data_6F8F
# 
_entry.id   6F8F 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.302 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6F8F         
WWPDB D_1200007924 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6F8F 
_pdbx_database_status.recvd_initial_deposition_date   2017-12-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Ostertag, M.S.' 1 ? 
'Popowicz, G.M.' 2 ? 
'Sattler, M.'    3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Structure 
_citation.journal_id_ASTM           STRUE6 
_citation.journal_id_CSD            2005 
_citation.journal_id_ISSN           1878-4186 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            27 
_citation.language                  ? 
_citation.page_first                327 
_citation.page_last                 334.e3 
_citation.title                     
'The Structure of the SPOP-Pdx1 Interface Reveals Insights into the Phosphorylation-Dependent Binding Regulation.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.str.2018.10.005 
_citation.pdbx_database_id_PubMed   30449689 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ostertag, M.S.' 1 ? 
primary 'Messias, A.C.'  2 ? 
primary 'Sattler, M.'    3 ? 
primary 'Popowicz, G.M.' 4 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6F8F 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     53.925 
_cell.length_a_esd                 ? 
_cell.length_b                     53.925 
_cell.length_b_esd                 ? 
_cell.length_c                     207.410 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6F8F 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Speckle-type POZ protein'             16616.137 1  ? ? ? ? 
2 polymer syn 'Pancreas/duodenum homeobox protein 1' 1135.159  1  ? ? ? ? 
3 water   nat water                                  18.015    35 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'HIB homolog 1,Roadkill homolog 1' 
2 
;PDX-1,Glucose-sensitive factor,GSF,Insulin promoter factor 1,IPF-1,Insulin upstream factor 1,IUF-1,Islet/duodenum homeobox-1,IDX-1,Somatostatin-transactivating factor 1,STF-1
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GAMASGKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAK
FKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQD
;
;GAMASGKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAK
FKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQD
;
D ? 
2 'polypeptide(L)' no no PEQDCAVTSGE PEQDCAVTSGE G ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   ALA n 
1 5   SER n 
1 6   GLY n 
1 7   LYS n 
1 8   VAL n 
1 9   VAL n 
1 10  LYS n 
1 11  PHE n 
1 12  SER n 
1 13  TYR n 
1 14  MET n 
1 15  TRP n 
1 16  THR n 
1 17  ILE n 
1 18  ASN n 
1 19  ASN n 
1 20  PHE n 
1 21  SER n 
1 22  PHE n 
1 23  CYS n 
1 24  ARG n 
1 25  GLU n 
1 26  GLU n 
1 27  MET n 
1 28  GLY n 
1 29  GLU n 
1 30  VAL n 
1 31  ILE n 
1 32  LYS n 
1 33  SER n 
1 34  SER n 
1 35  THR n 
1 36  PHE n 
1 37  SER n 
1 38  SER n 
1 39  GLY n 
1 40  ALA n 
1 41  ASN n 
1 42  ASP n 
1 43  LYS n 
1 44  LEU n 
1 45  LYS n 
1 46  TRP n 
1 47  CYS n 
1 48  LEU n 
1 49  ARG n 
1 50  VAL n 
1 51  ASN n 
1 52  PRO n 
1 53  LYS n 
1 54  GLY n 
1 55  LEU n 
1 56  ASP n 
1 57  GLU n 
1 58  GLU n 
1 59  SER n 
1 60  LYS n 
1 61  ASP n 
1 62  TYR n 
1 63  LEU n 
1 64  SER n 
1 65  LEU n 
1 66  TYR n 
1 67  LEU n 
1 68  LEU n 
1 69  LEU n 
1 70  VAL n 
1 71  SER n 
1 72  CYS n 
1 73  PRO n 
1 74  LYS n 
1 75  SER n 
1 76  GLU n 
1 77  VAL n 
1 78  ARG n 
1 79  ALA n 
1 80  LYS n 
1 81  PHE n 
1 82  LYS n 
1 83  PHE n 
1 84  SER n 
1 85  ILE n 
1 86  LEU n 
1 87  ASN n 
1 88  ALA n 
1 89  LYS n 
1 90  GLY n 
1 91  GLU n 
1 92  GLU n 
1 93  THR n 
1 94  LYS n 
1 95  ALA n 
1 96  MET n 
1 97  GLU n 
1 98  SER n 
1 99  GLN n 
1 100 ARG n 
1 101 ALA n 
1 102 TYR n 
1 103 ARG n 
1 104 PHE n 
1 105 VAL n 
1 106 GLN n 
1 107 GLY n 
1 108 LYS n 
1 109 ASP n 
1 110 TRP n 
1 111 GLY n 
1 112 PHE n 
1 113 LYS n 
1 114 LYS n 
1 115 PHE n 
1 116 ILE n 
1 117 ARG n 
1 118 ARG n 
1 119 ASP n 
1 120 PHE n 
1 121 LEU n 
1 122 LEU n 
1 123 ASP n 
1 124 GLU n 
1 125 ALA n 
1 126 ASN n 
1 127 GLY n 
1 128 LEU n 
1 129 LEU n 
1 130 PRO n 
1 131 ASP n 
1 132 ASP n 
1 133 LYS n 
1 134 LEU n 
1 135 THR n 
1 136 LEU n 
1 137 PHE n 
1 138 CYS n 
1 139 GLU n 
1 140 VAL n 
1 141 SER n 
1 142 VAL n 
1 143 VAL n 
1 144 GLN n 
1 145 ASP n 
2 1   PRO n 
2 2   GLU n 
2 3   GLN n 
2 4   ASP n 
2 5   CYS n 
2 6   ALA n 
2 7   VAL n 
2 8   THR n 
2 9   SER n 
2 10  GLY n 
2 11  GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   145 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 SPOP 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       11 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   Human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP SPOP_HUMAN O43791 ? 1 
;KVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSIL
NAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQD
;
28  
2 UNP PDX1_HUMAN P52945 ? 2 PEQDCAVTSGE 223 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6F8F D 7 ? 145 ? O43791 28  ? 166 ? 28  166 
2 2 6F8F G 1 ? 11  ? P52945 223 ? 233 ? 223 233 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6F8F GLY D 1 ? UNP O43791 ? ? 'expression tag' 22 1 
1 6F8F ALA D 2 ? UNP O43791 ? ? 'expression tag' 23 2 
1 6F8F MET D 3 ? UNP O43791 ? ? 'expression tag' 24 3 
1 6F8F ALA D 4 ? UNP O43791 ? ? 'expression tag' 25 4 
1 6F8F SER D 5 ? UNP O43791 ? ? 'expression tag' 26 5 
1 6F8F GLY D 6 ? UNP O43791 ? ? 'expression tag' 27 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6F8F 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.45 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         49.84 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M HEPES pH 6.5, 10% (w/v) PEG6000 (final pH 7.0)' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-12-16 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.82655 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID30B' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.82655 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID30B 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6F8F 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.00 
_reflns.d_resolution_low                 100 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       13193 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.0 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  8.96 
_reflns.pdbx_Rmerge_I_obs                0.039 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            26.23 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.000 
_reflns_shell.d_res_low                   2.051 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            0.00 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][2]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            -0.01 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               60.815 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.969 
_refine.correlation_coeff_Fo_to_Fc_free          0.945 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6F8F 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.00 
_refine.ls_d_res_low                             19.94 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     12184 
_refine.ls_number_reflns_R_free                  640 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.07 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.21841 
_refine.ls_R_factor_R_free                       0.27433 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.21549 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3IVV 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.176 
_refine.pdbx_overall_ESU_R_Free                  0.175 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             7.211 
_refine.overall_SU_ML                            0.183 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        1156 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             35 
_refine_hist.number_atoms_total               1191 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        19.94 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.017  0.020  1179 ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  1080 ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.830  1.956  1587 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 1.017  3.000  2497 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 7.605  5.000  145  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 37.291 23.962 53   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 15.336 15.000 206  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 20.567 15.000 7    ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.104  0.200  174  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.008  0.020  1304 ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  259  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 5.383  6.095  586  ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 5.343  6.093  585  ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 7.295  9.101  729  ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 7.291  9.103  730  ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 5.834  6.362  593  ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 5.829  6.364  594  ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 8.404  9.356  859  ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 10.999 69.260 1273 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 11.001 69.147 1271 ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_bonded          ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.000 
_refine_ls_shell.d_res_low                        2.051 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             42 
_refine_ls_shell.number_reflns_R_work             846 
_refine_ls_shell.percent_reflns_obs               98.01 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.435 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.414 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     6F8F 
_struct.title                        'Co-crystal structure of SPOP MATH domain and human Pdx1 fragment' 
_struct.pdbx_descriptor              'Speckle-type POZ protein, Pancreas/duodenum homeobox protein 1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6F8F 
_struct_keywords.text            'Ligase, Nuclear, Diabetes' 
_struct_keywords.pdbx_keywords   LIGASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 ASN A 19  ? SER A 21  ? ASN D 40  SER D 42  5 ? 3 
HELX_P HELX_P2 AA2 PHE A 22  ? GLY A 28  ? PHE D 43  GLY D 49  1 ? 7 
HELX_P HELX_P3 AA3 ARG A 118 ? ASP A 123 ? ARG D 139 ASP D 144 1 ? 6 
HELX_P HELX_P4 AA4 GLU A 124 ? GLY A 127 ? GLU D 145 GLY D 148 5 ? 4 
HELX_P HELX_P5 AA5 LEU A 129 ? LYS A 133 ? LEU D 150 LYS D 154 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 9   ? ILE A 17  ? VAL D 30  ILE D 38  
AA1 2 LEU A 134 ? VAL A 142 ? LEU D 155 VAL D 163 
AA1 3 VAL A 77  ? LEU A 86  ? VAL D 98  LEU D 107 
AA1 4 GLU A 92  ? GLU A 97  ? GLU D 113 GLU D 118 
AA2 1 VAL A 9   ? ILE A 17  ? VAL D 30  ILE D 38  
AA2 2 LEU A 134 ? VAL A 142 ? LEU D 155 VAL D 163 
AA2 3 VAL A 77  ? LEU A 86  ? VAL D 98  LEU D 107 
AA2 4 TYR A 102 ? PHE A 104 ? TYR D 123 PHE D 125 
AA3 1 ILE A 31  ? LYS A 32  ? ILE D 52  LYS D 53  
AA3 2 TRP A 46  ? ASN A 51  ? TRP D 67  ASN D 72  
AA3 3 TYR A 62  ? LEU A 69  ? TYR D 83  LEU D 90  
AA3 4 ASP A 109 ? ARG A 117 ? ASP D 130 ARG D 138 
AA3 5 VAL B 7   ? THR B 8   ? VAL G 229 THR G 230 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ILE A 17  ? N ILE D 38  O LEU A 134 ? O LEU D 155 
AA1 2 3 O GLU A 139 ? O GLU D 160 N LYS A 82  ? N LYS D 103 
AA1 3 4 N ILE A 85  ? N ILE D 106 O THR A 93  ? O THR D 114 
AA2 1 2 N ILE A 17  ? N ILE D 38  O LEU A 134 ? O LEU D 155 
AA2 2 3 O GLU A 139 ? O GLU D 160 N LYS A 82  ? N LYS D 103 
AA2 3 4 N VAL A 77  ? N VAL D 98  O PHE A 104 ? O PHE D 125 
AA3 1 2 N ILE A 31  ? N ILE D 52  O VAL A 50  ? O VAL D 71  
AA3 2 3 N CYS A 47  ? N CYS D 68  O LEU A 68  ? O LEU D 89  
AA3 3 4 N LEU A 63  ? N LEU D 84  O ILE A 116 ? O ILE D 137 
AA3 4 5 N GLY A 111 ? N GLY D 132 O THR B 8   ? O THR G 230 
# 
_atom_sites.entry_id                    6F8F 
_atom_sites.fract_transf_matrix[1][1]   0.018544 
_atom_sites.fract_transf_matrix[1][2]   0.010707 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021413 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004821 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LYS A 1 7   ? 16.674 30.771 -11.789 1.00 114.32 ? 28  LYS D N   1 
ATOM   2    C CA  . LYS A 1 7   ? 17.650 29.781 -11.227 1.00 109.07 ? 28  LYS D CA  1 
ATOM   3    C C   . LYS A 1 7   ? 17.175 29.133 -9.905  1.00 106.53 ? 28  LYS D C   1 
ATOM   4    O O   . LYS A 1 7   ? 16.300 29.662 -9.181  1.00 98.92  ? 28  LYS D O   1 
ATOM   5    C CB  . LYS A 1 7   ? 19.032 30.436 -11.034 1.00 101.27 ? 28  LYS D CB  1 
ATOM   6    C CG  . LYS A 1 7   ? 20.152 29.487 -10.594 1.00 90.01  ? 28  LYS D CG  1 
ATOM   7    N N   . VAL A 1 8   ? 17.759 27.963 -9.636  1.00 106.48 ? 29  VAL D N   1 
ATOM   8    C CA  . VAL A 1 8   ? 17.571 27.224 -8.379  1.00 103.28 ? 29  VAL D CA  1 
ATOM   9    C C   . VAL A 1 8   ? 18.429 27.779 -7.233  1.00 101.63 ? 29  VAL D C   1 
ATOM   10   O O   . VAL A 1 8   ? 19.616 28.098 -7.422  1.00 103.16 ? 29  VAL D O   1 
ATOM   11   C CB  . VAL A 1 8   ? 17.877 25.705 -8.532  1.00 95.71  ? 29  VAL D CB  1 
ATOM   12   C CG1 . VAL A 1 8   ? 17.031 25.108 -9.657  1.00 91.78  ? 29  VAL D CG1 1 
ATOM   13   C CG2 . VAL A 1 8   ? 19.380 25.430 -8.743  1.00 97.09  ? 29  VAL D CG2 1 
ATOM   14   N N   . VAL A 1 9   ? 17.807 27.892 -6.056  1.00 94.18  ? 30  VAL D N   1 
ATOM   15   C CA  . VAL A 1 9   ? 18.498 28.151 -4.787  1.00 80.05  ? 30  VAL D CA  1 
ATOM   16   C C   . VAL A 1 9   ? 18.617 26.811 -4.035  1.00 74.19  ? 30  VAL D C   1 
ATOM   17   O O   . VAL A 1 9   ? 17.604 26.292 -3.524  1.00 69.86  ? 30  VAL D O   1 
ATOM   18   C CB  . VAL A 1 9   ? 17.709 29.156 -3.901  1.00 84.51  ? 30  VAL D CB  1 
ATOM   19   C CG1 . VAL A 1 9   ? 18.528 29.539 -2.656  1.00 78.48  ? 30  VAL D CG1 1 
ATOM   20   C CG2 . VAL A 1 9   ? 17.266 30.380 -4.716  1.00 83.16  ? 30  VAL D CG2 1 
ATOM   21   N N   . LYS A 1 10  ? 19.828 26.261 -3.973  1.00 63.04  ? 31  LYS D N   1 
ATOM   22   C CA  . LYS A 1 10  ? 20.072 24.982 -3.322  1.00 69.76  ? 31  LYS D CA  1 
ATOM   23   C C   . LYS A 1 10  ? 20.649 25.287 -1.908  1.00 69.16  ? 31  LYS D C   1 
ATOM   24   O O   . LYS A 1 10  ? 21.605 26.036 -1.787  1.00 69.61  ? 31  LYS D O   1 
ATOM   25   C CB  . LYS A 1 10  ? 21.014 24.131 -4.199  1.00 79.85  ? 31  LYS D CB  1 
ATOM   26   C CG  . LYS A 1 10  ? 20.882 22.609 -4.072  1.00 85.22  ? 31  LYS D CG  1 
ATOM   27   C CD  . LYS A 1 10  ? 21.744 21.870 -5.099  1.00 82.65  ? 31  LYS D CD  1 
ATOM   28   N N   . PHE A 1 11  ? 20.056 24.741 -0.843  1.00 58.61  ? 32  PHE D N   1 
ATOM   29   C CA  . PHE A 1 11  ? 20.670 24.846 0.501   1.00 61.29  ? 32  PHE D CA  1 
ATOM   30   C C   . PHE A 1 11  ? 20.456 23.564 1.345   1.00 64.28  ? 32  PHE D C   1 
ATOM   31   O O   . PHE A 1 11  ? 19.818 22.589 0.872   1.00 58.77  ? 32  PHE D O   1 
ATOM   32   C CB  . PHE A 1 11  ? 20.163 26.118 1.211   1.00 55.92  ? 32  PHE D CB  1 
ATOM   33   C CG  . PHE A 1 11  ? 18.683 26.139 1.426   1.00 62.26  ? 32  PHE D CG  1 
ATOM   34   C CD1 . PHE A 1 11  ? 17.825 26.431 0.388   1.00 54.93  ? 32  PHE D CD1 1 
ATOM   35   C CD2 . PHE A 1 11  ? 18.137 25.856 2.689   1.00 62.44  ? 32  PHE D CD2 1 
ATOM   36   C CE1 . PHE A 1 11  ? 16.461 26.444 0.593   1.00 60.03  ? 32  PHE D CE1 1 
ATOM   37   C CE2 . PHE A 1 11  ? 16.754 25.879 2.892   1.00 58.26  ? 32  PHE D CE2 1 
ATOM   38   C CZ  . PHE A 1 11  ? 15.926 26.157 1.839   1.00 61.75  ? 32  PHE D CZ  1 
ATOM   39   N N   . SER A 1 12  ? 20.992 23.573 2.573   1.00 53.35  ? 33  SER D N   1 
ATOM   40   C CA  . SER A 1 12  ? 20.942 22.433 3.478   1.00 52.85  ? 33  SER D CA  1 
ATOM   41   C C   . SER A 1 12  ? 20.797 22.784 4.952   1.00 55.06  ? 33  SER D C   1 
ATOM   42   O O   . SER A 1 12  ? 20.877 23.943 5.363   1.00 59.39  ? 33  SER D O   1 
ATOM   43   C CB  . SER A 1 12  ? 22.177 21.557 3.293   1.00 56.57  ? 33  SER D CB  1 
ATOM   44   O OG  . SER A 1 12  ? 23.338 22.308 3.629   1.00 57.49  ? 33  SER D OG  1 
ATOM   45   N N   . TYR A 1 13  ? 20.509 21.757 5.730   1.00 49.41  ? 34  TYR D N   1 
ATOM   46   C CA  . TYR A 1 13  ? 20.378 21.849 7.168   1.00 50.91  ? 34  TYR D CA  1 
ATOM   47   C C   . TYR A 1 13  ? 20.796 20.504 7.668   1.00 48.82  ? 34  TYR D C   1 
ATOM   48   O O   . TYR A 1 13  ? 20.369 19.485 7.100   1.00 46.42  ? 34  TYR D O   1 
ATOM   49   C CB  . TYR A 1 13  ? 18.913 22.108 7.573   1.00 49.00  ? 34  TYR D CB  1 
ATOM   50   C CG  . TYR A 1 13  ? 18.719 22.288 9.045   1.00 48.28  ? 34  TYR D CG  1 
ATOM   51   C CD1 . TYR A 1 13  ? 19.380 23.316 9.711   1.00 52.58  ? 34  TYR D CD1 1 
ATOM   52   C CD2 . TYR A 1 13  ? 17.885 21.441 9.797   1.00 48.46  ? 34  TYR D CD2 1 
ATOM   53   C CE1 . TYR A 1 13  ? 19.247 23.482 11.075  1.00 51.37  ? 34  TYR D CE1 1 
ATOM   54   C CE2 . TYR A 1 13  ? 17.704 21.635 11.154  1.00 48.18  ? 34  TYR D CE2 1 
ATOM   55   C CZ  . TYR A 1 13  ? 18.411 22.648 11.806  1.00 56.94  ? 34  TYR D CZ  1 
ATOM   56   O OH  . TYR A 1 13  ? 18.302 22.891 13.173  1.00 57.63  ? 34  TYR D OH  1 
ATOM   57   N N   . MET A 1 14  ? 21.573 20.496 8.733   1.00 43.26  ? 35  MET D N   1 
ATOM   58   C CA  . MET A 1 14  ? 21.961 19.298 9.458   1.00 44.04  ? 35  MET D CA  1 
ATOM   59   C C   . MET A 1 14  ? 21.335 19.317 10.816  1.00 45.42  ? 35  MET D C   1 
ATOM   60   O O   . MET A 1 14  ? 21.541 20.261 11.604  1.00 45.06  ? 35  MET D O   1 
ATOM   61   C CB  . MET A 1 14  ? 23.461 19.241 9.584   1.00 48.67  ? 35  MET D CB  1 
ATOM   62   C CG  . MET A 1 14  ? 24.095 17.865 9.385   1.00 61.62  ? 35  MET D CG  1 
ATOM   63   S SD  . MET A 1 14  ? 25.821 17.888 9.935   1.00 78.38  ? 35  MET D SD  1 
ATOM   64   C CE  . MET A 1 14  ? 26.461 19.165 8.819   1.00 80.16  ? 35  MET D CE  1 
ATOM   65   N N   . TRP A 1 15  ? 20.515 18.303 11.095  1.00 42.95  ? 36  TRP D N   1 
ATOM   66   C CA  . TRP A 1 15  ? 19.771 18.245 12.320  1.00 44.30  ? 36  TRP D CA  1 
ATOM   67   C C   . TRP A 1 15  ? 20.301 17.085 13.177  1.00 46.79  ? 36  TRP D C   1 
ATOM   68   O O   . TRP A 1 15  ? 20.343 15.953 12.698  1.00 46.07  ? 36  TRP D O   1 
ATOM   69   C CB  . TRP A 1 15  ? 18.302 18.029 12.004  1.00 44.08  ? 36  TRP D CB  1 
ATOM   70   C CG  . TRP A 1 15  ? 17.431 18.108 13.193  1.00 42.95  ? 36  TRP D CG  1 
ATOM   71   C CD1 . TRP A 1 15  ? 17.746 18.598 14.401  1.00 44.77  ? 36  TRP D CD1 1 
ATOM   72   C CD2 . TRP A 1 15  ? 16.060 17.710 13.274  1.00 43.23  ? 36  TRP D CD2 1 
ATOM   73   N NE1 . TRP A 1 15  ? 16.680 18.544 15.213  1.00 40.29  ? 36  TRP D NE1 1 
ATOM   74   C CE2 . TRP A 1 15  ? 15.631 17.992 14.566  1.00 41.69  ? 36  TRP D CE2 1 
ATOM   75   C CE3 . TRP A 1 15  ? 15.166 17.145 12.373  1.00 39.94  ? 36  TRP D CE3 1 
ATOM   76   C CZ2 . TRP A 1 15  ? 14.357 17.708 15.014  1.00 44.26  ? 36  TRP D CZ2 1 
ATOM   77   C CZ3 . TRP A 1 15  ? 13.909 16.896 12.792  1.00 42.52  ? 36  TRP D CZ3 1 
ATOM   78   C CH2 . TRP A 1 15  ? 13.497 17.179 14.092  1.00 42.30  ? 36  TRP D CH2 1 
ATOM   79   N N   . THR A 1 16  ? 20.757 17.352 14.397  1.00 48.88  ? 37  THR D N   1 
ATOM   80   C CA  . THR A 1 16  ? 21.214 16.249 15.286  1.00 52.04  ? 37  THR D CA  1 
ATOM   81   C C   . THR A 1 16  ? 20.195 16.120 16.388  1.00 47.47  ? 37  THR D C   1 
ATOM   82   O O   . THR A 1 16  ? 19.928 17.068 17.089  1.00 47.67  ? 37  THR D O   1 
ATOM   83   C CB  . THR A 1 16  ? 22.609 16.481 15.835  1.00 50.08  ? 37  THR D CB  1 
ATOM   84   O OG1 . THR A 1 16  ? 23.513 16.453 14.741  1.00 54.94  ? 37  THR D OG1 1 
ATOM   85   C CG2 . THR A 1 16  ? 23.009 15.395 16.827  1.00 51.68  ? 37  THR D CG2 1 
ATOM   86   N N   . ILE A 1 17  ? 19.558 14.964 16.467  1.00 42.08  ? 38  ILE D N   1 
ATOM   87   C CA  . ILE A 1 17  ? 18.667 14.661 17.552  1.00 45.25  ? 38  ILE D CA  1 
ATOM   88   C C   . ILE A 1 17  ? 19.445 13.814 18.542  1.00 48.01  ? 38  ILE D C   1 
ATOM   89   O O   . ILE A 1 17  ? 19.745 12.659 18.242  1.00 41.57  ? 38  ILE D O   1 
ATOM   90   C CB  . ILE A 1 17  ? 17.436 13.884 17.087  1.00 49.26  ? 38  ILE D CB  1 
ATOM   91   C CG1 . ILE A 1 17  ? 16.605 14.763 16.121  1.00 49.43  ? 38  ILE D CG1 1 
ATOM   92   C CG2 . ILE A 1 17  ? 16.596 13.460 18.293  1.00 45.74  ? 38  ILE D CG2 1 
ATOM   93   C CD1 . ILE A 1 17  ? 15.435 14.033 15.479  1.00 51.54  ? 38  ILE D CD1 1 
ATOM   94   N N   . ASN A 1 18  ? 19.743 14.399 19.711  1.00 45.70  ? 39  ASN D N   1 
ATOM   95   C CA  . ASN A 1 18  ? 20.457 13.671 20.777  1.00 49.97  ? 39  ASN D CA  1 
ATOM   96   C C   . ASN A 1 18  ? 19.504 12.720 21.491  1.00 45.32  ? 39  ASN D C   1 
ATOM   97   O O   . ASN A 1 18  ? 18.268 12.944 21.577  1.00 44.10  ? 39  ASN D O   1 
ATOM   98   C CB  . ASN A 1 18  ? 21.117 14.652 21.762  1.00 47.77  ? 39  ASN D CB  1 
ATOM   99   C CG  . ASN A 1 18  ? 22.285 15.377 21.149  1.00 47.91  ? 39  ASN D CG  1 
ATOM   100  O OD1 . ASN A 1 18  ? 23.144 14.732 20.574  1.00 51.49  ? 39  ASN D OD1 1 
ATOM   101  N ND2 . ASN A 1 18  ? 22.307 16.718 21.219  1.00 44.46  ? 39  ASN D ND2 1 
ATOM   102  N N   . ASN A 1 19  ? 20.079 11.660 22.017  1.00 43.61  ? 40  ASN D N   1 
ATOM   103  C CA  . ASN A 1 19  ? 19.327 10.680 22.865  1.00 48.27  ? 40  ASN D CA  1 
ATOM   104  C C   . ASN A 1 19  ? 18.111 10.169 22.130  1.00 46.38  ? 40  ASN D C   1 
ATOM   105  O O   . ASN A 1 19  ? 16.972 10.148 22.661  1.00 44.36  ? 40  ASN D O   1 
ATOM   106  C CB  . ASN A 1 19  ? 18.935 11.308 24.198  1.00 51.47  ? 40  ASN D CB  1 
ATOM   107  C CG  . ASN A 1 19  ? 20.140 11.701 25.012  1.00 55.37  ? 40  ASN D CG  1 
ATOM   108  O OD1 . ASN A 1 19  ? 20.962 10.853 25.274  1.00 53.05  ? 40  ASN D OD1 1 
ATOM   109  N ND2 . ASN A 1 19  ? 20.277 12.992 25.371  1.00 50.55  ? 40  ASN D ND2 1 
ATOM   110  N N   . PHE A 1 20  ? 18.368 9.753  20.900  1.00 47.72  ? 41  PHE D N   1 
ATOM   111  C CA  . PHE A 1 20  ? 17.290 9.426  19.946  1.00 49.42  ? 41  PHE D CA  1 
ATOM   112  C C   . PHE A 1 20  ? 16.436 8.295  20.501  1.00 55.38  ? 41  PHE D C   1 
ATOM   113  O O   . PHE A 1 20  ? 15.206 8.350  20.451  1.00 46.47  ? 41  PHE D O   1 
ATOM   114  C CB  . PHE A 1 20  ? 17.850 9.068  18.555  1.00 50.53  ? 41  PHE D CB  1 
ATOM   115  C CG  . PHE A 1 20  ? 16.801 8.568  17.624  1.00 52.22  ? 41  PHE D CG  1 
ATOM   116  C CD1 . PHE A 1 20  ? 15.882 9.465  17.041  1.00 52.72  ? 41  PHE D CD1 1 
ATOM   117  C CD2 . PHE A 1 20  ? 16.617 7.196  17.427  1.00 53.95  ? 41  PHE D CD2 1 
ATOM   118  C CE1 . PHE A 1 20  ? 14.825 8.996  16.259  1.00 51.79  ? 41  PHE D CE1 1 
ATOM   119  C CE2 . PHE A 1 20  ? 15.549 6.729  16.635  1.00 54.13  ? 41  PHE D CE2 1 
ATOM   120  C CZ  . PHE A 1 20  ? 14.662 7.625  16.053  1.00 51.11  ? 41  PHE D CZ  1 
ATOM   121  N N   . SER A 1 21  ? 17.076 7.279  21.084  1.00 58.26  ? 42  SER D N   1 
ATOM   122  C CA  . SER A 1 21  ? 16.315 6.122  21.618  1.00 55.67  ? 42  SER D CA  1 
ATOM   123  C C   . SER A 1 21  ? 15.259 6.470  22.678  1.00 49.53  ? 42  SER D C   1 
ATOM   124  O O   . SER A 1 21  ? 14.365 5.692  22.855  1.00 51.72  ? 42  SER D O   1 
ATOM   125  C CB  . SER A 1 21  ? 17.260 5.012  22.100  1.00 60.62  ? 42  SER D CB  1 
ATOM   126  O OG  . SER A 1 21  ? 17.960 5.396  23.274  1.00 60.27  ? 42  SER D OG  1 
ATOM   127  N N   . PHE A 1 22  ? 15.323 7.664  23.318  1.00 54.70  ? 43  PHE D N   1 
ATOM   128  C CA  . PHE A 1 22  ? 14.312 8.173  24.296  1.00 52.61  ? 43  PHE D CA  1 
ATOM   129  C C   . PHE A 1 22  ? 13.466 9.351  23.813  1.00 58.21  ? 43  PHE D C   1 
ATOM   130  O O   . PHE A 1 22  ? 12.670 9.910  24.594  1.00 60.84  ? 43  PHE D O   1 
ATOM   131  C CB  . PHE A 1 22  ? 15.037 8.615  25.623  1.00 55.71  ? 43  PHE D CB  1 
ATOM   132  C CG  . PHE A 1 22  ? 15.784 7.492  26.274  1.00 58.34  ? 43  PHE D CG  1 
ATOM   133  C CD1 . PHE A 1 22  ? 17.066 7.159  25.854  1.00 57.58  ? 43  PHE D CD1 1 
ATOM   134  C CD2 . PHE A 1 22  ? 15.165 6.701  27.241  1.00 66.30  ? 43  PHE D CD2 1 
ATOM   135  C CE1 . PHE A 1 22  ? 17.732 6.076  26.403  1.00 64.31  ? 43  PHE D CE1 1 
ATOM   136  C CE2 . PHE A 1 22  ? 15.823 5.618  27.801  1.00 63.88  ? 43  PHE D CE2 1 
ATOM   137  C CZ  . PHE A 1 22  ? 17.113 5.308  27.385  1.00 68.08  ? 43  PHE D CZ  1 
ATOM   138  N N   . CYS A 1 23  ? 13.619 9.759  22.551  1.00 58.11  ? 44  CYS D N   1 
ATOM   139  C CA  . CYS A 1 23  ? 13.066 11.050 22.134  1.00 49.82  ? 44  CYS D CA  1 
ATOM   140  C C   . CYS A 1 23  ? 11.600 11.035 21.962  1.00 49.21  ? 44  CYS D C   1 
ATOM   141  O O   . CYS A 1 23  ? 10.981 12.106 21.904  1.00 52.96  ? 44  CYS D O   1 
ATOM   142  C CB  . CYS A 1 23  ? 13.746 11.594 20.871  1.00 49.08  ? 44  CYS D CB  1 
ATOM   143  S SG  . CYS A 1 23  ? 13.291 10.806 19.302  1.00 52.90  ? 44  CYS D SG  1 
ATOM   144  N N   . ARG A 1 24  ? 11.000 9.866  21.826  1.00 58.89  ? 45  ARG D N   1 
ATOM   145  C CA  . ARG A 1 24  ? 9.531  9.840  21.717  1.00 68.46  ? 45  ARG D CA  1 
ATOM   146  C C   . ARG A 1 24  ? 8.912  10.237 23.085  1.00 66.92  ? 45  ARG D C   1 
ATOM   147  O O   . ARG A 1 24  ? 7.933  10.982 23.139  1.00 66.67  ? 45  ARG D O   1 
ATOM   148  C CB  . ARG A 1 24  ? 9.020  8.499  21.199  1.00 71.62  ? 45  ARG D CB  1 
ATOM   149  C CG  . ARG A 1 24  ? 7.539  8.559  20.841  1.00 82.14  ? 45  ARG D CG  1 
ATOM   150  C CD  . ARG A 1 24  ? 6.953  7.220  20.413  1.00 93.39  ? 45  ARG D CD  1 
ATOM   151  N NE  . ARG A 1 24  ? 5.507  7.202  20.689  1.00 101.89 ? 45  ARG D NE  1 
ATOM   152  C CZ  . ARG A 1 24  ? 4.553  7.735  19.914  1.00 102.77 ? 45  ARG D CZ  1 
ATOM   153  N NH1 . ARG A 1 24  ? 4.835  8.332  18.760  1.00 100.88 ? 45  ARG D NH1 1 
ATOM   154  N NH2 . ARG A 1 24  ? 3.284  7.662  20.295  1.00 110.25 ? 45  ARG D NH2 1 
ATOM   155  N N   . GLU A 1 25  ? 9.548  9.790  24.163  1.00 66.16  ? 46  GLU D N   1 
ATOM   156  C CA  . GLU A 1 25  ? 9.167  10.140 25.557  1.00 77.32  ? 46  GLU D CA  1 
ATOM   157  C C   . GLU A 1 25  ? 9.453  11.616 25.890  1.00 71.95  ? 46  GLU D C   1 
ATOM   158  O O   . GLU A 1 25  ? 8.559  12.343 26.340  1.00 78.78  ? 46  GLU D O   1 
ATOM   159  C CB  . GLU A 1 25  ? 9.901  9.248  26.590  1.00 74.20  ? 46  GLU D CB  1 
ATOM   160  C CG  . GLU A 1 25  ? 9.596  7.750  26.520  1.00 79.25  ? 46  GLU D CG  1 
ATOM   161  C CD  . GLU A 1 25  ? 10.555 6.940  25.637  1.00 89.96  ? 46  GLU D CD  1 
ATOM   162  O OE1 . GLU A 1 25  ? 10.765 7.291  24.446  1.00 97.69  ? 46  GLU D OE1 1 
ATOM   163  O OE2 . GLU A 1 25  ? 11.096 5.919  26.122  1.00 95.70  ? 46  GLU D OE2 1 
ATOM   164  N N   . GLU A 1 26  ? 10.696 12.025 25.651  1.00 64.65  ? 47  GLU D N   1 
ATOM   165  C CA  . GLU A 1 26  ? 11.242 13.341 26.053  1.00 67.03  ? 47  GLU D CA  1 
ATOM   166  C C   . GLU A 1 26  ? 10.786 14.536 25.163  1.00 70.62  ? 47  GLU D C   1 
ATOM   167  O O   . GLU A 1 26  ? 10.616 15.670 25.652  1.00 67.94  ? 47  GLU D O   1 
ATOM   168  C CB  . GLU A 1 26  ? 12.783 13.268 26.115  1.00 66.70  ? 47  GLU D CB  1 
ATOM   169  C CG  . GLU A 1 26  ? 13.347 12.227 27.096  1.00 76.12  ? 47  GLU D CG  1 
ATOM   170  C CD  . GLU A 1 26  ? 14.872 12.153 27.130  1.00 81.24  ? 47  GLU D CD  1 
ATOM   171  O OE1 . GLU A 1 26  ? 15.403 11.207 27.759  1.00 95.18  ? 47  GLU D OE1 1 
ATOM   172  O OE2 . GLU A 1 26  ? 15.559 13.022 26.539  1.00 81.91  ? 47  GLU D OE2 1 
ATOM   173  N N   . MET A 1 27  ? 10.582 14.258 23.874  1.00 66.77  ? 48  MET D N   1 
ATOM   174  C CA  . MET A 1 27  ? 10.203 15.252 22.836  1.00 60.02  ? 48  MET D CA  1 
ATOM   175  C C   . MET A 1 27  ? 8.808  15.074 22.225  1.00 58.22  ? 48  MET D C   1 
ATOM   176  O O   . MET A 1 27  ? 8.288  16.012 21.648  1.00 55.59  ? 48  MET D O   1 
ATOM   177  C CB  . MET A 1 27  ? 11.193 15.174 21.686  1.00 63.63  ? 48  MET D CB  1 
ATOM   178  C CG  . MET A 1 27  ? 12.628 14.912 22.117  1.00 73.08  ? 48  MET D CG  1 
ATOM   179  S SD  . MET A 1 27  ? 13.337 16.487 22.495  1.00 88.95  ? 48  MET D SD  1 
ATOM   180  C CE  . MET A 1 27  ? 14.128 16.701 20.878  1.00 74.57  ? 48  MET D CE  1 
ATOM   181  N N   . GLY A 1 28  ? 8.253  13.864 22.284  1.00 58.17  ? 49  GLY D N   1 
ATOM   182  C CA  . GLY A 1 28  ? 6.889  13.603 21.836  1.00 61.84  ? 49  GLY D CA  1 
ATOM   183  C C   . GLY A 1 28  ? 6.761  12.766 20.563  1.00 56.02  ? 49  GLY D C   1 
ATOM   184  O O   . GLY A 1 28  ? 7.750  12.235 20.039  1.00 55.00  ? 49  GLY D O   1 
ATOM   185  N N   . GLU A 1 29  ? 5.515  12.681 20.108  1.00 56.82  ? 50  GLU D N   1 
ATOM   186  C CA  . GLU A 1 29  ? 5.063  11.932 18.930  1.00 61.88  ? 50  GLU D CA  1 
ATOM   187  C C   . GLU A 1 29  ? 5.535  12.599 17.666  1.00 59.32  ? 50  GLU D C   1 
ATOM   188  O O   . GLU A 1 29  ? 5.764  11.922 16.664  1.00 58.55  ? 50  GLU D O   1 
ATOM   189  C CB  . GLU A 1 29  ? 3.516  11.916 18.840  1.00 71.01  ? 50  GLU D CB  1 
ATOM   190  C CG  . GLU A 1 29  ? 2.790  11.101 19.919  1.00 85.72  ? 50  GLU D CG  1 
ATOM   191  C CD  . GLU A 1 29  ? 1.300  10.806 19.596  1.00 94.79  ? 50  GLU D CD  1 
ATOM   192  O OE1 . GLU A 1 29  ? 0.780  11.143 18.486  1.00 82.02  ? 50  GLU D OE1 1 
ATOM   193  O OE2 . GLU A 1 29  ? 0.629  10.216 20.478  1.00 91.73  ? 50  GLU D OE2 1 
ATOM   194  N N   . VAL A 1 30  ? 5.549  13.929 17.688  1.00 52.97  ? 51  VAL D N   1 
ATOM   195  C CA  . VAL A 1 30  ? 6.061  14.746 16.598  1.00 54.01  ? 51  VAL D CA  1 
ATOM   196  C C   . VAL A 1 30  ? 7.148  15.725 17.136  1.00 51.77  ? 51  VAL D C   1 
ATOM   197  O O   . VAL A 1 30  ? 7.046  16.265 18.241  1.00 56.79  ? 51  VAL D O   1 
ATOM   198  C CB  . VAL A 1 30  ? 4.902  15.435 15.866  1.00 59.87  ? 51  VAL D CB  1 
ATOM   199  C CG1 . VAL A 1 30  ? 3.954  16.103 16.849  1.00 67.20  ? 51  VAL D CG1 1 
ATOM   200  C CG2 . VAL A 1 30  ? 5.417  16.416 14.811  1.00 57.26  ? 51  VAL D CG2 1 
ATOM   201  N N   . ILE A 1 31  ? 8.220  15.896 16.389  1.00 49.57  ? 52  ILE D N   1 
ATOM   202  C CA  . ILE A 1 31  ? 9.369  16.687 16.825  1.00 46.73  ? 52  ILE D CA  1 
ATOM   203  C C   . ILE A 1 31  ? 9.662  17.626 15.706  1.00 47.06  ? 52  ILE D C   1 
ATOM   204  O O   . ILE A 1 31  ? 9.912  17.163 14.591  1.00 44.82  ? 52  ILE D O   1 
ATOM   205  C CB  . ILE A 1 31  ? 10.627 15.814 17.106  1.00 48.76  ? 52  ILE D CB  1 
ATOM   206  C CG1 . ILE A 1 31  ? 10.337 14.756 18.174  1.00 52.79  ? 52  ILE D CG1 1 
ATOM   207  C CG2 . ILE A 1 31  ? 11.811 16.639 17.600  1.00 50.09  ? 52  ILE D CG2 1 
ATOM   208  C CD1 . ILE A 1 31  ? 11.410 13.694 18.291  1.00 48.11  ? 52  ILE D CD1 1 
ATOM   209  N N   . LYS A 1 32  ? 9.685  18.940 15.990  1.00 43.37  ? 53  LYS D N   1 
ATOM   210  C CA  . LYS A 1 32  ? 10.082 19.930 14.986  1.00 41.94  ? 53  LYS D CA  1 
ATOM   211  C C   . LYS A 1 32  ? 11.456 20.477 15.263  1.00 46.64  ? 53  LYS D C   1 
ATOM   212  O O   . LYS A 1 32  ? 11.755 20.789 16.385  1.00 44.66  ? 53  LYS D O   1 
ATOM   213  C CB  . LYS A 1 32  ? 9.102  21.099 14.910  1.00 53.50  ? 53  LYS D CB  1 
ATOM   214  C CG  . LYS A 1 32  ? 7.847  20.846 14.097  1.00 56.66  ? 53  LYS D CG  1 
ATOM   215  C CD  . LYS A 1 32  ? 6.839  21.961 14.379  1.00 69.08  ? 53  LYS D CD  1 
ATOM   216  C CE  . LYS A 1 32  ? 5.560  21.904 13.550  1.00 73.15  ? 53  LYS D CE  1 
ATOM   217  N NZ  . LYS A 1 32  ? 4.977  20.540 13.548  1.00 76.80  ? 53  LYS D NZ  1 
ATOM   218  N N   . SER A 1 33  ? 12.268 20.577 14.219  1.00 43.71  ? 54  SER D N   1 
ATOM   219  C CA  . SER A 1 33  ? 13.544 21.179 14.311  1.00 43.51  ? 54  SER D CA  1 
ATOM   220  C C   . SER A 1 33  ? 13.459 22.680 14.505  1.00 48.94  ? 54  SER D C   1 
ATOM   221  O O   . SER A 1 33  ? 12.391 23.338 14.319  1.00 41.20  ? 54  SER D O   1 
ATOM   222  C CB  . SER A 1 33  ? 14.356 20.889 13.072  1.00 45.31  ? 54  SER D CB  1 
ATOM   223  O OG  . SER A 1 33  ? 13.979 21.704 11.999  1.00 42.08  ? 54  SER D OG  1 
ATOM   224  N N   . SER A 1 34  ? 14.622 23.250 14.771  1.00 42.03  ? 55  SER D N   1 
ATOM   225  C CA  . SER A 1 34  ? 14.740 24.717 14.694  1.00 43.19  ? 55  SER D CA  1 
ATOM   226  C C   . SER A 1 34  ? 14.523 25.200 13.280  1.00 44.39  ? 55  SER D C   1 
ATOM   227  O O   . SER A 1 34  ? 14.850 24.497 12.343  1.00 47.74  ? 55  SER D O   1 
ATOM   228  C CB  . SER A 1 34  ? 16.124 25.155 15.207  1.00 44.53  ? 55  SER D CB  1 
ATOM   229  O OG  . SER A 1 34  ? 16.261 24.716 16.548  1.00 42.87  ? 55  SER D OG  1 
ATOM   230  N N   . THR A 1 35  ? 13.987 26.413 13.136  1.00 47.13  ? 56  THR D N   1 
ATOM   231  C CA  . THR A 1 35  ? 13.802 27.067 11.871  1.00 49.79  ? 56  THR D CA  1 
ATOM   232  C C   . THR A 1 35  ? 15.075 27.418 11.144  1.00 49.92  ? 56  THR D C   1 
ATOM   233  O O   . THR A 1 35  ? 16.041 27.888 11.724  1.00 60.84  ? 56  THR D O   1 
ATOM   234  C CB  . THR A 1 35  ? 12.903 28.298 12.004  1.00 55.55  ? 56  THR D CB  1 
ATOM   235  O OG1 . THR A 1 35  ? 11.603 27.856 12.350  1.00 56.71  ? 56  THR D OG1 1 
ATOM   236  C CG2 . THR A 1 35  ? 12.757 29.013 10.671  1.00 60.59  ? 56  THR D CG2 1 
ATOM   237  N N   . PHE A 1 36  ? 15.069 27.191 9.838   1.00 45.80  ? 57  PHE D N   1 
ATOM   238  C CA  . PHE A 1 36  ? 16.226 27.478 9.008   1.00 45.97  ? 57  PHE D CA  1 
ATOM   239  C C   . PHE A 1 36  ? 15.835 28.075 7.673   1.00 47.37  ? 57  PHE D C   1 
ATOM   240  O O   . PHE A 1 36  ? 14.655 28.039 7.250   1.00 50.56  ? 57  PHE D O   1 
ATOM   241  C CB  . PHE A 1 36  ? 17.118 26.221 8.814   1.00 46.27  ? 57  PHE D CB  1 
ATOM   242  C CG  . PHE A 1 36  ? 16.430 25.070 8.057   1.00 50.17  ? 57  PHE D CG  1 
ATOM   243  C CD1 . PHE A 1 36  ? 15.668 24.124 8.733   1.00 52.62  ? 57  PHE D CD1 1 
ATOM   244  C CD2 . PHE A 1 36  ? 16.599 24.921 6.682   1.00 51.86  ? 57  PHE D CD2 1 
ATOM   245  C CE1 . PHE A 1 36  ? 15.068 23.047 8.080   1.00 51.91  ? 57  PHE D CE1 1 
ATOM   246  C CE2 . PHE A 1 36  ? 16.023 23.840 6.022   1.00 54.74  ? 57  PHE D CE2 1 
ATOM   247  C CZ  . PHE A 1 36  ? 15.220 22.923 6.723   1.00 47.88  ? 57  PHE D CZ  1 
ATOM   248  N N   . SER A 1 37  ? 16.850 28.604 7.005   1.00 46.37  ? 58  SER D N   1 
ATOM   249  C CA  . SER A 1 37  ? 16.734 29.169 5.643   1.00 55.36  ? 58  SER D CA  1 
ATOM   250  C C   . SER A 1 37  ? 18.081 29.082 4.964   1.00 55.71  ? 58  SER D C   1 
ATOM   251  O O   . SER A 1 37  ? 19.082 28.677 5.599   1.00 65.16  ? 58  SER D O   1 
ATOM   252  C CB  . SER A 1 37  ? 16.274 30.636 5.708   1.00 57.58  ? 58  SER D CB  1 
ATOM   253  O OG  . SER A 1 37  ? 17.308 31.497 6.162   1.00 65.56  ? 58  SER D OG  1 
ATOM   254  N N   . SER A 1 38  ? 18.133 29.499 3.697   1.00 70.61  ? 59  SER D N   1 
ATOM   255  C CA  . SER A 1 38  ? 19.406 29.597 2.933   1.00 79.69  ? 59  SER D CA  1 
ATOM   256  C C   . SER A 1 38  ? 20.376 30.645 3.511   1.00 79.69  ? 59  SER D C   1 
ATOM   257  O O   . SER A 1 38  ? 21.596 30.436 3.496   1.00 85.23  ? 59  SER D O   1 
ATOM   258  C CB  . SER A 1 38  ? 19.123 29.914 1.452   1.00 76.09  ? 59  SER D CB  1 
ATOM   259  O OG  . SER A 1 38  ? 18.515 31.189 1.334   1.00 73.71  ? 59  SER D OG  1 
ATOM   260  N N   . GLY A 1 39  ? 19.827 31.762 4.000   1.00 84.51  ? 60  GLY D N   1 
ATOM   261  C CA  . GLY A 1 39  ? 20.609 32.800 4.702   1.00 90.74  ? 60  GLY D CA  1 
ATOM   262  C C   . GLY A 1 39  ? 19.769 33.986 5.180   1.00 95.97  ? 60  GLY D C   1 
ATOM   263  O O   . GLY A 1 39  ? 18.538 33.863 5.398   1.00 91.82  ? 60  GLY D O   1 
ATOM   264  N N   . ALA A 1 40  ? 20.437 35.133 5.351   1.00 105.70 ? 61  ALA D N   1 
ATOM   265  C CA  . ALA A 1 40  ? 19.770 36.414 5.685   1.00 109.28 ? 61  ALA D CA  1 
ATOM   266  C C   . ALA A 1 40  ? 19.063 37.091 4.485   1.00 112.07 ? 61  ALA D C   1 
ATOM   267  O O   . ALA A 1 40  ? 18.178 37.913 4.693   1.00 104.72 ? 61  ALA D O   1 
ATOM   268  C CB  . ALA A 1 40  ? 20.763 37.379 6.326   1.00 107.66 ? 61  ALA D CB  1 
ATOM   269  N N   . ASN A 1 41  ? 19.437 36.730 3.250   1.00 118.02 ? 62  ASN D N   1 
ATOM   270  C CA  . ASN A 1 41  ? 18.797 37.240 2.019   1.00 116.83 ? 62  ASN D CA  1 
ATOM   271  C C   . ASN A 1 41  ? 17.586 36.385 1.548   1.00 113.70 ? 62  ASN D C   1 
ATOM   272  O O   . ASN A 1 41  ? 17.335 36.265 0.337   1.00 111.00 ? 62  ASN D O   1 
ATOM   273  C CB  . ASN A 1 41  ? 19.860 37.319 0.900   1.00 117.61 ? 62  ASN D CB  1 
ATOM   274  N N   . ASP A 1 42  ? 16.824 35.827 2.496   1.00 98.41  ? 63  ASP D N   1 
ATOM   275  C CA  . ASP A 1 42  ? 15.827 34.787 2.200   1.00 93.12  ? 63  ASP D CA  1 
ATOM   276  C C   . ASP A 1 42  ? 14.500 35.057 2.933   1.00 83.34  ? 63  ASP D C   1 
ATOM   277  O O   . ASP A 1 42  ? 14.410 34.944 4.160   1.00 79.74  ? 63  ASP D O   1 
ATOM   278  C CB  . ASP A 1 42  ? 16.390 33.399 2.581   1.00 91.37  ? 63  ASP D CB  1 
ATOM   279  C CG  . ASP A 1 42  ? 15.568 32.212 2.008   1.00 97.86  ? 63  ASP D CG  1 
ATOM   280  O OD1 . ASP A 1 42  ? 14.524 32.434 1.358   1.00 94.31  ? 63  ASP D OD1 1 
ATOM   281  O OD2 . ASP A 1 42  ? 15.971 31.034 2.211   1.00 90.92  ? 63  ASP D OD2 1 
ATOM   282  N N   . LYS A 1 43  ? 13.462 35.385 2.164   1.00 80.39  ? 64  LYS D N   1 
ATOM   283  C CA  . LYS A 1 43  ? 12.078 35.434 2.690   1.00 84.06  ? 64  LYS D CA  1 
ATOM   284  C C   . LYS A 1 43  ? 11.592 34.100 3.387   1.00 84.89  ? 64  LYS D C   1 
ATOM   285  O O   . LYS A 1 43  ? 10.656 34.114 4.204   1.00 77.13  ? 64  LYS D O   1 
ATOM   286  C CB  . LYS A 1 43  ? 11.106 35.826 1.555   1.00 71.37  ? 64  LYS D CB  1 
ATOM   287  N N   . LEU A 1 44  ? 12.228 32.962 3.079   1.00 77.78  ? 65  LEU D N   1 
ATOM   288  C CA  . LEU A 1 44  ? 11.656 31.650 3.406   1.00 76.51  ? 65  LEU D CA  1 
ATOM   289  C C   . LEU A 1 44  ? 12.171 31.059 4.698   1.00 66.37  ? 65  LEU D C   1 
ATOM   290  O O   . LEU A 1 44  ? 13.383 30.958 4.916   1.00 68.42  ? 65  LEU D O   1 
ATOM   291  C CB  . LEU A 1 44  ? 11.954 30.663 2.277   1.00 73.83  ? 65  LEU D CB  1 
ATOM   292  C CG  . LEU A 1 44  ? 11.451 31.069 0.895   1.00 73.83  ? 65  LEU D CG  1 
ATOM   293  C CD1 . LEU A 1 44  ? 12.084 30.168 -0.150  1.00 70.28  ? 65  LEU D CD1 1 
ATOM   294  C CD2 . LEU A 1 44  ? 9.924  31.036 0.863   1.00 72.93  ? 65  LEU D CD2 1 
ATOM   295  N N   . LYS A 1 45  ? 11.251 30.565 5.503   1.00 58.24  ? 66  LYS D N   1 
ATOM   296  C CA  . LYS A 1 45  ? 11.645 29.882 6.716   1.00 64.12  ? 66  LYS D CA  1 
ATOM   297  C C   . LYS A 1 45  ? 11.029 28.484 6.726   1.00 53.99  ? 66  LYS D C   1 
ATOM   298  O O   . LYS A 1 45  ? 9.812  28.327 6.645   1.00 61.80  ? 66  LYS D O   1 
ATOM   299  C CB  . LYS A 1 45  ? 11.285 30.676 7.971   1.00 67.10  ? 66  LYS D CB  1 
ATOM   300  C CG  . LYS A 1 45  ? 11.914 32.078 8.119   1.00 68.29  ? 66  LYS D CG  1 
ATOM   301  C CD  . LYS A 1 45  ? 13.392 32.219 7.757   1.00 66.91  ? 66  LYS D CD  1 
ATOM   302  N N   . TRP A 1 46  ? 11.895 27.498 6.886   1.00 50.83  ? 67  TRP D N   1 
ATOM   303  C CA  . TRP A 1 46  ? 11.532 26.065 6.918   1.00 48.87  ? 67  TRP D CA  1 
ATOM   304  C C   . TRP A 1 46  ? 11.908 25.353 8.206   1.00 49.26  ? 67  TRP D C   1 
ATOM   305  O O   . TRP A 1 46  ? 12.749 25.837 8.969   1.00 46.28  ? 67  TRP D O   1 
ATOM   306  C CB  . TRP A 1 46  ? 12.348 25.387 5.857   1.00 48.12  ? 67  TRP D CB  1 
ATOM   307  C CG  . TRP A 1 46  ? 12.336 25.957 4.542   1.00 49.97  ? 67  TRP D CG  1 
ATOM   308  C CD1 . TRP A 1 46  ? 13.150 26.939 4.052   1.00 48.95  ? 67  TRP D CD1 1 
ATOM   309  C CD2 . TRP A 1 46  ? 11.542 25.504 3.443   1.00 50.28  ? 67  TRP D CD2 1 
ATOM   310  N NE1 . TRP A 1 46  ? 12.871 27.174 2.749   1.00 48.48  ? 67  TRP D NE1 1 
ATOM   311  C CE2 . TRP A 1 46  ? 11.915 26.282 2.327   1.00 51.80  ? 67  TRP D CE2 1 
ATOM   312  C CE3 . TRP A 1 46  ? 10.545 24.522 3.304   1.00 48.95  ? 67  TRP D CE3 1 
ATOM   313  C CZ2 . TRP A 1 46  ? 11.351 26.095 1.056   1.00 50.83  ? 67  TRP D CZ2 1 
ATOM   314  C CZ3 . TRP A 1 46  ? 9.939  24.347 2.041   1.00 55.41  ? 67  TRP D CZ3 1 
ATOM   315  C CH2 . TRP A 1 46  ? 10.361 25.135 0.934   1.00 56.57  ? 67  TRP D CH2 1 
ATOM   316  N N   . CYS A 1 47  ? 11.272 24.216 8.499   1.00 48.14  ? 68  CYS D N   1 
ATOM   317  C CA  . CYS A 1 47  ? 11.798 23.284 9.533   1.00 48.92  ? 68  CYS D CA  1 
ATOM   318  C C   . CYS A 1 47  ? 11.584 21.844 9.090   1.00 49.56  ? 68  CYS D C   1 
ATOM   319  O O   . CYS A 1 47  ? 10.879 21.612 8.107   1.00 44.56  ? 68  CYS D O   1 
ATOM   320  C CB  . CYS A 1 47  ? 11.222 23.519 10.916  1.00 48.40  ? 68  CYS D CB  1 
ATOM   321  S SG  . CYS A 1 47  ? 9.502  23.039 11.155  1.00 55.26  ? 68  CYS D SG  1 
ATOM   322  N N   . LEU A 1 48  ? 12.263 20.916 9.763   1.00 44.48  ? 69  LEU D N   1 
ATOM   323  C CA  . LEU A 1 48  ? 12.024 19.492 9.605   1.00 43.68  ? 69  LEU D CA  1 
ATOM   324  C C   . LEU A 1 48  ? 11.099 19.033 10.684  1.00 43.79  ? 69  LEU D C   1 
ATOM   325  O O   . LEU A 1 48  ? 11.096 19.540 11.770  1.00 43.10  ? 69  LEU D O   1 
ATOM   326  C CB  . LEU A 1 48  ? 13.307 18.728 9.709   1.00 39.72  ? 69  LEU D CB  1 
ATOM   327  C CG  . LEU A 1 48  ? 14.394 19.121 8.742   1.00 40.89  ? 69  LEU D CG  1 
ATOM   328  C CD1 . LEU A 1 48  ? 15.607 18.222 8.870   1.00 40.33  ? 69  LEU D CD1 1 
ATOM   329  C CD2 . LEU A 1 48  ? 13.907 19.140 7.319   1.00 44.35  ? 69  LEU D CD2 1 
ATOM   330  N N   . ARG A 1 49  ? 10.307 18.025 10.391  1.00 41.64  ? 70  ARG D N   1 
ATOM   331  C CA  . ARG A 1 49  ? 9.396  17.423 11.344  1.00 38.80  ? 70  ARG D CA  1 
ATOM   332  C C   . ARG A 1 49  ? 9.623  15.890 11.269  1.00 45.72  ? 70  ARG D C   1 
ATOM   333  O O   . ARG A 1 49  ? 9.632  15.330 10.176  1.00 45.30  ? 70  ARG D O   1 
ATOM   334  C CB  . ARG A 1 49  ? 8.004  17.742 10.882  1.00 49.53  ? 70  ARG D CB  1 
ATOM   335  C CG  . ARG A 1 49  ? 6.866  17.340 11.775  1.00 55.16  ? 70  ARG D CG  1 
ATOM   336  C CD  . ARG A 1 49  ? 5.588  17.253 10.946  1.00 67.57  ? 70  ARG D CD  1 
ATOM   337  N NE  . ARG A 1 49  ? 5.067  15.885 10.987  1.00 81.37  ? 70  ARG D NE  1 
ATOM   338  C CZ  . ARG A 1 49  ? 4.333  15.277 10.050  1.00 80.26  ? 70  ARG D CZ  1 
ATOM   339  N NH1 . ARG A 1 49  ? 3.985  15.855 8.909   1.00 75.29  ? 70  ARG D NH1 1 
ATOM   340  N NH2 . ARG A 1 49  ? 3.937  14.034 10.283  1.00 94.55  ? 70  ARG D NH2 1 
ATOM   341  N N   . VAL A 1 50  ? 9.788  15.234 12.412  1.00 42.52  ? 71  VAL D N   1 
ATOM   342  C CA  . VAL A 1 50  ? 10.063 13.819 12.499  1.00 43.50  ? 71  VAL D CA  1 
ATOM   343  C C   . VAL A 1 50  ? 8.993  13.277 13.398  1.00 45.86  ? 71  VAL D C   1 
ATOM   344  O O   . VAL A 1 50  ? 8.628  13.942 14.355  1.00 43.83  ? 71  VAL D O   1 
ATOM   345  C CB  . VAL A 1 50  ? 11.467 13.563 13.105  1.00 47.62  ? 71  VAL D CB  1 
ATOM   346  C CG1 . VAL A 1 50  ? 11.574 12.196 13.768  1.00 52.08  ? 71  VAL D CG1 1 
ATOM   347  C CG2 . VAL A 1 50  ? 12.548 13.704 12.062  1.00 50.48  ? 71  VAL D CG2 1 
ATOM   348  N N   . ASN A 1 51  ? 8.430  12.122 13.050  1.00 42.10  ? 72  ASN D N   1 
ATOM   349  C CA  . ASN A 1 51  ? 7.659  11.295 13.969  1.00 41.93  ? 72  ASN D CA  1 
ATOM   350  C C   . ASN A 1 51  ? 8.531  10.080 14.246  1.00 49.45  ? 72  ASN D C   1 
ATOM   351  O O   . ASN A 1 51  ? 8.686  9.232  13.360  1.00 44.27  ? 72  ASN D O   1 
ATOM   352  C CB  . ASN A 1 51  ? 6.325  10.817 13.350  1.00 45.35  ? 72  ASN D CB  1 
ATOM   353  C CG  . ASN A 1 51  ? 5.438  11.965 12.901  1.00 49.46  ? 72  ASN D CG  1 
ATOM   354  O OD1 . ASN A 1 51  ? 5.221  12.141 11.714  1.00 55.72  ? 72  ASN D OD1 1 
ATOM   355  N ND2 . ASN A 1 51  ? 4.938  12.755 13.845  1.00 50.49  ? 72  ASN D ND2 1 
ATOM   356  N N   . PRO A 1 52  ? 9.133  9.983  15.435  1.00 44.60  ? 73  PRO D N   1 
ATOM   357  C CA  . PRO A 1 52  ? 10.049 8.850  15.627  1.00 44.44  ? 73  PRO D CA  1 
ATOM   358  C C   . PRO A 1 52  ? 9.413  7.460  15.454  1.00 46.68  ? 73  PRO D C   1 
ATOM   359  O O   . PRO A 1 52  ? 10.133 6.530  15.084  1.00 45.46  ? 73  PRO D O   1 
ATOM   360  C CB  . PRO A 1 52  ? 10.563 9.017  17.078  1.00 46.56  ? 73  PRO D CB  1 
ATOM   361  C CG  . PRO A 1 52  ? 9.666  9.996  17.704  1.00 51.62  ? 73  PRO D CG  1 
ATOM   362  C CD  . PRO A 1 52  ? 9.011  10.827 16.634  1.00 43.91  ? 73  PRO D CD  1 
ATOM   363  N N   . LYS A 1 53  ? 8.107  7.322  15.715  1.00 45.62  ? 74  LYS D N   1 
ATOM   364  C CA  . LYS A 1 53  ? 7.343  6.186  15.215  1.00 54.00  ? 74  LYS D CA  1 
ATOM   365  C C   . LYS A 1 53  ? 6.222  6.753  14.355  1.00 50.76  ? 74  LYS D C   1 
ATOM   366  O O   . LYS A 1 53  ? 5.509  7.661  14.812  1.00 47.60  ? 74  LYS D O   1 
ATOM   367  C CB  . LYS A 1 53  ? 6.685  5.361  16.353  1.00 57.59  ? 74  LYS D CB  1 
ATOM   368  C CG  . LYS A 1 53  ? 7.591  4.702  17.371  1.00 61.82  ? 74  LYS D CG  1 
ATOM   369  C CD  . LYS A 1 53  ? 6.806  3.706  18.235  1.00 69.78  ? 74  LYS D CD  1 
ATOM   370  N N   . GLY A 1 54  ? 6.002  6.190  13.159  1.00 49.87  ? 75  GLY D N   1 
ATOM   371  C CA  . GLY A 1 54  ? 4.934  6.677  12.259  1.00 51.55  ? 75  GLY D CA  1 
ATOM   372  C C   . GLY A 1 54  ? 3.574  6.585  12.946  1.00 52.70  ? 75  GLY D C   1 
ATOM   373  O O   . GLY A 1 54  ? 3.381  5.774  13.830  1.00 58.34  ? 75  GLY D O   1 
ATOM   374  N N   . LEU A 1 55  ? 2.639  7.431  12.537  1.00 62.72  ? 76  LEU D N   1 
ATOM   375  C CA  . LEU A 1 55  ? 1.394  7.651  13.282  1.00 70.90  ? 76  LEU D CA  1 
ATOM   376  C C   . LEU A 1 55  ? 0.135  6.911  12.730  1.00 81.32  ? 76  LEU D C   1 
ATOM   377  O O   . LEU A 1 55  ? -1.016 7.352  12.929  1.00 79.87  ? 76  LEU D O   1 
ATOM   378  C CB  . LEU A 1 55  ? 1.147  9.182  13.385  1.00 71.93  ? 76  LEU D CB  1 
ATOM   379  C CG  . LEU A 1 55  ? 2.186  9.997  14.210  1.00 76.97  ? 76  LEU D CG  1 
ATOM   380  C CD1 . LEU A 1 55  ? 1.843  11.493 14.209  1.00 80.34  ? 76  LEU D CD1 1 
ATOM   381  C CD2 . LEU A 1 55  ? 2.354  9.465  15.637  1.00 66.19  ? 76  LEU D CD2 1 
ATOM   382  N N   . ASP A 1 56  ? 0.351  5.791  12.048  1.00 78.38  ? 77  ASP D N   1 
ATOM   383  C CA  . ASP A 1 56  ? -0.744 4.911  11.660  1.00 75.52  ? 77  ASP D CA  1 
ATOM   384  C C   . ASP A 1 56  ? -0.216 3.492  11.666  1.00 78.43  ? 77  ASP D C   1 
ATOM   385  O O   . ASP A 1 56  ? 1.018  3.298  11.741  1.00 64.34  ? 77  ASP D O   1 
ATOM   386  C CB  . ASP A 1 56  ? -1.341 5.330  10.299  1.00 72.72  ? 77  ASP D CB  1 
ATOM   387  C CG  . ASP A 1 56  ? -0.324 5.294  9.141   1.00 76.22  ? 77  ASP D CG  1 
ATOM   388  O OD1 . ASP A 1 56  ? 0.707  4.578  9.184   1.00 75.88  ? 77  ASP D OD1 1 
ATOM   389  O OD2 . ASP A 1 56  ? -0.583 5.990  8.149   1.00 82.78  ? 77  ASP D OD2 1 
ATOM   390  N N   . GLU A 1 57  ? -1.144 2.527  11.585  1.00 80.89  ? 78  GLU D N   1 
ATOM   391  C CA  . GLU A 1 57  ? -0.837 1.084  11.655  1.00 84.49  ? 78  GLU D CA  1 
ATOM   392  C C   . GLU A 1 57  ? 0.330  0.724  10.746  1.00 75.32  ? 78  GLU D C   1 
ATOM   393  O O   . GLU A 1 57  ? 1.280  0.041  11.159  1.00 80.91  ? 78  GLU D O   1 
ATOM   394  C CB  . GLU A 1 57  ? -2.074 0.230  11.271  1.00 80.77  ? 78  GLU D CB  1 
ATOM   395  N N   . GLU A 1 58  ? 0.257  1.244  9.527   1.00 76.82  ? 79  GLU D N   1 
ATOM   396  C CA  . GLU A 1 58  ? 1.195  0.929  8.449   1.00 83.13  ? 79  GLU D CA  1 
ATOM   397  C C   . GLU A 1 58  ? 2.599  1.465  8.670   1.00 78.28  ? 79  GLU D C   1 
ATOM   398  O O   . GLU A 1 58  ? 3.571  0.766  8.361   1.00 72.90  ? 79  GLU D O   1 
ATOM   399  C CB  . GLU A 1 58  ? 0.653  1.491  7.142   1.00 89.52  ? 79  GLU D CB  1 
ATOM   400  C CG  . GLU A 1 58  ? 1.465  1.187  5.894   1.00 96.01  ? 79  GLU D CG  1 
ATOM   401  C CD  . GLU A 1 58  ? 1.311  2.258  4.808   1.00 103.67 ? 79  GLU D CD  1 
ATOM   402  O OE1 . GLU A 1 58  ? 0.581  3.261  5.006   1.00 111.89 ? 79  GLU D OE1 1 
ATOM   403  O OE2 . GLU A 1 58  ? 1.934  2.104  3.736   1.00 92.08  ? 79  GLU D OE2 1 
ATOM   404  N N   . SER A 1 59  ? 2.709  2.702  9.171   1.00 71.32  ? 80  SER D N   1 
ATOM   405  C CA  . SER A 1 59  ? 4.023  3.338  9.391   1.00 61.19  ? 80  SER D CA  1 
ATOM   406  C C   . SER A 1 59  ? 4.577  3.150  10.804  1.00 57.16  ? 80  SER D C   1 
ATOM   407  O O   . SER A 1 59  ? 5.728  3.546  11.055  1.00 53.59  ? 80  SER D O   1 
ATOM   408  C CB  . SER A 1 59  ? 3.969  4.836  9.022   1.00 63.88  ? 80  SER D CB  1 
ATOM   409  O OG  . SER A 1 59  ? 2.995  5.567  9.804   1.00 60.58  ? 80  SER D OG  1 
ATOM   410  N N   . LYS A 1 60  ? 3.816  2.515  11.706  1.00 62.33  ? 81  LYS D N   1 
ATOM   411  C CA  . LYS A 1 60  ? 4.231  2.319  13.140  1.00 61.94  ? 81  LYS D CA  1 
ATOM   412  C C   . LYS A 1 60  ? 5.672  1.819  13.295  1.00 57.56  ? 81  LYS D C   1 
ATOM   413  O O   . LYS A 1 60  ? 6.351  2.220  14.231  1.00 66.77  ? 81  LYS D O   1 
ATOM   414  C CB  . LYS A 1 60  ? 3.243  1.396  13.911  1.00 72.60  ? 81  LYS D CB  1 
ATOM   415  C CG  . LYS A 1 60  ? 3.321  -0.112 13.598  1.00 81.78  ? 81  LYS D CG  1 
ATOM   416  C CD  . LYS A 1 60  ? 2.117  -0.928 14.097  1.00 85.56  ? 81  LYS D CD  1 
ATOM   417  N N   . ASP A 1 61  ? 6.181  1.012  12.353  1.00 55.14  ? 82  ASP D N   1 
ATOM   418  C CA  . ASP A 1 61  ? 7.609  0.588  12.381  1.00 58.14  ? 82  ASP D CA  1 
ATOM   419  C C   . ASP A 1 61  ? 8.662  1.505  11.720  1.00 49.84  ? 82  ASP D C   1 
ATOM   420  O O   . ASP A 1 61  ? 9.914  1.183  11.658  1.00 50.22  ? 82  ASP D O   1 
ATOM   421  C CB  . ASP A 1 61  ? 7.714  -0.850 11.841  1.00 74.24  ? 82  ASP D CB  1 
ATOM   422  C CG  . ASP A 1 61  ? 7.003  -1.845 12.757  1.00 80.14  ? 82  ASP D CG  1 
ATOM   423  O OD1 . ASP A 1 61  ? 7.504  -2.016 13.894  1.00 80.44  ? 82  ASP D OD1 1 
ATOM   424  O OD2 . ASP A 1 61  ? 5.937  -2.386 12.372  1.00 81.61  ? 82  ASP D OD2 1 
ATOM   425  N N   . TYR A 1 62  ? 8.195  2.676  11.276  1.00 47.86  ? 83  TYR D N   1 
ATOM   426  C CA  . TYR A 1 62  ? 9.049  3.596  10.569  1.00 46.27  ? 83  TYR D CA  1 
ATOM   427  C C   . TYR A 1 62  ? 9.230  4.936  11.310  1.00 45.33  ? 83  TYR D C   1 
ATOM   428  O O   . TYR A 1 62  ? 8.323  5.443  11.948  1.00 48.30  ? 83  TYR D O   1 
ATOM   429  C CB  . TYR A 1 62  ? 8.485  3.799  9.186   1.00 45.89  ? 83  TYR D CB  1 
ATOM   430  C CG  . TYR A 1 62  ? 8.624  2.583  8.276   1.00 54.62  ? 83  TYR D CG  1 
ATOM   431  C CD1 . TYR A 1 62  ? 7.645  1.583  8.257   1.00 58.62  ? 83  TYR D CD1 1 
ATOM   432  C CD2 . TYR A 1 62  ? 9.736  2.429  7.425   1.00 49.51  ? 83  TYR D CD2 1 
ATOM   433  C CE1 . TYR A 1 62  ? 7.760  0.471  7.418   1.00 58.66  ? 83  TYR D CE1 1 
ATOM   434  C CE2 . TYR A 1 62  ? 9.860  1.322  6.591   1.00 57.17  ? 83  TYR D CE2 1 
ATOM   435  C CZ  . TYR A 1 62  ? 8.866  0.335  6.599   1.00 64.00  ? 83  TYR D CZ  1 
ATOM   436  O OH  . TYR A 1 62  ? 8.941  -0.795 5.787   1.00 66.13  ? 83  TYR D OH  1 
ATOM   437  N N   . LEU A 1 63  ? 10.405 5.511  11.181  1.00 46.32  ? 84  LEU D N   1 
ATOM   438  C CA  . LEU A 1 63  ? 10.557 6.963  11.395  1.00 48.24  ? 84  LEU D CA  1 
ATOM   439  C C   . LEU A 1 63  ? 10.050 7.691  10.161  1.00 44.48  ? 84  LEU D C   1 
ATOM   440  O O   . LEU A 1 63  ? 10.388 7.312  9.006   1.00 40.62  ? 84  LEU D O   1 
ATOM   441  C CB  . LEU A 1 63  ? 12.004 7.299  11.627  1.00 49.32  ? 84  LEU D CB  1 
ATOM   442  C CG  . LEU A 1 63  ? 12.381 8.782  11.743  1.00 44.52  ? 84  LEU D CG  1 
ATOM   443  C CD1 . LEU A 1 63  ? 13.445 8.880  12.813  1.00 47.16  ? 84  LEU D CD1 1 
ATOM   444  C CD2 . LEU A 1 63  ? 12.934 9.378  10.448  1.00 41.75  ? 84  LEU D CD2 1 
ATOM   445  N N   . SER A 1 64  ? 9.224  8.698  10.398  1.00 42.10  ? 85  SER D N   1 
ATOM   446  C CA  . SER A 1 64  ? 8.685  9.601  9.359   1.00 43.86  ? 85  SER D CA  1 
ATOM   447  C C   . SER A 1 64  ? 9.426  10.954 9.384   1.00 44.65  ? 85  SER D C   1 
ATOM   448  O O   . SER A 1 64  ? 9.722  11.481 10.468  1.00 46.90  ? 85  SER D O   1 
ATOM   449  C CB  . SER A 1 64  ? 7.206  9.908  9.591   1.00 42.93  ? 85  SER D CB  1 
ATOM   450  O OG  . SER A 1 64  ? 6.372  8.766  9.624   1.00 47.45  ? 85  SER D OG  1 
ATOM   451  N N   . LEU A 1 65  ? 9.695  11.477 8.198   1.00 41.60  ? 86  LEU D N   1 
ATOM   452  C CA  . LEU A 1 65  ? 10.508 12.657 7.980   1.00 39.42  ? 86  LEU D CA  1 
ATOM   453  C C   . LEU A 1 65  ? 9.922  13.574 6.901   1.00 44.72  ? 86  LEU D C   1 
ATOM   454  O O   . LEU A 1 65  ? 9.728  13.172 5.726   1.00 39.75  ? 86  LEU D O   1 
ATOM   455  C CB  . LEU A 1 65  ? 11.931 12.236 7.632   1.00 42.72  ? 86  LEU D CB  1 
ATOM   456  C CG  . LEU A 1 65  ? 12.928 13.361 7.420   1.00 42.27  ? 86  LEU D CG  1 
ATOM   457  C CD1 . LEU A 1 65  ? 13.044 14.281 8.631   1.00 47.44  ? 86  LEU D CD1 1 
ATOM   458  C CD2 . LEU A 1 65  ? 14.279 12.821 7.007   1.00 42.75  ? 86  LEU D CD2 1 
ATOM   459  N N   . TYR A 1 66  ? 9.623  14.820 7.299   1.00 40.37  ? 87  TYR D N   1 
ATOM   460  C CA  . TYR A 1 66  ? 9.034  15.846 6.408   1.00 42.41  ? 87  TYR D CA  1 
ATOM   461  C C   . TYR A 1 66  ? 9.783  17.184 6.416   1.00 41.19  ? 87  TYR D C   1 
ATOM   462  O O   . TYR A 1 66  ? 10.362 17.561 7.447   1.00 47.94  ? 87  TYR D O   1 
ATOM   463  C CB  . TYR A 1 66  ? 7.618  16.121 6.853   1.00 40.64  ? 87  TYR D CB  1 
ATOM   464  C CG  . TYR A 1 66  ? 6.736  14.935 6.899   1.00 44.96  ? 87  TYR D CG  1 
ATOM   465  C CD1 . TYR A 1 66  ? 6.690  14.139 8.018   1.00 49.37  ? 87  TYR D CD1 1 
ATOM   466  C CD2 . TYR A 1 66  ? 5.860  14.680 5.866   1.00 48.08  ? 87  TYR D CD2 1 
ATOM   467  C CE1 . TYR A 1 66  ? 5.854  13.045 8.067   1.00 55.44  ? 87  TYR D CE1 1 
ATOM   468  C CE2 . TYR A 1 66  ? 5.012  13.608 5.897   1.00 50.99  ? 87  TYR D CE2 1 
ATOM   469  C CZ  . TYR A 1 66  ? 5.003  12.790 6.979   1.00 57.54  ? 87  TYR D CZ  1 
ATOM   470  O OH  . TYR A 1 66  ? 4.114  11.745 6.966   1.00 60.57  ? 87  TYR D OH  1 
ATOM   471  N N   . LEU A 1 67  ? 9.688  17.902 5.307   1.00 40.01  ? 88  LEU D N   1 
ATOM   472  C CA  . LEU A 1 67  ? 10.113 19.290 5.168   1.00 40.30  ? 88  LEU D CA  1 
ATOM   473  C C   . LEU A 1 67  ? 8.834  20.157 5.280   1.00 48.89  ? 88  LEU D C   1 
ATOM   474  O O   . LEU A 1 67  ? 7.845  19.903 4.604   1.00 49.67  ? 88  LEU D O   1 
ATOM   475  C CB  . LEU A 1 67  ? 10.836 19.500 3.887   1.00 44.34  ? 88  LEU D CB  1 
ATOM   476  C CG  . LEU A 1 67  ? 11.188 20.950 3.543   1.00 43.42  ? 88  LEU D CG  1 
ATOM   477  C CD1 . LEU A 1 67  ? 12.219 21.592 4.481   1.00 42.19  ? 88  LEU D CD1 1 
ATOM   478  C CD2 . LEU A 1 67  ? 11.680 20.990 2.158   1.00 40.56  ? 88  LEU D CD2 1 
ATOM   479  N N   . LEU A 1 68  ? 8.846  21.106 6.204   1.00 38.71  ? 89  LEU D N   1 
ATOM   480  C CA  . LEU A 1 68  ? 7.720  21.986 6.544   1.00 46.54  ? 89  LEU D CA  1 
ATOM   481  C C   . LEU A 1 68  ? 8.113  23.440 6.197   1.00 49.27  ? 89  LEU D C   1 
ATOM   482  O O   . LEU A 1 68  ? 9.195  23.873 6.552   1.00 48.91  ? 89  LEU D O   1 
ATOM   483  C CB  . LEU A 1 68  ? 7.357  21.847 7.992   1.00 50.18  ? 89  LEU D CB  1 
ATOM   484  C CG  . LEU A 1 68  ? 6.390  22.865 8.646   1.00 54.29  ? 89  LEU D CG  1 
ATOM   485  C CD1 . LEU A 1 68  ? 5.118  23.095 7.861   1.00 63.29  ? 89  LEU D CD1 1 
ATOM   486  C CD2 . LEU A 1 68  ? 6.035  22.450 10.059  1.00 54.52  ? 89  LEU D CD2 1 
ATOM   487  N N   . LEU A 1 69  ? 7.285  24.136 5.414   1.00 53.31  ? 90  LEU D N   1 
ATOM   488  C CA  . LEU A 1 69  ? 7.452  25.599 5.175   1.00 53.89  ? 90  LEU D CA  1 
ATOM   489  C C   . LEU A 1 69  ? 6.773  26.387 6.306   1.00 59.78  ? 90  LEU D C   1 
ATOM   490  O O   . LEU A 1 69  ? 5.548  26.311 6.494   1.00 61.01  ? 90  LEU D O   1 
ATOM   491  C CB  . LEU A 1 69  ? 6.847  26.002 3.878   1.00 52.03  ? 90  LEU D CB  1 
ATOM   492  C CG  . LEU A 1 69  ? 6.960  27.517 3.617   1.00 58.49  ? 90  LEU D CG  1 
ATOM   493  C CD1 . LEU A 1 69  ? 8.375  27.878 3.171   1.00 57.71  ? 90  LEU D CD1 1 
ATOM   494  C CD2 . LEU A 1 69  ? 5.941  27.927 2.575   1.00 59.96  ? 90  LEU D CD2 1 
ATOM   495  N N   . VAL A 1 70  ? 7.559  27.095 7.097   1.00 57.19  ? 91  VAL D N   1 
ATOM   496  C CA  . VAL A 1 70  ? 7.014  27.786 8.298   1.00 67.09  ? 91  VAL D CA  1 
ATOM   497  C C   . VAL A 1 70  ? 6.579  29.248 8.038   1.00 72.19  ? 91  VAL D C   1 
ATOM   498  O O   . VAL A 1 70  ? 5.587  29.689 8.583   1.00 70.48  ? 91  VAL D O   1 
ATOM   499  C CB  . VAL A 1 70  ? 7.991  27.772 9.499   1.00 61.54  ? 91  VAL D CB  1 
ATOM   500  C CG1 . VAL A 1 70  ? 7.282  28.240 10.789  1.00 63.60  ? 91  VAL D CG1 1 
ATOM   501  C CG2 . VAL A 1 70  ? 8.548  26.375 9.739   1.00 55.73  ? 91  VAL D CG2 1 
ATOM   502  N N   . SER A 1 71  ? 7.328  29.980 7.224   1.00 79.99  ? 92  SER D N   1 
ATOM   503  C CA  . SER A 1 71  ? 7.048  31.392 6.948   1.00 80.33  ? 92  SER D CA  1 
ATOM   504  C C   . SER A 1 71  ? 5.753  31.572 6.136   1.00 100.26 ? 92  SER D C   1 
ATOM   505  O O   . SER A 1 71  ? 5.160  30.591 5.676   1.00 109.87 ? 92  SER D O   1 
ATOM   506  C CB  . SER A 1 71  ? 8.189  31.952 6.136   1.00 79.14  ? 92  SER D CB  1 
ATOM   507  O OG  . SER A 1 71  ? 8.208  31.354 4.814   1.00 71.33  ? 92  SER D OG  1 
ATOM   508  N N   . CYS A 1 72  ? 5.333  32.830 5.966   1.00 109.78 ? 93  CYS D N   1 
ATOM   509  C CA  . CYS A 1 72  ? 4.225  33.222 5.072   1.00 107.67 ? 93  CYS D CA  1 
ATOM   510  C C   . CYS A 1 72  ? 4.789  33.923 3.821   1.00 105.56 ? 93  CYS D C   1 
ATOM   511  O O   . CYS A 1 72  ? 4.918  35.144 3.789   1.00 110.42 ? 93  CYS D O   1 
ATOM   512  C CB  . CYS A 1 72  ? 3.263  34.159 5.802   1.00 111.16 ? 93  CYS D CB  1 
ATOM   513  S SG  . CYS A 1 72  ? 1.788  34.584 4.845   1.00 112.34 ? 93  CYS D SG  1 
ATOM   514  N N   . PRO A 1 73  ? 5.144  33.152 2.784   1.00 105.74 ? 94  PRO D N   1 
ATOM   515  C CA  . PRO A 1 73  ? 5.924  33.744 1.695   1.00 108.66 ? 94  PRO D CA  1 
ATOM   516  C C   . PRO A 1 73  ? 5.084  34.607 0.735   1.00 112.08 ? 94  PRO D C   1 
ATOM   517  O O   . PRO A 1 73  ? 3.862  34.717 0.922   1.00 93.30  ? 94  PRO D O   1 
ATOM   518  C CB  . PRO A 1 73  ? 6.481  32.502 0.989   1.00 108.31 ? 94  PRO D CB  1 
ATOM   519  C CG  . PRO A 1 73  ? 5.391  31.493 1.148   1.00 103.64 ? 94  PRO D CG  1 
ATOM   520  C CD  . PRO A 1 73  ? 4.809  31.738 2.512   1.00 103.02 ? 94  PRO D CD  1 
ATOM   521  N N   . LYS A 1 74  ? 5.755  35.221 -0.254  1.00 118.48 ? 95  LYS D N   1 
ATOM   522  C CA  . LYS A 1 74  ? 5.114  35.874 -1.420  1.00 113.00 ? 95  LYS D CA  1 
ATOM   523  C C   . LYS A 1 74  ? 3.817  35.138 -1.813  1.00 111.70 ? 95  LYS D C   1 
ATOM   524  O O   . LYS A 1 74  ? 2.700  35.656 -1.627  1.00 103.44 ? 95  LYS D O   1 
ATOM   525  C CB  . LYS A 1 74  ? 6.098  35.932 -2.616  1.00 102.34 ? 95  LYS D CB  1 
ATOM   526  N N   . SER A 1 75  ? 3.976  33.923 -2.326  1.00 101.81 ? 96  SER D N   1 
ATOM   527  C CA  . SER A 1 75  ? 2.860  32.982 -2.461  1.00 103.70 ? 96  SER D CA  1 
ATOM   528  C C   . SER A 1 75  ? 3.431  31.575 -2.508  1.00 101.63 ? 96  SER D C   1 
ATOM   529  O O   . SER A 1 75  ? 4.536  31.357 -1.997  1.00 113.59 ? 96  SER D O   1 
ATOM   530  C CB  . SER A 1 75  ? 2.038  33.250 -3.720  1.00 105.23 ? 96  SER D CB  1 
ATOM   531  O OG  . SER A 1 75  ? 0.886  32.404 -3.742  1.00 108.16 ? 96  SER D OG  1 
ATOM   532  N N   . GLU A 1 76  ? 2.686  30.635 -3.104  1.00 83.00  ? 97  GLU D N   1 
ATOM   533  C CA  . GLU A 1 76  ? 3.170  29.271 -3.392  1.00 86.13  ? 97  GLU D CA  1 
ATOM   534  C C   . GLU A 1 76  ? 4.647  29.203 -3.727  1.00 81.10  ? 97  GLU D C   1 
ATOM   535  O O   . GLU A 1 76  ? 5.185  30.049 -4.463  1.00 68.77  ? 97  GLU D O   1 
ATOM   536  C CB  . GLU A 1 76  ? 2.434  28.636 -4.583  1.00 91.65  ? 97  GLU D CB  1 
ATOM   537  C CG  . GLU A 1 76  ? 1.129  27.924 -4.229  1.00 96.64  ? 97  GLU D CG  1 
ATOM   538  C CD  . GLU A 1 76  ? 0.814  26.768 -5.171  1.00 96.56  ? 97  GLU D CD  1 
ATOM   539  O OE1 . GLU A 1 76  ? 1.246  26.825 -6.366  1.00 89.10  ? 97  GLU D OE1 1 
ATOM   540  O OE2 . GLU A 1 76  ? 0.140  25.813 -4.693  1.00 80.15  ? 97  GLU D OE2 1 
ATOM   541  N N   . VAL A 1 77  ? 5.276  28.169 -3.178  1.00 72.32  ? 98  VAL D N   1 
ATOM   542  C CA  . VAL A 1 77  ? 6.688  27.887 -3.363  1.00 61.25  ? 98  VAL D CA  1 
ATOM   543  C C   . VAL A 1 77  ? 6.744  26.477 -3.918  1.00 55.49  ? 98  VAL D C   1 
ATOM   544  O O   . VAL A 1 77  ? 6.032  25.576 -3.423  1.00 58.61  ? 98  VAL D O   1 
ATOM   545  C CB  . VAL A 1 77  ? 7.401  27.909 -1.990  1.00 68.76  ? 98  VAL D CB  1 
ATOM   546  C CG1 . VAL A 1 77  ? 8.902  27.678 -2.138  1.00 58.73  ? 98  VAL D CG1 1 
ATOM   547  C CG2 . VAL A 1 77  ? 7.078  29.215 -1.273  1.00 70.97  ? 98  VAL D CG2 1 
ATOM   548  N N   . ARG A 1 78  ? 7.612  26.260 -4.891  1.00 54.44  ? 99  ARG D N   1 
ATOM   549  C CA  . ARG A 1 78  ? 7.807  24.931 -5.449  1.00 55.88  ? 99  ARG D CA  1 
ATOM   550  C C   . ARG A 1 78  ? 9.213  24.517 -5.131  1.00 54.66  ? 99  ARG D C   1 
ATOM   551  O O   . ARG A 1 78  ? 10.189 25.204 -5.493  1.00 55.83  ? 99  ARG D O   1 
ATOM   552  C CB  . ARG A 1 78  ? 7.522  24.945 -6.966  1.00 61.52  ? 99  ARG D CB  1 
ATOM   553  C CG  . ARG A 1 78  ? 6.016  25.104 -7.262  1.00 59.41  ? 99  ARG D CG  1 
ATOM   554  C CD  . ARG A 1 78  ? 5.623  25.186 -8.741  1.00 60.68  ? 99  ARG D CD  1 
ATOM   555  N NE  . ARG A 1 78  ? 6.708  24.858 -9.677  1.00 63.36  ? 99  ARG D NE  1 
ATOM   556  C CZ  . ARG A 1 78  ? 7.045  23.641 -10.112 1.00 62.97  ? 99  ARG D CZ  1 
ATOM   557  N NH1 . ARG A 1 78  ? 6.406  22.540 -9.695  1.00 71.65  ? 99  ARG D NH1 1 
ATOM   558  N NH2 . ARG A 1 78  ? 8.074  23.521 -10.964 1.00 72.57  ? 99  ARG D NH2 1 
ATOM   559  N N   . ALA A 1 79  ? 9.343  23.422 -4.389  1.00 53.56  ? 100 ALA D N   1 
ATOM   560  C CA  . ALA A 1 79  ? 10.694 22.931 -4.050  1.00 50.57  ? 100 ALA D CA  1 
ATOM   561  C C   . ALA A 1 79  ? 10.883 21.422 -4.219  1.00 40.02  ? 100 ALA D C   1 
ATOM   562  O O   . ALA A 1 79  ? 10.037 20.696 -3.811  1.00 43.08  ? 100 ALA D O   1 
ATOM   563  C CB  . ALA A 1 79  ? 11.051 23.316 -2.610  1.00 48.35  ? 100 ALA D CB  1 
ATOM   564  N N   . LYS A 1 80  ? 12.053 21.013 -4.689  1.00 41.21  ? 101 LYS D N   1 
ATOM   565  C CA  . LYS A 1 80  ? 12.555 19.635 -4.545  1.00 47.25  ? 101 LYS D CA  1 
ATOM   566  C C   . LYS A 1 80  ? 13.325 19.444 -3.207  1.00 53.10  ? 101 LYS D C   1 
ATOM   567  O O   . LYS A 1 80  ? 13.976 20.362 -2.708  1.00 52.92  ? 101 LYS D O   1 
ATOM   568  C CB  . LYS A 1 80  ? 13.538 19.321 -5.661  1.00 54.26  ? 101 LYS D CB  1 
ATOM   569  C CG  . LYS A 1 80  ? 12.866 19.070 -6.985  1.00 61.29  ? 101 LYS D CG  1 
ATOM   570  C CD  . LYS A 1 80  ? 13.856 18.786 -8.100  1.00 63.63  ? 101 LYS D CD  1 
ATOM   571  C CE  . LYS A 1 80  ? 13.098 18.286 -9.318  1.00 66.36  ? 101 LYS D CE  1 
ATOM   572  N NZ  . LYS A 1 80  ? 13.884 18.399 -10.580 1.00 72.04  ? 101 LYS D NZ  1 
ATOM   573  N N   . PHE A 1 81  ? 13.275 18.255 -2.651  1.00 45.63  ? 102 PHE D N   1 
ATOM   574  C CA  . PHE A 1 81  ? 14.043 17.955 -1.454  1.00 49.58  ? 102 PHE D CA  1 
ATOM   575  C C   . PHE A 1 81  ? 14.642 16.589 -1.443  1.00 51.28  ? 102 PHE D C   1 
ATOM   576  O O   . PHE A 1 81  ? 14.133 15.691 -2.075  1.00 52.74  ? 102 PHE D O   1 
ATOM   577  C CB  . PHE A 1 81  ? 13.201 18.112 -0.238  1.00 44.51  ? 102 PHE D CB  1 
ATOM   578  C CG  . PHE A 1 81  ? 11.918 17.355 -0.260  1.00 52.64  ? 102 PHE D CG  1 
ATOM   579  C CD1 . PHE A 1 81  ? 10.776 17.927 -0.815  1.00 52.70  ? 102 PHE D CD1 1 
ATOM   580  C CD2 . PHE A 1 81  ? 11.828 16.105 0.325   1.00 48.73  ? 102 PHE D CD2 1 
ATOM   581  C CE1 . PHE A 1 81  ? 9.576  17.264 -0.806  1.00 51.72  ? 102 PHE D CE1 1 
ATOM   582  C CE2 . PHE A 1 81  ? 10.634 15.458 0.363   1.00 49.04  ? 102 PHE D CE2 1 
ATOM   583  C CZ  . PHE A 1 81  ? 9.493  16.029 -0.219  1.00 51.21  ? 102 PHE D CZ  1 
ATOM   584  N N   . LYS A 1 82  ? 15.741 16.481 -0.725  1.00 51.32  ? 103 LYS D N   1 
ATOM   585  C CA  . LYS A 1 82  ? 16.492 15.272 -0.494  1.00 50.42  ? 103 LYS D CA  1 
ATOM   586  C C   . LYS A 1 82  ? 16.801 15.164 1.009   1.00 50.31  ? 103 LYS D C   1 
ATOM   587  O O   . LYS A 1 82  ? 17.371 16.101 1.599   1.00 45.27  ? 103 LYS D O   1 
ATOM   588  C CB  . LYS A 1 82  ? 17.803 15.353 -1.250  1.00 50.20  ? 103 LYS D CB  1 
ATOM   589  C CG  . LYS A 1 82  ? 18.745 14.157 -1.092  1.00 56.15  ? 103 LYS D CG  1 
ATOM   590  C CD  . LYS A 1 82  ? 20.006 14.433 -1.890  1.00 58.90  ? 103 LYS D CD  1 
ATOM   591  C CE  . LYS A 1 82  ? 21.110 13.453 -1.530  1.00 71.34  ? 103 LYS D CE  1 
ATOM   592  N NZ  . LYS A 1 82  ? 22.399 14.138 -1.215  1.00 72.07  ? 103 LYS D NZ  1 
ATOM   593  N N   . PHE A 1 83  ? 16.472 14.014 1.601   1.00 48.90  ? 104 PHE D N   1 
ATOM   594  C CA  . PHE A 1 83  ? 16.903 13.665 2.959   1.00 46.08  ? 104 PHE D CA  1 
ATOM   595  C C   . PHE A 1 83  ? 17.832 12.444 2.976   1.00 53.83  ? 104 PHE D C   1 
ATOM   596  O O   . PHE A 1 83  ? 17.592 11.423 2.278   1.00 46.77  ? 104 PHE D O   1 
ATOM   597  C CB  . PHE A 1 83  ? 15.737 13.268 3.816   1.00 45.38  ? 104 PHE D CB  1 
ATOM   598  C CG  . PHE A 1 83  ? 14.648 14.267 3.896   1.00 46.74  ? 104 PHE D CG  1 
ATOM   599  C CD1 . PHE A 1 83  ? 14.887 15.550 4.252   1.00 57.30  ? 104 PHE D CD1 1 
ATOM   600  C CD2 . PHE A 1 83  ? 13.345 13.858 3.754   1.00 47.66  ? 104 PHE D CD2 1 
ATOM   601  C CE1 . PHE A 1 83  ? 13.836 16.433 4.359   1.00 59.20  ? 104 PHE D CE1 1 
ATOM   602  C CE2 . PHE A 1 83  ? 12.317 14.718 3.852   1.00 49.23  ? 104 PHE D CE2 1 
ATOM   603  C CZ  . PHE A 1 83  ? 12.562 16.026 4.150   1.00 50.72  ? 104 PHE D CZ  1 
ATOM   604  N N   . SER A 1 84  ? 18.813 12.504 3.853   1.00 48.97  ? 105 SER D N   1 
ATOM   605  C CA  . SER A 1 84  ? 19.623 11.349 4.133   1.00 51.38  ? 105 SER D CA  1 
ATOM   606  C C   . SER A 1 84  ? 20.113 11.331 5.594   1.00 51.87  ? 105 SER D C   1 
ATOM   607  O O   . SER A 1 84  ? 19.934 12.322 6.344   1.00 50.88  ? 105 SER D O   1 
ATOM   608  C CB  . SER A 1 84  ? 20.760 11.390 3.178   1.00 54.91  ? 105 SER D CB  1 
ATOM   609  O OG  . SER A 1 84  ? 21.497 12.529 3.466   1.00 56.01  ? 105 SER D OG  1 
ATOM   610  N N   . ILE A 1 85  ? 20.734 10.214 5.989   1.00 47.04  ? 106 ILE D N   1 
ATOM   611  C CA  . ILE A 1 85  ? 21.131 9.945  7.373   1.00 45.54  ? 106 ILE D CA  1 
ATOM   612  C C   . ILE A 1 85  ? 22.618 9.883  7.359   1.00 50.33  ? 106 ILE D C   1 
ATOM   613  O O   . ILE A 1 85  ? 23.153 9.227  6.477   1.00 51.80  ? 106 ILE D O   1 
ATOM   614  C CB  . ILE A 1 85  ? 20.606 8.592  7.894   1.00 48.23  ? 106 ILE D CB  1 
ATOM   615  C CG1 . ILE A 1 85  ? 19.105 8.495  7.711   1.00 50.13  ? 106 ILE D CG1 1 
ATOM   616  C CG2 . ILE A 1 85  ? 20.981 8.435  9.353   1.00 50.85  ? 106 ILE D CG2 1 
ATOM   617  C CD1 . ILE A 1 85  ? 18.431 7.171  8.037   1.00 52.28  ? 106 ILE D CD1 1 
ATOM   618  N N   . LEU A 1 86  ? 23.291 10.590 8.274   1.00 52.58  ? 107 LEU D N   1 
ATOM   619  C CA  . LEU A 1 86  ? 24.751 10.611 8.289   1.00 55.05  ? 107 LEU D CA  1 
ATOM   620  C C   . LEU A 1 86  ? 25.217 9.549  9.269   1.00 64.70  ? 107 LEU D C   1 
ATOM   621  O O   . LEU A 1 86  ? 24.785 9.525  10.414  1.00 56.87  ? 107 LEU D O   1 
ATOM   622  C CB  . LEU A 1 86  ? 25.335 11.966 8.651   1.00 61.94  ? 107 LEU D CB  1 
ATOM   623  C CG  . LEU A 1 86  ? 25.009 13.097 7.650   1.00 71.16  ? 107 LEU D CG  1 
ATOM   624  C CD1 . LEU A 1 86  ? 25.544 14.449 8.089   1.00 68.23  ? 107 LEU D CD1 1 
ATOM   625  C CD2 . LEU A 1 86  ? 25.496 12.796 6.239   1.00 77.58  ? 107 LEU D CD2 1 
ATOM   626  N N   . ASN A 1 87  ? 26.064 8.631  8.812   1.00 67.54  ? 108 ASN D N   1 
ATOM   627  C CA  . ASN A 1 87  ? 26.530 7.554  9.692   1.00 71.09  ? 108 ASN D CA  1 
ATOM   628  C C   . ASN A 1 87  ? 27.687 8.019  10.574  1.00 77.85  ? 108 ASN D C   1 
ATOM   629  O O   . ASN A 1 87  ? 28.154 9.166  10.459  1.00 61.85  ? 108 ASN D O   1 
ATOM   630  C CB  . ASN A 1 87  ? 26.892 6.288  8.897   1.00 70.80  ? 108 ASN D CB  1 
ATOM   631  C CG  . ASN A 1 87  ? 28.028 6.498  7.902   1.00 70.59  ? 108 ASN D CG  1 
ATOM   632  O OD1 . ASN A 1 87  ? 28.842 7.450  7.990   1.00 63.19  ? 108 ASN D OD1 1 
ATOM   633  N ND2 . ASN A 1 87  ? 28.064 5.617  6.922   1.00 64.04  ? 108 ASN D ND2 1 
ATOM   634  N N   . ALA A 1 88  ? 28.123 7.116  11.454  1.00 79.34  ? 109 ALA D N   1 
ATOM   635  C CA  . ALA A 1 88  ? 29.313 7.293  12.287  1.00 85.42  ? 109 ALA D CA  1 
ATOM   636  C C   . ALA A 1 88  ? 30.536 7.879  11.551  1.00 84.76  ? 109 ALA D C   1 
ATOM   637  O O   . ALA A 1 88  ? 31.225 8.759  12.089  1.00 81.23  ? 109 ALA D O   1 
ATOM   638  C CB  . ALA A 1 88  ? 29.679 5.960  12.924  1.00 87.37  ? 109 ALA D CB  1 
ATOM   639  N N   . LYS A 1 89  ? 30.790 7.426  10.325  1.00 88.46  ? 110 LYS D N   1 
ATOM   640  C CA  . LYS A 1 89  ? 31.959 7.912  9.553   1.00 90.24  ? 110 LYS D CA  1 
ATOM   641  C C   . LYS A 1 89  ? 31.770 9.283  8.890   1.00 89.10  ? 110 LYS D C   1 
ATOM   642  O O   . LYS A 1 89  ? 32.693 9.767  8.244   1.00 95.29  ? 110 LYS D O   1 
ATOM   643  C CB  . LYS A 1 89  ? 32.393 6.889  8.487   1.00 90.11  ? 110 LYS D CB  1 
ATOM   644  C CG  . LYS A 1 89  ? 32.554 5.464  9.009   1.00 93.88  ? 110 LYS D CG  1 
ATOM   645  C CD  . LYS A 1 89  ? 33.521 4.637  8.176   1.00 98.37  ? 110 LYS D CD  1 
ATOM   646  C CE  . LYS A 1 89  ? 33.133 3.166  8.179   1.00 103.62 ? 110 LYS D CE  1 
ATOM   647  N NZ  . LYS A 1 89  ? 32.012 2.879  7.240   1.00 104.17 ? 110 LYS D NZ  1 
ATOM   648  N N   . GLY A 1 90  ? 30.600 9.907  9.034   1.00 88.48  ? 111 GLY D N   1 
ATOM   649  C CA  . GLY A 1 90  ? 30.313 11.194 8.393   1.00 84.34  ? 111 GLY D CA  1 
ATOM   650  C C   . GLY A 1 90  ? 29.838 11.037 6.956   1.00 81.25  ? 111 GLY D C   1 
ATOM   651  O O   . GLY A 1 90  ? 29.906 11.984 6.175   1.00 73.98  ? 111 GLY D O   1 
ATOM   652  N N   . GLU A 1 91  ? 29.333 9.856  6.596   1.00 76.38  ? 112 GLU D N   1 
ATOM   653  C CA  . GLU A 1 91  ? 28.947 9.596  5.208   1.00 71.43  ? 112 GLU D CA  1 
ATOM   654  C C   . GLU A 1 91  ? 27.434 9.657  5.093   1.00 73.84  ? 112 GLU D C   1 
ATOM   655  O O   . GLU A 1 91  ? 26.697 9.339  6.014   1.00 66.55  ? 112 GLU D O   1 
ATOM   656  C CB  . GLU A 1 91  ? 29.489 8.255  4.739   1.00 75.11  ? 112 GLU D CB  1 
ATOM   657  C CG  . GLU A 1 91  ? 30.994 8.134  4.995   1.00 91.26  ? 112 GLU D CG  1 
ATOM   658  C CD  . GLU A 1 91  ? 31.636 6.837  4.523   1.00 94.48  ? 112 GLU D CD  1 
ATOM   659  O OE1 . GLU A 1 91  ? 30.924 5.952  3.982   1.00 87.05  ? 112 GLU D OE1 1 
ATOM   660  O OE2 . GLU A 1 91  ? 32.879 6.720  4.703   1.00 97.86  ? 112 GLU D OE2 1 
ATOM   661  N N   . GLU A 1 92  ? 26.970 10.075 3.941   1.00 71.27  ? 113 GLU D N   1 
ATOM   662  C CA  . GLU A 1 92  ? 25.555 10.188 3.709   1.00 70.31  ? 113 GLU D CA  1 
ATOM   663  C C   . GLU A 1 92  ? 25.019 8.840  3.290   1.00 67.47  ? 113 GLU D C   1 
ATOM   664  O O   . GLU A 1 92  ? 25.552 8.268  2.368   1.00 70.89  ? 113 GLU D O   1 
ATOM   665  C CB  . GLU A 1 92  ? 25.386 11.193 2.602   1.00 79.69  ? 113 GLU D CB  1 
ATOM   666  C CG  . GLU A 1 92  ? 23.992 11.382 2.105   1.00 84.00  ? 113 GLU D CG  1 
ATOM   667  C CD  . GLU A 1 92  ? 24.005 12.304 0.923   1.00 87.60  ? 113 GLU D CD  1 
ATOM   668  O OE1 . GLU A 1 92  ? 23.521 11.871 -0.160  1.00 79.50  ? 113 GLU D OE1 1 
ATOM   669  O OE2 . GLU A 1 92  ? 24.560 13.425 1.094   1.00 72.64  ? 113 GLU D OE2 1 
ATOM   670  N N   . THR A 1 93  ? 23.981 8.328  3.949   1.00 60.41  ? 114 THR D N   1 
ATOM   671  C CA  . THR A 1 93  ? 23.331 7.086  3.520   1.00 56.29  ? 114 THR D CA  1 
ATOM   672  C C   . THR A 1 93  ? 21.841 7.219  3.528   1.00 54.41  ? 114 THR D C   1 
ATOM   673  O O   . THR A 1 93  ? 21.293 8.157  4.095   1.00 56.76  ? 114 THR D O   1 
ATOM   674  C CB  . THR A 1 93  ? 23.688 5.888  4.451   1.00 64.64  ? 114 THR D CB  1 
ATOM   675  O OG1 . THR A 1 93  ? 23.457 6.243  5.816   1.00 65.02  ? 114 THR D OG1 1 
ATOM   676  C CG2 . THR A 1 93  ? 25.122 5.542  4.332   1.00 70.63  ? 114 THR D CG2 1 
ATOM   677  N N   . LYS A 1 94  ? 21.200 6.248  2.898   1.00 46.83  ? 115 LYS D N   1 
ATOM   678  C CA  . LYS A 1 94  ? 19.791 6.062  2.941   1.00 52.84  ? 115 LYS D CA  1 
ATOM   679  C C   . LYS A 1 94  ? 19.016 7.254  2.348   1.00 57.07  ? 115 LYS D C   1 
ATOM   680  O O   . LYS A 1 94  ? 17.885 7.569  2.762   1.00 57.00  ? 115 LYS D O   1 
ATOM   681  C CB  . LYS A 1 94  ? 19.351 5.783  4.367   1.00 63.20  ? 115 LYS D CB  1 
ATOM   682  C CG  . LYS A 1 94  ? 20.246 4.838  5.171   1.00 60.94  ? 115 LYS D CG  1 
ATOM   683  C CD  . LYS A 1 94  ? 20.564 3.542  4.483   1.00 72.03  ? 115 LYS D CD  1 
ATOM   684  C CE  . LYS A 1 94  ? 19.315 2.800  4.044   1.00 72.20  ? 115 LYS D CE  1 
ATOM   685  N NZ  . LYS A 1 94  ? 19.660 1.362  3.858   1.00 80.38  ? 115 LYS D NZ  1 
ATOM   686  N N   . ALA A 1 95  ? 19.616 7.855  1.338   1.00 54.17  ? 116 ALA D N   1 
ATOM   687  C CA  . ALA A 1 95  ? 19.079 9.058  0.742   1.00 48.74  ? 116 ALA D CA  1 
ATOM   688  C C   . ALA A 1 95  ? 17.859 8.796  -0.088  1.00 52.61  ? 116 ALA D C   1 
ATOM   689  O O   . ALA A 1 95  ? 17.817 7.818  -0.798  1.00 54.33  ? 116 ALA D O   1 
ATOM   690  C CB  . ALA A 1 95  ? 20.152 9.747  -0.060  1.00 46.15  ? 116 ALA D CB  1 
ATOM   691  N N   . MET A 1 96  ? 16.806 9.584  0.109   1.00 52.66  ? 117 MET D N   1 
ATOM   692  C CA  . MET A 1 96  ? 15.678 9.623  -0.797  1.00 50.93  ? 117 MET D CA  1 
ATOM   693  C C   . MET A 1 96  ? 15.318 11.068 -1.197  1.00 58.12  ? 117 MET D C   1 
ATOM   694  O O   . MET A 1 96  ? 15.516 11.997 -0.417  1.00 55.24  ? 117 MET D O   1 
ATOM   695  C CB  . MET A 1 96  ? 14.489 8.933  -0.180  1.00 55.35  ? 117 MET D CB  1 
ATOM   696  C CG  . MET A 1 96  ? 14.725 7.434  -0.027  1.00 52.09  ? 117 MET D CG  1 
ATOM   697  S SD  . MET A 1 96  ? 13.196 6.691  0.417   1.00 52.87  ? 117 MET D SD  1 
ATOM   698  C CE  . MET A 1 96  ? 12.789 7.446  2.003   1.00 54.78  ? 117 MET D CE  1 
ATOM   699  N N   . GLU A 1 97  ? 14.794 11.208 -2.421  1.00 56.47  ? 118 GLU D N   1 
ATOM   700  C CA  . GLU A 1 97  ? 14.509 12.465 -3.094  1.00 54.37  ? 118 GLU D CA  1 
ATOM   701  C C   . GLU A 1 97  ? 13.054 12.567 -3.448  1.00 55.89  ? 118 GLU D C   1 
ATOM   702  O O   . GLU A 1 97  ? 12.408 11.574 -3.675  1.00 49.01  ? 118 GLU D O   1 
ATOM   703  C CB  . GLU A 1 97  ? 15.317 12.547 -4.353  1.00 64.76  ? 118 GLU D CB  1 
ATOM   704  C CG  . GLU A 1 97  ? 16.778 12.694 -4.037  1.00 71.62  ? 118 GLU D CG  1 
ATOM   705  C CD  . GLU A 1 97  ? 17.580 13.080 -5.245  1.00 78.92  ? 118 GLU D CD  1 
ATOM   706  O OE1 . GLU A 1 97  ? 17.577 12.297 -6.194  1.00 80.16  ? 118 GLU D OE1 1 
ATOM   707  O OE2 . GLU A 1 97  ? 18.201 14.165 -5.242  1.00 93.58  ? 118 GLU D OE2 1 
ATOM   708  N N   . SER A 1 98  ? 12.522 13.788 -3.399  1.00 48.94  ? 119 SER D N   1 
ATOM   709  C CA  . SER A 1 98  ? 11.286 14.158 -4.045  1.00 58.17  ? 119 SER D CA  1 
ATOM   710  C C   . SER A 1 98  ? 11.746 14.012 -5.505  1.00 52.20  ? 119 SER D C   1 
ATOM   711  O O   . SER A 1 98  ? 12.902 14.335 -5.875  1.00 68.24  ? 119 SER D O   1 
ATOM   712  C CB  . SER A 1 98  ? 10.918 15.639 -3.780  1.00 48.68  ? 119 SER D CB  1 
ATOM   713  O OG  . SER A 1 98  ? 11.919 16.478 -4.408  1.00 45.86  ? 119 SER D OG  1 
ATOM   714  N N   . GLN A 1 99  ? 10.935 13.474 -6.333  1.00 55.56  ? 120 GLN D N   1 
ATOM   715  C CA  . GLN A 1 99  ? 11.483 13.373 -7.712  1.00 66.25  ? 120 GLN D CA  1 
ATOM   716  C C   . GLN A 1 99  ? 11.227 14.697 -8.443  1.00 56.30  ? 120 GLN D C   1 
ATOM   717  O O   . GLN A 1 99  ? 12.097 15.225 -9.095  1.00 64.84  ? 120 GLN D O   1 
ATOM   718  C CB  . GLN A 1 99  ? 10.984 12.119 -8.446  1.00 78.20  ? 120 GLN D CB  1 
ATOM   719  C CG  . GLN A 1 99  ? 11.734 10.821 -8.065  1.00 88.13  ? 120 GLN D CG  1 
ATOM   720  C CD  . GLN A 1 99  ? 13.276 10.929 -8.097  1.00 88.05  ? 120 GLN D CD  1 
ATOM   721  O OE1 . GLN A 1 99  ? 13.858 11.698 -8.869  1.00 96.84  ? 120 GLN D OE1 1 
ATOM   722  N NE2 . GLN A 1 99  ? 13.934 10.148 -7.252  1.00 78.06  ? 120 GLN D NE2 1 
ATOM   723  N N   . ARG A 1 100 ? 10.048 15.240 -8.224  1.00 53.85  ? 121 ARG D N   1 
ATOM   724  C CA  . ARG A 1 100 ? 9.662  16.543 -8.692  1.00 61.70  ? 121 ARG D CA  1 
ATOM   725  C C   . ARG A 1 100 ? 9.551  17.539 -7.547  1.00 62.47  ? 121 ARG D C   1 
ATOM   726  O O   . ARG A 1 100 ? 9.834  17.176 -6.392  1.00 50.70  ? 121 ARG D O   1 
ATOM   727  C CB  . ARG A 1 100 ? 8.323  16.383 -9.395  1.00 73.45  ? 121 ARG D CB  1 
ATOM   728  C CG  . ARG A 1 100 ? 7.155  15.863 -8.562  1.00 68.23  ? 121 ARG D CG  1 
ATOM   729  C CD  . ARG A 1 100 ? 6.437  14.797 -9.379  1.00 68.50  ? 121 ARG D CD  1 
ATOM   730  N NE  . ARG A 1 100 ? 5.002  14.726 -9.123  1.00 69.79  ? 121 ARG D NE  1 
ATOM   731  C CZ  . ARG A 1 100 ? 4.301  13.627 -8.819  1.00 76.55  ? 121 ARG D CZ  1 
ATOM   732  N NH1 . ARG A 1 100 ? 4.886  12.447 -8.687  1.00 74.65  ? 121 ARG D NH1 1 
ATOM   733  N NH2 . ARG A 1 100 ? 2.975  13.709 -8.647  1.00 80.99  ? 121 ARG D NH2 1 
ATOM   734  N N   . ALA A 1 101 ? 9.091  18.760 -7.867  1.00 57.40  ? 122 ALA D N   1 
ATOM   735  C CA  . ALA A 1 101 ? 8.985  19.853 -6.941  1.00 58.53  ? 122 ALA D CA  1 
ATOM   736  C C   . ALA A 1 101 ? 7.597  19.803 -6.399  1.00 60.45  ? 122 ALA D C   1 
ATOM   737  O O   . ALA A 1 101 ? 6.672  19.642 -7.162  1.00 64.18  ? 122 ALA D O   1 
ATOM   738  C CB  . ALA A 1 101 ? 9.225  21.141 -7.672  1.00 58.55  ? 122 ALA D CB  1 
ATOM   739  N N   . TYR A 1 102 ? 7.444  19.861 -5.082  1.00 45.31  ? 123 TYR D N   1 
ATOM   740  C CA  . TYR A 1 102 ? 6.156  19.844 -4.484  1.00 48.25  ? 123 TYR D CA  1 
ATOM   741  C C   . TYR A 1 102 ? 5.837  21.269 -4.122  1.00 54.84  ? 123 TYR D C   1 
ATOM   742  O O   . TYR A 1 102 ? 6.698  22.142 -4.225  1.00 60.40  ? 123 TYR D O   1 
ATOM   743  C CB  . TYR A 1 102 ? 6.130  18.884 -3.272  1.00 48.49  ? 123 TYR D CB  1 
ATOM   744  C CG  . TYR A 1 102 ? 6.051  17.435 -3.725  1.00 43.90  ? 123 TYR D CG  1 
ATOM   745  C CD1 . TYR A 1 102 ? 7.093  16.848 -4.381  1.00 47.00  ? 123 TYR D CD1 1 
ATOM   746  C CD2 . TYR A 1 102 ? 4.884  16.726 -3.598  1.00 48.04  ? 123 TYR D CD2 1 
ATOM   747  C CE1 . TYR A 1 102 ? 7.009  15.547 -4.817  1.00 51.23  ? 123 TYR D CE1 1 
ATOM   748  C CE2 . TYR A 1 102 ? 4.777  15.423 -4.046  1.00 44.34  ? 123 TYR D CE2 1 
ATOM   749  C CZ  . TYR A 1 102 ? 5.812  14.868 -4.682  1.00 46.15  ? 123 TYR D CZ  1 
ATOM   750  O OH  . TYR A 1 102 ? 5.695  13.595 -5.108  1.00 58.76  ? 123 TYR D OH  1 
ATOM   751  N N   . ARG A 1 103 ? 4.586  21.514 -3.726  1.00 65.56  ? 124 ARG D N   1 
ATOM   752  C CA  . ARG A 1 103 ? 4.071  22.857 -3.555  1.00 63.94  ? 124 ARG D CA  1 
ATOM   753  C C   . ARG A 1 103 ? 3.741  23.099 -2.159  1.00 59.63  ? 124 ARG D C   1 
ATOM   754  O O   . ARG A 1 103 ? 2.875  22.434 -1.620  1.00 71.08  ? 124 ARG D O   1 
ATOM   755  C CB  . ARG A 1 103 ? 2.761  23.067 -4.317  1.00 75.54  ? 124 ARG D CB  1 
ATOM   756  C CG  . ARG A 1 103 ? 2.890  22.929 -5.799  1.00 72.68  ? 124 ARG D CG  1 
ATOM   757  C CD  . ARG A 1 103 ? 1.658  23.469 -6.516  1.00 81.71  ? 124 ARG D CD  1 
ATOM   758  N NE  . ARG A 1 103 ? 0.310  23.044 -6.064  1.00 75.12  ? 124 ARG D NE  1 
ATOM   759  C CZ  . ARG A 1 103 ? -0.223 21.818 -6.223  1.00 89.51  ? 124 ARG D CZ  1 
ATOM   760  N NH1 . ARG A 1 103 ? 0.474  20.792 -6.738  1.00 88.69  ? 124 ARG D NH1 1 
ATOM   761  N NH2 . ARG A 1 103 ? -1.471 21.601 -5.822  1.00 89.63  ? 124 ARG D NH2 1 
ATOM   762  N N   . PHE A 1 104 ? 4.358  24.134 -1.607  1.00 55.09  ? 125 PHE D N   1 
ATOM   763  C CA  . PHE A 1 104 ? 4.279  24.459 -0.232  1.00 53.94  ? 125 PHE D CA  1 
ATOM   764  C C   . PHE A 1 104 ? 3.610  25.824 -0.078  1.00 53.81  ? 125 PHE D C   1 
ATOM   765  O O   . PHE A 1 104 ? 3.944  26.756 -0.760  1.00 59.11  ? 125 PHE D O   1 
ATOM   766  C CB  . PHE A 1 104 ? 5.739  24.583 0.379   1.00 50.22  ? 125 PHE D CB  1 
ATOM   767  C CG  . PHE A 1 104 ? 6.555  23.301 0.375   1.00 47.78  ? 125 PHE D CG  1 
ATOM   768  C CD1 . PHE A 1 104 ? 7.290  22.911 -0.743  1.00 44.87  ? 125 PHE D CD1 1 
ATOM   769  C CD2 . PHE A 1 104 ? 6.636  22.518 1.532   1.00 48.40  ? 125 PHE D CD2 1 
ATOM   770  C CE1 . PHE A 1 104 ? 8.062  21.757 -0.722  1.00 41.98  ? 125 PHE D CE1 1 
ATOM   771  C CE2 . PHE A 1 104 ? 7.401  21.345 1.565   1.00 43.33  ? 125 PHE D CE2 1 
ATOM   772  C CZ  . PHE A 1 104 ? 8.121  20.976 0.442   1.00 46.44  ? 125 PHE D CZ  1 
ATOM   773  N N   . VAL A 1 105 ? 2.754  25.917 0.909   1.00 61.72  ? 126 VAL D N   1 
ATOM   774  C CA  . VAL A 1 105 ? 2.201  27.149 1.393   1.00 71.33  ? 126 VAL D CA  1 
ATOM   775  C C   . VAL A 1 105 ? 2.580  27.150 2.868   1.00 77.93  ? 126 VAL D C   1 
ATOM   776  O O   . VAL A 1 105 ? 3.101  26.152 3.370   1.00 75.81  ? 126 VAL D O   1 
ATOM   777  C CB  . VAL A 1 105 ? 0.658  27.202 1.105   1.00 74.69  ? 126 VAL D CB  1 
ATOM   778  C CG1 . VAL A 1 105 ? 0.384  26.681 -0.304  1.00 79.36  ? 126 VAL D CG1 1 
ATOM   779  C CG2 . VAL A 1 105 ? -0.196 26.385 2.091   1.00 71.78  ? 126 VAL D CG2 1 
ATOM   780  N N   . GLN A 1 106 ? 2.349  28.265 3.556   1.00 72.22  ? 127 GLN D N   1 
ATOM   781  C CA  . GLN A 1 106 ? 2.591  28.320 4.976   1.00 71.36  ? 127 GLN D CA  1 
ATOM   782  C C   . GLN A 1 106 ? 1.878  27.171 5.689   1.00 68.39  ? 127 GLN D C   1 
ATOM   783  O O   . GLN A 1 106 ? 0.682  26.975 5.532   1.00 70.08  ? 127 GLN D O   1 
ATOM   784  C CB  . GLN A 1 106 ? 2.131  29.666 5.565   1.00 78.66  ? 127 GLN D CB  1 
ATOM   785  C CG  . GLN A 1 106 ? 2.438  29.823 7.050   1.00 77.27  ? 127 GLN D CG  1 
ATOM   786  C CD  . GLN A 1 106 ? 2.074  31.186 7.618   1.00 79.95  ? 127 GLN D CD  1 
ATOM   787  O OE1 . GLN A 1 106 ? 2.594  31.581 8.653   1.00 75.46  ? 127 GLN D OE1 1 
ATOM   788  N NE2 . GLN A 1 106 ? 1.135  31.872 6.984   1.00 87.15  ? 127 GLN D NE2 1 
ATOM   789  N N   . GLY A 1 107 ? 2.633  26.451 6.503   1.00 61.18  ? 128 GLY D N   1 
ATOM   790  C CA  . GLY A 1 107 ? 2.140  25.305 7.270   1.00 59.72  ? 128 GLY D CA  1 
ATOM   791  C C   . GLY A 1 107 ? 2.028  23.977 6.499   1.00 54.74  ? 128 GLY D C   1 
ATOM   792  O O   . GLY A 1 107 ? 1.567  22.988 7.044   1.00 57.08  ? 128 GLY D O   1 
ATOM   793  N N   . LYS A 1 108 ? 2.409  23.953 5.234   1.00 52.43  ? 129 LYS D N   1 
ATOM   794  C CA  . LYS A 1 108 ? 2.356  22.739 4.446   1.00 55.12  ? 129 LYS D CA  1 
ATOM   795  C C   . LYS A 1 108 ? 3.673  22.024 4.567   1.00 60.19  ? 129 LYS D C   1 
ATOM   796  O O   . LYS A 1 108 ? 4.706  22.644 4.399   1.00 56.62  ? 129 LYS D O   1 
ATOM   797  C CB  . LYS A 1 108 ? 2.185  23.066 2.987   1.00 54.19  ? 129 LYS D CB  1 
ATOM   798  C CG  . LYS A 1 108 ? 1.944  21.887 2.053   1.00 59.09  ? 129 LYS D CG  1 
ATOM   799  C CD  . LYS A 1 108 ? 0.536  21.365 2.184   1.00 63.74  ? 129 LYS D CD  1 
ATOM   800  C CE  . LYS A 1 108 ? 0.167  20.535 0.966   1.00 75.53  ? 129 LYS D CE  1 
ATOM   801  N NZ  . LYS A 1 108 ? -0.902 19.596 1.381   1.00 81.09  ? 129 LYS D NZ  1 
ATOM   802  N N   . ASP A 1 109 ? 3.606  20.711 4.784   1.00 64.49  ? 130 ASP D N   1 
ATOM   803  C CA  . ASP A 1 109 ? 4.778  19.824 4.723   1.00 60.66  ? 130 ASP D CA  1 
ATOM   804  C C   . ASP A 1 109 ? 4.615  18.724 3.689   1.00 57.17  ? 130 ASP D C   1 
ATOM   805  O O   . ASP A 1 109 ? 3.495  18.370 3.322   1.00 55.09  ? 130 ASP D O   1 
ATOM   806  C CB  . ASP A 1 109 ? 5.104  19.197 6.109   1.00 63.10  ? 130 ASP D CB  1 
ATOM   807  C CG  . ASP A 1 109 ? 3.937  18.406 6.714   1.00 65.72  ? 130 ASP D CG  1 
ATOM   808  O OD1 . ASP A 1 109 ? 3.072  17.857 5.986   1.00 66.70  ? 130 ASP D OD1 1 
ATOM   809  O OD2 . ASP A 1 109 ? 3.896  18.317 7.957   1.00 77.32  ? 130 ASP D OD2 1 
ATOM   810  N N   . TRP A 1 110 ? 5.754  18.235 3.199   1.00 52.96  ? 131 TRP D N   1 
ATOM   811  C CA  . TRP A 1 110 ? 5.840  17.106 2.301   1.00 50.16  ? 131 TRP D CA  1 
ATOM   812  C C   . TRP A 1 110 ? 7.032  16.265 2.800   1.00 55.18  ? 131 TRP D C   1 
ATOM   813  O O   . TRP A 1 110 ? 8.049  16.815 3.233   1.00 44.63  ? 131 TRP D O   1 
ATOM   814  C CB  . TRP A 1 110 ? 6.115  17.554 0.866   1.00 46.20  ? 131 TRP D CB  1 
ATOM   815  C CG  . TRP A 1 110 ? 4.896  18.210 0.191   1.00 59.53  ? 131 TRP D CG  1 
ATOM   816  C CD1 . TRP A 1 110 ? 4.688  19.537 -0.001  1.00 63.28  ? 131 TRP D CD1 1 
ATOM   817  C CD2 . TRP A 1 110 ? 3.737  17.547 -0.327  1.00 65.29  ? 131 TRP D CD2 1 
ATOM   818  N NE1 . TRP A 1 110 ? 3.486  19.749 -0.608  1.00 69.19  ? 131 TRP D NE1 1 
ATOM   819  C CE2 . TRP A 1 110 ? 2.877  18.546 -0.826  1.00 71.99  ? 131 TRP D CE2 1 
ATOM   820  C CE3 . TRP A 1 110 ? 3.340  16.200 -0.416  1.00 71.51  ? 131 TRP D CE3 1 
ATOM   821  C CZ2 . TRP A 1 110 ? 1.639  18.251 -1.406  1.00 64.15  ? 131 TRP D CZ2 1 
ATOM   822  C CZ3 . TRP A 1 110 ? 2.108  15.900 -0.990  1.00 70.00  ? 131 TRP D CZ3 1 
ATOM   823  C CH2 . TRP A 1 110 ? 1.273  16.924 -1.476  1.00 75.77  ? 131 TRP D CH2 1 
ATOM   824  N N   . GLY A 1 111 ? 6.901  14.948 2.728   1.00 46.73  ? 132 GLY D N   1 
ATOM   825  C CA  . GLY A 1 111 ? 8.034  14.076 2.922   1.00 47.21  ? 132 GLY D CA  1 
ATOM   826  C C   . GLY A 1 111 ? 7.673  12.618 2.898   1.00 45.94  ? 132 GLY D C   1 
ATOM   827  O O   . GLY A 1 111 ? 6.730  12.213 2.190   1.00 47.12  ? 132 GLY D O   1 
ATOM   828  N N   . PHE A 1 112 ? 8.371  11.822 3.703   1.00 42.49  ? 133 PHE D N   1 
ATOM   829  C CA  . PHE A 1 112 ? 8.193  10.380 3.691   1.00 42.68  ? 133 PHE D CA  1 
ATOM   830  C C   . PHE A 1 112 ? 7.602  9.840  4.964   1.00 43.09  ? 133 PHE D C   1 
ATOM   831  O O   . PHE A 1 112 ? 8.214  9.887  6.039   1.00 42.23  ? 133 PHE D O   1 
ATOM   832  C CB  . PHE A 1 112 ? 9.520  9.777  3.407   1.00 43.22  ? 133 PHE D CB  1 
ATOM   833  C CG  . PHE A 1 112 ? 10.223 10.361 2.207   1.00 46.11  ? 133 PHE D CG  1 
ATOM   834  C CD1 . PHE A 1 112 ? 9.973  9.885  0.907   1.00 49.99  ? 133 PHE D CD1 1 
ATOM   835  C CD2 . PHE A 1 112 ? 11.200 11.309 2.350   1.00 44.60  ? 133 PHE D CD2 1 
ATOM   836  C CE1 . PHE A 1 112 ? 10.682 10.379 -0.188  1.00 45.58  ? 133 PHE D CE1 1 
ATOM   837  C CE2 . PHE A 1 112 ? 11.915 11.778 1.269   1.00 42.66  ? 133 PHE D CE2 1 
ATOM   838  C CZ  . PHE A 1 112 ? 11.655 11.331 0.003   1.00 44.09  ? 133 PHE D CZ  1 
ATOM   839  N N   . LYS A 1 113 ? 6.371  9.336  4.897   1.00 44.78  ? 134 LYS D N   1 
ATOM   840  C CA  . LYS A 1 113 ? 5.755  8.738  6.058   1.00 45.87  ? 134 LYS D CA  1 
ATOM   841  C C   . LYS A 1 113 ? 6.588  7.502  6.548   1.00 51.09  ? 134 LYS D C   1 
ATOM   842  O O   . LYS A 1 113 ? 6.586  7.197  7.731   1.00 47.34  ? 134 LYS D O   1 
ATOM   843  C CB  . LYS A 1 113 ? 4.306  8.389  5.782   1.00 55.84  ? 134 LYS D CB  1 
ATOM   844  C CG  . LYS A 1 113 ? 3.388  8.431  6.998   1.00 66.59  ? 134 LYS D CG  1 
ATOM   845  C CD  . LYS A 1 113 ? 1.943  8.100  6.637   1.00 68.61  ? 134 LYS D CD  1 
ATOM   846  N N   . LYS A 1 114 ? 7.334  6.866  5.647   1.00 45.52  ? 135 LYS D N   1 
ATOM   847  C CA  . LYS A 1 114 ? 8.125  5.700  5.953   1.00 45.48  ? 135 LYS D CA  1 
ATOM   848  C C   . LYS A 1 114 ? 9.495  5.915  5.492   1.00 49.66  ? 135 LYS D C   1 
ATOM   849  O O   . LYS A 1 114 ? 9.965  5.223  4.579   1.00 50.25  ? 135 LYS D O   1 
ATOM   850  C CB  . LYS A 1 114 ? 7.596  4.510  5.200   1.00 51.69  ? 135 LYS D CB  1 
ATOM   851  C CG  . LYS A 1 114 ? 6.201  4.062  5.605   1.00 56.19  ? 135 LYS D CG  1 
ATOM   852  C CD  . LYS A 1 114 ? 5.981  2.730  4.884   1.00 67.72  ? 135 LYS D CD  1 
ATOM   853  C CE  . LYS A 1 114 ? 4.716  2.052  5.311   1.00 72.81  ? 135 LYS D CE  1 
ATOM   854  N NZ  . LYS A 1 114 ? 4.373  0.970  4.344   1.00 84.71  ? 135 LYS D NZ  1 
ATOM   855  N N   . PHE A 1 115 ? 10.160 6.876  6.123   1.00 43.62  ? 136 PHE D N   1 
ATOM   856  C CA  . PHE A 1 115 ? 11.463 7.248  5.692   1.00 42.99  ? 136 PHE D CA  1 
ATOM   857  C C   . PHE A 1 115 ? 12.466 6.148  5.955   1.00 41.75  ? 136 PHE D C   1 
ATOM   858  O O   . PHE A 1 115 ? 13.281 5.877  5.115   1.00 49.54  ? 136 PHE D O   1 
ATOM   859  C CB  . PHE A 1 115 ? 11.932 8.558  6.350   1.00 40.83  ? 136 PHE D CB  1 
ATOM   860  C CG  . PHE A 1 115 ? 13.336 8.911  5.972   1.00 41.02  ? 136 PHE D CG  1 
ATOM   861  C CD1 . PHE A 1 115 ? 13.610 9.292  4.693   1.00 40.06  ? 136 PHE D CD1 1 
ATOM   862  C CD2 . PHE A 1 115 ? 14.356 8.847  6.887   1.00 45.99  ? 136 PHE D CD2 1 
ATOM   863  C CE1 . PHE A 1 115 ? 14.878 9.564  4.302   1.00 42.14  ? 136 PHE D CE1 1 
ATOM   864  C CE2 . PHE A 1 115 ? 15.642 9.182  6.521   1.00 42.96  ? 136 PHE D CE2 1 
ATOM   865  C CZ  . PHE A 1 115 ? 15.888 9.521  5.210   1.00 41.48  ? 136 PHE D CZ  1 
ATOM   866  N N   . ILE A 1 116 ? 12.430 5.537  7.135   1.00 46.85  ? 137 ILE D N   1 
ATOM   867  C CA  . ILE A 1 116 ? 13.342 4.401  7.471   1.00 44.99  ? 137 ILE D CA  1 
ATOM   868  C C   . ILE A 1 116 ? 12.802 3.538  8.593   1.00 49.14  ? 137 ILE D C   1 
ATOM   869  O O   . ILE A 1 116 ? 12.197 4.068  9.545   1.00 45.25  ? 137 ILE D O   1 
ATOM   870  C CB  . ILE A 1 116 ? 14.753 4.876  7.863   1.00 51.98  ? 137 ILE D CB  1 
ATOM   871  C CG1 . ILE A 1 116 ? 15.714 3.675  7.886   1.00 55.75  ? 137 ILE D CG1 1 
ATOM   872  C CG2 . ILE A 1 116 ? 14.770 5.614  9.188   1.00 51.05  ? 137 ILE D CG2 1 
ATOM   873  C CD1 . ILE A 1 116 ? 17.060 3.958  7.285   1.00 62.32  ? 137 ILE D CD1 1 
ATOM   874  N N   . ARG A 1 117 ? 12.977 2.211  8.473   1.00 52.60  ? 138 ARG D N   1 
ATOM   875  C CA  . ARG A 1 117 ? 12.511 1.236  9.507   1.00 56.80  ? 138 ARG D CA  1 
ATOM   876  C C   . ARG A 1 117 ? 13.291 1.495  10.787  1.00 53.27  ? 138 ARG D C   1 
ATOM   877  O O   . ARG A 1 117 ? 14.532 1.638  10.759  1.00 46.51  ? 138 ARG D O   1 
ATOM   878  C CB  . ARG A 1 117 ? 12.766 -0.228 9.093   1.00 63.97  ? 138 ARG D CB  1 
ATOM   879  C CG  . ARG A 1 117 ? 11.788 -0.866 8.121   1.00 67.50  ? 138 ARG D CG  1 
ATOM   880  C CD  . ARG A 1 117 ? 11.933 -2.416 8.127   1.00 73.57  ? 138 ARG D CD  1 
ATOM   881  N NE  . ARG A 1 117 ? 11.059 -3.001 9.147   1.00 77.91  ? 138 ARG D NE  1 
ATOM   882  C CZ  . ARG A 1 117 ? 9.740  -3.236 9.013   1.00 91.15  ? 138 ARG D CZ  1 
ATOM   883  N NH1 . ARG A 1 117 ? 9.084  -3.005 7.869   1.00 84.83  ? 138 ARG D NH1 1 
ATOM   884  N NH2 . ARG A 1 117 ? 9.050  -3.734 10.044  1.00 97.61  ? 138 ARG D NH2 1 
ATOM   885  N N   . ARG A 1 118 ? 12.576 1.541  11.905  1.00 52.47  ? 139 ARG D N   1 
ATOM   886  C CA  . ARG A 1 118 ? 13.245 1.735  13.221  1.00 60.19  ? 139 ARG D CA  1 
ATOM   887  C C   . ARG A 1 118 ? 14.266 0.651  13.559  1.00 61.04  ? 139 ARG D C   1 
ATOM   888  O O   . ARG A 1 118 ? 15.386 0.961  14.026  1.00 54.98  ? 139 ARG D O   1 
ATOM   889  C CB  . ARG A 1 118 ? 12.206 1.806  14.326  1.00 58.61  ? 139 ARG D CB  1 
ATOM   890  C CG  . ARG A 1 118 ? 11.309 3.035  14.229  1.00 62.31  ? 139 ARG D CG  1 
ATOM   891  C CD  . ARG A 1 118 ? 10.299 3.091  15.369  1.00 70.08  ? 139 ARG D CD  1 
ATOM   892  N NE  . ARG A 1 118 ? 10.946 3.008  16.692  1.00 65.32  ? 139 ARG D NE  1 
ATOM   893  C CZ  . ARG A 1 118 ? 11.578 3.996  17.328  1.00 63.64  ? 139 ARG D CZ  1 
ATOM   894  N NH1 . ARG A 1 118 ? 11.651 5.241  16.841  1.00 62.76  ? 139 ARG D NH1 1 
ATOM   895  N NH2 . ARG A 1 118 ? 12.128 3.745  18.502  1.00 63.99  ? 139 ARG D NH2 1 
ATOM   896  N N   . ASP A 1 119 ? 13.903 -0.608 13.278  1.00 55.94  ? 140 ASP D N   1 
ATOM   897  C CA  . ASP A 1 119 ? 14.805 -1.720 13.530  1.00 65.02  ? 140 ASP D CA  1 
ATOM   898  C C   . ASP A 1 119 ? 16.102 -1.564 12.736  1.00 65.14  ? 140 ASP D C   1 
ATOM   899  O O   . ASP A 1 119 ? 17.165 -1.832 13.257  1.00 68.67  ? 140 ASP D O   1 
ATOM   900  C CB  . ASP A 1 119 ? 14.108 -3.106 13.344  1.00 73.05  ? 140 ASP D CB  1 
ATOM   901  C CG  . ASP A 1 119 ? 13.810 -3.481 11.876  1.00 74.82  ? 140 ASP D CG  1 
ATOM   902  O OD1 . ASP A 1 119 ? 14.709 -3.413 10.992  1.00 90.18  ? 140 ASP D OD1 1 
ATOM   903  O OD2 . ASP A 1 119 ? 12.649 -3.898 11.606  1.00 86.81  ? 140 ASP D OD2 1 
ATOM   904  N N   . PHE A 1 120 ? 16.034 -1.078 11.497  1.00 61.21  ? 141 PHE D N   1 
ATOM   905  C CA  . PHE A 1 120 ? 17.272 -0.841 10.736  1.00 58.63  ? 141 PHE D CA  1 
ATOM   906  C C   . PHE A 1 120 ? 18.097 0.154  11.511  1.00 62.96  ? 141 PHE D C   1 
ATOM   907  O O   . PHE A 1 120 ? 19.284 -0.032 11.720  1.00 63.53  ? 141 PHE D O   1 
ATOM   908  C CB  . PHE A 1 120 ? 17.007 -0.297 9.317   1.00 61.21  ? 141 PHE D CB  1 
ATOM   909  C CG  . PHE A 1 120 ? 18.242 -0.294 8.458   1.00 69.15  ? 141 PHE D CG  1 
ATOM   910  C CD1 . PHE A 1 120 ? 18.594 -1.428 7.725   1.00 69.73  ? 141 PHE D CD1 1 
ATOM   911  C CD2 . PHE A 1 120 ? 19.103 0.793  8.460   1.00 67.88  ? 141 PHE D CD2 1 
ATOM   912  C CE1 . PHE A 1 120 ? 19.773 -1.454 6.989   1.00 74.51  ? 141 PHE D CE1 1 
ATOM   913  C CE2 . PHE A 1 120 ? 20.277 0.778  7.721   1.00 75.70  ? 141 PHE D CE2 1 
ATOM   914  C CZ  . PHE A 1 120 ? 20.607 -0.349 6.973   1.00 77.82  ? 141 PHE D CZ  1 
ATOM   915  N N   . LEU A 1 121 ? 17.425 1.220  11.944  1.00 61.86  ? 142 LEU D N   1 
ATOM   916  C CA  . LEU A 1 121 ? 18.079 2.380  12.554  1.00 61.64  ? 142 LEU D CA  1 
ATOM   917  C C   . LEU A 1 121 ? 18.720 2.022  13.920  1.00 66.85  ? 142 LEU D C   1 
ATOM   918  O O   . LEU A 1 121 ? 19.902 2.336  14.200  1.00 58.96  ? 142 LEU D O   1 
ATOM   919  C CB  . LEU A 1 121 ? 17.003 3.459  12.688  1.00 61.79  ? 142 LEU D CB  1 
ATOM   920  C CG  . LEU A 1 121 ? 17.352 4.900  12.897  1.00 59.66  ? 142 LEU D CG  1 
ATOM   921  C CD1 . LEU A 1 121 ? 18.072 5.442  11.700  1.00 55.37  ? 142 LEU D CD1 1 
ATOM   922  C CD2 . LEU A 1 121 ? 16.062 5.652  13.135  1.00 61.17  ? 142 LEU D CD2 1 
ATOM   923  N N   . LEU A 1 122 ? 17.934 1.303  14.724  1.00 70.36  ? 143 LEU D N   1 
ATOM   924  C CA  . LEU A 1 122 ? 18.362 0.798  16.035  1.00 68.85  ? 143 LEU D CA  1 
ATOM   925  C C   . LEU A 1 122 ? 19.398 -0.326 16.004  1.00 76.50  ? 143 LEU D C   1 
ATOM   926  O O   . LEU A 1 122 ? 20.206 -0.427 16.924  1.00 81.81  ? 143 LEU D O   1 
ATOM   927  C CB  . LEU A 1 122 ? 17.148 0.353  16.850  1.00 60.67  ? 143 LEU D CB  1 
ATOM   928  C CG  . LEU A 1 122 ? 16.167 1.503  17.098  1.00 60.37  ? 143 LEU D CG  1 
ATOM   929  C CD1 . LEU A 1 122 ? 14.815 1.036  17.644  1.00 64.37  ? 143 LEU D CD1 1 
ATOM   930  C CD2 . LEU A 1 122 ? 16.782 2.575  17.984  1.00 66.32  ? 143 LEU D CD2 1 
ATOM   931  N N   . ASP A 1 123 ? 19.401 -1.179 14.987  1.00 75.96  ? 144 ASP D N   1 
ATOM   932  C CA  . ASP A 1 123 ? 20.479 -2.137 14.883  1.00 72.86  ? 144 ASP D CA  1 
ATOM   933  C C   . ASP A 1 123 ? 21.822 -1.390 14.724  1.00 78.92  ? 144 ASP D C   1 
ATOM   934  O O   . ASP A 1 123 ? 22.173 -0.893 13.638  1.00 81.53  ? 144 ASP D O   1 
ATOM   935  C CB  . ASP A 1 123 ? 20.245 -3.156 13.759  1.00 81.20  ? 144 ASP D CB  1 
ATOM   936  C CG  . ASP A 1 123 ? 21.462 -4.084 13.519  1.00 76.95  ? 144 ASP D CG  1 
ATOM   937  O OD1 . ASP A 1 123 ? 22.554 -3.844 14.087  1.00 73.74  ? 144 ASP D OD1 1 
ATOM   938  O OD2 . ASP A 1 123 ? 21.323 -5.053 12.744  1.00 87.25  ? 144 ASP D OD2 1 
ATOM   939  N N   . GLU A 1 124 ? 22.560 -1.376 15.833  1.00 78.12  ? 145 GLU D N   1 
ATOM   940  C CA  . GLU A 1 124 ? 23.939 -0.860 15.970  1.00 85.15  ? 145 GLU D CA  1 
ATOM   941  C C   . GLU A 1 124 ? 24.968 -1.264 14.936  1.00 81.74  ? 145 GLU D C   1 
ATOM   942  O O   . GLU A 1 124 ? 25.981 -0.591 14.809  1.00 80.00  ? 145 GLU D O   1 
ATOM   943  C CB  . GLU A 1 124 ? 24.525 -1.312 17.316  1.00 96.80  ? 145 GLU D CB  1 
ATOM   944  C CG  . GLU A 1 124 ? 24.506 -0.304 18.447  1.00 98.53  ? 145 GLU D CG  1 
ATOM   945  C CD  . GLU A 1 124 ? 25.434 -0.748 19.584  1.00 104.67 ? 145 GLU D CD  1 
ATOM   946  O OE1 . GLU A 1 124 ? 25.266 -1.882 20.093  1.00 97.05  ? 145 GLU D OE1 1 
ATOM   947  O OE2 . GLU A 1 124 ? 26.353 0.017  19.965  1.00 97.71  ? 145 GLU D OE2 1 
ATOM   948  N N   . ALA A 1 125 ? 24.774 -2.393 14.259  1.00 80.98  ? 146 ALA D N   1 
ATOM   949  C CA  . ALA A 1 125 ? 25.667 -2.787 13.151  1.00 81.35  ? 146 ALA D CA  1 
ATOM   950  C C   . ALA A 1 125 ? 25.664 -1.780 12.004  1.00 84.57  ? 146 ALA D C   1 
ATOM   951  O O   . ALA A 1 125 ? 26.672 -1.622 11.301  1.00 73.77  ? 146 ALA D O   1 
ATOM   952  C CB  . ALA A 1 125 ? 25.260 -4.153 12.605  1.00 78.84  ? 146 ALA D CB  1 
ATOM   953  N N   . ASN A 1 126 ? 24.508 -1.137 11.796  1.00 87.51  ? 147 ASN D N   1 
ATOM   954  C CA  . ASN A 1 126 ? 24.335 -0.136 10.738  1.00 76.21  ? 147 ASN D CA  1 
ATOM   955  C C   . ASN A 1 126 ? 24.984 1.243  11.050  1.00 75.35  ? 147 ASN D C   1 
ATOM   956  O O   . ASN A 1 126 ? 25.046 2.105  10.175  1.00 78.14  ? 147 ASN D O   1 
ATOM   957  C CB  . ASN A 1 126 ? 22.849 -0.006 10.424  1.00 73.15  ? 147 ASN D CB  1 
ATOM   958  C CG  . ASN A 1 126 ? 22.246 -1.303 9.910   1.00 71.90  ? 147 ASN D CG  1 
ATOM   959  O OD1 . ASN A 1 126 ? 22.824 -1.939 9.050   1.00 84.20  ? 147 ASN D OD1 1 
ATOM   960  N ND2 . ASN A 1 126 ? 21.070 -1.673 10.399  1.00 66.14  ? 147 ASN D ND2 1 
ATOM   961  N N   . GLY A 1 127 ? 25.472 1.450  12.275  1.00 69.31  ? 148 GLY D N   1 
ATOM   962  C CA  . GLY A 1 127 ? 26.186 2.669  12.635  1.00 69.18  ? 148 GLY D CA  1 
ATOM   963  C C   . GLY A 1 127 ? 25.451 3.997  12.416  1.00 65.00  ? 148 GLY D C   1 
ATOM   964  O O   . GLY A 1 127 ? 26.081 4.991  12.119  1.00 67.51  ? 148 GLY D O   1 
ATOM   965  N N   . LEU A 1 128 ? 24.130 4.015  12.585  1.00 65.50  ? 149 LEU D N   1 
ATOM   966  C CA  . LEU A 1 128 ? 23.331 5.213  12.333  1.00 61.91  ? 149 LEU D CA  1 
ATOM   967  C C   . LEU A 1 128 ? 22.993 6.023  13.575  1.00 67.67  ? 149 LEU D C   1 
ATOM   968  O O   . LEU A 1 128 ? 22.456 7.132  13.435  1.00 59.01  ? 149 LEU D O   1 
ATOM   969  C CB  . LEU A 1 128 ? 22.043 4.853  11.608  1.00 60.30  ? 149 LEU D CB  1 
ATOM   970  C CG  . LEU A 1 128 ? 22.204 4.128  10.270  1.00 63.03  ? 149 LEU D CG  1 
ATOM   971  C CD1 . LEU A 1 128 ? 20.845 3.878  9.666   1.00 60.58  ? 149 LEU D CD1 1 
ATOM   972  C CD2 . LEU A 1 128 ? 23.073 4.875  9.269   1.00 72.61  ? 149 LEU D CD2 1 
ATOM   973  N N   . LEU A 1 129 ? 23.285 5.481  14.766  1.00 61.03  ? 150 LEU D N   1 
ATOM   974  C CA  . LEU A 1 129 ? 23.018 6.162  16.023  1.00 60.01  ? 150 LEU D CA  1 
ATOM   975  C C   . LEU A 1 129 ? 24.226 6.158  16.960  1.00 59.15  ? 150 LEU D C   1 
ATOM   976  O O   . LEU A 1 129 ? 24.135 5.704  18.118  1.00 69.36  ? 150 LEU D O   1 
ATOM   977  C CB  . LEU A 1 129 ? 21.808 5.553  16.735  1.00 58.65  ? 150 LEU D CB  1 
ATOM   978  C CG  . LEU A 1 129 ? 20.491 5.542  15.982  1.00 60.94  ? 150 LEU D CG  1 
ATOM   979  C CD1 . LEU A 1 129 ? 19.499 4.724  16.790  1.00 59.10  ? 150 LEU D CD1 1 
ATOM   980  C CD2 . LEU A 1 129 ? 19.936 6.951  15.733  1.00 56.04  ? 150 LEU D CD2 1 
ATOM   981  N N   . PRO A 1 130 ? 25.345 6.720  16.485  1.00 63.48  ? 151 PRO D N   1 
ATOM   982  C CA  . PRO A 1 130 ? 26.561 6.850  17.283  1.00 61.73  ? 151 PRO D CA  1 
ATOM   983  C C   . PRO A 1 130 ? 26.340 7.733  18.516  1.00 73.60  ? 151 PRO D C   1 
ATOM   984  O O   . PRO A 1 130 ? 25.988 8.932  18.370  1.00 69.96  ? 151 PRO D O   1 
ATOM   985  C CB  . PRO A 1 130 ? 27.542 7.520  16.327  1.00 59.00  ? 151 PRO D CB  1 
ATOM   986  C CG  . PRO A 1 130 ? 26.689 8.214  15.330  1.00 54.53  ? 151 PRO D CG  1 
ATOM   987  C CD  . PRO A 1 130 ? 25.513 7.322  15.146  1.00 59.05  ? 151 PRO D CD  1 
ATOM   988  N N   . ASP A 1 131 ? 26.541 7.133  19.705  1.00 61.44  ? 152 ASP D N   1 
ATOM   989  C CA  . ASP A 1 131 ? 26.213 7.745  20.990  1.00 65.93  ? 152 ASP D CA  1 
ATOM   990  C C   . ASP A 1 131 ? 24.727 8.111  21.058  1.00 59.68  ? 152 ASP D C   1 
ATOM   991  O O   . ASP A 1 131 ? 24.366 9.078  21.702  1.00 65.86  ? 152 ASP D O   1 
ATOM   992  C CB  . ASP A 1 131 ? 27.140 8.930  21.313  1.00 69.36  ? 152 ASP D CB  1 
ATOM   993  C CG  . ASP A 1 131 ? 28.611 8.573  21.128  1.00 84.84  ? 152 ASP D CG  1 
ATOM   994  O OD1 . ASP A 1 131 ? 29.254 8.128  22.112  1.00 102.64 ? 152 ASP D OD1 1 
ATOM   995  O OD2 . ASP A 1 131 ? 29.117 8.670  19.980  1.00 82.29  ? 152 ASP D OD2 1 
ATOM   996  N N   . ASP A 1 132 ? 23.880 7.291  20.412  1.00 61.06  ? 153 ASP D N   1 
ATOM   997  C CA  . ASP A 1 132 ? 22.431 7.529  20.348  1.00 59.83  ? 153 ASP D CA  1 
ATOM   998  C C   . ASP A 1 132 ? 22.073 8.949  19.786  1.00 51.30  ? 153 ASP D C   1 
ATOM   999  O O   . ASP A 1 132 ? 21.115 9.586  20.231  1.00 52.94  ? 153 ASP D O   1 
ATOM   1000 C CB  . ASP A 1 132 ? 21.876 7.344  21.760  1.00 55.43  ? 153 ASP D CB  1 
ATOM   1001 C CG  . ASP A 1 132 ? 20.459 6.879  21.776  1.00 55.79  ? 153 ASP D CG  1 
ATOM   1002 O OD1 . ASP A 1 132 ? 20.094 6.106  20.851  1.00 56.66  ? 153 ASP D OD1 1 
ATOM   1003 O OD2 . ASP A 1 132 ? 19.733 7.294  22.741  1.00 58.75  ? 153 ASP D OD2 1 
ATOM   1004 N N   . LYS A 1 133 ? 22.915 9.441  18.880  1.00 53.39  ? 154 LYS D N   1 
ATOM   1005 C CA  . LYS A 1 133 ? 22.657 10.647 18.107  1.00 53.10  ? 154 LYS D CA  1 
ATOM   1006 C C   . LYS A 1 133 ? 22.196 10.282 16.681  1.00 53.78  ? 154 LYS D C   1 
ATOM   1007 O O   . LYS A 1 133 ? 22.885 9.605  15.943  1.00 51.39  ? 154 LYS D O   1 
ATOM   1008 C CB  . LYS A 1 133 ? 23.899 11.510 18.020  1.00 54.44  ? 154 LYS D CB  1 
ATOM   1009 C CG  . LYS A 1 133 ? 24.389 12.038 19.349  1.00 64.78  ? 154 LYS D CG  1 
ATOM   1010 C CD  . LYS A 1 133 ? 25.829 12.546 19.273  1.00 72.17  ? 154 LYS D CD  1 
ATOM   1011 C CE  . LYS A 1 133 ? 26.126 13.579 20.349  1.00 80.06  ? 154 LYS D CE  1 
ATOM   1012 N NZ  . LYS A 1 133 ? 25.644 14.950 19.939  1.00 82.10  ? 154 LYS D NZ  1 
ATOM   1013 N N   . LEU A 1 134 ? 21.007 10.741 16.302  1.00 47.82  ? 155 LEU D N   1 
ATOM   1014 C CA  . LEU A 1 134 ? 20.560 10.636 14.894  1.00 48.01  ? 155 LEU D CA  1 
ATOM   1015 C C   . LEU A 1 134 ? 20.849 11.998 14.254  1.00 44.36  ? 155 LEU D C   1 
ATOM   1016 O O   . LEU A 1 134 ? 20.386 13.031 14.761  1.00 43.21  ? 155 LEU D O   1 
ATOM   1017 C CB  . LEU A 1 134 ? 19.065 10.331 14.835  1.00 41.74  ? 155 LEU D CB  1 
ATOM   1018 C CG  . LEU A 1 134 ? 18.459 10.355 13.414  1.00 45.20  ? 155 LEU D CG  1 
ATOM   1019 C CD1 . LEU A 1 134 ? 19.049 9.230  12.570  1.00 46.78  ? 155 LEU D CD1 1 
ATOM   1020 C CD2 . LEU A 1 134 ? 16.963 10.252 13.423  1.00 40.19  ? 155 LEU D CD2 1 
ATOM   1021 N N   . THR A 1 135 ? 21.612 11.976 13.174  1.00 42.22  ? 156 THR D N   1 
ATOM   1022 C CA  . THR A 1 135 ? 21.914 13.136 12.368  1.00 44.82  ? 156 THR D CA  1 
ATOM   1023 C C   . THR A 1 135 ? 21.271 13.026 10.993  1.00 47.52  ? 156 THR D C   1 
ATOM   1024 O O   . THR A 1 135 ? 21.522 12.076 10.175  1.00 44.45  ? 156 THR D O   1 
ATOM   1025 C CB  . THR A 1 135 ? 23.415 13.399 12.275  1.00 49.36  ? 156 THR D CB  1 
ATOM   1026 O OG1 . THR A 1 135 ? 23.921 13.593 13.592  1.00 57.21  ? 156 THR D OG1 1 
ATOM   1027 C CG2 . THR A 1 135 ? 23.676 14.678 11.472  1.00 48.64  ? 156 THR D CG2 1 
ATOM   1028 N N   . LEU A 1 136 ? 20.380 13.974 10.746  1.00 46.72  ? 157 LEU D N   1 
ATOM   1029 C CA  . LEU A 1 136 ? 19.688 14.024 9.447   1.00 45.50  ? 157 LEU D CA  1 
ATOM   1030 C C   . LEU A 1 136 ? 20.212 15.213 8.611   1.00 45.28  ? 157 LEU D C   1 
ATOM   1031 O O   . LEU A 1 136 ? 20.429 16.354 9.129   1.00 47.42  ? 157 LEU D O   1 
ATOM   1032 C CB  . LEU A 1 136 ? 18.194 14.105 9.663   1.00 45.51  ? 157 LEU D CB  1 
ATOM   1033 C CG  . LEU A 1 136 ? 17.627 12.913 10.407  1.00 46.41  ? 157 LEU D CG  1 
ATOM   1034 C CD1 . LEU A 1 136 ? 16.151 13.181 10.741  1.00 40.39  ? 157 LEU D CD1 1 
ATOM   1035 C CD2 . LEU A 1 136 ? 17.831 11.604 9.655   1.00 47.00  ? 157 LEU D CD2 1 
ATOM   1036 N N   . PHE A 1 137 ? 20.444 14.939 7.334   1.00 43.73  ? 158 PHE D N   1 
ATOM   1037 C CA  . PHE A 1 137 ? 20.835 15.950 6.351   1.00 50.41  ? 158 PHE D CA  1 
ATOM   1038 C C   . PHE A 1 137 ? 19.698 16.248 5.364   1.00 53.69  ? 158 PHE D C   1 
ATOM   1039 O O   . PHE A 1 137 ? 19.182 15.356 4.686   1.00 49.26  ? 158 PHE D O   1 
ATOM   1040 C CB  . PHE A 1 137 ? 22.104 15.457 5.660   1.00 54.06  ? 158 PHE D CB  1 
ATOM   1041 C CG  . PHE A 1 137 ? 22.792 16.496 4.846   1.00 59.79  ? 158 PHE D CG  1 
ATOM   1042 C CD1 . PHE A 1 137 ? 23.033 17.758 5.356   1.00 63.12  ? 158 PHE D CD1 1 
ATOM   1043 C CD2 . PHE A 1 137 ? 23.218 16.204 3.548   1.00 67.74  ? 158 PHE D CD2 1 
ATOM   1044 C CE1 . PHE A 1 137 ? 23.659 18.732 4.566   1.00 67.51  ? 158 PHE D CE1 1 
ATOM   1045 C CE2 . PHE A 1 137 ? 23.863 17.157 2.761   1.00 64.24  ? 158 PHE D CE2 1 
ATOM   1046 C CZ  . PHE A 1 137 ? 24.079 18.424 3.265   1.00 68.17  ? 158 PHE D CZ  1 
ATOM   1047 N N   . CYS A 1 138 ? 19.232 17.490 5.323   1.00 48.69  ? 159 CYS D N   1 
ATOM   1048 C CA  . CYS A 1 138 ? 18.187 17.846 4.354   1.00 56.62  ? 159 CYS D CA  1 
ATOM   1049 C C   . CYS A 1 138 ? 18.782 18.793 3.332   1.00 52.77  ? 159 CYS D C   1 
ATOM   1050 O O   . CYS A 1 138 ? 19.321 19.786 3.731   1.00 50.47  ? 159 CYS D O   1 
ATOM   1051 C CB  . CYS A 1 138 ? 16.974 18.458 5.049   1.00 53.52  ? 159 CYS D CB  1 
ATOM   1052 S SG  . CYS A 1 138 ? 15.778 19.166 3.863   1.00 54.47  ? 159 CYS D SG  1 
ATOM   1053 N N   . GLU A 1 139 ? 18.675 18.491 2.041   1.00 46.47  ? 160 GLU D N   1 
ATOM   1054 C CA  . GLU A 1 139 ? 19.008 19.468 0.951   1.00 52.75  ? 160 GLU D CA  1 
ATOM   1055 C C   . GLU A 1 139 ? 17.736 19.887 0.235   1.00 54.82  ? 160 GLU D C   1 
ATOM   1056 O O   . GLU A 1 139 ? 16.943 19.048 -0.133  1.00 55.58  ? 160 GLU D O   1 
ATOM   1057 C CB  . GLU A 1 139 ? 19.965 18.927 -0.099  1.00 53.64  ? 160 GLU D CB  1 
ATOM   1058 C CG  . GLU A 1 139 ? 21.402 18.837 0.366   1.00 68.43  ? 160 GLU D CG  1 
ATOM   1059 C CD  . GLU A 1 139 ? 22.232 17.811 -0.410  1.00 79.68  ? 160 GLU D CD  1 
ATOM   1060 O OE1 . GLU A 1 139 ? 21.937 16.594 -0.284  1.00 85.85  ? 160 GLU D OE1 1 
ATOM   1061 O OE2 . GLU A 1 139 ? 23.204 18.208 -1.100  1.00 79.93  ? 160 GLU D OE2 1 
ATOM   1062 N N   . VAL A 1 140 ? 17.564 21.182 0.038   1.00 56.05  ? 161 VAL D N   1 
ATOM   1063 C CA  . VAL A 1 140 ? 16.311 21.764 -0.487  1.00 52.81  ? 161 VAL D CA  1 
ATOM   1064 C C   . VAL A 1 140 ? 16.718 22.544 -1.752  1.00 57.66  ? 161 VAL D C   1 
ATOM   1065 O O   . VAL A 1 140 ? 17.851 23.117 -1.833  1.00 57.20  ? 161 VAL D O   1 
ATOM   1066 C CB  . VAL A 1 140 ? 15.666 22.682 0.543   1.00 53.96  ? 161 VAL D CB  1 
ATOM   1067 C CG1 . VAL A 1 140 ? 14.334 23.273 0.036   1.00 54.18  ? 161 VAL D CG1 1 
ATOM   1068 C CG2 . VAL A 1 140 ? 15.438 21.919 1.827   1.00 52.70  ? 161 VAL D CG2 1 
ATOM   1069 N N   . SER A 1 141 ? 15.845 22.493 -2.761  1.00 54.78  ? 162 SER D N   1 
ATOM   1070 C CA  . SER A 1 141 ? 16.083 23.185 -4.045  1.00 59.24  ? 162 SER D CA  1 
ATOM   1071 C C   . SER A 1 141 ? 14.824 23.894 -4.502  1.00 58.80  ? 162 SER D C   1 
ATOM   1072 O O   . SER A 1 141 ? 13.775 23.230 -4.863  1.00 55.90  ? 162 SER D O   1 
ATOM   1073 C CB  . SER A 1 141 ? 16.546 22.206 -5.090  1.00 61.19  ? 162 SER D CB  1 
ATOM   1074 O OG  . SER A 1 141 ? 17.243 22.945 -6.068  1.00 83.66  ? 162 SER D OG  1 
ATOM   1075 N N   . VAL A 1 142 ? 14.878 25.226 -4.375  1.00 65.58  ? 163 VAL D N   1 
ATOM   1076 C CA  . VAL A 1 142 ? 13.744 26.088 -4.637  1.00 69.39  ? 163 VAL D CA  1 
ATOM   1077 C C   . VAL A 1 142 ? 13.993 26.689 -6.009  1.00 77.08  ? 163 VAL D C   1 
ATOM   1078 O O   . VAL A 1 142 ? 15.091 27.200 -6.277  1.00 75.08  ? 163 VAL D O   1 
ATOM   1079 C CB  . VAL A 1 142 ? 13.610 27.204 -3.591  1.00 74.13  ? 163 VAL D CB  1 
ATOM   1080 C CG1 . VAL A 1 142 ? 12.381 28.066 -3.856  1.00 69.52  ? 163 VAL D CG1 1 
ATOM   1081 C CG2 . VAL A 1 142 ? 13.529 26.613 -2.191  1.00 75.00  ? 163 VAL D CG2 1 
ATOM   1082 N N   . VAL A 1 143 ? 12.958 26.642 -6.852  1.00 82.19  ? 164 VAL D N   1 
ATOM   1083 C CA  . VAL A 1 143 ? 13.037 27.120 -8.246  1.00 90.49  ? 164 VAL D CA  1 
ATOM   1084 C C   . VAL A 1 143 ? 13.333 28.631 -8.362  1.00 75.64  ? 164 VAL D C   1 
ATOM   1085 O O   . VAL A 1 143 ? 12.821 29.431 -7.584  1.00 71.47  ? 164 VAL D O   1 
ATOM   1086 C CB  . VAL A 1 143 ? 11.769 26.716 -9.077  1.00 90.56  ? 164 VAL D CB  1 
ATOM   1087 C CG1 . VAL A 1 143 ? 11.608 25.186 -9.100  1.00 88.12  ? 164 VAL D CG1 1 
ATOM   1088 C CG2 . VAL A 1 143 ? 10.483 27.398 -8.592  1.00 83.78  ? 164 VAL D CG2 1 
ATOM   1089 N N   . PRO B 2 1   ? 10.271 -3.313 3.209   1.00 51.62  ? 223 PRO G N   1 
ATOM   1090 C CA  . PRO B 2 1   ? 10.955 -2.162 2.595   1.00 50.34  ? 223 PRO G CA  1 
ATOM   1091 C C   . PRO B 2 1   ? 11.623 -1.421 3.705   1.00 56.78  ? 223 PRO G C   1 
ATOM   1092 O O   . PRO B 2 1   ? 10.979 -1.018 4.642   1.00 56.93  ? 223 PRO G O   1 
ATOM   1093 C CB  . PRO B 2 1   ? 9.829  -1.311 1.998   1.00 54.70  ? 223 PRO G CB  1 
ATOM   1094 C CG  . PRO B 2 1   ? 8.540  -1.866 2.480   1.00 56.91  ? 223 PRO G CG  1 
ATOM   1095 C CD  . PRO B 2 1   ? 8.791  -3.169 3.190   1.00 56.64  ? 223 PRO G CD  1 
ATOM   1096 N N   . GLU B 2 2   ? 12.923 -1.345 3.625   1.00 51.59  ? 224 GLU G N   1 
ATOM   1097 C CA  . GLU B 2 2   ? 13.735 -0.668 4.541   1.00 53.16  ? 224 GLU G CA  1 
ATOM   1098 C C   . GLU B 2 2   ? 13.454 0.906  4.457   1.00 63.12  ? 224 GLU G C   1 
ATOM   1099 O O   . GLU B 2 2   ? 13.421 1.572  5.482   1.00 56.68  ? 224 GLU G O   1 
ATOM   1100 C CB  . GLU B 2 2   ? 15.129 -1.073 4.130   1.00 54.84  ? 224 GLU G CB  1 
ATOM   1101 C CG  . GLU B 2 2   ? 16.328 -0.647 4.944   1.00 63.00  ? 224 GLU G CG  1 
ATOM   1102 C CD  . GLU B 2 2   ? 17.579 -1.061 4.192   1.00 73.41  ? 224 GLU G CD  1 
ATOM   1103 O OE1 . GLU B 2 2   ? 18.137 -2.158 4.463   1.00 80.29  ? 224 GLU G OE1 1 
ATOM   1104 O OE2 . GLU B 2 2   ? 17.969 -0.316 3.253   1.00 84.02  ? 224 GLU G OE2 1 
ATOM   1105 N N   . GLN B 2 3   ? 13.221 1.452  3.250   1.00 54.21  ? 225 GLN G N   1 
ATOM   1106 C CA  . GLN B 2 3   ? 12.657 2.798  3.060   1.00 56.08  ? 225 GLN G CA  1 
ATOM   1107 C C   . GLN B 2 3   ? 11.581 2.804  1.983   1.00 58.57  ? 225 GLN G C   1 
ATOM   1108 O O   . GLN B 2 3   ? 11.635 2.021  1.019   1.00 63.89  ? 225 GLN G O   1 
ATOM   1109 C CB  . GLN B 2 3   ? 13.765 3.757  2.644   1.00 54.25  ? 225 GLN G CB  1 
ATOM   1110 C CG  . GLN B 2 3   ? 15.018 3.685  3.490   1.00 48.79  ? 225 GLN G CG  1 
ATOM   1111 C CD  . GLN B 2 3   ? 15.996 4.716  3.112   1.00 52.48  ? 225 GLN G CD  1 
ATOM   1112 O OE1 . GLN B 2 3   ? 16.926 4.444  2.395   1.00 57.97  ? 225 GLN G OE1 1 
ATOM   1113 N NE2 . GLN B 2 3   ? 15.806 5.943  3.604   1.00 60.35  ? 225 GLN G NE2 1 
ATOM   1114 N N   . ASP B 2 4   ? 10.591 3.675  2.133   1.00 52.04  ? 226 ASP G N   1 
ATOM   1115 C CA  . ASP B 2 4   ? 9.522  3.834  1.140   1.00 55.01  ? 226 ASP G CA  1 
ATOM   1116 C C   . ASP B 2 4   ? 9.476  5.281  0.610   1.00 54.81  ? 226 ASP G C   1 
ATOM   1117 O O   . ASP B 2 4   ? 9.205  6.204  1.371   1.00 53.75  ? 226 ASP G O   1 
ATOM   1118 C CB  . ASP B 2 4   ? 8.184  3.451  1.749   1.00 52.91  ? 226 ASP G CB  1 
ATOM   1119 C CG  . ASP B 2 4   ? 7.036  3.478  0.752   1.00 60.97  ? 226 ASP G CG  1 
ATOM   1120 O OD1 . ASP B 2 4   ? 7.231  4.024  -0.347  1.00 66.01  ? 226 ASP G OD1 1 
ATOM   1121 O OD2 . ASP B 2 4   ? 5.899  3.015  1.096   1.00 68.86  ? 226 ASP G OD2 1 
ATOM   1122 N N   . CYS B 2 5   ? 9.701  5.434  -0.702  1.00 56.85  ? 227 CYS G N   1 
ATOM   1123 C CA  . CYS B 2 5   ? 9.871  6.749  -1.370  1.00 50.88  ? 227 CYS G CA  1 
ATOM   1124 C C   . CYS B 2 5   ? 8.591  7.476  -1.750  1.00 48.60  ? 227 CYS G C   1 
ATOM   1125 O O   . CYS B 2 5   ? 8.657  8.527  -2.309  1.00 49.37  ? 227 CYS G O   1 
ATOM   1126 C CB  . CYS B 2 5   ? 10.850 6.708  -2.532  1.00 55.31  ? 227 CYS G CB  1 
ATOM   1127 S SG  . CYS B 2 5   ? 10.240 5.799  -3.991  1.00 56.78  ? 227 CYS G SG  1 
ATOM   1128 N N   . ALA B 2 6   ? 7.440  6.963  -1.362  1.00 44.10  ? 228 ALA G N   1 
ATOM   1129 C CA  . ALA B 2 6   ? 6.198  7.678  -1.513  1.00 54.84  ? 228 ALA G CA  1 
ATOM   1130 C C   . ALA B 2 6   ? 6.176  8.982  -0.687  1.00 53.94  ? 228 ALA G C   1 
ATOM   1131 O O   . ALA B 2 6   ? 6.262  8.943  0.572   1.00 45.42  ? 228 ALA G O   1 
ATOM   1132 C CB  . ALA B 2 6   ? 5.019  6.805  -1.078  1.00 49.98  ? 228 ALA G CB  1 
ATOM   1133 N N   . VAL B 2 7   ? 5.997  10.097 -1.405  1.00 48.14  ? 229 VAL G N   1 
ATOM   1134 C CA  . VAL B 2 7   ? 5.937  11.435 -0.816  1.00 48.46  ? 229 VAL G CA  1 
ATOM   1135 C C   . VAL B 2 7   ? 4.510  11.735 -0.494  1.00 50.11  ? 229 VAL G C   1 
ATOM   1136 O O   . VAL B 2 7   ? 3.666  11.644 -1.368  1.00 59.89  ? 229 VAL G O   1 
ATOM   1137 C CB  . VAL B 2 7   ? 6.500  12.489 -1.754  1.00 49.16  ? 229 VAL G CB  1 
ATOM   1138 C CG1 . VAL B 2 7   ? 6.271  13.928 -1.229  1.00 53.04  ? 229 VAL G CG1 1 
ATOM   1139 C CG2 . VAL B 2 7   ? 7.955  12.206 -2.014  1.00 48.48  ? 229 VAL G CG2 1 
ATOM   1140 N N   . THR B 2 8   ? 4.240  12.072 0.765   1.00 52.61  ? 230 THR G N   1 
ATOM   1141 C CA  . THR B 2 8   ? 2.923  12.480 1.228   1.00 51.00  ? 230 THR G CA  1 
ATOM   1142 C C   . THR B 2 8   ? 3.048  13.795 1.995   1.00 54.57  ? 230 THR G C   1 
ATOM   1143 O O   . THR B 2 8   ? 4.145  14.231 2.304   1.00 59.85  ? 230 THR G O   1 
ATOM   1144 C CB  . THR B 2 8   ? 2.223  11.383 2.087   1.00 56.22  ? 230 THR G CB  1 
ATOM   1145 O OG1 . THR B 2 8   ? 2.986  11.020 3.256   1.00 52.05  ? 230 THR G OG1 1 
ATOM   1146 C CG2 . THR B 2 8   ? 1.955  10.097 1.225   1.00 63.56  ? 230 THR G CG2 1 
ATOM   1147 N N   . SER B 2 9   ? 1.908  14.386 2.287   1.00 53.01  ? 231 SER G N   1 
ATOM   1148 C CA  . SER B 2 9   ? 1.748  15.540 3.168   1.00 61.13  ? 231 SER G CA  1 
ATOM   1149 C C   . SER B 2 9   ? 1.146  15.143 4.501   1.00 67.46  ? 231 SER G C   1 
ATOM   1150 O O   . SER B 2 9   ? 0.435  14.146 4.582   1.00 80.83  ? 231 SER G O   1 
ATOM   1151 C CB  . SER B 2 9   ? 0.843  16.583 2.521   1.00 62.90  ? 231 SER G CB  1 
ATOM   1152 O OG  . SER B 2 9   ? 0.996  17.812 3.203   1.00 64.53  ? 231 SER G OG  1 
ATOM   1153 N N   . GLY B 2 10  ? 1.422  15.940 5.539   1.00 71.11  ? 232 GLY G N   1 
ATOM   1154 C CA  . GLY B 2 10  ? 1.148  15.556 6.935   1.00 73.67  ? 232 GLY G CA  1 
ATOM   1155 C C   . GLY B 2 10  ? -0.296 15.471 7.365   1.00 68.67  ? 232 GLY G C   1 
ATOM   1156 O O   . GLY B 2 10  ? -1.090 16.335 7.022   1.00 84.70  ? 232 GLY G O   1 
HETATM 1157 O O   . HOH C 3 .   ? 7.355  12.039 -5.432  1.00 62.31  ? 201 HOH D O   1 
HETATM 1158 O O   . HOH C 3 .   ? 11.752 -1.283 12.478  1.00 58.08  ? 202 HOH D O   1 
HETATM 1159 O O   . HOH C 3 .   ? 22.798 9.336  12.459  1.00 51.68  ? 203 HOH D O   1 
HETATM 1160 O O   . HOH C 3 .   ? 16.951 21.736 14.880  1.00 59.42  ? 204 HOH D O   1 
HETATM 1161 O O   . HOH C 3 .   ? 22.014 1.826  13.023  1.00 67.09  ? 205 HOH D O   1 
HETATM 1162 O O   . HOH C 3 .   ? 5.102  -0.165 10.110  1.00 61.10  ? 206 HOH D O   1 
HETATM 1163 O O   . HOH C 3 .   ? 6.138  9.307  16.816  1.00 48.86  ? 207 HOH D O   1 
HETATM 1164 O O   . HOH C 3 .   ? 24.524 11.028 14.538  1.00 50.05  ? 208 HOH D O   1 
HETATM 1165 O O   . HOH C 3 .   ? 19.939 18.854 19.084  1.00 47.85  ? 209 HOH D O   1 
HETATM 1166 O O   . HOH C 3 .   ? 20.741 8.170  25.166  1.00 60.23  ? 210 HOH D O   1 
HETATM 1167 O O   . HOH C 3 .   ? 15.578 12.206 23.721  1.00 56.40  ? 211 HOH D O   1 
HETATM 1168 O O   . HOH C 3 .   ? 3.426  14.817 12.935  1.00 72.70  ? 212 HOH D O   1 
HETATM 1169 O O   . HOH C 3 .   ? 11.946 7.322  21.744  1.00 64.61  ? 213 HOH D O   1 
HETATM 1170 O O   . HOH C 3 .   ? 10.485 25.279 13.778  1.00 60.96  ? 214 HOH D O   1 
HETATM 1171 O O   . HOH C 3 .   ? 16.636 14.953 22.576  1.00 53.86  ? 215 HOH D O   1 
HETATM 1172 O O   . HOH C 3 .   ? 21.529 22.051 13.734  1.00 50.03  ? 216 HOH D O   1 
HETATM 1173 O O   . HOH C 3 .   ? 2.158  19.683 -4.765  1.00 61.80  ? 217 HOH D O   1 
HETATM 1174 O O   . HOH C 3 .   ? 8.749  19.981 18.448  1.00 56.39  ? 218 HOH D O   1 
HETATM 1175 O O   . HOH C 3 .   ? 20.638 14.716 1.885   1.00 59.69  ? 219 HOH D O   1 
HETATM 1176 O O   . HOH C 3 .   ? 7.823  34.204 4.195   1.00 75.80  ? 220 HOH D O   1 
HETATM 1177 O O   . HOH C 3 .   ? -1.918 2.520  8.227   1.00 74.71  ? 221 HOH D O   1 
HETATM 1178 O O   . HOH C 3 .   ? 9.648  18.134 20.344  1.00 51.45  ? 222 HOH D O   1 
HETATM 1179 O O   . HOH C 3 .   ? 15.257 8.863  -4.140  1.00 57.55  ? 223 HOH D O   1 
HETATM 1180 O O   . HOH C 3 .   ? 23.059 11.669 22.243  1.00 53.12  ? 224 HOH D O   1 
HETATM 1181 O O   . HOH C 3 .   ? 7.849  7.245  23.838  1.00 78.42  ? 225 HOH D O   1 
HETATM 1182 O O   . HOH C 3 .   ? 13.030 6.681  19.275  1.00 61.13  ? 226 HOH D O   1 
HETATM 1183 O O   . HOH C 3 .   ? 16.829 19.005 -3.159  1.00 58.81  ? 227 HOH D O   1 
HETATM 1184 O O   . HOH C 3 .   ? 23.299 25.562 2.442   1.00 67.99  ? 228 HOH D O   1 
HETATM 1185 O O   . HOH C 3 .   ? 9.774  28.536 -5.882  1.00 71.54  ? 229 HOH D O   1 
HETATM 1186 O O   . HOH C 3 .   ? 10.113 4.746  22.224  1.00 73.27  ? 230 HOH D O   1 
HETATM 1187 O O   . HOH C 3 .   ? 29.409 4.185  9.754   1.00 73.28  ? 231 HOH D O   1 
HETATM 1188 O O   . HOH C 3 .   ? 18.077 -4.214 10.720  1.00 75.59  ? 232 HOH D O   1 
HETATM 1189 O O   . HOH D 3 .   ? 7.328  7.107  2.478   1.00 52.34  ? 301 HOH G O   1 
HETATM 1190 O O   . HOH D 3 .   ? 1.911  11.669 5.311   1.00 59.92  ? 302 HOH G O   1 
HETATM 1191 O O   . HOH D 3 .   ? 4.680  9.350  2.467   1.00 46.72  ? 303 HOH G O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   22  ?   ?   ?   D . n 
A 1 2   ALA 2   23  ?   ?   ?   D . n 
A 1 3   MET 3   24  ?   ?   ?   D . n 
A 1 4   ALA 4   25  ?   ?   ?   D . n 
A 1 5   SER 5   26  ?   ?   ?   D . n 
A 1 6   GLY 6   27  ?   ?   ?   D . n 
A 1 7   LYS 7   28  28  LYS LYS D . n 
A 1 8   VAL 8   29  29  VAL VAL D . n 
A 1 9   VAL 9   30  30  VAL VAL D . n 
A 1 10  LYS 10  31  31  LYS LYS D . n 
A 1 11  PHE 11  32  32  PHE PHE D . n 
A 1 12  SER 12  33  33  SER SER D . n 
A 1 13  TYR 13  34  34  TYR TYR D . n 
A 1 14  MET 14  35  35  MET MET D . n 
A 1 15  TRP 15  36  36  TRP TRP D . n 
A 1 16  THR 16  37  37  THR THR D . n 
A 1 17  ILE 17  38  38  ILE ILE D . n 
A 1 18  ASN 18  39  39  ASN ASN D . n 
A 1 19  ASN 19  40  40  ASN ASN D . n 
A 1 20  PHE 20  41  41  PHE PHE D . n 
A 1 21  SER 21  42  42  SER SER D . n 
A 1 22  PHE 22  43  43  PHE PHE D . n 
A 1 23  CYS 23  44  44  CYS CYS D . n 
A 1 24  ARG 24  45  45  ARG ARG D . n 
A 1 25  GLU 25  46  46  GLU GLU D . n 
A 1 26  GLU 26  47  47  GLU GLU D . n 
A 1 27  MET 27  48  48  MET MET D . n 
A 1 28  GLY 28  49  49  GLY GLY D . n 
A 1 29  GLU 29  50  50  GLU GLU D . n 
A 1 30  VAL 30  51  51  VAL VAL D . n 
A 1 31  ILE 31  52  52  ILE ILE D . n 
A 1 32  LYS 32  53  53  LYS LYS D . n 
A 1 33  SER 33  54  54  SER SER D . n 
A 1 34  SER 34  55  55  SER SER D . n 
A 1 35  THR 35  56  56  THR THR D . n 
A 1 36  PHE 36  57  57  PHE PHE D . n 
A 1 37  SER 37  58  58  SER SER D . n 
A 1 38  SER 38  59  59  SER SER D . n 
A 1 39  GLY 39  60  60  GLY GLY D . n 
A 1 40  ALA 40  61  61  ALA ALA D . n 
A 1 41  ASN 41  62  62  ASN ASN D . n 
A 1 42  ASP 42  63  63  ASP ASP D . n 
A 1 43  LYS 43  64  64  LYS LYS D . n 
A 1 44  LEU 44  65  65  LEU LEU D . n 
A 1 45  LYS 45  66  66  LYS LYS D . n 
A 1 46  TRP 46  67  67  TRP TRP D . n 
A 1 47  CYS 47  68  68  CYS CYS D . n 
A 1 48  LEU 48  69  69  LEU LEU D . n 
A 1 49  ARG 49  70  70  ARG ARG D . n 
A 1 50  VAL 50  71  71  VAL VAL D . n 
A 1 51  ASN 51  72  72  ASN ASN D . n 
A 1 52  PRO 52  73  73  PRO PRO D . n 
A 1 53  LYS 53  74  74  LYS LYS D . n 
A 1 54  GLY 54  75  75  GLY GLY D . n 
A 1 55  LEU 55  76  76  LEU LEU D . n 
A 1 56  ASP 56  77  77  ASP ASP D . n 
A 1 57  GLU 57  78  78  GLU GLU D . n 
A 1 58  GLU 58  79  79  GLU GLU D . n 
A 1 59  SER 59  80  80  SER SER D . n 
A 1 60  LYS 60  81  81  LYS LYS D . n 
A 1 61  ASP 61  82  82  ASP ASP D . n 
A 1 62  TYR 62  83  83  TYR TYR D . n 
A 1 63  LEU 63  84  84  LEU LEU D . n 
A 1 64  SER 64  85  85  SER SER D . n 
A 1 65  LEU 65  86  86  LEU LEU D . n 
A 1 66  TYR 66  87  87  TYR TYR D . n 
A 1 67  LEU 67  88  88  LEU LEU D . n 
A 1 68  LEU 68  89  89  LEU LEU D . n 
A 1 69  LEU 69  90  90  LEU LEU D . n 
A 1 70  VAL 70  91  91  VAL VAL D . n 
A 1 71  SER 71  92  92  SER SER D . n 
A 1 72  CYS 72  93  93  CYS CYS D . n 
A 1 73  PRO 73  94  94  PRO PRO D . n 
A 1 74  LYS 74  95  95  LYS LYS D . n 
A 1 75  SER 75  96  96  SER SER D . n 
A 1 76  GLU 76  97  97  GLU GLU D . n 
A 1 77  VAL 77  98  98  VAL VAL D . n 
A 1 78  ARG 78  99  99  ARG ARG D . n 
A 1 79  ALA 79  100 100 ALA ALA D . n 
A 1 80  LYS 80  101 101 LYS LYS D . n 
A 1 81  PHE 81  102 102 PHE PHE D . n 
A 1 82  LYS 82  103 103 LYS LYS D . n 
A 1 83  PHE 83  104 104 PHE PHE D . n 
A 1 84  SER 84  105 105 SER SER D . n 
A 1 85  ILE 85  106 106 ILE ILE D . n 
A 1 86  LEU 86  107 107 LEU LEU D . n 
A 1 87  ASN 87  108 108 ASN ASN D . n 
A 1 88  ALA 88  109 109 ALA ALA D . n 
A 1 89  LYS 89  110 110 LYS LYS D . n 
A 1 90  GLY 90  111 111 GLY GLY D . n 
A 1 91  GLU 91  112 112 GLU GLU D . n 
A 1 92  GLU 92  113 113 GLU GLU D . n 
A 1 93  THR 93  114 114 THR THR D . n 
A 1 94  LYS 94  115 115 LYS LYS D . n 
A 1 95  ALA 95  116 116 ALA ALA D . n 
A 1 96  MET 96  117 117 MET MET D . n 
A 1 97  GLU 97  118 118 GLU GLU D . n 
A 1 98  SER 98  119 119 SER SER D . n 
A 1 99  GLN 99  120 120 GLN GLN D . n 
A 1 100 ARG 100 121 121 ARG ARG D . n 
A 1 101 ALA 101 122 122 ALA ALA D . n 
A 1 102 TYR 102 123 123 TYR TYR D . n 
A 1 103 ARG 103 124 124 ARG ARG D . n 
A 1 104 PHE 104 125 125 PHE PHE D . n 
A 1 105 VAL 105 126 126 VAL VAL D . n 
A 1 106 GLN 106 127 127 GLN GLN D . n 
A 1 107 GLY 107 128 128 GLY GLY D . n 
A 1 108 LYS 108 129 129 LYS LYS D . n 
A 1 109 ASP 109 130 130 ASP ASP D . n 
A 1 110 TRP 110 131 131 TRP TRP D . n 
A 1 111 GLY 111 132 132 GLY GLY D . n 
A 1 112 PHE 112 133 133 PHE PHE D . n 
A 1 113 LYS 113 134 134 LYS LYS D . n 
A 1 114 LYS 114 135 135 LYS LYS D . n 
A 1 115 PHE 115 136 136 PHE PHE D . n 
A 1 116 ILE 116 137 137 ILE ILE D . n 
A 1 117 ARG 117 138 138 ARG ARG D . n 
A 1 118 ARG 118 139 139 ARG ARG D . n 
A 1 119 ASP 119 140 140 ASP ASP D . n 
A 1 120 PHE 120 141 141 PHE PHE D . n 
A 1 121 LEU 121 142 142 LEU LEU D . n 
A 1 122 LEU 122 143 143 LEU LEU D . n 
A 1 123 ASP 123 144 144 ASP ASP D . n 
A 1 124 GLU 124 145 145 GLU GLU D . n 
A 1 125 ALA 125 146 146 ALA ALA D . n 
A 1 126 ASN 126 147 147 ASN ASN D . n 
A 1 127 GLY 127 148 148 GLY GLY D . n 
A 1 128 LEU 128 149 149 LEU LEU D . n 
A 1 129 LEU 129 150 150 LEU LEU D . n 
A 1 130 PRO 130 151 151 PRO PRO D . n 
A 1 131 ASP 131 152 152 ASP ASP D . n 
A 1 132 ASP 132 153 153 ASP ASP D . n 
A 1 133 LYS 133 154 154 LYS LYS D . n 
A 1 134 LEU 134 155 155 LEU LEU D . n 
A 1 135 THR 135 156 156 THR THR D . n 
A 1 136 LEU 136 157 157 LEU LEU D . n 
A 1 137 PHE 137 158 158 PHE PHE D . n 
A 1 138 CYS 138 159 159 CYS CYS D . n 
A 1 139 GLU 139 160 160 GLU GLU D . n 
A 1 140 VAL 140 161 161 VAL VAL D . n 
A 1 141 SER 141 162 162 SER SER D . n 
A 1 142 VAL 142 163 163 VAL VAL D . n 
A 1 143 VAL 143 164 164 VAL VAL D . n 
A 1 144 GLN 144 165 ?   ?   ?   D . n 
A 1 145 ASP 145 166 ?   ?   ?   D . n 
B 2 1   PRO 1   223 223 PRO PRO G . n 
B 2 2   GLU 2   224 224 GLU GLU G . n 
B 2 3   GLN 3   225 225 GLN GLN G . n 
B 2 4   ASP 4   226 226 ASP ASP G . n 
B 2 5   CYS 5   227 227 CYS CYS G . n 
B 2 6   ALA 6   228 228 ALA ALA G . n 
B 2 7   VAL 7   229 229 VAL VAL G . n 
B 2 8   THR 8   230 230 THR THR G . n 
B 2 9   SER 9   231 231 SER SER G . n 
B 2 10  GLY 10  232 232 GLY GLY G . n 
B 2 11  GLU 11  233 ?   ?   ?   G . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1  201 25 HOH HOH D . 
C 3 HOH 2  202 12 HOH HOH D . 
C 3 HOH 3  203 10 HOH HOH D . 
C 3 HOH 4  204 35 HOH HOH D . 
C 3 HOH 5  205 31 HOH HOH D . 
C 3 HOH 6  206 19 HOH HOH D . 
C 3 HOH 7  207 2  HOH HOH D . 
C 3 HOH 8  208 1  HOH HOH D . 
C 3 HOH 9  209 4  HOH HOH D . 
C 3 HOH 10 210 16 HOH HOH D . 
C 3 HOH 11 211 15 HOH HOH D . 
C 3 HOH 12 212 23 HOH HOH D . 
C 3 HOH 13 213 17 HOH HOH D . 
C 3 HOH 14 214 6  HOH HOH D . 
C 3 HOH 15 215 5  HOH HOH D . 
C 3 HOH 16 216 3  HOH HOH D . 
C 3 HOH 17 217 14 HOH HOH D . 
C 3 HOH 18 218 29 HOH HOH D . 
C 3 HOH 19 219 32 HOH HOH D . 
C 3 HOH 20 220 30 HOH HOH D . 
C 3 HOH 21 221 24 HOH HOH D . 
C 3 HOH 22 222 22 HOH HOH D . 
C 3 HOH 23 223 18 HOH HOH D . 
C 3 HOH 24 224 7  HOH HOH D . 
C 3 HOH 25 225 28 HOH HOH D . 
C 3 HOH 26 226 20 HOH HOH D . 
C 3 HOH 27 227 26 HOH HOH D . 
C 3 HOH 28 228 34 HOH HOH D . 
C 3 HOH 29 229 13 HOH HOH D . 
C 3 HOH 30 230 27 HOH HOH D . 
C 3 HOH 31 231 21 HOH HOH D . 
C 3 HOH 32 232 33 HOH HOH D . 
D 3 HOH 1  301 11 HOH HOH G . 
D 3 HOH 2  302 9  HOH HOH G . 
D 3 HOH 3  303 8  HOH HOH G . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1220 ? 
1 MORE         -4   ? 
1 'SSA (A^2)'  7590 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-11-28 
2 'Structure model' 1 1 2019-02-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation                
2 2 'Structure model' database_PDB_rev        
3 2 'Structure model' database_PDB_rev_record 
4 2 'Structure model' pdbx_database_proc      
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume' 
2 2 'Structure model' '_citation.page_first'     
3 2 'Structure model' '_citation.page_last'      
4 2 'Structure model' '_citation.year'           
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0189 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? .        4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             D 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              70 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             D 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              70 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             D 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              70 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                123.32 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            3.02 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN D 62 ? ? -89.14  34.65   
2 1 SER D 96 ? ? -156.57 -156.03 
3 1 GLU D 97 ? ? -33.48  138.89  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 D LYS 28  ? CD  ? A LYS 7   CD  
2  1 Y 1 D LYS 28  ? CE  ? A LYS 7   CE  
3  1 Y 1 D LYS 28  ? NZ  ? A LYS 7   NZ  
4  1 Y 1 D LYS 31  ? CE  ? A LYS 10  CE  
5  1 Y 1 D LYS 31  ? NZ  ? A LYS 10  NZ  
6  1 Y 1 D ASN 62  ? CG  ? A ASN 41  CG  
7  1 Y 1 D ASN 62  ? OD1 ? A ASN 41  OD1 
8  1 Y 1 D ASN 62  ? ND2 ? A ASN 41  ND2 
9  1 Y 1 D LYS 64  ? CG  ? A LYS 43  CG  
10 1 Y 1 D LYS 64  ? CD  ? A LYS 43  CD  
11 1 Y 1 D LYS 64  ? CE  ? A LYS 43  CE  
12 1 Y 1 D LYS 64  ? NZ  ? A LYS 43  NZ  
13 1 Y 1 D LYS 66  ? CE  ? A LYS 45  CE  
14 1 Y 1 D LYS 66  ? NZ  ? A LYS 45  NZ  
15 1 Y 1 D LYS 74  ? CE  ? A LYS 53  CE  
16 1 Y 1 D LYS 74  ? NZ  ? A LYS 53  NZ  
17 1 Y 1 D GLU 78  ? CG  ? A GLU 57  CG  
18 1 Y 1 D GLU 78  ? CD  ? A GLU 57  CD  
19 1 Y 1 D GLU 78  ? OE1 ? A GLU 57  OE1 
20 1 Y 1 D GLU 78  ? OE2 ? A GLU 57  OE2 
21 1 Y 1 D LYS 81  ? CE  ? A LYS 60  CE  
22 1 Y 1 D LYS 81  ? NZ  ? A LYS 60  NZ  
23 1 Y 1 D LYS 95  ? CG  ? A LYS 74  CG  
24 1 Y 1 D LYS 95  ? CD  ? A LYS 74  CD  
25 1 Y 1 D LYS 95  ? CE  ? A LYS 74  CE  
26 1 Y 1 D LYS 95  ? NZ  ? A LYS 74  NZ  
27 1 Y 1 D LYS 134 ? CE  ? A LYS 113 CE  
28 1 Y 1 D LYS 134 ? NZ  ? A LYS 113 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 D GLY 22  ? A GLY 1   
2 1 Y 1 D ALA 23  ? A ALA 2   
3 1 Y 1 D MET 24  ? A MET 3   
4 1 Y 1 D ALA 25  ? A ALA 4   
5 1 Y 1 D SER 26  ? A SER 5   
6 1 Y 1 D GLY 27  ? A GLY 6   
7 1 Y 1 D GLN 165 ? A GLN 144 
8 1 Y 1 D ASP 166 ? A ASP 145 
9 1 Y 1 G GLU 233 ? B GLU 11  
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'isothermal titration calorimetry' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#