B N    5  
ATOM 7245  C CA   . ARG A 1 67 ? -5.787  7.537   1.740   1.00 0.00 ? 1111 ARG B CA   5  
ATOM 7246  C C    . ARG A 1 67 ? -5.835  6.864   0.374   1.00 0.00 ? 1111 ARG B C    5  
ATOM 7247  O O    . ARG A 1 67 ? -6.437  5.802   0.208   1.00 0.00 ? 1111 ARG B O    5  
ATOM 7248  C CB   . ARG A 1 67 ? -6.742  8.732   1.755   1.00 0.00 ? 1111 ARG B CB   5  
ATOM 7249  C CG   . ARG A 1 67 ? -6.878  9.280   3.178   1.00 0.00 ? 1111 ARG B CG   5  
ATOM 7250  C CD   . ARG A 1 67 ? -7.631  8.277   4.047   1.00 0.00 ? 1111 ARG B CD   5  
ATOM 7251  N NE   . ARG A 1 67 ? -7.882  8.841   5.370   1.00 0.00 ? 1111 ARG B NE   5  
ATOM 7252  C CZ   . ARG A 1 67 ? -6.960  8.808   6.334   1.00 0.00 ? 1111 ARG B CZ   5  
ATOM 7253  N NH1  . ARG A 1 67 ? -5.785  8.269   6.122   1.00 0.00 ? 1111 ARG B NH1  5  
ATOM 7254  N NH2  . ARG A 1 67 ? -7.231  9.321   7.503   1.00 0.00 ? 1111 ARG B NH2  5  
ATOM 7255  H H    . ARG A 1 67 ? -4.284  8.969   2.147   1.00 0.00 ? 1111 ARG B H    5  
ATOM 7256  H HA   . ARG A 1 67 ? -6.082  6.829   2.490   1.00 0.00 ? 1111 ARG B HA   5  
ATOM 7257  H HB2  . ARG A 1 67 ? -6.338  9.511   1.112   1.00 0.00 ? 1111 ARG B HB2  5  
ATOM 7258  H HB3  . ARG A 1 67 ? -7.711  8.427   1.389   1.00 0.00 ? 1111 ARG B HB3  5  
ATOM 7259  H HG2  . ARG A 1 67 ? -5.900  9.439   3.595   1.00 0.00 ? 1111 ARG B HG2  5  
ATOM 7260  H HG3  . ARG A 1 67 ? -7.419  10.212  3.156   1.00 0.00 ? 1111 ARG B HG3  5  
ATOM 7261  H HD2  . ARG A 1 67 ? -8.566  8.033   3.575   1.00 0.00 ? 1111 ARG B HD2  5  
ATOM 7262  H HD3  . ARG A 1 67 ? -7.042  7.384   4.148   1.00 0.00 ? 1111 ARG B HD3  5  
ATOM 7263  H HE   . ARG A 1 67 ? -8.753  9.250   5.556   1.00 0.00 ? 1111 ARG B HE   5  
ATOM 7264  H HH11 . ARG A 1 67 ? -5.559  7.877   5.233   1.00 0.00 ? 1111 ARG B HH11 5  
ATOM 7265  H HH12 . ARG A 1 67 ? -5.108  8.252   6.855   1.00 0.00 ? 1111 ARG B HH12 5  
ATOM 7266  H HH21 . ARG A 1 67 ? -8.127  9.736   7.672   1.00 0.00 ? 1111 ARG B HH21 5  
ATOM 7267  H HH22 . ARG A 1 67 ? -6.545  9.303   8.230   1.00 0.00 ? 1111 ARG B HH22 5  
ATOM 7268  N N    . GLU A 1 68 ? -5.179  7.485   -0.589  1.00 0.00 ? 1112 GLU B N    5  
ATOM 7269  C CA   . GLU A 1 68 ? -5.132  6.940   -1.940  1.00 0.00 ? 1112 GLU B CA   5  
ATOM 7270  C C    . GLU A 1 68 ? -4.384  5.616   -1.953  1.00 0.00 ? 1112 GLU B C    5  
ATOM 7271  O O    . GLU A 1 68 ? -4.784  4.671   -2.635  1.00 0.00 ? 1112 GLU B O    5  
ATOM 7272  C CB   . GLU A 1 68 ? -4.434  7.916   -2.877  1.00 0.00 ? 1112 GLU B CB   5  
ATOM 7273  C CG   . GLU A 1 68 ? -4.475  7.363   -4.304  1.00 0.00 ? 1112 GLU B CG   5  
ATOM 7274  C CD   . GLU A 1 68 ? -3.850  8.360   -5.273  1.00 0.00 ? 1112 GLU B CD   5  
ATOM 7275  O OE1  . GLU A 1 68 ? -3.450  9.423   -4.823  1.00 0.00 ? 1112 GLU B OE1  5  
ATOM 7276  O OE2  . GLU A 1 68 ? -3.781  8.048   -6.449  1.00 0.00 ? 1112 GLU B OE2  5  
ATOM 7277  H H    . GLU A 1 68 ? -4.712  8.321   -0.387  1.00 0.00 ? 1112 GLU B H    5  
ATOM 7278  H HA   . GLU A 1 68 ? -6.140  6.779   -2.291  1.00 0.00 ? 1112 GLU B HA   5  
ATOM 7279  H HB2  . GLU A 1 68 ? -4.934  8.871   -2.841  1.00 0.00 ? 1112 GLU B HB2  5  
ATOM 7280  H HB3  . GLU A 1 68 ? -3.406  8.028   -2.566  1.00 0.00 ? 1112 GLU B HB3  5  
ATOM 7281  H HG2  . GLU A 1 68 ? -3.928  6.434   -4.343  1.00 0.00 ? 1112 GLU B HG2  5  
ATOM 7282  H HG3  . GLU A 1 68 ? -5.502  7.185   -4.588  1.00 0.00 ? 1112 GLU B HG3  5  
ATOM 7283  N N    . GLU A 1 69 ? -3.288  5.556   -1.200  1.00 0.00 ? 1113 GLU B N    5  
ATOM 7284  C CA   . GLU A 1 69 ? -2.492  4.338   -1.145  1.00 0.00 ? 1113 GLU B CA   5  
ATOM 7285  C C    . GLU A 1 69 ? -3.322  3.183   -0.613  1.00 0.00 ? 1113 GLU B C    5  
ATOM 7286  O O    . GLU A 1 69 ? -3.252  2.067   -1.126  1.00 0.00 ? 1113 GLU B O    5  
ATOM 7287  C CB   . GLU A 1 69 ? -1.271  4.545   -0.248  1.00 0.00 ? 1113 GLU B CB   5  
ATOM 7288  C CG   . GLU A 1 69 ? -0.467  3.246   -0.186  1.00 0.00 ? 1113 GLU B CG   5  
ATOM 7289  C CD   . GLU A 1 69 ? -0.035  2.840   -1.590  1.00 0.00 ? 1113 GLU B CD   5  
ATOM 7290  O OE1  . GLU A 1 69 ? 0.144   3.724   -2.412  1.00 0.00 ? 1113 GLU B OE1  5  
ATOM 7291  O OE2  . GLU A 1 69 ? 0.096   1.651   -1.828  1.00 0.00 ? 1113 GLU B OE2  5  
ATOM 7292  H H    . GLU A 1 69 ? -3.007  6.344   -0.678  1.00 0.00 ? 1113 GLU B H    5  
ATOM 7293  H HA   . GLU A 1 69 ? -2.156  4.096   -2.142  1.00 0.00 ? 1113 GLU B HA   5  
ATOM 7294  H HB2  . GLU A 1 69 ? -0.656  5.335   -0.654  1.00 0.00 ? 1113 GLU B HB2  5  
ATOM 7295  H HB3  . GLU A 1 69 ? -1.595  4.814   0.747   1.00 0.00 ? 1113 GLU B HB3  5  
ATOM 7296  H HG2  . GLU A 1 69 ? 0.408   3.396   0.430   1.00 0.00 ? 1113 GLU B HG2  5  
ATOM 7297  H HG3  . GLU A 1 69 ? -1.074  2.462   0.242   1.00 0.00 ? 1113 GLU B HG3  5  
ATOM 7298  N N    . PHE A 1 70 ? -4.104  3.455   0.419   1.00 0.00 ? 1114 PHE B N    5  
ATOM 7299  C CA   . PHE A 1 70 ? -4.935  2.420   1.013   1.00 0.00 ? 1114 PHE B CA   5  
ATOM 7300  C C    . PHE A 1 70 ? -6.001  1.964   0.027   1.00 0.00 ? 1114 PHE B C    5  
ATOM 7301  O O    . PHE A 1 70 ? -6.309  0.781   -0.045  1.00 0.00 ? 1114 PHE B O    5  
ATOM 7302  C CB   . PHE A 1 70 ? -5.599  2.922   2.300   1.00 0.00 ? 1114 PHE B CB   5  
ATOM 7303  C CG   . PHE A 1 70 ? -4.595  3.003   3.442   1.00 0.00 ? 1114 PHE B CG   5  
ATOM 7304  C CD1  . PHE A 1 70 ? -5.043  3.388   4.712   1.00 0.00 ? 1114 PHE B CD1  5  
ATOM 7305  C CD2  . PHE A 1 70 ? -3.229  2.720   3.244   1.00 0.00 ? 1114 PHE B CD2  5  
ATOM 7306  C CE1  . PHE A 1 70 ? -4.143  3.482   5.779   1.00 0.00 ? 1114 PHE B CE1  5  
ATOM 7307  C CE2  . PHE A 1 70 ? -2.329  2.816   4.317   1.00 0.00 ? 1114 PHE B CE2  5  
ATOM 7308  C CZ   . PHE A 1 70 ? -2.787  3.196   5.580   1.00 0.00 ? 1114 PHE B CZ   5  
ATOM 7309  H H    . PHE A 1 70 ? -4.119  4.361   0.786   1.00 0.00 ? 1114 PHE B H    5  
ATOM 7310  H HA   . PHE A 1 70 ? -4.315  1.569   1.247   1.00 0.00 ? 1114 PHE B HA   5  
ATOM 7311  H HB2  . PHE A 1 70 ? -6.014  3.902   2.125   1.00 0.00 ? 1114 PHE B HB2  5  
ATOM 7312  H HB3  . PHE A 1 70 ? -6.395  2.245   2.576   1.00 0.00 ? 1114 PHE B HB3  5  
ATOM 7313  H HD1  . PHE A 1 70 ? -6.092  3.608   4.870   1.00 0.00 ? 1114 PHE B HD1  5  
ATOM 7314  H HD2  . PHE A 1 70 ? -2.869  2.427   2.271   1.00 0.00 ? 1114 PHE B HD2  5  
ATOM 7315  H HE1  . PHE A 1 70 ? -4.494  3.776   6.756   1.00 0.00 ? 1114 PHE B HE1  5  
ATOM 7316  H HE2  . PHE A 1 70 ? -1.280  2.598   4.169   1.00 0.00 ? 1114 PHE B HE2  5  
ATOM 7317  H HZ   . PHE A 1 70 ? -2.093  3.268   6.403   1.00 0.00 ? 1114 PHE B HZ   5  
ATOM 7318  N N    . HIS A 1 71 ? -6.562  2.898   -0.735  1.00 0.00 ? 1115 HIS B N    5  
ATOM 7319  C CA   . HIS A 1 71 ? -7.588  2.531   -1.707  1.00 0.00 ? 1115 HIS B CA   5  
ATOM 7320  C C    . HIS A 1 71 ? -7.026  1.565   -2.744  1.00 0.00 ? 1115 HIS B C    5  
ATOM 7321  O O    . HIS A 1 71 ? -7.645  0.548   -3.063  1.00 0.00 ? 1115 HIS B O    5  
ATOM 7322  C CB   . HIS A 1 71 ? -8.119  3.779   -2.418  1.00 0.00 ? 1115 HIS B CB   5  
ATOM 7323  C CG   . HIS A 1 71 ? -9.091  4.488   -1.518  1.00 0.00 ? 1115 HIS B CG   5  
ATOM 7324  N ND1  . HIS A 1 71 ? -10.241 3.873   -1.052  1.00 0.00 ? 1115 HIS B ND1  5  
ATOM 7325  C CD2  . HIS A 1 71 ? -9.109  5.761   -1.004  1.00 0.00 ? 1115 HIS B CD2  5  
ATOM 7326  C CE1  . HIS A 1 71 ? -10.899 4.767   -0.293  1.00 0.00 ? 1115 HIS B CE1  5  
ATOM 7327  N NE2  . HIS A 1 71 ? -10.253 5.935   -0.232  1.00 0.00 ? 1115 HIS B NE2  5  
ATOM 7328  H H    . HIS A 1 71 ? -6.284  3.835   -0.647  1.00 0.00 ? 1115 HIS B H    5  
ATOM 7329  H HA   . HIS A 1 71 ? -8.405  2.051   -1.191  1.00 0.00 ? 1115 HIS B HA   5  
ATOM 7330  H HB2  . HIS A 1 71 ? -7.294  4.440   -2.646  1.00 0.00 ? 1115 HIS B HB2  5  
ATOM 7331  H HB3  . HIS A 1 71 ? -8.616  3.493   -3.331  1.00 0.00 ? 1115 HIS B HB3  5  
ATOM 7332  H HD1  . HIS A 1 71 ? -10.519 2.952   -1.235  1.00 0.00 ? 1115 HIS B HD1  5  
ATOM 7333  H HD2  . HIS A 1 71 ? -8.351  6.511   -1.174  1.00 0.00 ? 1115 HIS B HD2  5  
ATOM 7334  H HE1  . HIS A 1 71 ? -11.836 4.566   0.203   1.00 0.00 ? 1115 HIS B HE1  5  
ATOM 7335  N N    . ARG A 1 72 ? -5.848  1.886   -3.268  1.00 0.00 ? 1116 ARG B N    5  
ATOM 7336  C CA   . ARG A 1 72 ? -5.215  1.038   -4.272  1.00 0.00 ? 1116 ARG B CA   5  
ATOM 7337  C C    . ARG A 1 72 ? -4.794  -0.302  -3.674  1.00 0.00 ? 1116 ARG B C    5  
ATOM 7338  O O    . ARG A 1 72 ? -4.982  -1.353  -4.291  1.00 0.00 ? 1116 ARG B O    5  
ATOM 7339  C CB   . ARG A 1 72 ? -3.991  1.754   -4.847  1.00 0.00 ? 1116 ARG B CB   5  
ATOM 7340  C CG   . ARG A 1 72 ? -4.431  3.024   -5.584  1.00 0.00 ? 1116 ARG B CG   5  
ATOM 7341  C CD   . ARG A 1 72 ? -5.174  2.655   -6.870  1.00 0.00 ? 1116 ARG B CD   5  
ATOM 7342  N NE   . ARG A 1 72 ? -5.471  3.853   -7.647  1.00 0.00 ? 1116 ARG B NE   5  
ATOM 7343  C CZ   . ARG A 1 72 ? -6.097  3.788   -8.825  1.00 0.00 ? 1116 ARG B CZ   5  
ATOM 7344  N NH1  . ARG A 1 72 ? -6.462  2.633   -9.324  1.00 0.00 ? 1116 ARG B NH1  5  
ATOM 7345  N NH2  . ARG A 1 72 ? -6.353  4.885   -9.483  1.00 0.00 ? 1116 ARG B NH2  5  
ATOM 7346  H H    . ARG A 1 72 ? -5.398  2.707   -2.974  1.00 0.00 ? 1116 ARG B H    5  
ATOM 7347  H HA   . ARG A 1 72 ? -5.918  0.855   -5.066  1.00 0.00 ? 1116 ARG B HA   5  
ATOM 7348  H HB2  . ARG A 1 72 ? -3.318  2.016   -4.044  1.00 0.00 ? 1116 ARG B HB2  5  
ATOM 7349  H HB3  . ARG A 1 72 ? -3.485  1.097   -5.540  1.00 0.00 ? 1116 ARG B HB3  5  
ATOM 7350  H HG2  . ARG A 1 72 ? -5.086  3.596   -4.945  1.00 0.00 ? 1116 ARG B HG2  5  
ATOM 7351  H HG3  . ARG A 1 72 ? -3.562  3.615   -5.831  1.00 0.00 ? 1116 ARG B HG3  5  
ATOM 7352  H HD2  . ARG A 1 72 ? -4.562  1.991   -7.460  1.00 0.00 ? 1116 ARG B HD2  5  
ATOM 7353  H HD3  . ARG A 1 72 ? -6.099  2.156   -6.620  1.00 0.00 ? 1116 ARG B HD3  5  
ATOM 7354  H HE   . ARG A 1 72 ? -5.205  4.729   -7.294  1.00 0.00 ? 1116 ARG B HE   5  
ATOM 7355  H HH11 . ARG A 1 72 ? -6.275  1.786   -8.831  1.00 0.00 ? 1116 ARG B HH11 5  
ATOM 7356  H HH12 . ARG A 1 72 ? -6.929  2.599   -10.206 1.00 0.00 ? 1116 ARG B HH12 5  
ATOM 7357  H HH21 . ARG A 1 72 ? -6.080  5.771   -9.107  1.00 0.00 ? 1116 ARG B HH21 5  
ATOM 7358  H HH22 . ARG A 1 72 ? -6.822  4.840   -10.366 1.00 0.00 ? 1116 ARG B HH22 5  
ATOM 7359  N N    . ARG A 1 73 ? -4.232  -0.260  -2.472  1.00 0.00 ? 1117 ARG B N    5  
ATOM 7360  C CA   . ARG A 1 73 ? -3.797  -1.481  -1.804  1.00 0.00 ? 1117 ARG B CA   5  
ATOM 7361  C C    . ARG A 1 73 ? -4.976  -2.392  -1.482  1.00 0.00 ? 1117 ARG B C    5  
ATOM 7362  O O    . ARG A 1 73 ? -4.899  -3.610  -1.658  1.00 0.00 ? 1117 ARG B O    5  
ATOM 7363  C CB   . ARG A 1 73 ? -3.039  -1.133  -0.520  1.00 0.00 ? 1117 ARG B CB   5  
ATOM 7364  C CG   . ARG A 1 73 ? -1.645  -0.609  -0.873  1.00 0.00 ? 1117 ARG B CG   5  
ATOM 7365  C CD   . ARG A 1 73 ? -0.834  -0.448  0.411   1.00 0.00 ? 1117 ARG B CD   5  
ATOM 7366  N NE   . ARG A 1 73 ? 0.568   -0.160  0.112   1.00 0.00 ? 1117 ARG B NE   5  
ATOM 7367  C CZ   . ARG A 1 73 ? 1.517   -0.312  1.035   1.00 0.00 ? 1117 ARG B CZ   5  
ATOM 7368  N NH1  . ARG A 1 73 ? 1.215   -0.701  2.250   1.00 0.00 ? 1117 ARG B NH1  5  
ATOM 7369  N NH2  . ARG A 1 73 ? 2.759   -0.088  0.722   1.00 0.00 ? 1117 ARG B NH2  5  
ATOM 7370  H H    . ARG A 1 73 ? -4.111  0.603   -2.025  1.00 0.00 ? 1117 ARG B H    5  
ATOM 7371  H HA   . ARG A 1 73 ? -3.125  -2.011  -2.463  1.00 0.00 ? 1117 ARG B HA   5  
ATOM 7372  H HB2  . ARG A 1 73 ? -3.583  -0.364  0.019   1.00 0.00 ? 1117 ARG B HB2  5  
ATOM 7373  H HB3  . ARG A 1 73 ? -2.950  -2.013  0.097   1.00 0.00 ? 1117 ARG B HB3  5  
ATOM 7374  H HG2  . ARG A 1 73 ? -1.150  -1.312  -1.529  1.00 0.00 ? 1117 ARG B HG2  5  
ATOM 7375  H HG3  . ARG A 1 73 ? -1.732  0.345   -1.365  1.00 0.00 ? 1117 ARG B HG3  5  
ATOM 7376  H HD2  . ARG A 1 73 ? -1.245  0.364   0.990   1.00 0.00 ? 1117 ARG B HD2  5  
ATOM 7377  H HD3  . ARG A 1 73 ? -0.898  -1.361  0.986   1.00 0.00 ? 1117 ARG B HD3  5  
ATOM 7378  H HE   . ARG A 1 73 ? 0.819   0.160   -0.785  1.00 0.00 ? 1117 ARG B HE   5  
ATOM 7379  H HH11 . ARG A 1 73 ? 0.268   -0.889  2.501   1.00 0.00 ? 1117 ARG B HH11 5  
ATOM 7380  H HH12 . ARG A 1 73 ? 1.937   -0.810  2.930   1.00 0.00 ? 1117 ARG B HH12 5  
ATOM 7381  H HH21 . ARG A 1 73 ? 2.994   0.198   -0.204  1.00 0.00 ? 1117 ARG B HH21 5  
ATOM 7382  H HH22 . ARG A 1 73 ? 3.477   -0.207  1.408   1.00 0.00 ? 1117 ARG B HH22 5  
ATOM 7383  N N    . LEU A 1 74 ? -6.070  -1.799  -1.023  1.00 0.00 ? 1118 LEU B N    5  
ATOM 7384  C CA   . LEU A 1 74 ? -7.263  -2.565  -0.691  1.00 0.00 ? 1118 LEU B CA   5  
ATOM 7385  C C    . LEU A 1 74 ? -7.837  -3.223  -1.940  1.00 0.00 ? 1118 LEU B C    5  
ATOM 7386  O O    . LEU A 1 74 ? -8.282  -4.371  -1.899  1.00 0.00 ? 1118 LEU B O    5  
ATOM 7387  C CB   . LEU A 1 74 ? -8.307  -1.644  -0.056  1.00 0.00 ? 1118 LEU B CB   5  
ATOM 7388  C CG   . LEU A 1 74 ? -7.853  -1.252  1.354   1.00 0.00 ? 1118 LEU B CG   5  
ATOM 7389  C CD1  . LEU A 1 74 ? -8.690  -0.074  1.854   1.00 0.00 ? 1118 LEU B CD1  5  
ATOM 7390  C CD2  . LEU A 1 74 ? -8.051  -2.440  2.299   1.00 0.00 ? 1118 LEU B CD2  5  
ATOM 7391  H H    . LEU A 1 74 ? -6.078  -0.828  -0.913  1.00 0.00 ? 1118 LEU B H    5  
ATOM 7392  H HA   . LEU A 1 74 ? -6.999  -3.334  0.020   1.00 0.00 ? 1118 LEU B HA   5  
ATOM 7393  H HB2  . LEU A 1 74 ? -8.416  -0.755  -0.660  1.00 0.00 ? 1118 LEU B HB2  5  
ATOM 7394  H HB3  . LEU A 1 74 ? -9.254  -2.159  0.005   1.00 0.00 ? 1118 LEU B HB3  5  
ATOM 7395  H HG   . LEU A 1 74 ? -6.810  -0.975  1.336   1.00 0.00 ? 1118 LEU B HG   5  
ATOM 7396  H HD11 . LEU A 1 74 ? -8.870  -0.184  2.914   1.00 0.00 ? 1118 LEU B HD11 5  
ATOM 7397  H HD12 . LEU A 1 74 ? -9.633  -0.051  1.328   1.00 0.00 ? 1118 LEU B HD12 5  
ATOM 7398  H HD13 . LEU A 1 74 ? -8.156  0.848   1.675   1.00 0.00 ? 1118 LEU B HD13 5  
ATOM 7399  H HD21 . LEU A 1 74 ? -8.270  -2.077  3.293   1.00 0.00 ? 1118 LEU B HD21 5  
ATOM 7400  H HD22 . LEU A 1 74 ? -7.150  -3.035  2.324   1.00 0.00 ? 1118 LEU B HD22 5  
ATOM 7401  H HD23 . LEU A 1 74 ? -8.874  -3.045  1.949   1.00 0.00 ? 1118 LEU B HD23 5  
ATOM 7402  N N    . LYS A 1 75 ? -7.822  -2.488  -3.049  1.00 0.00 ? 1119 LYS B N    5  
ATOM 7403  C CA   . LYS A 1 75 ? -8.342  -3.010  -4.305  1.00 0.00 ? 1119 LYS B CA   5  
ATOM 7404  C C    . LYS A 1 75 ? -7.553  -4.241  -4.743  1.00 0.00 ? 1119 LYS B C    5  
ATOM 7405  O O    . LYS A 1 75 ? -8.130  -5.244  -5.166  1.00 0.00 ? 1119 LYS B O    5  
ATOM 7406  C CB   . LYS A 1 75 ? -8.233  -1.948  -5.396  1.00 0.00 ? 1119 LYS B CB   5  
ATOM 7407  C CG   . LYS A 1 75 ? -8.910  -2.458  -6.669  1.00 0.00 ? 1119 LYS B CG   5  
ATOM 7408  C CD   . LYS A 1 75 ? -8.693  -1.459  -7.805  1.00 0.00 ? 1119 LYS B CD   5  
ATOM 7409  C CE   . LYS A 1 75 ? -7.268  -1.611  -8.338  1.00 0.00 ? 1119 LYS B CE   5  
ATOM 7410  N NZ   . LYS A 1 75 ? -7.082  -0.725  -9.524  1.00 0.00 ? 1119 LYS B NZ   5  
ATOM 7411  H H    . LYS A 1 75 ? -7.454  -1.578  -3.021  1.00 0.00 ? 1119 LYS B H    5  
ATOM 7412  H HA   . LYS A 1 75 ? -9.380  -3.279  -4.179  1.00 0.00 ? 1119 LYS B HA   5  
ATOM 7413  H HB2  . LYS A 1 75 ? -8.718  -1.041  -5.064  1.00 0.00 ? 1119 LYS B HB2  5  
ATOM 7414  H HB3  . LYS A 1 75 ? -7.192  -1.749  -5.597  1.00 0.00 ? 1119 LYS B HB3  5  
ATOM 7415  H HG2  . LYS A 1 75 ? -8.487  -3.412  -6.944  1.00 0.00 ? 1119 LYS B HG2  5  
ATOM 7416  H HG3  . LYS A 1 75 ? -9.970  -2.573  -6.492  1.00 0.00 ? 1119 LYS B HG3  5  
ATOM 7417  H HD2  . LYS A 1 75 ? -9.401  -1.654  -8.599  1.00 0.00 ? 1119 LYS B HD2  5  
ATOM 7418  H HD3  . LYS A 1 75 ? -8.832  -0.455  -7.435  1.00 0.00 ? 1119 LYS B HD3  5  
ATOM 7419  H HE2  . LYS A 1 75 ? -6.564  -1.335  -7.569  1.00 0.00 ? 1119 LYS B HE2  5  
ATOM 7420  H HE3  . LYS A 1 75 ? -7.101  -2.640  -8.627  1.00 0.00 ? 1119 LYS B HE3  5  
ATOM 7421  H HZ1  . LYS A 1 75 ? -7.095  -1.300  -10.391 1.00 0.00 ? 1119 LYS B HZ1  5  
ATOM 7422  H HZ2  . LYS A 1 75 ? -6.169  -0.232  -9.447  1.00 0.00 ? 1119 LYS B HZ2  5  
ATOM 7423  H HZ3  . LYS A 1 75 ? -7.852  -0.029  -9.561  1.00 0.00 ? 1119 LYS B HZ3  5  
ATOM 7424  N N    . VAL A 1 76 ? -6.229  -4.153  -4.646  1.00 0.00 ? 1120 VAL B N    5  
ATOM 7425  C CA   . VAL A 1 76 ? -5.365  -5.259  -5.039  1.00 0.00 ? 1120 VAL B CA   5  
ATOM 7426  C C    . VAL A 1 76 ? -5.634  -6.470  -4.160  1.00 0.00 ? 1120 VAL B C    5  
ATOM 7427  O O    . VAL A 1 76 ? -5.691  -7.600  -4.639  1.00 0.00 ? 1120 VAL B O    5  
ATOM 7428  C CB   . VAL A 1 76 ? -3.898  -4.849  -4.921  1.00 0.00 ? 1120 VAL B CB   5  
ATOM 7429  C CG1  . VAL A 1 76 ? -3.004  -6.072  -5.141  1.00 0.00 ? 1120 VAL B CG1  5  
ATOM 7430  C CG2  . VAL A 1 76 ? -3.580  -3.789  -5.979  1.00 0.00 ? 1120 VAL B CG2  5  
ATOM 7431  H H    . VAL A 1 76 ? -5.823  -3.326  -4.306  1.00 0.00 ? 1120 VAL B H    5  
ATOM 7432  H HA   . VAL A 1 76 ? -5.575  -5.518  -6.067  1.00 0.00 ? 1120 VAL B HA   5  
ATOM 7433  H HB   . VAL A 1 76 ? -3.715  -4.443  -3.936  1.00 0.00 ? 1120 VAL B HB   5  
ATOM 7434  H HG11 . VAL A 1 76 ? -1.970  -5.761  -5.176  1.00 0.00 ? 1120 VAL B HG11 5  
ATOM 7435  H HG12 . VAL A 1 76 ? -3.267  -6.546  -6.075  1.00 0.00 ? 1120 VAL B HG12 5  
ATOM 7436  H HG13 . VAL A 1 76 ? -3.143  -6.774  -4.332  1.00 0.00 ? 1120 VAL B HG13 5  
ATOM 7437  H HG21 . VAL A 1 76 ? -2.758  -4.126  -6.591  1.00 0.00 ? 1120 VAL B HG21 5  
ATOM 7438  H HG22 . VAL A 1 76 ? -3.312  -2.865  -5.491  1.00 0.00 ? 1120 VAL B HG22 5  
ATOM 7439  H HG23 . VAL A 1 76 ? -4.450  -3.630  -6.598  1.00 0.00 ? 1120 VAL B HG23 5  
ATOM 7440  N N    . TYR A 1 77 ? -5.799  -6.220  -2.868  1.00 0.00 ? 1121 TYR B N    5  
ATOM 7441  C CA   . TYR A 1 77 ? -6.064  -7.296  -1.919  1.00 0.00 ? 1121 TYR B CA   5  
ATOM 7442  C C    . TYR A 1 77 ? -7.335  -8.038  -2.305  1.00 0.00 ? 1121 TYR B C    5  
ATOM 7443  O O    . TYR A 1 77 ? -7.364  -9.269  -2.332  1.00 0.00 ? 1121 TYR B O    5  
ATOM 7444  C CB   . TYR A 1 77 ? -6.210  -6.732  -0.506  1.00 0.00 ? 1121 TYR B CB   5  
ATOM 7445  C CG   . TYR A 1 77 ? -6.636  -7.834  0.435   1.00 0.00 ? 1121 TYR B CG   5  
ATOM 7446  C CD1  . TYR A 1 77 ? -5.707  -8.787  0.871   1.00 0.00 ? 1121 TYR B CD1  5  
ATOM 7447  C CD2  . TYR A 1 77 ? -7.965  -7.901  0.874   1.00 0.00 ? 1121 TYR B CD2  5  
ATOM 7448  C CE1  . TYR A 1 77 ? -6.106  -9.806  1.744   1.00 0.00 ? 1121 TYR B CE1  5  
ATOM 7449  C CE2  . TYR A 1 77 ? -8.364  -8.921  1.747   1.00 0.00 ? 1121 TYR B CE2  5  
ATOM 7450  C CZ   . TYR A 1 77 ? -7.434  -9.873  2.183   1.00 0.00 ? 1121 TYR B CZ   5  
ATOM 7451  O OH   . TYR A 1 77 ? -7.828  -10.878 3.044   1.00 0.00 ? 1121 TYR B OH   5  
ATOM 7452  H H    . TYR A 1 77 ? -5.745  -5.294  -2.546  1.00 0.00 ? 1121 TYR B H    5  
ATOM 7453  H HA   . TYR A 1 77 ? -5.236  -7.989  -1.935  1.00 0.00 ? 1121 TYR B HA   5  
ATOM 7454  H HB2  . TYR A 1 77 ? -5.261  -6.327  -0.181  1.00 0.00 ? 1121 TYR B HB2  5  
ATOM 7455  H HB3  . TYR A 1 77 ? -6.954  -5.950  -0.506  1.00 0.00 ? 1121 TYR B HB3  5  
ATOM 7456  H HD1  . TYR A 1 77 ? -4.683  -8.735  0.533   1.00 0.00 ? 1121 TYR B HD1  5  
ATOM 7457  H HD2  . TYR A 1 77 ? -8.682  -7.168  0.538   1.00 0.00 ? 1121 TYR B HD2  5  
ATOM 7458  H HE1  . TYR A 1 77 ? -5.390  -10.540 2.081   1.00 0.00 ? 1121 TYR B HE1  5  
ATOM 7459  H HE2  . TYR A 1 77 ? -9.388  -8.973  2.083   1.00 0.00 ? 1121 TYR B HE2  5  
ATOM 7460  H HH   . TYR A 1 77 ? -7.419  -11.696 2.755   1.00 0.00 ? 1121 TYR B HH   5  
ATOM 7461  N N    . HIS A 1 78 ? -8.382  -7.283  -2.604  1.00 0.00 ? 1122 HIS B N    5  
ATOM 7462  C CA   . HIS A 1 78 ? -9.652  -7.885  -2.987  1.00 0.00 ? 1122 HIS B CA   5  
ATOM 7463  C C    . HIS A 1 78 ? -9.466  -8.750  -4.229  1.00 0.00 ? 1122 HIS B C    5  
ATOM 7464  O O    . HIS A 1 78 ? -9.937  -9.885  -4.281  1.00 0.00 ? 1122 HIS B O    5  
ATOM 7465  C CB   . HIS A 1 78 ? -10.686 -6.792  -3.271  1.00 0.00 ? 1122 HIS B CB   5  
ATOM 7466  C CG   . HIS A 1 78 ? -11.980 -7.420  -3.712  1.00 0.00 ? 1122 HIS B CG   5  
ATOM 7467  N ND1  . HIS A 1 78 ? -12.826 -8.072  -2.827  1.00 0.00 ? 1122 HIS B ND1  5  
ATOM 7468  C CD2  . HIS A 1 78 ? -12.590 -7.500  -4.940  1.00 0.00 ? 1122 HIS B CD2  5  
ATOM 7469  C CE1  . HIS A 1 78 ? -13.887 -8.512  -3.529  1.00 0.00 ? 1122 HIS B CE1  5  
ATOM 7470  N NE2  . HIS A 1 78 ? -13.792 -8.190  -4.823  1.00 0.00 ? 1122 HIS B NE2  5  
ATOM 7471  H H    . HIS A 1 78 ? -8.299  -6.306  -2.568  1.00 0.00 ? 1122 HIS B H    5  
ATOM 7472  H HA   . HIS A 1 78 ? -10.006 -8.502  -2.177  1.00 0.00 ? 1122 HIS B HA   5  
ATOM 7473  H HB2  . HIS A 1 78 ? -10.854 -6.214  -2.373  1.00 0.00 ? 1122 HIS B HB2  5  
ATOM 7474  H HB3  . HIS A 1 78 ? -10.318 -6.142  -4.052  1.00 0.00 ? 1122 HIS B HB3  5  
ATOM 7475  H HD1  . HIS A 1 78 ? -12.679 -8.189  -1.866  1.00 0.00 ? 1122 HIS B HD1  5  
ATOM 7476  H HD2  . HIS A 1 78 ? -12.195 -7.090  -5.857  1.00 0.00 ? 1122 HIS B HD2  5  
ATOM 7477  H HE1  . HIS A 1 78 ? -14.713 -9.058  -3.099  1.00 0.00 ? 1122 HIS B HE1  5  
ATOM 7478  N N    . ALA A 1 79 ? -8.776  -8.210  -5.228  1.00 0.00 ? 1123 ALA B N    5  
ATOM 7479  C CA   . ALA A 1 79 ? -8.539  -8.954  -6.459  1.00 0.00 ? 1123 ALA B CA   5  
ATOM 7480  C C    . ALA A 1 79 ? -7.734  -10.226 -6.185  1.00 0.00 ? 1123 ALA B C    5  
ATOM 7481  O O    . ALA A 1 79 ? -8.038  -11.287 -6.727  1.00 0.00 ? 1123 ALA B O    5  
ATOM 7482  C CB   . ALA A 1 79 ? -7.787  -8.074  -7.461  1.00 0.00 ? 1123 ALA B CB   5  
ATOM 7483  H H    . ALA A 1 79 ? -8.417  -7.301  -5.137  1.00 0.00 ? 1123 ALA B H    5  
ATOM 7484  H HA   . ALA A 1 79 ? -9.492  -9.229  -6.886  1.00 0.00 ? 1123 ALA B HA   5  
ATOM 7485  H HB1  . ALA A 1 79 ? -8.375  -7.195  -7.679  1.00 0.00 ? 1123 ALA B HB1  5  
ATOM 7486  H HB2  . ALA A 1 79 ? -7.618  -8.629  -8.372  1.00 0.00 ? 1123 ALA B HB2  5  
ATOM 7487  H HB3  . ALA A 1 79 ? -6.839  -7.777  -7.038  1.00 0.00 ? 1123 ALA B HB3  5  
ATOM 7488  N N    . TRP A 1 80 ? -6.713  -10.119 -5.337  1.00 0.00 ? 1124 TRP B N    5  
ATOM 7489  C CA   . TRP A 1 80 ? -5.887  -11.259 -5.006  1.00 0.00 ? 1124 TRP B CA   5  
ATOM 7490  C C    . TRP A 1 80 ? -6.725  -12.355 -4.352  1.00 0.00 ? 1124 TRP B C    5  
ATOM 7491  O O    . TRP A 1 80 ? -6.624  -13.528 -4.716  1.00 0.00 ? 1124 TRP B O    5  
ATOM 7492  C CB   . TRP A 1 80 ? -4.774  -10.802 -4.070  1.00 0.00 ? 1124 TRP B CB   5  
ATOM 7493  C CG   . TRP A 1 80 ? -3.943  -11.970 -3.700  1.00 0.00 ? 1124 TRP B CG   5  
ATOM 7494  C CD1  . TRP A 1 80 ? -2.995  -12.516 -4.484  1.00 0.00 ? 1124 TRP B CD1  5  
ATOM 7495  C CD2  . TRP A 1 80 ? -3.960  -12.735 -2.472  1.00 0.00 ? 1124 TRP B CD2  5  
ATOM 7496  N NE1  . TRP A 1 80 ? -2.429  -13.590 -3.816  1.00 0.00 ? 1124 TRP B NE1  5  
ATOM 7497  C CE2  . TRP A 1 80 ? -2.993  -13.761 -2.566  1.00 0.00 ? 1124 TRP B CE2  5  
ATOM 7498  C CE3  . TRP A 1 80 ? -4.721  -12.636 -1.299  1.00 0.00 ? 1124 TRP B CE3  5  
ATOM 7499  C CZ2  . TRP A 1 80 ? -2.790  -14.664 -1.522  1.00 0.00 ? 1124 TRP B CZ2  5  
ATOM 7500  C CZ3  . TRP A 1 80 ? -4.519  -13.538 -0.245  1.00 0.00 ? 1124 TRP B CZ3  5  
ATOM 7501  C CH2  . TRP A 1 80 ? -3.554  -14.552 -0.356  1.00 0.00 ? 1124 TRP B CH2  5  
ATOM 7502  H H    . TRP A 1 80 ? -6.510  -9.260  -4.924  1.00 0.00 ? 1124 TRP B H    5  
ATOM 7503  H HA   . TRP A 1 80 ? -5.445  -11.647 -5.910  1.00 0.00 ? 1124 TRP B HA   5  
ATOM 7504  H HB2  . TRP A 1 80 ? -4.163  -10.064 -4.569  1.00 0.00 ? 1124 TRP B HB2  5  
ATOM 7505  H HB3  . TRP A 1 80 ? -5.206  -10.369 -3.179  1.00 0.00 ? 1124 TRP B HB3  5  
ATOM 7506  H HD1  . TRP A 1 80 ? -2.732  -12.171 -5.474  1.00 0.00 ? 1124 TRP B HD1  5  
ATOM 7507  H HE1  . TRP A 1 80 ? -1.715  -14.164 -4.166  1.00 0.00 ? 1124 TRP B HE1  5  
ATOM 7508  H HE3  . TRP A 1 80 ? -5.469  -11.856 -1.211  1.00 0.00 ? 1124 TRP B HE3  5  
ATOM 7509  H HZ2  . TRP A 1 80 ? -2.045  -15.442 -1.612  1.00 0.00 ? 1124 TRP B HZ2  5  
ATOM 7510  H HZ3  . TRP A 1 80 ? -5.106  -13.449 0.656   1.00 0.00 ? 1124 TRP B HZ3  5  
ATOM 7511  H HH2  . TRP A 1 80 ? -3.400  -15.246 0.457   1.00 0.00 ? 1124 TRP B HH2  5  
ATOM 7512  N N    . LYS A 1 81 ? -7.558  -11.959 -3.399  1.00 0.00 ? 1125 LYS B N    5  
ATOM 7513  C CA   . LYS A 1 81 ? -8.430  -12.899 -2.701  1.00 0.00 ? 1125 LYS B CA   5  
ATOM 7514  C C    . LYS A 1 81 ? -9.401  -13.533 -3.670  1.00 0.00 ? 1125 LYS B C    5  
ATOM 7515  O O    . LYS A 1 81 ? -9.739  -14.699 -3.544  1.00 0.00 ? 1125 LYS B O    5  
ATOM 7516  C CB   . LYS A 1 81 ? -9.201  -12.172 -1.594  1.00 0.00 ? 1125 LYS B CB   5  
ATOM 7517  C CG   . LYS A 1 81 ? -8.244  -11.789 -0.465  1.00 0.00 ? 1125 LYS B CG   5  
ATOM 7518  C CD   . LYS A 1 81 ? -7.904  -13.028 0.358   1.00 0.00 ? 1125 LYS B CD   5  
ATOM 7519  C CE   . LYS A 1 81 ? -9.054  -13.342 1.316   1.00 0.00 ? 1125 LYS B CE   5  
ATOM 7520  N NZ   . LYS A 1 81 ? -8.672  -14.481 2.198   1.00 0.00 ? 1125 LYS B NZ   5  
ATOM 7521  H H    . LYS A 1 81 ? -7.597  -11.007 -3.163  1.00 0.00 ? 1125 LYS B H    5  
ATOM 7522  H HA   . LYS A 1 81 ? -7.835  -13.684 -2.273  1.00 0.00 ? 1125 LYS B HA   5  
ATOM 7523  H HB2  . LYS A 1 81 ? -9.653  -11.278 -2.000  1.00 0.00 ? 1125 LYS B HB2  5  
ATOM 7524  H HB3  . LYS A 1 81 ? -9.972  -12.820 -1.205  1.00 0.00 ? 1125 LYS B HB3  5  
ATOM 7525  H HG2  . LYS A 1 81 ? -7.339  -11.375 -0.884  1.00 0.00 ? 1125 LYS B HG2  5  
ATOM 7526  H HG3  . LYS A 1 81 ? -8.715  -11.055 0.174   1.00 0.00 ? 1125 LYS B HG3  5  
ATOM 7527  H HD2  . LYS A 1 81 ? -7.755  -13.864 -0.306  1.00 0.00 ? 1125 LYS B HD2  5  
ATOM 7528  H HD3  . LYS A 1 81 ? -7.003  -12.851 0.922   1.00 0.00 ? 1125 LYS B HD3  5  
ATOM 7529  H HE2  . LYS A 1 81 ? -9.264  -12.472 1.922   1.00 0.00 ? 1125 LYS B HE2  5  
ATOM 7530  H HE3  . LYS A 1 81 ? -9.934  -13.606 0.748   1.00 0.00 ? 1125 LYS B HE3  5  
ATOM 7531  H HZ1  . LYS A 1 81 ? -8.494  -14.130 3.161   1.00 0.00 ? 1125 LYS B HZ1  5  
ATOM 7532  H HZ2  . LYS A 1 81 ? -7.813  -14.935 1.828   1.00 0.00 ? 1125 LYS B HZ2  5  
ATOM 7533  H HZ3  . LYS A 1 81 ? -9.447  -15.174 2.224   1.00 0.00 ? 1125 LYS B HZ3  5  
ATOM 7534  N N    . SER A 1 82 ? -9.851  -12.753 -4.623  1.00 0.00 ? 1126 SER B N    5  
ATOM 7535  C CA   . SER A 1 82 ? -10.793 -13.254 -5.613  1.00 0.00 ? 1126 SER B CA   5  
ATOM 7536  C C    . SER A 1 82 ? -10.168 -14.401 -6.396  1.00 0.00 ? 1126 SER B C    5  
ATOM 7537  O O    . SER A 1 82 ? -10.820 -15.406 -6.666  1.00 0.00 ? 1126 SER B O    5  
ATOM 7538  C CB   . SER A 1 82 ? -11.196 -12.133 -6.575  1.00 0.00 ? 1126 SER B CB   5  
ATOM 7539  O OG   . SER A 1 82 ? -11.926 -11.145 -5.862  1.00 0.00 ? 1126 SER B OG   5  
ATOM 7540  H H    . SER A 1 82 ? -9.541  -11.832 -4.662  1.00 0.00 ? 1126 SER B H    5  
ATOM 7541  H HA   . SER A 1 82 ? -11.676 -13.614 -5.107  1.00 0.00 ? 1126 SER B HA   5  
ATOM 7542  H HB2  . SER A 1 82 ? -10.313 -11.686 -6.999  1.00 0.00 ? 1126 SER B HB2  5  
ATOM 7543  H HB3  . SER A 1 82 ? -11.807 -12.544 -7.369  1.00 0.00 ? 1126 SER B HB3  5  
ATOM 7544  H HG   . SER A 1 82 ? -11.766 -10.296 -6.283  1.00 0.00 ? 1126 SER B HG   5  
ATOM 7545  N N    . LYS A 1 83 ? -8.903  -14.243 -6.763  1.00 0.00 ? 1127 LYS B N    5  
ATOM 7546  C CA   . LYS A 1 83 ? -8.203  -15.279 -7.523  1.00 0.00 ? 1127 LYS B CA   5  
ATOM 7547  C C    . LYS A 1 83 ? -8.034  -16.552 -6.697  1.00 0.00 ? 1127 LYS B C    5  
ATOM 7548  O O    . LYS A 1 83 ? -8.345  -17.651 -7.155  1.00 0.00 ? 1127 LYS B O    5  
ATOM 7549  C CB   . LYS A 1 83 ? -6.824  -14.767 -7.909  1.00 0.00 ? 1127 LYS B CB   5  
ATOM 7550  C CG   . LYS A 1 83 ? -6.973  -13.564 -8.832  1.00 0.00 ? 1127 LYS B CG   5  
ATOM 7551  C CD   . LYS A 1 83 ? -5.593  -13.005 -9.159  1.00 0.00 ? 1127 LYS B CD   5  
ATOM 7552  C CE   . LYS A 1 83 ? -5.752  -11.648 -9.837  1.00 0.00 ? 1127 LYS B CE   5  
ATOM 7553  N NZ   . LYS A 1 83 ? -6.451  -11.816 -11.144 1.00 0.00 ? 1127 LYS B NZ   5  
ATOM 7554  H H    . LYS A 1 83 ? -8.430  -13.415 -6.524  1.00 0.00 ? 1127 LYS B H    5  
ATOM 7555  H HA   . LYS A 1 83 ? -8.760  -15.503 -8.419  1.00 0.00 ? 1127 LYS B HA   5  
ATOM 7556  H HB2  . LYS A 1 83 ? -6.291  -14.469 -7.017  1.00 0.00 ? 1127 LYS B HB2  5  
ATOM 7557  H HB3  . LYS A 1 83 ? -6.276  -15.545 -8.419  1.00 0.00 ? 1127 LYS B HB3  5  
ATOM 7558  H HG2  . LYS A 1 83 ? -7.467  -13.871 -9.742  1.00 0.00 ? 1127 LYS B HG2  5  
ATOM 7559  H HG3  . LYS A 1 83 ? -7.561  -12.809 -8.341  1.00 0.00 ? 1127 LYS B HG3  5  
ATOM 7560  H HD2  . LYS A 1 83 ? -5.023  -12.889 -8.248  1.00 0.00 ? 1127 LYS B HD2  5  
ATOM 7561  H HD3  . LYS A 1 83 ? -5.078  -13.680 -9.825  1.00 0.00 ? 1127 LYS B HD3  5  
ATOM 7562  H HE2  . LYS A 1 83 ? -6.335  -11.002 -9.197  1.00 0.00 ? 1127 LYS B HE2  5  
ATOM 7563  H HE3  . LYS A 1 83 ? -4.778  -11.212 -9.999  1.00 0.00 ? 1127 LYS B HE3  5  
ATOM 7564  H HZ1  . LYS A 1 83 ? -7.381  -12.251 -10.986 1.00 0.00 ? 1127 LYS B HZ1  5  
ATOM 7565  H HZ2  . LYS A 1 83 ? -5.881  -12.426 -11.765 1.00 0.00 ? 1127 LYS B HZ2  5  
ATOM 7566  H HZ3  . LYS A 1 83 ? -6.578  -10.886 -11.592 1.00 0.00 ? 1127 LYS B HZ3  5  
ATOM 7567  N N    . ASN A 1 84 ? -7.526  -16.391 -5.480  1.00 0.00 ? 1128 ASN B N    5  
ATOM 7568  C CA   . ASN A 1 84 ? -7.300  -17.536 -4.594  1.00 0.00 ? 1128 ASN B CA   5  
ATOM 7569  C C    . ASN A 1 84 ? -8.616  -18.185 -4.180  1.00 0.00 ? 1128 ASN B C    5  
ATOM 7570  O O    . ASN A 1 84 ? -8.722  -19.409 -4.100  1.00 0.00 ? 1128 ASN B O    5  
ATOM 7571  C CB   . ASN A 1 84 ? -6.547  -17.072 -3.346  1.00 0.00 ? 1128 ASN B CB   5  
ATOM 7572  C CG   . ASN A 1 84 ? -5.089  -16.798 -3.697  1.00 0.00 ? 1128 ASN B CG   5  
ATOM 7573  O OD1  . ASN A 1 84 ? -4.257  -17.706 -3.655  1.00 0.00 ? 1128 ASN B OD1  5  
ATOM 7574  N ND2  . ASN A 1 84 ? -4.738  -15.603 -4.083  1.00 0.00 ? 1128 ASN B ND2  5  
ATOM 7575  H H    . ASN A 1 84 ? -7.287  -15.486 -5.177  1.00 0.00 ? 1128 ASN B H    5  
ATOM 7576  H HA   . ASN A 1 84 ? -6.699  -18.266 -5.111  1.00 0.00 ? 1128 ASN B HA   5  
ATOM 7577  H HB2  . ASN A 1 84 ? -7.001  -16.169 -2.965  1.00 0.00 ? 1128 ASN B HB2  5  
ATOM 7578  H HB3  . ASN A 1 84 ? -6.593  -17.844 -2.592  1.00 0.00 ? 1128 ASN B HB3  5  
ATOM 7579  H HD21 . ASN A 1 84 ? -5.410  -14.892 -4.147  1.00 0.00 ? 1128 ASN B HD21 5  
ATOM 7580  H HD22 . ASN A 1 84 ? -3.804  -15.417 -4.313  1.00 0.00 ? 1128 ASN B HD22 5  
ATOM 7581  N N    . LYS A 1 85 ? -9.616  -17.356 -3.923  1.00 0.00 ? 1129 LYS B N    5  
ATOM 7582  C CA   . LYS A 1 85 ? -10.927 -17.845 -3.524  1.00 0.00 ? 1129 LYS B CA   5  
ATOM 7583  C C    . LYS A 1 85 ? -11.612 -18.522 -4.693  1.00 0.00 ? 1129 LYS B C    5  
ATOM 7584  O O    . LYS A 1 85 ? -12.265 -19.555 -4.538  1.00 0.00 ? 1129 LYS B O    5  
ATOM 7585  C CB   . LYS A 1 85 ? -11.782 -16.682 -3.029  1.00 0.00 ? 1129 LYS B CB   5  
ATOM 7586  C CG   . LYS A 1 85 ? -11.253 -16.196 -1.679  1.00 0.00 ? 1129 LYS B CG   5  
ATOM 7587  C CD   . LYS A 1 85 ? -11.938 -14.880 -1.316  1.00 0.00 ? 1129 LYS B CD   5  
ATOM 7588  C CE   . LYS A 1 85 ? -13.423 -15.131 -1.047  1.00 0.00 ? 1129 LYS B CE   5  
ATOM 7589  N NZ   . LYS A 1 85 ? -14.071 -13.858 -0.621  1.00 0.00 ? 1129 LYS B NZ   5  
ATOM 7590  H H    . LYS A 1 85 ? -9.473  -16.397 -4.014  1.00 0.00 ? 1129 LYS B H    5  
ATOM 7591  H HA   . LYS A 1 85 ? -10.807 -18.557 -2.723  1.00 0.00 ? 1129 LYS B HA   5  
ATOM 7592  H HB2  . LYS A 1 85 ? -11.738 -15.873 -3.745  1.00 0.00 ? 1129 LYS B HB2  5  
ATOM 7593  H HB3  . LYS A 1 85 ? -12.804 -17.009 -2.917  1.00 0.00 ? 1129 LYS B HB3  5  
ATOM 7594  H HG2  . LYS A 1 85 ? -11.468 -16.936 -0.922  1.00 0.00 ? 1129 LYS B HG2  5  
ATOM 7595  H HG3  . LYS A 1 85 ? -10.187 -16.043 -1.740  1.00 0.00 ? 1129 LYS B HG3  5  
ATOM 7596  H HD2  . LYS A 1 85 ? -11.473 -14.465 -0.434  1.00 0.00 ? 1129 LYS B HD2  5  
ATOM 7597  H HD3  . LYS A 1 85 ? -11.834 -14.189 -2.140  1.00 0.00 ? 1129 LYS B HD3  5  
ATOM 7598  H HE2  . LYS A 1 85 ? -13.895 -15.492 -1.948  1.00 0.00 ? 1129 LYS B HE2  5  
ATOM 7599  H HE3  . LYS A 1 85 ? -13.527 -15.868 -0.265  1.00 0.00 ? 1129 LYS B HE3  5  
ATOM 7600  H HZ1  . LYS A 1 85 ? -14.448 -13.364 -1.455  1.00 0.00 ? 1129 LYS B HZ1  5  
ATOM 7601  H HZ2  . LYS A 1 85 ? -13.370 -13.253 -0.147  1.00 0.00 ? 1129 LYS B HZ2  5  
ATOM 7602  H HZ3  . LYS A 1 85 ? -14.849 -14.068 0.035   1.00 0.00 ? 1129 LYS B HZ3  5  
ATOM 7603  N N    . LYS A 1 86 ? -11.459 -17.926 -5.865  1.00 0.00 ? 1130 LYS B N    5  
ATOM 7604  C CA   . LYS A 1 86 ? -12.072 -18.478 -7.068  1.00 0.00 ? 1130 LYS B CA   5  
ATOM 7605  C C    . LYS A 1 86 ? -11.332 -19.734 -7.514  1.00 0.00 ? 1130 LYS B C    5  
ATOM 7606  O O    . LYS A 1 86 ? -10.121 -19.714 -7.730  1.00 0.00 ? 1130 LYS B O    5  
ATOM 7607  C CB   . LYS A 1 86 ? -12.059 -17.444 -8.193  1.00 0.00 ? 1130 LYS B CB   5  
ATOM 7608  C CG   . LYS A 1 86 ? -12.794 -18.008 -9.410  1.00 0.00 ? 1130 LYS B CG   5  
ATOM 7609  C CD   . LYS A 1 86 ? -12.741 -16.998 -10.555 1.00 0.00 ? 1130 LYS B CD   5  
ATOM 7610  C CE   . LYS A 1 86 ? -13.644 -15.805 -10.234 1.00 0.00 ? 1130 LYS B CE   5  
ATOM 7611  N NZ   . LYS A 1 86 ? -13.687 -14.883 -11.406 1.00 0.00 ? 1130 LYS B NZ   5  
ATOM 7612  H H    . LYS A 1 86 ? -10.928 -17.097 -5.920  1.00 0.00 ? 1130 LYS B H    5  
ATOM 7613  H HA   . LYS A 1 86 ? -13.097 -18.739 -6.848  1.00 0.00 ? 1130 LYS B HA   5  
ATOM 7614  H HB2  . LYS A 1 86 ? -12.552 -16.543 -7.859  1.00 0.00 ? 1130 LYS B HB2  5  
ATOM 7615  H HB3  . LYS A 1 86 ? -11.040 -17.217 -8.465  1.00 0.00 ? 1130 LYS B HB3  5  
ATOM 7616  H HG2  . LYS A 1 86 ? -12.325 -18.930 -9.720  1.00 0.00 ? 1130 LYS B HG2  5  
ATOM 7617  H HG3  . LYS A 1 86 ? -13.825 -18.200 -9.151  1.00 0.00 ? 1130 LYS B HG3  5  
ATOM 7618  H HD2  . LYS A 1 86 ? -11.725 -16.655 -10.679 1.00 0.00 ? 1130 LYS B HD2  5  
ATOM 7619  H HD3  . LYS A 1 86 ? -13.079 -17.468 -11.467 1.00 0.00 ? 1130 LYS B HD3  5  
ATOM 7620  H HE2  . LYS A 1 86 ? -14.643 -16.156 -10.016 1.00 0.00 ? 1130 LYS B HE2  5  
ATOM 7621  H HE3  . LYS A 1 86 ? -13.253 -15.277 -9.378  1.00 0.00 ? 1130 LYS B HE3  5  
ATOM 7622  H HZ1  . LYS A 1 86 ? -14.674 -14.753 -11.709 1.00 0.00 ? 1130 LYS B HZ1  5  
ATOM 7623  H HZ2  . LYS A 1 86 ? -13.136 -15.292 -12.188 1.00 0.00 ? 1130 LYS B HZ2  5  
ATOM 7624  H HZ3  . LYS A 1 86 ? -13.286 -13.964 -11.139 1.00 0.00 ? 1130 LYS B HZ3  5  
ATOM 7625  N N    . ARG A 1 87 ? -12.075 -20.827 -7.650  1.00 0.00 ? 1131 ARG B N    5  
ATOM 7626  C CA   . ARG A 1 87 ? -11.487 -22.096 -8.070  1.00 0.00 ? 1131 ARG B CA   5  
ATOM 7627  C C    . ARG A 1 87 ? -12.242 -22.667 -9.265  1.00 0.00 ? 1131 ARG B C    5  
ATOM 7628  O O    . ARG A 1 87 ? -11.679 -22.672 -10.346 1.00 0.00 ? 1131 ARG B O    5  
ATOM 7629  C CB   . ARG A 1 87 ? -11.528 -23.101 -6.914  1.00 0.00 ? 1131 ARG B CB   5  
ATOM 7630  C CG   . ARG A 1 87 ? -10.780 -22.534 -5.704  1.00 0.00 ? 1131 ARG B CG   5  
ATOM 7631  C CD   . ARG A 1 87 ? -9.290  -22.411 -6.028  1.00 0.00 ? 1131 ARG B CD   5  
ATOM 7632  N NE   . ARG A 1 87 ? -8.541  -22.009 -4.842  1.00 0.00 ? 1131 ARG B NE   5  
ATOM 7633  C CZ   . ARG A 1 87 ? -7.230  -21.762 -4.894  1.00 0.00 ? 1131 ARG B CZ   5  
ATOM 7634  N NH1  . ARG A 1 87 ? -6.571  -21.878 -6.022  1.00 0.00 ? 1131 ARG B NH1  5  
ATOM 7635  N NH2  . ARG A 1 87 ? -6.597  -21.397 -3.814  1.00 0.00 ? 1131 ARG B NH2  5  
ATOM 7636  O OXT  . ARG A 1 87 ? -13.371 -23.089 -9.080  1.00 0.00 ? 1131 ARG B OXT  5  
ATOM 7637  H H    . ARG A 1 87 ? -13.033 -20.779 -7.461  1.00 0.00 ? 1131 ARG B H    5  
ATOM 7638  H HA   . ARG A 1 87 ? -10.461 -21.934 -8.355  1.00 0.00 ? 1131 ARG B HA   5  
ATOM 7639  H HB2  . ARG A 1 87 ? -12.557 -23.294 -6.642  1.00 0.00 ? 1131 ARG B HB2  5  
ATOM 7640  H HB3  . ARG A 1 87 ? -11.061 -24.024 -7.222  1.00 0.00 ? 1131 ARG B HB3  5  
ATOM 7641  H HG2  . ARG A 1 87 ? -11.177 -21.559 -5.461  1.00 0.00 ? 1131 ARG B HG2  5  
ATOM 7642  H HG3  . ARG A 1 87 ? -10.909 -23.194 -4.860  1.00 0.00 ? 1131 ARG B HG3  5  
ATOM 7643  H HD2  . ARG A 1 87 ? -8.920  -23.363 -6.375  1.00 0.00 ? 1131 ARG B HD2  5  
ATOM 7644  H HD3  . ARG A 1 87 ? -9.152  -21.672 -6.803  1.00 0.00 ? 1131 ARG B HD3  5  
ATOM 7645  H HE   . ARG A 1 87 ? -9.012  -21.918 -3.987  1.00 0.00 ? 1131 ARG B HE   5  
ATOM 7646  H HH11 . ARG A 1 87 ? -7.043  -22.156 -6.858  1.00 0.00 ? 1131 ARG B HH11 5  
ATOM 7647  H HH12 . ARG A 1 87 ? -5.590  -21.690 -6.046  1.00 0.00 ? 1131 ARG B HH12 5  
ATOM 7648  H HH21 . ARG A 1 87 ? -7.092  -21.304 -2.951  1.00 0.00 ? 1131 ARG B HH21 5  
ATOM 7649  H HH22 . ARG A 1 87 ? -5.614  -21.210 -3.848  1.00 0.00 ? 1131 ARG B HH22 5  
ATOM 7650  N N    . ILE B 2 9  ? 2.858   -19.098 1.974   1.00 0.00 ? 46   ILE A N    5  
ATOM 7651  C CA   . ILE B 2 9  ? 3.150   -18.553 0.617   1.00 0.00 ? 46   ILE A CA   5  
ATOM 7652  C C    . ILE B 2 9  ? 2.077   -17.540 0.230   1.00 0.00 ? 46   ILE A C    5  
ATOM 7653  O O    . ILE B 2 9  ? 2.349   -16.347 0.078   1.00 0.00 ? 46   ILE A O    5  
ATOM 7654  C CB   . ILE B 2 9  ? 3.173   -19.702 -0.394  1.00 0.00 ? 46   ILE A CB   5  
ATOM 7655  C CG1  . ILE B 2 9  ? 4.470   -20.499 -0.224  1.00 0.00 ? 46   ILE A CG1  5  
ATOM 7656  C CG2  . ILE B 2 9  ? 3.095   -19.139 -1.815  1.00 0.00 ? 46   ILE A CG2  5  
ATOM 7657  C CD1  . ILE B 2 9  ? 4.380   -21.808 -1.010  1.00 0.00 ? 46   ILE A CD1  5  
ATOM 7658  H H    . ILE B 2 9  ? 3.178   -20.085 2.027   1.00 0.00 ? 46   ILE A H    5  
ATOM 7659  H HA   . ILE B 2 9  ? 4.112   -18.067 0.627   1.00 0.00 ? 46   ILE A HA   5  
ATOM 7660  H HB   . ILE B 2 9  ? 2.327   -20.351 -0.219  1.00 0.00 ? 46   ILE A HB   5  
ATOM 7661  H HG12 . ILE B 2 9  ? 5.300   -19.913 -0.594  1.00 0.00 ? 46   ILE A HG12 5  
ATOM 7662  H HG13 . ILE B 2 9  ? 4.623   -20.718 0.822   1.00 0.00 ? 46   ILE A HG13 5  
ATOM 7663  H HG21 . ILE B 2 9  ? 2.069   -19.141 -2.146  1.00 0.00 ? 46   ILE A HG21 5  
ATOM 7664  H HG22 . ILE B 2 9  ? 3.689   -19.750 -2.479  1.00 0.00 ? 46   ILE A HG22 5  
ATOM 7665  H HG23 . ILE B 2 9  ? 3.473   -18.127 -1.822  1.00 0.00 ? 46   ILE A HG23 5  
ATOM 7666  H HD11 . ILE B 2 9  ? 4.705   -22.626 -0.385  1.00 0.00 ? 46   ILE A HD11 5  
ATOM 7667  H HD12 . ILE B 2 9  ? 5.014   -21.748 -1.882  1.00 0.00 ? 46   ILE A HD12 5  
ATOM 7668  H HD13 . ILE B 2 9  ? 3.358   -21.974 -1.318  1.00 0.00 ? 46   ILE A HD13 5  
ATOM 7669  N N    . GLU B 2 10 ? 0.855   -18.022 0.067   1.00 0.00 ? 47   GLU A N    5  
ATOM 7670  C CA   . GLU B 2 10 ? -0.248  -17.149 -0.308  1.00 0.00 ? 47   GLU A CA   5  
ATOM 7671  C C    . GLU B 2 10 ? -0.465  -16.069 0.739   1.00 0.00 ? 47   GLU A C    5  
ATOM 7672  O O    . GLU B 2 10 ? -0.771  -14.921 0.413   1.00 0.00 ? 47   GLU A O    5  
ATOM 7673  C CB   . GLU B 2 10 ? -1.521  -17.971 -0.459  1.00 0.00 ? 47   GLU A CB   5  
ATOM 7674  C CG   . GLU B 2 10 ? -1.857  -18.665 0.864   1.00 0.00 ? 47   GLU A CG   5  
ATOM 7675  C CD   . GLU B 2 10 ? -2.991  -19.663 0.658   1.00 0.00 ? 47   GLU A CD   5  
ATOM 7676  O OE1  . GLU B 2 10 ? -3.412  -19.829 -0.475  1.00 0.00 ? 47   GLU A OE1  5  
ATOM 7677  O OE2  . GLU B 2 10 ? -3.422  -20.246 1.638   1.00 0.00 ? 47   GLU A OE2  5  
ATOM 7678  H H    . GLU B 2 10 ? 0.694   -18.979 0.196   1.00 0.00 ? 47   GLU A H    5  
ATOM 7679  H HA   . GLU B 2 10 ? -0.022  -16.682 -1.255  1.00 0.00 ? 47   GLU A HA   5  
ATOM 7680  H HB2  . GLU B 2 10 ? -2.330  -17.313 -0.730  1.00 0.00 ? 47   GLU A HB2  5  
ATOM 7681  H HB3  . GLU B 2 10 ? -1.381  -18.712 -1.226  1.00 0.00 ? 47   GLU A HB3  5  
ATOM 7682  H HG2  . GLU B 2 10 ? -0.984  -19.185 1.229   1.00 0.00 ? 47   GLU A HG2  5  
ATOM 7683  H HG3  . GLU B 2 10 ? -2.164  -17.925 1.588   1.00 0.00 ? 47   GLU A HG3  5  
ATOM 7684  N N    . ASN B 2 11 ? -0.295  -16.433 1.996   1.00 0.00 ? 48   ASN A N    5  
ATOM 7685  C CA   . ASN B 2 11 ? -0.470  -15.480 3.069   1.00 0.00 ? 48   ASN A CA   5  
ATOM 7686  C C    . ASN B 2 11 ? 0.545   -14.363 2.929   1.00 0.00 ? 48   ASN A C    5  
ATOM 7687  O O    . ASN B 2 11 ? 0.246   -13.196 3.175   1.00 0.00 ? 48   ASN A O    5  
ATOM 7688  C CB   . ASN B 2 11 ? -0.293  -16.172 4.420   1.00 0.00 ? 48   ASN A CB   5  
ATOM 7689  C CG   . ASN B 2 11 ? -1.469  -17.104 4.675   1.00 0.00 ? 48   ASN A CG   5  
ATOM 7690  O OD1  . ASN B 2 11 ? -1.276  -18.273 5.008   1.00 0.00 ? 48   ASN A OD1  5  
ATOM 7691  N ND2  . ASN B 2 11 ? -2.684  -16.656 4.519   1.00 0.00 ? 48   ASN A ND2  5  
ATOM 7692  H H    . ASN B 2 11 ? -0.043  -17.356 2.203   1.00 0.00 ? 48   ASN A H    5  
ATOM 7693  H HA   . ASN B 2 11 ? -1.463  -15.064 3.014   1.00 0.00 ? 48   ASN A HA   5  
ATOM 7694  H HB2  . ASN B 2 11 ? 0.625   -16.743 4.412   1.00 0.00 ? 48   ASN A HB2  5  
ATOM 7695  H HB3  . ASN B 2 11 ? -0.246  -15.429 5.202   1.00 0.00 ? 48   ASN A HB3  5  
ATOM 7696  H HD21 . ASN B 2 11 ? -2.832  -15.729 4.239   1.00 0.00 ? 48   ASN A HD21 5  
ATOM 7697  H HD22 . ASN B 2 11 ? -3.448  -17.249 4.679   1.00 0.00 ? 48   ASN A HD22 5  
ATOM 7698  N N    . ASP B 2 12 ? 1.750   -14.732 2.525   1.00 0.00 ? 49   ASP A N    5  
ATOM 7699  C CA   . ASP B 2 12 ? 2.815   -13.749 2.351   1.00 0.00 ? 49   ASP A CA   5  
ATOM 7700  C C    . ASP B 2 12 ? 2.455   -12.759 1.254   1.00 0.00 ? 49   ASP A C    5  
ATOM 7701  O O    . ASP B 2 12 ? 2.701   -11.559 1.382   1.00 0.00 ? 49   ASP A O    5  
ATOM 7702  C CB   . ASP B 2 12 ? 4.129   -14.447 1.999   1.00 0.00 ? 49   ASP A CB   5  
ATOM 7703  C CG   . ASP B 2 12 ? 4.667   -15.191 3.215   1.00 0.00 ? 49   ASP A CG   5  
ATOM 7704  O OD1  . ASP B 2 12 ? 4.193   -14.925 4.307   1.00 0.00 ? 49   ASP A OD1  5  
ATOM 7705  O OD2  . ASP B 2 12 ? 5.542   -16.023 3.035   1.00 0.00 ? 49   ASP A OD2  5  
ATOM 7706  H H    . ASP B 2 12 ? 1.921   -15.684 2.328   1.00 0.00 ? 49   ASP A H    5  
ATOM 7707  H HA   . ASP B 2 12 ? 2.944   -13.206 3.278   1.00 0.00 ? 49   ASP A HA   5  
ATOM 7708  H HB2  . ASP B 2 12 ? 3.958   -15.147 1.196   1.00 0.00 ? 49   ASP A HB2  5  
ATOM 7709  H HB3  . ASP B 2 12 ? 4.854   -13.709 1.682   1.00 0.00 ? 49   ASP A HB3  5  
ATOM 7710  N N    . GLU B 2 13 ? 1.873   -13.265 0.174   1.00 0.00 ? 50   GLU A N    5  
ATOM 7711  C CA   . GLU B 2 13 ? 1.491   -12.402 -0.934  1.00 0.00 ? 50   GLU A CA   5  
ATOM 7712  C C    . GLU B 2 13 ? 0.445   -11.386 -0.483  1.00 0.00 ? 50   GLU A C    5  
ATOM 7713  O O    . GLU B 2 13 ? 0.516   -10.206 -0.834  1.00 0.00 ? 50   GLU A O    5  
ATOM 7714  C CB   . GLU B 2 13 ? 0.919   -13.241 -2.079  1.00 0.00 ? 50   GLU A CB   5  
ATOM 7715  C CG   . GLU B 2 13 ? 2.037   -14.066 -2.716  1.00 0.00 ? 50   GLU A CG   5  
ATOM 7716  C CD   . GLU B 2 13 ? 1.455   -14.971 -3.797  1.00 0.00 ? 50   GLU A CD   5  
ATOM 7717  O OE1  . GLU B 2 13 ? 0.240   -15.034 -3.899  1.00 0.00 ? 50   GLU A OE1  5  
ATOM 7718  O OE2  . GLU B 2 13 ? 2.234   -15.587 -4.507  1.00 0.00 ? 50   GLU A OE2  5  
ATOM 7719  H H    . GLU B 2 13 ? 1.705   -14.232 0.122   1.00 0.00 ? 50   GLU A H    5  
ATOM 7720  H HA   . GLU B 2 13 ? 2.363   -11.876 -1.289  1.00 0.00 ? 50   GLU A HA   5  
ATOM 7721  H HB2  . GLU B 2 13 ? 0.157   -13.903 -1.693  1.00 0.00 ? 50   GLU A HB2  5  
ATOM 7722  H HB3  . GLU B 2 13 ? 0.487   -12.588 -2.823  1.00 0.00 ? 50   GLU A HB3  5  
ATOM 7723  H HG2  . GLU B 2 13 ? 2.767   -13.404 -3.155  1.00 0.00 ? 50   GLU A HG2  5  
ATOM 7724  H HG3  . GLU B 2 13 ? 2.511   -14.673 -1.958  1.00 0.00 ? 50   GLU A HG3  5  
ATOM 7725  N N    . ALA B 2 14 ? -0.521  -11.848 0.302   1.00 0.00 ? 51   ALA A N    5  
ATOM 7726  C CA   . ALA B 2 14 ? -1.565  -10.963 0.798   1.00 0.00 ? 51   ALA A CA   5  
ATOM 7727  C C    . ALA B 2 14 ? -0.971  -9.883  1.697   1.00 0.00 ? 51   ALA A C    5  
ATOM 7728  O O    . ALA B 2 14 ? -1.368  -8.719  1.629   1.00 0.00 ? 51   ALA A O    5  
ATOM 7729  C CB   . ALA B 2 14 ? -2.610  -11.764 1.570   1.00 0.00 ? 51   ALA A CB   5  
ATOM 7730  H H    . ALA B 2 14 ? -0.527  -12.796 0.557   1.00 0.00 ? 51   ALA A H    5  
ATOM 7731  H HA   . ALA B 2 14 ? -2.047  -10.488 -0.043  1.00 0.00 ? 51   ALA A HA   5  
ATOM 7732  H HB1  . ALA B 2 14 ? -2.527  -12.808 1.309   1.00 0.00 ? 51   ALA A HB1  5  
ATOM 7733  H HB2  . ALA B 2 14 ? -3.598  -11.406 1.313   1.00 0.00 ? 51   ALA A HB2  5  
ATOM 7734  H HB3  . ALA B 2 14 ? -2.445  -11.642 2.629   1.00 0.00 ? 51   ALA A HB3  5  
ATOM 7735  N N    . PHE B 2 15 ? -0.010  -10.272 2.533   1.00 0.00 ? 52   PHE A N    5  
ATOM 7736  C CA   . PHE B 2 15 ? 0.633   -9.315  3.428   1.00 0.00 ? 52   PHE A CA   5  
ATOM 7737  C C    . PHE B 2 15 ? 1.350   -8.231  2.632   1.00 0.00 ? 52   PHE A C    5  
ATOM 7738  O O    . PHE B 2 15 ? 1.268   -7.050  2.965   1.00 0.00 ? 52   PHE A O    5  
ATOM 7739  C CB   . PHE B 2 15 ? 1.639   -10.027 4.338   1.00 0.00 ? 52   PHE A CB   5  
ATOM 7740  C CG   . PHE B 2 15 ? 0.982   -10.393 5.650   1.00 0.00 ? 52   PHE A CG   5  
ATOM 7741  C CD1  . PHE B 2 15 ? 0.536   -11.701 5.879   1.00 0.00 ? 52   PHE A CD1  5  
ATOM 7742  C CD2  . PHE B 2 15 ? 0.824   -9.418  6.641   1.00 0.00 ? 52   PHE A CD2  5  
ATOM 7743  C CE1  . PHE B 2 15 ? -0.067  -12.031 7.098   1.00 0.00 ? 52   PHE A CE1  5  
ATOM 7744  C CE2  . PHE B 2 15 ? 0.221   -9.749  7.861   1.00 0.00 ? 52   PHE A CE2  5  
ATOM 7745  C CZ   . PHE B 2 15 ? -0.224  -11.055 8.089   1.00 0.00 ? 52   PHE A CZ   5  
ATOM 7746  H H    . PHE B 2 15 ? 0.272   -11.210 2.544   1.00 0.00 ? 52   PHE A H    5  
ATOM 7747  H HA   . PHE B 2 15 ? -0.123  -8.851  4.044   1.00 0.00 ? 52   PHE A HA   5  
ATOM 7748  H HB2  . PHE B 2 15 ? 1.989   -10.926 3.850   1.00 0.00 ? 52   PHE A HB2  5  
ATOM 7749  H HB3  . PHE B 2 15 ? 2.479   -9.374  4.528   1.00 0.00 ? 52   PHE A HB3  5  
ATOM 7750  H HD1  . PHE B 2 15 ? 0.659   -12.454 5.118   1.00 0.00 ? 52   PHE A HD1  5  
ATOM 7751  H HD2  . PHE B 2 15 ? 1.165   -8.410  6.466   1.00 0.00 ? 52   PHE A HD2  5  
ATOM 7752  H HE1  . PHE B 2 15 ? -0.409  -13.039 7.273   1.00 0.00 ? 52   PHE A HE1  5  
ATOM 7753  H HE2  . PHE B 2 15 ? 0.102   -8.997  8.627   1.00 0.00 ? 52   PHE A HE2  5  
ATOM 7754  H HZ   . PHE B 2 15 ? -0.689  -11.311 9.029   1.00 0.00 ? 52   PHE A HZ   5  
ATOM 7755  N N    . ALA B 2 16 ? 2.046   -8.636  1.575   1.00 0.00 ? 53   ALA A N    5  
ATOM 7756  C CA   . ALA B 2 16 ? 2.769   -7.683  0.740   1.00 0.00 ? 53   ALA A CA   5  
ATOM 7757  C C    . ALA B 2 16 ? 1.802   -6.690  0.107   1.00 0.00 ? 53   ALA A C    5  
ATOM 7758  O O    . ALA B 2 16 ? 2.087   -5.500  0.012   1.00 0.00 ? 53   ALA A O    5  
ATOM 7759  C CB   . ALA B 2 16 ? 3.536   -8.422  -0.354  1.00 0.00 ? 53   ALA A CB   5  
ATOM 7760  H H    . ALA B 2 16 ? 2.074   -9.591  1.353   1.00 0.00 ? 53   ALA A H    5  
ATOM 7761  H HA   . ALA B 2 16 ? 3.472   -7.141  1.355   1.00 0.00 ? 53   ALA A HA   5  
ATOM 7762  H HB1  . ALA B 2 16 ? 4.143   -9.195  0.092   1.00 0.00 ? 53   ALA A HB1  5  
ATOM 7763  H HB2  . ALA B 2 16 ? 4.171   -7.725  -0.880  1.00 0.00 ? 53   ALA A HB2  5  
ATOM 7764  H HB3  . ALA B 2 16 ? 2.836   -8.867  -1.046  1.00 0.00 ? 53   ALA A HB3  5  
ATOM 7765  N N    . ILE B 2 17 ? 0.651   -7.186  -0.323  1.00 0.00 ? 54   ILE A N    5  
ATOM 7766  C CA   . ILE B 2 17 ? -0.348  -6.330  -0.939  1.00 0.00 ? 54   ILE A CA   5  
ATOM 7767  C C    . ILE B 2 17 ? -0.794  -5.244  0.034   1.00 0.00 ? 54   ILE A C    5  
ATOM 7768  O O    . ILE B 2 17 ? -0.976  -4.089  -0.352  1.00 0.00 ? 54   ILE A O    5  
ATOM 7769  C CB   . ILE B 2 17 ? -1.549  -7.171  -1.369  1.00 0.00 ? 54   ILE A CB   5  
ATOM 7770  C CG1  . ILE B 2 17 ? -1.149  -8.067  -2.541  1.00 0.00 ? 54   ILE A CG1  5  
ATOM 7771  C CG2  . ILE B 2 17 ? -2.693  -6.256  -1.797  1.00 0.00 ? 54   ILE A CG2  5  
ATOM 7772  C CD1  . ILE B 2 17 ? -2.255  -9.090  -2.800  1.00 0.00 ? 54   ILE A CD1  5  
ATOM 7773  H H    . ILE B 2 17 ? 0.470   -8.146  -0.228  1.00 0.00 ? 54   ILE A H    5  
ATOM 7774  H HA   . ILE B 2 17 ? 0.080   -5.863  -1.806  1.00 0.00 ? 54   ILE A HA   5  
ATOM 7775  H HB   . ILE B 2 17 ? -1.870  -7.783  -0.540  1.00 0.00 ? 54   ILE A HB   5  
ATOM 7776  H HG12 . ILE B 2 17 ? -1.006  -7.462  -3.424  1.00 0.00 ? 54   ILE A HG12 5  
ATOM 7777  H HG13 . ILE B 2 17 ? -0.230  -8.582  -2.304  1.00 0.00 ? 54   ILE A HG13 5  
ATOM 7778  H HG21 . ILE B 2 17 ? -2.327  -5.535  -2.515  1.00 0.00 ? 54   ILE A HG21 5  
ATOM 7779  H HG22 . ILE B 2 17 ? -3.085  -5.740  -0.933  1.00 0.00 ? 54   ILE A HG22 5  
ATOM 7780  H HG23 . ILE B 2 17 ? -3.478  -6.847  -2.247  1.00 0.00 ? 54   ILE A HG23 5  
ATOM 7781  H HD11 . ILE B 2 17 ? -2.546  -9.549  -1.867  1.00 0.00 ? 54   ILE A HD11 5  
ATOM 7782  H HD12 . ILE B 2 17 ? -1.891  -9.849  -3.477  1.00 0.00 ? 54   ILE A HD12 5  
ATOM 7783  H HD13 . ILE B 2 17 ? -3.109  -8.593  -3.240  1.00 0.00 ? 54   ILE A HD13 5  
ATOM 7784  N N    . LEU B 2 18 ? -0.984  -5.623  1.289   1.00 0.00 ? 55   LEU A N    5  
ATOM 7785  C CA   . LEU B 2 18 ? -1.429  -4.675  2.305   1.00 0.00 ? 55   LEU A CA   5  
ATOM 7786  C C    . LEU B 2 18 ? -0.265  -4.181  3.167   1.00 0.00 ? 55   LEU A C    5  
ATOM 7787  O O    . LEU B 2 18 ? -0.472  -3.740  4.298   1.00 0.00 ? 55   LEU A O    5  
ATOM 7788  C CB   . LEU B 2 18 ? -2.489  -5.334  3.188   1.00 0.00 ? 55   LEU A CB   5  
ATOM 7789  C CG   . LEU B 2 18 ? -3.708  -5.701  2.333   1.00 0.00 ? 55   LEU A CG   5  
ATOM 7790  C CD1  . LEU B 2 18 ? -4.707  -6.499  3.175   1.00 0.00 ? 55   LEU A CD1  5  
ATOM 7791  C CD2  . LEU B 2 18 ? -4.387  -4.425  1.829   1.00 0.00 ? 55   LEU A CD2  5  
ATOM 7792  H H    . LEU B 2 18 ? -0.835  -6.561  1.536   1.00 0.00 ? 55   LEU A H    5  
ATOM 7793  H HA   . LEU B 2 18 ? -1.870  -3.823  1.813   1.00 0.00 ? 55   LEU A HA   5  
ATOM 7794  H HB2  . LEU B 2 18 ? -2.078  -6.227  3.634   1.00 0.00 ? 55   LEU A HB2  5  
ATOM 7795  H HB3  . LEU B 2 18 ? -2.788  -4.648  3.963   1.00 0.00 ? 55   LEU A HB3  5  
ATOM 7796  H HG   . LEU B 2 18 ? -3.390  -6.298  1.491   1.00 0.00 ? 55   LEU A HG   5  
ATOM 7797  H HD11 . LEU B 2 18 ? -4.846  -6.012  4.127   1.00 0.00 ? 55   LEU A HD11 5  
ATOM 7798  H HD12 . LEU B 2 18 ? -4.327  -7.497  3.331   1.00 0.00 ? 55   LEU A HD12 5  
ATOM 7799  H HD13 . LEU B 2 18 ? -5.653  -6.550  2.655   1.00 0.00 ? 55   LEU A HD13 5  
ATOM 7800  H HD21 . LEU B 2 18 ? -5.459  -4.555  1.849   1.00 0.00 ? 55   LEU A HD21 5  
ATOM 7801  H HD22 . LEU B 2 18 ? -4.069  -4.224  0.816   1.00 0.00 ? 55   LEU A HD22 5  
ATOM 7802  H HD23 . LEU B 2 18 ? -4.113  -3.595  2.464   1.00 0.00 ? 55   LEU A HD23 5  
ATOM 7803  N N    . ASP B 2 19 ? 0.952   -4.254  2.636   1.00 0.00 ? 56   ASP A N    5  
ATOM 7804  C CA   . ASP B 2 19 ? 2.120   -3.795  3.386   1.00 0.00 ? 56   ASP A CA   5  
ATOM 7805  C C    . ASP B 2 19 ? 3.176   -3.222  2.449   1.00 0.00 ? 56   ASP A C    5  
ATOM 7806  O O    . ASP B 2 19 ? 3.515   -2.040  2.518   1.00 0.00 ? 56   ASP A O    5  
ATOM 7807  C CB   . ASP B 2 19 ? 2.720   -4.960  4.172   1.00 0.00 ? 56   ASP A CB   5  
ATOM 7808  C CG   . ASP B 2 19 ? 3.667   -4.440  5.247   1.00 0.00 ? 56   ASP A CG   5  
ATOM 7809  O OD1  . ASP B 2 19 ? 3.705   -3.236  5.441   1.00 0.00 ? 56   ASP A OD1  5  
ATOM 7810  O OD2  . ASP B 2 19 ? 4.339   -5.254  5.858   1.00 0.00 ? 56   ASP A OD2  5  
ATOM 7811  H H    . ASP B 2 19 ? 1.067   -4.611  1.728   1.00 0.00 ? 56   ASP A H    5  
ATOM 7812  H HA   . ASP B 2 19 ? 1.813   -3.026  4.080   1.00 0.00 ? 56   ASP A HA   5  
ATOM 7813  H HB2  . ASP B 2 19 ? 1.925   -5.525  4.636   1.00 0.00 ? 56   ASP A HB2  5  
ATOM 7814  H HB3  . ASP B 2 19 ? 3.266   -5.602  3.496   1.00 0.00 ? 56   ASP A HB3  5  
ATOM 7815  N N    . GLY B 2 20 ? 3.682   -4.064  1.563   1.00 0.00 ? 57   GLY A N    5  
ATOM 7816  C CA   . GLY B 2 20 ? 4.690   -3.631  0.605   1.00 0.00 ? 57   GLY A CA   5  
ATOM 7817  C C    . GLY B 2 20 ? 4.049   -2.987  -0.623  1.00 0.00 ? 57   GLY A C    5  
ATOM 7818  O O    . GLY B 2 20 ? 4.747   -2.473  -1.498  1.00 0.00 ? 57   GLY A O    5  
ATOM 7819  H H    . GLY B 2 20 ? 3.365   -4.993  1.548   1.00 0.00 ? 57   GLY A H    5  
ATOM 7820  H HA2  . GLY B 2 20 ? 5.344   -2.913  1.081   1.00 0.00 ? 57   GLY A HA2  5  
ATOM 7821  H HA3  . GLY B 2 20 ? 5.272   -4.486  0.293   1.00 0.00 ? 57   GLY A HA3  5  
ATOM 7822  N N    . GLY B 2 21 ? 2.718   -3.028  -0.694  1.00 0.00 ? 58   GLY A N    5  
ATOM 7823  C CA   . GLY B 2 21 ? 2.011   -2.452  -1.829  1.00 0.00 ? 58   GLY A CA   5  
ATOM 7824  C C    . GLY B 2 21 ? 2.226   -3.302  -3.078  1.00 0.00 ? 58   GLY A C    5  
ATOM 7825  O O    . GLY B 2 21 ? 2.040   -2.829  -4.199  1.00 0.00 ? 58   GLY A O    5  
ATOM 7826  H H    . GLY B 2 21 ? 2.206   -3.454  0.020   1.00 0.00 ? 58   GLY A H    5  
ATOM 7827  H HA2  . GLY B 2 21 ? 0.954   -2.408  -1.602  1.00 0.00 ? 58   GLY A HA2  5  
ATOM 7828  H HA3  . GLY B 2 21 ? 2.379   -1.455  -2.011  1.00 0.00 ? 58   GLY A HA3  5  
ATOM 7829  N N    . ALA B 2 22 ? 2.633   -4.555  -2.878  1.00 0.00 ? 59   ALA A N    5  
ATOM 7830  C CA   . ALA B 2 22 ? 2.887   -5.454  -3.998  1.00 0.00 ? 59   ALA A CA   5  
ATOM 7831  C C    . ALA B 2 22 ? 1.581   -5.906  -4.645  1.00 0.00 ? 59   ALA A C    5  
ATOM 7832  O O    . ALA B 2 22 ? 0.519   -5.846  -4.030  1.00 0.00 ? 59   ALA A O    5  
ATOM 7833  C CB   . ALA B 2 22 ? 3.656   -6.681  -3.513  1.00 0.00 ? 59   ALA A CB   5  
ATOM 7834  H H    . ALA B 2 22 ? 2.774   -4.881  -1.962  1.00 0.00 ? 59   ALA A H    5  
ATOM 7835  H HA   . ALA B 2 22 ? 3.484   -4.933  -4.726  1.00 0.00 ? 59   ALA A HA   5  
ATOM 7836  H HB1  . ALA B 2 22 ? 2.980   -7.521  -3.438  1.00 0.00 ? 59   ALA A HB1  5  
ATOM 7837  H HB2  . ALA B 2 22 ? 4.087   -6.476  -2.546  1.00 0.00 ? 59   ALA A HB2  5  
ATOM 7838  H HB3  . ALA B 2 22 ? 4.442   -6.913  -4.216  1.00 0.00 ? 59   ALA A HB3  5  
ATOM 7839  N N    . PRO B 2 23 ? 1.638   -6.359  -5.867  1.00 0.00 ? 60   PRO A N    5  
ATOM 7840  C CA   . PRO B 2 23 ? 0.430   -6.834  -6.596  1.00 0.00 ? 60   PRO A CA   5  
ATOM 7841  C C    . PRO B 2 23 ? -0.087  -8.162  -6.051  1.00 0.00 ? 60   PRO A C    5  
ATOM 7842  O O    . PRO B 2 23 ? -1.252  -8.509  -6.240  1.00 0.00 ? 60   PRO A O    5  
ATOM 7843  C CB   . PRO B 2 23 ? 0.912   -6.972  -8.042  1.00 0.00 ? 60   PRO A CB   5  
ATOM 7844  C CG   . PRO B 2 23 ? 2.382   -7.213  -7.942  1.00 0.00 ? 60   PRO A CG   5  
ATOM 7845  C CD   . PRO B 2 23 ? 2.855   -6.472  -6.691  1.00 0.00 ? 60   PRO A CD   5  
ATOM 7846  H HA   . PRO B 2 23 ? -0.345  -6.091  -6.542  1.00 0.00 ? 60   PRO A HA   5  
ATOM 7847  H HB2  . PRO B 2 23 ? 0.425   -7.811  -8.520  1.00 0.00 ? 60   PRO A HB2  5  
ATOM 7848  H HB3  . PRO B 2 23 ? 0.723   -6.064  -8.591  1.00 0.00 ? 60   PRO A HB3  5  
ATOM 7849  H HG2  . PRO B 2 23 ? 2.579   -8.272  -7.849  1.00 0.00 ? 60   PRO A HG2  5  
ATOM 7850  H HG3  . PRO B 2 23 ? 2.884   -6.815  -8.810  1.00 0.00 ? 60   PRO A HG3  5  
ATOM 7851  H HD2  . PRO B 2 23 ? 3.613   -7.046  -6.176  1.00 0.00 ? 60   PRO A HD2  5  
ATOM 7852  H HD3  . PRO B 2 23 ? 3.224   -5.491  -6.946  1.00 0.00 ? 60   PRO A HD3  5  
ATOM 7853  N N    . GLY B 2 24 ? 0.788   -8.901  -5.377  1.00 0.00 ? 61   GLY A N    5  
ATOM 7854  C CA   . GLY B 2 24 ? 0.407   -10.189 -4.811  1.00 0.00 ? 61   GLY A CA   5  
ATOM 7855  C C    . GLY B 2 24 ? 1.336   -11.296 -5.300  1.00 0.00 ? 61   GLY A C    5  
ATOM 7856  O O    . GLY B 2 24 ? 0.998   -11.931 -6.285  1.00 0.00 ? 61   GLY A O    5  
ATOM 7857  O OXT  . GLY B 2 24 ? 2.371   -11.490 -4.685  1.00 0.00 ? 61   GLY A OXT  5  
ATOM 7858  H H    . GLY B 2 24 ? 1.704   -8.574  -5.257  1.00 0.00 ? 61   GLY A H    5  
ATOM 7859  H HA2  . GLY B 2 24 ? 0.459   -10.133 -3.732  1.00 0.00 ? 61   GLY A HA2  5  
ATOM 7860  H HA3  . GLY B 2 24 ? -0.604  -10.423 -5.106  1.00 0.00 ? 61   GLY A HA3  5  
ATOM 7861  N N    . ARG A 1 6  ? 6.851   -8.594  8.549   1.00 0.00 ? 1050 ARG B N    6  
ATOM 7862  C CA   . ARG A 1 6  ? 5.415   -8.274  8.303   1.00 0.00 ? 1050 ARG B CA   6  
ATOM 7863  C C    . ARG A 1 6  ? 4.738   -7.923  9.631   1.00 0.00 ? 1050 ARG B C    6  
ATOM 7864  O O    . ARG A 1 6  ? 5.194   -8.340  10.695  1.00 0.00 ? 1050 ARG B O    6  
ATOM 7865  C CB   . ARG A 1 6  ? 4.729   -9.490  7.677   1.00 0.00 ? 1050 ARG B CB   6  
ATOM 7866  C CG   . ARG A 1 6  ? 5.069   -10.745 8.483   1.00 0.00 ? 1050 ARG B CG   6  
ATOM 7867  C CD   . ARG A 1 6  ? 4.355   -11.946 7.866   1.00 0.00 ? 1050 ARG B CD   6  
ATOM 7868  N NE   . ARG A 1 6  ? 4.649   -13.158 8.623   1.00 0.00 ? 1050 ARG B NE   6  
ATOM 7869  C CZ   . ARG A 1 6  ? 4.120   -14.336 8.290   1.00 0.00 ? 1050 ARG B CZ   6  
ATOM 7870  N NH1  . ARG A 1 6  ? 3.312   -14.445 7.266   1.00 0.00 ? 1050 ARG B NH1  6  
ATOM 7871  N NH2  . ARG A 1 6  ? 4.411   -15.395 8.994   1.00 0.00 ? 1050 ARG B NH2  6  
ATOM 7872  H H    . ARG A 1 6  ? 6.951   -9.050  9.477   1.00 0.00 ? 1050 ARG B H    6  
ATOM 7873  H HA   . ARG A 1 6  ? 5.353   -7.437  7.624   1.00 0.00 ? 1050 ARG B HA   6  
ATOM 7874  H HB2  . ARG A 1 6  ? 3.660   -9.343  7.681   1.00 0.00 ? 1050 ARG B HB2  6  
ATOM 7875  H HB3  . ARG A 1 6  ? 5.071   -9.615  6.660   1.00 0.00 ? 1050 ARG B HB3  6  
ATOM 7876  H HG2  . ARG A 1 6  ? 6.137   -10.911 8.465   1.00 0.00 ? 1050 ARG B HG2  6  
ATOM 7877  H HG3  . ARG A 1 6  ? 4.740   -10.619 9.504   1.00 0.00 ? 1050 ARG B HG3  6  
ATOM 7878  H HD2  . ARG A 1 6  ? 3.290   -11.772 7.873   1.00 0.00 ? 1050 ARG B HD2  6  
ATOM 7879  H HD3  . ARG A 1 6  ? 4.688   -12.071 6.845   1.00 0.00 ? 1050 ARG B HD3  6  
ATOM 7880  H HE   . ARG A 1 6  ? 5.250   -13.104 9.394   1.00 0.00 ? 1050 ARG B HE   6  
ATOM 7881  H HH11 . ARG A 1 6  ? 3.080   -13.643 6.718   1.00 0.00 ? 1050 ARG B HH11 6  
ATOM 7882  H HH12 . ARG A 1 6  ? 2.924   -15.336 7.031   1.00 0.00 ? 1050 ARG B HH12 6  
ATOM 7883  H HH21 . ARG A 1 6  ? 5.028   -15.319 9.778   1.00 0.00 ? 1050 ARG B HH21 6  
ATOM 7884  H HH22 . ARG A 1 6  ? 4.018   -16.280 8.751   1.00 0.00 ? 1050 ARG B HH22 6  
ATOM 7885  N N    . PRO A 1 7  ? 3.663   -7.173  9.587   1.00 0.00 ? 1051 PRO B N    6  
ATOM 7886  C CA   . PRO A 1 7  ? 2.907   -6.767  10.807  1.00 0.00 ? 1051 PRO B CA   6  
ATOM 7887  C C    . PRO A 1 7  ? 2.162   -7.936  11.432  1.00 0.00 ? 1051 PRO B C    6  
ATOM 7888  O O    . PRO A 1 7  ? 1.752   -8.870  10.742  1.00 0.00 ? 1051 PRO B O    6  
ATOM 7889  C CB   . PRO A 1 7  ? 1.933   -5.701  10.297  1.00 0.00 ? 1051 PRO B CB   6  
ATOM 7890  C CG   . PRO A 1 7  ? 1.735   -6.021  8.856   1.00 0.00 ? 1051 PRO B CG   6  
ATOM 7891  C CD   . PRO A 1 7  ? 3.048   -6.629  8.372   1.00 0.00 ? 1051 PRO B CD   6  
ATOM 7892  H HA   . PRO A 1 7  ? 3.576   -6.324  11.528  1.00 0.00 ? 1051 PRO B HA   6  
ATOM 7893  H HB2  . PRO A 1 7  ? 0.994   -5.766  10.829  1.00 0.00 ? 1051 PRO B HB2  6  
ATOM 7894  H HB3  . PRO A 1 7  ? 2.362   -4.716  10.402  1.00 0.00 ? 1051 PRO B HB3  6  
ATOM 7895  H HG2  . PRO A 1 7  ? 0.925   -6.728  8.741   1.00 0.00 ? 1051 PRO B HG2  6  
ATOM 7896  H HG3  . PRO A 1 7  ? 1.527   -5.120  8.302   1.00 0.00 ? 1051 PRO B HG3  6  
ATOM 7897  H HD2  . PRO A 1 7  ? 2.856   -7.416  7.662   1.00 0.00 ? 1051 PRO B HD2  6  
ATOM 7898  H HD3  . PRO A 1 7  ? 3.682   -5.873  7.947   1.00 0.00 ? 1051 PRO B HD3  6  
ATOM 7899  N N    . LYS A 1 8  ? 1.998   -7.874  12.741  1.00 0.00 ? 1052 LYS B N    6  
ATOM 7900  C CA   . LYS A 1 8  ? 1.305   -8.930  13.470  1.00 0.00 ? 1052 LYS B CA   6  
ATOM 7901  C C    . LYS A 1 8  ? -0.142  -9.042  13.001  1.00 0.00 ? 1052 LYS B C    6  
ATOM 7902  O O    . LYS A 1 8  ? -0.755  -10.104 13.098  1.00 0.00 ? 1052 LYS B O    6  
ATOM 7903  C CB   . LYS A 1 8  ? 1.337   -8.631  14.969  1.00 0.00 ? 1052 LYS B CB   6  
ATOM 7904  C CG   . LYS A 1 8  ? 0.472   -7.405  15.263  1.00 0.00 ? 1052 LYS B CG   6  
ATOM 7905  C CD   . LYS A 1 8  ? 0.599   -7.040  16.743  1.00 0.00 ? 1052 LYS B CD   6  
ATOM 7906  C CE   . LYS A 1 8  ? -0.292  -5.836  17.056  1.00 0.00 ? 1052 LYS B CE   6  
ATOM 7907  N NZ   . LYS A 1 8  ? -0.157  -5.472  18.497  1.00 0.00 ? 1052 LYS B NZ   6  
ATOM 7908  H H    . LYS A 1 8  ? 2.353   -7.104  13.226  1.00 0.00 ? 1052 LYS B H    6  
ATOM 7909  H HA   . LYS A 1 8  ? 1.808   -9.868  13.291  1.00 0.00 ? 1052 LYS B HA   6  
ATOM 7910  H HB2  . LYS A 1 8  ? 0.952   -9.481  15.513  1.00 0.00 ? 1052 LYS B HB2  6  
ATOM 7911  H HB3  . LYS A 1 8  ? 2.352   -8.436  15.279  1.00 0.00 ? 1052 LYS B HB3  6  
ATOM 7912  H HG2  . LYS A 1 8  ? 0.803   -6.577  14.653  1.00 0.00 ? 1052 LYS B HG2  6  
ATOM 7913  H HG3  . LYS A 1 8  ? -0.560  -7.628  15.037  1.00 0.00 ? 1052 LYS B HG3  6  
ATOM 7914  H HD2  . LYS A 1 8  ? 0.297   -7.881  17.349  1.00 0.00 ? 1052 LYS B HD2  6  
ATOM 7915  H HD3  . LYS A 1 8  ? 1.627   -6.791  16.958  1.00 0.00 ? 1052 LYS B HD3  6  
ATOM 7916  H HE2  . LYS A 1 8  ? 0.007   -4.997  16.444  1.00 0.00 ? 1052 LYS B HE2  6  
ATOM 7917  H HE3  . LYS A 1 8  ? -1.321  -6.086  16.845  1.00 0.00 ? 1052 LYS B HE3  6  
ATOM 7918  H HZ1  . LYS A 1 8  ? 0.735   -4.957  18.643  1.00 0.00 ? 1052 LYS B HZ1  6  
ATOM 7919  H HZ2  . LYS A 1 8  ? -0.157  -6.337  19.075  1.00 0.00 ? 1052 LYS B HZ2  6  
ATOM 7920  H HZ3  . LYS A 1 8  ? -0.954  -4.867  18.778  1.00 0.00 ? 1052 LYS B HZ3  6  
ATOM 7921  N N    . MET A 1 9  ? -0.681  -7.939  12.487  1.00 0.00 ? 1053 MET B N    6  
ATOM 7922  C CA   . MET A 1 9  ? -2.053  -7.926  12.001  1.00 0.00 ? 1053 MET B CA   6  
ATOM 7923  C C    . MET A 1 9  ? -2.184  -8.769  10.743  1.00 0.00 ? 1053 MET B C    6  
ATOM 7924  O O    . MET A 1 9  ? -1.335  -8.716  9.863   1.00 0.00 ? 1053 MET B O    6  
ATOM 7925  C CB   . MET A 1 9  ? -2.470  -6.493  11.690  1.00 0.00 ? 1053 MET B CB   6  
ATOM 7926  C CG   . MET A 1 9  ? -2.785  -5.752  12.988  1.00 0.00 ? 1053 MET B CG   6  
ATOM 7927  S SD   . MET A 1 9  ? -2.833  -3.970  12.661  1.00 0.00 ? 1053 MET B SD   6  
ATOM 7928  C CE   . MET A 1 9  ? -4.155  -3.984  11.423  1.00 0.00 ? 1053 MET B CE   6  
ATOM 7929  H H    . MET A 1 9  ? -0.145  -7.119  12.427  1.00 0.00 ? 1053 MET B H    6  
ATOM 7930  H HA   . MET A 1 9  ? -2.704  -8.324  12.763  1.00 0.00 ? 1053 MET B HA   6  
ATOM 7931  H HB2  . MET A 1 9  ? -1.667  -5.988  11.172  1.00 0.00 ? 1053 MET B HB2  6  
ATOM 7932  H HB3  . MET A 1 9  ? -3.349  -6.509  11.063  1.00 0.00 ? 1053 MET B HB3  6  
ATOM 7933  H HG2  . MET A 1 9  ? -3.745  -6.077  13.363  1.00 0.00 ? 1053 MET B HG2  6  
ATOM 7934  H HG3  . MET A 1 9  ? -2.019  -5.966  13.717  1.00 0.00 ? 1053 MET B HG3  6  
ATOM 7935  H HE1  . MET A 1 9  ? -4.348  -2.973  11.093  1.00 0.00 ? 1053 MET B HE1  6  
ATOM 7936  H HE2  . MET A 1 9  ? -5.054  -4.397  11.851  1.00 0.00 ? 1053 MET B HE2  6  
ATOM 7937  H HE3  . MET A 1 9  ? -3.853  -4.587  10.582  1.00 0.00 ? 1053 MET B HE3  6  
ATOM 7938  N N    . THR A 1 10 ? -3.257  -9.539  10.659  1.00 0.00 ? 1054 THR B N    6  
ATOM 7939  C CA   . THR A 1 10 ? -3.484  -10.382 9.493   1.00 0.00 ? 1054 THR B CA   6  
ATOM 7940  C C    . THR A 1 10 ? -3.900  -9.527  8.296   1.00 0.00 ? 1054 THR B C    6  
ATOM 7941  O O    . THR A 1 10 ? -4.318  -8.380  8.460   1.00 0.00 ? 1054 THR B O    6  
ATOM 7942  C CB   . THR A 1 10 ? -4.570  -11.417 9.810   1.00 0.00 ? 1054 THR B CB   6  
ATOM 7943  O OG1  . THR A 1 10 ? -5.816  -10.763 9.974   1.00 0.00 ? 1054 THR B OG1  6  
ATOM 7944  C CG2  . THR A 1 10 ? -4.206  -12.163 11.099  1.00 0.00 ? 1054 THR B CG2  6  
ATOM 7945  H H    . THR A 1 10 ? -3.909  -9.539  11.390  1.00 0.00 ? 1054 THR B H    6  
ATOM 7946  H HA   . THR A 1 10 ? -2.569  -10.895 9.254   1.00 0.00 ? 1054 THR B HA   6  
ATOM 7947  H HB   . THR A 1 10 ? -4.640  -12.124 9.003   1.00 0.00 ? 1054 THR B HB   6  
ATOM 7948  H HG1  . THR A 1 10 ? -6.330  -11.264 10.614  1.00 0.00 ? 1054 THR B HG1  6  
ATOM 7949  H HG21 . THR A 1 10 ? -3.272  -12.687 10.961  1.00 0.00 ? 1054 THR B HG21 6  
ATOM 7950  H HG22 . THR A 1 10 ? -4.985  -12.870 11.335  1.00 0.00 ? 1054 THR B HG22 6  
ATOM 7951  H HG23 . THR A 1 10 ? -4.105  -11.453 11.907  1.00 0.00 ? 1054 THR B HG23 6  
ATOM 7952  N N    . PRO A 1 11 ? -3.787  -10.054 7.103   1.00 0.00 ? 1055 PRO B N    6  
ATOM 7953  C CA   . PRO A 1 11 ? -4.163  -9.305  5.865   1.00 0.00 ? 1055 PRO B CA   6  
ATOM 7954  C C    . PRO A 1 11 ? -5.565  -8.709  5.965   1.00 0.00 ? 1055 PRO B C    6  
ATOM 7955  O O    . PRO A 1 11 ? -5.791  -7.559  5.585   1.00 0.00 ? 1055 PRO B O    6  
ATOM 7956  C CB   . PRO A 1 11 ? -4.114  -10.380 4.777   1.00 0.00 ? 1055 PRO B CB   6  
ATOM 7957  C CG   . PRO A 1 11 ? -3.141  -11.396 5.277   1.00 0.00 ? 1055 PRO B CG   6  
ATOM 7958  C CD   . PRO A 1 11 ? -3.284  -11.407 6.796   1.00 0.00 ? 1055 PRO B CD   6  
ATOM 7959  H HA   . PRO A 1 11 ? -3.437  -8.537  5.650   1.00 0.00 ? 1055 PRO B HA   6  
ATOM 7960  H HB2  . PRO A 1 11 ? -5.090  -10.824 4.643   1.00 0.00 ? 1055 PRO B HB2  6  
ATOM 7961  H HB3  . PRO A 1 11 ? -3.760  -9.960  3.848   1.00 0.00 ? 1055 PRO B HB3  6  
ATOM 7962  H HG2  . PRO A 1 11 ? -3.388  -12.371 4.870   1.00 0.00 ? 1055 PRO B HG2  6  
ATOM 7963  H HG3  . PRO A 1 11 ? -2.135  -11.122 5.004   1.00 0.00 ? 1055 PRO B HG3  6  
ATOM 7964  H HD2  . PRO A 1 11 ? -3.990  -12.163 7.101   1.00 0.00 ? 1055 PRO B HD2  6  
ATOM 7965  H HD3  . PRO A 1 11 ? -2.325  -11.563 7.268   1.00 0.00 ? 1055 PRO B HD3  6  
ATOM 7966  N N    . GLU A 1 12 ? -6.502  -9.491  6.493   1.00 0.00 ? 1056 GLU B N    6  
ATOM 7967  C CA   . GLU A 1 12 ? -7.871  -9.016  6.648   1.00 0.00 ? 1056 GLU B CA   6  
ATOM 7968  C C    . GLU A 1 12 ? -7.937  -7.902  7.688   1.00 0.00 ? 1056 GLU B C    6  
ATOM 7969  O O    . GLU A 1 12 ? -8.638  -6.910  7.502   1.00 0.00 ? 1056 GLU B O    6  
ATOM 7970  C CB   . GLU A 1 12 ? -8.787  -10.167 7.067   1.00 0.00 ? 1056 GLU B CB   6  
ATOM 7971  C CG   . GLU A 1 12 ? -8.936  -11.147 5.903   1.00 0.00 ? 1056 GLU B CG   6  
ATOM 7972  C CD   . GLU A 1 12 ? -9.759  -12.353 6.339   1.00 0.00 ? 1056 GLU B CD   6  
ATOM 7973  O OE1  . GLU A 1 12 ? -10.020 -12.469 7.525   1.00 0.00 ? 1056 GLU B OE1  6  
ATOM 7974  O OE2  . GLU A 1 12 ? -10.117 -13.144 5.482   1.00 0.00 ? 1056 GLU B OE2  6  
ATOM 7975  H H    . GLU A 1 12 ? -6.268  -10.394 6.791   1.00 0.00 ? 1056 GLU B H    6  
ATOM 7976  H HA   . GLU A 1 12 ? -8.214  -8.626  5.701   1.00 0.00 ? 1056 GLU B HA   6  
ATOM 7977  H HB2  . GLU A 1 12 ? -8.359  -10.677 7.918   1.00 0.00 ? 1056 GLU B HB2  6  
ATOM 7978  H HB3  . GLU A 1 12 ? -9.757  -9.777  7.332   1.00 0.00 ? 1056 GLU B HB3  6  
ATOM 7979  H HG2  . GLU A 1 12 ? -9.431  -10.653 5.080   1.00 0.00 ? 1056 GLU B HG2  6  
ATOM 7980  H HG3  . GLU A 1 12 ? -7.958  -11.479 5.586   1.00 0.00 ? 1056 GLU B HG3  6  
ATOM 7981  N N    . GLN A 1 13 ? -7.198  -8.068  8.782   1.00 0.00 ? 1057 GLN B N    6  
ATOM 7982  C CA   . GLN A 1 13 ? -7.190  -7.060  9.836   1.00 0.00 ? 1057 GLN B CA   6  
ATOM 7983  C C    . GLN A 1 13 ? -6.637  -5.742  9.327   1.00 0.00 ? 1057 GLN B C    6  
ATOM 7984  O O    . GLN A 1 13 ? -7.176  -4.676  9.629   1.00 0.00 ? 1057 GLN B O    6  
ATOM 7985  C CB   . GLN A 1 13 ? -6.350  -7.538  11.017  1.00 0.00 ? 1057 GLN B CB   6  
ATOM 7986  C CG   . GLN A 1 13 ? -7.106  -8.631  11.764  1.00 0.00 ? 1057 GLN B CG   6  
ATOM 7987  C CD   . GLN A 1 13 ? -6.286  -9.099  12.960  1.00 0.00 ? 1057 GLN B CD   6  
ATOM 7988  O OE1  . GLN A 1 13 ? -5.774  -10.218 12.966  1.00 0.00 ? 1057 GLN B OE1  6  
ATOM 7989  N NE2  . GLN A 1 13 ? -6.117  -8.294  13.973  1.00 0.00 ? 1057 GLN B NE2  6  
ATOM 7990  H H    . GLN A 1 13 ? -6.650  -8.877  8.881   1.00 0.00 ? 1057 GLN B H    6  
ATOM 7991  H HA   . GLN A 1 13 ? -8.204  -6.906  10.176  1.00 0.00 ? 1057 GLN B HA   6  
ATOM 7992  H HB2  . GLN A 1 13 ? -5.413  -7.933  10.654  1.00 0.00 ? 1057 GLN B HB2  6  
ATOM 7993  H HB3  . GLN A 1 13 ? -6.160  -6.712  11.684  1.00 0.00 ? 1057 GLN B HB3  6  
ATOM 7994  H HG2  . GLN A 1 13 ? -8.052  -8.238  12.107  1.00 0.00 ? 1057 GLN B HG2  6  
ATOM 7995  H HG3  . GLN A 1 13 ? -7.284  -9.460  11.102  1.00 0.00 ? 1057 GLN B HG3  6  
ATOM 7996  H HE21 . GLN A 1 13 ? -6.514  -7.395  13.958  1.00 0.00 ? 1057 GLN B HE21 6  
ATOM 7997  H HE22 . GLN A 1 13 ? -5.593  -8.583  14.749  1.00 0.00 ? 1057 GLN B HE22 6  
ATOM 7998  N N    . MET A 1 14 ? -5.566  -5.811  8.548   1.00 0.00 ? 1058 MET B N    6  
ATOM 7999  C CA   . MET A 1 14 ? -4.973  -4.601  8.008   1.00 0.00 ? 1058 MET B CA   6  
ATOM 8000  C C    . MET A 1 14 ? -5.953  -3.892  7.086   1.00 0.00 ? 1058 MET B C    6  
ATOM 8001  O O    . MET A 1 14 ? -6.082  -2.667  7.124   1.00 0.00 ? 1058 MET B O    6  
ATOM 8002  C CB   . MET A 1 14 ? -3.693  -4.924  7.236   1.00 0.00 ? 1058 MET B CB   6  
ATOM 8003  C CG   . MET A 1 14 ? -2.592  -5.340  8.214   1.00 0.00 ? 1058 MET B CG   6  
ATOM 8004  S SD   . MET A 1 14 ? -1.001  -5.402  7.349   1.00 0.00 ? 1058 MET B SD   6  
ATOM 8005  C CE   . MET A 1 14 ? -1.321  -6.874  6.352   1.00 0.00 ? 1058 MET B CE   6  
ATOM 8006  H H    . MET A 1 14 ? -5.178  -6.683  8.330   1.00 0.00 ? 1058 MET B H    6  
ATOM 8007  H HA   . MET A 1 14 ? -4.724  -3.941  8.826   1.00 0.00 ? 1058 MET B HA   6  
ATOM 8008  H HB2  . MET A 1 14 ? -3.886  -5.736  6.547   1.00 0.00 ? 1058 MET B HB2  6  
ATOM 8009  H HB3  . MET A 1 14 ? -3.373  -4.053  6.683   1.00 0.00 ? 1058 MET B HB3  6  
ATOM 8010  H HG2  . MET A 1 14 ? -2.532  -4.617  9.012   1.00 0.00 ? 1058 MET B HG2  6  
ATOM 8011  H HG3  . MET A 1 14 ? -2.818  -6.313  8.624   1.00 0.00 ? 1058 MET B HG3  6  
ATOM 8012  H HE1  . MET A 1 14 ? -0.482  -7.045  5.688   1.00 0.00 ? 1058 MET B HE1  6  
ATOM 8013  H HE2  . MET A 1 14 ? -2.213  -6.726  5.768   1.00 0.00 ? 1058 MET B HE2  6  
ATOM 8014  H HE3  . MET A 1 14 ? -1.454  -7.728  7.004   1.00 0.00 ? 1058 MET B HE3  6  
ATOM 8015  N N    . ALA A 1 15 ? -6.646  -4.666  6.259   1.00 0.00 ? 1059 ALA B N    6  
ATOM 8016  C CA   . ALA A 1 15 ? -7.607  -4.085  5.333   1.00 0.00 ? 1059 ALA B CA   6  
ATOM 8017  C C    . ALA A 1 15 ? -8.761  -3.426  6.077   1.00 0.00 ? 1059 ALA B C    6  
ATOM 8018  O O    . ALA A 1 15 ? -9.205  -2.337  5.712   1.00 0.00 ? 1059 ALA B O    6  
ATOM 8019  C CB   . ALA A 1 15 ? -8.151  -5.160  4.398   1.00 0.00 ? 1059 ALA B CB   6  
ATOM 8020  H H    . ALA A 1 15 ? -6.508  -5.640  6.274   1.00 0.00 ? 1059 ALA B H    6  
ATOM 8021  H HA   . ALA A 1 15 ? -7.104  -3.338  4.742   1.00 0.00 ? 1059 ALA B HA   6  
ATOM 8022  H HB1  . ALA A 1 15 ? -7.921  -6.135  4.798   1.00 0.00 ? 1059 ALA B HB1  6  
ATOM 8023  H HB2  . ALA A 1 15 ? -7.696  -5.051  3.425   1.00 0.00 ? 1059 ALA B HB2  6  
ATOM 8024  H HB3  . ALA A 1 15 ? -9.221  -5.049  4.309   1.00 0.00 ? 1059 ALA B HB3  6  
ATOM 8025  N N    . LYS A 1 16 ? -9.246  -4.094  7.117   1.00 0.00 ? 1060 LYS B N    6  
ATOM 8026  C CA   . LYS A 1 16 ? -10.353 -3.562  7.900   1.00 0.00 ? 1060 LYS B CA   6  
ATOM 8027  C C    . LYS A 1 16 ? -9.967  -2.245  8.557   1.00 0.00 ? 1060 LYS B C    6  
ATOM 8028  O O    . LYS A 1 16 ? -10.755 -1.299  8.578   1.00 0.00 ? 1060 LYS B O    6  
ATOM 8029  C CB   . LYS A 1 16 ? -10.766 -4.572  8.970   1.00 0.00 ? 1060 LYS B CB   6  
ATOM 8030  C CG   . LYS A 1 16 ? -11.459 -5.767  8.311   1.00 0.00 ? 1060 LYS B CG   6  
ATOM 8031  C CD   . LYS A 1 16 ? -11.813 -6.803  9.380   1.00 0.00 ? 1060 LYS B CD   6  
ATOM 8032  C CE   . LYS A 1 16 ? -12.490 -8.007  8.725   1.00 0.00 ? 1060 LYS B CE   6  
ATOM 8033  N NZ   . LYS A 1 16 ? -13.772 -7.574  8.100   1.00 0.00 ? 1060 LYS B NZ   6  
ATOM 8034  H H    . LYS A 1 16 ? -8.854  -4.958  7.360   1.00 0.00 ? 1060 LYS B H    6  
ATOM 8035  H HA   . LYS A 1 16 ? -11.190 -3.389  7.244   1.00 0.00 ? 1060 LYS B HA   6  
ATOM 8036  H HB2  . LYS A 1 16 ? -9.887  -4.912  9.498   1.00 0.00 ? 1060 LYS B HB2  6  
ATOM 8037  H HB3  . LYS A 1 16 ? -11.445 -4.102  9.665   1.00 0.00 ? 1060 LYS B HB3  6  
ATOM 8038  H HG2  . LYS A 1 16 ? -12.362 -5.433  7.821   1.00 0.00 ? 1060 LYS B HG2  6  
ATOM 8039  H HG3  . LYS A 1 16 ? -10.802 -6.213  7.584   1.00 0.00 ? 1060 LYS B HG3  6  
ATOM 8040  H HD2  . LYS A 1 16 ? -10.911 -7.123  9.882   1.00 0.00 ? 1060 LYS B HD2  6  
ATOM 8041  H HD3  . LYS A 1 16 ? -12.487 -6.360  10.101  1.00 0.00 ? 1060 LYS B HD3  6  
ATOM 8042  H HE2  . LYS A 1 16 ? -11.839 -8.416  7.966   1.00 0.00 ? 1060 LYS B HE2  6  
ATOM 8043  H HE3  . LYS A 1 16 ? -12.690 -8.758  9.474   1.00 0.00 ? 1060 LYS B HE3  6  
ATOM 8044  H HZ1  . LYS A 1 16 ? -13.582 -7.182  7.157   1.00 0.00 ? 1060 LYS B HZ1  6  
ATOM 8045  H HZ2  . LYS A 1 16 ? -14.217 -6.845  8.696   1.00 0.00 ? 1060 LYS B HZ2  6  
ATOM 8046  H HZ3  . LYS A 1 16 ? -14.408 -8.389  8.015   1.00 0.00 ? 1060 LYS B HZ3  6  
ATOM 8047  N N    . GLU A 1 17 ? -8.752  -2.178  9.087   1.00 0.00 ? 1061 GLU B N    6  
ATOM 8048  C CA   . GLU A 1 17 ? -8.298  -0.957  9.729   1.00 0.00 ? 1061 GLU B CA   6  
ATOM 8049  C C    . GLU A 1 17 ? -8.218  0.183   8.717   1.00 0.00 ? 1061 GLU B C    6  
ATOM 8050  O O    . GLU A 1 17 ? -8.635  1.311   9.000   1.00 0.00 ? 1061 GLU B O    6  
ATOM 8051  C CB   . GLU A 1 17 ? -6.921  -1.192  10.357  1.00 0.00 ? 1061 GLU B CB   6  
ATOM 8052  C CG   . GLU A 1 17 ? -7.052  -2.113  11.576  1.00 0.00 ? 1061 GLU B CG   6  
ATOM 8053  C CD   . GLU A 1 17 ? -7.934  -1.461  12.636  1.00 0.00 ? 1061 GLU B CD   6  
ATOM 8054  O OE1  . GLU A 1 17 ? -7.657  -0.326  12.990  1.00 0.00 ? 1061 GLU B OE1  6  
ATOM 8055  O OE2  . GLU A 1 17 ? -8.874  -2.102  13.076  1.00 0.00 ? 1061 GLU B OE2  6  
ATOM 8056  H H    . GLU A 1 17 ? -8.152  -2.957  9.043   1.00 0.00 ? 1061 GLU B H    6  
ATOM 8057  H HA   . GLU A 1 17 ? -8.997  -0.689  10.505  1.00 0.00 ? 1061 GLU B HA   6  
ATOM 8058  H HB2  . GLU A 1 17 ? -6.272  -1.654  9.628   1.00 0.00 ? 1061 GLU B HB2  6  
ATOM 8059  H HB3  . GLU A 1 17 ? -6.499  -0.247  10.666  1.00 0.00 ? 1061 GLU B HB3  6  
ATOM 8060  H HG2  . GLU A 1 17 ? -7.492  -3.053  11.273  1.00 0.00 ? 1061 GLU B HG2  6  
ATOM 8061  H HG3  . GLU A 1 17 ? -6.076  -2.297  11.995  1.00 0.00 ? 1061 GLU B HG3  6  
ATOM 8062  N N    . MET A 1 18 ? -7.697  -0.112  7.529   1.00 0.00 ? 1062 MET B N    6  
ATOM 8063  C CA   . MET A 1 18 ? -7.587  0.913   6.501   1.00 0.00 ? 1062 MET B CA   6  
ATOM 8064  C C    . MET A 1 18 ? -8.967  1.376   6.053   1.00 0.00 ? 1062 MET B C    6  
ATOM 8065  O O    . MET A 1 18 ? -9.187  2.562   5.813   1.00 0.00 ? 1062 MET B O    6  
ATOM 8066  C CB   . MET A 1 18 ? -6.795  0.395   5.300   1.00 0.00 ? 1062 MET B CB   6  
ATOM 8067  C CG   . MET A 1 18 ? -5.331  0.218   5.708   1.00 0.00 ? 1062 MET B CG   6  
ATOM 8068  S SD   . MET A 1 18 ? -4.292  0.078   4.230   1.00 0.00 ? 1062 MET B SD   6  
ATOM 8069  C CE   . MET A 1 18 ? -4.844  -1.559  3.709   1.00 0.00 ? 1062 MET B CE   6  
ATOM 8070  H H    . MET A 1 18 ? -7.391  -1.027  7.338   1.00 0.00 ? 1062 MET B H    6  
ATOM 8071  H HA   . MET A 1 18 ? -7.062  1.757   6.920   1.00 0.00 ? 1062 MET B HA   6  
ATOM 8072  H HB2  . MET A 1 18 ? -7.201  -0.558  4.986   1.00 0.00 ? 1062 MET B HB2  6  
ATOM 8073  H HB3  . MET A 1 18 ? -6.861  1.101   4.489   1.00 0.00 ? 1062 MET B HB3  6  
ATOM 8074  H HG2  . MET A 1 18 ? -5.018  1.062   6.293   1.00 0.00 ? 1062 MET B HG2  6  
ATOM 8075  H HG3  . MET A 1 18 ? -5.232  -0.681  6.300   1.00 0.00 ? 1062 MET B HG3  6  
ATOM 8076  H HE1  . MET A 1 18 ? -4.038  -2.265  3.841   1.00 0.00 ? 1062 MET B HE1  6  
ATOM 8077  H HE2  . MET A 1 18 ? -5.129  -1.528  2.669   1.00 0.00 ? 1062 MET B HE2  6  
ATOM 8078  H HE3  . MET A 1 18 ? -5.694  -1.855  4.305   1.00 0.00 ? 1062 MET B HE3  6  
ATOM 8079  N N    . SER A 1 19 ? -9.891  0.432   5.942   1.00 0.00 ? 1063 SER B N    6  
ATOM 8080  C CA   . SER A 1 19 ? -11.245 0.756   5.518   1.00 0.00 ? 1063 SER B CA   6  
ATOM 8081  C C    . SER A 1 19 ? -11.899 1.703   6.515   1.00 0.00 ? 1063 SER B C    6  
ATOM 8082  O O    . SER A 1 19 ? -12.592 2.644   6.129   1.00 0.00 ? 1063 SER B O    6  
ATOM 8083  C CB   . SER A 1 19 ? -12.071 -0.524  5.398   1.00 0.00 ? 1063 SER B CB   6  
ATOM 8084  O OG   . SER A 1 19 ? -11.543 -1.324  4.347   1.00 0.00 ? 1063 SER B OG   6  
ATOM 8085  H H    . SER A 1 19 ? -9.659  -0.497  6.145   1.00 0.00 ? 1063 SER B H    6  
ATOM 8086  H HA   . SER A 1 19 ? -11.205 1.236   4.553   1.00 0.00 ? 1063 SER B HA   6  
ATOM 8087  H HB2  . SER A 1 19 ? -12.022 -1.076  6.322   1.00 0.00 ? 1063 SER B HB2  6  
ATOM 8088  H HB3  . SER A 1 19 ? -13.101 -0.268  5.187   1.00 0.00 ? 1063 SER B HB3  6  
ATOM 8089  H HG   . SER A 1 19 ? -11.918 -1.015  3.521   1.00 0.00 ? 1063 SER B HG   6  
ATOM 8090  N N    . GLU A 1 20 ? -11.670 1.453   7.796   1.00 0.00 ? 1064 GLU B N    6  
ATOM 8091  C CA   . GLU A 1 20 ? -12.238 2.297   8.836   1.00 0.00 ? 1064 GLU B CA   6  
ATOM 8092  C C    . GLU A 1 20 ? -11.712 3.723   8.718   1.00 0.00 ? 1064 GLU B C    6  
ATOM 8093  O O    . GLU A 1 20 ? -12.468 4.689   8.854   1.00 0.00 ? 1064 GLU B O    6  
ATOM 8094  C CB   . GLU A 1 20 ? -11.875 1.738   10.211  1.00 0.00 ? 1064 GLU B CB   6  
ATOM 8095  C CG   . GLU A 1 20 ? -12.655 0.446   10.468  1.00 0.00 ? 1064 GLU B CG   6  
ATOM 8096  C CD   . GLU A 1 20 ? -12.164 -0.220  11.750  1.00 0.00 ? 1064 GLU B CD   6  
ATOM 8097  O OE1  . GLU A 1 20 ? -11.112 0.172   12.231  1.00 0.00 ? 1064 GLU B OE1  6  
ATOM 8098  O OE2  . GLU A 1 20 ? -12.845 -1.108  12.232  1.00 0.00 ? 1064 GLU B OE2  6  
ATOM 8099  H H    . GLU A 1 20 ? -11.106 0.694   8.048   1.00 0.00 ? 1064 GLU B H    6  
ATOM 8100  H HA   . GLU A 1 20 ? -13.312 2.309   8.735   1.00 0.00 ? 1064 GLU B HA   6  
ATOM 8101  H HB2  . GLU A 1 20 ? -10.814 1.529   10.238  1.00 0.00 ? 1064 GLU B HB2  6  
ATOM 8102  H HB3  . GLU A 1 20 ? -12.119 2.464   10.970  1.00 0.00 ? 1064 GLU B HB3  6  
ATOM 8103  H HG2  . GLU A 1 20 ? -13.706 0.677   10.564  1.00 0.00 ? 1064 GLU B HG2  6  
ATOM 8104  H HG3  . GLU A 1 20 ? -12.513 -0.231  9.638   1.00 0.00 ? 1064 GLU B HG3  6  
ATOM 8105  N N    . PHE A 1 21 ? -10.415 3.856   8.455   1.00 0.00 ? 1065 PHE B N    6  
ATOM 8106  C CA   . PHE A 1 21 ? -9.819  5.178   8.318   1.00 0.00 ? 1065 PHE B CA   6  
ATOM 8107  C C    . PHE A 1 21 ? -10.356 5.879   7.075   1.00 0.00 ? 1065 PHE B C    6  
ATOM 8108  O O    . PHE A 1 21 ? -10.631 7.081   7.091   1.00 0.00 ? 1065 PHE B O    6  
ATOM 8109  C CB   . PHE A 1 21 ? -8.295  5.062   8.234   1.00 0.00 ? 1065 PHE B CB   6  
ATOM 8110  C CG   . PHE A 1 21 ? -7.730  4.795   9.609   1.00 0.00 ? 1065 PHE B CG   6  
ATOM 8111  C CD1  . PHE A 1 21 ? -7.153  3.554   9.902   1.00 0.00 ? 1065 PHE B CD1  6  
ATOM 8112  C CD2  . PHE A 1 21 ? -7.790  5.788   10.595  1.00 0.00 ? 1065 PHE B CD2  6  
ATOM 8113  C CE1  . PHE A 1 21 ? -6.634  3.306   11.180  1.00 0.00 ? 1065 PHE B CE1  6  
ATOM 8114  C CE2  . PHE A 1 21 ? -7.271  5.541   11.872  1.00 0.00 ? 1065 PHE B CE2  6  
ATOM 8115  C CZ   . PHE A 1 21 ? -6.693  4.298   12.164  1.00 0.00 ? 1065 PHE B CZ   6  
ATOM 8116  H H    . PHE A 1 21 ? -9.855  3.055   8.344   1.00 0.00 ? 1065 PHE B H    6  
ATOM 8117  H HA   . PHE A 1 21 ? -10.075 5.766   9.188   1.00 0.00 ? 1065 PHE B HA   6  
ATOM 8118  H HB2  . PHE A 1 21 ? -8.033  4.247   7.574   1.00 0.00 ? 1065 PHE B HB2  6  
ATOM 8119  H HB3  . PHE A 1 21 ? -7.883  5.983   7.848   1.00 0.00 ? 1065 PHE B HB3  6  
ATOM 8120  H HD1  . PHE A 1 21 ? -7.104  2.788   9.144   1.00 0.00 ? 1065 PHE B HD1  6  
ATOM 8121  H HD2  . PHE A 1 21 ? -8.236  6.746   10.371  1.00 0.00 ? 1065 PHE B HD2  6  
ATOM 8122  H HE1  . PHE A 1 21 ? -6.188  2.347   11.406  1.00 0.00 ? 1065 PHE B HE1  6  
ATOM 8123  H HE2  . PHE A 1 21 ? -7.316  6.307   12.632  1.00 0.00 ? 1065 PHE B HE2  6  
ATOM 8124  H HZ   . PHE A 1 21 ? -6.293  4.108   13.149  1.00 0.00 ? 1065 PHE B HZ   6  
ATOM 8125  N N    . LEU A 1 22 ? -10.502 5.116   6.000   1.00 0.00 ? 1066 LEU B N    6  
ATOM 8126  C CA   . LEU A 1 22 ? -11.007 5.667   4.749   1.00 0.00 ? 1066 LEU B CA   6  
ATOM 8127  C C    . LEU A 1 22 ? -12.451 6.133   4.904   1.00 0.00 ? 1066 LEU B C    6  
ATOM 8128  O O    . LEU A 1 22 ? -12.834 7.180   4.383   1.00 0.00 ? 1066 LEU B O    6  
ATOM 8129  C CB   . LEU A 1 22 ? -10.920 4.613   3.646   1.00 0.00 ? 1066 LEU B CB   6  
ATOM 8130  C CG   . LEU A 1 22 ? -9.453  4.362   3.296   1.00 0.00 ? 1066 LEU B CG   6  
ATOM 8131  C CD1  . LEU A 1 22 ? -9.349  3.125   2.409   1.00 0.00 ? 1066 LEU B CD1  6  
ATOM 8132  C CD2  . LEU A 1 22 ? -8.888  5.572   2.547   1.00 0.00 ? 1066 LEU B CD2  6  
ATOM 8133  H H    . LEU A 1 22 ? -10.269 4.164   6.050   1.00 0.00 ? 1066 LEU B H    6  
ATOM 8134  H HA   . LEU A 1 22 ? -10.398 6.513   4.468   1.00 0.00 ? 1066 LEU B HA   6  
ATOM 8135  H HB2  . LEU A 1 22 ? -11.372 3.693   3.992   1.00 0.00 ? 1066 LEU B HB2  6  
ATOM 8136  H HB3  . LEU A 1 22 ? -11.441 4.964   2.769   1.00 0.00 ? 1066 LEU B HB3  6  
ATOM 8137  H HG   . LEU A 1 22 ? -8.889  4.202   4.205   1.00 0.00 ? 1066 LEU B HG   6  
ATOM 8138  H HD11 . LEU A 1 22 ? -10.244 3.034   1.811   1.00 0.00 ? 1066 LEU B HD11 6  
ATOM 8139  H HD12 . LEU A 1 22 ? -9.239  2.249   3.029   1.00 0.00 ? 1066 LEU B HD12 6  
ATOM 8140  H HD13 . LEU A 1 22 ? -8.491  3.218   1.759   1.00 0.00 ? 1066 LEU B HD13 6  
ATOM 8141  H HD21 . LEU A 1 22 ? -9.617  5.930   1.836   1.00 0.00 ? 1066 LEU B HD21 6  
ATOM 8142  H HD22 . LEU A 1 22 ? -7.987  5.284   2.025   1.00 0.00 ? 1066 LEU B HD22 6  
ATOM 8143  H HD23 . LEU A 1 22 ? -8.659  6.357   3.253   1.00 0.00 ? 1066 LEU B HD23 6  
ATOM 8144  N N    . SER A 1 23 ? -13.248 5.349   5.624   1.00 0.00 ? 1067 SER B N    6  
ATOM 8145  C CA   . SER A 1 23 ? -14.646 5.696   5.836   1.00 0.00 ? 1067 SER B CA   6  
ATOM 8146  C C    . SER A 1 23 ? -14.756 6.988   6.637   1.00 0.00 ? 1067 SER B C    6  
ATOM 8147  O O    . SER A 1 23 ? -15.611 7.829   6.363   1.00 0.00 ? 1067 SER B O    6  
ATOM 8148  C CB   . SER A 1 23 ? -15.357 4.566   6.582   1.00 0.00 ? 1067 SER B CB   6  
ATOM 8149  O OG   . SER A 1 23 ? -14.764 4.402   7.864   1.00 0.00 ? 1067 SER B OG   6  
ATOM 8150  H H    . SER A 1 23 ? -12.890 4.525   6.014   1.00 0.00 ? 1067 SER B H    6  
ATOM 8151  H HA   . SER A 1 23 ? -15.123 5.836   4.878   1.00 0.00 ? 1067 SER B HA   6  
ATOM 8152  H HB2  . SER A 1 23 ? -16.398 4.811   6.702   1.00 0.00 ? 1067 SER B HB2  6  
ATOM 8153  H HB3  . SER A 1 23 ? -15.268 3.650   6.012   1.00 0.00 ? 1067 SER B HB3  6  
ATOM 8154  H HG   . SER A 1 23 ? -15.070 3.568   8.228   1.00 0.00 ? 1067 SER B HG   6  
ATOM 8155  N N    . ARG A 1 24 ? -13.878 7.143   7.622   1.00 0.00 ? 1068 ARG B N    6  
ATOM 8156  C CA   . ARG A 1 24 ? -13.886 8.345   8.444   1.00 0.00 ? 1068 ARG B CA   6  
ATOM 8157  C C    . ARG A 1 24 ? -13.561 9.571   7.598   1.00 0.00 ? 1068 ARG B C    6  
ATOM 8158  O O    . ARG A 1 24 ? -14.160 10.632  7.768   1.00 0.00 ? 1068 ARG B O    6  
ATOM 8159  C CB   . ARG A 1 24 ? -12.866 8.209   9.577   1.00 0.00 ? 1068 ARG B CB   6  
ATOM 8160  C CG   . ARG A 1 24 ? -13.363 7.179   10.595  1.00 0.00 ? 1068 ARG B CG   6  
ATOM 8161  C CD   . ARG A 1 24 ? -14.527 7.771   11.396  1.00 0.00 ? 1068 ARG B CD   6  
ATOM 8162  N NE   . ARG A 1 24 ? -15.806 7.377   10.816  1.00 0.00 ? 1068 ARG B NE   6  
ATOM 8163  C CZ   . ARG A 1 24 ? -16.965 7.834   11.299  1.00 0.00 ? 1068 ARG B CZ   6  
ATOM 8164  N NH1  . ARG A 1 24 ? -16.991 8.655   12.318  1.00 0.00 ? 1068 ARG B NH1  6  
ATOM 8165  N NH2  . ARG A 1 24 ? -18.086 7.460   10.746  1.00 0.00 ? 1068 ARG B NH2  6  
ATOM 8166  H H    . ARG A 1 24 ? -13.214 6.441   7.797   1.00 0.00 ? 1068 ARG B H    6  
ATOM 8167  H HA   . ARG A 1 24 ? -14.868 8.470   8.872   1.00 0.00 ? 1068 ARG B HA   6  
ATOM 8168  H HB2  . ARG A 1 24 ? -11.918 7.887   9.171   1.00 0.00 ? 1068 ARG B HB2  6  
ATOM 8169  H HB3  . ARG A 1 24 ? -12.743 9.164   10.067  1.00 0.00 ? 1068 ARG B HB3  6  
ATOM 8170  H HG2  . ARG A 1 24 ? -13.697 6.292   10.075  1.00 0.00 ? 1068 ARG B HG2  6  
ATOM 8171  H HG3  . ARG A 1 24 ? -12.559 6.921   11.268  1.00 0.00 ? 1068 ARG B HG3  6  
ATOM 8172  H HD2  . ARG A 1 24 ? -14.475 7.417   12.414  1.00 0.00 ? 1068 ARG B HD2  6  
ATOM 8173  H HD3  . ARG A 1 24 ? -14.447 8.850   11.391  1.00 0.00 ? 1068 ARG B HD3  6  
ATOM 8174  H HE   . ARG A 1 24 ? -15.816 6.765   10.051  1.00 0.00 ? 1068 ARG B HE   6  
ATOM 8175  H HH11 . ARG A 1 24 ? -16.142 8.951   12.749  1.00 0.00 ? 1068 ARG B HH11 6  
ATOM 8176  H HH12 . ARG A 1 24 ? -17.867 8.987   12.667  1.00 0.00 ? 1068 ARG B HH12 6  
ATOM 8177  H HH21 . ARG A 1 24 ? -18.074 6.834   9.965   1.00 0.00 ? 1068 ARG B HH21 6  
ATOM 8178  H HH22 . ARG A 1 24 ? -18.956 7.798   11.102  1.00 0.00 ? 1068 ARG B HH22 6  
ATOM 8179  N N    . GLY A 1 25 ? -12.607 9.415   6.684   1.00 0.00 ? 1069 GLY B N    6  
ATOM 8180  C CA   . GLY A 1 25 ? -12.215 10.520  5.816   1.00 0.00 ? 1069 GLY B CA   6  
ATOM 8181  C C    . GLY A 1 25 ? -11.917 11.780  6.630   1.00 0.00 ? 1069 GLY B C    6  
ATOM 8182  O O    . GLY A 1 25 ? -12.551 12.817  6.433   1.00 0.00 ? 1069 GLY B O    6  
ATOM 8183  H H    . GLY A 1 25 ? -12.162 8.545   6.594   1.00 0.00 ? 1069 GLY B H    6  
ATOM 8184  H HA2  . GLY A 1 25 ? -11.330 10.236  5.263   1.00 0.00 ? 1069 GLY B HA2  6  
ATOM 8185  H HA3  . GLY A 1 25 ? -13.015 10.727  5.122   1.00 0.00 ? 1069 GLY B HA3  6  
ATOM 8186  N N    . PRO A 1 26 ? -10.980 11.706  7.543   1.00 0.00 ? 1070 PRO B N    6  
ATOM 8187  C CA   . PRO A 1 26 ? -10.608 12.863  8.417   1.00 0.00 ? 1070 PRO B CA   6  
ATOM 8188  C C    . PRO A 1 26 ? -10.126 14.062  7.608   1.00 0.00 ? 1070 PRO B C    6  
ATOM 8189  O O    . PRO A 1 26 ? -10.281 15.210  8.026   1.00 0.00 ? 1070 PRO B O    6  
ATOM 8190  C CB   . PRO A 1 26 ? -9.481  12.309  9.302   1.00 0.00 ? 1070 PRO B CB   6  
ATOM 8191  C CG   . PRO A 1 26 ? -8.969  11.105  8.585   1.00 0.00 ? 1070 PRO B CG   6  
ATOM 8192  C CD   . PRO A 1 26 ? -10.164 10.522  7.839   1.00 0.00 ? 1070 PRO B CD   6  
ATOM 8193  H HA   . PRO A 1 26 ? -11.445 13.144  9.036   1.00 0.00 ? 1070 PRO B HA   6  
ATOM 8194  H HB2  . PRO A 1 26 ? -8.697  13.044  9.409   1.00 0.00 ? 1070 PRO B HB2  6  
ATOM 8195  H HB3  . PRO A 1 26 ? -9.868  12.025  10.266  1.00 0.00 ? 1070 PRO B HB3  6  
ATOM 8196  H HG2  . PRO A 1 26 ? -8.193  11.389  7.886   1.00 0.00 ? 1070 PRO B HG2  6  
ATOM 8197  H HG3  . PRO A 1 26 ? -8.593  10.381  9.290   1.00 0.00 ? 1070 PRO B HG3  6  
ATOM 8198  H HD2  . PRO A 1 26 ? -9.844  10.034  6.926   1.00 0.00 ? 1070 PRO B HD2  6  
ATOM 8199  H HD3  . PRO A 1 26 ? -10.712 9.838   8.469   1.00 0.00 ? 1070 PRO B HD3  6  
ATOM 8200  N N    . ALA A 1 27 ? -9.549  13.789  6.446   1.00 0.00 ? 1071 ALA B N    6  
ATOM 8201  C CA   . ALA A 1 27 ? -9.056  14.851  5.578   1.00 0.00 ? 1071 ALA B CA   6  
ATOM 8202  C C    . ALA A 1 27 ? -10.201 15.754  5.133   1.00 0.00 ? 1071 ALA B C    6  
ATOM 8203  O O    . ALA A 1 27 ? -10.042 16.971  5.027   1.00 0.00 ? 1071 ALA B O    6  
ATOM 8204  C CB   . ALA A 1 27 ? -8.365  14.252  4.353   1.00 0.00 ? 1071 ALA B CB   6  
ATOM 8205  H H    . ALA A 1 27 ? -9.460  12.855  6.161   1.00 0.00 ? 1071 ALA B H    6  
ATOM 8206  H HA   . ALA A 1 27 ? -8.340  15.441  6.127   1.00 0.00 ? 1071 ALA B HA   6  
ATOM 8207  H HB1  . ALA A 1 27 ? -9.080  14.151  3.548   1.00 0.00 ? 1071 ALA B HB1  6  
ATOM 8208  H HB2  . ALA A 1 27 ? -7.965  13.281  4.603   1.00 0.00 ? 1071 ALA B HB2  6  
ATOM 8209  H HB3  . ALA A 1 27 ? -7.561  14.902  4.039   1.00 0.00 ? 1071 ALA B HB3  6  
ATOM 8210  N N    . VAL A 1 28 ? -11.353 15.147  4.865   1.00 0.00 ? 1072 VAL B N    6  
ATOM 8211  C CA   . VAL A 1 28 ? -12.519 15.900  4.420   1.00 0.00 ? 1072 VAL B CA   6  
ATOM 8212  C C    . VAL A 1 28 ? -12.208 16.656  3.128   1.00 0.00 ? 1072 VAL B C    6  
ATOM 8213  O O    . VAL A 1 28 ? -12.898 17.614  2.775   1.00 0.00 ? 1072 VAL B O    6  
ATOM 8214  C CB   . VAL A 1 28 ? -12.944 16.886  5.507   1.00 0.00 ? 1072 VAL B CB   6  
ATOM 8215  C CG1  . VAL A 1 28 ? -14.337 17.436  5.191   1.00 0.00 ? 1072 VAL B CG1  6  
ATOM 8216  C CG2  . VAL A 1 28 ? -12.978 16.178  6.864   1.00 0.00 ? 1072 VAL B CG2  6  
ATOM 8217  H H    . VAL A 1 28 ? -11.419 14.178  4.965   1.00 0.00 ? 1072 VAL B H    6  
ATOM 8218  H HA   . VAL A 1 28 ? -13.331 15.211  4.236   1.00 0.00 ? 1072 VAL B HA   6  
ATOM 8219  H HB   . VAL A 1 28 ? -12.236 17.698  5.542   1.00 0.00 ? 1072 VAL B HB   6  
ATOM 8220  H HG11 . VAL A 1 28 ? -14.944 17.410  6.082   1.00 0.00 ? 1072 VAL B HG11 6  
ATOM 8221  H HG12 . VAL A 1 28 ? -14.798 16.829  4.424   1.00 0.00 ? 1072 VAL B HG12 6  
ATOM 8222  H HG13 . VAL A 1 28 ? -14.252 18.454  4.842   1.00 0.00 ? 1072 VAL B HG13 6  
ATOM 8223  H HG21 . VAL A 1 28 ? -12.941 15.110  6.715   1.00 0.00 ? 1072 VAL B HG21 6  
ATOM 8224  H HG22 . VAL A 1 28 ? -13.888 16.437  7.384   1.00 0.00 ? 1072 VAL B HG22 6  
ATOM 8225  H HG23 . VAL A 1 28 ? -12.128 16.489  7.453   1.00 0.00 ? 1072 VAL B HG23 6  
ATOM 8226  N N    . LEU A 1 29 ? -11.167 16.219  2.424   1.00 0.00 ? 1073 LEU B N    6  
ATOM 8227  C CA   . LEU A 1 29 ? -10.776 16.861  1.175   1.00 0.00 ? 1073 LEU B CA   6  
ATOM 8228  C C    . LEU A 1 29 ? -11.881 16.726  0.132   1.00 0.00 ? 1073 LEU B C    6  
ATOM 8229  O O    . LEU A 1 29 ? -12.151 17.657  -0.626  1.00 0.00 ? 1073 LEU B O    6  
ATOM 8230  C CB   . LEU A 1 29 ? -9.488  16.226  0.648   1.00 0.00 ? 1073 LEU B CB   6  
ATOM 8231  C CG   . LEU A 1 29 ? -8.317  16.615  1.553   1.00 0.00 ? 1073 LEU B CG   6  
ATOM 8232  C CD1  . LEU A 1 29 ? -7.089  15.780  1.188   1.00 0.00 ? 1073 LEU B CD1  6  
ATOM 8233  C CD2  . LEU A 1 29 ? -7.993  18.097  1.356   1.00 0.00 ? 1073 LEU B CD2  6  
ATOM 8234  H H    . LEU A 1 29 ? -10.654 15.451  2.746   1.00 0.00 ? 1073 LEU B H    6  
ATOM 8235  H HA   . LEU A 1 29 ? -10.600 17.909  1.361   1.00 0.00 ? 1073 LEU B HA   6  
ATOM 8236  H HB2  . LEU A 1 29 ? -9.594  15.150  0.640   1.00 0.00 ? 1073 LEU B HB2  6  
ATOM 8237  H HB3  . LEU A 1 29 ? -9.297  16.577  -0.354  1.00 0.00 ? 1073 LEU B HB3  6  
ATOM 8238  H HG   . LEU A 1 29 ? -8.582  16.434  2.585   1.00 0.00 ? 1073 LEU B HG   6  
ATOM 8239  H HD11 . LEU A 1 29 ? -6.386  16.392  0.643   1.00 0.00 ? 1073 LEU B HD11 6  
ATOM 8240  H HD12 . LEU A 1 29 ? -7.393  14.945  0.571   1.00 0.00 ? 1073 LEU B HD12 6  
ATOM 8241  H HD13 . LEU A 1 29 ? -6.623  15.410  2.089   1.00 0.00 ? 1073 LEU B HD13 6  
ATOM 8242  H HD21 . LEU A 1 29 ? -6.926  18.220  1.233   1.00 0.00 ? 1073 LEU B HD21 6  
ATOM 8243  H HD22 . LEU A 1 29 ? -8.322  18.655  2.222   1.00 0.00 ? 1073 LEU B HD22 6  
ATOM 8244  H HD23 . LEU A 1 29 ? -8.503  18.464  0.478   1.00 0.00 ? 1073 LEU B HD23 6  
ATOM 8245  N N    . ALA A 1 30 ? -12.517 15.559  0.099   1.00 0.00 ? 1074 ALA B N    6  
ATOM 8246  C CA   . ALA A 1 30 ? -13.591 15.313  -0.855  1.00 0.00 ? 1074 ALA B CA   6  
ATOM 8247  C C    . ALA A 1 30 ? -13.055 15.357  -2.282  1.00 0.00 ? 1074 ALA B C    6  
ATOM 8248  O O    . ALA A 1 30 ? -13.770 15.726  -3.213  1.00 0.00 ? 1074 ALA B O    6  
ATOM 8249  C CB   . ALA A 1 30 ? -14.688 16.365  -0.688  1.00 0.00 ? 1074 ALA B CB   6  
ATOM 8250  H H    . ALA A 1 30 ? -12.258 14.852  0.727   1.00 0.00 ? 1074 ALA B H    6  
ATOM 8251  H HA   . ALA A 1 30 ? -14.012 14.337  -0.668  1.00 0.00 ? 1074 ALA B HA   6  
ATOM 8252  H HB1  . ALA A 1 30 ? -15.654 15.901  -0.815  1.00 0.00 ? 1074 ALA B HB1  6  
ATOM 8253  H HB2  . ALA A 1 30 ? -14.558 17.138  -1.430  1.00 0.00 ? 1074 ALA B HB2  6  
ATOM 8254  H HB3  . ALA A 1 30 ? -14.623 16.798  0.299   1.00 0.00 ? 1074 ALA B HB3  6  
ATOM 8255  N N    . THR A 1 31 ? -11.792 14.976  -2.445  1.00 0.00 ? 1075 THR B N    6  
ATOM 8256  C CA   . THR A 1 31 ? -11.167 14.975  -3.763  1.00 0.00 ? 1075 THR B CA   6  
ATOM 8257  C C    . THR A 1 31 ? -10.311 13.728  -3.950  1.00 0.00 ? 1075 THR B C    6  
ATOM 8258  O O    . THR A 1 31 ? -9.768  13.186  -2.988  1.00 0.00 ? 1075 THR B O    6  
ATOM 8259  C CB   . THR A 1 31 ? -10.297 16.222  -3.931  1.00 0.00 ? 1075 THR B CB   6  
ATOM 8260  O OG1  . THR A 1 31 ? -10.300 16.967  -2.723  1.00 0.00 ? 1075 THR B OG1  6  
ATOM 8261  C CG2  . THR A 1 31 ? -10.853 17.082  -5.068  1.00 0.00 ? 1075 THR B CG2  6  
ATOM 8262  H H    . THR A 1 31 ? -11.271 14.691  -1.666  1.00 0.00 ? 1075 THR B H    6  
ATOM 8263  H HA   . THR A 1 31 ? -11.940 14.985  -4.516  1.00 0.00 ? 1075 THR B HA   6  
ATOM 8264  H HB   . THR A 1 31 ? -9.288  15.925  -4.171  1.00 0.00 ? 1075 THR B HB   6  
ATOM 8265  H HG1  . THR A 1 31 ? -9.430  17.358  -2.614  1.00 0.00 ? 1075 THR B HG1  6  
ATOM 8266  H HG21 . THR A 1 31 ? -10.541 16.671  -6.015  1.00 0.00 ? 1075 THR B HG21 6  
ATOM 8267  H HG22 . THR A 1 31 ? -10.478 18.091  -4.971  1.00 0.00 ? 1075 THR B HG22 6  
ATOM 8268  H HG23 . THR A 1 31 ? -11.931 17.092  -5.016  1.00 0.00 ? 1075 THR B HG23 6  
ATOM 8269  N N    . LYS A 1 32 ? -10.196 13.278  -5.194  1.00 0.00 ? 1076 LYS B N    6  
ATOM 8270  C CA   . LYS A 1 32 ? -9.402  12.093  -5.498  1.00 0.00 ? 1076 LYS B CA   6  
ATOM 8271  C C    . LYS A 1 32 ? -7.937  12.322  -5.138  1.00 0.00 ? 1076 LYS B C    6  
ATOM 8272  O O    . LYS A 1 32 ? -7.265  11.424  -4.630  1.00 0.00 ? 1076 LYS B O    6  
ATOM 8273  C CB   . LYS A 1 32 ? -9.515  11.755  -6.984  1.00 0.00 ? 1076 LYS B CB   6  
ATOM 8274  C CG   . LYS A 1 32 ? -10.921 11.228  -7.281  1.00 0.00 ? 1076 LYS B CG   6  
ATOM 8275  C CD   . LYS A 1 32 ? -11.113 11.084  -8.794  1.00 0.00 ? 1076 LYS B CD   6  
ATOM 8276  C CE   . LYS A 1 32 ? -10.248 9.937   -9.322  1.00 0.00 ? 1076 LYS B CE   6  
ATOM 8277  N NZ   . LYS A 1 32 ? -10.719 8.650   -8.736  1.00 0.00 ? 1076 LYS B NZ   6  
ATOM 8278  H H    . LYS A 1 32 ? -10.651 13.751  -5.921  1.00 0.00 ? 1076 LYS B H    6  
ATOM 8279  H HA   . LYS A 1 32 ? -9.778  11.263  -4.922  1.00 0.00 ? 1076 LYS B HA   6  
ATOM 8280  H HB2  . LYS A 1 32 ? -9.330  12.642  -7.571  1.00 0.00 ? 1076 LYS B HB2  6  
ATOM 8281  H HB3  . LYS A 1 32 ? -8.788  10.999  -7.234  1.00 0.00 ? 1076 LYS B HB3  6  
ATOM 8282  H HG2  . LYS A 1 32 ? -11.050 10.264  -6.808  1.00 0.00 ? 1076 LYS B HG2  6  
ATOM 8283  H HG3  . LYS A 1 32 ? -11.653 11.920  -6.893  1.00 0.00 ? 1076 LYS B HG3  6  
ATOM 8284  H HD2  . LYS A 1 32 ? -12.153 10.876  -9.005  1.00 0.00 ? 1076 LYS B HD2  6  
ATOM 8285  H HD3  . LYS A 1 32 ? -10.824 12.003  -9.281  1.00 0.00 ? 1076 LYS B HD3  6  
ATOM 8286  H HE2  . LYS A 1 32 ? -10.330 9.892   -10.398 1.00 0.00 ? 1076 LYS B HE2  6  
ATOM 8287  H HE3  . LYS A 1 32 ? -9.218  10.102  -9.048  1.00 0.00 ? 1076 LYS B HE3  6  
ATOM 8288  H HZ1  . LYS A 1 32 ? -10.127 8.405   -7.917  1.00 0.00 ? 1076 LYS B HZ1  6  
ATOM 8289  H HZ2  . LYS A 1 32 ? -10.652 7.898   -9.453  1.00 0.00 ? 1076 LYS B HZ2  6  
ATOM 8290  H HZ3  . LYS A 1 32 ? -11.707 8.751   -8.428  1.00 0.00 ? 1076 LYS B HZ3  6  
ATOM 8291  N N    . ALA A 1 33 ? -7.448  13.527  -5.413  1.00 0.00 ? 1077 ALA B N    6  
ATOM 8292  C CA   . ALA A 1 33 ? -6.060  13.862  -5.121  1.00 0.00 ? 1077 ALA B CA   6  
ATOM 8293  C C    . ALA A 1 33 ? -5.116  12.861  -5.782  1.00 0.00 ? 1077 ALA B C    6  
ATOM 8294  O O    . ALA A 1 33 ? -4.060  12.537  -5.239  1.00 0.00 ? 1077 ALA B O    6  
ATOM 8295  C CB   . ALA A 1 33 ? -5.830  13.862  -3.608  1.00 0.00 ? 1077 ALA B CB   6  
ATOM 8296  H H    . ALA A 1 33 ? -8.031  14.200  -5.822  1.00 0.00 ? 1077 ALA B H    6  
ATOM 8297  H HA   . ALA A 1 33 ? -5.849  14.849  -5.505  1.00 0.00 ? 1077 ALA B HA   6  
ATOM 8298  H HB1  . ALA A 1 33 ? -5.778  12.843  -3.252  1.00 0.00 ? 1077 ALA B HB1  6  
ATOM 8299  H HB2  . ALA A 1 33 ? -6.647  14.371  -3.120  1.00 0.00 ? 1077 ALA B HB2  6  
ATOM 8300  H HB3  . ALA A 1 33 ? -4.904  14.368  -3.384  1.00 0.00 ? 1077 ALA B HB3  6  
ATOM 8301  N N    . ALA A 1 34 ? -5.505  12.377  -6.954  1.00 0.00 ? 1078 ALA B N    6  
ATOM 8302  C CA   . ALA A 1 34 ? -4.687  11.415  -7.681  1.00 0.00 ? 1078 ALA B CA   6  
ATOM 8303  C C    . ALA A 1 34 ? -3.333  12.018  -8.039  1.00 0.00 ? 1078 ALA B C    6  
ATOM 8304  O O    . ALA A 1 34 ? -2.304  11.345  -7.966  1.00 0.00 ? 1078 ALA B O    6  
ATOM 8305  C CB   . ALA A 1 34 ? -5.404  10.978  -8.960  1.00 0.00 ? 1078 ALA B CB   6  
ATOM 8306  H H    . ALA A 1 34 ? -6.358  12.672  -7.339  1.00 0.00 ? 1078 ALA B H    6  
ATOM 8307  H HA   . ALA A 1 34 ? -4.530  10.547  -7.058  1.00 0.00 ? 1078 ALA B HA   6  
ATOM 8308  H HB1  . ALA A 1 34 ? -6.184  10.273  -8.714  1.00 0.00 ? 1078 ALA B HB1  6  
ATOM 8309  H HB2  . ALA A 1 34 ? -4.696  10.512  -9.629  1.00 0.00 ? 1078 ALA B HB2  6  
ATOM 8310  H HB3  . ALA A 1 34 ? -5.839  11.841  -9.442  1.00 0.00 ? 1078 ALA B HB3  6  
ATOM 8311  N N    . ALA A 1 35 ? -3.340  13.286  -8.431  1.00 0.00 ? 1079 ALA B N    6  
ATOM 8312  C CA   . ALA A 1 35 ? -2.107  13.965  -8.803  1.00 0.00 ? 1079 ALA B CA   6  
ATOM 8313  C C    . ALA A 1 35 ? -1.138  14.009  -7.626  1.00 0.00 ? 1079 ALA B C    6  
ATOM 8314  O O    . ALA A 1 35 ? 0.066   13.812  -7.789  1.00 0.00 ? 1079 ALA B O    6  
ATOM 8315  C CB   . ALA A 1 35 ? -2.418  15.392  -9.260  1.00 0.00 ? 1079 ALA B CB   6  
ATOM 8316  H H    . ALA A 1 35 ? -4.191  13.772  -8.474  1.00 0.00 ? 1079 ALA B H    6  
ATOM 8317  H HA   . ALA A 1 35 ? -1.644  13.433  -9.619  1.00 0.00 ? 1079 ALA B HA   6  
ATOM 8318  H HB1  . ALA A 1 35 ? -1.564  15.800  -9.780  1.00 0.00 ? 1079 ALA B HB1  6  
ATOM 8319  H HB2  . ALA A 1 35 ? -2.642  16.004  -8.399  1.00 0.00 ? 1079 ALA B HB2  6  
ATOM 8320  H HB3  . ALA A 1 35 ? -3.271  15.379  -9.924  1.00 0.00 ? 1079 ALA B HB3  6  
ATOM 8321  N N    . GLY A 1 36 ? -1.673  14.267  -6.438  1.00 0.00 ? 1080 GLY B N    6  
ATOM 8322  C CA   . GLY A 1 36 ? -0.850  14.333  -5.237  1.00 0.00 ? 1080 GLY B CA   6  
ATOM 8323  C C    . GLY A 1 36 ? -0.235  12.978  -4.926  1.00 0.00 ? 1080 GLY B C    6  
ATOM 8324  O O    . GLY A 1 36 ? 0.928   12.883  -4.542  1.00 0.00 ? 1080 GLY B O    6  
ATOM 8325  H H    . GLY A 1 36 ? -2.637  14.403  -6.366  1.00 0.00 ? 1080 GLY B H    6  
ATOM 8326  H HA2  . GLY A 1 36 ? -0.061  15.055  -5.389  1.00 0.00 ? 1080 GLY B HA2  6  
ATOM 8327  H HA3  . GLY A 1 36 ? -1.461  14.642  -4.405  1.00 0.00 ? 1080 GLY B HA3  6  
ATOM 8328  N N    . THR A 1 37 ? -1.027  11.932  -5.095  1.00 0.00 ? 1081 THR B N    6  
ATOM 8329  C CA   . THR A 1 37 ? -0.564  10.585  -4.827  1.00 0.00 ? 1081 THR B CA   6  
ATOM 8330  C C    . THR A 1 37 ? 0.603   10.229  -5.736  1.00 0.00 ? 1081 THR B C    6  
ATOM 8331  O O    . THR A 1 37 ? 1.582   9.627   -5.302  1.00 0.00 ? 1081 THR B O    6  
ATOM 8332  C CB   . THR A 1 37 ? -1.707  9.599   -5.035  1.00 0.00 ? 1081 THR B CB   6  
ATOM 8333  O OG1  . THR A 1 37 ? -2.756  9.883   -4.118  1.00 0.00 ? 1081 THR B OG1  6  
ATOM 8334  C CG2  . THR A 1 37 ? -1.193  8.191   -4.800  1.00 0.00 ? 1081 THR B CG2  6  
ATOM 8335  H H    . THR A 1 37 ? -1.945  12.066  -5.405  1.00 0.00 ? 1081 THR B H    6  
ATOM 8336  H HA   . THR A 1 37 ? -0.238  10.526  -3.800  1.00 0.00 ? 1081 THR B HA   6  
ATOM 8337  H HB   . THR A 1 37 ? -2.078  9.680   -6.045  1.00 0.00 ? 1081 THR B HB   6  
ATOM 8338  H HG1  . THR A 1 37 ? -2.902  10.831  -4.115  1.00 0.00 ? 1081 THR B HG1  6  
ATOM 8339  H HG21 . THR A 1 37 ? -0.394  8.224   -4.077  1.00 0.00 ? 1081 THR B HG21 6  
ATOM 8340  H HG22 . THR A 1 37 ? -0.824  7.790   -5.729  1.00 0.00 ? 1081 THR B HG22 6  
ATOM 8341  H HG23 . THR A 1 37 ? -1.995  7.574   -4.428  1.00 0.00 ? 1081 THR B HG23 6  
ATOM 8342  N N    . LYS A 1 38 ? 0.490   10.602  -6.997  1.00 0.00 ? 1082 LYS B N    6  
ATOM 8343  C CA   . LYS A 1 38 ? 1.544   10.316  -7.959  1.00 0.00 ? 1082 LYS B CA   6  
ATOM 8344  C C    . LYS A 1 38 ? 2.847   11.002  -7.567  1.00 0.00 ? 1082 LYS B C    6  
ATOM 8345  O O    . LYS A 1 38 ? 3.926   10.419  -7.680  1.00 0.00 ? 1082 LYS B O    6  
ATOM 8346  C CB   . LYS A 1 38 ? 1.118   10.806  -9.335  1.00 0.00 ? 1082 LYS B CB   6  
ATOM 8347  C CG   . LYS A 1 38 ? -0.005  9.913   -9.874  1.00 0.00 ? 1082 LYS B CG   6  
ATOM 8348  C CD   . LYS A 1 38 ? -0.427  10.390  -11.270 1.00 0.00 ? 1082 LYS B CD   6  
ATOM 8349  C CE   . LYS A 1 38 ? -1.543  9.486   -11.808 1.00 0.00 ? 1082 LYS B CE   6  
ATOM 8350  N NZ   . LYS A 1 38 ? -1.962  9.959   -13.159 1.00 0.00 ? 1082 LYS B NZ   6  
ATOM 8351  H H    . LYS A 1 38 ? -0.313  11.080  -7.289  1.00 0.00 ? 1082 LYS B H    6  
ATOM 8352  H HA   . LYS A 1 38 ? 1.704   9.250   -8.002  1.00 0.00 ? 1082 LYS B HA   6  
ATOM 8353  H HB2  . LYS A 1 38 ? 0.763   11.826  -9.244  1.00 0.00 ? 1082 LYS B HB2  6  
ATOM 8354  H HB3  . LYS A 1 38 ? 1.962   10.775  -10.005 1.00 0.00 ? 1082 LYS B HB3  6  
ATOM 8355  H HG2  . LYS A 1 38 ? 0.347   8.893   -9.933  1.00 0.00 ? 1082 LYS B HG2  6  
ATOM 8356  H HG3  . LYS A 1 38 ? -0.852  9.962   -9.208  1.00 0.00 ? 1082 LYS B HG3  6  
ATOM 8357  H HD2  . LYS A 1 38 ? -0.786  11.407  -11.210 1.00 0.00 ? 1082 LYS B HD2  6  
ATOM 8358  H HD3  . LYS A 1 38 ? 0.420   10.345  -11.937 1.00 0.00 ? 1082 LYS B HD3  6  
ATOM 8359  H HE2  . LYS A 1 38 ? -1.181  8.471   -11.880 1.00 0.00 ? 1082 LYS B HE2  6  
ATOM 8360  H HE3  . LYS A 1 38 ? -2.388  9.519   -11.137 1.00 0.00 ? 1082 LYS B HE3  6  
ATOM 8361  H HZ1  . LYS A 1 38 ? -2.839  10.511  -13.077 1.00 0.00 ? 1082 LYS B HZ1  6  
ATOM 8362  H HZ2  . LYS A 1 38 ? -2.124  9.137   -13.779 1.00 0.00 ? 1082 LYS B HZ2  6  
ATOM 8363  H HZ3  . LYS A 1 38 ? -1.215  10.557  -13.566 1.00 0.00 ? 1082 LYS B HZ3  6  
ATOM 8364  N N    . LYS A 1 39 ? 2.740   12.243  -7.110  1.00 0.00 ? 1083 LYS B N    6  
ATOM 8365  C CA   . LYS A 1 39 ? 3.913   13.003  -6.707  1.00 0.00 ? 1083 LYS B CA   6  
ATOM 8366  C C    . LYS A 1 39 ? 4.567   12.347  -5.501  1.00 0.00 ? 1083 LYS B C    6  
ATOM 8367  O O    . LYS A 1 39 ? 5.793   12.313  -5.385  1.00 0.00 ? 1083 LYS B O    6  
ATOM 8368  C CB   . LYS A 1 39 ? 3.499   14.428  -6.353  1.00 0.00 ? 1083 LYS B CB   6  
ATOM 8369  C CG   . LYS A 1 39 ? 2.990   15.127  -7.610  1.00 0.00 ? 1083 LYS B CG   6  
ATOM 8370  C CD   . LYS A 1 39 ? 2.370   16.464  -7.222  1.00 0.00 ? 1083 LYS B CD   6  
ATOM 8371  C CE   . LYS A 1 39 ? 1.577   17.007  -8.405  1.00 0.00 ? 1083 LYS B CE   6  
ATOM 8372  N NZ   . LYS A 1 39 ? 2.502   17.365  -9.520  1.00 0.00 ? 1083 LYS B NZ   6  
ATOM 8373  H H    . LYS A 1 39 ? 1.853   12.658  -7.045  1.00 0.00 ? 1083 LYS B H    6  
ATOM 8374  H HA   . LYS A 1 39 ? 4.618   13.032  -7.523  1.00 0.00 ? 1083 LYS B HA   6  
ATOM 8375  H HB2  . LYS A 1 39 ? 2.720   14.405  -5.608  1.00 0.00 ? 1083 LYS B HB2  6  
ATOM 8376  H HB3  . LYS A 1 39 ? 4.353   14.967  -5.967  1.00 0.00 ? 1083 LYS B HB3  6  
ATOM 8377  H HG2  . LYS A 1 39 ? 3.813   15.293  -8.291  1.00 0.00 ? 1083 LYS B HG2  6  
ATOM 8378  H HG3  . LYS A 1 39 ? 2.244   14.511  -8.088  1.00 0.00 ? 1083 LYS B HG3  6  
ATOM 8379  H HD2  . LYS A 1 39 ? 1.711   16.318  -6.378  1.00 0.00 ? 1083 LYS B HD2  6  
ATOM 8380  H HD3  . LYS A 1 39 ? 3.149   17.161  -6.957  1.00 0.00 ? 1083 LYS B HD3  6  
ATOM 8381  H HE2  . LYS A 1 39 ? 0.888   16.247  -8.740  1.00 0.00 ? 1083 LYS B HE2  6  
ATOM 8382  H HE3  . LYS A 1 39 ? 1.028   17.882  -8.095  1.00 0.00 ? 1083 LYS B HE3  6  
ATOM 8383  H HZ1  . LYS A 1 39 ? 3.481   17.149  -9.246  1.00 0.00 ? 1083 LYS B HZ1  6  
ATOM 8384  H HZ2  . LYS A 1 39 ? 2.416   18.381  -9.729  1.00 0.00 ? 1083 LYS B HZ2  6  
ATOM 8385  H HZ3  . LYS A 1 39 ? 2.253   16.816  -10.367 1.00 0.00 ? 1083 LYS B HZ3  6  
ATOM 8386  N N    . TYR A 1 40 ? 3.734   11.836  -4.596  1.00 0.00 ? 1084 TYR B N    6  
ATOM 8387  C CA   . TYR A 1 40 ? 4.244   11.190  -3.385  1.00 0.00 ? 1084 TYR B CA   6  
ATOM 8388  C C    . TYR A 1 40 ? 4.048   9.684   -3.453  1.00 0.00 ? 1084 TYR B C    6  
ATOM 8389  O O    . TYR A 1 40 ? 2.941   9.178   -3.271  1.00 0.00 ? 1084 TYR B O    6  
ATOM 8390  C CB   . TYR A 1 40 ? 3.528   11.734  -2.150  1.00 0.00 ? 1084 TYR B CB   6  
ATOM 8391  C CG   . TYR A 1 40 ? 3.291   13.206  -2.330  1.00 0.00 ? 1084 TYR B CG   6  
ATOM 8392  C CD1  . TYR A 1 40 ? 2.020   13.738  -2.105  1.00 0.00 ? 1084 TYR B CD1  6  
ATOM 8393  C CD2  . TYR A 1 40 ? 4.336   14.034  -2.745  1.00 0.00 ? 1084 TYR B CD2  6  
ATOM 8394  C CE1  . TYR A 1 40 ? 1.793   15.105  -2.295  1.00 0.00 ? 1084 TYR B CE1  6  
ATOM 8395  C CE2  . TYR A 1 40 ? 4.114   15.396  -2.935  1.00 0.00 ? 1084 TYR B CE2  6  
ATOM 8396  C CZ   . TYR A 1 40 ? 2.840   15.938  -2.710  1.00 0.00 ? 1084 TYR B CZ   6  
ATOM 8397  O OH   . TYR A 1 40 ? 2.616   17.286  -2.897  1.00 0.00 ? 1084 TYR B OH   6  
ATOM 8398  H H    . TYR A 1 40 ? 2.763   11.905  -4.739  1.00 0.00 ? 1084 TYR B H    6  
ATOM 8399  H HA   . TYR A 1 40 ? 5.299   11.402  -3.296  1.00 0.00 ? 1084 TYR B HA   6  
ATOM 8400  H HB2  . TYR A 1 40 ? 2.582   11.227  -2.026  1.00 0.00 ? 1084 TYR B HB2  6  
ATOM 8401  H HB3  . TYR A 1 40 ? 4.141   11.573  -1.277  1.00 0.00 ? 1084 TYR B HB3  6  
ATOM 8402  H HD1  . TYR A 1 40 ? 1.214   13.096  -1.784  1.00 0.00 ? 1084 TYR B HD1  6  
ATOM 8403  H HD2  . TYR A 1 40 ? 5.319   13.618  -2.918  1.00 0.00 ? 1084 TYR B HD2  6  
ATOM 8404  H HE1  . TYR A 1 40 ? 0.809   15.513  -2.127  1.00 0.00 ? 1084 TYR B HE1  6  
ATOM 8405  H HE2  . TYR A 1 40 ? 4.922   16.026  -3.261  1.00 0.00 ? 1084 TYR B HE2  6  
ATOM 8406  H HH   . TYR A 1 40 ? 1.679   17.452  -2.772  1.00 0.00 ? 1084 TYR B HH   6  
ATOM 8407  N N    . ASP A 1 41 ? 5.138   8.975   -3.703  1.00 0.00 ? 1085 ASP B N    6  
ATOM 8408  C CA   . ASP A 1 41 ? 5.084   7.513   -3.789  1.00 0.00 ? 1085 ASP B CA   6  
ATOM 8409  C C    . ASP A 1 41 ? 5.084   6.896   -2.395  1.00 0.00 ? 1085 ASP B C    6  
ATOM 8410  O O    . ASP A 1 41 ? 6.126   6.800   -1.745  1.00 0.00 ? 1085 ASP B O    6  
ATOM 8411  C CB   . ASP A 1 41 ? 6.284   6.980   -4.580  1.00 0.00 ? 1085 ASP B CB   6  
ATOM 8412  C CG   . ASP A 1 41 ? 6.138   7.334   -6.055  1.00 0.00 ? 1085 ASP B CG   6  
ATOM 8413  O OD1  . ASP A 1 41 ? 5.051   7.726   -6.446  1.00 0.00 ? 1085 ASP B OD1  6  
ATOM 8414  O OD2  . ASP A 1 41 ? 7.117   7.208   -6.774  1.00 0.00 ? 1085 ASP B OD2  6  
ATOM 8415  H H    . ASP A 1 41 ? 5.988   9.444   -3.829  1.00 0.00 ? 1085 ASP B H    6  
ATOM 8416  H HA   . ASP A 1 41 ? 4.176   7.228   -4.298  1.00 0.00 ? 1085 ASP B HA   6  
ATOM 8417  H HB2  . ASP A 1 41 ? 7.193   7.415   -4.193  1.00 0.00 ? 1085 ASP B HB2  6  
ATOM 8418  H HB3  . ASP A 1 41 ? 6.327   5.906   -4.475  1.00 0.00 ? 1085 ASP B HB3  6  
ATOM 8419  N N    . LEU A 1 42 ? 3.905   6.482   -1.942  1.00 0.00 ? 1086 LEU B N    6  
ATOM 8420  C CA   . LEU A 1 42 ? 3.772   5.881   -0.620  1.00 0.00 ? 1086 LEU B CA   6  
ATOM 8421  C C    . LEU A 1 42 ? 3.430   4.394   -0.728  1.00 0.00 ? 1086 LEU B C    6  
ATOM 8422  O O    . LEU A 1 42 ? 3.216   3.725   0.285   1.00 0.00 ? 1086 LEU B O    6  
ATOM 8423  C CB   . LEU A 1 42 ? 2.670   6.601   0.158   1.00 0.00 ? 1086 LEU B CB   6  
ATOM 8424  C CG   . LEU A 1 42 ? 2.921   8.109   0.106   1.00 0.00 ? 1086 LEU B CG   6  
ATOM 8425  C CD1  . LEU A 1 42 ? 1.784   8.847   0.806   1.00 0.00 ? 1086 LEU B CD1  6  
ATOM 8426  C CD2  . LEU A 1 42 ? 4.240   8.447   0.803   1.00 0.00 ? 1086 LEU B CD2  6  
ATOM 8427  H H    . LEU A 1 42 ? 3.111   6.587   -2.505  1.00 0.00 ? 1086 LEU B H    6  
ATOM 8428  H HA   . LEU A 1 42 ? 4.703   5.989   -0.087  1.00 0.00 ? 1086 LEU B HA   6  
ATOM 8429  H HB2  . LEU A 1 42 ? 1.709   6.376   -0.285  1.00 0.00 ? 1086 LEU B HB2  6  
ATOM 8430  H HB3  . LEU A 1 42 ? 2.679   6.272   1.185   1.00 0.00 ? 1086 LEU B HB3  6  
ATOM 8431  H HG   . LEU A 1 42 ? 2.970   8.421   -0.923  1.00 0.00 ? 1086 LEU B HG   6  
ATOM 8432  H HD11 . LEU A 1 42 ? 0.837   8.444   0.480   1.00 0.00 ? 1086 LEU B HD11 6  
ATOM 8433  H HD12 . LEU A 1 42 ? 1.833   9.897   0.558   1.00 0.00 ? 1086 LEU B HD12 6  
ATOM 8434  H HD13 . LEU A 1 42 ? 1.878   8.724   1.876   1.00 0.00 ? 1086 LEU B HD13 6  
ATOM 8435  H HD21 . LEU A 1 42 ? 4.642   7.563   1.271   1.00 0.00 ? 1086 LEU B HD21 6  
ATOM 8436  H HD22 . LEU A 1 42 ? 4.065   9.203   1.555   1.00 0.00 ? 1086 LEU B HD22 6  
ATOM 8437  H HD23 . LEU A 1 42 ? 4.943   8.822   0.074   1.00 0.00 ? 1086 LEU B HD23 6  
ATOM 8438  N N    . SER A 1 43 ? 3.390   3.877   -1.952  1.00 0.00 ? 1087 SER B N    6  
ATOM 8439  C CA   . SER A 1 43 ? 3.083   2.469   -2.166  1.00 0.00 ? 1087 SER B CA   6  
ATOM 8440  C C    . SER A 1 43 ? 4.233   1.595   -1.674  1.00 0.00 ? 1087 SER B C    6  
ATOM 8441  O O    . SER A 1 43 ? 4.103   0.375   -1.570  1.00 0.00 ? 1087 SER B O    6  
ATOM 8442  C CB   . SER A 1 43 ? 2.832   2.213   -3.651  1.00 0.00 ? 1087 SER B CB   6  
ATOM 8443  O OG   . SER A 1 43 ? 4.030   2.452   -4.377  1.00 0.00 ? 1087 SER B OG   6  
ATOM 8444  H H    . SER A 1 43 ? 3.574   4.447   -2.725  1.00 0.00 ? 1087 SER B H    6  
ATOM 8445  H HA   . SER A 1 43 ? 2.195   2.214   -1.611  1.00 0.00 ? 1087 SER B HA   6  
ATOM 8446  H HB2  . SER A 1 43 ? 2.525   1.191   -3.800  1.00 0.00 ? 1087 SER B HB2  6  
ATOM 8447  H HB3  . SER A 1 43 ? 2.051   2.876   -3.999  1.00 0.00 ? 1087 SER B HB3  6  
ATOM 8448  H HG   . SER A 1 43 ? 4.727   2.634   -3.745  1.00 0.00 ? 1087 SER B HG   6  
ATOM 8449  N N    . LYS A 1 44 ? 5.360   2.229   -1.364  1.00 0.00 ? 1088 LYS B N    6  
ATOM 8450  C CA   . LYS A 1 44 ? 6.518   1.497   -0.873  1.00 0.00 ? 1088 LYS B CA   6  
ATOM 8451  C C    . LYS A 1 44 ? 6.600   1.568   0.653   1.00 0.00 ? 1088 LYS B C    6  
ATOM 8452  O O    . LYS A 1 44 ? 7.496   0.982   1.259   1.00 0.00 ? 1088 LYS B O    6  
ATOM 8453  C CB   . LYS A 1 44 ? 7.794   2.073   -1.483  1.00 0.00 ? 1088 LYS B CB   6  
ATOM 8454  C CG   . LYS A 1 44 ? 7.742   1.919   -3.003  1.00 0.00 ? 1088 LYS B CG   6  
ATOM 8455  C CD   . LYS A 1 44 ? 9.074   2.359   -3.610  1.00 0.00 ? 1088 LYS B CD   6  
ATOM 8456  C CE   . LYS A 1 44 ? 9.229   3.875   -3.460  1.00 0.00 ? 1088 LYS B CE   6  
ATOM 8457  N NZ   . LYS A 1 44 ? 10.483  4.313   -4.133  1.00 0.00 ? 1088 LYS B NZ   6  
ATOM 8458  H H    . LYS A 1 44 ? 5.408   3.206   -1.455  1.00 0.00 ? 1088 LYS B H    6  
ATOM 8459  H HA   . LYS A 1 44 ? 6.427   0.463   -1.169  1.00 0.00 ? 1088 LYS B HA   6  
ATOM 8460  H HB2  . LYS A 1 44 ? 7.874   3.121   -1.227  1.00 0.00 ? 1088 LYS B HB2  6  
ATOM 8461  H HB3  . LYS A 1 44 ? 8.650   1.541   -1.097  1.00 0.00 ? 1088 LYS B HB3  6  
ATOM 8462  H HG2  . LYS A 1 44 ? 7.556   0.884   -3.253  1.00 0.00 ? 1088 LYS B HG2  6  
ATOM 8463  H HG3  . LYS A 1 44 ? 6.947   2.533   -3.400  1.00 0.00 ? 1088 LYS B HG3  6  
ATOM 8464  H HD2  . LYS A 1 44 ? 9.885   1.861   -3.099  1.00 0.00 ? 1088 LYS B HD2  6  
ATOM 8465  H HD3  . LYS A 1 44 ? 9.095   2.100   -4.658  1.00 0.00 ? 1088 LYS B HD3  6  
ATOM 8466  H HE2  . LYS A 1 44 ? 8.384   4.370   -3.914  1.00 0.00 ? 1088 LYS B HE2  6  
ATOM 8467  H HE3  . LYS A 1 44 ? 9.276   4.129   -2.412  1.00 0.00 ? 1088 LYS B HE3  6  
ATOM 8468  H HZ1  . LYS A 1 44 ? 10.520  3.914   -5.092  1.00 0.00 ? 1088 LYS B HZ1  6  
ATOM 8469  H HZ2  . LYS A 1 44 ? 11.305  3.979   -3.586  1.00 0.00 ? 1088 LYS B HZ2  6  
ATOM 8470  H HZ3  . LYS A 1 44 ? 10.503  5.350   -4.191  1.00 0.00 ? 1088 LYS B HZ3  6  
ATOM 8471  N N    . TRP A 1 45 ? 5.665   2.291   1.270   1.00 0.00 ? 1089 TRP B N    6  
ATOM 8472  C CA   . TRP A 1 45 ? 5.655   2.427   2.722   1.00 0.00 ? 1089 TRP B CA   6  
ATOM 8473  C C    . TRP A 1 45 ? 4.815   1.329   3.361   1.00 0.00 ? 1089 TRP B C    6  
ATOM 8474  O O    . TRP A 1 45 ? 3.706   1.041   2.914   1.00 0.00 ? 1089 TRP B O    6  
ATOM 8475  C CB   . TRP A 1 45 ? 5.087   3.794   3.113   1.00 0.00 ? 1089 TRP B CB   6  
ATOM 8476  C CG   . TRP A 1 45 ? 6.113   4.851   2.863   1.00 0.00 ? 1089 TRP B CG   6  
ATOM 8477  C CD1  . TRP A 1 45 ? 6.928   4.902   1.786   1.00 0.00 ? 1089 TRP B CD1  6  
ATOM 8478  C CD2  . TRP A 1 45 ? 6.450   6.005   3.687   1.00 0.00 ? 1089 TRP B CD2  6  
ATOM 8479  N NE1  . TRP A 1 45 ? 7.746   6.007   1.896   1.00 0.00 ? 1089 TRP B NE1  6  
ATOM 8480  C CE2  . TRP A 1 45 ? 7.489   6.723   3.048   1.00 0.00 ? 1089 TRP B CE2  6  
ATOM 8481  C CE3  . TRP A 1 45 ? 5.962   6.494   4.913   1.00 0.00 ? 1089 TRP B CE3  6  
ATOM 8482  C CZ2  . TRP A 1 45 ? 8.026   7.884   3.606   1.00 0.00 ? 1089 TRP B CZ2  6  
ATOM 8483  C CZ3  . TRP A 1 45 ? 6.501   7.665   5.476   1.00 0.00 ? 1089 TRP B CZ3  6  
ATOM 8484  C CH2  . TRP A 1 45 ? 7.530   8.357   4.823   1.00 0.00 ? 1089 TRP B CH2  6  
ATOM 8485  H H    . TRP A 1 45 ? 4.973   2.740   0.746   1.00 0.00 ? 1089 TRP B H    6  
ATOM 8486  H HA   . TRP A 1 45 ? 6.667   2.354   3.087   1.00 0.00 ? 1089 TRP B HA   6  
ATOM 8487  H HB2  . TRP A 1 45 ? 4.209   4.000   2.518   1.00 0.00 ? 1089 TRP B HB2  6  
ATOM 8488  H HB3  . TRP A 1 45 ? 4.822   3.789   4.158   1.00 0.00 ? 1089 TRP B HB3  6  
ATOM 8489  H HD1  . TRP A 1 45 ? 6.940   4.191   0.972   1.00 0.00 ? 1089 TRP B HD1  6  
ATOM 8490  H HE1  . TRP A 1 45 ? 8.426   6.269   1.247   1.00 0.00 ? 1089 TRP B HE1  6  
ATOM 8491  H HE3  . TRP A 1 45 ? 5.167   5.969   5.427   1.00 0.00 ? 1089 TRP B HE3  6  
ATOM 8492  H HZ2  . TRP A 1 45 ? 8.819   8.413   3.100   1.00 0.00 ? 1089 TRP B HZ2  6  
ATOM 8493  H HZ3  . TRP A 1 45 ? 6.123   8.033   6.416   1.00 0.00 ? 1089 TRP B HZ3  6  
ATOM 8494  H HH2  . TRP A 1 45 ? 7.938   9.255   5.261   1.00 0.00 ? 1089 TRP B HH2  6  
ATOM 8495  N N    . LYS A 1 46 ? 5.347   0.726   4.417   1.00 0.00 ? 1090 LYS B N    6  
ATOM 8496  C CA   . LYS A 1 46 ? 4.634   -0.335  5.118   1.00 0.00 ? 1090 LYS B CA   6  
ATOM 8497  C C    . LYS A 1 46 ? 3.336   0.184   5.712   1.00 0.00 ? 1090 LYS B C    6  
ATOM 8498  O O    . LYS A 1 46 ? 3.155   1.388   5.877   1.00 0.00 ? 1090 LYS B O    6  
ATOM 8499  C CB   . LYS A 1 46 ? 5.510   -0.902  6.230   1.00 0.00 ? 1090 LYS B CB   6  
ATOM 8500  C CG   . LYS A 1 46 ? 6.647   -1.697  5.603   1.00 0.00 ? 1090 LYS B CG   6  
ATOM 8501  C CD   . LYS A 1 46 ? 7.579   -2.201  6.702   1.00 0.00 ? 1090 LYS B CD   6  
ATOM 8502  C CE   . LYS A 1 46 ? 8.728   -3.009  6.087   1.00 0.00 ? 1090 LYS B CE   6  
ATOM 8503  N NZ   . LYS A 1 46 ? 9.653   -3.467  7.164   1.00 0.00 ? 1090 LYS B NZ   6  
ATOM 8504  H H    . LYS A 1 46 ? 6.236   1.004   4.736   1.00 0.00 ? 1090 LYS B H    6  
ATOM 8505  H HA   . LYS A 1 46 ? 4.408   -1.124  4.423   1.00 0.00 ? 1090 LYS B HA   6  
ATOM 8506  H HB2  . LYS A 1 46 ? 5.912   -0.095  6.823   1.00 0.00 ? 1090 LYS B HB2  6  
ATOM 8507  H HB3  . LYS A 1 46 ? 4.919   -1.555  6.858   1.00 0.00 ? 1090 LYS B HB3  6  
ATOM 8508  H HG2  . LYS A 1 46 ? 6.233   -2.537  5.065   1.00 0.00 ? 1090 LYS B HG2  6  
ATOM 8509  H HG3  . LYS A 1 46 ? 7.195   -1.064  4.926   1.00 0.00 ? 1090 LYS B HG3  6  
ATOM 8510  H HD2  . LYS A 1 46 ? 7.979   -1.354  7.238   1.00 0.00 ? 1090 LYS B HD2  6  
ATOM 8511  H HD3  . LYS A 1 46 ? 7.021   -2.828  7.380   1.00 0.00 ? 1090 LYS B HD3  6  
ATOM 8512  H HE2  . LYS A 1 46 ? 8.324   -3.870  5.570   1.00 0.00 ? 1090 LYS B HE2  6  
ATOM 8513  H HE3  . LYS A 1 46 ? 9.268   -2.388  5.386   1.00 0.00 ? 1090 LYS B HE3  6  
ATOM 8514  H HZ1  . LYS A 1 46 ? 10.628  -3.195  6.923   1.00 0.00 ? 1090 LYS B HZ1  6  
ATOM 8515  H HZ2  . LYS A 1 46 ? 9.594   -4.502  7.257   1.00 0.00 ? 1090 LYS B HZ2  6  
ATOM 8516  H HZ3  . LYS A 1 46 ? 9.386   -3.022  8.065   1.00 0.00 ? 1090 LYS B HZ3  6  
ATOM 8517  N N    . TYR A 1 47 ? 2.436   -0.735  6.035   1.00 0.00 ? 1091 TYR B N    6  
ATOM 8518  C CA   . TYR A 1 47 ? 1.158   -0.361  6.622   1.00 0.00 ? 1091 TYR B CA   6  
ATOM 8519  C C    . TYR A 1 47 ? 1.386   0.445   7.887   1.00 0.00 ? 1091 TYR B C    6  
ATOM 8520  O O    . TYR A 1 47 ? 0.780   1.497   8.085   1.00 0.00 ? 1091 TYR B O    6  
ATOM 8521  C CB   . TYR A 1 47 ? 0.345   -1.616  6.951   1.00 0.00 ? 1091 TYR B CB   6  
ATOM 8522  C CG   . TYR A 1 47 ? -0.836  -1.243  7.820   1.00 0.00 ? 1091 TYR B CG   6  
ATOM 8523  C CD1  . TYR A 1 47 ? -1.929  -0.558  7.276   1.00 0.00 ? 1091 TYR B CD1  6  
ATOM 8524  C CD2  . TYR A 1 47 ? -0.829  -1.580  9.179   1.00 0.00 ? 1091 TYR B CD2  6  
ATOM 8525  C CE1  . TYR A 1 47 ? -3.016  -0.217  8.091   1.00 0.00 ? 1091 TYR B CE1  6  
ATOM 8526  C CE2  . TYR A 1 47 ? -1.915  -1.239  9.993   1.00 0.00 ? 1091 TYR B CE2  6  
ATOM 8527  C CZ   . TYR A 1 47 ? -3.008  -0.556  9.450   1.00 0.00 ? 1091 TYR B CZ   6  
ATOM 8528  O OH   . TYR A 1 47 ? -4.077  -0.215  10.253  1.00 0.00 ? 1091 TYR B OH   6  
ATOM 8529  H H    . TYR A 1 47 ? 2.637   -1.682  5.882   1.00 0.00 ? 1091 TYR B H    6  
ATOM 8530  H HA   . TYR A 1 47 ? 0.609   0.240   5.913   1.00 0.00 ? 1091 TYR B HA   6  
ATOM 8531  H HB2  . TYR A 1 47 ? -0.012  -2.064  6.035   1.00 0.00 ? 1091 TYR B HB2  6  
ATOM 8532  H HB3  . TYR A 1 47 ? 0.968   -2.322  7.479   1.00 0.00 ? 1091 TYR B HB3  6  
ATOM 8533  H HD1  . TYR A 1 47 ? -1.936  -0.298  6.228   1.00 0.00 ? 1091 TYR B HD1  6  
ATOM 8534  H HD2  . TYR A 1 47 ? 0.014   -2.111  9.599   1.00 0.00 ? 1091 TYR B HD2  6  
ATOM 8535  H HE1  . TYR A 1 47 ? -3.860  0.312   7.673   1.00 0.00 ? 1091 TYR B HE1  6  
ATOM 8536  H HE2  . TYR A 1 47 ? -1.908  -1.502  11.040  1.00 0.00 ? 1091 TYR B HE2  6  
ATOM 8537  H HH   . TYR A 1 47 ? -4.358  -1.003  10.721  1.00 0.00 ? 1091 TYR B HH   6  
ATOM 8538  N N    . ALA A 1 48 ? 2.269   -0.052  8.739   1.00 0.00 ? 1092 ALA B N    6  
ATOM 8539  C CA   . ALA A 1 48 ? 2.569   0.643   9.983   1.00 0.00 ? 1092 ALA B CA   6  
ATOM 8540  C C    . ALA A 1 48 ? 3.172   2.016   9.696   1.00 0.00 ? 1092 ALA B C    6  
ATOM 8541  O O    . ALA A 1 48 ? 2.865   2.994   10.376  1.00 0.00 ? 1092 ALA B O    6  
ATOM 8542  C CB   . ALA A 1 48 ? 3.537   -0.181  10.831  1.00 0.00 ? 1092 ALA B CB   6  
ATOM 8543  H H    . ALA A 1 48 ? 2.735   -0.894  8.524   1.00 0.00 ? 1092 ALA B H    6  
ATOM 8544  H HA   . ALA A 1 48 ? 1.652   0.778   10.535  1.00 0.00 ? 1092 ALA B HA   6  
ATOM 8545  H HB1  . ALA A 1 48 ? 2.981   -0.732  11.574  1.00 0.00 ? 1092 ALA B HB1  6  
ATOM 8546  H HB2  . ALA A 1 48 ? 4.239   0.478   11.322  1.00 0.00 ? 1092 ALA B HB2  6  
ATOM 8547  H HB3  . ALA A 1 48 ? 4.075   -0.872  10.197  1.00 0.00 ? 1092 ALA B HB3  6  
ATOM 8548  N N    . GLU A 1 49 ? 4.040   2.074   8.688   1.00 0.00 ? 1093 GLU B N    6  
ATOM 8549  C CA   . GLU A 1 49 ? 4.693   3.328   8.321   1.00 0.00 ? 1093 GLU B CA   6  
ATOM 8550  C C    . GLU A 1 49 ? 3.671   4.358   7.848   1.00 0.00 ? 1093 GLU B C    6  
ATOM 8551  O O    . GLU A 1 49 ? 3.717   5.516   8.256   1.00 0.00 ? 1093 GLU B O    6  
ATOM 8552  C CB   . GLU A 1 49 ? 5.716   3.075   7.210   1.00 0.00 ? 1093 GLU B CB   6  
ATOM 8553  C CG   . GLU A 1 49 ? 6.882   2.250   7.761   1.00 0.00 ? 1093 GLU B CG   6  
ATOM 8554  C CD   . GLU A 1 49 ? 7.650   3.059   8.799   1.00 0.00 ? 1093 GLU B CD   6  
ATOM 8555  O OE1  . GLU A 1 49 ? 7.586   4.277   8.739   1.00 0.00 ? 1093 GLU B OE1  6  
ATOM 8556  O OE2  . GLU A 1 49 ? 8.292   2.450   9.640   1.00 0.00 ? 1093 GLU B OE2  6  
ATOM 8557  H H    . GLU A 1 49 ? 4.243   1.261   8.186   1.00 0.00 ? 1093 GLU B H    6  
ATOM 8558  H HA   . GLU A 1 49 ? 5.208   3.718   9.185   1.00 0.00 ? 1093 GLU B HA   6  
ATOM 8559  H HB2  . GLU A 1 49 ? 5.243   2.535   6.401   1.00 0.00 ? 1093 GLU B HB2  6  
ATOM 8560  H HB3  . GLU A 1 49 ? 6.087   4.019   6.843   1.00 0.00 ? 1093 GLU B HB3  6  
ATOM 8561  H HG2  . GLU A 1 49 ? 6.501   1.350   8.220   1.00 0.00 ? 1093 GLU B HG2  6  
ATOM 8562  H HG3  . GLU A 1 49 ? 7.548   1.985   6.952   1.00 0.00 ? 1093 GLU B HG3  6  
ATOM 8563  N N    . LEU A 1 50 ? 2.737   3.930   7.003   1.00 0.00 ? 1094 LEU B N    6  
ATOM 8564  C CA   . LEU A 1 50 ? 1.707   4.830   6.508   1.00 0.00 ? 1094 LEU B CA   6  
ATOM 8565  C C    . LEU A 1 50 ? 0.793   5.274   7.636   1.00 0.00 ? 1094 LEU B C    6  
ATOM 8566  O O    . LEU A 1 50 ? 0.384   6.430   7.698   1.00 0.00 ? 1094 LEU B O    6  
ATOM 8567  C CB   . LEU A 1 50 ? 0.895   4.149   5.407   1.00 0.00 ? 1094 LEU B CB   6  
ATOM 8568  C CG   . LEU A 1 50 ? 1.730   4.100   4.131   1.00 0.00 ? 1094 LEU B CG   6  
ATOM 8569  C CD1  . LEU A 1 50 ? 1.096   3.133   3.127   1.00 0.00 ? 1094 LEU B CD1  6  
ATOM 8570  C CD2  . LEU A 1 50 ? 1.768   5.500   3.515   1.00 0.00 ? 1094 LEU B CD2  6  
ATOM 8571  H H    . LEU A 1 50 ? 2.729   2.994   6.719   1.00 0.00 ? 1094 LEU B H    6  
ATOM 8572  H HA   . LEU A 1 50 ? 2.187   5.703   6.094   1.00 0.00 ? 1094 LEU B HA   6  
ATOM 8573  H HB2  . LEU A 1 50 ? 0.648   3.143   5.716   1.00 0.00 ? 1094 LEU B HB2  6  
ATOM 8574  H HB3  . LEU A 1 50 ? -0.011  4.706   5.225   1.00 0.00 ? 1094 LEU B HB3  6  
ATOM 8575  H HG   . LEU A 1 50 ? 2.733   3.781   4.370   1.00 0.00 ? 1094 LEU B HG   6  
ATOM 8576  H HD11 . LEU A 1 50 ? 0.352   3.658   2.543   1.00 0.00 ? 1094 LEU B HD11 6  
ATOM 8577  H HD12 . LEU A 1 50 ? 0.625   2.319   3.660   1.00 0.00 ? 1094 LEU B HD12 6  
ATOM 8578  H HD13 . LEU A 1 50 ? 1.858   2.742   2.472   1.00 0.00 ? 1094 LEU B HD13 6  
ATOM 8579  H HD21 . LEU A 1 50 ? 1.408   6.221   4.236   1.00 0.00 ? 1094 LEU B HD21 6  
ATOM 8580  H HD22 . LEU A 1 50 ? 1.138   5.523   2.637   1.00 0.00 ? 1094 LEU B HD22 6  
ATOM 8581  H HD23 . LEU A 1 50 ? 2.783   5.744   3.238   1.00 0.00 ? 1094 LEU B HD23 6  
ATOM 8582  N N    . ARG A 1 51 ? 0.472   4.346   8.522   1.00 0.00 ? 1095 ARG B N    6  
ATOM 8583  C CA   . ARG A 1 51 ? -0.399  4.662   9.635   1.00 0.00 ? 1095 ARG B CA   6  
ATOM 8584  C C    . ARG A 1 51 ? 0.221   5.758   10.488  1.00 0.00 ? 1095 ARG B C    6  
ATOM 8585  O O    . ARG A 1 51 ? -0.427  6.756   10.808  1.00 0.00 ? 1095 ARG B O    6  
ATOM 8586  C CB   . ARG A 1 51 ? -0.618  3.403   10.473  1.00 0.00 ? 1095 ARG B CB   6  
ATOM 8587  C CG   . ARG A 1 51 ? -1.700  3.669   11.523  1.00 0.00 ? 1095 ARG B CG   6  
ATOM 8588  C CD   . ARG A 1 51 ? -1.060  4.027   12.865  1.00 0.00 ? 1095 ARG B CD   6  
ATOM 8589  N NE   . ARG A 1 51 ? -0.234  2.923   13.335  1.00 0.00 ? 1095 ARG B NE   6  
ATOM 8590  C CZ   . ARG A 1 51 ? -0.770  1.831   13.887  1.00 0.00 ? 1095 ARG B CZ   6  
ATOM 8591  N NH1  . ARG A 1 51 ? -2.067  1.716   14.027  1.00 0.00 ? 1095 ARG B NH1  6  
ATOM 8592  N NH2  . ARG A 1 51 ? 0.008   0.867   14.289  1.00 0.00 ? 1095 ARG B NH2  6  
ATOM 8593  H H    . ARG A 1 51 ? 0.823   3.438   8.423   1.00 0.00 ? 1095 ARG B H    6  
ATOM 8594  H HA   . ARG A 1 51 ? -1.349  5.002   9.255   1.00 0.00 ? 1095 ARG B HA   6  
ATOM 8595  H HB2  . ARG A 1 51 ? -0.931  2.598   9.826   1.00 0.00 ? 1095 ARG B HB2  6  
ATOM 8596  H HB3  . ARG A 1 51 ? 0.308   3.129   10.963  1.00 0.00 ? 1095 ARG B HB3  6  
ATOM 8597  H HG2  . ARG A 1 51 ? -2.321  4.487   11.195  1.00 0.00 ? 1095 ARG B HG2  6  
ATOM 8598  H HG3  . ARG A 1 51 ? -2.305  2.783   11.642  1.00 0.00 ? 1095 ARG B HG3  6  
ATOM 8599  H HD2  . ARG A 1 51 ? -0.447  4.906   12.751  1.00 0.00 ? 1095 ARG B HD2  6  
ATOM 8600  H HD3  . ARG A 1 51 ? -1.838  4.227   13.589  1.00 0.00 ? 1095 ARG B HD3  6  
ATOM 8601  H HE   . ARG A 1 51 ? 0.739   2.985   13.242  1.00 0.00 ? 1095 ARG B HE   6  
ATOM 8602  H HH11 . ARG A 1 51 ? -2.675  2.444   13.720  1.00 0.00 ? 1095 ARG B HH11 6  
ATOM 8603  H HH12 . ARG A 1 51 ? -2.450  0.892   14.444  1.00 0.00 ? 1095 ARG B HH12 6  
ATOM 8604  H HH21 . ARG A 1 51 ? 1.000   0.945   14.181  1.00 0.00 ? 1095 ARG B HH21 6  
ATOM 8605  H HH22 . ARG A 1 51 ? -0.386  0.046   14.704  1.00 0.00 ? 1095 ARG B HH22 6  
ATOM 8606  N N    . ASP A 1 52 ? 1.490   5.576   10.832  1.00 0.00 ? 1096 ASP B N    6  
ATOM 8607  C CA   . ASP A 1 52 ? 2.202   6.562   11.630  1.00 0.00 ? 1096 ASP B CA   6  
ATOM 8608  C C    . ASP A 1 52 ? 2.329   7.869   10.862  1.00 0.00 ? 1096 ASP B C    6  
ATOM 8609  O O    . ASP A 1 52 ? 2.231   8.951   11.440  1.00 0.00 ? 1096 ASP B O    6  
ATOM 8610  C CB   . ASP A 1 52 ? 3.589   6.043   12.013  1.00 0.00 ? 1096 ASP B CB   6  
ATOM 8611  C CG   . ASP A 1 52 ? 3.460   4.940   13.060  1.00 0.00 ? 1096 ASP B CG   6  
ATOM 8612  O OD1  . ASP A 1 52 ? 2.381   4.798   13.612  1.00 0.00 ? 1096 ASP B OD1  6  
ATOM 8613  O OD2  . ASP A 1 52 ? 4.441   4.255   13.293  1.00 0.00 ? 1096 ASP B OD2  6  
ATOM 8614  H H    . ASP A 1 52 ? 1.959   4.772   10.531  1.00 0.00 ? 1096 ASP B H    6  
ATOM 8615  H HA   . ASP A 1 52 ? 1.637   6.748   12.530  1.00 0.00 ? 1096 ASP B HA   6  
ATOM 8616  H HB2  . ASP A 1 52 ? 4.082   5.652   11.137  1.00 0.00 ? 1096 ASP B HB2  6  
ATOM 8617  H HB3  . ASP A 1 52 ? 4.172   6.855   12.423  1.00 0.00 ? 1096 ASP B HB3  6  
ATOM 8618  N N    . THR A 1 53 ? 2.554   7.766   9.556   1.00 0.00 ? 1097 THR B N    6  
ATOM 8619  C CA   . THR A 1 53 ? 2.700   8.955   8.733   1.00 0.00 ? 1097 THR B CA   6  
ATOM 8620  C C    . THR A 1 53 ? 1.433   9.798   8.786   1.00 0.00 ? 1097 THR B C    6  
ATOM 8621  O O    . THR A 1 53 ? 1.495   11.014  8.917   1.00 0.00 ? 1097 THR B O    6  
ATOM 8622  C CB   . THR A 1 53 ? 2.987   8.552   7.292   1.00 0.00 ? 1097 THR B CB   6  
ATOM 8623  O OG1  . THR A 1 53 ? 4.189   7.800   7.250   1.00 0.00 ? 1097 THR B OG1  6  
ATOM 8624  C CG2  . THR A 1 53 ? 3.140   9.811   6.439   1.00 0.00 ? 1097 THR B CG2  6  
ATOM 8625  H H    . THR A 1 53 ? 2.630   6.875   9.137   1.00 0.00 ? 1097 THR B H    6  
ATOM 8626  H HA   . THR A 1 53 ? 3.529   9.540   9.104   1.00 0.00 ? 1097 THR B HA   6  
ATOM 8627  H HB   . THR A 1 53 ? 2.173   7.958   6.911   1.00 0.00 ? 1097 THR B HB   6  
ATOM 8628  H HG1  . THR A 1 53 ? 4.060   7.066   6.647   1.00 0.00 ? 1097 THR B HG1  6  
ATOM 8629  H HG21 . THR A 1 53 ? 3.106   10.683  7.079   1.00 0.00 ? 1097 THR B HG21 6  
ATOM 8630  H HG22 . THR A 1 53 ? 2.334   9.859   5.721   1.00 0.00 ? 1097 THR B HG22 6  
ATOM 8631  H HG23 . THR A 1 53 ? 4.086   9.781   5.919   1.00 0.00 ? 1097 THR B HG23 6  
ATOM 8632  N N    . ILE A 1 54 ? 0.281   9.148   8.673   1.00 0.00 ? 1098 ILE B N    6  
ATOM 8633  C CA   . ILE A 1 54 ? -0.991  9.862   8.704   1.00 0.00 ? 1098 ILE B CA   6  
ATOM 8634  C C    . ILE A 1 54 ? -1.187  10.574  10.042  1.00 0.00 ? 1098 ILE B C    6  
ATOM 8635  O O    . ILE A 1 54 ? -1.567  11.744  10.082  1.00 0.00 ? 1098 ILE B O    6  
ATOM 8636  C CB   . ILE A 1 54 ? -2.139  8.879   8.485   1.00 0.00 ? 1098 ILE B CB   6  
ATOM 8637  C CG1  . ILE A 1 54 ? -2.064  8.342   7.062   1.00 0.00 ? 1098 ILE B CG1  6  
ATOM 8638  C CG2  . ILE A 1 54 ? -3.476  9.592   8.687   1.00 0.00 ? 1098 ILE B CG2  6  
ATOM 8639  C CD1  . ILE A 1 54 ? -3.037  7.173   6.902   1.00 0.00 ? 1098 ILE B CD1  6  
ATOM 8640  H H    . ILE A 1 54 ? 0.285   8.176   8.562   1.00 0.00 ? 1098 ILE B H    6  
ATOM 8641  H HA   . ILE A 1 54 ? -1.005  10.596  7.911   1.00 0.00 ? 1098 ILE B HA   6  
ATOM 8642  H HB   . ILE A 1 54 ? -2.053  8.063   9.188   1.00 0.00 ? 1098 ILE B HB   6  
ATOM 8643  H HG12 . ILE A 1 54 ? -2.321  9.126   6.368   1.00 0.00 ? 1098 ILE B HG12 6  
ATOM 8644  H HG13 . ILE A 1 54 ? -1.061  8.000   6.868   1.00 0.00 ? 1098 ILE B HG13 6  
ATOM 8645  H HG21 . ILE A 1 54 ? -3.321  10.660  8.704   1.00 0.00 ? 1098 ILE B HG21 6  
ATOM 8646  H HG22 . ILE A 1 54 ? -3.914  9.276   9.623   1.00 0.00 ? 1098 ILE B HG22 6  
ATOM 8647  H HG23 . ILE A 1 54 ? -4.144  9.341   7.876   1.00 0.00 ? 1098 ILE B HG23 6  
ATOM 8648  H HD11 . ILE A 1 54 ? -3.159  6.672   7.852   1.00 0.00 ? 1098 ILE B HD11 6  
ATOM 8649  H HD12 . ILE A 1 54 ? -2.647  6.476   6.175   1.00 0.00 ? 1098 ILE B HD12 6  
ATOM 8650  H HD13 . ILE A 1 54 ? -3.994  7.545   6.566   1.00 0.00 ? 1098 ILE B HD13 6  
ATOM 8651  N N    . ASN A 1 55 ? -0.928  9.858   11.132  1.00 0.00 ? 1099 ASN B N    6  
ATOM 8652  C CA   . ASN A 1 55 ? -1.095  10.430  12.464  1.00 0.00 ? 1099 ASN B CA   6  
ATOM 8653  C C    . ASN A 1 55 ? -0.174  11.626  12.666  1.00 0.00 ? 1099 ASN B C    6  
ATOM 8654  O O    . ASN A 1 55 ? -0.562  12.621  13.281  1.00 0.00 ? 1099 ASN B O    6  
ATOM 8655  C CB   . ASN A 1 55 ? -0.794  9.368   13.520  1.00 0.00 ? 1099 ASN B CB   6  
ATOM 8656  C CG   . ASN A 1 55 ? -2.003  8.456   13.697  1.00 0.00 ? 1099 ASN B CG   6  
ATOM 8657  O OD1  . ASN A 1 55 ? -2.827  8.685   14.582  1.00 0.00 ? 1099 ASN B OD1  6  
ATOM 8658  N ND2  . ASN A 1 55 ? -2.184  7.459   12.873  1.00 0.00 ? 1099 ASN B ND2  6  
ATOM 8659  H H    . ASN A 1 55 ? -0.627  8.926   11.039  1.00 0.00 ? 1099 ASN B H    6  
ATOM 8660  H HA   . ASN A 1 55 ? -2.118  10.753  12.582  1.00 0.00 ? 1099 ASN B HA   6  
ATOM 8661  H HB2  . ASN A 1 55 ? 0.058   8.780   13.205  1.00 0.00 ? 1099 ASN B HB2  6  
ATOM 8662  H HB3  . ASN A 1 55 ? -0.568  9.848   14.460  1.00 0.00 ? 1099 ASN B HB3  6  
ATOM 8663  H HD21 . ASN A 1 55 ? -1.549  7.306   12.143  1.00 0.00 ? 1099 ASN B HD21 6  
ATOM 8664  H HD22 . ASN A 1 55 ? -2.951  6.862   12.989  1.00 0.00 ? 1099 ASN B HD22 6  
ATOM 8665  N N    . THR A 1 56 ? 1.041   11.528  12.145  1.00 0.00 ? 1100 THR B N    6  
ATOM 8666  C CA   . THR A 1 56 ? 2.001   12.615  12.281  1.00 0.00 ? 1100 THR B CA   6  
ATOM 8667  C C    . THR A 1 56 ? 1.914   13.583  11.098  1.00 0.00 ? 1100 THR B C    6  
ATOM 8668  O O    . THR A 1 56 ? 2.629   14.583  11.056  1.00 0.00 ? 1100 THR B O    6  
ATOM 8669  C CB   . THR A 1 56 ? 3.416   12.044  12.381  1.00 0.00 ? 1100 THR B CB   6  
ATOM 8670  O OG1  . THR A 1 56 ? 4.306   13.057  12.829  1.00 0.00 ? 1100 THR B OG1  6  
ATOM 8671  C CG2  . THR A 1 56 ? 3.859   11.538  11.010  1.00 0.00 ? 1100 THR B CG2  6  
ATOM 8672  H H    . THR A 1 56 ? 1.298   10.716  11.659  1.00 0.00 ? 1100 THR B H    6  
ATOM 8673  H HA   . THR A 1 56 ? 1.786   13.159  13.188  1.00 0.00 ? 1100 THR B HA   6  
ATOM 8674  H HB   . THR A 1 56 ? 3.425   11.223  13.082  1.00 0.00 ? 1100 THR B HB   6  
ATOM 8675  H HG1  . THR A 1 56 ? 4.336   13.022  13.788  1.00 0.00 ? 1100 THR B HG1  6  
ATOM 8676  H HG21 . THR A 1 56 ? 4.066   12.379  10.364  1.00 0.00 ? 1100 THR B HG21 6  
ATOM 8677  H HG22 . THR A 1 56 ? 3.072   10.939  10.581  1.00 0.00 ? 1100 THR B HG22 6  
ATOM 8678  H HG23 . THR A 1 56 ? 4.751   10.939  11.117  1.00 0.00 ? 1100 THR B HG23 6  
ATOM 8679  N N    . SER A 1 57 ? 1.047   13.281  10.135  1.00 0.00 ? 1101 SER B N    6  
ATOM 8680  C CA   . SER A 1 57 ? 0.898   14.133  8.966   1.00 0.00 ? 1101 SER B CA   6  
ATOM 8681  C C    . SER A 1 57 ? 0.348   15.494  9.362   1.00 0.00 ? 1101 SER B C    6  
ATOM 8682  O O    . SER A 1 57 ? -0.580  15.593  10.164  1.00 0.00 ? 1101 SER B O    6  
ATOM 8683  C CB   . SER A 1 57 ? -0.048  13.475  7.965   1.00 0.00 ? 1101 SER B CB   6  
ATOM 8684  O OG   . SER A 1 57 ? -0.233  14.343  6.856   1.00 0.00 ? 1101 SER B OG   6  
ATOM 8685  H H    . SER A 1 57 ? 0.503   12.471  10.202  1.00 0.00 ? 1101 SER B H    6  
ATOM 8686  H HA   . SER A 1 57 ? 1.862   14.265  8.497   1.00 0.00 ? 1101 SER B HA   6  
ATOM 8687  H HB2  . SER A 1 57 ? 0.374   12.546  7.621   1.00 0.00 ? 1101 SER B HB2  6  
ATOM 8688  H HB3  . SER A 1 57 ? -0.998  13.278  8.445   1.00 0.00 ? 1101 SER B HB3  6  
ATOM 8689  H HG   . SER A 1 57 ? -0.933  14.959  7.077   1.00 0.00 ? 1101 SER B HG   6  
ATOM 8690  N N    . CYS A 1 58 ? 0.919   16.535  8.781   1.00 0.00 ? 1102 CYS B N    6  
ATOM 8691  C CA   . CYS A 1 58 ? 0.476   17.891  9.058   1.00 0.00 ? 1102 CYS B CA   6  
ATOM 8692  C C    . CYS A 1 58 ? -0.049  18.553  7.786   1.00 0.00 ? 1102 CYS B C    6  
ATOM 8693  O O    . CYS A 1 58 ? -0.534  19.684  7.821   1.00 0.00 ? 1102 CYS B O    6  
ATOM 8694  C CB   . CYS A 1 58 ? 1.636   18.711  9.631   1.00 0.00 ? 1102 CYS B CB   6  
ATOM 8695  S SG   . CYS A 1 58 ? 2.803   19.110  8.306   1.00 0.00 ? 1102 CYS B SG   6  
ATOM 8696  H H    . CYS A 1 58 ? 1.648   16.390  8.140   1.00 0.00 ? 1102 CYS B H    6  
ATOM 8697  H HA   . CYS A 1 58 ? -0.318  17.855  9.789   1.00 0.00 ? 1102 CYS B HA   6  
ATOM 8698  H HB2  . CYS A 1 58 ? 1.253   19.625  10.059  1.00 0.00 ? 1102 CYS B HB2  6  
ATOM 8699  H HB3  . CYS A 1 58 ? 2.140   18.138  10.395  1.00 0.00 ? 1102 CYS B HB3  6  
ATOM 8700  H HG   . CYS A 1 58 ? 2.790   18.391  7.671   1.00 0.00 ? 1102 CYS B HG   6  
ATOM 8701  N N    . ASP A 1 59 ? 0.053   17.843  6.658   1.00 0.00 ? 1103 ASP B N    6  
ATOM 8702  C CA   . ASP A 1 59 ? -0.413  18.382  5.385   1.00 0.00 ? 1103 ASP B CA   6  
ATOM 8703  C C    . ASP A 1 59 ? -1.543  17.527  4.817   1.00 0.00 ? 1103 ASP B C    6  
ATOM 8704  O O    . ASP A 1 59 ? -1.494  16.296  4.866   1.00 0.00 ? 1103 ASP B O    6  
ATOM 8705  C CB   . ASP A 1 59 ? 0.744   18.436  4.388   1.00 0.00 ? 1103 ASP B CB   6  
ATOM 8706  C CG   . ASP A 1 59 ? 1.743   19.515  4.802   1.00 0.00 ? 1103 ASP B CG   6  
ATOM 8707  O OD1  . ASP A 1 59 ? 1.382   20.348  5.616   1.00 0.00 ? 1103 ASP B OD1  6  
ATOM 8708  O OD2  . ASP A 1 59 ? 2.854   19.490  4.296   1.00 0.00 ? 1103 ASP B OD2  6  
ATOM 8709  H H    . ASP A 1 59 ? 0.447   16.945  6.682   1.00 0.00 ? 1103 ASP B H    6  
ATOM 8710  H HA   . ASP A 1 59 ? -0.782  19.385  5.544   1.00 0.00 ? 1103 ASP B HA   6  
ATOM 8711  H HB2  . ASP A 1 59 ? 1.243   17.478  4.367   1.00 0.00 ? 1103 ASP B HB2  6  
ATOM 8712  H HB3  . ASP A 1 59 ? 0.362   18.661  3.404   1.00 0.00 ? 1103 ASP B HB3  6  
ATOM 8713  N N    . ILE A 1 60 ? -2.559  18.186  4.271   1.00 0.00 ? 1104 ILE B N    6  
ATOM 8714  C CA   . ILE A 1 60 ? -3.689  17.475  3.695   1.00 0.00 ? 1104 ILE B CA   6  
ATOM 8715  C C    . ILE A 1 60 ? -3.271  16.732  2.430   1.00 0.00 ? 1104 ILE B C    6  
ATOM 8716  O O    . ILE A 1 60 ? -3.863  15.715  2.071   1.00 0.00 ? 1104 ILE B O    6  
ATOM 8717  C CB   . ILE A 1 60 ? -4.809  18.467  3.370   1.00 0.00 ? 1104 ILE B CB   6  
ATOM 8718  C CG1  . ILE A 1 60 ? -4.289  19.539  2.404   1.00 0.00 ? 1104 ILE B CG1  6  
ATOM 8719  C CG2  . ILE A 1 60 ? -5.298  19.134  4.656   1.00 0.00 ? 1104 ILE B CG2  6  
ATOM 8720  C CD1  . ILE A 1 60 ? -5.452  20.418  1.935   1.00 0.00 ? 1104 ILE B CD1  6  
ATOM 8721  H H    . ILE A 1 60 ? -2.547  19.165  4.255   1.00 0.00 ? 1104 ILE B H    6  
ATOM 8722  H HA   . ILE A 1 60 ? -4.057  16.762  4.415   1.00 0.00 ? 1104 ILE B HA   6  
ATOM 8723  H HB   . ILE A 1 60 ? -5.628  17.939  2.910   1.00 0.00 ? 1104 ILE B HB   6  
ATOM 8724  H HG12 . ILE A 1 60 ? -3.554  20.153  2.908   1.00 0.00 ? 1104 ILE B HG12 6  
ATOM 8725  H HG13 . ILE A 1 60 ? -3.833  19.067  1.548   1.00 0.00 ? 1104 ILE B HG13 6  
ATOM 8726  H HG21 . ILE A 1 60 ? -5.401  18.390  5.431   1.00 0.00 ? 1104 ILE B HG21 6  
ATOM 8727  H HG22 . ILE A 1 60 ? -6.253  19.604  4.478   1.00 0.00 ? 1104 ILE B HG22 6  
ATOM 8728  H HG23 . ILE A 1 60 ? -4.583  19.882  4.969   1.00 0.00 ? 1104 ILE B HG23 6  
ATOM 8729  H HD11 . ILE A 1 60 ? -6.378  20.033  2.338   1.00 0.00 ? 1104 ILE B HD11 6  
ATOM 8730  H HD12 . ILE A 1 60 ? -5.497  20.410  0.857   1.00 0.00 ? 1104 ILE B HD12 6  
ATOM 8731  H HD13 . ILE A 1 60 ? -5.302  21.429  2.282   1.00 0.00 ? 1104 ILE B HD13 6  
ATOM 8732  N N    . GLU A 1 61 ? -2.248  17.247  1.760   1.00 0.00 ? 1105 GLU B N    6  
ATOM 8733  C CA   . GLU A 1 61 ? -1.759  16.626  0.534   1.00 0.00 ? 1105 GLU B CA   6  
ATOM 8734  C C    . GLU A 1 61 ? -1.207  15.236  0.823   1.00 0.00 ? 1105 GLU B C    6  
ATOM 8735  O O    . GLU A 1 61 ? -1.501  14.272  0.113   1.00 0.00 ? 1105 GLU B O    6  
ATOM 8736  C CB   . GLU A 1 61 ? -0.657  17.495  -0.083  1.00 0.00 ? 1105 GLU B CB   6  
ATOM 8737  C CG   . GLU A 1 61 ? -1.263  18.789  -0.637  1.00 0.00 ? 1105 GLU B CG   6  
ATOM 8738  C CD   . GLU A 1 61 ? -0.155  19.727  -1.106  1.00 0.00 ? 1105 GLU B CD   6  
ATOM 8739  O OE1  . GLU A 1 61 ? 0.990   19.477  -0.769  1.00 0.00 ? 1105 GLU B OE1  6  
ATOM 8740  O OE2  . GLU A 1 61 ? -0.469  20.683  -1.798  1.00 0.00 ? 1105 GLU B OE2  6  
ATOM 8741  H H    . GLU A 1 61 ? -1.817  18.053  2.096   1.00 0.00 ? 1105 GLU B H    6  
ATOM 8742  H HA   . GLU A 1 61 ? -2.574  16.544  -0.167  1.00 0.00 ? 1105 GLU B HA   6  
ATOM 8743  H HB2  . GLU A 1 61 ? 0.075   17.738  0.676   1.00 0.00 ? 1105 GLU B HB2  6  
ATOM 8744  H HB3  . GLU A 1 61 ? -0.178  16.953  -0.883  1.00 0.00 ? 1105 GLU B HB3  6  
ATOM 8745  H HG2  . GLU A 1 61 ? -1.911  18.555  -1.468  1.00 0.00 ? 1105 GLU B HG2  6  
ATOM 8746  H HG3  . GLU A 1 61 ? -1.838  19.276  0.138   1.00 0.00 ? 1105 GLU B HG3  6  
ATOM 8747  N N    . LEU A 1 62 ? -0.415  15.135  1.881   1.00 0.00 ? 1106 LEU B N    6  
ATOM 8748  C CA   . LEU A 1 62 ? 0.163   13.860  2.260   1.00 0.00 ? 1106 LEU B CA   6  
ATOM 8749  C C    . LEU A 1 62 ? -0.932  12.895  2.696   1.00 0.00 ? 1106 LEU B C    6  
ATOM 8750  O O    . LEU A 1 62 ? -0.892  11.704  2.384   1.00 0.00 ? 1106 LEU B O    6  
ATOM 8751  C CB   . LEU A 1 62 ? 1.163   14.053  3.401   1.00 0.00 ? 1106 LEU B CB   6  
ATOM 8752  C CG   . LEU A 1 62 ? 1.817   12.714  3.741   1.00 0.00 ? 1106 LEU B CG   6  
ATOM 8753  C CD1  . LEU A 1 62 ? 2.692   12.260  2.570   1.00 0.00 ? 1106 LEU B CD1  6  
ATOM 8754  C CD2  . LEU A 1 62 ? 2.683   12.872  4.992   1.00 0.00 ? 1106 LEU B CD2  6  
ATOM 8755  H H    . LEU A 1 62 ? -0.220  15.930  2.417   1.00 0.00 ? 1106 LEU B H    6  
ATOM 8756  H HA   . LEU A 1 62 ? 0.677   13.443  1.408   1.00 0.00 ? 1106 LEU B HA   6  
ATOM 8757  H HB2  . LEU A 1 62 ? 1.922   14.760  3.097   1.00 0.00 ? 1106 LEU B HB2  6  
ATOM 8758  H HB3  . LEU A 1 62 ? 0.647   14.431  4.271   1.00 0.00 ? 1106 LEU B HB3  6  
ATOM 8759  H HG   . LEU A 1 62 ? 1.046   11.974  3.916   1.00 0.00 ? 1106 LEU B HG   6  
ATOM 8760  H HD11 . LEU A 1 62 ? 2.307   11.334  2.169   1.00 0.00 ? 1106 LEU B HD11 6  
ATOM 8761  H HD12 . LEU A 1 62 ? 3.705   12.111  2.915   1.00 0.00 ? 1106 LEU B HD12 6  
ATOM 8762  H HD13 . LEU A 1 62 ? 2.682   13.017  1.800   1.00 0.00 ? 1106 LEU B HD13 6  
ATOM 8763  H HD21 . LEU A 1 62 ? 2.107   12.602  5.865   1.00 0.00 ? 1106 LEU B HD21 6  
ATOM 8764  H HD22 . LEU A 1 62 ? 3.007   13.899  5.078   1.00 0.00 ? 1106 LEU B HD22 6  
ATOM 8765  H HD23 . LEU A 1 62 ? 3.548   12.228  4.917   1.00 0.00 ? 1106 LEU B HD23 6  
ATOM 8766  N N    . LEU A 1 63 ? -1.905  13.418  3.435   1.00 0.00 ? 1107 LEU B N    6  
ATOM 8767  C CA   . LEU A 1 63 ? -3.002  12.593  3.930   1.00 0.00 ? 1107 LEU B CA   6  
ATOM 8768  C C    . LEU A 1 63 ? -3.763  11.997  2.758   1.00 0.00 ? 1107 LEU B C    6  
ATOM 8769  O O    . LEU A 1 63 ? -4.128  10.820  2.771   1.00 0.00 ? 1107 LEU B O    6  
ATOM 8770  C CB   . LEU A 1 63 ? -3.951  13.450  4.770   1.00 0.00 ? 1107 LEU B CB   6  
ATOM 8771  C CG   . LEU A 1 63 ? -3.245  13.869  6.060   1.00 0.00 ? 1107 LEU B CG   6  
ATOM 8772  C CD1  . LEU A 1 63 ? -4.070  14.944  6.767   1.00 0.00 ? 1107 LEU B CD1  6  
ATOM 8773  C CD2  . LEU A 1 63 ? -3.089  12.655  6.980   1.00 0.00 ? 1107 LEU B CD2  6  
ATOM 8774  H H    . LEU A 1 63 ? -1.876  14.372  3.662   1.00 0.00 ? 1107 LEU B H    6  
ATOM 8775  H HA   . LEU A 1 63 ? -2.604  11.798  4.541   1.00 0.00 ? 1107 LEU B HA   6  
ATOM 8776  H HB2  . LEU A 1 63 ? -4.236  14.330  4.211   1.00 0.00 ? 1107 LEU B HB2  6  
ATOM 8777  H HB3  . LEU A 1 63 ? -4.832  12.877  5.014   1.00 0.00 ? 1107 LEU B HB3  6  
ATOM 8778  H HG   . LEU A 1 63 ? -2.271  14.267  5.817   1.00 0.00 ? 1107 LEU B HG   6  
ATOM 8779  H HD11 . LEU A 1 63 ? -3.798  14.977  7.812   1.00 0.00 ? 1107 LEU B HD11 6  
ATOM 8780  H HD12 . LEU A 1 63 ? -5.120  14.713  6.674   1.00 0.00 ? 1107 LEU B HD12 6  
ATOM 8781  H HD13 . LEU A 1 63 ? -3.869  15.905  6.312   1.00 0.00 ? 1107 LEU B HD13 6  
ATOM 8782  H HD21 . LEU A 1 63 ? -3.050  12.986  8.007   1.00 0.00 ? 1107 LEU B HD21 6  
ATOM 8783  H HD22 . LEU A 1 63 ? -2.176  12.133  6.735   1.00 0.00 ? 1107 LEU B HD22 6  
ATOM 8784  H HD23 . LEU A 1 63 ? -3.932  11.992  6.847   1.00 0.00 ? 1107 LEU B HD23 6  
ATOM 8785  N N    . ALA A 1 64 ? -3.981  12.812  1.739   1.00 0.00 ? 1108 ALA B N    6  
ATOM 8786  C CA   . ALA A 1 64 ? -4.677  12.361  0.547   1.00 0.00 ? 1108 ALA B CA   6  
ATOM 8787  C C    . ALA A 1 64 ? -3.885  11.256  -0.143  1.00 0.00 ? 1108 ALA B C    6  
ATOM 8788  O O    . ALA A 1 64 ? -4.458  10.310  -0.680  1.00 0.00 ? 1108 ALA B O    6  
ATOM 8789  C CB   . ALA A 1 64 ? -4.883  13.531  -0.420  1.00 0.00 ? 1108 ALA B CB   6  
ATOM 8790  H H    . ALA A 1 64 ? -3.654  13.735  1.783   1.00 0.00 ? 1108 ALA B H    6  
ATOM 8791  H HA   . ALA A 1 64 ? -5.640  11.971  0.834   1.00 0.00 ? 1108 ALA B HA   6  
ATOM 8792  H HB1  . ALA A 1 64 ? -4.346  14.400  -0.059  1.00 0.00 ? 1108 ALA B HB1  6  
ATOM 8793  H HB2  . ALA A 1 64 ? -5.936  13.761  -0.484  1.00 0.00 ? 1108 ALA B HB2  6  
ATOM 8794  H HB3  . ALA A 1 64 ? -4.514  13.261  -1.399  1.00 0.00 ? 1108 ALA B HB3  6  
ATOM 8795  N N    . ALA A 1 65 ? -2.560  11.390  -0.134  1.00 0.00 ? 1109 ALA B N    6  
ATOM 8796  C CA   . ALA A 1 65 ? -1.702  10.402  -0.775  1.00 0.00 ? 1109 ALA B CA   6  
ATOM 8797  C C    . ALA A 1 65 ? -1.852  9.046   -0.101  1.00 0.00 ? 1109 ALA B C    6  
ATOM 8798  O O    . ALA A 1 65 ? -1.942  8.014   -0.766  1.00 0.00 ? 1109 ALA B O    6  
ATOM 8799  C CB   . ALA A 1 65 ? -0.244  10.867  -0.705  1.00 0.00 ? 1109 ALA B CB   6  
ATOM 8800  H H    . ALA A 1 65 ? -2.154  12.161  0.316   1.00 0.00 ? 1109 ALA B H    6  
ATOM 8801  H HA   . ALA A 1 65 ? -1.989  10.311  -1.811  1.00 0.00 ? 1109 ALA B HA   6  
ATOM 8802  H HB1  . ALA A 1 65 ? -0.116  11.735  -1.334  1.00 0.00 ? 1109 ALA B HB1  6  
ATOM 8803  H HB2  . ALA A 1 65 ? 0.405   10.076  -1.051  1.00 0.00 ? 1109 ALA B HB2  6  
ATOM 8804  H HB3  . ALA A 1 65 ? 0.004   11.124  0.317   1.00 0.00 ? 1109 ALA B HB3  6  
ATOM 8805  N N    . CYS A 1 66 ? -1.879  9.055   1.223   1.00 0.00 ? 1110 CYS B N    6  
ATOM 8806  C CA   . CYS A 1 66 ? -2.016  7.820   1.982   1.00 0.00 ? 1110 CYS B CA   6  
ATOM 8807  C C    . CYS A 1 66 ? -3.387  7.206   1.763   1.00 0.00 ? 1110 CYS B C    6  
ATOM 8808  O O    . CYS A 1 66 ? -3.522  5.990   1.629   1.00 0.00 ? 1110 CYS B O    6  
ATOM 8809  C CB   . CYS A 1 66 ? -1.806  8.107   3.460   1.00 0.00 ? 1110 CYS B CB   6  
ATOM 8810  S SG   . CYS A 1 66 ? -0.079  8.561   3.682   1.00 0.00 ? 1110 CYS B SG   6  
ATOM 8811  H H    . CYS A 1 66 ? -1.800  9.909   1.700   1.00 0.00 ? 1110 CYS B H    6  
ATOM 8812  H HA   . CYS A 1 66 ? -1.262  7.121   1.652   1.00 0.00 ? 1110 CYS B HA   6  
ATOM 8813  H HB2  . CYS A 1 66 ? -2.445  8.922   3.770   1.00 0.00 ? 1110 CYS B HB2  6  
ATOM 8814  H HB3  . CYS A 1 66 ? -2.027  7.224   4.039   1.00 0.00 ? 1110 CYS B HB3  6  
ATOM 8815  H HG   . CYS A 1 66 ? 0.205   8.987   2.862   1.00 0.00 ? 1110 CYS B HG   6  
ATOM 8816  N N    . ARG A 1 67 ? -4.402  8.057   1.724   1.00 0.00 ? 1111 ARG B N    6  
ATOM 8817  C CA   . ARG A 1 67 ? -5.765  7.594   1.519   1.00 0.00 ? 1111 ARG B CA   6  
ATOM 8818  C C    . ARG A 1 67 ? -5.890  6.901   0.168   1.00 0.00 ? 1111 ARG B C    6  
ATOM 8819  O O    . ARG A 1 67 ? -6.502  5.838   0.055   1.00 0.00 ? 1111 ARG B O    6  
ATOM 8820  C CB   . ARG A 1 67 ? -6.711  8.794   1.584   1.00 0.00 ? 1111 ARG B CB   6  
ATOM 8821  C CG   . ARG A 1 67 ? -6.819  9.284   3.030   1.00 0.00 ? 1111 ARG B CG   6  
ATOM 8822  C CD   . ARG A 1 67 ? -7.563  10.616  3.048   1.00 0.00 ? 1111 ARG B CD   6  
ATOM 8823  N NE   . ARG A 1 67 ? -8.939  10.439  2.579   1.00 0.00 ? 1111 ARG B NE   6  
ATOM 8824  C CZ   . ARG A 1 67 ? -9.308  10.677  1.312   1.00 0.00 ? 1111 ARG B CZ   6  
ATOM 8825  N NH1  . ARG A 1 67 ? -8.445  11.061  0.407   1.00 0.00 ? 1111 ARG B NH1  6  
ATOM 8826  N NH2  . ARG A 1 67 ? -10.556 10.513  0.970   1.00 0.00 ? 1111 ARG B NH2  6  
ATOM 8827  H H    . ARG A 1 67 ? -4.231  9.015   1.834   1.00 0.00 ? 1111 ARG B H    6  
ATOM 8828  H HA   . ARG A 1 67 ? -6.024  6.897   2.299   1.00 0.00 ? 1111 ARG B HA   6  
ATOM 8829  H HB2  . ARG A 1 67 ? -6.312  9.595   0.967   1.00 0.00 ? 1111 ARG B HB2  6  
ATOM 8830  H HB3  . ARG A 1 67 ? -7.687  8.507   1.226   1.00 0.00 ? 1111 ARG B HB3  6  
ATOM 8831  H HG2  . ARG A 1 67 ? -7.363  8.555   3.617   1.00 0.00 ? 1111 ARG B HG2  6  
ATOM 8832  H HG3  . ARG A 1 67 ? -5.831  9.415   3.444   1.00 0.00 ? 1111 ARG B HG3  6  
ATOM 8833  H HD2  . ARG A 1 67 ? -7.586  10.990  4.060   1.00 0.00 ? 1111 ARG B HD2  6  
ATOM 8834  H HD3  . ARG A 1 67 ? -7.047  11.326  2.422   1.00 0.00 ? 1111 ARG B HD3  6  
ATOM 8835  H HE   . ARG A 1 67 ? -9.618  10.139  3.219   1.00 0.00 ? 1111 ARG B HE   6  
ATOM 8836  H HH11 . ARG A 1 67 ? -7.487  11.182  0.641   1.00 0.00 ? 1111 ARG B HH11 6  
ATOM 8837  H HH12 . ARG A 1 67 ? -8.752  11.236  -0.528  1.00 0.00 ? 1111 ARG B HH12 6  
ATOM 8838  H HH21 . ARG A 1 67 ? -11.225 10.212  1.650   1.00 0.00 ? 1111 ARG B HH21 6  
ATOM 8839  H HH22 . ARG A 1 67 ? -10.843 10.686  0.029   1.00 0.00 ? 1111 ARG B HH22 6  
ATOM 8840  N N    . GLU A 1 68 ? -5.287  7.498   -0.849  1.00 0.00 ? 1112 GLU B N    6  
ATOM 8841  C CA   . GLU A 1 68 ? -5.320  6.915   -2.184  1.00 0.00 ? 1112 GLU B CA   6  
ATOM 8842  C C    . GLU A 1 68 ? -4.572  5.588   -2.207  1.00 0.00 ? 1112 GLU B C    6  
ATOM 8843  O O    . GLU A 1 68 ? -5.017  4.628   -2.837  1.00 0.00 ? 1112 GLU B O    6  
ATOM 8844  C CB   . GLU A 1 68 ? -4.682  7.869   -3.188  1.00 0.00 ? 1112 GLU B CB   6  
ATOM 8845  C CG   . GLU A 1 68 ? -5.587  9.085   -3.380  1.00 0.00 ? 1112 GLU B CG   6  
ATOM 8846  C CD   . GLU A 1 68 ? -6.931  8.662   -3.966  1.00 0.00 ? 1112 GLU B CD   6  
ATOM 8847  O OE1  . GLU A 1 68 ? -6.928  7.968   -4.969  1.00 0.00 ? 1112 GLU B OE1  6  
ATOM 8848  O OE2  . GLU A 1 68 ? -7.946  9.042   -3.404  1.00 0.00 ? 1112 GLU B OE2  6  
ATOM 8849  H H    . GLU A 1 68 ? -4.804  8.338   -0.697  1.00 0.00 ? 1112 GLU B H    6  
ATOM 8850  H HA   . GLU A 1 68 ? -6.346  6.741   -2.465  1.00 0.00 ? 1112 GLU B HA   6  
ATOM 8851  H HB2  . GLU A 1 68 ? -3.718  8.188   -2.814  1.00 0.00 ? 1112 GLU B HB2  6  
ATOM 8852  H HB3  . GLU A 1 68 ? -4.554  7.363   -4.132  1.00 0.00 ? 1112 GLU B HB3  6  
ATOM 8853  H HG2  . GLU A 1 68 ? -5.750  9.552   -2.421  1.00 0.00 ? 1112 GLU B HG2  6  
ATOM 8854  H HG3  . GLU A 1 68 ? -5.108  9.786   -4.045  1.00 0.00 ? 1112 GLU B HG3  6  
ATOM 8855  N N    . GLU A 1 69 ? -3.435  5.536   -1.517  1.00 0.00 ? 1113 GLU B N    6  
ATOM 8856  C CA   . GLU A 1 69 ? -2.653  4.315   -1.477  1.00 0.00 ? 1113 GLU B CA   6  
ATOM 8857  C C    . GLU A 1 69 ? -3.446  3.204   -0.807  1.00 0.00 ? 1113 GLU B C    6  
ATOM 8858  O O    . GLU A 1 69 ? -3.405  2.050   -1.231  1.00 0.00 ? 1113 GLU B O    6  
ATOM 8859  C CB   . GLU A 1 69 ? -1.344  4.558   -0.723  1.00 0.00 ? 1113 GLU B CB   6  
ATOM 8860  C CG   . GLU A 1 69 ? -0.536  3.260   -0.661  1.00 0.00 ? 1113 GLU B CG   6  
ATOM 8861  C CD   . GLU A 1 69 ? -0.203  2.784   -2.071  1.00 0.00 ? 1113 GLU B CD   6  
ATOM 8862  O OE1  . GLU A 1 69 ? -0.210  3.608   -2.970  1.00 0.00 ? 1113 GLU B OE1  6  
ATOM 8863  O OE2  . GLU A 1 69 ? 0.052   1.603   -2.230  1.00 0.00 ? 1113 GLU B OE2  6  
ATOM 8864  H H    . GLU A 1 69 ? -3.116  6.331   -1.022  1.00 0.00 ? 1113 GLU B H    6  
ATOM 8865  H HA   . GLU A 1 69 ? -2.424  4.015   -2.490  1.00 0.00 ? 1113 GLU B HA   6  
ATOM 8866  H HB2  . GLU A 1 69 ? -0.771  5.313   -1.238  1.00 0.00 ? 1113 GLU B HB2  6  
ATOM 8867  H HB3  . GLU A 1 69 ? -1.562  4.892   0.280   1.00 0.00 ? 1113 GLU B HB3  6  
ATOM 8868  H HG2  . GLU A 1 69 ? 0.381   3.438   -0.119  1.00 0.00 ? 1113 GLU B HG2  6  
ATOM 8869  H HG3  . GLU A 1 69 ? -1.110  2.501   -0.153  1.00 0.00 ? 1113 GLU B HG3  6  
ATOM 8870  N N    . PHE A 1 70 ? -4.161  3.564   0.247   1.00 0.00 ? 1114 PHE B N    6  
ATOM 8871  C CA   . PHE A 1 70 ? -4.954  2.589   0.983   1.00 0.00 ? 1114 PHE B CA   6  
ATOM 8872  C C    . PHE A 1 70 ? -6.063  2.015   0.107   1.00 0.00 ? 1114 PHE B C    6  
ATOM 8873  O O    . PHE A 1 70 ? -6.309  0.813   0.119   1.00 0.00 ? 1114 PHE B O    6  
ATOM 8874  C CB   . PHE A 1 70 ? -5.564  3.244   2.227   1.00 0.00 ? 1114 PHE B CB   6  
ATOM 8875  C CG   . PHE A 1 70 ? -4.551  3.277   3.363   1.00 0.00 ? 1114 PHE B CG   6  
ATOM 8876  C CD1  . PHE A 1 70 ? -3.173  3.200   3.103   1.00 0.00 ? 1114 PHE B CD1  6  
ATOM 8877  C CD2  . PHE A 1 70 ? -5.001  3.374   4.686   1.00 0.00 ? 1114 PHE B CD2  6  
ATOM 8878  C CE1  . PHE A 1 70 ? -2.255  3.217   4.166   1.00 0.00 ? 1114 PHE B CE1  6  
ATOM 8879  C CE2  . PHE A 1 70 ? -4.084  3.396   5.743   1.00 0.00 ? 1114 PHE B CE2  6  
ATOM 8880  C CZ   . PHE A 1 70 ? -2.713  3.316   5.484   1.00 0.00 ? 1114 PHE B CZ   6  
ATOM 8881  H H    . PHE A 1 70 ? -4.152  4.500   0.536   1.00 0.00 ? 1114 PHE B H    6  
ATOM 8882  H HA   . PHE A 1 70 ? -4.312  1.779   1.294   1.00 0.00 ? 1114 PHE B HA   6  
ATOM 8883  H HB2  . PHE A 1 70 ? -5.867  4.253   1.987   1.00 0.00 ? 1114 PHE B HB2  6  
ATOM 8884  H HB3  . PHE A 1 70 ? -6.428  2.675   2.535   1.00 0.00 ? 1114 PHE B HB3  6  
ATOM 8885  H HD1  . PHE A 1 70 ? -2.818  3.125   2.084   1.00 0.00 ? 1114 PHE B HD1  6  
ATOM 8886  H HD2  . PHE A 1 70 ? -6.059  3.435   4.890   1.00 0.00 ? 1114 PHE B HD2  6  
ATOM 8887  H HE1  . PHE A 1 70 ? -1.194  3.154   3.970   1.00 0.00 ? 1114 PHE B HE1  6  
ATOM 8888  H HE2  . PHE A 1 70 ? -4.435  3.466   6.760   1.00 0.00 ? 1114 PHE B HE2  6  
ATOM 8889  H HZ   . PHE A 1 70 ? -2.007  3.327   6.303   1.00 0.00 ? 1114 PHE B HZ   6  
ATOM 8890  N N    . HIS A 1 71 ? -6.725  2.874   -0.656  1.00 0.00 ? 1115 HIS B N    6  
ATOM 8891  C CA   . HIS A 1 71 ? -7.793  2.427   -1.529  1.00 0.00 ? 1115 HIS B CA   6  
ATOM 8892  C C    . HIS A 1 71 ? -7.263  1.429   -2.555  1.00 0.00 ? 1115 HIS B C    6  
ATOM 8893  O O    . HIS A 1 71 ? -7.836  0.356   -2.747  1.00 0.00 ? 1115 HIS B O    6  
ATOM 8894  C CB   . HIS A 1 71 ? -8.392  3.634   -2.246  1.00 0.00 ? 1115 HIS B CB   6  
ATOM 8895  C CG   . HIS A 1 71 ? -9.554  3.181   -3.071  1.00 0.00 ? 1115 HIS B CG   6  
ATOM 8896  N ND1  . HIS A 1 71 ? -10.053 3.922   -4.128  1.00 0.00 ? 1115 HIS B ND1  6  
ATOM 8897  C CD2  . HIS A 1 71 ? -10.325 2.058   -2.993  1.00 0.00 ? 1115 HIS B CD2  6  
ATOM 8898  C CE1  . HIS A 1 71 ? -11.090 3.235   -4.641  1.00 0.00 ? 1115 HIS B CE1  6  
ATOM 8899  N NE2  . HIS A 1 71 ? -11.299 2.089   -3.985  1.00 0.00 ? 1115 HIS B NE2  6  
ATOM 8900  H H    . HIS A 1 71 ? -6.495  3.822   -0.635  1.00 0.00 ? 1115 HIS B H    6  
ATOM 8901  H HA   . HIS A 1 71 ? -8.563  1.952   -0.939  1.00 0.00 ? 1115 HIS B HA   6  
ATOM 8902  H HB2  . HIS A 1 71 ? -8.725  4.357   -1.516  1.00 0.00 ? 1115 HIS B HB2  6  
ATOM 8903  H HB3  . HIS A 1 71 ? -7.645  4.081   -2.886  1.00 0.00 ? 1115 HIS B HB3  6  
ATOM 8904  H HD1  . HIS A 1 71 ? -9.714  4.785   -4.445  1.00 0.00 ? 1115 HIS B HD1  6  
ATOM 8905  H HD2  . HIS A 1 71 ? -10.192 1.272   -2.266  1.00 0.00 ? 1115 HIS B HD2  6  
ATOM 8906  H HE1  . HIS A 1 71 ? -11.682 3.569   -5.480  1.00 0.00 ? 1115 HIS B HE1  6  
ATOM 8907  N N    . ARG A 1 72 ? -6.161  1.784   -3.210  1.00 0.00 ? 1116 ARG B N    6  
ATOM 8908  C CA   . ARG A 1 72 ? -5.569  0.906   -4.209  1.00 0.00 ? 1116 ARG B CA   6  
ATOM 8909  C C    . ARG A 1 72 ? -5.107  -0.401  -3.575  1.00 0.00 ? 1116 ARG B C    6  
ATOM 8910  O O    . ARG A 1 72 ? -5.338  -1.480  -4.122  1.00 0.00 ? 1116 ARG B O    6  
ATOM 8911  C CB   . ARG A 1 72 ? -4.383  1.595   -4.870  1.00 0.00 ? 1116 ARG B CB   6  
ATOM 8912  C CG   . ARG A 1 72 ? -3.808  0.673   -5.939  1.00 0.00 ? 1116 ARG B CG   6  
ATOM 8913  C CD   . ARG A 1 72 ? -2.645  1.372   -6.632  1.00 0.00 ? 1116 ARG B CD   6  
ATOM 8914  N NE   . ARG A 1 72 ? -3.117  2.508   -7.425  1.00 0.00 ? 1116 ARG B NE   6  
ATOM 8915  C CZ   . ARG A 1 72 ? -2.268  3.308   -8.084  1.00 0.00 ? 1116 ARG B CZ   6  
ATOM 8916  N NH1  . ARG A 1 72 ? -0.976  3.098   -8.041  1.00 0.00 ? 1116 ARG B NH1  6  
ATOM 8917  N NH2  . ARG A 1 72 ? -2.732  4.309   -8.780  1.00 0.00 ? 1116 ARG B NH2  6  
ATOM 8918  H H    . ARG A 1 72 ? -5.738  2.648   -3.016  1.00 0.00 ? 1116 ARG B H    6  
ATOM 8919  H HA   . ARG A 1 72 ? -6.309  0.688   -4.964  1.00 0.00 ? 1116 ARG B HA   6  
ATOM 8920  H HB2  . ARG A 1 72 ? -4.709  2.520   -5.325  1.00 0.00 ? 1116 ARG B HB2  6  
ATOM 8921  H HB3  . ARG A 1 72 ? -3.626  1.802   -4.130  1.00 0.00 ? 1116 ARG B HB3  6  
ATOM 8922  H HG2  . ARG A 1 72 ? -3.459  -0.238  -5.478  1.00 0.00 ? 1116 ARG B HG2  6  
ATOM 8923  H HG3  . ARG A 1 72 ? -4.573  0.441   -6.666  1.00 0.00 ? 1116 ARG B HG3  6  
ATOM 8924  H HD2  . ARG A 1 72 ? -1.958  1.725   -5.883  1.00 0.00 ? 1116 ARG B HD2  6  
ATOM 8925  H HD3  . ARG A 1 72 ? -2.144  0.664   -7.276  1.00 0.00 ? 1116 ARG B HD3  6  
ATOM 8926  H HE   . ARG A 1 72 ? -4.078  2.692   -7.473  1.00 0.00 ? 1116 ARG B HE   6  
ATOM 8927  H HH11 . ARG A 1 72 ? -0.606  2.336   -7.514  1.00 0.00 ? 1116 ARG B HH11 6  
ATOM 8928  H HH12 . ARG A 1 72 ? -0.358  3.705   -8.540  1.00 0.00 ? 1116 ARG B HH12 6  
ATOM 8929  H HH21 . ARG A 1 72 ? -3.717  4.478   -8.819  1.00 0.00 ? 1116 ARG B HH21 6  
ATOM 8930  H HH22 . ARG A 1 72 ? -2.102  4.909   -9.274  1.00 0.00 ? 1116 ARG B HH22 6  
ATOM 8931  N N    . ARG A 1 73 ? -4.454  -0.297  -2.422  1.00 0.00 ? 1117 ARG B N    6  
ATOM 8932  C CA   . ARG A 1 73 ? -3.971  -1.482  -1.731  1.00 0.00 ? 1117 ARG B CA   6  
ATOM 8933  C C    . ARG A 1 73 ? -5.131  -2.396  -1.363  1.00 0.00 ? 1117 ARG B C    6  
ATOM 8934  O O    . ARG A 1 73 ? -5.053  -3.612  -1.535  1.00 0.00 ? 1117 ARG B O    6  
ATOM 8935  C CB   . ARG A 1 73 ? -3.202  -1.076  -0.471  1.00 0.00 ? 1117 ARG B CB   6  
ATOM 8936  C CG   . ARG A 1 73 ? -1.807  -0.579  -0.856  1.00 0.00 ? 1117 ARG B CG   6  
ATOM 8937  C CD   . ARG A 1 73 ? -1.003  -0.325  0.420   1.00 0.00 ? 1117 ARG B CD   6  
ATOM 8938  N NE   . ARG A 1 73 ? 0.395   -0.045  0.107   1.00 0.00 ? 1117 ARG B NE   6  
ATOM 8939  C CZ   . ARG A 1 73 ? 1.350   -0.150  1.031   1.00 0.00 ? 1117 ARG B CZ   6  
ATOM 8940  N NH1  . ARG A 1 73 ? 1.064   -0.497  2.261   1.00 0.00 ? 1117 ARG B NH1  6  
ATOM 8941  N NH2  . ARG A 1 73 ? 2.584   0.086   0.700   1.00 0.00 ? 1117 ARG B NH2  6  
ATOM 8942  H H    . ARG A 1 73 ? -4.297  0.587   -2.033  1.00 0.00 ? 1117 ARG B H    6  
ATOM 8943  H HA   . ARG A 1 73 ? -3.301  -2.018  -2.386  1.00 0.00 ? 1117 ARG B HA   6  
ATOM 8944  H HB2  . ARG A 1 73 ? -3.739  -0.278  0.033   1.00 0.00 ? 1117 ARG B HB2  6  
ATOM 8945  H HB3  . ARG A 1 73 ? -3.112  -1.926  0.188   1.00 0.00 ? 1117 ARG B HB3  6  
ATOM 8946  H HG2  . ARG A 1 73 ? -1.312  -1.328  -1.457  1.00 0.00 ? 1117 ARG B HG2  6  
ATOM 8947  H HG3  . ARG A 1 73 ? -1.890  0.338   -1.419  1.00 0.00 ? 1117 ARG B HG3  6  
ATOM 8948  H HD2  . ARG A 1 73 ? -1.423  0.521   0.942   1.00 0.00 ? 1117 ARG B HD2  6  
ATOM 8949  H HD3  . ARG A 1 73 ? -1.063  -1.197  1.056   1.00 0.00 ? 1117 ARG B HD3  6  
ATOM 8950  H HE   . ARG A 1 73 ? 0.641   0.234   -0.804  1.00 0.00 ? 1117 ARG B HE   6  
ATOM 8951  H HH11 . ARG A 1 73 ? 0.121   -0.690  2.527   1.00 0.00 ? 1117 ARG B HH11 6  
ATOM 8952  H HH12 . ARG A 1 73 ? 1.795   -0.572  2.938   1.00 0.00 ? 1117 ARG B HH12 6  
ATOM 8953  H HH21 . ARG A 1 73 ? 2.806   0.344   -0.239  1.00 0.00 ? 1117 ARG B HH21 6  
ATOM 8954  H HH22 . ARG A 1 73 ? 3.309   0.005   1.380   1.00 0.00 ? 1117 ARG B HH22 6  
ATOM 8955  N N    . LEU A 1 74 ? -6.214  -1.808  -0.880  1.00 0.00 ? 1118 LEU B N    6  
ATOM 8956  C CA   . LEU A 1 74 ? -7.386  -2.588  -0.520  1.00 0.00 ? 1118 LEU B CA   6  
ATOM 8957  C C    . LEU A 1 74 ? -7.979  -3.259  -1.755  1.00 0.00 ? 1118 LEU B C    6  
ATOM 8958  O O    . LEU A 1 74 ? -8.404  -4.414  -1.701  1.00 0.00 ? 1118 LEU B O    6  
ATOM 8959  C CB   . LEU A 1 74 ? -8.428  -1.685  0.138   1.00 0.00 ? 1118 LEU B CB   6  
ATOM 8960  C CG   . LEU A 1 74 ? -7.941  -1.275  1.529   1.00 0.00 ? 1118 LEU B CG   6  
ATOM 8961  C CD1  . LEU A 1 74 ? -8.821  -0.149  2.069   1.00 0.00 ? 1118 LEU B CD1  6  
ATOM 8962  C CD2  . LEU A 1 74 ? -8.037  -2.477  2.471   1.00 0.00 ? 1118 LEU B CD2  6  
ATOM 8963  H H    . LEU A 1 74 ? -6.231  -0.833  -0.775  1.00 0.00 ? 1118 LEU B H    6  
ATOM 8964  H HA   . LEU A 1 74 ? -7.092  -3.352  0.183   1.00 0.00 ? 1118 LEU B HA   6  
ATOM 8965  H HB2  . LEU A 1 74 ? -8.575  -0.803  -0.469  1.00 0.00 ? 1118 LEU B HB2  6  
ATOM 8966  H HB3  . LEU A 1 74 ? -9.363  -2.220  0.228   1.00 0.00 ? 1118 LEU B HB3  6  
ATOM 8967  H HG   . LEU A 1 74 ? -6.916  -0.941  1.472   1.00 0.00 ? 1118 LEU B HG   6  
ATOM 8968  H HD11 . LEU A 1 74 ? -9.857  -0.441  2.006   1.00 0.00 ? 1118 LEU B HD11 6  
ATOM 8969  H HD12 . LEU A 1 74 ? -8.660  0.745   1.486   1.00 0.00 ? 1118 LEU B HD12 6  
ATOM 8970  H HD13 . LEU A 1 74 ? -8.564  0.043   3.102   1.00 0.00 ? 1118 LEU B HD13 6  
ATOM 8971  H HD21 . LEU A 1 74 ? -8.390  -2.148  3.438   1.00 0.00 ? 1118 LEU B HD21 6  
ATOM 8972  H HD22 . LEU A 1 74 ? -7.061  -2.929  2.579   1.00 0.00 ? 1118 LEU B HD22 6  
ATOM 8973  H HD23 . LEU A 1 74 ? -8.727  -3.199  2.062   1.00 0.00 ? 1118 LEU B HD23 6  
ATOM 8974  N N    . LYS A 1 75 ? -8.009  -2.532  -2.868  1.00 0.00 ? 1119 LYS B N    6  
ATOM 8975  C CA   . LYS A 1 75 ? -8.551  -3.073  -4.101  1.00 0.00 ? 1119 LYS B CA   6  
ATOM 8976  C C    . LYS A 1 75 ? -7.749  -4.290  -4.546  1.00 0.00 ? 1119 LYS B C    6  
ATOM 8977  O O    . LYS A 1 75 ? -8.316  -5.325  -4.897  1.00 0.00 ? 1119 LYS B O    6  
ATOM 8978  C CB   . LYS A 1 75 ? -8.508  -2.003  -5.191  1.00 0.00 ? 1119 LYS B CB   6  
ATOM 8979  C CG   . LYS A 1 75 ? -9.123  -2.544  -6.484  1.00 0.00 ? 1119 LYS B CG   6  
ATOM 8980  C CD   . LYS A 1 75 ? -10.615 -2.810  -6.270  1.00 0.00 ? 1119 LYS B CD   6  
ATOM 8981  C CE   . LYS A 1 75 ? -11.249 -3.200  -7.598  1.00 0.00 ? 1119 LYS B CE   6  
ATOM 8982  N NZ   . LYS A 1 75 ? -12.702 -3.464  -7.393  1.00 0.00 ? 1119 LYS B NZ   6  
ATOM 8983  H H    . LYS A 1 75 ? -7.662  -1.618  -2.862  1.00 0.00 ? 1119 LYS B H    6  
ATOM 8984  H HA   . LYS A 1 75 ? -9.573  -3.367  -3.931  1.00 0.00 ? 1119 LYS B HA   6  
ATOM 8985  H HB2  . LYS A 1 75 ? -9.062  -1.137  -4.864  1.00 0.00 ? 1119 LYS B HB2  6  
ATOM 8986  H HB3  . LYS A 1 75 ? -7.480  -1.727  -5.374  1.00 0.00 ? 1119 LYS B HB3  6  
ATOM 8987  H HG2  . LYS A 1 75 ? -8.997  -1.815  -7.271  1.00 0.00 ? 1119 LYS B HG2  6  
ATOM 8988  H HG3  . LYS A 1 75 ? -8.633  -3.464  -6.762  1.00 0.00 ? 1119 LYS B HG3  6  
ATOM 8989  H HD2  . LYS A 1 75 ? -10.745 -3.614  -5.564  1.00 0.00 ? 1119 LYS B HD2  6  
ATOM 8990  H HD3  . LYS A 1 75 ? -11.091 -1.917  -5.894  1.00 0.00 ? 1119 LYS B HD3  6  
ATOM 8991  H HE2  . LYS A 1 75 ? -11.121 -2.396  -8.304  1.00 0.00 ? 1119 LYS B HE2  6  
ATOM 8992  H HE3  . LYS A 1 75 ? -10.769 -4.091  -7.972  1.00 0.00 ? 1119 LYS B HE3  6  
ATOM 8993  H HZ1  . LYS A 1 75 ? -12.896 -4.474  -7.541  1.00 0.00 ? 1119 LYS B HZ1  6  
ATOM 8994  H HZ2  . LYS A 1 75 ? -13.255 -2.901  -8.072  1.00 0.00 ? 1119 LYS B HZ2  6  
ATOM 8995  H HZ3  . LYS A 1 75 ? -12.970 -3.200  -6.425  1.00 0.00 ? 1119 LYS B HZ3  6  
ATOM 8996  N N    . VAL A 1 76 ? -6.424  -4.162  -4.523  1.00 0.00 ? 1120 VAL B N    6  
ATOM 8997  C CA   . VAL A 1 76 ? -5.558  -5.261  -4.920  1.00 0.00 ? 1120 VAL B CA   6  
ATOM 8998  C C    . VAL A 1 76 ? -5.760  -6.451  -3.991  1.00 0.00 ? 1120 VAL B C    6  
ATOM 8999  O O    . VAL A 1 76 ? -5.777  -7.597  -4.433  1.00 0.00 ? 1120 VAL B O    6  
ATOM 9000  C CB   . VAL A 1 76 ? -4.096  -4.817  -4.886  1.00 0.00 ? 1120 VAL B CB   6  
ATOM 9001  C CG1  . VAL A 1 76 ? -3.188  -6.031  -5.085  1.00 0.00 ? 1120 VAL B CG1  6  
ATOM 9002  C CG2  . VAL A 1 76 ? -3.848  -3.811  -6.011  1.00 0.00 ? 1120 VAL B CG2  6  
ATOM 9003  H H    . VAL A 1 76 ? -6.021  -3.312  -4.232  1.00 0.00 ? 1120 VAL B H    6  
ATOM 9004  H HA   . VAL A 1 76 ? -5.810  -5.557  -5.927  1.00 0.00 ? 1120 VAL B HA   6  
ATOM 9005  H HB   . VAL A 1 76 ? -3.879  -4.357  -3.933  1.00 0.00 ? 1120 VAL B HB   6  
ATOM 9006  H HG11 . VAL A 1 76 ? -2.166  -5.701  -5.190  1.00 0.00 ? 1120 VAL B HG11 6  
ATOM 9007  H HG12 . VAL A 1 76 ? -3.488  -6.562  -5.977  1.00 0.00 ? 1120 VAL B HG12 6  
ATOM 9008  H HG13 . VAL A 1 76 ? -3.269  -6.688  -4.233  1.00 0.00 ? 1120 VAL B HG13 6  
ATOM 9009  H HG21 . VAL A 1 76 ? -4.171  -4.236  -6.950  1.00 0.00 ? 1120 VAL B HG21 6  
ATOM 9010  H HG22 . VAL A 1 76 ? -2.795  -3.580  -6.062  1.00 0.00 ? 1120 VAL B HG22 6  
ATOM 9011  H HG23 . VAL A 1 76 ? -4.408  -2.908  -5.815  1.00 0.00 ? 1120 VAL B HG23 6  
ATOM 9012  N N    . TYR A 1 77 ? -5.900  -6.169  -2.703  1.00 0.00 ? 1121 TYR B N    6  
ATOM 9013  C CA   . TYR A 1 77 ? -6.090  -7.227  -1.716  1.00 0.00 ? 1121 TYR B CA   6  
ATOM 9014  C C    . TYR A 1 77 ? -7.335  -8.044  -2.041  1.00 0.00 ? 1121 TYR B C    6  
ATOM 9015  O O    . TYR A 1 77 ? -7.294  -9.274  -2.056  1.00 0.00 ? 1121 TYR B O    6  
ATOM 9016  C CB   . TYR A 1 77 ? -6.225  -6.616  -0.320  1.00 0.00 ? 1121 TYR B CB   6  
ATOM 9017  C CG   . TYR A 1 77 ? -6.485  -7.710  0.688   1.00 0.00 ? 1121 TYR B CG   6  
ATOM 9018  C CD1  . TYR A 1 77 ? -5.451  -8.578  1.055   1.00 0.00 ? 1121 TYR B CD1  6  
ATOM 9019  C CD2  . TYR A 1 77 ? -7.755  -7.852  1.258   1.00 0.00 ? 1121 TYR B CD2  6  
ATOM 9020  C CE1  . TYR A 1 77 ? -5.686  -9.589  1.993   1.00 0.00 ? 1121 TYR B CE1  6  
ATOM 9021  C CE2  . TYR A 1 77 ? -7.990  -8.864  2.196   1.00 0.00 ? 1121 TYR B CE2  6  
ATOM 9022  C CZ   . TYR A 1 77 ? -6.957  -9.734  2.563   1.00 0.00 ? 1121 TYR B CZ   6  
ATOM 9023  O OH   . TYR A 1 77 ? -7.187  -10.730 3.489   1.00 0.00 ? 1121 TYR B OH   6  
ATOM 9024  H H    . TYR A 1 77 ? -5.872  -5.233  -2.410  1.00 0.00 ? 1121 TYR B H    6  
ATOM 9025  H HA   . TYR A 1 77 ? -5.231  -7.878  -1.730  1.00 0.00 ? 1121 TYR B HA   6  
ATOM 9026  H HB2  . TYR A 1 77 ? -5.313  -6.098  -0.062  1.00 0.00 ? 1121 TYR B HB2  6  
ATOM 9027  H HB3  . TYR A 1 77 ? -7.049  -5.917  -0.311  1.00 0.00 ? 1121 TYR B HB3  6  
ATOM 9028  H HD1  . TYR A 1 77 ? -4.470  -8.467  0.613   1.00 0.00 ? 1121 TYR B HD1  6  
ATOM 9029  H HD2  . TYR A 1 77 ? -8.553  -7.180  0.975   1.00 0.00 ? 1121 TYR B HD2  6  
ATOM 9030  H HE1  . TYR A 1 77 ? -4.889  -10.260 2.274   1.00 0.00 ? 1121 TYR B HE1  6  
ATOM 9031  H HE2  . TYR A 1 77 ? -8.970  -8.975  2.637   1.00 0.00 ? 1121 TYR B HE2  6  
ATOM 9032  H HH   . TYR A 1 77 ? -6.491  -11.385 3.400   1.00 0.00 ? 1121 TYR B HH   6  
ATOM 9033  N N    . HIS A 1 78 ? -8.435  -7.352  -2.307  1.00 0.00 ? 1122 HIS B N    6  
ATOM 9034  C CA   . HIS A 1 78 ? -9.684  -8.028  -2.638  1.00 0.00 ? 1122 HIS B CA   6  
ATOM 9035  C C    . HIS A 1 78 ? -9.511  -8.858  -3.905  1.00 0.00 ? 1122 HIS B C    6  
ATOM 9036  O O    . HIS A 1 78 ? -9.928  -10.017 -3.966  1.00 0.00 ? 1122 HIS B O    6  
ATOM 9037  C CB   . HIS A 1 78 ? -10.800 -7.002  -2.836  1.00 0.00 ? 1122 HIS B CB   6  
ATOM 9038  C CG   . HIS A 1 78 ? -12.072 -7.710  -3.213  1.00 0.00 ? 1122 HIS B CG   6  
ATOM 9039  N ND1  . HIS A 1 78 ? -12.804 -8.450  -2.298  1.00 0.00 ? 1122 HIS B ND1  6  
ATOM 9040  C CD2  . HIS A 1 78 ? -12.754 -7.802  -4.401  1.00 0.00 ? 1122 HIS B CD2  6  
ATOM 9041  C CE1  . HIS A 1 78 ? -13.874 -8.950  -2.944  1.00 0.00 ? 1122 HIS B CE1  6  
ATOM 9042  N NE2  . HIS A 1 78 ? -13.893 -8.585  -4.229  1.00 0.00 ? 1122 HIS B NE2  6  
ATOM 9043  H H    . HIS A 1 78 ? -8.405  -6.373  -2.288  1.00 0.00 ? 1122 HIS B H    6  
ATOM 9044  H HA   . HIS A 1 78 ? -9.953  -8.684  -1.825  1.00 0.00 ? 1122 HIS B HA   6  
ATOM 9045  H HB2  . HIS A 1 78 ? -10.950 -6.454  -1.919  1.00 0.00 ? 1122 HIS B HB2  6  
ATOM 9046  H HB3  . HIS A 1 78 ? -10.524 -6.316  -3.624  1.00 0.00 ? 1122 HIS B HB3  6  
ATOM 9047  H HD1  . HIS A 1 78 ? -12.584 -8.586  -1.352  1.00 0.00 ? 1122 HIS B HD1  6  
ATOM 9048  H HD2  . HIS A 1 78 ? -12.454 -7.337  -5.327  1.00 0.00 ? 1122 HIS B HD2  6  
ATOM 9049  H HE1  . HIS A 1 78 ? -14.627 -9.571  -2.480  1.00 0.00 ? 1122 HIS B HE1  6  
ATOM 9050  N N    . ALA A 1 79 ? -8.893  -8.260  -4.916  1.00 0.00 ? 1123 ALA B N    6  
ATOM 9051  C CA   . ALA A 1 79 ? -8.674  -8.956  -6.178  1.00 0.00 ? 1123 ALA B CA   6  
ATOM 9052  C C    . ALA A 1 79 ? -7.813  -10.199 -5.959  1.00 0.00 ? 1123 ALA B C    6  
ATOM 9053  O O    . ALA A 1 79 ? -8.064  -11.246 -6.551  1.00 0.00 ? 1123 ALA B O    6  
ATOM 9054  C CB   . ALA A 1 79 ? -7.993  -8.019  -7.179  1.00 0.00 ? 1123 ALA B CB   6  
ATOM 9055  H H    . ALA A 1 79 ? -8.582  -7.337  -4.812  1.00 0.00 ? 1123 ALA B H    6  
ATOM 9056  H HA   . ALA A 1 79 ? -9.628  -9.258  -6.579  1.00 0.00 ? 1123 ALA B HA   6  
ATOM 9057  H HB1  . ALA A 1 79 ? -8.667  -7.821  -7.998  1.00 0.00 ? 1123 ALA B HB1  6  
ATOM 9058  H HB2  . ALA A 1 79 ? -7.094  -8.484  -7.555  1.00 0.00 ? 1123 ALA B HB2  6  
ATOM 9059  H HB3  . ALA A 1 79 ? -7.739  -7.089  -6.688  1.00 0.00 ? 1123 ALA B HB3  6  
ATOM 9060  N N    . TRP A 1 80 ? -6.803  -10.085 -5.101  1.00 0.00 ? 1124 TRP B N    6  
ATOM 9061  C CA   . TRP A 1 80 ? -5.931  -11.207 -4.813  1.00 0.00 ? 1124 TRP B CA   6  
ATOM 9062  C C    . TRP A 1 80 ? -6.734  -12.359 -4.213  1.00 0.00 ? 1124 TRP B C    6  
ATOM 9063  O O    . TRP A 1 80 ? -6.601  -13.511 -4.616  1.00 0.00 ? 1124 TRP B O    6  
ATOM 9064  C CB   . TRP A 1 80 ? -4.840  -10.755 -3.851  1.00 0.00 ? 1124 TRP B CB   6  
ATOM 9065  C CG   . TRP A 1 80 ? -3.992  -11.916 -3.506  1.00 0.00 ? 1124 TRP B CG   6  
ATOM 9066  C CD1  . TRP A 1 80 ? -3.075  -12.447 -4.324  1.00 0.00 ? 1124 TRP B CD1  6  
ATOM 9067  C CD2  . TRP A 1 80 ? -3.944  -12.671 -2.272  1.00 0.00 ? 1124 TRP B CD2  6  
ATOM 9068  N NE1  . TRP A 1 80 ? -2.474  -13.517 -3.687  1.00 0.00 ? 1124 TRP B NE1  6  
ATOM 9069  C CE2  . TRP A 1 80 ? -2.975  -13.691 -2.406  1.00 0.00 ? 1124 TRP B CE2  6  
ATOM 9070  C CE3  . TRP A 1 80 ? -4.648  -12.571 -1.065  1.00 0.00 ? 1124 TRP B CE3  6  
ATOM 9071  C CZ2  . TRP A 1 80 ? -2.716  -14.589 -1.368  1.00 0.00 ? 1124 TRP B CZ2  6  
ATOM 9072  C CZ3  . TRP A 1 80 ? -4.389  -13.466 -0.018  1.00 0.00 ? 1124 TRP B CZ3  6  
ATOM 9073  C CH2  . TRP A 1 80 ? -3.425  -14.473 -0.166  1.00 0.00 ? 1124 TRP B CH2  6  
ATOM 9074  H H    . TRP A 1 80 ? -6.642  -9.239  -4.650  1.00 0.00 ? 1124 TRP B H    6  
ATOM 9075  H HA   . TRP A 1 80 ? -5.472  -11.541 -5.733  1.00 0.00 ? 1124 TRP B HA   6  
ATOM 9076  H HB2  . TRP A 1 80 ? -4.235  -9.994  -4.321  1.00 0.00 ? 1124 TRP B HB2  6  
ATOM 9077  H HB3  . TRP A 1 80 ? -5.289  -10.355 -2.953  1.00 0.00 ? 1124 TRP B HB3  6  
ATOM 9078  H HD1  . TRP A 1 80 ? -2.863  -12.104 -5.324  1.00 0.00 ? 1124 TRP B HD1  6  
ATOM 9079  H HE1  . TRP A 1 80 ? -1.778  -14.085 -4.076  1.00 0.00 ? 1124 TRP B HE1  6  
ATOM 9080  H HE3  . TRP A 1 80 ? -5.395  -11.798 -0.944  1.00 0.00 ? 1124 TRP B HE3  6  
ATOM 9081  H HZ2  . TRP A 1 80 ? -1.973  -15.362 -1.487  1.00 0.00 ? 1124 TRP B HZ2  6  
ATOM 9082  H HZ3  . TRP A 1 80 ? -4.931  -13.376 0.908   1.00 0.00 ? 1124 TRP B HZ3  6  
ATOM 9083  H HH2  . TRP A 1 80 ? -3.230  -15.160 0.645   1.00 0.00 ? 1124 TRP B HH2  6  
ATOM 9084  N N    . LYS A 1 81 ? -7.589  -12.040 -3.259  1.00 0.00 ? 1125 LYS B N    6  
ATOM 9085  C CA   . LYS A 1 81 ? -8.419  -13.057 -2.637  1.00 0.00 ? 1125 LYS B CA   6  
ATOM 9086  C C    . LYS A 1 81 ? -9.316  -13.708 -3.672  1.00 0.00 ? 1125 LYS B C    6  
ATOM 9087  O O    . LYS A 1 81 ? -9.593  -14.895 -3.604  1.00 0.00 ? 1125 LYS B O    6  
ATOM 9088  C CB   . LYS A 1 81 ? -9.268  -12.440 -1.522  1.00 0.00 ? 1125 LYS B CB   6  
ATOM 9089  C CG   . LYS A 1 81 ? -8.378  -12.071 -0.333  1.00 0.00 ? 1125 LYS B CG   6  
ATOM 9090  C CD   . LYS A 1 81 ? -7.883  -13.351 0.340   1.00 0.00 ? 1125 LYS B CD   6  
ATOM 9091  C CE   . LYS A 1 81 ? -7.231  -13.008 1.680   1.00 0.00 ? 1125 LYS B CE   6  
ATOM 9092  N NZ   . LYS A 1 81 ? -6.697  -14.251 2.310   1.00 0.00 ? 1125 LYS B NZ   6  
ATOM 9093  H H    . LYS A 1 81 ? -7.671  -11.106 -2.976  1.00 0.00 ? 1125 LYS B H    6  
ATOM 9094  H HA   . LYS A 1 81 ? -7.787  -13.820 -2.223  1.00 0.00 ? 1125 LYS B HA   6  
ATOM 9095  H HB2  . LYS A 1 81 ? -9.758  -11.553 -1.895  1.00 0.00 ? 1125 LYS B HB2  6  
ATOM 9096  H HB3  . LYS A 1 81 ? -10.013 -13.155 -1.202  1.00 0.00 ? 1125 LYS B HB3  6  
ATOM 9097  H HG2  . LYS A 1 81 ? -7.530  -11.498 -0.683  1.00 0.00 ? 1125 LYS B HG2  6  
ATOM 9098  H HG3  . LYS A 1 81 ? -8.941  -11.487 0.375   1.00 0.00 ? 1125 LYS B HG3  6  
ATOM 9099  H HD2  . LYS A 1 81 ? -8.719  -14.014 0.499   1.00 0.00 ? 1125 LYS B HD2  6  
ATOM 9100  H HD3  . LYS A 1 81 ? -7.158  -13.833 -0.297  1.00 0.00 ? 1125 LYS B HD3  6  
ATOM 9101  H HE2  . LYS A 1 81 ? -6.423  -12.308 1.521   1.00 0.00 ? 1125 LYS B HE2  6  
ATOM 9102  H HE3  . LYS A 1 81 ? -7.966  -12.565 2.332   1.00 0.00 ? 1125 LYS B HE3  6  
ATOM 9103  H HZ1  . LYS A 1 81 ? -6.668  -15.013 1.605   1.00 0.00 ? 1125 LYS B HZ1  6  
ATOM 9104  H HZ2  . LYS A 1 81 ? -7.312  -14.531 3.100   1.00 0.00 ? 1125 LYS B HZ2  6  
ATOM 9105  H HZ3  . LYS A 1 81 ? -5.735  -14.075 2.665   1.00 0.00 ? 1125 LYS B HZ3  6  
ATOM 9106  N N    . SER A 1 82 ? -9.766  -12.920 -4.625  1.00 0.00 ? 1126 SER B N    6  
ATOM 9107  C CA   . SER A 1 82 ? -10.630 -13.430 -5.684  1.00 0.00 ? 1126 SER B CA   6  
ATOM 9108  C C    . SER A 1 82 ? -9.856  -14.366 -6.608  1.00 0.00 ? 1126 SER B C    6  
ATOM 9109  O O    . SER A 1 82 ? -10.388 -15.372 -7.070  1.00 0.00 ? 1126 SER B O    6  
ATOM 9110  C CB   . SER A 1 82 ? -11.214 -12.278 -6.498  1.00 0.00 ? 1126 SER B CB   6  
ATOM 9111  O OG   . SER A 1 82 ? -12.069 -11.506 -5.668  1.00 0.00 ? 1126 SER B OG   6  
ATOM 9112  H H    . SER A 1 82 ? -9.504  -11.983 -4.625  1.00 0.00 ? 1126 SER B H    6  
ATOM 9113  H HA   . SER A 1 82 ? -11.442 -13.981 -5.236  1.00 0.00 ? 1126 SER B HA   6  
ATOM 9114  H HB2  . SER A 1 82 ? -10.420 -11.655 -6.870  1.00 0.00 ? 1126 SER B HB2  6  
ATOM 9115  H HB3  . SER A 1 82 ? -11.774 -12.681 -7.332  1.00 0.00 ? 1126 SER B HB3  6  
ATOM 9116  H HG   . SER A 1 82 ? -12.954 -11.543 -6.037  1.00 0.00 ? 1126 SER B HG   6  
ATOM 9117  N N    . LYS A 1 83 ? -8.604  -14.016 -6.891  1.00 0.00 ? 1127 LYS B N    6  
ATOM 9118  C CA   . LYS A 1 83 ? -7.777  -14.825 -7.782  1.00 0.00 ? 1127 LYS B CA   6  
ATOM 9119  C C    . LYS A 1 83 ? -7.453  -16.169 -7.136  1.00 0.00 ? 1127 LYS B C    6  
ATOM 9120  O O    . LYS A 1 83 ? -7.241  -17.162 -7.829  1.00 0.00 ? 1127 LYS B O    6  
ATOM 9121  C CB   . LYS A 1 83 ? -6.475  -14.081 -8.118  1.00 0.00 ? 1127 LYS B CB   6  
ATOM 9122  C CG   . LYS A 1 83 ? -5.325  -14.599 -7.251  1.00 0.00 ? 1127 LYS B CG   6  
ATOM 9123  C CD   . LYS A 1 83 ? -4.117  -13.676 -7.407  1.00 0.00 ? 1127 LYS B CD   6  
ATOM 9124  C CE   . LYS A 1 83 ? -3.574  -13.784 -8.831  1.00 0.00 ? 1127 LYS B CE   6  
ATOM 9125  N NZ   . LYS A 1 83 ? -2.376  -12.910 -8.968  1.00 0.00 ? 1127 LYS B NZ   6  
ATOM 9126  H H    . LYS A 1 83 ? -8.237  -13.193 -6.507  1.00 0.00 ? 1127 LYS B H    6  
ATOM 9127  H HA   . LYS A 1 83 ? -8.321  -15.003 -8.701  1.00 0.00 ? 1127 LYS B HA   6  
ATOM 9128  H HB2  . LYS A 1 83 ? -6.233  -14.231 -9.158  1.00 0.00 ? 1127 LYS B HB2  6  
ATOM 9129  H HB3  . LYS A 1 83 ? -6.607  -13.025 -7.930  1.00 0.00 ? 1127 LYS B HB3  6  
ATOM 9130  H HG2  . LYS A 1 83 ? -5.634  -14.619 -6.222  1.00 0.00 ? 1127 LYS B HG2  6  
ATOM 9131  H HG3  . LYS A 1 83 ? -5.055  -15.593 -7.568  1.00 0.00 ? 1127 LYS B HG3  6  
ATOM 9132  H HD2  . LYS A 1 83 ? -4.418  -12.656 -7.212  1.00 0.00 ? 1127 LYS B HD2  6  
ATOM 9133  H HD3  . LYS A 1 83 ? -3.349  -13.965 -6.706  1.00 0.00 ? 1127 LYS B HD3  6  
ATOM 9134  H HE2  . LYS A 1 83 ? -3.298  -14.808 -9.034  1.00 0.00 ? 1127 LYS B HE2  6  
ATOM 9135  H HE3  . LYS A 1 83 ? -4.331  -13.469 -9.533  1.00 0.00 ? 1127 LYS B HE3  6  
ATOM 9136  H HZ1  . LYS A 1 83 ? -2.508  -12.264 -9.772  1.00 0.00 ? 1127 LYS B HZ1  6  
ATOM 9137  H HZ2  . LYS A 1 83 ? -1.535  -13.501 -9.131  1.00 0.00 ? 1127 LYS B HZ2  6  
ATOM 9138  H HZ3  . LYS A 1 83 ? -2.249  -12.357 -8.098  1.00 0.00 ? 1127 LYS B HZ3  6  
ATOM 9139  N N    . ASN A 1 84 ? -7.396  -16.193 -5.807  1.00 0.00 ? 1128 ASN B N    6  
ATOM 9140  C CA   . ASN A 1 84 ? -7.074  -17.430 -5.100  1.00 0.00 ? 1128 ASN B CA   6  
ATOM 9141  C C    . ASN A 1 84 ? -8.338  -18.196 -4.713  1.00 0.00 ? 1128 ASN B C    6  
ATOM 9142  O O    . ASN A 1 84 ? -8.388  -19.421 -4.812  1.00 0.00 ? 1128 ASN B O    6  
ATOM 9143  C CB   . ASN A 1 84 ? -6.280  -17.095 -3.835  1.00 0.00 ? 1128 ASN B CB   6  
ATOM 9144  C CG   . ASN A 1 84 ? -4.822  -16.815 -4.188  1.00 0.00 ? 1128 ASN B CG   6  
ATOM 9145  O OD1  . ASN A 1 84 ? -4.046  -17.746 -4.402  1.00 0.00 ? 1128 ASN B OD1  6  
ATOM 9146  N ND2  . ASN A 1 84 ? -4.403  -15.582 -4.262  1.00 0.00 ? 1128 ASN B ND2  6  
ATOM 9147  H H    . ASN A 1 84 ? -7.558  -15.368 -5.298  1.00 0.00 ? 1128 ASN B H    6  
ATOM 9148  H HA   . ASN A 1 84 ? -6.465  -18.051 -5.737  1.00 0.00 ? 1128 ASN B HA   6  
ATOM 9149  H HB2  . ASN A 1 84 ? -6.708  -16.220 -3.367  1.00 0.00 ? 1128 ASN B HB2  6  
ATOM 9150  H HB3  . ASN A 1 84 ? -6.330  -17.928 -3.149  1.00 0.00 ? 1128 ASN B HB3  6  
ATOM 9151  H HD21 . ASN A 1 84 ? -5.021  -14.839 -4.094  1.00 0.00 ? 1128 ASN B HD21 6  
ATOM 9152  H HD22 . ASN A 1 84 ? -3.468  -15.398 -4.489  1.00 0.00 ? 1128 ASN B HD22 6  
ATOM 9153  N N    . LYS A 1 85 ? -9.352  -17.462 -4.280  1.00 0.00 ? 1129 LYS B N    6  
ATOM 9154  C CA   . LYS A 1 85 ? -10.618 -18.066 -3.885  1.00 0.00 ? 1129 LYS B CA   6  
ATOM 9155  C C    . LYS A 1 85 ? -11.377 -18.546 -5.113  1.00 0.00 ? 1129 LYS B C    6  
ATOM 9156  O O    . LYS A 1 85 ? -11.965 -19.628 -5.113  1.00 0.00 ? 1129 LYS B O    6  
ATOM 9157  C CB   . LYS A 1 85 ? -11.462 -17.042 -3.124  1.00 0.00 ? 1129 LYS B CB   6  
ATOM 9158  C CG   . LYS A 1 85 ? -10.796 -16.734 -1.783  1.00 0.00 ? 1129 LYS B CG   6  
ATOM 9159  C CD   . LYS A 1 85 ? -11.479 -15.528 -1.140  1.00 0.00 ? 1129 LYS B CD   6  
ATOM 9160  C CE   . LYS A 1 85 ? -12.895 -15.906 -0.699  1.00 0.00 ? 1129 LYS B CE   6  
ATOM 9161  N NZ   . LYS A 1 85 ? -13.527 -14.744 -0.012  1.00 0.00 ? 1129 LYS B NZ   6  
ATOM 9162  H H    . LYS A 1 85 ? -9.249  -16.498 -4.232  1.00 0.00 ? 1129 LYS B H    6  
ATOM 9163  H HA   . LYS A 1 85 ? -10.422 -18.907 -3.241  1.00 0.00 ? 1129 LYS B HA   6  
ATOM 9164  H HB2  . LYS A 1 85 ? -11.540 -16.135 -3.706  1.00 0.00 ? 1129 LYS B HB2  6  
ATOM 9165  H HB3  . LYS A 1 85 ? -12.448 -17.444 -2.949  1.00 0.00 ? 1129 LYS B HB3  6  
ATOM 9166  H HG2  . LYS A 1 85 ? -10.887 -17.592 -1.130  1.00 0.00 ? 1129 LYS B HG2  6  
ATOM 9167  H HG3  . LYS A 1 85 ? -9.751  -16.512 -1.940  1.00 0.00 ? 1129 LYS B HG3  6  
ATOM 9168  H HD2  . LYS A 1 85 ? -10.908 -15.205 -0.282  1.00 0.00 ? 1129 LYS B HD2  6  
ATOM 9169  H HD3  . LYS A 1 85 ? -11.533 -14.725 -1.860  1.00 0.00 ? 1129 LYS B HD3  6  
ATOM 9170  H HE2  . LYS A 1 85 ? -13.483 -16.176 -1.564  1.00 0.00 ? 1129 LYS B HE2  6  
ATOM 9171  H HE3  . LYS A 1 85 ? -12.849 -16.744 -0.019  1.00 0.00 ? 1129 LYS B HE3  6  
ATOM 9172  H HZ1  . LYS A 1 85 ? -13.464 -14.873 1.019   1.00 0.00 ? 1129 LYS B HZ1  6  
ATOM 9173  H HZ2  . LYS A 1 85 ? -14.525 -14.675 -0.294  1.00 0.00 ? 1129 LYS B HZ2  6  
ATOM 9174  H HZ3  . LYS A 1 85 ? -13.029 -13.871 -0.278  1.00 0.00 ? 1129 LYS B HZ3  6  
ATOM 9175  N N    . LYS A 1 86 ? -11.354 -17.730 -6.159  1.00 0.00 ? 1130 LYS B N    6  
ATOM 9176  C CA   . LYS A 1 86 ? -12.041 -18.074 -7.399  1.00 0.00 ? 1130 LYS B CA   6  
ATOM 9177  C C    . LYS A 1 86 ? -11.036 -18.304 -8.524  1.00 0.00 ? 1130 LYS B C    6  
ATOM 9178  O O    . LYS A 1 86 ? -10.231 -17.429 -8.839  1.00 0.00 ? 1130 LYS B O    6  
ATOM 9179  C CB   . LYS A 1 86 ? -13.004 -16.954 -7.797  1.00 0.00 ? 1130 LYS B CB   6  
ATOM 9180  C CG   . LYS A 1 86 ? -13.740 -17.337 -9.085  1.00 0.00 ? 1130 LYS B CG   6  
ATOM 9181  C CD   . LYS A 1 86 ? -14.636 -16.177 -9.517  1.00 0.00 ? 1130 LYS B CD   6  
ATOM 9182  C CE   . LYS A 1 86 ? -15.819 -16.049 -8.553  1.00 0.00 ? 1130 LYS B CE   6  
ATOM 9183  N NZ   . LYS A 1 86 ? -16.759 -15.009 -9.058  1.00 0.00 ? 1130 LYS B NZ   6  
ATOM 9184  H H    . LYS A 1 86 ? -10.870 -16.874 -6.093  1.00 0.00 ? 1130 LYS B H    6  
ATOM 9185  H HA   . LYS A 1 86 ? -12.608 -18.980 -7.245  1.00 0.00 ? 1130 LYS B HA   6  
ATOM 9186  H HB2  . LYS A 1 86 ? -13.722 -16.798 -7.006  1.00 0.00 ? 1130 LYS B HB2  6  
ATOM 9187  H HB3  . LYS A 1 86 ? -12.447 -16.043 -7.963  1.00 0.00 ? 1130 LYS B HB3  6  
ATOM 9188  H HG2  . LYS A 1 86 ? -13.021 -17.546 -9.865  1.00 0.00 ? 1130 LYS B HG2  6  
ATOM 9189  H HG3  . LYS A 1 86 ? -14.346 -18.212 -8.907  1.00 0.00 ? 1130 LYS B HG3  6  
ATOM 9190  H HD2  . LYS A 1 86 ? -14.059 -15.263 -9.500  1.00 0.00 ? 1130 LYS B HD2  6  
ATOM 9191  H HD3  . LYS A 1 86 ? -15.002 -16.356 -10.516 1.00 0.00 ? 1130 LYS B HD3  6  
ATOM 9192  H HE2  . LYS A 1 86 ? -16.332 -16.997 -8.485  1.00 0.00 ? 1130 LYS B HE2  6  
ATOM 9193  H HE3  . LYS A 1 86 ? -15.458 -15.764 -7.577  1.00 0.00 ? 1130 LYS B HE3  6  
ATOM 9194  H HZ1  . LYS A 1 86 ? -16.956 -15.176 -10.065 1.00 0.00 ? 1130 LYS B HZ1  6  
ATOM 9195  H HZ2  . LYS A 1 86 ? -16.331 -14.068 -8.939  1.00 0.00 ? 1130 LYS B HZ2  6  
ATOM 9196  H HZ3  . LYS A 1 86 ? -17.649 -15.055 -8.521  1.00 0.00 ? 1130 LYS B HZ3  6  
ATOM 9197  N N    . ARG A 1 87 ? -11.097 -19.487 -9.129  1.00 0.00 ? 1131 ARG B N    6  
ATOM 9198  C CA   . ARG A 1 87 ? -10.192 -19.823 -10.222 1.00 0.00 ? 1131 ARG B CA   6  
ATOM 9199  C C    . ARG A 1 87 ? -10.543 -21.187 -10.811 1.00 0.00 ? 1131 ARG B C    6  
ATOM 9200  O O    . ARG A 1 87 ? -10.256 -21.399 -11.978 1.00 0.00 ? 1131 ARG B O    6  
ATOM 9201  C CB   . ARG A 1 87 ? -8.749  -19.839 -9.715  1.00 0.00 ? 1131 ARG B CB   6  
ATOM 9202  C CG   . ARG A 1 87 ? -8.586  -20.951 -8.681  1.00 0.00 ? 1131 ARG B CG   6  
ATOM 9203  C CD   . ARG A 1 87 ? -7.190  -20.879 -8.066  1.00 0.00 ? 1131 ARG B CD   6  
ATOM 9204  N NE   . ARG A 1 87 ? -7.031  -21.927 -7.066  1.00 0.00 ? 1131 ARG B NE   6  
ATOM 9205  C CZ   . ARG A 1 87 ? -6.759  -23.190 -7.408  1.00 0.00 ? 1131 ARG B CZ   6  
ATOM 9206  N NH1  . ARG A 1 87 ? -6.635  -23.536 -8.665  1.00 0.00 ? 1131 ARG B NH1  6  
ATOM 9207  N NH2  . ARG A 1 87 ? -6.617  -24.091 -6.477  1.00 0.00 ? 1131 ARG B NH2  6  
ATOM 9208  O OXT  . ARG A 1 87 ? -11.097 -22.000 -10.086 1.00 0.00 ? 1131 ARG B OXT  6  
ATOM 9209  H H    . ARG A 1 87 ? -11.765 -20.142 -8.838  1.00 0.00 ? 1131 ARG B H    6  
ATOM 9210  H HA   . ARG A 1 87 ? -10.283 -19.076 -10.995 1.00 0.00 ? 1131 ARG B HA   6  
ATOM 9211  H HB2  . ARG A 1 87 ? -8.078  -20.016 -10.544 1.00 0.00 ? 1131 ARG B HB2  6  
ATOM 9212  H HB3  . ARG A 1 87 ? -8.515  -18.890 -9.260  1.00 0.00 ? 1131 ARG B HB3  6  
ATOM 9213  H HG2  . ARG A 1 87 ? -9.329  -20.833 -7.904  1.00 0.00 ? 1131 ARG B HG2  6  
ATOM 9214  H HG3  . ARG A 1 87 ? -8.717  -21.910 -9.160  1.00 0.00 ? 1131 ARG B HG3  6  
ATOM 9215  H HD2  . ARG A 1 87 ? -6.448  -21.004 -8.840  1.00 0.00 ? 1131 ARG B HD2  6  
ATOM 9216  H HD3  . ARG A 1 87 ? -7.057  -19.913 -7.599  1.00 0.00 ? 1131 ARG B HD3  6  
ATOM 9217  H HE   . ARG A 1 87 ? -7.128  -21.699 -6.118  1.00 0.00 ? 1131 ARG B HE   6  
ATOM 9218  H HH11 . ARG A 1 87 ? -6.744  -22.858 -9.387  1.00 0.00 ? 1131 ARG B HH11 6  
ATOM 9219  H HH12 . ARG A 1 87 ? -6.430  -24.485 -8.900  1.00 0.00 ? 1131 ARG B HH12 6  
ATOM 9220  H HH21 . ARG A 1 87 ? -6.714  -23.835 -5.514  1.00 0.00 ? 1131 ARG B HH21 6  
ATOM 9221  H HH22 . ARG A 1 87 ? -6.413  -25.037 -6.724  1.00 0.00 ? 1131 ARG B HH22 6  
ATOM 9222  N N    . ILE B 2 9  ? 4.574   -17.809 -0.357  1.00 0.00 ? 46   ILE A N    6  
ATOM 9223  C CA   . ILE B 2 9  ? 3.380   -18.203 0.443   1.00 0.00 ? 46   ILE A CA   6  
ATOM 9224  C C    . ILE B 2 9  ? 2.223   -17.260 0.124   1.00 0.00 ? 46   ILE A C    6  
ATOM 9225  O O    . ILE B 2 9  ? 2.424   -16.067 -0.106  1.00 0.00 ? 46   ILE A O    6  
ATOM 9226  C CB   . ILE B 2 9  ? 3.719   -18.125 1.932   1.00 0.00 ? 46   ILE A CB   6  
ATOM 9227  C CG1  . ILE B 2 9  ? 4.704   -19.242 2.289   1.00 0.00 ? 46   ILE A CG1  6  
ATOM 9228  C CG2  . ILE B 2 9  ? 2.437   -18.291 2.752   1.00 0.00 ? 46   ILE A CG2  6  
ATOM 9229  C CD1  . ILE B 2 9  ? 5.275   -18.994 3.688   1.00 0.00 ? 46   ILE A CD1  6  
ATOM 9230  H H    . ILE B 2 9  ? 5.356   -17.564 0.283   1.00 0.00 ? 46   ILE A H    6  
ATOM 9231  H HA   . ILE B 2 9  ? 3.098   -19.215 0.190   1.00 0.00 ? 46   ILE A HA   6  
ATOM 9232  H HB   . ILE B 2 9  ? 4.163   -17.165 2.150   1.00 0.00 ? 46   ILE A HB   6  
ATOM 9233  H HG12 . ILE B 2 9  ? 4.191   -20.194 2.273   1.00 0.00 ? 46   ILE A HG12 6  
ATOM 9234  H HG13 . ILE B 2 9  ? 5.509   -19.255 1.570   1.00 0.00 ? 46   ILE A HG13 6  
ATOM 9235  H HG21 . ILE B 2 9  ? 1.760   -18.952 2.232   1.00 0.00 ? 46   ILE A HG21 6  
ATOM 9236  H HG22 . ILE B 2 9  ? 1.969   -17.328 2.883   1.00 0.00 ? 46   ILE A HG22 6  
ATOM 9237  H HG23 . ILE B 2 9  ? 2.676   -18.709 3.718   1.00 0.00 ? 46   ILE A HG23 6  
ATOM 9238  H HD11 . ILE B 2 9  ? 4.756   -19.614 4.403   1.00 0.00 ? 46   ILE A HD11 6  
ATOM 9239  H HD12 . ILE B 2 9  ? 5.144   -17.955 3.950   1.00 0.00 ? 46   ILE A HD12 6  
ATOM 9240  H HD13 . ILE B 2 9  ? 6.327   -19.238 3.696   1.00 0.00 ? 46   ILE A HD13 6  
ATOM 9241  N N    . GLU B 2 10 ? 1.011   -17.802 0.109   1.00 0.00 ? 47   GLU A N    6  
ATOM 9242  C CA   . GLU B 2 10 ? -0.166  -16.994 -0.185  1.00 0.00 ? 47   GLU A CA   6  
ATOM 9243  C C    . GLU B 2 10 ? -0.336  -15.896 0.859   1.00 0.00 ? 47   GLU A C    6  
ATOM 9244  O O    . GLU B 2 10 ? -0.648  -14.751 0.532   1.00 0.00 ? 47   GLU A O    6  
ATOM 9245  C CB   . GLU B 2 10 ? -1.412  -17.879 -0.191  1.00 0.00 ? 47   GLU A CB   6  
ATOM 9246  C CG   . GLU B 2 10 ? -1.382  -18.801 -1.414  1.00 0.00 ? 47   GLU A CG   6  
ATOM 9247  C CD   . GLU B 2 10 ? -2.583  -19.741 -1.392  1.00 0.00 ? 47   GLU A CD   6  
ATOM 9248  O OE1  . GLU B 2 10 ? -3.275  -19.764 -0.387  1.00 0.00 ? 47   GLU A OE1  6  
ATOM 9249  O OE2  . GLU B 2 10 ? -2.796  -20.423 -2.382  1.00 0.00 ? 47   GLU A OE2  6  
ATOM 9250  H H    . GLU B 2 10 ? 0.905   -18.759 0.298   1.00 0.00 ? 47   GLU A H    6  
ATOM 9251  H HA   . GLU B 2 10 ? -0.051  -16.542 -1.158  1.00 0.00 ? 47   GLU A HA   6  
ATOM 9252  H HB2  . GLU B 2 10 ? -1.429  -18.475 0.709   1.00 0.00 ? 47   GLU A HB2  6  
ATOM 9253  H HB3  . GLU B 2 10 ? -2.293  -17.258 -0.230  1.00 0.00 ? 47   GLU A HB3  6  
ATOM 9254  H HG2  . GLU B 2 10 ? -1.410  -18.202 -2.313  1.00 0.00 ? 47   GLU A HG2  6  
ATOM 9255  H HG3  . GLU B 2 10 ? -0.472  -19.381 -1.400  1.00 0.00 ? 47   GLU A HG3  6  
ATOM 9256  N N    . ASN B 2 11 ? -0.125  -16.252 2.119   1.00 0.00 ? 48   ASN A N    6  
ATOM 9257  C CA   . ASN B 2 11 ? -0.258  -15.285 3.197   1.00 0.00 ? 48   ASN A CA   6  
ATOM 9258  C C    . ASN B 2 11 ? 0.743   -14.153 3.019   1.00 0.00 ? 48   ASN A C    6  
ATOM 9259  O O    . ASN B 2 11 ? 0.430   -12.987 3.255   1.00 0.00 ? 48   ASN A O    6  
ATOM 9260  C CB   . ASN B 2 11 ? -0.027  -15.967 4.546   1.00 0.00 ? 48   ASN A CB   6  
ATOM 9261  C CG   . ASN B 2 11 ? -1.179  -16.916 4.850   1.00 0.00 ? 48   ASN A CG   6  
ATOM 9262  O OD1  . ASN B 2 11 ? -0.956  -18.078 5.191   1.00 0.00 ? 48   ASN A OD1  6  
ATOM 9263  N ND2  . ASN B 2 11 ? -2.406  -16.491 4.729   1.00 0.00 ? 48   ASN A ND2  6  
ATOM 9264  H H    . ASN B 2 11 ? 0.123   -17.176 2.326   1.00 0.00 ? 48   ASN A H    6  
ATOM 9265  H HA   . ASN B 2 11 ? -1.257  -14.877 3.179   1.00 0.00 ? 48   ASN A HA   6  
ATOM 9266  H HB2  . ASN B 2 11 ? 0.898   -16.524 4.510   1.00 0.00 ? 48   ASN A HB2  6  
ATOM 9267  H HB3  . ASN B 2 11 ? 0.034   -15.218 5.321   1.00 0.00 ? 48   ASN A HB3  6  
ATOM 9268  H HD21 . ASN B 2 11 ? -2.579  -15.569 4.442   1.00 0.00 ? 48   ASN A HD21 6  
ATOM 9269  H HD22 . ASN B 2 11 ? -3.154  -17.093 4.924   1.00 0.00 ? 48   ASN A HD22 6  
ATOM 9270  N N    . ASP B 2 12 ? 1.952   -14.504 2.598   1.00 0.00 ? 49   ASP A N    6  
ATOM 9271  C CA   . ASP B 2 12 ? 2.993   -13.505 2.390   1.00 0.00 ? 49   ASP A CA   6  
ATOM 9272  C C    . ASP B 2 12 ? 2.587   -12.522 1.299   1.00 0.00 ? 49   ASP A C    6  
ATOM 9273  O O    . ASP B 2 12 ? 2.821   -11.318 1.413   1.00 0.00 ? 49   ASP A O    6  
ATOM 9274  C CB   . ASP B 2 12 ? 4.307   -14.184 2.005   1.00 0.00 ? 49   ASP A CB   6  
ATOM 9275  C CG   . ASP B 2 12 ? 4.901   -14.900 3.215   1.00 0.00 ? 49   ASP A CG   6  
ATOM 9276  O OD1  . ASP B 2 12 ? 4.433   -14.652 4.314   1.00 0.00 ? 49   ASP A OD1  6  
ATOM 9277  O OD2  . ASP B 2 12 ? 5.814   -15.684 3.023   1.00 0.00 ? 49   ASP A OD2  6  
ATOM 9278  H H    . ASP B 2 12 ? 2.144   -15.452 2.417   1.00 0.00 ? 49   ASP A H    6  
ATOM 9279  H HA   . ASP B 2 12 ? 3.138   -12.960 3.310   1.00 0.00 ? 49   ASP A HA   6  
ATOM 9280  H HB2  . ASP B 2 12 ? 4.123   -14.900 1.219   1.00 0.00 ? 49   ASP A HB2  6  
ATOM 9281  H HB3  . ASP B 2 12 ? 5.005   -13.438 1.655   1.00 0.00 ? 49   ASP A HB3  6  
ATOM 9282  N N    . GLU B 2 13 ? 1.981   -13.045 0.236   1.00 0.00 ? 50   GLU A N    6  
ATOM 9283  C CA   . GLU B 2 13 ? 1.551   -12.200 -0.871  1.00 0.00 ? 50   GLU A CA   6  
ATOM 9284  C C    . GLU B 2 13 ? 0.505   -11.195 -0.404  1.00 0.00 ? 50   GLU A C    6  
ATOM 9285  O O    . GLU B 2 13 ? 0.549   -10.019 -0.768  1.00 0.00 ? 50   GLU A O    6  
ATOM 9286  C CB   . GLU B 2 13 ? 0.957   -13.069 -1.981  1.00 0.00 ? 50   GLU A CB   6  
ATOM 9287  C CG   . GLU B 2 13 ? 2.066   -13.896 -2.636  1.00 0.00 ? 50   GLU A CG   6  
ATOM 9288  C CD   . GLU B 2 13 ? 1.467   -14.818 -3.693  1.00 0.00 ? 50   GLU A CD   6  
ATOM 9289  O OE1  . GLU B 2 13 ? 0.254   -14.807 -3.842  1.00 0.00 ? 50   GLU A OE1  6  
ATOM 9290  O OE2  . GLU B 2 13 ? 2.229   -15.525 -4.333  1.00 0.00 ? 50   GLU A OE2  6  
ATOM 9291  H H    . GLU B 2 13 ? 1.824   -14.013 0.197   1.00 0.00 ? 50   GLU A H    6  
ATOM 9292  H HA   . GLU B 2 13 ? 2.401   -11.667 -1.264  1.00 0.00 ? 50   GLU A HA   6  
ATOM 9293  H HB2  . GLU B 2 13 ? 0.215   -13.732 -1.559  1.00 0.00 ? 50   GLU A HB2  6  
ATOM 9294  H HB3  . GLU B 2 13 ? 0.496   -12.437 -2.724  1.00 0.00 ? 50   GLU A HB3  6  
ATOM 9295  H HG2  . GLU B 2 13 ? 2.781   -13.234 -3.100  1.00 0.00 ? 50   GLU A HG2  6  
ATOM 9296  H HG3  . GLU B 2 13 ? 2.561   -14.491 -1.883  1.00 0.00 ? 50   GLU A HG3  6  
ATOM 9297  N N    . ALA B 2 14 ? -0.435  -11.663 0.411   1.00 0.00 ? 51   ALA A N    6  
ATOM 9298  C CA   . ALA B 2 14 ? -1.481  -10.787 0.922   1.00 0.00 ? 51   ALA A CA   6  
ATOM 9299  C C    . ALA B 2 14 ? -0.881  -9.684  1.790   1.00 0.00 ? 51   ALA A C    6  
ATOM 9300  O O    . ALA B 2 14 ? -1.301  -8.529  1.721   1.00 0.00 ? 51   ALA A O    6  
ATOM 9301  C CB   . ALA B 2 14 ? -2.492  -11.591 1.734   1.00 0.00 ? 51   ALA A CB   6  
ATOM 9302  H H    . ALA B 2 14 ? -0.422  -12.608 0.676   1.00 0.00 ? 51   ALA A H    6  
ATOM 9303  H HA   . ALA B 2 14 ? -1.990  -10.332 0.086   1.00 0.00 ? 51   ALA A HA   6  
ATOM 9304  H HB1  . ALA B 2 14 ? -3.489  -11.400 1.358   1.00 0.00 ? 51   ALA A HB1  6  
ATOM 9305  H HB2  . ALA B 2 14 ? -2.433  -11.298 2.769   1.00 0.00 ? 51   ALA A HB2  6  
ATOM 9306  H HB3  . ALA B 2 14 ? -2.270  -12.644 1.644   1.00 0.00 ? 51   ALA A HB3  6  
ATOM 9307  N N    . PHE B 2 15 ? 0.109   -10.046 2.599   1.00 0.00 ? 52   PHE A N    6  
ATOM 9308  C CA   . PHE B 2 15 ? 0.760   -9.071  3.467   1.00 0.00 ? 52   PHE A CA   6  
ATOM 9309  C C    . PHE B 2 15 ? 1.417   -7.970  2.647   1.00 0.00 ? 52   PHE A C    6  
ATOM 9310  O O    . PHE B 2 15 ? 1.291   -6.791  2.970   1.00 0.00 ? 52   PHE A O    6  
ATOM 9311  C CB   . PHE B 2 15 ? 1.821   -9.755  4.329   1.00 0.00 ? 52   PHE A CB   6  
ATOM 9312  C CG   . PHE B 2 15 ? 1.231   -10.131 5.666   1.00 0.00 ? 52   PHE A CG   6  
ATOM 9313  C CD1  . PHE B 2 15 ? 0.872   -11.457 5.930   1.00 0.00 ? 52   PHE A CD1  6  
ATOM 9314  C CD2  . PHE B 2 15 ? 1.057   -9.149  6.652   1.00 0.00 ? 52   PHE A CD2  6  
ATOM 9315  C CE1  . PHE B 2 15 ? 0.339   -11.802 7.177   1.00 0.00 ? 52   PHE A CE1  6  
ATOM 9316  C CE2  . PHE B 2 15 ? 0.524   -9.495  7.897   1.00 0.00 ? 52   PHE A CE2  6  
ATOM 9317  C CZ   . PHE B 2 15 ? 0.167   -10.822 8.160   1.00 0.00 ? 52   PHE A CZ   6  
ATOM 9318  H H    . PHE B 2 15 ? 0.409   -10.980 2.612   1.00 0.00 ? 52   PHE A H    6  
ATOM 9319  H HA   . PHE B 2 15 ? 0.017   -8.629  4.117   1.00 0.00 ? 52   PHE A HA   6  
ATOM 9320  H HB2  . PHE B 2 15 ? 2.166   -10.647 3.826   1.00 0.00 ? 52   PHE A HB2  6  
ATOM 9321  H HB3  . PHE B 2 15 ? 2.651   -9.084  4.478   1.00 0.00 ? 52   PHE A HB3  6  
ATOM 9322  H HD1  . PHE B 2 15 ? 1.007   -12.213 5.172   1.00 0.00 ? 52   PHE A HD1  6  
ATOM 9323  H HD2  . PHE B 2 15 ? 1.326   -8.121  6.450   1.00 0.00 ? 52   PHE A HD2  6  
ATOM 9324  H HE1  . PHE B 2 15 ? 0.062   -12.826 7.380   1.00 0.00 ? 52   PHE A HE1  6  
ATOM 9325  H HE2  . PHE B 2 15 ? 0.394   -8.737  8.656   1.00 0.00 ? 52   PHE A HE2  6  
ATOM 9326  H HZ   . PHE B 2 15 ? -0.244  -11.088 9.123   1.00 0.00 ? 52   PHE A HZ   6  
ATOM 9327  N N    . ALA B 2 16 ? 2.112   -8.359  1.586   1.00 0.00 ? 53   ALA A N    6  
ATOM 9328  C CA   . ALA B 2 16 ? 2.780   -7.386  0.733   1.00 0.00 ? 53   ALA A CA   6  
ATOM 9329  C C    . ALA B 2 16 ? 1.763   -6.435  0.116   1.00 0.00 ? 53   ALA A C    6  
ATOM 9330  O O    . ALA B 2 16 ? 2.002   -5.233  0.013   1.00 0.00 ? 53   ALA A O    6  
ATOM 9331  C CB   . ALA B 2 16 ? 3.546   -8.106  -0.375  1.00 0.00 ? 53   ALA A CB   6  
ATOM 9332  H H    . ALA B 2 16 ? 2.175   -9.313  1.373   1.00 0.00 ? 53   ALA A H    6  
ATOM 9333  H HA   . ALA B 2 16 ? 3.478   -6.816  1.328   1.00 0.00 ? 53   ALA A HA   6  
ATOM 9334  H HB1  . ALA B 2 16 ? 3.858   -9.077  -0.022  1.00 0.00 ? 53   ALA A HB1  6  
ATOM 9335  H HB2  . ALA B 2 16 ? 4.417   -7.526  -0.646  1.00 0.00 ? 53   ALA A HB2  6  
ATOM 9336  H HB3  . ALA B 2 16 ? 2.908   -8.223  -1.237  1.00 0.00 ? 53   ALA A HB3  6  
ATOM 9337  N N    . ILE B 2 17 ? 0.623   -6.976  -0.291  1.00 0.00 ? 54   ILE A N    6  
ATOM 9338  C CA   . ILE B 2 17 ? -0.418  -6.164  -0.891  1.00 0.00 ? 54   ILE A CA   6  
ATOM 9339  C C    . ILE B 2 17 ? -0.885  -5.082  0.076   1.00 0.00 ? 54   ILE A C    6  
ATOM 9340  O O    . ILE B 2 17 ? -1.142  -3.945  -0.325  1.00 0.00 ? 54   ILE A O    6  
ATOM 9341  C CB   . ILE B 2 17 ? -1.600  -7.046  -1.293  1.00 0.00 ? 54   ILE A CB   6  
ATOM 9342  C CG1  . ILE B 2 17 ? -1.195  -7.940  -2.468  1.00 0.00 ? 54   ILE A CG1  6  
ATOM 9343  C CG2  . ILE B 2 17 ? -2.769  -6.161  -1.706  1.00 0.00 ? 54   ILE A CG2  6  
ATOM 9344  C CD1  . ILE B 2 17 ? -2.288  -8.984  -2.709  1.00 0.00 ? 54   ILE A CD1  6  
ATOM 9345  H H    . ILE B 2 17 ? 0.481   -7.942  -0.188  1.00 0.00 ? 54   ILE A H    6  
ATOM 9346  H HA   . ILE B 2 17 ? -0.027  -5.690  -1.772  1.00 0.00 ? 54   ILE A HA   6  
ATOM 9347  H HB   . ILE B 2 17 ? -1.889  -7.659  -0.452  1.00 0.00 ? 54   ILE A HB   6  
ATOM 9348  H HG12 . ILE B 2 17 ? -1.069  -7.336  -3.354  1.00 0.00 ? 54   ILE A HG12 6  
ATOM 9349  H HG13 . ILE B 2 17 ? -0.267  -8.439  -2.237  1.00 0.00 ? 54   ILE A HG13 6  
ATOM 9350  H HG21 . ILE B 2 17 ? -3.537  -6.765  -2.161  1.00 0.00 ? 54   ILE A HG21 6  
ATOM 9351  H HG22 . ILE B 2 17 ? -2.425  -5.422  -2.414  1.00 0.00 ? 54   ILE A HG22 6  
ATOM 9352  H HG23 . ILE B 2 17 ? -3.171  -5.664  -0.835  1.00 0.00 ? 54   ILE A HG23 6  
ATOM 9353  H HD11 . ILE B 2 17 ? -2.535  -9.467  -1.776  1.00 0.00 ? 54   ILE A HD11 6  
ATOM 9354  H HD12 . ILE B 2 17 ? -1.934  -9.721  -3.414  1.00 0.00 ? 54   ILE A HD12 6  
ATOM 9355  H HD13 . ILE B 2 17 ? -3.167  -8.495  -3.105  1.00 0.00 ? 54   ILE A HD13 6  
ATOM 9356  N N    . LEU B 2 18 ? -1.010  -5.443  1.343   1.00 0.00 ? 55   LEU A N    6  
ATOM 9357  C CA   . LEU B 2 18 ? -1.465  -4.497  2.351   1.00 0.00 ? 55   LEU A CA   6  
ATOM 9358  C C    . LEU B 2 18 ? -0.307  -3.993  3.209   1.00 0.00 ? 55   LEU A C    6  
ATOM 9359  O O    . LEU B 2 18 ? -0.504  -3.610  4.363   1.00 0.00 ? 55   LEU A O    6  
ATOM 9360  C CB   . LEU B 2 18 ? -2.519  -5.163  3.232   1.00 0.00 ? 55   LEU A CB   6  
ATOM 9361  C CG   . LEU B 2 18 ? -3.690  -5.627  2.358   1.00 0.00 ? 55   LEU A CG   6  
ATOM 9362  C CD1  . LEU B 2 18 ? -4.687  -6.407  3.211   1.00 0.00 ? 55   LEU A CD1  6  
ATOM 9363  C CD2  . LEU B 2 18 ? -4.395  -4.411  1.749   1.00 0.00 ? 55   LEU A CD2  6  
ATOM 9364  H H    . LEU B 2 18 ? -0.805  -6.364  1.605   1.00 0.00 ? 55   LEU A H    6  
ATOM 9365  H HA   . LEU B 2 18 ? -1.914  -3.652  1.854   1.00 0.00 ? 55   LEU A HA   6  
ATOM 9366  H HB2  . LEU B 2 18 ? -2.080  -6.016  3.732   1.00 0.00 ? 55   LEU A HB2  6  
ATOM 9367  H HB3  . LEU B 2 18 ? -2.877  -4.459  3.967   1.00 0.00 ? 55   LEU A HB3  6  
ATOM 9368  H HG   . LEU B 2 18 ? -3.318  -6.262  1.569   1.00 0.00 ? 55   LEU A HG   6  
ATOM 9369  H HD11 . LEU B 2 18 ? -4.428  -7.455  3.200   1.00 0.00 ? 55   LEU A HD11 6  
ATOM 9370  H HD12 . LEU B 2 18 ? -5.682  -6.279  2.807   1.00 0.00 ? 55   LEU A HD12 6  
ATOM 9371  H HD13 . LEU B 2 18 ? -4.661  -6.038  4.226   1.00 0.00 ? 55   LEU A HD13 6  
ATOM 9372  H HD21 . LEU B 2 18 ? -5.450  -4.451  1.984   1.00 0.00 ? 55   LEU A HD21 6  
ATOM 9373  H HD22 . LEU B 2 18 ? -4.266  -4.419  0.677   1.00 0.00 ? 55   LEU A HD22 6  
ATOM 9374  H HD23 . LEU B 2 18 ? -3.972  -3.505  2.156   1.00 0.00 ? 55   LEU A HD23 6  
ATOM 9375  N N    . ASP B 2 19 ? 0.901   -3.992  2.650   1.00 0.00 ? 56   ASP A N    6  
ATOM 9376  C CA   . ASP B 2 19 ? 2.065   -3.518  3.394   1.00 0.00 ? 56   ASP A CA   6  
ATOM 9377  C C    . ASP B 2 19 ? 3.105   -2.942  2.444   1.00 0.00 ? 56   ASP A C    6  
ATOM 9378  O O    . ASP B 2 19 ? 3.420   -1.754  2.493   1.00 0.00 ? 56   ASP A O    6  
ATOM 9379  C CB   . ASP B 2 19 ? 2.682   -4.674  4.179   1.00 0.00 ? 56   ASP A CB   6  
ATOM 9380  C CG   . ASP B 2 19 ? 3.825   -4.166  5.049   1.00 0.00 ? 56   ASP A CG   6  
ATOM 9381  O OD1  . ASP B 2 19 ? 3.555   -3.406  5.964   1.00 0.00 ? 56   ASP A OD1  6  
ATOM 9382  O OD2  . ASP B 2 19 ? 4.955   -4.547  4.790   1.00 0.00 ? 56   ASP A OD2  6  
ATOM 9383  H H    . ASP B 2 19 ? 1.011   -4.306  1.724   1.00 0.00 ? 56   ASP A H    6  
ATOM 9384  H HA   . ASP B 2 19 ? 1.754   -2.750  4.085   1.00 0.00 ? 56   ASP A HA   6  
ATOM 9385  H HB2  . ASP B 2 19 ? 1.927   -5.124  4.805   1.00 0.00 ? 56   ASP A HB2  6  
ATOM 9386  H HB3  . ASP B 2 19 ? 3.063   -5.411  3.487   1.00 0.00 ? 56   ASP A HB3  6  
ATOM 9387  N N    . GLY B 2 20 ? 3.622   -3.786  1.567   1.00 0.00 ? 57   GLY A N    6  
ATOM 9388  C CA   . GLY B 2 20 ? 4.616   -3.340  0.602   1.00 0.00 ? 57   GLY A CA   6  
ATOM 9389  C C    . GLY B 2 20 ? 3.956   -2.701  -0.622  1.00 0.00 ? 57   GLY A C    6  
ATOM 9390  O O    . GLY B 2 20 ? 4.640   -2.169  -1.495  1.00 0.00 ? 57   GLY A O    6  
ATOM 9391  H H    . GLY B 2 20 ? 3.322   -4.722  1.563   1.00 0.00 ? 57   GLY A H    6  
ATOM 9392  H HA2  . GLY B 2 20 ? 5.265   -2.617  1.076   1.00 0.00 ? 57   GLY A HA2  6  
ATOM 9393  H HA3  . GLY B 2 20 ? 5.204   -4.187  0.283   1.00 0.00 ? 57   GLY A HA3  6  
ATOM 9394  N N    . GLY B 2 21 ? 2.623   -2.761  -0.684  1.00 0.00 ? 58   GLY A N    6  
ATOM 9395  C CA   . GLY B 2 21 ? 1.892   -2.193  -1.811  1.00 0.00 ? 58   GLY A CA   6  
ATOM 9396  C C    . GLY B 2 21 ? 2.098   -3.036  -3.066  1.00 0.00 ? 58   GLY A C    6  
ATOM 9397  O O    . GLY B 2 21 ? 1.905   -2.557  -4.184  1.00 0.00 ? 58   GLY A O    6  
ATOM 9398  H H    . GLY B 2 21 ? 2.125   -3.202  0.033   1.00 0.00 ? 58   GLY A H    6  
ATOM 9399  H HA2  . GLY B 2 21 ? 0.838   -2.159  -1.571  1.00 0.00 ? 58   GLY A HA2  6  
ATOM 9400  H HA3  . GLY B 2 21 ? 2.247   -1.190  -1.996  1.00 0.00 ? 58   GLY A HA3  6  
ATOM 9401  N N    . ALA B 2 22 ? 2.496   -4.290  -2.876  1.00 0.00 ? 59   ALA A N    6  
ATOM 9402  C CA   . ALA B 2 22 ? 2.733   -5.186  -4.002  1.00 0.00 ? 59   ALA A CA   6  
ATOM 9403  C C    . ALA B 2 22 ? 1.422   -5.665  -4.615  1.00 0.00 ? 59   ALA A C    6  
ATOM 9404  O O    . ALA B 2 22 ? 0.374   -5.622  -3.977  1.00 0.00 ? 59   ALA A O    6  
ATOM 9405  C CB   . ALA B 2 22 ? 3.535   -6.400  -3.544  1.00 0.00 ? 59   ALA A CB   6  
ATOM 9406  H H    . ALA B 2 22 ? 2.639   -4.619  -1.961  1.00 0.00 ? 59   ALA A H    6  
ATOM 9407  H HA   . ALA B 2 22 ? 3.304   -4.655  -4.747  1.00 0.00 ? 59   ALA A HA   6  
ATOM 9408  H HB1  . ALA B 2 22 ? 3.370   -6.561  -2.490  1.00 0.00 ? 59   ALA A HB1  6  
ATOM 9409  H HB2  . ALA B 2 22 ? 4.587   -6.227  -3.726  1.00 0.00 ? 59   ALA A HB2  6  
ATOM 9410  H HB3  . ALA B 2 22 ? 3.210   -7.268  -4.096  1.00 0.00 ? 59   ALA A HB3  6  
ATOM 9411  N N    . PRO B 2 23 ? 1.460   -6.125  -5.835  1.00 0.00 ? 60   PRO A N    6  
ATOM 9412  C CA   . PRO B 2 23 ? 0.246   -6.628  -6.535  1.00 0.00 ? 60   PRO A CA   6  
ATOM 9413  C C    . PRO B 2 23 ? -0.243  -7.954  -5.956  1.00 0.00 ? 60   PRO A C    6  
ATOM 9414  O O    . PRO B 2 23 ? -1.421  -8.292  -6.063  1.00 0.00 ? 60   PRO A O    6  
ATOM 9415  C CB   . PRO B 2 23 ? 0.703   -6.792  -7.985  1.00 0.00 ? 60   PRO A CB   6  
ATOM 9416  C CG   . PRO B 2 23 ? 2.180   -6.995  -7.911  1.00 0.00 ? 60   PRO A CG   6  
ATOM 9417  C CD   . PRO B 2 23 ? 2.661   -6.221  -6.683  1.00 0.00 ? 60   PRO A CD   6  
ATOM 9418  H HA   . PRO B 2 23 ? -0.538  -5.893  -6.482  1.00 0.00 ? 60   PRO A HA   6  
ATOM 9419  H HB2  . PRO B 2 23 ? 0.226   -7.655  -8.431  1.00 0.00 ? 60   PRO A HB2  6  
ATOM 9420  H HB3  . PRO B 2 23 ? 0.479   -5.903  -8.552  1.00 0.00 ? 60   PRO A HB3  6  
ATOM 9421  H HG2  . PRO B 2 23 ? 2.405   -8.047  -7.802  1.00 0.00 ? 60   PRO A HG2  6  
ATOM 9422  H HG3  . PRO B 2 23 ? 2.655   -6.599  -8.795  1.00 0.00 ? 60   PRO A HG3  6  
ATOM 9423  H HD2  . PRO B 2 23 ? 3.444   -6.770  -6.175  1.00 0.00 ? 60   PRO A HD2  6  
ATOM 9424  H HD3  . PRO B 2 23 ? 3.002   -5.236  -6.960  1.00 0.00 ? 60   PRO A HD3  6  
ATOM 9425  N N    . GLY B 2 24 ? 0.673   -8.700  -5.347  1.00 0.00 ? 61   GLY A N    6  
ATOM 9426  C CA   . GLY B 2 24 ? 0.325   -9.988  -4.756  1.00 0.00 ? 61   GLY A CA   6  
ATOM 9427  C C    . GLY B 2 24 ? 1.250   -11.086 -5.268  1.00 0.00 ? 61   GLY A C    6  
ATOM 9428  O O    . GLY B 2 24 ? 2.313   -11.254 -4.693  1.00 0.00 ? 61   GLY A O    6  
ATOM 9429  O OXT  . GLY B 2 24 ? 0.883   -11.744 -6.228  1.00 0.00 ? 61   GLY A OXT  6  
ATOM 9430  H H    . GLY B 2 24 ? 1.598   -8.380  -5.294  1.00 0.00 ? 61   GLY A H    6  
ATOM 9431  H HA2  . GLY B 2 24 ? 0.411   -9.920  -3.681  1.00 0.00 ? 61   GLY A HA2  6  
ATOM 9432  H HA3  . GLY B 2 24 ? -0.693  -10.235 -5.018  1.00 0.00 ? 61   GLY A HA3  6  
ATOM 9433  N N    . ARG A 1 6  ? 2.493   -13.169 10.901  1.00 0.00 ? 1050 ARG B N    7  
ATOM 9434  C CA   . ARG A 1 6  ? 1.508   -12.194 11.452  1.00 0.00 ? 1050 ARG B CA   7  
ATOM 9435  C C    . ARG A 1 6  ? 2.197   -11.307 12.482  1.00 0.00 ? 1050 ARG B C    7  
ATOM 9436  O O    . ARG A 1 6  ? 1.979   -11.449 13.685  1.00 0.00 ? 1050 ARG B O    7  
ATOM 9437  C CB   . ARG A 1 6  ? 0.359   -12.957 12.110  1.00 0.00 ? 1050 ARG B CB   7  
ATOM 9438  C CG   . ARG A 1 6  ? -0.775  -13.130 11.103  1.00 0.00 ? 1050 ARG B CG   7  
ATOM 9439  C CD   . ARG A 1 6  ? -0.316  -14.040 9.965   1.00 0.00 ? 1050 ARG B CD   7  
ATOM 9440  N NE   . ARG A 1 6  ? -1.410  -14.255 9.025   1.00 0.00 ? 1050 ARG B NE   7  
ATOM 9441  C CZ   . ARG A 1 6  ? -2.381  -15.141 9.264   1.00 0.00 ? 1050 ARG B CZ   7  
ATOM 9442  N NH1  . ARG A 1 6  ? -2.389  -15.851 10.365  1.00 0.00 ? 1050 ARG B NH1  7  
ATOM 9443  N NH2  . ARG A 1 6  ? -3.338  -15.298 8.394   1.00 0.00 ? 1050 ARG B NH2  7  
ATOM 9444  H H    . ARG A 1 6  ? 2.693   -12.935 9.907   1.00 0.00 ? 1050 ARG B H    7  
ATOM 9445  H HA   . ARG A 1 6  ? 1.123   -11.581 10.650  1.00 0.00 ? 1050 ARG B HA   7  
ATOM 9446  H HB2  . ARG A 1 6  ? 0.710   -13.928 12.430  1.00 0.00 ? 1050 ARG B HB2  7  
ATOM 9447  H HB3  . ARG A 1 6  ? 0.001   -12.403 12.964  1.00 0.00 ? 1050 ARG B HB3  7  
ATOM 9448  H HG2  . ARG A 1 6  ? -1.629  -13.571 11.596  1.00 0.00 ? 1050 ARG B HG2  7  
ATOM 9449  H HG3  . ARG A 1 6  ? -1.049  -12.165 10.703  1.00 0.00 ? 1050 ARG B HG3  7  
ATOM 9450  H HD2  . ARG A 1 6  ? 0.511   -13.576 9.448   1.00 0.00 ? 1050 ARG B HD2  7  
ATOM 9451  H HD3  . ARG A 1 6  ? 0.005   -14.987 10.371  1.00 0.00 ? 1050 ARG B HD3  7  
ATOM 9452  H HE   . ARG A 1 6  ? -1.433  -13.734 8.194   1.00 0.00 ? 1050 ARG B HE   7  
ATOM 9453  H HH11 . ARG A 1 6  ? -1.669  -15.741 11.043  1.00 0.00 ? 1050 ARG B HH11 7  
ATOM 9454  H HH12 . ARG A 1 6  ? -3.124  -16.510 10.525  1.00 0.00 ? 1050 ARG B HH12 7  
ATOM 9455  H HH21 . ARG A 1 6  ? -3.343  -14.757 7.552   1.00 0.00 ? 1050 ARG B HH21 7  
ATOM 9456  H HH22 . ARG A 1 6  ? -4.068  -15.960 8.567   1.00 0.00 ? 1050 ARG B HH22 7  
ATOM 9457  N N    . PRO A 1 7  ? 3.028   -10.406 12.031  1.00 0.00 ? 1051 PRO B N    7  
ATOM 9458  C CA   . PRO A 1 7  ? 3.781   -9.478  12.932  1.00 0.00 ? 1051 PRO B CA   7  
ATOM 9459  C C    . PRO A 1 7  ? 2.851   -8.643  13.806  1.00 0.00 ? 1051 PRO B C    7  
ATOM 9460  O O    . PRO A 1 7  ? 3.091   -8.470  15.000  1.00 0.00 ? 1051 PRO B O    7  
ATOM 9461  C CB   . PRO A 1 7  ? 4.556   -8.581  11.956  1.00 0.00 ? 1051 PRO B CB   7  
ATOM 9462  C CG   . PRO A 1 7  ? 4.637   -9.366  10.689  1.00 0.00 ? 1051 PRO B CG   7  
ATOM 9463  C CD   . PRO A 1 7  ? 3.342   -10.164 10.616  1.00 0.00 ? 1051 PRO B CD   7  
ATOM 9464  H HA   . PRO A 1 7  ? 4.474   -10.028 13.543  1.00 0.00 ? 1051 PRO B HA   7  
ATOM 9465  H HB2  . PRO A 1 7  ? 4.026   -7.654  11.795  1.00 0.00 ? 1051 PRO B HB2  7  
ATOM 9466  H HB3  . PRO A 1 7  ? 5.548   -8.388  12.333  1.00 0.00 ? 1051 PRO B HB3  7  
ATOM 9467  H HG2  . PRO A 1 7  ? 4.717   -8.696  9.843   1.00 0.00 ? 1051 PRO B HG2  7  
ATOM 9468  H HG3  . PRO A 1 7  ? 5.480   -10.038 10.716  1.00 0.00 ? 1051 PRO B HG3  7  
ATOM 9469  H HD2  . PRO A 1 7  ? 2.561   -9.581  10.141  1.00 0.00 ? 1051 PRO B HD2  7  
ATOM 9470  H HD3  . PRO A 1 7  ? 3.497   -11.098 10.102  1.00 0.00 ? 1051 PRO B HD3  7  
ATOM 9471  N N    . LYS A 1 8  ? 1.785   -8.133  13.197  1.00 0.00 ? 1052 LYS B N    7  
ATOM 9472  C CA   . LYS A 1 8  ? 0.816   -7.319  13.919  1.00 0.00 ? 1052 LYS B CA   7  
ATOM 9473  C C    . LYS A 1 8  ? -0.582  -7.916  13.800  1.00 0.00 ? 1052 LYS B C    7  
ATOM 9474  O O    . LYS A 1 8  ? -1.175  -8.342  14.792  1.00 0.00 ? 1052 LYS B O    7  
ATOM 9475  C CB   . LYS A 1 8  ? 0.810   -5.893  13.354  1.00 0.00 ? 1052 LYS B CB   7  
ATOM 9476  C CG   . LYS A 1 8  ? 2.235   -5.330  13.329  1.00 0.00 ? 1052 LYS B CG   7  
ATOM 9477  C CD   . LYS A 1 8  ? 2.773   -5.225  14.756  1.00 0.00 ? 1052 LYS B CD   7  
ATOM 9478  C CE   . LYS A 1 8  ? 4.168   -4.599  14.736  1.00 0.00 ? 1052 LYS B CE   7  
ATOM 9479  N NZ   . LYS A 1 8  ? 4.687   -4.494  16.131  1.00 0.00 ? 1052 LYS B NZ   7  
ATOM 9480  H H    . LYS A 1 8  ? 1.648   -8.308  12.247  1.00 0.00 ? 1052 LYS B H    7  
ATOM 9481  H HA   . LYS A 1 8  ? 1.090   -7.283  14.959  1.00 0.00 ? 1052 LYS B HA   7  
ATOM 9482  H HB2  . LYS A 1 8  ? 0.411   -5.906  12.351  1.00 0.00 ? 1052 LYS B HB2  7  
ATOM 9483  H HB3  . LYS A 1 8  ? 0.190   -5.264  13.977  1.00 0.00 ? 1052 LYS B HB3  7  
ATOM 9484  H HG2  . LYS A 1 8  ? 2.869   -5.986  12.751  1.00 0.00 ? 1052 LYS B HG2  7  
ATOM 9485  H HG3  . LYS A 1 8  ? 2.227   -4.349  12.876  1.00 0.00 ? 1052 LYS B HG3  7  
ATOM 9486  H HD2  . LYS A 1 8  ? 2.108   -4.612  15.347  1.00 0.00 ? 1052 LYS B HD2  7  
ATOM 9487  H HD3  . LYS A 1 8  ? 2.832   -6.210  15.188  1.00 0.00 ? 1052 LYS B HD3  7  
ATOM 9488  H HE2  . LYS A 1 8  ? 4.833   -5.220  14.152  1.00 0.00 ? 1052 LYS B HE2  7  
ATOM 9489  H HE3  . LYS A 1 8  ? 4.116   -3.615  14.296  1.00 0.00 ? 1052 LYS B HE3  7  
ATOM 9490  H HZ1  . LYS A 1 8  ? 3.920   -4.189  16.764  1.00 0.00 ? 1052 LYS B HZ1  7  
ATOM 9491  H HZ2  . LYS A 1 8  ? 5.460   -3.799  16.160  1.00 0.00 ? 1052 LYS B HZ2  7  
ATOM 9492  H HZ3  . LYS A 1 8  ? 5.039   -5.422  16.441  1.00 0.00 ? 1052 LYS B HZ3  7  
ATOM 9493  N N    . MET A 1 9  ? -1.109  -7.936  12.580  1.00 0.00 ? 1053 MET B N    7  
ATOM 9494  C CA   . MET A 1 9  ? -2.443  -8.477  12.348  1.00 0.00 ? 1053 MET B CA   7  
ATOM 9495  C C    . MET A 1 9  ? -2.483  -9.245  11.030  1.00 0.00 ? 1053 MET B C    7  
ATOM 9496  O O    . MET A 1 9  ? -1.595  -9.102  10.192  1.00 0.00 ? 1053 MET B O    7  
ATOM 9497  C CB   . MET A 1 9  ? -3.473  -7.348  12.299  1.00 0.00 ? 1053 MET B CB   7  
ATOM 9498  C CG   . MET A 1 9  ? -3.113  -6.262  13.317  1.00 0.00 ? 1053 MET B CG   7  
ATOM 9499  S SD   . MET A 1 9  ? -4.400  -4.988  13.304  1.00 0.00 ? 1053 MET B SD   7  
ATOM 9500  C CE   . MET A 1 9  ? -4.115  -4.404  11.613  1.00 0.00 ? 1053 MET B CE   7  
ATOM 9501  H H    . MET A 1 9  ? -0.596  -7.577  11.828  1.00 0.00 ? 1053 MET B H    7  
ATOM 9502  H HA   . MET A 1 9  ? -2.697  -9.149  13.153  1.00 0.00 ? 1053 MET B HA   7  
ATOM 9503  H HB2  . MET A 1 9  ? -3.491  -6.927  11.307  1.00 0.00 ? 1053 MET B HB2  7  
ATOM 9504  H HB3  . MET A 1 9  ? -4.448  -7.747  12.537  1.00 0.00 ? 1053 MET B HB3  7  
ATOM 9505  H HG2  . MET A 1 9  ? -3.044  -6.695  14.305  1.00 0.00 ? 1053 MET B HG2  7  
ATOM 9506  H HG3  . MET A 1 9  ? -2.167  -5.815  13.050  1.00 0.00 ? 1053 MET B HG3  7  
ATOM 9507  H HE1  . MET A 1 9  ? -4.972  -4.654  10.995  1.00 0.00 ? 1053 MET B HE1  7  
ATOM 9508  H HE2  . MET A 1 9  ? -3.232  -4.876  11.214  1.00 0.00 ? 1053 MET B HE2  7  
ATOM 9509  H HE3  . MET A 1 9  ? -3.973  -3.333  11.623  1.00 0.00 ? 1053 MET B HE3  7  
ATOM 9510  N N    . THR A 1 10 ? -3.520  -10.056 10.854  1.00 0.00 ? 1054 THR B N    7  
ATOM 9511  C CA   . THR A 1 10 ? -3.670  -10.838 9.630   1.00 0.00 ? 1054 THR B CA   7  
ATOM 9512  C C    . THR A 1 10 ? -4.001  -9.924  8.451   1.00 0.00 ? 1054 THR B C    7  
ATOM 9513  O O    . THR A 1 10 ? -4.403  -8.775  8.642   1.00 0.00 ? 1054 THR B O    7  
ATOM 9514  C CB   . THR A 1 10 ? -4.783  -11.874 9.810   1.00 0.00 ? 1054 THR B CB   7  
ATOM 9515  O OG1  . THR A 1 10 ? -6.033  -11.212 9.883   1.00 0.00 ? 1054 THR B OG1  7  
ATOM 9516  C CG2  . THR A 1 10 ? -4.548  -12.660 11.098  1.00 0.00 ? 1054 THR B CG2  7  
ATOM 9517  H H    . THR A 1 10 ? -4.199  -10.129 11.558  1.00 0.00 ? 1054 THR B H    7  
ATOM 9518  H HA   . THR A 1 10 ? -2.745  -11.349 9.426   1.00 0.00 ? 1054 THR B HA   7  
ATOM 9519  H HB   . THR A 1 10 ? -4.787  -12.552 8.978   1.00 0.00 ? 1054 THR B HB   7  
ATOM 9520  H HG1  . THR A 1 10 ? -5.867  -10.270 9.959   1.00 0.00 ? 1054 THR B HG1  7  
ATOM 9521  H HG21 . THR A 1 10 ? -3.497  -12.642 11.344  1.00 0.00 ? 1054 THR B HG21 7  
ATOM 9522  H HG22 . THR A 1 10 ? -4.869  -13.681 10.961  1.00 0.00 ? 1054 THR B HG22 7  
ATOM 9523  H HG23 . THR A 1 10 ? -5.112  -12.211 11.901  1.00 0.00 ? 1054 THR B HG23 7  
ATOM 9524  N N    . PRO A 1 11 ? -3.827  -10.401 7.243   1.00 0.00 ? 1055 PRO B N    7  
ATOM 9525  C CA   . PRO A 1 11 ? -4.110  -9.591  6.018   1.00 0.00 ? 1055 PRO B CA   7  
ATOM 9526  C C    . PRO A 1 11 ? -5.520  -9.000  6.044   1.00 0.00 ? 1055 PRO B C    7  
ATOM 9527  O O    . PRO A 1 11 ? -5.724  -7.836  5.688   1.00 0.00 ? 1055 PRO B O    7  
ATOM 9528  C CB   . PRO A 1 11 ? -3.977  -10.614 4.885   1.00 0.00 ? 1055 PRO B CB   7  
ATOM 9529  C CG   . PRO A 1 11 ? -3.063  -11.668 5.412   1.00 0.00 ? 1055 PRO B CG   7  
ATOM 9530  C CD   . PRO A 1 11 ? -3.337  -11.751 6.909   1.00 0.00 ? 1055 PRO B CD   7  
ATOM 9531  H HA   . PRO A 1 11 ? -3.373  -8.812  5.898   1.00 0.00 ? 1055 PRO B HA   7  
ATOM 9532  H HB2  . PRO A 1 11 ? -4.945  -11.035 4.649   1.00 0.00 ? 1055 PRO B HB2  7  
ATOM 9533  H HB3  . PRO A 1 11 ? -3.544  -10.152 4.011   1.00 0.00 ? 1055 PRO B HB3  7  
ATOM 9534  H HG2  . PRO A 1 11 ? -3.284  -12.616 4.938   1.00 0.00 ? 1055 PRO B HG2  7  
ATOM 9535  H HG3  . PRO A 1 11 ? -2.034  -11.393 5.242   1.00 0.00 ? 1055 PRO B HG3  7  
ATOM 9536  H HD2  . PRO A 1 11 ? -4.092  -12.495 7.106   1.00 0.00 ? 1055 PRO B HD2  7  
ATOM 9537  H HD3  . PRO A 1 11 ? -2.430  -11.968 7.452   1.00 0.00 ? 1055 PRO B HD3  7  
ATOM 9538  N N    . GLU A 1 12 ? -6.485  -9.804  6.477   1.00 0.00 ? 1056 GLU B N    7  
ATOM 9539  C CA   . GLU A 1 12 ? -7.866  -9.343  6.550   1.00 0.00 ? 1056 GLU B CA   7  
ATOM 9540  C C    . GLU A 1 12 ? -7.997  -8.237  7.588   1.00 0.00 ? 1056 GLU B C    7  
ATOM 9541  O O    . GLU A 1 12 ? -8.702  -7.251  7.374   1.00 0.00 ? 1056 GLU B O    7  
ATOM 9542  C CB   . GLU A 1 12 ? -8.793  -10.505 6.914   1.00 0.00 ? 1056 GLU B CB   7  
ATOM 9543  C CG   . GLU A 1 12 ? -8.869  -11.486 5.742   1.00 0.00 ? 1056 GLU B CG   7  
ATOM 9544  C CD   . GLU A 1 12 ? -9.676  -12.716 6.143   1.00 0.00 ? 1056 GLU B CD   7  
ATOM 9545  O OE1  . GLU A 1 12 ? -9.955  -12.857 7.322   1.00 0.00 ? 1056 GLU B OE1  7  
ATOM 9546  O OE2  . GLU A 1 12 ? -10.003 -13.498 5.265   1.00 0.00 ? 1056 GLU B OE2  7  
ATOM 9547  H H    . GLU A 1 12 ? -6.266  -10.717 6.754   1.00 0.00 ? 1056 GLU B H    7  
ATOM 9548  H HA   . GLU A 1 12 ? -8.157  -8.954  5.586   1.00 0.00 ? 1056 GLU B HA   7  
ATOM 9549  H HB2  . GLU A 1 12 ? -8.410  -11.013 7.787   1.00 0.00 ? 1056 GLU B HB2  7  
ATOM 9550  H HB3  . GLU A 1 12 ? -9.783  -10.124 7.125   1.00 0.00 ? 1056 GLU B HB3  7  
ATOM 9551  H HG2  . GLU A 1 12 ? -9.345  -11.003 4.900   1.00 0.00 ? 1056 GLU B HG2  7  
ATOM 9552  H HG3  . GLU A 1 12 ? -7.871  -11.788 5.463   1.00 0.00 ? 1056 GLU B HG3  7  
ATOM 9553  N N    . GLN A 1 13 ? -7.308  -8.403  8.714   1.00 0.00 ? 1057 GLN B N    7  
ATOM 9554  C CA   . GLN A 1 13 ? -7.354  -7.407  9.772   1.00 0.00 ? 1057 GLN B CA   7  
ATOM 9555  C C    . GLN A 1 13 ? -6.765  -6.085  9.302   1.00 0.00 ? 1057 GLN B C    7  
ATOM 9556  O O    . GLN A 1 13 ? -7.297  -5.018  9.606   1.00 0.00 ? 1057 GLN B O    7  
ATOM 9557  C CB   . GLN A 1 13 ? -6.584  -7.896  10.997  1.00 0.00 ? 1057 GLN B CB   7  
ATOM 9558  C CG   . GLN A 1 13 ? -7.382  -8.998  11.686  1.00 0.00 ? 1057 GLN B CG   7  
ATOM 9559  C CD   . GLN A 1 13 ? -6.675  -9.423  12.968  1.00 0.00 ? 1057 GLN B CD   7  
ATOM 9560  O OE1  . GLN A 1 13 ? -6.197  -10.552 13.073  1.00 0.00 ? 1057 GLN B OE1  7  
ATOM 9561  N NE2  . GLN A 1 13 ? -6.566  -8.570  13.950  1.00 0.00 ? 1057 GLN B NE2  7  
ATOM 9562  H H    . GLN A 1 13 ? -6.757  -9.207  8.826   1.00 0.00 ? 1057 GLN B H    7  
ATOM 9563  H HA   . GLN A 1 13 ? -8.384  -7.246  10.053  1.00 0.00 ? 1057 GLN B HA   7  
ATOM 9564  H HB2  . GLN A 1 13 ? -5.625  -8.286  10.685  1.00 0.00 ? 1057 GLN B HB2  7  
ATOM 9565  H HB3  . GLN A 1 13 ? -6.436  -7.077  11.684  1.00 0.00 ? 1057 GLN B HB3  7  
ATOM 9566  H HG2  . GLN A 1 13 ? -8.367  -8.629  11.923  1.00 0.00 ? 1057 GLN B HG2  7  
ATOM 9567  H HG3  . GLN A 1 13 ? -7.466  -9.844  11.025  1.00 0.00 ? 1057 GLN B HG3  7  
ATOM 9568  H HE21 . GLN A 1 13 ? -6.936  -7.665  13.858  1.00 0.00 ? 1057 GLN B HE21 7  
ATOM 9569  H HE22 . GLN A 1 13 ? -6.116  -8.833  14.781  1.00 0.00 ? 1057 GLN B HE22 7  
ATOM 9570  N N    . MET A 1 14 ? -5.665  -6.157  8.564   1.00 0.00 ? 1058 MET B N    7  
ATOM 9571  C CA   . MET A 1 14 ? -5.031  -4.947  8.071   1.00 0.00 ? 1058 MET B CA   7  
ATOM 9572  C C    . MET A 1 14 ? -5.970  -4.206  7.129   1.00 0.00 ? 1058 MET B C    7  
ATOM 9573  O O    . MET A 1 14 ? -6.074  -2.980  7.175   1.00 0.00 ? 1058 MET B O    7  
ATOM 9574  C CB   . MET A 1 14 ? -3.726  -5.284  7.344   1.00 0.00 ? 1058 MET B CB   7  
ATOM 9575  C CG   . MET A 1 14 ? -2.688  -5.770  8.358   1.00 0.00 ? 1058 MET B CG   7  
ATOM 9576  S SD   . MET A 1 14 ? -1.035  -5.723  7.618   1.00 0.00 ? 1058 MET B SD   7  
ATOM 9577  C CE   . MET A 1 14 ? -1.258  -7.051  6.415   1.00 0.00 ? 1058 MET B CE   7  
ATOM 9578  H H    . MET A 1 14 ? -5.277  -7.031  8.348   1.00 0.00 ? 1058 MET B H    7  
ATOM 9579  H HA   . MET A 1 14 ? -4.805  -4.306  8.912   1.00 0.00 ? 1058 MET B HA   7  
ATOM 9580  H HB2  . MET A 1 14 ? -3.916  -6.064  6.622   1.00 0.00 ? 1058 MET B HB2  7  
ATOM 9581  H HB3  . MET A 1 14 ? -3.354  -4.408  6.839   1.00 0.00 ? 1058 MET B HB3  7  
ATOM 9582  H HG2  . MET A 1 14 ? -2.712  -5.132  9.228   1.00 0.00 ? 1058 MET B HG2  7  
ATOM 9583  H HG3  . MET A 1 14 ? -2.920  -6.783  8.651   1.00 0.00 ? 1058 MET B HG3  7  
ATOM 9584  H HE1  . MET A 1 14 ? -2.159  -6.870  5.848   1.00 0.00 ? 1058 MET B HE1  7  
ATOM 9585  H HE2  . MET A 1 14 ? -1.342  -7.994  6.931   1.00 0.00 ? 1058 MET B HE2  7  
ATOM 9586  H HE3  . MET A 1 14 ? -0.404  -7.074  5.749   1.00 0.00 ? 1058 MET B HE3  7  
ATOM 9587  N N    . ALA A 1 15 ? -6.658  -4.957  6.280   1.00 0.00 ? 1059 ALA B N    7  
ATOM 9588  C CA   . ALA A 1 15 ? -7.590  -4.351  5.339   1.00 0.00 ? 1059 ALA B CA   7  
ATOM 9589  C C    . ALA A 1 15 ? -8.733  -3.664  6.076   1.00 0.00 ? 1059 ALA B C    7  
ATOM 9590  O O    . ALA A 1 15 ? -9.164  -2.575  5.697   1.00 0.00 ? 1059 ALA B O    7  
ATOM 9591  C CB   . ALA A 1 15 ? -8.153  -5.412  4.400   1.00 0.00 ? 1059 ALA B CB   7  
ATOM 9592  H H    . ALA A 1 15 ? -6.542  -5.934  6.291   1.00 0.00 ? 1059 ALA B H    7  
ATOM 9593  H HA   . ALA A 1 15 ? -7.061  -3.616  4.755   1.00 0.00 ? 1059 ALA B HA   7  
ATOM 9594  H HB1  . ALA A 1 15 ? -9.231  -5.359  4.406   1.00 0.00 ? 1059 ALA B HB1  7  
ATOM 9595  H HB2  . ALA A 1 15 ? -7.837  -6.390  4.731   1.00 0.00 ? 1059 ALA B HB2  7  
ATOM 9596  H HB3  . ALA A 1 15 ? -7.789  -5.234  3.399   1.00 0.00 ? 1059 ALA B HB3  7  
ATOM 9597  N N    . LYS A 1 16 ? -9.221  -4.311  7.129   1.00 0.00 ? 1060 LYS B N    7  
ATOM 9598  C CA   . LYS A 1 16 ? -10.318 -3.753  7.910   1.00 0.00 ? 1060 LYS B CA   7  
ATOM 9599  C C    . LYS A 1 16 ? -9.903  -2.435  8.548   1.00 0.00 ? 1060 LYS B C    7  
ATOM 9600  O O    . LYS A 1 16 ? -10.676 -1.478  8.572   1.00 0.00 ? 1060 LYS B O    7  
ATOM 9601  C CB   . LYS A 1 16 ? -10.734 -4.742  9.002   1.00 0.00 ? 1060 LYS B CB   7  
ATOM 9602  C CG   . LYS A 1 16 ? -11.433 -5.946  8.368   1.00 0.00 ? 1060 LYS B CG   7  
ATOM 9603  C CD   . LYS A 1 16 ? -11.675 -7.019  9.433   1.00 0.00 ? 1060 LYS B CD   7  
ATOM 9604  C CE   . LYS A 1 16 ? -12.700 -6.512  10.446  1.00 0.00 ? 1060 LYS B CE   7  
ATOM 9605  N NZ   . LYS A 1 16 ? -13.029 -7.598  11.410  1.00 0.00 ? 1060 LYS B NZ   7  
ATOM 9606  H H    . LYS A 1 16 ? -8.842  -5.178  7.382   1.00 0.00 ? 1060 LYS B H    7  
ATOM 9607  H HA   . LYS A 1 16 ? -11.160 -3.578  7.260   1.00 0.00 ? 1060 LYS B HA   7  
ATOM 9608  H HB2  . LYS A 1 16 ? -9.857  -5.075  9.541   1.00 0.00 ? 1060 LYS B HB2  7  
ATOM 9609  H HB3  . LYS A 1 16 ? -11.412 -4.255  9.689   1.00 0.00 ? 1060 LYS B HB3  7  
ATOM 9610  H HG2  . LYS A 1 16 ? -12.379 -5.633  7.951   1.00 0.00 ? 1060 LYS B HG2  7  
ATOM 9611  H HG3  . LYS A 1 16 ? -10.812 -6.353  7.585   1.00 0.00 ? 1060 LYS B HG3  7  
ATOM 9612  H HD2  . LYS A 1 16 ? -12.048 -7.918  8.960   1.00 0.00 ? 1060 LYS B HD2  7  
ATOM 9613  H HD3  . LYS A 1 16 ? -10.748 -7.238  9.940   1.00 0.00 ? 1060 LYS B HD3  7  
ATOM 9614  H HE2  . LYS A 1 16 ? -12.290 -5.667  10.982  1.00 0.00 ? 1060 LYS B HE2  7  
ATOM 9615  H HE3  . LYS A 1 16 ? -13.599 -6.206  9.930   1.00 0.00 ? 1060 LYS B HE3  7  
ATOM 9616  H HZ1  . LYS A 1 16 ? -13.143 -8.496  10.896  1.00 0.00 ? 1060 LYS B HZ1  7  
ATOM 9617  H HZ2  . LYS A 1 16 ? -13.913 -7.366  11.907  1.00 0.00 ? 1060 LYS B HZ2  7  
ATOM 9618  H HZ3  . LYS A 1 16 ? -12.257 -7.696  12.100  1.00 0.00 ? 1060 LYS B HZ3  7  
ATOM 9619  N N    . GLU A 1 17 ? -8.680  -2.386  9.059   1.00 0.00 ? 1061 GLU B N    7  
ATOM 9620  C CA   . GLU A 1 17 ? -8.185  -1.172  9.687   1.00 0.00 ? 1061 GLU B CA   7  
ATOM 9621  C C    . GLU A 1 17 ? -8.104  -0.038  8.667   1.00 0.00 ? 1061 GLU B C    7  
ATOM 9622  O O    . GLU A 1 17 ? -8.456  1.107   8.963   1.00 0.00 ? 1061 GLU B O    7  
ATOM 9623  C CB   . GLU A 1 17 ? -6.800  -1.431  10.284  1.00 0.00 ? 1061 GLU B CB   7  
ATOM 9624  C CG   . GLU A 1 17 ? -6.919  -2.367  11.492  1.00 0.00 ? 1061 GLU B CG   7  
ATOM 9625  C CD   . GLU A 1 17 ? -7.782  -1.728  12.574  1.00 0.00 ? 1061 GLU B CD   7  
ATOM 9626  O OE1  . GLU A 1 17 ? -7.532  -0.579  12.898  1.00 0.00 ? 1061 GLU B OE1  7  
ATOM 9627  O OE2  . GLU A 1 17 ? -8.679  -2.396  13.060  1.00 0.00 ? 1061 GLU B OE2  7  
ATOM 9628  H H    . GLU A 1 17 ? -8.098  -3.179  9.014   1.00 0.00 ? 1061 GLU B H    7  
ATOM 9629  H HA   . GLU A 1 17 ? -8.861  -0.884  10.477  1.00 0.00 ? 1061 GLU B HA   7  
ATOM 9630  H HB2  . GLU A 1 17 ? -6.169  -1.888  9.535   1.00 0.00 ? 1061 GLU B HB2  7  
ATOM 9631  H HB3  . GLU A 1 17 ? -6.364  -0.495  10.597  1.00 0.00 ? 1061 GLU B HB3  7  
ATOM 9632  H HG2  . GLU A 1 17 ? -7.369  -3.300  11.181  1.00 0.00 ? 1061 GLU B HG2  7  
ATOM 9633  H HG3  . GLU A 1 17 ? -5.936  -2.560  11.891  1.00 0.00 ? 1061 GLU B HG3  7  
ATOM 9634  N N    . MET A 1 18 ? -7.645  -0.358  7.461   1.00 0.00 ? 1062 MET B N    7  
ATOM 9635  C CA   . MET A 1 18 ? -7.528  0.652   6.416   1.00 0.00 ? 1062 MET B CA   7  
ATOM 9636  C C    . MET A 1 18 ? -8.900  1.202   6.049   1.00 0.00 ? 1062 MET B C    7  
ATOM 9637  O O    . MET A 1 18 ? -9.063  2.404   5.839   1.00 0.00 ? 1062 MET B O    7  
ATOM 9638  C CB   . MET A 1 18 ? -6.880  0.034   5.180   1.00 0.00 ? 1062 MET B CB   7  
ATOM 9639  C CG   . MET A 1 18 ? -5.437  -0.343  5.505   1.00 0.00 ? 1062 MET B CG   7  
ATOM 9640  S SD   . MET A 1 18 ? -4.764  -1.343  4.157   1.00 0.00 ? 1062 MET B SD   7  
ATOM 9641  C CE   . MET A 1 18 ? -3.740  -2.436  5.172   1.00 0.00 ? 1062 MET B CE   7  
ATOM 9642  H H    . MET A 1 18 ? -7.378  -1.285  7.271   1.00 0.00 ? 1062 MET B H    7  
ATOM 9643  H HA   . MET A 1 18 ? -6.905  1.459   6.771   1.00 0.00 ? 1062 MET B HA   7  
ATOM 9644  H HB2  . MET A 1 18 ? -7.429  -0.851  4.891   1.00 0.00 ? 1062 MET B HB2  7  
ATOM 9645  H HB3  . MET A 1 18 ? -6.892  0.747   4.371   1.00 0.00 ? 1062 MET B HB3  7  
ATOM 9646  H HG2  . MET A 1 18 ? -4.848  0.553   5.618   1.00 0.00 ? 1062 MET B HG2  7  
ATOM 9647  H HG3  . MET A 1 18 ? -5.412  -0.905  6.423   1.00 0.00 ? 1062 MET B HG3  7  
ATOM 9648  H HE1  . MET A 1 18 ? -4.143  -3.438  5.138   1.00 0.00 ? 1062 MET B HE1  7  
ATOM 9649  H HE2  . MET A 1 18 ? -3.740  -2.094  6.190   1.00 0.00 ? 1062 MET B HE2  7  
ATOM 9650  H HE3  . MET A 1 18 ? -2.727  -2.436  4.794   1.00 0.00 ? 1062 MET B HE3  7  
ATOM 9651  N N    . SER A 1 19 ? -9.888  0.313   5.975   1.00 0.00 ? 1063 SER B N    7  
ATOM 9652  C CA   . SER A 1 19 ? -11.245 0.721   5.634   1.00 0.00 ? 1063 SER B CA   7  
ATOM 9653  C C    . SER A 1 19 ? -11.806 1.659   6.693   1.00 0.00 ? 1063 SER B C    7  
ATOM 9654  O O    . SER A 1 19 ? -12.482 2.634   6.373   1.00 0.00 ? 1063 SER B O    7  
ATOM 9655  C CB   . SER A 1 19 ? -12.148 -0.504  5.504   1.00 0.00 ? 1063 SER B CB   7  
ATOM 9656  O OG   . SER A 1 19 ? -11.728 -1.280  4.390   1.00 0.00 ? 1063 SER B OG   7  
ATOM 9657  H H    . SER A 1 19 ? -9.698  -0.634  6.156   1.00 0.00 ? 1063 SER B H    7  
ATOM 9658  H HA   . SER A 1 19 ? -11.227 1.238   4.687   1.00 0.00 ? 1063 SER B HA   7  
ATOM 9659  H HB2  . SER A 1 19 ? -12.080 -1.100  6.399   1.00 0.00 ? 1063 SER B HB2  7  
ATOM 9660  H HB3  . SER A 1 19 ? -13.171 -0.181  5.365   1.00 0.00 ? 1063 SER B HB3  7  
ATOM 9661  H HG   . SER A 1 19 ? -11.167 -1.987  4.717   1.00 0.00 ? 1063 SER B HG   7  
ATOM 9662  N N    . GLU A 1 20 ? -11.527 1.356   7.954   1.00 0.00 ? 1064 GLU B N    7  
ATOM 9663  C CA   . GLU A 1 20 ? -12.017 2.180   9.049   1.00 0.00 ? 1064 GLU B CA   7  
ATOM 9664  C C    . GLU A 1 20 ? -11.451 3.595   8.960   1.00 0.00 ? 1064 GLU B C    7  
ATOM 9665  O O    . GLU A 1 20 ? -12.170 4.574   9.161   1.00 0.00 ? 1064 GLU B O    7  
ATOM 9666  C CB   . GLU A 1 20 ? -11.598 1.561   10.379  1.00 0.00 ? 1064 GLU B CB   7  
ATOM 9667  C CG   . GLU A 1 20 ? -12.395 0.276   10.626  1.00 0.00 ? 1064 GLU B CG   7  
ATOM 9668  C CD   . GLU A 1 20 ? -11.859 -0.446  11.858  1.00 0.00 ? 1064 GLU B CD   7  
ATOM 9669  O OE1  . GLU A 1 20 ? -10.803 -0.062  12.334  1.00 0.00 ? 1064 GLU B OE1  7  
ATOM 9670  O OE2  . GLU A 1 20 ? -12.511 -1.374  12.306  1.00 0.00 ? 1064 GLU B OE2  7  
ATOM 9671  H H    . GLU A 1 20 ? -10.986 0.562   8.151   1.00 0.00 ? 1064 GLU B H    7  
ATOM 9672  H HA   . GLU A 1 20 ? -13.095 2.226   9.007   1.00 0.00 ? 1064 GLU B HA   7  
ATOM 9673  H HB2  . GLU A 1 20 ? -10.543 1.331   10.344  1.00 0.00 ? 1064 GLU B HB2  7  
ATOM 9674  H HB3  . GLU A 1 20 ? -11.788 2.260   11.175  1.00 0.00 ? 1064 GLU B HB3  7  
ATOM 9675  H HG2  . GLU A 1 20 ? -13.435 0.525   10.781  1.00 0.00 ? 1064 GLU B HG2  7  
ATOM 9676  H HG3  . GLU A 1 20 ? -12.307 -0.370  9.766   1.00 0.00 ? 1064 GLU B HG3  7  
ATOM 9677  N N    . PHE A 1 21 ? -10.162 3.699   8.650   1.00 0.00 ? 1065 PHE B N    7  
ATOM 9678  C CA   . PHE A 1 21 ? -9.527  5.006   8.536   1.00 0.00 ? 1065 PHE B CA   7  
ATOM 9679  C C    . PHE A 1 21 ? -10.080 5.767   7.341   1.00 0.00 ? 1065 PHE B C    7  
ATOM 9680  O O    . PHE A 1 21 ? -10.324 6.971   7.415   1.00 0.00 ? 1065 PHE B O    7  
ATOM 9681  C CB   . PHE A 1 21 ? -8.012  4.841   8.385   1.00 0.00 ? 1065 PHE B CB   7  
ATOM 9682  C CG   . PHE A 1 21 ? -7.393  4.582   9.738   1.00 0.00 ? 1065 PHE B CG   7  
ATOM 9683  C CD1  . PHE A 1 21 ? -6.860  3.322   10.039  1.00 0.00 ? 1065 PHE B CD1  7  
ATOM 9684  C CD2  . PHE A 1 21 ? -7.350  5.605   10.694  1.00 0.00 ? 1065 PHE B CD2  7  
ATOM 9685  C CE1  . PHE A 1 21 ? -6.286  3.085   11.294  1.00 0.00 ? 1065 PHE B CE1  7  
ATOM 9686  C CE2  . PHE A 1 21 ? -6.776  5.368   11.949  1.00 0.00 ? 1065 PHE B CE2  7  
ATOM 9687  C CZ   . PHE A 1 21 ? -6.244  4.108   12.249  1.00 0.00 ? 1065 PHE B CZ   7  
ATOM 9688  H H    . PHE A 1 21 ? -9.633  2.887   8.488   1.00 0.00 ? 1065 PHE B H    7  
ATOM 9689  H HA   . PHE A 1 21 ? -9.728  5.570   9.435   1.00 0.00 ? 1065 PHE B HA   7  
ATOM 9690  H HB2  . PHE A 1 21 ? -7.806  4.007   7.730   1.00 0.00 ? 1065 PHE B HB2  7  
ATOM 9691  H HB3  . PHE A 1 21 ? -7.592  5.743   7.962   1.00 0.00 ? 1065 PHE B HB3  7  
ATOM 9692  H HD1  . PHE A 1 21 ? -6.891  2.533   9.302   1.00 0.00 ? 1065 PHE B HD1  7  
ATOM 9693  H HD2  . PHE A 1 21 ? -7.761  6.576   10.462  1.00 0.00 ? 1065 PHE B HD2  7  
ATOM 9694  H HE1  . PHE A 1 21 ? -5.877  2.114   11.526  1.00 0.00 ? 1065 PHE B HE1  7  
ATOM 9695  H HE2  . PHE A 1 21 ? -6.744  6.158   12.685  1.00 0.00 ? 1065 PHE B HE2  7  
ATOM 9696  H HZ   . PHE A 1 21 ? -5.802  3.926   13.217  1.00 0.00 ? 1065 PHE B HZ   7  
ATOM 9697  N N    . LEU A 1 22 ? -10.277 5.055   6.242   1.00 0.00 ? 1066 LEU B N    7  
ATOM 9698  C CA   . LEU A 1 22 ? -10.802 5.672   5.030   1.00 0.00 ? 1066 LEU B CA   7  
ATOM 9699  C C    . LEU A 1 22 ? -12.238 6.145   5.243   1.00 0.00 ? 1066 LEU B C    7  
ATOM 9700  O O    . LEU A 1 22 ? -12.624 7.218   4.779   1.00 0.00 ? 1066 LEU B O    7  
ATOM 9701  C CB   . LEU A 1 22 ? -10.754 4.670   3.877   1.00 0.00 ? 1066 LEU B CB   7  
ATOM 9702  C CG   . LEU A 1 22 ? -9.297  4.401   3.491   1.00 0.00 ? 1066 LEU B CG   7  
ATOM 9703  C CD1  . LEU A 1 22 ? -9.236  3.224   2.519   1.00 0.00 ? 1066 LEU B CD1  7  
ATOM 9704  C CD2  . LEU A 1 22 ? -8.702  5.644   2.820   1.00 0.00 ? 1066 LEU B CD2  7  
ATOM 9705  H H    . LEU A 1 22 ? -10.067 4.096   6.246   1.00 0.00 ? 1066 LEU B H    7  
ATOM 9706  H HA   . LEU A 1 22 ? -10.190 6.522   4.779   1.00 0.00 ? 1066 LEU B HA   7  
ATOM 9707  H HB2  . LEU A 1 22 ? -11.223 3.745   4.185   1.00 0.00 ? 1066 LEU B HB2  7  
ATOM 9708  H HB3  . LEU A 1 22 ? -11.281 5.075   3.025   1.00 0.00 ? 1066 LEU B HB3  7  
ATOM 9709  H HG   . LEU A 1 22 ? -8.729  4.163   4.379   1.00 0.00 ? 1066 LEU B HG   7  
ATOM 9710  H HD11 . LEU A 1 22 ? -10.238 2.888   2.300   1.00 0.00 ? 1066 LEU B HD11 7  
ATOM 9711  H HD12 . LEU A 1 22 ? -8.677  2.416   2.969   1.00 0.00 ? 1066 LEU B HD12 7  
ATOM 9712  H HD13 . LEU A 1 22 ? -8.751  3.535   1.605   1.00 0.00 ? 1066 LEU B HD13 7  
ATOM 9713  H HD21 . LEU A 1 22 ? -8.113  5.344   1.965   1.00 0.00 ? 1066 LEU B HD21 7  
ATOM 9714  H HD22 . LEU A 1 22 ? -8.072  6.164   3.526   1.00 0.00 ? 1066 LEU B HD22 7  
ATOM 9715  H HD23 . LEU A 1 22 ? -9.497  6.297   2.501   1.00 0.00 ? 1066 LEU B HD23 7  
ATOM 9716  N N    . SER A 1 23 ? -13.024 5.337   5.948   1.00 0.00 ? 1067 SER B N    7  
ATOM 9717  C CA   . SER A 1 23 ? -14.416 5.681   6.215   1.00 0.00 ? 1067 SER B CA   7  
ATOM 9718  C C    . SER A 1 23 ? -14.498 6.949   7.058   1.00 0.00 ? 1067 SER B C    7  
ATOM 9719  O O    . SER A 1 23 ? -15.306 7.836   6.785   1.00 0.00 ? 1067 SER B O    7  
ATOM 9720  C CB   . SER A 1 23 ? -15.103 4.530   6.947   1.00 0.00 ? 1067 SER B CB   7  
ATOM 9721  O OG   . SER A 1 23 ? -15.170 3.402   6.083   1.00 0.00 ? 1067 SER B OG   7  
ATOM 9722  H H    . SER A 1 23 ? -12.664 4.495   6.293   1.00 0.00 ? 1067 SER B H    7  
ATOM 9723  H HA   . SER A 1 23 ? -14.921 5.852   5.276   1.00 0.00 ? 1067 SER B HA   7  
ATOM 9724  H HB2  . SER A 1 23 ? -14.536 4.269   7.825   1.00 0.00 ? 1067 SER B HB2  7  
ATOM 9725  H HB3  . SER A 1 23 ? -16.099 4.833   7.239   1.00 0.00 ? 1067 SER B HB3  7  
ATOM 9726  H HG   . SER A 1 23 ? -16.089 3.270   5.840   1.00 0.00 ? 1067 SER B HG   7  
ATOM 9727  N N    . ARG A 1 24 ? -13.647 7.033   8.077   1.00 0.00 ? 1068 ARG B N    7  
ATOM 9728  C CA   . ARG A 1 24 ? -13.624 8.206   8.942   1.00 0.00 ? 1068 ARG B CA   7  
ATOM 9729  C C    . ARG A 1 24 ? -13.205 9.444   8.164   1.00 0.00 ? 1068 ARG B C    7  
ATOM 9730  O O    . ARG A 1 24 ? -13.738 10.532  8.375   1.00 0.00 ? 1068 ARG B O    7  
ATOM 9731  C CB   . ARG A 1 24 ? -12.667 7.988   10.114  1.00 0.00 ? 1068 ARG B CB   7  
ATOM 9732  C CG   . ARG A 1 24 ? -13.312 7.046   11.130  1.00 0.00 ? 1068 ARG B CG   7  
ATOM 9733  C CD   . ARG A 1 24 ? -12.454 6.999   12.393  1.00 0.00 ? 1068 ARG B CD   7  
ATOM 9734  N NE   . ARG A 1 24 ? -11.259 6.194   12.160  1.00 0.00 ? 1068 ARG B NE   7  
ATOM 9735  C CZ   . ARG A 1 24 ? -11.271 4.863   12.289  1.00 0.00 ? 1068 ARG B CZ   7  
ATOM 9736  N NH1  . ARG A 1 24 ? -12.369 4.228   12.624  1.00 0.00 ? 1068 ARG B NH1  7  
ATOM 9737  N NH2  . ARG A 1 24 ? -10.180 4.184   12.075  1.00 0.00 ? 1068 ARG B NH2  7  
ATOM 9738  H H    . ARG A 1 24 ? -13.016 6.300   8.243   1.00 0.00 ? 1068 ARG B H    7  
ATOM 9739  H HA   . ARG A 1 24 ? -14.618 8.364   9.332   1.00 0.00 ? 1068 ARG B HA   7  
ATOM 9740  H HB2  . ARG A 1 24 ? -11.748 7.551   9.750   1.00 0.00 ? 1068 ARG B HB2  7  
ATOM 9741  H HB3  . ARG A 1 24 ? -12.454 8.934   10.587  1.00 0.00 ? 1068 ARG B HB3  7  
ATOM 9742  H HG2  . ARG A 1 24 ? -14.301 7.401   11.376  1.00 0.00 ? 1068 ARG B HG2  7  
ATOM 9743  H HG3  . ARG A 1 24 ? -13.380 6.054   10.709  1.00 0.00 ? 1068 ARG B HG3  7  
ATOM 9744  H HD2  . ARG A 1 24 ? -12.157 8.003   12.656  1.00 0.00 ? 1068 ARG B HD2  7  
ATOM 9745  H HD3  . ARG A 1 24 ? -13.025 6.578   13.205  1.00 0.00 ? 1068 ARG B HD3  7  
ATOM 9746  H HE   . ARG A 1 24 ? -10.426 6.642   11.901  1.00 0.00 ? 1068 ARG B HE   7  
ATOM 9747  H HH11 . ARG A 1 24 ? -13.214 4.725   12.782  1.00 0.00 ? 1068 ARG B HH11 7  
ATOM 9748  H HH12 . ARG A 1 24 ? -12.355 3.235   12.730  1.00 0.00 ? 1068 ARG B HH12 7  
ATOM 9749  H HH21 . ARG A 1 24 ? -9.340  4.659   11.815  1.00 0.00 ? 1068 ARG B HH21 7  
ATOM 9750  H HH22 . ARG A 1 24 ? -10.185 3.189   12.170  1.00 0.00 ? 1068 ARG B HH22 7  
ATOM 9751  N N    . GLY A 1 25 ? -12.240 9.271   7.271   1.00 0.00 ? 1069 GLY B N    7  
ATOM 9752  C CA   . GLY A 1 25 ? -11.751 10.388  6.476   1.00 0.00 ? 1069 GLY B CA   7  
ATOM 9753  C C    . GLY A 1 25 ? -12.780 10.811  5.434   1.00 0.00 ? 1069 GLY B C    7  
ATOM 9754  O O    . GLY A 1 25 ? -13.745 10.093  5.168   1.00 0.00 ? 1069 GLY B O    7  
ATOM 9755  H H    . GLY A 1 25 ? -11.847 8.383   7.151   1.00 0.00 ? 1069 GLY B H    7  
ATOM 9756  H HA2  . GLY A 1 25 ? -11.543 11.218  7.134   1.00 0.00 ? 1069 GLY B HA2  7  
ATOM 9757  H HA3  . GLY A 1 25 ? -10.842 10.095  5.976   1.00 0.00 ? 1069 GLY B HA3  7  
ATOM 9758  N N    . PRO A 1 26 ? -12.594 11.963  4.844   1.00 0.00 ? 1070 PRO B N    7  
ATOM 9759  C CA   . PRO A 1 26 ? -13.524 12.503  3.806   1.00 0.00 ? 1070 PRO B CA   7  
ATOM 9760  C C    . PRO A 1 26 ? -13.663 11.558  2.616   1.00 0.00 ? 1070 PRO B C    7  
ATOM 9761  O O    . PRO A 1 26 ? -12.684 10.958  2.171   1.00 0.00 ? 1070 PRO B O    7  
ATOM 9762  C CB   . PRO A 1 26 ? -12.864 13.819  3.372   1.00 0.00 ? 1070 PRO B CB   7  
ATOM 9763  C CG   . PRO A 1 26 ? -11.966 14.198  4.499   1.00 0.00 ? 1070 PRO B CG   7  
ATOM 9764  C CD   . PRO A 1 26 ? -11.476 12.887  5.100   1.00 0.00 ? 1070 PRO B CD   7  
ATOM 9765  H HA   . PRO A 1 26 ? -14.490 12.710  4.236   1.00 0.00 ? 1070 PRO B HA   7  
ATOM 9766  H HB2  . PRO A 1 26 ? -12.292 13.669  2.468   1.00 0.00 ? 1070 PRO B HB2  7  
ATOM 9767  H HB3  . PRO A 1 26 ? -13.612 14.583  3.223   1.00 0.00 ? 1070 PRO B HB3  7  
ATOM 9768  H HG2  . PRO A 1 26 ? -11.131 14.778  4.128   1.00 0.00 ? 1070 PRO B HG2  7  
ATOM 9769  H HG3  . PRO A 1 26 ? -12.512 14.758  5.242   1.00 0.00 ? 1070 PRO B HG3  7  
ATOM 9770  H HD2  . PRO A 1 26 ? -10.582 12.551  4.597   1.00 0.00 ? 1070 PRO B HD2  7  
ATOM 9771  H HD3  . PRO A 1 26 ? -11.309 12.993  6.157   1.00 0.00 ? 1070 PRO B HD3  7  
ATOM 9772  N N    . ALA A 1 27 ? -14.881 11.439  2.103   1.00 0.00 ? 1071 ALA B N    7  
ATOM 9773  C CA   . ALA A 1 27 ? -15.139 10.575  0.959   1.00 0.00 ? 1071 ALA B CA   7  
ATOM 9774  C C    . ALA A 1 27 ? -15.514 11.401  -0.274  1.00 0.00 ? 1071 ALA B C    7  
ATOM 9775  O O    . ALA A 1 27 ? -15.557 10.882  -1.388  1.00 0.00 ? 1071 ALA B O    7  
ATOM 9776  C CB   . ALA A 1 27 ? -16.273 9.602   1.286   1.00 0.00 ? 1071 ALA B CB   7  
ATOM 9777  H H    . ALA A 1 27 ? -15.620 11.948  2.498   1.00 0.00 ? 1071 ALA B H    7  
ATOM 9778  H HA   . ALA A 1 27 ? -14.247 10.009  0.740   1.00 0.00 ? 1071 ALA B HA   7  
ATOM 9779  H HB1  . ALA A 1 27 ? -17.221 10.058  1.044   1.00 0.00 ? 1071 ALA B HB1  7  
ATOM 9780  H HB2  . ALA A 1 27 ? -16.247 9.360   2.337   1.00 0.00 ? 1071 ALA B HB2  7  
ATOM 9781  H HB3  . ALA A 1 27 ? -16.149 8.698   0.706   1.00 0.00 ? 1071 ALA B HB3  7  
ATOM 9782  N N    . VAL A 1 28 ? -15.784 12.689  -0.067  1.00 0.00 ? 1072 VAL B N    7  
ATOM 9783  C CA   . VAL A 1 28 ? -16.152 13.568  -1.167  1.00 0.00 ? 1072 VAL B CA   7  
ATOM 9784  C C    . VAL A 1 28 ? -15.023 13.659  -2.184  1.00 0.00 ? 1072 VAL B C    7  
ATOM 9785  O O    . VAL A 1 28 ? -15.257 13.607  -3.385  1.00 0.00 ? 1072 VAL B O    7  
ATOM 9786  C CB   . VAL A 1 28 ? -16.474 14.962  -0.630  1.00 0.00 ? 1072 VAL B CB   7  
ATOM 9787  C CG1  . VAL A 1 28 ? -16.633 15.935  -1.800  1.00 0.00 ? 1072 VAL B CG1  7  
ATOM 9788  C CG2  . VAL A 1 28 ? -17.778 14.910  0.169   1.00 0.00 ? 1072 VAL B CG2  7  
ATOM 9789  H H    . VAL A 1 28 ? -15.737 13.055  0.840   1.00 0.00 ? 1072 VAL B H    7  
ATOM 9790  H HA   . VAL A 1 28 ? -17.030 13.173  -1.655  1.00 0.00 ? 1072 VAL B HA   7  
ATOM 9791  H HB   . VAL A 1 28 ? -15.670 15.295  0.009   1.00 0.00 ? 1072 VAL B HB   7  
ATOM 9792  H HG11 . VAL A 1 28 ? -17.370 16.685  -1.547  1.00 0.00 ? 1072 VAL B HG11 7  
ATOM 9793  H HG12 . VAL A 1 28 ? -16.955 15.395  -2.676  1.00 0.00 ? 1072 VAL B HG12 7  
ATOM 9794  H HG13 . VAL A 1 28 ? -15.686 16.415  -2.000  1.00 0.00 ? 1072 VAL B HG13 7  
ATOM 9795  H HG21 . VAL A 1 28 ? -17.819 15.750  0.846   1.00 0.00 ? 1072 VAL B HG21 7  
ATOM 9796  H HG22 . VAL A 1 28 ? -17.818 13.990  0.733   1.00 0.00 ? 1072 VAL B HG22 7  
ATOM 9797  H HG23 . VAL A 1 28 ? -18.618 14.952  -0.510  1.00 0.00 ? 1072 VAL B HG23 7  
ATOM 9798  N N    . LEU A 1 29 ? -13.800 13.797  -1.691  1.00 0.00 ? 1073 LEU B N    7  
ATOM 9799  C CA   . LEU A 1 29 ? -12.633 13.900  -2.563  1.00 0.00 ? 1073 LEU B CA   7  
ATOM 9800  C C    . LEU A 1 29 ? -12.430 12.611  -3.355  1.00 0.00 ? 1073 LEU B C    7  
ATOM 9801  O O    . LEU A 1 29 ? -11.832 12.620  -4.432  1.00 0.00 ? 1073 LEU B O    7  
ATOM 9802  C CB   . LEU A 1 29 ? -11.387 14.177  -1.728  1.00 0.00 ? 1073 LEU B CB   7  
ATOM 9803  C CG   . LEU A 1 29 ? -11.479 15.577  -1.114  1.00 0.00 ? 1073 LEU B CG   7  
ATOM 9804  C CD1  . LEU A 1 29 ? -10.360 15.762  -0.089  1.00 0.00 ? 1073 LEU B CD1  7  
ATOM 9805  C CD2  . LEU A 1 29 ? -11.333 16.630  -2.214  1.00 0.00 ? 1073 LEU B CD2  7  
ATOM 9806  H H    . LEU A 1 29 ? -13.678 13.833  -0.719  1.00 0.00 ? 1073 LEU B H    7  
ATOM 9807  H HA   . LEU A 1 29 ? -12.780 14.717  -3.252  1.00 0.00 ? 1073 LEU B HA   7  
ATOM 9808  H HB2  . LEU A 1 29 ? -11.316 13.439  -0.943  1.00 0.00 ? 1073 LEU B HB2  7  
ATOM 9809  H HB3  . LEU A 1 29 ? -10.516 14.118  -2.360  1.00 0.00 ? 1073 LEU B HB3  7  
ATOM 9810  H HG   . LEU A 1 29 ? -12.437 15.694  -0.626  1.00 0.00 ? 1073 LEU B HG   7  
ATOM 9811  H HD11 . LEU A 1 29 ? -10.398 14.963  0.636   1.00 0.00 ? 1073 LEU B HD11 7  
ATOM 9812  H HD12 . LEU A 1 29 ? -10.487 16.710  0.415   1.00 0.00 ? 1073 LEU B HD12 7  
ATOM 9813  H HD13 . LEU A 1 29 ? -9.404  15.747  -0.592  1.00 0.00 ? 1073 LEU B HD13 7  
ATOM 9814  H HD21 . LEU A 1 29 ? -12.308 16.872  -2.613  1.00 0.00 ? 1073 LEU B HD21 7  
ATOM 9815  H HD22 . LEU A 1 29 ? -10.708 16.242  -3.004  1.00 0.00 ? 1073 LEU B HD22 7  
ATOM 9816  H HD23 . LEU A 1 29 ? -10.883 17.521  -1.802  1.00 0.00 ? 1073 LEU B HD23 7  
ATOM 9817  N N    . ALA A 1 30 ? -12.925 11.506  -2.812  1.00 0.00 ? 1074 ALA B N    7  
ATOM 9818  C CA   . ALA A 1 30 ? -12.788 10.212  -3.470  1.00 0.00 ? 1074 ALA B CA   7  
ATOM 9819  C C    . ALA A 1 30 ? -13.417 10.257  -4.858  1.00 0.00 ? 1074 ALA B C    7  
ATOM 9820  O O    . ALA A 1 30 ? -12.936 9.612   -5.788  1.00 0.00 ? 1074 ALA B O    7  
ATOM 9821  C CB   . ALA A 1 30 ? -13.471 9.128   -2.636  1.00 0.00 ? 1074 ALA B CB   7  
ATOM 9822  H H    . ALA A 1 30 ? -13.388 11.561  -1.951  1.00 0.00 ? 1074 ALA B H    7  
ATOM 9823  H HA   . ALA A 1 30 ? -11.739 9.973   -3.565  1.00 0.00 ? 1074 ALA B HA   7  
ATOM 9824  H HB1  . ALA A 1 30 ? -13.542 9.454   -1.609  1.00 0.00 ? 1074 ALA B HB1  7  
ATOM 9825  H HB2  . ALA A 1 30 ? -12.892 8.217   -2.684  1.00 0.00 ? 1074 ALA B HB2  7  
ATOM 9826  H HB3  . ALA A 1 30 ? -14.462 8.947   -3.025  1.00 0.00 ? 1074 ALA B HB3  7  
ATOM 9827  N N    . THR A 1 31 ? -14.497 11.018  -4.987  1.00 0.00 ? 1075 THR B N    7  
ATOM 9828  C CA   . THR A 1 31 ? -15.186 11.135  -6.268  1.00 0.00 ? 1075 THR B CA   7  
ATOM 9829  C C    . THR A 1 31 ? -15.344 12.594  -6.673  1.00 0.00 ? 1075 THR B C    7  
ATOM 9830  O O    . THR A 1 31 ? -15.283 13.492  -5.839  1.00 0.00 ? 1075 THR B O    7  
ATOM 9831  C CB   . THR A 1 31 ? -16.564 10.478  -6.188  1.00 0.00 ? 1075 THR B CB   7  
ATOM 9832  O OG1  . THR A 1 31 ? -17.330 11.102  -5.168  1.00 0.00 ? 1075 THR B OG1  7  
ATOM 9833  C CG2  . THR A 1 31 ? -16.397 8.992   -5.883  1.00 0.00 ? 1075 THR B CG2  7  
ATOM 9834  H H    . THR A 1 31 ? -14.833 11.512  -4.208  1.00 0.00 ? 1075 THR B H    7  
ATOM 9835  H HA   . THR A 1 31 ? -14.605 10.626  -7.021  1.00 0.00 ? 1075 THR B HA   7  
ATOM 9836  H HB   . THR A 1 31 ? -17.069 10.590  -7.134  1.00 0.00 ? 1075 THR B HB   7  
ATOM 9837  H HG1  . THR A 1 31 ? -17.645 11.942  -5.507  1.00 0.00 ? 1075 THR B HG1  7  
ATOM 9838  H HG21 . THR A 1 31 ? -15.831 8.529   -6.677  1.00 0.00 ? 1075 THR B HG21 7  
ATOM 9839  H HG22 . THR A 1 31 ? -17.371 8.528   -5.813  1.00 0.00 ? 1075 THR B HG22 7  
ATOM 9840  H HG23 . THR A 1 31 ? -15.873 8.874   -4.947  1.00 0.00 ? 1075 THR B HG23 7  
ATOM 9841  N N    . LYS A 1 32 ? -15.546 12.821  -7.962  1.00 0.00 ? 1076 LYS B N    7  
ATOM 9842  C CA   . LYS A 1 32 ? -15.713 14.180  -8.470  1.00 0.00 ? 1076 LYS B CA   7  
ATOM 9843  C C    . LYS A 1 32 ? -14.595 15.083  -7.959  1.00 0.00 ? 1076 LYS B C    7  
ATOM 9844  O O    . LYS A 1 32 ? -14.817 16.258  -7.665  1.00 0.00 ? 1076 LYS B O    7  
ATOM 9845  C CB   . LYS A 1 32 ? -17.065 14.740  -8.022  1.00 0.00 ? 1076 LYS B CB   7  
ATOM 9846  C CG   . LYS A 1 32 ? -18.191 13.799  -8.464  1.00 0.00 ? 1076 LYS B CG   7  
ATOM 9847  C CD   . LYS A 1 32 ? -18.232 13.720  -9.992  1.00 0.00 ? 1076 LYS B CD   7  
ATOM 9848  C CE   . LYS A 1 32 ? -19.418 12.861  -10.427 1.00 0.00 ? 1076 LYS B CE   7  
ATOM 9849  N NZ   . LYS A 1 32 ? -19.438 12.771  -11.914 1.00 0.00 ? 1076 LYS B NZ   7  
ATOM 9850  H H    . LYS A 1 32 ? -15.585 12.060  -8.583  1.00 0.00 ? 1076 LYS B H    7  
ATOM 9851  H HA   . LYS A 1 32 ? -15.679 14.161  -9.548  1.00 0.00 ? 1076 LYS B HA   7  
ATOM 9852  H HB2  . LYS A 1 32 ? -17.074 14.831  -6.945  1.00 0.00 ? 1076 LYS B HB2  7  
ATOM 9853  H HB3  . LYS A 1 32 ? -17.215 15.712  -8.467  1.00 0.00 ? 1076 LYS B HB3  7  
ATOM 9854  H HG2  . LYS A 1 32 ? -18.012 12.814  -8.058  1.00 0.00 ? 1076 LYS B HG2  7  
ATOM 9855  H HG3  . LYS A 1 32 ? -19.135 14.173  -8.100  1.00 0.00 ? 1076 LYS B HG3  7  
ATOM 9856  H HD2  . LYS A 1 32 ? -18.334 14.714  -10.403 1.00 0.00 ? 1076 LYS B HD2  7  
ATOM 9857  H HD3  . LYS A 1 32 ? -17.321 13.271  -10.356 1.00 0.00 ? 1076 LYS B HD3  7  
ATOM 9858  H HE2  . LYS A 1 32 ? -19.321 11.871  -10.007 1.00 0.00 ? 1076 LYS B HE2  7  
ATOM 9859  H HE3  . LYS A 1 32 ? -20.336 13.313  -10.080 1.00 0.00 ? 1076 LYS B HE3  7  
ATOM 9860  H HZ1  . LYS A 1 32 ? -20.191 13.384  -12.289 1.00 0.00 ? 1076 LYS B HZ1  7  
ATOM 9861  H HZ2  . LYS A 1 32 ? -19.616 11.787  -12.200 1.00 0.00 ? 1076 LYS B HZ2  7  
ATOM 9862  H HZ3  . LYS A 1 32 ? -18.522 13.083  -12.293 1.00 0.00 ? 1076 LYS B HZ3  7  
ATOM 9863  N N    . ALA A 1 33 ? -13.393 14.528  -7.853  1.00 0.00 ? 1077 ALA B N    7  
ATOM 9864  C CA   . ALA A 1 33 ? -12.246 15.293  -7.376  1.00 0.00 ? 1077 ALA B CA   7  
ATOM 9865  C C    . ALA A 1 33 ? -10.946 14.625  -7.804  1.00 0.00 ? 1077 ALA B C    7  
ATOM 9866  O O    . ALA A 1 33 ? -10.190 15.173  -8.606  1.00 0.00 ? 1077 ALA B O    7  
ATOM 9867  C CB   . ALA A 1 33 ? -12.288 15.404  -5.851  1.00 0.00 ? 1077 ALA B CB   7  
ATOM 9868  H H    . ALA A 1 33 ? -13.275 13.587  -8.099  1.00 0.00 ? 1077 ALA B H    7  
ATOM 9869  H HA   . ALA A 1 33 ? -12.288 16.285  -7.799  1.00 0.00 ? 1077 ALA B HA   7  
ATOM 9870  H HB1  . ALA A 1 33 ? -12.834 14.567  -5.443  1.00 0.00 ? 1077 ALA B HB1  7  
ATOM 9871  H HB2  . ALA A 1 33 ? -12.779 16.325  -5.571  1.00 0.00 ? 1077 ALA B HB2  7  
ATOM 9872  H HB3  . ALA A 1 33 ? -11.280 15.401  -5.462  1.00 0.00 ? 1077 ALA B HB3  7  
ATOM 9873  N N    . ALA A 1 34 ? -10.691 13.436  -7.267  1.00 0.00 ? 1078 ALA B N    7  
ATOM 9874  C CA   . ALA A 1 34 ? -9.477  12.702  -7.606  1.00 0.00 ? 1078 ALA B CA   7  
ATOM 9875  C C    . ALA A 1 34 ? -8.243  13.573  -7.390  1.00 0.00 ? 1078 ALA B C    7  
ATOM 9876  O O    . ALA A 1 34 ? -7.719  14.169  -8.332  1.00 0.00 ? 1078 ALA B O    7  
ATOM 9877  C CB   . ALA A 1 34 ? -9.532  12.244  -9.064  1.00 0.00 ? 1078 ALA B CB   7  
ATOM 9878  H H    . ALA A 1 34 ? -11.331 13.045  -6.635  1.00 0.00 ? 1078 ALA B H    7  
ATOM 9879  H HA   . ALA A 1 34 ? -9.406  11.831  -6.971  1.00 0.00 ? 1078 ALA B HA   7  
ATOM 9880  H HB1  . ALA A 1 34 ? -8.550  12.333  -9.507  1.00 0.00 ? 1078 ALA B HB1  7  
ATOM 9881  H HB2  . ALA A 1 34 ? -10.230 12.862  -9.610  1.00 0.00 ? 1078 ALA B HB2  7  
ATOM 9882  H HB3  . ALA A 1 34 ? -9.853  11.213  -9.106  1.00 0.00 ? 1078 ALA B HB3  7  
ATOM 9883  N N    . ALA A 1 35 ? -7.784  13.644  -6.144  1.00 0.00 ? 1079 ALA B N    7  
ATOM 9884  C CA   . ALA A 1 35 ? -6.610  14.446  -5.818  1.00 0.00 ? 1079 ALA B CA   7  
ATOM 9885  C C    . ALA A 1 35 ? -5.393  13.950  -6.593  1.00 0.00 ? 1079 ALA B C    7  
ATOM 9886  O O    . ALA A 1 35 ? -5.251  12.753  -6.844  1.00 0.00 ? 1079 ALA B O    7  
ATOM 9887  C CB   . ALA A 1 35 ? -6.328  14.373  -4.315  1.00 0.00 ? 1079 ALA B CB   7  
ATOM 9888  H H    . ALA A 1 35 ? -8.243  13.149  -5.434  1.00 0.00 ? 1079 ALA B H    7  
ATOM 9889  H HA   . ALA A 1 35 ? -6.801  15.474  -6.087  1.00 0.00 ? 1079 ALA B HA   7  
ATOM 9890  H HB1  . ALA A 1 35 ? -5.475  14.990  -4.079  1.00 0.00 ? 1079 ALA B HB1  7  
ATOM 9891  H HB2  . ALA A 1 35 ? -6.123  13.350  -4.038  1.00 0.00 ? 1079 ALA B HB2  7  
ATOM 9892  H HB3  . ALA A 1 35 ? -7.191  14.727  -3.770  1.00 0.00 ? 1079 ALA B HB3  7  
ATOM 9893  N N    . GLY A 1 36 ? -4.515  14.877  -6.960  1.00 0.00 ? 1080 GLY B N    7  
ATOM 9894  C CA   . GLY A 1 36 ? -3.309  14.524  -7.699  1.00 0.00 ? 1080 GLY B CA   7  
ATOM 9895  C C    . GLY A 1 36 ? -2.131  14.313  -6.754  1.00 0.00 ? 1080 GLY B C    7  
ATOM 9896  O O    . GLY A 1 36 ? -1.018  14.018  -7.190  1.00 0.00 ? 1080 GLY B O    7  
ATOM 9897  H H    . GLY A 1 36 ? -4.673  15.813  -6.720  1.00 0.00 ? 1080 GLY B H    7  
ATOM 9898  H HA2  . GLY A 1 36 ? -3.489  13.614  -8.255  1.00 0.00 ? 1080 GLY B HA2  7  
ATOM 9899  H HA3  . GLY A 1 36 ? -3.069  15.318  -8.387  1.00 0.00 ? 1080 GLY B HA3  7  
ATOM 9900  N N    . THR A 1 37 ? -2.378  14.457  -5.457  1.00 0.00 ? 1081 THR B N    7  
ATOM 9901  C CA   . THR A 1 37 ? -1.332  14.274  -4.470  1.00 0.00 ? 1081 THR B CA   7  
ATOM 9902  C C    . THR A 1 37 ? -0.934  12.803  -4.377  1.00 0.00 ? 1081 THR B C    7  
ATOM 9903  O O    . THR A 1 37 ? 0.158   12.471  -3.921  1.00 0.00 ? 1081 THR B O    7  
ATOM 9904  C CB   . THR A 1 37 ? -1.826  14.765  -3.111  1.00 0.00 ? 1081 THR B CB   7  
ATOM 9905  O OG1  . THR A 1 37 ? -2.970  14.016  -2.728  1.00 0.00 ? 1081 THR B OG1  7  
ATOM 9906  C CG2  . THR A 1 37 ? -2.185  16.250  -3.196  1.00 0.00 ? 1081 THR B CG2  7  
ATOM 9907  H H    . THR A 1 37 ? -3.280  14.686  -5.156  1.00 0.00 ? 1081 THR B H    7  
ATOM 9908  H HA   . THR A 1 37 ? -0.469  14.855  -4.760  1.00 0.00 ? 1081 THR B HA   7  
ATOM 9909  H HB   . THR A 1 37 ? -1.051  14.630  -2.384  1.00 0.00 ? 1081 THR B HB   7  
ATOM 9910  H HG1  . THR A 1 37 ? -3.695  14.629  -2.598  1.00 0.00 ? 1081 THR B HG1  7  
ATOM 9911  H HG21 . THR A 1 37 ? -1.279  16.836  -3.250  1.00 0.00 ? 1081 THR B HG21 7  
ATOM 9912  H HG22 . THR A 1 37 ? -2.744  16.534  -2.318  1.00 0.00 ? 1081 THR B HG22 7  
ATOM 9913  H HG23 . THR A 1 37 ? -2.783  16.428  -4.078  1.00 0.00 ? 1081 THR B HG23 7  
ATOM 9914  N N    . LYS A 1 38 ? -1.822  11.925  -4.830  1.00 0.00 ? 1082 LYS B N    7  
ATOM 9915  C CA   . LYS A 1 38 ? -1.543  10.498  -4.804  1.00 0.00 ? 1082 LYS B CA   7  
ATOM 9916  C C    . LYS A 1 38 ? -0.300  10.168  -5.627  1.00 0.00 ? 1082 LYS B C    7  
ATOM 9917  O O    . LYS A 1 38 ? 0.259   9.077   -5.511  1.00 0.00 ? 1082 LYS B O    7  
ATOM 9918  C CB   . LYS A 1 38 ? -2.740  9.728   -5.348  1.00 0.00 ? 1082 LYS B CB   7  
ATOM 9919  C CG   . LYS A 1 38 ? -2.913  10.034  -6.838  1.00 0.00 ? 1082 LYS B CG   7  
ATOM 9920  C CD   . LYS A 1 38 ? -4.159  9.320   -7.364  1.00 0.00 ? 1082 LYS B CD   7  
ATOM 9921  C CE   . LYS A 1 38 ? -4.277  9.545   -8.871  1.00 0.00 ? 1082 LYS B CE   7  
ATOM 9922  N NZ   . LYS A 1 38 ? -4.446  11.001  -9.146  1.00 0.00 ? 1082 LYS B NZ   7  
ATOM 9923  H H    . LYS A 1 38 ? -2.673  12.240  -5.195  1.00 0.00 ? 1082 LYS B H    7  
ATOM 9924  H HA   . LYS A 1 38 ? -1.373  10.197  -3.781  1.00 0.00 ? 1082 LYS B HA   7  
ATOM 9925  H HB2  . LYS A 1 38 ? -2.575  8.670   -5.212  1.00 0.00 ? 1082 LYS B HB2  7  
ATOM 9926  H HB3  . LYS A 1 38 ? -3.628  10.029  -4.815  1.00 0.00 ? 1082 LYS B HB3  7  
ATOM 9927  H HG2  . LYS A 1 38 ? -3.022  11.100  -6.977  1.00 0.00 ? 1082 LYS B HG2  7  
ATOM 9928  H HG3  . LYS A 1 38 ? -2.048  9.685   -7.382  1.00 0.00 ? 1082 LYS B HG3  7  
ATOM 9929  H HD2  . LYS A 1 38 ? -4.081  8.261   -7.162  1.00 0.00 ? 1082 LYS B HD2  7  
ATOM 9930  H HD3  . LYS A 1 38 ? -5.036  9.716   -6.873  1.00 0.00 ? 1082 LYS B HD3  7  
ATOM 9931  H HE2  . LYS A 1 38 ? -3.382  9.189   -9.359  1.00 0.00 ? 1082 LYS B HE2  7  
ATOM 9932  H HE3  . LYS A 1 38 ? -5.132  9.007   -9.252  1.00 0.00 ? 1082 LYS B HE3  7  
ATOM 9933  H HZ1  . LYS A 1 38 ? -3.606  11.361  -9.640  1.00 0.00 ? 1082 LYS B HZ1  7  
ATOM 9934  H HZ2  . LYS A 1 38 ? -4.563  11.511  -8.245  1.00 0.00 ? 1082 LYS B HZ2  7  
ATOM 9935  H HZ3  . LYS A 1 38 ? -5.285  11.148  -9.740  1.00 0.00 ? 1082 LYS B HZ3  7  
ATOM 9936  N N    . LYS A 1 39 ? 0.136   11.116  -6.455  1.00 0.00 ? 1083 LYS B N    7  
ATOM 9937  C CA   . LYS A 1 39 ? 1.318   10.911  -7.283  1.00 0.00 ? 1083 LYS B CA   7  
ATOM 9938  C C    . LYS A 1 39 ? 2.512   10.482  -6.434  1.00 0.00 ? 1083 LYS B C    7  
ATOM 9939  O O    . LYS A 1 39 ? 3.473   9.904   -6.945  1.00 0.00 ? 1083 LYS B O    7  
ATOM 9940  C CB   . LYS A 1 39 ? 1.656   12.210  -8.013  1.00 0.00 ? 1083 LYS B CB   7  
ATOM 9941  C CG   . LYS A 1 39 ? 2.101   13.269  -6.998  1.00 0.00 ? 1083 LYS B CG   7  
ATOM 9942  C CD   . LYS A 1 39 ? 2.226   14.625  -7.697  1.00 0.00 ? 1083 LYS B CD   7  
ATOM 9943  C CE   . LYS A 1 39 ? 3.404   14.594  -8.675  1.00 0.00 ? 1083 LYS B CE   7  
ATOM 9944  N NZ   . LYS A 1 39 ? 3.545   15.928  -9.327  1.00 0.00 ? 1083 LYS B NZ   7  
ATOM 9945  H H    . LYS A 1 39 ? -0.340  11.969  -6.512  1.00 0.00 ? 1083 LYS B H    7  
ATOM 9946  H HA   . LYS A 1 39 ? 1.111   10.145  -8.014  1.00 0.00 ? 1083 LYS B HA   7  
ATOM 9947  H HB2  . LYS A 1 39 ? 2.453   12.028  -8.717  1.00 0.00 ? 1083 LYS B HB2  7  
ATOM 9948  H HB3  . LYS A 1 39 ? 0.783   12.563  -8.537  1.00 0.00 ? 1083 LYS B HB3  7  
ATOM 9949  H HG2  . LYS A 1 39 ? 1.368   13.337  -6.206  1.00 0.00 ? 1083 LYS B HG2  7  
ATOM 9950  H HG3  . LYS A 1 39 ? 3.057   12.991  -6.582  1.00 0.00 ? 1083 LYS B HG3  7  
ATOM 9951  H HD2  . LYS A 1 39 ? 1.313   14.836  -8.237  1.00 0.00 ? 1083 LYS B HD2  7  
ATOM 9952  H HD3  . LYS A 1 39 ? 2.393   15.396  -6.960  1.00 0.00 ? 1083 LYS B HD3  7  
ATOM 9953  H HE2  . LYS A 1 39 ? 4.310   14.358  -8.139  1.00 0.00 ? 1083 LYS B HE2  7  
ATOM 9954  H HE3  . LYS A 1 39 ? 3.224   13.844  -9.431  1.00 0.00 ? 1083 LYS B HE3  7  
ATOM 9955  H HZ1  . LYS A 1 39 ? 2.988   16.632  -8.802  1.00 0.00 ? 1083 LYS B HZ1  7  
ATOM 9956  H HZ2  . LYS A 1 39 ? 3.202   15.873  -10.308 1.00 0.00 ? 1083 LYS B HZ2  7  
ATOM 9957  H HZ3  . LYS A 1 39 ? 4.546   16.211  -9.325  1.00 0.00 ? 1083 LYS B HZ3  7  
ATOM 9958  N N    . TYR A 1 40 ? 2.445   10.766  -5.137  1.00 0.00 ? 1084 TYR B N    7  
ATOM 9959  C CA   . TYR A 1 40 ? 3.522   10.405  -4.229  1.00 0.00 ? 1084 TYR B CA   7  
ATOM 9960  C C    . TYR A 1 40 ? 3.693   8.893   -4.194  1.00 0.00 ? 1084 TYR B C    7  
ATOM 9961  O O    . TYR A 1 40 ? 2.721   8.142   -4.283  1.00 0.00 ? 1084 TYR B O    7  
ATOM 9962  C CB   . TYR A 1 40 ? 3.209   10.914  -2.819  1.00 0.00 ? 1084 TYR B CB   7  
ATOM 9963  C CG   . TYR A 1 40 ? 2.948   12.401  -2.859  1.00 0.00 ? 1084 TYR B CG   7  
ATOM 9964  C CD1  . TYR A 1 40 ? 2.081   12.983  -1.925  1.00 0.00 ? 1084 TYR B CD1  7  
ATOM 9965  C CD2  . TYR A 1 40 ? 3.559   13.197  -3.835  1.00 0.00 ? 1084 TYR B CD2  7  
ATOM 9966  C CE1  . TYR A 1 40 ? 1.826   14.359  -1.969  1.00 0.00 ? 1084 TYR B CE1  7  
ATOM 9967  C CE2  . TYR A 1 40 ? 3.307   14.571  -3.877  1.00 0.00 ? 1084 TYR B CE2  7  
ATOM 9968  C CZ   . TYR A 1 40 ? 2.440   15.154  -2.945  1.00 0.00 ? 1084 TYR B CZ   7  
ATOM 9969  O OH   . TYR A 1 40 ? 2.190   16.511  -2.990  1.00 0.00 ? 1084 TYR B OH   7  
ATOM 9970  H H    . TYR A 1 40 ? 1.657   11.226  -4.787  1.00 0.00 ? 1084 TYR B H    7  
ATOM 9971  H HA   . TYR A 1 40 ? 4.441   10.852  -4.572  1.00 0.00 ? 1084 TYR B HA   7  
ATOM 9972  H HB2  . TYR A 1 40 ? 2.334   10.404  -2.443  1.00 0.00 ? 1084 TYR B HB2  7  
ATOM 9973  H HB3  . TYR A 1 40 ? 4.048   10.714  -2.169  1.00 0.00 ? 1084 TYR B HB3  7  
ATOM 9974  H HD1  . TYR A 1 40 ? 1.608   12.370  -1.172  1.00 0.00 ? 1084 TYR B HD1  7  
ATOM 9975  H HD2  . TYR A 1 40 ? 4.229   12.751  -4.555  1.00 0.00 ? 1084 TYR B HD2  7  
ATOM 9976  H HE1  . TYR A 1 40 ? 1.154   14.808  -1.251  1.00 0.00 ? 1084 TYR B HE1  7  
ATOM 9977  H HE2  . TYR A 1 40 ? 3.778   15.182  -4.631  1.00 0.00 ? 1084 TYR B HE2  7  
ATOM 9978  H HH   . TYR A 1 40 ? 1.239   16.638  -3.007  1.00 0.00 ? 1084 TYR B HH   7  
ATOM 9979  N N    . ASP A 1 41 ? 4.937   8.461   -4.071  1.00 0.00 ? 1085 ASP B N    7  
ATOM 9980  C CA   . ASP A 1 41 ? 5.243   7.036   -4.030  1.00 0.00 ? 1085 ASP B CA   7  
ATOM 9981  C C    . ASP A 1 41 ? 5.213   6.520   -2.596  1.00 0.00 ? 1085 ASP B C    7  
ATOM 9982  O O    . ASP A 1 41 ? 6.258   6.288   -1.985  1.00 0.00 ? 1085 ASP B O    7  
ATOM 9983  C CB   . ASP A 1 41 ? 6.626   6.776   -4.637  1.00 0.00 ? 1085 ASP B CB   7  
ATOM 9984  C CG   . ASP A 1 41 ? 6.584   6.983   -6.147  1.00 0.00 ? 1085 ASP B CG   7  
ATOM 9985  O OD1  . ASP A 1 41 ? 5.492   7.036   -6.689  1.00 0.00 ? 1085 ASP B OD1  7  
ATOM 9986  O OD2  . ASP A 1 41 ? 7.645   7.089   -6.740  1.00 0.00 ? 1085 ASP B OD2  7  
ATOM 9987  H H    . ASP A 1 41 ? 5.662   9.116   -4.008  1.00 0.00 ? 1085 ASP B H    7  
ATOM 9988  H HA   . ASP A 1 41 ? 4.504   6.501   -4.609  1.00 0.00 ? 1085 ASP B HA   7  
ATOM 9989  H HB2  . ASP A 1 41 ? 7.342   7.457   -4.200  1.00 0.00 ? 1085 ASP B HB2  7  
ATOM 9990  H HB3  . ASP A 1 41 ? 6.922   5.760   -4.426  1.00 0.00 ? 1085 ASP B HB3  7  
ATOM 9991  N N    . LEU A 1 42 ? 4.008   6.332   -2.069  1.00 0.00 ? 1086 LEU B N    7  
ATOM 9992  C CA   . LEU A 1 42 ? 3.842   5.830   -0.710  1.00 0.00 ? 1086 LEU B CA   7  
ATOM 9993  C C    . LEU A 1 42 ? 3.492   4.342   -0.716  1.00 0.00 ? 1086 LEU B C    7  
ATOM 9994  O O    . LEU A 1 42 ? 3.321   3.732   0.338   1.00 0.00 ? 1086 LEU B O    7  
ATOM 9995  C CB   . LEU A 1 42 ? 2.734   6.610   -0.007  1.00 0.00 ? 1086 LEU B CB   7  
ATOM 9996  C CG   . LEU A 1 42 ? 3.126   8.083   0.055   1.00 0.00 ? 1086 LEU B CG   7  
ATOM 9997  C CD1  . LEU A 1 42 ? 1.930   8.909   0.527   1.00 0.00 ? 1086 LEU B CD1  7  
ATOM 9998  C CD2  . LEU A 1 42 ? 4.284   8.265   1.040   1.00 0.00 ? 1086 LEU B CD2  7  
ATOM 9999  H H    . LEU A 1 42 ? 3.214   6.526   -2.609  1.00 0.00 ? 1086 LEU B H    7  
ATOM 10000 H HA   . LEU A 1 42 ? 4.765   5.971   -0.168  1.00 0.00 ? 1086 LEU B HA   7  
ATOM 10001 H HB2  . LEU A 1 42 ? 1.810   6.500   -0.557  1.00 0.00 ? 1086 LEU B HB2  7  
ATOM 10002 H HB3  . LEU A 1 42 ? 2.606   6.231   0.997   1.00 0.00 ? 1086 LEU B HB3  7  
ATOM 10003 H HG   . LEU A 1 42 ? 3.433   8.409   -0.927  1.00 0.00 ? 1086 LEU B HG   7  
ATOM 10004 H HD11 . LEU A 1 42 ? 1.869   8.870   1.604   1.00 0.00 ? 1086 LEU B HD11 7  
ATOM 10005 H HD12 . LEU A 1 42 ? 1.024   8.507   0.099   1.00 0.00 ? 1086 LEU B HD12 7  
ATOM 10006 H HD13 . LEU A 1 42 ? 2.055   9.935   0.211   1.00 0.00 ? 1086 LEU B HD13 7  
ATOM 10007 H HD21 . LEU A 1 42 ? 4.083   7.702   1.940   1.00 0.00 ? 1086 LEU B HD21 7  
ATOM 10008 H HD22 . LEU A 1 42 ? 4.382   9.312   1.286   1.00 0.00 ? 1086 LEU B HD22 7  
ATOM 10009 H HD23 . LEU A 1 42 ? 5.200   7.914   0.590   1.00 0.00 ? 1086 LEU B HD23 7  
ATOM 10010 N N    . SER A 1 43 ? 3.393   3.757   -1.910  1.00 0.00 ? 1087 SER B N    7  
ATOM 10011 C CA   . SER A 1 43 ? 3.068   2.343   -2.033  1.00 0.00 ? 1087 SER B CA   7  
ATOM 10012 C C    . SER A 1 43 ? 4.230   1.484   -1.541  1.00 0.00 ? 1087 SER B C    7  
ATOM 10013 O O    . SER A 1 43 ? 4.090   0.273   -1.362  1.00 0.00 ? 1087 SER B O    7  
ATOM 10014 C CB   . SER A 1 43 ? 2.756   2.003   -3.491  1.00 0.00 ? 1087 SER B CB   7  
ATOM 10015 O OG   . SER A 1 43 ? 3.932   2.160   -4.276  1.00 0.00 ? 1087 SER B OG   7  
ATOM 10016 H H    . SER A 1 43 ? 3.545   4.282   -2.720  1.00 0.00 ? 1087 SER B H    7  
ATOM 10017 H HA   . SER A 1 43 ? 2.199   2.129   -1.431  1.00 0.00 ? 1087 SER B HA   7  
ATOM 10018 H HB2  . SER A 1 43 ? 2.414   0.986   -3.565  1.00 0.00 ? 1087 SER B HB2  7  
ATOM 10019 H HB3  . SER A 1 43 ? 1.982   2.667   -3.852  1.00 0.00 ? 1087 SER B HB3  7  
ATOM 10020 H HG   . SER A 1 43 ? 4.652   2.392   -3.688  1.00 0.00 ? 1087 SER B HG   7  
ATOM 10021 N N    . LYS A 1 44 ? 5.374   2.117   -1.316  1.00 0.00 ? 1088 LYS B N    7  
ATOM 10022 C CA   . LYS A 1 44 ? 6.542   1.397   -0.833  1.00 0.00 ? 1088 LYS B CA   7  
ATOM 10023 C C    . LYS A 1 44 ? 6.627   1.463   0.692   1.00 0.00 ? 1088 LYS B C    7  
ATOM 10024 O O    . LYS A 1 44 ? 7.423   0.753   1.308   1.00 0.00 ? 1088 LYS B O    7  
ATOM 10025 C CB   . LYS A 1 44 ? 7.808   2.000   -1.438  1.00 0.00 ? 1088 LYS B CB   7  
ATOM 10026 C CG   . LYS A 1 44 ? 7.798   1.782   -2.952  1.00 0.00 ? 1088 LYS B CG   7  
ATOM 10027 C CD   . LYS A 1 44 ? 8.958   2.550   -3.589  1.00 0.00 ? 1088 LYS B CD   7  
ATOM 10028 C CE   . LYS A 1 44 ? 10.285  1.963   -3.108  1.00 0.00 ? 1088 LYS B CE   7  
ATOM 10029 N NZ   . LYS A 1 44 ? 11.413  2.668   -3.778  1.00 0.00 ? 1088 LYS B NZ   7  
ATOM 10030 H H    . LYS A 1 44 ? 5.430   3.083   -1.466  1.00 0.00 ? 1088 LYS B H    7  
ATOM 10031 H HA   . LYS A 1 44 ? 6.468   0.366   -1.135  1.00 0.00 ? 1088 LYS B HA   7  
ATOM 10032 H HB2  . LYS A 1 44 ? 7.840   3.060   -1.224  1.00 0.00 ? 1088 LYS B HB2  7  
ATOM 10033 H HB3  . LYS A 1 44 ? 8.671   1.519   -1.011  1.00 0.00 ? 1088 LYS B HB3  7  
ATOM 10034 H HG2  . LYS A 1 44 ? 7.903   0.729   -3.164  1.00 0.00 ? 1088 LYS B HG2  7  
ATOM 10035 H HG3  . LYS A 1 44 ? 6.865   2.140   -3.362  1.00 0.00 ? 1088 LYS B HG3  7  
ATOM 10036 H HD2  . LYS A 1 44 ? 8.896   2.469   -4.664  1.00 0.00 ? 1088 LYS B HD2  7  
ATOM 10037 H HD3  . LYS A 1 44 ? 8.902   3.590   -3.302  1.00 0.00 ? 1088 LYS B HD3  7  
ATOM 10038 H HE2  . LYS A 1 44 ? 10.369  2.089   -2.039  1.00 0.00 ? 1088 LYS B HE2  7  
ATOM 10039 H HE3  . LYS A 1 44 ? 10.322  0.911   -3.350  1.00 0.00 ? 1088 LYS B HE3  7  
ATOM 10040 H HZ1  . LYS A 1 44 ? 12.111  1.973   -4.107  1.00 0.00 ? 1088 LYS B HZ1  7  
ATOM 10041 H HZ2  . LYS A 1 44 ? 11.863  3.321   -3.103  1.00 0.00 ? 1088 LYS B HZ2  7  
ATOM 10042 H HZ3  . LYS A 1 44 ? 11.052  3.205   -4.592  1.00 0.00 ? 1088 LYS B HZ3  7  
ATOM 10043 N N    . TRP A 1 45 ? 5.804   2.319   1.295   1.00 0.00 ? 1089 TRP B N    7  
ATOM 10044 C CA   . TRP A 1 45 ? 5.799   2.469   2.743   1.00 0.00 ? 1089 TRP B CA   7  
ATOM 10045 C C    . TRP A 1 45 ? 4.982   1.361   3.386   1.00 0.00 ? 1089 TRP B C    7  
ATOM 10046 O O    . TRP A 1 45 ? 3.911   1.003   2.904   1.00 0.00 ? 1089 TRP B O    7  
ATOM 10047 C CB   . TRP A 1 45 ? 5.209   3.827   3.134   1.00 0.00 ? 1089 TRP B CB   7  
ATOM 10048 C CG   . TRP A 1 45 ? 6.200   4.908   2.846   1.00 0.00 ? 1089 TRP B CG   7  
ATOM 10049 C CD1  . TRP A 1 45 ? 6.997   4.958   1.756   1.00 0.00 ? 1089 TRP B CD1  7  
ATOM 10050 C CD2  . TRP A 1 45 ? 6.513   6.093   3.638   1.00 0.00 ? 1089 TRP B CD2  7  
ATOM 10051 N NE1  . TRP A 1 45 ? 7.777   6.092   1.825   1.00 0.00 ? 1089 TRP B NE1  7  
ATOM 10052 C CE2  . TRP A 1 45 ? 7.518   6.826   2.965   1.00 0.00 ? 1089 TRP B CE2  7  
ATOM 10053 C CE3  . TRP A 1 45 ? 6.028   6.597   4.861   1.00 0.00 ? 1089 TRP B CE3  7  
ATOM 10054 C CZ2  . TRP A 1 45 ? 8.025   8.017   3.484   1.00 0.00 ? 1089 TRP B CZ2  7  
ATOM 10055 C CZ3  . TRP A 1 45 ? 6.539   7.796   5.385   1.00 0.00 ? 1089 TRP B CZ3  7  
ATOM 10056 C CH2  . TRP A 1 45 ? 7.534   8.504   4.696   1.00 0.00 ? 1089 TRP B CH2  7  
ATOM 10057 H H    . TRP A 1 45 ? 5.195   2.863   0.758   1.00 0.00 ? 1089 TRP B H    7  
ATOM 10058 H HA   . TRP A 1 45 ? 6.812   2.413   3.108   1.00 0.00 ? 1089 TRP B HA   7  
ATOM 10059 H HB2  . TRP A 1 45 ? 4.310   4.004   2.564   1.00 0.00 ? 1089 TRP B HB2  7  
ATOM 10060 H HB3  . TRP A 1 45 ? 4.972   3.826   4.189   1.00 0.00 ? 1089 TRP B HB3  7  
ATOM 10061 H HD1  . TRP A 1 45 ? 7.018   4.228   0.960   1.00 0.00 ? 1089 TRP B HD1  7  
ATOM 10062 H HE1  . TRP A 1 45 ? 8.437   6.358   1.160   1.00 0.00 ? 1089 TRP B HE1  7  
ATOM 10063 H HE3  . TRP A 1 45 ? 5.258   6.058   5.403   1.00 0.00 ? 1089 TRP B HE3  7  
ATOM 10064 H HZ2  . TRP A 1 45 ? 8.791   8.558   2.951   1.00 0.00 ? 1089 TRP B HZ2  7  
ATOM 10065 H HZ3  . TRP A 1 45 ? 6.165   8.176   6.321   1.00 0.00 ? 1089 TRP B HZ3  7  
ATOM 10066 H HH2  . TRP A 1 45 ? 7.921   9.427   5.104   1.00 0.00 ? 1089 TRP B HH2  7  
ATOM 10067 N N    . LYS A 1 46 ? 5.495   0.830   4.483   1.00 0.00 ? 1090 LYS B N    7  
ATOM 10068 C CA   . LYS A 1 46 ? 4.803   -0.238  5.194   1.00 0.00 ? 1090 LYS B CA   7  
ATOM 10069 C C    . LYS A 1 46 ? 3.473   0.258   5.743   1.00 0.00 ? 1090 LYS B C    7  
ATOM 10070 O O    . LYS A 1 46 ? 3.271   1.457   5.929   1.00 0.00 ? 1090 LYS B O    7  
ATOM 10071 C CB   . LYS A 1 46 ? 5.663   -0.753  6.348   1.00 0.00 ? 1090 LYS B CB   7  
ATOM 10072 C CG   . LYS A 1 46 ? 6.970   -1.336  5.813   1.00 0.00 ? 1090 LYS B CG   7  
ATOM 10073 C CD   . LYS A 1 46 ? 6.685   -2.628  5.043   1.00 0.00 ? 1090 LYS B CD   7  
ATOM 10074 C CE   . LYS A 1 46 ? 8.004   -3.271  4.603   1.00 0.00 ? 1090 LYS B CE   7  
ATOM 10075 N NZ   . LYS A 1 46 ? 7.719   -4.537  3.868   1.00 0.00 ? 1090 LYS B NZ   7  
ATOM 10076 H H    . LYS A 1 46 ? 6.353   1.164   4.823   1.00 0.00 ? 1090 LYS B H    7  
ATOM 10077 H HA   . LYS A 1 46 ? 4.613   -1.046  4.509   1.00 0.00 ? 1090 LYS B HA   7  
ATOM 10078 H HB2  . LYS A 1 46 ? 5.884   0.062   7.020   1.00 0.00 ? 1090 LYS B HB2  7  
ATOM 10079 H HB3  . LYS A 1 46 ? 5.124   -1.519  6.881   1.00 0.00 ? 1090 LYS B HB3  7  
ATOM 10080 H HG2  . LYS A 1 46 ? 7.439   -0.619  5.157   1.00 0.00 ? 1090 LYS B HG2  7  
ATOM 10081 H HG3  . LYS A 1 46 ? 7.623   -1.551  6.642   1.00 0.00 ? 1090 LYS B HG3  7  
ATOM 10082 H HD2  . LYS A 1 46 ? 6.142   -3.312  5.682   1.00 0.00 ? 1090 LYS B HD2  7  
ATOM 10083 H HD3  . LYS A 1 46 ? 6.092   -2.406  4.169   1.00 0.00 ? 1090 LYS B HD3  7  
ATOM 10084 H HE2  . LYS A 1 46 ? 8.538   -2.591  3.954   1.00 0.00 ? 1090 LYS B HE2  7  
ATOM 10085 H HE3  . LYS A 1 46 ? 8.608   -3.488  5.474   1.00 0.00 ? 1090 LYS B HE3  7  
ATOM 10086 H HZ1  . LYS A 1 46 ? 8.602   -5.075  3.745   1.00 0.00 ? 1090 LYS B HZ1  7  
ATOM 10087 H HZ2  . LYS A 1 46 ? 7.316   -4.312  2.936   1.00 0.00 ? 1090 LYS B HZ2  7  
ATOM 10088 H HZ3  . LYS A 1 46 ? 7.041   -5.108  4.412   1.00 0.00 ? 1090 LYS B HZ3  7  
ATOM 10089 N N    . TYR A 1 47 ? 2.570   -0.679  5.999   1.00 0.00 ? 1091 TYR B N    7  
ATOM 10090 C CA   . TYR A 1 47 ? 1.265   -0.332  6.533   1.00 0.00 ? 1091 TYR B CA   7  
ATOM 10091 C C    . TYR A 1 47 ? 1.429   0.464   7.816   1.00 0.00 ? 1091 TYR B C    7  
ATOM 10092 O O    . TYR A 1 47 ? 0.784   1.495   8.007   1.00 0.00 ? 1091 TYR B O    7  
ATOM 10093 C CB   . TYR A 1 47 ? 0.448   -1.601  6.807   1.00 0.00 ? 1091 TYR B CB   7  
ATOM 10094 C CG   . TYR A 1 47 ? -0.785  -1.246  7.608   1.00 0.00 ? 1091 TYR B CG   7  
ATOM 10095 C CD1  . TYR A 1 47 ? -1.817  -0.505  7.023   1.00 0.00 ? 1091 TYR B CD1  7  
ATOM 10096 C CD2  . TYR A 1 47 ? -0.892  -1.667  8.939   1.00 0.00 ? 1091 TYR B CD2  7  
ATOM 10097 C CE1  . TYR A 1 47 ? -2.956  -0.180  7.771   1.00 0.00 ? 1091 TYR B CE1  7  
ATOM 10098 C CE2  . TYR A 1 47 ? -2.031  -1.342  9.687   1.00 0.00 ? 1091 TYR B CE2  7  
ATOM 10099 C CZ   . TYR A 1 47 ? -3.063  -0.599  9.103   1.00 0.00 ? 1091 TYR B CZ   7  
ATOM 10100 O OH   . TYR A 1 47 ? -4.185  -0.279  9.840   1.00 0.00 ? 1091 TYR B OH   7  
ATOM 10101 H H    . TYR A 1 47 ? 2.786   -1.621  5.830   1.00 0.00 ? 1091 TYR B H    7  
ATOM 10102 H HA   . TYR A 1 47 ? 0.741   0.274   5.809   1.00 0.00 ? 1091 TYR B HA   7  
ATOM 10103 H HB2  . TYR A 1 47 ? 0.151   -2.046  5.870   1.00 0.00 ? 1091 TYR B HB2  7  
ATOM 10104 H HB3  . TYR A 1 47 ? 1.048   -2.303  7.366   1.00 0.00 ? 1091 TYR B HB3  7  
ATOM 10105 H HD1  . TYR A 1 47 ? -1.735  -0.182  5.995   1.00 0.00 ? 1091 TYR B HD1  7  
ATOM 10106 H HD2  . TYR A 1 47 ? -0.097  -2.241  9.391   1.00 0.00 ? 1091 TYR B HD2  7  
ATOM 10107 H HE1  . TYR A 1 47 ? -3.753  0.393   7.320   1.00 0.00 ? 1091 TYR B HE1  7  
ATOM 10108 H HE2  . TYR A 1 47 ? -2.113  -1.667  10.713  1.00 0.00 ? 1091 TYR B HE2  7  
ATOM 10109 H HH   . TYR A 1 47 ? -4.009  -0.497  10.757  1.00 0.00 ? 1091 TYR B HH   7  
ATOM 10110 N N    . ALA A 1 48 ? 2.297   -0.018  8.692   1.00 0.00 ? 1092 ALA B N    7  
ATOM 10111 C CA   . ALA A 1 48 ? 2.535   0.672   9.953   1.00 0.00 ? 1092 ALA B CA   7  
ATOM 10112 C C    . ALA A 1 48 ? 3.121   2.065   9.712   1.00 0.00 ? 1092 ALA B C    7  
ATOM 10113 O O    . ALA A 1 48 ? 2.777   3.024   10.404  1.00 0.00 ? 1092 ALA B O    7  
ATOM 10114 C CB   . ALA A 1 48 ? 3.482   -0.143  10.832  1.00 0.00 ? 1092 ALA B CB   7  
ATOM 10115 H H    . ALA A 1 48 ? 2.797   -0.845  8.478   1.00 0.00 ? 1092 ALA B H    7  
ATOM 10116 H HA   . ALA A 1 48 ? 1.593   0.783   10.466  1.00 0.00 ? 1092 ALA B HA   7  
ATOM 10117 H HB1  . ALA A 1 48 ? 4.245   -0.598  10.219  1.00 0.00 ? 1092 ALA B HB1  7  
ATOM 10118 H HB2  . ALA A 1 48 ? 2.923   -0.912  11.341  1.00 0.00 ? 1092 ALA B HB2  7  
ATOM 10119 H HB3  . ALA A 1 48 ? 3.944   0.507   11.561  1.00 0.00 ? 1092 ALA B HB3  7  
ATOM 10120 N N    . GLU A 1 49 ? 4.015   2.157   8.734   1.00 0.00 ? 1093 GLU B N    7  
ATOM 10121 C CA   . GLU A 1 49 ? 4.659   3.425   8.405   1.00 0.00 ? 1093 GLU B CA   7  
ATOM 10122 C C    . GLU A 1 49 ? 3.635   4.444   7.922   1.00 0.00 ? 1093 GLU B C    7  
ATOM 10123 O O    . GLU A 1 49 ? 3.667   5.605   8.329   1.00 0.00 ? 1093 GLU B O    7  
ATOM 10124 C CB   . GLU A 1 49 ? 5.714   3.206   7.315   1.00 0.00 ? 1093 GLU B CB   7  
ATOM 10125 C CG   . GLU A 1 49 ? 6.880   2.392   7.881   1.00 0.00 ? 1093 GLU B CG   7  
ATOM 10126 C CD   . GLU A 1 49 ? 7.679   3.236   8.867   1.00 0.00 ? 1093 GLU B CD   7  
ATOM 10127 O OE1  . GLU A 1 49 ? 7.493   4.443   8.869   1.00 0.00 ? 1093 GLU B OE1  7  
ATOM 10128 O OE2  . GLU A 1 49 ? 8.466   2.666   9.603   1.00 0.00 ? 1093 GLU B OE2  7  
ATOM 10129 H H    . GLU A 1 49 ? 4.245   1.358   8.225   1.00 0.00 ? 1093 GLU B H    7  
ATOM 10130 H HA   . GLU A 1 49 ? 5.147   3.811   9.288   1.00 0.00 ? 1093 GLU B HA   7  
ATOM 10131 H HB2  . GLU A 1 49 ? 5.269   2.671   6.487   1.00 0.00 ? 1093 GLU B HB2  7  
ATOM 10132 H HB3  . GLU A 1 49 ? 6.079   4.161   6.970   1.00 0.00 ? 1093 GLU B HB3  7  
ATOM 10133 H HG2  . GLU A 1 49 ? 6.496   1.520   8.387   1.00 0.00 ? 1093 GLU B HG2  7  
ATOM 10134 H HG3  . GLU A 1 49 ? 7.526   2.082   7.072   1.00 0.00 ? 1093 GLU B HG3  7  
ATOM 10135 N N    . LEU A 1 50 ? 2.718   4.006   7.067   1.00 0.00 ? 1094 LEU B N    7  
ATOM 10136 C CA   . LEU A 1 50 ? 1.689   4.897   6.558   1.00 0.00 ? 1094 LEU B CA   7  
ATOM 10137 C C    . LEU A 1 50 ? 0.789   5.370   7.688   1.00 0.00 ? 1094 LEU B C    7  
ATOM 10138 O O    . LEU A 1 50 ? 0.393   6.533   7.733   1.00 0.00 ? 1094 LEU B O    7  
ATOM 10139 C CB   . LEU A 1 50 ? 0.859   4.184   5.491   1.00 0.00 ? 1094 LEU B CB   7  
ATOM 10140 C CG   . LEU A 1 50 ? 1.698   4.026   4.225   1.00 0.00 ? 1094 LEU B CG   7  
ATOM 10141 C CD1  . LEU A 1 50 ? 1.015   3.040   3.273   1.00 0.00 ? 1094 LEU B CD1  7  
ATOM 10142 C CD2  . LEU A 1 50 ? 1.819   5.385   3.532   1.00 0.00 ? 1094 LEU B CD2  7  
ATOM 10143 H H    . LEU A 1 50 ? 2.729   3.069   6.780   1.00 0.00 ? 1094 LEU B H    7  
ATOM 10144 H HA   . LEU A 1 50 ? 2.166   5.756   6.113   1.00 0.00 ? 1094 LEU B HA   7  
ATOM 10145 H HB2  . LEU A 1 50 ? 0.568   3.208   5.854   1.00 0.00 ? 1094 LEU B HB2  7  
ATOM 10146 H HB3  . LEU A 1 50 ? -0.024  4.764   5.268   1.00 0.00 ? 1094 LEU B HB3  7  
ATOM 10147 H HG   . LEU A 1 50 ? 2.680   3.665   4.491   1.00 0.00 ? 1094 LEU B HG   7  
ATOM 10148 H HD11 . LEU A 1 50 ? 0.311   3.573   2.648   1.00 0.00 ? 1094 LEU B HD11 7  
ATOM 10149 H HD12 . LEU A 1 50 ? 0.489   2.290   3.846   1.00 0.00 ? 1094 LEU B HD12 7  
ATOM 10150 H HD13 . LEU A 1 50 ? 1.757   2.563   2.651   1.00 0.00 ? 1094 LEU B HD13 7  
ATOM 10151 H HD21 . LEU A 1 50 ? 1.466   6.162   4.196   1.00 0.00 ? 1094 LEU B HD21 7  
ATOM 10152 H HD22 . LEU A 1 50 ? 1.221   5.383   2.630   1.00 0.00 ? 1094 LEU B HD22 7  
ATOM 10153 H HD23 . LEU A 1 50 ? 2.853   5.570   3.276   1.00 0.00 ? 1094 LEU B HD23 7  
ATOM 10154 N N    . ARG A 1 51 ? 0.472   4.463   8.601   1.00 0.00 ? 1095 ARG B N    7  
ATOM 10155 C CA   . ARG A 1 51 ? -0.379  4.814   9.721   1.00 0.00 ? 1095 ARG B CA   7  
ATOM 10156 C C    . ARG A 1 51 ? 0.260   5.929   10.540  1.00 0.00 ? 1095 ARG B C    7  
ATOM 10157 O O    . ARG A 1 51 ? -0.385  6.928   10.866  1.00 0.00 ? 1095 ARG B O    7  
ATOM 10158 C CB   . ARG A 1 51 ? -0.587  3.582   10.598  1.00 0.00 ? 1095 ARG B CB   7  
ATOM 10159 C CG   . ARG A 1 51 ? -1.580  3.915   11.713  1.00 0.00 ? 1095 ARG B CG   7  
ATOM 10160 C CD   . ARG A 1 51 ? -1.738  2.706   12.632  1.00 0.00 ? 1095 ARG B CD   7  
ATOM 10161 N NE   . ARG A 1 51 ? -0.505  2.465   13.373  1.00 0.00 ? 1095 ARG B NE   7  
ATOM 10162 C CZ   . ARG A 1 51 ? -0.338  1.367   14.114  1.00 0.00 ? 1095 ARG B CZ   7  
ATOM 10163 N NH1  . ARG A 1 51 ? -1.284  0.465   14.203  1.00 0.00 ? 1095 ARG B NH1  7  
ATOM 10164 N NH2  . ARG A 1 51 ? 0.781   1.189   14.759  1.00 0.00 ? 1095 ARG B NH2  7  
ATOM 10165 H H    . ARG A 1 51 ? 0.813   3.548   8.521   1.00 0.00 ? 1095 ARG B H    7  
ATOM 10166 H HA   . ARG A 1 51 ? -1.332  5.148   9.348   1.00 0.00 ? 1095 ARG B HA   7  
ATOM 10167 H HB2  . ARG A 1 51 ? -0.974  2.776   9.994   1.00 0.00 ? 1095 ARG B HB2  7  
ATOM 10168 H HB3  . ARG A 1 51 ? 0.359   3.282   11.030  1.00 0.00 ? 1095 ARG B HB3  7  
ATOM 10169 H HG2  . ARG A 1 51 ? -1.215  4.758   12.282  1.00 0.00 ? 1095 ARG B HG2  7  
ATOM 10170 H HG3  . ARG A 1 51 ? -2.536  4.161   11.279  1.00 0.00 ? 1095 ARG B HG3  7  
ATOM 10171 H HD2  . ARG A 1 51 ? -2.540  2.890   13.329  1.00 0.00 ? 1095 ARG B HD2  7  
ATOM 10172 H HD3  . ARG A 1 51 ? -1.974  1.835   12.037  1.00 0.00 ? 1095 ARG B HD3  7  
ATOM 10173 H HE   . ARG A 1 51 ? 0.215   3.129   13.328  1.00 0.00 ? 1095 ARG B HE   7  
ATOM 10174 H HH11 . ARG A 1 51 ? -2.146  0.588   13.717  1.00 0.00 ? 1095 ARG B HH11 7  
ATOM 10175 H HH12 . ARG A 1 51 ? -1.142  -0.351  14.762  1.00 0.00 ? 1095 ARG B HH12 7  
ATOM 10176 H HH21 . ARG A 1 51 ? 1.509   1.870   14.696  1.00 0.00 ? 1095 ARG B HH21 7  
ATOM 10177 H HH22 . ARG A 1 51 ? 0.911   0.367   15.314  1.00 0.00 ? 1095 ARG B HH22 7  
ATOM 10178 N N    . ASP A 1 52 ? 1.539   5.758   10.853  1.00 0.00 ? 1096 ASP B N    7  
ATOM 10179 C CA   . ASP A 1 52 ? 2.264   6.761   11.616  1.00 0.00 ? 1096 ASP B CA   7  
ATOM 10180 C C    . ASP A 1 52 ? 2.384   8.052   10.819  1.00 0.00 ? 1096 ASP B C    7  
ATOM 10181 O O    . ASP A 1 52 ? 2.278   9.145   11.375  1.00 0.00 ? 1096 ASP B O    7  
ATOM 10182 C CB   . ASP A 1 52 ? 3.658   6.251   11.980  1.00 0.00 ? 1096 ASP B CB   7  
ATOM 10183 C CG   . ASP A 1 52 ? 3.552   5.148   13.028  1.00 0.00 ? 1096 ASP B CG   7  
ATOM 10184 O OD1  . ASP A 1 52 ? 2.479   4.990   13.589  1.00 0.00 ? 1096 ASP B OD1  7  
ATOM 10185 O OD2  . ASP A 1 52 ? 4.544   4.475   13.255  1.00 0.00 ? 1096 ASP B OD2  7  
ATOM 10186 H H    . ASP A 1 52 ? 2.004   4.949   10.556  1.00 0.00 ? 1096 ASP B H    7  
ATOM 10187 H HA   . ASP A 1 52 ? 1.721   6.966   12.524  1.00 0.00 ? 1096 ASP B HA   7  
ATOM 10188 H HB2  . ASP A 1 52 ? 4.143   5.863   11.096  1.00 0.00 ? 1096 ASP B HB2  7  
ATOM 10189 H HB3  . ASP A 1 52 ? 4.243   7.066   12.381  1.00 0.00 ? 1096 ASP B HB3  7  
ATOM 10190 N N    . THR A 1 53 ? 2.613   7.924   9.513   1.00 0.00 ? 1097 THR B N    7  
ATOM 10191 C CA   . THR A 1 53 ? 2.753   9.099   8.668   1.00 0.00 ? 1097 THR B CA   7  
ATOM 10192 C C    . THR A 1 53 ? 1.477   9.927   8.695   1.00 0.00 ? 1097 THR B C    7  
ATOM 10193 O O    . THR A 1 53 ? 1.529   11.143  8.805   1.00 0.00 ? 1097 THR B O    7  
ATOM 10194 C CB   . THR A 1 53 ? 3.054   8.673   7.236   1.00 0.00 ? 1097 THR B CB   7  
ATOM 10195 O OG1  . THR A 1 53 ? 4.262   7.931   7.220   1.00 0.00 ? 1097 THR B OG1  7  
ATOM 10196 C CG2  . THR A 1 53 ? 3.202   9.914   6.352   1.00 0.00 ? 1097 THR B CG2  7  
ATOM 10197 H H    . THR A 1 53 ? 2.699   7.028   9.110   1.00 0.00 ? 1097 THR B H    7  
ATOM 10198 H HA   . THR A 1 53 ? 3.573   9.701   9.032   1.00 0.00 ? 1097 THR B HA   7  
ATOM 10199 H HB   . THR A 1 53 ? 2.248   8.063   6.862   1.00 0.00 ? 1097 THR B HB   7  
ATOM 10200 H HG1  . THR A 1 53 ? 4.499   7.727   8.127   1.00 0.00 ? 1097 THR B HG1  7  
ATOM 10201 H HG21 . THR A 1 53 ? 2.442   9.902   5.586   1.00 0.00 ? 1097 THR B HG21 7  
ATOM 10202 H HG22 . THR A 1 53 ? 4.179   9.914   5.891   1.00 0.00 ? 1097 THR B HG22 7  
ATOM 10203 H HG23 . THR A 1 53 ? 3.090   10.804  6.956   1.00 0.00 ? 1097 THR B HG23 7  
ATOM 10204 N N    . ILE A 1 54 ? 0.334   9.263   8.590   1.00 0.00 ? 1098 ILE B N    7  
ATOM 10205 C CA   . ILE A 1 54 ? -0.946  9.967   8.600   1.00 0.00 ? 1098 ILE B CA   7  
ATOM 10206 C C    . ILE A 1 54 ? -1.139  10.722  9.913   1.00 0.00 ? 1098 ILE B C    7  
ATOM 10207 O O    . ILE A 1 54 ? -1.517  11.893  9.916   1.00 0.00 ? 1098 ILE B O    7  
ATOM 10208 C CB   . ILE A 1 54 ? -2.084  8.964   8.421   1.00 0.00 ? 1098 ILE B CB   7  
ATOM 10209 C CG1  . ILE A 1 54 ? -2.028  8.393   7.007   1.00 0.00 ? 1098 ILE B CG1  7  
ATOM 10210 C CG2  . ILE A 1 54 ? -3.426  9.664   8.636   1.00 0.00 ? 1098 ILE B CG2  7  
ATOM 10211 C CD1  . ILE A 1 54 ? -2.975  7.196   6.895   1.00 0.00 ? 1098 ILE B CD1  7  
ATOM 10212 H H    . ILE A 1 54 ? 0.348   8.285   8.497   1.00 0.00 ? 1098 ILE B H    7  
ATOM 10213 H HA   . ILE A 1 54 ? -0.967  10.670  7.781   1.00 0.00 ? 1098 ILE B HA   7  
ATOM 10214 H HB   . ILE A 1 54 ? -1.975  8.164   9.138   1.00 0.00 ? 1098 ILE B HB   7  
ATOM 10215 H HG12 . ILE A 1 54 ? -2.320  9.154   6.301   1.00 0.00 ? 1098 ILE B HG12 7  
ATOM 10216 H HG13 . ILE A 1 54 ? -1.021  8.074   6.794   1.00 0.00 ? 1098 ILE B HG13 7  
ATOM 10217 H HG21 . ILE A 1 54 ? -3.807  9.416   9.616   1.00 0.00 ? 1098 ILE B HG21 7  
ATOM 10218 H HG22 . ILE A 1 54 ? -4.128  9.337   7.883   1.00 0.00 ? 1098 ILE B HG22 7  
ATOM 10219 H HG23 . ILE A 1 54 ? -3.291  10.731  8.563   1.00 0.00 ? 1098 ILE B HG23 7  
ATOM 10220 H HD11 . ILE A 1 54 ? -3.854  7.485   6.339   1.00 0.00 ? 1098 ILE B HD11 7  
ATOM 10221 H HD12 . ILE A 1 54 ? -3.263  6.873   7.885   1.00 0.00 ? 1098 ILE B HD12 7  
ATOM 10222 H HD13 . ILE A 1 54 ? -2.474  6.389   6.384   1.00 0.00 ? 1098 ILE B HD13 7  
ATOM 10223 N N    . ASN A 1 55 ? -0.874  10.046  11.025  1.00 0.00 ? 1099 ASN B N    7  
ATOM 10224 C CA   . ASN A 1 55 ? -1.026  10.663  12.341  1.00 0.00 ? 1099 ASN B CA   7  
ATOM 10225 C C    . ASN A 1 55 ? -0.082  11.851  12.500  1.00 0.00 ? 1099 ASN B C    7  
ATOM 10226 O O    . ASN A 1 55 ? -0.443  12.865  13.095  1.00 0.00 ? 1099 ASN B O    7  
ATOM 10227 C CB   . ASN A 1 55 ? -0.748  9.632   13.431  1.00 0.00 ? 1099 ASN B CB   7  
ATOM 10228 C CG   . ASN A 1 55 ? -1.982  8.760   13.638  1.00 0.00 ? 1099 ASN B CG   7  
ATOM 10229 O OD1  . ASN A 1 55 ? -2.761  8.996   14.561  1.00 0.00 ? 1099 ASN B OD1  7  
ATOM 10230 N ND2  . ASN A 1 55 ? -2.234  7.790   12.800  1.00 0.00 ? 1099 ASN B ND2  7  
ATOM 10231 H H    . ASN A 1 55 ? -0.570  9.113   10.963  1.00 0.00 ? 1099 ASN B H    7  
ATOM 10232 H HA   . ASN A 1 55 ? -2.043  11.011  12.447  1.00 0.00 ? 1099 ASN B HA   7  
ATOM 10233 H HB2  . ASN A 1 55 ? 0.086   9.012   13.135  1.00 0.00 ? 1099 ASN B HB2  7  
ATOM 10234 H HB3  . ASN A 1 55 ? -0.512  10.140  14.354  1.00 0.00 ? 1099 ASN B HB3  7  
ATOM 10235 H HD21 . ASN A 1 55 ? -1.636  7.631   12.038  1.00 0.00 ? 1099 ASN B HD21 7  
ATOM 10236 H HD22 . ASN A 1 55 ? -3.018  7.220   12.932  1.00 0.00 ? 1099 ASN B HD22 7  
ATOM 10237 N N    . THR A 1 56 ? 1.124   11.719  11.965  1.00 0.00 ? 1100 THR B N    7  
ATOM 10238 C CA   . THR A 1 56 ? 2.109   12.791  12.056  1.00 0.00 ? 1100 THR B CA   7  
ATOM 10239 C C    . THR A 1 56 ? 2.000   13.741  10.865  1.00 0.00 ? 1100 THR B C    7  
ATOM 10240 O O    . THR A 1 56 ? 2.732   14.727  10.783  1.00 0.00 ? 1100 THR B O    7  
ATOM 10241 C CB   . THR A 1 56 ? 3.515   12.194  12.106  1.00 0.00 ? 1100 THR B CB   7  
ATOM 10242 O OG1  . THR A 1 56 ? 3.750   11.440  10.925  1.00 0.00 ? 1100 THR B OG1  7  
ATOM 10243 C CG2  . THR A 1 56 ? 3.635   11.288  13.326  1.00 0.00 ? 1100 THR B CG2  7  
ATOM 10244 H H    . THR A 1 56 ? 1.357   10.887  11.497  1.00 0.00 ? 1100 THR B H    7  
ATOM 10245 H HA   . THR A 1 56 ? 1.937   13.347  12.962  1.00 0.00 ? 1100 THR B HA   7  
ATOM 10246 H HB   . THR A 1 56 ? 4.242   12.989  12.177  1.00 0.00 ? 1100 THR B HB   7  
ATOM 10247 H HG1  . THR A 1 56 ? 4.370   11.926  10.379  1.00 0.00 ? 1100 THR B HG1  7  
ATOM 10248 H HG21 . THR A 1 56 ? 4.623   10.858  13.359  1.00 0.00 ? 1100 THR B HG21 7  
ATOM 10249 H HG22 . THR A 1 56 ? 2.899   10.501  13.262  1.00 0.00 ? 1100 THR B HG22 7  
ATOM 10250 H HG23 . THR A 1 56 ? 3.463   11.869  14.220  1.00 0.00 ? 1100 THR B HG23 7  
ATOM 10251 N N    . SER A 1 57 ? 1.097   13.439  9.934   1.00 0.00 ? 1101 SER B N    7  
ATOM 10252 C CA   . SER A 1 57 ? 0.928   14.274  8.760   1.00 0.00 ? 1101 SER B CA   7  
ATOM 10253 C C    . SER A 1 57 ? 0.264   15.586  9.136   1.00 0.00 ? 1101 SER B C    7  
ATOM 10254 O O    . SER A 1 57 ? -0.784  15.606  9.783   1.00 0.00 ? 1101 SER B O    7  
ATOM 10255 C CB   . SER A 1 57 ? 0.070   13.547  7.728   1.00 0.00 ? 1101 SER B CB   7  
ATOM 10256 O OG   . SER A 1 57 ? -0.159  14.406  6.621   1.00 0.00 ? 1101 SER B OG   7  
ATOM 10257 H H    . SER A 1 57 ? 0.542   12.639  10.032  1.00 0.00 ? 1101 SER B H    7  
ATOM 10258 H HA   . SER A 1 57 ? 1.894   14.480  8.325   1.00 0.00 ? 1101 SER B HA   7  
ATOM 10259 H HB2  . SER A 1 57 ? 0.580   12.662  7.388   1.00 0.00 ? 1101 SER B HB2  7  
ATOM 10260 H HB3  . SER A 1 57 ? -0.868  13.266  8.180   1.00 0.00 ? 1101 SER B HB3  7  
ATOM 10261 H HG   . SER A 1 57 ? -0.803  15.067  6.887   1.00 0.00 ? 1101 SER B HG   7  
ATOM 10262 N N    . CYS A 1 58 ? 0.877   16.675  8.711   1.00 0.00 ? 1102 CYS B N    7  
ATOM 10263 C CA   . CYS A 1 58 ? 0.341   18.001  8.988   1.00 0.00 ? 1102 CYS B CA   7  
ATOM 10264 C C    . CYS A 1 58 ? -0.201  18.641  7.708   1.00 0.00 ? 1102 CYS B C    7  
ATOM 10265 O O    . CYS A 1 58 ? -0.771  19.731  7.747   1.00 0.00 ? 1102 CYS B O    7  
ATOM 10266 C CB   . CYS A 1 58 ? 1.427   18.895  9.591   1.00 0.00 ? 1102 CYS B CB   7  
ATOM 10267 S SG   . CYS A 1 58 ? 2.556   19.442  8.285   1.00 0.00 ? 1102 CYS B SG   7  
ATOM 10268 H H    . CYS A 1 58 ? 1.703   16.584  8.193   1.00 0.00 ? 1102 CYS B H    7  
ATOM 10269 H HA   . CYS A 1 58 ? -0.467  17.906  9.698   1.00 0.00 ? 1102 CYS B HA   7  
ATOM 10270 H HB2  . CYS A 1 58 ? 0.968   19.756  10.051  1.00 0.00 ? 1102 CYS B HB2  7  
ATOM 10271 H HB3  . CYS A 1 58 ? 1.980   18.339  10.335  1.00 0.00 ? 1102 CYS B HB3  7  
ATOM 10272 H HG   . CYS A 1 58 ? 2.434   20.387  8.166   1.00 0.00 ? 1102 CYS B HG   7  
ATOM 10273 N N    . ASP A 1 59 ? -0.017  17.961  6.574   1.00 0.00 ? 1103 ASP B N    7  
ATOM 10274 C CA   . ASP A 1 59 ? -0.492  18.481  5.297   1.00 0.00 ? 1103 ASP B CA   7  
ATOM 10275 C C    . ASP A 1 59 ? -1.627  17.618  4.753   1.00 0.00 ? 1103 ASP B C    7  
ATOM 10276 O O    . ASP A 1 59 ? -1.579  16.389  4.825   1.00 0.00 ? 1103 ASP B O    7  
ATOM 10277 C CB   . ASP A 1 59 ? 0.659   18.509  4.291   1.00 0.00 ? 1103 ASP B CB   7  
ATOM 10278 C CG   . ASP A 1 59 ? 1.656   19.600  4.667   1.00 0.00 ? 1103 ASP B CG   7  
ATOM 10279 O OD1  . ASP A 1 59 ? 1.297   20.457  5.459   1.00 0.00 ? 1103 ASP B OD1  7  
ATOM 10280 O OD2  . ASP A 1 59 ? 2.766   19.560  4.162   1.00 0.00 ? 1103 ASP B OD2  7  
ATOM 10281 H H    . ASP A 1 59 ? 0.443   17.096  6.596   1.00 0.00 ? 1103 ASP B H    7  
ATOM 10282 H HA   . ASP A 1 59 ? -0.855  19.488  5.439   1.00 0.00 ? 1103 ASP B HA   7  
ATOM 10283 H HB2  . ASP A 1 59 ? 1.157   17.551  4.295   1.00 0.00 ? 1103 ASP B HB2  7  
ATOM 10284 H HB3  . ASP A 1 59 ? 0.269   18.706  3.303   1.00 0.00 ? 1103 ASP B HB3  7  
ATOM 10285 N N    . ILE A 1 60 ? -2.648  18.266  4.206   1.00 0.00 ? 1104 ILE B N    7  
ATOM 10286 C CA   . ILE A 1 60 ? -3.783  17.546  3.654   1.00 0.00 ? 1104 ILE B CA   7  
ATOM 10287 C C    . ILE A 1 60 ? -3.383  16.796  2.385   1.00 0.00 ? 1104 ILE B C    7  
ATOM 10288 O O    . ILE A 1 60 ? -3.976  15.773  2.046   1.00 0.00 ? 1104 ILE B O    7  
ATOM 10289 C CB   . ILE A 1 60 ? -4.915  18.530  3.343   1.00 0.00 ? 1104 ILE B CB   7  
ATOM 10290 C CG1  . ILE A 1 60 ? -4.421  19.594  2.355   1.00 0.00 ? 1104 ILE B CG1  7  
ATOM 10291 C CG2  . ILE A 1 60 ? -5.375  19.209  4.635   1.00 0.00 ? 1104 ILE B CG2  7  
ATOM 10292 C CD1  . ILE A 1 60 ? -5.600  20.451  1.892   1.00 0.00 ? 1104 ILE B CD1  7  
ATOM 10293 H H    . ILE A 1 60 ? -2.638  19.246  4.173   1.00 0.00 ? 1104 ILE B H    7  
ATOM 10294 H HA   . ILE A 1 60 ? -4.133  16.833  4.386   1.00 0.00 ? 1104 ILE B HA   7  
ATOM 10295 H HB   . ILE A 1 60 ? -5.743  17.993  2.909   1.00 0.00 ? 1104 ILE B HB   7  
ATOM 10296 H HG12 . ILE A 1 60 ? -3.687  20.221  2.840   1.00 0.00 ? 1104 ILE B HG12 7  
ATOM 10297 H HG13 . ILE A 1 60 ? -3.974  19.113  1.501   1.00 0.00 ? 1104 ILE B HG13 7  
ATOM 10298 H HG21 . ILE A 1 60 ? -4.906  20.177  4.719   1.00 0.00 ? 1104 ILE B HG21 7  
ATOM 10299 H HG22 . ILE A 1 60 ? -5.100  18.599  5.482   1.00 0.00 ? 1104 ILE B HG22 7  
ATOM 10300 H HG23 . ILE A 1 60 ? -6.448  19.332  4.614   1.00 0.00 ? 1104 ILE B HG23 7  
ATOM 10301 H HD11 . ILE A 1 60 ? -5.660  20.426  0.813   1.00 0.00 ? 1104 ILE B HD11 7  
ATOM 10302 H HD12 . ILE A 1 60 ? -5.456  21.470  2.220   1.00 0.00 ? 1104 ILE B HD12 7  
ATOM 10303 H HD13 . ILE A 1 60 ? -6.516  20.062  2.312   1.00 0.00 ? 1104 ILE B HD13 7  
ATOM 10304 N N    . GLU A 1 61 ? -2.377  17.315  1.690   1.00 0.00 ? 1105 GLU B N    7  
ATOM 10305 C CA   . GLU A 1 61 ? -1.909  16.689  0.461   1.00 0.00 ? 1105 GLU B CA   7  
ATOM 10306 C C    . GLU A 1 61 ? -1.336  15.305  0.750   1.00 0.00 ? 1105 GLU B C    7  
ATOM 10307 O O    . GLU A 1 61 ? -1.641  14.330  0.058   1.00 0.00 ? 1105 GLU B O    7  
ATOM 10308 C CB   . GLU A 1 61 ? -0.833  17.569  -0.190  1.00 0.00 ? 1105 GLU B CB   7  
ATOM 10309 C CG   . GLU A 1 61 ? -1.478  18.839  -0.756  1.00 0.00 ? 1105 GLU B CG   7  
ATOM 10310 C CD   . GLU A 1 61 ? -0.399  19.805  -1.239  1.00 0.00 ? 1105 GLU B CD   7  
ATOM 10311 O OE1  . GLU A 1 61 ? 0.758   19.571  -0.934  1.00 0.00 ? 1105 GLU B OE1  7  
ATOM 10312 O OE2  . GLU A 1 61 ? -0.747  20.767  -1.904  1.00 0.00 ? 1105 GLU B OE2  7  
ATOM 10313 H H    . GLU A 1 61 ? -1.945  18.125  2.011   1.00 0.00 ? 1105 GLU B H    7  
ATOM 10314 H HA   . GLU A 1 61 ? -2.740  16.588  -0.219  1.00 0.00 ? 1105 GLU B HA   7  
ATOM 10315 H HB2  . GLU A 1 61 ? -0.097  17.842  0.551   1.00 0.00 ? 1105 GLU B HB2  7  
ATOM 10316 H HB3  . GLU A 1 61 ? -0.354  17.024  -0.989  1.00 0.00 ? 1105 GLU B HB3  7  
ATOM 10317 H HG2  . GLU A 1 61 ? -2.119  18.575  -1.586  1.00 0.00 ? 1105 GLU B HG2  7  
ATOM 10318 H HG3  . GLU A 1 61 ? -2.067  19.317  0.012   1.00 0.00 ? 1105 GLU B HG3  7  
ATOM 10319 N N    . LEU A 1 62 ? -0.517  15.222  1.788   1.00 0.00 ? 1106 LEU B N    7  
ATOM 10320 C CA   . LEU A 1 62 ? 0.079   13.957  2.168   1.00 0.00 ? 1106 LEU B CA   7  
ATOM 10321 C C    . LEU A 1 62 ? -1.003  12.990  2.637   1.00 0.00 ? 1106 LEU B C    7  
ATOM 10322 O O    . LEU A 1 62 ? -0.959  11.796  2.341   1.00 0.00 ? 1106 LEU B O    7  
ATOM 10323 C CB   . LEU A 1 62 ? 1.101   14.166  3.286   1.00 0.00 ? 1106 LEU B CB   7  
ATOM 10324 C CG   . LEU A 1 62 ? 1.757   12.831  3.634   1.00 0.00 ? 1106 LEU B CG   7  
ATOM 10325 C CD1  . LEU A 1 62 ? 2.606   12.355  2.455   1.00 0.00 ? 1106 LEU B CD1  7  
ATOM 10326 C CD2  . LEU A 1 62 ? 2.647   13.008  4.867   1.00 0.00 ? 1106 LEU B CD2  7  
ATOM 10327 H H    . LEU A 1 62 ? -0.315  16.026  2.311   1.00 0.00 ? 1106 LEU B H    7  
ATOM 10328 H HA   . LEU A 1 62 ? 0.577   13.534  1.310   1.00 0.00 ? 1106 LEU B HA   7  
ATOM 10329 H HB2  . LEU A 1 62 ? 1.855   14.865  2.954   1.00 0.00 ? 1106 LEU B HB2  7  
ATOM 10330 H HB3  . LEU A 1 62 ? 0.604   14.560  4.160   1.00 0.00 ? 1106 LEU B HB3  7  
ATOM 10331 H HG   . LEU A 1 62 ? 0.991   12.097  3.839   1.00 0.00 ? 1106 LEU B HG   7  
ATOM 10332 H HD11 . LEU A 1 62 ? 2.676   13.145  1.720   1.00 0.00 ? 1106 LEU B HD11 7  
ATOM 10333 H HD12 . LEU A 1 62 ? 2.146   11.487  2.008   1.00 0.00 ? 1106 LEU B HD12 7  
ATOM 10334 H HD13 . LEU A 1 62 ? 3.596   12.100  2.803   1.00 0.00 ? 1106 LEU B HD13 7  
ATOM 10335 H HD21 . LEU A 1 62 ? 3.654   12.692  4.635   1.00 0.00 ? 1106 LEU B HD21 7  
ATOM 10336 H HD22 . LEU A 1 62 ? 2.261   12.409  5.679   1.00 0.00 ? 1106 LEU B HD22 7  
ATOM 10337 H HD23 . LEU A 1 62 ? 2.656   14.049  5.158   1.00 0.00 ? 1106 LEU B HD23 7  
ATOM 10338 N N    . LEU A 1 63 ? -1.964  13.520  3.385   1.00 0.00 ? 1107 LEU B N    7  
ATOM 10339 C CA   . LEU A 1 63 ? -3.050  12.701  3.913   1.00 0.00 ? 1107 LEU B CA   7  
ATOM 10340 C C    . LEU A 1 63 ? -3.829  12.077  2.766   1.00 0.00 ? 1107 LEU B C    7  
ATOM 10341 O O    . LEU A 1 63 ? -4.174  10.896  2.805   1.00 0.00 ? 1107 LEU B O    7  
ATOM 10342 C CB   . LEU A 1 63 ? -3.990  13.571  4.754   1.00 0.00 ? 1107 LEU B CB   7  
ATOM 10343 C CG   . LEU A 1 63 ? -3.275  14.002  6.034   1.00 0.00 ? 1107 LEU B CG   7  
ATOM 10344 C CD1  . LEU A 1 63 ? -4.081  15.098  6.729   1.00 0.00 ? 1107 LEU B CD1  7  
ATOM 10345 C CD2  . LEU A 1 63 ? -3.143  12.801  6.972   1.00 0.00 ? 1107 LEU B CD2  7  
ATOM 10346 H H    . LEU A 1 63 ? -1.935  14.476  3.596   1.00 0.00 ? 1107 LEU B H    7  
ATOM 10347 H HA   . LEU A 1 63 ? -2.639  11.919  4.532   1.00 0.00 ? 1107 LEU B HA   7  
ATOM 10348 H HB2  . LEU A 1 63 ? -4.277  14.446  4.188   1.00 0.00 ? 1107 LEU B HB2  7  
ATOM 10349 H HB3  . LEU A 1 63 ? -4.872  13.003  5.011   1.00 0.00 ? 1107 LEU B HB3  7  
ATOM 10350 H HG   . LEU A 1 63 ? -2.295  14.378  5.787   1.00 0.00 ? 1107 LEU B HG   7  
ATOM 10351 H HD11 . LEU A 1 63 ? -3.894  15.064  7.793   1.00 0.00 ? 1107 LEU B HD11 7  
ATOM 10352 H HD12 . LEU A 1 63 ? -5.134  14.946  6.543   1.00 0.00 ? 1107 LEU B HD12 7  
ATOM 10353 H HD13 . LEU A 1 63 ? -3.781  16.063  6.341   1.00 0.00 ? 1107 LEU B HD13 7  
ATOM 10354 H HD21 . LEU A 1 63 ? -3.990  12.144  6.838   1.00 0.00 ? 1107 LEU B HD21 7  
ATOM 10355 H HD22 . LEU A 1 63 ? -3.112  13.145  7.994   1.00 0.00 ? 1107 LEU B HD22 7  
ATOM 10356 H HD23 . LEU A 1 63 ? -2.232  12.267  6.744   1.00 0.00 ? 1107 LEU B HD23 7  
ATOM 10357 N N    . ALA A 1 64 ? -4.081  12.871  1.740   1.00 0.00 ? 1108 ALA B N    7  
ATOM 10358 C CA   . ALA A 1 64 ? -4.796  12.386  0.573   1.00 0.00 ? 1108 ALA B CA   7  
ATOM 10359 C C    . ALA A 1 64 ? -4.005  11.278  -0.114  1.00 0.00 ? 1108 ALA B C    7  
ATOM 10360 O O    . ALA A 1 64 ? -4.581  10.313  -0.615  1.00 0.00 ? 1108 ALA B O    7  
ATOM 10361 C CB   . ALA A 1 64 ? -5.041  13.534  -0.410  1.00 0.00 ? 1108 ALA B CB   7  
ATOM 10362 H H    . ALA A 1 64 ? -3.766  13.798  1.759   1.00 0.00 ? 1108 ALA B H    7  
ATOM 10363 H HA   . ALA A 1 64 ? -5.747  11.989  0.890   1.00 0.00 ? 1108 ALA B HA   7  
ATOM 10364 H HB1  . ALA A 1 64 ? -4.738  13.230  -1.402  1.00 0.00 ? 1108 ALA B HB1  7  
ATOM 10365 H HB2  . ALA A 1 64 ? -4.466  14.401  -0.107  1.00 0.00 ? 1108 ALA B HB2  7  
ATOM 10366 H HB3  . ALA A 1 64 ? -6.091  13.784  -0.418  1.00 0.00 ? 1108 ALA B HB3  7  
ATOM 10367 N N    . ALA A 1 65 ? -2.684  11.430  -0.146  1.00 0.00 ? 1109 ALA B N    7  
ATOM 10368 C CA   . ALA A 1 65 ? -1.831  10.441  -0.789  1.00 0.00 ? 1109 ALA B CA   7  
ATOM 10369 C C    . ALA A 1 65 ? -1.913  9.102   -0.067  1.00 0.00 ? 1109 ALA B C    7  
ATOM 10370 O O    . ALA A 1 65 ? -2.026  8.049   -0.695  1.00 0.00 ? 1109 ALA B O    7  
ATOM 10371 C CB   . ALA A 1 65 ? -0.383  10.942  -0.798  1.00 0.00 ? 1109 ALA B CB   7  
ATOM 10372 H H    . ALA A 1 65 ? -2.273  12.216  0.276   1.00 0.00 ? 1109 ALA B H    7  
ATOM 10373 H HA   . ALA A 1 65 ? -2.156  10.307  -1.808  1.00 0.00 ? 1109 ALA B HA   7  
ATOM 10374 H HB1  . ALA A 1 65 ? -0.290  11.757  -1.501  1.00 0.00 ? 1109 ALA B HB1  7  
ATOM 10375 H HB2  . ALA A 1 65 ? 0.278   10.138  -1.093  1.00 0.00 ? 1109 ALA B HB2  7  
ATOM 10376 H HB3  . ALA A 1 65 ? -0.116  11.288  0.192   1.00 0.00 ? 1109 ALA B HB3  7  
ATOM 10377 N N    . CYS A 1 66 ? -1.856  9.152   1.256   1.00 0.00 ? 1110 CYS B N    7  
ATOM 10378 C CA   . CYS A 1 66 ? -1.921  7.940   2.059   1.00 0.00 ? 1110 CYS B CA   7  
ATOM 10379 C C    . CYS A 1 66 ? -3.286  7.286   1.930   1.00 0.00 ? 1110 CYS B C    7  
ATOM 10380 O O    . CYS A 1 66 ? -3.398  6.066   1.835   1.00 0.00 ? 1110 CYS B O    7  
ATOM 10381 C CB   . CYS A 1 66 ? -1.643  8.278   3.516   1.00 0.00 ? 1110 CYS B CB   7  
ATOM 10382 S SG   . CYS A 1 66 ? 0.084   8.774   3.640   1.00 0.00 ? 1110 CYS B SG   7  
ATOM 10383 H H    . CYS A 1 66 ? -1.760  10.021  1.701   1.00 0.00 ? 1110 CYS B H    7  
ATOM 10384 H HA   . CYS A 1 66 ? -1.169  7.248   1.711   1.00 0.00 ? 1110 CYS B HA   7  
ATOM 10385 H HB2  . CYS A 1 66 ? -2.285  9.088   3.834   1.00 0.00 ? 1110 CYS B HB2  7  
ATOM 10386 H HB3  . CYS A 1 66 ? -1.820  7.409   4.133   1.00 0.00 ? 1110 CYS B HB3  7  
ATOM 10387 H HG   . CYS A 1 66 ? 0.315   9.179   2.796   1.00 0.00 ? 1110 CYS B HG   7  
ATOM 10388 N N    . ARG A 1 67 ? -4.322  8.115   1.923   1.00 0.00 ? 1111 ARG B N    7  
ATOM 10389 C CA   . ARG A 1 67 ? -5.682  7.616   1.801   1.00 0.00 ? 1111 ARG B CA   7  
ATOM 10390 C C    . ARG A 1 67 ? -5.860  6.888   0.476   1.00 0.00 ? 1111 ARG B C    7  
ATOM 10391 O O    . ARG A 1 67 ? -6.471  5.818   0.416   1.00 0.00 ? 1111 ARG B O    7  
ATOM 10392 C CB   . ARG A 1 67 ? -6.653  8.793   1.882   1.00 0.00 ? 1111 ARG B CB   7  
ATOM 10393 C CG   . ARG A 1 67 ? -6.715  9.313   3.321   1.00 0.00 ? 1111 ARG B CG   7  
ATOM 10394 C CD   . ARG A 1 67 ? -7.474  10.640  3.340   1.00 0.00 ? 1111 ARG B CD   7  
ATOM 10395 N NE   . ARG A 1 67 ? -7.576  11.151  4.704   1.00 0.00 ? 1111 ARG B NE   7  
ATOM 10396 C CZ   . ARG A 1 67 ? -7.994  12.395  4.957   1.00 0.00 ? 1111 ARG B CZ   7  
ATOM 10397 N NH1  . ARG A 1 67 ? -8.326  13.203  3.980   1.00 0.00 ? 1111 ARG B NH1  7  
ATOM 10398 N NH2  . ARG A 1 67 ? -8.071  12.813  6.189   1.00 0.00 ? 1111 ARG B NH2  7  
ATOM 10399 H H    . ARG A 1 67 ? -4.168  9.079   2.001   1.00 0.00 ? 1111 ARG B H    7  
ATOM 10400 H HA   . ARG A 1 67 ? -5.883  6.934   2.612   1.00 0.00 ? 1111 ARG B HA   7  
ATOM 10401 H HB2  . ARG A 1 67 ? -6.303  9.589   1.230   1.00 0.00 ? 1111 ARG B HB2  7  
ATOM 10402 H HB3  . ARG A 1 67 ? -7.637  8.473   1.571   1.00 0.00 ? 1111 ARG B HB3  7  
ATOM 10403 H HG2  . ARG A 1 67 ? -7.229  8.593   3.941   1.00 0.00 ? 1111 ARG B HG2  7  
ATOM 10404 H HG3  . ARG A 1 67 ? -5.717  9.462   3.696   1.00 0.00 ? 1111 ARG B HG3  7  
ATOM 10405 H HD2  . ARG A 1 67 ? -6.951  11.358  2.729   1.00 0.00 ? 1111 ARG B HD2  7  
ATOM 10406 H HD3  . ARG A 1 67 ? -8.466  10.486  2.939   1.00 0.00 ? 1111 ARG B HD3  7  
ATOM 10407 H HE   . ARG A 1 67 ? -7.333  10.567  5.453   1.00 0.00 ? 1111 ARG B HE   7  
ATOM 10408 H HH11 . ARG A 1 67 ? -8.272  12.899  3.032   1.00 0.00 ? 1111 ARG B HH11 7  
ATOM 10409 H HH12 . ARG A 1 67 ? -8.638  14.129  4.187   1.00 0.00 ? 1111 ARG B HH12 7  
ATOM 10410 H HH21 . ARG A 1 67 ? -7.817  12.204  6.940   1.00 0.00 ? 1111 ARG B HH21 7  
ATOM 10411 H HH22 . ARG A 1 67 ? -8.383  13.744  6.384   1.00 0.00 ? 1111 ARG B HH22 7  
ATOM 10412 N N    . GLU A 1 68 ? -5.310  7.464   -0.579  1.00 0.00 ? 1112 GLU B N    7  
ATOM 10413 C CA   . GLU A 1 68 ? -5.403  6.852   -1.892  1.00 0.00 ? 1112 GLU B CA   7  
ATOM 10414 C C    . GLU A 1 68 ? -4.651  5.527   -1.910  1.00 0.00 ? 1112 GLU B C    7  
ATOM 10415 O O    . GLU A 1 68 ? -5.115  4.553   -2.500  1.00 0.00 ? 1112 GLU B O    7  
ATOM 10416 C CB   . GLU A 1 68 ? -4.811  7.779   -2.946  1.00 0.00 ? 1112 GLU B CB   7  
ATOM 10417 C CG   . GLU A 1 68 ? -4.987  7.156   -4.334  1.00 0.00 ? 1112 GLU B CG   7  
ATOM 10418 C CD   . GLU A 1 68 ? -6.468  7.057   -4.683  1.00 0.00 ? 1112 GLU B CD   7  
ATOM 10419 O OE1  . GLU A 1 68 ? -7.256  7.721   -4.029  1.00 0.00 ? 1112 GLU B OE1  7  
ATOM 10420 O OE2  . GLU A 1 68 ? -6.792  6.325   -5.604  1.00 0.00 ? 1112 GLU B OE2  7  
ATOM 10421 H H    . GLU A 1 68 ? -4.828  8.311   -0.472  1.00 0.00 ? 1112 GLU B H    7  
ATOM 10422 H HA   . GLU A 1 68 ? -6.439  6.673   -2.124  1.00 0.00 ? 1112 GLU B HA   7  
ATOM 10423 H HB2  . GLU A 1 68 ? -5.314  8.734   -2.908  1.00 0.00 ? 1112 GLU B HB2  7  
ATOM 10424 H HB3  . GLU A 1 68 ? -3.759  7.915   -2.746  1.00 0.00 ? 1112 GLU B HB3  7  
ATOM 10425 H HG2  . GLU A 1 68 ? -4.486  7.771   -5.067  1.00 0.00 ? 1112 GLU B HG2  7  
ATOM 10426 H HG3  . GLU A 1 68 ? -4.555  6.167   -4.341  1.00 0.00 ? 1112 GLU B HG3  7  
ATOM 10427 N N    . GLU A 1 69 ? -3.480  5.495   -1.273  1.00 0.00 ? 1113 GLU B N    7  
ATOM 10428 C CA   . GLU A 1 69 ? -2.685  4.279   -1.245  1.00 0.00 ? 1113 GLU B CA   7  
ATOM 10429 C C    . GLU A 1 69 ? -3.467  3.157   -0.576  1.00 0.00 ? 1113 GLU B C    7  
ATOM 10430 O O    . GLU A 1 69 ? -3.441  2.015   -1.027  1.00 0.00 ? 1113 GLU B O    7  
ATOM 10431 C CB   . GLU A 1 69 ? -1.382  4.529   -0.485  1.00 0.00 ? 1113 GLU B CB   7  
ATOM 10432 C CG   . GLU A 1 69 ? -0.545  3.249   -0.466  1.00 0.00 ? 1113 GLU B CG   7  
ATOM 10433 C CD   . GLU A 1 69 ? -0.192  2.837   -1.890  1.00 0.00 ? 1113 GLU B CD   7  
ATOM 10434 O OE1  . GLU A 1 69 ? -0.188  3.702   -2.751  1.00 0.00 ? 1113 GLU B OE1  7  
ATOM 10435 O OE2  . GLU A 1 69 ? 0.057   1.661   -2.100  1.00 0.00 ? 1113 GLU B OE2  7  
ATOM 10436 H H    . GLU A 1 69 ? -3.143  6.303   -0.820  1.00 0.00 ? 1113 GLU B H    7  
ATOM 10437 H HA   . GLU A 1 69 ? -2.450  3.989   -2.259  1.00 0.00 ? 1113 GLU B HA   7  
ATOM 10438 H HB2  . GLU A 1 69 ? -0.828  5.315   -0.974  1.00 0.00 ? 1113 GLU B HB2  7  
ATOM 10439 H HB3  . GLU A 1 69 ? -1.607  4.823   0.529   1.00 0.00 ? 1113 GLU B HB3  7  
ATOM 10440 H HG2  . GLU A 1 69 ? 0.364   3.426   0.091   1.00 0.00 ? 1113 GLU B HG2  7  
ATOM 10441 H HG3  . GLU A 1 69 ? -1.108  2.458   0.008   1.00 0.00 ? 1113 GLU B HG3  7  
ATOM 10442 N N    . PHE A 1 70 ? -4.164  3.495   0.497   1.00 0.00 ? 1114 PHE B N    7  
ATOM 10443 C CA   . PHE A 1 70 ? -4.951  2.509   1.218   1.00 0.00 ? 1114 PHE B CA   7  
ATOM 10444 C C    . PHE A 1 70 ? -6.052  1.955   0.325   1.00 0.00 ? 1114 PHE B C    7  
ATOM 10445 O O    . PHE A 1 70 ? -6.287  0.751   0.298   1.00 0.00 ? 1114 PHE B O    7  
ATOM 10446 C CB   . PHE A 1 70 ? -5.578  3.143   2.462   1.00 0.00 ? 1114 PHE B CB   7  
ATOM 10447 C CG   . PHE A 1 70 ? -4.589  3.127   3.610   1.00 0.00 ? 1114 PHE B CG   7  
ATOM 10448 C CD1  . PHE A 1 70 ? -3.210  3.158   3.358   1.00 0.00 ? 1114 PHE B CD1  7  
ATOM 10449 C CD2  . PHE A 1 70 ? -5.056  3.075   4.929   1.00 0.00 ? 1114 PHE B CD2  7  
ATOM 10450 C CE1  . PHE A 1 70 ? -2.302  3.134   4.427   1.00 0.00 ? 1114 PHE B CE1  7  
ATOM 10451 C CE2  . PHE A 1 70 ? -4.146  3.053   5.996   1.00 0.00 ? 1114 PHE B CE2  7  
ATOM 10452 C CZ   . PHE A 1 70 ? -2.770  3.081   5.745   1.00 0.00 ? 1114 PHE B CZ   7  
ATOM 10453 H H    . PHE A 1 70 ? -4.148  4.422   0.805   1.00 0.00 ? 1114 PHE B H    7  
ATOM 10454 H HA   . PHE A 1 70 ? -4.310  1.699   1.521   1.00 0.00 ? 1114 PHE B HA   7  
ATOM 10455 H HB2  . PHE A 1 70 ? -5.858  4.163   2.242   1.00 0.00 ? 1114 PHE B HB2  7  
ATOM 10456 H HB3  . PHE A 1 70 ? -6.460  2.583   2.738   1.00 0.00 ? 1114 PHE B HB3  7  
ATOM 10457 H HD1  . PHE A 1 70 ? -2.847  3.196   2.340   1.00 0.00 ? 1114 PHE B HD1  7  
ATOM 10458 H HD2  . PHE A 1 70 ? -6.117  3.052   5.126   1.00 0.00 ? 1114 PHE B HD2  7  
ATOM 10459 H HE1  . PHE A 1 70 ? -1.238  3.157   4.237   1.00 0.00 ? 1114 PHE B HE1  7  
ATOM 10460 H HE2  . PHE A 1 70 ? -4.507  3.012   7.013   1.00 0.00 ? 1114 PHE B HE2  7  
ATOM 10461 H HZ   . PHE A 1 70 ? -2.070  3.062   6.566   1.00 0.00 ? 1114 PHE B HZ   7  
ATOM 10462 N N    . HIS A 1 71 ? -6.716  2.833   -0.415  1.00 0.00 ? 1115 HIS B N    7  
ATOM 10463 C CA   . HIS A 1 71 ? -7.779  2.392   -1.308  1.00 0.00 ? 1115 HIS B CA   7  
ATOM 10464 C C    . HIS A 1 71 ? -7.232  1.458   -2.383  1.00 0.00 ? 1115 HIS B C    7  
ATOM 10465 O O    . HIS A 1 71 ? -7.821  0.415   -2.670  1.00 0.00 ? 1115 HIS B O    7  
ATOM 10466 C CB   . HIS A 1 71 ? -8.433  3.599   -1.972  1.00 0.00 ? 1115 HIS B CB   7  
ATOM 10467 C CG   . HIS A 1 71 ? -9.386  4.249   -1.009  1.00 0.00 ? 1115 HIS B CG   7  
ATOM 10468 N ND1  . HIS A 1 71 ? -10.529 3.608   -0.561  1.00 0.00 ? 1115 HIS B ND1  7  
ATOM 10469 C CD2  . HIS A 1 71 ? -9.387  5.483   -0.409  1.00 0.00 ? 1115 HIS B CD2  7  
ATOM 10470 C CE1  . HIS A 1 71 ? -11.167 4.450   0.270   1.00 0.00 ? 1115 HIS B CE1  7  
ATOM 10471 N NE2  . HIS A 1 71 ? -10.514 5.608   0.399   1.00 0.00 ? 1115 HIS B NE2  7  
ATOM 10472 H H    . HIS A 1 71 ? -6.486  3.787   -0.365  1.00 0.00 ? 1115 HIS B H    7  
ATOM 10473 H HA   . HIS A 1 71 ? -8.524  1.865   -0.729  1.00 0.00 ? 1115 HIS B HA   7  
ATOM 10474 H HB2  . HIS A 1 71 ? -7.671  4.310   -2.258  1.00 0.00 ? 1115 HIS B HB2  7  
ATOM 10475 H HB3  . HIS A 1 71 ? -8.973  3.279   -2.851  1.00 0.00 ? 1115 HIS B HB3  7  
ATOM 10476 H HD1  . HIS A 1 71 ? -10.819 2.705   -0.805  1.00 0.00 ? 1115 HIS B HD1  7  
ATOM 10477 H HD2  . HIS A 1 71 ? -8.628  6.240   -0.539  1.00 0.00 ? 1115 HIS B HD2  7  
ATOM 10478 H HE1  . HIS A 1 71 ? -12.092 4.217   0.776   1.00 0.00 ? 1115 HIS B HE1  7  
ATOM 10479 N N    . ARG A 1 72 ? -6.100  1.833   -2.969  1.00 0.00 ? 1116 ARG B N    7  
ATOM 10480 C CA   . ARG A 1 72 ? -5.486  1.015   -4.008  1.00 0.00 ? 1116 ARG B CA   7  
ATOM 10481 C C    . ARG A 1 72 ? -5.038  -0.325  -3.438  1.00 0.00 ? 1116 ARG B C    7  
ATOM 10482 O O    . ARG A 1 72 ? -5.227  -1.372  -4.058  1.00 0.00 ? 1116 ARG B O    7  
ATOM 10483 C CB   . ARG A 1 72 ? -4.283  1.754   -4.600  1.00 0.00 ? 1116 ARG B CB   7  
ATOM 10484 C CG   . ARG A 1 72 ? -4.765  2.955   -5.420  1.00 0.00 ? 1116 ARG B CG   7  
ATOM 10485 C CD   . ARG A 1 72 ? -5.286  2.480   -6.778  1.00 0.00 ? 1116 ARG B CD   7  
ATOM 10486 N NE   . ARG A 1 72 ? -4.201  1.909   -7.565  1.00 0.00 ? 1116 ARG B NE   7  
ATOM 10487 C CZ   . ARG A 1 72 ? -4.428  1.295   -8.729  1.00 0.00 ? 1116 ARG B CZ   7  
ATOM 10488 N NH1  . ARG A 1 72 ? -5.642  1.184   -9.202  1.00 0.00 ? 1116 ARG B NH1  7  
ATOM 10489 N NH2  . ARG A 1 72 ? -3.427  0.802   -9.403  1.00 0.00 ? 1116 ARG B NH2  7  
ATOM 10490 H H    . ARG A 1 72 ? -5.669  2.671   -2.696  1.00 0.00 ? 1116 ARG B H    7  
ATOM 10491 H HA   . ARG A 1 72 ? -6.210  0.838   -4.786  1.00 0.00 ? 1116 ARG B HA   7  
ATOM 10492 H HB2  . ARG A 1 72 ? -3.644  2.098   -3.798  1.00 0.00 ? 1116 ARG B HB2  7  
ATOM 10493 H HB3  . ARG A 1 72 ? -3.728  1.084   -5.238  1.00 0.00 ? 1116 ARG B HB3  7  
ATOM 10494 H HG2  . ARG A 1 72 ? -5.560  3.456   -4.887  1.00 0.00 ? 1116 ARG B HG2  7  
ATOM 10495 H HG3  . ARG A 1 72 ? -3.945  3.639   -5.570  1.00 0.00 ? 1116 ARG B HG3  7  
ATOM 10496 H HD2  . ARG A 1 72 ? -6.047  1.732   -6.632  1.00 0.00 ? 1116 ARG B HD2  7  
ATOM 10497 H HD3  . ARG A 1 72 ? -5.712  3.319   -7.308  1.00 0.00 ? 1116 ARG B HD3  7  
ATOM 10498 H HE   . ARG A 1 72 ? -3.280  1.977   -7.232  1.00 0.00 ? 1116 ARG B HE   7  
ATOM 10499 H HH11 . ARG A 1 72 ? -6.419  1.556   -8.696  1.00 0.00 ? 1116 ARG B HH11 7  
ATOM 10500 H HH12 . ARG A 1 72 ? -5.797  0.722   -10.076 1.00 0.00 ? 1116 ARG B HH12 7  
ATOM 10501 H HH21 . ARG A 1 72 ? -2.496  0.883   -9.049  1.00 0.00 ? 1116 ARG B HH21 7  
ATOM 10502 H HH22 . ARG A 1 72 ? -3.592  0.342   -10.275 1.00 0.00 ? 1116 ARG B HH22 7  
ATOM 10503 N N    . ARG A 1 73 ? -4.457  -0.285  -2.245  1.00 0.00 ? 1117 ARG B N    7  
ATOM 10504 C CA   . ARG A 1 73 ? -4.001  -1.502  -1.590  1.00 0.00 ? 1117 ARG B CA   7  
ATOM 10505 C C    . ARG A 1 73 ? -5.176  -2.414  -1.262  1.00 0.00 ? 1117 ARG B C    7  
ATOM 10506 O O    . ARG A 1 73 ? -5.103  -3.627  -1.453  1.00 0.00 ? 1117 ARG B O    7  
ATOM 10507 C CB   . ARG A 1 73 ? -3.228  -1.154  -0.316  1.00 0.00 ? 1117 ARG B CB   7  
ATOM 10508 C CG   . ARG A 1 73 ? -1.839  -0.633  -0.693  1.00 0.00 ? 1117 ARG B CG   7  
ATOM 10509 C CD   . ARG A 1 73 ? -1.026  -0.430  0.587   1.00 0.00 ? 1117 ARG B CD   7  
ATOM 10510 N NE   . ARG A 1 73 ? 0.364   -0.114  0.275   1.00 0.00 ? 1117 ARG B NE   7  
ATOM 10511 C CZ   . ARG A 1 73 ? 1.331   -0.268  1.180   1.00 0.00 ? 1117 ARG B CZ   7  
ATOM 10512 N NH1  . ARG A 1 73 ? 1.066   -0.697  2.389   1.00 0.00 ? 1117 ARG B NH1  7  
ATOM 10513 N NH2  . ARG A 1 73 ? 2.558   0.005   0.854   1.00 0.00 ? 1117 ARG B NH2  7  
ATOM 10514 H H    . ARG A 1 73 ? -4.346  0.574   -1.792  1.00 0.00 ? 1117 ARG B H    7  
ATOM 10515 H HA   . ARG A 1 73 ? -3.337  -2.024  -2.262  1.00 0.00 ? 1117 ARG B HA   7  
ATOM 10516 H HB2  . ARG A 1 73 ? -3.762  -0.384  0.231   1.00 0.00 ? 1117 ARG B HB2  7  
ATOM 10517 H HB3  . ARG A 1 73 ? -3.127  -2.035  0.300   1.00 0.00 ? 1117 ARG B HB3  7  
ATOM 10518 H HG2  . ARG A 1 73 ? -1.344  -1.353  -1.328  1.00 0.00 ? 1117 ARG B HG2  7  
ATOM 10519 H HG3  . ARG A 1 73 ? -1.930  0.304   -1.215  1.00 0.00 ? 1117 ARG B HG3  7  
ATOM 10520 H HD2  . ARG A 1 73 ? -1.455  0.382   1.152   1.00 0.00 ? 1117 ARG B HD2  7  
ATOM 10521 H HD3  . ARG A 1 73 ? -1.066  -1.333  1.178   1.00 0.00 ? 1117 ARG B HD3  7  
ATOM 10522 H HE   . ARG A 1 73 ? 0.595   0.228   -0.619  1.00 0.00 ? 1117 ARG B HE   7  
ATOM 10523 H HH11 . ARG A 1 73 ? 0.131   -0.917  2.655   1.00 0.00 ? 1117 ARG B HH11 7  
ATOM 10524 H HH12 . ARG A 1 73 ? 1.807   -0.806  3.051   1.00 0.00 ? 1117 ARG B HH12 7  
ATOM 10525 H HH21 . ARG A 1 73 ? 2.768   0.329   -0.064  1.00 0.00 ? 1117 ARG B HH21 7  
ATOM 10526 H HH22 . ARG A 1 73 ? 3.292   -0.119  1.522   1.00 0.00 ? 1117 ARG B HH22 7  
ATOM 10527 N N    . LEU A 1 74 ? -6.264  -1.824  -0.779  1.00 0.00 ? 1118 LEU B N    7  
ATOM 10528 C CA   . LEU A 1 74 ? -7.447  -2.603  -0.444  1.00 0.00 ? 1118 LEU B CA   7  
ATOM 10529 C C    . LEU A 1 74 ? -8.036  -3.262  -1.691  1.00 0.00 ? 1118 LEU B C    7  
ATOM 10530 O O    . LEU A 1 74 ? -8.449  -4.421  -1.649  1.00 0.00 ? 1118 LEU B O    7  
ATOM 10531 C CB   . LEU A 1 74 ? -8.493  -1.702  0.216   1.00 0.00 ? 1118 LEU B CB   7  
ATOM 10532 C CG   . LEU A 1 74 ? -8.032  -1.326  1.626   1.00 0.00 ? 1118 LEU B CG   7  
ATOM 10533 C CD1  . LEU A 1 74 ? -8.924  -0.210  2.174   1.00 0.00 ? 1118 LEU B CD1  7  
ATOM 10534 C CD2  . LEU A 1 74 ? -8.143  -2.551  2.537   1.00 0.00 ? 1118 LEU B CD2  7  
ATOM 10535 H H    . LEU A 1 74 ? -6.273  -0.852  -0.657  1.00 0.00 ? 1118 LEU B H    7  
ATOM 10536 H HA   . LEU A 1 74 ? -7.165  -3.376  0.253   1.00 0.00 ? 1118 LEU B HA   7  
ATOM 10537 H HB2  . LEU A 1 74 ? -8.617  -0.805  -0.374  1.00 0.00 ? 1118 LEU B HB2  7  
ATOM 10538 H HB3  . LEU A 1 74 ? -9.433  -2.226  0.274   1.00 0.00 ? 1118 LEU B HB3  7  
ATOM 10539 H HG   . LEU A 1 74 ? -7.005  -0.987  1.596   1.00 0.00 ? 1118 LEU B HG   7  
ATOM 10540 H HD11 . LEU A 1 74 ? -8.645  0.007   3.194   1.00 0.00 ? 1118 LEU B HD11 7  
ATOM 10541 H HD12 . LEU A 1 74 ? -9.956  -0.526  2.142   1.00 0.00 ? 1118 LEU B HD12 7  
ATOM 10542 H HD13 . LEU A 1 74 ? -8.802  0.677   1.571   1.00 0.00 ? 1118 LEU B HD13 7  
ATOM 10543 H HD21 . LEU A 1 74 ? -8.253  -2.231  3.560   1.00 0.00 ? 1118 LEU B HD21 7  
ATOM 10544 H HD22 . LEU A 1 74 ? -7.250  -3.152  2.442   1.00 0.00 ? 1118 LEU B HD22 7  
ATOM 10545 H HD23 . LEU A 1 74 ? -9.002  -3.136  2.246   1.00 0.00 ? 1118 LEU B HD23 7  
ATOM 10546 N N    . LYS A 1 75 ? -8.066  -2.528  -2.800  1.00 0.00 ? 1119 LYS B N    7  
ATOM 10547 C CA   . LYS A 1 75 ? -8.596  -3.067  -4.040  1.00 0.00 ? 1119 LYS B CA   7  
ATOM 10548 C C    . LYS A 1 75 ? -7.785  -4.272  -4.498  1.00 0.00 ? 1119 LYS B C    7  
ATOM 10549 O O    . LYS A 1 75 ? -8.342  -5.299  -4.885  1.00 0.00 ? 1119 LYS B O    7  
ATOM 10550 C CB   . LYS A 1 75 ? -8.554  -1.984  -5.112  1.00 0.00 ? 1119 LYS B CB   7  
ATOM 10551 C CG   . LYS A 1 75 ? -9.101  -2.541  -6.421  1.00 0.00 ? 1119 LYS B CG   7  
ATOM 10552 C CD   . LYS A 1 75 ? -9.085  -1.448  -7.488  1.00 0.00 ? 1119 LYS B CD   7  
ATOM 10553 C CE   . LYS A 1 75 ? -9.598  -2.038  -8.792  1.00 0.00 ? 1119 LYS B CE   7  
ATOM 10554 N NZ   . LYS A 1 75 ? -9.604  -0.985  -9.852  1.00 0.00 ? 1119 LYS B NZ   7  
ATOM 10555 H H    . LYS A 1 75 ? -7.719  -1.613  -2.790  1.00 0.00 ? 1119 LYS B H    7  
ATOM 10556 H HA   . LYS A 1 75 ? -9.621  -3.367  -3.885  1.00 0.00 ? 1119 LYS B HA   7  
ATOM 10557 H HB2  . LYS A 1 75 ? -9.155  -1.144  -4.797  1.00 0.00 ? 1119 LYS B HB2  7  
ATOM 10558 H HB3  . LYS A 1 75 ? -7.533  -1.666  -5.257  1.00 0.00 ? 1119 LYS B HB3  7  
ATOM 10559 H HG2  . LYS A 1 75 ? -8.488  -3.368  -6.746  1.00 0.00 ? 1119 LYS B HG2  7  
ATOM 10560 H HG3  . LYS A 1 75 ? -10.115 -2.881  -6.272  1.00 0.00 ? 1119 LYS B HG3  7  
ATOM 10561 H HD2  . LYS A 1 75 ? -9.724  -0.633  -7.181  1.00 0.00 ? 1119 LYS B HD2  7  
ATOM 10562 H HD3  . LYS A 1 75 ? -8.076  -1.089  -7.625  1.00 0.00 ? 1119 LYS B HD3  7  
ATOM 10563 H HE2  . LYS A 1 75 ? -8.951  -2.850  -9.089  1.00 0.00 ? 1119 LYS B HE2  7  
ATOM 10564 H HE3  . LYS A 1 75 ? -10.597 -2.411  -8.643  1.00 0.00 ? 1119 LYS B HE3  7  
ATOM 10565 H HZ1  . LYS A 1 75 ? -9.773  -0.055  -9.416  1.00 0.00 ? 1119 LYS B HZ1  7  
ATOM 10566 H HZ2  . LYS A 1 75 ? -10.358 -1.188  -10.538 1.00 0.00 ? 1119 LYS B HZ2  7  
ATOM 10567 H HZ3  . LYS A 1 75 ? -8.685  -0.975  -10.338 1.00 0.00 ? 1119 LYS B HZ3  7  
ATOM 10568 N N    . VAL A 1 76 ? -6.463  -4.137  -4.454  1.00 0.00 ? 1120 VAL B N    7  
ATOM 10569 C CA   . VAL A 1 76 ? -5.582  -5.217  -4.869  1.00 0.00 ? 1120 VAL B CA   7  
ATOM 10570 C C    . VAL A 1 76 ? -5.762  -6.419  -3.957  1.00 0.00 ? 1120 VAL B C    7  
ATOM 10571 O O    . VAL A 1 76 ? -5.772  -7.562  -4.411  1.00 0.00 ? 1120 VAL B O    7  
ATOM 10572 C CB   . VAL A 1 76 ? -4.126  -4.754  -4.838  1.00 0.00 ? 1120 VAL B CB   7  
ATOM 10573 C CG1  . VAL A 1 76 ? -3.210  -5.950  -5.097  1.00 0.00 ? 1120 VAL B CG1  7  
ATOM 10574 C CG2  . VAL A 1 76 ? -3.904  -3.700  -5.925  1.00 0.00 ? 1120 VAL B CG2  7  
ATOM 10575 H H    . VAL A 1 76 ? -6.073  -3.296  -4.137  1.00 0.00 ? 1120 VAL B H    7  
ATOM 10576 H HA   . VAL A 1 76 ? -5.834  -5.504  -5.879  1.00 0.00 ? 1120 VAL B HA   7  
ATOM 10577 H HB   . VAL A 1 76 ? -3.901  -4.330  -3.870  1.00 0.00 ? 1120 VAL B HB   7  
ATOM 10578 H HG11 . VAL A 1 76 ? -2.440  -5.668  -5.800  1.00 0.00 ? 1120 VAL B HG11 7  
ATOM 10579 H HG12 . VAL A 1 76 ? -3.789  -6.764  -5.504  1.00 0.00 ? 1120 VAL B HG12 7  
ATOM 10580 H HG13 . VAL A 1 76 ? -2.753  -6.263  -4.173  1.00 0.00 ? 1120 VAL B HG13 7  
ATOM 10581 H HG21 . VAL A 1 76 ? -3.521  -2.796  -5.477  1.00 0.00 ? 1120 VAL B HG21 7  
ATOM 10582 H HG22 . VAL A 1 76 ? -4.842  -3.489  -6.417  1.00 0.00 ? 1120 VAL B HG22 7  
ATOM 10583 H HG23 . VAL A 1 76 ? -3.193  -4.073  -6.648  1.00 0.00 ? 1120 VAL B HG23 7  
ATOM 10584 N N    . TYR A 1 77 ? -5.899  -6.151  -2.665  1.00 0.00 ? 1121 TYR B N    7  
ATOM 10585 C CA   . TYR A 1 77 ? -6.076  -7.220  -1.689  1.00 0.00 ? 1121 TYR B CA   7  
ATOM 10586 C C    . TYR A 1 77 ? -7.316  -8.039  -2.030  1.00 0.00 ? 1121 TYR B C    7  
ATOM 10587 O O    . TYR A 1 77 ? -7.272  -9.269  -2.059  1.00 0.00 ? 1121 TYR B O    7  
ATOM 10588 C CB   . TYR A 1 77 ? -6.211  -6.626  -0.282  1.00 0.00 ? 1121 TYR B CB   7  
ATOM 10589 C CG   . TYR A 1 77 ? -6.429  -7.737  0.718   1.00 0.00 ? 1121 TYR B CG   7  
ATOM 10590 C CD1  . TYR A 1 77 ? -5.364  -8.573  1.074   1.00 0.00 ? 1121 TYR B CD1  7  
ATOM 10591 C CD2  . TYR A 1 77 ? -7.691  -7.928  1.290   1.00 0.00 ? 1121 TYR B CD2  7  
ATOM 10592 C CE1  . TYR A 1 77 ? -5.563  -9.602  2.001   1.00 0.00 ? 1121 TYR B CE1  7  
ATOM 10593 C CE2  . TYR A 1 77 ? -7.889  -8.957  2.217   1.00 0.00 ? 1121 TYR B CE2  7  
ATOM 10594 C CZ   . TYR A 1 77 ? -6.825  -9.794  2.572   1.00 0.00 ? 1121 TYR B CZ   7  
ATOM 10595 O OH   . TYR A 1 77 ? -7.019  -10.810 3.484   1.00 0.00 ? 1121 TYR B OH   7  
ATOM 10596 H H    . TYR A 1 77 ? -5.880  -5.219  -2.361  1.00 0.00 ? 1121 TYR B H    7  
ATOM 10597 H HA   . TYR A 1 77 ? -5.212  -7.866  -1.716  1.00 0.00 ? 1121 TYR B HA   7  
ATOM 10598 H HB2  . TYR A 1 77 ? -5.308  -6.088  -0.030  1.00 0.00 ? 1121 TYR B HB2  7  
ATOM 10599 H HB3  . TYR A 1 77 ? -7.052  -5.949  -0.254  1.00 0.00 ? 1121 TYR B HB3  7  
ATOM 10600 H HD1  . TYR A 1 77 ? -4.390  -8.424  0.633   1.00 0.00 ? 1121 TYR B HD1  7  
ATOM 10601 H HD2  . TYR A 1 77 ? -8.513  -7.281  1.017   1.00 0.00 ? 1121 TYR B HD2  7  
ATOM 10602 H HE1  . TYR A 1 77 ? -4.741  -10.246 2.275   1.00 0.00 ? 1121 TYR B HE1  7  
ATOM 10603 H HE2  . TYR A 1 77 ? -8.864  -9.107  2.659   1.00 0.00 ? 1121 TYR B HE2  7  
ATOM 10604 H HH   . TYR A 1 77 ? -7.022  -10.423 4.361   1.00 0.00 ? 1121 TYR B HH   7  
ATOM 10605 N N    . HIS A 1 78 ? -8.417  -7.346  -2.299  1.00 0.00 ? 1122 HIS B N    7  
ATOM 10606 C CA   . HIS A 1 78 ? -9.663  -8.016  -2.654  1.00 0.00 ? 1122 HIS B CA   7  
ATOM 10607 C C    . HIS A 1 78 ? -9.487  -8.824  -3.936  1.00 0.00 ? 1122 HIS B C    7  
ATOM 10608 O O    . HIS A 1 78 ? -9.903  -9.982  -4.018  1.00 0.00 ? 1122 HIS B O    7  
ATOM 10609 C CB   . HIS A 1 78 ? -10.780 -6.987  -2.841  1.00 0.00 ? 1122 HIS B CB   7  
ATOM 10610 C CG   . HIS A 1 78 ? -12.049 -7.692  -3.235  1.00 0.00 ? 1122 HIS B CG   7  
ATOM 10611 N ND1  . HIS A 1 78 ? -12.789 -8.441  -2.333  1.00 0.00 ? 1122 HIS B ND1  7  
ATOM 10612 C CD2  . HIS A 1 78 ? -12.720 -7.775  -4.430  1.00 0.00 ? 1122 HIS B CD2  7  
ATOM 10613 C CE1  . HIS A 1 78 ? -13.852 -8.936  -2.993  1.00 0.00 ? 1122 HIS B CE1  7  
ATOM 10614 N NE2  . HIS A 1 78 ? -13.859 -8.560  -4.276  1.00 0.00 ? 1122 HIS B NE2  7  
ATOM 10615 H H    . HIS A 1 78 ? -8.385  -6.366  -2.273  1.00 0.00 ? 1122 HIS B H    7  
ATOM 10616 H HA   . HIS A 1 78 ? -9.939  -8.686  -1.855  1.00 0.00 ? 1122 HIS B HA   7  
ATOM 10617 H HB2  . HIS A 1 78 ? -10.937 -6.454  -1.916  1.00 0.00 ? 1122 HIS B HB2  7  
ATOM 10618 H HB3  . HIS A 1 78 ? -10.502 -6.289  -3.617  1.00 0.00 ? 1122 HIS B HB3  7  
ATOM 10619 H HD1  . HIS A 1 78 ? -12.577 -8.584  -1.386  1.00 0.00 ? 1122 HIS B HD1  7  
ATOM 10620 H HD2  . HIS A 1 78 ? -12.410 -7.304  -5.351  1.00 0.00 ? 1122 HIS B HD2  7  
ATOM 10621 H HE1  . HIS A 1 78 ? -14.611 -9.558  -2.541  1.00 0.00 ? 1122 HIS B HE1  7  
ATOM 10622 N N    . ALA A 1 79 ? -8.867  -8.206  -4.936  1.00 0.00 ? 1123 ALA B N    7  
ATOM 10623 C CA   . ALA A 1 79 ? -8.648  -8.880  -6.209  1.00 0.00 ? 1123 ALA B CA   7  
ATOM 10624 C C    . ALA A 1 79 ? -7.801  -10.136 -6.010  1.00 0.00 ? 1123 ALA B C    7  
ATOM 10625 O O    . ALA A 1 79 ? -8.072  -11.172 -6.608  1.00 0.00 ? 1123 ALA B O    7  
ATOM 10626 C CB   . ALA A 1 79 ? -7.947  -7.934  -7.188  1.00 0.00 ? 1123 ALA B CB   7  
ATOM 10627 H H    . ALA A 1 79 ? -8.559  -7.283  -4.822  1.00 0.00 ? 1123 ALA B H    7  
ATOM 10628 H HA   . ALA A 1 79 ? -9.604  -9.165  -6.624  1.00 0.00 ? 1123 ALA B HA   7  
ATOM 10629 H HB1  . ALA A 1 79 ? -7.081  -8.423  -7.606  1.00 0.00 ? 1123 ALA B HB1  7  
ATOM 10630 H HB2  . ALA A 1 79 ? -7.639  -7.038  -6.667  1.00 0.00 ? 1123 ALA B HB2  7  
ATOM 10631 H HB3  . ALA A 1 79 ? -8.630  -7.670  -7.982  1.00 0.00 ? 1123 ALA B HB3  7  
ATOM 10632 N N    . TRP A 1 80 ? -6.784  -10.049 -5.154  1.00 0.00 ? 1124 TRP B N    7  
ATOM 10633 C CA   . TRP A 1 80 ? -5.930  -11.189 -4.884  1.00 0.00 ? 1124 TRP B CA   7  
ATOM 10634 C C    . TRP A 1 80 ? -6.734  -12.343 -4.299  1.00 0.00 ? 1124 TRP B C    7  
ATOM 10635 O O    . TRP A 1 80 ? -6.587  -13.497 -4.708  1.00 0.00 ? 1124 TRP B O    7  
ATOM 10636 C CB   . TRP A 1 80 ? -4.824  -10.772 -3.918  1.00 0.00 ? 1124 TRP B CB   7  
ATOM 10637 C CG   . TRP A 1 80 ? -4.028  -11.966 -3.547  1.00 0.00 ? 1124 TRP B CG   7  
ATOM 10638 C CD1  . TRP A 1 80 ? -3.108  -12.538 -4.337  1.00 0.00 ? 1124 TRP B CD1  7  
ATOM 10639 C CD2  . TRP A 1 80 ? -4.042  -12.722 -2.309  1.00 0.00 ? 1124 TRP B CD2  7  
ATOM 10640 N NE1  . TRP A 1 80 ? -2.561  -13.623 -3.675  1.00 0.00 ? 1124 TRP B NE1  7  
ATOM 10641 C CE2  . TRP A 1 80 ? -3.104  -13.774 -2.413  1.00 0.00 ? 1124 TRP B CE2  7  
ATOM 10642 C CE3  . TRP A 1 80 ? -4.777  -12.598 -1.123  1.00 0.00 ? 1124 TRP B CE3  7  
ATOM 10643 C CZ2  . TRP A 1 80 ? -2.903  -14.675 -1.367  1.00 0.00 ? 1124 TRP B CZ2  7  
ATOM 10644 C CZ3  . TRP A 1 80 ? -4.576  -13.497 -0.067  1.00 0.00 ? 1124 TRP B CZ3  7  
ATOM 10645 C CH2  . TRP A 1 80 ? -3.642  -14.537 -0.188  1.00 0.00 ? 1124 TRP B CH2  7  
ATOM 10646 H H    . TRP A 1 80 ? -6.607  -9.211  -4.689  1.00 0.00 ? 1124 TRP B H    7  
ATOM 10647 H HA   . TRP A 1 80 ? -5.480  -11.511 -5.804  1.00 0.00 ? 1124 TRP B HA   7  
ATOM 10648 H HB2  . TRP A 1 80 ? -4.180  -10.047 -4.396  1.00 0.00 ? 1124 TRP B HB2  7  
ATOM 10649 H HB3  . TRP A 1 80 ? -5.260  -10.336 -3.029  1.00 0.00 ? 1124 TRP B HB3  7  
ATOM 10650 H HD1  . TRP A 1 80 ? -2.862  -12.211 -5.332  1.00 0.00 ? 1124 TRP B HD1  7  
ATOM 10651 H HE1  . TRP A 1 80 ? -1.870  -14.215 -4.036  1.00 0.00 ? 1124 TRP B HE1  7  
ATOM 10652 H HE3  . TRP A 1 80 ? -5.498  -11.798 -1.023  1.00 0.00 ? 1124 TRP B HE3  7  
ATOM 10653 H HZ2  . TRP A 1 80 ? -2.184  -15.476 -1.465  1.00 0.00 ? 1124 TRP B HZ2  7  
ATOM 10654 H HZ3  . TRP A 1 80 ? -5.143  -13.388 0.840   1.00 0.00 ? 1124 TRP B HZ3  7  
ATOM 10655 H HH2  . TRP A 1 80 ? -3.494  -15.228 0.628   1.00 0.00 ? 1124 TRP B HH2  7  
ATOM 10656 N N    . LYS A 1 81 ? -7.592  -12.032 -3.349  1.00 0.00 ? 1125 LYS B N    7  
ATOM 10657 C CA   . LYS A 1 81 ? -8.410  -13.057 -2.726  1.00 0.00 ? 1125 LYS B CA   7  
ATOM 10658 C C    . LYS A 1 81 ? -9.274  -13.755 -3.761  1.00 0.00 ? 1125 LYS B C    7  
ATOM 10659 O O    . LYS A 1 81 ? -9.444  -14.968 -3.720  1.00 0.00 ? 1125 LYS B O    7  
ATOM 10660 C CB   . LYS A 1 81 ? -9.300  -12.425 -1.655  1.00 0.00 ? 1125 LYS B CB   7  
ATOM 10661 C CG   . LYS A 1 81 ? -8.461  -12.032 -0.437  1.00 0.00 ? 1125 LYS B CG   7  
ATOM 10662 C CD   . LYS A 1 81 ? -8.049  -13.297 0.310   1.00 0.00 ? 1125 LYS B CD   7  
ATOM 10663 C CE   . LYS A 1 81 ? -7.427  -12.927 1.659   1.00 0.00 ? 1125 LYS B CE   7  
ATOM 10664 N NZ   . LYS A 1 81 ? -7.021  -14.167 2.384   1.00 0.00 ? 1125 LYS B NZ   7  
ATOM 10665 H H    . LYS A 1 81 ? -7.677  -11.097 -3.058  1.00 0.00 ? 1125 LYS B H    7  
ATOM 10666 H HA   . LYS A 1 81 ? -7.773  -13.787 -2.273  1.00 0.00 ? 1125 LYS B HA   7  
ATOM 10667 H HB2  . LYS A 1 81 ? -9.779  -11.545 -2.061  1.00 0.00 ? 1125 LYS B HB2  7  
ATOM 10668 H HB3  . LYS A 1 81 ? -10.055 -13.136 -1.352  1.00 0.00 ? 1125 LYS B HB3  7  
ATOM 10669 H HG2  . LYS A 1 81 ? -7.577  -11.499 -0.761  1.00 0.00 ? 1125 LYS B HG2  7  
ATOM 10670 H HG3  . LYS A 1 81 ? -9.042  -11.401 0.219   1.00 0.00 ? 1125 LYS B HG3  7  
ATOM 10671 H HD2  . LYS A 1 81 ? -8.922  -13.911 0.470   1.00 0.00 ? 1125 LYS B HD2  7  
ATOM 10672 H HD3  . LYS A 1 81 ? -7.330  -13.844 -0.279  1.00 0.00 ? 1125 LYS B HD3  7  
ATOM 10673 H HE2  . LYS A 1 81 ? -6.563  -12.301 1.500   1.00 0.00 ? 1125 LYS B HE2  7  
ATOM 10674 H HE3  . LYS A 1 81 ? -8.154  -12.388 2.249   1.00 0.00 ? 1125 LYS B HE3  7  
ATOM 10675 H HZ1  . LYS A 1 81 ? -7.646  -14.951 2.106   1.00 0.00 ? 1125 LYS B HZ1  7  
ATOM 10676 H HZ2  . LYS A 1 81 ? -7.099  -14.008 3.410   1.00 0.00 ? 1125 LYS B HZ2  7  
ATOM 10677 H HZ3  . LYS A 1 81 ? -6.041  -14.405 2.143   1.00 0.00 ? 1125 LYS B HZ3  7  
ATOM 10678 N N    . SER A 1 82 ? -9.795  -12.986 -4.694  1.00 0.00 ? 1126 SER B N    7  
ATOM 10679 C CA   . SER A 1 82 ? -10.634 -13.546 -5.745  1.00 0.00 ? 1126 SER B CA   7  
ATOM 10680 C C    . SER A 1 82 ? -9.784  -14.186 -6.835  1.00 0.00 ? 1126 SER B C    7  
ATOM 10681 O O    . SER A 1 82 ? -10.269 -15.017 -7.602  1.00 0.00 ? 1126 SER B O    7  
ATOM 10682 C CB   . SER A 1 82 ? -11.514 -12.456 -6.353  1.00 0.00 ? 1126 SER B CB   7  
ATOM 10683 O OG   . SER A 1 82 ? -12.371 -11.930 -5.349  1.00 0.00 ? 1126 SER B OG   7  
ATOM 10684 H H    . SER A 1 82 ? -9.596  -12.034 -4.684  1.00 0.00 ? 1126 SER B H    7  
ATOM 10685 H HA   . SER A 1 82 ? -11.269 -14.302 -5.313  1.00 0.00 ? 1126 SER B HA   7  
ATOM 10686 H HB2  . SER A 1 82 ? -10.895 -11.666 -6.744  1.00 0.00 ? 1126 SER B HB2  7  
ATOM 10687 H HB3  . SER A 1 82 ? -12.102 -12.879 -7.156  1.00 0.00 ? 1126 SER B HB3  7  
ATOM 10688 H HG   . SER A 1 82 ? -13.087 -11.462 -5.785  1.00 0.00 ? 1126 SER B HG   7  
ATOM 10689 N N    . LYS A 1 83 ? -8.515  -13.793 -6.907  1.00 0.00 ? 1127 LYS B N    7  
ATOM 10690 C CA   . LYS A 1 83 ? -7.620  -14.338 -7.920  1.00 0.00 ? 1127 LYS B CA   7  
ATOM 10691 C C    . LYS A 1 83 ? -7.287  -15.787 -7.590  1.00 0.00 ? 1127 LYS B C    7  
ATOM 10692 O O    . LYS A 1 83 ? -7.070  -16.603 -8.486  1.00 0.00 ? 1127 LYS B O    7  
ATOM 10693 C CB   . LYS A 1 83 ? -6.326  -13.502 -7.996  1.00 0.00 ? 1127 LYS B CB   7  
ATOM 10694 C CG   . LYS A 1 83 ? -5.162  -14.253 -7.331  1.00 0.00 ? 1127 LYS B CG   7  
ATOM 10695 C CD   . LYS A 1 83 ? -3.908  -13.381 -7.343  1.00 0.00 ? 1127 LYS B CD   7  
ATOM 10696 C CE   . LYS A 1 83 ? -3.331  -13.364 -8.753  1.00 0.00 ? 1127 LYS B CE   7  
ATOM 10697 N NZ   . LYS A 1 83 ? -2.078  -12.563 -8.758  1.00 0.00 ? 1127 LYS B NZ   7  
ATOM 10698 H H    . LYS A 1 83 ? -8.178  -13.125 -6.275  1.00 0.00 ? 1127 LYS B H    7  
ATOM 10699 H HA   . LYS A 1 83 ? -8.110  -14.304 -8.880  1.00 0.00 ? 1127 LYS B HA   7  
ATOM 10700 H HB2  . LYS A 1 83 ? -6.086  -13.301 -9.029  1.00 0.00 ? 1127 LYS B HB2  7  
ATOM 10701 H HB3  . LYS A 1 83 ? -6.479  -12.566 -7.480  1.00 0.00 ? 1127 LYS B HB3  7  
ATOM 10702 H HG2  . LYS A 1 83 ? -5.425  -14.493 -6.314  1.00 0.00 ? 1127 LYS B HG2  7  
ATOM 10703 H HG3  . LYS A 1 83 ? -4.955  -15.160 -7.880  1.00 0.00 ? 1127 LYS B HG3  7  
ATOM 10704 H HD2  . LYS A 1 83 ? -4.157  -12.378 -7.049  1.00 0.00 ? 1127 LYS B HD2  7  
ATOM 10705 H HD3  . LYS A 1 83 ? -3.177  -13.789 -6.662  1.00 0.00 ? 1127 LYS B HD3  7  
ATOM 10706 H HE2  . LYS A 1 83 ? -3.115  -14.375 -9.062  1.00 0.00 ? 1127 LYS B HE2  7  
ATOM 10707 H HE3  . LYS A 1 83 ? -4.046  -12.922 -9.429  1.00 0.00 ? 1127 LYS B HE3  7  
ATOM 10708 H HZ1  . LYS A 1 83 ? -2.115  -11.857 -7.995  1.00 0.00 ? 1127 LYS B HZ1  7  
ATOM 10709 H HZ2  . LYS A 1 83 ? -1.979  -12.081 -9.674  1.00 0.00 ? 1127 LYS B HZ2  7  
ATOM 10710 H HZ3  . LYS A 1 83 ? -1.264  -13.193 -8.605  1.00 0.00 ? 1127 LYS B HZ3  7  
ATOM 10711 N N    . ASN A 1 84 ? -7.220  -16.098 -6.300  1.00 0.00 ? 1128 ASN B N    7  
ATOM 10712 C CA   . ASN A 1 84 ? -6.881  -17.450 -5.879  1.00 0.00 ? 1128 ASN B CA   7  
ATOM 10713 C C    . ASN A 1 84 ? -8.135  -18.232 -5.502  1.00 0.00 ? 1128 ASN B C    7  
ATOM 10714 O O    . ASN A 1 84 ? -8.235  -19.428 -5.778  1.00 0.00 ? 1128 ASN B O    7  
ATOM 10715 C CB   . ASN A 1 84 ? -5.921  -17.397 -4.686  1.00 0.00 ? 1128 ASN B CB   7  
ATOM 10716 C CG   . ASN A 1 84 ? -6.679  -17.026 -3.422  1.00 0.00 ? 1128 ASN B CG   7  
ATOM 10717 O OD1  . ASN A 1 84 ? -7.351  -17.869 -2.827  1.00 0.00 ? 1128 ASN B OD1  7  
ATOM 10718 N ND2  . ASN A 1 84 ? -6.618  -15.803 -2.975  1.00 0.00 ? 1128 ASN B ND2  7  
ATOM 10719 H H    . ASN A 1 84 ? -7.378  -15.401 -5.623  1.00 0.00 ? 1128 ASN B H    7  
ATOM 10720 H HA   . ASN A 1 84 ? -6.385  -17.954 -6.695  1.00 0.00 ? 1128 ASN B HA   7  
ATOM 10721 H HB2  . ASN A 1 84 ? -5.457  -18.363 -4.556  1.00 0.00 ? 1128 ASN B HB2  7  
ATOM 10722 H HB3  . ASN A 1 84 ? -5.157  -16.656 -4.874  1.00 0.00 ? 1128 ASN B HB3  7  
ATOM 10723 H HD21 . ASN A 1 84 ? -6.086  -15.129 -3.458  1.00 0.00 ? 1128 ASN B HD21 7  
ATOM 10724 H HD22 . ASN A 1 84 ? -7.102  -15.557 -2.159  1.00 0.00 ? 1128 ASN B HD22 7  
ATOM 10725 N N    . LYS A 1 85 ? -9.089  -17.553 -4.875  1.00 0.00 ? 1129 LYS B N    7  
ATOM 10726 C CA   . LYS A 1 85 ? -10.332 -18.202 -4.475  1.00 0.00 ? 1129 LYS B CA   7  
ATOM 10727 C C    . LYS A 1 85 ? -11.176 -18.513 -5.696  1.00 0.00 ? 1129 LYS B C    7  
ATOM 10728 O O    . LYS A 1 85 ? -11.792 -19.576 -5.789  1.00 0.00 ? 1129 LYS B O    7  
ATOM 10729 C CB   . LYS A 1 85 ? -11.114 -17.293 -3.531  1.00 0.00 ? 1129 LYS B CB   7  
ATOM 10730 C CG   . LYS A 1 85 ? -10.363 -17.186 -2.202  1.00 0.00 ? 1129 LYS B CG   7  
ATOM 10731 C CD   . LYS A 1 85 ? -11.099 -16.218 -1.281  1.00 0.00 ? 1129 LYS B CD   7  
ATOM 10732 C CE   . LYS A 1 85 ? -10.343 -16.104 0.046   1.00 0.00 ? 1129 LYS B CE   7  
ATOM 10733 N NZ   . LYS A 1 85 ? -10.386 -17.412 0.764   1.00 0.00 ? 1129 LYS B NZ   7  
ATOM 10734 H H    . LYS A 1 85 ? -8.961  -16.600 -4.687  1.00 0.00 ? 1129 LYS B H    7  
ATOM 10735 H HA   . LYS A 1 85 ? -10.100 -19.123 -3.963  1.00 0.00 ? 1129 LYS B HA   7  
ATOM 10736 H HB2  . LYS A 1 85 ? -11.222 -16.317 -3.974  1.00 0.00 ? 1129 LYS B HB2  7  
ATOM 10737 H HB3  . LYS A 1 85 ? -12.091 -17.714 -3.354  1.00 0.00 ? 1129 LYS B HB3  7  
ATOM 10738 H HG2  . LYS A 1 85 ? -10.312 -18.159 -1.738  1.00 0.00 ? 1129 LYS B HG2  7  
ATOM 10739 H HG3  . LYS A 1 85 ? -9.362  -16.820 -2.379  1.00 0.00 ? 1129 LYS B HG3  7  
ATOM 10740 H HD2  . LYS A 1 85 ? -11.154 -15.247 -1.754  1.00 0.00 ? 1129 LYS B HD2  7  
ATOM 10741 H HD3  . LYS A 1 85 ? -12.096 -16.587 -1.096  1.00 0.00 ? 1129 LYS B HD3  7  
ATOM 10742 H HE2  . LYS A 1 85 ? -9.315  -15.841 -0.151  1.00 0.00 ? 1129 LYS B HE2  7  
ATOM 10743 H HE3  . LYS A 1 85 ? -10.801 -15.341 0.659   1.00 0.00 ? 1129 LYS B HE3  7  
ATOM 10744 H HZ1  . LYS A 1 85 ? -10.902 -18.107 0.188   1.00 0.00 ? 1129 LYS B HZ1  7  
ATOM 10745 H HZ2  . LYS A 1 85 ? -10.869 -17.288 1.677   1.00 0.00 ? 1129 LYS B HZ2  7  
ATOM 10746 H HZ3  . LYS A 1 85 ? -9.417  -17.750 0.925   1.00 0.00 ? 1129 LYS B HZ3  7  
ATOM 10747 N N    . LYS A 1 86 ? -11.195 -17.573 -6.632  1.00 0.00 ? 1130 LYS B N    7  
ATOM 10748 C CA   . LYS A 1 86 ? -11.972 -17.754 -7.857  1.00 0.00 ? 1130 LYS B CA   7  
ATOM 10749 C C    . LYS A 1 86 ? -11.063 -17.789 -9.081  1.00 0.00 ? 1130 LYS B C    7  
ATOM 10750 O O    . LYS A 1 86 ? -10.135 -16.989 -9.205  1.00 0.00 ? 1130 LYS B O    7  
ATOM 10751 C CB   . LYS A 1 86 ? -12.994 -16.624 -8.010  1.00 0.00 ? 1130 LYS B CB   7  
ATOM 10752 C CG   . LYS A 1 86 ? -13.940 -16.602 -6.805  1.00 0.00 ? 1130 LYS B CG   7  
ATOM 10753 C CD   . LYS A 1 86 ? -14.820 -17.854 -6.810  1.00 0.00 ? 1130 LYS B CD   7  
ATOM 10754 C CE   . LYS A 1 86 ? -15.870 -17.746 -5.703  1.00 0.00 ? 1130 LYS B CE   7  
ATOM 10755 N NZ   . LYS A 1 86 ? -16.761 -16.584 -5.978  1.00 0.00 ? 1130 LYS B NZ   7  
ATOM 10756 H H    . LYS A 1 86 ? -10.682 -16.741 -6.488  1.00 0.00 ? 1130 LYS B H    7  
ATOM 10757 H HA   . LYS A 1 86 ? -12.502 -18.691 -7.794  1.00 0.00 ? 1130 LYS B HA   7  
ATOM 10758 H HB2  . LYS A 1 86 ? -12.476 -15.678 -8.079  1.00 0.00 ? 1130 LYS B HB2  7  
ATOM 10759 H HB3  . LYS A 1 86 ? -13.568 -16.783 -8.910  1.00 0.00 ? 1130 LYS B HB3  7  
ATOM 10760 H HG2  . LYS A 1 86 ? -13.357 -16.574 -5.894  1.00 0.00 ? 1130 LYS B HG2  7  
ATOM 10761 H HG3  . LYS A 1 86 ? -14.567 -15.723 -6.856  1.00 0.00 ? 1130 LYS B HG3  7  
ATOM 10762 H HD2  . LYS A 1 86 ? -15.313 -17.945 -7.767  1.00 0.00 ? 1130 LYS B HD2  7  
ATOM 10763 H HD3  . LYS A 1 86 ? -14.210 -18.727 -6.635  1.00 0.00 ? 1130 LYS B HD3  7  
ATOM 10764 H HE2  . LYS A 1 86 ? -16.457 -18.651 -5.673  1.00 0.00 ? 1130 LYS B HE2  7  
ATOM 10765 H HE3  . LYS A 1 86 ? -15.378 -17.604 -4.752  1.00 0.00 ? 1130 LYS B HE3  7  
ATOM 10766 H HZ1  . LYS A 1 86 ? -16.804 -16.414 -7.003  1.00 0.00 ? 1130 LYS B HZ1  7  
ATOM 10767 H HZ2  . LYS A 1 86 ? -16.385 -15.738 -5.502  1.00 0.00 ? 1130 LYS B HZ2  7  
ATOM 10768 H HZ3  . LYS A 1 86 ? -17.716 -16.787 -5.624  1.00 0.00 ? 1130 LYS B HZ3  7  
ATOM 10769 N N    . ARG A 1 87 ? -11.346 -18.724 -9.987  1.00 0.00 ? 1131 ARG B N    7  
ATOM 10770 C CA   . ARG A 1 87 ? -10.555 -18.863 -11.207 1.00 0.00 ? 1131 ARG B CA   7  
ATOM 10771 C C    . ARG A 1 87 ? -11.451 -18.841 -12.441 1.00 0.00 ? 1131 ARG B C    7  
ATOM 10772 O O    . ARG A 1 87 ? -12.654 -18.954 -12.280 1.00 0.00 ? 1131 ARG B O    7  
ATOM 10773 C CB   . ARG A 1 87 ? -9.764  -20.171 -11.174 1.00 0.00 ? 1131 ARG B CB   7  
ATOM 10774 C CG   . ARG A 1 87 ? -8.615  -20.048 -10.174 1.00 0.00 ? 1131 ARG B CG   7  
ATOM 10775 C CD   . ARG A 1 87 ? -7.688  -21.254 -10.307 1.00 0.00 ? 1131 ARG B CD   7  
ATOM 10776 N NE   . ARG A 1 87 ? -8.375  -22.462 -9.861  1.00 0.00 ? 1131 ARG B NE   7  
ATOM 10777 C CZ   . ARG A 1 87 ? -8.439  -22.802 -8.571  1.00 0.00 ? 1131 ARG B CZ   7  
ATOM 10778 N NH1  . ARG A 1 87 ? -7.900  -22.049 -7.644  1.00 0.00 ? 1131 ARG B NH1  7  
ATOM 10779 N NH2  . ARG A 1 87 ? -9.060  -23.895 -8.223  1.00 0.00 ? 1131 ARG B NH2  7  
ATOM 10780 O OXT  . ARG A 1 87 ? -10.918 -18.713 -13.532 1.00 0.00 ? 1131 ARG B OXT  7  
ATOM 10781 H H    . ARG A 1 87 ? -12.098 -19.329 -9.829  1.00 0.00 ? 1131 ARG B H    7  
ATOM 10782 H HA   . ARG A 1 87 ? -9.860  -18.038 -11.265 1.00 0.00 ? 1131 ARG B HA   7  
ATOM 10783 H HB2  . ARG A 1 87 ? -10.417 -20.979 -10.878 1.00 0.00 ? 1131 ARG B HB2  7  
ATOM 10784 H HB3  . ARG A 1 87 ? -9.363  -20.374 -12.157 1.00 0.00 ? 1131 ARG B HB3  7  
ATOM 10785 H HG2  . ARG A 1 87 ? -8.062  -19.142 -10.369 1.00 0.00 ? 1131 ARG B HG2  7  
ATOM 10786 H HG3  . ARG A 1 87 ? -9.014  -20.017 -9.172  1.00 0.00 ? 1131 ARG B HG3  7  
ATOM 10787 H HD2  . ARG A 1 87 ? -7.402  -21.370 -11.343 1.00 0.00 ? 1131 ARG B HD2  7  
ATOM 10788 H HD3  . ARG A 1 87 ? -6.801  -21.097 -9.711  1.00 0.00 ? 1131 ARG B HD3  7  
ATOM 10789 H HE   . ARG A 1 87 ? -8.798  -23.042 -10.529 1.00 0.00 ? 1131 ARG B HE   7  
ATOM 10790 H HH11 . ARG A 1 87 ? -7.431  -21.206 -7.889  1.00 0.00 ? 1131 ARG B HH11 7  
ATOM 10791 H HH12 . ARG A 1 87 ? -7.959  -22.321 -6.686  1.00 0.00 ? 1131 ARG B HH12 7  
ATOM 10792 H HH21 . ARG A 1 87 ? -9.481  -24.473 -8.921  1.00 0.00 ? 1131 ARG B HH21 7  
ATOM 10793 H HH22 . ARG A 1 87 ? -9.114  -24.154 -7.258  1.00 0.00 ? 1131 ARG B HH22 7  
ATOM 10794 N N    . ILE B 2 9  ? 3.275   -18.639 1.560   1.00 0.00 ? 46   ILE A N    7  
ATOM 10795 C CA   . ILE B 2 9  ? 3.194   -18.331 0.105   1.00 0.00 ? 46   ILE A CA   7  
ATOM 10796 C C    . ILE B 2 9  ? 2.043   -17.361 -0.142  1.00 0.00 ? 46   ILE A C    7  
ATOM 10797 O O    . ILE B 2 9  ? 2.258   -16.166 -0.358  1.00 0.00 ? 46   ILE A O    7  
ATOM 10798 C CB   . ILE B 2 9  ? 2.964   -19.627 -0.677  1.00 0.00 ? 46   ILE A CB   7  
ATOM 10799 C CG1  . ILE B 2 9  ? 4.233   -20.484 -0.625  1.00 0.00 ? 46   ILE A CG1  7  
ATOM 10800 C CG2  . ILE B 2 9  ? 2.632   -19.293 -2.133  1.00 0.00 ? 46   ILE A CG2  7  
ATOM 10801 C CD1  . ILE B 2 9  ? 3.923   -21.894 -1.135  1.00 0.00 ? 46   ILE A CD1  7  
ATOM 10802 H H    . ILE B 2 9  ? 4.225   -18.408 1.911   1.00 0.00 ? 46   ILE A H    7  
ATOM 10803 H HA   . ILE B 2 9  ? 4.118   -17.878 -0.217  1.00 0.00 ? 46   ILE A HA   7  
ATOM 10804 H HB   . ILE B 2 9  ? 2.141   -20.172 -0.237  1.00 0.00 ? 46   ILE A HB   7  
ATOM 10805 H HG12 . ILE B 2 9  ? 4.995   -20.037 -1.247  1.00 0.00 ? 46   ILE A HG12 7  
ATOM 10806 H HG13 . ILE B 2 9  ? 4.587   -20.542 0.394   1.00 0.00 ? 46   ILE A HG13 7  
ATOM 10807 H HG21 . ILE B 2 9  ? 3.000   -20.077 -2.778  1.00 0.00 ? 46   ILE A HG21 7  
ATOM 10808 H HG22 . ILE B 2 9  ? 3.100   -18.358 -2.402  1.00 0.00 ? 46   ILE A HG22 7  
ATOM 10809 H HG23 . ILE B 2 9  ? 1.560   -19.207 -2.248  1.00 0.00 ? 46   ILE A HG23 7  
ATOM 10810 H HD11 . ILE B 2 9  ? 3.773   -22.556 -0.294  1.00 0.00 ? 46   ILE A HD11 7  
ATOM 10811 H HD12 . ILE B 2 9  ? 4.749   -22.252 -1.732  1.00 0.00 ? 46   ILE A HD12 7  
ATOM 10812 H HD13 . ILE B 2 9  ? 3.026   -21.869 -1.737  1.00 0.00 ? 46   ILE A HD13 7  
ATOM 10813 N N    . GLU B 2 10 ? 0.823   -17.880 -0.114  1.00 0.00 ? 47   GLU A N    7  
ATOM 10814 C CA   . GLU B 2 10 ? -0.351  -17.047 -0.339  1.00 0.00 ? 47   GLU A CA   7  
ATOM 10815 C C    . GLU B 2 10 ? -0.473  -15.982 0.745   1.00 0.00 ? 47   GLU A C    7  
ATOM 10816 O O    . GLU B 2 10 ? -0.781  -14.824 0.464   1.00 0.00 ? 47   GLU A O    7  
ATOM 10817 C CB   . GLU B 2 10 ? -1.606  -17.918 -0.331  1.00 0.00 ? 47   GLU A CB   7  
ATOM 10818 C CG   . GLU B 2 10 ? -1.626  -18.798 -1.580  1.00 0.00 ? 47   GLU A CG   7  
ATOM 10819 C CD   . GLU B 2 10 ? -2.782  -19.793 -1.503  1.00 0.00 ? 47   GLU A CD   7  
ATOM 10820 O OE1  . GLU B 2 10 ? -3.358  -19.922 -0.435  1.00 0.00 ? 47   GLU A OE1  7  
ATOM 10821 O OE2  . GLU B 2 10 ? -3.074  -20.411 -2.515  1.00 0.00 ? 47   GLU A OE2  7  
ATOM 10822 H H    . GLU B 2 10 ? 0.711   -18.837 0.060   1.00 0.00 ? 47   GLU A H    7  
ATOM 10823 H HA   . GLU B 2 10 ? -0.265  -16.566 -1.300  1.00 0.00 ? 47   GLU A HA   7  
ATOM 10824 H HB2  . GLU B 2 10 ? -1.601  -18.539 0.553   1.00 0.00 ? 47   GLU A HB2  7  
ATOM 10825 H HB3  . GLU B 2 10 ? -2.481  -17.285 -0.321  1.00 0.00 ? 47   GLU A HB3  7  
ATOM 10826 H HG2  . GLU B 2 10 ? -1.748  -18.176 -2.454  1.00 0.00 ? 47   GLU A HG2  7  
ATOM 10827 H HG3  . GLU B 2 10 ? -0.695  -19.338 -1.651  1.00 0.00 ? 47   GLU A HG3  7  
ATOM 10828 N N    . ASN B 2 11 ? -0.225  -16.377 1.987   1.00 0.00 ? 48   ASN A N    7  
ATOM 10829 C CA   . ASN B 2 11 ? -0.314  -15.443 3.101   1.00 0.00 ? 48   ASN A CA   7  
ATOM 10830 C C    . ASN B 2 11 ? 0.699   -14.320 2.930   1.00 0.00 ? 48   ASN A C    7  
ATOM 10831 O O    . ASN B 2 11 ? 0.409   -13.158 3.215   1.00 0.00 ? 48   ASN A O    7  
ATOM 10832 C CB   . ASN B 2 11 ? -0.056  -16.175 4.418   1.00 0.00 ? 48   ASN A CB   7  
ATOM 10833 C CG   . ASN B 2 11 ? -1.215  -17.116 4.727   1.00 0.00 ? 48   ASN A CG   7  
ATOM 10834 O OD1  . ASN B 2 11 ? -1.002  -18.298 4.997   1.00 0.00 ? 48   ASN A OD1  7  
ATOM 10835 N ND2  . ASN B 2 11 ? -2.439  -16.664 4.690   1.00 0.00 ? 48   ASN A ND2  7  
ATOM 10836 H H    . ASN B 2 11 ? 0.018   -17.311 2.157   1.00 0.00 ? 48   ASN A H    7  
ATOM 10837 H HA   . ASN B 2 11 ? -1.307  -15.020 3.124   1.00 0.00 ? 48   ASN A HA   7  
ATOM 10838 H HB2  . ASN B 2 11 ? 0.858   -16.745 4.338   1.00 0.00 ? 48   ASN A HB2  7  
ATOM 10839 H HB3  . ASN B 2 11 ? 0.039   -15.454 5.218   1.00 0.00 ? 48   ASN A HB3  7  
ATOM 10840 H HD21 . ASN B 2 11 ? -2.608  -15.725 4.462   1.00 0.00 ? 48   ASN A HD21 7  
ATOM 10841 H HD22 . ASN B 2 11 ? -3.188  -17.264 4.886   1.00 0.00 ? 48   ASN A HD22 7  
ATOM 10842 N N    . ASP B 2 12 ? 1.888   -14.676 2.463   1.00 0.00 ? 49   ASP A N    7  
ATOM 10843 C CA   . ASP B 2 12 ? 2.940   -13.686 2.258   1.00 0.00 ? 49   ASP A CA   7  
ATOM 10844 C C    . ASP B 2 12 ? 2.523   -12.673 1.198   1.00 0.00 ? 49   ASP A C    7  
ATOM 10845 O O    . ASP B 2 12 ? 2.751   -11.473 1.350   1.00 0.00 ? 49   ASP A O    7  
ATOM 10846 C CB   . ASP B 2 12 ? 4.240   -14.375 1.832   1.00 0.00 ? 49   ASP A CB   7  
ATOM 10847 C CG   . ASP B 2 12 ? 5.371   -13.355 1.753   1.00 0.00 ? 49   ASP A CG   7  
ATOM 10848 O OD1  . ASP B 2 12 ? 5.107   -12.186 1.980   1.00 0.00 ? 49   ASP A OD1  7  
ATOM 10849 O OD2  . ASP B 2 12 ? 6.486   -13.759 1.465   1.00 0.00 ? 49   ASP A OD2  7  
ATOM 10850 H H    . ASP B 2 12 ? 2.058   -15.619 2.248   1.00 0.00 ? 49   ASP A H    7  
ATOM 10851 H HA   . ASP B 2 12 ? 3.111   -13.164 3.188   1.00 0.00 ? 49   ASP A HA   7  
ATOM 10852 H HB2  . ASP B 2 12 ? 4.494   -15.137 2.555   1.00 0.00 ? 49   ASP A HB2  7  
ATOM 10853 H HB3  . ASP B 2 12 ? 4.101   -14.833 0.864   1.00 0.00 ? 49   ASP A HB3  7  
ATOM 10854 N N    . GLU B 2 13 ? 1.914   -13.164 0.123   1.00 0.00 ? 50   GLU A N    7  
ATOM 10855 C CA   . GLU B 2 13 ? 1.475   -12.286 -0.957  1.00 0.00 ? 50   GLU A CA   7  
ATOM 10856 C C    . GLU B 2 13 ? 0.434   -11.291 -0.451  1.00 0.00 ? 50   GLU A C    7  
ATOM 10857 O O    . GLU B 2 13 ? 0.479   -10.107 -0.784  1.00 0.00 ? 50   GLU A O    7  
ATOM 10858 C CB   . GLU B 2 13 ? 0.874   -13.118 -2.091  1.00 0.00 ? 50   GLU A CB   7  
ATOM 10859 C CG   . GLU B 2 13 ? 1.981   -13.908 -2.791  1.00 0.00 ? 50   GLU A CG   7  
ATOM 10860 C CD   . GLU B 2 13 ? 1.381   -14.791 -3.882  1.00 0.00 ? 50   GLU A CD   7  
ATOM 10861 O OE1  . GLU B 2 13 ? 0.165   -14.867 -3.952  1.00 0.00 ? 50   GLU A OE1  7  
ATOM 10862 O OE2  . GLU B 2 13 ? 2.146   -15.378 -4.629  1.00 0.00 ? 50   GLU A OE2  7  
ATOM 10863 H H    . GLU B 2 13 ? 1.762   -14.131 0.051   1.00 0.00 ? 50   GLU A H    7  
ATOM 10864 H HA   . GLU B 2 13 ? 2.326   -11.742 -1.337  1.00 0.00 ? 50   GLU A HA   7  
ATOM 10865 H HB2  . GLU B 2 13 ? 0.144   -13.804 -1.685  1.00 0.00 ? 50   GLU A HB2  7  
ATOM 10866 H HB3  . GLU B 2 13 ? 0.395   -12.464 -2.804  1.00 0.00 ? 50   GLU A HB3  7  
ATOM 10867 H HG2  . GLU B 2 13 ? 2.687   -13.221 -3.234  1.00 0.00 ? 50   GLU A HG2  7  
ATOM 10868 H HG3  . GLU B 2 13 ? 2.490   -14.529 -2.070  1.00 0.00 ? 50   GLU A HG3  7  
ATOM 10869 N N    . ALA B 2 14 ? -0.498  -11.776 0.360   1.00 0.00 ? 51   ALA A N    7  
ATOM 10870 C CA   . ALA B 2 14 ? -1.535  -10.912 0.907   1.00 0.00 ? 51   ALA A CA   7  
ATOM 10871 C C    . ALA B 2 14 ? -0.916  -9.838  1.796   1.00 0.00 ? 51   ALA A C    7  
ATOM 10872 O O    . ALA B 2 14 ? -1.333  -8.680  1.769   1.00 0.00 ? 51   ALA A O    7  
ATOM 10873 C CB   . ALA B 2 14 ? -2.543  -11.737 1.705   1.00 0.00 ? 51   ALA A CB   7  
ATOM 10874 H H    . ALA B 2 14 ? -0.487  -12.727 0.597   1.00 0.00 ? 51   ALA A H    7  
ATOM 10875 H HA   . ALA B 2 14 ? -2.049  -10.430 0.089   1.00 0.00 ? 51   ALA A HA   7  
ATOM 10876 H HB1  . ALA B 2 14 ? -3.542  -11.525 1.348   1.00 0.00 ? 51   ALA A HB1  7  
ATOM 10877 H HB2  . ALA B 2 14 ? -2.469  -11.481 2.751   1.00 0.00 ? 51   ALA A HB2  7  
ATOM 10878 H HB3  . ALA B 2 14 ? -2.330  -12.787 1.575   1.00 0.00 ? 51   ALA A HB3  7  
ATOM 10879 N N    . PHE B 2 15 ? 0.084   -10.231 2.580   1.00 0.00 ? 52   PHE A N    7  
ATOM 10880 C CA   . PHE B 2 15 ? 0.753   -9.285  3.465   1.00 0.00 ? 52   PHE A CA   7  
ATOM 10881 C C    . PHE B 2 15 ? 1.427   -8.179  2.664   1.00 0.00 ? 52   PHE A C    7  
ATOM 10882 O O    . PHE B 2 15 ? 1.325   -7.005  3.010   1.00 0.00 ? 52   PHE A O    7  
ATOM 10883 C CB   . PHE B 2 15 ? 1.805   -10.005 4.312   1.00 0.00 ? 52   PHE A CB   7  
ATOM 10884 C CG   . PHE B 2 15 ? 1.191   -10.447 5.617   1.00 0.00 ? 52   PHE A CG   7  
ATOM 10885 C CD1  . PHE B 2 15 ? 0.955   -11.805 5.861   1.00 0.00 ? 52   PHE A CD1  7  
ATOM 10886 C CD2  . PHE B 2 15 ? 0.864   -9.494  6.590   1.00 0.00 ? 52   PHE A CD2  7  
ATOM 10887 C CE1  . PHE B 2 15 ? 0.390   -12.210 7.078   1.00 0.00 ? 52   PHE A CE1  7  
ATOM 10888 C CE2  . PHE B 2 15 ? 0.302   -9.898  7.805   1.00 0.00 ? 52   PHE A CE2  7  
ATOM 10889 C CZ   . PHE B 2 15 ? 0.064   -11.256 8.049   1.00 0.00 ? 52   PHE A CZ   7  
ATOM 10890 H H    . PHE B 2 15 ? 0.378   -11.165 2.561   1.00 0.00 ? 52   PHE A H    7  
ATOM 10891 H HA   . PHE B 2 15 ? 0.021   -8.842  4.123   1.00 0.00 ? 52   PHE A HA   7  
ATOM 10892 H HB2  . PHE B 2 15 ? 2.167   -10.869 3.774   1.00 0.00 ? 52   PHE A HB2  7  
ATOM 10893 H HB3  . PHE B 2 15 ? 2.627   -9.334  4.510   1.00 0.00 ? 52   PHE A HB3  7  
ATOM 10894 H HD1  . PHE B 2 15 ? 1.208   -12.540 5.113   1.00 0.00 ? 52   PHE A HD1  7  
ATOM 10895 H HD2  . PHE B 2 15 ? 1.045   -8.445  6.403   1.00 0.00 ? 52   PHE A HD2  7  
ATOM 10896 H HE1  . PHE B 2 15 ? 0.209   -13.257 7.266   1.00 0.00 ? 52   PHE A HE1  7  
ATOM 10897 H HE2  . PHE B 2 15 ? 0.051   -9.162  8.556   1.00 0.00 ? 52   PHE A HE2  7  
ATOM 10898 H HZ   . PHE B 2 15 ? -0.369  -11.567 8.987   1.00 0.00 ? 52   PHE A HZ   7  
ATOM 10899 N N    . ALA B 2 16 ? 2.105   -8.558  1.587   1.00 0.00 ? 53   ALA A N    7  
ATOM 10900 C CA   . ALA B 2 16 ? 2.786   -7.582  0.750   1.00 0.00 ? 53   ALA A CA   7  
ATOM 10901 C C    . ALA B 2 16 ? 1.782   -6.591  0.167   1.00 0.00 ? 53   ALA A C    7  
ATOM 10902 O O    . ALA B 2 16 ? 2.046   -5.393  0.095   1.00 0.00 ? 53   ALA A O    7  
ATOM 10903 C CB   . ALA B 2 16 ? 3.527   -8.294  -0.381  1.00 0.00 ? 53   ALA A CB   7  
ATOM 10904 H H    . ALA B 2 16 ? 2.148   -9.510  1.355   1.00 0.00 ? 53   ALA A H    7  
ATOM 10905 H HA   . ALA B 2 16 ? 3.502   -7.042  1.353   1.00 0.00 ? 53   ALA A HA   7  
ATOM 10906 H HB1  . ALA B 2 16 ? 4.299   -7.648  -0.770  1.00 0.00 ? 53   ALA A HB1  7  
ATOM 10907 H HB2  . ALA B 2 16 ? 2.829   -8.539  -1.169  1.00 0.00 ? 53   ALA A HB2  7  
ATOM 10908 H HB3  . ALA B 2 16 ? 3.974   -9.201  -0.000  1.00 0.00 ? 53   ALA A HB3  7  
ATOM 10909 N N    . ILE B 2 17 ? 0.627   -7.097  -0.241  1.00 0.00 ? 54   ILE A N    7  
ATOM 10910 C CA   . ILE B 2 17 ? -0.404  -6.243  -0.807  1.00 0.00 ? 54   ILE A CA   7  
ATOM 10911 C C    . ILE B 2 17 ? -0.842  -5.180  0.197   1.00 0.00 ? 54   ILE A C    7  
ATOM 10912 O O    . ILE B 2 17 ? -1.055  -4.023  -0.162  1.00 0.00 ? 54   ILE A O    7  
ATOM 10913 C CB   . ILE B 2 17 ? -1.608  -7.088  -1.213  1.00 0.00 ? 54   ILE A CB   7  
ATOM 10914 C CG1  . ILE B 2 17 ? -1.239  -7.957  -2.420  1.00 0.00 ? 54   ILE A CG1  7  
ATOM 10915 C CG2  . ILE B 2 17 ? -2.767  -6.166  -1.576  1.00 0.00 ? 54   ILE A CG2  7  
ATOM 10916 C CD1  . ILE B 2 17 ? -2.344  -8.982  -2.671  1.00 0.00 ? 54   ILE A CD1  7  
ATOM 10917 H H    . ILE B 2 17 ? 0.461   -8.060  -0.161  1.00 0.00 ? 54   ILE A H    7  
ATOM 10918 H HA   . ILE B 2 17 ? -0.014  -5.753  -1.683  1.00 0.00 ? 54   ILE A HA   7  
ATOM 10919 H HB   . ILE B 2 17 ? -1.895  -7.721  -0.387  1.00 0.00 ? 54   ILE A HB   7  
ATOM 10920 H HG12 . ILE B 2 17 ? -1.128  -7.331  -3.291  1.00 0.00 ? 54   ILE A HG12 7  
ATOM 10921 H HG13 . ILE B 2 17 ? -0.310  -8.470  -2.224  1.00 0.00 ? 54   ILE A HG13 7  
ATOM 10922 H HG21 . ILE B 2 17 ? -3.516  -6.724  -2.115  1.00 0.00 ? 54   ILE A HG21 7  
ATOM 10923 H HG22 . ILE B 2 17 ? -2.402  -5.360  -2.194  1.00 0.00 ? 54   ILE A HG22 7  
ATOM 10924 H HG23 . ILE B 2 17 ? -3.200  -5.764  -0.673  1.00 0.00 ? 54   ILE A HG23 7  
ATOM 10925 H HD11 . ILE B 2 17 ? -2.122  -9.535  -3.571  1.00 0.00 ? 54   ILE A HD11 7  
ATOM 10926 H HD12 . ILE B 2 17 ? -3.289  -8.470  -2.786  1.00 0.00 ? 54   ILE A HD12 7  
ATOM 10927 H HD13 . ILE B 2 17 ? -2.399  -9.662  -1.835  1.00 0.00 ? 54   ILE A HD13 7  
ATOM 10928 N N    . LEU B 2 18 ? -0.985  -5.584  1.449   1.00 0.00 ? 55   LEU A N    7  
ATOM 10929 C CA   . LEU B 2 18 ? -1.413  -4.664  2.494   1.00 0.00 ? 55   LEU A CA   7  
ATOM 10930 C C    . LEU B 2 18 ? -0.231  -4.198  3.344   1.00 0.00 ? 55   LEU A C    7  
ATOM 10931 O O    . LEU B 2 18 ? -0.396  -3.869  4.519   1.00 0.00 ? 55   LEU A O    7  
ATOM 10932 C CB   . LEU B 2 18 ? -2.455  -5.346  3.380   1.00 0.00 ? 55   LEU A CB   7  
ATOM 10933 C CG   . LEU B 2 18 ? -3.653  -5.770  2.521   1.00 0.00 ? 55   LEU A CG   7  
ATOM 10934 C CD1  . LEU B 2 18 ? -4.649  -6.552  3.379   1.00 0.00 ? 55   LEU A CD1  7  
ATOM 10935 C CD2  . LEU B 2 18 ? -4.348  -4.529  1.951   1.00 0.00 ? 55   LEU A CD2  7  
ATOM 10936 H H    . LEU B 2 18 ? -0.808  -6.522  1.677   1.00 0.00 ? 55   LEU A H    7  
ATOM 10937 H HA   . LEU B 2 18 ? -1.865  -3.799  2.032   1.00 0.00 ? 55   LEU A HA   7  
ATOM 10938 H HB2  . LEU B 2 18 ? -2.016  -6.215  3.844   1.00 0.00 ? 55   LEU A HB2  7  
ATOM 10939 H HB3  . LEU B 2 18 ? -2.785  -4.660  4.141   1.00 0.00 ? 55   LEU A HB3  7  
ATOM 10940 H HG   . LEU B 2 18 ? -3.309  -6.396  1.711   1.00 0.00 ? 55   LEU A HG   7  
ATOM 10941 H HD11 . LEU B 2 18 ? -5.629  -6.501  2.927   1.00 0.00 ? 55   LEU A HD11 7  
ATOM 10942 H HD12 . LEU B 2 18 ? -4.685  -6.123  4.368   1.00 0.00 ? 55   LEU A HD12 7  
ATOM 10943 H HD13 . LEU B 2 18 ? -4.336  -7.584  3.442   1.00 0.00 ? 55   LEU A HD13 7  
ATOM 10944 H HD21 . LEU B 2 18 ? -4.360  -3.748  2.698   1.00 0.00 ? 55   LEU A HD21 7  
ATOM 10945 H HD22 . LEU B 2 18 ? -5.362  -4.779  1.676   1.00 0.00 ? 55   LEU A HD22 7  
ATOM 10946 H HD23 . LEU B 2 18 ? -3.812  -4.185  1.079   1.00 0.00 ? 55   LEU A HD23 7  
ATOM 10947 N N    . ASP B 2 19 ? 0.961   -4.168  2.753   1.00 0.00 ? 56   ASP A N    7  
ATOM 10948 C CA   . ASP B 2 19 ? 2.147   -3.731  3.486   1.00 0.00 ? 56   ASP A CA   7  
ATOM 10949 C C    . ASP B 2 19 ? 3.161   -3.102  2.539   1.00 0.00 ? 56   ASP A C    7  
ATOM 10950 O O    . ASP B 2 19 ? 3.491   -1.921  2.652   1.00 0.00 ? 56   ASP A O    7  
ATOM 10951 C CB   . ASP B 2 19 ? 2.783   -4.923  4.195   1.00 0.00 ? 56   ASP A CB   7  
ATOM 10952 C CG   . ASP B 2 19 ? 3.746   -4.443  5.274   1.00 0.00 ? 56   ASP A CG   7  
ATOM 10953 O OD1  . ASP B 2 19 ? 3.689   -3.272  5.611   1.00 0.00 ? 56   ASP A OD1  7  
ATOM 10954 O OD2  . ASP B 2 19 ? 4.524   -5.253  5.746   1.00 0.00 ? 56   ASP A OD2  7  
ATOM 10955 H H    . ASP B 2 19 ? 1.045   -4.441  1.813   1.00 0.00 ? 56   ASP A H    7  
ATOM 10956 H HA   . ASP B 2 19 ? 1.855   -3.000  4.225   1.00 0.00 ? 56   ASP A HA   7  
ATOM 10957 H HB2  . ASP B 2 19 ? 2.008   -5.523  4.647   1.00 0.00 ? 56   ASP A HB2  7  
ATOM 10958 H HB3  . ASP B 2 19 ? 3.323   -5.521  3.474   1.00 0.00 ? 56   ASP A HB3  7  
ATOM 10959 N N    . GLY B 2 20 ? 3.638   -3.899  1.595   1.00 0.00 ? 57   GLY A N    7  
ATOM 10960 C CA   . GLY B 2 20 ? 4.609   -3.417  0.619   1.00 0.00 ? 57   GLY A CA   7  
ATOM 10961 C C    . GLY B 2 20 ? 3.914   -2.837  -0.617  1.00 0.00 ? 57   GLY A C    7  
ATOM 10962 O O    . GLY B 2 20 ? 4.577   -2.346  -1.533  1.00 0.00 ? 57   GLY A O    7  
ATOM 10963 H H    . GLY B 2 20 ? 3.326   -4.829  1.548   1.00 0.00 ? 57   GLY A H    7  
ATOM 10964 H HA2  . GLY B 2 20 ? 5.216   -2.649  1.075   1.00 0.00 ? 57   GLY A HA2  7  
ATOM 10965 H HA3  . GLY B 2 20 ? 5.242   -4.238  0.315   1.00 0.00 ? 57   GLY A HA3  7  
ATOM 10966 N N    . GLY B 2 21 ? 2.583   -2.903  -0.645  1.00 0.00 ? 58   GLY A N    7  
ATOM 10967 C CA   . GLY B 2 21 ? 1.830   -2.383  -1.781  1.00 0.00 ? 58   GLY A CA   7  
ATOM 10968 C C    . GLY B 2 21 ? 2.052   -3.249  -3.016  1.00 0.00 ? 58   GLY A C    7  
ATOM 10969 O O    . GLY B 2 21 ? 1.850   -2.800  -4.144  1.00 0.00 ? 58   GLY A O    7  
ATOM 10970 H H    . GLY B 2 21 ? 2.100   -3.308  0.103   1.00 0.00 ? 58   GLY A H    7  
ATOM 10971 H HA2  . GLY B 2 21 ? 0.776   -2.375  -1.537  1.00 0.00 ? 58   GLY A HA2  7  
ATOM 10972 H HA3  . GLY B 2 21 ? 2.152   -1.376  -1.994  1.00 0.00 ? 58   GLY A HA3  7  
ATOM 10973 N N    . ALA B 2 22 ? 2.477   -4.491  -2.798  1.00 0.00 ? 59   ALA A N    7  
ATOM 10974 C CA   . ALA B 2 22 ? 2.731   -5.404  -3.904  1.00 0.00 ? 59   ALA A CA   7  
ATOM 10975 C C    . ALA B 2 22 ? 1.424   -5.857  -4.547  1.00 0.00 ? 59   ALA A C    7  
ATOM 10976 O O    . ALA B 2 22 ? 0.362   -5.753  -3.941  1.00 0.00 ? 59   ALA A O    7  
ATOM 10977 C CB   . ALA B 2 22 ? 3.491   -6.629  -3.409  1.00 0.00 ? 59   ALA A CB   7  
ATOM 10978 H H    . ALA B 2 22 ? 2.625   -4.795  -1.878  1.00 0.00 ? 59   ALA A H    7  
ATOM 10979 H HA   . ALA B 2 22 ? 3.333   -4.893  -4.642  1.00 0.00 ? 59   ALA A HA   7  
ATOM 10980 H HB1  . ALA B 2 22 ? 2.816   -7.472  -3.364  1.00 0.00 ? 59   ALA A HB1  7  
ATOM 10981 H HB2  . ALA B 2 22 ? 3.889   -6.432  -2.426  1.00 0.00 ? 59   ALA A HB2  7  
ATOM 10982 H HB3  . ALA B 2 22 ? 4.298   -6.850  -4.090  1.00 0.00 ? 59   ALA A HB3  7  
ATOM 10983 N N    . PRO B 2 23 ? 1.484   -6.341  -5.758  1.00 0.00 ? 60   PRO A N    7  
ATOM 10984 C CA   . PRO B 2 23 ? 0.277   -6.819  -6.491  1.00 0.00 ? 60   PRO A CA   7  
ATOM 10985 C C    . PRO B 2 23 ? -0.266  -8.128  -5.927  1.00 0.00 ? 60   PRO A C    7  
ATOM 10986 O O    . PRO B 2 23 ? -1.450  -8.433  -6.069  1.00 0.00 ? 60   PRO A O    7  
ATOM 10987 C CB   . PRO B 2 23 ? 0.775   -6.996  -7.925  1.00 0.00 ? 60   PRO A CB   7  
ATOM 10988 C CG   . PRO B 2 23 ? 2.240   -7.255  -7.802  1.00 0.00 ? 60   PRO A CG   7  
ATOM 10989 C CD   . PRO B 2 23 ? 2.710   -6.501  -6.559  1.00 0.00 ? 60   PRO A CD   7  
ATOM 10990 H HA   . PRO B 2 23 ? -0.488  -6.062  -6.466  1.00 0.00 ? 60   PRO A HA   7  
ATOM 10991 H HB2  . PRO B 2 23 ? 0.282   -7.840  -8.388  1.00 0.00 ? 60   PRO A HB2  7  
ATOM 10992 H HB3  . PRO B 2 23 ? 0.605   -6.099  -8.498  1.00 0.00 ? 60   PRO A HB3  7  
ATOM 10993 H HG2  . PRO B 2 23 ? 2.420   -8.314  -7.687  1.00 0.00 ? 60   PRO A HG2  7  
ATOM 10994 H HG3  . PRO B 2 23 ? 2.758   -6.880  -8.671  1.00 0.00 ? 60   PRO A HG3  7  
ATOM 10995 H HD2  . PRO B 2 23 ? 3.445   -7.082  -6.020  1.00 0.00 ? 60   PRO A HD2  7  
ATOM 10996 H HD3  . PRO B 2 23 ? 3.109   -5.534  -6.826  1.00 0.00 ? 60   PRO A HD3  7  
ATOM 10997 N N    . GLY B 2 24 ? 0.610   -8.898  -5.292  1.00 0.00 ? 61   GLY A N    7  
ATOM 10998 C CA   . GLY B 2 24 ? 0.210   -10.175 -4.715  1.00 0.00 ? 61   GLY A CA   7  
ATOM 10999 C C    . GLY B 2 24 ? 1.284   -11.233 -4.942  1.00 0.00 ? 61   GLY A C    7  
ATOM 11000 O O    . GLY B 2 24 ? 2.407   -11.009 -4.521  1.00 0.00 ? 61   GLY A O    7  
ATOM 11001 O OXT  . GLY B 2 24 ? 0.970   -12.251 -5.536  1.00 0.00 ? 61   GLY A OXT  7  
ATOM 11002 H H    . GLY B 2 24 ? 1.540   -8.604  -5.213  1.00 0.00 ? 61   GLY A H    7  
ATOM 11003 H HA2  . GLY B 2 24 ? 0.052   -10.051 -3.653  1.00 0.00 ? 61   GLY A HA2  7  
ATOM 11004 H HA3  . GLY B 2 24 ? -0.710  -10.503 -5.176  1.00 0.00 ? 61   GLY A HA3  7  
ATOM 11005 N N    . ARG A 1 6  ? 5.766   -3.926  15.270  1.00 0.00 ? 1050 ARG B N    8  
ATOM 11006 C CA   . ARG A 1 6  ? 4.793   -3.841  14.145  1.00 0.00 ? 1050 ARG B CA   8  
ATOM 11007 C C    . ARG A 1 6  ? 3.419   -4.311  14.622  1.00 0.00 ? 1050 ARG B C    8  
ATOM 11008 O O    . ARG A 1 6  ? 3.309   -4.997  15.638  1.00 0.00 ? 1050 ARG B O    8  
ATOM 11009 C CB   . ARG A 1 6  ? 5.263   -4.730  12.994  1.00 0.00 ? 1050 ARG B CB   8  
ATOM 11010 C CG   . ARG A 1 6  ? 6.062   -3.893  11.996  1.00 0.00 ? 1050 ARG B CG   8  
ATOM 11011 C CD   . ARG A 1 6  ? 6.646   -4.808  10.917  1.00 0.00 ? 1050 ARG B CD   8  
ATOM 11012 N NE   . ARG A 1 6  ? 7.643   -5.707  11.495  1.00 0.00 ? 1050 ARG B NE   8  
ATOM 11013 C CZ   . ARG A 1 6  ? 8.240   -6.653  10.766  1.00 0.00 ? 1050 ARG B CZ   8  
ATOM 11014 N NH1  . ARG A 1 6  ? 7.951   -6.805  9.499   1.00 0.00 ? 1050 ARG B NH1  8  
ATOM 11015 N NH2  . ARG A 1 6  ? 9.124   -7.434  11.322  1.00 0.00 ? 1050 ARG B NH2  8  
ATOM 11016 H H    . ARG A 1 6  ? 6.559   -4.539  14.997  1.00 0.00 ? 1050 ARG B H    8  
ATOM 11017 H HA   . ARG A 1 6  ? 4.729   -2.818  13.807  1.00 0.00 ? 1050 ARG B HA   8  
ATOM 11018 H HB2  . ARG A 1 6  ? 5.887   -5.521  13.385  1.00 0.00 ? 1050 ARG B HB2  8  
ATOM 11019 H HB3  . ARG A 1 6  ? 4.406   -5.162  12.496  1.00 0.00 ? 1050 ARG B HB3  8  
ATOM 11020 H HG2  . ARG A 1 6  ? 5.409   -3.164  11.538  1.00 0.00 ? 1050 ARG B HG2  8  
ATOM 11021 H HG3  . ARG A 1 6  ? 6.864   -3.386  12.512  1.00 0.00 ? 1050 ARG B HG3  8  
ATOM 11022 H HD2  . ARG A 1 6  ? 5.854   -5.391  10.478  1.00 0.00 ? 1050 ARG B HD2  8  
ATOM 11023 H HD3  . ARG A 1 6  ? 7.110   -4.203  10.150  1.00 0.00 ? 1050 ARG B HD3  8  
ATOM 11024 H HE   . ARG A 1 6  ? 7.878   -5.616  12.440  1.00 0.00 ? 1050 ARG B HE   8  
ATOM 11025 H HH11 . ARG A 1 6  ? 7.275   -6.214  9.060   1.00 0.00 ? 1050 ARG B HH11 8  
ATOM 11026 H HH12 . ARG A 1 6  ? 8.408   -7.519  8.967   1.00 0.00 ? 1050 ARG B HH12 8  
ATOM 11027 H HH21 . ARG A 1 6  ? 9.351   -7.324  12.290  1.00 0.00 ? 1050 ARG B HH21 8  
ATOM 11028 H HH22 . ARG A 1 6  ? 9.576   -8.144  10.781  1.00 0.00 ? 1050 ARG B HH22 8  
ATOM 11029 N N    . PRO A 1 7  ? 2.381   -3.957  13.909  1.00 0.00 ? 1051 PRO B N    8  
ATOM 11030 C CA   . PRO A 1 7  ? 0.985   -4.353  14.264  1.00 0.00 ? 1051 PRO B CA   8  
ATOM 11031 C C    . PRO A 1 7  ? 0.759   -5.858  14.132  1.00 0.00 ? 1051 PRO B C    8  
ATOM 11032 O O    . PRO A 1 7  ? -0.105  -6.427  14.798  1.00 0.00 ? 1051 PRO B O    8  
ATOM 11033 C CB   . PRO A 1 7  ? 0.121   -3.577  13.267  1.00 0.00 ? 1051 PRO B CB   8  
ATOM 11034 C CG   . PRO A 1 7  ? 1.014   -3.292  12.108  1.00 0.00 ? 1051 PRO B CG   8  
ATOM 11035 C CD   . PRO A 1 7  ? 2.422   -3.143  12.681  1.00 0.00 ? 1051 PRO B CD   8  
ATOM 11036 H HA   . PRO A 1 7  ? 0.753   -4.030  15.265  1.00 0.00 ? 1051 PRO B HA   8  
ATOM 11037 H HB2  . PRO A 1 7  ? -0.719  -4.182  12.954  1.00 0.00 ? 1051 PRO B HB2  8  
ATOM 11038 H HB3  . PRO A 1 7  ? -0.223  -2.654  13.705  1.00 0.00 ? 1051 PRO B HB3  8  
ATOM 11039 H HG2  . PRO A 1 7  ? 0.980   -4.111  11.402  1.00 0.00 ? 1051 PRO B HG2  8  
ATOM 11040 H HG3  . PRO A 1 7  ? 0.718   -2.373  11.626  1.00 0.00 ? 1051 PRO B HG3  8  
ATOM 11041 H HD2  . PRO A 1 7  ? 3.155   -3.527  11.987  1.00 0.00 ? 1051 PRO B HD2  8  
ATOM 11042 H HD3  . PRO A 1 7  ? 2.627   -2.112  12.924  1.00 0.00 ? 1051 PRO B HD3  8  
ATOM 11043 N N    . LYS A 1 8  ? 1.548   -6.497  13.271  1.00 0.00 ? 1052 LYS B N    8  
ATOM 11044 C CA   . LYS A 1 8  ? 1.434   -7.937  13.057  1.00 0.00 ? 1052 LYS B CA   8  
ATOM 11045 C C    . LYS A 1 8  ? -0.021  -8.341  12.853  1.00 0.00 ? 1052 LYS B C    8  
ATOM 11046 O O    . LYS A 1 8  ? -0.445  -9.409  13.294  1.00 0.00 ? 1052 LYS B O    8  
ATOM 11047 C CB   . LYS A 1 8  ? 2.016   -8.672  14.262  1.00 0.00 ? 1052 LYS B CB   8  
ATOM 11048 C CG   . LYS A 1 8  ? 3.535   -8.510  14.260  1.00 0.00 ? 1052 LYS B CG   8  
ATOM 11049 C CD   . LYS A 1 8  ? 4.018   -8.320  15.694  1.00 0.00 ? 1052 LYS B CD   8  
ATOM 11050 C CE   . LYS A 1 8  ? 5.548   -8.319  15.729  1.00 0.00 ? 1052 LYS B CE   8  
ATOM 11051 N NZ   . LYS A 1 8  ? 6.013   -7.971  17.102  1.00 0.00 ? 1052 LYS B NZ   8  
ATOM 11052 H H    . LYS A 1 8  ? 2.225   -5.993  12.779  1.00 0.00 ? 1052 LYS B H    8  
ATOM 11053 H HA   . LYS A 1 8  ? 2.001   -8.206  12.178  1.00 0.00 ? 1052 LYS B HA   8  
ATOM 11054 H HB2  . LYS A 1 8  ? 1.608   -8.255  15.172  1.00 0.00 ? 1052 LYS B HB2  8  
ATOM 11055 H HB3  . LYS A 1 8  ? 1.768   -9.720  14.201  1.00 0.00 ? 1052 LYS B HB3  8  
ATOM 11056 H HG2  . LYS A 1 8  ? 3.992   -9.395  13.838  1.00 0.00 ? 1052 LYS B HG2  8  
ATOM 11057 H HG3  . LYS A 1 8  ? 3.806   -7.647  13.670  1.00 0.00 ? 1052 LYS B HG3  8  
ATOM 11058 H HD2  . LYS A 1 8  ? 3.649   -7.374  16.064  1.00 0.00 ? 1052 LYS B HD2  8  
ATOM 11059 H HD3  . LYS A 1 8  ? 3.643   -9.120  16.311  1.00 0.00 ? 1052 LYS B HD3  8  
ATOM 11060 H HE2  . LYS A 1 8  ? 5.913   -9.301  15.464  1.00 0.00 ? 1052 LYS B HE2  8  
ATOM 11061 H HE3  . LYS A 1 8  ? 5.925   -7.593  15.026  1.00 0.00 ? 1052 LYS B HE3  8  
ATOM 11062 H HZ1  . LYS A 1 8  ? 6.886   -8.494  17.316  1.00 0.00 ? 1052 LYS B HZ1  8  
ATOM 11063 H HZ2  . LYS A 1 8  ? 5.277   -8.226  17.792  1.00 0.00 ? 1052 LYS B HZ2  8  
ATOM 11064 H HZ3  . LYS A 1 8  ? 6.202   -6.950  17.155  1.00 0.00 ? 1052 LYS B HZ3  8  
ATOM 11065 N N    . MET A 1 9  ? -0.780  -7.482  12.181  1.00 0.00 ? 1053 MET B N    8  
ATOM 11066 C CA   . MET A 1 9  ? -2.188  -7.763  11.925  1.00 0.00 ? 1053 MET B CA   8  
ATOM 11067 C C    . MET A 1 9  ? -2.351  -8.635  10.686  1.00 0.00 ? 1053 MET B C    8  
ATOM 11068 O O    . MET A 1 9  ? -1.542  -8.580  9.765   1.00 0.00 ? 1053 MET B O    8  
ATOM 11069 C CB   . MET A 1 9  ? -2.958  -6.460  11.720  1.00 0.00 ? 1053 MET B CB   8  
ATOM 11070 C CG   . MET A 1 9  ? -3.275  -5.829  13.076  1.00 0.00 ? 1053 MET B CG   8  
ATOM 11071 S SD   . MET A 1 9  ? -4.705  -4.729  12.912  1.00 0.00 ? 1053 MET B SD   8  
ATOM 11072 C CE   . MET A 1 9  ? -4.331  -4.091  11.260  1.00 0.00 ? 1053 MET B CE   8  
ATOM 11073 H H    . MET A 1 9  ? -0.387  -6.648  11.852  1.00 0.00 ? 1053 MET B H    8  
ATOM 11074 H HA   . MET A 1 9  ? -2.600  -8.282  12.777  1.00 0.00 ? 1053 MET B HA   8  
ATOM 11075 H HB2  . MET A 1 9  ? -2.356  -5.778  11.136  1.00 0.00 ? 1053 MET B HB2  8  
ATOM 11076 H HB3  . MET A 1 9  ? -3.879  -6.668  11.198  1.00 0.00 ? 1053 MET B HB3  8  
ATOM 11077 H HG2  . MET A 1 9  ? -3.498  -6.609  13.789  1.00 0.00 ? 1053 MET B HG2  8  
ATOM 11078 H HG3  . MET A 1 9  ? -2.422  -5.263  13.419  1.00 0.00 ? 1053 MET B HG3  8  
ATOM 11079 H HE1  . MET A 1 9  ? -4.598  -4.834  10.521  1.00 0.00 ? 1053 MET B HE1  8  
ATOM 11080 H HE2  . MET A 1 9  ? -3.277  -3.878  11.183  1.00 0.00 ? 1053 MET B HE2  8  
ATOM 11081 H HE3  . MET A 1 9  ? -4.896  -3.186  11.082  1.00 0.00 ? 1053 MET B HE3  8  
ATOM 11082 N N    . THR A 1 10 ? -3.411  -9.433  10.668  1.00 0.00 ? 1054 THR B N    8  
ATOM 11083 C CA   . THR A 1 10 ? -3.677  -10.308 9.535   1.00 0.00 ? 1054 THR B CA   8  
ATOM 11084 C C    . THR A 1 10 ? -4.132  -9.481  8.331   1.00 0.00 ? 1054 THR B C    8  
ATOM 11085 O O    . THR A 1 10 ? -4.529  -8.324  8.479   1.00 0.00 ? 1054 THR B O    8  
ATOM 11086 C CB   . THR A 1 10 ? -4.757  -11.325 9.911   1.00 0.00 ? 1054 THR B CB   8  
ATOM 11087 O OG1  . THR A 1 10 ? -6.007  -10.666 10.033  1.00 0.00 ? 1054 THR B OG1  8  
ATOM 11088 C CG2  . THR A 1 10 ? -4.396  -11.976 11.245  1.00 0.00 ? 1054 THR B CG2  8  
ATOM 11089 H H    . THR A 1 10 ? -4.027  -9.431  11.430  1.00 0.00 ? 1054 THR B H    8  
ATOM 11090 H HA   . THR A 1 10 ? -2.776  -10.834 9.280   1.00 0.00 ? 1054 THR B HA   8  
ATOM 11091 H HB   . THR A 1 10 ? -4.823  -12.087 9.155   1.00 0.00 ? 1054 THR B HB   8  
ATOM 11092 H HG1  . THR A 1 10 ? -6.455  -11.019 10.807  1.00 0.00 ? 1054 THR B HG1  8  
ATOM 11093 H HG21 . THR A 1 10 ? -4.995  -12.865 11.387  1.00 0.00 ? 1054 THR B HG21 8  
ATOM 11094 H HG22 . THR A 1 10 ? -4.590  -11.282 12.048  1.00 0.00 ? 1054 THR B HG22 8  
ATOM 11095 H HG23 . THR A 1 10 ? -3.350  -12.243 11.245  1.00 0.00 ? 1054 THR B HG23 8  
ATOM 11096 N N    . PRO A 1 11 ? -4.070  -10.041 7.149   1.00 0.00 ? 1055 PRO B N    8  
ATOM 11097 C CA   . PRO A 1 11 ? -4.477  -9.321  5.905   1.00 0.00 ? 1055 PRO B CA   8  
ATOM 11098 C C    . PRO A 1 11 ? -5.879  -8.728  6.025   1.00 0.00 ? 1055 PRO B C    8  
ATOM 11099 O O    . PRO A 1 11 ? -6.117  -7.587  5.628   1.00 0.00 ? 1055 PRO B O    8  
ATOM 11100 C CB   . PRO A 1 11 ? -4.452  -10.419 4.837   1.00 0.00 ? 1055 PRO B CB   8  
ATOM 11101 C CG   . PRO A 1 11 ? -3.465  -11.418 5.337   1.00 0.00 ? 1055 PRO B CG   8  
ATOM 11102 C CD   . PRO A 1 11 ? -3.603  -11.409 6.860   1.00 0.00 ? 1055 PRO B CD   8  
ATOM 11103 H HA   . PRO A 1 11 ? -3.763  -8.556  5.657   1.00 0.00 ? 1055 PRO B HA   8  
ATOM 11104 H HB2  . PRO A 1 11 ? -5.431  -10.869 4.738   1.00 0.00 ? 1055 PRO B HB2  8  
ATOM 11105 H HB3  . PRO A 1 11 ? -4.126  -10.017 3.891   1.00 0.00 ? 1055 PRO B HB3  8  
ATOM 11106 H HG2  . PRO A 1 11 ? -3.700  -12.399 4.939   1.00 0.00 ? 1055 PRO B HG2  8  
ATOM 11107 H HG3  . PRO A 1 11 ? -2.465  -11.132 5.057   1.00 0.00 ? 1055 PRO B HG3  8  
ATOM 11108 H HD2  . PRO A 1 11 ? -4.332  -12.142 7.177   1.00 0.00 ? 1055 PRO B HD2  8  
ATOM 11109 H HD3  . PRO A 1 11 ? -2.650  -11.586 7.332   1.00 0.00 ? 1055 PRO B HD3  8  
ATOM 11110 N N    . GLU A 1 12 ? -6.803  -9.505  6.583   1.00 0.00 ? 1056 GLU B N    8  
ATOM 11111 C CA   . GLU A 1 12 ? -8.171  -9.037  6.749   1.00 0.00 ? 1056 GLU B CA   8  
ATOM 11112 C C    . GLU A 1 12 ? -8.232  -7.892  7.754   1.00 0.00 ? 1056 GLU B C    8  
ATOM 11113 O O    . GLU A 1 12 ? -8.949  -6.914  7.550   1.00 0.00 ? 1056 GLU B O    8  
ATOM 11114 C CB   . GLU A 1 12 ? -9.065  -10.187 7.223   1.00 0.00 ? 1056 GLU B CB   8  
ATOM 11115 C CG   . GLU A 1 12 ? -9.236  -11.199 6.091   1.00 0.00 ? 1056 GLU B CG   8  
ATOM 11116 C CD   . GLU A 1 12 ? -9.968  -12.436 6.601   1.00 0.00 ? 1056 GLU B CD   8  
ATOM 11117 O OE1  . GLU A 1 12 ? -10.067 -12.583 7.808   1.00 0.00 ? 1056 GLU B OE1  8  
ATOM 11118 O OE2  . GLU A 1 12 ? -10.418 -13.216 5.779   1.00 0.00 ? 1056 GLU B OE2  8  
ATOM 11119 H H    . GLU A 1 12 ? -6.558  -10.407 6.886   1.00 0.00 ? 1056 GLU B H    8  
ATOM 11120 H HA   . GLU A 1 12 ? -8.536  -8.685  5.797   1.00 0.00 ? 1056 GLU B HA   8  
ATOM 11121 H HB2  . GLU A 1 12 ? -8.612  -10.670 8.076   1.00 0.00 ? 1056 GLU B HB2  8  
ATOM 11122 H HB3  . GLU A 1 12 ? -10.033 -9.797  7.502   1.00 0.00 ? 1056 GLU B HB3  8  
ATOM 11123 H HG2  . GLU A 1 12 ? -9.806  -10.749 5.290   1.00 0.00 ? 1056 GLU B HG2  8  
ATOM 11124 H HG3  . GLU A 1 12 ? -8.264  -11.488 5.719   1.00 0.00 ? 1056 GLU B HG3  8  
ATOM 11125 N N    . GLN A 1 13 ? -7.474  -8.015  8.842   1.00 0.00 ? 1057 GLN B N    8  
ATOM 11126 C CA   . GLN A 1 13 ? -7.465  -6.973  9.864   1.00 0.00 ? 1057 GLN B CA   8  
ATOM 11127 C C    . GLN A 1 13 ? -6.922  -5.665  9.314   1.00 0.00 ? 1057 GLN B C    8  
ATOM 11128 O O    . GLN A 1 13 ? -7.463  -4.593  9.592   1.00 0.00 ? 1057 GLN B O    8  
ATOM 11129 C CB   . GLN A 1 13 ? -6.615  -7.407  11.054  1.00 0.00 ? 1057 GLN B CB   8  
ATOM 11130 C CG   . GLN A 1 13 ? -7.355  -8.487  11.835  1.00 0.00 ? 1057 GLN B CG   8  
ATOM 11131 C CD   . GLN A 1 13 ? -6.577  -8.823  13.100  1.00 0.00 ? 1057 GLN B CD   8  
ATOM 11132 O OE1  . GLN A 1 13 ? -6.131  -9.956  13.277  1.00 0.00 ? 1057 GLN B OE1  8  
ATOM 11133 N NE2  . GLN A 1 13 ? -6.371  -7.887  13.986  1.00 0.00 ? 1057 GLN B NE2  8  
ATOM 11134 H H    . GLN A 1 13 ? -6.917  -8.816  8.961   1.00 0.00 ? 1057 GLN B H    8  
ATOM 11135 H HA   . GLN A 1 13 ? -8.476  -6.815  10.205  1.00 0.00 ? 1057 GLN B HA   8  
ATOM 11136 H HB2  . GLN A 1 13 ? -5.674  -7.798  10.698  1.00 0.00 ? 1057 GLN B HB2  8  
ATOM 11137 H HB3  . GLN A 1 13 ? -6.436  -6.558  11.696  1.00 0.00 ? 1057 GLN B HB3  8  
ATOM 11138 H HG2  . GLN A 1 13 ? -8.338  -8.126  12.101  1.00 0.00 ? 1057 GLN B HG2  8  
ATOM 11139 H HG3  . GLN A 1 13 ? -7.449  -9.370  11.226  1.00 0.00 ? 1057 GLN B HG3  8  
ATOM 11140 H HE21 . GLN A 1 13 ? -6.716  -6.980  13.832  1.00 0.00 ? 1057 GLN B HE21 8  
ATOM 11141 H HE22 . GLN A 1 13 ? -5.875  -8.089  14.806  1.00 0.00 ? 1057 GLN B HE22 8  
ATOM 11142 N N    . MET A 1 14 ? -5.854  -5.751  8.534   1.00 0.00 ? 1058 MET B N    8  
ATOM 11143 C CA   . MET A 1 14 ? -5.265  -4.554  7.962   1.00 0.00 ? 1058 MET B CA   8  
ATOM 11144 C C    . MET A 1 14 ? -6.247  -3.889  7.011   1.00 0.00 ? 1058 MET B C    8  
ATOM 11145 O O    . MET A 1 14 ? -6.373  -2.667  6.988   1.00 0.00 ? 1058 MET B O    8  
ATOM 11146 C CB   . MET A 1 14 ? -3.964  -4.888  7.225   1.00 0.00 ? 1058 MET B CB   8  
ATOM 11147 C CG   . MET A 1 14 ? -2.890  -5.282  8.241   1.00 0.00 ? 1058 MET B CG   8  
ATOM 11148 S SD   . MET A 1 14 ? -1.269  -5.345  7.431   1.00 0.00 ? 1058 MET B SD   8  
ATOM 11149 C CE   . MET A 1 14 ? -1.536  -6.835  6.440   1.00 0.00 ? 1058 MET B CE   8  
ATOM 11150 H H    . MET A 1 14 ? -5.460  -6.629  8.342   1.00 0.00 ? 1058 MET B H    8  
ATOM 11151 H HA   . MET A 1 14 ? -5.042  -3.860  8.757   1.00 0.00 ? 1058 MET B HA   8  
ATOM 11152 H HB2  . MET A 1 14 ? -4.138  -5.709  6.544   1.00 0.00 ? 1058 MET B HB2  8  
ATOM 11153 H HB3  . MET A 1 14 ? -3.631  -4.025  6.673   1.00 0.00 ? 1058 MET B HB3  8  
ATOM 11154 H HG2  . MET A 1 14 ? -2.863  -4.554  9.038   1.00 0.00 ? 1058 MET B HG2  8  
ATOM 11155 H HG3  . MET A 1 14 ? -3.126  -6.255  8.654   1.00 0.00 ? 1058 MET B HG3  8  
ATOM 11156 H HE1  . MET A 1 14 ? -1.673  -7.684  7.098   1.00 0.00 ? 1058 MET B HE1  8  
ATOM 11157 H HE2  . MET A 1 14 ? -0.675  -7.008  5.809   1.00 0.00 ? 1058 MET B HE2  8  
ATOM 11158 H HE3  . MET A 1 14 ? -2.413  -6.705  5.822   1.00 0.00 ? 1058 MET B HE3  8  
ATOM 11159 N N    . ALA A 1 15 ? -6.949  -4.697  6.232   1.00 0.00 ? 1059 ALA B N    8  
ATOM 11160 C CA   . ALA A 1 15 ? -7.917  -4.158  5.290   1.00 0.00 ? 1059 ALA B CA   8  
ATOM 11161 C C    . ALA A 1 15 ? -9.029  -3.412  6.018   1.00 0.00 ? 1059 ALA B C    8  
ATOM 11162 O O    . ALA A 1 15 ? -9.461  -2.342  5.583   1.00 0.00 ? 1059 ALA B O    8  
ATOM 11163 C CB   . ALA A 1 15 ? -8.523  -5.284  4.458   1.00 0.00 ? 1059 ALA B CB   8  
ATOM 11164 H H    . ALA A 1 15 ? -6.817  -5.670  6.294   1.00 0.00 ? 1059 ALA B H    8  
ATOM 11165 H HA   . ALA A 1 15 ? -7.412  -3.471  4.627   1.00 0.00 ? 1059 ALA B HA   8  
ATOM 11166 H HB1  . ALA A 1 15 ? -9.391  -4.914  3.936   1.00 0.00 ? 1059 ALA B HB1  8  
ATOM 11167 H HB2  . ALA A 1 15 ? -8.808  -6.096  5.110   1.00 0.00 ? 1059 ALA B HB2  8  
ATOM 11168 H HB3  . ALA A 1 15 ? -7.794  -5.634  3.743   1.00 0.00 ? 1059 ALA B HB3  8  
ATOM 11169 N N    . LYS A 1 16 ? -9.494  -3.980  7.129   1.00 0.00 ? 1060 LYS B N    8  
ATOM 11170 C CA   . LYS A 1 16 ? -10.558 -3.351  7.900   1.00 0.00 ? 1060 LYS B CA   8  
ATOM 11171 C C    . LYS A 1 16 ? -10.106 -1.998  8.427   1.00 0.00 ? 1060 LYS B C    8  
ATOM 11172 O O    . LYS A 1 16 ? -10.861 -1.024  8.397   1.00 0.00 ? 1060 LYS B O    8  
ATOM 11173 C CB   . LYS A 1 16 ? -10.959 -4.250  9.071   1.00 0.00 ? 1060 LYS B CB   8  
ATOM 11174 C CG   . LYS A 1 16 ? -11.681 -5.493  8.546   1.00 0.00 ? 1060 LYS B CG   8  
ATOM 11175 C CD   . LYS A 1 16 ? -12.059 -6.396  9.721   1.00 0.00 ? 1060 LYS B CD   8  
ATOM 11176 C CE   . LYS A 1 16 ? -12.778 -7.641  9.199   1.00 0.00 ? 1060 LYS B CE   8  
ATOM 11177 N NZ   . LYS A 1 16 ? -13.142 -8.523  10.344  1.00 0.00 ? 1060 LYS B NZ   8  
ATOM 11178 H H    . LYS A 1 16 ? -9.116  -4.834  7.429   1.00 0.00 ? 1060 LYS B H    8  
ATOM 11179 H HA   . LYS A 1 16 ? -11.416 -3.209  7.262   1.00 0.00 ? 1060 LYS B HA   8  
ATOM 11180 H HB2  . LYS A 1 16 ? -10.072 -4.551  9.612   1.00 0.00 ? 1060 LYS B HB2  8  
ATOM 11181 H HB3  . LYS A 1 16 ? -11.617 -3.707  9.733   1.00 0.00 ? 1060 LYS B HB3  8  
ATOM 11182 H HG2  . LYS A 1 16 ? -12.576 -5.191  8.020   1.00 0.00 ? 1060 LYS B HG2  8  
ATOM 11183 H HG3  . LYS A 1 16 ? -11.032 -6.031  7.874   1.00 0.00 ? 1060 LYS B HG3  8  
ATOM 11184 H HD2  . LYS A 1 16 ? -11.163 -6.692  10.248  1.00 0.00 ? 1060 LYS B HD2  8  
ATOM 11185 H HD3  . LYS A 1 16 ? -12.713 -5.861  10.391  1.00 0.00 ? 1060 LYS B HD3  8  
ATOM 11186 H HE2  . LYS A 1 16 ? -13.673 -7.346  8.670   1.00 0.00 ? 1060 LYS B HE2  8  
ATOM 11187 H HE3  . LYS A 1 16 ? -12.126 -8.178  8.525   1.00 0.00 ? 1060 LYS B HE3  8  
ATOM 11188 H HZ1  . LYS A 1 16 ? -13.972 -8.129  10.834  1.00 0.00 ? 1060 LYS B HZ1  8  
ATOM 11189 H HZ2  . LYS A 1 16 ? -12.341 -8.580  11.005  1.00 0.00 ? 1060 LYS B HZ2  8  
ATOM 11190 H HZ3  . LYS A 1 16 ? -13.371 -9.473  9.992   1.00 0.00 ? 1060 LYS B HZ3  8  
ATOM 11191 N N    . GLU A 1 17 ? -8.868  -1.935  8.906   1.00 0.00 ? 1061 GLU B N    8  
ATOM 11192 C CA   . GLU A 1 17 ? -8.348  -0.680  9.427   1.00 0.00 ? 1061 GLU B CA   8  
ATOM 11193 C C    . GLU A 1 17 ? -8.262  0.368   8.321   1.00 0.00 ? 1061 GLU B C    8  
ATOM 11194 O O    . GLU A 1 17 ? -8.561  1.542   8.543   1.00 0.00 ? 1061 GLU B O    8  
ATOM 11195 C CB   . GLU A 1 17 ? -6.974  -0.886  10.060  1.00 0.00 ? 1061 GLU B CB   8  
ATOM 11196 C CG   . GLU A 1 17 ? -7.125  -1.686  11.357  1.00 0.00 ? 1061 GLU B CG   8  
ATOM 11197 C CD   . GLU A 1 17 ? -6.006  -1.319  12.323  1.00 0.00 ? 1061 GLU B CD   8  
ATOM 11198 O OE1  . GLU A 1 17 ? -5.050  -0.702  11.885  1.00 0.00 ? 1061 GLU B OE1  8  
ATOM 11199 O OE2  . GLU A 1 17 ? -6.123  -1.658  13.490  1.00 0.00 ? 1061 GLU B OE2  8  
ATOM 11200 H H    . GLU A 1 17 ? -8.298  -2.738  8.909   1.00 0.00 ? 1061 GLU B H    8  
ATOM 11201 H HA   . GLU A 1 17 ? -9.026  -0.319  10.186  1.00 0.00 ? 1061 GLU B HA   8  
ATOM 11202 H HB2  . GLU A 1 17 ? -6.339  -1.428  9.372   1.00 0.00 ? 1061 GLU B HB2  8  
ATOM 11203 H HB3  . GLU A 1 17 ? -6.530  0.073   10.281  1.00 0.00 ? 1061 GLU B HB3  8  
ATOM 11204 H HG2  . GLU A 1 17 ? -8.081  -1.464  11.808  1.00 0.00 ? 1061 GLU B HG2  8  
ATOM 11205 H HG3  . GLU A 1 17 ? -7.072  -2.744  11.135  1.00 0.00 ? 1061 GLU B HG3  8  
ATOM 11206 N N    . MET A 1 18 ? -7.853  -0.057  7.126   1.00 0.00 ? 1062 MET B N    8  
ATOM 11207 C CA   . MET A 1 18 ? -7.736  0.868   6.006   1.00 0.00 ? 1062 MET B CA   8  
ATOM 11208 C C    . MET A 1 18 ? -9.092  1.482   5.675   1.00 0.00 ? 1062 MET B C    8  
ATOM 11209 O O    . MET A 1 18 ? -9.194  2.682   5.427   1.00 0.00 ? 1062 MET B O    8  
ATOM 11210 C CB   . MET A 1 18 ? -7.211  0.123   4.782   1.00 0.00 ? 1062 MET B CB   8  
ATOM 11211 C CG   . MET A 1 18 ? -5.761  -0.275  5.020   1.00 0.00 ? 1062 MET B CG   8  
ATOM 11212 S SD   . MET A 1 18 ? -5.232  -1.413  3.717   1.00 0.00 ? 1062 MET B SD   8  
ATOM 11213 C CE   . MET A 1 18 ? -4.055  -2.356  4.712   1.00 0.00 ? 1062 MET B CE   8  
ATOM 11214 H H    . MET A 1 18 ? -7.623  -1.005  6.998   1.00 0.00 ? 1062 MET B H    8  
ATOM 11215 H HA   . MET A 1 18 ? -7.043  1.655   6.262   1.00 0.00 ? 1062 MET B HA   8  
ATOM 11216 H HB2  . MET A 1 18 ? -7.806  -0.763  4.619   1.00 0.00 ? 1062 MET B HB2  8  
ATOM 11217 H HB3  . MET A 1 18 ? -7.270  0.763   3.914   1.00 0.00 ? 1062 MET B HB3  8  
ATOM 11218 H HG2  . MET A 1 18 ? -5.138  0.607   5.001   1.00 0.00 ? 1062 MET B HG2  8  
ATOM 11219 H HG3  . MET A 1 18 ? -5.675  -0.757  5.980   1.00 0.00 ? 1062 MET B HG3  8  
ATOM 11220 H HE1  . MET A 1 18 ? -4.376  -3.387  4.759   1.00 0.00 ? 1062 MET B HE1  8  
ATOM 11221 H HE2  . MET A 1 18 ? -4.018  -1.950  5.710   1.00 0.00 ? 1062 MET B HE2  8  
ATOM 11222 H HE3  . MET A 1 18 ? -3.073  -2.296  4.264   1.00 0.00 ? 1062 MET B HE3  8  
ATOM 11223 N N    . SER A 1 19 ? -10.131 0.653   5.679   1.00 0.00 ? 1063 SER B N    8  
ATOM 11224 C CA   . SER A 1 19 ? -11.473 1.139   5.379   1.00 0.00 ? 1063 SER B CA   8  
ATOM 11225 C C    . SER A 1 19 ? -11.912 2.169   6.411   1.00 0.00 ? 1063 SER B C    8  
ATOM 11226 O O    . SER A 1 19 ? -12.501 3.195   6.070   1.00 0.00 ? 1063 SER B O    8  
ATOM 11227 C CB   . SER A 1 19 ? -12.465 -0.025  5.358   1.00 0.00 ? 1063 SER B CB   8  
ATOM 11228 O OG   . SER A 1 19 ? -13.766 0.475   5.074   1.00 0.00 ? 1063 SER B OG   8  
ATOM 11229 H H    . SER A 1 19 ? -9.995  -0.298  5.888   1.00 0.00 ? 1063 SER B H    8  
ATOM 11230 H HA   . SER A 1 19 ? -11.464 1.605   4.406   1.00 0.00 ? 1063 SER B HA   8  
ATOM 11231 H HB2  . SER A 1 19 ? -12.181 -0.727  4.592   1.00 0.00 ? 1063 SER B HB2  8  
ATOM 11232 H HB3  . SER A 1 19 ? -12.460 -0.522  6.319   1.00 0.00 ? 1063 SER B HB3  8  
ATOM 11233 H HG   . SER A 1 19 ? -13.788 0.735   4.150   1.00 0.00 ? 1063 SER B HG   8  
ATOM 11234 N N    . GLU A 1 20 ? -11.628 1.887   7.676   1.00 0.00 ? 1064 GLU B N    8  
ATOM 11235 C CA   . GLU A 1 20 ? -12.003 2.793   8.754   1.00 0.00 ? 1064 GLU B CA   8  
ATOM 11236 C C    . GLU A 1 20 ? -11.325 4.149   8.587   1.00 0.00 ? 1064 GLU B C    8  
ATOM 11237 O O    . GLU A 1 20 ? -11.944 5.189   8.804   1.00 0.00 ? 1064 GLU B O    8  
ATOM 11238 C CB   . GLU A 1 20 ? -11.594 2.191   10.094  1.00 0.00 ? 1064 GLU B CB   8  
ATOM 11239 C CG   . GLU A 1 20 ? -12.484 0.987   10.411  1.00 0.00 ? 1064 GLU B CG   8  
ATOM 11240 C CD   . GLU A 1 20 ? -11.995 0.292   11.677  1.00 0.00 ? 1064 GLU B CD   8  
ATOM 11241 O OE1  . GLU A 1 20 ? -10.904 0.611   12.123  1.00 0.00 ? 1064 GLU B OE1  8  
ATOM 11242 O OE2  . GLU A 1 20 ? -12.719 -0.549  12.186  1.00 0.00 ? 1064 GLU B OE2  8  
ATOM 11243 H H    . GLU A 1 20 ? -11.161 1.050   7.891   1.00 0.00 ? 1064 GLU B H    8  
ATOM 11244 H HA   . GLU A 1 20 ? -13.074 2.929   8.744   1.00 0.00 ? 1064 GLU B HA   8  
ATOM 11245 H HB2  . GLU A 1 20 ? -10.564 1.871   10.037  1.00 0.00 ? 1064 GLU B HB2  8  
ATOM 11246 H HB3  . GLU A 1 20 ? -11.701 2.931   10.870  1.00 0.00 ? 1064 GLU B HB3  8  
ATOM 11247 H HG2  . GLU A 1 20 ? -13.501 1.322   10.556  1.00 0.00 ? 1064 GLU B HG2  8  
ATOM 11248 H HG3  . GLU A 1 20 ? -12.451 0.290   9.587   1.00 0.00 ? 1064 GLU B HG3  8  
ATOM 11249 N N    . PHE A 1 21 ? -10.055 4.135   8.199   1.00 0.00 ? 1065 PHE B N    8  
ATOM 11250 C CA   . PHE A 1 21 ? -9.319  5.377   8.011   1.00 0.00 ? 1065 PHE B CA   8  
ATOM 11251 C C    . PHE A 1 21 ? -9.889  6.165   6.841   1.00 0.00 ? 1065 PHE B C    8  
ATOM 11252 O O    . PHE A 1 21 ? -9.999  7.392   6.893   1.00 0.00 ? 1065 PHE B O    8  
ATOM 11253 C CB   . PHE A 1 21 ? -7.838  5.078   7.761   1.00 0.00 ? 1065 PHE B CB   8  
ATOM 11254 C CG   . PHE A 1 21 ? -7.152  4.779   9.074   1.00 0.00 ? 1065 PHE B CG   8  
ATOM 11255 C CD1  . PHE A 1 21 ? -6.645  3.499   9.327   1.00 0.00 ? 1065 PHE B CD1  8  
ATOM 11256 C CD2  . PHE A 1 21 ? -7.024  5.785   10.038  1.00 0.00 ? 1065 PHE B CD2  8  
ATOM 11257 C CE1  . PHE A 1 21 ? -6.008  3.227   10.545  1.00 0.00 ? 1065 PHE B CE1  8  
ATOM 11258 C CE2  . PHE A 1 21 ? -6.389  5.513   11.256  1.00 0.00 ? 1065 PHE B CE2  8  
ATOM 11259 C CZ   . PHE A 1 21 ? -5.880  4.234   11.509  1.00 0.00 ? 1065 PHE B CZ   8  
ATOM 11260 H H    . PHE A 1 21 ? -9.609  3.278   8.032   1.00 0.00 ? 1065 PHE B H    8  
ATOM 11261 H HA   . PHE A 1 21 ? -9.405  5.972   8.907   1.00 0.00 ? 1065 PHE B HA   8  
ATOM 11262 H HB2  . PHE A 1 21 ? -7.750  4.223   7.106   1.00 0.00 ? 1065 PHE B HB2  8  
ATOM 11263 H HB3  . PHE A 1 21 ? -7.372  5.936   7.298   1.00 0.00 ? 1065 PHE B HB3  8  
ATOM 11264 H HD1  . PHE A 1 21 ? -6.742  2.722   8.583   1.00 0.00 ? 1065 PHE B HD1  8  
ATOM 11265 H HD2  . PHE A 1 21 ? -7.418  6.772   9.844   1.00 0.00 ? 1065 PHE B HD2  8  
ATOM 11266 H HE1  . PHE A 1 21 ? -5.614  2.239   10.740  1.00 0.00 ? 1065 PHE B HE1  8  
ATOM 11267 H HE2  . PHE A 1 21 ? -6.291  6.290   11.999  1.00 0.00 ? 1065 PHE B HE2  8  
ATOM 11268 H HZ   . PHE A 1 21 ? -5.388  4.024   12.447  1.00 0.00 ? 1065 PHE B HZ   8  
ATOM 11269 N N    . LEU A 1 22 ? -10.251 5.451   5.783   1.00 0.00 ? 1066 LEU B N    8  
ATOM 11270 C CA   . LEU A 1 22 ? -10.808 6.089   4.598   1.00 0.00 ? 1066 LEU B CA   8  
ATOM 11271 C C    . LEU A 1 22 ? -12.138 6.764   4.920   1.00 0.00 ? 1066 LEU B C    8  
ATOM 11272 O O    . LEU A 1 22 ? -12.408 7.874   4.459   1.00 0.00 ? 1066 LEU B O    8  
ATOM 11273 C CB   . LEU A 1 22 ? -11.016 5.043   3.502   1.00 0.00 ? 1066 LEU B CB   8  
ATOM 11274 C CG   . LEU A 1 22 ? -9.657  4.570   2.985   1.00 0.00 ? 1066 LEU B CG   8  
ATOM 11275 C CD1  . LEU A 1 22 ? -9.851  3.343   2.095   1.00 0.00 ? 1066 LEU B CD1  8  
ATOM 11276 C CD2  . LEU A 1 22 ? -9.001  5.688   2.169   1.00 0.00 ? 1066 LEU B CD2  8  
ATOM 11277 H H    . LEU A 1 22 ? -10.140 4.476   5.801   1.00 0.00 ? 1066 LEU B H    8  
ATOM 11278 H HA   . LEU A 1 22 ? -10.114 6.835   4.242   1.00 0.00 ? 1066 LEU B HA   8  
ATOM 11279 H HB2  . LEU A 1 22 ? -11.560 4.202   3.909   1.00 0.00 ? 1066 LEU B HB2  8  
ATOM 11280 H HB3  . LEU A 1 22 ? -11.577 5.477   2.690   1.00 0.00 ? 1066 LEU B HB3  8  
ATOM 11281 H HG   . LEU A 1 22 ? -9.022  4.312   3.820   1.00 0.00 ? 1066 LEU B HG   8  
ATOM 11282 H HD11 . LEU A 1 22 ? -10.393 2.587   2.643   1.00 0.00 ? 1066 LEU B HD11 8  
ATOM 11283 H HD12 . LEU A 1 22 ? -8.888  2.956   1.801   1.00 0.00 ? 1066 LEU B HD12 8  
ATOM 11284 H HD13 . LEU A 1 22 ? -10.412 3.622   1.216   1.00 0.00 ? 1066 LEU B HD13 8  
ATOM 11285 H HD21 . LEU A 1 22 ? -8.343  6.260   2.807   1.00 0.00 ? 1066 LEU B HD21 8  
ATOM 11286 H HD22 . LEU A 1 22 ? -9.766  6.337   1.768   1.00 0.00 ? 1066 LEU B HD22 8  
ATOM 11287 H HD23 . LEU A 1 22 ? -8.434  5.258   1.359   1.00 0.00 ? 1066 LEU B HD23 8  
ATOM 11288 N N    . SER A 1 23 ? -12.965 6.087   5.711   1.00 0.00 ? 1067 SER B N    8  
ATOM 11289 C CA   . SER A 1 23 ? -14.264 6.635   6.087   1.00 0.00 ? 1067 SER B CA   8  
ATOM 11290 C C    . SER A 1 23 ? -14.090 7.867   6.967   1.00 0.00 ? 1067 SER B C    8  
ATOM 11291 O O    . SER A 1 23 ? -14.835 8.839   6.849   1.00 0.00 ? 1067 SER B O    8  
ATOM 11292 C CB   . SER A 1 23 ? -15.080 5.582   6.834   1.00 0.00 ? 1067 SER B CB   8  
ATOM 11293 O OG   . SER A 1 23 ? -14.420 5.256   8.049   1.00 0.00 ? 1067 SER B OG   8  
ATOM 11294 H H    . SER A 1 23 ? -12.698 5.207   6.050   1.00 0.00 ? 1067 SER B H    8  
ATOM 11295 H HA   . SER A 1 23 ? -14.796 6.919   5.192   1.00 0.00 ? 1067 SER B HA   8  
ATOM 11296 H HB2  . SER A 1 23 ? -16.060 5.973   7.054   1.00 0.00 ? 1067 SER B HB2  8  
ATOM 11297 H HB3  . SER A 1 23 ? -15.178 4.701   6.216   1.00 0.00 ? 1067 SER B HB3  8  
ATOM 11298 H HG   . SER A 1 23 ? -14.297 4.305   8.074   1.00 0.00 ? 1067 SER B HG   8  
ATOM 11299 N N    . ARG A 1 24 ? -13.097 7.815   7.849   1.00 0.00 ? 1068 ARG B N    8  
ATOM 11300 C CA   . ARG A 1 24 ? -12.829 8.934   8.743   1.00 0.00 ? 1068 ARG B CA   8  
ATOM 11301 C C    . ARG A 1 24 ? -12.439 10.168  7.948   1.00 0.00 ? 1068 ARG B C    8  
ATOM 11302 O O    . ARG A 1 24 ? -12.844 11.285  8.273   1.00 0.00 ? 1068 ARG B O    8  
ATOM 11303 C CB   . ARG A 1 24 ? -11.695 8.579   9.701   1.00 0.00 ? 1068 ARG B CB   8  
ATOM 11304 C CG   . ARG A 1 24 ? -12.176 7.552   10.726  1.00 0.00 ? 1068 ARG B CG   8  
ATOM 11305 C CD   . ARG A 1 24 ? -13.042 8.241   11.785  1.00 0.00 ? 1068 ARG B CD   8  
ATOM 11306 N NE   . ARG A 1 24 ? -12.270 9.272   12.475  1.00 0.00 ? 1068 ARG B NE   8  
ATOM 11307 C CZ   . ARG A 1 24 ? -12.822 10.068  13.392  1.00 0.00 ? 1068 ARG B CZ   8  
ATOM 11308 N NH1  . ARG A 1 24 ? -14.086 9.951   13.709  1.00 0.00 ? 1068 ARG B NH1  8  
ATOM 11309 N NH2  . ARG A 1 24 ? -12.093 10.977  13.978  1.00 0.00 ? 1068 ARG B NH2  8  
ATOM 11310 H H    . ARG A 1 24 ? -12.534 7.014   7.897   1.00 0.00 ? 1068 ARG B H    8  
ATOM 11311 H HA   . ARG A 1 24 ? -13.717 9.151   9.313   1.00 0.00 ? 1068 ARG B HA   8  
ATOM 11312 H HB2  . ARG A 1 24 ? -10.871 8.167   9.138   1.00 0.00 ? 1068 ARG B HB2  8  
ATOM 11313 H HB3  . ARG A 1 24 ? -11.368 9.471   10.213  1.00 0.00 ? 1068 ARG B HB3  8  
ATOM 11314 H HG2  . ARG A 1 24 ? -12.758 6.794   10.226  1.00 0.00 ? 1068 ARG B HG2  8  
ATOM 11315 H HG3  . ARG A 1 24 ? -11.322 7.094   11.203  1.00 0.00 ? 1068 ARG B HG3  8  
ATOM 11316 H HD2  . ARG A 1 24 ? -13.899 8.695   11.314  1.00 0.00 ? 1068 ARG B HD2  8  
ATOM 11317 H HD3  . ARG A 1 24 ? -13.378 7.506   12.501  1.00 0.00 ? 1068 ARG B HD3  8  
ATOM 11318 H HE   . ARG A 1 24 ? -11.320 9.382   12.256  1.00 0.00 ? 1068 ARG B HE   8  
ATOM 11319 H HH11 . ARG A 1 24 ? -14.656 9.260   13.266  1.00 0.00 ? 1068 ARG B HH11 8  
ATOM 11320 H HH12 . ARG A 1 24 ? -14.483 10.557  14.399  1.00 0.00 ? 1068 ARG B HH12 8  
ATOM 11321 H HH21 . ARG A 1 24 ? -11.127 11.073  13.740  1.00 0.00 ? 1068 ARG B HH21 8  
ATOM 11322 H HH22 . ARG A 1 24 ? -12.500 11.579  14.667  1.00 0.00 ? 1068 ARG B HH22 8  
ATOM 11323 N N    . GLY A 1 25 ? -11.639 9.966   6.911   1.00 0.00 ? 1069 GLY B N    8  
ATOM 11324 C CA   . GLY A 1 25 ? -11.195 11.082  6.089   1.00 0.00 ? 1069 GLY B CA   8  
ATOM 11325 C C    . GLY A 1 25 ? -12.379 11.709  5.338   1.00 0.00 ? 1069 GLY B C    8  
ATOM 11326 O O    . GLY A 1 25 ? -13.177 10.990  4.734   1.00 0.00 ? 1069 GLY B O    8  
ATOM 11327 H H    . GLY A 1 25 ? -11.336 9.056   6.704   1.00 0.00 ? 1069 GLY B H    8  
ATOM 11328 H HA2  . GLY A 1 25 ? -10.724 11.808  6.728   1.00 0.00 ? 1069 GLY B HA2  8  
ATOM 11329 H HA3  . GLY A 1 25 ? -10.474 10.725  5.369   1.00 0.00 ? 1069 GLY B HA3  8  
ATOM 11330 N N    . PRO A 1 26 ? -12.511 13.023  5.343   1.00 0.00 ? 1070 PRO B N    8  
ATOM 11331 C CA   . PRO A 1 26 ? -13.626 13.717  4.624   1.00 0.00 ? 1070 PRO B CA   8  
ATOM 11332 C C    . PRO A 1 26 ? -13.403 13.758  3.112   1.00 0.00 ? 1070 PRO B C    8  
ATOM 11333 O O    . PRO A 1 26 ? -12.281 13.963  2.652   1.00 0.00 ? 1070 PRO B O    8  
ATOM 11334 C CB   . PRO A 1 26 ? -13.617 15.127  5.219   1.00 0.00 ? 1070 PRO B CB   8  
ATOM 11335 C CG   . PRO A 1 26 ? -12.208 15.360  5.650   1.00 0.00 ? 1070 PRO B CG   8  
ATOM 11336 C CD   . PRO A 1 26 ? -11.630 13.992  6.025   1.00 0.00 ? 1070 PRO B CD   8  
ATOM 11337 H HA   . PRO A 1 26 ? -14.566 13.239  4.846   1.00 0.00 ? 1070 PRO B HA   8  
ATOM 11338 H HB2  . PRO A 1 26 ? -13.908 15.851  4.469   1.00 0.00 ? 1070 PRO B HB2  8  
ATOM 11339 H HB3  . PRO A 1 26 ? -14.278 15.180  6.070   1.00 0.00 ? 1070 PRO B HB3  8  
ATOM 11340 H HG2  . PRO A 1 26 ? -11.642 15.800  4.839   1.00 0.00 ? 1070 PRO B HG2  8  
ATOM 11341 H HG3  . PRO A 1 26 ? -12.188 16.013  6.511   1.00 0.00 ? 1070 PRO B HG3  8  
ATOM 11342 H HD2  . PRO A 1 26 ? -10.612 13.901  5.668   1.00 0.00 ? 1070 PRO B HD2  8  
ATOM 11343 H HD3  . PRO A 1 26 ? -11.671 13.841  7.094   1.00 0.00 ? 1070 PRO B HD3  8  
ATOM 11344 N N    . ALA A 1 27 ? -14.481 13.580  2.346   1.00 0.00 ? 1071 ALA B N    8  
ATOM 11345 C CA   . ALA A 1 27 ? -14.389 13.610  0.888   1.00 0.00 ? 1071 ALA B CA   8  
ATOM 11346 C C    . ALA A 1 27 ? -13.227 12.751  0.399   1.00 0.00 ? 1071 ALA B C    8  
ATOM 11347 O O    . ALA A 1 27 ? -12.100 13.226  0.263   1.00 0.00 ? 1071 ALA B O    8  
ATOM 11348 C CB   . ALA A 1 27 ? -14.201 15.047  0.408   1.00 0.00 ? 1071 ALA B CB   8  
ATOM 11349 H H    . ALA A 1 27 ? -15.353 13.431  2.770   1.00 0.00 ? 1071 ALA B H    8  
ATOM 11350 H HA   . ALA A 1 27 ? -15.308 13.222  0.472   1.00 0.00 ? 1071 ALA B HA   8  
ATOM 11351 H HB1  . ALA A 1 27 ? -15.023 15.653  0.757   1.00 0.00 ? 1071 ALA B HB1  8  
ATOM 11352 H HB2  . ALA A 1 27 ? -14.174 15.064  -0.672  1.00 0.00 ? 1071 ALA B HB2  8  
ATOM 11353 H HB3  . ALA A 1 27 ? -13.273 15.438  0.798   1.00 0.00 ? 1071 ALA B HB3  8  
ATOM 11354 N N    . VAL A 1 28 ? -13.510 11.481  0.135   1.00 0.00 ? 1072 VAL B N    8  
ATOM 11355 C CA   . VAL A 1 28 ? -12.478 10.562  -0.329  1.00 0.00 ? 1072 VAL B CA   8  
ATOM 11356 C C    . VAL A 1 28 ? -11.858 11.074  -1.624  1.00 0.00 ? 1072 VAL B C    8  
ATOM 11357 O O    . VAL A 1 28 ? -10.640 11.060  -1.788  1.00 0.00 ? 1072 VAL B O    8  
ATOM 11358 C CB   . VAL A 1 28 ? -13.078 9.175   -0.561  1.00 0.00 ? 1072 VAL B CB   8  
ATOM 11359 C CG1  . VAL A 1 28 ? -12.048 8.278   -1.251  1.00 0.00 ? 1072 VAL B CG1  8  
ATOM 11360 C CG2  . VAL A 1 28 ? -13.477 8.558   0.781   1.00 0.00 ? 1072 VAL B CG2  8  
ATOM 11361 H H    . VAL A 1 28 ? -14.425 11.156  0.258   1.00 0.00 ? 1072 VAL B H    8  
ATOM 11362 H HA   . VAL A 1 28 ? -11.708 10.488  0.423   1.00 0.00 ? 1072 VAL B HA   8  
ATOM 11363 H HB   . VAL A 1 28 ? -13.952 9.266   -1.190  1.00 0.00 ? 1072 VAL B HB   8  
ATOM 11364 H HG11 . VAL A 1 28 ? -12.017 8.510   -2.305  1.00 0.00 ? 1072 VAL B HG11 8  
ATOM 11365 H HG12 . VAL A 1 28 ? -12.327 7.244   -1.119  1.00 0.00 ? 1072 VAL B HG12 8  
ATOM 11366 H HG13 . VAL A 1 28 ? -11.075 8.448   -0.816  1.00 0.00 ? 1072 VAL B HG13 8  
ATOM 11367 H HG21 . VAL A 1 28 ? -12.723 8.788   1.520   1.00 0.00 ? 1072 VAL B HG21 8  
ATOM 11368 H HG22 . VAL A 1 28 ? -13.562 7.487   0.674   1.00 0.00 ? 1072 VAL B HG22 8  
ATOM 11369 H HG23 . VAL A 1 28 ? -14.426 8.964   1.097   1.00 0.00 ? 1072 VAL B HG23 8  
ATOM 11370 N N    . LEU A 1 29 ? -12.705 11.530  -2.538  1.00 0.00 ? 1073 LEU B N    8  
ATOM 11371 C CA   . LEU A 1 29 ? -12.227 12.052  -3.811  1.00 0.00 ? 1073 LEU B CA   8  
ATOM 11372 C C    . LEU A 1 29 ? -12.378 13.565  -3.866  1.00 0.00 ? 1073 LEU B C    8  
ATOM 11373 O O    . LEU A 1 29 ? -12.747 14.127  -4.899  1.00 0.00 ? 1073 LEU B O    8  
ATOM 11374 C CB   . LEU A 1 29 ? -13.002 11.425  -4.962  1.00 0.00 ? 1073 LEU B CB   8  
ATOM 11375 C CG   . LEU A 1 29 ? -12.568 9.969   -5.148  1.00 0.00 ? 1073 LEU B CG   8  
ATOM 11376 C CD1  . LEU A 1 29 ? -13.523 9.268   -6.112  1.00 0.00 ? 1073 LEU B CD1  8  
ATOM 11377 C CD2  . LEU A 1 29 ? -11.149 9.929   -5.729  1.00 0.00 ? 1073 LEU B CD2  8  
ATOM 11378 H H    . LEU A 1 29 ? -13.667 11.521  -2.349  1.00 0.00 ? 1073 LEU B H    8  
ATOM 11379 H HA   . LEU A 1 29 ? -11.184 11.803  -3.919  1.00 0.00 ? 1073 LEU B HA   8  
ATOM 11380 H HB2  . LEU A 1 29 ? -14.056 11.465  -4.737  1.00 0.00 ? 1073 LEU B HB2  8  
ATOM 11381 H HB3  . LEU A 1 29 ? -12.804 11.979  -5.866  1.00 0.00 ? 1073 LEU B HB3  8  
ATOM 11382 H HG   . LEU A 1 29 ? -12.583 9.464   -4.193  1.00 0.00 ? 1073 LEU B HG   8  
ATOM 11383 H HD11 . LEU A 1 29 ? -14.539 9.555   -5.884  1.00 0.00 ? 1073 LEU B HD11 8  
ATOM 11384 H HD12 . LEU A 1 29 ? -13.420 8.198   -6.008  1.00 0.00 ? 1073 LEU B HD12 8  
ATOM 11385 H HD13 . LEU A 1 29 ? -13.287 9.556   -7.126  1.00 0.00 ? 1073 LEU B HD13 8  
ATOM 11386 H HD21 . LEU A 1 29 ? -10.753 10.935  -5.785  1.00 0.00 ? 1073 LEU B HD21 8  
ATOM 11387 H HD22 . LEU A 1 29 ? -11.178 9.497   -6.718  1.00 0.00 ? 1073 LEU B HD22 8  
ATOM 11388 H HD23 . LEU A 1 29 ? -10.517 9.330   -5.092  1.00 0.00 ? 1073 LEU B HD23 8  
ATOM 11389 N N    . ALA A 1 30 ? -12.088 14.216  -2.753  1.00 0.00 ? 1074 ALA B N    8  
ATOM 11390 C CA   . ALA A 1 30 ? -12.189 15.670  -2.676  1.00 0.00 ? 1074 ALA B CA   8  
ATOM 11391 C C    . ALA A 1 30 ? -11.275 16.317  -3.711  1.00 0.00 ? 1074 ALA B C    8  
ATOM 11392 O O    . ALA A 1 30 ? -11.627 17.331  -4.315  1.00 0.00 ? 1074 ALA B O    8  
ATOM 11393 C CB   . ALA A 1 30 ? -11.793 16.149  -1.276  1.00 0.00 ? 1074 ALA B CB   8  
ATOM 11394 H H    . ALA A 1 30 ? -11.803 13.709  -1.966  1.00 0.00 ? 1074 ALA B H    8  
ATOM 11395 H HA   . ALA A 1 30 ? -13.209 15.964  -2.872  1.00 0.00 ? 1074 ALA B HA   8  
ATOM 11396 H HB1  . ALA A 1 30 ? -12.607 16.715  -0.848  1.00 0.00 ? 1074 ALA B HB1  8  
ATOM 11397 H HB2  . ALA A 1 30 ? -10.915 16.775  -1.346  1.00 0.00 ? 1074 ALA B HB2  8  
ATOM 11398 H HB3  . ALA A 1 30 ? -11.580 15.295  -0.654  1.00 0.00 ? 1074 ALA B HB3  8  
ATOM 11399 N N    . THR A 1 31 ? -10.105 15.723  -3.910  1.00 0.00 ? 1075 THR B N    8  
ATOM 11400 C CA   . THR A 1 31 ? -9.148  16.247  -4.878  1.00 0.00 ? 1075 THR B CA   8  
ATOM 11401 C C    . THR A 1 31 ? -8.910  15.246  -5.997  1.00 0.00 ? 1075 THR B C    8  
ATOM 11402 O O    . THR A 1 31 ? -9.171  14.053  -5.846  1.00 0.00 ? 1075 THR B O    8  
ATOM 11403 C CB   . THR A 1 31 ? -7.821  16.568  -4.191  1.00 0.00 ? 1075 THR B CB   8  
ATOM 11404 O OG1  . THR A 1 31 ? -7.319  15.398  -3.559  1.00 0.00 ? 1075 THR B OG1  8  
ATOM 11405 C CG2  . THR A 1 31 ? -8.035  17.670  -3.158  1.00 0.00 ? 1075 THR B CG2  8  
ATOM 11406 H H    . THR A 1 31 ? -9.882  14.915  -3.402  1.00 0.00 ? 1075 THR B H    8  
ATOM 11407 H HA   . THR A 1 31 ? -9.546  17.156  -5.303  1.00 0.00 ? 1075 THR B HA   8  
ATOM 11408 H HB   . THR A 1 31 ? -7.110  16.908  -4.928  1.00 0.00 ? 1075 THR B HB   8  
ATOM 11409 H HG1  . THR A 1 31 ? -7.885  15.202  -2.807  1.00 0.00 ? 1075 THR B HG1  8  
ATOM 11410 H HG21 . THR A 1 31 ? -8.787  17.358  -2.450  1.00 0.00 ? 1075 THR B HG21 8  
ATOM 11411 H HG22 . THR A 1 31 ? -8.362  18.568  -3.660  1.00 0.00 ? 1075 THR B HG22 8  
ATOM 11412 H HG23 . THR A 1 31 ? -7.108  17.864  -2.641  1.00 0.00 ? 1075 THR B HG23 8  
ATOM 11413 N N    . LYS A 1 32 ? -8.416  15.744  -7.122  1.00 0.00 ? 1076 LYS B N    8  
ATOM 11414 C CA   . LYS A 1 32 ? -8.147  14.891  -8.275  1.00 0.00 ? 1076 LYS B CA   8  
ATOM 11415 C C    . LYS A 1 32 ? -6.662  14.545  -8.357  1.00 0.00 ? 1076 LYS B C    8  
ATOM 11416 O O    . LYS A 1 32 ? -6.200  14.000  -9.360  1.00 0.00 ? 1076 LYS B O    8  
ATOM 11417 C CB   . LYS A 1 32 ? -8.575  15.602  -9.561  1.00 0.00 ? 1076 LYS B CB   8  
ATOM 11418 C CG   . LYS A 1 32 ? -10.048 16.017  -9.467  1.00 0.00 ? 1076 LYS B CG   8  
ATOM 11419 C CD   . LYS A 1 32 ? -10.937 14.777  -9.337  1.00 0.00 ? 1076 LYS B CD   8  
ATOM 11420 C CE   . LYS A 1 32 ? -12.405 15.204  -9.327  1.00 0.00 ? 1076 LYS B CE   8  
ATOM 11421 N NZ   . LYS A 1 32 ? -13.268 13.997  -9.189  1.00 0.00 ? 1076 LYS B NZ   8  
ATOM 11422 H H    . LYS A 1 32 ? -8.233  16.706  -7.179  1.00 0.00 ? 1076 LYS B H    8  
ATOM 11423 H HA   . LYS A 1 32 ? -8.708  13.977  -8.175  1.00 0.00 ? 1076 LYS B HA   8  
ATOM 11424 H HB2  . LYS A 1 32 ? -7.963  16.479  -9.708  1.00 0.00 ? 1076 LYS B HB2  8  
ATOM 11425 H HB3  . LYS A 1 32 ? -8.447  14.933  -10.399 1.00 0.00 ? 1076 LYS B HB3  8  
ATOM 11426 H HG2  . LYS A 1 32 ? -10.186 16.647  -8.599  1.00 0.00 ? 1076 LYS B HG2  8  
ATOM 11427 H HG3  . LYS A 1 32 ? -10.324 16.563  -10.354 1.00 0.00 ? 1076 LYS B HG3  8  
ATOM 11428 H HD2  . LYS A 1 32 ? -10.760 14.116  -10.172 1.00 0.00 ? 1076 LYS B HD2  8  
ATOM 11429 H HD3  . LYS A 1 32 ? -10.713 14.263  -8.417  1.00 0.00 ? 1076 LYS B HD3  8  
ATOM 11430 H HE2  . LYS A 1 32 ? -12.582 15.869  -8.495  1.00 0.00 ? 1076 LYS B HE2  8  
ATOM 11431 H HE3  . LYS A 1 32 ? -12.639 15.712  -10.251 1.00 0.00 ? 1076 LYS B HE3  8  
ATOM 11432 H HZ1  . LYS A 1 32 ? -14.185 14.173  -9.647  1.00 0.00 ? 1076 LYS B HZ1  8  
ATOM 11433 H HZ2  . LYS A 1 32 ? -13.417 13.792  -8.181  1.00 0.00 ? 1076 LYS B HZ2  8  
ATOM 11434 H HZ3  . LYS A 1 32 ? -12.806 13.188  -9.646  1.00 0.00 ? 1076 LYS B HZ3  8  
ATOM 11435 N N    . ALA A 1 33 ? -5.913  14.865  -7.304  1.00 0.00 ? 1077 ALA B N    8  
ATOM 11436 C CA   . ALA A 1 33 ? -4.485  14.583  -7.284  1.00 0.00 ? 1077 ALA B CA   8  
ATOM 11437 C C    . ALA A 1 33 ? -3.797  15.204  -8.496  1.00 0.00 ? 1077 ALA B C    8  
ATOM 11438 O O    . ALA A 1 33 ? -2.996  14.556  -9.170  1.00 0.00 ? 1077 ALA B O    8  
ATOM 11439 C CB   . ALA A 1 33 ? -4.249  13.071  -7.279  1.00 0.00 ? 1077 ALA B CB   8  
ATOM 11440 H H    . ALA A 1 33 ? -6.328  15.297  -6.529  1.00 0.00 ? 1077 ALA B H    8  
ATOM 11441 H HA   . ALA A 1 33 ? -4.061  15.005  -6.386  1.00 0.00 ? 1077 ALA B HA   8  
ATOM 11442 H HB1  . ALA A 1 33 ? -3.189  12.872  -7.223  1.00 0.00 ? 1077 ALA B HB1  8  
ATOM 11443 H HB2  . ALA A 1 33 ? -4.649  12.642  -8.186  1.00 0.00 ? 1077 ALA B HB2  8  
ATOM 11444 H HB3  . ALA A 1 33 ? -4.743  12.632  -6.425  1.00 0.00 ? 1077 ALA B HB3  8  
ATOM 11445 N N    . ALA A 1 34 ? -4.118  16.465  -8.766  1.00 0.00 ? 1078 ALA B N    8  
ATOM 11446 C CA   . ALA A 1 34 ? -3.526  17.169  -9.899  1.00 0.00 ? 1078 ALA B CA   8  
ATOM 11447 C C    . ALA A 1 34 ? -2.011  17.256  -9.748  1.00 0.00 ? 1078 ALA B C    8  
ATOM 11448 O O    . ALA A 1 34 ? -1.272  17.120  -10.722 1.00 0.00 ? 1078 ALA B O    8  
ATOM 11449 C CB   . ALA A 1 34 ? -4.110  18.580  -10.000 1.00 0.00 ? 1078 ALA B CB   8  
ATOM 11450 H H    . ALA A 1 34 ? -4.761  16.931  -8.194  1.00 0.00 ? 1078 ALA B H    8  
ATOM 11451 H HA   . ALA A 1 34 ? -3.758  16.630  -10.804 1.00 0.00 ? 1078 ALA B HA   8  
ATOM 11452 H HB1  . ALA A 1 34 ? -4.932  18.680  -9.307  1.00 0.00 ? 1078 ALA B HB1  8  
ATOM 11453 H HB2  . ALA A 1 34 ? -4.465  18.751  -11.005 1.00 0.00 ? 1078 ALA B HB2  8  
ATOM 11454 H HB3  . ALA A 1 34 ? -3.346  19.304  -9.759  1.00 0.00 ? 1078 ALA B HB3  8  
ATOM 11455 N N    . ALA A 1 35 ? -1.555  17.491  -8.521  1.00 0.00 ? 1079 ALA B N    8  
ATOM 11456 C CA   . ALA A 1 35 ? -0.125  17.603  -8.255  1.00 0.00 ? 1079 ALA B CA   8  
ATOM 11457 C C    . ALA A 1 35 ? 0.249   16.831  -6.993  1.00 0.00 ? 1079 ALA B C    8  
ATOM 11458 O O    . ALA A 1 35 ? -0.619  16.442  -6.214  1.00 0.00 ? 1079 ALA B O    8  
ATOM 11459 C CB   . ALA A 1 35 ? 0.262   19.074  -8.086  1.00 0.00 ? 1079 ALA B CB   8  
ATOM 11460 H H    . ALA A 1 35 ? -2.192  17.595  -7.783  1.00 0.00 ? 1079 ALA B H    8  
ATOM 11461 H HA   . ALA A 1 35 ? 0.419   17.193  -9.091  1.00 0.00 ? 1079 ALA B HA   8  
ATOM 11462 H HB1  . ALA A 1 35 ? -0.329  19.682  -8.756  1.00 0.00 ? 1079 ALA B HB1  8  
ATOM 11463 H HB2  . ALA A 1 35 ? 1.309   19.200  -8.317  1.00 0.00 ? 1079 ALA B HB2  8  
ATOM 11464 H HB3  . ALA A 1 35 ? 0.078   19.381  -7.067  1.00 0.00 ? 1079 ALA B HB3  8  
ATOM 11465 N N    . GLY A 1 36 ? 1.547   16.606  -6.803  1.00 0.00 ? 1080 GLY B N    8  
ATOM 11466 C CA   . GLY A 1 36 ? 2.018   15.872  -5.635  1.00 0.00 ? 1080 GLY B CA   8  
ATOM 11467 C C    . GLY A 1 36 ? 1.946   14.368  -5.871  1.00 0.00 ? 1080 GLY B C    8  
ATOM 11468 O O    . GLY A 1 36 ? 1.891   13.584  -4.929  1.00 0.00 ? 1080 GLY B O    8  
ATOM 11469 H H    . GLY A 1 36 ? 2.195   16.932  -7.461  1.00 0.00 ? 1080 GLY B H    8  
ATOM 11470 H HA2  . GLY A 1 36 ? 3.041   16.152  -5.428  1.00 0.00 ? 1080 GLY B HA2  8  
ATOM 11471 H HA3  . GLY A 1 36 ? 1.402   16.125  -4.784  1.00 0.00 ? 1080 GLY B HA3  8  
ATOM 11472 N N    . THR A 1 37 ? 1.951   13.973  -7.134  1.00 0.00 ? 1081 THR B N    8  
ATOM 11473 C CA   . THR A 1 37 ? 1.882   12.565  -7.483  1.00 0.00 ? 1081 THR B CA   8  
ATOM 11474 C C    . THR A 1 37 ? 3.047   11.801  -6.866  1.00 0.00 ? 1081 THR B C    8  
ATOM 11475 O O    . THR A 1 37 ? 2.890   10.667  -6.416  1.00 0.00 ? 1081 THR B O    8  
ATOM 11476 C CB   . THR A 1 37 ? 1.910   12.412  -9.002  1.00 0.00 ? 1081 THR B CB   8  
ATOM 11477 O OG1  . THR A 1 37 ? 0.782   13.068  -9.565  1.00 0.00 ? 1081 THR B OG1  8  
ATOM 11478 C CG2  . THR A 1 37 ? 1.867   10.932  -9.354  1.00 0.00 ? 1081 THR B CG2  8  
ATOM 11479 H H    . THR A 1 37 ? 2.005   14.635  -7.849  1.00 0.00 ? 1081 THR B H    8  
ATOM 11480 H HA   . THR A 1 37 ? 0.958   12.156  -7.109  1.00 0.00 ? 1081 THR B HA   8  
ATOM 11481 H HB   . THR A 1 37 ? 2.816   12.847  -9.395  1.00 0.00 ? 1081 THR B HB   8  
ATOM 11482 H HG1  . THR A 1 37 ? 0.754   13.962  -9.215  1.00 0.00 ? 1081 THR B HG1  8  
ATOM 11483 H HG21 . THR A 1 37 ? 1.278   10.408  -8.618  1.00 0.00 ? 1081 THR B HG21 8  
ATOM 11484 H HG22 . THR A 1 37 ? 2.872   10.537  -9.359  1.00 0.00 ? 1081 THR B HG22 8  
ATOM 11485 H HG23 . THR A 1 37 ? 1.424   10.807  -10.328 1.00 0.00 ? 1081 THR B HG23 8  
ATOM 11486 N N    . LYS A 1 38 ? 4.213   12.425  -6.853  1.00 0.00 ? 1082 LYS B N    8  
ATOM 11487 C CA   . LYS A 1 38 ? 5.399   11.791  -6.297  1.00 0.00 ? 1082 LYS B CA   8  
ATOM 11488 C C    . LYS A 1 38 ? 5.200   11.435  -4.825  1.00 0.00 ? 1082 LYS B C    8  
ATOM 11489 O O    . LYS A 1 38 ? 5.574   10.348  -4.386  1.00 0.00 ? 1082 LYS B O    8  
ATOM 11490 C CB   . LYS A 1 38 ? 6.573   12.756  -6.413  1.00 0.00 ? 1082 LYS B CB   8  
ATOM 11491 C CG   . LYS A 1 38 ? 7.000   12.910  -7.880  1.00 0.00 ? 1082 LYS B CG   8  
ATOM 11492 C CD   . LYS A 1 38 ? 7.663   11.620  -8.376  1.00 0.00 ? 1082 LYS B CD   8  
ATOM 11493 C CE   . LYS A 1 38 ? 8.196   11.830  -9.795  1.00 0.00 ? 1082 LYS B CE   8  
ATOM 11494 N NZ   . LYS A 1 38 ? 8.857   10.579  -10.262 1.00 0.00 ? 1082 LYS B NZ   8  
ATOM 11495 H H    . LYS A 1 38 ? 4.280   13.327  -7.232  1.00 0.00 ? 1082 LYS B H    8  
ATOM 11496 H HA   . LYS A 1 38 ? 5.618   10.896  -6.849  1.00 0.00 ? 1082 LYS B HA   8  
ATOM 11497 H HB2  . LYS A 1 38 ? 6.266   13.720  -6.028  1.00 0.00 ? 1082 LYS B HB2  8  
ATOM 11498 H HB3  . LYS A 1 38 ? 7.400   12.385  -5.832  1.00 0.00 ? 1082 LYS B HB3  8  
ATOM 11499 H HG2  . LYS A 1 38 ? 6.130   13.122  -8.485  1.00 0.00 ? 1082 LYS B HG2  8  
ATOM 11500 H HG3  . LYS A 1 38 ? 7.700   13.726  -7.962  1.00 0.00 ? 1082 LYS B HG3  8  
ATOM 11501 H HD2  . LYS A 1 38 ? 8.480   11.360  -7.718  1.00 0.00 ? 1082 LYS B HD2  8  
ATOM 11502 H HD3  . LYS A 1 38 ? 6.942   10.818  -8.385  1.00 0.00 ? 1082 LYS B HD3  8  
ATOM 11503 H HE2  . LYS A 1 38 ? 7.377   12.074  -10.456 1.00 0.00 ? 1082 LYS B HE2  8  
ATOM 11504 H HE3  . LYS A 1 38 ? 8.913   12.638  -9.797  1.00 0.00 ? 1082 LYS B HE3  8  
ATOM 11505 H HZ1  . LYS A 1 38 ? 8.186   10.020  -10.826 1.00 0.00 ? 1082 LYS B HZ1  8  
ATOM 11506 H HZ2  . LYS A 1 38 ? 9.165   10.023  -9.438  1.00 0.00 ? 1082 LYS B HZ2  8  
ATOM 11507 H HZ3  . LYS A 1 38 ? 9.683   10.819  -10.847 1.00 0.00 ? 1082 LYS B HZ3  8  
ATOM 11508 N N    . LYS A 1 39 ? 4.611   12.350  -4.068  1.00 0.00 ? 1083 LYS B N    8  
ATOM 11509 C CA   . LYS A 1 39 ? 4.368   12.113  -2.650  1.00 0.00 ? 1083 LYS B CA   8  
ATOM 11510 C C    . LYS A 1 39 ? 3.248   11.096  -2.474  1.00 0.00 ? 1083 LYS B C    8  
ATOM 11511 O O    . LYS A 1 39 ? 3.197   10.369  -1.484  1.00 0.00 ? 1083 LYS B O    8  
ATOM 11512 C CB   . LYS A 1 39 ? 3.965   13.425  -1.986  1.00 0.00 ? 1083 LYS B CB   8  
ATOM 11513 C CG   . LYS A 1 39 ? 5.109   14.423  -2.127  1.00 0.00 ? 1083 LYS B CG   8  
ATOM 11514 C CD   . LYS A 1 39 ? 4.648   15.791  -1.639  1.00 0.00 ? 1083 LYS B CD   8  
ATOM 11515 C CE   . LYS A 1 39 ? 5.702   16.826  -2.011  1.00 0.00 ? 1083 LYS B CE   8  
ATOM 11516 N NZ   . LYS A 1 39 ? 5.254   18.180  -1.577  1.00 0.00 ? 1083 LYS B NZ   8  
ATOM 11517 H H    . LYS A 1 39 ? 4.330   13.199  -4.469  1.00 0.00 ? 1083 LYS B H    8  
ATOM 11518 H HA   . LYS A 1 39 ? 5.271   11.740  -2.189  1.00 0.00 ? 1083 LYS B HA   8  
ATOM 11519 H HB2  . LYS A 1 39 ? 3.079   13.816  -2.466  1.00 0.00 ? 1083 LYS B HB2  8  
ATOM 11520 H HB3  . LYS A 1 39 ? 3.764   13.254  -0.940  1.00 0.00 ? 1083 LYS B HB3  8  
ATOM 11521 H HG2  . LYS A 1 39 ? 5.950   14.092  -1.535  1.00 0.00 ? 1083 LYS B HG2  8  
ATOM 11522 H HG3  . LYS A 1 39 ? 5.402   14.491  -3.164  1.00 0.00 ? 1083 LYS B HG3  8  
ATOM 11523 H HD2  . LYS A 1 39 ? 3.708   16.039  -2.108  1.00 0.00 ? 1083 LYS B HD2  8  
ATOM 11524 H HD3  . LYS A 1 39 ? 4.525   15.771  -0.566  1.00 0.00 ? 1083 LYS B HD3  8  
ATOM 11525 H HE2  . LYS A 1 39 ? 6.633   16.580  -1.528  1.00 0.00 ? 1083 LYS B HE2  8  
ATOM 11526 H HE3  . LYS A 1 39 ? 5.838   16.816  -3.084  1.00 0.00 ? 1083 LYS B HE3  8  
ATOM 11527 H HZ1  . LYS A 1 39 ? 5.223   18.218  -0.539  1.00 0.00 ? 1083 LYS B HZ1  8  
ATOM 11528 H HZ2  . LYS A 1 39 ? 4.306   18.371  -1.961  1.00 0.00 ? 1083 LYS B HZ2  8  
ATOM 11529 H HZ3  . LYS A 1 39 ? 5.921   18.896  -1.929  1.00 0.00 ? 1083 LYS B HZ3  8  
ATOM 11530 N N    . TYR A 1 40 ? 2.339   11.079  -3.443  1.00 0.00 ? 1084 TYR B N    8  
ATOM 11531 C CA   . TYR A 1 40 ? 1.186   10.175  -3.410  1.00 0.00 ? 1084 TYR B CA   8  
ATOM 11532 C C    . TYR A 1 40 ? 1.630   8.731   -3.575  1.00 0.00 ? 1084 TYR B C    8  
ATOM 11533 O O    . TYR A 1 40 ? 0.980   7.810   -3.081  1.00 0.00 ? 1084 TYR B O    8  
ATOM 11534 C CB   . TYR A 1 40 ? 0.198   10.539  -4.526  1.00 0.00 ? 1084 TYR B CB   8  
ATOM 11535 C CG   . TYR A 1 40 ? -0.392  11.921  -4.291  1.00 0.00 ? 1084 TYR B CG   8  
ATOM 11536 C CD1  . TYR A 1 40 ? -0.053  12.668  -3.149  1.00 0.00 ? 1084 TYR B CD1  8  
ATOM 11537 C CD2  . TYR A 1 40 ? -1.252  12.472  -5.245  1.00 0.00 ? 1084 TYR B CD2  8  
ATOM 11538 C CE1  . TYR A 1 40 ? -0.569  13.946  -2.969  1.00 0.00 ? 1084 TYR B CE1  8  
ATOM 11539 C CE2  . TYR A 1 40 ? -1.777  13.754  -5.058  1.00 0.00 ? 1084 TYR B CE2  8  
ATOM 11540 C CZ   . TYR A 1 40 ? -1.433  14.496  -3.922  1.00 0.00 ? 1084 TYR B CZ   8  
ATOM 11541 O OH   . TYR A 1 40 ? -1.943  15.769  -3.743  1.00 0.00 ? 1084 TYR B OH   8  
ATOM 11542 H H    . TYR A 1 4