data_6FF8
# 
_entry.id   6FF8 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.318 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6FF8         
WWPDB D_1200008205 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6FF8 
_pdbx_database_status.recvd_initial_deposition_date   2018-01-04 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Khan, A.R.' 1 ? 
'Kecman, T.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Small GTPases' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2154-1256 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                1 
_citation.page_last                 14 
_citation.title                     'LRRK2 binds to the Rab32 subfamily in a GTP-dependent mannerviaits armadillo domain.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1080/21541248.2019.1666623 
_citation.pdbx_database_id_PubMed   31552791 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'McGrath, E.'    1 0000-0002-7257-560X 
primary 'Waschbusch, D.' 2 ?                   
primary 'Baker, B.M.'    3 ?                   
primary 'Khan, A.R.'     4 0000-0003-1176-6952 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6FF8 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     53.658 
_cell.length_a_esd                 ? 
_cell.length_b                     53.658 
_cell.length_b_esd                 ? 
_cell.length_c                     129.784 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6FF8 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                78 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 43' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ras-related protein Rab-32' 20588.467 2  ? ? ? ? 
2 non-polymer nat "GUANOSINE-5'-TRIPHOSPHATE"  523.180   2  ? ? ? ? 
3 non-polymer syn 'MAGNESIUM ION'              24.305    2  ? ? ? ? 
4 water       nat water                        18.015    50 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGLERFGNMTRVYYK
EAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKD
NINIEEAARFLVEKILVNHQS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGLERFGNMTRVYYK
EAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKD
NINIEEAARFLVEKILVNHQS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   GLU n 
1 4   THR n 
1 5   ARG n 
1 6   GLU n 
1 7   HIS n 
1 8   LEU n 
1 9   PHE n 
1 10  LYS n 
1 11  VAL n 
1 12  LEU n 
1 13  VAL n 
1 14  ILE n 
1 15  GLY n 
1 16  GLU n 
1 17  LEU n 
1 18  GLY n 
1 19  VAL n 
1 20  GLY n 
1 21  LYS n 
1 22  THR n 
1 23  SER n 
1 24  ILE n 
1 25  ILE n 
1 26  LYS n 
1 27  ARG n 
1 28  TYR n 
1 29  VAL n 
1 30  HIS n 
1 31  GLN n 
1 32  LEU n 
1 33  PHE n 
1 34  SER n 
1 35  GLN n 
1 36  HIS n 
1 37  TYR n 
1 38  ARG n 
1 39  ALA n 
1 40  THR n 
1 41  ILE n 
1 42  GLY n 
1 43  VAL n 
1 44  ASP n 
1 45  PHE n 
1 46  ALA n 
1 47  LEU n 
1 48  LYS n 
1 49  VAL n 
1 50  LEU n 
1 51  ASN n 
1 52  TRP n 
1 53  ASP n 
1 54  SER n 
1 55  ARG n 
1 56  THR n 
1 57  LEU n 
1 58  VAL n 
1 59  ARG n 
1 60  LEU n 
1 61  GLN n 
1 62  LEU n 
1 63  TRP n 
1 64  ASP n 
1 65  ILE n 
1 66  ALA n 
1 67  GLY n 
1 68  LEU n 
1 69  GLU n 
1 70  ARG n 
1 71  PHE n 
1 72  GLY n 
1 73  ASN n 
1 74  MET n 
1 75  THR n 
1 76  ARG n 
1 77  VAL n 
1 78  TYR n 
1 79  TYR n 
1 80  LYS n 
1 81  GLU n 
1 82  ALA n 
1 83  VAL n 
1 84  GLY n 
1 85  ALA n 
1 86  PHE n 
1 87  VAL n 
1 88  VAL n 
1 89  PHE n 
1 90  ASP n 
1 91  ILE n 
1 92  SER n 
1 93  ARG n 
1 94  SER n 
1 95  SER n 
1 96  THR n 
1 97  PHE n 
1 98  GLU n 
1 99  ALA n 
1 100 VAL n 
1 101 LEU n 
1 102 LYS n 
1 103 TRP n 
1 104 LYS n 
1 105 SER n 
1 106 ASP n 
1 107 LEU n 
1 108 ASP n 
1 109 SER n 
1 110 LYS n 
1 111 VAL n 
1 112 HIS n 
1 113 LEU n 
1 114 PRO n 
1 115 ASN n 
1 116 GLY n 
1 117 SER n 
1 118 PRO n 
1 119 ILE n 
1 120 PRO n 
1 121 ALA n 
1 122 VAL n 
1 123 LEU n 
1 124 LEU n 
1 125 ALA n 
1 126 ASN n 
1 127 LYS n 
1 128 CYS n 
1 129 ASP n 
1 130 GLN n 
1 131 ASN n 
1 132 LYS n 
1 133 ASP n 
1 134 SER n 
1 135 SER n 
1 136 GLN n 
1 137 SER n 
1 138 PRO n 
1 139 SER n 
1 140 GLN n 
1 141 VAL n 
1 142 ASP n 
1 143 GLN n 
1 144 PHE n 
1 145 CYS n 
1 146 LYS n 
1 147 GLU n 
1 148 HIS n 
1 149 GLY n 
1 150 PHE n 
1 151 ALA n 
1 152 GLY n 
1 153 TRP n 
1 154 PHE n 
1 155 GLU n 
1 156 THR n 
1 157 SER n 
1 158 ALA n 
1 159 LYS n 
1 160 ASP n 
1 161 ASN n 
1 162 ILE n 
1 163 ASN n 
1 164 ILE n 
1 165 GLU n 
1 166 GLU n 
1 167 ALA n 
1 168 ALA n 
1 169 ARG n 
1 170 PHE n 
1 171 LEU n 
1 172 VAL n 
1 173 GLU n 
1 174 LYS n 
1 175 ILE n 
1 176 LEU n 
1 177 VAL n 
1 178 ASN n 
1 179 HIS n 
1 180 GLN n 
1 181 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   181 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 RAB32 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RAB32_HUMAN 
_struct_ref.pdbx_db_accession          Q13637 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;ETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEA
VGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNI
NIEEAARFLVEKILVNHQS
;
_struct_ref.pdbx_align_begin           20 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6FF8 A 3 ? 181 ? Q13637 20 ? 198 ? 20 198 
2 1 6FF8 B 3 ? 181 ? Q13637 20 ? 198 ? 20 198 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6FF8 SER A 1  ? UNP Q13637 ?   ?  'expression tag' 18 1 
1 6FF8 MET A 2  ? UNP Q13637 ?   ?  'expression tag' 19 2 
1 6FF8 LEU A 68 ? UNP Q13637 GLN 85 conflict         85 3 
2 6FF8 SER B 1  ? UNP Q13637 ?   ?  'expression tag' 18 4 
2 6FF8 MET B 2  ? UNP Q13637 ?   ?  'expression tag' 19 5 
2 6FF8 LEU B 68 ? UNP Q13637 GLN 85 conflict         85 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                     ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                    ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                    ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                   ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                     ? 'C2 H5 N O2'        75.067  
GTP non-polymer         n "GUANOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O14 P3' 523.180 
HIS 'L-peptide linking' y HISTIDINE                   ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                       ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                  ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                     ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                      ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                  ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'             ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE               ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                     ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                      ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                   ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                  ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                    ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                      ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6FF8 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.27 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         45.78 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'O.2M sodium potassium tartrate, 0.1M Bis-Tris propane pH 8.5, 20% w/v PEG 3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-09-16 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9801 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SOLEIL BEAMLINE PROXIMA 2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9801 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   'PROXIMA 2' 
_diffrn_source.pdbx_synchrotron_site       SOLEIL 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6FF8 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.13 
_reflns.d_resolution_low                 41.36 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       20447 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.3 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.2 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            12.4 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.13 
_reflns_shell.d_res_low                   2.19 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.5 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           1646 
_reflns_shell.percent_possible_all        99.7 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.891 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             4.2 
_reflns_shell.pdbx_Rsym_value             0 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             1.02 
_reflns_shell.pdbx_Rpim_I_all             0.488 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.588 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6FF8 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.130 
_refine.ls_d_res_low                             41.352 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     20447 
_refine.ls_number_reflns_R_free                  1015 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.80 
_refine.ls_percent_reflns_R_free                 4.96 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1923 
_refine.ls_R_factor_R_free                       0.2232 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1907 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4cym 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 22.49 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.22 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2775 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         66 
_refine_hist.number_atoms_solvent             50 
_refine_hist.number_atoms_total               2891 
_refine_hist.d_res_high                       2.130 
_refine_hist.d_res_low                        41.352 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.018  ? 2905 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.922  ? 3942 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 21.466 ? 1048 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.137  ? 435  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.011  ? 486  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.1300 2.2423  . . 147 2770 100.00 . . . 0.1956 . 0.1684 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2423 2.3828  . . 141 2750 100.00 . . . 0.1919 . 0.1647 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3828 2.5668  . . 145 2784 100.00 . . . 0.1903 . 0.1890 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5668 2.8250  . . 135 2782 100.00 . . . 0.2673 . 0.2211 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8250 3.2337  . . 152 2771 100.00 . . . 0.2981 . 0.2308 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2337 4.0735  . . 149 2789 100.00 . . . 0.2428 . 0.1990 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0735 41.3599 . . 146 2786 99.00  . . . 0.1797 . 0.1659 . . . . . . . . . . 
# 
_struct.entry_id                     6FF8 
_struct.title                        
'Crystal structure of uncomplexed Rab32 in the active GTP-bound state at 2.13 Angstrom resolution' 
_struct.pdbx_descriptor              'Ras-related protein Rab-32' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6FF8 
_struct_keywords.text            'small GTPase, Rab, GTP, vesicle trafficking, cell dynamics, SIGNALING PROTEIN' 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 20  ? GLN A 31  ? GLY A 37  GLN A 48  1 ? 12 
HELX_P HELX_P2  AA2 GLY A 67  ? GLY A 72  ? GLY A 84  GLY A 89  5 ? 6  
HELX_P HELX_P3  AA3 MET A 74  ? LYS A 80  ? MET A 91  LYS A 97  1 ? 7  
HELX_P HELX_P4  AA4 ARG A 93  ? VAL A 111 ? ARG A 110 VAL A 128 1 ? 19 
HELX_P HELX_P5  AA5 SER A 137 ? GLY A 149 ? SER A 154 GLY A 166 1 ? 13 
HELX_P HELX_P6  AA6 ASN A 163 ? SER A 181 ? ASN A 180 SER A 198 1 ? 19 
HELX_P HELX_P7  AA7 GLY B 20  ? GLN B 31  ? GLY B 37  GLN B 48  1 ? 12 
HELX_P HELX_P8  AA8 LEU B 68  ? GLY B 72  ? LEU B 85  GLY B 89  5 ? 5  
HELX_P HELX_P9  AA9 MET B 74  ? LYS B 80  ? MET B 91  LYS B 97  1 ? 7  
HELX_P HELX_P10 AB1 ARG B 93  ? ALA B 99  ? ARG B 110 ALA B 116 1 ? 7  
HELX_P HELX_P11 AB2 ALA B 99  ? VAL B 111 ? ALA B 116 VAL B 128 1 ? 13 
HELX_P HELX_P12 AB3 PRO B 138 ? GLY B 149 ? PRO B 155 GLY B 166 1 ? 12 
HELX_P HELX_P13 AB4 ASN B 163 ? HIS B 179 ? ASN B 180 HIS B 196 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A THR 22 OG1 ? ? ? 1_555 D MG  . MG ? ? A THR 39  A MG  901  1_555 ? ? ? ? ? ? ? 2.164 ? 
metalc2  metalc ? ? A THR 40 OG1 ? ? ? 1_555 D MG  . MG ? ? A THR 57  A MG  901  1_555 ? ? ? ? ? ? ? 2.182 ? 
metalc3  metalc ? ? B THR 22 OG1 ? ? ? 1_555 F MG  . MG ? ? B THR 39  B MG  901  1_555 ? ? ? ? ? ? ? 2.205 ? 
metalc4  metalc ? ? B THR 40 OG1 ? ? ? 1_555 F MG  . MG ? ? B THR 57  B MG  901  1_555 ? ? ? ? ? ? ? 2.358 ? 
metalc5  metalc ? ? C GTP .  O1G ? ? ? 1_555 D MG  . MG ? ? A GTP 900 A MG  901  1_555 ? ? ? ? ? ? ? 1.968 ? 
metalc6  metalc ? ? C GTP .  O1B ? ? ? 1_555 D MG  . MG ? ? A GTP 900 A MG  901  1_555 ? ? ? ? ? ? ? 2.046 ? 
metalc7  metalc ? ? D MG  .  MG  ? ? ? 1_555 G HOH . O  ? ? A MG  901 A HOH 1001 1_555 ? ? ? ? ? ? ? 2.247 ? 
metalc8  metalc ? ? D MG  .  MG  ? ? ? 1_555 G HOH . O  ? ? A MG  901 A HOH 1003 1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc9  metalc ? ? E GTP .  O3G ? ? ? 1_555 F MG  . MG ? ? B GTP 900 B MG  901  1_555 ? ? ? ? ? ? ? 1.846 ? 
metalc10 metalc ? ? E GTP .  O2B ? ? ? 1_555 F MG  . MG ? ? B GTP 900 B MG  901  1_555 ? ? ? ? ? ? ? 2.233 ? 
metalc11 metalc ? ? F MG  .  MG  ? ? ? 1_555 H HOH . O  ? ? B MG  901 B HOH 1002 1_555 ? ? ? ? ? ? ? 2.264 ? 
metalc12 metalc ? ? F MG  .  MG  ? ? ? 1_555 H HOH . O  ? ? B MG  901 B HOH 1008 1_555 ? ? ? ? ? ? ? 2.176 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? parallel      
AA2 4 5 ? parallel      
AA2 5 6 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 43  ? ASP A 53  ? VAL A 60  ASP A 70  
AA1 2 THR A 56  ? ILE A 65  ? THR A 73  ILE A 82  
AA1 3 ARG A 5   ? GLY A 15  ? ARG A 22  GLY A 32  
AA1 4 GLY A 84  ? ASP A 90  ? GLY A 101 ASP A 107 
AA1 5 ALA A 121 ? ASN A 126 ? ALA A 138 ASN A 143 
AA1 6 GLY A 152 ? THR A 156 ? GLY A 169 THR A 173 
AA2 1 VAL B 43  ? ASP B 53  ? VAL B 60  ASP B 70  
AA2 2 THR B 56  ? ILE B 65  ? THR B 73  ILE B 82  
AA2 3 ARG B 5   ? GLY B 15  ? ARG B 22  GLY B 32  
AA2 4 GLY B 84  ? ASP B 90  ? GLY B 101 ASP B 107 
AA2 5 ALA B 121 ? ASN B 126 ? ALA B 138 ASN B 143 
AA2 6 GLY B 152 ? THR B 156 ? GLY B 169 THR B 173 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 50  ? N LEU A 67  O VAL A 58  ? O VAL A 75  
AA1 2 3 O ARG A 59  ? O ARG A 76  N HIS A 7   ? N HIS A 24  
AA1 3 4 N ILE A 14  ? N ILE A 31  O PHE A 86  ? O PHE A 103 
AA1 4 5 N PHE A 89  ? N PHE A 106 O ASN A 126 ? O ASN A 143 
AA1 5 6 N ALA A 125 ? N ALA A 142 O PHE A 154 ? O PHE A 171 
AA2 1 2 N LEU B 50  ? N LEU B 67  O VAL B 58  ? O VAL B 75  
AA2 2 3 O LEU B 57  ? O LEU B 74  N ARG B 5   ? N ARG B 22  
AA2 3 4 N ILE B 14  ? N ILE B 31  O PHE B 86  ? O PHE B 103 
AA2 4 5 N PHE B 89  ? N PHE B 106 O ASN B 126 ? O ASN B 143 
AA2 5 6 N ALA B 125 ? N ALA B 142 O PHE B 154 ? O PHE B 171 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A GTP 900 ? 25 'binding site for residue GTP A 900' 
AC2 Software A MG  901 ? 5  'binding site for residue MG A 901'  
AC3 Software B GTP 900 ? 24 'binding site for residue GTP B 900' 
AC4 Software B MG  901 ? 5  'binding site for residue MG B 901'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 25 LEU A 17  ? LEU A 34   . ? 1_555 ? 
2  AC1 25 GLY A 18  ? GLY A 35   . ? 1_555 ? 
3  AC1 25 VAL A 19  ? VAL A 36   . ? 1_555 ? 
4  AC1 25 GLY A 20  ? GLY A 37   . ? 1_555 ? 
5  AC1 25 LYS A 21  ? LYS A 38   . ? 1_555 ? 
6  AC1 25 THR A 22  ? THR A 39   . ? 1_555 ? 
7  AC1 25 SER A 23  ? SER A 40   . ? 1_555 ? 
8  AC1 25 PHE A 33  ? PHE A 50   . ? 1_555 ? 
9  AC1 25 SER A 34  ? SER A 51   . ? 1_555 ? 
10 AC1 25 GLN A 35  ? GLN A 52   . ? 1_555 ? 
11 AC1 25 TYR A 37  ? TYR A 54   . ? 1_555 ? 
12 AC1 25 THR A 40  ? THR A 57   . ? 1_555 ? 
13 AC1 25 GLY A 67  ? GLY A 84   . ? 1_555 ? 
14 AC1 25 ASN A 126 ? ASN A 143  . ? 1_555 ? 
15 AC1 25 LYS A 127 ? LYS A 144  . ? 1_555 ? 
16 AC1 25 ASP A 129 ? ASP A 146  . ? 1_555 ? 
17 AC1 25 GLN A 130 ? GLN A 147  . ? 1_555 ? 
18 AC1 25 SER A 157 ? SER A 174  . ? 1_555 ? 
19 AC1 25 ALA A 158 ? ALA A 175  . ? 1_555 ? 
20 AC1 25 LYS A 159 ? LYS A 176  . ? 1_555 ? 
21 AC1 25 MG  D .   ? MG  A 901  . ? 1_555 ? 
22 AC1 25 HOH G .   ? HOH A 1001 . ? 1_555 ? 
23 AC1 25 HOH G .   ? HOH A 1003 . ? 1_555 ? 
24 AC1 25 HOH G .   ? HOH A 1006 . ? 1_555 ? 
25 AC1 25 HOH G .   ? HOH A 1009 . ? 1_555 ? 
26 AC2 5  THR A 22  ? THR A 39   . ? 1_555 ? 
27 AC2 5  THR A 40  ? THR A 57   . ? 1_555 ? 
28 AC2 5  GTP C .   ? GTP A 900  . ? 1_555 ? 
29 AC2 5  HOH G .   ? HOH A 1001 . ? 1_555 ? 
30 AC2 5  HOH G .   ? HOH A 1003 . ? 1_555 ? 
31 AC3 24 LEU B 17  ? LEU B 34   . ? 1_555 ? 
32 AC3 24 GLY B 18  ? GLY B 35   . ? 1_555 ? 
33 AC3 24 VAL B 19  ? VAL B 36   . ? 1_555 ? 
34 AC3 24 GLY B 20  ? GLY B 37   . ? 1_555 ? 
35 AC3 24 LYS B 21  ? LYS B 38   . ? 1_555 ? 
36 AC3 24 THR B 22  ? THR B 39   . ? 1_555 ? 
37 AC3 24 SER B 23  ? SER B 40   . ? 1_555 ? 
38 AC3 24 PHE B 33  ? PHE B 50   . ? 1_555 ? 
39 AC3 24 SER B 34  ? SER B 51   . ? 1_555 ? 
40 AC3 24 GLN B 35  ? GLN B 52   . ? 1_555 ? 
41 AC3 24 TYR B 37  ? TYR B 54   . ? 1_555 ? 
42 AC3 24 THR B 40  ? THR B 57   . ? 1_555 ? 
43 AC3 24 GLY B 67  ? GLY B 84   . ? 1_555 ? 
44 AC3 24 ASN B 126 ? ASN B 143  . ? 1_555 ? 
45 AC3 24 LYS B 127 ? LYS B 144  . ? 1_555 ? 
46 AC3 24 ASP B 129 ? ASP B 146  . ? 1_555 ? 
47 AC3 24 SER B 157 ? SER B 174  . ? 1_555 ? 
48 AC3 24 ALA B 158 ? ALA B 175  . ? 1_555 ? 
49 AC3 24 LYS B 159 ? LYS B 176  . ? 1_555 ? 
50 AC3 24 MG  F .   ? MG  B 901  . ? 1_555 ? 
51 AC3 24 HOH H .   ? HOH B 1002 . ? 1_555 ? 
52 AC3 24 HOH H .   ? HOH B 1008 . ? 1_555 ? 
53 AC3 24 HOH H .   ? HOH B 1009 . ? 1_555 ? 
54 AC3 24 HOH H .   ? HOH B 1010 . ? 1_555 ? 
55 AC4 5  THR B 22  ? THR B 39   . ? 1_555 ? 
56 AC4 5  THR B 40  ? THR B 57   . ? 1_555 ? 
57 AC4 5  GTP E .   ? GTP B 900  . ? 1_555 ? 
58 AC4 5  HOH H .   ? HOH B 1002 . ? 1_555 ? 
59 AC4 5  HOH H .   ? HOH B 1008 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6FF8 
_atom_sites.fract_transf_matrix[1][1]   0.018637 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018637 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007705 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLU A 1 3   ? -19.982 0.862   -11.760 1.00 80.38  ? 20   GLU A N     1 
ATOM   2    C  CA    . GLU A 1 3   ? -20.787 -0.314  -11.969 1.00 79.12  ? 20   GLU A CA    1 
ATOM   3    C  C     . GLU A 1 3   ? -20.717 -1.124  -10.679 1.00 74.67  ? 20   GLU A C     1 
ATOM   4    O  O     . GLU A 1 3   ? -21.674 -1.189  -9.982  1.00 73.21  ? 20   GLU A O     1 
ATOM   5    C  CB    . GLU A 1 3   ? -20.373 -1.101  -13.238 1.00 81.81  ? 20   GLU A CB    1 
ATOM   6    C  CG    . GLU A 1 3   ? -21.447 -1.178  -14.338 1.00 85.25  ? 20   GLU A CG    1 
ATOM   7    C  CD    . GLU A 1 3   ? -20.915 -1.521  -15.743 1.00 88.39  ? 20   GLU A CD    1 
ATOM   8    O  OE1   . GLU A 1 3   ? -19.742 -1.255  -16.030 1.00 89.92  ? 20   GLU A OE1   1 
ATOM   9    O  OE2   . GLU A 1 3   ? -21.665 -2.034  -16.607 1.00 89.70  ? 20   GLU A OE2   1 
ATOM   10   N  N     . THR A 1 4   ? -19.574 -1.672  -10.333 1.00 72.38  ? 21   THR A N     1 
ATOM   11   C  CA    . THR A 1 4   ? -19.493 -2.451  -9.136  1.00 67.47  ? 21   THR A CA    1 
ATOM   12   C  C     . THR A 1 4   ? -20.013 -1.871  -7.807  1.00 64.56  ? 21   THR A C     1 
ATOM   13   O  O     . THR A 1 4   ? -19.816 -0.734  -7.461  1.00 67.95  ? 21   THR A O     1 
ATOM   14   C  CB    . THR A 1 4   ? -18.094 -3.040  -8.911  1.00 66.94  ? 21   THR A CB    1 
ATOM   15   O  OG1   . THR A 1 4   ? -17.551 -3.491  -10.138 1.00 70.23  ? 21   THR A OG1   1 
ATOM   16   C  CG2   . THR A 1 4   ? -18.180 -4.216  -8.012  1.00 63.96  ? 21   THR A CG2   1 
ATOM   17   N  N     . ARG A 1 5   ? -20.751 -2.716  -7.139  1.00 59.43  ? 22   ARG A N     1 
ATOM   18   C  CA    . ARG A 1 5   ? -21.301 -2.556  -5.810  1.00 55.68  ? 22   ARG A CA    1 
ATOM   19   C  C     . ARG A 1 5   ? -20.679 -3.597  -4.905  1.00 50.64  ? 22   ARG A C     1 
ATOM   20   O  O     . ARG A 1 5   ? -20.548 -4.752  -5.292  1.00 47.83  ? 22   ARG A O     1 
ATOM   21   C  CB    . ARG A 1 5   ? -22.809 -2.737  -5.884  1.00 55.26  ? 22   ARG A CB    1 
ATOM   22   C  CG    . ARG A 1 5   ? -23.577 -2.544  -4.604  1.00 54.99  ? 22   ARG A CG    1 
ATOM   23   C  CD    . ARG A 1 5   ? -23.887 -1.078  -4.329  1.00 57.94  ? 22   ARG A CD    1 
ATOM   24   N  NE    . ARG A 1 5   ? -24.722 -0.960  -3.128  1.00 57.50  ? 22   ARG A NE    1 
ATOM   25   C  CZ    . ARG A 1 5   ? -24.296 -1.055  -1.860  1.00 56.06  ? 22   ARG A CZ    1 
ATOM   26   N  NH1   . ARG A 1 5   ? -23.006 -1.239  -1.564  1.00 54.09  ? 22   ARG A NH1   1 
ATOM   27   N  NH2   . ARG A 1 5   ? -25.184 -0.942  -0.861  1.00 56.59  ? 22   ARG A NH2   1 
ATOM   28   N  N     . GLU A 1 6   ? -20.298 -3.169  -3.703  1.00 49.19  ? 23   GLU A N     1 
ATOM   29   C  CA    . GLU A 1 6   ? -19.669 -4.012  -2.714  1.00 48.77  ? 23   GLU A CA    1 
ATOM   30   C  C     . GLU A 1 6   ? -20.629 -4.085  -1.535  1.00 42.91  ? 23   GLU A C     1 
ATOM   31   O  O     . GLU A 1 6   ? -21.220 -3.085  -1.177  1.00 44.69  ? 23   GLU A O     1 
ATOM   32   C  CB    . GLU A 1 6   ? -18.276 -3.466  -2.297  1.00 56.12  ? 23   GLU A CB    1 
ATOM   33   C  CG    . GLU A 1 6   ? -17.270 -3.384  -3.461  1.00 62.76  ? 23   GLU A CG    1 
ATOM   34   C  CD    . GLU A 1 6   ? -15.811 -3.091  -3.095  1.00 70.78  ? 23   GLU A CD    1 
ATOM   35   O  OE1   . GLU A 1 6   ? -15.413 -3.171  -1.909  1.00 73.96  ? 23   GLU A OE1   1 
ATOM   36   O  OE2   . GLU A 1 6   ? -15.024 -2.785  -4.023  1.00 76.00  ? 23   GLU A OE2   1 
ATOM   37   N  N     . HIS A 1 7   ? -20.808 -5.275  -0.985  1.00 36.82  ? 24   HIS A N     1 
ATOM   38   C  CA    . HIS A 1 7   ? -21.590 -5.499  0.234   1.00 33.19  ? 24   HIS A CA    1 
ATOM   39   C  C     . HIS A 1 7   ? -20.801 -6.233  1.281   1.00 32.38  ? 24   HIS A C     1 
ATOM   40   O  O     . HIS A 1 7   ? -20.019 -7.095  0.939   1.00 32.37  ? 24   HIS A O     1 
ATOM   41   C  CB    . HIS A 1 7   ? -22.785 -6.378  -0.033  1.00 29.89  ? 24   HIS A CB    1 
ATOM   42   C  CG    . HIS A 1 7   ? -23.721 -5.846  -1.055  1.00 30.15  ? 24   HIS A CG    1 
ATOM   43   N  ND1   . HIS A 1 7   ? -24.781 -5.036  -0.718  1.00 30.50  ? 24   HIS A ND1   1 
ATOM   44   C  CD2   . HIS A 1 7   ? -23.803 -6.061  -2.388  1.00 30.04  ? 24   HIS A CD2   1 
ATOM   45   C  CE1   . HIS A 1 7   ? -25.472 -4.777  -1.809  1.00 32.61  ? 24   HIS A CE1   1 
ATOM   46   N  NE2   . HIS A 1 7   ? -24.863 -5.337  -2.841  1.00 32.47  ? 24   HIS A NE2   1 
ATOM   47   N  N     . LEU A 1 8   ? -21.085 -5.945  2.558   1.00 33.38  ? 25   LEU A N     1 
ATOM   48   C  CA    . LEU A 1 8   ? -20.555 -6.689  3.690   1.00 32.68  ? 25   LEU A CA    1 
ATOM   49   C  C     . LEU A 1 8   ? -21.738 -7.226  4.522   1.00 31.20  ? 25   LEU A C     1 
ATOM   50   O  O     . LEU A 1 8   ? -22.547 -6.456  4.999   1.00 32.33  ? 25   LEU A O     1 
ATOM   51   C  CB    . LEU A 1 8   ? -19.700 -5.762  4.543   1.00 35.84  ? 25   LEU A CB    1 
ATOM   52   C  CG    . LEU A 1 8   ? -18.958 -6.451  5.725   1.00 36.04  ? 25   LEU A CG    1 
ATOM   53   C  CD1   . LEU A 1 8   ? -17.963 -7.461  5.273   1.00 35.89  ? 25   LEU A CD1   1 
ATOM   54   C  CD2   . LEU A 1 8   ? -18.184 -5.416  6.505   1.00 38.24  ? 25   LEU A CD2   1 
ATOM   55   N  N     . PHE A 1 9   ? -21.883 -8.545  4.626   1.00 29.12  ? 26   PHE A N     1 
ATOM   56   C  CA    . PHE A 1 9   ? -23.020 -9.097  5.355   1.00 27.09  ? 26   PHE A CA    1 
ATOM   57   C  C     . PHE A 1 9   ? -22.542 -9.919  6.543   1.00 25.13  ? 26   PHE A C     1 
ATOM   58   O  O     . PHE A 1 9   ? -21.585 -10.681 6.385   1.00 25.48  ? 26   PHE A O     1 
ATOM   59   C  CB    . PHE A 1 9   ? -23.889 -9.991  4.425   1.00 25.88  ? 26   PHE A CB    1 
ATOM   60   C  CG    . PHE A 1 9   ? -24.433 -9.310  3.232   1.00 27.30  ? 26   PHE A CG    1 
ATOM   61   C  CD1   . PHE A 1 9   ? -25.113 -8.099  3.361   1.00 28.78  ? 26   PHE A CD1   1 
ATOM   62   C  CD2   . PHE A 1 9   ? -24.320 -9.883  1.951   1.00 27.90  ? 26   PHE A CD2   1 
ATOM   63   C  CE1   . PHE A 1 9   ? -25.679 -7.482  2.246   1.00 31.20  ? 26   PHE A CE1   1 
ATOM   64   C  CE2   . PHE A 1 9   ? -24.865 -9.247  0.847   1.00 29.39  ? 26   PHE A CE2   1 
ATOM   65   C  CZ    . PHE A 1 9   ? -25.541 -8.048  0.991   1.00 31.14  ? 26   PHE A CZ    1 
ATOM   66   N  N     . LYS A 1 10  ? -23.227 -9.781  7.689   1.00 23.86  ? 27   LYS A N     1 
ATOM   67   C  CA    . LYS A 1 10  ? -23.031 -10.628 8.816   1.00 21.93  ? 27   LYS A CA    1 
ATOM   68   C  C     . LYS A 1 10  ? -23.874 -11.886 8.698   1.00 22.29  ? 27   LYS A C     1 
ATOM   69   O  O     . LYS A 1 10  ? -25.154 -11.828 8.723   1.00 23.00  ? 27   LYS A O     1 
ATOM   70   C  CB    . LYS A 1 10  ? -23.336 -9.905  10.099  1.00 23.82  ? 27   LYS A CB    1 
ATOM   71   C  CG    . LYS A 1 10  ? -23.250 -10.769 11.344  1.00 24.66  ? 27   LYS A CG    1 
ATOM   72   C  CD    . LYS A 1 10  ? -23.397 -9.932  12.593  1.00 27.53  ? 27   LYS A CD    1 
ATOM   73   C  CE    . LYS A 1 10  ? -23.415 -10.790 13.824  1.00 27.50  ? 27   LYS A CE    1 
ATOM   74   N  NZ    . LYS A 1 10  ? -23.357 -9.967  15.096  1.00 28.84  ? 27   LYS A NZ    1 
ATOM   75   N  N     . VAL A 1 11  ? -23.192 -13.011 8.630   1.00 20.73  ? 28   VAL A N     1 
ATOM   76   C  CA    . VAL A 1 11  ? -23.802 -14.329 8.622   1.00 21.31  ? 28   VAL A CA    1 
ATOM   77   C  C     . VAL A 1 11  ? -23.432 -15.276 9.780   1.00 22.79  ? 28   VAL A C     1 
ATOM   78   O  O     . VAL A 1 11  ? -22.260 -15.467 10.109  1.00 22.56  ? 28   VAL A O     1 
ATOM   79   C  CB    . VAL A 1 11  ? -23.490 -14.968 7.277   1.00 19.24  ? 28   VAL A CB    1 
ATOM   80   C  CG1   . VAL A 1 11  ? -24.012 -16.388 7.153   1.00 17.04  ? 28   VAL A CG1   1 
ATOM   81   C  CG2   . VAL A 1 11  ? -23.980 -14.030 6.117   1.00 18.34  ? 28   VAL A CG2   1 
ATOM   82   N  N     . LEU A 1 12  ? -24.448 -15.883 10.384  1.00 24.60  ? 29   LEU A N     1 
ATOM   83   C  CA    . LEU A 1 12  ? -24.252 -16.755 11.532  1.00 23.32  ? 29   LEU A CA    1 
ATOM   84   C  C     . LEU A 1 12  ? -24.125 -18.184 11.100  1.00 23.03  ? 29   LEU A C     1 
ATOM   85   O  O     . LEU A 1 12  ? -24.741 -18.591 10.141  1.00 23.84  ? 29   LEU A O     1 
ATOM   86   C  CB    . LEU A 1 12  ? -25.442 -16.656 12.491  1.00 21.00  ? 29   LEU A CB    1 
ATOM   87   C  CG    . LEU A 1 12  ? -25.678 -15.243 12.990  1.00 21.04  ? 29   LEU A CG    1 
ATOM   88   C  CD1   . LEU A 1 12  ? -27.014 -15.164 13.657  1.00 19.39  ? 29   LEU A CD1   1 
ATOM   89   C  CD2   . LEU A 1 12  ? -24.677 -14.805 14.028  1.00 21.79  ? 29   LEU A CD2   1 
ATOM   90   N  N     . VAL A 1 13  ? -23.316 -18.946 11.831  1.00 22.75  ? 30   VAL A N     1 
ATOM   91   C  CA    . VAL A 1 13  ? -23.216 -20.381 11.610  1.00 20.58  ? 30   VAL A CA    1 
ATOM   92   C  C     . VAL A 1 13  ? -23.476 -21.034 12.926  1.00 20.13  ? 30   VAL A C     1 
ATOM   93   O  O     . VAL A 1 13  ? -22.653 -20.902 13.840  1.00 18.99  ? 30   VAL A O     1 
ATOM   94   C  CB    . VAL A 1 13  ? -21.876 -20.847 11.050  1.00 19.27  ? 30   VAL A CB    1 
ATOM   95   C  CG1   . VAL A 1 13  ? -21.969 -22.377 10.664  1.00 16.32  ? 30   VAL A CG1   1 
ATOM   96   C  CG2   . VAL A 1 13  ? -21.536 -20.082 9.810   1.00 19.12  ? 30   VAL A CG2   1 
ATOM   97   N  N     . ILE A 1 14  ? -24.644 -21.719 13.077  1.00 18.80  ? 31   ILE A N     1 
ATOM   98   C  CA    . ILE A 1 14  ? -24.962 -22.185 14.411  1.00 19.80  ? 31   ILE A CA    1 
ATOM   99   C  C     . ILE A 1 14  ? -25.368 -23.657 14.329  1.00 19.95  ? 31   ILE A C     1 
ATOM   100  O  O     . ILE A 1 14  ? -25.620 -24.178 13.222  1.00 19.82  ? 31   ILE A O     1 
ATOM   101  C  CB    . ILE A 1 14  ? -26.056 -21.374 15.100  1.00 19.22  ? 31   ILE A CB    1 
ATOM   102  C  CG1   . ILE A 1 14  ? -27.397 -21.500 14.325  1.00 19.67  ? 31   ILE A CG1   1 
ATOM   103  C  CG2   . ILE A 1 14  ? -25.683 -19.906 15.325  1.00 18.16  ? 31   ILE A CG2   1 
ATOM   104  C  CD1   . ILE A 1 14  ? -28.408 -20.571 14.906  1.00 20.01  ? 31   ILE A CD1   1 
ATOM   105  N  N     . GLY A 1 15  ? -25.383 -24.307 15.478  1.00 18.96  ? 32   GLY A N     1 
ATOM   106  C  CA    . GLY A 1 15  ? -25.616 -25.782 15.571  1.00 20.65  ? 32   GLY A CA    1 
ATOM   107  C  C     . GLY A 1 15  ? -24.902 -26.437 16.756  1.00 22.64  ? 32   GLY A C     1 
ATOM   108  O  O     . GLY A 1 15  ? -24.075 -25.814 17.439  1.00 22.63  ? 32   GLY A O     1 
ATOM   109  N  N     . GLU A 1 16  ? -25.225 -27.702 17.012  1.00 24.50  ? 33   GLU A N     1 
ATOM   110  C  CA    . GLU A 1 16  ? -24.770 -28.391 18.229  1.00 26.83  ? 33   GLU A CA    1 
ATOM   111  C  C     . GLU A 1 16  ? -23.270 -28.668 18.085  1.00 25.81  ? 33   GLU A C     1 
ATOM   112  O  O     . GLU A 1 16  ? -22.750 -28.680 16.986  1.00 21.40  ? 33   GLU A O     1 
ATOM   113  C  CB    . GLU A 1 16  ? -25.452 -29.763 18.464  1.00 30.68  ? 33   GLU A CB    1 
ATOM   114  C  CG    . GLU A 1 16  ? -26.919 -29.728 18.969  1.00 34.60  ? 33   GLU A CG    1 
ATOM   115  C  CD    . GLU A 1 16  ? -27.145 -28.921 20.247  1.00 36.76  ? 33   GLU A CD    1 
ATOM   116  O  OE1   . GLU A 1 16  ? -27.263 -27.687 20.171  1.00 39.01  ? 33   GLU A OE1   1 
ATOM   117  O  OE2   . GLU A 1 16  ? -27.178 -29.494 21.351  1.00 40.33  ? 33   GLU A OE2   1 
ATOM   118  N  N     . LEU A 1 17  ? -22.631 -28.917 19.207  1.00 25.88  ? 34   LEU A N     1 
ATOM   119  C  CA    . LEU A 1 17  ? -21.229 -29.413 19.287  1.00 26.38  ? 34   LEU A CA    1 
ATOM   120  C  C     . LEU A 1 17  ? -20.915 -30.474 18.272  1.00 26.13  ? 34   LEU A C     1 
ATOM   121  O  O     . LEU A 1 17  ? -21.683 -31.395 18.146  1.00 27.76  ? 34   LEU A O     1 
ATOM   122  C  CB    . LEU A 1 17  ? -21.048 -30.031 20.641  1.00 27.75  ? 34   LEU A CB    1 
ATOM   123  C  CG    . LEU A 1 17  ? -21.080 -29.072 21.821  1.00 29.00  ? 34   LEU A CG    1 
ATOM   124  C  CD1   . LEU A 1 17  ? -21.281 -29.891 23.090  1.00 29.90  ? 34   LEU A CD1   1 
ATOM   125  C  CD2   . LEU A 1 17  ? -19.800 -28.266 21.894  1.00 28.83  ? 34   LEU A CD2   1 
ATOM   126  N  N     . GLY A 1 18  ? -19.839 -30.280 17.511  1.00 25.75  ? 35   GLY A N     1 
ATOM   127  C  CA    . GLY A 1 18  ? -19.238 -31.344 16.689  1.00 25.99  ? 35   GLY A CA    1 
ATOM   128  C  C     . GLY A 1 18  ? -19.924 -31.580 15.376  1.00 25.32  ? 35   GLY A C     1 
ATOM   129  O  O     . GLY A 1 18  ? -19.611 -32.571 14.741  1.00 25.58  ? 35   GLY A O     1 
ATOM   130  N  N     . VAL A 1 19  ? -20.854 -30.692 14.960  1.00 24.18  ? 36   VAL A N     1 
ATOM   131  C  CA    . VAL A 1 19  ? -21.639 -30.912 13.727  1.00 22.04  ? 36   VAL A CA    1 
ATOM   132  C  C     . VAL A 1 19  ? -20.906 -30.526 12.489  1.00 24.55  ? 36   VAL A C     1 
ATOM   133  O  O     . VAL A 1 19  ? -21.260 -31.022 11.436  1.00 22.80  ? 36   VAL A O     1 
ATOM   134  C  CB    . VAL A 1 19  ? -23.048 -30.262 13.678  1.00 21.72  ? 36   VAL A CB    1 
ATOM   135  C  CG1   . VAL A 1 19  ? -23.923 -30.816 14.769  1.00 22.79  ? 36   VAL A CG1   1 
ATOM   136  C  CG2   . VAL A 1 19  ? -23.007 -28.710 13.704  1.00 20.23  ? 36   VAL A CG2   1 
ATOM   137  N  N     . GLY A 1 20  ? -19.842 -29.692 12.612  1.00 20.49  ? 37   GLY A N     1 
ATOM   138  C  CA    . GLY A 1 20  ? -19.048 -29.258 11.488  1.00 23.88  ? 37   GLY A CA    1 
ATOM   139  C  C     . GLY A 1 20  ? -18.970 -27.730 11.240  1.00 22.32  ? 37   GLY A C     1 
ATOM   140  O  O     . GLY A 1 20  ? -18.591 -27.341 10.220  1.00 23.71  ? 37   GLY A O     1 
ATOM   141  N  N     . LYS A 1 21  ? -19.494 -26.901 12.100  1.00 21.25  ? 38   LYS A N     1 
ATOM   142  C  CA    . LYS A 1 21  ? -19.588 -25.422 11.867  1.00 21.37  ? 38   LYS A CA    1 
ATOM   143  C  C     . LYS A 1 21  ? -18.250 -24.865 11.456  1.00 20.25  ? 38   LYS A C     1 
ATOM   144  O  O     . LYS A 1 21  ? -18.140 -24.324 10.378  1.00 21.57  ? 38   LYS A O     1 
ATOM   145  C  CB    . LYS A 1 21  ? -20.066 -24.715 13.102  1.00 19.95  ? 38   LYS A CB    1 
ATOM   146  C  CG    . LYS A 1 21  ? -21.531 -25.026 13.441  1.00 22.66  ? 38   LYS A CG    1 
ATOM   147  C  CD    . LYS A 1 21  ? -21.987 -24.374 14.758  1.00 24.12  ? 38   LYS A CD    1 
ATOM   148  C  CE    . LYS A 1 21  ? -21.200 -24.774 15.997  1.00 26.52  ? 38   LYS A CE    1 
ATOM   149  N  NZ    . LYS A 1 21  ? -21.126 -26.254 16.282  1.00 29.00  ? 38   LYS A NZ    1 
ATOM   150  N  N     . THR A 1 22  ? -17.212 -25.204 12.195  1.00 21.63  ? 39   THR A N     1 
ATOM   151  C  CA    . THR A 1 22  ? -15.880 -24.685 11.980  1.00 22.97  ? 39   THR A CA    1 
ATOM   152  C  C     . THR A 1 22  ? -15.284 -25.157 10.678  1.00 22.82  ? 39   THR A C     1 
ATOM   153  O  O     . THR A 1 22  ? -14.646 -24.365 9.979   1.00 21.87  ? 39   THR A O     1 
ATOM   154  C  CB    . THR A 1 22  ? -14.993 -24.916 13.162  1.00 25.72  ? 39   THR A CB    1 
ATOM   155  O  OG1   . THR A 1 22  ? -15.523 -24.186 14.272  1.00 30.42  ? 39   THR A OG1   1 
ATOM   156  C  CG2   . THR A 1 22  ? -13.448 -24.533 12.948  1.00 23.67  ? 39   THR A CG2   1 
ATOM   157  N  N     . SER A 1 23  ? -15.504 -26.420 10.364  1.00 22.13  ? 40   SER A N     1 
ATOM   158  C  CA    . SER A 1 23  ? -14.983 -27.058 9.204   1.00 21.32  ? 40   SER A CA    1 
ATOM   159  C  C     . SER A 1 23  ? -15.639 -26.657 7.934   1.00 20.31  ? 40   SER A C     1 
ATOM   160  O  O     . SER A 1 23  ? -14.989 -26.605 6.902   1.00 19.87  ? 40   SER A O     1 
ATOM   161  C  CB    . SER A 1 23  ? -15.133 -28.619 9.332   1.00 20.87  ? 40   SER A CB    1 
ATOM   162  O  OG    . SER A 1 23  ? -14.485 -29.074 10.480  1.00 21.18  ? 40   SER A OG    1 
ATOM   163  N  N     . ILE A 1 24  ? -16.954 -26.411 7.961   1.00 18.25  ? 41   ILE A N     1 
ATOM   164  C  CA    . ILE A 1 24  ? -17.610 -25.907 6.780   1.00 17.95  ? 41   ILE A CA    1 
ATOM   165  C  C     . ILE A 1 24  ? -17.031 -24.481 6.452   1.00 17.38  ? 41   ILE A C     1 
ATOM   166  O  O     . ILE A 1 24  ? -16.799 -24.157 5.268   1.00 20.49  ? 41   ILE A O     1 
ATOM   167  C  CB    . ILE A 1 24  ? -19.165 -25.838 7.054   1.00 19.39  ? 41   ILE A CB    1 
ATOM   168  C  CG1   . ILE A 1 24  ? -19.765 -27.219 6.939   1.00 19.98  ? 41   ILE A CG1   1 
ATOM   169  C  CG2   . ILE A 1 24  ? -19.841 -24.762 6.239   1.00 17.11  ? 41   ILE A CG2   1 
ATOM   170  C  CD1   . ILE A 1 24  ? -21.133 -27.367 7.590   1.00 18.79  ? 41   ILE A CD1   1 
ATOM   171  N  N     . ILE A 1 25  ? -16.795 -23.671 7.464   1.00 16.91  ? 42   ILE A N     1 
ATOM   172  C  CA    . ILE A 1 25  ? -16.251 -22.308 7.237   1.00 18.79  ? 42   ILE A CA    1 
ATOM   173  C  C     . ILE A 1 25  ? -14.782 -22.385 6.696   1.00 22.33  ? 42   ILE A C     1 
ATOM   174  O  O     . ILE A 1 25  ? -14.427 -21.701 5.740   1.00 23.61  ? 42   ILE A O     1 
ATOM   175  C  CB    . ILE A 1 25  ? -16.309 -21.503 8.522   1.00 18.76  ? 42   ILE A CB    1 
ATOM   176  C  CG1   . ILE A 1 25  ? -17.768 -21.235 8.899   1.00 20.59  ? 42   ILE A CG1   1 
ATOM   177  C  CG2   . ILE A 1 25  ? -15.587 -20.146 8.391   1.00 17.63  ? 42   ILE A CG2   1 
ATOM   178  C  CD1   . ILE A 1 25  ? -17.920 -20.695 10.339  1.00 19.99  ? 42   ILE A CD1   1 
ATOM   179  N  N     . LYS A 1 26  ? -13.982 -23.306 7.256   1.00 23.08  ? 43   LYS A N     1 
ATOM   180  C  CA    . LYS A 1 26  ? -12.604 -23.467 6.843   1.00 24.44  ? 43   LYS A CA    1 
ATOM   181  C  C     . LYS A 1 26  ? -12.485 -23.999 5.396   1.00 26.99  ? 43   LYS A C     1 
ATOM   182  O  O     . LYS A 1 26  ? -11.631 -23.550 4.594   1.00 29.25  ? 43   LYS A O     1 
ATOM   183  C  CB    . LYS A 1 26  ? -11.820 -24.282 7.887   1.00 26.10  ? 43   LYS A CB    1 
ATOM   184  C  CG    . LYS A 1 26  ? -10.355 -24.608 7.542   1.00 28.85  ? 43   LYS A CG    1 
ATOM   185  C  CD    . LYS A 1 26  ? -9.567  -25.189 8.720   1.00 32.56  ? 43   LYS A CD    1 
ATOM   186  C  CE    . LYS A 1 26  ? -8.540  -26.231 8.280   1.00 36.33  ? 43   LYS A CE    1 
ATOM   187  N  NZ    . LYS A 1 26  ? -7.689  -26.852 9.355   1.00 38.57  ? 43   LYS A NZ    1 
ATOM   188  N  N     . ARG A 1 27  ? -13.350 -24.935 5.044   1.00 27.76  ? 44   ARG A N     1 
ATOM   189  C  CA    . ARG A 1 27  ? -13.442 -25.384 3.659   1.00 27.14  ? 44   ARG A CA    1 
ATOM   190  C  C     . ARG A 1 27  ? -13.871 -24.278 2.691   1.00 25.58  ? 44   ARG A C     1 
ATOM   191  O  O     . ARG A 1 27  ? -13.262 -24.067 1.658   1.00 25.28  ? 44   ARG A O     1 
ATOM   192  C  CB    . ARG A 1 27  ? -14.382 -26.559 3.533   1.00 26.71  ? 44   ARG A CB    1 
ATOM   193  C  CG    . ARG A 1 27  ? -14.727 -26.899 2.101   1.00 28.90  ? 44   ARG A CG    1 
ATOM   194  C  CD    . ARG A 1 27  ? -13.539 -27.385 1.300   1.00 31.54  ? 44   ARG A CD    1 
ATOM   195  N  NE    . ARG A 1 27  ? -13.155 -28.714 1.747   1.00 33.75  ? 44   ARG A NE    1 
ATOM   196  C  CZ    . ARG A 1 27  ? -12.087 -29.398 1.347   1.00 35.62  ? 44   ARG A CZ    1 
ATOM   197  N  NH1   . ARG A 1 27  ? -11.259 -28.875 0.458   1.00 37.32  ? 44   ARG A NH1   1 
ATOM   198  N  NH2   . ARG A 1 27  ? -11.836 -30.586 1.887   1.00 35.59  ? 44   ARG A NH2   1 
ATOM   199  N  N     . TYR A 1 28  ? -14.958 -23.620 3.000   1.00 26.35  ? 45   TYR A N     1 
ATOM   200  C  CA    . TYR A 1 28  ? -15.432 -22.534 2.148   1.00 27.11  ? 45   TYR A CA    1 
ATOM   201  C  C     . TYR A 1 28  ? -14.450 -21.347 2.024   1.00 27.94  ? 45   TYR A C     1 
ATOM   202  O  O     . TYR A 1 28  ? -14.314 -20.798 0.948   1.00 30.88  ? 45   TYR A O     1 
ATOM   203  C  CB    . TYR A 1 28  ? -16.775 -22.105 2.692   1.00 25.79  ? 45   TYR A CB    1 
ATOM   204  C  CG    . TYR A 1 28  ? -17.507 -21.075 1.852   1.00 26.54  ? 45   TYR A CG    1 
ATOM   205  C  CD1   . TYR A 1 28  ? -17.641 -21.246 0.467   1.00 28.47  ? 45   TYR A CD1   1 
ATOM   206  C  CD2   . TYR A 1 28  ? -18.105 -20.026 2.425   1.00 25.07  ? 45   TYR A CD2   1 
ATOM   207  C  CE1   . TYR A 1 28  ? -18.329 -20.351 -0.307  1.00 29.46  ? 45   TYR A CE1   1 
ATOM   208  C  CE2   . TYR A 1 28  ? -18.832 -19.089 1.664   1.00 26.33  ? 45   TYR A CE2   1 
ATOM   209  C  CZ    . TYR A 1 28  ? -18.943 -19.259 0.311   1.00 27.79  ? 45   TYR A CZ    1 
ATOM   210  O  OH    . TYR A 1 28  ? -19.617 -18.305 -0.420  1.00 27.68  ? 45   TYR A OH    1 
ATOM   211  N  N     . VAL A 1 29  ? -13.747 -20.991 3.083   1.00 26.40  ? 46   VAL A N     1 
ATOM   212  C  CA    . VAL A 1 29  ? -12.882 -19.767 3.089   1.00 27.10  ? 46   VAL A CA    1 
ATOM   213  C  C     . VAL A 1 29  ? -11.442 -20.109 2.714   1.00 30.20  ? 46   VAL A C     1 
ATOM   214  O  O     . VAL A 1 29  ? -10.796 -19.417 1.937   1.00 29.85  ? 46   VAL A O     1 
ATOM   215  C  CB    . VAL A 1 29  ? -13.004 -19.037 4.467   1.00 24.62  ? 46   VAL A CB    1 
ATOM   216  C  CG1   . VAL A 1 29  ? -12.087 -17.831 4.563   1.00 25.19  ? 46   VAL A CG1   1 
ATOM   217  C  CG2   . VAL A 1 29  ? -14.412 -18.638 4.671   1.00 22.34  ? 46   VAL A CG2   1 
ATOM   218  N  N     . HIS A 1 30  ? -10.929 -21.210 3.227   1.00 31.26  ? 47   HIS A N     1 
ATOM   219  C  CA    . HIS A 1 30  ? -9.511  -21.537 2.997   1.00 35.50  ? 47   HIS A CA    1 
ATOM   220  C  C     . HIS A 1 30  ? -9.303  -22.771 2.151   1.00 38.29  ? 47   HIS A C     1 
ATOM   221  O  O     . HIS A 1 30  ? -8.180  -23.094 1.878   1.00 40.74  ? 47   HIS A O     1 
ATOM   222  C  CB    . HIS A 1 30  ? -8.787  -21.725 4.324   1.00 36.10  ? 47   HIS A CB    1 
ATOM   223  C  CG    . HIS A 1 30  ? -8.876  -20.532 5.203   1.00 37.94  ? 47   HIS A CG    1 
ATOM   224  N  ND1   . HIS A 1 30  ? -8.233  -19.349 4.905   1.00 39.38  ? 47   HIS A ND1   1 
ATOM   225  C  CD2   . HIS A 1 30  ? -9.524  -20.327 6.374   1.00 37.43  ? 47   HIS A CD2   1 
ATOM   226  C  CE1   . HIS A 1 30  ? -8.491  -18.465 5.853   1.00 38.79  ? 47   HIS A CE1   1 
ATOM   227  N  NE2   . HIS A 1 30  ? -9.299  -19.027 6.741   1.00 37.74  ? 47   HIS A NE2   1 
ATOM   228  N  N     . GLN A 1 31  ? -10.374 -23.439 1.724   1.00 39.03  ? 48   GLN A N     1 
ATOM   229  C  CA    . GLN A 1 31  ? -10.252 -24.713 1.023   1.00 40.92  ? 48   GLN A CA    1 
ATOM   230  C  C     . GLN A 1 31  ? -9.352  -25.734 1.729   1.00 41.30  ? 48   GLN A C     1 
ATOM   231  O  O     . GLN A 1 31  ? -8.497  -26.384 1.121   1.00 42.80  ? 48   GLN A O     1 
ATOM   232  C  CB    . GLN A 1 31  ? -9.877  -24.486 -0.455  1.00 44.24  ? 48   GLN A CB    1 
ATOM   233  C  CG    . GLN A 1 31  ? -11.101 -24.197 -1.324  1.00 45.31  ? 48   GLN A CG    1 
ATOM   234  C  CD    . GLN A 1 31  ? -12.165 -25.310 -1.256  1.00 47.07  ? 48   GLN A CD    1 
ATOM   235  O  OE1   . GLN A 1 31  ? -11.832 -26.507 -1.292  1.00 48.82  ? 48   GLN A OE1   1 
ATOM   236  N  NE2   . GLN A 1 31  ? -13.455 -24.912 -1.125  1.00 46.93  ? 48   GLN A NE2   1 
ATOM   237  N  N     . LEU A 1 32  ? -9.600  -25.892 3.032   1.00 40.33  ? 49   LEU A N     1 
ATOM   238  C  CA    . LEU A 1 32  ? -8.857  -26.826 3.858   1.00 40.06  ? 49   LEU A CA    1 
ATOM   239  C  C     . LEU A 1 32  ? -9.799  -27.637 4.735   1.00 36.30  ? 49   LEU A C     1 
ATOM   240  O  O     . LEU A 1 32  ? -10.879 -27.179 5.105   1.00 33.53  ? 49   LEU A O     1 
ATOM   241  C  CB    . LEU A 1 32  ? -7.898  -26.040 4.760   1.00 40.85  ? 49   LEU A CB    1 
ATOM   242  C  CG    . LEU A 1 32  ? -6.668  -25.406 4.134   1.00 42.03  ? 49   LEU A CG    1 
ATOM   243  C  CD1   . LEU A 1 32  ? -5.935  -24.627 5.229   1.00 40.72  ? 49   LEU A CD1   1 
ATOM   244  C  CD2   . LEU A 1 32  ? -5.761  -26.473 3.552   1.00 43.95  ? 49   LEU A CD2   1 
ATOM   245  N  N     . PHE A 1 33  ? -9.341  -28.812 5.107   1.00 36.27  ? 50   PHE A N     1 
ATOM   246  C  CA    . PHE A 1 33  ? -10.058 -29.681 6.061   1.00 34.18  ? 50   PHE A CA    1 
ATOM   247  C  C     . PHE A 1 33  ? -9.084  -30.488 6.894   1.00 34.65  ? 50   PHE A C     1 
ATOM   248  O  O     . PHE A 1 33  ? -8.154  -31.047 6.377   1.00 34.50  ? 50   PHE A O     1 
ATOM   249  C  CB    . PHE A 1 33  ? -10.959 -30.647 5.301   1.00 32.73  ? 50   PHE A CB    1 
ATOM   250  C  CG    . PHE A 1 33  ? -11.668 -31.607 6.165   1.00 32.16  ? 50   PHE A CG    1 
ATOM   251  C  CD1   . PHE A 1 33  ? -12.875 -31.248 6.754   1.00 31.24  ? 50   PHE A CD1   1 
ATOM   252  C  CD2   . PHE A 1 33  ? -11.177 -32.882 6.377   1.00 32.75  ? 50   PHE A CD2   1 
ATOM   253  C  CE1   . PHE A 1 33  ? -13.560 -32.153 7.551   1.00 31.13  ? 50   PHE A CE1   1 
ATOM   254  C  CE2   . PHE A 1 33  ? -11.838 -33.762 7.201   1.00 33.48  ? 50   PHE A CE2   1 
ATOM   255  C  CZ    . PHE A 1 33  ? -13.051 -33.391 7.769   1.00 31.53  ? 50   PHE A CZ    1 
ATOM   256  N  N     . SER A 1 34  ? -9.357  -30.551 8.190   1.00 34.25  ? 51   SER A N     1 
ATOM   257  C  CA    . SER A 1 34  ? -8.705  -31.404 9.111   1.00 34.77  ? 51   SER A CA    1 
ATOM   258  C  C     . SER A 1 34  ? -9.765  -32.264 9.736   1.00 34.20  ? 51   SER A C     1 
ATOM   259  O  O     . SER A 1 34  ? -10.782 -31.806 10.180  1.00 32.43  ? 51   SER A O     1 
ATOM   260  C  CB    . SER A 1 34  ? -7.999  -30.563 10.199  1.00 35.66  ? 51   SER A CB    1 
ATOM   261  O  OG    . SER A 1 34  ? -7.449  -31.392 11.204  1.00 39.01  ? 51   SER A OG    1 
ATOM   262  N  N     . GLN A 1 35  ? -9.493  -33.557 9.786   1.00 36.98  ? 52   GLN A N     1 
ATOM   263  C  CA    . GLN A 1 35  ? -10.280 -34.468 10.600  1.00 38.10  ? 52   GLN A CA    1 
ATOM   264  C  C     . GLN A 1 35  ? -10.125 -34.237 12.124  1.00 36.75  ? 52   GLN A C     1 
ATOM   265  O  O     . GLN A 1 35  ? -10.882 -34.817 12.912  1.00 36.61  ? 52   GLN A O     1 
ATOM   266  C  CB    . GLN A 1 35  ? -9.929  -35.929 10.217  1.00 42.67  ? 52   GLN A CB    1 
ATOM   267  C  CG    . GLN A 1 35  ? -8.540  -36.326 10.576  1.00 47.21  ? 52   GLN A CG    1 
ATOM   268  C  CD    . GLN A 1 35  ? -7.478  -36.143 9.487   1.00 50.68  ? 52   GLN A CD    1 
ATOM   269  O  OE1   . GLN A 1 35  ? -7.440  -35.154 8.702   1.00 50.84  ? 52   GLN A OE1   1 
ATOM   270  N  NE2   . GLN A 1 35  ? -6.568  -37.103 9.467   1.00 53.74  ? 52   GLN A NE2   1 
ATOM   271  N  N     . HIS A 1 36  ? -9.109  -33.480 12.576  1.00 35.20  ? 53   HIS A N     1 
ATOM   272  C  CA    . HIS A 1 36  ? -8.863  -33.385 14.022  1.00 34.13  ? 53   HIS A CA    1 
ATOM   273  C  C     . HIS A 1 36  ? -9.840  -32.381 14.589  1.00 31.74  ? 53   HIS A C     1 
ATOM   274  O  O     . HIS A 1 36  ? -9.874  -31.269 14.185  1.00 30.97  ? 53   HIS A O     1 
ATOM   275  C  CB    . HIS A 1 36  ? -7.419  -33.042 14.355  1.00 35.77  ? 53   HIS A CB    1 
ATOM   276  C  CG    . HIS A 1 36  ? -6.447  -34.059 13.860  1.00 38.16  ? 53   HIS A CG    1 
ATOM   277  N  ND1   . HIS A 1 36  ? -6.621  -35.414 14.067  1.00 40.29  ? 53   HIS A ND1   1 
ATOM   278  C  CD2   . HIS A 1 36  ? -5.346  -33.936 13.076  1.00 39.24  ? 53   HIS A CD2   1 
ATOM   279  C  CE1   . HIS A 1 36  ? -5.650  -36.076 13.460  1.00 41.83  ? 53   HIS A CE1   1 
ATOM   280  N  NE2   . HIS A 1 36  ? -4.882  -35.201 12.825  1.00 41.83  ? 53   HIS A NE2   1 
ATOM   281  N  N     . TYR A 1 37  ? -10.637 -32.815 15.547  1.00 32.33  ? 54   TYR A N     1 
ATOM   282  C  CA    . TYR A 1 37  ? -11.541 -31.981 16.277  1.00 29.88  ? 54   TYR A CA    1 
ATOM   283  C  C     . TYR A 1 37  ? -10.810 -31.013 17.203  1.00 30.31  ? 54   TYR A C     1 
ATOM   284  O  O     . TYR A 1 37  ? -10.121 -31.405 18.086  1.00 28.82  ? 54   TYR A O     1 
ATOM   285  C  CB    . TYR A 1 37  ? -12.513 -32.827 17.097  1.00 27.92  ? 54   TYR A CB    1 
ATOM   286  C  CG    . TYR A 1 37  ? -13.563 -32.026 17.869  1.00 27.11  ? 54   TYR A CG    1 
ATOM   287  C  CD1   . TYR A 1 37  ? -14.236 -30.947 17.271  1.00 24.91  ? 54   TYR A CD1   1 
ATOM   288  C  CD2   . TYR A 1 37  ? -13.933 -32.375 19.158  1.00 27.66  ? 54   TYR A CD2   1 
ATOM   289  C  CE1   . TYR A 1 37  ? -15.235 -30.243 17.968  1.00 24.11  ? 54   TYR A CE1   1 
ATOM   290  C  CE2   . TYR A 1 37  ? -14.916 -31.678 19.871  1.00 26.87  ? 54   TYR A CE2   1 
ATOM   291  C  CZ    . TYR A 1 37  ? -15.558 -30.607 19.264  1.00 25.11  ? 54   TYR A CZ    1 
ATOM   292  O  OH    . TYR A 1 37  ? -16.507 -29.897 19.988  1.00 24.60  ? 54   TYR A OH    1 
ATOM   293  N  N     . ARG A 1 38  ? -10.995 -29.722 16.984  1.00 29.75  ? 55   ARG A N     1 
ATOM   294  C  CA    . ARG A 1 38  ? -10.526 -28.725 17.923  1.00 33.15  ? 55   ARG A CA    1 
ATOM   295  C  C     . ARG A 1 38  ? -11.801 -27.948 18.292  1.00 28.57  ? 55   ARG A C     1 
ATOM   296  O  O     . ARG A 1 38  ? -12.377 -27.315 17.478  1.00 23.23  ? 55   ARG A O     1 
ATOM   297  C  CB    . ARG A 1 38  ? -9.536  -27.796 17.241  1.00 38.12  ? 55   ARG A CB    1 
ATOM   298  C  CG    . ARG A 1 38  ? -8.230  -28.479 16.853  1.00 47.08  ? 55   ARG A CG    1 
ATOM   299  C  CD    . ARG A 1 38  ? -7.098  -27.473 16.644  1.00 55.68  ? 55   ARG A CD    1 
ATOM   300  N  NE    . ARG A 1 38  ? -6.388  -27.216 17.892  1.00 63.42  ? 55   ARG A NE    1 
ATOM   301  C  CZ    . ARG A 1 38  ? -5.718  -26.100 18.184  1.00 70.28  ? 55   ARG A CZ    1 
ATOM   302  N  NH1   . ARG A 1 38  ? -5.646  -25.080 17.322  1.00 73.13  ? 55   ARG A NH1   1 
ATOM   303  N  NH2   . ARG A 1 38  ? -5.111  -25.995 19.364  1.00 75.05  ? 55   ARG A NH2   1 
ATOM   304  N  N     . ALA A 1 39  ? -12.190 -27.982 19.560  1.00 27.59  ? 56   ALA A N     1 
ATOM   305  C  CA    . ALA A 1 39  ? -13.506 -27.509 19.958  1.00 26.25  ? 56   ALA A CA    1 
ATOM   306  C  C     . ALA A 1 39  ? -13.468 -25.971 20.021  1.00 25.48  ? 56   ALA A C     1 
ATOM   307  O  O     . ALA A 1 39  ? -12.557 -25.416 20.623  1.00 24.26  ? 56   ALA A O     1 
ATOM   308  C  CB    . ALA A 1 39  ? -13.815 -28.099 21.323  1.00 25.50  ? 56   ALA A CB    1 
ATOM   309  N  N     . THR A 1 40  ? -14.441 -25.301 19.458  1.00 26.17  ? 57   THR A N     1 
ATOM   310  C  CA    . THR A 1 40  ? -14.427 -23.836 19.473  1.00 28.70  ? 57   THR A CA    1 
ATOM   311  C  C     . THR A 1 40  ? -14.821 -23.314 20.894  1.00 28.98  ? 57   THR A C     1 
ATOM   312  O  O     . THR A 1 40  ? -15.678 -23.893 21.568  1.00 29.75  ? 57   THR A O     1 
ATOM   313  C  CB    . THR A 1 40  ? -15.331 -23.299 18.368  1.00 31.63  ? 57   THR A CB    1 
ATOM   314  O  OG1   . THR A 1 40  ? -14.928 -23.846 17.113  1.00 36.21  ? 57   THR A OG1   1 
ATOM   315  C  CG2   . THR A 1 40  ? -15.292 -21.725 18.307  1.00 29.95  ? 57   THR A CG2   1 
ATOM   316  N  N     . ILE A 1 41  ? -14.198 -22.226 21.344  1.00 30.92  ? 58   ILE A N     1 
ATOM   317  C  CA    . ILE A 1 41  ? -14.584 -21.525 22.577  1.00 32.25  ? 58   ILE A CA    1 
ATOM   318  C  C     . ILE A 1 41  ? -15.300 -20.214 22.239  1.00 33.32  ? 58   ILE A C     1 
ATOM   319  O  O     . ILE A 1 41  ? -14.751 -19.319 21.638  1.00 34.13  ? 58   ILE A O     1 
ATOM   320  C  CB    . ILE A 1 41  ? -13.395 -21.336 23.536  1.00 33.50  ? 58   ILE A CB    1 
ATOM   321  C  CG1   . ILE A 1 41  ? -12.861 -22.717 23.939  1.00 34.14  ? 58   ILE A CG1   1 
ATOM   322  C  CG2   . ILE A 1 41  ? -13.846 -20.604 24.803  1.00 34.96  ? 58   ILE A CG2   1 
ATOM   323  C  CD1   . ILE A 1 41  ? -11.570 -22.750 24.730  1.00 35.49  ? 58   ILE A CD1   1 
ATOM   324  N  N     . GLY A 1 42  ? -16.569 -20.123 22.588  1.00 34.26  ? 59   GLY A N     1 
ATOM   325  C  CA    . GLY A 1 42  ? -17.417 -18.898 22.285  1.00 33.48  ? 59   GLY A CA    1 
ATOM   326  C  C     . GLY A 1 42  ? -17.632 -18.643 20.812  1.00 33.44  ? 59   GLY A C     1 
ATOM   327  O  O     . GLY A 1 42  ? -18.344 -19.360 20.167  1.00 33.77  ? 59   GLY A O     1 
ATOM   328  N  N     . VAL A 1 43  ? -16.941 -17.639 20.248  1.00 33.92  ? 60   VAL A N     1 
ATOM   329  C  CA    . VAL A 1 43  ? -17.140 -17.286 18.831  1.00 34.11  ? 60   VAL A CA    1 
ATOM   330  C  C     . VAL A 1 43  ? -15.842 -17.200 18.106  1.00 35.15  ? 60   VAL A C     1 
ATOM   331  O  O     . VAL A 1 43  ? -14.895 -16.764 18.672  1.00 34.22  ? 60   VAL A O     1 
ATOM   332  C  CB    . VAL A 1 43  ? -17.955 -15.995 18.697  1.00 34.13  ? 60   VAL A CB    1 
ATOM   333  C  CG1   . VAL A 1 43  ? -18.179 -15.522 17.243  1.00 31.79  ? 60   VAL A CG1   1 
ATOM   334  C  CG2   . VAL A 1 43  ? -19.353 -16.289 19.272  1.00 34.88  ? 60   VAL A CG2   1 
ATOM   335  N  N     . ASP A 1 44  ? -15.852 -17.616 16.848  1.00 36.59  ? 61   ASP A N     1 
ATOM   336  C  CA    . ASP A 1 44  ? -14.674 -17.509 15.961  1.00 39.19  ? 61   ASP A CA    1 
ATOM   337  C  C     . ASP A 1 44  ? -15.177 -16.872 14.690  1.00 32.51  ? 61   ASP A C     1 
ATOM   338  O  O     . ASP A 1 44  ? -16.372 -16.788 14.512  1.00 29.74  ? 61   ASP A O     1 
ATOM   339  C  CB    . ASP A 1 44  ? -14.104 -18.914 15.666  1.00 45.64  ? 61   ASP A CB    1 
ATOM   340  C  CG    . ASP A 1 44  ? -12.748 -18.881 14.966  1.00 54.86  ? 61   ASP A CG    1 
ATOM   341  O  OD1   . ASP A 1 44  ? -12.044 -17.793 14.949  1.00 58.90  ? 61   ASP A OD1   1 
ATOM   342  O  OD2   . ASP A 1 44  ? -12.411 -19.958 14.386  1.00 59.38  ? 61   ASP A OD2   1 
ATOM   343  N  N     . PHE A 1 45  ? -14.278 -16.409 13.831  1.00 28.97  ? 62   PHE A N     1 
ATOM   344  C  CA    . PHE A 1 45  ? -14.628 -15.570 12.683  1.00 26.08  ? 62   PHE A CA    1 
ATOM   345  C  C     . PHE A 1 45  ? -13.839 -15.856 11.476  1.00 24.96  ? 62   PHE A C     1 
ATOM   346  O  O     . PHE A 1 45  ? -12.693 -16.269 11.557  1.00 26.31  ? 62   PHE A O     1 
ATOM   347  C  CB    . PHE A 1 45  ? -14.356 -14.118 12.994  1.00 26.60  ? 62   PHE A CB    1 
ATOM   348  C  CG    . PHE A 1 45  ? -15.168 -13.604 14.111  1.00 29.22  ? 62   PHE A CG    1 
ATOM   349  C  CD1   . PHE A 1 45  ? -16.405 -12.994 13.863  1.00 30.02  ? 62   PHE A CD1   1 
ATOM   350  C  CD2   . PHE A 1 45  ? -14.712 -13.690 15.433  1.00 31.19  ? 62   PHE A CD2   1 
ATOM   351  C  CE1   . PHE A 1 45  ? -17.162 -12.551 14.915  1.00 30.81  ? 62   PHE A CE1   1 
ATOM   352  C  CE2   . PHE A 1 45  ? -15.441 -13.168 16.483  1.00 32.27  ? 62   PHE A CE2   1 
ATOM   353  C  CZ    . PHE A 1 45  ? -16.662 -12.601 16.235  1.00 31.83  ? 62   PHE A CZ    1 
ATOM   354  N  N     . ALA A 1 46  ? -14.446 -15.523 10.363  1.00 23.91  ? 63   ALA A N     1 
ATOM   355  C  CA    . ALA A 1 46  ? -13.859 -15.615 9.077   1.00 24.51  ? 63   ALA A CA    1 
ATOM   356  C  C     . ALA A 1 46  ? -14.503 -14.544 8.221   1.00 26.59  ? 63   ALA A C     1 
ATOM   357  O  O     . ALA A 1 46  ? -15.639 -14.138 8.462   1.00 26.36  ? 63   ALA A O     1 
ATOM   358  C  CB    . ALA A 1 46  ? -14.120 -16.978 8.514   1.00 21.81  ? 63   ALA A CB    1 
ATOM   359  N  N     . LEU A 1 47  ? -13.802 -14.129 7.191   1.00 30.11  ? 64   LEU A N     1 
ATOM   360  C  CA    . LEU A 1 47  ? -14.320 -13.322 6.101   1.00 29.64  ? 64   LEU A CA    1 
ATOM   361  C  C     . LEU A 1 47  ? -14.246 -14.104 4.803   1.00 27.98  ? 64   LEU A C     1 
ATOM   362  O  O     . LEU A 1 47  ? -13.180 -14.522 4.397   1.00 28.41  ? 64   LEU A O     1 
ATOM   363  C  CB    . LEU A 1 47  ? -13.501 -12.034 6.001   1.00 31.41  ? 64   LEU A CB    1 
ATOM   364  C  CG    . LEU A 1 47  ? -14.019 -10.941 5.050   1.00 33.91  ? 64   LEU A CG    1 
ATOM   365  C  CD1   . LEU A 1 47  ? -15.152 -10.181 5.683   1.00 34.36  ? 64   LEU A CD1   1 
ATOM   366  C  CD2   . LEU A 1 47  ? -12.870 -9.990  4.732   1.00 36.59  ? 64   LEU A CD2   1 
ATOM   367  N  N     . LYS A 1 48  ? -15.374 -14.284 4.142   1.00 27.08  ? 65   LYS A N     1 
ATOM   368  C  CA    . LYS A 1 48  ? -15.359 -14.743 2.753   1.00 26.76  ? 65   LYS A CA    1 
ATOM   369  C  C     . LYS A 1 48  ? -15.605 -13.568 1.824   1.00 27.97  ? 65   LYS A C     1 
ATOM   370  O  O     . LYS A 1 48  ? -16.466 -12.771 2.076   1.00 25.67  ? 65   LYS A O     1 
ATOM   371  C  CB    . LYS A 1 48  ? -16.422 -15.789 2.559   1.00 26.52  ? 65   LYS A CB    1 
ATOM   372  C  CG    . LYS A 1 48  ? -16.581 -16.288 1.138   1.00 28.76  ? 65   LYS A CG    1 
ATOM   373  C  CD    . LYS A 1 48  ? -15.590 -17.361 0.786   1.00 29.98  ? 65   LYS A CD    1 
ATOM   374  C  CE    . LYS A 1 48  ? -15.632 -17.547 -0.704  1.00 32.41  ? 65   LYS A CE    1 
ATOM   375  N  NZ    . LYS A 1 48  ? -14.832 -18.753 -1.009  1.00 33.95  ? 65   LYS A NZ    1 
ATOM   376  N  N     . VAL A 1 49  ? -14.881 -13.572 0.731   1.00 30.09  ? 66   VAL A N     1 
ATOM   377  C  CA    . VAL A 1 49  ? -14.960 -12.629 -0.323  1.00 32.70  ? 66   VAL A CA    1 
ATOM   378  C  C     . VAL A 1 49  ? -15.513 -13.377 -1.490  1.00 33.63  ? 66   VAL A C     1 
ATOM   379  O  O     . VAL A 1 49  ? -14.874 -14.267 -2.008  1.00 34.03  ? 66   VAL A O     1 
ATOM   380  C  CB    . VAL A 1 49  ? -13.540 -12.069 -0.663  1.00 34.00  ? 66   VAL A CB    1 
ATOM   381  C  CG1   . VAL A 1 49  ? -13.603 -11.120 -1.848  1.00 34.79  ? 66   VAL A CG1   1 
ATOM   382  C  CG2   . VAL A 1 49  ? -12.989 -11.330 0.538   1.00 33.82  ? 66   VAL A CG2   1 
ATOM   383  N  N     . LEU A 1 50  ? -16.711 -12.988 -1.937  1.00 35.03  ? 67   LEU A N     1 
ATOM   384  C  CA    . LEU A 1 50  ? -17.357 -13.607 -3.079  1.00 36.95  ? 67   LEU A CA    1 
ATOM   385  C  C     . LEU A 1 50  ? -17.527 -12.635 -4.264  1.00 40.20  ? 67   LEU A C     1 
ATOM   386  O  O     . LEU A 1 50  ? -18.173 -11.567 -4.123  1.00 42.35  ? 67   LEU A O     1 
ATOM   387  C  CB    . LEU A 1 50  ? -18.700 -14.055 -2.530  1.00 37.40  ? 67   LEU A CB    1 
ATOM   388  C  CG    . LEU A 1 50  ? -19.600 -15.064 -3.226  1.00 39.55  ? 67   LEU A CG    1 
ATOM   389  C  CD1   . LEU A 1 50  ? -18.779 -16.321 -3.582  1.00 40.20  ? 67   LEU A CD1   1 
ATOM   390  C  CD2   . LEU A 1 50  ? -20.787 -15.390 -2.301  1.00 38.70  ? 67   LEU A CD2   1 
ATOM   391  N  N     . ASN A 1 51  ? -16.985 -13.017 -5.413  1.00 41.42  ? 68   ASN A N     1 
ATOM   392  C  CA    . ASN A 1 51  ? -17.138 -12.268 -6.617  1.00 44.55  ? 68   ASN A CA    1 
ATOM   393  C  C     . ASN A 1 51  ? -18.438 -12.733 -7.189  1.00 42.15  ? 68   ASN A C     1 
ATOM   394  O  O     . ASN A 1 51  ? -18.464 -13.711 -7.914  1.00 42.65  ? 68   ASN A O     1 
ATOM   395  C  CB    . ASN A 1 51  ? -16.005 -12.547 -7.598  1.00 49.01  ? 68   ASN A CB    1 
ATOM   396  C  CG    . ASN A 1 51  ? -14.697 -11.993 -7.123  1.00 52.35  ? 68   ASN A CG    1 
ATOM   397  O  OD1   . ASN A 1 51  ? -13.687 -12.729 -6.993  1.00 55.08  ? 68   ASN A OD1   1 
ATOM   398  N  ND2   . ASN A 1 51  ? -14.677 -10.678 -6.843  1.00 54.05  ? 68   ASN A ND2   1 
ATOM   399  N  N     . TRP A 1 52  ? -19.525 -12.073 -6.797  1.00 38.38  ? 69   TRP A N     1 
ATOM   400  C  CA    . TRP A 1 52  ? -20.853 -12.562 -7.075  1.00 34.82  ? 69   TRP A CA    1 
ATOM   401  C  C     . TRP A 1 52  ? -21.089 -12.565 -8.579  1.00 33.93  ? 69   TRP A C     1 
ATOM   402  O  O     . TRP A 1 52  ? -21.445 -13.570 -9.144  1.00 34.81  ? 69   TRP A O     1 
ATOM   403  C  CB    . TRP A 1 52  ? -21.891 -11.695 -6.372  1.00 34.34  ? 69   TRP A CB    1 
ATOM   404  C  CG    . TRP A 1 52  ? -23.322 -12.117 -6.646  1.00 33.06  ? 69   TRP A CG    1 
ATOM   405  C  CD1   . TRP A 1 52  ? -24.182 -11.573 -7.533  1.00 33.74  ? 69   TRP A CD1   1 
ATOM   406  C  CD2   . TRP A 1 52  ? -24.001 -13.211 -6.050  1.00 31.83  ? 69   TRP A CD2   1 
ATOM   407  N  NE1   . TRP A 1 52  ? -25.393 -12.236 -7.524  1.00 33.33  ? 69   TRP A NE1   1 
ATOM   408  C  CE2   . TRP A 1 52  ? -25.304 -13.260 -6.614  1.00 32.13  ? 69   TRP A CE2   1 
ATOM   409  C  CE3   . TRP A 1 52  ? -23.648 -14.171 -5.096  1.00 30.75  ? 69   TRP A CE3   1 
ATOM   410  C  CZ2   . TRP A 1 52  ? -26.240 -14.218 -6.242  1.00 32.34  ? 69   TRP A CZ2   1 
ATOM   411  C  CZ3   . TRP A 1 52  ? -24.573 -15.118 -4.739  1.00 30.97  ? 69   TRP A CZ3   1 
ATOM   412  C  CH2   . TRP A 1 52  ? -25.856 -15.118 -5.276  1.00 31.41  ? 69   TRP A CH2   1 
ATOM   413  N  N     . ASP A 1 53  ? -20.863 -11.428 -9.221  1.00 33.13  ? 70   ASP A N     1 
ATOM   414  C  CA    . ASP A 1 53  ? -20.902 -11.294 -10.648 1.00 34.75  ? 70   ASP A CA    1 
ATOM   415  C  C     . ASP A 1 53  ? -20.153 -9.996  -10.976 1.00 36.84  ? 70   ASP A C     1 
ATOM   416  O  O     . ASP A 1 53  ? -19.534 -9.410  -10.093 1.00 36.64  ? 70   ASP A O     1 
ATOM   417  C  CB    . ASP A 1 53  ? -22.362 -11.315 -11.196 1.00 35.58  ? 70   ASP A CB    1 
ATOM   418  C  CG    . ASP A 1 53  ? -23.215 -10.106 -10.773 1.00 37.11  ? 70   ASP A CG    1 
ATOM   419  O  OD1   . ASP A 1 53  ? -22.644 -9.072  -10.301 1.00 37.64  ? 70   ASP A OD1   1 
ATOM   420  O  OD2   . ASP A 1 53  ? -24.484 -10.165 -10.929 1.00 36.89  ? 70   ASP A OD2   1 
ATOM   421  N  N     . SER A 1 54  ? -20.290 -9.528  -12.203 1.00 38.57  ? 71   SER A N     1 
ATOM   422  C  CA    . SER A 1 54  ? -19.592 -8.388  -12.714 1.00 39.95  ? 71   SER A CA    1 
ATOM   423  C  C     . SER A 1 54  ? -19.997 -7.044  -12.104 1.00 41.50  ? 71   SER A C     1 
ATOM   424  O  O     . SER A 1 54  ? -19.268 -6.073  -12.276 1.00 42.55  ? 71   SER A O     1 
ATOM   425  C  CB    . SER A 1 54  ? -19.733 -8.330  -14.213 1.00 40.96  ? 71   SER A CB    1 
ATOM   426  O  OG    . SER A 1 54  ? -21.057 -7.904  -14.587 1.00 43.06  ? 71   SER A OG    1 
ATOM   427  N  N     . ARG A 1 55  ? -21.127 -6.959  -11.409 1.00 40.08  ? 72   ARG A N     1 
ATOM   428  C  CA    . ARG A 1 55  ? -21.550 -5.702  -10.792 1.00 41.25  ? 72   ARG A CA    1 
ATOM   429  C  C     . ARG A 1 55  ? -21.604 -5.832  -9.282  1.00 37.40  ? 72   ARG A C     1 
ATOM   430  O  O     . ARG A 1 55  ? -22.038 -4.904  -8.619  1.00 36.84  ? 72   ARG A O     1 
ATOM   431  C  CB    . ARG A 1 55  ? -22.932 -5.320  -11.297 1.00 45.61  ? 72   ARG A CB    1 
ATOM   432  C  CG    . ARG A 1 55  ? -23.016 -5.127  -12.775 1.00 51.83  ? 72   ARG A CG    1 
ATOM   433  C  CD    . ARG A 1 55  ? -24.118 -4.142  -13.082 1.00 56.51  ? 72   ARG A CD    1 
ATOM   434  N  NE    . ARG A 1 55  ? -24.373 -4.035  -14.512 1.00 61.54  ? 72   ARG A NE    1 
ATOM   435  C  CZ    . ARG A 1 55  ? -25.405 -3.390  -15.055 1.00 65.43  ? 72   ARG A CZ    1 
ATOM   436  N  NH1   . ARG A 1 55  ? -26.315 -2.782  -14.281 1.00 66.34  ? 72   ARG A NH1   1 
ATOM   437  N  NH2   . ARG A 1 55  ? -25.527 -3.348  -16.383 1.00 67.76  ? 72   ARG A NH2   1 
ATOM   438  N  N     . THR A 1 56  ? -21.076 -6.906  -8.728  1.00 33.84  ? 73   THR A N     1 
ATOM   439  C  CA    . THR A 1 56  ? -21.361 -7.272  -7.365  1.00 31.76  ? 73   THR A CA    1 
ATOM   440  C  C     . THR A 1 56  ? -20.194 -7.995  -6.675  1.00 31.30  ? 73   THR A C     1 
ATOM   441  O  O     . THR A 1 56  ? -19.846 -9.159  -7.027  1.00 30.86  ? 73   THR A O     1 
ATOM   442  C  CB    . THR A 1 56  ? -22.585 -8.229  -7.261  1.00 31.02  ? 73   THR A CB    1 
ATOM   443  O  OG1   . THR A 1 56  ? -23.636 -7.811  -8.136  1.00 33.22  ? 73   THR A OG1   1 
ATOM   444  C  CG2   . THR A 1 56  ? -23.111 -8.340  -5.795  1.00 27.96  ? 73   THR A CG2   1 
ATOM   445  N  N     . LEU A 1 57  ? -19.670 -7.361  -5.638  1.00 30.81  ? 74   LEU A N     1 
ATOM   446  C  CA    . LEU A 1 57  ? -18.707 -8.008  -4.777  1.00 32.27  ? 74   LEU A CA    1 
ATOM   447  C  C     . LEU A 1 57  ? -19.355 -8.137  -3.451  1.00 30.62  ? 74   LEU A C     1 
ATOM   448  O  O     . LEU A 1 57  ? -19.898 -7.189  -2.957  1.00 31.88  ? 74   LEU A O     1 
ATOM   449  C  CB    . LEU A 1 57  ? -17.412 -7.213  -4.706  1.00 36.99  ? 74   LEU A CB    1 
ATOM   450  C  CG    . LEU A 1 57  ? -16.317 -7.795  -3.802  1.00 38.85  ? 74   LEU A CG    1 
ATOM   451  C  CD1   . LEU A 1 57  ? -15.939 -9.183  -4.277  1.00 40.92  ? 74   LEU A CD1   1 
ATOM   452  C  CD2   . LEU A 1 57  ? -15.072 -6.947  -3.807  1.00 40.09  ? 74   LEU A CD2   1 
ATOM   453  N  N     . VAL A 1 58  ? -19.407 -9.348  -2.919  1.00 29.18  ? 75   VAL A N     1 
ATOM   454  C  CA    . VAL A 1 58  ? -19.971 -9.577  -1.602  1.00 28.26  ? 75   VAL A CA    1 
ATOM   455  C  C     . VAL A 1 58  ? -18.877 -10.042 -0.683  1.00 29.39  ? 75   VAL A C     1 
ATOM   456  O  O     . VAL A 1 58  ? -18.137 -10.974 -1.037  1.00 30.78  ? 75   VAL A O     1 
ATOM   457  C  CB    . VAL A 1 58  ? -21.053 -10.672 -1.617  1.00 26.29  ? 75   VAL A CB    1 
ATOM   458  C  CG1   . VAL A 1 58  ? -21.590 -10.955 -0.239  1.00 25.24  ? 75   VAL A CG1   1 
ATOM   459  C  CG2   . VAL A 1 58  ? -22.146 -10.359 -2.603  1.00 26.02  ? 75   VAL A CG2   1 
ATOM   460  N  N     . ARG A 1 59  ? -18.832 -9.468  0.515   1.00 28.79  ? 76   ARG A N     1 
ATOM   461  C  CA    . ARG A 1 59  ? -18.050 -10.009 1.621   1.00 29.11  ? 76   ARG A CA    1 
ATOM   462  C  C     . ARG A 1 59  ? -18.970 -10.469 2.711   1.00 28.24  ? 76   ARG A C     1 
ATOM   463  O  O     . ARG A 1 59  ? -19.899 -9.768  3.080   1.00 28.55  ? 76   ARG A O     1 
ATOM   464  C  CB    . ARG A 1 59  ? -17.119 -8.946  2.176   1.00 30.40  ? 76   ARG A CB    1 
ATOM   465  C  CG    . ARG A 1 59  ? -16.148 -8.475  1.159   1.00 33.78  ? 76   ARG A CG    1 
ATOM   466  C  CD    . ARG A 1 59  ? -15.316 -7.386  1.753   1.00 38.63  ? 76   ARG A CD    1 
ATOM   467  N  NE    . ARG A 1 59  ? -14.137 -7.192  0.919   1.00 42.49  ? 76   ARG A NE    1 
ATOM   468  C  CZ    . ARG A 1 59  ? -14.040 -6.374  -0.127  1.00 44.02  ? 76   ARG A CZ    1 
ATOM   469  N  NH1   . ARG A 1 59  ? -15.042 -5.566  -0.511  1.00 43.78  ? 76   ARG A NH1   1 
ATOM   470  N  NH2   . ARG A 1 59  ? -12.867 -6.338  -0.769  1.00 45.46  ? 76   ARG A NH2   1 
ATOM   471  N  N     . LEU A 1 60  ? -18.672 -11.638 3.261   1.00 26.59  ? 77   LEU A N     1 
ATOM   472  C  CA    . LEU A 1 60  ? -19.372 -12.192 4.392   1.00 25.32  ? 77   LEU A CA    1 
ATOM   473  C  C     . LEU A 1 60  ? -18.508 -12.223 5.598   1.00 26.51  ? 77   LEU A C     1 
ATOM   474  O  O     . LEU A 1 60  ? -17.425 -12.810 5.551   1.00 29.85  ? 77   LEU A O     1 
ATOM   475  C  CB    . LEU A 1 60  ? -19.755 -13.659 4.121   1.00 24.45  ? 77   LEU A CB    1 
ATOM   476  C  CG    . LEU A 1 60  ? -20.583 -13.918 2.876   1.00 24.76  ? 77   LEU A CG    1 
ATOM   477  C  CD1   . LEU A 1 60  ? -20.849 -15.422 2.817   1.00 24.37  ? 77   LEU A CD1   1 
ATOM   478  C  CD2   . LEU A 1 60  ? -21.882 -13.125 2.888   1.00 24.50  ? 77   LEU A CD2   1 
ATOM   479  N  N     . GLN A 1 61  ? -18.984 -11.601 6.667   1.00 24.68  ? 78   GLN A N     1 
ATOM   480  C  CA    . GLN A 1 61  ? -18.432 -11.736 7.998   1.00 24.53  ? 78   GLN A CA    1 
ATOM   481  C  C     . GLN A 1 61  ? -19.136 -12.957 8.628   1.00 23.72  ? 78   GLN A C     1 
ATOM   482  O  O     . GLN A 1 61  ? -20.364 -12.882 8.996   1.00 22.52  ? 78   GLN A O     1 
ATOM   483  C  CB    . GLN A 1 61  ? -18.664 -10.504 8.804   1.00 27.86  ? 78   GLN A CB    1 
ATOM   484  C  CG    . GLN A 1 61  ? -18.044 -10.507 10.199  1.00 31.22  ? 78   GLN A CG    1 
ATOM   485  C  CD    . GLN A 1 61  ? -18.520 -9.349  11.037  1.00 34.27  ? 78   GLN A CD    1 
ATOM   486  O  OE1   . GLN A 1 61  ? -19.699 -9.216  11.271  1.00 35.30  ? 78   GLN A OE1   1 
ATOM   487  N  NE2   . GLN A 1 61  ? -17.584 -8.548  11.578  1.00 35.49  ? 78   GLN A NE2   1 
ATOM   488  N  N     . LEU A 1 62  ? -18.405 -14.079 8.659   1.00 23.63  ? 79   LEU A N     1 
ATOM   489  C  CA    . LEU A 1 62  ? -18.863 -15.315 9.279   1.00 22.60  ? 79   LEU A CA    1 
ATOM   490  C  C     . LEU A 1 62  ? -18.572 -15.425 10.750  1.00 22.04  ? 79   LEU A C     1 
ATOM   491  O  O     . LEU A 1 62  ? -17.409 -15.345 11.210  1.00 23.73  ? 79   LEU A O     1 
ATOM   492  C  CB    . LEU A 1 62  ? -18.412 -16.535 8.579   1.00 23.03  ? 79   LEU A CB    1 
ATOM   493  C  CG    . LEU A 1 62  ? -18.821 -16.631 7.151   1.00 23.60  ? 79   LEU A CG    1 
ATOM   494  C  CD1   . LEU A 1 62  ? -17.769 -17.346 6.325   1.00 23.58  ? 79   LEU A CD1   1 
ATOM   495  C  CD2   . LEU A 1 62  ? -20.208 -17.172 7.000   1.00 23.45  ? 79   LEU A CD2   1 
ATOM   496  N  N     . TRP A 1 63  ? -19.670 -15.489 11.504  1.00 21.83  ? 80   TRP A N     1 
ATOM   497  C  CA    . TRP A 1 63  ? -19.649 -15.664 12.931  1.00 23.24  ? 80   TRP A CA    1 
ATOM   498  C  C     . TRP A 1 63  ? -19.893 -17.184 13.200  1.00 23.58  ? 80   TRP A C     1 
ATOM   499  O  O     . TRP A 1 63  ? -21.016 -17.660 13.000  1.00 22.37  ? 80   TRP A O     1 
ATOM   500  C  CB    . TRP A 1 63  ? -20.738 -14.853 13.600  1.00 22.91  ? 80   TRP A CB    1 
ATOM   501  C  CG    . TRP A 1 63  ? -20.380 -13.358 13.692  1.00 24.96  ? 80   TRP A CG    1 
ATOM   502  C  CD1   . TRP A 1 63  ? -20.014 -12.560 12.644  1.00 26.01  ? 80   TRP A CD1   1 
ATOM   503  C  CD2   . TRP A 1 63  ? -20.441 -12.525 14.838  1.00 26.35  ? 80   TRP A CD2   1 
ATOM   504  N  NE1   . TRP A 1 63  ? -19.773 -11.298 13.089  1.00 27.84  ? 80   TRP A NE1   1 
ATOM   505  C  CE2   . TRP A 1 63  ? -20.020 -11.237 14.436  1.00 27.77  ? 80   TRP A CE2   1 
ATOM   506  C  CE3   . TRP A 1 63  ? -20.738 -12.751 16.189  1.00 26.92  ? 80   TRP A CE3   1 
ATOM   507  C  CZ2   . TRP A 1 63  ? -19.908 -10.149 15.331  1.00 29.24  ? 80   TRP A CZ2   1 
ATOM   508  C  CZ3   . TRP A 1 63  ? -20.633 -11.678 17.085  1.00 28.93  ? 80   TRP A CZ3   1 
ATOM   509  C  CH2   . TRP A 1 63  ? -20.261 -10.349 16.627  1.00 29.45  ? 80   TRP A CH2   1 
ATOM   510  N  N     . ASP A 1 64  ? -18.860 -17.861 13.666  1.00 23.96  ? 81   ASP A N     1 
ATOM   511  C  CA    . ASP A 1 64  ? -18.863 -19.337 14.069  1.00 24.34  ? 81   ASP A CA    1 
ATOM   512  C  C     . ASP A 1 64  ? -19.166 -19.435 15.536  1.00 24.24  ? 81   ASP A C     1 
ATOM   513  O  O     . ASP A 1 64  ? -18.304 -19.224 16.373  1.00 27.55  ? 81   ASP A O     1 
ATOM   514  C  CB    . ASP A 1 64  ? -17.493 -19.922 13.747  1.00 23.77  ? 81   ASP A CB    1 
ATOM   515  C  CG    . ASP A 1 64  ? -17.323 -21.424 14.097  1.00 26.62  ? 81   ASP A CG    1 
ATOM   516  O  OD1   . ASP A 1 64  ? -18.288 -22.134 14.439  1.00 27.81  ? 81   ASP A OD1   1 
ATOM   517  O  OD2   . ASP A 1 64  ? -16.128 -21.895 14.102  1.00 27.64  ? 81   ASP A OD2   1 
ATOM   518  N  N     . ILE A 1 65  ? -20.444 -19.691 15.864  1.00 23.09  ? 82   ILE A N     1 
ATOM   519  C  CA    . ILE A 1 65  ? -20.898 -19.721 17.228  1.00 22.97  ? 82   ILE A CA    1 
ATOM   520  C  C     . ILE A 1 65  ? -20.717 -21.141 17.734  1.00 24.40  ? 82   ILE A C     1 
ATOM   521  O  O     . ILE A 1 65  ? -21.112 -22.099 17.070  1.00 23.09  ? 82   ILE A O     1 
ATOM   522  C  CB    . ILE A 1 65  ? -22.364 -19.208 17.301  1.00 22.21  ? 82   ILE A CB    1 
ATOM   523  C  CG1   . ILE A 1 65  ? -22.302 -17.671 17.006  1.00 24.58  ? 82   ILE A CG1   1 
ATOM   524  C  CG2   . ILE A 1 65  ? -23.012 -19.482 18.630  1.00 21.53  ? 82   ILE A CG2   1 
ATOM   525  C  CD1   . ILE A 1 65  ? -23.505 -17.194 16.312  1.00 24.42  ? 82   ILE A CD1   1 
ATOM   526  N  N     . ALA A 1 66  ? -19.998 -21.267 18.851  1.00 27.06  ? 83   ALA A N     1 
ATOM   527  C  CA    . ALA A 1 66  ? -19.703 -22.562 19.434  1.00 27.40  ? 83   ALA A CA    1 
ATOM   528  C  C     . ALA A 1 66  ? -21.023 -23.220 19.915  1.00 26.30  ? 83   ALA A C     1 
ATOM   529  O  O     . ALA A 1 66  ? -21.905 -22.549 20.422  1.00 24.38  ? 83   ALA A O     1 
ATOM   530  C  CB    . ALA A 1 66  ? -18.764 -22.413 20.596  1.00 27.82  ? 83   ALA A CB    1 
ATOM   531  N  N     . GLY A 1 67  ? -21.010 -24.546 19.894  1.00 26.20  ? 84   GLY A N     1 
ATOM   532  C  CA    . GLY A 1 67  ? -22.114 -25.422 20.253  1.00 26.53  ? 84   GLY A CA    1 
ATOM   533  C  C     . GLY A 1 67  ? -22.746 -25.237 21.593  1.00 26.89  ? 84   GLY A C     1 
ATOM   534  O  O     . GLY A 1 67  ? -23.971 -25.380 21.718  1.00 25.99  ? 84   GLY A O     1 
ATOM   535  N  N     . LEU A 1 68  ? -21.959 -24.899 22.614  1.00 27.42  ? 85   LEU A N     1 
ATOM   536  C  CA    . LEU A 1 68  ? -22.579 -24.620 23.913  1.00 30.61  ? 85   LEU A CA    1 
ATOM   537  C  C     . LEU A 1 68  ? -23.301 -23.266 24.090  1.00 30.75  ? 85   LEU A C     1 
ATOM   538  O  O     . LEU A 1 68  ? -23.917 -23.038 25.129  1.00 31.21  ? 85   LEU A O     1 
ATOM   539  C  CB    . LEU A 1 68  ? -21.586 -24.805 25.054  1.00 32.54  ? 85   LEU A CB    1 
ATOM   540  C  CG    . LEU A 1 68  ? -21.146 -26.251 25.306  1.00 35.15  ? 85   LEU A CG    1 
ATOM   541  C  CD1   . LEU A 1 68  ? -20.082 -26.219 26.394  1.00 37.36  ? 85   LEU A CD1   1 
ATOM   542  C  CD2   . LEU A 1 68  ? -22.319 -27.179 25.705  1.00 36.11  ? 85   LEU A CD2   1 
ATOM   543  N  N     . GLU A 1 69  ? -23.243 -22.371 23.124  1.00 30.73  ? 86   GLU A N     1 
ATOM   544  C  CA    . GLU A 1 69  ? -23.575 -20.956 23.435  1.00 31.92  ? 86   GLU A CA    1 
ATOM   545  C  C     . GLU A 1 69  ? -25.085 -20.717 23.627  1.00 32.29  ? 86   GLU A C     1 
ATOM   546  O  O     . GLU A 1 69  ? -25.445 -19.762 24.323  1.00 32.30  ? 86   GLU A O     1 
ATOM   547  C  CB    . GLU A 1 69  ? -22.944 -19.990 22.426  1.00 32.97  ? 86   GLU A CB    1 
ATOM   548  C  CG    . GLU A 1 69  ? -21.413 -19.894 22.569  1.00 34.28  ? 86   GLU A CG    1 
ATOM   549  C  CD    . GLU A 1 69  ? -20.937 -19.426 23.919  1.00 36.30  ? 86   GLU A CD    1 
ATOM   550  O  OE1   . GLU A 1 69  ? -21.490 -18.439 24.503  1.00 38.85  ? 86   GLU A OE1   1 
ATOM   551  O  OE2   . GLU A 1 69  ? -19.960 -20.040 24.421  1.00 37.69  ? 86   GLU A OE2   1 
ATOM   552  N  N     . ARG A 1 70  ? -25.922 -21.658 23.188  1.00 32.66  ? 87   ARG A N     1 
ATOM   553  C  CA    . ARG A 1 70  ? -27.350 -21.553 23.397  1.00 33.63  ? 87   ARG A CA    1 
ATOM   554  C  C     . ARG A 1 70  ? -27.705 -21.831 24.834  1.00 35.34  ? 87   ARG A C     1 
ATOM   555  O  O     . ARG A 1 70  ? -28.818 -21.550 25.206  1.00 36.60  ? 87   ARG A O     1 
ATOM   556  C  CB    . ARG A 1 70  ? -28.172 -22.474 22.485  1.00 33.19  ? 87   ARG A CB    1 
ATOM   557  C  CG    . ARG A 1 70  ? -28.059 -23.987 22.741  1.00 33.18  ? 87   ARG A CG    1 
ATOM   558  C  CD    . ARG A 1 70  ? -28.948 -24.687 21.755  1.00 34.34  ? 87   ARG A CD    1 
ATOM   559  N  NE    . ARG A 1 70  ? -29.002 -26.140 21.918  1.00 35.97  ? 87   ARG A NE    1 
ATOM   560  C  CZ    . ARG A 1 70  ? -29.748 -26.795 22.795  1.00 38.63  ? 87   ARG A CZ    1 
ATOM   561  N  NH1   . ARG A 1 70  ? -30.541 -26.167 23.628  1.00 39.97  ? 87   ARG A NH1   1 
ATOM   562  N  NH2   . ARG A 1 70  ? -29.722 -28.133 22.823  1.00 39.74  ? 87   ARG A NH2   1 
ATOM   563  N  N     . PHE A 1 71  ? -26.800 -22.426 25.618  1.00 36.46  ? 88   PHE A N     1 
ATOM   564  C  CA    . PHE A 1 71  ? -27.052 -22.623 27.055  1.00 38.66  ? 88   PHE A CA    1 
ATOM   565  C  C     . PHE A 1 71  ? -26.567 -21.414 27.893  1.00 39.91  ? 88   PHE A C     1 
ATOM   566  O  O     . PHE A 1 71  ? -26.950 -21.274 29.045  1.00 42.32  ? 88   PHE A O     1 
ATOM   567  C  CB    . PHE A 1 71  ? -26.383 -23.903 27.543  1.00 38.33  ? 88   PHE A CB    1 
ATOM   568  C  CG    . PHE A 1 71  ? -26.923 -25.134 26.911  1.00 38.21  ? 88   PHE A CG    1 
ATOM   569  C  CD1   . PHE A 1 71  ? -28.125 -25.678 27.343  1.00 40.94  ? 88   PHE A CD1   1 
ATOM   570  C  CD2   . PHE A 1 71  ? -26.257 -25.739 25.885  1.00 37.18  ? 88   PHE A CD2   1 
ATOM   571  C  CE1   . PHE A 1 71  ? -28.630 -26.827 26.760  1.00 42.39  ? 88   PHE A CE1   1 
ATOM   572  C  CE2   . PHE A 1 71  ? -26.764 -26.894 25.275  1.00 38.07  ? 88   PHE A CE2   1 
ATOM   573  C  CZ    . PHE A 1 71  ? -27.949 -27.435 25.718  1.00 40.87  ? 88   PHE A CZ    1 
ATOM   574  N  N     . GLY A 1 72  ? -25.721 -20.575 27.314  1.00 38.63  ? 89   GLY A N     1 
ATOM   575  C  CA    . GLY A 1 72  ? -25.235 -19.357 27.922  1.00 40.54  ? 89   GLY A CA    1 
ATOM   576  C  C     . GLY A 1 72  ? -26.206 -18.211 27.693  1.00 43.62  ? 89   GLY A C     1 
ATOM   577  O  O     . GLY A 1 72  ? -27.387 -18.414 27.369  1.00 43.96  ? 89   GLY A O     1 
ATOM   578  N  N     . ASN A 1 73  ? -25.709 -16.994 27.862  1.00 45.68  ? 90   ASN A N     1 
ATOM   579  C  CA    . ASN A 1 73  ? -26.588 -15.803 27.895  1.00 48.38  ? 90   ASN A CA    1 
ATOM   580  C  C     . ASN A 1 73  ? -26.141 -14.681 26.951  1.00 45.47  ? 90   ASN A C     1 
ATOM   581  O  O     . ASN A 1 73  ? -26.440 -13.525 27.175  1.00 48.22  ? 90   ASN A O     1 
ATOM   582  C  CB    . ASN A 1 73  ? -26.673 -15.275 29.326  1.00 53.28  ? 90   ASN A CB    1 
ATOM   583  C  CG    . ASN A 1 73  ? -25.310 -14.978 29.918  1.00 54.71  ? 90   ASN A CG    1 
ATOM   584  O  OD1   . ASN A 1 73  ? -24.390 -14.450 29.267  1.00 53.99  ? 90   ASN A OD1   1 
ATOM   585  N  ND2   . ASN A 1 73  ? -25.182 -15.308 31.187  1.00 59.98  ? 90   ASN A ND2   1 
ATOM   586  N  N     . MET A 1 74  ? -25.418 -15.037 25.912  1.00 40.33  ? 91   MET A N     1 
ATOM   587  C  CA    . MET A 1 74  ? -24.733 -14.093 25.032  1.00 39.18  ? 91   MET A CA    1 
ATOM   588  C  C     . MET A 1 74  ? -25.239 -14.142 23.599  1.00 35.71  ? 91   MET A C     1 
ATOM   589  O  O     . MET A 1 74  ? -24.814 -13.310 22.790  1.00 37.64  ? 91   MET A O     1 
ATOM   590  C  CB    . MET A 1 74  ? -23.217 -14.435 25.005  1.00 42.16  ? 91   MET A CB    1 
ATOM   591  C  CG    . MET A 1 74  ? -22.452 -13.967 26.218  1.00 47.87  ? 91   MET A CG    1 
ATOM   592  S  SD    . MET A 1 74  ? -20.714 -13.606 25.986  1.00 50.39  ? 91   MET A SD    1 
ATOM   593  C  CE    . MET A 1 74  ? -20.769 -12.335 24.743  1.00 54.21  ? 91   MET A CE    1 
ATOM   594  N  N     . THR A 1 75  ? -26.071 -15.109 23.223  1.00 31.90  ? 92   THR A N     1 
ATOM   595  C  CA    . THR A 1 75  ? -26.494 -15.210 21.836  1.00 30.62  ? 92   THR A CA    1 
ATOM   596  C  C     . THR A 1 75  ? -27.235 -13.964 21.312  1.00 31.74  ? 92   THR A C     1 
ATOM   597  O  O     . THR A 1 75  ? -27.032 -13.590 20.149  1.00 30.69  ? 92   THR A O     1 
ATOM   598  C  CB    . THR A 1 75  ? -27.372 -16.468 21.528  1.00 29.10  ? 92   THR A CB    1 
ATOM   599  O  OG1   . THR A 1 75  ? -28.523 -16.471 22.314  1.00 25.80  ? 92   THR A OG1   1 
ATOM   600  C  CG2   . THR A 1 75  ? -26.616 -17.739 21.758  1.00 27.00  ? 92   THR A CG2   1 
ATOM   601  N  N     . ARG A 1 76  ? -28.005 -13.284 22.165  1.00 34.07  ? 93   ARG A N     1 
ATOM   602  C  CA    . ARG A 1 76  ? -28.621 -12.030 21.736  1.00 36.83  ? 93   ARG A CA    1 
ATOM   603  C  C     . ARG A 1 76  ? -27.551 -11.038 21.260  1.00 35.12  ? 93   ARG A C     1 
ATOM   604  O  O     . ARG A 1 76  ? -27.710 -10.446 20.190  1.00 34.91  ? 93   ARG A O     1 
ATOM   605  C  CB    . ARG A 1 76  ? -29.551 -11.405 22.796  1.00 42.12  ? 93   ARG A CB    1 
ATOM   606  C  CG    . ARG A 1 76  ? -30.371 -10.203 22.301  1.00 46.89  ? 93   ARG A CG    1 
ATOM   607  C  CD    . ARG A 1 76  ? -31.472 -9.767  23.252  1.00 53.26  ? 93   ARG A CD    1 
ATOM   608  N  NE    . ARG A 1 76  ? -32.697 -10.577 23.171  1.00 56.47  ? 93   ARG A NE    1 
ATOM   609  C  CZ    . ARG A 1 76  ? -33.123 -11.488 24.071  1.00 58.73  ? 93   ARG A CZ    1 
ATOM   610  N  NH1   . ARG A 1 76  ? -32.417 -11.787 25.175  1.00 59.75  ? 93   ARG A NH1   1 
ATOM   611  N  NH2   . ARG A 1 76  ? -34.287 -12.121 23.869  1.00 58.91  ? 93   ARG A NH2   1 
ATOM   612  N  N     . VAL A 1 77  ? -26.432 -10.935 21.971  1.00 35.39  ? 94   VAL A N     1 
ATOM   613  C  CA    . VAL A 1 77  ? -25.338 -10.078 21.509  1.00 35.35  ? 94   VAL A CA    1 
ATOM   614  C  C     . VAL A 1 77  ? -24.734 -10.618 20.226  1.00 34.11  ? 94   VAL A C     1 
ATOM   615  O  O     . VAL A 1 77  ? -24.478 -9.847  19.315  1.00 35.74  ? 94   VAL A O     1 
ATOM   616  C  CB    . VAL A 1 77  ? -24.259 -9.865  22.590  1.00 37.41  ? 94   VAL A CB    1 
ATOM   617  C  CG1   . VAL A 1 77  ? -23.065 -9.071  22.040  1.00 37.18  ? 94   VAL A CG1   1 
ATOM   618  C  CG2   . VAL A 1 77  ? -24.857 -9.089  23.737  1.00 40.49  ? 94   VAL A CG2   1 
ATOM   619  N  N     . TYR A 1 78  ? -24.489 -11.933 20.150  1.00 31.63  ? 95   TYR A N     1 
ATOM   620  C  CA    . TYR A 1 78  ? -23.847 -12.506 18.987  1.00 29.47  ? 95   TYR A CA    1 
ATOM   621  C  C     . TYR A 1 78  ? -24.630 -12.317 17.724  1.00 29.28  ? 95   TYR A C     1 
ATOM   622  O  O     . TYR A 1 78  ? -24.052 -12.180 16.644  1.00 28.11  ? 95   TYR A O     1 
ATOM   623  C  CB    . TYR A 1 78  ? -23.632 -14.032 19.141  1.00 29.01  ? 95   TYR A CB    1 
ATOM   624  C  CG    . TYR A 1 78  ? -22.704 -14.462 20.247  1.00 32.41  ? 95   TYR A CG    1 
ATOM   625  C  CD1   . TYR A 1 78  ? -21.708 -13.634 20.737  1.00 33.74  ? 95   TYR A CD1   1 
ATOM   626  C  CD2   . TYR A 1 78  ? -22.827 -15.747 20.800  1.00 33.19  ? 95   TYR A CD2   1 
ATOM   627  C  CE1   . TYR A 1 78  ? -20.872 -14.053 21.755  1.00 35.40  ? 95   TYR A CE1   1 
ATOM   628  C  CE2   . TYR A 1 78  ? -21.999 -16.176 21.800  1.00 34.44  ? 95   TYR A CE2   1 
ATOM   629  C  CZ    . TYR A 1 78  ? -20.987 -15.360 22.241  1.00 36.43  ? 95   TYR A CZ    1 
ATOM   630  O  OH    . TYR A 1 78  ? -20.199 -15.868 23.237  1.00 39.39  ? 95   TYR A OH    1 
ATOM   631  N  N     . TYR A 1 79  ? -25.961 -12.442 17.832  1.00 28.31  ? 96   TYR A N     1 
ATOM   632  C  CA    . TYR A 1 79  ? -26.816 -12.383 16.659  1.00 28.31  ? 96   TYR A CA    1 
ATOM   633  C  C     . TYR A 1 79  ? -27.065 -10.961 16.146  1.00 30.07  ? 96   TYR A C     1 
ATOM   634  O  O     . TYR A 1 79  ? -27.517 -10.783 15.033  1.00 29.96  ? 96   TYR A O     1 
ATOM   635  C  CB    . TYR A 1 79  ? -28.165 -12.987 16.975  1.00 27.54  ? 96   TYR A CB    1 
ATOM   636  C  CG    . TYR A 1 79  ? -28.187 -14.427 17.385  1.00 26.56  ? 96   TYR A CG    1 
ATOM   637  C  CD1   . TYR A 1 79  ? -27.151 -15.297 17.067  1.00 25.62  ? 96   TYR A CD1   1 
ATOM   638  C  CD2   . TYR A 1 79  ? -29.278 -14.932 18.058  1.00 27.91  ? 96   TYR A CD2   1 
ATOM   639  C  CE1   . TYR A 1 79  ? -27.192 -16.630 17.447  1.00 27.06  ? 96   TYR A CE1   1 
ATOM   640  C  CE2   . TYR A 1 79  ? -29.344 -16.287 18.401  1.00 29.36  ? 96   TYR A CE2   1 
ATOM   641  C  CZ    . TYR A 1 79  ? -28.305 -17.124 18.104  1.00 29.13  ? 96   TYR A CZ    1 
ATOM   642  O  OH    . TYR A 1 79  ? -28.363 -18.427 18.486  1.00 30.78  ? 96   TYR A OH    1 
ATOM   643  N  N     . LYS A 1 80  ? -26.806 -9.963  16.940  1.00 32.21  ? 97   LYS A N     1 
ATOM   644  C  CA    . LYS A 1 80  ? -27.192 -8.624  16.586  1.00 36.78  ? 97   LYS A CA    1 
ATOM   645  C  C     . LYS A 1 80  ? -26.747 -8.206  15.169  1.00 37.11  ? 97   LYS A C     1 
ATOM   646  O  O     . LYS A 1 80  ? -25.576 -8.388  14.779  1.00 36.30  ? 97   LYS A O     1 
ATOM   647  C  CB    . LYS A 1 80  ? -26.658 -7.677  17.642  1.00 41.99  ? 97   LYS A CB    1 
ATOM   648  C  CG    . LYS A 1 80  ? -27.114 -6.249  17.551  1.00 46.26  ? 97   LYS A CG    1 
ATOM   649  C  CD    . LYS A 1 80  ? -26.364 -5.440  18.617  1.00 50.04  ? 97   LYS A CD    1 
ATOM   650  C  CE    . LYS A 1 80  ? -26.693 -5.822  20.062  1.00 52.02  ? 97   LYS A CE    1 
ATOM   651  N  NZ    . LYS A 1 80  ? -28.148 -6.064  20.331  1.00 54.32  ? 97   LYS A NZ    1 
ATOM   652  N  N     . GLU A 1 81  ? -27.720 -7.675  14.419  1.00 39.35  ? 98   GLU A N     1 
ATOM   653  C  CA    . GLU A 1 81  ? -27.575 -7.270  13.026  1.00 41.93  ? 98   GLU A CA    1 
ATOM   654  C  C     . GLU A 1 81  ? -27.225 -8.365  11.981  1.00 36.44  ? 98   GLU A C     1 
ATOM   655  O  O     . GLU A 1 81  ? -26.918 -8.058  10.843  1.00 35.62  ? 98   GLU A O     1 
ATOM   656  C  CB    . GLU A 1 81  ? -26.664 -6.048  12.970  1.00 49.52  ? 98   GLU A CB    1 
ATOM   657  C  CG    . GLU A 1 81  ? -27.322 -4.881  13.745  1.00 58.12  ? 98   GLU A CG    1 
ATOM   658  C  CD    . GLU A 1 81  ? -26.359 -3.840  14.270  1.00 65.24  ? 98   GLU A CD    1 
ATOM   659  O  OE1   . GLU A 1 81  ? -25.343 -3.543  13.586  1.00 68.56  ? 98   GLU A OE1   1 
ATOM   660  O  OE2   . GLU A 1 81  ? -26.633 -3.262  15.361  1.00 70.10  ? 98   GLU A OE2   1 
ATOM   661  N  N     . ALA A 1 82  ? -27.370 -9.656  12.334  1.00 30.83  ? 99   ALA A N     1 
ATOM   662  C  CA    . ALA A 1 82  ? -27.146 -10.675 11.331  1.00 26.09  ? 99   ALA A CA    1 
ATOM   663  C  C     . ALA A 1 82  ? -28.229 -10.540 10.298  1.00 25.40  ? 99   ALA A C     1 
ATOM   664  O  O     . ALA A 1 82  ? -29.362 -10.253 10.639  1.00 23.18  ? 99   ALA A O     1 
ATOM   665  C  CB    . ALA A 1 82  ? -27.199 -12.098 11.918  1.00 23.46  ? 99   ALA A CB    1 
ATOM   666  N  N     . VAL A 1 83  ? -27.898 -10.796 9.051   1.00 23.96  ? 100  VAL A N     1 
ATOM   667  C  CA    . VAL A 1 83  ? -28.876 -10.762 7.949   1.00 23.86  ? 100  VAL A CA    1 
ATOM   668  C  C     . VAL A 1 83  ? -29.087 -12.191 7.362   1.00 22.06  ? 100  VAL A C     1 
ATOM   669  O  O     . VAL A 1 83  ? -29.968 -12.388 6.569   1.00 23.89  ? 100  VAL A O     1 
ATOM   670  C  CB    . VAL A 1 83  ? -28.473 -9.768  6.847   1.00 24.10  ? 100  VAL A CB    1 
ATOM   671  C  CG1   . VAL A 1 83  ? -28.710 -8.325  7.271   1.00 24.57  ? 100  VAL A CG1   1 
ATOM   672  C  CG2   . VAL A 1 83  ? -27.020 -9.940  6.406   1.00 21.58  ? 100  VAL A CG2   1 
ATOM   673  N  N     . GLY A 1 84  ? -28.319 -13.181 7.787   1.00 21.47  ? 101  GLY A N     1 
ATOM   674  C  CA    . GLY A 1 84  ? -28.556 -14.605 7.314   1.00 21.62  ? 101  GLY A CA    1 
ATOM   675  C  C     . GLY A 1 84  ? -27.978 -15.573 8.316   1.00 22.22  ? 101  GLY A C     1 
ATOM   676  O  O     . GLY A 1 84  ? -27.143 -15.181 9.137   1.00 22.00  ? 101  GLY A O     1 
ATOM   677  N  N     . ALA A 1 85  ? -28.401 -16.831 8.233   1.00 22.23  ? 102  ALA A N     1 
ATOM   678  C  CA    . ALA A 1 85  ? -27.802 -17.894 9.055   1.00 22.52  ? 102  ALA A CA    1 
ATOM   679  C  C     . ALA A 1 85  ? -27.760 -19.220 8.365   1.00 24.86  ? 102  ALA A C     1 
ATOM   680  O  O     . ALA A 1 85  ? -28.636 -19.511 7.589   1.00 27.55  ? 102  ALA A O     1 
ATOM   681  C  CB    . ALA A 1 85  ? -28.510 -18.050 10.379  1.00 22.33  ? 102  ALA A CB    1 
ATOM   682  N  N     . PHE A 1 86  ? -26.656 -19.964 8.585   1.00 25.05  ? 103  PHE A N     1 
ATOM   683  C  CA    . PHE A 1 86  ? -26.635 -21.401 8.409   1.00 24.41  ? 103  PHE A CA    1 
ATOM   684  C  C     . PHE A 1 86  ? -26.861 -22.140 9.721   1.00 23.09  ? 103  PHE A C     1 
ATOM   685  O  O     . PHE A 1 86  ? -26.259 -21.813 10.725  1.00 22.04  ? 103  PHE A O     1 
ATOM   686  C  CB    . PHE A 1 86  ? -25.259 -21.839 7.940   1.00 24.35  ? 103  PHE A CB    1 
ATOM   687  C  CG    . PHE A 1 86  ? -24.945 -21.387 6.573   1.00 28.13  ? 103  PHE A CG    1 
ATOM   688  C  CD1   . PHE A 1 86  ? -25.685 -21.824 5.519   1.00 29.03  ? 103  PHE A CD1   1 
ATOM   689  C  CD2   . PHE A 1 86  ? -23.861 -20.503 6.360   1.00 31.22  ? 103  PHE A CD2   1 
ATOM   690  C  CE1   . PHE A 1 86  ? -25.387 -21.458 4.249   1.00 30.09  ? 103  PHE A CE1   1 
ATOM   691  C  CE2   . PHE A 1 86  ? -23.585 -20.084 5.071   1.00 32.11  ? 103  PHE A CE2   1 
ATOM   692  C  CZ    . PHE A 1 86  ? -24.324 -20.597 4.014   1.00 30.57  ? 103  PHE A CZ    1 
ATOM   693  N  N     . VAL A 1 87  ? -27.749 -23.122 9.703   1.00 23.38  ? 104  VAL A N     1 
ATOM   694  C  CA    . VAL A 1 87  ? -28.074 -23.914 10.863  1.00 22.65  ? 104  VAL A CA    1 
ATOM   695  C  C     . VAL A 1 87  ? -27.697 -25.368 10.466  1.00 23.30  ? 104  VAL A C     1 
ATOM   696  O  O     . VAL A 1 87  ? -28.109 -25.823 9.453   1.00 20.12  ? 104  VAL A O     1 
ATOM   697  C  CB    . VAL A 1 87  ? -29.553 -23.779 11.268  1.00 22.22  ? 104  VAL A CB    1 
ATOM   698  C  CG1   . VAL A 1 87  ? -29.779 -24.503 12.593  1.00 22.02  ? 104  VAL A CG1   1 
ATOM   699  C  CG2   . VAL A 1 87  ? -29.931 -22.333 11.466  1.00 20.72  ? 104  VAL A CG2   1 
ATOM   700  N  N     . VAL A 1 88  ? -26.773 -25.954 11.212  1.00 22.82  ? 105  VAL A N     1 
ATOM   701  C  CA    . VAL A 1 88  ? -25.934 -27.070 10.804  1.00 19.62  ? 105  VAL A CA    1 
ATOM   702  C  C     . VAL A 1 88  ? -26.266 -28.200 11.745  1.00 20.76  ? 105  VAL A C     1 
ATOM   703  O  O     . VAL A 1 88  ? -26.435 -28.006 12.929  1.00 20.90  ? 105  VAL A O     1 
ATOM   704  C  CB    . VAL A 1 88  ? -24.412 -26.810 10.820  1.00 18.74  ? 105  VAL A CB    1 
ATOM   705  C  CG1   . VAL A 1 88  ? -23.639 -28.022 10.323  1.00 19.36  ? 105  VAL A CG1   1 
ATOM   706  C  CG2   . VAL A 1 88  ? -24.108 -25.691 9.893   1.00 19.30  ? 105  VAL A CG2   1 
ATOM   707  N  N     . PHE A 1 89  ? -26.473 -29.368 11.182  1.00 21.85  ? 106  PHE A N     1 
ATOM   708  C  CA    . PHE A 1 89  ? -26.521 -30.606 11.971  1.00 23.19  ? 106  PHE A CA    1 
ATOM   709  C  C     . PHE A 1 89  ? -25.679 -31.652 11.305  1.00 26.78  ? 106  PHE A C     1 
ATOM   710  O  O     . PHE A 1 89  ? -25.245 -31.501 10.186  1.00 26.05  ? 106  PHE A O     1 
ATOM   711  C  CB    . PHE A 1 89  ? -27.943 -31.064 12.286  1.00 24.65  ? 106  PHE A CB    1 
ATOM   712  C  CG    . PHE A 1 89  ? -28.691 -31.600 11.108  1.00 26.14  ? 106  PHE A CG    1 
ATOM   713  C  CD1   . PHE A 1 89  ? -29.238 -30.747 10.160  1.00 25.20  ? 106  PHE A CD1   1 
ATOM   714  C  CD2   . PHE A 1 89  ? -28.859 -33.001 10.947  1.00 27.57  ? 106  PHE A CD2   1 
ATOM   715  C  CE1   . PHE A 1 89  ? -29.904 -31.252 9.074   1.00 27.16  ? 106  PHE A CE1   1 
ATOM   716  C  CE2   . PHE A 1 89  ? -29.592 -33.503 9.884   1.00 28.89  ? 106  PHE A CE2   1 
ATOM   717  C  CZ    . PHE A 1 89  ? -30.126 -32.629 8.946   1.00 28.32  ? 106  PHE A CZ    1 
ATOM   718  N  N     . ASP A 1 90  ? -25.469 -32.747 12.030  1.00 26.75  ? 107  ASP A N     1 
ATOM   719  C  CA    . ASP A 1 90  ? -24.709 -33.882 11.576  1.00 27.73  ? 107  ASP A CA    1 
ATOM   720  C  C     . ASP A 1 90  ? -25.707 -34.932 11.136  1.00 28.13  ? 107  ASP A C     1 
ATOM   721  O  O     . ASP A 1 90  ? -26.420 -35.501 11.951  1.00 29.42  ? 107  ASP A O     1 
ATOM   722  C  CB    . ASP A 1 90  ? -23.845 -34.341 12.744  1.00 31.91  ? 107  ASP A CB    1 
ATOM   723  C  CG    . ASP A 1 90  ? -23.007 -35.581 12.443  1.00 32.26  ? 107  ASP A CG    1 
ATOM   724  O  OD1   . ASP A 1 90  ? -23.205 -36.273 11.423  1.00 32.07  ? 107  ASP A OD1   1 
ATOM   725  O  OD2   . ASP A 1 90  ? -22.131 -35.837 13.316  1.00 34.59  ? 107  ASP A OD2   1 
ATOM   726  N  N     . ILE A 1 91  ? -25.683 -35.215 9.838   1.00 31.37  ? 108  ILE A N     1 
ATOM   727  C  CA    . ILE A 1 91  ? -26.652 -35.985 9.151   1.00 35.33  ? 108  ILE A CA    1 
ATOM   728  C  C     . ILE A 1 91  ? -26.691 -37.424 9.719   1.00 39.37  ? 108  ILE A C     1 
ATOM   729  O  O     . ILE A 1 91  ? -27.713 -38.081 9.603   1.00 42.40  ? 108  ILE A O     1 
ATOM   730  C  CB    . ILE A 1 91  ? -26.400 -35.951 7.624   1.00 36.79  ? 108  ILE A CB    1 
ATOM   731  C  CG1   . ILE A 1 91  ? -27.706 -36.246 6.867   1.00 39.45  ? 108  ILE A CG1   1 
ATOM   732  C  CG2   . ILE A 1 91  ? -25.260 -36.911 7.205   1.00 36.41  ? 108  ILE A CG2   1 
ATOM   733  C  CD1   . ILE A 1 91  ? -27.557 -36.033 5.380   1.00 39.91  ? 108  ILE A CD1   1 
ATOM   734  N  N     . SER A 1 92  ? -25.596 -37.841 10.381  1.00 42.03  ? 109  SER A N     1 
ATOM   735  C  CA    . SER A 1 92  ? -25.486 -39.149 11.076  1.00 44.99  ? 109  SER A CA    1 
ATOM   736  C  C     . SER A 1 92  ? -26.004 -39.210 12.527  1.00 44.08  ? 109  SER A C     1 
ATOM   737  O  O     . SER A 1 92  ? -26.094 -40.319 13.079  1.00 46.05  ? 109  SER A O     1 
ATOM   738  C  CB    . SER A 1 92  ? -24.017 -39.590 11.099  1.00 47.91  ? 109  SER A CB    1 
ATOM   739  O  OG    . SER A 1 92  ? -23.419 -39.455 9.808   1.00 49.87  ? 109  SER A OG    1 
ATOM   740  N  N     . ARG A 1 93  ? -26.296 -38.064 13.163  1.00 41.23  ? 110  ARG A N     1 
ATOM   741  C  CA    . ARG A 1 93  ? -26.646 -38.050 14.587  1.00 40.89  ? 110  ARG A CA    1 
ATOM   742  C  C     . ARG A 1 93  ? -27.951 -37.290 14.863  1.00 40.16  ? 110  ARG A C     1 
ATOM   743  O  O     . ARG A 1 93  ? -27.970 -36.026 14.871  1.00 38.96  ? 110  ARG A O     1 
ATOM   744  C  CB    . ARG A 1 93  ? -25.504 -37.429 15.394  1.00 39.62  ? 110  ARG A CB    1 
ATOM   745  C  CG    . ARG A 1 93  ? -24.215 -38.244 15.435  1.00 41.33  ? 110  ARG A CG    1 
ATOM   746  C  CD    . ARG A 1 93  ? -23.008 -37.355 15.641  1.00 41.17  ? 110  ARG A CD    1 
ATOM   747  N  NE    . ARG A 1 93  ? -23.090 -36.639 16.898  1.00 40.98  ? 110  ARG A NE    1 
ATOM   748  C  CZ    . ARG A 1 93  ? -22.709 -35.397 17.151  1.00 37.88  ? 110  ARG A CZ    1 
ATOM   749  N  NH1   . ARG A 1 93  ? -22.148 -34.619 16.239  1.00 35.94  ? 110  ARG A NH1   1 
ATOM   750  N  NH2   . ARG A 1 93  ? -22.919 -34.939 18.383  1.00 36.08  ? 110  ARG A NH2   1 
ATOM   751  N  N     . SER A 1 94  ? -29.006 -38.041 15.149  1.00 39.88  ? 111  SER A N     1 
ATOM   752  C  CA    . SER A 1 94  ? -30.349 -37.473 15.202  1.00 40.39  ? 111  SER A CA    1 
ATOM   753  C  C     . SER A 1 94  ? -30.565 -36.466 16.361  1.00 40.54  ? 111  SER A C     1 
ATOM   754  O  O     . SER A 1 94  ? -31.381 -35.556 16.236  1.00 41.23  ? 111  SER A O     1 
ATOM   755  C  CB    . SER A 1 94  ? -31.391 -38.565 15.189  1.00 42.83  ? 111  SER A CB    1 
ATOM   756  O  OG    . SER A 1 94  ? -31.190 -39.465 16.261  1.00 44.52  ? 111  SER A OG    1 
ATOM   757  N  N     . SER A 1 95  ? -29.814 -36.610 17.450  1.00 41.66  ? 112  SER A N     1 
ATOM   758  C  CA    . SER A 1 95  ? -29.794 -35.633 18.526  1.00 42.65  ? 112  SER A CA    1 
ATOM   759  C  C     . SER A 1 95  ? -29.493 -34.203 18.016  1.00 39.65  ? 112  SER A C     1 
ATOM   760  O  O     . SER A 1 95  ? -30.102 -33.242 18.456  1.00 42.24  ? 112  SER A O     1 
ATOM   761  C  CB    . SER A 1 95  ? -28.721 -36.010 19.530  1.00 45.34  ? 112  SER A CB    1 
ATOM   762  O  OG    . SER A 1 95  ? -27.451 -35.974 18.883  1.00 46.97  ? 112  SER A OG    1 
ATOM   763  N  N     . THR A 1 96  ? -28.550 -34.097 17.091  1.00 36.65  ? 113  THR A N     1 
ATOM   764  C  CA    . THR A 1 96  ? -28.194 -32.819 16.489  1.00 33.95  ? 113  THR A CA    1 
ATOM   765  C  C     . THR A 1 96  ? -29.268 -32.249 15.539  1.00 34.18  ? 113  THR A C     1 
ATOM   766  O  O     . THR A 1 96  ? -29.401 -31.008 15.413  1.00 32.28  ? 113  THR A O     1 
ATOM   767  C  CB    . THR A 1 96  ? -26.845 -32.829 15.808  1.00 31.41  ? 113  THR A CB    1 
ATOM   768  O  OG1   . THR A 1 96  ? -26.914 -33.595 14.609  1.00 32.08  ? 113  THR A OG1   1 
ATOM   769  C  CG2   . THR A 1 96  ? -25.747 -33.332 16.744  1.00 31.32  ? 113  THR A CG2   1 
ATOM   770  N  N     . PHE A 1 97  ? -30.047 -33.125 14.910  1.00 35.54  ? 114  PHE A N     1 
ATOM   771  C  CA    . PHE A 1 97  ? -31.220 -32.691 14.150  1.00 36.71  ? 114  PHE A CA    1 
ATOM   772  C  C     . PHE A 1 97  ? -32.337 -32.169 15.045  1.00 38.44  ? 114  PHE A C     1 
ATOM   773  O  O     . PHE A 1 97  ? -32.856 -31.114 14.768  1.00 38.64  ? 114  PHE A O     1 
ATOM   774  C  CB    . PHE A 1 97  ? -31.740 -33.809 13.251  1.00 39.21  ? 114  PHE A CB    1 
ATOM   775  C  CG    . PHE A 1 97  ? -32.905 -33.385 12.391  1.00 39.50  ? 114  PHE A CG    1 
ATOM   776  C  CD1   . PHE A 1 97  ? -32.759 -32.336 11.479  1.00 38.03  ? 114  PHE A CD1   1 
ATOM   777  C  CD2   . PHE A 1 97  ? -34.123 -33.972 12.538  1.00 40.82  ? 114  PHE A CD2   1 
ATOM   778  C  CE1   . PHE A 1 97  ? -33.827 -31.914 10.700  1.00 39.29  ? 114  PHE A CE1   1 
ATOM   779  C  CE2   . PHE A 1 97  ? -35.201 -33.580 11.746  1.00 42.51  ? 114  PHE A CE2   1 
ATOM   780  C  CZ    . PHE A 1 97  ? -35.062 -32.561 10.817  1.00 40.83  ? 114  PHE A CZ    1 
ATOM   781  N  N     . GLU A 1 98  ? -32.693 -32.887 16.116  1.00 41.42  ? 115  GLU A N     1 
ATOM   782  C  CA    . GLU A 1 98  ? -33.715 -32.424 17.082  1.00 43.35  ? 115  GLU A CA    1 
ATOM   783  C  C     . GLU A 1 98  ? -33.331 -31.015 17.640  1.00 39.63  ? 115  GLU A C     1 
ATOM   784  O  O     . GLU A 1 98  ? -34.178 -30.179 17.834  1.00 39.28  ? 115  GLU A O     1 
ATOM   785  C  CB    . GLU A 1 98  ? -33.958 -33.445 18.199  1.00 49.47  ? 115  GLU A CB    1 
ATOM   786  C  CG    . GLU A 1 98  ? -34.710 -34.687 17.695  1.00 56.11  ? 115  GLU A CG    1 
ATOM   787  C  CD    . GLU A 1 98  ? -34.687 -35.927 18.599  1.00 61.51  ? 115  GLU A CD    1 
ATOM   788  O  OE1   . GLU A 1 98  ? -33.592 -36.346 19.044  1.00 62.53  ? 115  GLU A OE1   1 
ATOM   789  O  OE2   . GLU A 1 98  ? -35.777 -36.568 18.822  1.00 66.68  ? 115  GLU A OE2   1 
ATOM   790  N  N     . ALA A 1 99  ? -32.043 -30.766 17.850  1.00 35.90  ? 116  ALA A N     1 
ATOM   791  C  CA    . ALA A 1 99  ? -31.580 -29.508 18.413  1.00 33.26  ? 116  ALA A CA    1 
ATOM   792  C  C     . ALA A 1 99  ? -31.644 -28.293 17.446  1.00 32.78  ? 116  ALA A C     1 
ATOM   793  O  O     . ALA A 1 99  ? -31.626 -27.173 17.914  1.00 31.88  ? 116  ALA A O     1 
ATOM   794  C  CB    . ALA A 1 99  ? -30.157 -29.688 18.912  1.00 32.23  ? 116  ALA A CB    1 
ATOM   795  N  N     . VAL A 1 100 ? -31.751 -28.529 16.131  1.00 33.44  ? 117  VAL A N     1 
ATOM   796  C  CA    . VAL A 1 100 ? -31.878 -27.452 15.186  1.00 32.55  ? 117  VAL A CA    1 
ATOM   797  C  C     . VAL A 1 100 ? -33.096 -26.512 15.453  1.00 32.27  ? 117  VAL A C     1 
ATOM   798  O  O     . VAL A 1 100 ? -33.002 -25.329 15.197  1.00 31.46  ? 117  VAL A O     1 
ATOM   799  C  CB    . VAL A 1 100 ? -31.854 -27.861 13.693  1.00 33.88  ? 117  VAL A CB    1 
ATOM   800  C  CG1   . VAL A 1 100 ? -30.603 -28.650 13.302  1.00 33.08  ? 117  VAL A CG1   1 
ATOM   801  C  CG2   . VAL A 1 100 ? -33.129 -28.503 13.205  1.00 36.00  ? 117  VAL A CG2   1 
ATOM   802  N  N     . LEU A 1 101 ? -34.183 -27.028 15.992  1.00 34.65  ? 118  LEU A N     1 
ATOM   803  C  CA    . LEU A 1 101 ? -35.339 -26.205 16.337  1.00 35.02  ? 118  LEU A CA    1 
ATOM   804  C  C     . LEU A 1 101 ? -35.090 -25.364 17.568  1.00 33.86  ? 118  LEU A C     1 
ATOM   805  O  O     . LEU A 1 101 ? -35.619 -24.248 17.668  1.00 34.63  ? 118  LEU A O     1 
ATOM   806  C  CB    . LEU A 1 101 ? -36.549 -27.060 16.588  1.00 37.97  ? 118  LEU A CB    1 
ATOM   807  C  CG    . LEU A 1 101 ? -37.025 -27.916 15.397  1.00 39.56  ? 118  LEU A CG    1 
ATOM   808  C  CD1   . LEU A 1 101 ? -38.261 -28.650 15.881  1.00 42.21  ? 118  LEU A CD1   1 
ATOM   809  C  CD2   . LEU A 1 101 ? -37.230 -27.206 14.051  1.00 38.94  ? 118  LEU A CD2   1 
ATOM   810  N  N     . LYS A 1 102 ? -34.269 -25.868 18.494  1.00 32.58  ? 119  LYS A N     1 
ATOM   811  C  CA    . LYS A 1 102 ? -33.816 -25.064 19.608  1.00 33.26  ? 119  LYS A CA    1 
ATOM   812  C  C     . LYS A 1 102 ? -32.990 -23.881 19.137  1.00 31.20  ? 119  LYS A C     1 
ATOM   813  O  O     . LYS A 1 102 ? -33.264 -22.785 19.525  1.00 30.96  ? 119  LYS A O     1 
ATOM   814  C  CB    . LYS A 1 102 ? -33.086 -25.904 20.635  1.00 33.52  ? 119  LYS A CB    1 
ATOM   815  C  CG    . LYS A 1 102 ? -34.013 -26.973 21.234  1.00 36.41  ? 119  LYS A CG    1 
ATOM   816  C  CD    . LYS A 1 102 ? -33.975 -26.944 22.752  1.00 39.89  ? 119  LYS A CD    1 
ATOM   817  C  CE    . LYS A 1 102 ? -34.702 -28.135 23.357  1.00 43.67  ? 119  LYS A CE    1 
ATOM   818  N  NZ    . LYS A 1 102 ? -35.467 -27.672 24.563  1.00 46.26  ? 119  LYS A NZ    1 
ATOM   819  N  N     . TRP A 1 103 ? -31.997 -24.117 18.288  1.00 29.54  ? 120  TRP A N     1 
ATOM   820  C  CA    . TRP A 1 103 ? -31.259 -23.024 17.648  1.00 28.87  ? 120  TRP A CA    1 
ATOM   821  C  C     . TRP A 1 103 ? -32.157 -22.105 16.816  1.00 29.49  ? 120  TRP A C     1 
ATOM   822  O  O     . TRP A 1 103 ? -32.053 -20.887 16.901  1.00 30.29  ? 120  TRP A O     1 
ATOM   823  C  CB    . TRP A 1 103 ? -30.180 -23.579 16.768  1.00 28.45  ? 120  TRP A CB    1 
ATOM   824  C  CG    . TRP A 1 103 ? -28.997 -24.109 17.554  1.00 29.33  ? 120  TRP A CG    1 
ATOM   825  C  CD1   . TRP A 1 103 ? -28.696 -25.413 17.779  1.00 29.70  ? 120  TRP A CD1   1 
ATOM   826  C  CD2   . TRP A 1 103 ? -28.000 -23.355 18.198  1.00 30.25  ? 120  TRP A CD2   1 
ATOM   827  N  NE1   . TRP A 1 103 ? -27.560 -25.533 18.526  1.00 29.01  ? 120  TRP A NE1   1 
ATOM   828  C  CE2   . TRP A 1 103 ? -27.089 -24.277 18.779  1.00 29.94  ? 120  TRP A CE2   1 
ATOM   829  C  CE3   . TRP A 1 103 ? -27.748 -21.985 18.335  1.00 30.82  ? 120  TRP A CE3   1 
ATOM   830  C  CZ2   . TRP A 1 103 ? -25.979 -23.875 19.478  1.00 29.77  ? 120  TRP A CZ2   1 
ATOM   831  C  CZ3   . TRP A 1 103 ? -26.598 -21.595 19.032  1.00 30.87  ? 120  TRP A CZ3   1 
ATOM   832  C  CH2   . TRP A 1 103 ? -25.743 -22.549 19.600  1.00 30.36  ? 120  TRP A CH2   1 
ATOM   833  N  N     . LYS A 1 104 ? -33.045 -22.689 16.015  1.00 29.50  ? 121  LYS A N     1 
ATOM   834  C  CA    . LYS A 1 104 ? -33.922 -21.907 15.160  1.00 29.92  ? 121  LYS A CA    1 
ATOM   835  C  C     . LYS A 1 104 ? -34.875 -21.004 15.956  1.00 29.86  ? 121  LYS A C     1 
ATOM   836  O  O     . LYS A 1 104 ? -34.989 -19.796 15.643  1.00 28.07  ? 121  LYS A O     1 
ATOM   837  C  CB    . LYS A 1 104 ? -34.613 -22.783 14.148  1.00 31.63  ? 121  LYS A CB    1 
ATOM   838  C  CG    . LYS A 1 104 ? -35.430 -22.039 13.116  1.00 33.19  ? 121  LYS A CG    1 
ATOM   839  C  CD    . LYS A 1 104 ? -34.596 -21.036 12.351  1.00 32.87  ? 121  LYS A CD    1 
ATOM   840  C  CE    . LYS A 1 104 ? -35.290 -20.627 11.082  1.00 34.68  ? 121  LYS A CE    1 
ATOM   841  N  NZ    . LYS A 1 104 ? -36.660 -20.068 11.290  1.00 36.06  ? 121  LYS A NZ    1 
ATOM   842  N  N     . SER A 1 105 ? -35.472 -21.544 17.010  1.00 31.67  ? 122  SER A N     1 
ATOM   843  C  CA    . SER A 1 105 ? -36.298 -20.743 17.915  1.00 34.92  ? 122  SER A CA    1 
ATOM   844  C  C     . SER A 1 105 ? -35.488 -19.636 18.664  1.00 34.72  ? 122  SER A C     1 
ATOM   845  O  O     . SER A 1 105 ? -36.003 -18.547 18.890  1.00 34.59  ? 122  SER A O     1 
ATOM   846  C  CB    . SER A 1 105 ? -37.048 -21.637 18.909  1.00 38.92  ? 122  SER A CB    1 
ATOM   847  O  OG    . SER A 1 105 ? -37.726 -22.748 18.266  1.00 41.20  ? 122  SER A OG    1 
ATOM   848  N  N     . ASP A 1 106 ? -34.232 -19.920 19.043  1.00 33.90  ? 123  ASP A N     1 
ATOM   849  C  CA    . ASP A 1 106 ? -33.344 -18.949 19.718  1.00 33.12  ? 123  ASP A CA    1 
ATOM   850  C  C     . ASP A 1 106 ? -33.098 -17.754 18.797  1.00 31.84  ? 123  ASP A C     1 
ATOM   851  O  O     . ASP A 1 106 ? -33.183 -16.602 19.198  1.00 31.92  ? 123  ASP A O     1 
ATOM   852  C  CB    . ASP A 1 106 ? -31.991 -19.626 20.055  1.00 31.92  ? 123  ASP A CB    1 
ATOM   853  C  CG    . ASP A 1 106 ? -31.084 -18.775 20.977  1.00 33.25  ? 123  ASP A CG    1 
ATOM   854  O  OD1   . ASP A 1 106 ? -31.500 -18.402 22.065  1.00 35.08  ? 123  ASP A OD1   1 
ATOM   855  O  OD2   . ASP A 1 106 ? -29.887 -18.540 20.627  1.00 33.70  ? 123  ASP A OD2   1 
ATOM   856  N  N     . LEU A 1 107 ? -32.770 -18.076 17.556  1.00 32.60  ? 124  LEU A N     1 
ATOM   857  C  CA    . LEU A 1 107 ? -32.504 -17.123 16.500  1.00 33.63  ? 124  LEU A CA    1 
ATOM   858  C  C     . LEU A 1 107 ? -33.705 -16.248 16.224  1.00 36.38  ? 124  LEU A C     1 
ATOM   859  O  O     . LEU A 1 107 ? -33.601 -15.033 16.277  1.00 36.92  ? 124  LEU A O     1 
ATOM   860  C  CB    . LEU A 1 107 ? -32.096 -17.870 15.250  1.00 32.71  ? 124  LEU A CB    1 
ATOM   861  C  CG    . LEU A 1 107 ? -31.590 -17.127 14.032  1.00 32.30  ? 124  LEU A CG    1 
ATOM   862  C  CD1   . LEU A 1 107 ? -30.173 -16.585 14.289  1.00 29.57  ? 124  LEU A CD1   1 
ATOM   863  C  CD2   . LEU A 1 107 ? -31.552 -18.100 12.872  1.00 31.64  ? 124  LEU A CD2   1 
ATOM   864  N  N     . ASP A 1 108 ? -34.846 -16.849 15.958  1.00 37.65  ? 125  ASP A N     1 
ATOM   865  C  CA    . ASP A 1 108 ? -36.061 -16.049 15.694  1.00 40.69  ? 125  ASP A CA    1 
ATOM   866  C  C     . ASP A 1 108 ? -36.579 -15.247 16.865  1.00 42.03  ? 125  ASP A C     1 
ATOM   867  O  O     . ASP A 1 108 ? -37.171 -14.217 16.642  1.00 44.42  ? 125  ASP A O     1 
ATOM   868  C  CB    . ASP A 1 108 ? -37.133 -16.896 14.993  1.00 42.10  ? 125  ASP A CB    1 
ATOM   869  C  CG    . ASP A 1 108 ? -36.691 -17.312 13.565  1.00 42.42  ? 125  ASP A CG    1 
ATOM   870  O  OD1   . ASP A 1 108 ? -35.629 -16.826 13.042  1.00 41.83  ? 125  ASP A OD1   1 
ATOM   871  O  OD2   . ASP A 1 108 ? -37.365 -18.164 12.949  1.00 44.59  ? 125  ASP A OD2   1 
ATOM   872  N  N     . SER A 1 109 ? -36.284 -15.664 18.094  1.00 43.52  ? 126  SER A N     1 
ATOM   873  C  CA    . SER A 1 109 ? -36.610 -14.862 19.294  1.00 46.87  ? 126  SER A CA    1 
ATOM   874  C  C     . SER A 1 109 ? -35.761 -13.580 19.397  1.00 46.28  ? 126  SER A C     1 
ATOM   875  O  O     . SER A 1 109 ? -36.218 -12.559 19.935  1.00 48.37  ? 126  SER A O     1 
ATOM   876  C  CB    . SER A 1 109 ? -36.372 -15.692 20.549  1.00 48.81  ? 126  SER A CB    1 
ATOM   877  O  OG    . SER A 1 109 ? -34.977 -15.876 20.733  1.00 48.19  ? 126  SER A OG    1 
ATOM   878  N  N     . LYS A 1 110 ? -34.538 -13.642 18.873  1.00 42.71  ? 127  LYS A N     1 
ATOM   879  C  CA    . LYS A 1 110 ? -33.515 -12.649 19.182  1.00 41.72  ? 127  LYS A CA    1 
ATOM   880  C  C     . LYS A 1 110 ? -33.123 -11.707 18.069  1.00 39.29  ? 127  LYS A C     1 
ATOM   881  O  O     . LYS A 1 110 ? -32.516 -10.681 18.360  1.00 39.78  ? 127  LYS A O     1 
ATOM   882  C  CB    . LYS A 1 110 ? -32.262 -13.378 19.691  1.00 39.12  ? 127  LYS A CB    1 
ATOM   883  C  CG    . LYS A 1 110 ? -32.469 -13.793 21.118  1.00 40.73  ? 127  LYS A CG    1 
ATOM   884  C  CD    . LYS A 1 110 ? -31.394 -14.717 21.642  1.00 41.02  ? 127  LYS A CD    1 
ATOM   885  C  CE    . LYS A 1 110 ? -31.795 -15.058 23.063  1.00 43.68  ? 127  LYS A CE    1 
ATOM   886  N  NZ    . LYS A 1 110 ? -30.850 -16.073 23.531  1.00 43.71  ? 127  LYS A NZ    1 
ATOM   887  N  N     . VAL A 1 111 ? -33.410 -12.025 16.816  1.00 36.04  ? 128  VAL A N     1 
ATOM   888  C  CA    . VAL A 1 111 ? -32.999 -11.105 15.763  1.00 34.93  ? 128  VAL A CA    1 
ATOM   889  C  C     . VAL A 1 111 ? -33.906 -11.192 14.557  1.00 37.39  ? 128  VAL A C     1 
ATOM   890  O  O     . VAL A 1 111 ? -34.336 -12.304 14.191  1.00 37.07  ? 128  VAL A O     1 
ATOM   891  C  CB    . VAL A 1 111 ? -31.515 -11.356 15.364  1.00 30.15  ? 128  VAL A CB    1 
ATOM   892  C  CG1   . VAL A 1 111 ? -31.383 -12.705 14.685  1.00 27.26  ? 128  VAL A CG1   1 
ATOM   893  C  CG2   . VAL A 1 111 ? -30.995 -10.180 14.517  1.00 28.23  ? 128  VAL A CG2   1 
ATOM   894  N  N     . HIS A 1 112 ? -34.135 -10.044 13.912  1.00 40.33  ? 129  HIS A N     1 
ATOM   895  C  CA    . HIS A 1 112 ? -34.975 -9.921  12.718  1.00 45.00  ? 129  HIS A CA    1 
ATOM   896  C  C     . HIS A 1 112 ? -34.348 -8.933  11.769  1.00 43.71  ? 129  HIS A C     1 
ATOM   897  O  O     . HIS A 1 112 ? -33.462 -8.209  12.138  1.00 42.75  ? 129  HIS A O     1 
ATOM   898  C  CB    . HIS A 1 112 ? -36.365 -9.418  13.156  1.00 53.56  ? 129  HIS A CB    1 
ATOM   899  C  CG    . HIS A 1 112 ? -36.930 -10.218 14.283  1.00 59.02  ? 129  HIS A CG    1 
ATOM   900  N  ND1   . HIS A 1 112 ? -36.703 -9.891  15.603  1.00 61.32  ? 129  HIS A ND1   1 
ATOM   901  C  CD2   . HIS A 1 112 ? -37.605 -11.395 14.298  1.00 60.70  ? 129  HIS A CD2   1 
ATOM   902  C  CE1   . HIS A 1 112 ? -37.252 -10.806 16.385  1.00 62.43  ? 129  HIS A CE1   1 
ATOM   903  N  NE2   . HIS A 1 112 ? -37.810 -11.727 15.618  1.00 61.49  ? 129  HIS A NE2   1 
ATOM   904  N  N     . LEU A 1 113 ? -34.812 -8.904  10.537  1.00 44.64  ? 130  LEU A N     1 
ATOM   905  C  CA    . LEU A 1 113 ? -34.344 -7.939  9.585   1.00 45.49  ? 130  LEU A CA    1 
ATOM   906  C  C     . LEU A 1 113 ? -34.891 -6.540  9.908   1.00 46.98  ? 130  LEU A C     1 
ATOM   907  O  O     . LEU A 1 113 ? -35.801 -6.387  10.766  1.00 46.53  ? 130  LEU A O     1 
ATOM   908  C  CB    . LEU A 1 113 ? -34.770 -8.366  8.190   1.00 46.56  ? 130  LEU A CB    1 
ATOM   909  C  CG    . LEU A 1 113 ? -34.271 -9.700  7.717   1.00 44.38  ? 130  LEU A CG    1 
ATOM   910  C  CD1   . LEU A 1 113 ? -35.043 -10.019 6.448   1.00 44.73  ? 130  LEU A CD1   1 
ATOM   911  C  CD2   . LEU A 1 113 ? -32.752 -9.684  7.491   1.00 42.67  ? 130  LEU A CD2   1 
ATOM   912  N  N     . PRO A 1 114 ? -34.310 -5.504  9.250   1.00 48.90  ? 131  PRO A N     1 
ATOM   913  C  CA    . PRO A 1 114 ? -34.774 -4.167  9.630   1.00 52.18  ? 131  PRO A CA    1 
ATOM   914  C  C     . PRO A 1 114 ? -36.277 -3.942  9.378   1.00 54.89  ? 131  PRO A C     1 
ATOM   915  O  O     . PRO A 1 114 ? -36.889 -3.150  10.081  1.00 56.69  ? 131  PRO A O     1 
ATOM   916  C  CB    . PRO A 1 114 ? -33.934 -3.237  8.749   1.00 52.74  ? 131  PRO A CB    1 
ATOM   917  C  CG    . PRO A 1 114 ? -32.692 -4.048  8.418   1.00 49.47  ? 131  PRO A CG    1 
ATOM   918  C  CD    . PRO A 1 114 ? -33.135 -5.468  8.347   1.00 47.41  ? 131  PRO A CD    1 
ATOM   919  N  N     . ASN A 1 115 ? -36.838 -4.657  8.404   1.00 54.83  ? 132  ASN A N     1 
ATOM   920  C  CA    . ASN A 1 115 ? -38.261 -4.621  8.127   1.00 57.91  ? 132  ASN A CA    1 
ATOM   921  C  C     . ASN A 1 115 ? -39.142 -5.500  9.041   1.00 58.27  ? 132  ASN A C     1 
ATOM   922  O  O     . ASN A 1 115 ? -40.350 -5.587  8.797   1.00 59.44  ? 132  ASN A O     1 
ATOM   923  C  CB    . ASN A 1 115 ? -38.495 -4.933  6.632   1.00 58.60  ? 132  ASN A CB    1 
ATOM   924  C  CG    . ASN A 1 115 ? -38.223 -6.391  6.255   1.00 57.32  ? 132  ASN A CG    1 
ATOM   925  O  OD1   . ASN A 1 115 ? -37.962 -7.219  7.091   1.00 55.90  ? 132  ASN A OD1   1 
ATOM   926  N  ND2   . ASN A 1 115 ? -38.294 -6.687  4.972   1.00 58.16  ? 132  ASN A ND2   1 
ATOM   927  N  N     . GLY A 1 116 ? -38.564 -6.169  10.048  1.00 56.73  ? 133  GLY A N     1 
ATOM   928  C  CA    . GLY A 1 116 ? -39.342 -6.959  11.015  1.00 56.24  ? 133  GLY A CA    1 
ATOM   929  C  C     . GLY A 1 116 ? -39.482 -8.460  10.752  1.00 53.04  ? 133  GLY A C     1 
ATOM   930  O  O     . GLY A 1 116 ? -39.894 -9.182  11.633  1.00 52.49  ? 133  GLY A O     1 
ATOM   931  N  N     . SER A 1 117 ? -39.181 -8.929  9.552   1.00 51.06  ? 134  SER A N     1 
ATOM   932  C  CA    . SER A 1 117 ? -39.240 -10.381 9.237   1.00 49.71  ? 134  SER A CA    1 
ATOM   933  C  C     . SER A 1 117 ? -38.097 -11.197 9.802   1.00 46.74  ? 134  SER A C     1 
ATOM   934  O  O     . SER A 1 117 ? -37.030 -10.631 10.106  1.00 47.00  ? 134  SER A O     1 
ATOM   935  C  CB    . SER A 1 117 ? -39.247 -10.573 7.729   1.00 50.14  ? 134  SER A CB    1 
ATOM   936  O  OG    . SER A 1 117 ? -38.505 -9.527  7.102   1.00 50.12  ? 134  SER A OG    1 
ATOM   937  N  N     . PRO A 1 118 ? -38.265 -12.523 9.841   1.00 43.69  ? 135  PRO A N     1 
ATOM   938  C  CA    . PRO A 1 118 ? -37.145 -13.403 10.208  1.00 39.62  ? 135  PRO A CA    1 
ATOM   939  C  C     . PRO A 1 118 ? -35.990 -13.369 9.203   1.00 36.13  ? 135  PRO A C     1 
ATOM   940  O  O     . PRO A 1 118 ? -36.214 -13.247 7.997   1.00 37.56  ? 135  PRO A O     1 
ATOM   941  C  CB    . PRO A 1 118 ? -37.773 -14.817 10.245  1.00 39.78  ? 135  PRO A CB    1 
ATOM   942  C  CG    . PRO A 1 118 ? -39.254 -14.589 10.446  1.00 43.11  ? 135  PRO A CG    1 
ATOM   943  C  CD    . PRO A 1 118 ? -39.565 -13.223 9.849   1.00 45.00  ? 135  PRO A CD    1 
ATOM   944  N  N     . ILE A 1 119 ? -34.756 -13.502 9.696   1.00 29.95  ? 136  ILE A N     1 
ATOM   945  C  CA    . ILE A 1 119 ? -33.609 -13.519 8.781   1.00 28.48  ? 136  ILE A CA    1 
ATOM   946  C  C     . ILE A 1 119 ? -33.628 -14.838 7.983   1.00 28.97  ? 136  ILE A C     1 
ATOM   947  O  O     . ILE A 1 119 ? -34.058 -15.831 8.514   1.00 28.58  ? 136  ILE A O     1 
ATOM   948  C  CB    . ILE A 1 119 ? -32.293 -13.263 9.517   1.00 25.12  ? 136  ILE A CB    1 
ATOM   949  C  CG1   . ILE A 1 119 ? -31.857 -14.483 10.381  1.00 23.15  ? 136  ILE A CG1   1 
ATOM   950  C  CG2   . ILE A 1 119 ? -32.411 -11.968 10.365  1.00 25.59  ? 136  ILE A CG2   1 
ATOM   951  C  CD1   . ILE A 1 119 ? -30.382 -14.396 10.812  1.00 21.27  ? 136  ILE A CD1   1 
ATOM   952  N  N     . PRO A 1 120 ? -33.273 -14.824 6.692   1.00 28.43  ? 137  PRO A N     1 
ATOM   953  C  CA    . PRO A 1 120 ? -33.244 -16.139 6.044   1.00 28.25  ? 137  PRO A CA    1 
ATOM   954  C  C     . PRO A 1 120 ? -32.234 -17.115 6.698   1.00 28.03  ? 137  PRO A C     1 
ATOM   955  O  O     . PRO A 1 120 ? -31.119 -16.743 7.168   1.00 26.57  ? 137  PRO A O     1 
ATOM   956  C  CB    . PRO A 1 120 ? -32.853 -15.807 4.588   1.00 27.29  ? 137  PRO A CB    1 
ATOM   957  C  CG    . PRO A 1 120 ? -32.125 -14.469 4.688   1.00 26.90  ? 137  PRO A CG    1 
ATOM   958  C  CD    . PRO A 1 120 ? -32.931 -13.735 5.755   1.00 27.84  ? 137  PRO A CD    1 
ATOM   959  N  N     . ALA A 1 121 ? -32.636 -18.369 6.727   1.00 29.84  ? 138  ALA A N     1 
ATOM   960  C  CA    . ALA A 1 121 ? -31.911 -19.413 7.411   1.00 29.49  ? 138  ALA A CA    1 
ATOM   961  C  C     . ALA A 1 121 ? -31.927 -20.681 6.549   1.00 30.26  ? 138  ALA A C     1 
ATOM   962  O  O     . ALA A 1 121 ? -32.984 -21.103 6.098   1.00 29.82  ? 138  ALA A O     1 
ATOM   963  C  CB    . ALA A 1 121 ? -32.521 -19.672 8.791   1.00 29.93  ? 138  ALA A CB    1 
ATOM   964  N  N     . VAL A 1 122 ? -30.725 -21.206 6.266   1.00 29.60  ? 139  VAL A N     1 
ATOM   965  C  CA    . VAL A 1 122 ? -30.558 -22.359 5.423   1.00 29.97  ? 139  VAL A CA    1 
ATOM   966  C  C     . VAL A 1 122 ? -30.053 -23.536 6.292   1.00 28.42  ? 139  VAL A C     1 
ATOM   967  O  O     . VAL A 1 122 ? -29.161 -23.381 7.115   1.00 27.43  ? 139  VAL A O     1 
ATOM   968  C  CB    . VAL A 1 122 ? -29.622 -22.018 4.247   1.00 29.51  ? 139  VAL A CB    1 
ATOM   969  C  CG1   . VAL A 1 122 ? -29.199 -23.234 3.460   1.00 28.50  ? 139  VAL A CG1   1 
ATOM   970  C  CG2   . VAL A 1 122 ? -30.328 -21.048 3.326   1.00 30.43  ? 139  VAL A CG2   1 
ATOM   971  N  N     . LEU A 1 123 ? -30.637 -24.688 6.088   1.00 28.63  ? 140  LEU A N     1 
ATOM   972  C  CA    . LEU A 1 123 ? -30.319 -25.890 6.884   1.00 28.72  ? 140  LEU A CA    1 
ATOM   973  C  C     . LEU A 1 123 ? -29.242 -26.685 6.163   1.00 27.73  ? 140  LEU A C     1 
ATOM   974  O  O     . LEU A 1 123 ? -29.376 -26.933 5.007   1.00 28.20  ? 140  LEU A O     1 
ATOM   975  C  CB    . LEU A 1 123 ? -31.590 -26.682 7.105   1.00 29.97  ? 140  LEU A CB    1 
ATOM   976  C  CG    . LEU A 1 123 ? -31.611 -27.787 8.147   1.00 31.21  ? 140  LEU A CG    1 
ATOM   977  C  CD1   . LEU A 1 123 ? -31.399 -27.346 9.605   1.00 30.58  ? 140  LEU A CD1   1 
ATOM   978  C  CD2   . LEU A 1 123 ? -32.973 -28.496 8.017   1.00 32.74  ? 140  LEU A CD2   1 
ATOM   979  N  N     . LEU A 1 124 ? -28.132 -26.965 6.838   1.00 28.02  ? 141  LEU A N     1 
ATOM   980  C  CA    . LEU A 1 124 ? -27.015 -27.764 6.286   1.00 27.90  ? 141  LEU A CA    1 
ATOM   981  C  C     . LEU A 1 124 ? -26.915 -29.096 7.014   1.00 29.35  ? 141  LEU A C     1 
ATOM   982  O  O     . LEU A 1 124 ? -26.584 -29.158 8.177   1.00 30.07  ? 141  LEU A O     1 
ATOM   983  C  CB    . LEU A 1 124 ? -25.676 -27.010 6.399   1.00 25.21  ? 141  LEU A CB    1 
ATOM   984  C  CG    . LEU A 1 124 ? -25.632 -25.589 5.797   1.00 26.01  ? 141  LEU A CG    1 
ATOM   985  C  CD1   . LEU A 1 124 ? -24.206 -25.040 5.899   1.00 24.76  ? 141  LEU A CD1   1 
ATOM   986  C  CD2   . LEU A 1 124 ? -25.981 -25.717 4.330   1.00 27.12  ? 141  LEU A CD2   1 
ATOM   987  N  N     . ALA A 1 125 ? -27.247 -30.156 6.321   1.00 30.16  ? 142  ALA A N     1 
ATOM   988  C  CA    . ALA A 1 125 ? -27.127 -31.496 6.844   1.00 30.85  ? 142  ALA A CA    1 
ATOM   989  C  C     . ALA A 1 125 ? -25.734 -31.954 6.535   1.00 29.23  ? 142  ALA A C     1 
ATOM   990  O  O     . ALA A 1 125 ? -25.461 -32.396 5.448   1.00 28.73  ? 142  ALA A O     1 
ATOM   991  C  CB    . ALA A 1 125 ? -28.171 -32.385 6.174   1.00 32.78  ? 142  ALA A CB    1 
ATOM   992  N  N     . ASN A 1 126 ? -24.836 -31.793 7.488   1.00 29.11  ? 143  ASN A N     1 
ATOM   993  C  CA    . ASN A 1 126 ? -23.379 -31.959 7.198   1.00 29.01  ? 143  ASN A CA    1 
ATOM   994  C  C     . ASN A 1 126 ? -22.927 -33.369 7.460   1.00 30.49  ? 143  ASN A C     1 
ATOM   995  O  O     . ASN A 1 126 ? -23.617 -34.165 8.124   1.00 32.57  ? 143  ASN A O     1 
ATOM   996  C  CB    . ASN A 1 126 ? -22.559 -30.887 7.957   1.00 27.05  ? 143  ASN A CB    1 
ATOM   997  C  CG    . ASN A 1 126 ? -21.116 -30.768 7.485   1.00 28.77  ? 143  ASN A CG    1 
ATOM   998  O  OD1   . ASN A 1 126 ? -20.833 -30.695 6.282   1.00 30.18  ? 143  ASN A OD1   1 
ATOM   999  N  ND2   . ASN A 1 126 ? -20.176 -30.826 8.437   1.00 27.85  ? 143  ASN A ND2   1 
ATOM   1000 N  N     . LYS A 1 127 ? -21.790 -33.701 6.871   1.00 32.50  ? 144  LYS A N     1 
ATOM   1001 C  CA    . LYS A 1 127 ? -21.181 -35.038 6.949   1.00 34.04  ? 144  LYS A CA    1 
ATOM   1002 C  C     . LYS A 1 127 ? -21.873 -36.042 6.052   1.00 37.77  ? 144  LYS A C     1 
ATOM   1003 O  O     . LYS A 1 127 ? -21.813 -37.287 6.301   1.00 39.74  ? 144  LYS A O     1 
ATOM   1004 C  CB    . LYS A 1 127 ? -21.037 -35.529 8.383   1.00 34.03  ? 144  LYS A CB    1 
ATOM   1005 C  CG    . LYS A 1 127 ? -20.476 -34.513 9.357   1.00 33.08  ? 144  LYS A CG    1 
ATOM   1006 C  CD    . LYS A 1 127 ? -19.850 -35.179 10.577  1.00 34.17  ? 144  LYS A CD    1 
ATOM   1007 C  CE    . LYS A 1 127 ? -19.419 -34.102 11.560  1.00 34.50  ? 144  LYS A CE    1 
ATOM   1008 N  NZ    . LYS A 1 127 ? -19.293 -34.534 12.956  1.00 35.08  ? 144  LYS A NZ    1 
ATOM   1009 N  N     . CYS A 1 128 ? -22.383 -35.546 4.923   1.00 38.55  ? 145  CYS A N     1 
ATOM   1010 C  CA    . CYS A 1 128 ? -23.182 -36.416 4.040   1.00 42.73  ? 145  CYS A CA    1 
ATOM   1011 C  C     . CYS A 1 128 ? -22.361 -37.560 3.419   1.00 44.72  ? 145  CYS A C     1 
ATOM   1012 O  O     . CYS A 1 128 ? -22.912 -38.537 2.938   1.00 47.94  ? 145  CYS A O     1 
ATOM   1013 C  CB    . CYS A 1 128 ? -23.921 -35.604 2.972   1.00 44.25  ? 145  CYS A CB    1 
ATOM   1014 S  SG    . CYS A 1 128 ? -22.853 -34.922 1.685   1.00 46.66  ? 145  CYS A SG    1 
ATOM   1015 N  N     . ASP A 1 129 ? -21.061 -37.369 3.396   1.00 43.61  ? 146  ASP A N     1 
ATOM   1016 C  CA    . ASP A 1 129 ? -20.127 -38.383 3.078   1.00 45.48  ? 146  ASP A CA    1 
ATOM   1017 C  C     . ASP A 1 129 ? -20.173 -39.655 3.951   1.00 48.95  ? 146  ASP A C     1 
ATOM   1018 O  O     . ASP A 1 129 ? -19.832 -40.699 3.450   1.00 53.23  ? 146  ASP A O     1 
ATOM   1019 C  CB    . ASP A 1 129 ? -18.698 -37.776 3.024   1.00 41.54  ? 146  ASP A CB    1 
ATOM   1020 C  CG    . ASP A 1 129 ? -18.229 -37.213 4.341   1.00 37.65  ? 146  ASP A CG    1 
ATOM   1021 O  OD1   . ASP A 1 129 ? -18.499 -35.978 4.649   1.00 34.39  ? 146  ASP A OD1   1 
ATOM   1022 O  OD2   . ASP A 1 129 ? -17.500 -37.935 5.066   1.00 37.03  ? 146  ASP A OD2   1 
ATOM   1023 N  N     . GLN A 1 130 ? -20.644 -39.617 5.195   1.00 48.41  ? 147  GLN A N     1 
ATOM   1024 C  CA    . GLN A 1 130 ? -20.729 -40.790 6.059   1.00 51.89  ? 147  GLN A CA    1 
ATOM   1025 C  C     . GLN A 1 130 ? -21.864 -41.799 5.711   1.00 55.21  ? 147  GLN A C     1 
ATOM   1026 O  O     . GLN A 1 130 ? -22.914 -41.411 5.179   1.00 55.52  ? 147  GLN A O     1 
ATOM   1027 C  CB    . GLN A 1 130 ? -20.804 -40.371 7.520   1.00 51.74  ? 147  GLN A CB    1 
ATOM   1028 C  CG    . GLN A 1 130 ? -19.463 -39.855 8.005   1.00 52.36  ? 147  GLN A CG    1 
ATOM   1029 C  CD    . GLN A 1 130 ? -19.484 -39.056 9.306   1.00 52.49  ? 147  GLN A CD    1 
ATOM   1030 O  OE1   . GLN A 1 130 ? -18.431 -38.670 9.795   1.00 52.15  ? 147  GLN A OE1   1 
ATOM   1031 N  NE2   . GLN A 1 130 ? -20.675 -38.764 9.847   1.00 53.48  ? 147  GLN A NE2   1 
ATOM   1032 N  N     . SER A 1 135 ? -33.166 -39.648 7.644   1.00 90.25  ? 152  SER A N     1 
ATOM   1033 C  CA    . SER A 1 135 ? -34.389 -39.735 6.852   1.00 92.64  ? 152  SER A CA    1 
ATOM   1034 C  C     . SER A 1 135 ? -34.225 -39.048 5.478   1.00 91.41  ? 152  SER A C     1 
ATOM   1035 O  O     . SER A 1 135 ? -34.612 -37.877 5.272   1.00 90.22  ? 152  SER A O     1 
ATOM   1036 C  CB    . SER A 1 135 ? -35.563 -39.147 7.634   1.00 93.46  ? 152  SER A CB    1 
ATOM   1037 O  OG    . SER A 1 135 ? -36.786 -39.346 6.950   1.00 96.16  ? 152  SER A OG    1 
ATOM   1038 N  N     . GLN A 1 136 ? -33.656 -39.811 4.544   1.00 91.60  ? 153  GLN A N     1 
ATOM   1039 C  CA    . GLN A 1 136 ? -33.316 -39.353 3.184   1.00 89.54  ? 153  GLN A CA    1 
ATOM   1040 C  C     . GLN A 1 136 ? -34.630 -39.070 2.394   1.00 89.67  ? 153  GLN A C     1 
ATOM   1041 O  O     . GLN A 1 136 ? -35.158 -40.002 1.791   1.00 92.41  ? 153  GLN A O     1 
ATOM   1042 C  CB    . GLN A 1 136 ? -32.475 -40.474 2.478   1.00 91.09  ? 153  GLN A CB    1 
ATOM   1043 C  CG    . GLN A 1 136 ? -31.169 -40.925 3.186   1.00 89.99  ? 153  GLN A CG    1 
ATOM   1044 C  CD    . GLN A 1 136 ? -30.851 -42.443 3.114   1.00 92.91  ? 153  GLN A CD    1 
ATOM   1045 O  OE1   . GLN A 1 136 ? -31.098 -43.105 2.097   1.00 96.10  ? 153  GLN A OE1   1 
ATOM   1046 N  NE2   . GLN A 1 136 ? -30.281 -42.993 4.205   1.00 91.80  ? 153  GLN A NE2   1 
ATOM   1047 N  N     . SER A 1 137 ? -35.162 -37.822 2.380   1.00 86.56  ? 154  SER A N     1 
ATOM   1048 C  CA    . SER A 1 137 ? -36.599 -37.605 1.913   1.00 87.23  ? 154  SER A CA    1 
ATOM   1049 C  C     . SER A 1 137 ? -37.009 -36.287 1.190   1.00 85.04  ? 154  SER A C     1 
ATOM   1050 O  O     . SER A 1 137 ? -37.065 -35.278 1.865   1.00 82.73  ? 154  SER A O     1 
ATOM   1051 C  CB    . SER A 1 137 ? -37.514 -37.661 3.147   1.00 87.64  ? 154  SER A CB    1 
ATOM   1052 O  OG    . SER A 1 137 ? -37.708 -38.940 3.735   1.00 89.66  ? 154  SER A OG    1 
ATOM   1053 N  N     . PRO A 1 138 ? -37.424 -36.327 -0.108  1.00 85.70  ? 155  PRO A N     1 
ATOM   1054 C  CA    . PRO A 1 138 ? -37.664 -35.097 -0.922  1.00 83.97  ? 155  PRO A CA    1 
ATOM   1055 C  C     . PRO A 1 138 ? -38.871 -34.217 -0.484  1.00 82.89  ? 155  PRO A C     1 
ATOM   1056 O  O     . PRO A 1 138 ? -38.733 -33.005 -0.281  1.00 78.71  ? 155  PRO A O     1 
ATOM   1057 C  CB    . PRO A 1 138 ? -37.904 -35.654 -2.334  1.00 86.74  ? 155  PRO A CB    1 
ATOM   1058 C  CG    . PRO A 1 138 ? -38.414 -37.056 -2.124  1.00 90.17  ? 155  PRO A CG    1 
ATOM   1059 C  CD    . PRO A 1 138 ? -38.002 -37.529 -0.749  1.00 89.14  ? 155  PRO A CD    1 
ATOM   1060 N  N     . SER A 1 139 ? -40.056 -34.818 -0.372  1.00 84.71  ? 156  SER A N     1 
ATOM   1061 C  CA    . SER A 1 139 ? -41.247 -34.089 0.097   1.00 84.14  ? 156  SER A CA    1 
ATOM   1062 C  C     . SER A 1 139 ? -41.077 -33.664 1.575   1.00 81.86  ? 156  SER A C     1 
ATOM   1063 O  O     . SER A 1 139 ? -41.600 -32.631 1.976   1.00 80.32  ? 156  SER A O     1 
ATOM   1064 C  CB    . SER A 1 139 ? -42.517 -34.943 -0.102  1.00 87.10  ? 156  SER A CB    1 
ATOM   1065 O  OG    . SER A 1 139 ? -43.708 -34.185 0.052   1.00 87.17  ? 156  SER A OG    1 
ATOM   1066 N  N     . GLN A 1 140 ? -40.360 -34.474 2.364   1.00 82.84  ? 157  GLN A N     1 
ATOM   1067 C  CA    . GLN A 1 140 ? -40.214 -34.254 3.809   1.00 82.48  ? 157  GLN A CA    1 
ATOM   1068 C  C     . GLN A 1 140 ? -39.416 -33.001 4.116   1.00 78.75  ? 157  GLN A C     1 
ATOM   1069 O  O     . GLN A 1 140 ? -39.778 -32.239 5.013   1.00 77.45  ? 157  GLN A O     1 
ATOM   1070 C  CB    . GLN A 1 140 ? -39.522 -35.455 4.454   1.00 84.25  ? 157  GLN A CB    1 
ATOM   1071 C  CG    . GLN A 1 140 ? -39.339 -35.400 5.969   1.00 84.34  ? 157  GLN A CG    1 
ATOM   1072 C  CD    . GLN A 1 140 ? -38.015 -36.010 6.401   1.00 84.18  ? 157  GLN A CD    1 
ATOM   1073 O  OE1   . GLN A 1 140 ? -37.768 -37.182 6.143   1.00 87.51  ? 157  GLN A OE1   1 
ATOM   1074 N  NE2   . GLN A 1 140 ? -37.165 -35.224 7.059   1.00 80.71  ? 157  GLN A NE2   1 
ATOM   1075 N  N     . VAL A 1 141 ? -38.293 -32.840 3.409   1.00 78.55  ? 158  VAL A N     1 
ATOM   1076 C  CA    . VAL A 1 141 ? -37.475 -31.633 3.461   1.00 76.53  ? 158  VAL A CA    1 
ATOM   1077 C  C     . VAL A 1 141 ? -38.297 -30.388 3.263   1.00 76.89  ? 158  VAL A C     1 
ATOM   1078 O  O     . VAL A 1 141 ? -38.223 -29.472 4.062   1.00 76.38  ? 158  VAL A O     1 
ATOM   1079 C  CB    . VAL A 1 141 ? -36.388 -31.650 2.336   1.00 76.50  ? 158  VAL A CB    1 
ATOM   1080 C  CG1   . VAL A 1 141 ? -36.105 -30.288 1.665   1.00 75.41  ? 158  VAL A CG1   1 
ATOM   1081 C  CG2   . VAL A 1 141 ? -35.106 -32.313 2.798   1.00 75.62  ? 158  VAL A CG2   1 
ATOM   1082 N  N     . ASP A 1 142 ? -39.043 -30.357 2.163   1.00 78.71  ? 159  ASP A N     1 
ATOM   1083 C  CA    . ASP A 1 142 ? -39.882 -29.186 1.832   1.00 79.10  ? 159  ASP A CA    1 
ATOM   1084 C  C     . ASP A 1 142 ? -40.818 -28.886 3.006   1.00 74.47  ? 159  ASP A C     1 
ATOM   1085 O  O     . ASP A 1 142 ? -40.823 -27.753 3.506   1.00 71.85  ? 159  ASP A O     1 
ATOM   1086 C  CB    . ASP A 1 142 ? -40.715 -29.409 0.549   1.00 86.20  ? 159  ASP A CB    1 
ATOM   1087 C  CG    . ASP A 1 142 ? -41.233 -28.083 -0.091  1.00 91.03  ? 159  ASP A CG    1 
ATOM   1088 O  OD1   . ASP A 1 142 ? -41.513 -27.074 0.614   1.00 92.13  ? 159  ASP A OD1   1 
ATOM   1089 O  OD2   . ASP A 1 142 ? -41.376 -28.063 -1.334  1.00 94.06  ? 159  ASP A OD2   1 
ATOM   1090 N  N     . GLN A 1 143 ? -41.563 -29.909 3.457   1.00 70.19  ? 160  GLN A N     1 
ATOM   1091 C  CA    . GLN A 1 143 ? -42.482 -29.777 4.586   1.00 64.91  ? 160  GLN A CA    1 
ATOM   1092 C  C     . GLN A 1 143 ? -41.806 -29.241 5.848   1.00 58.15  ? 160  GLN A C     1 
ATOM   1093 O  O     . GLN A 1 143 ? -42.271 -28.244 6.424   1.00 57.62  ? 160  GLN A O     1 
ATOM   1094 C  CB    . GLN A 1 143 ? -43.133 -31.134 4.887   1.00 65.28  ? 160  GLN A CB    1 
ATOM   1095 C  CG    . GLN A 1 143 ? -44.393 -31.117 5.724   1.00 65.68  ? 160  GLN A CG    1 
ATOM   1096 C  CD    . GLN A 1 143 ? -44.989 -32.531 5.872   1.00 69.06  ? 160  GLN A CD    1 
ATOM   1097 O  OE1   . GLN A 1 143 ? -44.274 -33.515 6.138   1.00 68.59  ? 160  GLN A OE1   1 
ATOM   1098 N  NE2   . GLN A 1 143 ? -46.300 -32.641 5.689   1.00 72.86  ? 160  GLN A NE2   1 
ATOM   1099 N  N     . PHE A 1 144 ? -40.698 -29.868 6.253   1.00 53.93  ? 161  PHE A N     1 
ATOM   1100 C  CA    . PHE A 1 144 ? -39.983 -29.414 7.413   1.00 49.79  ? 161  PHE A CA    1 
ATOM   1101 C  C     . PHE A 1 144 ? -39.574 -27.903 7.298   1.00 47.70  ? 161  PHE A C     1 
ATOM   1102 O  O     . PHE A 1 144 ? -39.828 -27.095 8.211   1.00 46.89  ? 161  PHE A O     1 
ATOM   1103 C  CB    . PHE A 1 144 ? -38.754 -30.291 7.665   1.00 46.95  ? 161  PHE A CB    1 
ATOM   1104 C  CG    . PHE A 1 144 ? -38.033 -29.954 8.933   1.00 44.14  ? 161  PHE A CG    1 
ATOM   1105 C  CD1   . PHE A 1 144 ? -38.441 -30.500 10.157  1.00 43.42  ? 161  PHE A CD1   1 
ATOM   1106 C  CD2   . PHE A 1 144 ? -36.932 -29.097 8.914   1.00 42.63  ? 161  PHE A CD2   1 
ATOM   1107 C  CE1   . PHE A 1 144 ? -37.803 -30.178 11.333  1.00 41.89  ? 161  PHE A CE1   1 
ATOM   1108 C  CE2   . PHE A 1 144 ? -36.246 -28.787 10.106  1.00 40.46  ? 161  PHE A CE2   1 
ATOM   1109 C  CZ    . PHE A 1 144 ? -36.670 -29.331 11.309  1.00 40.68  ? 161  PHE A CZ    1 
ATOM   1110 N  N     . CYS A 1 145 ? -39.012 -27.514 6.159   1.00 47.99  ? 162  CYS A N     1 
ATOM   1111 C  CA    . CYS A 1 145 ? -38.523 -26.118 5.973   1.00 47.07  ? 162  CYS A CA    1 
ATOM   1112 C  C     . CYS A 1 145 ? -39.676 -25.155 5.995   1.00 46.36  ? 162  CYS A C     1 
ATOM   1113 O  O     . CYS A 1 145 ? -39.587 -24.107 6.648   1.00 43.56  ? 162  CYS A O     1 
ATOM   1114 C  CB    . CYS A 1 145 ? -37.764 -25.964 4.661   1.00 48.28  ? 162  CYS A CB    1 
ATOM   1115 S  SG    . CYS A 1 145 ? -36.221 -26.884 4.682   1.00 50.49  ? 162  CYS A SG    1 
ATOM   1116 N  N     . LYS A 1 146 ? -40.756 -25.486 5.295   1.00 48.73  ? 163  LYS A N     1 
ATOM   1117 C  CA    . LYS A 1 146 ? -41.926 -24.634 5.354   1.00 50.88  ? 163  LYS A CA    1 
ATOM   1118 C  C     . LYS A 1 146 ? -42.403 -24.449 6.784   1.00 51.61  ? 163  LYS A C     1 
ATOM   1119 O  O     . LYS A 1 146 ? -42.740 -23.363 7.204   1.00 51.70  ? 163  LYS A O     1 
ATOM   1120 C  CB    . LYS A 1 146 ? -43.090 -25.140 4.475   1.00 53.91  ? 163  LYS A CB    1 
ATOM   1121 C  CG    . LYS A 1 146 ? -43.227 -24.445 3.110   1.00 54.27  ? 163  LYS A CG    1 
ATOM   1122 C  CD    . LYS A 1 146 ? -44.653 -24.553 2.606   1.00 57.78  ? 163  LYS A CD    1 
ATOM   1123 C  CE    . LYS A 1 146 ? -44.774 -24.655 1.092   1.00 58.64  ? 163  LYS A CE    1 
ATOM   1124 N  NZ    . LYS A 1 146 ? -46.065 -25.316 0.731   1.00 61.67  ? 163  LYS A NZ    1 
ATOM   1125 N  N     . GLU A 1 147 ? -42.428 -25.526 7.527   1.00 53.56  ? 164  GLU A N     1 
ATOM   1126 C  CA    . GLU A 1 147 ? -43.017 -25.526 8.873   1.00 56.56  ? 164  GLU A CA    1 
ATOM   1127 C  C     . GLU A 1 147 ? -42.159 -24.841 9.926   1.00 53.01  ? 164  GLU A C     1 
ATOM   1128 O  O     . GLU A 1 147 ? -42.664 -24.367 10.949  1.00 54.46  ? 164  GLU A O     1 
ATOM   1129 C  CB    . GLU A 1 147 ? -43.203 -26.956 9.299   1.00 60.79  ? 164  GLU A CB    1 
ATOM   1130 C  CG    . GLU A 1 147 ? -44.082 -27.155 10.510  1.00 65.27  ? 164  GLU A CG    1 
ATOM   1131 C  CD    . GLU A 1 147 ? -44.513 -28.599 10.638  1.00 68.32  ? 164  GLU A CD    1 
ATOM   1132 O  OE1   . GLU A 1 147 ? -44.391 -29.355 9.639   1.00 68.74  ? 164  GLU A OE1   1 
ATOM   1133 O  OE2   . GLU A 1 147 ? -44.962 -28.965 11.742  1.00 70.54  ? 164  GLU A OE2   1 
ATOM   1134 N  N     . HIS A 1 148 ? -40.864 -24.780 9.682   1.00 49.04  ? 165  HIS A N     1 
ATOM   1135 C  CA    . HIS A 1 148 ? -39.959 -24.196 10.639  1.00 46.39  ? 165  HIS A CA    1 
ATOM   1136 C  C     . HIS A 1 148 ? -39.214 -23.002 10.043  1.00 41.90  ? 165  HIS A C     1 
ATOM   1137 O  O     . HIS A 1 148 ? -38.317 -22.513 10.673  1.00 39.49  ? 165  HIS A O     1 
ATOM   1138 C  CB    . HIS A 1 148 ? -38.961 -25.242 11.139  1.00 47.52  ? 165  HIS A CB    1 
ATOM   1139 C  CG    . HIS A 1 148 ? -39.600 -26.415 11.811  1.00 52.59  ? 165  HIS A CG    1 
ATOM   1140 N  ND1   . HIS A 1 148 ? -40.234 -26.320 13.033  1.00 54.66  ? 165  HIS A ND1   1 
ATOM   1141 C  CD2   . HIS A 1 148 ? -39.706 -27.711 11.434  1.00 54.51  ? 165  HIS A CD2   1 
ATOM   1142 C  CE1   . HIS A 1 148 ? -40.700 -27.507 13.378  1.00 56.79  ? 165  HIS A CE1   1 
ATOM   1143 N  NE2   . HIS A 1 148 ? -40.394 -28.369 12.427  1.00 56.68  ? 165  HIS A NE2   1 
ATOM   1144 N  N     . GLY A 1 149 ? -39.627 -22.498 8.875   1.00 41.10  ? 166  GLY A N     1 
ATOM   1145 C  CA    . GLY A 1 149 ? -39.145 -21.208 8.360   1.00 38.17  ? 166  GLY A CA    1 
ATOM   1146 C  C     . GLY A 1 149 ? -37.723 -21.188 7.847   1.00 35.49  ? 166  GLY A C     1 
ATOM   1147 O  O     . GLY A 1 149 ? -37.043 -20.198 8.047   1.00 35.34  ? 166  GLY A O     1 
ATOM   1148 N  N     . PHE A 1 150 ? -37.265 -22.284 7.244   1.00 33.65  ? 167  PHE A N     1 
ATOM   1149 C  CA    . PHE A 1 150 ? -35.995 -22.356 6.582   1.00 33.67  ? 167  PHE A CA    1 
ATOM   1150 C  C     . PHE A 1 150 ? -36.195 -22.083 5.107   1.00 35.68  ? 167  PHE A C     1 
ATOM   1151 O  O     . PHE A 1 150 ? -37.109 -22.628 4.509   1.00 36.59  ? 167  PHE A O     1 
ATOM   1152 C  CB    . PHE A 1 150 ? -35.362 -23.760 6.717   1.00 32.31  ? 167  PHE A CB    1 
ATOM   1153 C  CG    . PHE A 1 150 ? -34.860 -24.014 8.067   1.00 31.94  ? 167  PHE A CG    1 
ATOM   1154 C  CD1   . PHE A 1 150 ? -33.612 -23.559 8.440   1.00 32.04  ? 167  PHE A CD1   1 
ATOM   1155 C  CD2   . PHE A 1 150 ? -35.657 -24.647 9.003   1.00 33.32  ? 167  PHE A CD2   1 
ATOM   1156 C  CE1   . PHE A 1 150 ? -33.135 -23.775 9.722   1.00 32.16  ? 167  PHE A CE1   1 
ATOM   1157 C  CE2   . PHE A 1 150 ? -35.193 -24.866 10.294  1.00 33.37  ? 167  PHE A CE2   1 
ATOM   1158 C  CZ    . PHE A 1 150 ? -33.934 -24.414 10.640  1.00 32.08  ? 167  PHE A CZ    1 
ATOM   1159 N  N     . ALA A 1 151 ? -35.280 -21.308 4.530   1.00 34.41  ? 168  ALA A N     1 
ATOM   1160 C  CA    . ALA A 1 151 ? -35.362 -20.939 3.119   1.00 35.09  ? 168  ALA A CA    1 
ATOM   1161 C  C     . ALA A 1 151 ? -34.993 -22.103 2.209   1.00 35.16  ? 168  ALA A C     1 
ATOM   1162 O  O     . ALA A 1 151 ? -35.440 -22.139 1.056   1.00 36.68  ? 168  ALA A O     1 
ATOM   1163 C  CB    . ALA A 1 151 ? -34.499 -19.707 2.818   1.00 33.53  ? 168  ALA A CB    1 
ATOM   1164 N  N     . GLY A 1 152 ? -34.201 -23.049 2.728   1.00 34.72  ? 169  GLY A N     1 
ATOM   1165 C  CA    . GLY A 1 152 ? -33.797 -24.248 1.980   1.00 34.90  ? 169  GLY A CA    1 
ATOM   1166 C  C     . GLY A 1 152 ? -32.958 -25.196 2.818   1.00 34.58  ? 169  GLY A C     1 
ATOM   1167 O  O     . GLY A 1 152 ? -32.749 -24.972 4.017   1.00 33.71  ? 169  GLY A O     1 
ATOM   1168 N  N     . TRP A 1 153 ? -32.479 -26.270 2.193   1.00 35.62  ? 170  TRP A N     1 
ATOM   1169 C  CA    . TRP A 1 153 ? -31.815 -27.376 2.893   1.00 37.73  ? 170  TRP A CA    1 
ATOM   1170 C  C     . TRP A 1 153 ? -30.838 -28.048 1.908   1.00 35.04  ? 170  TRP A C     1 
ATOM   1171 O  O     . TRP A 1 153 ? -31.200 -28.357 0.766   1.00 36.54  ? 170  TRP A O     1 
ATOM   1172 C  CB    . TRP A 1 153 ? -32.923 -28.323 3.399   1.00 44.47  ? 170  TRP A CB    1 
ATOM   1173 C  CG    . TRP A 1 153 ? -32.604 -29.731 3.854   1.00 50.75  ? 170  TRP A CG    1 
ATOM   1174 C  CD1   . TRP A 1 153 ? -31.559 -30.547 3.463   1.00 52.65  ? 170  TRP A CD1   1 
ATOM   1175 C  CD2   . TRP A 1 153 ? -33.354 -30.494 4.797   1.00 55.54  ? 170  TRP A CD2   1 
ATOM   1176 N  NE1   . TRP A 1 153 ? -31.594 -31.714 4.142   1.00 55.40  ? 170  TRP A NE1   1 
ATOM   1177 C  CE2   . TRP A 1 153 ? -32.697 -31.731 4.951   1.00 57.30  ? 170  TRP A CE2   1 
ATOM   1178 C  CE3   . TRP A 1 153 ? -34.531 -30.256 5.527   1.00 57.79  ? 170  TRP A CE3   1 
ATOM   1179 C  CZ2   . TRP A 1 153 ? -33.189 -32.743 5.795   1.00 59.79  ? 170  TRP A CZ2   1 
ATOM   1180 C  CZ3   . TRP A 1 153 ? -35.012 -31.252 6.366   1.00 60.06  ? 170  TRP A CZ3   1 
ATOM   1181 C  CH2   . TRP A 1 153 ? -34.343 -32.484 6.493   1.00 60.89  ? 170  TRP A CH2   1 
ATOM   1182 N  N     . PHE A 1 154 ? -29.626 -28.304 2.356   1.00 31.12  ? 171  PHE A N     1 
ATOM   1183 C  CA    . PHE A 1 154 ? -28.604 -28.907 1.515   1.00 30.95  ? 171  PHE A CA    1 
ATOM   1184 C  C     . PHE A 1 154 ? -27.882 -29.946 2.363   1.00 30.98  ? 171  PHE A C     1 
ATOM   1185 O  O     . PHE A 1 154 ? -27.602 -29.696 3.542   1.00 30.38  ? 171  PHE A O     1 
ATOM   1186 C  CB    . PHE A 1 154 ? -27.573 -27.848 1.164   1.00 31.02  ? 171  PHE A CB    1 
ATOM   1187 C  CG    . PHE A 1 154 ? -28.056 -26.770 0.250   1.00 32.07  ? 171  PHE A CG    1 
ATOM   1188 C  CD1   . PHE A 1 154 ? -28.721 -25.695 0.736   1.00 32.22  ? 171  PHE A CD1   1 
ATOM   1189 C  CD2   . PHE A 1 154 ? -27.796 -26.854 -1.119  1.00 32.94  ? 171  PHE A CD2   1 
ATOM   1190 C  CE1   . PHE A 1 154 ? -29.115 -24.640 -0.131  1.00 32.83  ? 171  PHE A CE1   1 
ATOM   1191 C  CE2   . PHE A 1 154 ? -28.165 -25.832 -1.984  1.00 32.76  ? 171  PHE A CE2   1 
ATOM   1192 C  CZ    . PHE A 1 154 ? -28.845 -24.731 -1.498  1.00 32.45  ? 171  PHE A CZ    1 
ATOM   1193 N  N     . GLU A 1 155 ? -27.569 -31.077 1.767   1.00 31.96  ? 172  GLU A N     1 
ATOM   1194 C  CA    . GLU A 1 155 ? -26.628 -32.021 2.333   1.00 34.71  ? 172  GLU A CA    1 
ATOM   1195 C  C     . GLU A 1 155 ? -25.254 -31.554 1.953   1.00 33.23  ? 172  GLU A C     1 
ATOM   1196 O  O     . GLU A 1 155 ? -25.026 -31.294 0.795   1.00 32.41  ? 172  GLU A O     1 
ATOM   1197 C  CB    . GLU A 1 155 ? -26.809 -33.401 1.773   1.00 39.42  ? 172  GLU A CB    1 
ATOM   1198 C  CG    . GLU A 1 155 ? -28.188 -33.981 2.022   1.00 42.77  ? 172  GLU A CG    1 
ATOM   1199 C  CD    . GLU A 1 155 ? -28.265 -35.459 1.694   1.00 47.74  ? 172  GLU A CD    1 
ATOM   1200 O  OE1   . GLU A 1 155 ? -27.289 -35.997 1.100   1.00 51.29  ? 172  GLU A OE1   1 
ATOM   1201 O  OE2   . GLU A 1 155 ? -29.318 -36.085 2.006   1.00 49.72  ? 172  GLU A OE2   1 
ATOM   1202 N  N     . THR A 1 156 ? -24.347 -31.500 2.918   1.00 32.59  ? 173  THR A N     1 
ATOM   1203 C  CA    . THR A 1 156 ? -22.972 -30.984 2.717   1.00 30.94  ? 173  THR A CA    1 
ATOM   1204 C  C     . THR A 1 156 ? -21.910 -31.903 3.240   1.00 32.86  ? 173  THR A C     1 
ATOM   1205 O  O     . THR A 1 156 ? -22.148 -32.661 4.165   1.00 35.23  ? 173  THR A O     1 
ATOM   1206 C  CB    . THR A 1 156 ? -22.762 -29.627 3.437   1.00 28.87  ? 173  THR A CB    1 
ATOM   1207 O  OG1   . THR A 1 156 ? -22.978 -29.716 4.850   1.00 29.48  ? 173  THR A OG1   1 
ATOM   1208 C  CG2   . THR A 1 156 ? -23.692 -28.607 2.857   1.00 25.72  ? 173  THR A CG2   1 
ATOM   1209 N  N     . SER A 1 157 ? -20.715 -31.787 2.671   1.00 33.95  ? 174  SER A N     1 
ATOM   1210 C  CA    . SER A 1 157 ? -19.528 -32.336 3.251   1.00 34.67  ? 174  SER A CA    1 
ATOM   1211 C  C     . SER A 1 157 ? -18.406 -31.291 3.252   1.00 33.13  ? 174  SER A C     1 
ATOM   1212 O  O     . SER A 1 157 ? -17.886 -30.903 2.178   1.00 34.83  ? 174  SER A O     1 
ATOM   1213 C  CB    . SER A 1 157 ? -19.098 -33.588 2.487   1.00 37.97  ? 174  SER A CB    1 
ATOM   1214 O  OG    . SER A 1 157 ? -17.862 -34.107 2.961   1.00 40.41  ? 174  SER A OG    1 
ATOM   1215 N  N     . ALA A 1 158 ? -17.953 -30.904 4.445   1.00 29.10  ? 175  ALA A N     1 
ATOM   1216 C  CA    . ALA A 1 158 ? -16.709 -30.160 4.512   1.00 27.58  ? 175  ALA A CA    1 
ATOM   1217 C  C     . ALA A 1 158 ? -15.483 -31.027 4.093   1.00 30.48  ? 175  ALA A C     1 
ATOM   1218 O  O     . ALA A 1 158 ? -14.501 -30.533 3.534   1.00 31.46  ? 175  ALA A O     1 
ATOM   1219 C  CB    . ALA A 1 158 ? -16.523 -29.515 5.888   1.00 23.96  ? 175  ALA A CB    1 
ATOM   1220 N  N     . LYS A 1 159 ? -15.560 -32.312 4.354   1.00 30.72  ? 176  LYS A N     1 
ATOM   1221 C  CA    . LYS A 1 159 ? -14.474 -33.242 4.051   1.00 33.34  ? 176  LYS A CA    1 
ATOM   1222 C  C     . LYS A 1 159 ? -14.223 -33.364 2.532   1.00 36.76  ? 176  LYS A C     1 
ATOM   1223 O  O     . LYS A 1 159 ? -13.091 -33.130 2.030   1.00 36.27  ? 176  LYS A O     1 
ATOM   1224 C  CB    . LYS A 1 159 ? -14.816 -34.621 4.628   1.00 32.82  ? 176  LYS A CB    1 
ATOM   1225 C  CG    . LYS A 1 159 ? -13.698 -35.587 4.561   1.00 35.81  ? 176  LYS A CG    1 
ATOM   1226 C  CD    . LYS A 1 159 ? -14.100 -36.950 5.106   1.00 38.27  ? 176  LYS A CD    1 
ATOM   1227 C  CE    . LYS A 1 159 ? -12.991 -37.929 4.809   1.00 42.47  ? 176  LYS A CE    1 
ATOM   1228 N  NZ    . LYS A 1 159 ? -12.873 -39.059 5.783   1.00 46.03  ? 176  LYS A NZ    1 
ATOM   1229 N  N     . ASP A 1 160 ? -15.301 -33.688 1.816   1.00 39.28  ? 177  ASP A N     1 
ATOM   1230 C  CA    . ASP A 1 160 ? -15.270 -33.860 0.357   1.00 42.16  ? 177  ASP A CA    1 
ATOM   1231 C  C     . ASP A 1 160 ? -15.693 -32.636 -0.457  1.00 37.38  ? 177  ASP A C     1 
ATOM   1232 O  O     . ASP A 1 160 ? -15.835 -32.715 -1.675  1.00 37.78  ? 177  ASP A O     1 
ATOM   1233 C  CB    . ASP A 1 160 ? -16.166 -35.035 -0.036  1.00 46.92  ? 177  ASP A CB    1 
ATOM   1234 C  CG    . ASP A 1 160 ? -15.649 -36.357 0.492   1.00 49.53  ? 177  ASP A CG    1 
ATOM   1235 O  OD1   . ASP A 1 160 ? -14.447 -36.461 0.804   1.00 51.05  ? 177  ASP A OD1   1 
ATOM   1236 O  OD2   . ASP A 1 160 ? -16.452 -37.304 0.556   1.00 53.27  ? 177  ASP A OD2   1 
ATOM   1237 N  N     . ASN A 1 161 ? -15.827 -31.497 0.197   1.00 33.91  ? 178  ASN A N     1 
ATOM   1238 C  CA    . ASN A 1 161 ? -16.268 -30.284 -0.459  1.00 33.27  ? 178  ASN A CA    1 
ATOM   1239 C  C     . ASN A 1 161 ? -17.549 -30.441 -1.337  1.00 33.51  ? 178  ASN A C     1 
ATOM   1240 O  O     . ASN A 1 161 ? -17.542 -30.166 -2.527  1.00 34.02  ? 178  ASN A O     1 
ATOM   1241 C  CB    . ASN A 1 161 ? -15.141 -29.669 -1.275  1.00 34.27  ? 178  ASN A CB    1 
ATOM   1242 C  CG    . ASN A 1 161 ? -15.431 -28.223 -1.588  1.00 33.24  ? 178  ASN A CG    1 
ATOM   1243 O  OD1   . ASN A 1 161 ? -16.181 -27.598 -0.886  1.00 32.44  ? 178  ASN A OD1   1 
ATOM   1244 N  ND2   . ASN A 1 161 ? -14.844 -27.700 -2.624  1.00 33.96  ? 178  ASN A ND2   1 
ATOM   1245 N  N     . ILE A 1 162 ? -18.644 -30.864 -0.716  1.00 33.92  ? 179  ILE A N     1 
ATOM   1246 C  CA    . ILE A 1 162 ? -19.879 -31.133 -1.449  1.00 32.88  ? 179  ILE A CA    1 
ATOM   1247 C  C     . ILE A 1 162 ? -20.868 -30.076 -1.028  1.00 32.76  ? 179  ILE A C     1 
ATOM   1248 O  O     . ILE A 1 162 ? -21.078 -29.902 0.148   1.00 31.59  ? 179  ILE A O     1 
ATOM   1249 C  CB    . ILE A 1 162 ? -20.470 -32.514 -1.088  1.00 33.90  ? 179  ILE A CB    1 
ATOM   1250 C  CG1   . ILE A 1 162 ? -19.516 -33.603 -1.531  1.00 35.68  ? 179  ILE A CG1   1 
ATOM   1251 C  CG2   . ILE A 1 162 ? -21.853 -32.671 -1.736  1.00 34.13  ? 179  ILE A CG2   1 
ATOM   1252 C  CD1   . ILE A 1 162 ? -20.030 -35.008 -1.306  1.00 38.13  ? 179  ILE A CD1   1 
ATOM   1253 N  N     . ASN A 1 163 ? -21.447 -29.384 -2.004  1.00 32.85  ? 180  ASN A N     1 
ATOM   1254 C  CA    . ASN A 1 163 ? -22.520 -28.405 -1.822  1.00 32.38  ? 180  ASN A CA    1 
ATOM   1255 C  C     . ASN A 1 163 ? -22.296 -27.192 -0.900  1.00 32.33  ? 180  ASN A C     1 
ATOM   1256 O  O     . ASN A 1 163 ? -23.243 -26.458 -0.656  1.00 32.30  ? 180  ASN A O     1 
ATOM   1257 C  CB    . ASN A 1 163 ? -23.826 -29.094 -1.411  1.00 31.03  ? 180  ASN A CB    1 
ATOM   1258 C  CG    . ASN A 1 163 ? -24.378 -30.001 -2.497  1.00 34.42  ? 180  ASN A CG    1 
ATOM   1259 O  OD1   . ASN A 1 163 ? -24.125 -29.820 -3.675  1.00 37.31  ? 180  ASN A OD1   1 
ATOM   1260 N  ND2   . ASN A 1 163 ? -25.128 -31.004 -2.081  1.00 33.86  ? 180  ASN A ND2   1 
ATOM   1261 N  N     . ILE A 1 164 ? -21.090 -26.965 -0.410  1.00 32.58  ? 181  ILE A N     1 
ATOM   1262 C  CA    . ILE A 1 164 ? -20.849 -25.844 0.463   1.00 32.12  ? 181  ILE A CA    1 
ATOM   1263 C  C     . ILE A 1 164 ? -20.935 -24.505 -0.309  1.00 33.97  ? 181  ILE A C     1 
ATOM   1264 O  O     . ILE A 1 164 ? -21.647 -23.607 0.135   1.00 34.35  ? 181  ILE A O     1 
ATOM   1265 C  CB    . ILE A 1 164 ? -19.583 -26.022 1.294   1.00 29.23  ? 181  ILE A CB    1 
ATOM   1266 C  CG1   . ILE A 1 164 ? -19.880 -26.957 2.444   1.00 27.67  ? 181  ILE A CG1   1 
ATOM   1267 C  CG2   . ILE A 1 164 ? -19.086 -24.707 1.882   1.00 27.16  ? 181  ILE A CG2   1 
ATOM   1268 C  CD1   . ILE A 1 164 ? -18.671 -27.741 2.904   1.00 27.55  ? 181  ILE A CD1   1 
ATOM   1269 N  N     . GLU A 1 165 ? -20.344 -24.463 -1.493  1.00 36.04  ? 182  GLU A N     1 
ATOM   1270 C  CA    . GLU A 1 165 ? -20.379 -23.321 -2.391  1.00 39.93  ? 182  GLU A CA    1 
ATOM   1271 C  C     . GLU A 1 165 ? -21.825 -22.991 -2.837  1.00 36.94  ? 182  GLU A C     1 
ATOM   1272 O  O     . GLU A 1 165 ? -22.227 -21.842 -2.829  1.00 34.66  ? 182  GLU A O     1 
ATOM   1273 C  CB    . GLU A 1 165 ? -19.573 -23.633 -3.652  1.00 48.15  ? 182  GLU A CB    1 
ATOM   1274 C  CG    . GLU A 1 165 ? -18.090 -23.912 -3.417  1.00 53.91  ? 182  GLU A CG    1 
ATOM   1275 C  CD    . GLU A 1 165 ? -17.292 -22.651 -3.218  1.00 60.17  ? 182  GLU A CD    1 
ATOM   1276 O  OE1   . GLU A 1 165 ? -17.538 -21.647 -3.944  1.00 63.26  ? 182  GLU A OE1   1 
ATOM   1277 O  OE2   . GLU A 1 165 ? -16.423 -22.646 -2.315  1.00 64.18  ? 182  GLU A OE2   1 
ATOM   1278 N  N     . GLU A 1 166 ? -22.568 -24.016 -3.250  1.00 35.20  ? 183  GLU A N     1 
ATOM   1279 C  CA    . GLU A 1 166 ? -23.979 -23.867 -3.651  1.00 34.53  ? 183  GLU A CA    1 
ATOM   1280 C  C     . GLU A 1 166 ? -24.841 -23.383 -2.508  1.00 30.96  ? 183  GLU A C     1 
ATOM   1281 O  O     . GLU A 1 166 ? -25.670 -22.459 -2.689  1.00 31.12  ? 183  GLU A O     1 
ATOM   1282 C  CB    . GLU A 1 166 ? -24.530 -25.165 -4.195  1.00 37.99  ? 183  GLU A CB    1 
ATOM   1283 C  CG    . GLU A 1 166 ? -23.905 -25.542 -5.545  1.00 40.26  ? 183  GLU A CG    1 
ATOM   1284 C  CD    . GLU A 1 166 ? -22.551 -26.226 -5.486  1.00 40.11  ? 183  GLU A CD    1 
ATOM   1285 O  OE1   . GLU A 1 166 ? -21.910 -26.372 -4.374  1.00 39.36  ? 183  GLU A OE1   1 
ATOM   1286 O  OE2   . GLU A 1 166 ? -22.136 -26.585 -6.595  1.00 42.66  ? 183  GLU A OE2   1 
ATOM   1287 N  N     . ALA A 1 167 ? -24.648 -23.977 -1.326  1.00 27.66  ? 184  ALA A N     1 
ATOM   1288 C  CA    . ALA A 1 167 ? -25.383 -23.544 -0.140  1.00 24.83  ? 184  ALA A CA    1 
ATOM   1289 C  C     . ALA A 1 167 ? -25.120 -22.074 0.203   1.00 24.45  ? 184  ALA A C     1 
ATOM   1290 O  O     . ALA A 1 167 ? -26.063 -21.309 0.492   1.00 25.33  ? 184  ALA A O     1 
ATOM   1291 C  CB    . ALA A 1 167 ? -25.073 -24.425 1.052   1.00 22.34  ? 184  ALA A CB    1 
ATOM   1292 N  N     . ALA A 1 168 ? -23.850 -21.685 0.224   1.00 22.95  ? 185  ALA A N     1 
ATOM   1293 C  CA    . ALA A 1 168 ? -23.502 -20.244 0.397   1.00 23.40  ? 185  ALA A CA    1 
ATOM   1294 C  C     . ALA A 1 168 ? -24.102 -19.314 -0.615  1.00 25.01  ? 185  ALA A C     1 
ATOM   1295 O  O     . ALA A 1 168 ? -24.559 -18.214 -0.231  1.00 25.79  ? 185  ALA A O     1 
ATOM   1296 C  CB    . ALA A 1 168 ? -21.998 -20.032 0.432   1.00 22.15  ? 185  ALA A CB    1 
ATOM   1297 N  N     . ARG A 1 169 ? -24.041 -19.668 -1.910  1.00 26.36  ? 186  ARG A N     1 
ATOM   1298 C  CA    . ARG A 1 169 ? -24.588 -18.809 -2.908  1.00 28.37  ? 186  ARG A CA    1 
ATOM   1299 C  C     . ARG A 1 169 ? -26.103 -18.688 -2.749  1.00 26.70  ? 186  ARG A C     1 
ATOM   1300 O  O     . ARG A 1 169 ? -26.631 -17.581 -2.961  1.00 24.23  ? 186  ARG A O     1 
ATOM   1301 C  CB    . ARG A 1 169 ? -24.282 -19.252 -4.329  1.00 32.58  ? 186  ARG A CB    1 
ATOM   1302 C  CG    . ARG A 1 169 ? -23.183 -18.471 -4.977  1.00 34.09  ? 186  ARG A CG    1 
ATOM   1303 C  CD    . ARG A 1 169 ? -23.135 -18.697 -6.466  1.00 34.34  ? 186  ARG A CD    1 
ATOM   1304 N  NE    . ARG A 1 169 ? -23.629 -17.556 -7.163  1.00 34.55  ? 186  ARG A NE    1 
ATOM   1305 C  CZ    . ARG A 1 169 ? -22.879 -16.593 -7.693  1.00 34.71  ? 186  ARG A CZ    1 
ATOM   1306 N  NH1   . ARG A 1 169 ? -21.536 -16.551 -7.572  1.00 33.90  ? 186  ARG A NH1   1 
ATOM   1307 N  NH2   . ARG A 1 169 ? -23.495 -15.645 -8.330  1.00 35.91  ? 186  ARG A NH2   1 
ATOM   1308 N  N     . PHE A 1 170 ? -26.763 -19.791 -2.403  1.00 26.19  ? 187  PHE A N     1 
ATOM   1309 C  CA    . PHE A 1 170 ? -28.200 -19.788 -2.127  1.00 27.66  ? 187  PHE A CA    1 
ATOM   1310 C  C     . PHE A 1 170 ? -28.609 -18.840 -1.007  1.00 28.19  ? 187  PHE A C     1 
ATOM   1311 O  O     . PHE A 1 170 ? -29.555 -18.045 -1.146  1.00 29.09  ? 187  PHE A O     1 
ATOM   1312 C  CB    . PHE A 1 170 ? -28.691 -21.204 -1.862  1.00 28.38  ? 187  PHE A CB    1 
ATOM   1313 C  CG    . PHE A 1 170 ? -30.187 -21.314 -1.686  1.00 29.37  ? 187  PHE A CG    1 
ATOM   1314 C  CD1   . PHE A 1 170 ? -30.774 -21.136 -0.438  1.00 30.20  ? 187  PHE A CD1   1 
ATOM   1315 C  CD2   . PHE A 1 170 ? -30.990 -21.673 -2.751  1.00 32.11  ? 187  PHE A CD2   1 
ATOM   1316 C  CE1   . PHE A 1 170 ? -32.162 -21.309 -0.269  1.00 34.19  ? 187  PHE A CE1   1 
ATOM   1317 C  CE2   . PHE A 1 170 ? -32.386 -21.839 -2.612  1.00 34.42  ? 187  PHE A CE2   1 
ATOM   1318 C  CZ    . PHE A 1 170 ? -32.971 -21.640 -1.365  1.00 35.34  ? 187  PHE A CZ    1 
ATOM   1319 N  N     . LEU A 1 171 ? -27.858 -18.846 0.080   1.00 28.30  ? 188  LEU A N     1 
ATOM   1320 C  CA    . LEU A 1 171 ? -28.188 -17.952 1.168   1.00 27.15  ? 188  LEU A CA    1 
ATOM   1321 C  C     . LEU A 1 171 ? -27.922 -16.481 0.806   1.00 26.75  ? 188  LEU A C     1 
ATOM   1322 O  O     . LEU A 1 171 ? -28.706 -15.588 1.190   1.00 25.40  ? 188  LEU A O     1 
ATOM   1323 C  CB    . LEU A 1 171 ? -27.491 -18.379 2.429   1.00 24.86  ? 188  LEU A CB    1 
ATOM   1324 C  CG    . LEU A 1 171 ? -27.616 -17.468 3.658   1.00 24.86  ? 188  LEU A CG    1 
ATOM   1325 C  CD1   . LEU A 1 171 ? -29.025 -17.363 4.153   1.00 24.23  ? 188  LEU A CD1   1 
ATOM   1326 C  CD2   . LEU A 1 171 ? -26.716 -17.841 4.803   1.00 24.48  ? 188  LEU A CD2   1 
ATOM   1327 N  N     . VAL A 1 172 ? -26.814 -16.247 0.100   1.00 26.43  ? 189  VAL A N     1 
ATOM   1328 C  CA    . VAL A 1 172 ? -26.438 -14.886 -0.344  1.00 26.56  ? 189  VAL A CA    1 
ATOM   1329 C  C     . VAL A 1 172 ? -27.402 -14.324 -1.296  1.00 29.06  ? 189  VAL A C     1 
ATOM   1330 O  O     . VAL A 1 172 ? -27.705 -13.101 -1.218  1.00 28.53  ? 189  VAL A O     1 
ATOM   1331 C  CB    . VAL A 1 172 ? -25.010 -14.855 -0.940  1.00 22.94  ? 189  VAL A CB    1 
ATOM   1332 C  CG1   . VAL A 1 172 ? -24.709 -13.484 -1.572  1.00 22.78  ? 189  VAL A CG1   1 
ATOM   1333 C  CG2   . VAL A 1 172 ? -24.046 -15.145 0.173   1.00 19.29  ? 189  VAL A CG2   1 
ATOM   1334 N  N     . GLU A 1 173 ? -27.919 -15.187 -2.178  1.00 32.69  ? 190  GLU A N     1 
ATOM   1335 C  CA    . GLU A 1 173 ? -28.997 -14.794 -3.052  1.00 37.84  ? 190  GLU A CA    1 
ATOM   1336 C  C     . GLU A 1 173 ? -30.200 -14.259 -2.250  1.00 36.78  ? 190  GLU A C     1 
ATOM   1337 O  O     . GLU A 1 173 ? -30.687 -13.166 -2.549  1.00 38.06  ? 190  GLU A O     1 
ATOM   1338 C  CB    . GLU A 1 173 ? -29.382 -15.920 -3.982  1.00 43.81  ? 190  GLU A CB    1 
ATOM   1339 C  CG    . GLU A 1 173 ? -30.418 -15.543 -5.051  1.00 48.63  ? 190  GLU A CG    1 
ATOM   1340 C  CD    . GLU A 1 173 ? -30.853 -16.726 -5.889  1.00 55.76  ? 190  GLU A CD    1 
ATOM   1341 O  OE1   . GLU A 1 173 ? -31.471 -17.708 -5.376  1.00 60.34  ? 190  GLU A OE1   1 
ATOM   1342 O  OE2   . GLU A 1 173 ? -30.561 -16.683 -7.088  1.00 60.95  ? 190  GLU A OE2   1 
ATOM   1343 N  N     . LYS A 1 174 ? -30.645 -14.981 -1.225  1.00 35.12  ? 191  LYS A N     1 
ATOM   1344 C  CA    . LYS A 1 174 ? -31.762 -14.474 -0.373  1.00 35.16  ? 191  LYS A CA    1 
ATOM   1345 C  C     . LYS A 1 174 ? -31.395 -13.166 0.363   1.00 32.91  ? 191  LYS A C     1 
ATOM   1346 O  O     . LYS A 1 174 ? -32.219 -12.307 0.475   1.00 34.07  ? 191  LYS A O     1 
ATOM   1347 C  CB    . LYS A 1 174 ? -32.184 -15.477 0.690   1.00 37.33  ? 191  LYS A CB    1 
ATOM   1348 C  CG    . LYS A 1 174 ? -32.591 -16.857 0.215   1.00 41.34  ? 191  LYS A CG    1 
ATOM   1349 C  CD    . LYS A 1 174 ? -33.946 -16.844 -0.428  1.00 46.78  ? 191  LYS A CD    1 
ATOM   1350 C  CE    . LYS A 1 174 ? -34.071 -17.999 -1.390  1.00 49.72  ? 191  LYS A CE    1 
ATOM   1351 N  NZ    . LYS A 1 174 ? -33.023 -17.932 -2.442  1.00 51.00  ? 191  LYS A NZ    1 
ATOM   1352 N  N     . ILE A 1 175 ? -30.158 -13.018 0.840   1.00 29.77  ? 192  ILE A N     1 
ATOM   1353 C  CA    . ILE A 1 175 ? -29.752 -11.788 1.497   1.00 29.22  ? 192  ILE A CA    1 
ATOM   1354 C  C     . ILE A 1 175 ? -29.755 -10.589 0.528   1.00 29.50  ? 192  ILE A C     1 
ATOM   1355 O  O     . ILE A 1 175 ? -30.225 -9.473  0.866   1.00 33.27  ? 192  ILE A O     1 
ATOM   1356 C  CB    . ILE A 1 175 ? -28.313 -11.918 2.154   1.00 25.91  ? 192  ILE A CB    1 
ATOM   1357 C  CG1   . ILE A 1 175 ? -28.256 -13.001 3.178   1.00 25.65  ? 192  ILE A CG1   1 
ATOM   1358 C  CG2   . ILE A 1 175 ? -27.919 -10.580 2.813   1.00 26.33  ? 192  ILE A CG2   1 
ATOM   1359 C  CD1   . ILE A 1 175 ? -26.823 -13.531 3.429   1.00 23.76  ? 192  ILE A CD1   1 
ATOM   1360 N  N     . LEU A 1 176 ? -29.290 -10.818 -0.693  1.00 27.85  ? 193  LEU A N     1 
ATOM   1361 C  CA    . LEU A 1 176 ? -29.313 -9.790  -1.714  1.00 28.93  ? 193  LEU A CA    1 
ATOM   1362 C  C     . LEU A 1 176 ? -30.712 -9.299  -2.091  1.00 31.27  ? 193  LEU A C     1 
ATOM   1363 O  O     . LEU A 1 176 ? -30.914 -8.108  -2.297  1.00 32.52  ? 193  LEU A O     1 
ATOM   1364 C  CB    . LEU A 1 176 ? -28.574 -10.197 -2.964  1.00 29.23  ? 193  LEU A CB    1 
ATOM   1365 C  CG    . LEU A 1 176 ? -27.070 -10.222 -2.842  1.00 29.34  ? 193  LEU A CG    1 
ATOM   1366 C  CD1   . LEU A 1 176 ? -26.488 -10.921 -4.065  1.00 28.79  ? 193  LEU A CD1   1 
ATOM   1367 C  CD2   . LEU A 1 176 ? -26.513 -8.781  -2.764  1.00 31.30  ? 193  LEU A CD2   1 
ATOM   1368 N  N     . VAL A 1 177 ? -31.679 -10.199 -2.152  1.00 31.15  ? 194  VAL A N     1 
ATOM   1369 C  CA    . VAL A 1 177 ? -33.050 -9.783  -2.485  1.00 33.39  ? 194  VAL A CA    1 
ATOM   1370 C  C     . VAL A 1 177 ? -33.599 -8.878  -1.381  1.00 35.41  ? 194  VAL A C     1 
ATOM   1371 O  O     . VAL A 1 177 ? -34.160 -7.820  -1.679  1.00 39.89  ? 194  VAL A O     1 
ATOM   1372 C  CB    . VAL A 1 177 ? -33.992 -10.998 -2.763  1.00 32.83  ? 194  VAL A CB    1 
ATOM   1373 C  CG1   . VAL A 1 177 ? -35.448 -10.535 -2.959  1.00 33.47  ? 194  VAL A CG1   1 
ATOM   1374 C  CG2   . VAL A 1 177 ? -33.503 -11.732 -3.988  1.00 31.16  ? 194  VAL A CG2   1 
ATOM   1375 N  N     . ASN A 1 178 ? -33.346 -9.254  -0.135  1.00 35.70  ? 195  ASN A N     1 
ATOM   1376 C  CA    . ASN A 1 178 ? -33.753 -8.494  1.047   1.00 38.54  ? 195  ASN A CA    1 
ATOM   1377 C  C     . ASN A 1 178 ? -33.036 -7.168  1.148   1.00 42.33  ? 195  ASN A C     1 
ATOM   1378 O  O     . ASN A 1 178 ? -33.598 -6.223  1.666   1.00 43.42  ? 195  ASN A O     1 
ATOM   1379 C  CB    . ASN A 1 178 ? -33.447 -9.252  2.338   1.00 36.20  ? 195  ASN A CB    1 
ATOM   1380 C  CG    . ASN A 1 178 ? -34.240 -10.526 2.472   1.00 35.17  ? 195  ASN A CG    1 
ATOM   1381 O  OD1   . ASN A 1 178 ? -35.203 -10.742 1.745   1.00 36.55  ? 195  ASN A OD1   1 
ATOM   1382 N  ND2   . ASN A 1 178 ? -33.790 -11.410 3.380   1.00 33.50  ? 195  ASN A ND2   1 
ATOM   1383 N  N     . HIS A 1 179 ? -31.814 -7.089  0.640   1.00 44.53  ? 196  HIS A N     1 
ATOM   1384 C  CA    . HIS A 1 179 ? -31.048 -5.893  0.789   1.00 49.53  ? 196  HIS A CA    1 
ATOM   1385 C  C     . HIS A 1 179 ? -31.493 -4.858  -0.219  1.00 59.61  ? 196  HIS A C     1 
ATOM   1386 O  O     . HIS A 1 179 ? -31.616 -3.703  0.149   1.00 61.31  ? 196  HIS A O     1 
ATOM   1387 C  CB    . HIS A 1 179 ? -29.556 -6.187  0.751   1.00 45.45  ? 196  HIS A CB    1 
ATOM   1388 C  CG    . HIS A 1 179 ? -28.709 -5.015  1.078   1.00 44.76  ? 196  HIS A CG    1 
ATOM   1389 N  ND1   . HIS A 1 179 ? -28.342 -4.095  0.117   1.00 46.21  ? 196  HIS A ND1   1 
ATOM   1390 C  CD2   . HIS A 1 179 ? -28.229 -4.553  2.253   1.00 44.32  ? 196  HIS A CD2   1 
ATOM   1391 C  CE1   . HIS A 1 179 ? -27.645 -3.128  0.684   1.00 47.01  ? 196  HIS A CE1   1 
ATOM   1392 N  NE2   . HIS A 1 179 ? -27.560 -3.384  1.978   1.00 45.72  ? 196  HIS A NE2   1 
ATOM   1393 N  N     . GLN A 1 180 ? -31.816 -5.300  -1.433  1.00 69.63  ? 197  GLN A N     1 
ATOM   1394 C  CA    . GLN A 1 180 ? -32.528 -4.477  -2.422  1.00 81.93  ? 197  GLN A CA    1 
ATOM   1395 C  C     . GLN A 1 180 ? -33.962 -4.052  -2.020  1.00 83.79  ? 197  GLN A C     1 
ATOM   1396 O  O     . GLN A 1 180 ? -34.383 -2.937  -2.339  1.00 86.10  ? 197  GLN A O     1 
ATOM   1397 C  CB    . GLN A 1 180 ? -32.560 -5.205  -3.783  1.00 92.29  ? 197  GLN A CB    1 
ATOM   1398 C  CG    . GLN A 1 180 ? -31.219 -5.389  -4.504  1.00 100.38 ? 197  GLN A CG    1 
ATOM   1399 C  CD    . GLN A 1 180 ? -31.310 -6.178  -5.808  1.00 111.51 ? 197  GLN A CD    1 
ATOM   1400 O  OE1   . GLN A 1 180 ? -32.224 -6.985  -6.002  1.00 115.29 ? 197  GLN A OE1   1 
ATOM   1401 N  NE2   . GLN A 1 180 ? -30.366 -5.941  -6.714  1.00 115.89 ? 197  GLN A NE2   1 
ATOM   1402 N  N     . SER A 1 181 ? -34.718 -4.928  -1.367  1.00 83.62  ? 198  SER A N     1 
ATOM   1403 C  CA    . SER A 1 181 ? -36.179 -4.724  -1.190  1.00 85.65  ? 198  SER A CA    1 
ATOM   1404 C  C     . SER A 1 181 ? -36.534 -3.460  -0.402  1.00 87.25  ? 198  SER A C     1 
ATOM   1405 O  O     . SER A 1 181 ? -36.230 -3.354  0.789   1.00 86.29  ? 198  SER A O     1 
ATOM   1406 C  CB    . SER A 1 181 ? -36.815 -5.951  -0.505  1.00 84.40  ? 198  SER A CB    1 
ATOM   1407 O  OG    . SER A 1 181 ? -36.241 -6.183  0.781   1.00 82.39  ? 198  SER A OG    1 
ATOM   1408 N  N     . GLU B 1 3   ? -27.664 -1.890  40.222  1.00 74.01  ? 20   GLU B N     1 
ATOM   1409 C  CA    . GLU B 1 3   ? -27.735 -1.769  38.719  1.00 72.04  ? 20   GLU B CA    1 
ATOM   1410 C  C     . GLU B 1 3   ? -26.393 -1.937  38.034  1.00 67.57  ? 20   GLU B C     1 
ATOM   1411 O  O     . GLU B 1 3   ? -25.392 -1.245  38.370  1.00 67.64  ? 20   GLU B O     1 
ATOM   1412 C  CB    . GLU B 1 3   ? -28.321 -0.397  38.281  1.00 74.41  ? 20   GLU B CB    1 
ATOM   1413 C  CG    . GLU B 1 3   ? -29.628 0.045   38.957  1.00 78.40  ? 20   GLU B CG    1 
ATOM   1414 C  CD    . GLU B 1 3   ? -29.470 1.258   39.881  1.00 79.78  ? 20   GLU B CD    1 
ATOM   1415 O  OE1   . GLU B 1 3   ? -28.536 2.075   39.673  1.00 77.72  ? 20   GLU B OE1   1 
ATOM   1416 O  OE2   . GLU B 1 3   ? -30.291 1.397   40.803  1.00 82.70  ? 20   GLU B OE2   1 
ATOM   1417 N  N     . THR B 1 4   ? -26.379 -2.840  37.045  1.00 63.87  ? 21   THR B N     1 
ATOM   1418 C  CA    . THR B 1 4   ? -25.254 -2.996  36.131  1.00 59.91  ? 21   THR B CA    1 
ATOM   1419 C  C     . THR B 1 4   ? -25.494 -2.529  34.683  1.00 57.49  ? 21   THR B C     1 
ATOM   1420 O  O     . THR B 1 4   ? -26.610 -2.275  34.254  1.00 59.13  ? 21   THR B O     1 
ATOM   1421 C  CB    . THR B 1 4   ? -24.760 -4.444  36.081  1.00 59.92  ? 21   THR B CB    1 
ATOM   1422 O  OG1   . THR B 1 4   ? -23.514 -4.473  35.360  1.00 58.93  ? 21   THR B OG1   1 
ATOM   1423 C  CG2   . THR B 1 4   ? -25.740 -5.384  35.439  1.00 60.07  ? 21   THR B CG2   1 
ATOM   1424 N  N     . ARG B 1 5   ? -24.399 -2.460  33.944  1.00 53.13  ? 22   ARG B N     1 
ATOM   1425 C  CA    . ARG B 1 5   ? -24.385 -1.959  32.614  1.00 50.15  ? 22   ARG B CA    1 
ATOM   1426 C  C     . ARG B 1 5   ? -23.506 -2.844  31.748  1.00 45.62  ? 22   ARG B C     1 
ATOM   1427 O  O     . ARG B 1 5   ? -22.417 -3.253  32.156  1.00 43.95  ? 22   ARG B O     1 
ATOM   1428 C  CB    . ARG B 1 5   ? -23.859 -0.541  32.669  1.00 52.37  ? 22   ARG B CB    1 
ATOM   1429 C  CG    . ARG B 1 5   ? -24.845 0.449   33.264  1.00 58.62  ? 22   ARG B CG    1 
ATOM   1430 C  CD    . ARG B 1 5   ? -24.197 1.749   33.703  1.00 63.30  ? 22   ARG B CD    1 
ATOM   1431 N  NE    . ARG B 1 5   ? -23.675 2.529   32.572  1.00 64.39  ? 22   ARG B NE    1 
ATOM   1432 C  CZ    . ARG B 1 5   ? -23.289 3.810   32.634  1.00 65.83  ? 22   ARG B CZ    1 
ATOM   1433 N  NH1   . ARG B 1 5   ? -23.333 4.499   33.779  1.00 67.69  ? 22   ARG B NH1   1 
ATOM   1434 N  NH2   . ARG B 1 5   ? -22.839 4.415   31.527  1.00 64.84  ? 22   ARG B NH2   1 
ATOM   1435 N  N     . GLU B 1 6   ? -23.984 -3.103  30.545  1.00 43.02  ? 23   GLU B N     1 
ATOM   1436 C  CA    . GLU B 1 6   ? -23.313 -3.840  29.537  1.00 40.13  ? 23   GLU B CA    1 
ATOM   1437 C  C     . GLU B 1 6   ? -23.081 -2.882  28.386  1.00 38.02  ? 23   GLU B C     1 
ATOM   1438 O  O     . GLU B 1 6   ? -23.969 -2.107  28.045  1.00 40.96  ? 23   GLU B O     1 
ATOM   1439 C  CB    . GLU B 1 6   ? -24.142 -5.047  29.081  1.00 42.65  ? 23   GLU B CB    1 
ATOM   1440 C  CG    . GLU B 1 6   ? -24.454 -6.101  30.157  1.00 45.34  ? 23   GLU B CG    1 
ATOM   1441 C  CD    . GLU B 1 6   ? -24.892 -7.470  29.581  1.00 46.73  ? 23   GLU B CD    1 
ATOM   1442 O  OE1   . GLU B 1 6   ? -24.943 -7.652  28.327  1.00 48.26  ? 23   GLU B OE1   1 
ATOM   1443 O  OE2   . GLU B 1 6   ? -25.158 -8.411  30.380  1.00 51.61  ? 23   GLU B OE2   1 
ATOM   1444 N  N     . HIS B 1 7   ? -21.873 -2.905  27.828  1.00 33.53  ? 24   HIS B N     1 
ATOM   1445 C  CA    . HIS B 1 7   ? -21.508 -2.145  26.648  1.00 31.74  ? 24   HIS B CA    1 
ATOM   1446 C  C     . HIS B 1 7   ? -20.957 -3.018  25.558  1.00 28.62  ? 24   HIS B C     1 
ATOM   1447 O  O     . HIS B 1 7   ? -20.305 -4.020  25.839  1.00 27.80  ? 24   HIS B O     1 
ATOM   1448 C  CB    . HIS B 1 7   ? -20.416 -1.141  26.973  1.00 32.98  ? 24   HIS B CB    1 
ATOM   1449 C  CG    . HIS B 1 7   ? -20.784 -0.161  28.039  1.00 36.90  ? 24   HIS B CG    1 
ATOM   1450 N  ND1   . HIS B 1 7   ? -20.555 -0.399  29.379  1.00 38.63  ? 24   HIS B ND1   1 
ATOM   1451 C  CD2   . HIS B 1 7   ? -21.325 1.069   27.965  1.00 38.62  ? 24   HIS B CD2   1 
ATOM   1452 C  CE1   . HIS B 1 7   ? -20.965 0.631   30.088  1.00 39.91  ? 24   HIS B CE1   1 
ATOM   1453 N  NE2   . HIS B 1 7   ? -21.410 1.547   29.252  1.00 40.16  ? 24   HIS B NE2   1 
ATOM   1454 N  N     . LEU B 1 8   ? -21.171 -2.584  24.310  1.00 29.19  ? 25   LEU B N     1 
ATOM   1455 C  CA    . LEU B 1 8   ? -20.615 -3.226  23.126  1.00 29.26  ? 25   LEU B CA    1 
ATOM   1456 C  C     . LEU B 1 8   ? -19.871 -2.183  22.321  1.00 28.71  ? 25   LEU B C     1 
ATOM   1457 O  O     . LEU B 1 8   ? -20.478 -1.232  21.858  1.00 30.40  ? 25   LEU B O     1 
ATOM   1458 C  CB    . LEU B 1 8   ? -21.689 -3.881  22.272  1.00 31.86  ? 25   LEU B CB    1 
ATOM   1459 C  CG    . LEU B 1 8   ? -21.221 -4.702  21.075  1.00 33.33  ? 25   LEU B CG    1 
ATOM   1460 C  CD1   . LEU B 1 8   ? -20.386 -5.906  21.533  1.00 33.14  ? 25   LEU B CD1   1 
ATOM   1461 C  CD2   . LEU B 1 8   ? -22.485 -5.138  20.325  1.00 34.30  ? 25   LEU B CD2   1 
ATOM   1462 N  N     . PHE B 1 9   ? -18.543 -2.277  22.257  1.00 27.03  ? 26   PHE B N     1 
ATOM   1463 C  CA    . PHE B 1 9   ? -17.765 -1.251  21.549  1.00 26.20  ? 26   PHE B CA    1 
ATOM   1464 C  C     . PHE B 1 9   ? -17.007 -1.883  20.390  1.00 25.49  ? 26   PHE B C     1 
ATOM   1465 O  O     . PHE B 1 9   ? -16.418 -2.958  20.505  1.00 25.06  ? 26   PHE B O     1 
ATOM   1466 C  CB    . PHE B 1 9   ? -16.778 -0.578  22.507  1.00 26.41  ? 26   PHE B CB    1 
ATOM   1467 C  CG    . PHE B 1 9   ? -17.400 0.113   23.687  1.00 28.97  ? 26   PHE B CG    1 
ATOM   1468 C  CD1   . PHE B 1 9   ? -18.510 0.941   23.554  1.00 31.22  ? 26   PHE B CD1   1 
ATOM   1469 C  CD2   . PHE B 1 9   ? -16.832 -0.030  24.943  1.00 30.04  ? 26   PHE B CD2   1 
ATOM   1470 C  CE1   . PHE B 1 9   ? -19.062 1.587   24.654  1.00 33.01  ? 26   PHE B CE1   1 
ATOM   1471 C  CE2   . PHE B 1 9   ? -17.375 0.597   26.048  1.00 31.34  ? 26   PHE B CE2   1 
ATOM   1472 C  CZ    . PHE B 1 9   ? -18.487 1.421   25.910  1.00 33.43  ? 26   PHE B CZ    1 
ATOM   1473 N  N     . LYS B 1 10  ? -17.046 -1.213  19.242  1.00 24.97  ? 27   LYS B N     1 
ATOM   1474 C  CA    . LYS B 1 10  ? -16.313 -1.567  18.077  1.00 21.79  ? 27   LYS B CA    1 
ATOM   1475 C  C     . LYS B 1 10  ? -15.004 -0.843  18.147  1.00 20.77  ? 27   LYS B C     1 
ATOM   1476 O  O     . LYS B 1 10  ? -14.959 0.413   18.181  1.00 21.95  ? 27   LYS B O     1 
ATOM   1477 C  CB    . LYS B 1 10  ? -17.097 -1.254  16.779  1.00 22.72  ? 27   LYS B CB    1 
ATOM   1478 C  CG    . LYS B 1 10  ? -16.230 -1.405  15.535  1.00 24.30  ? 27   LYS B CG    1 
ATOM   1479 C  CD    . LYS B 1 10  ? -17.091 -1.376  14.283  1.00 26.49  ? 27   LYS B CD    1 
ATOM   1480 C  CE    . LYS B 1 10  ? -16.210 -1.406  13.033  1.00 28.35  ? 27   LYS B CE    1 
ATOM   1481 N  NZ    . LYS B 1 10  ? -16.975 -1.368  11.762  1.00 30.33  ? 27   LYS B NZ    1 
ATOM   1482 N  N     . VAL B 1 11  ? -13.936 -1.641  18.187  1.00 19.05  ? 28   VAL B N     1 
ATOM   1483 C  CA    . VAL B 1 11  ? -12.563 -1.158  18.244  1.00 17.77  ? 28   VAL B CA    1 
ATOM   1484 C  C     . VAL B 1 11  ? -11.686 -1.578  17.058  1.00 18.53  ? 28   VAL B C     1 
ATOM   1485 O  O     . VAL B 1 11  ? -11.590 -2.735  16.736  1.00 18.95  ? 28   VAL B O     1 
ATOM   1486 C  CB    . VAL B 1 11  ? -11.945 -1.524  19.555  1.00 17.07  ? 28   VAL B CB    1 
ATOM   1487 C  CG1   . VAL B 1 11  ? -10.480 -1.087  19.677  1.00 18.91  ? 28   VAL B CG1   1 
ATOM   1488 C  CG2   . VAL B 1 11  ? -12.775 -1.049  20.695  1.00 16.90  ? 28   VAL B CG2   1 
ATOM   1489 N  N     . LEU B 1 12  ? -11.016 -0.598  16.437  1.00 20.84  ? 29   LEU B N     1 
ATOM   1490 C  CA    . LEU B 1 12  ? -10.165 -0.833  15.330  1.00 21.24  ? 29   LEU B CA    1 
ATOM   1491 C  C     . LEU B 1 12  ? -8.754  -1.117  15.751  1.00 21.28  ? 29   LEU B C     1 
ATOM   1492 O  O     . LEU B 1 12  ? -8.270  -0.569  16.699  1.00 23.36  ? 29   LEU B O     1 
ATOM   1493 C  CB    . LEU B 1 12  ? -10.194 0.330   14.380  1.00 21.75  ? 29   LEU B CB    1 
ATOM   1494 C  CG    . LEU B 1 12  ? -11.569 0.614   13.811  1.00 24.76  ? 29   LEU B CG    1 
ATOM   1495 C  CD1   . LEU B 1 12  ? -11.505 2.032   13.252  1.00 24.39  ? 29   LEU B CD1   1 
ATOM   1496 C  CD2   . LEU B 1 12  ? -11.998 -0.436  12.754  1.00 24.89  ? 29   LEU B CD2   1 
ATOM   1497 N  N     . VAL B 1 13  ? -8.093  -1.992  15.016  1.00 22.55  ? 30   VAL B N     1 
ATOM   1498 C  CA    . VAL B 1 13  ? -6.655  -2.226  15.204  1.00 20.81  ? 30   VAL B CA    1 
ATOM   1499 C  C     . VAL B 1 13  ? -6.047  -2.008  13.874  1.00 21.43  ? 30   VAL B C     1 
ATOM   1500 O  O     . VAL B 1 13  ? -6.207  -2.834  12.989  1.00 23.10  ? 30   VAL B O     1 
ATOM   1501 C  CB    . VAL B 1 13  ? -6.351  -3.631  15.738  1.00 19.97  ? 30   VAL B CB    1 
ATOM   1502 C  CG1   . VAL B 1 13  ? -4.871  -3.758  16.097  1.00 18.68  ? 30   VAL B CG1   1 
ATOM   1503 C  CG2   . VAL B 1 13  ? -7.124  -3.895  16.987  1.00 18.71  ? 30   VAL B CG2   1 
ATOM   1504 N  N     . ILE B 1 14  ? -5.248  -0.937  13.714  1.00 21.76  ? 31   ILE B N     1 
ATOM   1505 C  CA    . ILE B 1 14  ? -4.739  -0.612  12.388  1.00 21.51  ? 31   ILE B CA    1 
ATOM   1506 C  C     . ILE B 1 14  ? -3.264  -0.403  12.451  1.00 22.57  ? 31   ILE B C     1 
ATOM   1507 O  O     . ILE B 1 14  ? -2.690  -0.229  13.546  1.00 25.15  ? 31   ILE B O     1 
ATOM   1508 C  CB    . ILE B 1 14  ? -5.462  0.575   11.738  1.00 22.37  ? 31   ILE B CB    1 
ATOM   1509 C  CG1   . ILE B 1 14  ? -5.144  1.870   12.467  1.00 23.37  ? 31   ILE B CG1   1 
ATOM   1510 C  CG2   . ILE B 1 14  ? -6.985  0.374   11.664  1.00 20.75  ? 31   ILE B CG2   1 
ATOM   1511 C  CD1   . ILE B 1 14  ? -6.012  2.999   11.949  1.00 24.55  ? 31   ILE B CD1   1 
ATOM   1512 N  N     . GLY B 1 15  ? -2.642  -0.458  11.277  1.00 23.75  ? 32   GLY B N     1 
ATOM   1513 C  CA    . GLY B 1 15  ? -1.153  -0.405  11.163  1.00 25.34  ? 32   GLY B CA    1 
ATOM   1514 C  C     . GLY B 1 15  ? -0.616  -1.189  9.970   1.00 27.38  ? 32   GLY B C     1 
ATOM   1515 O  O     . GLY B 1 15  ? -1.373  -1.942  9.288   1.00 26.01  ? 32   GLY B O     1 
ATOM   1516 N  N     . GLU B 1 16  ? 0.674   -0.990  9.688   1.00 28.65  ? 33   GLU B N     1 
ATOM   1517 C  CA    . GLU B 1 16  ? 1.297   -1.517  8.467   1.00 31.02  ? 33   GLU B CA    1 
ATOM   1518 C  C     . GLU B 1 16  ? 1.400   -3.021  8.569   1.00 30.54  ? 33   GLU B C     1 
ATOM   1519 O  O     . GLU B 1 16  ? 1.353   -3.577  9.644   1.00 28.63  ? 33   GLU B O     1 
ATOM   1520 C  CB    . GLU B 1 16  ? 2.751   -0.950  8.270   1.00 34.87  ? 33   GLU B CB    1 
ATOM   1521 C  CG    . GLU B 1 16  ? 2.880   0.485   7.750   1.00 36.50  ? 33   GLU B CG    1 
ATOM   1522 C  CD    . GLU B 1 16  ? 2.122   0.785   6.462   1.00 37.72  ? 33   GLU B CD    1 
ATOM   1523 O  OE1   . GLU B 1 16  ? 0.911   1.047   6.522   1.00 37.79  ? 33   GLU B OE1   1 
ATOM   1524 O  OE2   . GLU B 1 16  ? 2.683   0.769   5.364   1.00 40.98  ? 33   GLU B OE2   1 
ATOM   1525 N  N     . LEU B 1 17  ? 1.582   -3.650  7.426   1.00 32.99  ? 34   LEU B N     1 
ATOM   1526 C  CA    . LEU B 1 17  ? 1.890   -5.121  7.333   1.00 33.62  ? 34   LEU B CA    1 
ATOM   1527 C  C     . LEU B 1 17  ? 2.987   -5.502  8.317   1.00 34.25  ? 34   LEU B C     1 
ATOM   1528 O  O     . LEU B 1 17  ? 3.999   -4.789  8.429   1.00 34.83  ? 34   LEU B O     1 
ATOM   1529 C  CB    . LEU B 1 17  ? 2.461   -5.415  5.982   1.00 36.65  ? 34   LEU B CB    1 
ATOM   1530 C  CG    . LEU B 1 17  ? 1.561   -5.227  4.782   1.00 37.97  ? 34   LEU B CG    1 
ATOM   1531 C  CD1   . LEU B 1 17  ? 2.490   -5.225  3.567   1.00 39.57  ? 34   LEU B CD1   1 
ATOM   1532 C  CD2   . LEU B 1 17  ? 0.528   -6.344  4.703   1.00 37.54  ? 34   LEU B CD2   1 
ATOM   1533 N  N     . GLY B 1 18  ? 2.771   -6.602  9.032   1.00 32.80  ? 35   GLY B N     1 
ATOM   1534 C  CA    . GLY B 1 18  ? 3.797   -7.274  9.791   1.00 32.98  ? 35   GLY B CA    1 
ATOM   1535 C  C     . GLY B 1 18  ? 4.065   -6.672  11.160  1.00 32.12  ? 35   GLY B C     1 
ATOM   1536 O  O     . GLY B 1 18  ? 4.976   -7.087  11.824  1.00 32.75  ? 35   GLY B O     1 
ATOM   1537 N  N     . VAL B 1 19  ? 3.215   -5.756  11.601  1.00 31.92  ? 36   VAL B N     1 
ATOM   1538 C  CA    . VAL B 1 19  ? 3.460   -4.897  12.768  1.00 29.20  ? 36   VAL B CA    1 
ATOM   1539 C  C     . VAL B 1 19  ? 3.052   -5.601  14.056  1.00 30.35  ? 36   VAL B C     1 
ATOM   1540 O  O     . VAL B 1 19  ? 3.618   -5.367  15.138  1.00 31.12  ? 36   VAL B O     1 
ATOM   1541 C  CB    . VAL B 1 19  ? 2.832   -3.536  12.355  1.00 28.47  ? 36   VAL B CB    1 
ATOM   1542 C  CG1   . VAL B 1 19  ? 1.454   -3.205  12.957  1.00 26.22  ? 36   VAL B CG1   1 
ATOM   1543 C  CG2   . VAL B 1 19  ? 3.826   -2.439  12.381  1.00 29.98  ? 36   VAL B CG2   1 
ATOM   1544 N  N     . GLY B 1 20  ? 2.107   -6.552  13.918  1.00 29.72  ? 37   GLY B N     1 
ATOM   1545 C  CA    . GLY B 1 20  ? 1.638   -7.384  15.033  1.00 26.75  ? 37   GLY B CA    1 
ATOM   1546 C  C     . GLY B 1 20  ? 0.145   -7.264  15.392  1.00 26.79  ? 37   GLY B C     1 
ATOM   1547 O  O     . GLY B 1 20  ? -0.223  -7.727  16.424  1.00 28.52  ? 37   GLY B O     1 
ATOM   1548 N  N     . LYS B 1 21  ? -0.671  -6.606  14.561  1.00 24.65  ? 38   LYS B N     1 
ATOM   1549 C  CA    . LYS B 1 21  ? -2.082  -6.413  14.838  1.00 23.57  ? 38   LYS B CA    1 
ATOM   1550 C  C     . LYS B 1 21  ? -2.747  -7.712  15.222  1.00 24.55  ? 38   LYS B C     1 
ATOM   1551 O  O     . LYS B 1 21  ? -3.343  -7.791  16.279  1.00 25.87  ? 38   LYS B O     1 
ATOM   1552 C  CB    . LYS B 1 21  ? -2.810  -5.829  13.638  1.00 22.68  ? 38   LYS B CB    1 
ATOM   1553 C  CG    . LYS B 1 21  ? -2.395  -4.398  13.280  1.00 23.35  ? 38   LYS B CG    1 
ATOM   1554 C  CD    . LYS B 1 21  ? -2.966  -3.869  11.977  1.00 22.81  ? 38   LYS B CD    1 
ATOM   1555 C  CE    . LYS B 1 21  ? -2.672  -4.701  10.722  1.00 24.00  ? 38   LYS B CE    1 
ATOM   1556 N  NZ    . LYS B 1 21  ? -1.240  -4.942  10.405  1.00 25.04  ? 38   LYS B NZ    1 
ATOM   1557 N  N     . THR B 1 22  ? -2.539  -8.757  14.437  1.00 25.07  ? 39   THR B N     1 
ATOM   1558 C  CA    . THR B 1 22  ? -3.255  -10.029 14.667  1.00 23.75  ? 39   THR B CA    1 
ATOM   1559 C  C     . THR B 1 22  ? -2.765  -10.719 15.903  1.00 24.21  ? 39   THR B C     1 
ATOM   1560 O  O     . THR B 1 22  ? -3.574  -11.307 16.623  1.00 25.06  ? 39   THR B O     1 
ATOM   1561 C  CB    . THR B 1 22  ? -3.149  -10.894 13.434  1.00 24.44  ? 39   THR B CB    1 
ATOM   1562 O  OG1   . THR B 1 22  ? -3.842  -10.262 12.355  1.00 23.17  ? 39   THR B OG1   1 
ATOM   1563 C  CG2   . THR B 1 22  ? -3.680  -12.369 13.609  1.00 24.06  ? 39   THR B CG2   1 
ATOM   1564 N  N     . SER B 1 23  ? -1.438  -10.662 16.159  1.00 25.75  ? 40   SER B N     1 
ATOM   1565 C  CA    . SER B 1 23  ? -0.867  -11.234 17.367  1.00 24.47  ? 40   SER B CA    1 
ATOM   1566 C  C     . SER B 1 23  ? -1.305  -10.583 18.647  1.00 23.40  ? 40   SER B C     1 
ATOM   1567 O  O     . SER B 1 23  ? -1.463  -11.252 19.659  1.00 23.68  ? 40   SER B O     1 
ATOM   1568 C  CB    . SER B 1 23  ? 0.683   -11.212 17.287  1.00 26.25  ? 40   SER B CB    1 
ATOM   1569 O  OG    . SER B 1 23  ? 1.089   -11.960 16.173  1.00 27.60  ? 40   SER B OG    1 
ATOM   1570 N  N     . ILE B 1 24  ? -1.404  -9.244  18.653  1.00 22.49  ? 41   ILE B N     1 
ATOM   1571 C  CA    . ILE B 1 24  ? -1.848  -8.550  19.834  1.00 21.69  ? 41   ILE B CA    1 
ATOM   1572 C  C     . ILE B 1 24  ? -3.308  -8.970  20.187  1.00 25.03  ? 41   ILE B C     1 
ATOM   1573 O  O     . ILE B 1 24  ? -3.653  -9.207  21.385  1.00 25.38  ? 41   ILE B O     1 
ATOM   1574 C  CB    . ILE B 1 24  ? -1.714  -7.001  19.624  1.00 22.44  ? 41   ILE B CB    1 
ATOM   1575 C  CG1   . ILE B 1 24  ? -0.248  -6.555  19.708  1.00 24.33  ? 41   ILE B CG1   1 
ATOM   1576 C  CG2   . ILE B 1 24  ? -2.460  -6.295  20.717  1.00 22.27  ? 41   ILE B CG2   1 
ATOM   1577 C  CD1   . ILE B 1 24  ? 0.045   -5.198  19.082  1.00 23.90  ? 41   ILE B CD1   1 
ATOM   1578 N  N     . ILE B 1 25  ? -4.142  -9.079  19.167  1.00 20.02  ? 42   ILE B N     1 
ATOM   1579 C  CA    . ILE B 1 25  ? -5.539  -9.539  19.395  1.00 27.55  ? 42   ILE B CA    1 
ATOM   1580 C  C     . ILE B 1 25  ? -5.622  -10.983 19.888  1.00 29.43  ? 42   ILE B C     1 
ATOM   1581 O  O     . ILE B 1 25  ? -6.371  -11.270 20.839  1.00 28.99  ? 42   ILE B O     1 
ATOM   1582 C  CB    . ILE B 1 25  ? -6.376  -9.308  18.111  1.00 26.20  ? 42   ILE B CB    1 
ATOM   1583 C  CG1   . ILE B 1 25  ? -6.529  -7.810  17.861  1.00 25.58  ? 42   ILE B CG1   1 
ATOM   1584 C  CG2   . ILE B 1 25  ? -7.738  -9.971  18.143  1.00 24.23  ? 42   ILE B CG2   1 
ATOM   1585 C  CD1   . ILE B 1 25  ? -6.953  -7.549  16.420  1.00 24.95  ? 42   ILE B CD1   1 
ATOM   1586 N  N     . LYS B 1 26  ? -4.825  -11.858 19.289  1.00 29.94  ? 43   LYS B N     1 
ATOM   1587 C  CA    . LYS B 1 26  ? -4.846  -13.312 19.655  1.00 30.36  ? 43   LYS B CA    1 
ATOM   1588 C  C     . LYS B 1 26  ? -4.315  -13.529 21.088  1.00 31.46  ? 43   LYS B C     1 
ATOM   1589 O  O     . LYS B 1 26  ? -4.841  -14.343 21.851  1.00 32.07  ? 43   LYS B O     1 
ATOM   1590 C  CB    . LYS B 1 26  ? -4.095  -14.136 18.579  1.00 31.96  ? 43   LYS B CB    1 
ATOM   1591 C  CG    . LYS B 1 26  ? -3.811  -15.620 18.853  1.00 36.72  ? 43   LYS B CG    1 
ATOM   1592 C  CD    . LYS B 1 26  ? -2.840  -16.166 17.768  1.00 41.20  ? 43   LYS B CD    1 
ATOM   1593 C  CE    . LYS B 1 26  ? -2.380  -17.585 18.081  1.00 45.77  ? 43   LYS B CE    1 
ATOM   1594 N  NZ    . LYS B 1 26  ? -1.733  -18.364 16.976  1.00 48.36  ? 43   LYS B NZ    1 
ATOM   1595 N  N     . ARG B 1 27  ? -3.294  -12.766 21.464  1.00 30.99  ? 44   ARG B N     1 
ATOM   1596 C  CA    . ARG B 1 27  ? -2.851  -12.756 22.844  1.00 30.73  ? 44   ARG B CA    1 
ATOM   1597 C  C     . ARG B 1 27  ? -3.907  -12.250 23.831  1.00 29.75  ? 44   ARG B C     1 
ATOM   1598 O  O     . ARG B 1 27  ? -4.165  -12.867 24.851  1.00 31.68  ? 44   ARG B O     1 
ATOM   1599 C  CB    . ARG B 1 27  ? -1.597  -11.952 22.998  1.00 29.16  ? 44   ARG B CB    1 
ATOM   1600 C  CG    . ARG B 1 27  ? -1.215  -11.657 24.435  1.00 29.98  ? 44   ARG B CG    1 
ATOM   1601 C  CD    . ARG B 1 27  ? -0.845  -12.911 25.169  1.00 30.79  ? 44   ARG B CD    1 
ATOM   1602 N  NE    . ARG B 1 27  ? 0.442   -13.391 24.698  1.00 32.59  ? 44   ARG B NE    1 
ATOM   1603 C  CZ    . ARG B 1 27  ? 0.991   -14.551 25.026  1.00 34.83  ? 44   ARG B CZ    1 
ATOM   1604 N  NH1   . ARG B 1 27  ? 0.383   -15.355 25.866  1.00 34.17  ? 44   ARG B NH1   1 
ATOM   1605 N  NH2   . ARG B 1 27  ? 2.199   -14.847 24.570  1.00 36.28  ? 44   ARG B NH2   1 
ATOM   1606 N  N     . TYR B 1 28  ? -4.446  -11.081 23.571  1.00 27.22  ? 45   TYR B N     1 
ATOM   1607 C  CA    . TYR B 1 28  ? -5.447  -10.513 24.460  1.00 24.73  ? 45   TYR B CA    1 
ATOM   1608 C  C     . TYR B 1 28  ? -6.742  -11.375 24.585  1.00 24.47  ? 45   TYR B C     1 
ATOM   1609 O  O     . TYR B 1 28  ? -7.290  -11.511 25.691  1.00 24.97  ? 45   TYR B O     1 
ATOM   1610 C  CB    . TYR B 1 28  ? -5.768  -9.137  23.964  1.00 22.75  ? 45   TYR B CB    1 
ATOM   1611 C  CG    . TYR B 1 28  ? -6.679  -8.323  24.861  1.00 22.37  ? 45   TYR B CG    1 
ATOM   1612 C  CD1   . TYR B 1 28  ? -6.472  -8.251  26.224  1.00 23.35  ? 45   TYR B CD1   1 
ATOM   1613 C  CD2   . TYR B 1 28  ? -7.721  -7.611  24.329  1.00 21.78  ? 45   TYR B CD2   1 
ATOM   1614 C  CE1   . TYR B 1 28  ? -7.293  -7.524  27.043  1.00 23.16  ? 45   TYR B CE1   1 
ATOM   1615 C  CE2   . TYR B 1 28  ? -8.580  -6.871  25.135  1.00 22.42  ? 45   TYR B CE2   1 
ATOM   1616 C  CZ    . TYR B 1 28  ? -8.358  -6.802  26.478  1.00 23.56  ? 45   TYR B CZ    1 
ATOM   1617 O  OH    . TYR B 1 28  ? -9.145  -6.045  27.288  1.00 27.07  ? 45   TYR B OH    1 
ATOM   1618 N  N     . VAL B 1 29  ? -7.186  -11.981 23.482  1.00 23.82  ? 46   VAL B N     1 
ATOM   1619 C  CA    . VAL B 1 29  ? -8.476  -12.688 23.454  1.00 25.20  ? 46   VAL B CA    1 
ATOM   1620 C  C     . VAL B 1 29  ? -8.298  -14.177 23.774  1.00 26.89  ? 46   VAL B C     1 
ATOM   1621 O  O     . VAL B 1 29  ? -9.077  -14.779 24.536  1.00 28.62  ? 46   VAL B O     1 
ATOM   1622 C  CB    . VAL B 1 29  ? -9.195  -12.424 22.110  1.00 24.75  ? 46   VAL B CB    1 
ATOM   1623 C  CG1   . VAL B 1 29  ? -10.520 -13.143 22.031  1.00 26.88  ? 46   VAL B CG1   1 
ATOM   1624 C  CG2   . VAL B 1 29  ? -9.440  -10.927 22.011  1.00 23.94  ? 46   VAL B CG2   1 
ATOM   1625 N  N     . HIS B 1 30  ? -7.271  -14.792 23.239  1.00 28.08  ? 47   HIS B N     1 
ATOM   1626 C  CA    . HIS B 1 30  ? -7.092  -16.249 23.439  1.00 31.31  ? 47   HIS B CA    1 
ATOM   1627 C  C     . HIS B 1 30  ? -5.888  -16.621 24.238  1.00 33.71  ? 47   HIS B C     1 
ATOM   1628 O  O     . HIS B 1 30  ? -5.634  -17.831 24.425  1.00 34.69  ? 47   HIS B O     1 
ATOM   1629 C  CB    . HIS B 1 30  ? -7.024  -16.943 22.082  1.00 33.84  ? 47   HIS B CB    1 
ATOM   1630 C  CG    . HIS B 1 30  ? -8.212  -16.697 21.224  1.00 35.11  ? 47   HIS B CG    1 
ATOM   1631 N  ND1   . HIS B 1 30  ? -8.138  -16.027 20.018  1.00 35.82  ? 47   HIS B ND1   1 
ATOM   1632 C  CD2   . HIS B 1 30  ? -9.521  -16.951 21.435  1.00 35.85  ? 47   HIS B CD2   1 
ATOM   1633 C  CE1   . HIS B 1 30  ? -9.357  -15.875 19.522  1.00 34.96  ? 47   HIS B CE1   1 
ATOM   1634 N  NE2   . HIS B 1 30  ? -10.211 -16.447 20.353  1.00 35.49  ? 47   HIS B NE2   1 
ATOM   1635 N  N     . GLN B 1 31  ? -5.108  -15.640 24.696  1.00 34.76  ? 48   GLN B N     1 
ATOM   1636 C  CA    . GLN B 1 31  ? -3.849  -15.953 25.379  1.00 39.19  ? 48   GLN B CA    1 
ATOM   1637 C  C     . GLN B 1 31  ? -2.925  -16.931 24.626  1.00 39.78  ? 48   GLN B C     1 
ATOM   1638 O  O     . GLN B 1 31  ? -2.339  -17.850 25.211  1.00 42.94  ? 48   GLN B O     1 
ATOM   1639 C  CB    . GLN B 1 31  ? -4.092  -16.366 26.843  1.00 43.99  ? 48   GLN B CB    1 
ATOM   1640 C  CG    . GLN B 1 31  ? -4.241  -15.140 27.764  1.00 45.92  ? 48   GLN B CG    1 
ATOM   1641 C  CD    . GLN B 1 31  ? -3.028  -14.190 27.709  1.00 48.35  ? 48   GLN B CD    1 
ATOM   1642 O  OE1   . GLN B 1 31  ? -1.863  -14.645 27.700  1.00 50.27  ? 48   GLN B OE1   1 
ATOM   1643 N  NE2   . GLN B 1 31  ? -3.295  -12.859 27.626  1.00 48.07  ? 48   GLN B NE2   1 
ATOM   1644 N  N     . LEU B 1 32  ? -2.727  -16.658 23.340  1.00 37.88  ? 49   LEU B N     1 
ATOM   1645 C  CA    . LEU B 1 32  ? -1.838  -17.466 22.510  1.00 38.35  ? 49   LEU B CA    1 
ATOM   1646 C  C     . LEU B 1 32  ? -0.916  -16.583 21.689  1.00 36.13  ? 49   LEU B C     1 
ATOM   1647 O  O     . LEU B 1 32  ? -1.273  -15.436 21.316  1.00 33.95  ? 49   LEU B O     1 
ATOM   1648 C  CB    . LEU B 1 32  ? -2.683  -18.330 21.558  1.00 39.95  ? 49   LEU B CB    1 
ATOM   1649 C  CG    . LEU B 1 32  ? -3.419  -19.522 22.184  1.00 43.43  ? 49   LEU B CG    1 
ATOM   1650 C  CD1   . LEU B 1 32  ? -4.354  -20.226 21.204  1.00 43.63  ? 49   LEU B CD1   1 
ATOM   1651 C  CD2   . LEU B 1 32  ? -2.398  -20.531 22.730  1.00 46.73  ? 49   LEU B CD2   1 
ATOM   1652 N  N     . PHE B 1 33  ? 0.235   -17.133 21.373  1.00 37.63  ? 50   PHE B N     1 
ATOM   1653 C  CA    . PHE B 1 33  ? 1.171   -16.564 20.420  1.00 37.49  ? 50   PHE B CA    1 
ATOM   1654 C  C     . PHE B 1 33  ? 1.856   -17.612 19.576  1.00 40.56  ? 50   PHE B C     1 
ATOM   1655 O  O     . PHE B 1 33  ? 2.332   -18.620 20.113  1.00 42.86  ? 50   PHE B O     1 
ATOM   1656 C  CB    . PHE B 1 33  ? 2.231   -15.823 21.193  1.00 37.88  ? 50   PHE B CB    1 
ATOM   1657 C  CG    . PHE B 1 33  ? 3.256   -15.174 20.322  1.00 37.67  ? 50   PHE B CG    1 
ATOM   1658 C  CD1   . PHE B 1 33  ? 3.003   -13.951 19.757  1.00 36.45  ? 50   PHE B CD1   1 
ATOM   1659 C  CD2   . PHE B 1 33  ? 4.465   -15.783 20.100  1.00 38.46  ? 50   PHE B CD2   1 
ATOM   1660 C  CE1   . PHE B 1 33  ? 3.940   -13.344 18.936  1.00 36.96  ? 50   PHE B CE1   1 
ATOM   1661 C  CE2   . PHE B 1 33  ? 5.392   -15.208 19.270  1.00 39.94  ? 50   PHE B CE2   1 
ATOM   1662 C  CZ    . PHE B 1 33  ? 5.153   -13.960 18.711  1.00 38.69  ? 50   PHE B CZ    1 
ATOM   1663 N  N     . SER B 1 34  ? 1.946   -17.358 18.273  1.00 39.47  ? 51   SER B N     1 
ATOM   1664 C  CA    . SER B 1 34  ? 2.804   -18.136 17.381  1.00 42.52  ? 51   SER B CA    1 
ATOM   1665 C  C     . SER B 1 34  ? 3.758   -17.145 16.742  1.00 43.93  ? 51   SER B C     1 
ATOM   1666 O  O     . SER B 1 34  ? 3.344   -16.064 16.312  1.00 40.89  ? 51   SER B O     1 
ATOM   1667 C  CB    . SER B 1 34  ? 1.965   -18.833 16.307  1.00 41.46  ? 51   SER B CB    1 
ATOM   1668 O  OG    . SER B 1 34  ? 2.737   -19.411 15.299  1.00 42.82  ? 51   SER B OG    1 
ATOM   1669 N  N     . GLN B 1 35  ? 5.020   -17.517 16.666  1.00 47.47  ? 52   GLN B N     1 
ATOM   1670 C  CA    . GLN B 1 35  ? 5.947   -16.786 15.837  1.00 50.94  ? 52   GLN B CA    1 
ATOM   1671 C  C     . GLN B 1 35  ? 5.700   -16.917 14.319  1.00 51.25  ? 52   GLN B C     1 
ATOM   1672 O  O     . GLN B 1 35  ? 6.219   -16.080 13.542  1.00 53.00  ? 52   GLN B O     1 
ATOM   1673 C  CB    . GLN B 1 35  ? 7.421   -17.122 16.159  1.00 56.09  ? 52   GLN B CB    1 
ATOM   1674 C  CG    . GLN B 1 35  ? 8.408   -16.071 15.583  1.00 58.33  ? 52   GLN B CG    1 
ATOM   1675 C  CD    . GLN B 1 35  ? 8.640   -14.817 16.468  1.00 57.94  ? 52   GLN B CD    1 
ATOM   1676 O  OE1   . GLN B 1 35  ? 9.286   -14.946 17.510  1.00 61.30  ? 52   GLN B OE1   1 
ATOM   1677 N  NE2   . GLN B 1 35  ? 8.185   -13.619 16.036  1.00 53.47  ? 52   GLN B NE2   1 
ATOM   1678 N  N     . HIS B 1 36  ? 4.919   -17.910 13.873  1.00 49.91  ? 53   HIS B N     1 
ATOM   1679 C  CA    . HIS B 1 36  ? 4.730   -18.083 12.426  1.00 49.05  ? 53   HIS B CA    1 
ATOM   1680 C  C     . HIS B 1 36  ? 3.736   -17.023 11.929  1.00 46.70  ? 53   HIS B C     1 
ATOM   1681 O  O     . HIS B 1 36  ? 2.599   -16.946 12.394  1.00 45.05  ? 53   HIS B O     1 
ATOM   1682 C  CB    . HIS B 1 36  ? 4.219   -19.463 12.097  1.00 49.73  ? 53   HIS B CB    1 
ATOM   1683 C  CG    . HIS B 1 36  ? 5.176   -20.548 12.463  1.00 54.10  ? 53   HIS B CG    1 
ATOM   1684 N  ND1   . HIS B 1 36  ? 4.965   -21.407 13.520  1.00 54.88  ? 53   HIS B ND1   1 
ATOM   1685 C  CD2   . HIS B 1 36  ? 6.359   -20.905 11.914  1.00 57.62  ? 53   HIS B CD2   1 
ATOM   1686 C  CE1   . HIS B 1 36  ? 5.981   -22.255 13.602  1.00 58.60  ? 53   HIS B CE1   1 
ATOM   1687 N  NE2   . HIS B 1 36  ? 6.837   -21.977 12.632  1.00 60.07  ? 53   HIS B NE2   1 
ATOM   1688 N  N     . TYR B 1 37  ? 4.195   -16.211 10.987  1.00 46.63  ? 54   TYR B N     1 
ATOM   1689 C  CA    . TYR B 1 37  ? 3.372   -15.202 10.367  1.00 43.41  ? 54   TYR B CA    1 
ATOM   1690 C  C     . TYR B 1 37  ? 2.290   -15.800 9.468   1.00 41.62  ? 54   TYR B C     1 
ATOM   1691 O  O     . TYR B 1 37  ? 2.594   -16.523 8.533   1.00 39.25  ? 54   TYR B O     1 
ATOM   1692 C  CB    . TYR B 1 37  ? 4.293   -14.323 9.506   1.00 42.68  ? 54   TYR B CB    1 
ATOM   1693 C  CG    . TYR B 1 37  ? 3.600   -13.188 8.768   1.00 40.92  ? 54   TYR B CG    1 
ATOM   1694 C  CD1   . TYR B 1 37  ? 2.655   -12.408 9.369   1.00 37.40  ? 54   TYR B CD1   1 
ATOM   1695 C  CD2   . TYR B 1 37  ? 4.006   -12.841 7.475   1.00 43.37  ? 54   TYR B CD2   1 
ATOM   1696 C  CE1   . TYR B 1 37  ? 2.071   -11.325 8.693   1.00 37.45  ? 54   TYR B CE1   1 
ATOM   1697 C  CE2   . TYR B 1 37  ? 3.421   -11.763 6.782   1.00 42.01  ? 54   TYR B CE2   1 
ATOM   1698 C  CZ    . TYR B 1 37  ? 2.457   -11.021 7.391   1.00 39.31  ? 54   TYR B CZ    1 
ATOM   1699 O  OH    . TYR B 1 37  ? 1.874   -9.965  6.714   1.00 38.90  ? 54   TYR B OH    1 
ATOM   1700 N  N     . ARG B 1 38  ? 1.040   -15.482 9.730   1.00 39.65  ? 55   ARG B N     1 
ATOM   1701 C  CA    . ARG B 1 38  ? 0.000   -15.743 8.731   1.00 40.12  ? 55   ARG B CA    1 
ATOM   1702 C  C     . ARG B 1 38  ? -0.620  -14.417 8.336   1.00 36.19  ? 55   ARG B C     1 
ATOM   1703 O  O     . ARG B 1 38  ? -1.182  -13.792 9.160   1.00 34.41  ? 55   ARG B O     1 
ATOM   1704 C  CB    . ARG B 1 38  ? -1.068  -16.662 9.298   1.00 42.46  ? 55   ARG B CB    1 
ATOM   1705 C  CG    . ARG B 1 38  ? -0.589  -18.040 9.709   1.00 50.17  ? 55   ARG B CG    1 
ATOM   1706 C  CD    . ARG B 1 38  ? -1.806  -18.787 10.232  1.00 54.71  ? 55   ARG B CD    1 
ATOM   1707 N  NE    . ARG B 1 38  ? -1.775  -20.177 9.834   1.00 61.01  ? 55   ARG B NE    1 
ATOM   1708 C  CZ    . ARG B 1 38  ? -2.845  -20.970 9.705   1.00 62.43  ? 55   ARG B CZ    1 
ATOM   1709 N  NH1   . ARG B 1 38  ? -4.083  -20.522 9.930   1.00 60.92  ? 55   ARG B NH1   1 
ATOM   1710 N  NH2   . ARG B 1 38  ? -2.671  -22.228 9.327   1.00 65.20  ? 55   ARG B NH2   1 
ATOM   1711 N  N     . ALA B 1 39  ? -0.525  -14.000 7.079   1.00 36.57  ? 56   ALA B N     1 
ATOM   1712 C  CA    . ALA B 1 39  ? -0.897  -12.621 6.717   1.00 34.42  ? 56   ALA B CA    1 
ATOM   1713 C  C     . ALA B 1 39  ? -2.412  -12.476 6.681   1.00 32.98  ? 56   ALA B C     1 
ATOM   1714 O  O     . ALA B 1 39  ? -3.091  -13.305 6.096   1.00 33.55  ? 56   ALA B O     1 
ATOM   1715 C  CB    . ALA B 1 39  ? -0.307  -12.307 5.355   1.00 35.85  ? 56   ALA B CB    1 
ATOM   1716 N  N     . THR B 1 40  ? -2.958  -11.436 7.281   1.00 31.39  ? 57   THR B N     1 
ATOM   1717 C  CA    . THR B 1 40  ? -4.408  -11.234 7.200   1.00 31.43  ? 57   THR B CA    1 
ATOM   1718 C  C     . THR B 1 40  ? -4.840  -10.794 5.768   1.00 32.85  ? 57   THR B C     1 
ATOM   1719 O  O     . THR B 1 40  ? -4.143  -10.036 5.102   1.00 33.46  ? 57   THR B O     1 
ATOM   1720 C  CB    . THR B 1 40  ? -4.875  -10.319 8.315   1.00 29.46  ? 57   THR B CB    1 
ATOM   1721 O  OG1   . THR B 1 40  ? -4.477  -10.926 9.563   1.00 32.13  ? 57   THR B OG1   1 
ATOM   1722 C  CG2   . THR B 1 40  ? -6.409  -10.143 8.320   1.00 25.30  ? 57   THR B CG2   1 
ATOM   1723 N  N     . ILE B 1 41  ? -5.968  -11.312 5.301   1.00 35.35  ? 58   ILE B N     1 
ATOM   1724 C  CA    . ILE B 1 41  ? -6.599  -10.897 4.036   1.00 37.99  ? 58   ILE B CA    1 
ATOM   1725 C  C     . ILE B 1 41  ? -7.824  -10.020 4.351   1.00 36.93  ? 58   ILE B C     1 
ATOM   1726 O  O     . ILE B 1 41  ? -8.773  -10.486 4.916   1.00 36.01  ? 58   ILE B O     1 
ATOM   1727 C  CB    . ILE B 1 41  ? -7.046  -12.109 3.236   1.00 41.27  ? 58   ILE B CB    1 
ATOM   1728 C  CG1   . ILE B 1 41  ? -5.904  -13.138 3.102   1.00 44.74  ? 58   ILE B CG1   1 
ATOM   1729 C  CG2   . ILE B 1 41  ? -7.564  -11.685 1.867   1.00 42.38  ? 58   ILE B CG2   1 
ATOM   1730 C  CD1   . ILE B 1 41  ? -4.614  -12.566 2.609   1.00 46.12  ? 58   ILE B CD1   1 
ATOM   1731 N  N     . GLY B 1 42  ? -7.765  -8.731  4.043   1.00 37.04  ? 59   GLY B N     1 
ATOM   1732 C  CA    . GLY B 1 42  ? -8.869  -7.791  4.357   1.00 35.97  ? 59   GLY B CA    1 
ATOM   1733 C  C     . GLY B 1 42  ? -9.021  -7.445  5.816   1.00 34.80  ? 59   GLY B C     1 
ATOM   1734 O  O     . GLY B 1 42  ? -8.393  -6.458  6.293   1.00 34.72  ? 59   GLY B O     1 
ATOM   1735 N  N     . VAL B 1 43  ? -9.896  -8.151  6.526   1.00 34.67  ? 60   VAL B N     1 
ATOM   1736 C  CA    . VAL B 1 43  ? -10.184 -7.856  7.922   1.00 33.67  ? 60   VAL B CA    1 
ATOM   1737 C  C     . VAL B 1 43  ? -10.343 -9.154  8.659   1.00 33.41  ? 60   VAL B C     1 
ATOM   1738 O  O     . VAL B 1 43  ? -10.914 -10.101 8.120   1.00 33.65  ? 60   VAL B O     1 
ATOM   1739 C  CB    . VAL B 1 43  ? -11.517 -7.049  8.096   1.00 34.24  ? 60   VAL B CB    1 
ATOM   1740 C  CG1   . VAL B 1 43  ? -11.618 -6.512  9.506   1.00 32.46  ? 60   VAL B CG1   1 
ATOM   1741 C  CG2   . VAL B 1 43  ? -11.591 -5.887  7.138   1.00 36.42  ? 60   VAL B CG2   1 
ATOM   1742 N  N     . ASP B 1 44  ? -9.935  -9.185  9.925   1.00 33.63  ? 61   ASP B N     1 
ATOM   1743 C  CA    . ASP B 1 44  ? -10.217 -10.317 10.836  1.00 37.27  ? 61   ASP B CA    1 
ATOM   1744 C  C     . ASP B 1 44  ? -10.900 -9.741  12.056  1.00 32.16  ? 61   ASP B C     1 
ATOM   1745 O  O     . ASP B 1 44  ? -10.937 -8.515  12.214  1.00 30.00  ? 61   ASP B O     1 
ATOM   1746 C  CB    . ASP B 1 44  ? -8.914  -10.994 11.224  1.00 42.42  ? 61   ASP B CB    1 
ATOM   1747 C  CG    . ASP B 1 44  ? -9.109  -12.386 11.846  1.00 48.08  ? 61   ASP B CG    1 
ATOM   1748 O  OD1   . ASP B 1 44  ? -10.235 -12.945 11.900  1.00 50.75  ? 61   ASP B OD1   1 
ATOM   1749 O  OD2   . ASP B 1 44  ? -8.063  -12.971 12.251  1.00 54.48  ? 61   ASP B OD2   1 
ATOM   1750 N  N     . PHE B 1 45  ? -11.512 -10.583 12.863  1.00 29.35  ? 62   PHE B N     1 
ATOM   1751 C  CA    . PHE B 1 45  ? -12.329 -10.146 14.008  1.00 27.11  ? 62   PHE B CA    1 
ATOM   1752 C  C     . PHE B 1 45  ? -12.174 -11.057 15.177  1.00 25.17  ? 62   PHE B C     1 
ATOM   1753 O  O     . PHE B 1 45  ? -11.961 -12.238 15.022  1.00 25.59  ? 62   PHE B O     1 
ATOM   1754 C  CB    . PHE B 1 45  ? -13.819 -10.197 13.690  1.00 29.48  ? 62   PHE B CB    1 
ATOM   1755 C  CG    . PHE B 1 45  ? -14.175 -9.736  12.319  1.00 32.34  ? 62   PHE B CG    1 
ATOM   1756 C  CD1   . PHE B 1 45  ? -14.139 -10.621 11.257  1.00 33.81  ? 62   PHE B CD1   1 
ATOM   1757 C  CD2   . PHE B 1 45  ? -14.499 -8.377  12.077  1.00 33.00  ? 62   PHE B CD2   1 
ATOM   1758 C  CE1   . PHE B 1 45  ? -14.441 -10.210 9.987   1.00 34.80  ? 62   PHE B CE1   1 
ATOM   1759 C  CE2   . PHE B 1 45  ? -14.813 -7.948  10.799  1.00 33.85  ? 62   PHE B CE2   1 
ATOM   1760 C  CZ    . PHE B 1 45  ? -14.812 -8.866  9.755   1.00 34.57  ? 62   PHE B CZ    1 
ATOM   1761 N  N     . ALA B 1 46  ? -12.463 -10.501 16.330  1.00 24.08  ? 63   ALA B N     1 
ATOM   1762 C  CA    . ALA B 1 46  ? -12.460 -11.180 17.577  1.00 23.69  ? 63   ALA B CA    1 
ATOM   1763 C  C     . ALA B 1 46  ? -13.436 -10.428 18.486  1.00 24.88  ? 63   ALA B C     1 
ATOM   1764 O  O     . ALA B 1 46  ? -13.649 -9.200  18.315  1.00 24.82  ? 63   ALA B O     1 
ATOM   1765 C  CB    . ALA B 1 46  ? -11.063 -11.071 18.160  1.00 23.34  ? 63   ALA B CB    1 
ATOM   1766 N  N     . LEU B 1 47  ? -13.954 -11.129 19.484  1.00 26.00  ? 64   LEU B N     1 
ATOM   1767 C  CA    . LEU B 1 47  ? -14.731 -10.529 20.557  1.00 27.42  ? 64   LEU B CA    1 
ATOM   1768 C  C     . LEU B 1 47  ? -14.049 -10.764 21.898  1.00 26.74  ? 64   LEU B C     1 
ATOM   1769 O  O     . LEU B 1 47  ? -13.773 -11.924 22.282  1.00 27.92  ? 64   LEU B O     1 
ATOM   1770 C  CB    . LEU B 1 47  ? -16.113 -11.164 20.597  1.00 31.93  ? 64   LEU B CB    1 
ATOM   1771 C  CG    . LEU B 1 47  ? -17.175 -10.408 21.428  1.00 34.45  ? 64   LEU B CG    1 
ATOM   1772 C  CD1   . LEU B 1 47  ? -17.691 -9.263  20.627  1.00 34.44  ? 64   LEU B CD1   1 
ATOM   1773 C  CD2   . LEU B 1 47  ? -18.337 -11.255 21.800  1.00 36.95  ? 64   LEU B CD2   1 
ATOM   1774 N  N     . LYS B 1 48  ? -13.694 -9.700  22.598  1.00 25.36  ? 65   LYS B N     1 
ATOM   1775 C  CA    . LYS B 1 48  ? -13.316 -9.813  23.985  1.00 25.40  ? 65   LYS B CA    1 
ATOM   1776 C  C     . LYS B 1 48  ? -14.467 -9.435  24.879  1.00 26.37  ? 65   LYS B C     1 
ATOM   1777 O  O     . LYS B 1 48  ? -15.172 -8.426  24.638  1.00 25.87  ? 65   LYS B O     1 
ATOM   1778 C  CB    . LYS B 1 48  ? -12.129 -8.894  24.225  1.00 25.23  ? 65   LYS B CB    1 
ATOM   1779 C  CG    . LYS B 1 48  ? -11.626 -8.780  25.648  1.00 26.66  ? 65   LYS B CG    1 
ATOM   1780 C  CD    . LYS B 1 48  ? -10.651 -9.933  25.918  1.00 29.96  ? 65   LYS B CD    1 
ATOM   1781 C  CE    . LYS B 1 48  ? -10.382 -9.927  27.388  1.00 32.33  ? 65   LYS B CE    1 
ATOM   1782 N  NZ    . LYS B 1 48  ? -9.245  -10.759 27.688  1.00 33.67  ? 65   LYS B NZ    1 
ATOM   1783 N  N     . VAL B 1 49  ? -14.589 -10.209 25.954  1.00 28.42  ? 66   VAL B N     1 
ATOM   1784 C  CA    . VAL B 1 49  ? -15.520 -9.956  27.008  1.00 32.61  ? 66   VAL B CA    1 
ATOM   1785 C  C     . VAL B 1 49  ? -14.694 -9.488  28.181  1.00 33.89  ? 66   VAL B C     1 
ATOM   1786 O  O     . VAL B 1 49  ? -13.910 -10.270 28.705  1.00 34.17  ? 66   VAL B O     1 
ATOM   1787 C  CB    . VAL B 1 49  ? -16.281 -11.242 27.378  1.00 35.71  ? 66   VAL B CB    1 
ATOM   1788 C  CG1   . VAL B 1 49  ? -17.174 -11.038 28.593  1.00 36.20  ? 66   VAL B CG1   1 
ATOM   1789 C  CG2   . VAL B 1 49  ? -17.100 -11.703 26.183  1.00 36.58  ? 66   VAL B CG2   1 
ATOM   1790 N  N     . LEU B 1 50  ? -14.866 -8.226  28.582  1.00 35.43  ? 67   LEU B N     1 
ATOM   1791 C  CA    . LEU B 1 50  ? -14.096 -7.677  29.699  1.00 38.46  ? 67   LEU B CA    1 
ATOM   1792 C  C     . LEU B 1 50  ? -14.979 -7.239  30.890  1.00 40.57  ? 67   LEU B C     1 
ATOM   1793 O  O     . LEU B 1 50  ? -16.027 -6.572  30.783  1.00 41.70  ? 67   LEU B O     1 
ATOM   1794 C  CB    . LEU B 1 50  ? -12.995 -6.705  29.203  1.00 39.45  ? 67   LEU B CB    1 
ATOM   1795 C  CG    . LEU B 1 50  ? -12.886 -5.184  29.092  1.00 42.30  ? 67   LEU B CG    1 
ATOM   1796 C  CD1   . LEU B 1 50  ? -12.714 -4.437  30.404  1.00 44.80  ? 67   LEU B CD1   1 
ATOM   1797 C  CD2   . LEU B 1 50  ? -11.647 -4.923  28.288  1.00 42.24  ? 67   LEU B CD2   1 
ATOM   1798 N  N     . ASN B 1 51  ? -14.636 -7.755  32.047  1.00 41.71  ? 68   ASN B N     1 
ATOM   1799 C  CA    . ASN B 1 51  ? -15.263 -7.395  33.294  1.00 45.30  ? 68   ASN B CA    1 
ATOM   1800 C  C     . ASN B 1 51  ? -14.577 -6.133  33.711  1.00 43.85  ? 68   ASN B C     1 
ATOM   1801 O  O     . ASN B 1 51  ? -13.529 -6.203  34.343  1.00 46.02  ? 68   ASN B O     1 
ATOM   1802 C  CB    . ASN B 1 51  ? -15.005 -8.482  34.329  1.00 50.14  ? 68   ASN B CB    1 
ATOM   1803 C  CG    . ASN B 1 51  ? -15.772 -9.736  34.031  1.00 52.76  ? 68   ASN B CG    1 
ATOM   1804 O  OD1   . ASN B 1 51  ? -15.179 -10.835 33.918  1.00 54.14  ? 68   ASN B OD1   1 
ATOM   1805 N  ND2   . ASN B 1 51  ? -17.114 -9.591  33.887  1.00 55.36  ? 68   ASN B ND2   1 
ATOM   1806 N  N     . TRP B 1 52  ? -15.115 -4.992  33.315  1.00 39.71  ? 69   TRP B N     1 
ATOM   1807 C  CA    . TRP B 1 52  ? -14.510 -3.722  33.668  1.00 38.29  ? 69   TRP B CA    1 
ATOM   1808 C  C     . TRP B 1 52  ? -14.444 -3.546  35.198  1.00 40.80  ? 69   TRP B C     1 
ATOM   1809 O  O     . TRP B 1 52  ? -13.396 -3.317  35.772  1.00 41.92  ? 69   TRP B O     1 
ATOM   1810 C  CB    . TRP B 1 52  ? -15.262 -2.565  33.009  1.00 37.10  ? 69   TRP B CB    1 
ATOM   1811 C  CG    . TRP B 1 52  ? -14.719 -1.197  33.404  1.00 38.30  ? 69   TRP B CG    1 
ATOM   1812 C  CD1   . TRP B 1 52  ? -15.227 -0.347  34.322  1.00 39.58  ? 69   TRP B CD1   1 
ATOM   1813 C  CD2   . TRP B 1 52  ? -13.496 -0.614  32.931  1.00 37.36  ? 69   TRP B CD2   1 
ATOM   1814 N  NE1   . TRP B 1 52  ? -14.415 0.760   34.426  1.00 40.41  ? 69   TRP B NE1   1 
ATOM   1815 C  CE2   . TRP B 1 52  ? -13.347 0.617   33.583  1.00 38.89  ? 69   TRP B CE2   1 
ATOM   1816 C  CE3   . TRP B 1 52  ? -12.535 -1.017  31.993  1.00 35.66  ? 69   TRP B CE3   1 
ATOM   1817 C  CZ2   . TRP B 1 52  ? -12.270 1.466   33.333  1.00 38.92  ? 69   TRP B CZ2   1 
ATOM   1818 C  CZ3   . TRP B 1 52  ? -11.508 -0.171  31.706  1.00 35.66  ? 69   TRP B CZ3   1 
ATOM   1819 C  CH2   . TRP B 1 52  ? -11.358 1.048   32.388  1.00 37.33  ? 69   TRP B CH2   1 
ATOM   1820 N  N     . ASP B 1 53  ? -15.578 -3.707  35.840  1.00 42.27  ? 70   ASP B N     1 
ATOM   1821 C  CA    . ASP B 1 53  ? -15.683 -3.742  37.288  1.00 43.82  ? 70   ASP B CA    1 
ATOM   1822 C  C     . ASP B 1 53  ? -17.020 -4.400  37.594  1.00 44.86  ? 70   ASP B C     1 
ATOM   1823 O  O     . ASP B 1 53  ? -17.666 -4.920  36.665  1.00 42.64  ? 70   ASP B O     1 
ATOM   1824 C  CB    . ASP B 1 53  ? -15.536 -2.321  37.892  1.00 44.75  ? 70   ASP B CB    1 
ATOM   1825 C  CG    . ASP B 1 53  ? -16.698 -1.359  37.557  1.00 45.48  ? 70   ASP B CG    1 
ATOM   1826 O  OD1   . ASP B 1 53  ? -17.796 -1.808  37.120  1.00 45.39  ? 70   ASP B OD1   1 
ATOM   1827 O  OD2   . ASP B 1 53  ? -16.501 -0.128  37.785  1.00 46.28  ? 70   ASP B OD2   1 
ATOM   1828 N  N     . SER B 1 54  ? -17.451 -4.296  38.842  1.00 48.03  ? 71   SER B N     1 
ATOM   1829 C  CA    . SER B 1 54  ? -18.635 -4.953  39.339  1.00 49.92  ? 71   SER B CA    1 
ATOM   1830 C  C     . SER B 1 54  ? -19.959 -4.478  38.745  1.00 49.98  ? 71   SER B C     1 
ATOM   1831 O  O     . SER B 1 54  ? -20.945 -5.162  38.888  1.00 51.52  ? 71   SER B O     1 
ATOM   1832 C  CB    . SER B 1 54  ? -18.693 -4.806  40.861  1.00 52.54  ? 71   SER B CB    1 
ATOM   1833 O  OG    . SER B 1 54  ? -17.597 -5.476  41.465  1.00 53.31  ? 71   SER B OG    1 
ATOM   1834 N  N     . ARG B 1 55  ? -20.003 -3.288  38.149  1.00 48.73  ? 72   ARG B N     1 
ATOM   1835 C  CA    . ARG B 1 55  ? -21.248 -2.743  37.603  1.00 48.74  ? 72   ARG B CA    1 
ATOM   1836 C  C     . ARG B 1 55  ? -21.151 -2.533  36.117  1.00 44.17  ? 72   ARG B C     1 
ATOM   1837 O  O     . ARG B 1 55  ? -22.028 -1.888  35.519  1.00 44.22  ? 72   ARG B O     1 
ATOM   1838 C  CB    . ARG B 1 55  ? -21.576 -1.438  38.293  1.00 53.29  ? 72   ARG B CB    1 
ATOM   1839 C  CG    . ARG B 1 55  ? -22.108 -1.716  39.679  1.00 61.13  ? 72   ARG B CG    1 
ATOM   1840 C  CD    . ARG B 1 55  ? -22.186 -0.454  40.486  1.00 67.31  ? 72   ARG B CD    1 
ATOM   1841 N  NE    . ARG B 1 55  ? -22.904 -0.670  41.743  1.00 73.50  ? 72   ARG B NE    1 
ATOM   1842 C  CZ    . ARG B 1 55  ? -22.385 -1.239  42.837  1.00 75.70  ? 72   ARG B CZ    1 
ATOM   1843 N  NH1   . ARG B 1 55  ? -21.114 -1.669  42.857  1.00 74.51  ? 72   ARG B NH1   1 
ATOM   1844 N  NH2   . ARG B 1 55  ? -23.147 -1.373  43.923  1.00 78.52  ? 72   ARG B NH2   1 
ATOM   1845 N  N     . THR B 1 56  ? -20.086 -3.074  35.517  1.00 39.56  ? 73   THR B N     1 
ATOM   1846 C  CA    . THR B 1 56  ? -19.737 -2.692  34.164  1.00 37.12  ? 73   THR B CA    1 
ATOM   1847 C  C     . THR B 1 56  ? -19.125 -3.840  33.394  1.00 35.68  ? 73   THR B C     1 
ATOM   1848 O  O     . THR B 1 56  ? -17.958 -4.271  33.661  1.00 35.04  ? 73   THR B O     1 
ATOM   1849 C  CB    . THR B 1 56  ? -18.768 -1.487  34.078  1.00 37.46  ? 73   THR B CB    1 
ATOM   1850 O  OG1   . THR B 1 56  ? -19.041 -0.523  35.101  1.00 41.11  ? 73   THR B OG1   1 
ATOM   1851 C  CG2   . THR B 1 56  ? -18.930 -0.845  32.736  1.00 35.14  ? 73   THR B CG2   1 
ATOM   1852 N  N     . LEU B 1 57  ? -19.875 -4.314  32.409  1.00 34.74  ? 74   LEU B N     1 
ATOM   1853 C  CA    . LEU B 1 57  ? -19.379 -5.402  31.572  1.00 34.07  ? 74   LEU B CA    1 
ATOM   1854 C  C     . LEU B 1 57  ? -19.232 -4.826  30.214  1.00 31.73  ? 74   LEU B C     1 
ATOM   1855 O  O     . LEU B 1 57  ? -20.148 -4.226  29.733  1.00 32.34  ? 74   LEU B O     1 
ATOM   1856 C  CB    . LEU B 1 57  ? -20.270 -6.620  31.626  1.00 36.67  ? 74   LEU B CB    1 
ATOM   1857 C  CG    . LEU B 1 57  ? -19.715 -7.785  30.812  1.00 38.04  ? 74   LEU B CG    1 
ATOM   1858 C  CD1   . LEU B 1 57  ? -19.396 -9.006  31.668  1.00 40.26  ? 74   LEU B CD1   1 
ATOM   1859 C  CD2   . LEU B 1 57  ? -20.693 -8.032  29.701  1.00 38.85  ? 74   LEU B CD2   1 
ATOM   1860 N  N     . VAL B 1 58  ? -18.036 -4.925  29.652  1.00 29.30  ? 75   VAL B N     1 
ATOM   1861 C  CA    . VAL B 1 58  ? -17.751 -4.428  28.334  1.00 29.71  ? 75   VAL B CA    1 
ATOM   1862 C  C     . VAL B 1 58  ? -17.493 -5.607  27.419  1.00 29.87  ? 75   VAL B C     1 
ATOM   1863 O  O     . VAL B 1 58  ? -16.736 -6.532  27.770  1.00 29.11  ? 75   VAL B O     1 
ATOM   1864 C  CB    . VAL B 1 58  ? -16.473 -3.575  28.343  1.00 30.55  ? 75   VAL B CB    1 
ATOM   1865 C  CG1   . VAL B 1 58  ? -16.154 -3.063  26.950  1.00 29.79  ? 75   VAL B CG1   1 
ATOM   1866 C  CG2   . VAL B 1 58  ? -16.694 -2.358  29.266  1.00 32.82  ? 75   VAL B CG2   1 
ATOM   1867 N  N     . ARG B 1 59  ? -18.117 -5.555  26.243  1.00 29.67  ? 76   ARG B N     1 
ATOM   1868 C  CA    . ARG B 1 59  ? -17.702 -6.413  25.124  1.00 28.80  ? 76   ARG B CA    1 
ATOM   1869 C  C     . ARG B 1 59  ? -17.108 -5.558  24.049  1.00 26.78  ? 76   ARG B C     1 
ATOM   1870 O  O     . ARG B 1 59  ? -17.700 -4.522  23.677  1.00 27.81  ? 76   ARG B O     1 
ATOM   1871 C  CB    . ARG B 1 59  ? -18.905 -7.146  24.566  1.00 28.34  ? 76   ARG B CB    1 
ATOM   1872 C  CG    . ARG B 1 59  ? -19.483 -8.065  25.589  1.00 28.50  ? 76   ARG B CG    1 
ATOM   1873 C  CD    . ARG B 1 59  ? -20.494 -8.968  24.984  1.00 29.20  ? 76   ARG B CD    1 
ATOM   1874 N  NE    . ARG B 1 59  ? -21.028 -9.808  26.015  1.00 31.15  ? 76   ARG B NE    1 
ATOM   1875 C  CZ    . ARG B 1 59  ? -22.075 -9.555  26.791  1.00 33.33  ? 76   ARG B CZ    1 
ATOM   1876 N  NH1   . ARG B 1 59  ? -22.754 -8.408  26.766  1.00 33.46  ? 76   ARG B NH1   1 
ATOM   1877 N  NH2   . ARG B 1 59  ? -22.392 -10.455 27.699  1.00 35.33  ? 76   ARG B NH2   1 
ATOM   1878 N  N     . LEU B 1 60  ? -15.922 -5.951  23.603  1.00 24.88  ? 77   LEU B N     1 
ATOM   1879 C  CA    . LEU B 1 60  ? -15.278 -5.354  22.485  1.00 22.20  ? 77   LEU B CA    1 
ATOM   1880 C  C     . LEU B 1 60  ? -15.290 -6.216  21.248  1.00 25.29  ? 77   LEU B C     1 
ATOM   1881 O  O     . LEU B 1 60  ? -14.827 -7.392  21.292  1.00 27.20  ? 77   LEU B O     1 
ATOM   1882 C  CB    . LEU B 1 60  ? -13.817 -5.153  22.802  1.00 18.70  ? 77   LEU B CB    1 
ATOM   1883 C  CG    . LEU B 1 60  ? -13.475 -4.310  24.011  1.00 18.67  ? 77   LEU B CG    1 
ATOM   1884 C  CD1   . LEU B 1 60  ? -11.967 -4.214  24.059  1.00 19.59  ? 77   LEU B CD1   1 
ATOM   1885 C  CD2   . LEU B 1 60  ? -14.057 -2.930  23.856  1.00 18.08  ? 77   LEU B CD2   1 
ATOM   1886 N  N     . GLN B 1 61  ? -15.861 -5.677  20.184  1.00 26.62  ? 78   GLN B N     1 
ATOM   1887 C  CA    . GLN B 1 61  ? -15.730 -6.220  18.857  1.00 28.44  ? 78   GLN B CA    1 
ATOM   1888 C  C     . GLN B 1 61  ? -14.440 -5.629  18.246  1.00 25.45  ? 78   GLN B C     1 
ATOM   1889 O  O     . GLN B 1 61  ? -14.401 -4.436  17.868  1.00 25.80  ? 78   GLN B O     1 
ATOM   1890 C  CB    . GLN B 1 61  ? -16.931 -5.869  18.027  1.00 32.97  ? 78   GLN B CB    1 
ATOM   1891 C  CG    . GLN B 1 61  ? -18.158 -6.496  18.595  1.00 39.42  ? 78   GLN B CG    1 
ATOM   1892 C  CD    . GLN B 1 61  ? -19.422 -6.176  17.829  1.00 45.08  ? 78   GLN B CD    1 
ATOM   1893 O  OE1   . GLN B 1 61  ? -19.744 -4.989  17.630  1.00 49.40  ? 78   GLN B OE1   1 
ATOM   1894 N  NE2   . GLN B 1 61  ? -20.164 -7.221  17.427  1.00 45.70  ? 78   GLN B NE2   1 
ATOM   1895 N  N     . LEU B 1 62  ? -13.371 -6.428  18.250  1.00 22.75  ? 79   LEU B N     1 
ATOM   1896 C  CA    . LEU B 1 62  ? -12.099 -6.085  17.620  1.00 22.18  ? 79   LEU B CA    1 
ATOM   1897 C  C     . LEU B 1 62  ? -11.992 -6.364  16.130  1.00 22.43  ? 79   LEU B C     1 
ATOM   1898 O  O     . LEU B 1 62  ? -12.108 -7.502  15.676  1.00 23.49  ? 79   LEU B O     1 
ATOM   1899 C  CB    . LEU B 1 62  ? -10.961 -6.683  18.362  1.00 23.98  ? 79   LEU B CB    1 
ATOM   1900 C  CG    . LEU B 1 62  ? -10.879 -6.237  19.825  1.00 24.36  ? 79   LEU B CG    1 
ATOM   1901 C  CD1   . LEU B 1 62  ? -10.272 -7.365  20.651  1.00 23.56  ? 79   LEU B CD1   1 
ATOM   1902 C  CD2   . LEU B 1 62  ? -10.061 -4.987  19.874  1.00 24.00  ? 79   LEU B CD2   1 
ATOM   1903 N  N     . TRP B 1 63  ? -11.892 -5.285  15.357  1.00 21.67  ? 80   TRP B N     1 
ATOM   1904 C  CA    . TRP B 1 63  ? -11.754 -5.322  13.910  1.00 21.77  ? 80   TRP B CA    1 
ATOM   1905 C  C     . TRP B 1 63  ? -10.254 -5.097  13.582  1.00 23.18  ? 80   TRP B C     1 
ATOM   1906 O  O     . TRP B 1 63  ? -9.743  -3.988  13.694  1.00 23.22  ? 80   TRP B O     1 
ATOM   1907 C  CB    . TRP B 1 63  ? -12.577 -4.267  13.244  1.00 22.69  ? 80   TRP B CB    1 
ATOM   1908 C  CG    . TRP B 1 63  ? -14.062 -4.600  13.184  1.00 23.71  ? 80   TRP B CG    1 
ATOM   1909 C  CD1   . TRP B 1 63  ? -14.851 -4.895  14.215  1.00 23.71  ? 80   TRP B CD1   1 
ATOM   1910 C  CD2   . TRP B 1 63  ? -14.881 -4.540  12.007  1.00 24.27  ? 80   TRP B CD2   1 
ATOM   1911 N  NE1   . TRP B 1 63  ? -16.147 -5.133  13.747  1.00 26.98  ? 80   TRP B NE1   1 
ATOM   1912 C  CE2   . TRP B 1 63  ? -16.187 -4.863  12.397  1.00 26.34  ? 80   TRP B CE2   1 
ATOM   1913 C  CE3   . TRP B 1 63  ? -14.625 -4.218  10.649  1.00 24.05  ? 80   TRP B CE3   1 
ATOM   1914 C  CZ2   . TRP B 1 63  ? -17.240 -4.904  11.498  1.00 26.15  ? 80   TRP B CZ2   1 
ATOM   1915 C  CZ3   . TRP B 1 63  ? -15.647 -4.241  9.770   1.00 25.81  ? 80   TRP B CZ3   1 
ATOM   1916 C  CH2   . TRP B 1 63  ? -16.967 -4.580  10.181  1.00 26.23  ? 80   TRP B CH2   1 
ATOM   1917 N  N     . ASP B 1 64  ? -9.595  -6.155  13.158  1.00 24.99  ? 81   ASP B N     1 
ATOM   1918 C  CA    . ASP B 1 64  ? -8.141  -6.243  12.753  1.00 27.23  ? 81   ASP B CA    1 
ATOM   1919 C  C     . ASP B 1 64  ? -8.040  -5.979  11.272  1.00 27.40  ? 81   ASP B C     1 
ATOM   1920 O  O     . ASP B 1 64  ? -8.306  -6.849  10.446  1.00 27.17  ? 81   ASP B O     1 
ATOM   1921 C  CB    . ASP B 1 64  ? -7.708  -7.703  13.076  1.00 30.44  ? 81   ASP B CB    1 
ATOM   1922 C  CG    . ASP B 1 64  ? -6.274  -8.084  12.645  1.00 32.89  ? 81   ASP B CG    1 
ATOM   1923 O  OD1   . ASP B 1 64  ? -5.453  -7.196  12.270  1.00 36.61  ? 81   ASP B OD1   1 
ATOM   1924 O  OD2   . ASP B 1 64  ? -6.025  -9.352  12.633  1.00 34.61  ? 81   ASP B OD2   1 
ATOM   1925 N  N     . ILE B 1 65  ? -7.648  -4.759  10.913  1.00 28.72  ? 82   ILE B N     1 
ATOM   1926 C  CA    . ILE B 1 65  ? -7.659  -4.332  9.536   1.00 29.00  ? 82   ILE B CA    1 
ATOM   1927 C  C     . ILE B 1 65  ? -6.282  -4.685  8.976   1.00 30.23  ? 82   ILE B C     1 
ATOM   1928 O  O     . ILE B 1 65  ? -5.279  -4.339  9.599   1.00 32.05  ? 82   ILE B O     1 
ATOM   1929 C  CB    . ILE B 1 65  ? -7.836  -2.790  9.449   1.00 30.06  ? 82   ILE B CB    1 
ATOM   1930 C  CG1   . ILE B 1 65  ? -9.097  -2.281  10.198  1.00 30.39  ? 82   ILE B CG1   1 
ATOM   1931 C  CG2   . ILE B 1 65  ? -7.842  -2.354  7.992   1.00 30.95  ? 82   ILE B CG2   1 
ATOM   1932 C  CD1   . ILE B 1 65  ? -10.431 -2.758  9.685   1.00 30.94  ? 82   ILE B CD1   1 
ATOM   1933 N  N     . ALA B 1 66  ? -6.238  -5.431  7.870   1.00 30.69  ? 83   ALA B N     1 
ATOM   1934 C  CA    . ALA B 1 66  ? -4.999  -5.851  7.273   1.00 31.37  ? 83   ALA B CA    1 
ATOM   1935 C  C     . ALA B 1 66  ? -4.188  -4.639  6.769   1.00 31.51  ? 83   ALA B C     1 
ATOM   1936 O  O     . ALA B 1 66  ? -4.769  -3.665  6.307   1.00 31.56  ? 83   ALA B O     1 
ATOM   1937 C  CB    . ALA B 1 66  ? -5.267  -6.792  6.114   1.00 31.66  ? 83   ALA B CB    1 
ATOM   1938 N  N     . GLY B 1 67  ? -2.881  -4.795  6.785   1.00 30.68  ? 84   GLY B N     1 
ATOM   1939 C  CA    . GLY B 1 67  ? -1.909  -3.746  6.398   1.00 31.61  ? 84   GLY B CA    1 
ATOM   1940 C  C     . GLY B 1 67  ? -2.037  -3.089  5.051   1.00 31.97  ? 84   GLY B C     1 
ATOM   1941 O  O     . GLY B 1 67  ? -1.730  -1.914  4.933   1.00 30.71  ? 84   GLY B O     1 
ATOM   1942 N  N     . LEU B 1 68  ? -2.499  -3.795  4.034   1.00 31.04  ? 85   LEU B N     1 
ATOM   1943 C  CA    . LEU B 1 68  ? -2.767  -3.136  2.752   1.00 35.17  ? 85   LEU B CA    1 
ATOM   1944 C  C     . LEU B 1 68  ? -4.035  -2.257  2.654   1.00 36.35  ? 85   LEU B C     1 
ATOM   1945 O  O     . LEU B 1 68  ? -4.232  -1.597  1.614   1.00 37.14  ? 85   LEU B O     1 
ATOM   1946 C  CB    . LEU B 1 68  ? -2.806  -4.163  1.614   1.00 36.44  ? 85   LEU B CB    1 
ATOM   1947 C  CG    . LEU B 1 68  ? -1.450  -4.774  1.264   1.00 38.23  ? 85   LEU B CG    1 
ATOM   1948 C  CD1   . LEU B 1 68  ? -1.642  -5.966  0.324   1.00 39.72  ? 85   LEU B CD1   1 
ATOM   1949 C  CD2   . LEU B 1 68  ? -0.518  -3.754  0.667   1.00 38.40  ? 85   LEU B CD2   1 
ATOM   1950 N  N     . GLU B 1 69  ? -4.900  -2.219  3.674   1.00 35.91  ? 86   GLU B N     1 
ATOM   1951 C  CA    . GLU B 1 69  ? -6.254  -1.686  3.411   1.00 39.71  ? 86   GLU B CA    1 
ATOM   1952 C  C     . GLU B 1 69  ? -6.323  -0.179  3.153   1.00 38.85  ? 86   GLU B C     1 
ATOM   1953 O  O     . GLU B 1 69  ? -7.251  0.295   2.444   1.00 39.89  ? 86   GLU B O     1 
ATOM   1954 C  CB    . GLU B 1 69  ? -7.272  -2.160  4.446   1.00 43.34  ? 86   GLU B CB    1 
ATOM   1955 C  CG    . GLU B 1 69  ? -7.622  -3.671  4.391   1.00 46.90  ? 86   GLU B CG    1 
ATOM   1956 C  CD    . GLU B 1 69  ? -8.039  -4.187  3.008   1.00 53.49  ? 86   GLU B CD    1 
ATOM   1957 O  OE1   . GLU B 1 69  ? -8.955  -3.587  2.398   1.00 57.38  ? 86   GLU B OE1   1 
ATOM   1958 O  OE2   . GLU B 1 69  ? -7.469  -5.182  2.520   1.00 57.77  ? 86   GLU B OE2   1 
ATOM   1959 N  N     . ARG B 1 70  ? -5.288  0.545   3.617   1.00 37.47  ? 87   ARG B N     1 
ATOM   1960 C  CA    . ARG B 1 70  ? -5.214  1.972   3.416   1.00 37.13  ? 87   ARG B CA    1 
ATOM   1961 C  C     . ARG B 1 70  ? -4.934  2.313   1.996   1.00 39.28  ? 87   ARG B C     1 
ATOM   1962 O  O     . ARG B 1 70  ? -5.086  3.454   1.664   1.00 40.63  ? 87   ARG B O     1 
ATOM   1963 C  CB    . ARG B 1 70  ? -4.168  2.648   4.332   1.00 35.83  ? 87   ARG B CB    1 
ATOM   1964 C  CG    . ARG B 1 70  ? -2.705  2.361   4.047   1.00 36.47  ? 87   ARG B CG    1 
ATOM   1965 C  CD    . ARG B 1 70  ? -1.867  3.150   5.035   1.00 37.44  ? 87   ARG B CD    1 
ATOM   1966 N  NE    . ARG B 1 70  ? -0.412  3.001   4.834   1.00 38.92  ? 87   ARG B NE    1 
ATOM   1967 C  CZ    . ARG B 1 70  ? 0.300   3.637   3.913   1.00 41.52  ? 87   ARG B CZ    1 
ATOM   1968 N  NH1   . ARG B 1 70  ? -0.279  4.507   3.064   1.00 43.14  ? 87   ARG B NH1   1 
ATOM   1969 N  NH2   . ARG B 1 70  ? 1.622   3.420   3.840   1.00 42.84  ? 87   ARG B NH2   1 
ATOM   1970 N  N     . PHE B 1 71  ? -4.486  1.358   1.175   1.00 41.84  ? 88   PHE B N     1 
ATOM   1971 C  CA    . PHE B 1 71  ? -4.284  1.614   -0.257  1.00 46.28  ? 88   PHE B CA    1 
ATOM   1972 C  C     . PHE B 1 71  ? -5.553  1.397   -1.082  1.00 48.72  ? 88   PHE B C     1 
ATOM   1973 O  O     . PHE B 1 71  ? -5.650  1.913   -2.197  1.00 51.28  ? 88   PHE B O     1 
ATOM   1974 C  CB    . PHE B 1 71  ? -3.125  0.768   -0.801  1.00 47.44  ? 88   PHE B CB    1 
ATOM   1975 C  CG    . PHE B 1 71  ? -1.811  1.118   -0.187  1.00 48.38  ? 88   PHE B CG    1 
ATOM   1976 C  CD1   . PHE B 1 71  ? -1.095  2.194   -0.651  1.00 50.40  ? 88   PHE B CD1   1 
ATOM   1977 C  CD2   . PHE B 1 71  ? -1.286  0.363   0.849   1.00 46.60  ? 88   PHE B CD2   1 
ATOM   1978 C  CE1   . PHE B 1 71  ? 0.134   2.532   -0.071  1.00 51.01  ? 88   PHE B CE1   1 
ATOM   1979 C  CE2   . PHE B 1 71  ? -0.088  0.680   1.439   1.00 46.66  ? 88   PHE B CE2   1 
ATOM   1980 C  CZ    . PHE B 1 71  ? 0.634   1.776   0.979   1.00 49.09  ? 88   PHE B CZ    1 
ATOM   1981 N  N     . GLY B 1 72  ? -6.495  0.633   -0.531  1.00 48.40  ? 89   GLY B N     1 
ATOM   1982 C  CA    . GLY B 1 72  ? -7.763  0.368   -1.175  1.00 50.76  ? 89   GLY B CA    1 
ATOM   1983 C  C     . GLY B 1 72  ? -8.783  1.456   -0.886  1.00 51.88  ? 89   GLY B C     1 
ATOM   1984 O  O     . GLY B 1 72  ? -8.444  2.562   -0.481  1.00 51.54  ? 89   GLY B O     1 
ATOM   1985 N  N     . ASN B 1 73  ? -10.043 1.110   -1.061  1.00 53.53  ? 90   ASN B N     1 
ATOM   1986 C  CA    . ASN B 1 73  ? -11.158 2.079   -0.933  1.00 56.41  ? 90   ASN B CA    1 
ATOM   1987 C  C     . ASN B 1 73  ? -12.259 1.576   0.003   1.00 52.96  ? 90   ASN B C     1 
ATOM   1988 O  O     . ASN B 1 73  ? -13.408 2.034   -0.107  1.00 54.19  ? 90   ASN B O     1 
ATOM   1989 C  CB    . ASN B 1 73  ? -11.751 2.357   -2.314  1.00 62.67  ? 90   ASN B CB    1 
ATOM   1990 C  CG    . ASN B 1 73  ? -12.213 1.084   -3.019  1.00 65.93  ? 90   ASN B CG    1 
ATOM   1991 O  OD1   . ASN B 1 73  ? -11.797 0.814   -4.137  1.00 70.81  ? 90   ASN B OD1   1 
ATOM   1992 N  ND2   . ASN B 1 73  ? -13.057 0.282   -2.358  1.00 65.53  ? 90   ASN B ND2   1 
ATOM   1993 N  N     . MET B 1 74  ? -11.914 0.687   0.934   1.00 48.83  ? 91   MET B N     1 
ATOM   1994 C  CA    . MET B 1 74  ? -12.890 0.070   1.824   1.00 44.81  ? 91   MET B CA    1 
ATOM   1995 C  C     . MET B 1 74  ? -12.796 0.509   3.271   1.00 39.16  ? 91   MET B C     1 
ATOM   1996 O  O     . MET B 1 74  ? -13.694 0.173   4.044   1.00 37.36  ? 91   MET B O     1 
ATOM   1997 C  CB    . MET B 1 74  ? -12.816 -1.464  1.742   1.00 45.97  ? 91   MET B CB    1 
ATOM   1998 C  CG    . MET B 1 74  ? -13.508 -2.041  0.505   1.00 50.33  ? 91   MET B CG    1 
ATOM   1999 S  SD    . MET B 1 74  ? -15.331 -1.976  0.454   1.00 53.72  ? 91   MET B SD    1 
ATOM   2000 C  CE    . MET B 1 74  ? -15.808 -2.711  2.002   1.00 50.97  ? 91   MET B CE    1 
ATOM   2001 N  N     . THR B 1 75  ? -11.779 1.289   3.637   1.00 36.66  ? 92   THR B N     1 
ATOM   2002 C  CA    . THR B 1 75  ? -11.580 1.607   5.054   1.00 34.20  ? 92   THR B CA    1 
ATOM   2003 C  C     . THR B 1 75  ? -12.754 2.418   5.626   1.00 35.14  ? 92   THR B C     1 
ATOM   2004 O  O     . THR B 1 75  ? -13.123 2.180   6.783   1.00 33.15  ? 92   THR B O     1 
ATOM   2005 C  CB    . THR B 1 75  ? -10.257 2.322   5.370   1.00 32.86  ? 92   THR B CB    1 
ATOM   2006 O  OG1   . THR B 1 75  ? -10.149 3.538   4.600   1.00 35.23  ? 92   THR B OG1   1 
ATOM   2007 C  CG2   . THR B 1 75  ? -9.101  1.453   5.134   1.00 32.68  ? 92   THR B CG2   1 
ATOM   2008 N  N     . ARG B 1 76  ? -13.357 3.315   4.845   1.00 38.05  ? 93   ARG B N     1 
ATOM   2009 C  CA    . ARG B 1 76  ? -14.518 4.047   5.340   1.00 41.02  ? 93   ARG B CA    1 
ATOM   2010 C  C     . ARG B 1 76  ? -15.609 3.074   5.778   1.00 39.69  ? 93   ARG B C     1 
ATOM   2011 O  O     . ARG B 1 76  ? -16.181 3.227   6.852   1.00 39.32  ? 93   ARG B O     1 
ATOM   2012 C  CB    . ARG B 1 76  ? -15.089 5.075   4.331   1.00 45.94  ? 93   ARG B CB    1 
ATOM   2013 C  CG    . ARG B 1 76  ? -16.049 6.081   4.999   1.00 49.86  ? 93   ARG B CG    1 
ATOM   2014 C  CD    . ARG B 1 76  ? -16.538 7.235   4.105   1.00 56.59  ? 93   ARG B CD    1 
ATOM   2015 N  NE    . ARG B 1 76  ? -15.470 8.161   3.668   1.00 61.29  ? 93   ARG B NE    1 
ATOM   2016 C  CZ    . ARG B 1 76  ? -15.239 9.399   4.128   1.00 63.97  ? 93   ARG B CZ    1 
ATOM   2017 N  NH1   . ARG B 1 76  ? -15.968 9.944   5.104   1.00 65.32  ? 93   ARG B NH1   1 
ATOM   2018 N  NH2   . ARG B 1 76  ? -14.213 10.097  3.629   1.00 66.02  ? 93   ARG B NH2   1 
ATOM   2019 N  N     . VAL B 1 77  ? -15.851 2.032   4.988   1.00 39.66  ? 94   VAL B N     1 
ATOM   2020 C  CA    . VAL B 1 77  ? -16.828 1.010   5.376   1.00 37.05  ? 94   VAL B CA    1 
ATOM   2021 C  C     . VAL B 1 77  ? -16.369 0.252   6.614   1.00 32.01  ? 94   VAL B C     1 
ATOM   2022 O  O     . VAL B 1 77  ? -17.170 0.024   7.521   1.00 29.93  ? 94   VAL B O     1 
ATOM   2023 C  CB    . VAL B 1 77  ? -17.163 0.035   4.228   1.00 39.31  ? 94   VAL B CB    1 
ATOM   2024 C  CG1   . VAL B 1 77  ? -18.180 -1.009  4.702   1.00 38.25  ? 94   VAL B CG1   1 
ATOM   2025 C  CG2   . VAL B 1 77  ? -17.723 0.809   3.042   1.00 41.89  ? 94   VAL B CG2   1 
ATOM   2026 N  N     . TYR B 1 78  ? -15.103 -0.122  6.669   1.00 30.55  ? 95   TYR B N     1 
ATOM   2027 C  CA    . TYR B 1 78  ? -14.588 -0.895  7.784   1.00 30.04  ? 95   TYR B CA    1 
ATOM   2028 C  C     . TYR B 1 78  ? -14.623 -0.185  9.093   1.00 29.03  ? 95   TYR B C     1 
ATOM   2029 O  O     . TYR B 1 78  ? -14.835 -0.833  10.121  1.00 28.35  ? 95   TYR B O     1 
ATOM   2030 C  CB    . TYR B 1 78  ? -13.134 -1.349  7.536   1.00 31.24  ? 95   TYR B CB    1 
ATOM   2031 C  CG    . TYR B 1 78  ? -12.971 -2.318  6.372   1.00 34.78  ? 95   TYR B CG    1 
ATOM   2032 C  CD1   . TYR B 1 78  ? -14.012 -3.132  5.937   1.00 37.12  ? 95   TYR B CD1   1 
ATOM   2033 C  CD2   . TYR B 1 78  ? -11.730 -2.451  5.730   1.00 36.92  ? 95   TYR B CD2   1 
ATOM   2034 C  CE1   . TYR B 1 78  ? -13.845 -4.009  4.885   1.00 39.52  ? 95   TYR B CE1   1 
ATOM   2035 C  CE2   . TYR B 1 78  ? -11.557 -3.320  4.687   1.00 39.37  ? 95   TYR B CE2   1 
ATOM   2036 C  CZ    . TYR B 1 78  ? -12.606 -4.108  4.266   1.00 40.63  ? 95   TYR B CZ    1 
ATOM   2037 O  OH    . TYR B 1 78  ? -12.465 -4.982  3.230   1.00 42.67  ? 95   TYR B OH    1 
ATOM   2038 N  N     . TYR B 1 79  ? -14.334 1.117   9.063   1.00 29.98  ? 96   TYR B N     1 
ATOM   2039 C  CA    . TYR B 1 79  ? -14.287 1.927   10.269  1.00 28.42  ? 96   TYR B CA    1 
ATOM   2040 C  C     . TYR B 1 79  ? -15.679 2.283   10.832  1.00 26.31  ? 96   TYR B C     1 
ATOM   2041 O  O     . TYR B 1 79  ? -15.789 2.697   11.966  1.00 24.57  ? 96   TYR B O     1 
ATOM   2042 C  CB    . TYR B 1 79  ? -13.604 3.260   9.968   1.00 30.29  ? 96   TYR B CB    1 
ATOM   2043 C  CG    . TYR B 1 79  ? -12.171 3.175   9.540   1.00 32.92  ? 96   TYR B CG    1 
ATOM   2044 C  CD1   . TYR B 1 79  ? -11.389 2.080   9.814   1.00 32.90  ? 96   TYR B CD1   1 
ATOM   2045 C  CD2   . TYR B 1 79  ? -11.580 4.257   8.909   1.00 36.01  ? 96   TYR B CD2   1 
ATOM   2046 C  CE1   . TYR B 1 79  ? -10.044 2.054   9.437   1.00 34.91  ? 96   TYR B CE1   1 
ATOM   2047 C  CE2   . TYR B 1 79  ? -10.232 4.250   8.536   1.00 37.33  ? 96   TYR B CE2   1 
ATOM   2048 C  CZ    . TYR B 1 79  ? -9.482  3.142   8.800   1.00 36.82  ? 96   TYR B CZ    1 
ATOM   2049 O  OH    . TYR B 1 79  ? -8.176  3.093   8.406   1.00 39.52  ? 96   TYR B OH    1 
ATOM   2050 N  N     . LYS B 1 80  ? -16.722 2.154   10.038  1.00 27.97  ? 97   LYS B N     1 
ATOM   2051 C  CA    . LYS B 1 80  ? -18.007 2.679   10.449  1.00 30.42  ? 97   LYS B CA    1 
ATOM   2052 C  C     . LYS B 1 80  ? -18.417 2.175   11.847  1.00 29.98  ? 97   LYS B C     1 
ATOM   2053 O  O     . LYS B 1 80  ? -18.352 0.977   12.149  1.00 29.44  ? 97   LYS B O     1 
ATOM   2054 C  CB    . LYS B 1 80  ? -19.032 2.338   9.391   1.00 32.97  ? 97   LYS B CB    1 
ATOM   2055 C  CG    . LYS B 1 80  ? -20.434 2.920   9.616   1.00 36.57  ? 97   LYS B CG    1 
ATOM   2056 C  CD    . LYS B 1 80  ? -21.315 2.674   8.422   1.00 40.83  ? 97   LYS B CD    1 
ATOM   2057 C  CE    . LYS B 1 80  ? -22.796 2.752   8.794   1.00 42.89  ? 97   LYS B CE    1 
ATOM   2058 N  NZ    . LYS B 1 80  ? -23.175 4.100   9.346   1.00 43.40  ? 97   LYS B NZ    1 
ATOM   2059 N  N     . GLU B 1 81  ? -18.855 3.099   12.678  1.00 31.14  ? 98   GLU B N     1 
ATOM   2060 C  CA    . GLU B 1 81  ? -19.359 2.833   14.033  1.00 33.71  ? 98   GLU B CA    1 
ATOM   2061 C  C     . GLU B 1 81  ? -18.245 2.636   15.044  1.00 29.29  ? 98   GLU B C     1 
ATOM   2062 O  O     . GLU B 1 81  ? -18.561 2.534   16.235  1.00 29.86  ? 98   GLU B O     1 
ATOM   2063 C  CB    . GLU B 1 81  ? -20.330 1.568   14.152  1.00 40.93  ? 98   GLU B CB    1 
ATOM   2064 C  CG    . GLU B 1 81  ? -21.514 1.470   13.208  1.00 48.71  ? 98   GLU B CG    1 
ATOM   2065 C  CD    . GLU B 1 81  ? -22.694 2.415   13.512  1.00 57.94  ? 98   GLU B CD    1 
ATOM   2066 O  OE1   . GLU B 1 81  ? -22.844 2.935   14.654  1.00 61.62  ? 98   GLU B OE1   1 
ATOM   2067 O  OE2   . GLU B 1 81  ? -23.471 2.655   12.566  1.00 63.57  ? 98   GLU B OE2   1 
ATOM   2068 N  N     . ALA B 1 82  ? -16.970 2.603   14.671  1.00 25.56  ? 99   ALA B N     1 
ATOM   2069 C  CA    . ALA B 1 82  ? -15.931 2.459   15.671  1.00 21.94  ? 99   ALA B CA    1 
ATOM   2070 C  C     . ALA B 1 82  ? -15.982 3.598   16.653  1.00 22.62  ? 99   ALA B C     1 
ATOM   2071 O  O     . ALA B 1 82  ? -16.160 4.758   16.274  1.00 26.30  ? 99   ALA B O     1 
ATOM   2072 C  CB    . ALA B 1 82  ? -14.536 2.416   15.033  1.00 20.09  ? 99   ALA B CB    1 
ATOM   2073 N  N     . VAL B 1 83  ? -15.739 3.278   17.912  1.00 21.79  ? 100  VAL B N     1 
ATOM   2074 C  CA    . VAL B 1 83  ? -15.666 4.259   18.975  1.00 23.11  ? 100  VAL B CA    1 
ATOM   2075 C  C     . VAL B 1 83  ? -14.219 4.337   19.542  1.00 24.10  ? 100  VAL B C     1 
ATOM   2076 O  O     . VAL B 1 83  ? -13.910 5.225   20.349  1.00 24.48  ? 100  VAL B O     1 
ATOM   2077 C  CB    . VAL B 1 83  ? -16.671 4.017   20.109  1.00 25.05  ? 100  VAL B CB    1 
ATOM   2078 C  CG1   . VAL B 1 83  ? -18.100 4.378   19.687  1.00 26.98  ? 100  VAL B CG1   1 
ATOM   2079 C  CG2   . VAL B 1 83  ? -16.585 2.552   20.582  1.00 24.17  ? 100  VAL B CG2   1 
ATOM   2080 N  N     . GLY B 1 84  ? -13.306 3.515   19.073  1.00 25.34  ? 101  GLY B N     1 
ATOM   2081 C  CA    . GLY B 1 84  ? -11.874 3.655   19.481  1.00 19.07  ? 101  GLY B CA    1 
ATOM   2082 C  C     . GLY B 1 84  ? -10.962 2.901   18.553  1.00 19.71  ? 101  GLY B C     1 
ATOM   2083 O  O     . GLY B 1 84  ? -11.447 2.117   17.720  1.00 19.96  ? 101  GLY B O     1 
ATOM   2084 N  N     . ALA B 1 85  ? -9.649  3.126   18.668  1.00 22.19  ? 102  ALA B N     1 
ATOM   2085 C  CA    . ALA B 1 85  ? -8.662  2.482   17.845  1.00 22.96  ? 102  ALA B CA    1 
ATOM   2086 C  C     . ALA B 1 85  ? -7.326  2.311   18.517  1.00 22.94  ? 102  ALA B C     1 
ATOM   2087 O  O     . ALA B 1 85  ? -6.937  3.121   19.309  1.00 22.26  ? 102  ALA B O     1 
ATOM   2088 C  CB    . ALA B 1 85  ? -8.440  3.242   16.541  1.00 24.76  ? 102  ALA B CB    1 
ATOM   2089 N  N     . PHE B 1 86  ? -6.646  1.192   18.197  1.00 23.32  ? 103  PHE B N     1 
ATOM   2090 C  CA    . PHE B 1 86  ? -5.226  1.059   18.331  1.00 22.82  ? 103  PHE B CA    1 
ATOM   2091 C  C     . PHE B 1 86  ? -4.517  1.268   17.017  1.00 22.47  ? 103  PHE B C     1 
ATOM   2092 O  O     . PHE B 1 86  ? -4.960  0.765   16.015  1.00 22.13  ? 103  PHE B O     1 
ATOM   2093 C  CB    . PHE B 1 86  ? -4.864  -0.379  18.771  1.00 22.61  ? 103  PHE B CB    1 
ATOM   2094 C  CG    . PHE B 1 86  ? -5.302  -0.710  20.135  1.00 23.54  ? 103  PHE B CG    1 
ATOM   2095 C  CD1   . PHE B 1 86  ? -4.822  0.012   21.204  1.00 23.33  ? 103  PHE B CD1   1 
ATOM   2096 C  CD2   . PHE B 1 86  ? -6.322  -1.648  20.351  1.00 24.62  ? 103  PHE B CD2   1 
ATOM   2097 C  CE1   . PHE B 1 86  ? -5.198  -0.272  22.498  1.00 24.83  ? 103  PHE B CE1   1 
ATOM   2098 C  CE2   . PHE B 1 86  ? -6.752  -1.910  21.622  1.00 25.41  ? 103  PHE B CE2   1 
ATOM   2099 C  CZ    . PHE B 1 86  ? -6.159  -1.262  22.701  1.00 26.06  ? 103  PHE B CZ    1 
ATOM   2100 N  N     . VAL B 1 87  ? -3.373  1.964   17.056  1.00 24.22  ? 104  VAL B N     1 
ATOM   2101 C  CA    . VAL B 1 87  ? -2.525  2.160   15.912  1.00 24.80  ? 104  VAL B CA    1 
ATOM   2102 C  C     . VAL B 1 87  ? -1.189  1.596   16.350  1.00 25.19  ? 104  VAL B C     1 
ATOM   2103 O  O     . VAL B 1 87  ? -0.680  1.978   17.382  1.00 26.34  ? 104  VAL B O     1 
ATOM   2104 C  CB    . VAL B 1 87  ? -2.403  3.632   15.449  1.00 26.18  ? 104  VAL B CB    1 
ATOM   2105 C  CG1   . VAL B 1 87  ? -1.527  3.749   14.188  1.00 26.69  ? 104  VAL B CG1   1 
ATOM   2106 C  CG2   . VAL B 1 87  ? -3.774  4.215   15.204  1.00 24.65  ? 104  VAL B CG2   1 
ATOM   2107 N  N     . VAL B 1 88  ? -0.712  0.608   15.589  1.00 23.78  ? 105  VAL B N     1 
ATOM   2108 C  CA    . VAL B 1 88  ? 0.343   -0.287  15.997  1.00 24.72  ? 105  VAL B CA    1 
ATOM   2109 C  C     . VAL B 1 88  ? 1.442   -0.102  15.023  1.00 26.06  ? 105  VAL B C     1 
ATOM   2110 O  O     . VAL B 1 88  ? 1.218   -0.017  13.814  1.00 27.87  ? 105  VAL B O     1 
ATOM   2111 C  CB    . VAL B 1 88  ? -0.090  -1.816  15.988  1.00 24.22  ? 105  VAL B CB    1 
ATOM   2112 C  CG1   . VAL B 1 88  ? 0.996   -2.681  16.526  1.00 24.06  ? 105  VAL B CG1   1 
ATOM   2113 C  CG2   . VAL B 1 88  ? -1.335  -1.993  16.804  1.00 23.18  ? 105  VAL B CG2   1 
ATOM   2114 N  N     . PHE B 1 89  ? 2.635   0.052   15.545  1.00 27.52  ? 106  PHE B N     1 
ATOM   2115 C  CA    . PHE B 1 89  ? 3.851   -0.071  14.750  1.00 29.81  ? 106  PHE B CA    1 
ATOM   2116 C  C     . PHE B 1 89  ? 4.820   -1.048  15.433  1.00 32.41  ? 106  PHE B C     1 
ATOM   2117 O  O     . PHE B 1 89  ? 4.622   -1.452  16.561  1.00 30.10  ? 106  PHE B O     1 
ATOM   2118 C  CB    . PHE B 1 89  ? 4.491   1.288   14.456  1.00 30.85  ? 106  PHE B CB    1 
ATOM   2119 C  CG    . PHE B 1 89  ? 5.155   1.933   15.645  1.00 31.70  ? 106  PHE B CG    1 
ATOM   2120 C  CD1   . PHE B 1 89  ? 4.405   2.573   16.616  1.00 31.29  ? 106  PHE B CD1   1 
ATOM   2121 C  CD2   . PHE B 1 89  ? 6.586   1.915   15.765  1.00 34.10  ? 106  PHE B CD2   1 
ATOM   2122 C  CE1   . PHE B 1 89  ? 4.995   3.160   17.704  1.00 31.98  ? 106  PHE B CE1   1 
ATOM   2123 C  CE2   . PHE B 1 89  ? 7.199   2.568   16.825  1.00 36.05  ? 106  PHE B CE2   1 
ATOM   2124 C  CZ    . PHE B 1 89  ? 6.403   3.189   17.810  1.00 33.94  ? 106  PHE B CZ    1 
ATOM   2125 N  N     . ASP B 1 90  ? 5.861   -1.389  14.697  1.00 35.46  ? 107  ASP B N     1 
ATOM   2126 C  CA    . ASP B 1 90  ? 6.878   -2.321  15.105  1.00 39.69  ? 107  ASP B CA    1 
ATOM   2127 C  C     . ASP B 1 90  ? 8.095   -1.484  15.516  1.00 43.43  ? 107  ASP B C     1 
ATOM   2128 O  O     . ASP B 1 90  ? 8.733   -0.853  14.690  1.00 43.69  ? 107  ASP B O     1 
ATOM   2129 C  CB    . ASP B 1 90  ? 7.173   -3.211  13.901  1.00 42.12  ? 107  ASP B CB    1 
ATOM   2130 C  CG    . ASP B 1 90  ? 8.309   -4.190  14.106  1.00 46.40  ? 107  ASP B CG    1 
ATOM   2131 O  OD1   . ASP B 1 90  ? 9.048   -4.151  15.118  1.00 48.42  ? 107  ASP B OD1   1 
ATOM   2132 O  OD2   . ASP B 1 90  ? 8.488   -5.021  13.209  1.00 47.56  ? 107  ASP B OD2   1 
ATOM   2133 N  N     . ILE B 1 91  ? 8.412   -1.576  16.798  1.00 47.05  ? 108  ILE B N     1 
ATOM   2134 C  CA    . ILE B 1 91  ? 9.418   -0.797  17.482  1.00 51.63  ? 108  ILE B CA    1 
ATOM   2135 C  C     . ILE B 1 91  ? 10.801  -0.970  16.815  1.00 55.16  ? 108  ILE B C     1 
ATOM   2136 O  O     . ILE B 1 91  ? 11.609  -0.082  16.917  1.00 57.03  ? 108  ILE B O     1 
ATOM   2137 C  CB    . ILE B 1 91  ? 9.443   -1.175  18.998  1.00 52.40  ? 108  ILE B CB    1 
ATOM   2138 C  CG1   . ILE B 1 91  ? 10.105  -0.110  19.862  1.00 54.53  ? 108  ILE B CG1   1 
ATOM   2139 C  CG2   . ILE B 1 91  ? 10.142  -2.502  19.246  1.00 53.76  ? 108  ILE B CG2   1 
ATOM   2140 C  CD1   . ILE B 1 91  ? 9.818   -0.332  21.352  1.00 53.57  ? 108  ILE B CD1   1 
ATOM   2141 N  N     . SER B 1 92  ? 11.005  -2.077  16.093  1.00 55.62  ? 109  SER B N     1 
ATOM   2142 C  CA    . SER B 1 92  ? 12.231  -2.380  15.331  1.00 58.50  ? 109  SER B CA    1 
ATOM   2143 C  C     . SER B 1 92  ? 12.297  -1.865  13.879  1.00 57.54  ? 109  SER B C     1 
ATOM   2144 O  O     . SER B 1 92  ? 13.369  -1.947  13.268  1.00 58.79  ? 109  SER B O     1 
ATOM   2145 C  CB    . SER B 1 92  ? 12.475  -3.917  15.253  1.00 60.32  ? 109  SER B CB    1 
ATOM   2146 O  OG    . SER B 1 92  ? 11.936  -4.655  16.347  1.00 59.71  ? 109  SER B OG    1 
ATOM   2147 N  N     . ARG B 1 93  ? 11.201  -1.361  13.326  1.00 54.66  ? 110  ARG B N     1 
ATOM   2148 C  CA    . ARG B 1 93  ? 11.161  -0.926  11.920  1.00 54.26  ? 110  ARG B CA    1 
ATOM   2149 C  C     . ARG B 1 93  ? 10.557  0.473   11.763  1.00 53.39  ? 110  ARG B C     1 
ATOM   2150 O  O     . ARG B 1 93  ? 9.312   0.649   11.790  1.00 49.92  ? 110  ARG B O     1 
ATOM   2151 C  CB    . ARG B 1 93  ? 10.340  -1.909  11.084  1.00 50.97  ? 110  ARG B CB    1 
ATOM   2152 C  CG    . ARG B 1 93  ? 10.966  -3.259  10.851  1.00 51.36  ? 110  ARG B CG    1 
ATOM   2153 C  CD    . ARG B 1 93  ? 10.192  -3.934  9.724   1.00 50.36  ? 110  ARG B CD    1 
ATOM   2154 N  NE    . ARG B 1 93  ? 8.866   -4.308  10.206  1.00 46.79  ? 110  ARG B NE    1 
ATOM   2155 C  CZ    . ARG B 1 93  ? 7.785   -4.519  9.465   1.00 44.43  ? 110  ARG B CZ    1 
ATOM   2156 N  NH1   . ARG B 1 93  ? 7.775   -4.338  8.162   1.00 45.31  ? 110  ARG B NH1   1 
ATOM   2157 N  NH2   . ARG B 1 93  ? 6.647   -4.864  10.059  1.00 41.12  ? 110  ARG B NH2   1 
ATOM   2158 N  N     . SER B 1 94  ? 11.414  1.472   11.591  1.00 55.61  ? 111  SER B N     1 
ATOM   2159 C  CA    . SER B 1 94  ? 10.980  2.861   11.564  1.00 54.57  ? 111  SER B CA    1 
ATOM   2160 C  C     . SER B 1 94  ? 10.061  3.216   10.381  1.00 54.03  ? 111  SER B C     1 
ATOM   2161 O  O     . SER B 1 94  ? 9.269   4.140   10.485  1.00 53.65  ? 111  SER B O     1 
ATOM   2162 C  CB    . SER B 1 94  ? 12.196  3.790   11.634  1.00 56.63  ? 111  SER B CB    1 
ATOM   2163 O  OG    . SER B 1 94  ? 13.102  3.484   10.601  1.00 58.99  ? 111  SER B OG    1 
ATOM   2164 N  N     . SER B 1 95  ? 10.139  2.490   9.270   1.00 55.55  ? 112  SER B N     1 
ATOM   2165 C  CA    . SER B 1 95  ? 9.168   2.629   8.177   1.00 55.09  ? 112  SER B CA    1 
ATOM   2166 C  C     . SER B 1 95  ? 7.705   2.466   8.675   1.00 51.09  ? 112  SER B C     1 
ATOM   2167 O  O     . SER B 1 95  ? 6.805   3.184   8.237   1.00 50.09  ? 112  SER B O     1 
ATOM   2168 C  CB    . SER B 1 95  ? 9.425   1.551   7.143   1.00 57.26  ? 112  SER B CB    1 
ATOM   2169 O  OG    . SER B 1 95  ? 9.235   0.276   7.762   1.00 56.59  ? 112  SER B OG    1 
ATOM   2170 N  N     . THR B 1 96  ? 7.481   1.512   9.582   1.00 47.81  ? 113  THR B N     1 
ATOM   2171 C  CA    . THR B 1 96  ? 6.163   1.338   10.175  1.00 43.27  ? 113  THR B CA    1 
ATOM   2172 C  C     . THR B 1 96  ? 5.744   2.468   11.152  1.00 42.04  ? 113  THR B C     1 
ATOM   2173 O  O     . THR B 1 96  ? 4.541   2.770   11.294  1.00 40.04  ? 113  THR B O     1 
ATOM   2174 C  CB    . THR B 1 96  ? 6.004   -0.029  10.868  1.00 40.20  ? 113  THR B CB    1 
ATOM   2175 O  OG1   . THR B 1 96  ? 6.789   -0.071  12.064  1.00 39.45  ? 113  THR B OG1   1 
ATOM   2176 C  CG2   . THR B 1 96  ? 6.365   -1.162  9.903   1.00 41.05  ? 113  THR B CG2   1 
ATOM   2177 N  N     . PHE B 1 97  ? 6.710   3.102   11.794  1.00 44.30  ? 114  PHE B N     1 
ATOM   2178 C  CA    . PHE B 1 97  ? 6.445   4.339   12.561  1.00 44.98  ? 114  PHE B CA    1 
ATOM   2179 C  C     . PHE B 1 97  ? 6.052   5.524   11.661  1.00 46.64  ? 114  PHE B C     1 
ATOM   2180 O  O     . PHE B 1 97  ? 5.062   6.178   11.955  1.00 44.60  ? 114  PHE B O     1 
ATOM   2181 C  CB    . PHE B 1 97  ? 7.608   4.724   13.450  1.00 46.70  ? 114  PHE B CB    1 
ATOM   2182 C  CG    . PHE B 1 97  ? 7.328   5.914   14.313  1.00 46.95  ? 114  PHE B CG    1 
ATOM   2183 C  CD1   . PHE B 1 97  ? 6.305   5.867   15.247  1.00 44.08  ? 114  PHE B CD1   1 
ATOM   2184 C  CD2   . PHE B 1 97  ? 8.036   7.089   14.167  1.00 49.32  ? 114  PHE B CD2   1 
ATOM   2185 C  CE1   . PHE B 1 97  ? 6.011   6.959   16.045  1.00 44.93  ? 114  PHE B CE1   1 
ATOM   2186 C  CE2   . PHE B 1 97  ? 7.759   8.190   14.977  1.00 49.48  ? 114  PHE B CE2   1 
ATOM   2187 C  CZ    . PHE B 1 97  ? 6.740   8.134   15.909  1.00 46.91  ? 114  PHE B CZ    1 
ATOM   2188 N  N     . GLU B 1 98  ? 6.807   5.796   10.588  1.00 50.29  ? 115  GLU B N     1 
ATOM   2189 C  CA    . GLU B 1 98  ? 6.448   6.845   9.620   1.00 53.97  ? 115  GLU B CA    1 
ATOM   2190 C  C     . GLU B 1 98  ? 5.018   6.655   9.069   1.00 51.00  ? 115  GLU B C     1 
ATOM   2191 O  O     . GLU B 1 98  ? 4.274   7.625   8.895   1.00 51.88  ? 115  GLU B O     1 
ATOM   2192 C  CB    . GLU B 1 98  ? 7.484   6.935   8.468   1.00 60.62  ? 115  GLU B CB    1 
ATOM   2193 C  CG    . GLU B 1 98  ? 8.861   7.476   8.869   1.00 67.57  ? 115  GLU B CG    1 
ATOM   2194 C  CD    . GLU B 1 98  ? 10.085  6.789   8.196   1.00 72.88  ? 115  GLU B CD    1 
ATOM   2195 O  OE1   . GLU B 1 98  ? 10.015  6.277   7.036   1.00 74.50  ? 115  GLU B OE1   1 
ATOM   2196 O  OE2   . GLU B 1 98  ? 11.134  6.732   8.872   1.00 74.86  ? 115  GLU B OE2   1 
ATOM   2197 N  N     . ALA B 1 99  ? 4.602   5.415   8.865   1.00 47.39  ? 116  ALA B N     1 
ATOM   2198 C  CA    . ALA B 1 99  ? 3.253   5.116   8.341   1.00 42.76  ? 116  ALA B CA    1 
ATOM   2199 C  C     . ALA B 1 99  ? 2.068   5.371   9.298   1.00 39.79  ? 116  ALA B C     1 
ATOM   2200 O  O     . ALA B 1 99  ? 0.917   5.450   8.868   1.00 39.66  ? 116  ALA B O     1 
ATOM   2201 C  CB    . ALA B 1 99  ? 3.220   3.686   7.849   1.00 39.41  ? 116  ALA B CB    1 
ATOM   2202 N  N     . VAL B 1 100 ? 2.350   5.464   10.590  1.00 36.98  ? 117  VAL B N     1 
ATOM   2203 C  CA    . VAL B 1 100 ? 1.383   5.776   11.621  1.00 34.81  ? 117  VAL B CA    1 
ATOM   2204 C  C     . VAL B 1 100 ? 0.497   7.001   11.331  1.00 34.39  ? 117  VAL B C     1 
ATOM   2205 O  O     . VAL B 1 100 ? -0.729  6.962   11.633  1.00 30.17  ? 117  VAL B O     1 
ATOM   2206 C  CB    . VAL B 1 100 ? 2.116   6.013   12.951  1.00 35.35  ? 117  VAL B CB    1 
ATOM   2207 C  CG1   . VAL B 1 100 ? 1.331   6.912   13.928  1.00 33.95  ? 117  VAL B CG1   1 
ATOM   2208 C  CG2   . VAL B 1 100 ? 2.450   4.670   13.562  1.00 35.85  ? 117  VAL B CG2   1 
ATOM   2209 N  N     . LEU B 1 101 ? 1.084   8.033   10.734  1.00 37.33  ? 118  LEU B N     1 
ATOM   2210 C  CA    . LEU B 1 101 ? 0.364   9.240   10.453  1.00 42.00  ? 118  LEU B CA    1 
ATOM   2211 C  C     . LEU B 1 101 ? -0.549  9.070   9.267   1.00 42.34  ? 118  LEU B C     1 
ATOM   2212 O  O     . LEU B 1 101 ? -1.633  9.694   9.232   1.00 42.42  ? 118  LEU B O     1 
ATOM   2213 C  CB    . LEU B 1 101 ? 1.292   10.413  10.181  1.00 47.50  ? 118  LEU B CB    1 
ATOM   2214 C  CG    . LEU B 1 101 ? 2.148   10.833  11.386  1.00 50.53  ? 118  LEU B CG    1 
ATOM   2215 C  CD1   . LEU B 1 101 ? 1.270   11.017  12.628  1.00 50.09  ? 118  LEU B CD1   1 
ATOM   2216 C  CD2   . LEU B 1 101 ? 3.263   9.835   11.652  1.00 51.45  ? 118  LEU B CD2   1 
ATOM   2217 N  N     . LYS B 1 102 ? -0.137  8.217   8.317   1.00 43.59  ? 119  LYS B N     1 
ATOM   2218 C  CA    . LYS B 1 102 ? -1.009  7.843   7.199   1.00 43.00  ? 119  LYS B CA    1 
ATOM   2219 C  C     . LYS B 1 102 ? -2.252  7.150   7.713   1.00 39.48  ? 119  LYS B C     1 
ATOM   2220 O  O     . LYS B 1 102 ? -3.350  7.554   7.364   1.00 39.59  ? 119  LYS B O     1 
ATOM   2221 C  CB    . LYS B 1 102 ? -0.283  7.042   6.133   1.00 45.89  ? 119  LYS B CB    1 
ATOM   2222 C  CG    . LYS B 1 102 ? 0.899   7.849   5.582   1.00 51.43  ? 119  LYS B CG    1 
ATOM   2223 C  CD    . LYS B 1 102 ? 1.039   7.700   4.095   1.00 56.10  ? 119  LYS B CD    1 
ATOM   2224 C  CE    . LYS B 1 102 ? 2.303   8.368   3.554   1.00 60.50  ? 119  LYS B CE    1 
ATOM   2225 N  NZ    . LYS B 1 102 ? 3.468   7.421   3.620   1.00 61.75  ? 119  LYS B NZ    1 
ATOM   2226 N  N     . TRP B 1 103 ? -2.087  6.138   8.560   1.00 37.43  ? 120  TRP B N     1 
ATOM   2227 C  CA    . TRP B 1 103 ? -3.227  5.498   9.205   1.00 34.42  ? 120  TRP B CA    1 
ATOM   2228 C  C     . TRP B 1 103 ? -4.054  6.454   10.053  1.00 34.20  ? 120  TRP B C     1 
ATOM   2229 O  O     . TRP B 1 103 ? -5.287  6.485   9.935   1.00 32.25  ? 120  TRP B O     1 
ATOM   2230 C  CB    . TRP B 1 103 ? -2.787  4.357   10.062  1.00 32.61  ? 120  TRP B CB    1 
ATOM   2231 C  CG    . TRP B 1 103 ? -2.389  3.150   9.248   1.00 32.27  ? 120  TRP B CG    1 
ATOM   2232 C  CD1   . TRP B 1 103 ? -1.122  2.716   8.994   1.00 33.54  ? 120  TRP B CD1   1 
ATOM   2233 C  CD2   . TRP B 1 103 ? -3.273  2.248   8.593   1.00 30.51  ? 120  TRP B CD2   1 
ATOM   2234 N  NE1   . TRP B 1 103 ? -1.153  1.594   8.221   1.00 34.01  ? 120  TRP B NE1   1 
ATOM   2235 C  CE2   . TRP B 1 103 ? -2.456  1.255   7.981   1.00 31.78  ? 120  TRP B CE2   1 
ATOM   2236 C  CE3   . TRP B 1 103 ? -4.660  2.145   8.489   1.00 28.54  ? 120  TRP B CE3   1 
ATOM   2237 C  CZ2   . TRP B 1 103 ? -2.976  0.217   7.253   1.00 31.60  ? 120  TRP B CZ2   1 
ATOM   2238 C  CZ3   . TRP B 1 103 ? -5.185  1.095   7.762   1.00 28.75  ? 120  TRP B CZ3   1 
ATOM   2239 C  CH2   . TRP B 1 103 ? -4.323  0.122   7.153   1.00 30.36  ? 120  TRP B CH2   1 
ATOM   2240 N  N     . LYS B 1 104 ? -3.374  7.236   10.887  1.00 35.38  ? 121  LYS B N     1 
ATOM   2241 C  CA    . LYS B 1 104 ? -4.068  8.163   11.774  1.00 36.57  ? 121  LYS B CA    1 
ATOM   2242 C  C     . LYS B 1 104 ? -4.883  9.219   11.013  1.00 39.68  ? 121  LYS B C     1 
ATOM   2243 O  O     . LYS B 1 104 ? -6.064  9.437   11.348  1.00 39.58  ? 121  LYS B O     1 
ATOM   2244 C  CB    . LYS B 1 104 ? -3.111  8.744   12.796  1.00 37.88  ? 121  LYS B CB    1 
ATOM   2245 C  CG    . LYS B 1 104 ? -3.745  9.596   13.849  1.00 39.89  ? 121  LYS B CG    1 
ATOM   2246 C  CD    . LYS B 1 104 ? -4.821  8.907   14.641  1.00 39.36  ? 121  LYS B CD    1 
ATOM   2247 C  CE    . LYS B 1 104 ? -5.092  9.710   15.922  1.00 39.77  ? 121  LYS B CE    1 
ATOM   2248 N  NZ    . LYS B 1 104 ? -5.431  11.149  15.720  1.00 39.91  ? 121  LYS B NZ    1 
ATOM   2249 N  N     . SER B 1 105 ? -4.312  9.800   9.967   1.00 41.97  ? 122  SER B N     1 
ATOM   2250 C  CA    . SER B 1 105 ? -5.061  10.725  9.122   1.00 44.84  ? 122  SER B CA    1 
ATOM   2251 C  C     . SER B 1 105 ? -6.250  10.060  8.349   1.00 42.41  ? 122  SER B C     1 
ATOM   2252 O  O     . SER B 1 105 ? -7.302  10.691  8.191   1.00 41.79  ? 122  SER B O     1 
ATOM   2253 C  CB    . SER B 1 105 ? -4.147  11.495  8.183   1.00 50.14  ? 122  SER B CB    1 
ATOM   2254 O  OG    . SER B 1 105 ? -3.337  10.637  7.442   1.00 52.32  ? 122  SER B OG    1 
ATOM   2255 N  N     . ASP B 1 106 ? -6.082  8.807   7.907   1.00 42.08  ? 123  ASP B N     1 
ATOM   2256 C  CA    . ASP B 1 106 ? -7.152  8.030   7.225   1.00 42.16  ? 123  ASP B CA    1 
ATOM   2257 C  C     . ASP B 1 106 ? -8.348  7.857   8.174   1.00 40.08  ? 123  ASP B C     1 
ATOM   2258 O  O     . ASP B 1 106 ? -9.474  8.062   7.811   1.00 41.68  ? 123  ASP B O     1 
ATOM   2259 C  CB    . ASP B 1 106 ? -6.604  6.610   6.847   1.00 42.56  ? 123  ASP B CB    1 
ATOM   2260 C  CG    . ASP B 1 106 ? -7.553  5.786   5.951   1.00 43.31  ? 123  ASP B CG    1 
ATOM   2261 O  OD1   . ASP B 1 106 ? -7.909  6.261   4.867   1.00 46.08  ? 123  ASP B OD1   1 
ATOM   2262 O  OD2   . ASP B 1 106 ? -7.946  4.641   6.283   1.00 42.78  ? 123  ASP B OD2   1 
ATOM   2263 N  N     . LEU B 1 107 ? -8.026  7.454   9.396   1.00 38.04  ? 124  LEU B N     1 
ATOM   2264 C  CA    . LEU B 1 107 ? -8.964  7.247   10.475  1.00 38.00  ? 124  LEU B CA    1 
ATOM   2265 C  C     . LEU B 1 107 ? -9.729  8.509   10.814  1.00 39.06  ? 124  LEU B C     1 
ATOM   2266 O  O     . LEU B 1 107 ? -10.946 8.492   10.761  1.00 37.35  ? 124  LEU B O     1 
ATOM   2267 C  CB    . LEU B 1 107 ? -8.195  6.755   11.686  1.00 37.84  ? 124  LEU B CB    1 
ATOM   2268 C  CG    . LEU B 1 107 ? -8.886  6.282   12.935  1.00 37.25  ? 124  LEU B CG    1 
ATOM   2269 C  CD1   . LEU B 1 107 ? -9.560  4.944   12.704  1.00 34.03  ? 124  LEU B CD1   1 
ATOM   2270 C  CD2   . LEU B 1 107 ? -7.822  6.174   14.019  1.00 37.33  ? 124  LEU B CD2   1 
ATOM   2271 N  N     . ASP B 1 108 ? -9.028  9.610   11.094  1.00 40.74  ? 125  ASP B N     1 
ATOM   2272 C  CA    . ASP B 1 108 ? -9.719  10.835  11.447  1.00 44.95  ? 125  ASP B CA    1 
ATOM   2273 C  C     . ASP B 1 108 ? -10.527 11.456  10.288  1.00 45.18  ? 125  ASP B C     1 
ATOM   2274 O  O     . ASP B 1 108 ? -11.518 12.112  10.553  1.00 46.18  ? 125  ASP B O     1 
ATOM   2275 C  CB    . ASP B 1 108 ? -8.792  11.844  12.125  1.00 48.66  ? 125  ASP B CB    1 
ATOM   2276 C  CG    . ASP B 1 108 ? -8.275  11.350  13.496  1.00 49.09  ? 125  ASP B CG    1 
ATOM   2277 O  OD1   . ASP B 1 108 ? -8.746  10.277  14.019  1.00 48.64  ? 125  ASP B OD1   1 
ATOM   2278 O  OD2   . ASP B 1 108 ? -7.350  12.017  14.053  1.00 51.63  ? 125  ASP B OD2   1 
ATOM   2279 N  N     . SER B 1 109 ? -10.154 11.177  9.035   1.00 45.24  ? 126  SER B N     1 
ATOM   2280 C  CA    . SER B 1 109 ? -10.937 11.599  7.871   1.00 47.39  ? 126  SER B CA    1 
ATOM   2281 C  C     . SER B 1 109 ? -12.295 10.859  7.752   1.00 46.58  ? 126  SER B C     1 
ATOM   2282 O  O     . SER B 1 109 ? -13.289 11.399  7.270   1.00 47.95  ? 126  SER B O     1 
ATOM   2283 C  CB    . SER B 1 109 ? -10.120 11.342  6.599   1.00 49.17  ? 126  SER B CB    1 
ATOM   2284 O  OG    . SER B 1 109 ? -10.405 12.251  5.575   1.00 53.29  ? 126  SER B OG    1 
ATOM   2285 N  N     . LYS B 1 110 ? -12.312 9.614   8.223   1.00 45.92  ? 127  LYS B N     1 
ATOM   2286 C  CA    . LYS B 1 110 ? -13.377 8.684   7.897   1.00 46.49  ? 127  LYS B CA    1 
ATOM   2287 C  C     . LYS B 1 110 ? -14.312 8.259   8.997   1.00 45.05  ? 127  LYS B C     1 
ATOM   2288 O  O     . LYS B 1 110 ? -15.379 7.742   8.704   1.00 45.95  ? 127  LYS B O     1 
ATOM   2289 C  CB    . LYS B 1 110 ? -12.746 7.421   7.291   1.00 46.32  ? 127  LYS B CB    1 
ATOM   2290 C  CG    . LYS B 1 110 ? -12.328 7.689   5.858   1.00 49.64  ? 127  LYS B CG    1 
ATOM   2291 C  CD    . LYS B 1 110 ? -11.555 6.520   5.333   1.00 50.56  ? 127  LYS B CD    1 
ATOM   2292 C  CE    . LYS B 1 110 ? -10.585 6.903   4.232   1.00 52.39  ? 127  LYS B CE    1 
ATOM   2293 N  NZ    . LYS B 1 110 ? -11.283 7.372   3.026   1.00 55.02  ? 127  LYS B NZ    1 
ATOM   2294 N  N     . VAL B 1 111 ? -13.967 8.478   10.250  1.00 42.46  ? 128  VAL B N     1 
ATOM   2295 C  CA    . VAL B 1 111 ? -14.922 8.145   11.326  1.00 40.15  ? 128  VAL B CA    1 
ATOM   2296 C  C     . VAL B 1 111 ? -14.752 9.109   12.497  1.00 37.46  ? 128  VAL B C     1 
ATOM   2297 O  O     . VAL B 1 111 ? -13.668 9.580   12.746  1.00 36.56  ? 128  VAL B O     1 
ATOM   2298 C  CB    . VAL B 1 111 ? -14.724 6.661   11.757  1.00 39.08  ? 128  VAL B CB    1 
ATOM   2299 C  CG1   . VAL B 1 111 ? -13.358 6.457   12.375  1.00 37.82  ? 128  VAL B CG1   1 
ATOM   2300 C  CG2   . VAL B 1 111 ? -15.749 6.199   12.774  1.00 39.61  ? 128  VAL B CG2   1 
ATOM   2301 N  N     . HIS B 1 112 ? -15.846 9.376   13.181  1.00 35.25  ? 129  HIS B N     1 
ATOM   2302 C  CA    . HIS B 1 112 ? -15.940 10.304  14.321  1.00 34.18  ? 129  HIS B CA    1 
ATOM   2303 C  C     . HIS B 1 112 ? -17.020 9.743   15.250  1.00 32.67  ? 129  HIS B C     1 
ATOM   2304 O  O     . HIS B 1 112 ? -17.791 8.911   14.877  1.00 31.73  ? 129  HIS B O     1 
ATOM   2305 C  CB    . HIS B 1 112 ? -16.371 11.719  13.881  1.00 35.13  ? 129  HIS B CB    1 
ATOM   2306 C  CG    . HIS B 1 112 ? -17.461 11.683  12.868  1.00 36.77  ? 129  HIS B CG    1 
ATOM   2307 N  ND1   . HIS B 1 112 ? -18.805 11.686  13.202  1.00 37.50  ? 129  HIS B ND1   1 
ATOM   2308 C  CD2   . HIS B 1 112 ? -17.406 11.592  11.519  1.00 37.76  ? 129  HIS B CD2   1 
ATOM   2309 C  CE1   . HIS B 1 112 ? -19.527 11.612  12.101  1.00 39.05  ? 129  HIS B CE1   1 
ATOM   2310 N  NE2   . HIS B 1 112 ? -18.703 11.569  11.066  1.00 38.71  ? 129  HIS B NE2   1 
ATOM   2311 N  N     . LEU B 1 113 ? -17.044 10.209  16.476  1.00 33.09  ? 130  LEU B N     1 
ATOM   2312 C  CA    . LEU B 1 113 ? -18.070 9.831   17.416  1.00 33.04  ? 130  LEU B CA    1 
ATOM   2313 C  C     . LEU B 1 113 ? -19.428 10.460  17.041  1.00 32.55  ? 130  LEU B C     1 
ATOM   2314 O  O     . LEU B 1 113 ? -19.514 11.320  16.125  1.00 32.10  ? 130  LEU B O     1 
ATOM   2315 C  CB    . LEU B 1 113 ? -17.653 10.250  18.824  1.00 32.54  ? 130  LEU B CB    1 
ATOM   2316 C  CG    . LEU B 1 113 ? -16.313 9.647   19.282  1.00 30.69  ? 130  LEU B CG    1 
ATOM   2317 C  CD1   . LEU B 1 113 ? -15.945 10.322  20.586  1.00 32.23  ? 130  LEU B CD1   1 
ATOM   2318 C  CD2   . LEU B 1 113 ? -16.380 8.155   19.484  1.00 27.66  ? 130  LEU B CD2   1 
ATOM   2319 N  N     . PRO B 1 114 ? -20.507 10.042  17.729  1.00 32.92  ? 131  PRO B N     1 
ATOM   2320 C  CA    . PRO B 1 114 ? -21.793 10.619  17.354  1.00 34.62  ? 131  PRO B CA    1 
ATOM   2321 C  C     . PRO B 1 114 ? -21.860 12.131  17.518  1.00 38.33  ? 131  PRO B C     1 
ATOM   2322 O  O     . PRO B 1 114 ? -22.605 12.784  16.769  1.00 40.37  ? 131  PRO B O     1 
ATOM   2323 C  CB    . PRO B 1 114 ? -22.784 9.918   18.285  1.00 34.07  ? 131  PRO B CB    1 
ATOM   2324 C  CG    . PRO B 1 114 ? -22.197 8.556   18.463  1.00 30.68  ? 131  PRO B CG    1 
ATOM   2325 C  CD    . PRO B 1 114 ? -20.693 8.808   18.541  1.00 30.00  ? 131  PRO B CD    1 
ATOM   2326 N  N     . ASN B 1 115 ? -21.068 12.668  18.450  1.00 38.62  ? 132  ASN B N     1 
ATOM   2327 C  CA    . ASN B 1 115 ? -20.974 14.114  18.618  1.00 42.22  ? 132  ASN B CA    1 
ATOM   2328 C  C     . ASN B 1 115 ? -20.020 14.836  17.642  1.00 42.49  ? 132  ASN B C     1 
ATOM   2329 O  O     . ASN B 1 115 ? -19.857 16.019  17.762  1.00 44.21  ? 132  ASN B O     1 
ATOM   2330 C  CB    . ASN B 1 115 ? -20.682 14.454  20.088  1.00 43.76  ? 132  ASN B CB    1 
ATOM   2331 C  CG    . ASN B 1 115 ? -19.262 14.106  20.518  1.00 43.72  ? 132  ASN B CG    1 
ATOM   2332 O  OD1   . ASN B 1 115 ? -18.413 13.672  19.713  1.00 42.12  ? 132  ASN B OD1   1 
ATOM   2333 N  ND2   . ASN B 1 115 ? -18.992 14.319  21.813  1.00 44.49  ? 132  ASN B ND2   1 
ATOM   2334 N  N     . GLY B 1 116 ? -19.396 14.121  16.692  1.00 40.51  ? 133  GLY B N     1 
ATOM   2335 C  CA    . GLY B 1 116 ? -18.556 14.749  15.660  1.00 40.40  ? 133  GLY B CA    1 
ATOM   2336 C  C     . GLY B 1 116 ? -17.040 14.780  15.931  1.00 37.91  ? 133  GLY B C     1 
ATOM   2337 O  O     . GLY B 1 116 ? -16.254 14.956  15.007  1.00 37.04  ? 133  GLY B O     1 
ATOM   2338 N  N     . SER B 1 117 ? -16.621 14.567  17.175  1.00 36.82  ? 134  SER B N     1 
ATOM   2339 C  CA    . SER B 1 117 ? -15.207 14.585  17.536  1.00 37.06  ? 134  SER B CA    1 
ATOM   2340 C  C     . SER B 1 117 ? -14.479 13.317  17.238  1.00 34.78  ? 134  SER B C     1 
ATOM   2341 O  O     . SER B 1 117 ? -15.103 12.263  16.978  1.00 33.61  ? 134  SER B O     1 
ATOM   2342 C  CB    . SER B 1 117 ? -15.030 14.885  19.015  1.00 39.42  ? 134  SER B CB    1 
ATOM   2343 O  OG    . SER B 1 117 ? -16.178 14.534  19.727  1.00 42.57  ? 134  SER B OG    1 
ATOM   2344 N  N     . PRO B 1 118 ? -13.124 13.409  17.235  1.00 33.91  ? 135  PRO B N     1 
ATOM   2345 C  CA    . PRO B 1 118 ? -12.278 12.287  16.920  1.00 30.84  ? 135  PRO B CA    1 
ATOM   2346 C  C     . PRO B 1 118 ? -12.432 11.084  17.868  1.00 29.83  ? 135  PRO B C     1 
ATOM   2347 O  O     . PRO B 1 118 ? -12.605 11.278  19.095  1.00 27.59  ? 135  PRO B O     1 
ATOM   2348 C  CB    . PRO B 1 118 ? -10.845 12.899  17.031  1.00 31.15  ? 135  PRO B CB    1 
ATOM   2349 C  CG    . PRO B 1 118 ? -11.006 14.334  16.781  1.00 33.22  ? 135  PRO B CG    1 
ATOM   2350 C  CD    . PRO B 1 118 ? -12.344 14.686  17.378  1.00 34.10  ? 135  PRO B CD    1 
ATOM   2351 N  N     . ILE B 1 119 ? -12.367 9.859   17.327  1.00 28.80  ? 136  ILE B N     1 
ATOM   2352 C  CA    . ILE B 1 119 ? -12.454 8.695   18.184  1.00 29.03  ? 136  ILE B CA    1 
ATOM   2353 C  C     . ILE B 1 119 ? -11.098 8.583   18.943  1.00 29.07  ? 136  ILE B C     1 
ATOM   2354 O  O     . ILE B 1 119 ? -10.062 8.867   18.367  1.00 28.03  ? 136  ILE B O     1 
ATOM   2355 C  CB    . ILE B 1 119 ? -12.819 7.402   17.411  1.00 27.67  ? 136  ILE B CB    1 
ATOM   2356 C  CG1   . ILE B 1 119 ? -11.655 6.838   16.564  1.00 26.79  ? 136  ILE B CG1   1 
ATOM   2357 C  CG2   . ILE B 1 119 ? -14.101 7.649   16.627  1.00 29.50  ? 136  ILE B CG2   1 
ATOM   2358 C  CD1   . ILE B 1 119 ? -11.864 5.410   16.063  1.00 25.31  ? 136  ILE B CD1   1 
ATOM   2359 N  N     . PRO B 1 120 ? -11.116 8.180   20.222  1.00 30.07  ? 137  PRO B N     1 
ATOM   2360 C  CA    . PRO B 1 120 ? -9.831  7.992   20.855  1.00 29.96  ? 137  PRO B CA    1 
ATOM   2361 C  C     . PRO B 1 120 ? -8.934  6.941   20.198  1.00 28.16  ? 137  PRO B C     1 
ATOM   2362 O  O     . PRO B 1 120 ? -9.408  5.840   19.724  1.00 27.23  ? 137  PRO B O     1 
ATOM   2363 C  CB    . PRO B 1 120 ? -10.204 7.612   22.275  1.00 30.28  ? 137  PRO B CB    1 
ATOM   2364 C  CG    . PRO B 1 120 ? -11.586 7.073   22.207  1.00 29.23  ? 137  PRO B CG    1 
ATOM   2365 C  CD    . PRO B 1 120 ? -12.220 7.969   21.182  1.00 29.55  ? 137  PRO B CD    1 
ATOM   2366 N  N     . ALA B 1 121 ? -7.646  7.254   20.187  1.00 29.26  ? 138  ALA B N     1 
ATOM   2367 C  CA    . ALA B 1 121 ? -6.669  6.409   19.522  1.00 28.66  ? 138  ALA B CA    1 
ATOM   2368 C  C     . ALA B 1 121 ? -5.406  6.253   20.380  1.00 29.12  ? 138  ALA B C     1 
ATOM   2369 O  O     . ALA B 1 121 ? -4.872  7.232   20.875  1.00 28.98  ? 138  ALA B O     1 
ATOM   2370 C  CB    . ALA B 1 121 ? -6.337  7.012   18.165  1.00 29.93  ? 138  ALA B CB    1 
ATOM   2371 N  N     . VAL B 1 122 ? -5.006  5.002   20.619  1.00 28.23  ? 139  VAL B N     1 
ATOM   2372 C  CA    . VAL B 1 122 ? -3.906  4.664   21.479  1.00 28.74  ? 139  VAL B CA    1 
ATOM   2373 C  C     . VAL B 1 122 ? -2.788  4.026   20.606  1.00 27.25  ? 139  VAL B C     1 
ATOM   2374 O  O     . VAL B 1 122 ? -3.025  3.185   19.760  1.00 27.16  ? 139  VAL B O     1 
ATOM   2375 C  CB    . VAL B 1 122 ? -4.366  3.757   22.618  1.00 28.97  ? 139  VAL B CB    1 
ATOM   2376 C  CG1   . VAL B 1 122 ? -3.197  3.168   23.418  1.00 29.87  ? 139  VAL B CG1   1 
ATOM   2377 C  CG2   . VAL B 1 122 ? -5.380  4.472   23.496  1.00 27.93  ? 139  VAL B CG2   1 
ATOM   2378 N  N     . LEU B 1 123 ? -1.575  4.469   20.824  1.00 28.04  ? 140  LEU B N     1 
ATOM   2379 C  CA    . LEU B 1 123 ? -0.426  4.066   20.038  1.00 27.70  ? 140  LEU B CA    1 
ATOM   2380 C  C     . LEU B 1 123 ? 0.253   2.897   20.724  1.00 28.03  ? 140  LEU B C     1 
ATOM   2381 O  O     . LEU B 1 123 ? 0.539   2.980   21.891  1.00 29.53  ? 140  LEU B O     1 
ATOM   2382 C  CB    . LEU B 1 123 ? 0.528   5.268   19.871  1.00 28.83  ? 140  LEU B CB    1 
ATOM   2383 C  CG    . LEU B 1 123 ? 1.698   5.169   18.869  1.00 28.87  ? 140  LEU B CG    1 
ATOM   2384 C  CD1   . LEU B 1 123 ? 1.226   5.081   17.424  1.00 29.22  ? 140  LEU B CD1   1 
ATOM   2385 C  CD2   . LEU B 1 123 ? 2.553   6.387   19.031  1.00 30.27  ? 140  LEU B CD2   1 
ATOM   2386 N  N     . LEU B 1 124 ? 0.451   1.784   19.995  1.00 27.51  ? 141  LEU B N     1 
ATOM   2387 C  CA    . LEU B 1 124 ? 1.141   0.606   20.509  1.00 26.92  ? 141  LEU B CA    1 
ATOM   2388 C  C     . LEU B 1 124 ? 2.469   0.420   19.768  1.00 28.49  ? 141  LEU B C     1 
ATOM   2389 O  O     . LEU B 1 124 ? 2.496   0.151   18.593  1.00 26.22  ? 141  LEU B O     1 
ATOM   2390 C  CB    . LEU B 1 124 ? 0.258   -0.658  20.334  1.00 24.95  ? 141  LEU B CB    1 
ATOM   2391 C  CG    . LEU B 1 124 ? -1.131  -0.595  21.003  1.00 24.85  ? 141  LEU B CG    1 
ATOM   2392 C  CD1   . LEU B 1 124 ? -1.849  -1.957  20.801  1.00 23.98  ? 141  LEU B CD1   1 
ATOM   2393 C  CD2   . LEU B 1 124 ? -0.996  -0.274  22.486  1.00 24.95  ? 141  LEU B CD2   1 
ATOM   2394 N  N     . ALA B 1 125 ? 3.555   0.590   20.462  1.00 27.84  ? 142  ALA B N     1 
ATOM   2395 C  CA    . ALA B 1 125 ? 4.887   0.319   19.913  1.00 31.80  ? 142  ALA B CA    1 
ATOM   2396 C  C     . ALA B 1 125 ? 5.155   -1.145  20.204  1.00 29.81  ? 142  ALA B C     1 
ATOM   2397 O  O     . ALA B 1 125 ? 5.592   -1.497  21.296  1.00 32.83  ? 142  ALA B O     1 
ATOM   2398 C  CB    . ALA B 1 125 ? 5.912   1.227   20.562  1.00 31.85  ? 142  ALA B CB    1 
ATOM   2399 N  N     . ASN B 1 126 ? 4.852   -2.002  19.229  1.00 29.17  ? 143  ASN B N     1 
ATOM   2400 C  CA    . ASN B 1 126 ? 4.868   -3.463  19.479  1.00 32.19  ? 143  ASN B CA    1 
ATOM   2401 C  C     . ASN B 1 126 ? 6.215   -4.071  19.191  1.00 35.20  ? 143  ASN B C     1 
ATOM   2402 O  O     . ASN B 1 126 ? 7.093   -3.464  18.533  1.00 35.39  ? 143  ASN B O     1 
ATOM   2403 C  CB    . ASN B 1 126 ? 3.718   -4.146  18.694  1.00 30.33  ? 143  ASN B CB    1 
ATOM   2404 C  CG    . ASN B 1 126 ? 3.437   -5.591  19.113  1.00 29.94  ? 143  ASN B CG    1 
ATOM   2405 O  OD1   . ASN B 1 126 ? 3.358   -5.925  20.300  1.00 27.09  ? 143  ASN B OD1   1 
ATOM   2406 N  ND2   . ASN B 1 126 ? 3.335   -6.475  18.110  1.00 28.55  ? 143  ASN B ND2   1 
ATOM   2407 N  N     . LYS B 1 127 ? 6.401   -5.272  19.736  1.00 36.92  ? 144  LYS B N     1 
ATOM   2408 C  CA    . LYS B 1 127 ? 7.608   -6.057  19.643  1.00 39.44  ? 144  LYS B CA    1 
ATOM   2409 C  C     . LYS B 1 127 ? 8.705   -5.519  20.549  1.00 43.19  ? 144  LYS B C     1 
ATOM   2410 O  O     . LYS B 1 127 ? 9.933   -5.677  20.269  1.00 44.13  ? 144  LYS B O     1 
ATOM   2411 C  CB    . LYS B 1 127 ? 8.073   -6.213  18.184  1.00 39.30  ? 144  LYS B CB    1 
ATOM   2412 C  CG    . LYS B 1 127 ? 6.998   -6.606  17.206  1.00 37.13  ? 144  LYS B CG    1 
ATOM   2413 C  CD    . LYS B 1 127 ? 7.567   -7.286  15.959  1.00 37.68  ? 144  LYS B CD    1 
ATOM   2414 C  CE    . LYS B 1 127 ? 6.450   -7.555  14.960  1.00 34.67  ? 144  LYS B CE    1 
ATOM   2415 N  NZ    . LYS B 1 127 ? 6.936   -7.733  13.561  1.00 35.65  ? 144  LYS B NZ    1 
ATOM   2416 N  N     . CYS B 1 128 ? 8.292   -4.953  21.687  1.00 43.13  ? 145  CYS B N     1 
ATOM   2417 C  CA    . CYS B 1 128 ? 9.251   -4.240  22.555  1.00 44.73  ? 145  CYS B CA    1 
ATOM   2418 C  C     . CYS B 1 128 ? 10.300  -5.170  23.158  1.00 46.14  ? 145  CYS B C     1 
ATOM   2419 O  O     . CYS B 1 128 ? 11.340  -4.736  23.619  1.00 47.09  ? 145  CYS B O     1 
ATOM   2420 C  CB    . CYS B 1 128 ? 8.523   -3.476  23.659  1.00 45.88  ? 145  CYS B CB    1 
ATOM   2421 S  SG    . CYS B 1 128 ? 7.736   -4.478  24.943  1.00 47.11  ? 145  CYS B SG    1 
ATOM   2422 N  N     . ASP B 1 129 ? 10.005  -6.459  23.171  1.00 46.05  ? 146  ASP B N     1 
ATOM   2423 C  CA    . ASP B 1 129 ? 11.034  -7.492  23.344  1.00 48.29  ? 146  ASP B CA    1 
ATOM   2424 C  C     . ASP B 1 129 ? 12.012  -7.448  22.147  1.00 48.68  ? 146  ASP B C     1 
ATOM   2425 O  O     . ASP B 1 129 ? 13.167  -7.782  22.277  1.00 51.85  ? 146  ASP B O     1 
ATOM   2426 C  CB    . ASP B 1 129 ? 10.325  -8.844  23.502  1.00 47.64  ? 146  ASP B CB    1 
ATOM   2427 C  CG    . ASP B 1 129 ? 9.511   -9.270  22.241  1.00 44.59  ? 146  ASP B CG    1 
ATOM   2428 O  OD1   . ASP B 1 129 ? 8.315   -8.850  21.994  1.00 42.83  ? 146  ASP B OD1   1 
ATOM   2429 O  OD2   . ASP B 1 129 ? 10.067  -10.112 21.510  1.00 44.03  ? 146  ASP B OD2   1 
ATOM   2430 N  N     . SER B 1 137 ? 13.272  7.475   21.116  1.00 68.86  ? 154  SER B N     1 
ATOM   2431 C  CA    . SER B 1 137 ? 13.165  7.344   22.552  1.00 69.35  ? 154  SER B CA    1 
ATOM   2432 C  C     . SER B 1 137 ? 11.716  7.544   23.122  1.00 67.31  ? 154  SER B C     1 
ATOM   2433 O  O     . SER B 1 137 ? 10.786  7.981   22.414  1.00 65.97  ? 154  SER B O     1 
ATOM   2434 C  CB    . SER B 1 137 ? 14.119  8.334   23.228  1.00 72.95  ? 154  SER B CB    1 
ATOM   2435 O  OG    . SER B 1 137 ? 13.499  9.600   23.380  1.00 72.22  ? 154  SER B OG    1 
ATOM   2436 N  N     . PRO B 1 138 ? 11.521  7.229   24.432  1.00 68.10  ? 155  PRO B N     1 
ATOM   2437 C  CA    . PRO B 1 138 ? 10.293  7.509   25.216  1.00 66.24  ? 155  PRO B CA    1 
ATOM   2438 C  C     . PRO B 1 138 ? 9.766   8.965   25.244  1.00 65.59  ? 155  PRO B C     1 
ATOM   2439 O  O     . PRO B 1 138 ? 8.569   9.181   24.967  1.00 63.48  ? 155  PRO B O     1 
ATOM   2440 C  CB    . PRO B 1 138 ? 10.686  7.073   26.631  1.00 68.20  ? 155  PRO B CB    1 
ATOM   2441 C  CG    . PRO B 1 138 ? 11.611  5.916   26.409  1.00 68.95  ? 155  PRO B CG    1 
ATOM   2442 C  CD    . PRO B 1 138 ? 12.357  6.224   25.136  1.00 69.68  ? 155  PRO B CD    1 
ATOM   2443 N  N     . SER B 1 139 ? 10.622  9.937   25.578  1.00 67.17  ? 156  SER B N     1 
ATOM   2444 C  CA    . SER B 1 139 ? 10.218  11.352  25.570  1.00 66.58  ? 156  SER B CA    1 
ATOM   2445 C  C     . SER B 1 139 ? 9.802   11.845  24.172  1.00 65.12  ? 156  SER B C     1 
ATOM   2446 O  O     . SER B 1 139 ? 8.854   12.653  24.061  1.00 65.82  ? 156  SER B O     1 
ATOM   2447 C  CB    . SER B 1 139 ? 11.296  12.252  26.168  1.00 69.14  ? 156  SER B CB    1 
ATOM   2448 O  OG    . SER B 1 139 ? 12.584  11.960  25.625  1.00 70.42  ? 156  SER B OG    1 
ATOM   2449 N  N     . GLN B 1 140 ? 10.425  11.312  23.107  1.00 62.22  ? 157  GLN B N     1 
ATOM   2450 C  CA    . GLN B 1 140 ? 10.011  11.671  21.728  1.00 60.14  ? 157  GLN B CA    1 
ATOM   2451 C  C     . GLN B 1 140 ? 8.607   11.142  21.391  1.00 58.48  ? 157  GLN B C     1 
ATOM   2452 O  O     . GLN B 1 140 ? 7.785   11.839  20.797  1.00 57.26  ? 157  GLN B O     1 
ATOM   2453 C  CB    . GLN B 1 140 ? 10.983  11.131  20.717  1.00 59.64  ? 157  GLN B CB    1 
ATOM   2454 C  CG    . GLN B 1 140 ? 12.324  11.816  20.801  1.00 63.59  ? 157  GLN B CG    1 
ATOM   2455 C  CD    . GLN B 1 140 ? 13.289  11.262  19.792  1.00 65.71  ? 157  GLN B CD    1 
ATOM   2456 O  OE1   . GLN B 1 140 ? 13.542  10.038  19.750  1.00 64.37  ? 157  GLN B OE1   1 
ATOM   2457 N  NE2   . GLN B 1 140 ? 13.887  12.166  18.990  1.00 69.45  ? 157  GLN B NE2   1 
ATOM   2458 N  N     . VAL B 1 141 ? 8.384   9.889   21.737  1.00 58.68  ? 158  VAL B N     1 
ATOM   2459 C  CA    . VAL B 1 141 ? 7.075   9.267   21.522  1.00 56.55  ? 158  VAL B CA    1 
ATOM   2460 C  C     . VAL B 1 141 ? 5.990   9.982   22.320  1.00 56.35  ? 158  VAL B C     1 
ATOM   2461 O  O     . VAL B 1 141 ? 4.908   10.214  21.779  1.00 54.56  ? 158  VAL B O     1 
ATOM   2462 C  CB    . VAL B 1 141 ? 7.083   7.725   21.694  1.00 53.74  ? 158  VAL B CB    1 
ATOM   2463 C  CG1   . VAL B 1 141 ? 7.963   7.058   20.640  1.00 53.39  ? 158  VAL B CG1   1 
ATOM   2464 C  CG2   . VAL B 1 141 ? 7.533   7.296   23.043  1.00 54.10  ? 158  VAL B CG2   1 
ATOM   2465 N  N     . ASP B 1 142 ? 6.264   10.336  23.575  1.00 60.15  ? 159  ASP B N     1 
ATOM   2466 C  CA    . ASP B 1 142 ? 5.320   11.146  24.369  1.00 63.01  ? 159  ASP B CA    1 
ATOM   2467 C  C     . ASP B 1 142 ? 4.937   12.428  23.601  1.00 62.99  ? 159  ASP B C     1 
ATOM   2468 O  O     . ASP B 1 142 ? 3.765   12.699  23.387  1.00 61.85  ? 159  ASP B O     1 
ATOM   2469 C  CB    . ASP B 1 142 ? 5.866   11.533  25.761  1.00 68.72  ? 159  ASP B CB    1 
ATOM   2470 C  CG    . ASP B 1 142 ? 6.147   10.327  26.695  1.00 71.01  ? 159  ASP B CG    1 
ATOM   2471 O  OD1   . ASP B 1 142 ? 5.452   9.277   26.640  1.00 70.03  ? 159  ASP B OD1   1 
ATOM   2472 O  OD2   . ASP B 1 142 ? 7.101   10.448  27.513  1.00 75.94  ? 159  ASP B OD2   1 
ATOM   2473 N  N     . GLN B 1 143 ? 5.935   13.178  23.165  1.00 63.87  ? 160  GLN B N     1 
ATOM   2474 C  CA    . GLN B 1 143 ? 5.716   14.415  22.397  1.00 63.53  ? 160  GLN B CA    1 
ATOM   2475 C  C     . GLN B 1 143 ? 4.908   14.185  21.108  1.00 57.95  ? 160  GLN B C     1 
ATOM   2476 O  O     . GLN B 1 143 ? 3.948   14.881  20.820  1.00 56.01  ? 160  GLN B O     1 
ATOM   2477 C  CB    . GLN B 1 143 ? 7.059   15.075  22.064  1.00 68.74  ? 160  GLN B CB    1 
ATOM   2478 C  CG    . GLN B 1 143 ? 6.934   16.574  21.794  1.00 73.35  ? 160  GLN B CG    1 
ATOM   2479 C  CD    . GLN B 1 143 ? 6.059   17.268  22.835  1.00 75.27  ? 160  GLN B CD    1 
ATOM   2480 O  OE1   . GLN B 1 143 ? 6.284   17.101  24.032  1.00 76.59  ? 160  GLN B OE1   1 
ATOM   2481 N  NE2   . GLN B 1 143 ? 5.018   17.991  22.388  1.00 75.46  ? 160  GLN B NE2   1 
ATOM   2482 N  N     . PHE B 1 144 ? 5.329   13.201  20.328  1.00 54.85  ? 161  PHE B N     1 
ATOM   2483 C  CA    . PHE B 1 144 ? 4.571   12.763  19.155  1.00 51.62  ? 161  PHE B CA    1 
ATOM   2484 C  C     . PHE B 1 144 ? 3.037   12.565  19.448  1.00 49.12  ? 161  PHE B C     1 
ATOM   2485 O  O     . PHE B 1 144 ? 2.228   13.072  18.701  1.00 49.78  ? 161  PHE B O     1 
ATOM   2486 C  CB    . PHE B 1 144 ? 5.239   11.508  18.603  1.00 49.50  ? 161  PHE B CB    1 
ATOM   2487 C  CG    . PHE B 1 144 ? 4.577   10.923  17.398  1.00 45.93  ? 161  PHE B CG    1 
ATOM   2488 C  CD1   . PHE B 1 144 ? 4.945   11.322  16.126  1.00 46.69  ? 161  PHE B CD1   1 
ATOM   2489 C  CD2   . PHE B 1 144 ? 3.593   9.950   17.543  1.00 40.72  ? 161  PHE B CD2   1 
ATOM   2490 C  CE1   . PHE B 1 144 ? 4.323   10.763  15.009  1.00 44.31  ? 161  PHE B CE1   1 
ATOM   2491 C  CE2   . PHE B 1 144 ? 2.953   9.398   16.450  1.00 40.10  ? 161  PHE B CE2   1 
ATOM   2492 C  CZ    . PHE B 1 144 ? 3.338   9.787   15.179  1.00 42.04  ? 161  PHE B CZ    1 
ATOM   2493 N  N     . CYS B 1 145 ? 2.664   11.869  20.528  1.00 47.66  ? 162  CYS B N     1 
ATOM   2494 C  CA    . CYS B 1 145 ? 1.233   11.666  20.865  1.00 46.96  ? 162  CYS B CA    1 
ATOM   2495 C  C     . CYS B 1 145 ? 0.460   12.949  21.081  1.00 48.87  ? 162  CYS B C     1 
ATOM   2496 O  O     . CYS B 1 145 ? -0.634  13.140  20.548  1.00 47.66  ? 162  CYS B O     1 
ATOM   2497 C  CB    . CYS B 1 145 ? 1.058   10.827  22.130  1.00 46.88  ? 162  CYS B CB    1 
ATOM   2498 S  SG    . CYS B 1 145 ? 1.602   9.175   21.867  1.00 47.23  ? 162  CYS B SG    1 
ATOM   2499 N  N     . LYS B 1 146 ? 1.053   13.848  21.835  1.00 52.51  ? 163  LYS B N     1 
ATOM   2500 C  CA    . LYS B 1 146 ? 0.425   15.160  22.037  1.00 55.15  ? 163  LYS B CA    1 
ATOM   2501 C  C     . LYS B 1 146 ? 0.258   15.858  20.705  1.00 55.22  ? 163  LYS B C     1 
ATOM   2502 O  O     . LYS B 1 146 ? -0.797  16.443  20.450  1.00 54.59  ? 163  LYS B O     1 
ATOM   2503 C  CB    . LYS B 1 146 ? 1.182   16.052  23.014  1.00 59.80  ? 163  LYS B CB    1 
ATOM   2504 C  CG    . LYS B 1 146 ? 0.912   15.720  24.466  1.00 61.96  ? 163  LYS B CG    1 
ATOM   2505 C  CD    . LYS B 1 146 ? 1.839   14.609  24.925  1.00 63.25  ? 163  LYS B CD    1 
ATOM   2506 C  CE    . LYS B 1 146 ? 1.258   13.684  25.989  1.00 63.01  ? 163  LYS B CE    1 
ATOM   2507 N  NZ    . LYS B 1 146 ? 1.978   12.363  25.957  1.00 61.86  ? 163  LYS B NZ    1 
ATOM   2508 N  N     . GLU B 1 147 ? 1.251   15.769  19.844  1.00 54.76  ? 164  GLU B N     1 
ATOM   2509 C  CA    . GLU B 1 147 ? 1.175   16.448  18.550  1.00 55.38  ? 164  GLU B CA    1 
ATOM   2510 C  C     . GLU B 1 147 ? 0.197   15.860  17.531  1.00 51.49  ? 164  GLU B C     1 
ATOM   2511 O  O     . GLU B 1 147 ? -0.218  16.562  16.602  1.00 52.53  ? 164  GLU B O     1 
ATOM   2512 C  CB    . GLU B 1 147 ? 2.539   16.483  17.918  1.00 58.37  ? 164  GLU B CB    1 
ATOM   2513 C  CG    . GLU B 1 147 ? 3.510   17.330  18.687  1.00 60.97  ? 164  GLU B CG    1 
ATOM   2514 C  CD    . GLU B 1 147 ? 4.912   17.244  18.138  1.00 64.06  ? 164  GLU B CD    1 
ATOM   2515 O  OE1   . GLU B 1 147 ? 5.089   16.682  17.033  1.00 63.84  ? 164  GLU B OE1   1 
ATOM   2516 O  OE2   . GLU B 1 147 ? 5.829   17.764  18.807  1.00 67.50  ? 164  GLU B OE2   1 
ATOM   2517 N  N     . HIS B 1 148 ? -0.119  14.570  17.663  1.00 47.61  ? 165  HIS B N     1 
ATOM   2518 C  CA    . HIS B 1 148 ? -0.857  13.906  16.619  1.00 46.07  ? 165  HIS B CA    1 
ATOM   2519 C  C     . HIS B 1 148 ? -2.203  13.334  17.095  1.00 42.47  ? 165  HIS B C     1 
ATOM   2520 O  O     . HIS B 1 148 ? -2.821  12.536  16.390  1.00 41.68  ? 165  HIS B O     1 
ATOM   2521 C  CB    . HIS B 1 148 ? 0.027   12.859  15.959  1.00 48.24  ? 165  HIS B CB    1 
ATOM   2522 C  CG    . HIS B 1 148 ? 1.215   13.455  15.274  1.00 53.73  ? 165  HIS B CG    1 
ATOM   2523 N  ND1   . HIS B 1 148 ? 1.113   14.200  14.120  1.00 56.02  ? 165  HIS B ND1   1 
ATOM   2524 C  CD2   . HIS B 1 148 ? 2.524   13.466  15.605  1.00 56.06  ? 165  HIS B CD2   1 
ATOM   2525 C  CE1   . HIS B 1 148 ? 2.305   14.631  13.761  1.00 58.53  ? 165  HIS B CE1   1 
ATOM   2526 N  NE2   . HIS B 1 148 ? 3.183   14.203  14.649  1.00 58.55  ? 165  HIS B NE2   1 
ATOM   2527 N  N     . GLY B 1 149 ? -2.648  13.734  18.290  1.00 40.73  ? 166  GLY B N     1 
ATOM   2528 C  CA    . GLY B 1 149 ? -3.995  13.399  18.747  1.00 37.53  ? 166  GLY B CA    1 
ATOM   2529 C  C     . GLY B 1 149 ? -4.198  11.969  19.193  1.00 34.60  ? 166  GLY B C     1 
ATOM   2530 O  O     . GLY B 1 149 ? -5.279  11.433  18.993  1.00 32.24  ? 166  GLY B O     1 
ATOM   2531 N  N     . PHE B 1 150 ? -3.152  11.369  19.781  1.00 33.47  ? 167  PHE B N     1 
ATOM   2532 C  CA    . PHE B 1 150 ? -3.234  10.088  20.449  1.00 32.12  ? 167  PHE B CA    1 
ATOM   2533 C  C     . PHE B 1 150 ? -3.505  10.284  21.908  1.00 32.05  ? 167  PHE B C     1 
ATOM   2534 O  O     . PHE B 1 150 ? -2.918  11.139  22.507  1.00 33.19  ? 167  PHE B O     1 
ATOM   2535 C  CB    . PHE B 1 150 ? -1.936  9.292   20.284  1.00 31.97  ? 167  PHE B CB    1 
ATOM   2536 C  CG    . PHE B 1 150 ? -1.775  8.774   18.901  1.00 31.52  ? 167  PHE B CG    1 
ATOM   2537 C  CD1   . PHE B 1 150 ? -2.344  7.582   18.555  1.00 30.81  ? 167  PHE B CD1   1 
ATOM   2538 C  CD2   . PHE B 1 150 ? -1.131  9.504   17.928  1.00 32.73  ? 167  PHE B CD2   1 
ATOM   2539 C  CE1   . PHE B 1 150 ? -2.204  7.071   17.264  1.00 31.40  ? 167  PHE B CE1   1 
ATOM   2540 C  CE2   . PHE B 1 150 ? -1.044  9.046   16.627  1.00 32.42  ? 167  PHE B CE2   1 
ATOM   2541 C  CZ    . PHE B 1 150 ? -1.533  7.820   16.304  1.00 31.85  ? 167  PHE B CZ    1 
ATOM   2542 N  N     . ALA B 1 151 ? -4.426  9.482   22.457  1.00 32.71  ? 168  ALA B N     1 
ATOM   2543 C  CA    . ALA B 1 151 ? -4.786  9.571   23.887  1.00 33.26  ? 168  ALA B CA    1 
ATOM   2544 C  C     . ALA B 1 151 ? -3.653  9.082   24.794  1.00 32.00  ? 168  ALA B C     1 
ATOM   2545 O  O     . ALA B 1 151 ? -3.578  9.496   25.940  1.00 33.08  ? 168  ALA B O     1 
ATOM   2546 C  CB    . ALA B 1 151 ? -6.071  8.825   24.176  1.00 32.33  ? 168  ALA B CB    1 
ATOM   2547 N  N     . GLY B 1 152 ? -2.789  8.225   24.257  1.00 30.95  ? 169  GLY B N     1 
ATOM   2548 C  CA    . GLY B 1 152 ? -1.618  7.689   24.972  1.00 32.34  ? 169  GLY B CA    1 
ATOM   2549 C  C     . GLY B 1 152 ? -0.829  6.692   24.131  1.00 31.99  ? 169  GLY B C     1 
ATOM   2550 O  O     . GLY B 1 152 ? -1.162  6.489   22.958  1.00 30.37  ? 169  GLY B O     1 
ATOM   2551 N  N     . TRP B 1 153 ? 0.207   6.087   24.724  1.00 33.47  ? 170  TRP B N     1 
ATOM   2552 C  CA    . TRP B 1 153 ? 0.987   5.069   24.073  1.00 34.01  ? 170  TRP B CA    1 
ATOM   2553 C  C     . TRP B 1 153 ? 1.647   4.089   25.050  1.00 33.50  ? 170  TRP B C     1 
ATOM   2554 O  O     . TRP B 1 153 ? 1.970   4.402   26.152  1.00 35.14  ? 170  TRP B O     1 
ATOM   2555 C  CB    . TRP B 1 153 ? 2.063   5.653   23.207  1.00 37.15  ? 170  TRP B CB    1 
ATOM   2556 C  CG    . TRP B 1 153 ? 3.177   6.215   24.012  1.00 41.00  ? 170  TRP B CG    1 
ATOM   2557 C  CD1   . TRP B 1 153 ? 3.159   7.376   24.692  1.00 43.09  ? 170  TRP B CD1   1 
ATOM   2558 C  CD2   . TRP B 1 153 ? 4.423   5.586   24.318  1.00 43.94  ? 170  TRP B CD2   1 
ATOM   2559 N  NE1   . TRP B 1 153 ? 4.369   7.576   25.342  1.00 45.83  ? 170  TRP B NE1   1 
ATOM   2560 C  CE2   . TRP B 1 153 ? 5.148   6.471   25.145  1.00 46.23  ? 170  TRP B CE2   1 
ATOM   2561 C  CE3   . TRP B 1 153 ? 5.021   4.367   23.936  1.00 43.93  ? 170  TRP B CE3   1 
ATOM   2562 C  CZ2   . TRP B 1 153 ? 6.422   6.165   25.636  1.00 49.05  ? 170  TRP B CZ2   1 
ATOM   2563 C  CZ3   . TRP B 1 153 ? 6.249   4.072   24.382  1.00 45.93  ? 170  TRP B CZ3   1 
ATOM   2564 C  CH2   . TRP B 1 153 ? 6.978   4.967   25.227  1.00 48.87  ? 170  TRP B CH2   1 
ATOM   2565 N  N     . PHE B 1 154 ? 1.849   2.883   24.571  1.00 32.93  ? 171  PHE B N     1 
ATOM   2566 C  CA    . PHE B 1 154 ? 2.403   1.788   25.359  1.00 33.58  ? 171  PHE B CA    1 
ATOM   2567 C  C     . PHE B 1 154 ? 3.364   1.031   24.459  1.00 34.66  ? 171  PHE B C     1 
ATOM   2568 O  O     . PHE B 1 154 ? 3.089   0.826   23.264  1.00 31.27  ? 171  PHE B O     1 
ATOM   2569 C  CB    . PHE B 1 154 ? 1.301   0.786   25.707  1.00 32.75  ? 171  PHE B CB    1 
ATOM   2570 C  CG    . PHE B 1 154 ? 0.228   1.316   26.598  1.00 33.61  ? 171  PHE B CG    1 
ATOM   2571 C  CD1   . PHE B 1 154 ? -0.811  2.086   26.098  1.00 33.50  ? 171  PHE B CD1   1 
ATOM   2572 C  CD2   . PHE B 1 154 ? 0.279   1.049   27.968  1.00 34.66  ? 171  PHE B CD2   1 
ATOM   2573 C  CE1   . PHE B 1 154 ? -1.747  2.622   26.941  1.00 33.93  ? 171  PHE B CE1   1 
ATOM   2574 C  CE2   . PHE B 1 154 ? -0.684  1.520   28.820  1.00 34.91  ? 171  PHE B CE2   1 
ATOM   2575 C  CZ    . PHE B 1 154 ? -1.684  2.333   28.311  1.00 35.12  ? 171  PHE B CZ    1 
ATOM   2576 N  N     . GLU B 1 155 ? 4.448   0.542   25.059  1.00 37.67  ? 172  GLU B N     1 
ATOM   2577 C  CA    . GLU B 1 155 ? 5.269   -0.474  24.473  1.00 40.15  ? 172  GLU B CA    1 
ATOM   2578 C  C     . GLU B 1 155 ? 4.618   -1.770  24.789  1.00 38.77  ? 172  GLU B C     1 
ATOM   2579 O  O     . GLU B 1 155 ? 4.276   -2.010  25.951  1.00 39.76  ? 172  GLU B O     1 
ATOM   2580 C  CB    . GLU B 1 155 ? 6.627   -0.517  25.134  1.00 45.13  ? 172  GLU B CB    1 
ATOM   2581 C  CG    . GLU B 1 155 ? 7.439   0.726   24.970  1.00 49.39  ? 172  GLU B CG    1 
ATOM   2582 C  CD    . GLU B 1 155 ? 8.911   0.491   25.298  1.00 55.59  ? 172  GLU B CD    1 
ATOM   2583 O  OE1   . GLU B 1 155 ? 9.236   -0.519  26.018  1.00 57.67  ? 172  GLU B OE1   1 
ATOM   2584 O  OE2   . GLU B 1 155 ? 9.743   1.312   24.836  1.00 58.81  ? 172  GLU B OE2   1 
ATOM   2585 N  N     . THR B 1 156 ? 4.470   -2.615  23.770  1.00 36.25  ? 173  THR B N     1 
ATOM   2586 C  CA    . THR B 1 156 ? 3.810   -3.914  23.929  1.00 32.62  ? 173  THR B CA    1 
ATOM   2587 C  C     . THR B 1 156 ? 4.620   -5.042  23.383  1.00 32.57  ? 173  THR B C     1 
ATOM   2588 O  O     . THR B 1 156 ? 5.394   -4.854  22.457  1.00 33.82  ? 173  THR B O     1 
ATOM   2589 C  CB    . THR B 1 156 ? 2.436   -3.988  23.206  1.00 29.06  ? 173  THR B CB    1 
ATOM   2590 O  OG1   . THR B 1 156 ? 2.572   -3.709  21.793  1.00 28.94  ? 173  THR B OG1   1 
ATOM   2591 C  CG2   . THR B 1 156 ? 1.528   -2.987  23.783  1.00 27.53  ? 173  THR B CG2   1 
ATOM   2592 N  N     . SER B 1 157 ? 4.381   -6.221  23.961  1.00 31.84  ? 174  SER B N     1 
ATOM   2593 C  CA    . SER B 1 157 ? 4.798   -7.429  23.353  1.00 31.13  ? 174  SER B CA    1 
ATOM   2594 C  C     . SER B 1 157 ? 3.644   -8.420  23.341  1.00 30.53  ? 174  SER B C     1 
ATOM   2595 O  O     . SER B 1 157 ? 3.238   -8.929  24.394  1.00 30.63  ? 174  SER B O     1 
ATOM   2596 C  CB    . SER B 1 157 ? 6.005   -8.021  24.094  1.00 33.24  ? 174  SER B CB    1 
ATOM   2597 O  OG    . SER B 1 157 ? 6.367   -9.304  23.623  1.00 34.60  ? 174  SER B OG    1 
ATOM   2598 N  N     . ALA B 1 158 ? 3.201   -8.790  22.139  1.00 29.82  ? 175  ALA B N     1 
ATOM   2599 C  CA    . ALA B 1 158 ? 2.315   -9.930  22.032  1.00 30.30  ? 175  ALA B CA    1 
ATOM   2600 C  C     . ALA B 1 158 ? 2.998   -11.253 22.380  1.00 31.42  ? 175  ALA B C     1 
ATOM   2601 O  O     . ALA B 1 158 ? 2.365   -12.175 22.924  1.00 31.01  ? 175  ALA B O     1 
ATOM   2602 C  CB    . ALA B 1 158 ? 1.656   -9.964  20.661  1.00 29.60  ? 175  ALA B CB    1 
ATOM   2603 N  N     . LYS B 1 159 ? 4.309   -11.329 22.123  1.00 34.24  ? 176  LYS B N     1 
ATOM   2604 C  CA    . LYS B 1 159 ? 5.092   -12.510 22.412  1.00 35.48  ? 176  LYS B CA    1 
ATOM   2605 C  C     . LYS B 1 159 ? 5.164   -12.821 23.902  1.00 38.18  ? 176  LYS B C     1 
ATOM   2606 O  O     . LYS B 1 159 ? 4.804   -13.937 24.352  1.00 37.13  ? 176  LYS B O     1 
ATOM   2607 C  CB    . LYS B 1 159 ? 6.507   -12.311 21.844  1.00 37.98  ? 176  LYS B CB    1 
ATOM   2608 C  CG    . LYS B 1 159 ? 7.362   -13.538 21.939  1.00 40.50  ? 176  LYS B CG    1 
ATOM   2609 C  CD    . LYS B 1 159 ? 8.705   -13.323 21.312  1.00 44.58  ? 176  LYS B CD    1 
ATOM   2610 C  CE    . LYS B 1 159 ? 9.595   -14.499 21.646  1.00 47.78  ? 176  LYS B CE    1 
ATOM   2611 N  NZ    . LYS B 1 159 ? 10.823  -14.429 20.812  1.00 51.15  ? 176  LYS B NZ    1 
ATOM   2612 N  N     . ASP B 1 160 ? 5.617   -11.825 24.667  1.00 39.86  ? 177  ASP B N     1 
ATOM   2613 C  CA    . ASP B 1 160 ? 5.778   -11.930 26.125  1.00 42.98  ? 177  ASP B CA    1 
ATOM   2614 C  C     . ASP B 1 160 ? 4.613   -11.396 26.951  1.00 40.55  ? 177  ASP B C     1 
ATOM   2615 O  O     . ASP B 1 160 ? 4.720   -11.271 28.164  1.00 43.20  ? 177  ASP B O     1 
ATOM   2616 C  CB    . ASP B 1 160 ? 7.066   -11.213 26.528  1.00 46.30  ? 177  ASP B CB    1 
ATOM   2617 C  CG    . ASP B 1 160 ? 8.291   -11.907 26.013  1.00 49.41  ? 177  ASP B CG    1 
ATOM   2618 O  OD1   . ASP B 1 160 ? 8.188   -13.157 25.789  1.00 51.46  ? 177  ASP B OD1   1 
ATOM   2619 O  OD2   . ASP B 1 160 ? 9.373   -11.245 25.892  1.00 53.06  ? 177  ASP B OD2   1 
ATOM   2620 N  N     . ASN B 1 161 ? 3.491   -11.108 26.299  1.00 36.95  ? 178  ASN B N     1 
ATOM   2621 C  CA    . ASN B 1 161 ? 2.338   -10.559 26.974  1.00 35.85  ? 178  ASN B CA    1 
ATOM   2622 C  C     . ASN B 1 161 ? 2.624   -9.331  27.880  1.00 35.80  ? 178  ASN B C     1 
ATOM   2623 O  O     . ASN B 1 161 ? 2.352   -9.340  29.075  1.00 36.38  ? 178  ASN B O     1 
ATOM   2624 C  CB    . ASN B 1 161 ? 1.611   -11.636 27.770  1.00 37.29  ? 178  ASN B CB    1 
ATOM   2625 C  CG    . ASN B 1 161 ? 0.203   -11.209 28.109  1.00 36.73  ? 178  ASN B CG    1 
ATOM   2626 O  OD1   . ASN B 1 161 ? -0.341  -10.390 27.434  1.00 36.22  ? 178  ASN B OD1   1 
ATOM   2627 N  ND2   . ASN B 1 161 ? -0.377  -11.769 29.105  1.00 38.66  ? 178  ASN B ND2   1 
ATOM   2628 N  N     . ILE B 1 162 ? 3.173   -8.277  27.299  1.00 35.46  ? 179  ILE B N     1 
ATOM   2629 C  CA    . ILE B 1 162 ? 3.631   -7.124  28.080  1.00 34.29  ? 179  ILE B CA    1 
ATOM   2630 C  C     . ILE B 1 162 ? 2.694   -6.002  27.694  1.00 32.52  ? 179  ILE B C     1 
ATOM   2631 O  O     . ILE B 1 162 ? 2.540   -5.722  26.507  1.00 32.09  ? 179  ILE B O     1 
ATOM   2632 C  CB    . ILE B 1 162 ? 5.045   -6.700  27.704  1.00 34.24  ? 179  ILE B CB    1 
ATOM   2633 C  CG1   . ILE B 1 162 ? 6.033   -7.785  28.124  1.00 36.82  ? 179  ILE B CG1   1 
ATOM   2634 C  CG2   . ILE B 1 162 ? 5.398   -5.331  28.315  1.00 33.65  ? 179  ILE B CG2   1 
ATOM   2635 C  CD1   . ILE B 1 162 ? 7.490   -7.392  27.899  1.00 38.69  ? 179  ILE B CD1   1 
ATOM   2636 N  N     . ASN B 1 163 ? 2.083   -5.397  28.718  1.00 32.82  ? 180  ASN B N     1 
ATOM   2637 C  CA    . ASN B 1 163 ? 1.209   -4.229  28.627  1.00 32.96  ? 180  ASN B CA    1 
ATOM   2638 C  C     . ASN B 1 163 ? -0.027  -4.323  27.712  1.00 33.39  ? 180  ASN B C     1 
ATOM   2639 O  O     . ASN B 1 163 ? -0.644  -3.320  27.454  1.00 34.27  ? 180  ASN B O     1 
ATOM   2640 C  CB    . ASN B 1 163 ? 2.031   -2.994  28.231  1.00 33.46  ? 180  ASN B CB    1 
ATOM   2641 C  CG    . ASN B 1 163 ? 3.054   -2.586  29.286  1.00 34.67  ? 180  ASN B CG    1 
ATOM   2642 O  OD1   . ASN B 1 163 ? 2.990   -2.938  30.493  1.00 35.96  ? 180  ASN B OD1   1 
ATOM   2643 N  ND2   . ASN B 1 163 ? 4.047   -1.888  28.816  1.00 35.32  ? 180  ASN B ND2   1 
ATOM   2644 N  N     . ILE B 1 164 ? -0.378  -5.500  27.197  1.00 33.87  ? 181  ILE B N     1 
ATOM   2645 C  CA    . ILE B 1 164 ? -1.530  -5.613  26.339  1.00 34.63  ? 181  ILE B CA    1 
ATOM   2646 C  C     . ILE B 1 164 ? -2.840  -5.406  27.108  1.00 33.72  ? 181  ILE B C     1 
ATOM   2647 O  O     . ILE B 1 164 ? -3.678  -4.615  26.679  1.00 32.33  ? 181  ILE B O     1 
ATOM   2648 C  CB    . ILE B 1 164 ? -1.471  -6.884  25.467  1.00 36.24  ? 181  ILE B CB    1 
ATOM   2649 C  CG1   . ILE B 1 164 ? -0.430  -6.623  24.359  1.00 36.68  ? 181  ILE B CG1   1 
ATOM   2650 C  CG2   . ILE B 1 164 ? -2.833  -7.191  24.847  1.00 35.39  ? 181  ILE B CG2   1 
ATOM   2651 C  CD1   . ILE B 1 164 ? 0.158   -7.841  23.791  1.00 36.57  ? 181  ILE B CD1   1 
ATOM   2652 N  N     . GLU B 1 165 ? -2.929  -5.998  28.284  1.00 34.31  ? 182  GLU B N     1 
ATOM   2653 C  CA    . GLU B 1 165 ? -4.075  -5.820  29.203  1.00 36.79  ? 182  GLU B CA    1 
ATOM   2654 C  C     . GLU B 1 165 ? -4.264  -4.367  29.650  1.00 34.02  ? 182  GLU B C     1 
ATOM   2655 O  O     . GLU B 1 165 ? -5.386  -3.847  29.616  1.00 32.40  ? 182  GLU B O     1 
ATOM   2656 C  CB    . GLU B 1 165 ? -3.873  -6.686  30.458  1.00 44.35  ? 182  GLU B CB    1 
ATOM   2657 C  CG    . GLU B 1 165 ? -3.725  -8.187  30.194  1.00 49.61  ? 182  GLU B CG    1 
ATOM   2658 C  CD    . GLU B 1 165 ? -5.057  -8.855  29.874  1.00 53.55  ? 182  GLU B CD    1 
ATOM   2659 O  OE1   . GLU B 1 165 ? -6.036  -8.592  30.604  1.00 56.91  ? 182  GLU B OE1   1 
ATOM   2660 O  OE2   . GLU B 1 165 ? -5.105  -9.652  28.916  1.00 56.23  ? 182  GLU B OE2   1 
ATOM   2661 N  N     . GLU B 1 166 ? -3.163  -3.746  30.078  1.00 32.79  ? 183  GLU B N     1 
ATOM   2662 C  CA    . GLU B 1 166 ? -3.126  -2.313  30.449  1.00 31.72  ? 183  GLU B CA    1 
ATOM   2663 C  C     . GLU B 1 166 ? -3.547  -1.431  29.291  1.00 29.40  ? 183  GLU B C     1 
ATOM   2664 O  O     . GLU B 1 166 ? -4.360  -0.514  29.466  1.00 29.74  ? 183  GLU B O     1 
ATOM   2665 C  CB    . GLU B 1 166 ? -1.709  -1.895  30.878  1.00 34.75  ? 183  GLU B CB    1 
ATOM   2666 C  CG    . GLU B 1 166 ? -1.284  -2.475  32.205  1.00 37.71  ? 183  GLU B CG    1 
ATOM   2667 C  CD    . GLU B 1 166 ? -0.767  -3.932  32.156  1.00 38.36  ? 183  GLU B CD    1 
ATOM   2668 O  OE1   . GLU B 1 166 ? -0.873  -4.654  31.155  1.00 36.71  ? 183  GLU B OE1   1 
ATOM   2669 O  OE2   . GLU B 1 166 ? -0.218  -4.373  33.173  1.00 40.64  ? 183  GLU B OE2   1 
ATOM   2670 N  N     . ALA B 1 167 ? -2.993  -1.697  28.095  1.00 27.27  ? 184  ALA B N     1 
ATOM   2671 C  CA    . ALA B 1 167 ? -3.325  -0.915  26.914  1.00 25.11  ? 184  ALA B CA    1 
ATOM   2672 C  C     . ALA B 1 167 ? -4.807  -0.984  26.577  1.00 25.62  ? 184  ALA B C     1 
ATOM   2673 O  O     . ALA B 1 167 ? -5.455  0.061   26.315  1.00 25.04  ? 184  ALA B O     1 
ATOM   2674 C  CB    . ALA B 1 167 ? -2.477  -1.331  25.730  1.00 24.36  ? 184  ALA B CB    1 
ATOM   2675 N  N     . ALA B 1 168 ? -5.365  -2.203  26.563  1.00 25.48  ? 185  ALA B N     1 
ATOM   2676 C  CA    . ALA B 1 168 ? -6.802  -2.361  26.393  1.00 24.29  ? 185  ALA B CA    1 
ATOM   2677 C  C     . ALA B 1 168 ? -7.665  -1.616  27.432  1.00 25.13  ? 185  ALA B C     1 
ATOM   2678 O  O     . ALA B 1 168 ? -8.672  -1.022  27.077  1.00 26.21  ? 185  ALA B O     1 
ATOM   2679 C  CB    . ALA B 1 168 ? -7.192  -3.856  26.367  1.00 23.94  ? 185  ALA B CB    1 
ATOM   2680 N  N     . ARG B 1 169 ? -7.307  -1.727  28.710  1.00 25.84  ? 186  ARG B N     1 
ATOM   2681 C  CA    . ARG B 1 169 ? -8.055  -1.102  29.747  1.00 25.55  ? 186  ARG B CA    1 
ATOM   2682 C  C     . ARG B 1 169 ? -7.999  0.440   29.592  1.00 26.12  ? 186  ARG B C     1 
ATOM   2683 O  O     . ARG B 1 169 ? -9.019  1.105   29.823  1.00 27.00  ? 186  ARG B O     1 
ATOM   2684 C  CB    . ARG B 1 169 ? -7.617  -1.465  31.168  1.00 28.05  ? 186  ARG B CB    1 
ATOM   2685 C  CG    . ARG B 1 169 ? -8.064  -2.846  31.709  1.00 29.86  ? 186  ARG B CG    1 
ATOM   2686 C  CD    . ARG B 1 169 ? -7.938  -2.904  33.227  1.00 32.09  ? 186  ARG B CD    1 
ATOM   2687 N  NE    . ARG B 1 169 ? -8.940  -2.061  33.952  1.00 33.80  ? 186  ARG B NE    1 
ATOM   2688 C  CZ    . ARG B 1 169 ? -10.153 -2.483  34.332  1.00 33.34  ? 186  ARG B CZ    1 
ATOM   2689 N  NH1   . ARG B 1 169 ? -10.493 -3.749  34.153  1.00 32.65  ? 186  ARG B NH1   1 
ATOM   2690 N  NH2   . ARG B 1 169 ? -10.973 -1.694  35.039  1.00 32.84  ? 186  ARG B NH2   1 
ATOM   2691 N  N     . PHE B 1 170 ? -6.846  0.954   29.226  1.00 25.59  ? 187  PHE B N     1 
ATOM   2692 C  CA    . PHE B 1 170 ? -6.645  2.379   28.957  1.00 27.86  ? 187  PHE B CA    1 
ATOM   2693 C  C     . PHE B 1 170 ? -7.514  2.903   27.830  1.00 27.50  ? 187  PHE B C     1 
ATOM   2694 O  O     . PHE B 1 170 ? -8.137  3.949   27.965  1.00 29.30  ? 187  PHE B O     1 
ATOM   2695 C  CB    . PHE B 1 170 ? -5.169  2.667   28.669  1.00 29.88  ? 187  PHE B CB    1 
ATOM   2696 C  CG    . PHE B 1 170 ? -4.855  4.133   28.482  1.00 35.00  ? 187  PHE B CG    1 
ATOM   2697 C  CD1   . PHE B 1 170 ? -4.963  4.742   27.234  1.00 36.25  ? 187  PHE B CD1   1 
ATOM   2698 C  CD2   . PHE B 1 170 ? -4.397  4.907   29.556  1.00 37.75  ? 187  PHE B CD2   1 
ATOM   2699 C  CE1   . PHE B 1 170 ? -4.651  6.109   27.081  1.00 37.75  ? 187  PHE B CE1   1 
ATOM   2700 C  CE2   . PHE B 1 170 ? -4.076  6.238   29.397  1.00 40.17  ? 187  PHE B CE2   1 
ATOM   2701 C  CZ    . PHE B 1 170 ? -4.203  6.845   28.161  1.00 39.34  ? 187  PHE B CZ    1 
ATOM   2702 N  N     . LEU B 1 171 ? -7.635  2.162   26.748  1.00 25.33  ? 188  LEU B N     1 
ATOM   2703 C  CA    . LEU B 1 171 ? -8.491  2.605   25.686  1.00 26.28  ? 188  LEU B CA    1 
ATOM   2704 C  C     . LEU B 1 171 ? -9.972  2.550   26.066  1.00 26.79  ? 188  LEU B C     1 
ATOM   2705 O  O     . LEU B 1 171 ? -10.739 3.452   25.707  1.00 27.14  ? 188  LEU B O     1 
ATOM   2706 C  CB    . LEU B 1 171 ? -8.227  1.838   24.408  1.00 25.06  ? 188  LEU B CB    1 
ATOM   2707 C  CG    . LEU B 1 171 ? -9.089  2.267   23.197  1.00 25.53  ? 188  LEU B CG    1 
ATOM   2708 C  CD1   . LEU B 1 171 ? -8.901  3.727   22.791  1.00 24.77  ? 188  LEU B CD1   1 
ATOM   2709 C  CD2   . LEU B 1 171 ? -8.694  1.354   22.062  1.00 26.19  ? 188  LEU B CD2   1 
ATOM   2710 N  N     . VAL B 1 172 ? -10.356 1.499   26.785  1.00 27.28  ? 189  VAL B N     1 
ATOM   2711 C  CA    . VAL B 1 172 ? -11.726 1.328   27.256  1.00 28.03  ? 189  VAL B CA    1 
ATOM   2712 C  C     . VAL B 1 172 ? -12.109 2.431   28.216  1.00 30.56  ? 189  VAL B C     1 
ATOM   2713 O  O     . VAL B 1 172 ? -13.257 2.926   28.173  1.00 28.96  ? 189  VAL B O     1 
ATOM   2714 C  CB    . VAL B 1 172 ? -11.944 -0.030  27.916  1.00 27.67  ? 189  VAL B CB    1 
ATOM   2715 C  CG1   . VAL B 1 172 ? -13.310 -0.115  28.553  1.00 28.91  ? 189  VAL B CG1   1 
ATOM   2716 C  CG2   . VAL B 1 172 ? -11.724 -1.142  26.906  1.00 26.16  ? 189  VAL B CG2   1 
ATOM   2717 N  N     . GLU B 1 173 ? -11.172 2.803   29.082  1.00 33.69  ? 190  GLU B N     1 
ATOM   2718 C  CA    . GLU B 1 173 ? -11.329 3.948   29.929  1.00 39.82  ? 190  GLU B CA    1 
ATOM   2719 C  C     . GLU B 1 173 ? -11.688 5.217   29.150  1.00 35.84  ? 190  GLU B C     1 
ATOM   2720 O  O     . GLU B 1 173 ? -12.690 5.835   29.470  1.00 37.76  ? 190  GLU B O     1 
ATOM   2721 C  CB    . GLU B 1 173 ? -10.062 4.206   30.733  1.00 48.59  ? 190  GLU B CB    1 
ATOM   2722 C  CG    . GLU B 1 173 ? -10.256 5.048   31.955  1.00 56.38  ? 190  GLU B CG    1 
ATOM   2723 C  CD    . GLU B 1 173 ? -9.123  4.749   33.002  1.00 65.67  ? 190  GLU B CD    1 
ATOM   2724 O  OE1   . GLU B 1 173 ? -8.074  5.401   32.829  1.00 70.60  ? 190  GLU B OE1   1 
ATOM   2725 O  OE2   . GLU B 1 173 ? -9.243  3.852   33.943  1.00 71.09  ? 190  GLU B OE2   1 
ATOM   2726 N  N     . LYS B 1 174 ? -10.940 5.527   28.101  1.00 30.91  ? 191  LYS B N     1 
ATOM   2727 C  CA    . LYS B 1 174 ? -11.284 6.655   27.204  1.00 32.75  ? 191  LYS B CA    1 
ATOM   2728 C  C     . LYS B 1 174 ? -12.628 6.526   26.526  1.00 30.78  ? 191  LYS B C     1 
ATOM   2729 O  O     . LYS B 1 174 ? -13.357 7.490   26.432  1.00 31.69  ? 191  LYS B O     1 
ATOM   2730 C  CB    . LYS B 1 174 ? -10.242 6.885   26.092  1.00 34.89  ? 191  LYS B CB    1 
ATOM   2731 C  CG    . LYS B 1 174 ? -8.811  7.090   26.530  1.00 39.63  ? 191  LYS B CG    1 
ATOM   2732 C  CD    . LYS B 1 174 ? -8.639  8.488   27.094  1.00 46.00  ? 191  LYS B CD    1 
ATOM   2733 C  CE    . LYS B 1 174 ? -7.588  8.529   28.184  1.00 49.64  ? 191  LYS B CE    1 
ATOM   2734 N  NZ    . LYS B 1 174 ? -7.833  7.479   29.245  1.00 51.05  ? 191  LYS B NZ    1 
ATOM   2735 N  N     . ILE B 1 175 ? -12.987 5.324   26.073  1.00 28.65  ? 192  ILE B N     1 
ATOM   2736 C  CA    . ILE B 1 175 ? -14.306 5.109   25.437  1.00 27.69  ? 192  ILE B CA    1 
ATOM   2737 C  C     . ILE B 1 175 ? -15.430 5.367   26.434  1.00 30.49  ? 192  ILE B C     1 
ATOM   2738 O  O     . ILE B 1 175 ? -16.480 6.037   26.119  1.00 33.52  ? 192  ILE B O     1 
ATOM   2739 C  CB    . ILE B 1 175 ? -14.411 3.719   24.765  1.00 24.98  ? 192  ILE B CB    1 
ATOM   2740 C  CG1   . ILE B 1 175 ? -13.335 3.564   23.666  1.00 21.35  ? 192  ILE B CG1   1 
ATOM   2741 C  CG2   . ILE B 1 175 ? -15.789 3.527   24.150  1.00 25.18  ? 192  ILE B CG2   1 
ATOM   2742 C  CD1   . ILE B 1 175 ? -13.140 2.222   23.015  1.00 20.75  ? 192  ILE B CD1   1 
ATOM   2743 N  N     . LEU B 1 176 ? -15.258 4.858   27.649  1.00 33.14  ? 193  LEU B N     1 
ATOM   2744 C  CA    . LEU B 1 176 ? -16.282 5.032   28.678  1.00 37.81  ? 193  LEU B CA    1 
ATOM   2745 C  C     . LEU B 1 176 ? -16.495 6.478   29.093  1.00 41.76  ? 193  LEU B C     1 
ATOM   2746 O  O     . LEU B 1 176 ? -17.631 6.880   29.354  1.00 44.00  ? 193  LEU B O     1 
ATOM   2747 C  CB    . LEU B 1 176 ? -15.972 4.199   29.921  1.00 38.29  ? 193  LEU B CB    1 
ATOM   2748 C  CG    . LEU B 1 176 ? -16.135 2.696   29.740  1.00 37.92  ? 193  LEU B CG    1 
ATOM   2749 C  CD1   . LEU B 1 176 ? -15.378 2.026   30.885  1.00 37.95  ? 193  LEU B CD1   1 
ATOM   2750 C  CD2   . LEU B 1 176 ? -17.604 2.258   29.651  1.00 38.17  ? 193  LEU B CD2   1 
ATOM   2751 N  N     . VAL B 1 177 ? -15.435 7.274   29.156  1.00 42.95  ? 194  VAL B N     1 
ATOM   2752 C  CA    . VAL B 1 177 ? -15.614 8.687   29.514  1.00 46.26  ? 194  VAL B CA    1 
ATOM   2753 C  C     . VAL B 1 177 ? -16.428 9.405   28.450  1.00 49.58  ? 194  VAL B C     1 
ATOM   2754 O  O     . VAL B 1 177 ? -17.323 10.187  28.783  1.00 51.97  ? 194  VAL B O     1 
ATOM   2755 C  CB    . VAL B 1 177 ? -14.294 9.422   29.914  1.00 45.46  ? 194  VAL B CB    1 
ATOM   2756 C  CG1   . VAL B 1 177 ? -13.525 8.605   30.953  1.00 45.10  ? 194  VAL B CG1   1 
ATOM   2757 C  CG2   . VAL B 1 177 ? -13.404 9.813   28.747  1.00 43.29  ? 194  VAL B CG2   1 
ATOM   2758 N  N     . ASN B 1 178 ? -16.154 9.099   27.186  1.00 50.77  ? 195  ASN B N     1 
ATOM   2759 C  CA    . ASN B 1 178 ? -16.883 9.660   26.045  1.00 54.84  ? 195  ASN B CA    1 
ATOM   2760 C  C     . ASN B 1 178 ? -18.315 9.191   26.000  1.00 60.94  ? 195  ASN B C     1 
ATOM   2761 O  O     . ASN B 1 178 ? -19.188 9.921   25.561  1.00 62.92  ? 195  ASN B O     1 
ATOM   2762 C  CB    . ASN B 1 178 ? -16.237 9.286   24.723  1.00 51.85  ? 195  ASN B CB    1 
ATOM   2763 C  CG    . ASN B 1 178 ? -14.844 9.878   24.560  1.00 51.15  ? 195  ASN B CG    1 
ATOM   2764 O  OD1   . ASN B 1 178 ? -14.432 10.749  25.316  1.00 53.13  ? 195  ASN B OD1   1 
ATOM   2765 N  ND2   . ASN B 1 178 ? -14.136 9.423   23.573  1.00 48.81  ? 195  ASN B ND2   1 
ATOM   2766 N  N     . HIS B 1 179 ? -18.561 7.984   26.473  1.00 66.49  ? 196  HIS B N     1 
ATOM   2767 C  CA    . HIS B 1 179 ? -19.869 7.416   26.329  1.00 72.86  ? 196  HIS B CA    1 
ATOM   2768 C  C     . HIS B 1 179 ? -20.787 7.905   27.411  1.00 75.12  ? 196  HIS B C     1 
ATOM   2769 O  O     . HIS B 1 179 ? -21.911 8.261   27.122  1.00 76.86  ? 196  HIS B O     1 
ATOM   2770 C  CB    . HIS B 1 179 ? -19.826 5.891   26.292  1.00 76.60  ? 196  HIS B CB    1 
ATOM   2771 C  CG    . HIS B 1 179 ? -21.060 5.300   25.696  1.00 81.56  ? 196  HIS B CG    1 
ATOM   2772 N  ND1   . HIS B 1 179 ? -22.023 6.057   25.056  1.00 84.23  ? 196  HIS B ND1   1 
ATOM   2773 C  CD2   . HIS B 1 179 ? -21.461 4.017   25.586  1.00 81.97  ? 196  HIS B CD2   1 
ATOM   2774 C  CE1   . HIS B 1 179 ? -22.980 5.266   24.612  1.00 84.64  ? 196  HIS B CE1   1 
ATOM   2775 N  NE2   . HIS B 1 179 ? -22.656 4.020   24.911  1.00 83.08  ? 196  HIS B NE2   1 
HETATM 2776 P  PG    . GTP C 2 .   ? -17.927 -26.929 18.052  1.00 28.23  ? 900  GTP A PG    1 
HETATM 2777 O  O1G   . GTP C 2 .   ? -16.677 -26.095 17.719  1.00 26.98  ? 900  GTP A O1G   1 
HETATM 2778 O  O2G   . GTP C 2 .   ? -19.241 -26.182 18.035  1.00 29.86  ? 900  GTP A O2G   1 
HETATM 2779 O  O3G   . GTP C 2 .   ? -17.721 -27.737 19.230  1.00 27.78  ? 900  GTP A O3G   1 
HETATM 2780 O  O3B   . GTP C 2 .   ? -17.971 -27.973 16.837  1.00 27.22  ? 900  GTP A O3B   1 
HETATM 2781 P  PB    . GTP C 2 .   ? -18.035 -27.692 15.293  1.00 26.24  ? 900  GTP A PB    1 
HETATM 2782 O  O1B   . GTP C 2 .   ? -17.244 -26.477 14.792  1.00 24.97  ? 900  GTP A O1B   1 
HETATM 2783 O  O2B   . GTP C 2 .   ? -19.482 -27.783 14.939  1.00 26.50  ? 900  GTP A O2B   1 
HETATM 2784 O  O3A   . GTP C 2 .   ? -17.333 -28.988 14.644  1.00 25.36  ? 900  GTP A O3A   1 
HETATM 2785 P  PA    . GTP C 2 .   ? -15.968 -29.131 13.760  1.00 26.28  ? 900  GTP A PA    1 
HETATM 2786 O  O1A   . GTP C 2 .   ? -16.038 -28.367 12.459  1.00 29.14  ? 900  GTP A O1A   1 
HETATM 2787 O  O2A   . GTP C 2 .   ? -14.906 -28.908 14.789  1.00 25.57  ? 900  GTP A O2A   1 
HETATM 2788 O  "O5'" . GTP C 2 .   ? -16.060 -30.671 13.348  1.00 29.45  ? 900  GTP A "O5'" 1 
HETATM 2789 C  "C5'" . GTP C 2 .   ? -16.279 -31.731 14.302  1.00 30.05  ? 900  GTP A "C5'" 1 
HETATM 2790 C  "C4'" . GTP C 2 .   ? -15.622 -33.023 13.805  1.00 29.94  ? 900  GTP A "C4'" 1 
HETATM 2791 O  "O4'" . GTP C 2 .   ? -16.326 -33.472 12.649  1.00 30.12  ? 900  GTP A "O4'" 1 
HETATM 2792 C  "C3'" . GTP C 2 .   ? -14.172 -32.823 13.328  1.00 31.48  ? 900  GTP A "C3'" 1 
HETATM 2793 O  "O3'" . GTP C 2 .   ? -13.321 -33.941 13.613  1.00 32.66  ? 900  GTP A "O3'" 1 
HETATM 2794 C  "C2'" . GTP C 2 .   ? -14.244 -32.709 11.847  1.00 32.56  ? 900  GTP A "C2'" 1 
HETATM 2795 O  "O2'" . GTP C 2 .   ? -13.068 -33.151 11.168  1.00 35.17  ? 900  GTP A "O2'" 1 
HETATM 2796 C  "C1'" . GTP C 2 .   ? -15.445 -33.577 11.535  1.00 30.79  ? 900  GTP A "C1'" 1 
HETATM 2797 N  N9    . GTP C 2 .   ? -16.146 -33.107 10.348  1.00 30.36  ? 900  GTP A N9    1 
HETATM 2798 C  C8    . GTP C 2 .   ? -16.651 -31.862 10.125  1.00 29.65  ? 900  GTP A C8    1 
HETATM 2799 N  N7    . GTP C 2 .   ? -17.261 -31.811 8.933   1.00 29.40  ? 900  GTP A N7    1 
HETATM 2800 C  C5    . GTP C 2 .   ? -17.180 -33.042 8.378   1.00 29.63  ? 900  GTP A C5    1 
HETATM 2801 C  C6    . GTP C 2 .   ? -17.633 -33.707 7.149   1.00 30.64  ? 900  GTP A C6    1 
HETATM 2802 O  O6    . GTP C 2 .   ? -18.241 -33.142 6.223   1.00 29.46  ? 900  GTP A O6    1 
HETATM 2803 N  N1    . GTP C 2 .   ? -17.323 -35.004 6.982   1.00 33.48  ? 900  GTP A N1    1 
HETATM 2804 C  C2    . GTP C 2 .   ? -16.642 -35.714 7.911   1.00 32.59  ? 900  GTP A C2    1 
HETATM 2805 N  N2    . GTP C 2 .   ? -16.384 -37.010 7.685   1.00 31.97  ? 900  GTP A N2    1 
HETATM 2806 N  N3    . GTP C 2 .   ? -16.225 -35.185 9.067   1.00 31.32  ? 900  GTP A N3    1 
HETATM 2807 C  C4    . GTP C 2 .   ? -16.453 -33.885 9.334   1.00 30.47  ? 900  GTP A C4    1 
HETATM 2808 MG MG    . MG  D 3 .   ? -16.016 -25.381 16.008  1.00 25.16  ? 901  MG  A MG    1 
HETATM 2809 P  PG    . GTP E 2 .   ? -0.923  -8.323  8.535   1.00 34.00  ? 900  GTP B PG    1 
HETATM 2810 O  O1G   . GTP E 2 .   ? -0.061  -8.579  7.351   1.00 36.99  ? 900  GTP B O1G   1 
HETATM 2811 O  O2G   . GTP E 2 .   ? -1.514  -6.943  8.399   1.00 32.80  ? 900  GTP B O2G   1 
HETATM 2812 O  O3G   . GTP E 2 .   ? -1.895  -9.436  8.912   1.00 35.02  ? 900  GTP B O3G   1 
HETATM 2813 O  O3B   . GTP E 2 .   ? 0.124   -8.363  9.785   1.00 30.61  ? 900  GTP B O3B   1 
HETATM 2814 P  PB    . GTP E 2 .   ? -0.108  -8.189  11.352  1.00 28.76  ? 900  GTP B PB    1 
HETATM 2815 O  O1B   . GTP E 2 .   ? 0.177   -6.714  11.615  1.00 28.02  ? 900  GTP B O1B   1 
HETATM 2816 O  O2B   . GTP E 2 .   ? -1.336  -8.750  12.016  1.00 25.83  ? 900  GTP B O2B   1 
HETATM 2817 O  O3A   . GTP E 2 .   ? 1.137   -8.965  12.032  1.00 27.36  ? 900  GTP B O3A   1 
HETATM 2818 P  PA    . GTP E 2 .   ? 1.100   -10.367 12.834  1.00 28.25  ? 900  GTP B PA    1 
HETATM 2819 O  O1A   . GTP E 2 .   ? 0.752   -11.285 11.693  1.00 29.92  ? 900  GTP B O1A   1 
HETATM 2820 O  O2A   . GTP E 2 .   ? 0.482   -10.298 14.159  1.00 27.74  ? 900  GTP B O2A   1 
HETATM 2821 O  "O5'" . GTP E 2 .   ? 2.682   -10.474 13.273  1.00 28.37  ? 900  GTP B "O5'" 1 
HETATM 2822 C  "C5'" . GTP E 2 .   ? 3.653   -10.462 12.242  1.00 30.07  ? 900  GTP B "C5'" 1 
HETATM 2823 C  "C4'" . GTP E 2 .   ? 4.882   -11.239 12.697  1.00 32.36  ? 900  GTP B "C4'" 1 
HETATM 2824 O  "O4'" . GTP E 2 .   ? 5.480   -10.567 13.816  1.00 32.10  ? 900  GTP B "O4'" 1 
HETATM 2825 C  "C3'" . GTP E 2 .   ? 4.511   -12.655 13.137  1.00 34.88  ? 900  GTP B "C3'" 1 
HETATM 2826 O  "O3'" . GTP E 2 .   ? 5.483   -13.581 12.653  1.00 38.03  ? 900  GTP B "O3'" 1 
HETATM 2827 C  "C2'" . GTP E 2 .   ? 4.540   -12.594 14.617  1.00 36.09  ? 900  GTP B "C2'" 1 
HETATM 2828 O  "O2'" . GTP E 2 .   ? 4.952   -13.851 15.121  1.00 39.27  ? 900  GTP B "O2'" 1 
HETATM 2829 C  "C1'" . GTP E 2 .   ? 5.494   -11.447 14.944  1.00 33.81  ? 900  GTP B "C1'" 1 
HETATM 2830 N  N9    . GTP E 2 .   ? 5.095   -10.698 16.143  1.00 35.04  ? 900  GTP B N9    1 
HETATM 2831 C  C8    . GTP E 2 .   ? 3.912   -10.097 16.414  1.00 35.40  ? 900  GTP B C8    1 
HETATM 2832 N  N7    . GTP E 2 .   ? 3.913   -9.512  17.631  1.00 35.19  ? 900  GTP B N7    1 
HETATM 2833 C  C5    . GTP E 2 .   ? 5.139   -9.717  18.150  1.00 35.45  ? 900  GTP B C5    1 
HETATM 2834 C  C6    . GTP E 2 .   ? 5.873   -9.358  19.370  1.00 35.34  ? 900  GTP B C6    1 
HETATM 2835 O  O6    . GTP E 2 .   ? 5.358   -8.711  20.287  1.00 34.55  ? 900  GTP B O6    1 
HETATM 2836 N  N1    . GTP E 2 .   ? 7.135   -9.800  19.521  1.00 36.81  ? 900  GTP B N1    1 
HETATM 2837 C  C2    . GTP E 2 .   ? 7.780   -10.518 18.569  1.00 36.79  ? 900  GTP B C2    1 
HETATM 2838 N  N2    . GTP E 2 .   ? 9.066   -10.917 18.764  1.00 35.71  ? 900  GTP B N2    1 
HETATM 2839 N  N3    . GTP E 2 .   ? 7.181   -10.861 17.421  1.00 36.64  ? 900  GTP B N3    1 
HETATM 2840 C  C4    . GTP E 2 .   ? 5.901   -10.495 17.164  1.00 35.83  ? 900  GTP B C4    1 
HETATM 2841 MG MG    . MG  F 3 .   ? -2.659  -9.796  10.553  1.00 36.79  ? 901  MG  B MG    1 
HETATM 2842 O  O     . HOH G 4 .   ? -17.774 -23.982 15.986  1.00 29.31  ? 1001 HOH A O     1 
HETATM 2843 O  O     . HOH G 4 .   ? -12.811 -18.113 18.883  1.00 31.74  ? 1002 HOH A O     1 
HETATM 2844 O  O     . HOH G 4 .   ? -14.309 -26.732 15.946  1.00 26.33  ? 1003 HOH A O     1 
HETATM 2845 O  O     . HOH G 4 .   ? -12.699 -27.787 6.864   1.00 28.05  ? 1004 HOH A O     1 
HETATM 2846 O  O     . HOH G 4 .   ? -23.654 -22.273 17.527  1.00 71.42  ? 1005 HOH A O     1 
HETATM 2847 O  O     . HOH G 4 .   ? -12.313 -29.054 14.580  1.00 27.64  ? 1006 HOH A O     1 
HETATM 2848 O  O     . HOH G 4 .   ? -13.288 -22.147 10.450  1.00 27.28  ? 1007 HOH A O     1 
HETATM 2849 O  O     . HOH G 4 .   ? -17.686 -36.632 13.025  1.00 38.38  ? 1008 HOH A O     1 
HETATM 2850 O  O     . HOH G 4 .   ? -17.236 -26.078 21.526  1.00 24.53  ? 1009 HOH A O     1 
HETATM 2851 O  O     . HOH G 4 .   ? -27.191 -28.894 15.356  1.00 28.34  ? 1010 HOH A O     1 
HETATM 2852 O  O     . HOH G 4 .   ? -34.681 -14.228 12.318  1.00 35.42  ? 1011 HOH A O     1 
HETATM 2853 O  O     . HOH G 4 .   ? -25.908 -7.943  -11.540 1.00 41.63  ? 1012 HOH A O     1 
HETATM 2854 O  O     . HOH G 4 .   ? -18.783 -26.961 -1.888  1.00 38.63  ? 1013 HOH A O     1 
HETATM 2855 O  O     . HOH G 4 .   ? -20.752 -29.954 -4.620  1.00 48.27  ? 1014 HOH A O     1 
HETATM 2856 O  O     . HOH G 4 .   ? -30.378 -8.609  3.492   1.00 33.21  ? 1015 HOH A O     1 
HETATM 2857 O  O     . HOH G 4 .   ? -34.832 -13.183 0.090   1.00 47.59  ? 1016 HOH A O     1 
HETATM 2858 O  O     . HOH G 4 .   ? -16.142 -19.258 -3.598  1.00 55.06  ? 1017 HOH A O     1 
HETATM 2859 O  O     . HOH G 4 .   ? -31.221 -10.916 4.491   1.00 34.55  ? 1018 HOH A O     1 
HETATM 2860 O  O     . HOH G 4 .   ? -11.130 -15.182 7.204   1.00 34.12  ? 1019 HOH A O     1 
HETATM 2861 O  O     . HOH G 4 .   ? -10.458 -34.054 2.735   1.00 43.08  ? 1020 HOH A O     1 
HETATM 2862 O  O     . HOH G 4 .   ? -20.896 -38.379 12.770  1.00 39.58  ? 1021 HOH A O     1 
HETATM 2863 O  O     . HOH G 4 .   ? -6.961  -29.663 3.723   1.00 48.77  ? 1022 HOH A O     1 
HETATM 2864 O  O     . HOH G 4 .   ? -11.796 -28.993 9.001   1.00 29.79  ? 1023 HOH A O     1 
HETATM 2865 O  O     . HOH G 4 .   ? -26.245 -16.825 -8.808  1.00 25.38  ? 1024 HOH A O     1 
HETATM 2866 O  O     . HOH G 4 .   ? -11.789 -17.895 -0.542  1.00 42.24  ? 1025 HOH A O     1 
HETATM 2867 O  O     . HOH G 4 .   ? -11.099 -8.530  1.427   1.00 29.66  ? 1026 HOH A O     1 
HETATM 2868 O  O     . HOH G 4 .   ? -31.195 -41.670 9.692   1.00 52.61  ? 1027 HOH A O     1 
HETATM 2869 O  O     . HOH H 4 .   ? -14.030 14.747  14.096  1.00 30.56  ? 1001 HOH B O     1 
HETATM 2870 O  O     . HOH H 4 .   ? -1.523  -11.731 10.857  1.00 46.01  ? 1002 HOH B O     1 
HETATM 2871 O  O     . HOH H 4 .   ? -4.484  -1.987  9.145   1.00 74.77  ? 1003 HOH B O     1 
HETATM 2872 O  O     . HOH H 4 .   ? -8.393  9.794   16.689  1.00 48.29  ? 1004 HOH B O     1 
HETATM 2873 O  O     . HOH H 4 .   ? -6.445  -11.692 28.148  1.00 53.32  ? 1005 HOH B O     1 
HETATM 2874 O  O     . HOH H 4 .   ? -0.371  -13.564 19.783  1.00 30.67  ? 1006 HOH B O     1 
HETATM 2875 O  O     . HOH H 4 .   ? -2.406  -15.219 4.453   1.00 43.09  ? 1007 HOH B O     1 
HETATM 2876 O  O     . HOH H 4 .   ? -3.813  -7.959  10.380  1.00 36.96  ? 1008 HOH B O     1 
HETATM 2877 O  O     . HOH H 4 .   ? 0.477   -13.897 12.037  1.00 37.81  ? 1009 HOH B O     1 
HETATM 2878 O  O     . HOH H 4 .   ? -1.766  -8.765  5.331   1.00 29.75  ? 1010 HOH B O     1 
HETATM 2879 O  O     . HOH H 4 .   ? -9.773  2.748   1.877   1.00 40.66  ? 1011 HOH B O     1 
HETATM 2880 O  O     . HOH H 4 .   ? -0.395  -7.824  28.604  1.00 33.43  ? 1012 HOH B O     1 
HETATM 2881 O  O     . HOH H 4 .   ? -2.998  -6.467  3.648   1.00 26.88  ? 1013 HOH B O     1 
HETATM 2882 O  O     . HOH H 4 .   ? 2.150   1.131   11.451  1.00 27.14  ? 1014 HOH B O     1 
HETATM 2883 O  O     . HOH H 4 .   ? -13.308 -13.864 19.276  1.00 34.05  ? 1015 HOH B O     1 
HETATM 2884 O  O     . HOH H 4 .   ? -13.617 -12.861 25.763  1.00 35.82  ? 1016 HOH B O     1 
HETATM 2885 O  O     . HOH H 4 .   ? -9.134  0.626   34.868  1.00 38.03  ? 1017 HOH B O     1 
HETATM 2886 O  O     . HOH H 4 .   ? -15.077 6.962   22.416  1.00 32.64  ? 1018 HOH B O     1 
HETATM 2887 O  O     . HOH H 4 .   ? 5.445   -20.071 17.930  1.00 42.32  ? 1019 HOH B O     1 
HETATM 2888 O  O     . HOH H 4 .   ? -7.193  10.144  20.785  1.00 35.05  ? 1020 HOH B O     1 
HETATM 2889 O  O     . HOH H 4 .   ? 7.082   -0.125  30.169  1.00 51.05  ? 1021 HOH B O     1 
HETATM 2890 O  O     . HOH H 4 .   ? -1.262  -15.444 13.156  1.00 35.91  ? 1022 HOH B O     1 
HETATM 2891 O  O     . HOH H 4 .   ? 8.188   -2.246  29.911  1.00 59.49  ? 1023 HOH B O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLU A 3   ? 1.2267 0.9083 0.9192 -0.0253 -0.0733 0.2732  20  GLU A N   
2    C CA  . GLU A 3   ? 1.1996 0.9169 0.8897 -0.0119 -0.0834 0.2616  20  GLU A CA  
3    C C   . GLU A 3   ? 1.1313 0.8590 0.8470 -0.0162 -0.0852 0.2377  20  GLU A C   
4    O O   . GLU A 3   ? 1.1087 0.8338 0.8393 -0.0010 -0.0945 0.2260  20  GLU A O   
5    C CB  . GLU A 3   ? 1.2294 0.9827 0.8963 -0.0163 -0.0779 0.2670  20  GLU A CB  
6    C CG  . GLU A 3   ? 1.2745 1.0434 0.9213 0.0038  -0.0881 0.2739  20  GLU A CG  
7    C CD  . GLU A 3   ? 1.3170 1.1085 0.9330 -0.0003 -0.0797 0.2835  20  GLU A CD  
8    O OE1 . GLU A 3   ? 1.3401 1.1273 0.9492 -0.0164 -0.0638 0.2927  20  GLU A OE1 
9    O OE2 . GLU A 3   ? 1.3320 1.1465 0.9296 0.0128  -0.0886 0.2816  20  GLU A OE2 
10   N N   . THR A 4   ? 1.0926 0.8377 0.8197 -0.0348 -0.0734 0.2281  21  THR A N   
11   C CA  . THR A 4   ? 1.0156 0.7769 0.7709 -0.0363 -0.0726 0.2030  21  THR A CA  
12   C C   . THR A 4   ? 0.9821 0.7146 0.7564 -0.0302 -0.0786 0.1924  21  THR A C   
13   O O   . THR A 4   ? 1.0395 0.7314 0.8108 -0.0352 -0.0785 0.2015  21  THR A O   
14   C CB  . THR A 4   ? 0.9975 0.7818 0.7640 -0.0563 -0.0590 0.1964  21  THR A CB  
15   O OG1 . THR A 4   ? 1.0375 0.8466 0.7845 -0.0608 -0.0508 0.2066  21  THR A OG1 
16   C CG2 . THR A 4   ? 0.9431 0.7548 0.7324 -0.0527 -0.0595 0.1715  21  THR A CG2 
17   N N   . ARG A 5   ? 0.9044 0.6583 0.6955 -0.0184 -0.0839 0.1730  22  ARG A N   
18   C CA  . ARG A 5   ? 0.8549 0.5953 0.6653 -0.0105 -0.0878 0.1579  22  ARG A CA  
19   C C   . ARG A 5   ? 0.7755 0.5427 0.6060 -0.0205 -0.0821 0.1379  22  ARG A C   
20   O O   . ARG A 5   ? 0.7273 0.5299 0.5603 -0.0217 -0.0798 0.1310  22  ARG A O   
21   C CB  . ARG A 5   ? 0.8453 0.5953 0.6591 0.0132  -0.0986 0.1551  22  ARG A CB  
22   C CG  . ARG A 5   ? 0.8393 0.5787 0.6716 0.0259  -0.1017 0.1413  22  ARG A CG  
23   C CD  . ARG A 5   ? 0.8961 0.5856 0.7197 0.0355  -0.1039 0.1514  22  ARG A CD  
24   N NE  . ARG A 5   ? 0.8873 0.5704 0.7269 0.0514  -0.1057 0.1366  22  ARG A NE  
25   C CZ  . ARG A 5   ? 0.8683 0.5434 0.7184 0.0439  -0.1004 0.1194  22  ARG A CZ  
26   N NH1 . ARG A 5   ? 0.8443 0.5170 0.6937 0.0199  -0.0944 0.1146  22  ARG A NH1 
27   N NH2 . ARG A 5   ? 0.8723 0.5439 0.7338 0.0614  -0.1013 0.1072  22  ARG A NH2 
28   N N   . GLU A 6   ? 0.7596 0.5072 0.6020 -0.0271 -0.0803 0.1286  23  GLU A N   
29   C CA  . GLU A 6   ? 0.7410 0.5103 0.6016 -0.0362 -0.0759 0.1115  23  GLU A CA  
30   C C   . GLU A 6   ? 0.6649 0.4284 0.5373 -0.0219 -0.0808 0.0963  23  GLU A C   
31   O O   . GLU A 6   ? 0.7003 0.4303 0.5675 -0.0128 -0.0847 0.0984  23  GLU A O   
32   C CB  . GLU A 6   ? 0.8374 0.5941 0.7008 -0.0589 -0.0700 0.1141  23  GLU A CB  
33   C CG  . GLU A 6   ? 0.9209 0.6886 0.7749 -0.0740 -0.0627 0.1309  23  GLU A CG  
34   C CD  . GLU A 6   ? 1.0183 0.7890 0.8819 -0.0987 -0.0561 0.1336  23  GLU A CD  
35   O OE1 . GLU A 6   ? 1.0533 0.8247 0.9322 -0.1059 -0.0578 0.1202  23  GLU A OE1 
36   O OE2 . GLU A 6   ? 1.0852 0.8610 0.9413 -0.1119 -0.0491 0.1503  23  GLU A OE2 
37   N N   . HIS A 7   ? 0.5722 0.3674 0.4592 -0.0189 -0.0798 0.0820  24  HIS A N   
38   C CA  . HIS A 7   ? 0.5218 0.3180 0.4213 -0.0078 -0.0820 0.0674  24  HIS A CA  
39   C C   . HIS A 7   ? 0.5023 0.3140 0.4139 -0.0183 -0.0776 0.0543  24  HIS A C   
40   O O   . HIS A 7   ? 0.4927 0.3290 0.4083 -0.0278 -0.0736 0.0540  24  HIS A O   
41   C CB  . HIS A 7   ? 0.4682 0.2919 0.3755 0.0071  -0.0858 0.0637  24  HIS A CB  
42   C CG  . HIS A 7   ? 0.4763 0.2949 0.3745 0.0200  -0.0924 0.0763  24  HIS A CG  
43   N ND1 . HIS A 7   ? 0.4856 0.2876 0.3857 0.0376  -0.0968 0.0783  24  HIS A ND1 
44   C CD2 . HIS A 7   ? 0.4746 0.3053 0.3612 0.0198  -0.0957 0.0872  24  HIS A CD2 
45   C CE1 . HIS A 7   ? 0.5135 0.3195 0.4060 0.0477  -0.1036 0.0913  24  HIS A CE1 
46   N NE2 . HIS A 7   ? 0.5101 0.3314 0.3921 0.0361  -0.1034 0.0972  24  HIS A NE2 
47   N N   . LEU A 8   ? 0.5177 0.3166 0.4339 -0.0140 -0.0783 0.0431  25  LEU A N   
48   C CA  . LEU A 8   ? 0.5000 0.3153 0.4264 -0.0204 -0.0756 0.0305  25  LEU A CA  
49   C C   . LEU A 8   ? 0.4747 0.3015 0.4095 -0.0044 -0.0758 0.0203  25  LEU A C   
50   O O   . LEU A 8   ? 0.4971 0.3035 0.4278 0.0077  -0.0771 0.0175  25  LEU A O   
51   C CB  . LEU A 8   ? 0.5509 0.3395 0.4714 -0.0329 -0.0764 0.0264  25  LEU A CB  
52   C CG  . LEU A 8   ? 0.5444 0.3514 0.4734 -0.0416 -0.0754 0.0148  25  LEU A CG  
53   C CD1 . LEU A 8   ? 0.5275 0.3687 0.4674 -0.0521 -0.0721 0.0189  25  LEU A CD1 
54   C CD2 . LEU A 8   ? 0.5846 0.3633 0.5051 -0.0554 -0.0788 0.0102  25  LEU A CD2 
55   N N   . PHE A 9   ? 0.4338 0.2926 0.3799 -0.0035 -0.0738 0.0159  26  PHE A N   
56   C CA  . PHE A 9   ? 0.4003 0.2729 0.3559 0.0093  -0.0730 0.0087  26  PHE A CA  
57   C C   . PHE A 9   ? 0.3690 0.2551 0.3306 0.0042  -0.0693 -0.0006 26  PHE A C   
58   O O   . PHE A 9   ? 0.3681 0.2677 0.3324 -0.0062 -0.0678 0.0000  26  PHE A O   
59   C CB  . PHE A 9   ? 0.3740 0.2717 0.3376 0.0150  -0.0751 0.0127  26  PHE A CB  
60   C CG  . PHE A 9   ? 0.3967 0.2868 0.3537 0.0212  -0.0803 0.0229  26  PHE A CG  
61   C CD1 . PHE A 9   ? 0.4241 0.2926 0.3770 0.0337  -0.0827 0.0265  26  PHE A CD1 
62   C CD2 . PHE A 9   ? 0.4011 0.3052 0.3539 0.0166  -0.0831 0.0291  26  PHE A CD2 
63   C CE1 . PHE A 9   ? 0.4588 0.3214 0.4054 0.0418  -0.0884 0.0381  26  PHE A CE1 
64   C CE2 . PHE A 9   ? 0.4247 0.3234 0.3687 0.0231  -0.0891 0.0397  26  PHE A CE2 
65   C CZ  . PHE A 9   ? 0.4542 0.3329 0.3961 0.0358  -0.0921 0.0453  26  PHE A CZ  
66   N N   . LYS A 10  ? 0.3533 0.2371 0.3162 0.0132  -0.0672 -0.0082 27  LYS A N   
67   C CA  . LYS A 10  ? 0.3224 0.2213 0.2896 0.0112  -0.0636 -0.0153 27  LYS A CA  
68   C C   . LYS A 10  ? 0.3131 0.2397 0.2941 0.0157  -0.0611 -0.0140 27  LYS A C   
69   O O   . LYS A 10  ? 0.3169 0.2516 0.3054 0.0271  -0.0601 -0.0136 27  LYS A O   
70   C CB  . LYS A 10  ? 0.3545 0.2379 0.3128 0.0181  -0.0616 -0.0240 27  LYS A CB  
71   C CG  . LYS A 10  ? 0.3590 0.2592 0.3186 0.0175  -0.0575 -0.0301 27  LYS A CG  
72   C CD  . LYS A 10  ? 0.4068 0.2883 0.3510 0.0235  -0.0558 -0.0402 27  LYS A CD  
73   C CE  . LYS A 10  ? 0.4007 0.3006 0.3435 0.0244  -0.0513 -0.0445 27  LYS A CE  
74   N NZ  . LYS A 10  ? 0.4313 0.3116 0.3528 0.0285  -0.0502 -0.0562 27  LYS A NZ  
75   N N   . VAL A 11  ? 0.2870 0.2282 0.2723 0.0073  -0.0599 -0.0133 28  VAL A N   
76   C CA  . VAL A 11  ? 0.2838 0.2457 0.2801 0.0081  -0.0574 -0.0128 28  VAL A CA  
77   C C   . VAL A 11  ? 0.2989 0.2699 0.2970 0.0056  -0.0529 -0.0154 28  VAL A C   
78   O O   . VAL A 11  ? 0.2983 0.2674 0.2916 -0.0001 -0.0529 -0.0158 28  VAL A O   
79   C CB  . VAL A 11  ? 0.2557 0.2227 0.2528 0.0024  -0.0600 -0.0089 28  VAL A CB  
80   C CG1 . VAL A 11  ? 0.2200 0.2019 0.2255 0.0005  -0.0585 -0.0096 28  VAL A CG1 
81   C CG2 . VAL A 11  ? 0.2481 0.2076 0.2410 0.0059  -0.0651 -0.0043 28  VAL A CG2 
82   N N   . LEU A 12  ? 0.3151 0.2986 0.3212 0.0100  -0.0491 -0.0157 29  LEU A N   
83   C CA  . LEU A 12  ? 0.2963 0.2874 0.3023 0.0087  -0.0442 -0.0160 29  LEU A CA  
84   C C   . LEU A 12  ? 0.2879 0.2863 0.3007 0.0028  -0.0432 -0.0123 29  LEU A C   
85   O O   . LEU A 12  ? 0.2945 0.2968 0.3145 0.0005  -0.0453 -0.0111 29  LEU A O   
86   C CB  . LEU A 12  ? 0.2623 0.2634 0.2724 0.0162  -0.0384 -0.0168 29  LEU A CB  
87   C CG  . LEU A 12  ? 0.2698 0.2595 0.2703 0.0253  -0.0379 -0.0222 29  LEU A CG  
88   C CD1 . LEU A 12  ? 0.2415 0.2458 0.2493 0.0355  -0.0307 -0.0223 29  LEU A CD1 
89   C CD2 . LEU A 12  ? 0.2893 0.2663 0.2723 0.0236  -0.0382 -0.0276 29  LEU A CD2 
90   N N   . VAL A 13  ? 0.2857 0.2842 0.2945 0.0007  -0.0407 -0.0107 30  VAL A N   
91   C CA  . VAL A 13  ? 0.2563 0.2561 0.2695 -0.0030 -0.0385 -0.0070 30  VAL A CA  
92   C C   . VAL A 13  ? 0.2492 0.2541 0.2617 -0.0017 -0.0330 -0.0031 30  VAL A C   
93   O O   . VAL A 13  ? 0.2376 0.2425 0.2414 0.0008  -0.0327 -0.0021 30  VAL A O   
94   C CB  . VAL A 13  ? 0.2431 0.2371 0.2521 -0.0043 -0.0399 -0.0063 30  VAL A CB  
95   C CG1 . VAL A 13  ? 0.2067 0.1951 0.2182 -0.0063 -0.0371 -0.0041 30  VAL A CG1 
96   C CG2 . VAL A 13  ? 0.2429 0.2335 0.2501 -0.0058 -0.0439 -0.0089 30  VAL A CG2 
97   N N   . ILE A 14  ? 0.2271 0.2386 0.2485 -0.0044 -0.0290 0.0001  31  ILE A N   
98   C CA  . ILE A 14  ? 0.2386 0.2563 0.2576 -0.0031 -0.0222 0.0056  31  ILE A CA  
99   C C   . ILE A 14  ? 0.2393 0.2536 0.2651 -0.0104 -0.0188 0.0124  31  ILE A C   
100  O O   . ILE A 14  ? 0.2375 0.2455 0.2702 -0.0167 -0.0223 0.0104  31  ILE A O   
101  C CB  . ILE A 14  ? 0.2254 0.2573 0.2475 0.0016  -0.0175 0.0044  31  ILE A CB  
102  C CG1 . ILE A 14  ? 0.2206 0.2654 0.2615 -0.0022 -0.0173 0.0053  31  ILE A CG1 
103  C CG2 . ILE A 14  ? 0.2169 0.2447 0.2283 0.0095  -0.0204 -0.0033 31  ILE A CG2 
104  C CD1 . ILE A 14  ? 0.2176 0.2791 0.2635 0.0062  -0.0121 0.0041  31  ILE A CD1 
105  N N   . GLY A 15  ? 0.2279 0.2436 0.2489 -0.0100 -0.0125 0.0203  32  GLY A N   
106  C CA  . GLY A 15  ? 0.2517 0.2573 0.2757 -0.0175 -0.0085 0.0290  32  GLY A CA  
107  C C   . GLY A 15  ? 0.2833 0.2826 0.2943 -0.0129 -0.0041 0.0388  32  GLY A C   
108  O O   . GLY A 15  ? 0.2857 0.2897 0.2846 -0.0045 -0.0059 0.0379  32  GLY A O   
109  N N   . GLU A 16  ? 0.3104 0.2981 0.3226 -0.0193 0.0008  0.0488  33  GLU A N   
110  C CA  . GLU A 16  ? 0.3460 0.3284 0.3452 -0.0150 0.0059  0.0618  33  GLU A CA  
111  C C   . GLU A 16  ? 0.3410 0.3094 0.3301 -0.0049 0.0002  0.0619  33  GLU A C   
112  O O   . GLU A 16  ? 0.2870 0.2457 0.2805 -0.0039 -0.0049 0.0538  33  GLU A O   
113  C CB  . GLU A 16  ? 0.3985 0.3660 0.4010 -0.0254 0.0128  0.0746  33  GLU A CB  
114  C CG  . GLU A 16  ? 0.4378 0.4252 0.4516 -0.0363 0.0213  0.0806  33  GLU A CG  
115  C CD  . GLU A 16  ? 0.4599 0.4726 0.4643 -0.0283 0.0282  0.0845  33  GLU A CD  
116  O OE1 . GLU A 16  ? 0.4819 0.5127 0.4875 -0.0216 0.0259  0.0732  33  GLU A OE1 
117  O OE2 . GLU A 16  ? 0.5090 0.5216 0.5018 -0.0278 0.0360  0.0987  33  GLU A OE2 
118  N N   . LEU A 17  ? 0.3458 0.3161 0.3214 0.0028  0.0016  0.0721  34  LEU A N   
119  C CA  . LEU A 17  ? 0.3578 0.3189 0.3258 0.0140  -0.0031 0.0770  34  LEU A CA  
120  C C   . LEU A 17  ? 0.3616 0.2960 0.3350 0.0145  -0.0029 0.0773  34  LEU A C   
121  O O   . LEU A 17  ? 0.3882 0.3030 0.3634 0.0064  0.0023  0.0826  34  LEU A O   
122  C CB  . LEU A 17  ? 0.3799 0.3411 0.3334 0.0193  0.0005  0.0934  34  LEU A CB  
123  C CG  . LEU A 17  ? 0.3919 0.3778 0.3322 0.0221  -0.0003 0.0934  34  LEU A CG  
124  C CD1 . LEU A 17  ? 0.4094 0.3927 0.3338 0.0244  0.0060  0.1120  34  LEU A CD1 
125  C CD2 . LEU A 17  ? 0.3865 0.3868 0.3222 0.0304  -0.0111 0.0865  34  LEU A CD2 
126  N N   . GLY A 18  ? 0.3559 0.2904 0.3320 0.0228  -0.0083 0.0703  35  GLY A N   
127  C CA  . GLY A 18  ? 0.3674 0.2760 0.3440 0.0293  -0.0071 0.0710  35  GLY A CA  
128  C C   . GLY A 18  ? 0.3632 0.2537 0.3452 0.0194  -0.0062 0.0594  35  GLY A C   
129  O O   . GLY A 18  ? 0.3769 0.2396 0.3552 0.0236  -0.0040 0.0587  35  GLY A O   
130  N N   . VAL A 19  ? 0.3415 0.2465 0.3307 0.0076  -0.0082 0.0500  36  VAL A N   
131  C CA  . VAL A 19  ? 0.3175 0.2086 0.3112 -0.0035 -0.0092 0.0395  36  VAL A CA  
132  C C   . VAL A 19  ? 0.3498 0.2405 0.3426 0.0021  -0.0129 0.0278  36  VAL A C   
133  O O   . VAL A 19  ? 0.3347 0.2068 0.3250 -0.0037 -0.0137 0.0196  36  VAL A O   
134  C CB  . VAL A 19  ? 0.3044 0.2124 0.3083 -0.0178 -0.0103 0.0360  36  VAL A CB  
135  C CG1 . VAL A 19  ? 0.3172 0.2256 0.3233 -0.0255 -0.0044 0.0481  36  VAL A CG1 
136  C CG2 . VAL A 19  ? 0.2744 0.2116 0.2825 -0.0143 -0.0140 0.0298  36  VAL A CG2 
137  N N   . GLY A 20  ? 0.2915 0.2022 0.2848 0.0125  -0.0150 0.0273  37  GLY A N   
138  C CA  . GLY A 20  ? 0.3331 0.2479 0.3262 0.0177  -0.0168 0.0185  37  GLY A CA  
139  C C   . GLY A 20  ? 0.3031 0.2437 0.3014 0.0144  -0.0215 0.0132  37  GLY A C   
140  O O   . GLY A 20  ? 0.3201 0.2631 0.3177 0.0151  -0.0225 0.0067  37  GLY A O   
141  N N   . LYS A 21  ? 0.2834 0.2391 0.2847 0.0099  -0.0237 0.0155  38  LYS A N   
142  C CA  . LYS A 21  ? 0.2786 0.2509 0.2826 0.0063  -0.0281 0.0098  38  LYS A CA  
143  C C   . LYS A 21  ? 0.2607 0.2434 0.2652 0.0112  -0.0301 0.0087  38  LYS A C   
144  O O   . LYS A 21  ? 0.2770 0.2606 0.2819 0.0088  -0.0314 0.0034  38  LYS A O   
145  C CB  . LYS A 21  ? 0.2570 0.2409 0.2603 0.0048  -0.0289 0.0125  38  LYS A CB  
146  C CG  . LYS A 21  ? 0.2911 0.2724 0.2974 -0.0011 -0.0256 0.0139  38  LYS A CG  
147  C CD  . LYS A 21  ? 0.3066 0.3004 0.3093 0.0002  -0.0238 0.0165  38  LYS A CD  
148  C CE  . LYS A 21  ? 0.3393 0.3359 0.3325 0.0058  -0.0226 0.0243  38  LYS A CE  
149  N NZ  . LYS A 21  ? 0.3752 0.3595 0.3671 0.0069  -0.0182 0.0345  38  LYS A NZ  
150  N N   . THR A 22  ? 0.2753 0.2661 0.2803 0.0185  -0.0299 0.0151  39  THR A N   
151  C CA  . THR A 22  ? 0.2849 0.2931 0.2947 0.0221  -0.0321 0.0161  39  THR A CA  
152  C C   . THR A 22  ? 0.2835 0.2881 0.2953 0.0271  -0.0277 0.0136  39  THR A C   
153  O O   . THR A 22  ? 0.2658 0.2837 0.2815 0.0247  -0.0284 0.0115  39  THR A O   
154  C CB  . THR A 22  ? 0.3142 0.3373 0.3256 0.0285  -0.0347 0.0243  39  THR A CB  
155  O OG1 . THR A 22  ? 0.3742 0.4020 0.3796 0.0225  -0.0392 0.0240  39  THR A OG1 
156  C CG2 . THR A 22  ? 0.2762 0.3251 0.2979 0.0323  -0.0375 0.0273  39  THR A CG2 
157  N N   . SER A 23  ? 0.2828 0.2678 0.2901 0.0336  -0.0225 0.0137  40  SER A N   
158  C CA  . SER A 23  ? 0.2765 0.2528 0.2808 0.0409  -0.0169 0.0099  40  SER A CA  
159  C C   . SER A 23  ? 0.2690 0.2365 0.2664 0.0330  -0.0170 0.0004  40  SER A C   
160  O O   . SER A 23  ? 0.2630 0.2344 0.2576 0.0374  -0.0130 -0.0030 40  SER A O   
161  C CB  . SER A 23  ? 0.2824 0.2309 0.2797 0.0501  -0.0118 0.0116  40  SER A CB  
162  O OG  . SER A 23  ? 0.2823 0.2382 0.2843 0.0598  -0.0118 0.0225  40  SER A OG  
163  N N   . ILE A 24  ? 0.2472 0.2045 0.2416 0.0221  -0.0212 -0.0032 41  ILE A N   
164  C CA  . ILE A 24  ? 0.2468 0.2002 0.2352 0.0147  -0.0235 -0.0108 41  ILE A CA  
165  C C   . ILE A 24  ? 0.2313 0.2057 0.2235 0.0122  -0.0257 -0.0092 41  ILE A C   
166  O O   . ILE A 24  ? 0.2725 0.2481 0.2580 0.0116  -0.0243 -0.0126 41  ILE A O   
167  C CB  . ILE A 24  ? 0.2670 0.2132 0.2567 0.0041  -0.0285 -0.0127 41  ILE A CB  
168  C CG1 . ILE A 24  ? 0.2840 0.2068 0.2684 0.0020  -0.0268 -0.0155 41  ILE A CG1 
169  C CG2 . ILE A 24  ? 0.2358 0.1897 0.2245 -0.0028 -0.0339 -0.0165 41  ILE A CG2 
170  C CD1 . ILE A 24  ? 0.2671 0.1885 0.2583 -0.0085 -0.0299 -0.0135 41  ILE A CD1 
171  N N   . ILE A 25  ? 0.2179 0.2062 0.2182 0.0100  -0.0288 -0.0043 42  ILE A N   
172  C CA  . ILE A 25  ? 0.2359 0.2388 0.2392 0.0051  -0.0316 -0.0027 42  ILE A CA  
173  C C   . ILE A 25  ? 0.2742 0.2928 0.2816 0.0099  -0.0265 0.0007  42  ILE A C   
174  O O   . ILE A 25  ? 0.2890 0.3137 0.2942 0.0062  -0.0251 0.0010  42  ILE A O   
175  C CB  . ILE A 25  ? 0.2316 0.2417 0.2396 0.0011  -0.0366 -0.0002 42  ILE A CB  
176  C CG1 . ILE A 25  ? 0.2595 0.2585 0.2644 -0.0022 -0.0394 -0.0034 42  ILE A CG1 
177  C CG2 . ILE A 25  ? 0.2128 0.2337 0.2234 -0.0058 -0.0400 0.0013  42  ILE A CG2 
178  C CD1 . ILE A 25  ? 0.2503 0.2537 0.2556 -0.0032 -0.0423 -0.0024 42  ILE A CD1 
179  N N   . LYS A 26  ? 0.2793 0.3051 0.2926 0.0194  -0.0230 0.0044  43  LYS A N   
180  C CA  . LYS A 26  ? 0.2870 0.3335 0.3081 0.0266  -0.0174 0.0087  43  LYS A CA  
181  C C   . LYS A 26  ? 0.3253 0.3636 0.3365 0.0329  -0.0088 0.0040  43  LYS A C   
182  O O   . LYS A 26  ? 0.3468 0.4035 0.3609 0.0333  -0.0035 0.0064  43  LYS A O   
183  C CB  . LYS A 26  ? 0.3008 0.3590 0.3317 0.0376  -0.0168 0.0152  43  LYS A CB  
184  C CG  . LYS A 26  ? 0.3224 0.4078 0.3658 0.0489  -0.0103 0.0211  43  LYS A CG  
185  C CD  . LYS A 26  ? 0.3593 0.4627 0.4150 0.0593  -0.0130 0.0299  43  LYS A CD  
186  C CE  . LYS A 26  ? 0.4007 0.5157 0.4638 0.0799  -0.0032 0.0342  43  LYS A CE  
187  N NZ  . LYS A 26  ? 0.4178 0.5535 0.4943 0.0937  -0.0060 0.0450  43  LYS A NZ  
188  N N   . ARG A 27  ? 0.3486 0.3597 0.3466 0.0365  -0.0073 -0.0030 44  ARG A N   
189  C CA  . ARG A 27  ? 0.3503 0.3484 0.3326 0.0404  -0.0012 -0.0104 44  ARG A CA  
190  C C   . ARG A 27  ? 0.3319 0.3338 0.3062 0.0294  -0.0041 -0.0122 44  ARG A C   
191  O O   . ARG A 27  ? 0.3274 0.3384 0.2947 0.0320  0.0024  -0.0123 44  ARG A O   
192  C CB  . ARG A 27  ? 0.3604 0.3256 0.3290 0.0426  -0.0016 -0.0187 44  ARG A CB  
193  C CG  . ARG A 27  ? 0.4007 0.3490 0.3482 0.0427  0.0013  -0.0292 44  ARG A CG  
194  C CD  . ARG A 27  ? 0.4347 0.3886 0.3750 0.0578  0.0135  -0.0312 44  ARG A CD  
195  N NE  . ARG A 27  ? 0.4693 0.4045 0.4084 0.0725  0.0194  -0.0330 44  ARG A NE  
196  C CZ  . ARG A 27  ? 0.4933 0.4307 0.4292 0.0912  0.0313  -0.0341 44  ARG A CZ  
197  N NH1 . ARG A 27  ? 0.5073 0.4692 0.4415 0.0965  0.0397  -0.0334 44  ARG A NH1 
198  N NH2 . ARG A 27  ? 0.5003 0.4164 0.4354 0.1055  0.0355  -0.0342 44  ARG A NH2 
199  N N   . TYR A 28  ? 0.3443 0.3387 0.3183 0.0184  -0.0131 -0.0128 45  TYR A N   
200  C CA  . TYR A 28  ? 0.3559 0.3519 0.3223 0.0097  -0.0170 -0.0125 45  TYR A CA  
201  C C   . TYR A 28  ? 0.3568 0.3739 0.3308 0.0052  -0.0149 -0.0039 45  TYR A C   
202  O O   . TYR A 28  ? 0.3965 0.4163 0.3604 0.0024  -0.0125 -0.0021 45  TYR A O   
203  C CB  . TYR A 28  ? 0.3419 0.3279 0.3103 0.0020  -0.0266 -0.0138 45  TYR A CB  
204  C CG  . TYR A 28  ? 0.3546 0.3389 0.3148 -0.0046 -0.0323 -0.0130 45  TYR A CG  
205  C CD1 . TYR A 28  ? 0.3865 0.3662 0.3292 -0.0041 -0.0313 -0.0163 45  TYR A CD1 
206  C CD2 . TYR A 28  ? 0.3334 0.3186 0.3005 -0.0095 -0.0386 -0.0094 45  TYR A CD2 
207  C CE1 . TYR A 28  ? 0.4024 0.3810 0.3362 -0.0088 -0.0375 -0.0138 45  TYR A CE1 
208  C CE2 . TYR A 28  ? 0.3530 0.3347 0.3126 -0.0129 -0.0442 -0.0071 45  TYR A CE2 
209  C CZ  . TYR A 28  ? 0.3776 0.3571 0.3213 -0.0127 -0.0442 -0.0084 45  TYR A CZ  
210  O OH  . TYR A 28  ? 0.3796 0.3568 0.3152 -0.0149 -0.0505 -0.0040 45  TYR A OH  
211  N N   . VAL A 29  ? 0.3270 0.3588 0.3173 0.0036  -0.0160 0.0017  46  VAL A N   
212  C CA  . VAL A 29  ? 0.3266 0.3771 0.3261 -0.0053 -0.0163 0.0098  46  VAL A CA  
213  C C   . VAL A 29  ? 0.3539 0.4308 0.3628 0.0001  -0.0066 0.0152  46  VAL A C   
214  O O   . VAL A 29  ? 0.3446 0.4356 0.3540 -0.0057 -0.0019 0.0213  46  VAL A O   
215  C CB  . VAL A 29  ? 0.2914 0.3426 0.3014 -0.0129 -0.0252 0.0115  46  VAL A CB  
216  C CG1 . VAL A 29  ? 0.2906 0.3571 0.3096 -0.0249 -0.0270 0.0186  46  VAL A CG1 
217  C CG2 . VAL A 29  ? 0.2731 0.3017 0.2741 -0.0157 -0.0320 0.0068  46  VAL A CG2 
218  N N   . HIS A 30  ? 0.3622 0.4469 0.3788 0.0123  -0.0027 0.0141  47  HIS A N   
219  C CA  . HIS A 30  ? 0.4010 0.5167 0.4312 0.0203  0.0068  0.0204  47  HIS A CA  
220  C C   . HIS A 30  ? 0.4419 0.5517 0.4613 0.0380  0.0186  0.0152  47  HIS A C   
221  O O   . HIS A 30  ? 0.4606 0.5967 0.4906 0.0479  0.0283  0.0199  47  HIS A O   
222  C CB  . HIS A 30  ? 0.3945 0.5314 0.4456 0.0228  0.0021  0.0258  47  HIS A CB  
223  C CG  . HIS A 30  ? 0.4136 0.5554 0.4724 0.0055  -0.0096 0.0289  47  HIS A CG  
224  N ND1 . HIS A 30  ? 0.4227 0.5832 0.4903 -0.0097 -0.0107 0.0352  47  HIS A ND1 
225  C CD2 . HIS A 30  ? 0.4122 0.5406 0.4692 0.0006  -0.0201 0.0262  47  HIS A CD2 
226  C CE1 . HIS A 30  ? 0.4166 0.5711 0.4863 -0.0232 -0.0223 0.0347  47  HIS A CE1 
227  N NE2 . HIS A 30  ? 0.4120 0.5476 0.4742 -0.0163 -0.0277 0.0287  47  HIS A NE2 
228  N N   . GLN A 31  ? 0.4695 0.5456 0.4678 0.0416  0.0176  0.0051  48  GLN A N   
229  C CA  . GLN A 31  ? 0.5031 0.5647 0.4869 0.0582  0.0275  -0.0027 48  GLN A CA  
230  C C   . GLN A 31  ? 0.5000 0.5715 0.4978 0.0761  0.0336  0.0003  48  GLN A C   
231  O O   . GLN A 31  ? 0.5164 0.5975 0.5125 0.0926  0.0462  -0.0004 48  GLN A O   
232  C CB  . GLN A 31  ? 0.5480 0.6168 0.5161 0.0605  0.0380  -0.0047 48  GLN A CB  
233  C CG  . GLN A 31  ? 0.5790 0.6211 0.5214 0.0505  0.0319  -0.0127 48  GLN A CG  
234  C CD  . GLN A 31  ? 0.6193 0.6238 0.5452 0.0541  0.0267  -0.0255 48  GLN A CD  
235  O OE1 . GLN A 31  ? 0.6482 0.6390 0.5676 0.0687  0.0341  -0.0322 48  GLN A OE1 
236  N NE2 . GLN A 31  ? 0.6249 0.6128 0.5455 0.0406  0.0140  -0.0284 48  GLN A NE2 
237  N N   . LEU A 32  ? 0.4848 0.5529 0.4944 0.0742  0.0247  0.0041  49  LEU A N   
238  C CA  . LEU A 32  ? 0.4746 0.5505 0.4968 0.0910  0.0278  0.0094  49  LEU A CA  
239  C C   . LEU A 32  ? 0.4410 0.4828 0.4553 0.0919  0.0212  0.0067  49  LEU A C   
240  O O   . LEU A 32  ? 0.4129 0.4394 0.4216 0.0766  0.0121  0.0040  49  LEU A O   
241  C CB  . LEU A 32  ? 0.4614 0.5802 0.5104 0.0864  0.0227  0.0218  49  LEU A CB  
242  C CG  . LEU A 32  ? 0.4564 0.6185 0.5219 0.0867  0.0302  0.0288  49  LEU A CG  
243  C CD1 . LEU A 32  ? 0.4186 0.6185 0.5100 0.0768  0.0204  0.0397  49  LEU A CD1 
244  C CD2 . LEU A 32  ? 0.4764 0.6492 0.5444 0.1119  0.0450  0.0293  49  LEU A CD2 
245  N N   . PHE A 33  ? 0.4435 0.4758 0.4588 0.1107  0.0264  0.0090  50  PHE A N   
246  C CA  . PHE A 33  ? 0.4293 0.4307 0.4386 0.1127  0.0215  0.0102  50  PHE A CA  
247  C C   . PHE A 33  ? 0.4274 0.4400 0.4490 0.1332  0.0244  0.0212  50  PHE A C   
248  O O   . PHE A 33  ? 0.4218 0.4425 0.4465 0.1526  0.0344  0.0220  50  PHE A O   
249  C CB  . PHE A 33  ? 0.4351 0.3885 0.4202 0.1140  0.0255  -0.0021 50  PHE A CB  
250  C CG  . PHE A 33  ? 0.4412 0.3607 0.4201 0.1145  0.0221  0.0002  50  PHE A CG  
251  C CD1 . PHE A 33  ? 0.4334 0.3429 0.4109 0.0952  0.0129  0.0002  50  PHE A CD1 
252  C CD2 . PHE A 33  ? 0.4580 0.3541 0.4321 0.1346  0.0290  0.0030  50  PHE A CD2 
253  C CE1 . PHE A 33  ? 0.4437 0.3233 0.4159 0.0939  0.0111  0.0040  50  PHE A CE1 
254  C CE2 . PHE A 33  ? 0.4808 0.3430 0.4483 0.1335  0.0261  0.0074  50  PHE A CE2 
255  C CZ  . PHE A 33  ? 0.4588 0.3136 0.4254 0.1116  0.0174  0.0080  50  PHE A CZ  
256  N N   . SER A 34  ? 0.4206 0.4332 0.4477 0.1296  0.0159  0.0300  51  SER A N   
257  C CA  . SER A 34  ? 0.4239 0.4394 0.4580 0.1478  0.0163  0.0418  51  SER A CA  
258  C C   . SER A 34  ? 0.4369 0.4076 0.4549 0.1450  0.0140  0.0424  51  SER A C   
259  O O   . SER A 34  ? 0.4192 0.3810 0.4319 0.1262  0.0072  0.0405  51  SER A O   
260  C CB  . SER A 34  ? 0.4126 0.4753 0.4669 0.1436  0.0064  0.0539  51  SER A CB  
261  O OG  . SER A 34  ? 0.4520 0.5188 0.5116 0.1612  0.0045  0.0672  51  SER A OG  
262  N N   . GLN A 35  ? 0.4841 0.4261 0.4948 0.1649  0.0207  0.0462  52  GLN A N   
263  C CA  . GLN A 35  ? 0.5158 0.4180 0.5140 0.1639  0.0188  0.0521  52  GLN A CA  
264  C C   . GLN A 35  ? 0.4878 0.4137 0.4948 0.1630  0.0100  0.0689  52  GLN A C   
265  O O   . GLN A 35  ? 0.4990 0.3967 0.4953 0.1583  0.0081  0.0758  52  GLN A O   
266  C CB  . GLN A 35  ? 0.5918 0.4516 0.5778 0.1872  0.0288  0.0522  52  GLN A CB  
267  C CG  . GLN A 35  ? 0.6363 0.5216 0.6361 0.2161  0.0325  0.0651  52  GLN A CG  
268  C CD  . GLN A 35  ? 0.6681 0.5802 0.6774 0.2329  0.0419  0.0581  52  GLN A CD  
269  O OE1 . GLN A 35  ? 0.6590 0.5988 0.6737 0.2197  0.0422  0.0482  52  GLN A OE1 
270  N NE2 . GLN A 35  ? 0.7083 0.6136 0.7198 0.2640  0.0503  0.0649  52  GLN A NE2 
271  N N   . HIS A 36  ? 0.4450 0.4221 0.4703 0.1681  0.0046  0.0765  53  HIS A N   
272  C CA  . HIS A 36  ? 0.4228 0.4213 0.4526 0.1697  -0.0046 0.0922  53  HIS A CA  
273  C C   . HIS A 36  ? 0.3925 0.3967 0.4167 0.1441  -0.0126 0.0877  53  HIS A C   
274  O O   . HIS A 36  ? 0.3731 0.3995 0.4039 0.1300  -0.0159 0.0786  53  HIS A O   
275  C CB  . HIS A 36  ? 0.4189 0.4704 0.4700 0.1841  -0.0092 0.1022  53  HIS A CB  
276  C CG  . HIS A 36  ? 0.4474 0.4967 0.5057 0.2135  0.0000  0.1079  53  HIS A CG  
277  N ND1 . HIS A 36  ? 0.4938 0.4987 0.5384 0.2323  0.0062  0.1152  53  HIS A ND1 
278  C CD2 . HIS A 36  ? 0.4439 0.5263 0.5207 0.2279  0.0059  0.1067  53  HIS A CD2 
279  C CE1 . HIS A 36  ? 0.5090 0.5183 0.5622 0.2581  0.0151  0.1169  53  HIS A CE1 
280  N NE2 . HIS A 36  ? 0.4859 0.5441 0.5593 0.2572  0.0159  0.1120  53  HIS A NE2 
281  N N   . TYR A 37  ? 0.4116 0.3940 0.4228 0.1393  -0.0146 0.0953  54  TYR A N   
282  C CA  . TYR A 37  ? 0.3806 0.3695 0.3853 0.1194  -0.0206 0.0932  54  TYR A CA  
283  C C   . TYR A 37  ? 0.3687 0.4026 0.3802 0.1174  -0.0315 0.0983  54  TYR A C   
284  O O   . TYR A 37  ? 0.3448 0.3939 0.3565 0.1296  -0.0362 0.1119  54  TYR A O   
285  C CB  . TYR A 37  ? 0.3720 0.3281 0.3609 0.1167  -0.0178 0.1024  54  TYR A CB  
286  C CG  . TYR A 37  ? 0.3619 0.3250 0.3432 0.0978  -0.0213 0.1003  54  TYR A CG  
287  C CD1 . TYR A 37  ? 0.3301 0.3010 0.3152 0.0812  -0.0223 0.0850  54  TYR A CD1 
288  C CD2 . TYR A 37  ? 0.3740 0.3343 0.3428 0.0979  -0.0222 0.1140  54  TYR A CD2 
289  C CE1 . TYR A 37  ? 0.3206 0.2968 0.2987 0.0672  -0.0239 0.0828  54  TYR A CE1 
290  C CE2 . TYR A 37  ? 0.3645 0.3318 0.3248 0.0828  -0.0230 0.1117  54  TYR A CE2 
291  C CZ  . TYR A 37  ? 0.3376 0.3130 0.3034 0.0684  -0.0236 0.0955  54  TYR A CZ  
292  O OH  . TYR A 37  ? 0.3312 0.3146 0.2889 0.0569  -0.0233 0.0930  54  TYR A OH  
293  N N   . ARG A 38  ? 0.3539 0.4071 0.3694 0.1010  -0.0363 0.0870  55  ARG A N   
294  C CA  . ARG A 38  ? 0.3850 0.4727 0.4018 0.0940  -0.0476 0.0887  55  ARG A CA  
295  C C   . ARG A 38  ? 0.3363 0.4101 0.3390 0.0763  -0.0482 0.0797  55  ARG A C   
296  O O   . ARG A 38  ? 0.2708 0.3360 0.2758 0.0656  -0.0454 0.0679  55  ARG A O   
297  C CB  . ARG A 38  ? 0.4310 0.5517 0.4658 0.0898  -0.0520 0.0825  55  ARG A CB  
298  C CG  . ARG A 38  ? 0.5312 0.6740 0.5836 0.1085  -0.0502 0.0916  55  ARG A CG  
299  C CD  . ARG A 38  ? 0.6179 0.8072 0.6905 0.1019  -0.0577 0.0902  55  ARG A CD  
300  N NE  . ARG A 38  ? 0.7036 0.9271 0.7791 0.1020  -0.0715 0.0996  55  ARG A NE  
301  C CZ  . ARG A 38  ? 0.7750 1.0348 0.8606 0.0872  -0.0833 0.0968  55  ARG A CZ  
302  N NH1 . ARG A 38  ? 0.8059 1.0719 0.9007 0.0707  -0.0821 0.0863  55  ARG A NH1 
303  N NH2 . ARG A 38  ? 0.8256 1.1151 0.9107 0.0877  -0.0973 0.1052  55  ARG A NH2 
304  N N   . ALA A 39  ? 0.3287 0.4033 0.3165 0.0750  -0.0518 0.0864  56  ALA A N   
305  C CA  . ALA A 39  ? 0.3213 0.3807 0.2953 0.0627  -0.0488 0.0799  56  ALA A CA  
306  C C   . ALA A 39  ? 0.3061 0.3828 0.2792 0.0500  -0.0562 0.0667  56  ALA A C   
307  O O   . ALA A 39  ? 0.2827 0.3842 0.2550 0.0494  -0.0664 0.0676  56  ALA A O   
308  C CB  . ALA A 39  ? 0.3186 0.3755 0.2749 0.0675  -0.0488 0.0929  56  ALA A CB  
309  N N   . THR A 40  ? 0.3196 0.3827 0.2921 0.0399  -0.0519 0.0552  57  THR A N   
310  C CA  . THR A 40  ? 0.3494 0.4217 0.3194 0.0291  -0.0583 0.0429  57  THR A CA  
311  C C   . THR A 40  ? 0.3586 0.4351 0.3073 0.0266  -0.0621 0.0415  57  THR A C   
312  O O   . THR A 40  ? 0.3755 0.4426 0.3125 0.0301  -0.0554 0.0472  57  THR A O   
313  C CB  . THR A 40  ? 0.3901 0.4460 0.3659 0.0220  -0.0527 0.0326  57  THR A CB  
314  O OG1 . THR A 40  ? 0.4444 0.4967 0.4347 0.0251  -0.0492 0.0337  57  THR A OG1 
315  C CG2 . THR A 40  ? 0.3687 0.4281 0.3411 0.0118  -0.0591 0.0205  57  THR A CG2 
316  N N   . ILE A 41  ? 0.3809 0.4707 0.3232 0.0197  -0.0725 0.0339  58  ILE A N   
317  C CA  . ILE A 41  ? 0.4059 0.4958 0.3236 0.0164  -0.0764 0.0278  58  ILE A CA  
318  C C   . ILE A 41  ? 0.4265 0.5007 0.3387 0.0079  -0.0751 0.0116  58  ILE A C   
319  O O   . ILE A 41  ? 0.4342 0.5086 0.3539 -0.0006 -0.0816 0.0036  58  ILE A O   
320  C CB  . ILE A 41  ? 0.4170 0.5304 0.3253 0.0152  -0.0906 0.0306  58  ILE A CB  
321  C CG1 . ILE A 41  ? 0.4195 0.5462 0.3316 0.0278  -0.0905 0.0492  58  ILE A CG1 
322  C CG2 . ILE A 41  ? 0.4472 0.5571 0.3242 0.0119  -0.0944 0.0219  58  ILE A CG2 
323  C CD1 . ILE A 41  ? 0.4273 0.5843 0.3368 0.0293  -0.1057 0.0560  58  ILE A CD1 
324  N N   . GLY A 42  ? 0.4470 0.5075 0.3473 0.0109  -0.0656 0.0081  59  GLY A N   
325  C CA  . GLY A 42  ? 0.4444 0.4883 0.3394 0.0071  -0.0626 -0.0065 59  GLY A CA  
326  C C   . GLY A 42  ? 0.4399 0.4744 0.3564 0.0038  -0.0601 -0.0090 59  GLY A C   
327  O O   . GLY A 42  ? 0.4408 0.4722 0.3699 0.0074  -0.0519 -0.0034 59  GLY A O   
328  N N   . VAL A 43  ? 0.4462 0.4765 0.3663 -0.0045 -0.0681 -0.0167 60  VAL A N   
329  C CA  . VAL A 43  ? 0.4462 0.4670 0.3830 -0.0076 -0.0658 -0.0182 60  VAL A CA  
330  C C   . VAL A 43  ? 0.4513 0.4826 0.4016 -0.0153 -0.0729 -0.0151 60  VAL A C   
331  O O   . VAL A 43  ? 0.4380 0.4787 0.3834 -0.0221 -0.0820 -0.0169 60  VAL A O   
332  C CB  . VAL A 43  ? 0.4566 0.4563 0.3838 -0.0087 -0.0647 -0.0296 60  VAL A CB  
333  C CG1 . VAL A 43  ? 0.4258 0.4149 0.3672 -0.0114 -0.0634 -0.0299 60  VAL A CG1 
334  C CG2 . VAL A 43  ? 0.4696 0.4662 0.3896 0.0017  -0.0545 -0.0303 60  VAL A CG2 
335  N N   . ASP A 44  ? 0.4641 0.4954 0.4309 -0.0144 -0.0683 -0.0105 61  ASP A N   
336  C CA  . ASP A 44  ? 0.4882 0.5315 0.4694 -0.0206 -0.0720 -0.0068 61  ASP A CA  
337  C C   . ASP A 44  ? 0.4072 0.4352 0.3928 -0.0240 -0.0685 -0.0097 61  ASP A C   
338  O O   . ASP A 44  ? 0.3789 0.3915 0.3595 -0.0194 -0.0638 -0.0129 61  ASP A O   
339  C CB  . ASP A 44  ? 0.5602 0.6199 0.5541 -0.0122 -0.0680 0.0034  61  ASP A CB  
340  C CG  . ASP A 44  ? 0.6648 0.7452 0.6746 -0.0160 -0.0706 0.0083  61  ASP A CG  
341  O OD1 . ASP A 44  ? 0.7127 0.8004 0.7249 -0.0285 -0.0778 0.0054  61  ASP A OD1 
342  O OD2 . ASP A 44  ? 0.7160 0.8043 0.7360 -0.0067 -0.0646 0.0149  61  ASP A OD2 
343  N N   . PHE A 45  ? 0.3570 0.3916 0.3520 -0.0319 -0.0707 -0.0074 62  PHE A N   
344  C CA  . PHE A 45  ? 0.3256 0.3446 0.3209 -0.0369 -0.0689 -0.0089 62  PHE A CA  
345  C C   . PHE A 45  ? 0.3028 0.3349 0.3106 -0.0392 -0.0654 -0.0021 62  PHE A C   
346  O O   . PHE A 45  ? 0.3083 0.3641 0.3271 -0.0410 -0.0662 0.0031  62  PHE A O   
347  C CB  . PHE A 45  ? 0.3395 0.3448 0.3265 -0.0491 -0.0760 -0.0142 62  PHE A CB  
348  C CG  . PHE A 45  ? 0.3843 0.3716 0.3543 -0.0460 -0.0786 -0.0233 62  PHE A CG  
349  C CD1 . PHE A 45  ? 0.4057 0.3683 0.3668 -0.0397 -0.0750 -0.0282 62  PHE A CD1 
350  C CD2 . PHE A 45  ? 0.4091 0.4053 0.3708 -0.0480 -0.0845 -0.0272 62  PHE A CD2 
351  C CE1 . PHE A 45  ? 0.4257 0.3739 0.3710 -0.0342 -0.0752 -0.0369 62  PHE A CE1 
352  C CE2 . PHE A 45  ? 0.4352 0.4141 0.3770 -0.0445 -0.0858 -0.0368 62  PHE A CE2 
353  C CZ  . PHE A 45  ? 0.4403 0.3950 0.3740 -0.0370 -0.0802 -0.0421 62  PHE A CZ  
354  N N   . ALA A 46  ? 0.2950 0.3131 0.3004 -0.0390 -0.0616 -0.0018 63  ALA A N   
355  C CA  . ALA A 46  ? 0.2976 0.3242 0.3095 -0.0412 -0.0571 0.0040  63  ALA A CA  
356  C C   . ALA A 46  ? 0.3340 0.3392 0.3372 -0.0459 -0.0577 0.0039  63  ALA A C   
357  O O   . ALA A 46  ? 0.3406 0.3260 0.3351 -0.0419 -0.0597 -0.0007 63  ALA A O   
358  C CB  . ALA A 46  ? 0.2607 0.2932 0.2750 -0.0295 -0.0502 0.0051  63  ALA A CB  
359  N N   . LEU A 47  ? 0.3758 0.3865 0.3817 -0.0530 -0.0551 0.0104  64  LEU A N   
360  C CA  . LEU A 47  ? 0.3789 0.3717 0.3755 -0.0556 -0.0542 0.0138  64  LEU A CA  
361  C C   . LEU A 47  ? 0.3546 0.3583 0.3501 -0.0497 -0.0468 0.0181  64  LEU A C   
362  O O   . LEU A 47  ? 0.3503 0.3755 0.3535 -0.0517 -0.0412 0.0227  64  LEU A O   
363  C CB  . LEU A 47  ? 0.4031 0.3901 0.4001 -0.0716 -0.0571 0.0193  64  LEU A CB  
364  C CG  . LEU A 47  ? 0.4475 0.4087 0.4321 -0.0754 -0.0575 0.0249  64  LEU A CG  
365  C CD1 . LEU A 47  ? 0.4674 0.3973 0.4410 -0.0704 -0.0635 0.0182  64  LEU A CD1 
366  C CD2 . LEU A 47  ? 0.4797 0.4426 0.4680 -0.0940 -0.0576 0.0337  64  LEU A CD2 
367  N N   . LYS A 48  ? 0.3511 0.3414 0.3366 -0.0422 -0.0470 0.0162  65  LYS A N   
368  C CA  . LYS A 48  ? 0.3480 0.3433 0.3257 -0.0388 -0.0416 0.0196  65  LYS A CA  
369  C C   . LYS A 48  ? 0.3718 0.3530 0.3381 -0.0443 -0.0433 0.0273  65  LYS A C   
370  O O   . LYS A 48  ? 0.3505 0.3125 0.3122 -0.0436 -0.0496 0.0270  65  LYS A O   
371  C CB  . LYS A 48  ? 0.3478 0.3391 0.3206 -0.0288 -0.0423 0.0126  65  LYS A CB  
372  C CG  . LYS A 48  ? 0.3802 0.3728 0.3398 -0.0253 -0.0389 0.0131  65  LYS A CG  
373  C CD  . LYS A 48  ? 0.3905 0.3976 0.3508 -0.0211 -0.0298 0.0114  65  LYS A CD  
374  C CE  . LYS A 48  ? 0.4278 0.4342 0.3696 -0.0190 -0.0258 0.0121  65  LYS A CE  
375  N NZ  . LYS A 48  ? 0.4445 0.4610 0.3846 -0.0111 -0.0161 0.0074  65  LYS A NZ  
376  N N   . VAL A 49  ? 0.3970 0.3884 0.3577 -0.0474 -0.0368 0.0344  66  VAL A N   
377  C CA  . VAL A 49  ? 0.4380 0.4190 0.3853 -0.0524 -0.0365 0.0445  66  VAL A CA  
378  C C   . VAL A 49  ? 0.4539 0.4381 0.3857 -0.0435 -0.0342 0.0430  66  VAL A C   
379  O O   . VAL A 49  ? 0.4542 0.4552 0.3838 -0.0402 -0.0261 0.0410  66  VAL A O   
380  C CB  . VAL A 49  ? 0.4479 0.4433 0.4007 -0.0652 -0.0291 0.0554  66  VAL A CB  
381  C CG1 . VAL A 49  ? 0.4674 0.4509 0.4036 -0.0709 -0.0273 0.0685  66  VAL A CG1 
382  C CG2 . VAL A 49  ? 0.4418 0.4337 0.4095 -0.0769 -0.0339 0.0553  66  VAL A CG2 
383  N N   . LEU A 50  ? 0.4812 0.4491 0.4008 -0.0389 -0.0418 0.0438  67  LEU A N   
384  C CA  . LEU A 50  ? 0.5104 0.4808 0.4125 -0.0321 -0.0429 0.0419  67  LEU A CA  
385  C C   . LEU A 50  ? 0.5612 0.5229 0.4435 -0.0341 -0.0444 0.0552  67  LEU A C   
386  O O   . LEU A 50  ? 0.5945 0.5388 0.4758 -0.0341 -0.0519 0.0623  67  LEU A O   
387  C CB  . LEU A 50  ? 0.5163 0.4809 0.4238 -0.0251 -0.0523 0.0326  67  LEU A CB  
388  C CG  . LEU A 50  ? 0.5456 0.5145 0.4426 -0.0196 -0.0569 0.0246  67  LEU A CG  
389  C CD1 . LEU A 50  ? 0.5527 0.5309 0.4438 -0.0188 -0.0479 0.0167  67  LEU A CD1 
390  C CD2 . LEU A 50  ? 0.5302 0.4978 0.4422 -0.0161 -0.0649 0.0173  67  LEU A CD2 
391  N N   . ASN A 51  ? 0.5787 0.5512 0.4437 -0.0341 -0.0371 0.0586  68  ASN A N   
392  C CA  . ASN A 51  ? 0.6280 0.5946 0.4700 -0.0352 -0.0379 0.0717  68  ASN A CA  
393  C C   . ASN A 51  ? 0.6034 0.5671 0.4309 -0.0265 -0.0490 0.0655  68  ASN A C   
394  O O   . ASN A 51  ? 0.6118 0.5851 0.4237 -0.0229 -0.0469 0.0572  68  ASN A O   
395  C CB  . ASN A 51  ? 0.6839 0.6668 0.5114 -0.0383 -0.0240 0.0774  68  ASN A CB  
396  C CG  . ASN A 51  ? 0.7174 0.7092 0.5622 -0.0492 -0.0136 0.0864  68  ASN A CG  
397  O OD1 . ASN A 51  ? 0.7414 0.7553 0.5962 -0.0491 -0.0022 0.0819  68  ASN A OD1 
398  N ND2 . ASN A 51  ? 0.7431 0.7179 0.5926 -0.0587 -0.0175 0.0994  68  ASN A ND2 
399  N N   . TRP A 52  ? 0.5578 0.5089 0.3914 -0.0227 -0.0609 0.0682  69  TRP A N   
400  C CA  . TRP A 52  ? 0.5131 0.4677 0.3423 -0.0152 -0.0733 0.0613  69  TRP A CA  
401  C C   . TRP A 52  ? 0.5107 0.4696 0.3090 -0.0132 -0.0769 0.0679  69  TRP A C   
402  O O   . TRP A 52  ? 0.5228 0.4914 0.3086 -0.0117 -0.0804 0.0571  69  TRP A O   
403  C CB  . TRP A 52  ? 0.5056 0.4496 0.3496 -0.0095 -0.0835 0.0657  69  TRP A CB  
404  C CG  . TRP A 52  ? 0.4856 0.4401 0.3304 -0.0021 -0.0971 0.0609  69  TRP A CG  
405  C CD1 . TRP A 52  ? 0.4982 0.4544 0.3295 0.0044  -0.1082 0.0710  69  TRP A CD1 
406  C CD2 . TRP A 52  ? 0.4604 0.4281 0.3210 -0.0018 -0.1011 0.0460  69  TRP A CD2 
407  N NE1 . TRP A 52  ? 0.4842 0.4576 0.3244 0.0084  -0.1200 0.0628  69  TRP A NE1 
408  C CE2 . TRP A 52  ? 0.4609 0.4406 0.3194 0.0035  -0.1153 0.0473  69  TRP A CE2 
409  C CE3 . TRP A 52  ? 0.4403 0.4114 0.3168 -0.0059 -0.0944 0.0330  69  TRP A CE3 
410  C CZ2 . TRP A 52  ? 0.4532 0.4488 0.3268 0.0022  -0.1225 0.0357  69  TRP A CZ2 
411  C CZ3 . TRP A 52  ? 0.4352 0.4177 0.3238 -0.0061 -0.1008 0.0223  69  TRP A CZ3 
412  C CH2 . TRP A 52  ? 0.4367 0.4316 0.3253 -0.0032 -0.1143 0.0236  69  TRP A CH2 
413  N N   . ASP A 53  ? 0.5086 0.4578 0.2923 -0.0139 -0.0762 0.0859  70  ASP A N   
414  C CA  . ASP A 53  ? 0.5389 0.4917 0.2896 -0.0125 -0.0778 0.0956  70  ASP A CA  
415  C C   . ASP A 53  ? 0.5732 0.5117 0.3150 -0.0174 -0.0703 0.1174  70  ASP A C   
416  O O   . ASP A 53  ? 0.5675 0.4952 0.3296 -0.0237 -0.0639 0.1209  70  ASP A O   
417  C CB  . ASP A 53  ? 0.5514 0.5086 0.2921 -0.0040 -0.0963 0.0959  70  ASP A CB  
418  C CG  . ASP A 53  ? 0.5708 0.5147 0.3245 0.0034  -0.1066 0.1094  70  ASP A CG  
419  O OD1 . ASP A 53  ? 0.5816 0.5057 0.3428 0.0011  -0.0997 0.1212  70  ASP A OD1 
420  O OD2 . ASP A 53  ? 0.5638 0.5172 0.3205 0.0119  -0.1222 0.1085  70  ASP A OD2 
421  N N   . SER A 54  ? 0.6057 0.5428 0.3170 -0.0154 -0.0727 0.1322  71  SER A N   
422  C CA  . SER A 54  ? 0.6323 0.5557 0.3298 -0.0213 -0.0649 0.1551  71  SER A CA  
423  C C   . SER A 54  ? 0.6573 0.5519 0.3678 -0.0202 -0.0716 0.1694  71  SER A C   
424  O O   . SER A 54  ? 0.6783 0.5558 0.3828 -0.0289 -0.0637 0.1874  71  SER A O   
425  C CB  . SER A 54  ? 0.6564 0.5862 0.3137 -0.0180 -0.0664 0.1674  71  SER A CB  
426  O OG  . SER A 54  ? 0.6886 0.6119 0.3356 -0.0067 -0.0853 0.1744  71  SER A OG  
427  N N   . ARG A 55  ? 0.6358 0.5240 0.3632 -0.0097 -0.0851 0.1621  72  ARG A N   
428  C CA  . ARG A 55  ? 0.6572 0.5149 0.3953 -0.0052 -0.0905 0.1736  72  ARG A CA  
429  C C   . ARG A 55  ? 0.5994 0.4516 0.3700 -0.0059 -0.0897 0.1571  72  ARG A C   
430  O O   . ARG A 55  ? 0.5977 0.4240 0.3779 -0.0001 -0.0940 0.1616  72  ARG A O   
431  C CB  . ARG A 55  ? 0.7162 0.5718 0.4449 0.0120  -0.1068 0.1820  72  ARG A CB  
432  C CG  . ARG A 55  ? 0.8051 0.6657 0.4985 0.0145  -0.1105 0.1996  72  ARG A CG  
433  C CD  . ARG A 55  ? 0.8720 0.7166 0.5586 0.0312  -0.1249 0.2170  72  ARG A CD  
434  N NE  . ARG A 55  ? 0.9413 0.7988 0.5981 0.0370  -0.1285 0.2304  72  ARG A NE  
435  C CZ  . ARG A 55  ? 0.9909 0.8503 0.6447 0.0547  -0.1386 0.2417  72  ARG A CZ  
436  N NH1 . ARG A 55  ? 0.9977 0.8466 0.6763 0.0691  -0.1465 0.2428  72  ARG A NH1 
437  N NH2 . ARG A 55  ? 1.0258 0.8985 0.6504 0.0596  -0.1401 0.2520  72  ARG A NH2 
438  N N   . THR A 56  ? 0.5426 0.4155 0.3278 -0.0126 -0.0830 0.1392  73  THR A N   
439  C CA  . THR A 56  ? 0.5066 0.3806 0.3195 -0.0106 -0.0845 0.1225  73  THR A CA  
440  C C   . THR A 56  ? 0.4920 0.3783 0.3190 -0.0227 -0.0729 0.1107  73  THR A C   
441  O O   . THR A 56  ? 0.4794 0.3894 0.3038 -0.0245 -0.0682 0.1013  73  THR A O   
442  C CB  . THR A 56  ? 0.4873 0.3827 0.3086 0.0007  -0.0946 0.1090  73  THR A CB  
443  O OG1 . THR A 56  ? 0.5196 0.4157 0.3270 0.0120  -0.1066 0.1199  73  THR A OG1 
444  C CG2 . THR A 56  ? 0.4399 0.3332 0.2891 0.0053  -0.0965 0.0960  73  THR A CG2 
445  N N   . LEU A 57  ? 0.4862 0.3561 0.3282 -0.0296 -0.0696 0.1098  74  LEU A N   
446  C CA  . LEU A 57  ? 0.4944 0.3780 0.3538 -0.0391 -0.0617 0.0984  74  LEU A CA  
447  C C   . LEU A 57  ? 0.4691 0.3474 0.3468 -0.0329 -0.0671 0.0850  74  LEU A C   
448  O O   . LEU A 57  ? 0.4929 0.3468 0.3717 -0.0287 -0.0722 0.0877  74  LEU A O   
449  C CB  . LEU A 57  ? 0.5567 0.4314 0.4173 -0.0555 -0.0537 0.1089  74  LEU A CB  
450  C CG  . LEU A 57  ? 0.5673 0.4608 0.4481 -0.0658 -0.0468 0.0992  74  LEU A CG  
451  C CD1 . LEU A 57  ? 0.5822 0.5089 0.4636 -0.0616 -0.0397 0.0918  74  LEU A CD1 
452  C CD2 . LEU A 57  ? 0.5833 0.4724 0.4677 -0.0845 -0.0403 0.1111  74  LEU A CD2 
453  N N   . VAL A 58  ? 0.4397 0.3396 0.3296 -0.0305 -0.0656 0.0708  75  VAL A N   
454  C CA  . VAL A 58  ? 0.4229 0.3211 0.3295 -0.0253 -0.0690 0.0586  75  VAL A CA  
455  C C   . VAL A 58  ? 0.4298 0.3376 0.3492 -0.0345 -0.0626 0.0514  75  VAL A C   
456  O O   . VAL A 58  ? 0.4401 0.3684 0.3609 -0.0380 -0.0564 0.0492  75  VAL A O   
457  C CB  . VAL A 58  ? 0.3905 0.3062 0.3022 -0.0154 -0.0735 0.0491  75  VAL A CB  
458  C CG1 . VAL A 58  ? 0.3710 0.2880 0.2999 -0.0109 -0.0747 0.0383  75  VAL A CG1 
459  C CG2 . VAL A 58  ? 0.3911 0.3058 0.2919 -0.0065 -0.0818 0.0562  75  VAL A CG2 
460  N N   . ARG A 59  ? 0.4239 0.3181 0.3520 -0.0365 -0.0644 0.0467  76  ARG A N   
461  C CA  . ARG A 59  ? 0.4196 0.3258 0.3607 -0.0426 -0.0614 0.0380  76  ARG A CA  
462  C C   . ARG A 59  ? 0.4056 0.3127 0.3545 -0.0328 -0.0644 0.0269  76  ARG A C   
463  O O   . ARG A 59  ? 0.4163 0.3059 0.3626 -0.0253 -0.0686 0.0255  76  ARG A O   
464  C CB  . ARG A 59  ? 0.4407 0.3315 0.3827 -0.0560 -0.0616 0.0413  76  ARG A CB  
465  C CG  . ARG A 59  ? 0.4845 0.3774 0.4214 -0.0683 -0.0572 0.0542  76  ARG A CG  
466  C CD  . ARG A 59  ? 0.5510 0.4266 0.4900 -0.0846 -0.0591 0.0572  76  ARG A CD  
467  N NE  . ARG A 59  ? 0.5946 0.4845 0.5354 -0.0996 -0.0527 0.0699  76  ARG A NE  
468  C CZ  . ARG A 59  ? 0.6232 0.4979 0.5516 -0.1058 -0.0503 0.0847  76  ARG A CZ  
469  N NH1 . ARG A 59  ? 0.6370 0.4775 0.5490 -0.0978 -0.0552 0.0897  76  ARG A NH1 
470  N NH2 . ARG A 59  ? 0.6328 0.5284 0.5662 -0.1204 -0.0425 0.0960  76  ARG A NH2 
471  N N   . LEU A 60  ? 0.3748 0.3021 0.3333 -0.0324 -0.0614 0.0198  77  LEU A N   
472  C CA  . LEU A 60  ? 0.3550 0.2861 0.3210 -0.0254 -0.0625 0.0108  77  LEU A CA  
473  C C   . LEU A 60  ? 0.3671 0.3016 0.3386 -0.0314 -0.0617 0.0062  77  LEU A C   
474  O O   . LEU A 60  ? 0.4022 0.3528 0.3791 -0.0373 -0.0586 0.0078  77  LEU A O   
475  C CB  . LEU A 60  ? 0.3362 0.2858 0.3072 -0.0205 -0.0603 0.0072  77  LEU A CB  
476  C CG  . LEU A 60  ? 0.3414 0.2931 0.3062 -0.0162 -0.0627 0.0098  77  LEU A CG  
477  C CD1 . LEU A 60  ? 0.3307 0.2957 0.2996 -0.0144 -0.0608 0.0038  77  LEU A CD1 
478  C CD2 . LEU A 60  ? 0.3411 0.2839 0.3058 -0.0086 -0.0685 0.0113  77  LEU A CD2 
479  N N   . GLN A 61  ? 0.3493 0.2701 0.3185 -0.0286 -0.0644 0.0006  78  GLN A N   
480  C CA  . GLN A 61  ? 0.3453 0.2702 0.3165 -0.0322 -0.0650 -0.0057 78  GLN A CA  
481  C C   . GLN A 61  ? 0.3277 0.2684 0.3050 -0.0228 -0.0621 -0.0099 78  GLN A C   
482  O O   . GLN A 61  ? 0.3145 0.2501 0.2909 -0.0133 -0.0614 -0.0133 78  GLN A O   
483  C CB  . GLN A 61  ? 0.3994 0.2990 0.3603 -0.0329 -0.0687 -0.0112 78  GLN A CB  
484  C CG  . GLN A 61  ? 0.4421 0.3442 0.4000 -0.0382 -0.0711 -0.0189 78  GLN A CG  
485  C CD  . GLN A 61  ? 0.4957 0.3681 0.4384 -0.0359 -0.0740 -0.0276 78  GLN A CD  
486  O OE1 . GLN A 61  ? 0.5130 0.3766 0.4516 -0.0219 -0.0711 -0.0313 78  GLN A OE1 
487  N NE2 . GLN A 61  ? 0.5186 0.3770 0.4528 -0.0496 -0.0798 -0.0319 78  GLN A NE2 
488  N N   . LEU A 62  ? 0.3178 0.2777 0.3022 -0.0249 -0.0595 -0.0083 79  LEU A N   
489  C CA  . LEU A 62  ? 0.2993 0.2708 0.2885 -0.0184 -0.0565 -0.0103 79  LEU A CA  
490  C C   . LEU A 62  ? 0.2916 0.2672 0.2788 -0.0182 -0.0573 -0.0136 79  LEU A C   
491  O O   . LEU A 62  ? 0.3102 0.2936 0.2979 -0.0242 -0.0599 -0.0128 79  LEU A O   
492  C CB  . LEU A 62  ? 0.2987 0.2826 0.2936 -0.0175 -0.0529 -0.0071 79  LEU A CB  
493  C CG  . LEU A 62  ? 0.3077 0.2885 0.3005 -0.0169 -0.0521 -0.0052 79  LEU A CG  
494  C CD1 . LEU A 62  ? 0.3040 0.2944 0.2975 -0.0180 -0.0480 -0.0025 79  LEU A CD1 
495  C CD2 . LEU A 62  ? 0.3060 0.2848 0.3000 -0.0120 -0.0526 -0.0076 79  LEU A CD2 
496  N N   . TRP A 63  ? 0.2911 0.2632 0.2754 -0.0114 -0.0554 -0.0171 80  TRP A N   
497  C CA  . TRP A 63  ? 0.3095 0.2854 0.2879 -0.0092 -0.0549 -0.0202 80  TRP A CA  
498  C C   . TRP A 63  ? 0.3072 0.2966 0.2923 -0.0053 -0.0501 -0.0154 80  TRP A C   
499  O O   . TRP A 63  ? 0.2898 0.2802 0.2799 -0.0013 -0.0460 -0.0144 80  TRP A O   
500  C CB  . TRP A 63  ? 0.3120 0.2767 0.2820 -0.0027 -0.0532 -0.0262 80  TRP A CB  
501  C CG  . TRP A 63  ? 0.3488 0.2927 0.3068 -0.0062 -0.0583 -0.0323 80  TRP A CG  
502  C CD1 . TRP A 63  ? 0.3661 0.2971 0.3251 -0.0118 -0.0619 -0.0303 80  TRP A CD1 
503  C CD2 . TRP A 63  ? 0.3766 0.3067 0.3180 -0.0045 -0.0596 -0.0413 80  TRP A CD2 
504  N NE1 . TRP A 63  ? 0.4015 0.3095 0.3469 -0.0153 -0.0659 -0.0369 80  TRP A NE1 
505  C CE2 . TRP A 63  ? 0.4054 0.3112 0.3387 -0.0107 -0.0650 -0.0450 80  TRP A CE2 
506  C CE3 . TRP A 63  ? 0.3862 0.3208 0.3159 0.0009  -0.0567 -0.0465 80  TRP A CE3 
507  C CZ2 . TRP A 63  ? 0.4386 0.3204 0.3519 -0.0120 -0.0684 -0.0559 80  TRP A CZ2 
508  C CZ3 . TRP A 63  ? 0.4255 0.3398 0.3340 0.0010  -0.0596 -0.0577 80  TRP A CZ3 
509  C CH2 . TRP A 63  ? 0.4445 0.3299 0.3446 -0.0052 -0.0657 -0.0634 80  TRP A CH2 
510  N N   . ASP A 64  ? 0.3084 0.3077 0.2941 -0.0068 -0.0511 -0.0118 81  ASP A N   
511  C CA  . ASP A 64  ? 0.3094 0.3168 0.2987 -0.0024 -0.0468 -0.0056 81  ASP A CA  
512  C C   . ASP A 64  ? 0.3102 0.3209 0.2897 0.0007  -0.0457 -0.0052 81  ASP A C   
513  O O   . ASP A 64  ? 0.3524 0.3698 0.3246 -0.0002 -0.0502 -0.0050 81  ASP A O   
514  C CB  . ASP A 64  ? 0.2971 0.3140 0.2920 -0.0026 -0.0486 -0.0008 81  ASP A CB  
515  C CG  . ASP A 64  ? 0.3314 0.3514 0.3287 0.0041  -0.0445 0.0065  81  ASP A CG  
516  O OD1 . ASP A 64  ? 0.3496 0.3623 0.3449 0.0062  -0.0399 0.0086  81  ASP A OD1 
517  O OD2 . ASP A 64  ? 0.3392 0.3700 0.3410 0.0075  -0.0459 0.0114  81  ASP A OD2 
518  N N   . ILE A 65  ? 0.2965 0.3051 0.2756 0.0039  -0.0397 -0.0050 82  ILE A N   
519  C CA  . ILE A 65  ? 0.2974 0.3102 0.2651 0.0075  -0.0362 -0.0043 82  ILE A CA  
520  C C   . ILE A 65  ? 0.3135 0.3315 0.2820 0.0092  -0.0326 0.0063  82  ILE A C   
521  O O   . ILE A 65  ? 0.2946 0.3090 0.2739 0.0080  -0.0288 0.0113  82  ILE A O   
522  C CB  . ILE A 65  ? 0.2876 0.2997 0.2567 0.0109  -0.0301 -0.0081 82  ILE A CB  
523  C CG1 . ILE A 65  ? 0.3232 0.3245 0.2862 0.0117  -0.0348 -0.0183 82  ILE A CG1 
524  C CG2 . ILE A 65  ? 0.2797 0.2996 0.2386 0.0156  -0.0227 -0.0054 82  ILE A CG2 
525  C CD1 . ILE A 65  ? 0.3185 0.3182 0.2911 0.0158  -0.0315 -0.0204 82  ILE A CD1 
526  N N   . ALA A 66  ? 0.3493 0.3737 0.3051 0.0116  -0.0351 0.0096  83  ALA A N   
527  C CA  . ALA A 66  ? 0.3533 0.3809 0.3071 0.0150  -0.0324 0.0218  83  ALA A CA  
528  C C   . ALA A 66  ? 0.3403 0.3660 0.2931 0.0153  -0.0220 0.0279  83  ALA A C   
529  O O   . ALA A 66  ? 0.3165 0.3466 0.2633 0.0159  -0.0175 0.0233  83  ALA A O   
530  C CB  . ALA A 66  ? 0.3603 0.3981 0.2985 0.0179  -0.0386 0.0244  83  ALA A CB  
531  N N   . GLY A 67  ? 0.3396 0.3594 0.2966 0.0157  -0.0181 0.0394  84  GLY A N   
532  C CA  . GLY A 67  ? 0.3442 0.3608 0.3032 0.0128  -0.0084 0.0486  84  GLY A CA  
533  C C   . GLY A 67  ? 0.3498 0.3776 0.2945 0.0148  -0.0015 0.0534  84  GLY A C   
534  O O   . GLY A 67  ? 0.3346 0.3674 0.2855 0.0107  0.0076  0.0561  84  GLY A O   
535  N N   . LEU A 68  ? 0.3607 0.3952 0.2858 0.0207  -0.0058 0.0545  85  LEU A N   
536  C CA  . LEU A 68  ? 0.4040 0.4493 0.3099 0.0236  0.0014  0.0573  85  LEU A CA  
537  C C   . LEU A 68  ? 0.4050 0.4578 0.3054 0.0254  0.0043  0.0425  85  LEU A C   
538  O O   . LEU A 68  ? 0.4133 0.4754 0.2970 0.0294  0.0126  0.0436  85  LEU A O   
539  C CB  . LEU A 68  ? 0.4346 0.4849 0.3167 0.0294  -0.0043 0.0643  85  LEU A CB  
540  C CG  . LEU A 68  ? 0.4701 0.5136 0.3518 0.0316  -0.0031 0.0838  85  LEU A CG  
541  C CD1 . LEU A 68  ? 0.5026 0.5561 0.3607 0.0389  -0.0119 0.0896  85  LEU A CD1 
542  C CD2 . LEU A 68  ? 0.4834 0.5230 0.3657 0.0277  0.0115  0.0983  85  LEU A CD2 
543  N N   . GLU A 69  ? 0.4027 0.4505 0.3146 0.0240  -0.0015 0.0292  86  GLU A N   
544  C CA  . GLU A 69  ? 0.4215 0.4699 0.3213 0.0285  -0.0015 0.0143  86  GLU A CA  
545  C C   . GLU A 69  ? 0.4211 0.4793 0.3265 0.0326  0.0121  0.0135  86  GLU A C   
546  O O   . GLU A 69  ? 0.4266 0.4862 0.3146 0.0402  0.0161  0.0038  86  GLU A O   
547  C CB  . GLU A 69  ? 0.4360 0.4732 0.3433 0.0258  -0.0123 0.0020  86  GLU A CB  
548  C CG  . GLU A 69  ? 0.4566 0.4912 0.3547 0.0224  -0.0252 0.0008  86  GLU A CG  
549  C CD  . GLU A 69  ? 0.4907 0.5286 0.3598 0.0249  -0.0292 -0.0036 86  GLU A CD  
550  O OE1 . GLU A 69  ? 0.5309 0.5632 0.3821 0.0287  -0.0260 -0.0154 86  GLU A OE1 
551  O OE2 . GLU A 69  ? 0.5079 0.5539 0.3703 0.0239  -0.0361 0.0044  86  GLU A OE2 
552  N N   . ARG A 70  ? 0.4161 0.4822 0.3426 0.0279  0.0198  0.0245  87  ARG A N   
553  C CA  . ARG A 70  ? 0.4192 0.5025 0.3560 0.0307  0.0330  0.0266  87  ARG A CA  
554  C C   . ARG A 70  ? 0.4435 0.5394 0.3598 0.0353  0.0450  0.0342  87  ARG A C   
555  O O   . ARG A 70  ? 0.4520 0.5658 0.3727 0.0403  0.0577  0.0346  87  ARG A O   
556  C CB  . ARG A 70  ? 0.4010 0.4918 0.3683 0.0208  0.0362  0.0361  87  ARG A CB  
557  C CG  . ARG A 70  ? 0.4011 0.4887 0.3710 0.0109  0.0396  0.0529  87  ARG A CG  
558  C CD  . ARG A 70  ? 0.4043 0.4967 0.4035 -0.0007 0.0411  0.0580  87  ARG A CD  
559  N NE  . ARG A 70  ? 0.4265 0.5107 0.4294 -0.0122 0.0450  0.0737  87  ARG A NE  
560  C CZ  . ARG A 70  ? 0.4559 0.5529 0.4590 -0.0173 0.0576  0.0880  87  ARG A CZ  
561  N NH1 . ARG A 70  ? 0.4651 0.5883 0.4654 -0.0108 0.0692  0.0887  87  ARG A NH1 
562  N NH2 . ARG A 70  ? 0.4740 0.5560 0.4799 -0.0291 0.0598  0.1025  87  ARG A NH2 
563  N N   . PHE A 71  ? 0.4669 0.5565 0.3618 0.0343  0.0416  0.0418  88  PHE A N   
564  C CA  . PHE A 71  ? 0.4997 0.6007 0.3684 0.0396  0.0523  0.0494  88  PHE A CA  
565  C C   . PHE A 71  ? 0.5280 0.6252 0.3632 0.0498  0.0484  0.0333  88  PHE A C   
566  O O   . PHE A 71  ? 0.5636 0.6711 0.3734 0.0567  0.0587  0.0345  88  PHE A O   
567  C CB  . PHE A 71  ? 0.5002 0.5963 0.3600 0.0345  0.0505  0.0677  88  PHE A CB  
568  C CG  . PHE A 71  ? 0.4903 0.5847 0.3767 0.0239  0.0559  0.0834  88  PHE A CG  
569  C CD1 . PHE A 71  ? 0.5168 0.6274 0.4113 0.0193  0.0722  0.0962  88  PHE A CD1 
570  C CD2 . PHE A 71  ? 0.4777 0.5543 0.3807 0.0177  0.0452  0.0849  88  PHE A CD2 
571  C CE1 . PHE A 71  ? 0.5286 0.6348 0.4473 0.0061  0.0760  0.1102  88  PHE A CE1 
572  C CE2 . PHE A 71  ? 0.4842 0.5535 0.4087 0.0068  0.0494  0.0972  88  PHE A CE2 
573  C CZ  . PHE A 71  ? 0.5125 0.5953 0.4448 -0.0002 0.0640  0.1097  88  PHE A CZ  
574  N N   . GLY A 72  ? 0.5175 0.5989 0.3511 0.0495  0.0338  0.0184  89  GLY A N   
575  C CA  . GLY A 72  ? 0.5550 0.6266 0.3589 0.0557  0.0276  0.0007  89  GLY A CA  
576  C C   . GLY A 72  ? 0.5941 0.6627 0.4005 0.0648  0.0357  -0.0142 89  GLY A C   
577  O O   . GLY A 72  ? 0.5864 0.6695 0.4146 0.0684  0.0488  -0.0085 89  GLY A O   
578  N N   . ASN A 73  ? 0.6338 0.6833 0.4184 0.0684  0.0274  -0.0329 90  ASN A N   
579  C CA  . ASN A 73  ? 0.6732 0.7142 0.4509 0.0812  0.0360  -0.0485 90  ASN A CA  
580  C C   . ASN A 73  ? 0.6433 0.6573 0.4270 0.0793  0.0236  -0.0632 90  ASN A C   
581  O O   . ASN A 73  ? 0.6905 0.6857 0.4561 0.0892  0.0259  -0.0794 90  ASN A O   
582  C CB  . ASN A 73  ? 0.7510 0.7890 0.4845 0.0913  0.0428  -0.0594 90  ASN A CB  
583  C CG  . ASN A 73  ? 0.7855 0.8066 0.4866 0.0830  0.0253  -0.0685 90  ASN A CG  
584  O OD1 . ASN A 73  ? 0.7811 0.7832 0.4872 0.0734  0.0086  -0.0765 90  ASN A OD1 
585  N ND2 . ASN A 73  ? 0.8604 0.8912 0.5276 0.0861  0.0291  -0.0665 90  ASN A ND2 
586  N N   . MET A 74  ? 0.5717 0.5820 0.3787 0.0670  0.0114  -0.0569 91  MET A N   
587  C CA  . MET A 74  ? 0.5641 0.5497 0.3750 0.0612  -0.0018 -0.0674 91  MET A CA  
588  C C   . MET A 74  ? 0.5078 0.4950 0.3538 0.0603  -0.0014 -0.0613 91  MET A C   
589  O O   . MET A 74  ? 0.5380 0.5045 0.3877 0.0567  -0.0104 -0.0683 91  MET A O   
590  C CB  . MET A 74  ? 0.6040 0.5873 0.4108 0.0462  -0.0181 -0.0647 91  MET A CB  
591  C CG  . MET A 74  ? 0.6913 0.6667 0.4610 0.0440  -0.0257 -0.0754 91  MET A CG  
592  S SD  . MET A 74  ? 0.7271 0.6940 0.4935 0.0261  -0.0480 -0.0798 91  MET A SD  
593  C CE  . MET A 74  ? 0.7810 0.7182 0.5607 0.0221  -0.0521 -0.0906 91  MET A CE  
594  N N   . THR A 75  ? 0.4435 0.4539 0.3146 0.0615  0.0075  -0.0480 92  THR A N   
595  C CA  . THR A 75  ? 0.4161 0.4292 0.3181 0.0590  0.0054  -0.0427 92  THR A CA  
596  C C   . THR A 75  ? 0.4334 0.4339 0.3386 0.0705  0.0073  -0.0520 92  THR A C   
597  O O   . THR A 75  ? 0.4193 0.4087 0.3382 0.0667  -0.0008 -0.0519 92  THR A O   
598  C CB  . THR A 75  ? 0.3791 0.4192 0.3075 0.0562  0.0138  -0.0278 92  THR A CB  
599  O OG1 . THR A 75  ? 0.3312 0.3900 0.2590 0.0665  0.0283  -0.0261 92  THR A OG1 
600  C CG2 . THR A 75  ? 0.3507 0.3962 0.2790 0.0452  0.0109  -0.0169 92  THR A CG2 
601  N N   . ARG A 76  ? 0.4682 0.4680 0.3582 0.0856  0.0178  -0.0601 93  ARG A N   
602  C CA  . ARG A 76  ? 0.5090 0.4916 0.3989 0.0997  0.0193  -0.0694 93  ARG A CA  
603  C C   . ARG A 76  ? 0.5054 0.4493 0.3797 0.0927  0.0052  -0.0794 93  ARG A C   
604  O O   . ARG A 76  ? 0.5026 0.4337 0.3901 0.0947  0.0003  -0.0785 93  ARG A O   
605  C CB  . ARG A 76  ? 0.5810 0.5660 0.4533 0.1200  0.0342  -0.0783 93  ARG A CB  
606  C CG  . ARG A 76  ? 0.6450 0.6150 0.5217 0.1392  0.0380  -0.0856 93  ARG A CG  
607  C CD  . ARG A 76  ? 0.7253 0.7068 0.5916 0.1628  0.0561  -0.0920 93  ARG A CD  
608  N NE  . ARG A 76  ? 0.7381 0.7694 0.6380 0.1693  0.0693  -0.0774 93  ARG A NE  
609  C CZ  . ARG A 76  ? 0.7551 0.8204 0.6560 0.1678  0.0823  -0.0699 93  ARG A CZ  
610  N NH1 . ARG A 76  ? 0.7820 0.8384 0.6497 0.1614  0.0840  -0.0746 93  ARG A NH1 
611  N NH2 . ARG A 76  ? 0.7305 0.8413 0.6663 0.1718  0.0936  -0.0560 93  ARG A NH2 
612  N N   . VAL A 77  ? 0.5226 0.4508 0.3714 0.0825  -0.0023 -0.0867 94  VAL A N   
613  C CA  . VAL A 77  ? 0.5366 0.4322 0.3742 0.0713  -0.0164 -0.0945 94  VAL A CA  
614  C C   . VAL A 77  ? 0.5093 0.4132 0.3735 0.0573  -0.0252 -0.0824 94  VAL A C   
615  O O   . VAL A 77  ? 0.5357 0.4183 0.4040 0.0540  -0.0317 -0.0836 94  VAL A O   
616  C CB  . VAL A 77  ? 0.5777 0.4600 0.3837 0.0614  -0.0242 -0.1050 94  VAL A CB  
617  C CG1 . VAL A 77  ? 0.5860 0.4403 0.3865 0.0451  -0.0397 -0.1106 94  VAL A CG1 
618  C CG2 . VAL A 77  ? 0.6333 0.4985 0.4067 0.0764  -0.0159 -0.1206 94  VAL A CG2 
619  N N   . TYR A 78  ? 0.4632 0.3955 0.3430 0.0496  -0.0249 -0.0705 95  TYR A N   
620  C CA  . TYR A 78  ? 0.4265 0.3656 0.3276 0.0377  -0.0322 -0.0607 95  TYR A CA  
621  C C   . TYR A 78  ? 0.4172 0.3565 0.3389 0.0424  -0.0308 -0.0557 95  TYR A C   
622  O O   . TYR A 78  ? 0.4018 0.3339 0.3323 0.0341  -0.0380 -0.0520 95  TYR A O   
623  C CB  . TYR A 78  ? 0.4077 0.3737 0.3209 0.0321  -0.0300 -0.0492 95  TYR A CB  
624  C CG  . TYR A 78  ? 0.4547 0.4259 0.3507 0.0269  -0.0335 -0.0496 95  TYR A CG  
625  C CD1 . TYR A 78  ? 0.4832 0.4393 0.3594 0.0205  -0.0430 -0.0591 95  TYR A CD1 
626  C CD2 . TYR A 78  ? 0.4565 0.4484 0.3563 0.0274  -0.0282 -0.0393 95  TYR A CD2 
627  C CE1 . TYR A 78  ? 0.5061 0.4717 0.3670 0.0158  -0.0481 -0.0587 95  TYR A CE1 
628  C CE2 . TYR A 78  ? 0.4755 0.4739 0.3591 0.0243  -0.0321 -0.0374 95  TYR A CE2 
629  C CZ  . TYR A 78  ? 0.5103 0.4982 0.3757 0.0186  -0.0428 -0.0468 95  TYR A CZ  
630  O OH  . TYR A 78  ? 0.5490 0.5483 0.3994 0.0160  -0.0480 -0.0435 95  TYR A OH  
631  N N   . TYR A 79  ? 0.3971 0.3504 0.3284 0.0552  -0.0212 -0.0536 96  TYR A N   
632  C CA  . TYR A 79  ? 0.3872 0.3480 0.3404 0.0601  -0.0210 -0.0473 96  TYR A CA  
633  C C   . TYR A 79  ? 0.4205 0.3549 0.3671 0.0698  -0.0239 -0.0530 96  TYR A C   
634  O O   . TYR A 79  ? 0.4134 0.3500 0.3749 0.0724  -0.0271 -0.0468 96  TYR A O   
635  C CB  . TYR A 79  ? 0.3622 0.3526 0.3317 0.0697  -0.0104 -0.0421 96  TYR A CB  
636  C CG  . TYR A 79  ? 0.3385 0.3536 0.3172 0.0606  -0.0061 -0.0339 96  TYR A CG  
637  C CD1 . TYR A 79  ? 0.3274 0.3399 0.3063 0.0462  -0.0128 -0.0295 96  TYR A CD1 
638  C CD2 . TYR A 79  ? 0.3438 0.3847 0.3320 0.0671  0.0054  -0.0295 96  TYR A CD2 
639  C CE1 . TYR A 79  ? 0.3377 0.3670 0.3235 0.0393  -0.0086 -0.0212 96  TYR A CE1 
640  C CE2 . TYR A 79  ? 0.3529 0.4130 0.3497 0.0571  0.0096  -0.0199 96  TYR A CE2 
641  C CZ  . TYR A 79  ? 0.3538 0.4051 0.3480 0.0437  0.0023  -0.0160 96  TYR A CZ  
642  O OH  . TYR A 79  ? 0.3685 0.4325 0.3685 0.0355  0.0068  -0.0064 96  TYR A OH  
643  N N   . LYS A 80  ? 0.4645 0.3723 0.3872 0.0754  -0.0232 -0.0643 97  LYS A N   
644  C CA  . LYS A 80  ? 0.5350 0.4130 0.4494 0.0875  -0.0240 -0.0696 97  LYS A CA  
645  C C   . LYS A 80  ? 0.5416 0.4042 0.4643 0.0796  -0.0338 -0.0623 97  LYS A C   
646  O O   . LYS A 80  ? 0.5345 0.3902 0.4544 0.0614  -0.0418 -0.0601 97  LYS A O   
647  C CB  . LYS A 80  ? 0.6233 0.4667 0.5052 0.0890  -0.0243 -0.0849 97  LYS A CB  
648  C CG  . LYS A 80  ? 0.6955 0.4998 0.5624 0.1045  -0.0231 -0.0932 97  LYS A CG  
649  C CD  . LYS A 80  ? 0.7682 0.5343 0.5989 0.1000  -0.0258 -0.1105 97  LYS A CD  
650  C CE  . LYS A 80  ? 0.7942 0.5750 0.6075 0.1084  -0.0163 -0.1205 97  LYS A CE  
651  N NZ  . LYS A 80  ? 0.8101 0.6180 0.6359 0.1329  -0.0007 -0.1175 97  LYS A NZ  
652  N N   . GLU A 81  ? 0.5667 0.4280 0.5003 0.0944  -0.0325 -0.0572 98  GLU A N   
653  C CA  . GLU A 81  ? 0.6007 0.4509 0.5416 0.0910  -0.0406 -0.0479 98  GLU A CA  
654  C C   . GLU A 81  ? 0.5160 0.3936 0.4750 0.0760  -0.0460 -0.0369 98  GLU A C   
655  O O   . GLU A 81  ? 0.5085 0.3762 0.4687 0.0709  -0.0526 -0.0295 98  GLU A O   
656  C CB  . GLU A 81  ? 0.7208 0.5226 0.6382 0.0848  -0.0463 -0.0533 98  GLU A CB  
657  C CG  . GLU A 81  ? 0.8465 0.6160 0.7458 0.1051  -0.0408 -0.0641 98  GLU A CG  
658  C CD  . GLU A 81  ? 0.9633 0.6826 0.8331 0.0957  -0.0452 -0.0757 98  GLU A CD  
659  O OE1 . GLU A 81  ? 1.0128 0.7133 0.8789 0.0766  -0.0539 -0.0708 98  GLU A OE1 
660  O OE2 . GLU A 81  ? 1.0391 0.7364 0.8880 0.1072  -0.0398 -0.0901 98  GLU A OE2 
661  N N   . ALA A 82  ? 0.4296 0.3405 0.4014 0.0703  -0.0424 -0.0353 99  ALA A N   
662  C CA  . ALA A 82  ? 0.3578 0.2895 0.3440 0.0584  -0.0470 -0.0268 99  ALA A CA  
663  C C   . ALA A 82  ? 0.3396 0.2848 0.3409 0.0678  -0.0498 -0.0192 99  ALA A C   
664  O O   . ALA A 82  ? 0.3044 0.2616 0.3148 0.0832  -0.0455 -0.0192 99  ALA A O   
665  C CB  . ALA A 82  ? 0.3118 0.2715 0.3081 0.0514  -0.0424 -0.0262 99  ALA A CB  
666  N N   . VAL A 83  ? 0.3199 0.2667 0.3239 0.0593  -0.0569 -0.0125 100 VAL A N   
667  C CA  . VAL A 83  ? 0.3091 0.2719 0.3257 0.0663  -0.0624 -0.0044 100 VAL A CA  
668  C C   . VAL A 83  ? 0.2717 0.2642 0.3021 0.0546  -0.0652 -0.0016 100 VAL A C   
669  O O   . VAL A 83  ? 0.2843 0.2965 0.3267 0.0576  -0.0707 0.0037  100 VAL A O   
670  C CB  . VAL A 83  ? 0.3245 0.2625 0.3286 0.0675  -0.0694 0.0020  100 VAL A CB  
671  C CG1 . VAL A 83  ? 0.3439 0.2520 0.3375 0.0828  -0.0676 0.0008  100 VAL A CG1 
672  C CG2 . VAL A 83  ? 0.3026 0.2244 0.2929 0.0501  -0.0712 0.0022  100 VAL A CG2 
673  N N   . GLY A 84  ? 0.2643 0.2590 0.2924 0.0418  -0.0620 -0.0054 101 GLY A N   
674  C CA  . GLY A 84  ? 0.2555 0.2717 0.2943 0.0309  -0.0639 -0.0041 101 GLY A CA  
675  C C   . GLY A 84  ? 0.2629 0.2802 0.3009 0.0232  -0.0571 -0.0079 101 GLY A C   
676  O O   . GLY A 84  ? 0.2689 0.2714 0.2958 0.0239  -0.0531 -0.0112 101 GLY A O   
677  N N   . ALA A 85  ? 0.2542 0.2876 0.3029 0.0151  -0.0567 -0.0070 102 ALA A N   
678  C CA  . ALA A 85  ? 0.2594 0.2906 0.3058 0.0077  -0.0508 -0.0083 102 ALA A CA  
679  C C   . ALA A 85  ? 0.2872 0.3205 0.3366 -0.0036 -0.0534 -0.0080 102 ALA A C   
680  O O   . ALA A 85  ? 0.3142 0.3596 0.3730 -0.0075 -0.0587 -0.0071 102 ALA A O   
681  C CB  . ALA A 85  ? 0.2497 0.2944 0.3043 0.0117  -0.0426 -0.0072 102 ALA A CB  
682  N N   . PHE A 86  ? 0.2975 0.3173 0.3371 -0.0082 -0.0504 -0.0092 103 PHE A N   
683  C CA  . PHE A 86  ? 0.2900 0.3064 0.3311 -0.0171 -0.0495 -0.0092 103 PHE A CA  
684  C C   . PHE A 86  ? 0.2702 0.2903 0.3166 -0.0187 -0.0420 -0.0052 103 PHE A C   
685  O O   . PHE A 86  ? 0.2598 0.2776 0.3001 -0.0131 -0.0373 -0.0038 103 PHE A O   
686  C CB  . PHE A 86  ? 0.2996 0.2988 0.3269 -0.0176 -0.0491 -0.0114 103 PHE A CB  
687  C CG  . PHE A 86  ? 0.3516 0.3464 0.3707 -0.0177 -0.0547 -0.0144 103 PHE A CG  
688  C CD1 . PHE A 86  ? 0.3624 0.3590 0.3816 -0.0234 -0.0606 -0.0171 103 PHE A CD1 
689  C CD2 . PHE A 86  ? 0.3956 0.3850 0.4057 -0.0133 -0.0541 -0.0138 103 PHE A CD2 
690  C CE1 . PHE A 86  ? 0.3810 0.3737 0.3886 -0.0232 -0.0655 -0.0192 103 PHE A CE1 
691  C CE2 . PHE A 86  ? 0.4109 0.3971 0.4120 -0.0138 -0.0580 -0.0145 103 PHE A CE2 
692  C CZ  . PHE A 86  ? 0.3920 0.3793 0.3900 -0.0178 -0.0633 -0.0173 103 PHE A CZ  
693  N N   . VAL A 87  ? 0.2684 0.2947 0.3254 -0.0277 -0.0414 -0.0029 104 VAL A N   
694  C CA  . VAL A 87  ? 0.2563 0.2860 0.3184 -0.0313 -0.0336 0.0032  104 VAL A CA  
695  C C   . VAL A 87  ? 0.2733 0.2820 0.3301 -0.0412 -0.0341 0.0034  104 VAL A C   
696  O O   . VAL A 87  ? 0.2334 0.2381 0.2928 -0.0498 -0.0402 -0.0008 104 VAL A O   
697  C CB  . VAL A 87  ? 0.2353 0.2920 0.3170 -0.0346 -0.0310 0.0077  104 VAL A CB  
698  C CG1 . VAL A 87  ? 0.2307 0.2914 0.3147 -0.0377 -0.0206 0.0160  104 VAL A CG1 
699  C CG2 . VAL A 87  ? 0.2098 0.2827 0.2949 -0.0218 -0.0306 0.0060  104 VAL A CG2 
700  N N   . VAL A 88  ? 0.2758 0.2692 0.3222 -0.0375 -0.0287 0.0072  105 VAL A N   
701  C CA  . VAL A 88  ? 0.2476 0.2146 0.2833 -0.0391 -0.0286 0.0062  105 VAL A CA  
702  C C   . VAL A 88  ? 0.2645 0.2224 0.3019 -0.0452 -0.0221 0.0154  105 VAL A C   
703  O O   . VAL A 88  ? 0.2616 0.2315 0.3009 -0.0421 -0.0163 0.0235  105 VAL A O   
704  C CB  . VAL A 88  ? 0.2439 0.2016 0.2667 -0.0270 -0.0280 0.0048  105 VAL A CB  
705  C CG1 . VAL A 88  ? 0.2637 0.1951 0.2767 -0.0257 -0.0266 0.0036  105 VAL A CG1 
706  C CG2 . VAL A 88  ? 0.2488 0.2147 0.2698 -0.0233 -0.0333 -0.0023 105 VAL A CG2 
707  N N   . PHE A 89  ? 0.2865 0.2219 0.3219 -0.0551 -0.0233 0.0142  106 PHE A N   
708  C CA  . PHE A 89  ? 0.3110 0.2264 0.3436 -0.0605 -0.0170 0.0241  106 PHE A CA  
709  C C   . PHE A 89  ? 0.3740 0.2517 0.3919 -0.0580 -0.0178 0.0197  106 PHE A C   
710  O O   . PHE A 89  ? 0.3699 0.2394 0.3806 -0.0548 -0.0228 0.0083  106 PHE A O   
711  C CB  . PHE A 89  ? 0.3209 0.2467 0.3690 -0.0784 -0.0152 0.0303  106 PHE A CB  
712  C CG  . PHE A 89  ? 0.3410 0.2574 0.3947 -0.0951 -0.0231 0.0217  106 PHE A CG  
713  C CD1 . PHE A 89  ? 0.3186 0.2579 0.3809 -0.0974 -0.0318 0.0123  106 PHE A CD1 
714  C CD2 . PHE A 89  ? 0.3726 0.2542 0.4208 -0.1092 -0.0227 0.0233  106 PHE A CD2 
715  C CE1 . PHE A 89  ? 0.3449 0.2772 0.4099 -0.1134 -0.0410 0.0040  106 PHE A CE1 
716  C CE2 . PHE A 89  ? 0.3914 0.2635 0.4429 -0.1274 -0.0316 0.0138  106 PHE A CE2 
717  C CZ  . PHE A 89  ? 0.3720 0.2719 0.4321 -0.1298 -0.0414 0.0039  106 PHE A CZ  
718  N N   . ASP A 90  ? 0.3839 0.2370 0.3955 -0.0586 -0.0119 0.0297  107 ASP A N   
719  C CA  . ASP A 90  ? 0.4152 0.2267 0.4116 -0.0539 -0.0108 0.0273  107 ASP A CA  
720  C C   . ASP A 90  ? 0.4290 0.2137 0.4263 -0.0747 -0.0126 0.0252  107 ASP A C   
721  O O   . ASP A 90  ? 0.4444 0.2252 0.4481 -0.0869 -0.0083 0.0373  107 ASP A O   
722  C CB  . ASP A 90  ? 0.4738 0.2758 0.4627 -0.0398 -0.0039 0.0418  107 ASP A CB  
723  C CG  . ASP A 90  ? 0.4985 0.2554 0.4720 -0.0304 -0.0011 0.0423  107 ASP A CG  
724  O OD1 . ASP A 90  ? 0.5090 0.2344 0.4749 -0.0374 -0.0033 0.0312  107 ASP A OD1 
725  O OD2 . ASP A 90  ? 0.5310 0.2848 0.4987 -0.0145 0.0032  0.0545  107 ASP A OD2 
726  N N   . ILE A 91  ? 0.4797 0.2442 0.4681 -0.0791 -0.0187 0.0098  108 ILE A N   
727  C CA  . ILE A 91  ? 0.5370 0.2802 0.5253 -0.1013 -0.0243 0.0026  108 ILE A CA  
728  C C   . ILE A 91  ? 0.6064 0.3032 0.5861 -0.1090 -0.0186 0.0116  108 ILE A C   
729  O O   . ILE A 91  ? 0.6473 0.3311 0.6328 -0.1331 -0.0219 0.0119  108 ILE A O   
730  C CB  . ILE A 91  ? 0.5652 0.2940 0.5386 -0.1006 -0.0321 -0.0174 108 ILE A CB  
731  C CG1 . ILE A 91  ? 0.5969 0.3256 0.5763 -0.1276 -0.0427 -0.0262 108 ILE A CG1 
732  C CG2 . ILE A 91  ? 0.5855 0.2645 0.5333 -0.0857 -0.0273 -0.0242 108 ILE A CG2 
733  C CD1 . ILE A 91  ? 0.6104 0.3327 0.5733 -0.1272 -0.0518 -0.0456 108 ILE A CD1 
734  N N   . SER A 92  ? 0.6514 0.3267 0.6190 -0.0887 -0.0106 0.0207  109 SER A N   
735  C CA  . SER A 92  ? 0.7075 0.3369 0.6651 -0.0908 -0.0039 0.0333  109 SER A CA  
736  C C   . SER A 92  ? 0.6862 0.3328 0.6557 -0.0976 0.0029  0.0561  109 SER A C   
737  O O   . SER A 92  ? 0.7270 0.3343 0.6885 -0.1035 0.0081  0.0686  109 SER A O   
738  C CB  . SER A 92  ? 0.7604 0.3606 0.6994 -0.0622 0.0014  0.0342  109 SER A CB  
739  O OG  . SER A 92  ? 0.7927 0.3824 0.7197 -0.0522 -0.0022 0.0141  109 SER A OG  
740  N N   . ARG A 93  ? 0.6269 0.3276 0.6122 -0.0953 0.0037  0.0619  110 ARG A N   
741  C CA  . ARG A 93  ? 0.6142 0.3335 0.6059 -0.0972 0.0118  0.0829  110 ARG A CA  
742  C C   . ARG A 93  ? 0.5817 0.3483 0.5960 -0.1149 0.0120  0.0851  110 ARG A C   
743  O O   . ARG A 93  ? 0.5491 0.3589 0.5723 -0.1061 0.0098  0.0791  110 ARG A O   
744  C CB  . ARG A 93  ? 0.5946 0.3325 0.5782 -0.0708 0.0149  0.0901  110 ARG A CB  
745  C CG  . ARG A 93  ? 0.6356 0.3344 0.6006 -0.0504 0.0167  0.0942  110 ARG A CG  
746  C CD  . ARG A 93  ? 0.6250 0.3520 0.5873 -0.0258 0.0147  0.0921  110 ARG A CD  
747  N NE  . ARG A 93  ? 0.6091 0.3733 0.5744 -0.0224 0.0172  0.1048  110 ARG A NE  
748  C CZ  . ARG A 93  ? 0.5550 0.3597 0.5245 -0.0135 0.0139  0.0999  110 ARG A CZ  
749  N NH1 . ARG A 93  ? 0.5247 0.3426 0.4982 -0.0066 0.0080  0.0841  110 ARG A NH1 
750  N NH2 . ARG A 93  ? 0.5243 0.3550 0.4917 -0.0123 0.0171  0.1116  110 ARG A NH2 
751  N N   . SER A 94  ? 0.5775 0.3363 0.6014 -0.1388 0.0153  0.0951  111 SER A N   
752  C CA  . SER A 94  ? 0.5603 0.3646 0.6098 -0.1577 0.0152  0.0962  111 SER A CA  
753  C C   . SER A 94  ? 0.5427 0.3969 0.6006 -0.1466 0.0238  0.1074  111 SER A C   
754  O O   . SER A 94  ? 0.5299 0.4292 0.6074 -0.1507 0.0226  0.1028  111 SER A O   
755  C CB  . SER A 94  ? 0.5940 0.3796 0.6538 -0.1882 0.0165  0.1047  111 SER A CB  
756  O OG  . SER A 94  ? 0.6285 0.3861 0.6770 -0.1895 0.0274  0.1256  111 SER A OG  
757  N N   . SER A 95  ? 0.5653 0.4109 0.6066 -0.1311 0.0318  0.1210  112 SER A N   
758  C CA  . SER A 95  ? 0.5644 0.4509 0.6052 -0.1173 0.0389  0.1282  112 SER A CA  
759  C C   . SER A 95  ? 0.5147 0.4323 0.5596 -0.1022 0.0318  0.1105  112 SER A C   
760  O O   . SER A 95  ? 0.5306 0.4886 0.5857 -0.0995 0.0357  0.1101  112 SER A O   
761  C CB  . SER A 95  ? 0.6133 0.4797 0.6299 -0.0999 0.0438  0.1415  112 SER A CB  
762  O OG  . SER A 95  ? 0.6461 0.4887 0.6497 -0.0827 0.0353  0.1302  112 SER A OG  
763  N N   . THR A 96  ? 0.4866 0.3832 0.5226 -0.0921 0.0226  0.0967  113 THR A N   
764  C CA  . THR A 96  ? 0.4439 0.3635 0.4824 -0.0799 0.0155  0.0811  113 THR A CA  
765  C C   . THR A 96  ? 0.4321 0.3754 0.4911 -0.0920 0.0098  0.0701  113 THR A C   
766  O O   . THR A 96  ? 0.3962 0.3691 0.4613 -0.0832 0.0073  0.0626  113 THR A O   
767  C CB  . THR A 96  ? 0.4246 0.3201 0.4485 -0.0654 0.0089  0.0715  113 THR A CB  
768  O OG1 . THR A 96  ? 0.4429 0.3092 0.4667 -0.0749 0.0034  0.0625  113 THR A OG1 
769  C CG2 . THR A 96  ? 0.4350 0.3136 0.4415 -0.0509 0.0131  0.0832  113 THR A CG2 
770  N N   . PHE A 97  ? 0.4504 0.3806 0.5195 -0.1122 0.0070  0.0699  114 PHE A N   
771  C CA  . PHE A 97  ? 0.4480 0.4073 0.5396 -0.1260 0.0009  0.0629  114 PHE A CA  
772  C C   . PHE A 97  ? 0.4479 0.4525 0.5603 -0.1303 0.0095  0.0737  114 PHE A C   
773  O O   . PHE A 97  ? 0.4342 0.4737 0.5602 -0.1245 0.0067  0.0676  114 PHE A O   
774  C CB  . PHE A 97  ? 0.4868 0.4203 0.5827 -0.1490 -0.0061 0.0589  114 PHE A CB  
775  C CG  . PHE A 97  ? 0.4718 0.4382 0.5909 -0.1638 -0.0153 0.0515  114 PHE A CG  
776  C CD1 . PHE A 97  ? 0.4472 0.4313 0.5666 -0.1525 -0.0247 0.0382  114 PHE A CD1 
777  C CD2 . PHE A 97  ? 0.4754 0.4586 0.6169 -0.1883 -0.0146 0.0597  114 PHE A CD2 
778  C CE1 . PHE A 97  ? 0.4451 0.4623 0.5856 -0.1638 -0.0343 0.0331  114 PHE A CE1 
779  C CE2 . PHE A 97  ? 0.4766 0.4962 0.6424 -0.2016 -0.0247 0.0538  114 PHE A CE2 
780  C CZ  . PHE A 97  ? 0.4500 0.4866 0.6148 -0.1886 -0.0351 0.0405  114 PHE A CZ  
781  N N   . GLU A 98  ? 0.4854 0.4893 0.5992 -0.1387 0.0209  0.0903  115 GLU A N   
782  C CA  . GLU A 98  ? 0.4886 0.5381 0.6203 -0.1408 0.0324  0.1020  115 GLU A CA  
783  C C   . GLU A 98  ? 0.4358 0.5109 0.5592 -0.1152 0.0361  0.0967  115 GLU A C   
784  O O   . GLU A 98  ? 0.4121 0.5279 0.5525 -0.1113 0.0403  0.0963  115 GLU A O   
785  C CB  . GLU A 98  ? 0.5705 0.6105 0.6986 -0.1521 0.0455  0.1225  115 GLU A CB  
786  C CG  . GLU A 98  ? 0.6552 0.6783 0.7985 -0.1824 0.0428  0.1286  115 GLU A CG  
787  C CD  . GLU A 98  ? 0.7367 0.7306 0.8698 -0.1953 0.0536  0.1492  115 GLU A CD  
788  O OE1 . GLU A 98  ? 0.7721 0.7268 0.8770 -0.1817 0.0556  0.1536  115 GLU A OE1 
789  O OE2 . GLU A 98  ? 0.7901 0.7988 0.9446 -0.2210 0.0596  0.1623  115 GLU A OE2 
790  N N   . ALA A 99  ? 0.4055 0.4556 0.5031 -0.0980 0.0338  0.0920  116 ALA A N   
791  C CA  . ALA A 99  ? 0.3702 0.4373 0.4564 -0.0769 0.0359  0.0863  116 ALA A CA  
792  C C   . ALA A 99  ? 0.3566 0.4378 0.4509 -0.0682 0.0264  0.0701  116 ALA A C   
793  O O   . ALA A 99  ? 0.3409 0.4399 0.4306 -0.0534 0.0293  0.0656  116 ALA A O   
794  C CB  . ALA A 99  ? 0.3761 0.4143 0.4343 -0.0643 0.0345  0.0873  116 ALA A CB  
795  N N   . VAL A 100 ? 0.3650 0.4364 0.4692 -0.0774 0.0153  0.0619  117 VAL A N   
796  C CA  . VAL A 100 ? 0.3470 0.4315 0.4581 -0.0700 0.0063  0.0495  117 VAL A CA  
797  C C   . VAL A 100 ? 0.3221 0.4498 0.4542 -0.0653 0.0110  0.0508  117 VAL A C   
798  O O   . VAL A 100 ? 0.3096 0.4460 0.4397 -0.0509 0.0077  0.0428  117 VAL A O   
799  C CB  . VAL A 100 ? 0.3676 0.4368 0.4829 -0.0807 -0.0067 0.0407  117 VAL A CB  
800  C CG1 . VAL A 100 ? 0.3787 0.4057 0.4723 -0.0805 -0.0105 0.0369  117 VAL A CG1 
801  C CG2 . VAL A 100 ? 0.3806 0.4675 0.5198 -0.1008 -0.0098 0.0440  117 VAL A CG2 
802  N N   . LEU A 101 ? 0.3371 0.4906 0.4886 -0.0764 0.0195  0.0617  118 LEU A N   
803  C CA  . LEU A 101 ? 0.3195 0.5183 0.4929 -0.0695 0.0264  0.0644  118 LEU A CA  
804  C C   . LEU A 101 ? 0.3077 0.5138 0.4648 -0.0495 0.0389  0.0652  118 LEU A C   
805  O O   . LEU A 101 ? 0.3068 0.5376 0.4713 -0.0339 0.0421  0.0606  118 LEU A O   
806  C CB  . LEU A 101 ? 0.3377 0.5663 0.5388 -0.0888 0.0332  0.0773  118 LEU A CB  
807  C CG  . LEU A 101 ? 0.3525 0.5783 0.5722 -0.1126 0.0198  0.0761  118 LEU A CG  
808  C CD1 . LEU A 101 ? 0.3645 0.6256 0.6138 -0.1326 0.0286  0.0908  118 LEU A CD1 
809  C CD2 . LEU A 101 ? 0.3382 0.5735 0.5677 -0.1088 0.0037  0.0640  118 LEU A CD2 
810  N N   . LYS A 102 ? 0.3073 0.4904 0.4401 -0.0485 0.0454  0.0703  119 LYS A N   
811  C CA  . LYS A 102 ? 0.3235 0.5070 0.4332 -0.0300 0.0541  0.0681  119 LYS A CA  
812  C C   . LYS A 102 ? 0.3083 0.4746 0.4026 -0.0144 0.0442  0.0526  119 LYS A C   
813  O O   . LYS A 102 ? 0.3025 0.4814 0.3926 0.0010  0.0487  0.0463  119 LYS A O   
814  C CB  . LYS A 102 ? 0.3412 0.5050 0.4275 -0.0330 0.0605  0.0780  119 LYS A CB  
815  C CG  . LYS A 102 ? 0.3669 0.5489 0.4676 -0.0485 0.0730  0.0958  119 LYS A CG  
816  C CD  . LYS A 102 ? 0.4151 0.6063 0.4942 -0.0398 0.0883  0.1055  119 LYS A CD  
817  C CE  . LYS A 102 ? 0.4558 0.6585 0.5451 -0.0572 0.1010  0.1263  119 LYS A CE  
818  N NZ  . LYS A 102 ? 0.4775 0.7170 0.5632 -0.0478 0.1201  0.1338  119 LYS A NZ  
819  N N   . TRP A 103 ? 0.3000 0.4367 0.3858 -0.0187 0.0315  0.0468  120 TRP A N   
820  C CA  . TRP A 103 ? 0.2999 0.4219 0.3752 -0.0077 0.0216  0.0338  120 TRP A CA  
821  C C   . TRP A 103 ? 0.2951 0.4361 0.3893 -0.0021 0.0177  0.0281  120 TRP A C   
822  O O   . TRP A 103 ? 0.3086 0.4479 0.3945 0.0125  0.0172  0.0202  120 TRP A O   
823  C CB  . TRP A 103 ? 0.3066 0.4002 0.3743 -0.0147 0.0106  0.0307  120 TRP A CB  
824  C CG  . TRP A 103 ? 0.3318 0.4052 0.3776 -0.0132 0.0120  0.0343  120 TRP A CG  
825  C CD1 . TRP A 103 ? 0.3417 0.4021 0.3847 -0.0219 0.0140  0.0437  120 TRP A CD1 
826  C CD2 . TRP A 103 ? 0.3534 0.4181 0.3779 -0.0025 0.0104  0.0292  120 TRP A CD2 
827  N NE1 . TRP A 103 ? 0.3443 0.3912 0.3666 -0.0152 0.0138  0.0461  120 TRP A NE1 
828  C CE2 . TRP A 103 ? 0.3585 0.4095 0.3696 -0.0044 0.0107  0.0367  120 TRP A CE2 
829  C CE3 . TRP A 103 ? 0.3637 0.4288 0.3784 0.0080  0.0077  0.0189  120 TRP A CE3 
830  C CZ2 . TRP A 103 ? 0.3653 0.4096 0.3562 0.0032  0.0075  0.0345  120 TRP A CZ2 
831  C CZ3 . TRP A 103 ? 0.3755 0.4292 0.3681 0.0132  0.0045  0.0154  120 TRP A CZ3 
832  C CH2 . TRP A 103 ? 0.3749 0.4216 0.3570 0.0105  0.0040  0.0235  120 TRP A CH2 
833  N N   . LYS A 104 ? 0.2814 0.4393 0.4004 -0.0139 0.0143  0.0324  121 LYS A N   
834  C CA  . LYS A 104 ? 0.2728 0.4525 0.4116 -0.0085 0.0087  0.0291  121 LYS A CA  
835  C C   . LYS A 104 ? 0.2585 0.4689 0.4073 0.0076  0.0200  0.0306  121 LYS A C   
836  O O   . LYS A 104 ? 0.2363 0.4471 0.3834 0.0240  0.0171  0.0239  121 LYS A O   
837  C CB  . LYS A 104 ? 0.2825 0.4751 0.4441 -0.0265 0.0004  0.0328  121 LYS A CB  
838  C CG  . LYS A 104 ? 0.2881 0.5038 0.4691 -0.0216 -0.0090 0.0302  121 LYS A CG  
839  C CD  . LYS A 104 ? 0.2987 0.4892 0.4610 -0.0092 -0.0184 0.0210  121 LYS A CD  
840  C CE  . LYS A 104 ? 0.3105 0.5183 0.4888 -0.0089 -0.0310 0.0203  121 LYS A CE  
841  N NZ  . LYS A 104 ? 0.3038 0.5559 0.5105 0.0009  -0.0273 0.0262  121 LYS A NZ  
842  N N   . SER A 105 ? 0.2719 0.5040 0.4274 0.0046  0.0339  0.0394  122 SER A N   
843  C CA  . SER A 105 ? 0.3017 0.5628 0.4625 0.0221  0.0481  0.0405  122 SER A CA  
844  C C   . SER A 105 ? 0.3191 0.5540 0.4461 0.0423  0.0520  0.0295  122 SER A C   
845  O O   . SER A 105 ? 0.3137 0.5594 0.4412 0.0619  0.0576  0.0240  122 SER A O   
846  C CB  . SER A 105 ? 0.3384 0.6290 0.5112 0.0130  0.0638  0.0539  122 SER A CB  
847  O OG  . SER A 105 ? 0.3509 0.6610 0.5535 -0.0103 0.0593  0.0640  122 SER A OG  
848  N N   . ASP A 106 ? 0.3298 0.5303 0.4279 0.0375  0.0484  0.0262  123 ASP A N   
849  C CA  . ASP A 106 ? 0.3398 0.5138 0.4048 0.0517  0.0488  0.0150  123 ASP A CA  
850  C C   . ASP A 106 ? 0.3301 0.4863 0.3933 0.0617  0.0380  0.0040  123 ASP A C   
851  O O   . ASP A 106 ? 0.3384 0.4865 0.3879 0.0788  0.0417  -0.0050 123 ASP A O   
852  C CB  . ASP A 106 ? 0.3419 0.4877 0.3830 0.0412  0.0430  0.0156  123 ASP A CB  
853  C CG  . ASP A 106 ? 0.3776 0.5016 0.3840 0.0522  0.0432  0.0053  123 ASP A CG  
854  O OD1 . ASP A 106 ? 0.4022 0.5360 0.3945 0.0628  0.0549  0.0036  123 ASP A OD1 
855  O OD2 . ASP A 106 ? 0.3971 0.4945 0.3889 0.0486  0.0313  -0.0009 123 ASP A OD2 
856  N N   . LEU A 107 ? 0.3390 0.4861 0.4134 0.0507  0.0249  0.0051  124 LEU A N   
857  C CA  . LEU A 107 ? 0.3579 0.4882 0.4316 0.0566  0.0137  -0.0018 124 LEU A CA  
858  C C   . LEU A 107 ? 0.3796 0.5315 0.4711 0.0725  0.0169  -0.0018 124 LEU A C   
859  O O   . LEU A 107 ? 0.3965 0.5311 0.4750 0.0884  0.0166  -0.0095 124 LEU A O   
860  C CB  . LEU A 107 ? 0.3454 0.4691 0.4285 0.0409  0.0014  0.0014  124 LEU A CB  
861  C CG  . LEU A 107 ? 0.3481 0.4523 0.4270 0.0426  -0.0109 -0.0033 124 LEU A CG  
862  C CD1 . LEU A 107 ? 0.3338 0.4043 0.3856 0.0431  -0.0142 -0.0104 124 LEU A CD1 
863  C CD2 . LEU A 107 ? 0.3347 0.4423 0.4253 0.0272  -0.0200 0.0007  124 LEU A CD2 
864  N N   . ASP A 108 ? 0.3731 0.5626 0.4946 0.0685  0.0198  0.0071  125 ASP A N   
865  C CA  . ASP A 108 ? 0.3948 0.6129 0.5382 0.0857  0.0228  0.0089  125 ASP A CA  
866  C C   . ASP A 108 ? 0.4113 0.6384 0.5472 0.1077  0.0388  0.0052  125 ASP A C   
867  O O   . ASP A 108 ? 0.4379 0.6700 0.5799 0.1281  0.0400  0.0026  125 ASP A O   
868  C CB  . ASP A 108 ? 0.3860 0.6469 0.5669 0.0735  0.0190  0.0197  125 ASP A CB  
869  C CG  . ASP A 108 ? 0.3937 0.6406 0.5773 0.0576  0.0006  0.0198  125 ASP A CG  
870  O OD1 . ASP A 108 ? 0.4074 0.6154 0.5668 0.0588  -0.0081 0.0129  125 ASP A OD1 
871  O OD2 . ASP A 108 ? 0.4039 0.6781 0.6122 0.0422  -0.0053 0.0264  125 ASP A OD2 
872  N N   . SER A 109 ? 0.4368 0.6615 0.5553 0.1053  0.0508  0.0043  126 SER A N   
873  C CA  . SER A 109 ? 0.4843 0.7107 0.5858 0.1270  0.0667  -0.0022 126 SER A CA  
874  C C   . SER A 109 ? 0.5044 0.6827 0.5714 0.1413  0.0618  -0.0175 126 SER A C   
875  O O   . SER A 109 ? 0.5358 0.7099 0.5921 0.1646  0.0713  -0.0255 126 SER A O   
876  C CB  . SER A 109 ? 0.5120 0.7447 0.5978 0.1186  0.0790  0.0013  126 SER A CB  
877  O OG  . SER A 109 ? 0.5280 0.7203 0.5826 0.1074  0.0698  -0.0048 126 SER A OG  
878  N N   . LYS A 110 ? 0.4768 0.6190 0.5270 0.1270  0.0473  -0.0216 127 LYS A N   
879  C CA  . LYS A 110 ? 0.4915 0.5876 0.5062 0.1327  0.0424  -0.0353 127 LYS A CA  
880  C C   . LYS A 110 ? 0.4713 0.5373 0.4841 0.1357  0.0292  -0.0394 127 LYS A C   
881  O O   . LYS A 110 ? 0.4993 0.5273 0.4848 0.1430  0.0269  -0.0509 127 LYS A O   
882  C CB  . LYS A 110 ? 0.4714 0.5504 0.4646 0.1141  0.0375  -0.0364 127 LYS A CB  
883  C CG  . LYS A 110 ? 0.4921 0.5855 0.4700 0.1177  0.0516  -0.0366 127 LYS A CG  
884  C CD  . LYS A 110 ? 0.5038 0.5893 0.4653 0.1004  0.0471  -0.0334 127 LYS A CD  
885  C CE  . LYS A 110 ? 0.5371 0.6400 0.4824 0.1066  0.0626  -0.0316 127 LYS A CE  
886  N NZ  . LYS A 110 ? 0.5431 0.6420 0.4756 0.0909  0.0580  -0.0248 127 LYS A NZ  
887  N N   . VAL A 111 ? 0.4172 0.4968 0.4555 0.1289  0.0199  -0.0304 128 VAL A N   
888  C CA  . VAL A 111 ? 0.4147 0.4646 0.4477 0.1319  0.0079  -0.0325 128 VAL A CA  
889  C C   . VAL A 111 ? 0.4273 0.5033 0.4902 0.1352  0.0018  -0.0222 128 VAL A C   
890  O O   . VAL A 111 ? 0.4041 0.5141 0.4904 0.1224  0.0001  -0.0136 128 VAL A O   
891  C CB  . VAL A 111 ? 0.3700 0.3901 0.3856 0.1115  -0.0034 -0.0348 128 VAL A CB  
892  C CG1 . VAL A 111 ? 0.3193 0.3626 0.3536 0.0927  -0.0087 -0.0254 128 VAL A CG1 
893  C CG2 . VAL A 111 ? 0.3619 0.3453 0.3653 0.1152  -0.0130 -0.0377 128 VAL A CG2 
894  N N   . HIS A 112 ? 0.4715 0.5289 0.5319 0.1509  -0.0031 -0.0227 129 HIS A N   
895  C CA  . HIS A 112 ? 0.5148 0.5948 0.6002 0.1572  -0.0111 -0.0123 129 HIS A CA  
896  C C   . HIS A 112 ? 0.5175 0.5571 0.5862 0.1601  -0.0223 -0.0121 129 HIS A C   
897  O O   . HIS A 112 ? 0.5290 0.5250 0.5702 0.1601  -0.0219 -0.0204 129 HIS A O   
898  C CB  . HIS A 112 ? 0.6063 0.7172 0.7114 0.1835  -0.0007 -0.0098 129 HIS A CB  
899  C CG  . HIS A 112 ? 0.6594 0.8067 0.7764 0.1822  0.0139  -0.0102 129 HIS A CG  
900  N ND1 . HIS A 112 ? 0.7017 0.8325 0.7956 0.1914  0.0277  -0.0205 129 HIS A ND1 
901  C CD2 . HIS A 112 ? 0.6547 0.8510 0.8008 0.1692  0.0164  -0.0013 129 HIS A CD2 
902  C CE1 . HIS A 112 ? 0.6977 0.8681 0.8062 0.1863  0.0393  -0.0165 129 HIS A CE1 
903  N NE2 . HIS A 112 ? 0.6616 0.8715 0.8032 0.1721  0.0329  -0.0044 129 HIS A NE2 
904  N N   . LEU A 113 ? 0.5190 0.5735 0.6037 0.1613  -0.0329 -0.0019 130 LEU A N   
905  C CA  . LEU A 113 ? 0.5468 0.5654 0.6160 0.1656  -0.0427 0.0015  130 LEU A CA  
906  C C   . LEU A 113 ? 0.5763 0.5711 0.6378 0.1947  -0.0375 -0.0001 130 LEU A C   
907  O O   . LEU A 113 ? 0.5598 0.5755 0.6327 0.2140  -0.0261 -0.0032 130 LEU A O   
908  C CB  . LEU A 113 ? 0.5458 0.5909 0.6324 0.1596  -0.0557 0.0135  130 LEU A CB  
909  C CG  . LEU A 113 ? 0.5109 0.5735 0.6020 0.1328  -0.0614 0.0141  130 LEU A CG  
910  C CD1 . LEU A 113 ? 0.4986 0.5930 0.6079 0.1317  -0.0740 0.0246  130 LEU A CD1 
911  C CD2 . LEU A 113 ? 0.5117 0.5340 0.5755 0.1159  -0.0642 0.0097  130 LEU A CD2 
912  N N   . PRO A 114 ? 0.6229 0.5716 0.6634 0.1984  -0.0446 0.0022  131 PRO A N   
913  C CA  . PRO A 114 ? 0.6789 0.5957 0.7081 0.2267  -0.0390 -0.0006 131 PRO A CA  
914  C C   . PRO A 114 ? 0.6905 0.6471 0.7482 0.2551  -0.0371 0.0090  131 PRO A C   
915  O O   . PRO A 114 ? 0.7178 0.6636 0.7727 0.2821  -0.0269 0.0040  131 PRO A O   
916  C CB  . PRO A 114 ? 0.7116 0.5754 0.7168 0.2219  -0.0488 0.0045  131 PRO A CB  
917  C CG  . PRO A 114 ? 0.6739 0.5350 0.6706 0.1884  -0.0548 0.0033  131 PRO A CG  
918  C CD  . PRO A 114 ? 0.6200 0.5388 0.6427 0.1774  -0.0551 0.0057  131 PRO A CD  
919  N N   . ASN A 115 ? 0.6653 0.6685 0.7495 0.2487  -0.0470 0.0219  132 ASN A N   
920  C CA  . ASN A 115 ? 0.6765 0.7299 0.7938 0.2715  -0.0475 0.0324  132 ASN A CA  
921  C C   . ASN A 115 ? 0.6519 0.7633 0.7989 0.2730  -0.0358 0.0292  132 ASN A C   
922  O O   . ASN A 115 ? 0.6396 0.8001 0.8188 0.2836  -0.0362 0.0385  132 ASN A O   
923  C CB  . ASN A 115 ? 0.6725 0.7507 0.8033 0.2630  -0.0656 0.0477  132 ASN A CB  
924  C CG  . ASN A 115 ? 0.6408 0.7538 0.7831 0.2303  -0.0724 0.0473  132 ASN A CG  
925  O OD1 . ASN A 115 ? 0.6186 0.7420 0.7635 0.2151  -0.0637 0.0381  132 ASN A OD1 
926  N ND2 . ASN A 115 ? 0.6449 0.7733 0.7916 0.2206  -0.0883 0.0576  132 ASN A ND2 
927  N N   . GLY A 116 ? 0.6375 0.7441 0.7741 0.2561  -0.0258 0.0176  133 GLY A N   
928  C CA  . GLY A 116 ? 0.6064 0.7633 0.7671 0.2570  -0.0124 0.0157  133 GLY A CA  
929  C C   . GLY A 116 ? 0.5422 0.7460 0.7270 0.2281  -0.0175 0.0212  133 GLY A C   
930  O O   . GLY A 116 ? 0.5196 0.7561 0.7186 0.2232  -0.0057 0.0197  133 GLY A O   
931  N N   . SER A 117 ? 0.5153 0.7215 0.7035 0.2094  -0.0343 0.0278  134 SER A N   
932  C CA  . SER A 117 ? 0.4803 0.7218 0.6866 0.1803  -0.0402 0.0310  134 SER A CA  
933  C C   . SER A 117 ? 0.4594 0.6733 0.6434 0.1561  -0.0359 0.0221  134 SER A C   
934  O O   . SER A 117 ? 0.4898 0.6543 0.6419 0.1569  -0.0337 0.0140  134 SER A O   
935  C CB  . SER A 117 ? 0.4820 0.7302 0.6930 0.1696  -0.0599 0.0390  134 SER A CB  
936  O OG  . SER A 117 ? 0.5074 0.7068 0.6899 0.1791  -0.0665 0.0389  134 SER A OG  
937  N N   . PRO A 118 ? 0.4055 0.6490 0.6057 0.1335  -0.0366 0.0243  135 PRO A N   
938  C CA  . PRO A 118 ? 0.3696 0.5865 0.5493 0.1108  -0.0347 0.0179  135 PRO A CA  
939  C C   . PRO A 118 ? 0.3462 0.5247 0.5020 0.0987  -0.0474 0.0152  135 PRO A C   
940  O O   . PRO A 118 ? 0.3606 0.5452 0.5214 0.0973  -0.0604 0.0202  135 PRO A O   
941  C CB  . PRO A 118 ? 0.3494 0.6069 0.5550 0.0902  -0.0347 0.0231  135 PRO A CB  
942  C CG  . PRO A 118 ? 0.3623 0.6725 0.6031 0.1042  -0.0299 0.0310  135 PRO A CG  
943  C CD  . PRO A 118 ? 0.3887 0.6928 0.6282 0.1302  -0.0357 0.0328  135 PRO A CD  
944  N N   . ILE A 119 ? 0.2885 0.4309 0.4185 0.0899  -0.0435 0.0080  136 ILE A N   
945  C CA  . ILE A 119 ? 0.2873 0.3980 0.3967 0.0782  -0.0533 0.0062  136 ILE A CA  
946  C C   . ILE A 119 ? 0.2848 0.4123 0.4035 0.0577  -0.0611 0.0086  136 ILE A C   
947  O O   . ILE A 119 ? 0.2681 0.4170 0.4009 0.0481  -0.0564 0.0092  136 ILE A O   
948  C CB  . ILE A 119 ? 0.2659 0.3393 0.3491 0.0747  -0.0478 -0.0013 136 ILE A CB  
949  C CG1 . ILE A 119 ? 0.2392 0.3187 0.3218 0.0605  -0.0410 -0.0039 136 ILE A CG1 
950  C CG2 . ILE A 119 ? 0.2818 0.3367 0.3539 0.0943  -0.0405 -0.0058 136 ILE A CG2 
951  C CD1 . ILE A 119 ? 0.2343 0.2813 0.2923 0.0537  -0.0400 -0.0097 136 ILE A CD1 
952  N N   . PRO A 120 ? 0.2840 0.4020 0.3943 0.0516  -0.0728 0.0103  137 PRO A N   
953  C CA  . PRO A 120 ? 0.2769 0.4054 0.3911 0.0321  -0.0790 0.0094  137 PRO A CA  
954  C C   . PRO A 120 ? 0.2843 0.3939 0.3869 0.0189  -0.0717 0.0039  137 PRO A C   
955  O O   . PRO A 120 ? 0.2810 0.3634 0.3651 0.0214  -0.0663 0.0005  137 PRO A O   
956  C CB  . PRO A 120 ? 0.2739 0.3898 0.3731 0.0303  -0.0912 0.0110  137 PRO A CB  
957  C CG  . PRO A 120 ? 0.2848 0.3712 0.3660 0.0438  -0.0882 0.0121  137 PRO A CG  
958  C CD  . PRO A 120 ? 0.2884 0.3858 0.3838 0.0606  -0.0804 0.0133  137 PRO A CD  
959  N N   . ALA A 121 ? 0.2986 0.4227 0.4125 0.0045  -0.0721 0.0038  138 ALA A N   
960  C CA  . ALA A 121 ? 0.3016 0.4109 0.4080 -0.0063 -0.0649 0.0009  138 ALA A CA  
961  C C   . ALA A 121 ? 0.3124 0.4192 0.4182 -0.0238 -0.0722 -0.0016 138 ALA A C   
962  O O   . ALA A 121 ? 0.2932 0.4235 0.4161 -0.0321 -0.0789 0.0003  138 ALA A O   
963  C CB  . ALA A 121 ? 0.2966 0.4232 0.4173 -0.0046 -0.0536 0.0044  138 ALA A CB  
964  N N   . VAL A 122 ? 0.3205 0.3986 0.4058 -0.0286 -0.0714 -0.0063 139 VAL A N   
965  C CA  . VAL A 122 ? 0.3314 0.3980 0.4092 -0.0423 -0.0770 -0.0110 139 VAL A CA  
966  C C   . VAL A 122 ? 0.3183 0.3684 0.3932 -0.0496 -0.0682 -0.0113 139 VAL A C   
967  O O   . VAL A 122 ? 0.3126 0.3503 0.3794 -0.0421 -0.0599 -0.0098 139 VAL A O   
968  C CB  . VAL A 122 ? 0.3395 0.3873 0.3946 -0.0391 -0.0823 -0.0157 139 VAL A CB  
969  C CG1 . VAL A 122 ? 0.3379 0.3666 0.3784 -0.0503 -0.0853 -0.0230 139 VAL A CG1 
970  C CG2 . VAL A 122 ? 0.3445 0.4092 0.4025 -0.0341 -0.0925 -0.0132 139 VAL A CG2 
971  N N   . LEU A 123 ? 0.3192 0.3685 0.4002 -0.0646 -0.0711 -0.0125 140 LEU A N   
972  C CA  . LEU A 123 ? 0.3272 0.3581 0.4060 -0.0723 -0.0632 -0.0107 140 LEU A CA  
973  C C   . LEU A 123 ? 0.3340 0.3300 0.3896 -0.0738 -0.0643 -0.0184 140 LEU A C   
974  O O   . LEU A 123 ? 0.3450 0.3343 0.3920 -0.0802 -0.0730 -0.0259 140 LEU A O   
975  C CB  . LEU A 123 ? 0.3308 0.3780 0.4299 -0.0892 -0.0650 -0.0068 140 LEU A CB  
976  C CG  . LEU A 123 ? 0.3496 0.3842 0.4520 -0.0984 -0.0555 -0.0002 140 LEU A CG  
977  C CD1 . LEU A 123 ? 0.3371 0.3817 0.4431 -0.0867 -0.0427 0.0092  140 LEU A CD1 
978  C CD2 . LEU A 123 ? 0.3552 0.4090 0.4797 -0.1197 -0.0602 0.0030  140 LEU A CD2 
979  N N   . LEU A 124 ? 0.3478 0.3244 0.3924 -0.0655 -0.0556 -0.0164 141 LEU A N   
980  C CA  . LEU A 124 ? 0.3636 0.3086 0.3878 -0.0629 -0.0540 -0.0225 141 LEU A CA  
981  C C   . LEU A 124 ? 0.3903 0.3121 0.4128 -0.0686 -0.0478 -0.0188 141 LEU A C   
982  O O   . LEU A 124 ? 0.3977 0.3208 0.4239 -0.0628 -0.0402 -0.0099 141 LEU A O   
983  C CB  . LEU A 124 ? 0.3335 0.2769 0.3476 -0.0470 -0.0494 -0.0218 141 LEU A CB  
984  C CG  . LEU A 124 ? 0.3376 0.2991 0.3516 -0.0410 -0.0541 -0.0231 141 LEU A CG  
985  C CD1 . LEU A 124 ? 0.3263 0.2837 0.3308 -0.0294 -0.0492 -0.0220 141 LEU A CD1 
986  C CD2 . LEU A 124 ? 0.3563 0.3137 0.3605 -0.0468 -0.0624 -0.0309 141 LEU A CD2 
987  N N   . ALA A 125 ? 0.4105 0.3095 0.4258 -0.0807 -0.0518 -0.0254 142 ALA A N   
988  C CA  . ALA A 125 ? 0.4314 0.2992 0.4415 -0.0866 -0.0464 -0.0223 142 ALA A CA  
989  C C   . ALA A 125 ? 0.4280 0.2658 0.4170 -0.0716 -0.0414 -0.0270 142 ALA A C   
990  O O   . ALA A 125 ? 0.4344 0.2503 0.4068 -0.0722 -0.0448 -0.0388 142 ALA A O   
991  C CB  . ALA A 125 ? 0.4600 0.3142 0.4712 -0.1086 -0.0543 -0.0289 142 ALA A CB  
992  N N   . ASN A 126 ? 0.4253 0.2657 0.4149 -0.0569 -0.0334 -0.0178 143 ASN A N   
993  C CA  . ASN A 126 ? 0.4342 0.2591 0.4089 -0.0387 -0.0285 -0.0207 143 ASN A CA  
994  C C   . ASN A 126 ? 0.4701 0.2551 0.4332 -0.0349 -0.0227 -0.0187 143 ASN A C   
995  O O   . ASN A 126 ? 0.5005 0.2695 0.4674 -0.0460 -0.0214 -0.0117 143 ASN A O   
996  C CB  . ASN A 126 ? 0.3973 0.2511 0.3794 -0.0249 -0.0254 -0.0128 143 ASN A CB  
997  C CG  . ASN A 126 ? 0.4229 0.2746 0.3956 -0.0082 -0.0217 -0.0157 143 ASN A CG  
998  O OD1 . ASN A 126 ? 0.4461 0.2921 0.4085 -0.0063 -0.0229 -0.0258 143 ASN A OD1 
999  N ND2 . ASN A 126 ? 0.4083 0.2658 0.3840 0.0043  -0.0169 -0.0061 143 ASN A ND2 
1000 N N   . LYS A 127 ? 0.5060 0.2739 0.4548 -0.0192 -0.0187 -0.0245 144 LYS A N   
1001 C CA  . LYS A 127 ? 0.5446 0.2698 0.4791 -0.0098 -0.0123 -0.0242 144 LYS A CA  
1002 C C   . LYS A 127 ? 0.6110 0.2947 0.5295 -0.0234 -0.0156 -0.0373 144 LYS A C   
1003 O O   . LYS A 127 ? 0.6543 0.2937 0.5619 -0.0228 -0.0116 -0.0357 144 LYS A O   
1004 C CB  . LYS A 127 ? 0.5436 0.2638 0.4855 -0.0053 -0.0073 -0.0067 144 LYS A CB  
1005 C CG  . LYS A 127 ? 0.5131 0.2751 0.4687 0.0049  -0.0063 0.0050  144 LYS A CG  
1006 C CD  . LYS A 127 ? 0.5304 0.2827 0.4853 0.0174  -0.0008 0.0212  144 LYS A CD  
1007 C CE  . LYS A 127 ? 0.5164 0.3118 0.4827 0.0237  -0.0022 0.0309  144 LYS A CE  
1008 N NZ  . LYS A 127 ? 0.5239 0.3187 0.4901 0.0287  0.0006  0.0483  144 LYS A NZ  
1009 N N   . CYS A 128 ? 0.6193 0.3127 0.5325 -0.0335 -0.0230 -0.0510 145 CYS A N   
1010 C CA  . CYS A 128 ? 0.6896 0.3472 0.5869 -0.0508 -0.0293 -0.0652 145 CYS A CA  
1011 C C   . CYS A 128 ? 0.7416 0.3468 0.6107 -0.0377 -0.0229 -0.0767 145 CYS A C   
1012 O O   . CYS A 128 ? 0.8021 0.3646 0.6547 -0.0513 -0.0268 -0.0876 145 CYS A O   
1013 C CB  . CYS A 128 ? 0.7006 0.3838 0.5970 -0.0639 -0.0404 -0.0765 145 CYS A CB  
1014 S SG  . CYS A 128 ? 0.7347 0.4277 0.6105 -0.0447 -0.0379 -0.0887 145 CYS A SG  
1015 N N   . ASP A 129 ? 0.7273 0.3383 0.5915 -0.0116 -0.0135 -0.0747 146 ASP A N   
1016 C CA  . ASP A 129 ? 0.7726 0.3404 0.6151 0.0079  -0.0042 -0.0813 146 ASP A CA  
1017 C C   . ASP A 129 ? 0.8335 0.3539 0.6726 0.0089  0.0003  -0.0727 146 ASP A C   
1018 O O   . ASP A 129 ? 0.9128 0.3819 0.7280 0.0176  0.0050  -0.0833 146 ASP A O   
1019 C CB  . ASP A 129 ? 0.7113 0.3092 0.5577 0.0364  0.0055  -0.0767 146 ASP A CB  
1020 C CG  . ASP A 129 ? 0.6412 0.2754 0.5140 0.0448  0.0079  -0.0558 146 ASP A CG  
1021 O OD1 . ASP A 129 ? 0.5778 0.2595 0.4695 0.0362  0.0025  -0.0492 146 ASP A OD1 
1022 O OD2 . ASP A 129 ? 0.6388 0.2558 0.5124 0.0622  0.0152  -0.0457 146 ASP A OD2 
1023 N N   . GLN A 130 ? 0.8156 0.3486 0.6751 -0.0003 -0.0009 -0.0543 147 GLN A N   
1024 C CA  . GLN A 130 ? 0.8760 0.3643 0.7315 -0.0006 0.0036  -0.0430 147 GLN A CA  
1025 C C   . GLN A 130 ? 0.9341 0.3817 0.7818 -0.0276 -0.0023 -0.0513 147 GLN A C   
1026 O O   . GLN A 130 ? 0.9312 0.3946 0.7839 -0.0527 -0.0121 -0.0604 147 GLN A O   
1027 C CB  . GLN A 130 ? 0.8549 0.3769 0.7339 -0.0006 0.0052  -0.0192 147 GLN A CB  
1028 C CG  . GLN A 130 ? 0.8503 0.4028 0.7362 0.0291  0.0115  -0.0093 147 GLN A CG  
1029 C CD  . GLN A 130 ? 0.8293 0.4285 0.7366 0.0288  0.0106  0.0101  147 GLN A CD  
1030 O OE1 . GLN A 130 ? 0.8143 0.4391 0.7279 0.0499  0.0138  0.0189  147 GLN A OE1 
1031 N NE2 . GLN A 130 ? 0.8333 0.4468 0.7520 0.0049  0.0061  0.0159  147 GLN A NE2 
1032 N N   . SER A 135 ? 1.2172 0.9443 1.2675 -0.2522 -0.0551 -0.0068 152 SER A N   
1033 C CA  . SER A 135 ? 1.2318 0.9878 1.3004 -0.2729 -0.0663 -0.0160 152 SER A CA  
1034 C C   . SER A 135 ? 1.2163 0.9843 1.2727 -0.2654 -0.0801 -0.0359 152 SER A C   
1035 O O   . SER A 135 ? 1.1793 0.9975 1.2512 -0.2618 -0.0865 -0.0350 152 SER A O   
1036 C CB  . SER A 135 ? 1.2093 1.0262 1.3157 -0.2858 -0.0639 0.0002  152 SER A CB  
1037 O OG  . SER A 135 ? 1.2272 1.0724 1.3539 -0.3060 -0.0743 -0.0068 152 SER A OG  
1038 N N   . GLN A 136 ? 1.2437 0.9650 1.2717 -0.2620 -0.0838 -0.0531 153 GLN A N   
1039 C CA  . GLN A 136 ? 1.2241 0.9463 1.2318 -0.2529 -0.0947 -0.0726 153 GLN A CA  
1040 C C   . GLN A 136 ? 1.2045 0.9708 1.2320 -0.2716 -0.1095 -0.0790 153 GLN A C   
1041 O O   . GLN A 136 ? 1.2468 0.9940 1.2703 -0.2878 -0.1161 -0.0894 153 GLN A O   
1042 C CB  . GLN A 136 ? 1.2764 0.9352 1.2493 -0.2460 -0.0926 -0.0886 153 GLN A CB  
1043 C CG  . GLN A 136 ? 1.2844 0.8969 1.2378 -0.2250 -0.0781 -0.0825 153 GLN A CG  
1044 C CD  . GLN A 136 ? 1.3476 0.8992 1.2833 -0.2266 -0.0729 -0.0883 153 GLN A CD  
1045 O OE1 . GLN A 136 ? 1.3997 0.9299 1.3216 -0.2351 -0.0804 -0.1059 153 GLN A OE1 
1046 N NE2 . GLN A 136 ? 1.3434 0.8661 1.2785 -0.2175 -0.0603 -0.0731 153 GLN A NE2 
1047 N N   . SER A 137 ? 1.1387 0.9627 1.1874 -0.2687 -0.1154 -0.0728 154 SER A N   
1048 C CA  . SER A 137 ? 1.1215 0.9948 1.1980 -0.2867 -0.1281 -0.0733 154 SER A CA  
1049 C C   . SER A 137 ? 1.0731 0.9991 1.1590 -0.2779 -0.1398 -0.0752 154 SER A C   
1050 O O   . SER A 137 ? 1.0253 0.9878 1.1301 -0.2675 -0.1353 -0.0621 154 SER A O   
1051 C CB  . SER A 137 ? 1.1031 1.0095 1.2175 -0.2999 -0.1204 -0.0538 154 SER A CB  
1052 O OG  . SER A 137 ? 1.1394 1.0115 1.2558 -0.3164 -0.1129 -0.0495 154 SER A OG  
1053 N N   . PRO A 138 ? 1.0826 1.0151 1.1583 -0.2832 -0.1548 -0.0897 155 PRO A N   
1054 C CA  . PRO A 138 ? 1.0459 1.0211 1.1235 -0.2714 -0.1661 -0.0915 155 PRO A CA  
1055 C C   . PRO A 138 ? 0.9956 1.0380 1.1160 -0.2739 -0.1705 -0.0767 155 PRO A C   
1056 O O   . PRO A 138 ? 0.9293 1.0029 1.0583 -0.2564 -0.1692 -0.0680 155 PRO A O   
1057 C CB  . PRO A 138 ? 1.0934 1.0538 1.1487 -0.2804 -0.1807 -0.1102 155 PRO A CB  
1058 C CG  . PRO A 138 ? 1.1442 1.0771 1.2049 -0.3039 -0.1804 -0.1148 155 PRO A CG  
1059 C CD  . PRO A 138 ? 1.1358 1.0452 1.2060 -0.3044 -0.1630 -0.1021 155 PRO A CD  
1060 N N   . SER A 139 ? 1.0022 1.0668 1.1496 -0.2948 -0.1756 -0.0740 156 SER A N   
1061 C CA  . SER A 139 ? 0.9589 1.0887 1.1495 -0.2965 -0.1778 -0.0595 156 SER A CA  
1062 C C   . SER A 139 ? 0.9183 1.0626 1.1296 -0.2880 -0.1600 -0.0416 156 SER A C   
1063 O O   . SER A 139 ? 0.8732 1.0676 1.1109 -0.2763 -0.1583 -0.0299 156 SER A O   
1064 C CB  . SER A 139 ? 0.9819 1.1306 1.1967 -0.3228 -0.1865 -0.0608 156 SER A CB  
1065 O OG  . SER A 139 ? 0.9471 1.1630 1.2020 -0.3222 -0.1916 -0.0492 156 SER A OG  
1066 N N   . GLN A 140 ? 0.9498 1.0497 1.1481 -0.2927 -0.1467 -0.0395 157 GLN A N   
1067 C CA  . GLN A 140 ? 0.9361 1.0462 1.1514 -0.2875 -0.1296 -0.0222 157 GLN A CA  
1068 C C   . GLN A 140 ? 0.8872 1.0087 1.0961 -0.2622 -0.1249 -0.0174 157 GLN A C   
1069 O O   . GLN A 140 ? 0.8488 1.0106 1.0833 -0.2535 -0.1164 -0.0032 157 GLN A O   
1070 C CB  . GLN A 140 ? 0.9837 1.0367 1.1805 -0.2968 -0.1181 -0.0215 157 GLN A CB  
1071 C CG  . GLN A 140 ? 0.9789 1.0371 1.1888 -0.2932 -0.1000 -0.0028 157 GLN A CG  
1072 C CD  . GLN A 140 ? 1.0083 1.0042 1.1858 -0.2863 -0.0905 -0.0036 157 GLN A CD  
1073 O OE1 . GLN A 140 ? 1.0728 1.0201 1.2321 -0.2971 -0.0905 -0.0107 157 GLN A OE1 
1074 N NE2 . GLN A 140 ? 0.9663 0.9633 1.1370 -0.2675 -0.0826 0.0039  157 GLN A NE2 
1075 N N   . VAL A 141 ? 0.9090 0.9926 1.0829 -0.2503 -0.1291 -0.0292 158 VAL A N   
1076 C CA  . VAL A 141 ? 0.8842 0.9749 1.0487 -0.2274 -0.1278 -0.0270 158 VAL A CA  
1077 C C   . VAL A 141 ? 0.8607 1.0101 1.0507 -0.2166 -0.1343 -0.0205 158 VAL A C   
1078 O O   . VAL A 141 ? 0.8402 1.0159 1.0459 -0.2024 -0.1268 -0.0093 158 VAL A O   
1079 C CB  . VAL A 141 ? 0.9115 0.9603 1.0350 -0.2183 -0.1347 -0.0430 158 VAL A CB  
1080 C CG1 . VAL A 141 ? 0.8921 0.9641 1.0091 -0.1990 -0.1424 -0.0441 158 VAL A CG1 
1081 C CG2 . VAL A 141 ? 0.9279 0.9209 1.0243 -0.2142 -0.1241 -0.0458 158 VAL A CG2 
1082 N N   . ASP A 142 ? 0.8768 1.0446 1.0691 -0.2216 -0.1485 -0.0281 159 ASP A N   
1083 C CA  . ASP A 142 ? 0.8560 1.0782 1.0714 -0.2091 -0.1563 -0.0218 159 ASP A CA  
1084 C C   . ASP A 142 ? 0.7679 1.0368 1.0247 -0.2084 -0.1459 -0.0059 159 ASP A C   
1085 O O   . ASP A 142 ? 0.7207 1.0185 0.9910 -0.1882 -0.1405 0.0035  159 ASP A O   
1086 C CB  . ASP A 142 ? 0.9411 1.1781 1.1562 -0.2184 -0.1738 -0.0308 159 ASP A CB  
1087 C CG  . ASP A 142 ? 0.9844 1.2645 1.2100 -0.1994 -0.1841 -0.0260 159 ASP A CG  
1088 O OD1 . ASP A 142 ? 0.9790 1.2935 1.2280 -0.1824 -0.1774 -0.0131 159 ASP A OD1 
1089 O OD2 . ASP A 142 ? 1.0290 1.3072 1.2379 -0.2006 -0.1991 -0.0351 159 ASP A OD2 
1090 N N   . GLN A 143 ? 0.7061 0.9798 0.9810 -0.2296 -0.1419 -0.0029 160 GLN A N   
1091 C CA  . GLN A 143 ? 0.6119 0.9296 0.9248 -0.2309 -0.1297 0.0123  160 GLN A CA  
1092 C C   . GLN A 143 ? 0.5263 0.8429 0.8401 -0.2156 -0.1120 0.0231  160 GLN A C   
1093 O O   . GLN A 143 ? 0.4973 0.8576 0.8342 -0.1978 -0.1048 0.0331  160 GLN A O   
1094 C CB  . GLN A 143 ? 0.6154 0.9250 0.9399 -0.2589 -0.1268 0.0135  160 GLN A CB  
1095 C CG  . GLN A 143 ? 0.5888 0.9516 0.9553 -0.2649 -0.1179 0.0279  160 GLN A CG  
1096 C CD  . GLN A 143 ? 0.6332 0.9825 1.0083 -0.2955 -0.1170 0.0283  160 GLN A CD  
1097 O OE1 . GLN A 143 ? 0.6524 0.9489 1.0046 -0.3079 -0.1115 0.0252  160 GLN A OE1 
1098 N NE2 . GLN A 143 ? 0.6547 1.0505 1.0632 -0.3074 -0.1228 0.0324  160 GLN A NE2 
1099 N N   . PHE A 144 ? 0.4983 0.7647 0.7860 -0.2203 -0.1050 0.0207  161 PHE A N   
1100 C CA  . PHE A 144 ? 0.4474 0.7108 0.7336 -0.2070 -0.0897 0.0306  161 PHE A CA  
1101 C C   . PHE A 144 ? 0.4190 0.6955 0.6978 -0.1738 -0.0885 0.0286  161 PHE A C   
1102 O O   . PHE A 144 ? 0.3948 0.6994 0.6876 -0.1553 -0.0755 0.0373  161 PHE A O   
1103 C CB  . PHE A 144 ? 0.4452 0.6430 0.6958 -0.2101 -0.0831 0.0254  161 PHE A CB  
1104 C CG  . PHE A 144 ? 0.4170 0.6028 0.6571 -0.1898 -0.0637 0.0332  161 PHE A CG  
1105 C CD1 . PHE A 144 ? 0.3997 0.5959 0.6541 -0.1984 -0.0487 0.0473  161 PHE A CD1 
1106 C CD2 . PHE A 144 ? 0.4134 0.5782 0.6281 -0.1633 -0.0608 0.0270  161 PHE A CD2 
1107 C CE1 . PHE A 144 ? 0.3876 0.5748 0.6294 -0.1798 -0.0320 0.0543  161 PHE A CE1 
1108 C CE2 . PHE A 144 ? 0.3931 0.5476 0.5966 -0.1462 -0.0448 0.0333  161 PHE A CE2 
1109 C CZ  . PHE A 144 ? 0.3884 0.5535 0.6037 -0.1537 -0.0310 0.0464  161 PHE A CZ  
1110 N N   . CYS A 145 ? 0.4371 0.6932 0.6932 -0.1665 -0.1019 0.0172  162 CYS A N   
1111 C CA  . CYS A 145 ? 0.4282 0.6873 0.6729 -0.1369 -0.1011 0.0157  162 CYS A CA  
1112 C C   . CYS A 145 ? 0.3889 0.7058 0.6666 -0.1259 -0.1039 0.0241  162 CYS A C   
1113 O O   . CYS A 145 ? 0.3493 0.6765 0.6294 -0.1014 -0.0932 0.0287  162 CYS A O   
1114 C CB  . CYS A 145 ? 0.4639 0.6923 0.6782 -0.1341 -0.1148 0.0038  162 CYS A CB  
1115 S SG  . CYS A 145 ? 0.5277 0.6889 0.7018 -0.1377 -0.1080 -0.0060 162 CYS A SG  
1116 N N   . LYS A 146 ? 0.3980 0.7525 0.7009 -0.1429 -0.1185 0.0259  163 LYS A N   
1117 C CA  . LYS A 146 ? 0.3975 0.8047 0.7310 -0.1281 -0.1183 0.0337  163 LYS A CA  
1118 C C   . LYS A 146 ? 0.3878 0.8256 0.7475 -0.1204 -0.0983 0.0455  163 LYS A C   
1119 O O   . LYS A 146 ? 0.3748 0.8414 0.7481 -0.0955 -0.0912 0.0516  163 LYS A O   
1120 C CB  . LYS A 146 ? 0.4227 0.8536 0.7719 -0.1432 -0.1317 0.0310  163 LYS A CB  
1121 C CG  . LYS A 146 ? 0.4295 0.8649 0.7677 -0.1326 -0.1502 0.0255  163 LYS A CG  
1122 C CD  . LYS A 146 ? 0.4495 0.9291 0.8166 -0.1392 -0.1602 0.0283  163 LYS A CD  
1123 C CE  . LYS A 146 ? 0.4690 0.9408 0.8184 -0.1453 -0.1817 0.0189  163 LYS A CE  
1124 N NZ  . LYS A 146 ? 0.4866 0.9933 0.8631 -0.1640 -0.1914 0.0192  163 LYS A NZ  
1125 N N   . GLU A 147 ? 0.4145 0.8427 0.7780 -0.1407 -0.0884 0.0486  164 GLU A N   
1126 C CA  . GLU A 147 ? 0.4343 0.8934 0.8212 -0.1367 -0.0682 0.0607  164 GLU A CA  
1127 C C   . GLU A 147 ? 0.4014 0.8424 0.7702 -0.1132 -0.0508 0.0625  164 GLU A C   
1128 O O   . GLU A 147 ? 0.4039 0.8765 0.7890 -0.0990 -0.0341 0.0710  164 GLU A O   
1129 C CB  . GLU A 147 ? 0.4924 0.9359 0.8813 -0.1661 -0.0629 0.0636  164 GLU A CB  
1130 C CG  . GLU A 147 ? 0.5286 1.0081 0.9433 -0.1677 -0.0438 0.0768  164 GLU A CG  
1131 C CD  . GLU A 147 ? 0.5699 1.0362 0.9896 -0.1996 -0.0430 0.0797  164 GLU A CD  
1132 O OE1 . GLU A 147 ? 0.5889 1.0258 0.9971 -0.2188 -0.0592 0.0697  164 GLU A OE1 
1133 O OE2 . GLU A 147 ? 0.5881 1.0712 1.0209 -0.2043 -0.0254 0.0916  164 GLU A OE2 
1134 N N   . HIS A 148 ? 0.3835 0.7673 0.7125 -0.1066 -0.0531 0.0522  165 HIS A N   
1135 C CA  . HIS A 148 ? 0.3680 0.7233 0.6714 -0.0852 -0.0380 0.0507  165 HIS A CA  
1136 C C   . HIS A 148 ? 0.3264 0.6589 0.6068 -0.0617 -0.0447 0.0417  165 HIS A C   
1137 O O   . HIS A 148 ? 0.3137 0.6170 0.5696 -0.0469 -0.0358 0.0382  165 HIS A O   
1138 C CB  . HIS A 148 ? 0.4068 0.7148 0.6839 -0.0984 -0.0319 0.0491  165 HIS A CB  
1139 C CG  . HIS A 148 ? 0.4603 0.7824 0.7556 -0.1216 -0.0237 0.0598  165 HIS A CG  
1140 N ND1 . HIS A 148 ? 0.4699 0.8249 0.7820 -0.1171 -0.0060 0.0716  165 HIS A ND1 
1141 C CD2 . HIS A 148 ? 0.4891 0.7949 0.7870 -0.1502 -0.0302 0.0608  165 HIS A CD2 
1142 C CE1 . HIS A 148 ? 0.4906 0.8507 0.8163 -0.1430 -0.0017 0.0813  165 HIS A CE1 
1143 N NE2 . HIS A 148 ? 0.5026 0.8310 0.8201 -0.1639 -0.0167 0.0747  165 HIS A NE2 
1144 N N   . GLY A 149 ? 0.3081 0.6563 0.5971 -0.0588 -0.0605 0.0393  166 GLY A N   
1145 C CA  . GLY A 149 ? 0.2817 0.6151 0.5536 -0.0349 -0.0654 0.0346  166 GLY A CA  
1146 C C   . GLY A 149 ? 0.2786 0.5578 0.5122 -0.0347 -0.0701 0.0252  166 GLY A C   
1147 O O   . GLY A 149 ? 0.2899 0.5478 0.5051 -0.0158 -0.0658 0.0225  166 GLY A O   
1148 N N   . PHE A 150 ? 0.2667 0.5234 0.4885 -0.0556 -0.0776 0.0203  167 PHE A N   
1149 C CA  . PHE A 150 ? 0.2928 0.5048 0.4815 -0.0558 -0.0824 0.0118  167 PHE A CA  
1150 C C   . PHE A 150 ? 0.3183 0.5349 0.5023 -0.0577 -0.0997 0.0084  167 PHE A C   
1151 O O   . PHE A 150 ? 0.3158 0.5578 0.5167 -0.0723 -0.1107 0.0092  167 PHE A O   
1152 C CB  . PHE A 150 ? 0.2901 0.4719 0.4655 -0.0748 -0.0799 0.0078  167 PHE A CB  
1153 C CG  . PHE A 150 ? 0.2912 0.4601 0.4621 -0.0711 -0.0641 0.0115  167 PHE A CG  
1154 C CD1 . PHE A 150 ? 0.3107 0.4496 0.4572 -0.0578 -0.0580 0.0082  167 PHE A CD1 
1155 C CD2 . PHE A 150 ? 0.2946 0.4851 0.4863 -0.0808 -0.0554 0.0196  167 PHE A CD2 
1156 C CE1 . PHE A 150 ? 0.3174 0.4466 0.4579 -0.0539 -0.0449 0.0119  167 PHE A CE1 
1157 C CE2 . PHE A 150 ? 0.3016 0.4807 0.4856 -0.0763 -0.0406 0.0243  167 PHE A CE2 
1158 C CZ  . PHE A 150 ? 0.3042 0.4528 0.4619 -0.0623 -0.0363 0.0201  167 PHE A CZ  
1159 N N   . ALA A 151 ? 0.3193 0.5099 0.4782 -0.0452 -0.1022 0.0047  168 ALA A N   
1160 C CA  . ALA A 151 ? 0.3307 0.5231 0.4794 -0.0447 -0.1176 0.0029  168 ALA A CA  
1161 C C   . ALA A 151 ? 0.3440 0.5167 0.4750 -0.0644 -0.1264 -0.0060 168 ALA A C   
1162 O O   . ALA A 151 ? 0.3610 0.5449 0.4879 -0.0704 -0.1415 -0.0081 168 ALA A O   
1163 C CB  . ALA A 151 ? 0.3256 0.4956 0.4526 -0.0260 -0.1160 0.0038  168 ALA A CB  
1164 N N   . GLY A 152 ? 0.3525 0.4954 0.4713 -0.0732 -0.1172 -0.0114 169 GLY A N   
1165 C CA  . GLY A 152 ? 0.3697 0.4868 0.4694 -0.0901 -0.1229 -0.0213 169 GLY A CA  
1166 C C   . GLY A 152 ? 0.3795 0.4646 0.4699 -0.0947 -0.1101 -0.0240 169 GLY A C   
1167 O O   . GLY A 152 ? 0.3647 0.4515 0.4645 -0.0868 -0.0977 -0.0176 169 GLY A O   
1168 N N   . TRP A 153 ? 0.4095 0.4644 0.4796 -0.1064 -0.1132 -0.0337 170 TRP A N   
1169 C CA  . TRP A 153 ? 0.4497 0.4722 0.5116 -0.1118 -0.1027 -0.0358 170 TRP A CA  
1170 C C   . TRP A 153 ? 0.4395 0.4234 0.4685 -0.1125 -0.1047 -0.0481 170 TRP A C   
1171 O O   . TRP A 153 ? 0.4638 0.4441 0.4804 -0.1224 -0.1169 -0.0574 170 TRP A O   
1172 C CB  . TRP A 153 ? 0.5241 0.5574 0.6080 -0.1326 -0.1047 -0.0324 170 TRP A CB  
1173 C CG  . TRP A 153 ? 0.6187 0.6156 0.6942 -0.1454 -0.0984 -0.0346 170 TRP A CG  
1174 C CD1 . TRP A 153 ? 0.6678 0.6183 0.7143 -0.1436 -0.0955 -0.0439 170 TRP A CD1 
1175 C CD2 . TRP A 153 ? 0.6703 0.6733 0.7667 -0.1610 -0.0934 -0.0260 170 TRP A CD2 
1176 N NE1 . TRP A 153 ? 0.7110 0.6355 0.7584 -0.1553 -0.0893 -0.0411 170 TRP A NE1 
1177 C CE2 . TRP A 153 ? 0.7149 0.6701 0.7922 -0.1679 -0.0882 -0.0298 170 TRP A CE2 
1178 C CE3 . TRP A 153 ? 0.6736 0.7189 0.8033 -0.1693 -0.0918 -0.0144 170 TRP A CE3 
1179 C CZ2 . TRP A 153 ? 0.7460 0.6907 0.8350 -0.1848 -0.0823 -0.0215 170 TRP A CZ2 
1180 C CZ3 . TRP A 153 ? 0.6999 0.7397 0.8426 -0.1867 -0.0850 -0.0063 170 TRP A CZ3 
1181 C CH2 . TRP A 153 ? 0.7346 0.7226 0.8562 -0.1952 -0.0807 -0.0094 170 TRP A CH2 
1182 N N   . PHE A 154 ? 0.4037 0.3604 0.4183 -0.1015 -0.0930 -0.0485 171 PHE A N   
1183 C CA  . PHE A 154 ? 0.4231 0.3453 0.4077 -0.0976 -0.0915 -0.0594 171 PHE A CA  
1184 C C   . PHE A 154 ? 0.4352 0.3264 0.4153 -0.0955 -0.0800 -0.0582 171 PHE A C   
1185 O O   . PHE A 154 ? 0.4206 0.3197 0.4141 -0.0879 -0.0710 -0.0476 171 PHE A O   
1186 C CB  . PHE A 154 ? 0.4261 0.3537 0.3990 -0.0794 -0.0870 -0.0578 171 PHE A CB  
1187 C CG  . PHE A 154 ? 0.4318 0.3835 0.4034 -0.0778 -0.0971 -0.0574 171 PHE A CG  
1188 C CD1 . PHE A 154 ? 0.4165 0.3984 0.4095 -0.0741 -0.0996 -0.0475 171 PHE A CD1 
1189 C CD2 . PHE A 154 ? 0.4549 0.3963 0.4003 -0.0784 -0.1035 -0.0667 171 PHE A CD2 
1190 C CE1 . PHE A 154 ? 0.4185 0.4200 0.4088 -0.0697 -0.1089 -0.0451 171 PHE A CE1 
1191 C CE2 . PHE A 154 ? 0.4471 0.4096 0.3880 -0.0755 -0.1127 -0.0641 171 PHE A CE2 
1192 C CZ  . PHE A 154 ? 0.4256 0.4176 0.3898 -0.0711 -0.1160 -0.0526 171 PHE A CZ  
1193 N N   . GLU A 155 ? 0.4669 0.3216 0.4259 -0.1008 -0.0804 -0.0691 172 GLU A N   
1194 C CA  . GLU A 155 ? 0.5170 0.3364 0.4653 -0.0927 -0.0690 -0.0687 172 GLU A CA  
1195 C C   . GLU A 155 ? 0.5047 0.3208 0.4372 -0.0715 -0.0614 -0.0708 172 GLU A C   
1196 O O   . GLU A 155 ? 0.5006 0.3155 0.4151 -0.0689 -0.0654 -0.0805 172 GLU A O   
1197 C CB  . GLU A 155 ? 0.5973 0.3737 0.5266 -0.1048 -0.0720 -0.0807 172 GLU A CB  
1198 C CG  . GLU A 155 ? 0.6340 0.4122 0.5789 -0.1307 -0.0808 -0.0793 172 GLU A CG  
1199 C CD  . GLU A 155 ? 0.7209 0.4468 0.6461 -0.1441 -0.0823 -0.0902 172 GLU A CD  
1200 O OE1 . GLU A 155 ? 0.7885 0.4761 0.6844 -0.1311 -0.0772 -0.1015 172 GLU A OE1 
1201 O OE2 . GLU A 155 ? 0.7426 0.4650 0.6814 -0.1681 -0.0883 -0.0877 172 GLU A OE2 
1202 N N   . THR A 156 ? 0.4945 0.3105 0.4333 -0.0573 -0.0508 -0.0613 173 THR A N   
1203 C CA  . THR A 156 ? 0.4747 0.2958 0.4050 -0.0378 -0.0430 -0.0605 173 THR A CA  
1204 C C   . THR A 156 ? 0.5096 0.3058 0.4333 -0.0240 -0.0325 -0.0582 173 THR A C   
1205 O O   . THR A 156 ? 0.5426 0.3233 0.4729 -0.0272 -0.0300 -0.0517 173 THR A O   
1206 C CB  . THR A 156 ? 0.4302 0.2880 0.3789 -0.0318 -0.0420 -0.0491 173 THR A CB  
1207 O OG1 . THR A 156 ? 0.4302 0.2944 0.3956 -0.0326 -0.0388 -0.0381 173 THR A OG1 
1208 C CG2 . THR A 156 ? 0.3805 0.2621 0.3348 -0.0404 -0.0515 -0.0503 173 THR A CG2 
1209 N N   . SER A 157 ? 0.5275 0.3230 0.4395 -0.0078 -0.0257 -0.0616 174 SER A N   
1210 C CA  . SER A 157 ? 0.5398 0.3258 0.4517 0.0102  -0.0154 -0.0559 174 SER A CA  
1211 C C   . SER A 157 ? 0.5061 0.3265 0.4262 0.0234  -0.0107 -0.0497 174 SER A C   
1212 O O   . SER A 157 ? 0.5289 0.3567 0.4377 0.0287  -0.0081 -0.0564 174 SER A O   
1213 C CB  . SER A 157 ? 0.6034 0.3479 0.4914 0.0188  -0.0096 -0.0678 174 SER A CB  
1214 O OG  . SER A 157 ? 0.6362 0.3741 0.5250 0.0405  0.0011  -0.0616 174 SER A OG  
1215 N N   . ALA A 158 ? 0.4423 0.2829 0.3803 0.0285  -0.0091 -0.0368 175 ALA A N   
1216 C CA  . ALA A 158 ? 0.4107 0.2802 0.3569 0.0408  -0.0044 -0.0308 175 ALA A CA  
1217 C C   . ALA A 158 ? 0.4537 0.3126 0.3917 0.0607  0.0060  -0.0327 175 ALA A C   
1218 O O   . ALA A 158 ? 0.4581 0.3393 0.3978 0.0701  0.0116  -0.0323 175 ALA A O   
1219 C CB  . ALA A 158 ? 0.3504 0.2445 0.3154 0.0400  -0.0072 -0.0180 175 ALA A CB  
1220 N N   . LYS A 159 ? 0.4710 0.2957 0.4005 0.0675  0.0095  -0.0342 176 LYS A N   
1221 C CA  . LYS A 159 ? 0.5120 0.3215 0.4333 0.0897  0.0201  -0.0359 176 LYS A CA  
1222 C C   . LYS A 159 ? 0.5659 0.3648 0.4661 0.0951  0.0261  -0.0510 176 LYS A C   
1223 O O   . LYS A 159 ? 0.5517 0.3728 0.4535 0.1113  0.0353  -0.0502 176 LYS A O   
1224 C CB  . LYS A 159 ? 0.5232 0.2878 0.4358 0.0938  0.0217  -0.0347 176 LYS A CB  
1225 C CG  . LYS A 159 ? 0.5689 0.3164 0.4754 0.1203  0.0326  -0.0334 176 LYS A CG  
1226 C CD  . LYS A 159 ? 0.6213 0.3166 0.5164 0.1234  0.0339  -0.0315 176 LYS A CD  
1227 C CE  . LYS A 159 ? 0.6855 0.3579 0.5704 0.1534  0.0459  -0.0329 176 LYS A CE  
1228 N NZ  . LYS A 159 ? 0.7430 0.3795 0.6264 0.1655  0.0483  -0.0209 176 LYS A NZ  
1229 N N   . ASP A 160 ? 0.6143 0.3831 0.4951 0.0804  0.0205  -0.0641 177 ASP A N   
1230 C CA  . ASP A 160 ? 0.6647 0.4184 0.5188 0.0826  0.0240  -0.0805 177 ASP A CA  
1231 C C   . ASP A 160 ? 0.5951 0.3781 0.4471 0.0688  0.0176  -0.0832 177 ASP A C   
1232 O O   . ASP A 160 ? 0.6123 0.3839 0.4392 0.0678  0.0184  -0.0963 177 ASP A O   
1233 C CB  . ASP A 160 ? 0.7511 0.4509 0.5808 0.0741  0.0201  -0.0950 177 ASP A CB  
1234 C CG  . ASP A 160 ? 0.7994 0.4594 0.6232 0.0909  0.0285  -0.0944 177 ASP A CG  
1235 O OD1 . ASP A 160 ? 0.8110 0.4851 0.6437 0.1148  0.0395  -0.0863 177 ASP A OD1 
1236 O OD2 . ASP A 160 ? 0.8666 0.4807 0.6768 0.0801  0.0239  -0.1017 177 ASP A OD2 
1237 N N   . ASN A 161 ? 0.5313 0.3504 0.4068 0.0599  0.0118  -0.0706 178 ASN A N   
1238 C CA  . ASN A 161 ? 0.5152 0.3589 0.3900 0.0476  0.0052  -0.0705 178 ASN A CA  
1239 C C   . ASN A 161 ? 0.5316 0.3551 0.3863 0.0318  -0.0052 -0.0829 178 ASN A C   
1240 O O   . ASN A 161 ? 0.5445 0.3696 0.3786 0.0313  -0.0053 -0.0907 178 ASN A O   
1241 C CB  . ASN A 161 ? 0.5212 0.3896 0.3911 0.0589  0.0150  -0.0687 178 ASN A CB  
1242 C CG  . ASN A 161 ? 0.4965 0.3939 0.3727 0.0467  0.0086  -0.0620 178 ASN A CG  
1243 O OD1 . ASN A 161 ? 0.4788 0.3837 0.3700 0.0348  -0.0013 -0.0559 178 ASN A OD1 
1244 N ND2 . ASN A 161 ? 0.5049 0.4169 0.3686 0.0506  0.0149  -0.0624 178 ASN A ND2 
1245 N N   . ILE A 162 ? 0.5396 0.3479 0.4014 0.0183  -0.0144 -0.0834 179 ILE A N   
1246 C CA  . ILE A 162 ? 0.5367 0.3288 0.3837 0.0016  -0.0259 -0.0947 179 ILE A CA  
1247 C C   . ILE A 162 ? 0.5186 0.3398 0.3865 -0.0124 -0.0369 -0.0856 179 ILE A C   
1248 O O   . ILE A 162 ? 0.4927 0.3241 0.3835 -0.0146 -0.0371 -0.0752 179 ILE A O   
1249 C CB  . ILE A 162 ? 0.5651 0.3171 0.4060 -0.0057 -0.0281 -0.1020 179 ILE A CB  
1250 C CG1 . ILE A 162 ? 0.6074 0.3238 0.4247 0.0109  -0.0167 -0.1122 179 ILE A CG1 
1251 C CG2 . ILE A 162 ? 0.5737 0.3173 0.4056 -0.0277 -0.0428 -0.1120 179 ILE A CG2 
1252 C CD1 . ILE A 162 ? 0.6586 0.3258 0.4644 0.0039  -0.0184 -0.1207 179 ILE A CD1 
1253 N N   . ASN A 163 ? 0.5187 0.3530 0.3766 -0.0200 -0.0456 -0.0895 180 ASN A N   
1254 C CA  . ASN A 163 ? 0.4984 0.3586 0.3733 -0.0316 -0.0571 -0.0822 180 ASN A CA  
1255 C C   . ASN A 163 ? 0.4802 0.3688 0.3797 -0.0269 -0.0548 -0.0673 180 ASN A C   
1256 O O   . ASN A 163 ? 0.4690 0.3756 0.3827 -0.0343 -0.0633 -0.0618 180 ASN A O   
1257 C CB  . ASN A 163 ? 0.4807 0.3326 0.3658 -0.0479 -0.0670 -0.0852 180 ASN A CB  
1258 C CG  . ASN A 163 ? 0.5399 0.3680 0.4001 -0.0587 -0.0752 -0.1011 180 ASN A CG  
1259 O OD1 . ASN A 163 ? 0.5855 0.4114 0.4206 -0.0557 -0.0775 -0.1093 180 ASN A OD1 
1260 N ND2 . ASN A 163 ? 0.5374 0.3462 0.4029 -0.0725 -0.0798 -0.1054 180 ASN A ND2 
1261 N N   . ILE A 164 ? 0.4801 0.3733 0.3844 -0.0150 -0.0441 -0.0612 181 ILE A N   
1262 C CA  . ILE A 164 ? 0.4600 0.3760 0.3842 -0.0127 -0.0431 -0.0492 181 ILE A CA  
1263 C C   . ILE A 164 ? 0.4792 0.4124 0.3993 -0.0139 -0.0475 -0.0450 181 ILE A C   
1264 O O   . ILE A 164 ? 0.4754 0.4212 0.4086 -0.0179 -0.0537 -0.0388 181 ILE A O   
1265 C CB  . ILE A 164 ? 0.4199 0.3383 0.3523 -0.0020 -0.0328 -0.0436 181 ILE A CB  
1266 C CG1 . ILE A 164 ? 0.4009 0.3072 0.3435 -0.0026 -0.0317 -0.0421 181 ILE A CG1 
1267 C CG2 . ILE A 164 ? 0.3813 0.3229 0.3278 -0.0007 -0.0324 -0.0335 181 ILE A CG2 
1268 C CD1 . ILE A 164 ? 0.4019 0.3006 0.3443 0.0103  -0.0221 -0.0399 181 ILE A CD1 
1269 N N   . GLU A 165 ? 0.5128 0.4439 0.4126 -0.0102 -0.0443 -0.0486 182 GLU A N   
1270 C CA  . GLU A 165 ? 0.5610 0.5045 0.4516 -0.0114 -0.0477 -0.0435 182 GLU A CA  
1271 C C   . GLU A 165 ? 0.5229 0.4694 0.4114 -0.0196 -0.0619 -0.0446 182 GLU A C   
1272 O O   . GLU A 165 ? 0.4875 0.4462 0.3830 -0.0204 -0.0672 -0.0358 182 GLU A O   
1273 C CB  . GLU A 165 ? 0.6754 0.6143 0.5397 -0.0059 -0.0405 -0.0486 182 GLU A CB  
1274 C CG  . GLU A 165 ? 0.7461 0.6889 0.6132 0.0044  -0.0256 -0.0464 182 GLU A CG  
1275 C CD  . GLU A 165 ? 0.8143 0.7784 0.6937 0.0045  -0.0212 -0.0328 182 GLU A CD  
1276 O OE1 . GLU A 165 ? 0.8541 0.8248 0.7246 -0.0002 -0.0251 -0.0265 182 GLU A OE1 
1277 O OE2 . GLU A 165 ? 0.8556 0.8293 0.7536 0.0083  -0.0147 -0.0276 182 GLU A OE2 
1278 N N   . GLU A 166 ? 0.5080 0.4429 0.3866 -0.0256 -0.0681 -0.0554 183 GLU A N   
1279 C CA  . GLU A 166 ? 0.4964 0.4391 0.3764 -0.0349 -0.0831 -0.0569 183 GLU A CA  
1280 C C   . GLU A 166 ? 0.4362 0.3937 0.3465 -0.0378 -0.0875 -0.0490 183 GLU A C   
1281 O O   . GLU A 166 ? 0.4298 0.4045 0.3480 -0.0383 -0.0965 -0.0422 183 GLU A O   
1282 C CB  . GLU A 166 ? 0.5508 0.4768 0.4159 -0.0438 -0.0892 -0.0712 183 GLU A CB  
1283 C CG  . GLU A 166 ? 0.5964 0.5085 0.4249 -0.0405 -0.0870 -0.0812 183 GLU A CG  
1284 C CD  . GLU A 166 ? 0.6048 0.4980 0.4211 -0.0296 -0.0705 -0.0864 183 GLU A CD  
1285 O OE1 . GLU A 166 ? 0.5889 0.4808 0.4257 -0.0236 -0.0605 -0.0808 183 GLU A OE1 
1286 O OE2 . GLU A 166 ? 0.6513 0.5333 0.4363 -0.0261 -0.0678 -0.0959 183 GLU A OE2 
1287 N N   . ALA A 167 ? 0.3912 0.3424 0.3174 -0.0379 -0.0805 -0.0489 184 ALA A N   
1288 C CA  . ALA A 167 ? 0.3418 0.3073 0.2945 -0.0391 -0.0819 -0.0415 184 ALA A CA  
1289 C C   . ALA A 167 ? 0.3303 0.3083 0.2905 -0.0308 -0.0802 -0.0316 184 ALA A C   
1290 O O   . ALA A 167 ? 0.3317 0.3249 0.3060 -0.0301 -0.0860 -0.0262 184 ALA A O   
1291 C CB  . ALA A 167 ? 0.3101 0.2653 0.2733 -0.0397 -0.0736 -0.0418 184 ALA A CB  
1292 N N   . ALA A 168 ? 0.3160 0.2877 0.2683 -0.0246 -0.0719 -0.0291 185 ALA A N   
1293 C CA  . ALA A 168 ? 0.3186 0.2966 0.2742 -0.0194 -0.0711 -0.0202 185 ALA A CA  
1294 C C   . ALA A 168 ? 0.3399 0.3233 0.2872 -0.0186 -0.0793 -0.0156 185 ALA A C   
1295 O O   . ALA A 168 ? 0.3452 0.3332 0.3016 -0.0146 -0.0823 -0.0087 185 ALA A O   
1296 C CB  . ALA A 168 ? 0.3064 0.2798 0.2555 -0.0162 -0.0618 -0.0178 185 ALA A CB  
1297 N N   . ARG A 169 ? 0.3644 0.3455 0.2917 -0.0206 -0.0827 -0.0189 186 ARG A N   
1298 C CA  . ARG A 169 ? 0.3914 0.3784 0.3080 -0.0191 -0.0914 -0.0128 186 ARG A CA  
1299 C C   . ARG A 169 ? 0.3605 0.3618 0.2922 -0.0199 -0.1033 -0.0117 186 ARG A C   
1300 O O   . ARG A 169 ? 0.3260 0.3341 0.2606 -0.0140 -0.1093 -0.0023 186 ARG A O   
1301 C CB  . ARG A 169 ? 0.4554 0.4386 0.3438 -0.0212 -0.0932 -0.0170 186 ARG A CB  
1302 C CG  . ARG A 169 ? 0.4816 0.4606 0.3532 -0.0175 -0.0855 -0.0089 186 ARG A CG  
1303 C CD  . ARG A 169 ? 0.4952 0.4739 0.3357 -0.0182 -0.0886 -0.0110 186 ARG A CD  
1304 N NE  . ARG A 169 ? 0.4991 0.4831 0.3306 -0.0158 -0.0969 0.0015  186 ARG A NE  
1305 C CZ  . ARG A 169 ? 0.5064 0.4875 0.3249 -0.0134 -0.0909 0.0140  186 ARG A CZ  
1306 N NH1 . ARG A 169 ? 0.4982 0.4755 0.3145 -0.0140 -0.0759 0.0161  186 ARG A NH1 
1307 N NH2 . ARG A 169 ? 0.5240 0.5073 0.3332 -0.0105 -0.1002 0.0259  186 ARG A NH2 
1308 N N   . PHE A 170 ? 0.3492 0.3550 0.2909 -0.0269 -0.1064 -0.0200 187 PHE A N   
1309 C CA  . PHE A 170 ? 0.3542 0.3802 0.3164 -0.0294 -0.1164 -0.0184 187 PHE A CA  
1310 C C   . PHE A 170 ? 0.3502 0.3857 0.3353 -0.0206 -0.1129 -0.0102 187 PHE A C   
1311 O O   . PHE A 170 ? 0.3523 0.4047 0.3482 -0.0143 -0.1206 -0.0032 187 PHE A O   
1312 C CB  . PHE A 170 ? 0.3609 0.3872 0.3303 -0.0416 -0.1183 -0.0281 187 PHE A CB  
1313 C CG  . PHE A 170 ? 0.3568 0.4096 0.3494 -0.0475 -0.1290 -0.0261 187 PHE A CG  
1314 C CD1 . PHE A 170 ? 0.3531 0.4206 0.3739 -0.0451 -0.1239 -0.0208 187 PHE A CD1 
1315 C CD2 . PHE A 170 ? 0.3895 0.4548 0.3757 -0.0564 -0.1440 -0.0299 187 PHE A CD2 
1316 C CE1 . PHE A 170 ? 0.3852 0.4830 0.4311 -0.0510 -0.1323 -0.0181 187 PHE A CE1 
1317 C CE2 . PHE A 170 ? 0.3999 0.4961 0.4117 -0.0639 -0.1550 -0.0274 187 PHE A CE2 
1318 C CZ  . PHE A 170 ? 0.3950 0.5091 0.4386 -0.0607 -0.1484 -0.0208 187 PHE A CZ  
1319 N N   . LEU A 171 ? 0.3534 0.3778 0.3441 -0.0184 -0.1014 -0.0108 188 LEU A N   
1320 C CA  . LEU A 171 ? 0.3315 0.3613 0.3387 -0.0098 -0.0974 -0.0053 188 LEU A CA  
1321 C C   . LEU A 171 ? 0.3321 0.3537 0.3306 0.0003  -0.0988 0.0026  188 LEU A C   
1322 O O   . LEU A 171 ? 0.3087 0.3377 0.3187 0.0100  -0.1009 0.0078  188 LEU A O   
1323 C CB  . LEU A 171 ? 0.3038 0.3246 0.3161 -0.0109 -0.0865 -0.0084 188 LEU A CB  
1324 C CG  . LEU A 171 ? 0.3002 0.3216 0.3228 -0.0021 -0.0809 -0.0052 188 LEU A CG  
1325 C CD1 . LEU A 171 ? 0.2782 0.3214 0.3209 0.0022  -0.0829 -0.0030 188 LEU A CD1 
1326 C CD2 . LEU A 171 ? 0.2989 0.3106 0.3204 -0.0037 -0.0716 -0.0080 188 LEU A CD2 
1327 N N   . VAL A 172 ? 0.3399 0.3458 0.3185 -0.0017 -0.0964 0.0038  189 VAL A N   
1328 C CA  . VAL A 172 ? 0.3493 0.3428 0.3169 0.0047  -0.0972 0.0129  189 VAL A CA  
1329 C C   . VAL A 172 ? 0.3791 0.3815 0.3433 0.0107  -0.1080 0.0202  189 VAL A C   
1330 O O   . VAL A 172 ? 0.3746 0.3695 0.3398 0.0208  -0.1099 0.0288  189 VAL A O   
1331 C CB  . VAL A 172 ? 0.3145 0.2940 0.2631 -0.0010 -0.0910 0.0142  189 VAL A CB  
1332 C CG1 . VAL A 172 ? 0.3212 0.2874 0.2570 0.0028  -0.0925 0.0259  189 VAL A CG1 
1333 C CG2 . VAL A 172 ? 0.2679 0.2413 0.2238 -0.0045 -0.0814 0.0095  189 VAL A CG2 
1334 N N   . GLU A 173 ? 0.4219 0.4389 0.3812 0.0052  -0.1160 0.0167  190 GLU A N   
1335 C CA  . GLU A 173 ? 0.4820 0.5150 0.4407 0.0104  -0.1292 0.0234  190 GLU A CA  
1336 C C   . GLU A 173 ? 0.4539 0.5040 0.4395 0.0210  -0.1326 0.0276  190 GLU A C   
1337 O O   . GLU A 173 ? 0.4699 0.5205 0.4556 0.0338  -0.1379 0.0383  190 GLU A O   
1338 C CB  . GLU A 173 ? 0.5561 0.6028 0.5057 0.0001  -0.1383 0.0162  190 GLU A CB  
1339 C CG  . GLU A 173 ? 0.6120 0.6786 0.5571 0.0042  -0.1548 0.0235  190 GLU A CG  
1340 C CD  . GLU A 173 ? 0.7012 0.7811 0.6364 -0.0088 -0.1656 0.0136  190 GLU A CD  
1341 O OE1 . GLU A 173 ? 0.7485 0.8417 0.7024 -0.0187 -0.1681 0.0044  190 GLU A OE1 
1342 O OE2 . GLU A 173 ? 0.7781 0.8533 0.6843 -0.0103 -0.1716 0.0148  190 GLU A OE2 
1343 N N   . LYS A 174 ? 0.4213 0.4843 0.4287 0.0173  -0.1283 0.0205  191 LYS A N   
1344 C CA  . LYS A 174 ? 0.4065 0.4890 0.4403 0.0289  -0.1284 0.0245  191 LYS A CA  
1345 C C   . LYS A 174 ? 0.3861 0.4465 0.4176 0.0436  -0.1201 0.0292  191 LYS A C   
1346 O O   . LYS A 174 ? 0.3946 0.4633 0.4367 0.0589  -0.1229 0.0361  191 LYS A O   
1347 C CB  . LYS A 174 ? 0.4214 0.5202 0.4767 0.0212  -0.1223 0.0172  191 LYS A CB  
1348 C CG  . LYS A 174 ? 0.4650 0.5807 0.5250 0.0041  -0.1292 0.0110  191 LYS A CG  
1349 C CD  . LYS A 174 ? 0.5162 0.6678 0.5935 0.0048  -0.1434 0.0160  191 LYS A CD  
1350 C CE  . LYS A 174 ? 0.5547 0.7119 0.6225 -0.0139 -0.1545 0.0089  191 LYS A CE  
1351 N NZ  . LYS A 174 ? 0.5922 0.7214 0.6243 -0.0157 -0.1566 0.0060  191 LYS A NZ  
1352 N N   . ILE A 175 ? 0.3606 0.3927 0.3779 0.0391  -0.1105 0.0253  192 ILE A N   
1353 C CA  . ILE A 175 ? 0.3639 0.3706 0.3756 0.0495  -0.1043 0.0281  192 ILE A CA  
1354 C C   . ILE A 175 ? 0.3779 0.3679 0.3749 0.0588  -0.1107 0.0396  192 ILE A C   
1355 O O   . ILE A 175 ? 0.4290 0.4068 0.4284 0.0745  -0.1103 0.0448  192 ILE A O   
1356 C CB  . ILE A 175 ? 0.3339 0.3167 0.3337 0.0391  -0.0947 0.0218  192 ILE A CB  
1357 C CG1 . ILE A 175 ? 0.3226 0.3179 0.3341 0.0323  -0.0883 0.0128  192 ILE A CG1 
1358 C CG2 . ILE A 175 ? 0.3516 0.3053 0.3436 0.0473  -0.0903 0.0234  192 ILE A CG2 
1359 C CD1 . ILE A 175 ? 0.3069 0.2884 0.3073 0.0204  -0.0822 0.0080  192 ILE A CD1 
1360 N N   . LEU A 176 ? 0.3630 0.3516 0.3435 0.0506  -0.1162 0.0441  193 LEU A N   
1361 C CA  . LEU A 176 ? 0.3869 0.3614 0.3510 0.0582  -0.1227 0.0574  193 LEU A CA  
1362 C C   . LEU A 176 ? 0.4061 0.4000 0.3819 0.0751  -0.1333 0.0663  193 LEU A C   
1363 O O   . LEU A 176 ? 0.4305 0.4055 0.3995 0.0893  -0.1354 0.0775  193 LEU A O   
1364 C CB  . LEU A 176 ? 0.3987 0.3716 0.3403 0.0465  -0.1256 0.0608  193 LEU A CB  
1365 C CG  . LEU A 176 ? 0.4121 0.3630 0.3397 0.0341  -0.1149 0.0582  193 LEU A CG  
1366 C CD1 . LEU A 176 ? 0.4094 0.3677 0.3170 0.0241  -0.1162 0.0589  193 LEU A CD1 
1367 C CD2 . LEU A 176 ? 0.4516 0.3693 0.3683 0.0381  -0.1114 0.0690  193 LEU A CD2 
1368 N N   . VAL A 177 ? 0.3860 0.4172 0.3803 0.0737  -0.1400 0.0621  194 VAL A N   
1369 C CA  . VAL A 177 ? 0.3998 0.4585 0.4104 0.0898  -0.1510 0.0713  194 VAL A CA  
1370 C C   . VAL A 177 ? 0.4217 0.4741 0.4496 0.1096  -0.1436 0.0729  194 VAL A C   
1371 O O   . VAL A 177 ? 0.4803 0.5272 0.5081 0.1294  -0.1483 0.0847  194 VAL A O   
1372 C CB  . VAL A 177 ? 0.3709 0.4755 0.4010 0.0804  -0.1608 0.0661  194 VAL A CB  
1373 C CG1 . VAL A 177 ? 0.3588 0.4999 0.4129 0.0979  -0.1720 0.0764  194 VAL A CG1 
1374 C CG2 . VAL A 177 ? 0.3576 0.4625 0.3640 0.0642  -0.1694 0.0641  194 VAL A CG2 
1375 N N   . ASN A 178 ? 0.4231 0.4718 0.4614 0.1052  -0.1315 0.0613  195 ASN A N   
1376 C CA  . ASN A 178 ? 0.4581 0.4982 0.5081 0.1228  -0.1220 0.0592  195 ASN A CA  
1377 C C   . ASN A 178 ? 0.5304 0.5204 0.5577 0.1323  -0.1175 0.0631  195 ASN A C   
1378 O O   . ASN A 178 ? 0.5465 0.5249 0.5783 0.1534  -0.1140 0.0655  195 ASN A O   
1379 C CB  . ASN A 178 ? 0.4242 0.4680 0.4832 0.1129  -0.1099 0.0457  195 ASN A CB  
1380 C CG  . ASN A 178 ? 0.3877 0.4773 0.4713 0.1034  -0.1120 0.0423  195 ASN A CG  
1381 O OD1 . ASN A 178 ? 0.3886 0.5122 0.4879 0.1064  -0.1226 0.0490  195 ASN A OD1 
1382 N ND2 . ASN A 178 ? 0.3654 0.4556 0.4519 0.0900  -0.1027 0.0323  195 ASN A ND2 
1383 N N   . HIS A 179 ? 0.5762 0.5363 0.5793 0.1170  -0.1173 0.0638  196 HIS A N   
1384 C CA  . HIS A 179 ? 0.6627 0.5742 0.6451 0.1208  -0.1129 0.0672  196 HIS A CA  
1385 C C   . HIS A 179 ? 0.7988 0.6955 0.7707 0.1363  -0.1213 0.0840  196 HIS A C   
1386 O O   . HIS A 179 ? 0.8340 0.6966 0.7990 0.1520  -0.1184 0.0877  196 HIS A O   
1387 C CB  . HIS A 179 ? 0.6241 0.5139 0.5888 0.0978  -0.1081 0.0624  196 HIS A CB  
1388 C CG  . HIS A 179 ? 0.6378 0.4788 0.5841 0.0967  -0.1034 0.0642  196 HIS A CG  
1389 N ND1 . HIS A 179 ? 0.6722 0.4843 0.5994 0.0970  -0.1075 0.0786  196 HIS A ND1 
1390 C CD2 . HIS A 179 ? 0.6424 0.4566 0.5851 0.0953  -0.0959 0.0538  196 HIS A CD2 
1391 C CE1 . HIS A 179 ? 0.7015 0.4693 0.6155 0.0939  -0.1025 0.0770  196 HIS A CE1 
1392 N NE2 . HIS A 179 ? 0.6821 0.4505 0.6046 0.0927  -0.0961 0.0611  196 HIS A NE2 
1393 N N   . GLN A 180 ? 0.9175 0.8401 0.8879 0.1332  -0.1321 0.0936  197 GLN A N   
1394 C CA  . GLN A 180 ? 1.0757 0.9973 1.0402 0.1511  -0.1428 0.1115  197 GLN A CA  
1395 C C   . GLN A 180 ? 1.0833 1.0279 1.0724 0.1789  -0.1462 0.1155  197 GLN A C   
1396 O O   . GLN A 180 ? 1.1218 1.0453 1.1044 0.2005  -0.1498 0.1291  197 GLN A O   
1397 C CB  . GLN A 180 ? 1.2003 1.1504 1.1558 0.1398  -0.1547 0.1188  197 GLN A CB  
1398 C CG  . GLN A 180 ? 1.3199 1.2472 1.2467 0.1185  -0.1516 0.1203  197 GLN A CG  
1399 C CD  . GLN A 180 ? 1.4554 1.4115 1.3699 0.1089  -0.1624 0.1246  197 GLN A CD  
1400 O OE1 . GLN A 180 ? 1.4845 1.4814 1.4148 0.1098  -0.1719 0.1200  197 GLN A OE1 
1401 N NE2 . GLN A 180 ? 1.5278 1.4629 1.4127 0.0987  -0.1610 0.1333  197 GLN A NE2 
1402 N N   . SER A 181 ? 1.0570 1.0454 1.0747 0.1790  -0.1448 0.1053  198 SER A N   
1403 C CA  . SER A 181 ? 1.0602 1.0872 1.1069 0.2037  -0.1494 0.1111  198 SER A CA  
1404 C C   . SER A 181 ? 1.0900 1.0863 1.1387 0.2292  -0.1391 0.1128  198 SER A C   
1405 O O   . SER A 181 ? 1.0849 1.0608 1.1328 0.2328  -0.1268 0.0999  198 SER A O   
1406 C CB  . SER A 181 ? 1.0167 1.0956 1.0946 0.1941  -0.1467 0.0994  198 SER A CB  
1407 O OG  . SER A 181 ? 0.9976 1.0577 1.0751 0.1867  -0.1309 0.0842  198 SER A OG  
1408 N N   . GLU B 3   ? 0.9060 1.1642 0.7417 0.0151  0.2914  -0.0757 20  GLU B N   
1409 C CA  . GLU B 3   ? 0.8586 1.1247 0.7540 0.0209  0.2706  -0.0728 20  GLU B CA  
1410 C C   . GLU B 3   ? 0.8219 1.0429 0.7026 0.0182  0.2364  -0.0676 20  GLU B C   
1411 O O   . GLU B 3   ? 0.8465 1.0315 0.6920 0.0279  0.2244  -0.0798 20  GLU B O   
1412 C CB  . GLU B 3   ? 0.8688 1.1539 0.8044 0.0486  0.2771  -0.0936 20  GLU B CB  
1413 C CG  . GLU B 3   ? 0.9004 1.2227 0.8557 0.0594  0.3082  -0.1011 20  GLU B CG  
1414 C CD  . GLU B 3   ? 0.9389 1.2325 0.8597 0.0810  0.3179  -0.1217 20  GLU B CD  
1415 O OE1 . GLU B 3   ? 0.9316 1.1881 0.8333 0.0929  0.3010  -0.1361 20  GLU B OE1 
1416 O OE2 . GLU B 3   ? 0.9737 1.2811 0.8872 0.0854  0.3426  -0.1235 20  GLU B OE2 
1417 N N   . THR B 4   ? 0.7641 0.9886 0.6740 0.0048  0.2208  -0.0508 21  THR B N   
1418 C CA  . THR B 4   ? 0.7255 0.9158 0.6351 0.0041  0.1903  -0.0466 21  THR B CA  
1419 C C   . THR B 4   ? 0.6736 0.8756 0.6353 0.0141  0.1765  -0.0494 21  THR B C   
1420 O O   . THR B 4   ? 0.6673 0.9073 0.6722 0.0195  0.1872  -0.0512 21  THR B O   
1421 C CB  . THR B 4   ? 0.7375 0.9100 0.6294 -0.0180 0.1788  -0.0259 21  THR B CB  
1422 O OG1 . THR B 4   ? 0.7385 0.8764 0.6243 -0.0151 0.1512  -0.0253 21  THR B OG1 
1423 C CG2 . THR B 4   ? 0.7166 0.9182 0.6475 -0.0338 0.1841  -0.0120 21  THR B CG2 
1424 N N   . ARG B 5   ? 0.6308 0.8008 0.5869 0.0158  0.1521  -0.0487 22  ARG B N   
1425 C CA  . ARG B 5   ? 0.5803 0.7522 0.5731 0.0251  0.1372  -0.0510 22  ARG B CA  
1426 C C   . ARG B 5   ? 0.5312 0.6807 0.5215 0.0128  0.1152  -0.0394 22  ARG B C   
1427 O O   . ARG B 5   ? 0.5315 0.6508 0.4878 0.0069  0.1057  -0.0366 22  ARG B O   
1428 C CB  . ARG B 5   ? 0.6179 0.7695 0.6025 0.0448  0.1337  -0.0676 22  ARG B CB  
1429 C CG  . ARG B 5   ? 0.6858 0.8597 0.6819 0.0617  0.1549  -0.0815 22  ARG B CG  
1430 C CD  . ARG B 5   ? 0.7631 0.9061 0.7359 0.0781  0.1537  -0.0999 22  ARG B CD  
1431 N NE  . ARG B 5   ? 0.7776 0.8998 0.7691 0.0880  0.1350  -0.1021 22  ARG B NE  
1432 C CZ  . ARG B 5   ? 0.8073 0.9029 0.7912 0.1035  0.1327  -0.1172 22  ARG B CZ  
1433 N NH1 . ARG B 5   ? 0.8434 0.9284 0.8003 0.1121  0.1470  -0.1345 22  ARG B NH1 
1434 N NH2 . ARG B 5   ? 0.7953 0.8720 0.7963 0.1094  0.1161  -0.1153 22  ARG B NH2 
1435 N N   . GLU B 6   ? 0.4809 0.6463 0.5075 0.0104  0.1067  -0.0339 23  GLU B N   
1436 C CA  . GLU B 6   ? 0.4493 0.5971 0.4785 0.0012  0.0876  -0.0259 23  GLU B CA  
1437 C C   . GLU B 6   ? 0.4173 0.5609 0.4664 0.0151  0.0750  -0.0320 23  GLU B C   
1438 O O   . GLU B 6   ? 0.4372 0.6047 0.5143 0.0266  0.0798  -0.0364 23  GLU B O   
1439 C CB  . GLU B 6   ? 0.4672 0.6358 0.5177 -0.0165 0.0884  -0.0142 23  GLU B CB  
1440 C CG  . GLU B 6   ? 0.5069 0.6776 0.5381 -0.0338 0.1019  -0.0046 23  GLU B CG  
1441 C CD  . GLU B 6   ? 0.5183 0.6932 0.5638 -0.0554 0.0969  0.0078  23  GLU B CD  
1442 O OE1 . GLU B 6   ? 0.5293 0.7063 0.5982 -0.0572 0.0822  0.0075  23  GLU B OE1 
1443 O OE2 . GLU B 6   ? 0.5862 0.7586 0.6160 -0.0721 0.1073  0.0182  23  GLU B OE2 
1444 N N   . HIS B 7   ? 0.3754 0.4888 0.4098 0.0148  0.0594  -0.0319 24  HIS B N   
1445 C CA  . HIS B 7   ? 0.3510 0.4559 0.3988 0.0241  0.0470  -0.0347 24  HIS B CA  
1446 C C   . HIS B 7   ? 0.3146 0.4089 0.3638 0.0140  0.0327  -0.0277 24  HIS B C   
1447 O O   . HIS B 7   ? 0.3151 0.3945 0.3468 0.0032  0.0295  -0.0234 24  HIS B O   
1448 C CB  . HIS B 7   ? 0.3829 0.4598 0.4104 0.0336  0.0436  -0.0436 24  HIS B CB  
1449 C CG  . HIS B 7   ? 0.4344 0.5132 0.4543 0.0449  0.0567  -0.0542 24  HIS B CG  
1450 N ND1 . HIS B 7   ? 0.4674 0.5407 0.4595 0.0410  0.0655  -0.0580 24  HIS B ND1 
1451 C CD2 . HIS B 7   ? 0.4505 0.5328 0.4839 0.0608  0.0620  -0.0625 24  HIS B CD2 
1452 C CE1 . HIS B 7   ? 0.4846 0.5594 0.4725 0.0534  0.0771  -0.0700 24  HIS B CE1 
1453 N NE2 . HIS B 7   ? 0.4778 0.5564 0.4917 0.0663  0.0751  -0.0733 24  HIS B NE2 
1454 N N   . LEU B 8   ? 0.3141 0.4135 0.3815 0.0190  0.0238  -0.0270 25  LEU B N   
1455 C CA  . LEU B 8   ? 0.3193 0.4074 0.3852 0.0115  0.0107  -0.0229 25  LEU B CA  
1456 C C   . LEU B 8   ? 0.3191 0.3904 0.3815 0.0216  0.0034  -0.0256 25  LEU B C   
1457 O O   . LEU B 8   ? 0.3328 0.4132 0.4093 0.0322  0.0024  -0.0258 25  LEU B O   
1458 C CB  . LEU B 8   ? 0.3370 0.4491 0.4246 0.0038  0.0059  -0.0179 25  LEU B CB  
1459 C CG  . LEU B 8   ? 0.3616 0.4613 0.4434 -0.0057 -0.0068 -0.0156 25  LEU B CG  
1460 C CD1 . LEU B 8   ? 0.3734 0.4506 0.4353 -0.0170 -0.0063 -0.0147 25  LEU B CD1 
1461 C CD2 . LEU B 8   ? 0.3566 0.4848 0.4620 -0.0130 -0.0125 -0.0125 25  LEU B CD2 
1462 N N   . PHE B 9   ? 0.3120 0.3588 0.3562 0.0191  -0.0009 -0.0274 26  PHE B N   
1463 C CA  . PHE B 9   ? 0.3081 0.3386 0.3488 0.0259  -0.0056 -0.0293 26  PHE B CA  
1464 C C   . PHE B 9   ? 0.3041 0.3254 0.3391 0.0189  -0.0135 -0.0265 26  PHE B C   
1465 O O   . PHE B 9   ? 0.3030 0.3187 0.3303 0.0112  -0.0149 -0.0267 26  PHE B O   
1466 C CB  . PHE B 9   ? 0.3213 0.3339 0.3483 0.0289  -0.0023 -0.0360 26  PHE B CB  
1467 C CG  . PHE B 9   ? 0.3525 0.3695 0.3788 0.0365  0.0066  -0.0419 26  PHE B CG  
1468 C CD1 . PHE B 9   ? 0.3721 0.4007 0.4136 0.0474  0.0111  -0.0426 26  PHE B CD1 
1469 C CD2 . PHE B 9   ? 0.3745 0.3836 0.3834 0.0339  0.0101  -0.0474 26  PHE B CD2 
1470 C CE1 . PHE B 9   ? 0.3939 0.4263 0.4342 0.0561  0.0216  -0.0503 26  PHE B CE1 
1471 C CE2 . PHE B 9   ? 0.3920 0.4038 0.3948 0.0406  0.0196  -0.0546 26  PHE B CE2 
1472 C CZ  . PHE B 9   ? 0.4094 0.4325 0.4282 0.0521  0.0267  -0.0571 26  PHE B CZ  
1473 N N   . LYS B 10  ? 0.2976 0.3163 0.3351 0.0227  -0.0183 -0.0235 27  LYS B N   
1474 C CA  . LYS B 10  ? 0.2632 0.2728 0.2919 0.0175  -0.0234 -0.0218 27  LYS B CA  
1475 C C   . LYS B 10  ? 0.2592 0.2507 0.2795 0.0185  -0.0208 -0.0243 27  LYS B C   
1476 O O   . LYS B 10  ? 0.2767 0.2593 0.2979 0.0246  -0.0194 -0.0235 27  LYS B O   
1477 C CB  . LYS B 10  ? 0.2716 0.2887 0.3029 0.0197  -0.0304 -0.0158 27  LYS B CB  
1478 C CG  . LYS B 10  ? 0.3010 0.3057 0.3166 0.0149  -0.0335 -0.0144 27  LYS B CG  
1479 C CD  . LYS B 10  ? 0.3267 0.3403 0.3395 0.0151  -0.0428 -0.0086 27  LYS B CD  
1480 C CE  . LYS B 10  ? 0.3620 0.3619 0.3533 0.0106  -0.0436 -0.0072 27  LYS B CE  
1481 N NZ  . LYS B 10  ? 0.3883 0.3946 0.3695 0.0102  -0.0543 -0.0013 27  LYS B NZ  
1482 N N   . VAL B 11  ? 0.2411 0.2270 0.2555 0.0126  -0.0203 -0.0276 28  VAL B N   
1483 C CA  . VAL B 11  ? 0.2296 0.2046 0.2410 0.0112  -0.0181 -0.0307 28  VAL B CA  
1484 C C   . VAL B 11  ? 0.2417 0.2141 0.2484 0.0067  -0.0173 -0.0303 28  VAL B C   
1485 O O   . VAL B 11  ? 0.2468 0.2221 0.2510 0.0043  -0.0184 -0.0322 28  VAL B O   
1486 C CB  . VAL B 11  ? 0.2207 0.1951 0.2327 0.0106  -0.0178 -0.0358 28  VAL B CB  
1487 C CG1 . VAL B 11  ? 0.2452 0.2141 0.2594 0.0081  -0.0175 -0.0399 28  VAL B CG1 
1488 C CG2 . VAL B 11  ? 0.2180 0.1944 0.2297 0.0148  -0.0161 -0.0373 28  VAL B CG2 
1489 N N   . LEU B 12  ? 0.2739 0.2392 0.2787 0.0052  -0.0143 -0.0283 29  LEU B N   
1490 C CA  . LEU B 12  ? 0.2810 0.2457 0.2803 0.0007  -0.0103 -0.0280 29  LEU B CA  
1491 C C   . LEU B 12  ? 0.2770 0.2456 0.2858 -0.0022 -0.0064 -0.0342 29  LEU B C   
1492 O O   . LEU B 12  ? 0.3007 0.2685 0.3182 -0.0027 -0.0073 -0.0368 29  LEU B O   
1493 C CB  . LEU B 12  ? 0.2934 0.2488 0.2843 -0.0010 -0.0079 -0.0203 29  LEU B CB  
1494 C CG  . LEU B 12  ? 0.3347 0.2886 0.3174 0.0038  -0.0142 -0.0129 29  LEU B CG  
1495 C CD1 . LEU B 12  ? 0.3376 0.2758 0.3131 0.0041  -0.0128 -0.0037 29  LEU B CD1 
1496 C CD2 . LEU B 12  ? 0.3380 0.2993 0.3084 0.0016  -0.0175 -0.0128 29  LEU B CD2 
1497 N N   . VAL B 13  ? 0.2918 0.2657 0.2992 -0.0035 -0.0025 -0.0374 30  VAL B N   
1498 C CA  . VAL B 13  ? 0.2622 0.2450 0.2834 -0.0048 0.0022  -0.0432 30  VAL B CA  
1499 C C   . VAL B 13  ? 0.2711 0.2566 0.2866 -0.0093 0.0123  -0.0421 30  VAL B C   
1500 O O   . VAL B 13  ? 0.2961 0.2815 0.2999 -0.0077 0.0153  -0.0445 30  VAL B O   
1501 C CB  . VAL B 13  ? 0.2479 0.2354 0.2756 0.0011  -0.0014 -0.0494 30  VAL B CB  
1502 C CG1 . VAL B 13  ? 0.2202 0.2213 0.2682 0.0024  0.0010  -0.0548 30  VAL B CG1 
1503 C CG2 . VAL B 13  ? 0.2338 0.2166 0.2606 0.0041  -0.0102 -0.0479 30  VAL B CG2 
1504 N N   . ILE B 14  ? 0.2721 0.2598 0.2950 -0.0164 0.0187  -0.0394 31  ILE B N   
1505 C CA  . ILE B 14  ? 0.2716 0.2610 0.2848 -0.0228 0.0307  -0.0359 31  ILE B CA  
1506 C C   . ILE B 14  ? 0.2718 0.2783 0.3074 -0.0288 0.0403  -0.0402 31  ILE B C   
1507 O O   . ILE B 14  ? 0.2940 0.3090 0.3524 -0.0294 0.0349  -0.0444 31  ILE B O   
1508 C CB  . ILE B 14  ? 0.2949 0.2666 0.2885 -0.0278 0.0309  -0.0240 31  ILE B CB  
1509 C CG1 . ILE B 14  ? 0.3065 0.2695 0.3121 -0.0340 0.0299  -0.0202 31  ILE B CG1 
1510 C CG2 . ILE B 14  ? 0.2836 0.2445 0.2604 -0.0206 0.0199  -0.0198 31  ILE B CG2 
1511 C CD1 . ILE B 14  ? 0.3355 0.2753 0.3219 -0.0352 0.0276  -0.0078 31  ILE B CD1 
1512 N N   . GLY B 15  ? 0.2863 0.3005 0.3155 -0.0337 0.0546  -0.0396 32  GLY B N   
1513 C CA  . GLY B 15  ? 0.2896 0.3283 0.3449 -0.0395 0.0673  -0.0446 32  GLY B CA  
1514 C C   . GLY B 15  ? 0.3136 0.3653 0.3612 -0.0373 0.0833  -0.0499 32  GLY B C   
1515 O O   . GLY B 15  ? 0.3094 0.3493 0.3298 -0.0305 0.0825  -0.0520 32  GLY B O   
1516 N N   . GLU B 16  ? 0.3135 0.3904 0.3847 -0.0439 0.0984  -0.0531 33  GLU B N   
1517 C CA  . GLU B 16  ? 0.3411 0.4328 0.4046 -0.0434 0.1187  -0.0582 33  GLU B CA  
1518 C C   . GLU B 16  ? 0.3301 0.4296 0.4005 -0.0256 0.1167  -0.0728 33  GLU B C   
1519 O O   . GLU B 16  ? 0.2988 0.3997 0.3894 -0.0157 0.1020  -0.0776 33  GLU B O   
1520 C CB  . GLU B 16  ? 0.3681 0.4924 0.4645 -0.0551 0.1371  -0.0589 33  GLU B CB  
1521 C CG  . GLU B 16  ? 0.3953 0.5111 0.4804 -0.0764 0.1472  -0.0441 33  GLU B CG  
1522 C CD  . GLU B 16  ? 0.4364 0.5268 0.4701 -0.0814 0.1559  -0.0333 33  GLU B CD  
1523 O OE1 . GLU B 16  ? 0.4576 0.5164 0.4617 -0.0782 0.1404  -0.0253 33  GLU B OE1 
1524 O OE2 . GLU B 16  ? 0.4782 0.5802 0.4987 -0.0880 0.1777  -0.0323 33  GLU B OE2 
1525 N N   . LEU B 17  ? 0.3665 0.4690 0.4178 -0.0220 0.1325  -0.0796 34  LEU B N   
1526 C CA  . LEU B 17  ? 0.3700 0.4788 0.4287 -0.0043 0.1354  -0.0962 34  LEU B CA  
1527 C C   . LEU B 17  ? 0.3511 0.4889 0.4616 0.0052  0.1331  -0.1035 34  LEU B C   
1528 O O   . LEU B 17  ? 0.3378 0.5055 0.4800 -0.0031 0.1429  -0.1013 34  LEU B O   
1529 C CB  . LEU B 17  ? 0.4101 0.5300 0.4524 -0.0044 0.1601  -0.1042 34  LEU B CB  
1530 C CG  . LEU B 17  ? 0.4537 0.5487 0.4402 -0.0122 0.1646  -0.0996 34  LEU B CG  
1531 C CD1 . LEU B 17  ? 0.4705 0.5856 0.4473 -0.0158 0.1942  -0.1059 34  LEU B CD1 
1532 C CD2 . LEU B 17  ? 0.4667 0.5339 0.4258 -0.0012 0.1502  -0.1087 34  LEU B CD2 
1533 N N   . GLY B 18  ? 0.3330 0.4615 0.4519 0.0216  0.1190  -0.1111 35  GLY B N   
1534 C CA  . GLY B 18  ? 0.3122 0.4655 0.4753 0.0361  0.1162  -0.1195 35  GLY B CA  
1535 C C   . GLY B 18  ? 0.2870 0.4526 0.4808 0.0323  0.0984  -0.1118 35  GLY B C   
1536 O O   . GLY B 18  ? 0.2738 0.4642 0.5062 0.0430  0.0937  -0.1169 35  GLY B O   
1537 N N   . VAL B 19  ? 0.2972 0.4437 0.4719 0.0188  0.0872  -0.1004 36  VAL B N   
1538 C CA  . VAL B 19  ? 0.2520 0.4083 0.4491 0.0106  0.0732  -0.0940 36  VAL B CA  
1539 C C   . VAL B 19  ? 0.2700 0.4136 0.4696 0.0227  0.0509  -0.0940 36  VAL B C   
1540 O O   . VAL B 19  ? 0.2657 0.4252 0.4913 0.0230  0.0379  -0.0934 36  VAL B O   
1541 C CB  . VAL B 19  ? 0.2562 0.3966 0.4289 -0.0090 0.0774  -0.0833 36  VAL B CB  
1542 C CG1 . VAL B 19  ? 0.2489 0.3553 0.3920 -0.0109 0.0612  -0.0755 36  VAL B CG1 
1543 C CG2 . VAL B 19  ? 0.2577 0.4232 0.4582 -0.0246 0.0853  -0.0807 36  VAL B CG2 
1544 N N   . GLY B 20  ? 0.2809 0.3959 0.4525 0.0323  0.0463  -0.0949 37  GLY B N   
1545 C CA  . GLY B 20  ? 0.2499 0.3482 0.4183 0.0433  0.0277  -0.0934 37  GLY B CA  
1546 C C   . GLY B 20  ? 0.2726 0.3388 0.4066 0.0373  0.0179  -0.0858 37  GLY B C   
1547 O O   . GLY B 20  ? 0.2992 0.3541 0.4303 0.0426  0.0038  -0.0825 37  GLY B O   
1548 N N   . LYS B 21  ? 0.2576 0.3119 0.3670 0.0265  0.0254  -0.0822 38  LYS B N   
1549 C CA  . LYS B 21  ? 0.2607 0.2913 0.3435 0.0215  0.0169  -0.0752 38  LYS B CA  
1550 C C   . LYS B 21  ? 0.2831 0.2947 0.3548 0.0301  0.0083  -0.0767 38  LYS B C   
1551 O O   . LYS B 21  ? 0.3041 0.3067 0.3720 0.0301  -0.0031 -0.0713 38  LYS B O   
1552 C CB  . LYS B 21  ? 0.2604 0.2821 0.3191 0.0127  0.0256  -0.0721 38  LYS B CB  
1553 C CG  . LYS B 21  ? 0.2643 0.2958 0.3272 0.0016  0.0333  -0.0668 38  LYS B CG  
1554 C CD  . LYS B 21  ? 0.2694 0.2914 0.3058 -0.0058 0.0421  -0.0619 38  LYS B CD  
1555 C CE  . LYS B 21  ? 0.2884 0.3125 0.3111 -0.0026 0.0542  -0.0692 38  LYS B CE  
1556 N NZ  . LYS B 21  ? 0.2864 0.3335 0.3314 -0.0002 0.0686  -0.0771 38  LYS B NZ  
1557 N N   . THR B 22  ? 0.2933 0.2986 0.3607 0.0373  0.0144  -0.0845 39  THR B N   
1558 C CA  . THR B 22  ? 0.2894 0.2700 0.3431 0.0430  0.0067  -0.0861 39  THR B CA  
1559 C C   . THR B 22  ? 0.2907 0.2689 0.3602 0.0533  -0.0041 -0.0838 39  THR B C   
1560 O O   . THR B 22  ? 0.3123 0.2703 0.3694 0.0526  -0.0139 -0.0782 39  THR B O   
1561 C CB  . THR B 22  ? 0.3054 0.2758 0.3473 0.0474  0.0164  -0.0972 39  THR B CB  
1562 O OG1 . THR B 22  ? 0.2973 0.2665 0.3164 0.0362  0.0229  -0.0968 39  THR B OG1 
1563 C CG2 . THR B 22  ? 0.3147 0.2548 0.3448 0.0536  0.0091  -0.1014 39  THR B CG2 
1564 N N   . SER B 23  ? 0.2936 0.2937 0.3909 0.0626  -0.0028 -0.0874 40  SER B N   
1565 C CA  . SER B 23  ? 0.2718 0.2728 0.3851 0.0738  -0.0160 -0.0839 40  SER B CA  
1566 C C   . SER B 23  ? 0.2599 0.2612 0.3678 0.0667  -0.0288 -0.0736 40  SER B C   
1567 O O   . SER B 23  ? 0.2701 0.2575 0.3724 0.0725  -0.0411 -0.0674 40  SER B O   
1568 C CB  . SER B 23  ? 0.2717 0.3040 0.4215 0.0852  -0.0126 -0.0905 40  SER B CB  
1569 O OG  . SER B 23  ? 0.2882 0.3187 0.4418 0.0948  0.0007  -0.1015 40  SER B OG  
1570 N N   . ILE B 24  ? 0.2429 0.2595 0.3521 0.0545  -0.0257 -0.0720 41  ILE B N   
1571 C CA  . ILE B 24  ? 0.2359 0.2510 0.3371 0.0478  -0.0361 -0.0650 41  ILE B CA  
1572 C C   . ILE B 24  ? 0.2967 0.2854 0.3691 0.0437  -0.0391 -0.0584 41  ILE B C   
1573 O O   . ILE B 24  ? 0.3075 0.2874 0.3695 0.0445  -0.0493 -0.0519 41  ILE B O   
1574 C CB  . ILE B 24  ? 0.2383 0.2691 0.3453 0.0355  -0.0306 -0.0661 41  ILE B CB  
1575 C CG1 . ILE B 24  ? 0.2420 0.3018 0.3808 0.0363  -0.0312 -0.0711 41  ILE B CG1 
1576 C CG2 . ILE B 24  ? 0.2441 0.2662 0.3357 0.0290  -0.0389 -0.0612 41  ILE B CG2 
1577 C CD1 . ILE B 24  ? 0.2295 0.3022 0.3765 0.0227  -0.0212 -0.0728 41  ILE B CD1 
1578 N N   . ILE B 25  ? 0.2409 0.2193 0.3004 0.0386  -0.0305 -0.0598 42  ILE B N   
1579 C CA  . ILE B 25  ? 0.3502 0.3086 0.3881 0.0332  -0.0328 -0.0542 42  ILE B CA  
1580 C C   . ILE B 25  ? 0.3830 0.3207 0.4145 0.0395  -0.0393 -0.0513 42  ILE B C   
1581 O O   . ILE B 25  ? 0.3855 0.3117 0.4042 0.0358  -0.0450 -0.0432 42  ILE B O   
1582 C CB  . ILE B 25  ? 0.3375 0.2928 0.3651 0.0259  -0.0246 -0.0569 42  ILE B CB  
1583 C CG1 . ILE B 25  ? 0.3245 0.2937 0.3538 0.0194  -0.0204 -0.0554 42  ILE B CG1 
1584 C CG2 . ILE B 25  ? 0.3234 0.2625 0.3349 0.0196  -0.0274 -0.0530 42  ILE B CG2 
1585 C CD1 . ILE B 25  ? 0.3198 0.2885 0.3397 0.0147  -0.0131 -0.0576 42  ILE B CD1 
1586 N N   . LYS B 26  ? 0.3884 0.3206 0.4287 0.0493  -0.0377 -0.0577 43  LYS B N   
1587 C CA  . LYS B 26  ? 0.4049 0.3102 0.4387 0.0570  -0.0440 -0.0552 43  LYS B CA  
1588 C C   . LYS B 26  ? 0.4179 0.3223 0.4550 0.0647  -0.0564 -0.0459 43  LYS B C   
1589 O O   . LYS B 26  ? 0.4390 0.3192 0.4603 0.0640  -0.0633 -0.0366 43  LYS B O   
1590 C CB  . LYS B 26  ? 0.4245 0.3228 0.4671 0.0681  -0.0378 -0.0669 43  LYS B CB  
1591 C CG  . LYS B 26  ? 0.4956 0.3635 0.5362 0.0806  -0.0441 -0.0667 43  LYS B CG  
1592 C CD  . LYS B 26  ? 0.5473 0.4163 0.6020 0.0949  -0.0352 -0.0817 43  LYS B CD  
1593 C CE  . LYS B 26  ? 0.6148 0.4525 0.6718 0.1119  -0.0420 -0.0823 43  LYS B CE  
1594 N NZ  . LYS B 26  ? 0.6486 0.4761 0.7127 0.1261  -0.0320 -0.0992 43  LYS B NZ  
1595 N N   . ARG B 27  ? 0.3970 0.3279 0.4528 0.0702  -0.0599 -0.0476 44  ARG B N   
1596 C CA  . ARG B 27  ? 0.3927 0.3268 0.4482 0.0752  -0.0738 -0.0390 44  ARG B CA  
1597 C C   . ARG B 27  ? 0.3908 0.3182 0.4215 0.0629  -0.0767 -0.0300 44  ARG B C   
1598 O O   . ARG B 27  ? 0.4266 0.3370 0.4400 0.0644  -0.0855 -0.0196 44  ARG B O   
1599 C CB  . ARG B 27  ? 0.3528 0.3201 0.4351 0.0804  -0.0778 -0.0444 44  ARG B CB  
1600 C CG  . ARG B 27  ? 0.3619 0.3368 0.4404 0.0820  -0.0939 -0.0371 44  ARG B CG  
1601 C CD  . ARG B 27  ? 0.3798 0.3366 0.4536 0.0966  -0.1079 -0.0281 44  ARG B CD  
1602 N NE  . ARG B 27  ? 0.3857 0.3590 0.4934 0.1136  -0.1111 -0.0343 44  ARG B NE  
1603 C CZ  . ARG B 27  ? 0.4171 0.3762 0.5303 0.1318  -0.1221 -0.0288 44  ARG B CZ  
1604 N NH1 . ARG B 27  ? 0.4300 0.3548 0.5134 0.1333  -0.1318 -0.0151 44  ARG B NH1 
1605 N NH2 . ARG B 27  ? 0.4157 0.3970 0.5659 0.1486  -0.1237 -0.0364 44  ARG B NH2 
1606 N N   . TYR B 28  ? 0.3546 0.2959 0.3836 0.0517  -0.0690 -0.0338 45  TYR B N   
1607 C CA  . TYR B 28  ? 0.3311 0.2691 0.3393 0.0419  -0.0691 -0.0278 45  TYR B CA  
1608 C C   . TYR B 28  ? 0.3424 0.2574 0.3299 0.0352  -0.0654 -0.0197 45  TYR B C   
1609 O O   . TYR B 28  ? 0.3578 0.2649 0.3260 0.0313  -0.0685 -0.0109 45  TYR B O   
1610 C CB  . TYR B 28  ? 0.2988 0.2531 0.3125 0.0338  -0.0608 -0.0344 45  TYR B CB  
1611 C CG  . TYR B 28  ? 0.2996 0.2543 0.2962 0.0264  -0.0595 -0.0316 45  TYR B CG  
1612 C CD1 . TYR B 28  ? 0.3171 0.2706 0.2996 0.0275  -0.0681 -0.0279 45  TYR B CD1 
1613 C CD2 . TYR B 28  ? 0.2922 0.2491 0.2862 0.0195  -0.0498 -0.0333 45  TYR B CD2 
1614 C CE1 . TYR B 28  ? 0.3206 0.2741 0.2852 0.0218  -0.0646 -0.0274 45  TYR B CE1 
1615 C CE2 . TYR B 28  ? 0.3042 0.2626 0.2852 0.0152  -0.0467 -0.0323 45  TYR B CE2 
1616 C CZ  . TYR B 28  ? 0.3242 0.2808 0.2901 0.0162  -0.0528 -0.0304 45  TYR B CZ  
1617 O OH  . TYR B 28  ? 0.3731 0.3311 0.3242 0.0130  -0.0480 -0.0317 45  TYR B OH  
1618 N N   . VAL B 29  ? 0.3366 0.2414 0.3272 0.0329  -0.0590 -0.0230 46  VAL B N   
1619 C CA  . VAL B 29  ? 0.3649 0.2520 0.3406 0.0228  -0.0551 -0.0170 46  VAL B CA  
1620 C C   . VAL B 29  ? 0.3993 0.2563 0.3661 0.0268  -0.0613 -0.0101 46  VAL B C   
1621 O O   . VAL B 29  ? 0.4326 0.2727 0.3822 0.0189  -0.0621 0.0009  46  VAL B O   
1622 C CB  . VAL B 29  ? 0.3552 0.2482 0.3368 0.0154  -0.0469 -0.0247 46  VAL B CB  
1623 C CG1 . VAL B 29  ? 0.3901 0.2697 0.3614 0.0030  -0.0445 -0.0198 46  VAL B CG1 
1624 C CG2 . VAL B 29  ? 0.3349 0.2524 0.3222 0.0125  -0.0423 -0.0278 46  VAL B CG2 
1625 N N   . HIS B 30  ? 0.4134 0.2622 0.3914 0.0393  -0.0650 -0.0157 47  HIS B N   
1626 C CA  . HIS B 30  ? 0.4685 0.2824 0.4385 0.0454  -0.0710 -0.0098 47  HIS B CA  
1627 C C   . HIS B 30  ? 0.4986 0.3087 0.4735 0.0625  -0.0829 -0.0043 47  HIS B C   
1628 O O   . HIS B 30  ? 0.5237 0.3017 0.4926 0.0709  -0.0893 0.0016  47  HIS B O   
1629 C CB  . HIS B 30  ? 0.5033 0.3024 0.4801 0.0478  -0.0657 -0.0220 47  HIS B CB  
1630 C CG  . HIS B 30  ? 0.5203 0.3223 0.4913 0.0310  -0.0573 -0.0274 47  HIS B CG  
1631 N ND1 . HIS B 30  ? 0.5199 0.3414 0.4997 0.0301  -0.0501 -0.0402 47  HIS B ND1 
1632 C CD2 . HIS B 30  ? 0.5374 0.3295 0.4954 0.0139  -0.0556 -0.0207 47  HIS B CD2 
1633 C CE1 . HIS B 30  ? 0.5112 0.3341 0.4831 0.0145  -0.0466 -0.0410 47  HIS B CE1 
1634 N NE2 . HIS B 30  ? 0.5266 0.3337 0.4881 0.0043  -0.0496 -0.0300 47  HIS B NE2 
1635 N N   . GLN B 31  ? 0.4978 0.3384 0.4844 0.0683  -0.0873 -0.0062 48  GLN B N   
1636 C CA  . GLN B 31  ? 0.5493 0.3934 0.5463 0.0857  -0.1012 -0.0023 48  GLN B CA  
1637 C C   . GLN B 31  ? 0.5539 0.3864 0.5711 0.1040  -0.1030 -0.0090 48  GLN B C   
1638 O O   . GLN B 31  ? 0.6007 0.4138 0.6171 0.1189  -0.1153 -0.0006 48  GLN B O   
1639 C CB  . GLN B 31  ? 0.6252 0.4508 0.5953 0.0850  -0.1134 0.0153  48  GLN B CB  
1640 C CG  . GLN B 31  ? 0.6446 0.4960 0.6043 0.0762  -0.1157 0.0170  48  GLN B CG  
1641 C CD  . GLN B 31  ? 0.6540 0.5420 0.6409 0.0844  -0.1224 0.0065  48  GLN B CD  
1642 O OE1 . GLN B 31  ? 0.6692 0.5638 0.6769 0.1007  -0.1335 0.0057  48  GLN B OE1 
1643 N NE2 . GLN B 31  ? 0.6415 0.5538 0.6312 0.0730  -0.1151 -0.0020 48  GLN B NE2 
1644 N N   . LEU B 32  ? 0.5192 0.3656 0.5545 0.1044  -0.0907 -0.0243 49  LEU B N   
1645 C CA  . LEU B 32  ? 0.5206 0.3606 0.5761 0.1222  -0.0884 -0.0345 49  LEU B CA  
1646 C C   . LEU B 32  ? 0.4683 0.3502 0.5541 0.1267  -0.0795 -0.0486 49  LEU B C   
1647 O O   . LEU B 32  ? 0.4332 0.3384 0.5185 0.1119  -0.0709 -0.0526 49  LEU B O   
1648 C CB  . LEU B 32  ? 0.5580 0.3627 0.5973 0.1160  -0.0787 -0.0407 49  LEU B CB  
1649 C CG  . LEU B 32  ? 0.6267 0.3829 0.6406 0.1131  -0.0863 -0.0281 49  LEU B CG  
1650 C CD1 . LEU B 32  ? 0.6450 0.3694 0.6435 0.1016  -0.0772 -0.0363 49  LEU B CD1 
1651 C CD2 . LEU B 32  ? 0.6723 0.4077 0.6956 0.1373  -0.0988 -0.0224 49  LEU B CD2 
1652 N N   . PHE B 33  ? 0.4758 0.3658 0.5882 0.1471  -0.0805 -0.0558 50  PHE B N   
1653 C CA  . PHE B 33  ? 0.4513 0.3786 0.5946 0.1527  -0.0682 -0.0704 50  PHE B CA  
1654 C C   . PHE B 33  ? 0.4885 0.4050 0.6477 0.1732  -0.0607 -0.0827 50  PHE B C   
1655 O O   . PHE B 33  ? 0.5214 0.4188 0.6881 0.1928  -0.0723 -0.0783 50  PHE B O   
1656 C CB  . PHE B 33  ? 0.4324 0.4013 0.6055 0.1583  -0.0787 -0.0672 50  PHE B CB  
1657 C CG  . PHE B 33  ? 0.4031 0.4156 0.6124 0.1615  -0.0657 -0.0806 50  PHE B CG  
1658 C CD1 . PHE B 33  ? 0.3812 0.4153 0.5885 0.1421  -0.0531 -0.0847 50  PHE B CD1 
1659 C CD2 . PHE B 33  ? 0.3945 0.4264 0.6405 0.1841  -0.0657 -0.0879 50  PHE B CD2 
1660 C CE1 . PHE B 33  ? 0.3641 0.4374 0.6030 0.1423  -0.0392 -0.0954 50  PHE B CE1 
1661 C CE2 . PHE B 33  ? 0.3873 0.4624 0.6680 0.1855  -0.0506 -0.1002 50  PHE B CE2 
1662 C CZ  . PHE B 33  ? 0.3655 0.4621 0.6423 0.1631  -0.0372 -0.1032 50  PHE B CZ  
1663 N N   . SER B 34  ? 0.4692 0.3977 0.6328 0.1699  -0.0415 -0.0979 51  SER B N   
1664 C CA  . SER B 34  ? 0.5009 0.4304 0.6845 0.1904  -0.0302 -0.1135 51  SER B CA  
1665 C C   . SER B 34  ? 0.4899 0.4737 0.7054 0.1896  -0.0158 -0.1230 51  SER B C   
1666 O O   . SER B 34  ? 0.4491 0.4502 0.6542 0.1688  -0.0067 -0.1227 51  SER B O   
1667 C CB  . SER B 34  ? 0.5112 0.4010 0.6631 0.1851  -0.0180 -0.1248 51  SER B CB  
1668 O OG  . SER B 34  ? 0.5231 0.4166 0.6873 0.2005  -0.0023 -0.1415 51  SER B OG  
1669 N N   . GLN B 35  ? 0.5133 0.5234 0.7670 0.2109  -0.0130 -0.1298 52  GLN B N   
1670 C CA  . GLN B 35  ? 0.5311 0.5903 0.8140 0.2092  0.0060  -0.1402 52  GLN B CA  
1671 C C   . GLN B 35  ? 0.5451 0.5949 0.8073 0.2046  0.0315  -0.1557 52  GLN B C   
1672 O O   . GLN B 35  ? 0.5495 0.6378 0.8265 0.1966  0.0499  -0.1629 52  GLN B O   
1673 C CB  . GLN B 35  ? 0.5702 0.6651 0.8957 0.2274  0.0039  -0.1385 52  GLN B CB  
1674 C CG  . GLN B 35  ? 0.5664 0.7217 0.9282 0.2199  0.0203  -0.1451 52  GLN B CG  
1675 C CD  . GLN B 35  ? 0.5405 0.7344 0.9264 0.2050  0.0068  -0.1367 52  GLN B CD  
1676 O OE1 . GLN B 35  ? 0.5700 0.7801 0.9790 0.2134  -0.0128 -0.1277 52  GLN B OE1 
1677 N NE2 . GLN B 35  ? 0.4807 0.6896 0.8613 0.1830  0.0173  -0.1398 52  GLN B NE2 
1678 N N   . HIS B 36  ? 0.5570 0.5564 0.7829 0.2070  0.0331  -0.1604 53  HIS B N   
1679 C CA  . HIS B 36  ? 0.5574 0.5471 0.7591 0.2026  0.0557  -0.1757 53  HIS B CA  
1680 C C   . HIS B 36  ? 0.5358 0.5273 0.7113 0.1783  0.0609  -0.1768 53  HIS B C   
1681 O O   . HIS B 36  ? 0.5340 0.4969 0.6807 0.1634  0.0469  -0.1656 53  HIS B O   
1682 C CB  . HIS B 36  ? 0.5947 0.5296 0.7652 0.2104  0.0546  -0.1812 53  HIS B CB  
1683 C CG  . HIS B 36  ? 0.6448 0.5733 0.8375 0.2347  0.0521  -0.1800 53  HIS B CG  
1684 N ND1 . HIS B 36  ? 0.6662 0.5612 0.8576 0.2434  0.0324  -0.1679 53  HIS B ND1 
1685 C CD2 . HIS B 36  ? 0.6737 0.6252 0.8904 0.2525  0.0674  -0.1885 53  HIS B CD2 
1686 C CE1 . HIS B 36  ? 0.7052 0.6019 0.9192 0.2664  0.0349  -0.1691 53  HIS B CE1 
1687 N NE2 . HIS B 36  ? 0.7068 0.6381 0.9377 0.2729  0.0562  -0.1822 53  HIS B NE2 
1688 N N   . TYR B 37  ? 0.5220 0.5476 0.7022 0.1704  0.0813  -0.1837 54  TYR B N   
1689 C CA  . TYR B 37  ? 0.4918 0.5180 0.6396 0.1449  0.0873  -0.1782 54  TYR B CA  
1690 C C   . TYR B 37  ? 0.4997 0.4834 0.5984 0.1380  0.0902  -0.1868 54  TYR B C   
1691 O O   . TYR B 37  ? 0.4766 0.4501 0.5645 0.1485  0.1050  -0.2046 54  TYR B O   
1692 C CB  . TYR B 37  ? 0.4619 0.5330 0.6268 0.1402  0.1107  -0.1837 54  TYR B CB  
1693 C CG  . TYR B 37  ? 0.4500 0.5230 0.5820 0.1151  0.1185  -0.1764 54  TYR B CG  
1694 C CD1 . TYR B 37  ? 0.4144 0.4760 0.5308 0.0979  0.1024  -0.1601 54  TYR B CD1 
1695 C CD2 . TYR B 37  ? 0.4797 0.5694 0.5987 0.1100  0.1436  -0.1854 54  TYR B CD2 
1696 C CE1 . TYR B 37  ? 0.4235 0.4867 0.5126 0.0776  0.1087  -0.1523 54  TYR B CE1 
1697 C CE2 . TYR B 37  ? 0.4729 0.5630 0.5601 0.0877  0.1500  -0.1762 54  TYR B CE2 
1698 C CZ  . TYR B 37  ? 0.4480 0.5239 0.5216 0.0727  0.1316  -0.1595 54  TYR B CZ  
1699 O OH  . TYR B 37  ? 0.4537 0.5274 0.4970 0.0535  0.1362  -0.1495 54  TYR B OH  
1700 N N   . ARG B 38  ? 0.4919 0.4531 0.5617 0.1203  0.0765  -0.1754 55  ARG B N   
1701 C CA  . ARG B 38  ? 0.5228 0.4546 0.5471 0.1085  0.0792  -0.1826 55  ARG B CA  
1702 C C   . ARG B 38  ? 0.4736 0.4218 0.4799 0.0872  0.0807  -0.1711 55  ARG B C   
1703 O O   . ARG B 38  ? 0.4484 0.3994 0.4597 0.0778  0.0673  -0.1557 55  ARG B O   
1704 C CB  . ARG B 38  ? 0.5728 0.4615 0.5789 0.1060  0.0607  -0.1798 55  ARG B CB  
1705 C CG  . ARG B 38  ? 0.6755 0.5367 0.6940 0.1265  0.0569  -0.1891 55  ARG B CG  
1706 C CD  . ARG B 38  ? 0.7550 0.5726 0.7510 0.1169  0.0392  -0.1830 55  ARG B CD  
1707 N NE  . ARG B 38  ? 0.8534 0.6285 0.8363 0.1282  0.0403  -0.1990 55  ARG B NE  
1708 C CZ  . ARG B 38  ? 0.8951 0.6280 0.8489 0.1154  0.0313  -0.2004 55  ARG B CZ  
1709 N NH1 . ARG B 38  ? 0.8827 0.6120 0.8201 0.0934  0.0195  -0.1902 55  ARG B NH1 
1710 N NH2 . ARG B 38  ? 0.9455 0.6433 0.8883 0.1221  0.0356  -0.2094 55  ARG B NH2 
1711 N N   . ALA B 39  ? 0.4831 0.4402 0.4664 0.0806  0.0971  -0.1783 56  ALA B N   
1712 C CA  . ALA B 39  ? 0.4543 0.4291 0.4245 0.0626  0.0996  -0.1648 56  ALA B CA  
1713 C C   . ALA B 39  ? 0.4549 0.4052 0.3929 0.0484  0.0827  -0.1564 56  ALA B C   
1714 O O   . ALA B 39  ? 0.4804 0.4046 0.3895 0.0472  0.0788  -0.1667 56  ALA B O   
1715 C CB  . ALA B 39  ? 0.4739 0.4631 0.4251 0.0602  0.1229  -0.1739 56  ALA B CB  
1716 N N   . THR B 40  ? 0.4299 0.3891 0.3736 0.0378  0.0726  -0.1391 57  THR B N   
1717 C CA  . THR B 40  ? 0.4446 0.3870 0.3625 0.0256  0.0575  -0.1312 57  THR B CA  
1718 C C   . THR B 40  ? 0.4764 0.4168 0.3550 0.0159  0.0639  -0.1328 57  THR B C   
1719 O O   . THR B 40  ? 0.4804 0.4371 0.3540 0.0136  0.0789  -0.1306 57  THR B O   
1720 C CB  . THR B 40  ? 0.4104 0.3618 0.3471 0.0202  0.0456  -0.1141 57  THR B CB  
1721 O OG1 . THR B 40  ? 0.4353 0.3851 0.4003 0.0296  0.0391  -0.1142 57  THR B OG1 
1722 C CG2 . THR B 40  ? 0.3684 0.3072 0.2855 0.0099  0.0303  -0.1061 57  THR B CG2 
1723 N N   . ILE B 41  ? 0.5242 0.4448 0.3743 0.0094  0.0520  -0.1365 58  ILE B N   
1724 C CA  . ILE B 41  ? 0.5722 0.4897 0.3816 -0.0007 0.0516  -0.1360 58  ILE B CA  
1725 C C   . ILE B 41  ? 0.5581 0.4793 0.3659 -0.0103 0.0338  -0.1181 58  ILE B C   
1726 O O   . ILE B 41  ? 0.5470 0.4598 0.3615 -0.0133 0.0181  -0.1171 58  ILE B O   
1727 C CB  . ILE B 41  ? 0.6319 0.5261 0.4102 -0.0019 0.0480  -0.1546 58  ILE B CB  
1728 C CG1 . ILE B 41  ? 0.6764 0.5624 0.4613 0.0115  0.0645  -0.1745 58  ILE B CG1 
1729 C CG2 . ILE B 41  ? 0.6620 0.5547 0.3937 -0.0118 0.0474  -0.1550 58  ILE B CG2 
1730 C CD1 . ILE B 41  ? 0.6848 0.5931 0.4745 0.0179  0.0883  -0.1762 58  ILE B CD1 
1731 N N   . GLY B 42  ? 0.5571 0.4910 0.3593 -0.0146 0.0373  -0.1035 59  GLY B N   
1732 C CA  . GLY B 42  ? 0.5417 0.4793 0.3457 -0.0203 0.0215  -0.0863 59  GLY B CA  
1733 C C   . GLY B 42  ? 0.5120 0.4559 0.3542 -0.0169 0.0151  -0.0777 59  GLY B C   
1734 O O   . GLY B 42  ? 0.5021 0.4553 0.3618 -0.0155 0.0221  -0.0683 59  GLY B O   
1735 N N   . VAL B 43  ? 0.5083 0.4472 0.3619 -0.0173 0.0017  -0.0799 60  VAL B N   
1736 C CA  . VAL B 43  ? 0.4835 0.4281 0.3678 -0.0148 -0.0043 -0.0718 60  VAL B CA  
1737 C C   . VAL B 43  ? 0.4798 0.4143 0.3755 -0.0135 -0.0089 -0.0806 60  VAL B C   
1738 O O   . VAL B 43  ? 0.4918 0.4147 0.3720 -0.0182 -0.0149 -0.0892 60  VAL B O   
1739 C CB  . VAL B 43  ? 0.4879 0.4395 0.3737 -0.0186 -0.0178 -0.0592 60  VAL B CB  
1740 C CG1 . VAL B 43  ? 0.4536 0.4118 0.3679 -0.0148 -0.0192 -0.0516 60  VAL B CG1 
1741 C CG2 . VAL B 43  ? 0.5208 0.4755 0.3875 -0.0201 -0.0169 -0.0493 60  VAL B CG2 
1742 N N   . ASP B 44  ? 0.4734 0.4103 0.3942 -0.0084 -0.0080 -0.0774 61  ASP B N   
1743 C CA  . ASP B 44  ? 0.5200 0.4451 0.4511 -0.0077 -0.0140 -0.0807 61  ASP B CA  
1744 C C   . ASP B 44  ? 0.4467 0.3809 0.3945 -0.0093 -0.0203 -0.0691 61  ASP B C   
1745 O O   . ASP B 44  ? 0.4130 0.3605 0.3665 -0.0084 -0.0190 -0.0611 61  ASP B O   
1746 C CB  . ASP B 44  ? 0.5837 0.5022 0.5259 0.0024  -0.0063 -0.0881 61  ASP B CB  
1747 C CG  . ASP B 44  ? 0.6618 0.5588 0.6064 0.0039  -0.0122 -0.0926 61  ASP B CG  
1748 O OD1 . ASP B 44  ? 0.7020 0.5878 0.6386 -0.0055 -0.0208 -0.0916 61  ASP B OD1 
1749 O OD2 . ASP B 44  ? 0.7412 0.6318 0.6970 0.0149  -0.0080 -0.0973 61  ASP B OD2 
1750 N N   . PHE B 45  ? 0.4120 0.3377 0.3655 -0.0125 -0.0264 -0.0680 62  PHE B N   
1751 C CA  . PHE B 45  ? 0.3762 0.3115 0.3424 -0.0152 -0.0307 -0.0579 62  PHE B CA  
1752 C C   . PHE B 45  ? 0.3536 0.2767 0.3261 -0.0143 -0.0320 -0.0561 62  PHE B C   
1753 O O   . PHE B 45  ? 0.3674 0.2709 0.3339 -0.0151 -0.0332 -0.0617 62  PHE B O   
1754 C CB  . PHE B 45  ? 0.4043 0.3471 0.3686 -0.0254 -0.0382 -0.0549 62  PHE B CB  
1755 C CG  . PHE B 45  ? 0.4426 0.3921 0.3941 -0.0281 -0.0415 -0.0573 62  PHE B CG  
1756 C CD1 . PHE B 45  ? 0.4717 0.4080 0.4052 -0.0332 -0.0441 -0.0675 62  PHE B CD1 
1757 C CD2 . PHE B 45  ? 0.4446 0.4104 0.3987 -0.0247 -0.0423 -0.0494 62  PHE B CD2 
1758 C CE1 . PHE B 45  ? 0.4883 0.4299 0.4042 -0.0360 -0.0480 -0.0695 62  PHE B CE1 
1759 C CE2 . PHE B 45  ? 0.4594 0.4292 0.3976 -0.0266 -0.0468 -0.0493 62  PHE B CE2 
1760 C CZ  . PHE B 45  ? 0.4787 0.4380 0.3967 -0.0328 -0.0501 -0.0590 62  PHE B CZ  
1761 N N   . ALA B 46  ? 0.3336 0.2662 0.3152 -0.0137 -0.0321 -0.0478 63  ALA B N   
1762 C CA  . ALA B 46  ? 0.3312 0.2541 0.3148 -0.0139 -0.0336 -0.0428 63  ALA B CA  
1763 C C   . ALA B 46  ? 0.3390 0.2782 0.3281 -0.0179 -0.0327 -0.0347 63  ALA B C   
1764 O O   . ALA B 46  ? 0.3309 0.2869 0.3253 -0.0151 -0.0308 -0.0340 63  ALA B O   
1765 C CB  . ALA B 46  ? 0.3265 0.2462 0.3140 -0.0026 -0.0323 -0.0437 63  ALA B CB  
1766 N N   . LEU B 47  ? 0.3561 0.2887 0.3432 -0.0234 -0.0330 -0.0285 64  LEU B N   
1767 C CA  . LEU B 47  ? 0.3680 0.3156 0.3584 -0.0258 -0.0293 -0.0216 64  LEU B CA  
1768 C C   . LEU B 47  ? 0.3659 0.3029 0.3472 -0.0214 -0.0289 -0.0165 64  LEU B C   
1769 O O   . LEU B 47  ? 0.3907 0.3067 0.3633 -0.0237 -0.0318 -0.0123 64  LEU B O   
1770 C CB  . LEU B 47  ? 0.4218 0.3751 0.4163 -0.0394 -0.0284 -0.0172 64  LEU B CB  
1771 C CG  . LEU B 47  ? 0.4425 0.4206 0.4459 -0.0418 -0.0217 -0.0120 64  LEU B CG  
1772 C CD1 . LEU B 47  ? 0.4304 0.4311 0.4472 -0.0368 -0.0223 -0.0159 64  LEU B CD1 
1773 C CD2 . LEU B 47  ? 0.4706 0.4542 0.4790 -0.0569 -0.0187 -0.0059 64  LEU B CD2 
1774 N N   . LYS B 48  ? 0.3449 0.2928 0.3260 -0.0145 -0.0269 -0.0169 65  LYS B N   
1775 C CA  . LYS B 48  ? 0.3515 0.2934 0.3202 -0.0122 -0.0274 -0.0117 65  LYS B CA  
1776 C C   . LYS B 48  ? 0.3610 0.3155 0.3253 -0.0178 -0.0195 -0.0071 65  LYS B C   
1777 O O   . LYS B 48  ? 0.3449 0.3183 0.3196 -0.0167 -0.0141 -0.0111 65  LYS B O   
1778 C CB  . LYS B 48  ? 0.3477 0.2933 0.3176 -0.0024 -0.0309 -0.0172 65  LYS B CB  
1779 C CG  . LYS B 48  ? 0.3719 0.3141 0.3271 0.0008  -0.0342 -0.0140 65  LYS B CG  
1780 C CD  . LYS B 48  ? 0.4214 0.3462 0.3706 0.0051  -0.0435 -0.0091 65  LYS B CD  
1781 C CE  . LYS B 48  ? 0.4595 0.3804 0.3887 0.0067  -0.0482 -0.0033 65  LYS B CE  
1782 N NZ  . LYS B 48  ? 0.4816 0.3895 0.4080 0.0147  -0.0604 0.0010  65  LYS B NZ  
1783 N N   . VAL B 49  ? 0.3959 0.3396 0.3441 -0.0224 -0.0185 0.0015  66  VAL B N   
1784 C CA  . VAL B 49  ? 0.4484 0.4033 0.3874 -0.0278 -0.0088 0.0064  66  VAL B CA  
1785 C C   . VAL B 49  ? 0.4734 0.4227 0.3918 -0.0204 -0.0115 0.0062  66  VAL B C   
1786 O O   . VAL B 49  ? 0.4886 0.4187 0.3910 -0.0190 -0.0195 0.0128  66  VAL B O   
1787 C CB  . VAL B 49  ? 0.4937 0.4383 0.4248 -0.0415 -0.0049 0.0181  66  VAL B CB  
1788 C CG1 . VAL B 49  ? 0.4998 0.4573 0.4183 -0.0480 0.0080  0.0244  66  VAL B CG1 
1789 C CG2 . VAL B 49  ? 0.4956 0.4465 0.4479 -0.0509 -0.0045 0.0163  66  VAL B CG2 
1790 N N   . LEU B 50  ? 0.4878 0.4523 0.4060 -0.0151 -0.0061 -0.0017 67  LEU B N   
1791 C CA  . LEU B 50  ? 0.5352 0.4946 0.4316 -0.0093 -0.0098 -0.0047 67  LEU B CA  
1792 C C   . LEU B 50  ? 0.5653 0.5339 0.4422 -0.0119 0.0030  -0.0046 67  LEU B C   
1793 O O   . LEU B 50  ? 0.5697 0.5563 0.4583 -0.0119 0.0158  -0.0095 67  LEU B O   
1794 C CB  . LEU B 50  ? 0.5438 0.5038 0.4513 -0.0008 -0.0188 -0.0158 67  LEU B CB  
1795 C CG  . LEU B 50  ? 0.5747 0.5428 0.4895 0.0047  -0.0164 -0.0285 67  LEU B CG  
1796 C CD1 . LEU B 50  ? 0.6150 0.5812 0.5060 0.0067  -0.0156 -0.0351 67  LEU B CD1 
1797 C CD2 . LEU B 50  ? 0.5703 0.5348 0.5000 0.0079  -0.0270 -0.0332 67  LEU B CD2 
1798 N N   . ASN B 51  ? 0.5940 0.5508 0.4400 -0.0141 0.0004  0.0026  68  ASN B N   
1799 C CA  . ASN B 51  ? 0.6466 0.6093 0.4655 -0.0163 0.0124  0.0024  68  ASN B CA  
1800 C C   . ASN B 51  ? 0.6310 0.5943 0.4409 -0.0073 0.0074  -0.0128 68  ASN B C   
1801 O O   . ASN B 51  ? 0.6698 0.6206 0.4581 -0.0050 -0.0064 -0.0127 68  ASN B O   
1802 C CB  . ASN B 51  ? 0.7256 0.6706 0.5090 -0.0225 0.0086  0.0177  68  ASN B CB  
1803 C CG  . ASN B 51  ? 0.7585 0.6983 0.5478 -0.0344 0.0152  0.0332  68  ASN B CG  
1804 O OD1 . ASN B 51  ? 0.7858 0.7028 0.5686 -0.0365 0.0034  0.0452  68  ASN B OD1 
1805 N ND2 . ASN B 51  ? 0.7794 0.7405 0.5836 -0.0422 0.0340  0.0327  68  ASN B ND2 
1806 N N   . TRP B 52  ? 0.5681 0.5446 0.3960 -0.0021 0.0165  -0.0257 69  TRP B N   
1807 C CA  . TRP B 52  ? 0.5542 0.5266 0.3740 0.0052  0.0123  -0.0415 69  TRP B CA  
1808 C C   . TRP B 52  ? 0.6024 0.5689 0.3789 0.0044  0.0153  -0.0453 69  TRP B C   
1809 O O   . TRP B 52  ? 0.6272 0.5823 0.3832 0.0053  0.0009  -0.0503 69  TRP B O   
1810 C CB  . TRP B 52  ? 0.5271 0.5103 0.3721 0.0120  0.0232  -0.0531 69  TRP B CB  
1811 C CG  . TRP B 52  ? 0.5489 0.5220 0.3842 0.0186  0.0202  -0.0705 69  TRP B CG  
1812 C CD1 . TRP B 52  ? 0.5722 0.5443 0.3875 0.0235  0.0316  -0.0832 69  TRP B CD1 
1813 C CD2 . TRP B 52  ? 0.5384 0.4991 0.3821 0.0192  0.0045  -0.0772 69  TRP B CD2 
1814 N NE1 . TRP B 52  ? 0.5897 0.5459 0.3997 0.0269  0.0228  -0.0983 69  TRP B NE1 
1815 C CE2 . TRP B 52  ? 0.5663 0.5166 0.3948 0.0231  0.0062  -0.0941 69  TRP B CE2 
1816 C CE3 . TRP B 52  ? 0.5109 0.4693 0.3747 0.0164  -0.0092 -0.0713 69  TRP B CE3 
1817 C CZ2 . TRP B 52  ? 0.5692 0.5063 0.4033 0.0219  -0.0065 -0.1042 69  TRP B CZ2 
1818 C CZ3 . TRP B 52  ? 0.5111 0.4611 0.3827 0.0162  -0.0195 -0.0806 69  TRP B CZ3 
1819 C CH2 . TRP B 52  ? 0.5406 0.4798 0.3978 0.0177  -0.0189 -0.0964 69  TRP B CH2 
1820 N N   . ASP B 53  ? 0.6222 0.5989 0.3848 0.0018  0.0341  -0.0425 70  ASP B N   
1821 C CA  . ASP B 53  ? 0.6590 0.6310 0.3749 -0.0007 0.0406  -0.0432 70  ASP B CA  
1822 C C   . ASP B 53  ? 0.6677 0.6556 0.3812 -0.0076 0.0630  -0.0323 70  ASP B C   
1823 O O   . ASP B 53  ? 0.6237 0.6239 0.3727 -0.0114 0.0680  -0.0238 70  ASP B O   
1824 C CB  . ASP B 53  ? 0.6775 0.6460 0.3767 0.0073  0.0437  -0.0658 70  ASP B CB  
1825 C CG  . ASP B 53  ? 0.6736 0.6575 0.3967 0.0155  0.0648  -0.0786 70  ASP B CG  
1826 O OD1 . ASP B 53  ? 0.6576 0.6618 0.4052 0.0139  0.0802  -0.0699 70  ASP B OD1 
1827 O OD2 . ASP B 53  ? 0.6888 0.6640 0.4059 0.0238  0.0653  -0.0983 70  ASP B OD2 
1828 N N   . SER B 54  ? 0.7206 0.7103 0.3941 -0.0097 0.0771  -0.0343 71  SER B N   
1829 C CA  . SER B 54  ? 0.7420 0.7477 0.4070 -0.0188 0.1002  -0.0229 71  SER B CA  
1830 C C   . SER B 54  ? 0.7182 0.7551 0.4256 -0.0155 0.1222  -0.0297 71  SER B C   
1831 O O   . SER B 54  ? 0.7293 0.7848 0.4435 -0.0255 0.1398  -0.0181 71  SER B O   
1832 C CB  . SER B 54  ? 0.7965 0.7967 0.4030 -0.0208 0.1112  -0.0258 71  SER B CB  
1833 O OG  . SER B 54  ? 0.8285 0.8026 0.3944 -0.0254 0.0900  -0.0142 71  SER B OG  
1834 N N   . ARG B 55  ? 0.6910 0.7342 0.4262 -0.0016 0.1215  -0.0480 72  ARG B N   
1835 C CA  . ARG B 55  ? 0.6670 0.7408 0.4439 0.0053  0.1401  -0.0549 72  ARG B CA  
1836 C C   . ARG B 55  ? 0.5921 0.6688 0.4173 0.0103  0.1261  -0.0547 72  ARG B C   
1837 O O   . ARG B 55  ? 0.5729 0.6722 0.4352 0.0197  0.1356  -0.0616 72  ARG B O   
1838 C CB  . ARG B 55  ? 0.7278 0.8053 0.4917 0.0200  0.1550  -0.0770 72  ARG B CB  
1839 C CG  . ARG B 55  ? 0.8385 0.9244 0.5599 0.0143  0.1772  -0.0767 72  ARG B CG  
1840 C CD  . ARG B 55  ? 0.9268 1.0074 0.6233 0.0291  0.1895  -0.1015 72  ARG B CD  
1841 N NE  . ARG B 55  ? 1.0128 1.1081 0.6716 0.0247  0.2164  -0.1027 72  ARG B NE  
1842 C CZ  . ARG B 55  ? 1.0666 1.1445 0.6652 0.0135  0.2150  -0.0957 72  ARG B CZ  
1843 N NH1 . ARG B 55  ? 1.0708 1.1174 0.6429 0.0066  0.1859  -0.0873 72  ARG B NH1 
1844 N NH2 . ARG B 55  ? 1.1076 1.2003 0.6756 0.0112  0.2407  -0.0953 72  ARG B NH2 
1845 N N   . THR B 56  ? 0.5413 0.5961 0.3656 0.0051  0.1034  -0.0466 73  THR B N   
1846 C CA  . THR B 56  ? 0.4994 0.5512 0.3596 0.0110  0.0890  -0.0492 73  THR B CA  
1847 C C   . THR B 56  ? 0.4821 0.5232 0.3503 0.0007  0.0729  -0.0346 73  THR B C   
1848 O O   . THR B 56  ? 0.4894 0.5075 0.3345 -0.0022 0.0578  -0.0309 73  THR B O   
1849 C CB  . THR B 56  ? 0.5130 0.5440 0.3663 0.0222  0.0775  -0.0648 73  THR B CB  
1850 O OG1 . THR B 56  ? 0.5673 0.5968 0.3980 0.0306  0.0901  -0.0804 73  THR B OG1 
1851 C CG2 . THR B 56  ? 0.4689 0.5044 0.3618 0.0299  0.0720  -0.0678 73  THR B CG2 
1852 N N   . LEU B 57  ? 0.4534 0.5112 0.3554 -0.0037 0.0746  -0.0275 74  LEU B N   
1853 C CA  . LEU B 57  ? 0.4460 0.4920 0.3565 -0.0129 0.0604  -0.0161 74  LEU B CA  
1854 C C   . LEU B 57  ? 0.4053 0.4541 0.3461 -0.0058 0.0508  -0.0218 74  LEU B C   
1855 O O   . LEU B 57  ? 0.3976 0.4676 0.3637 -0.0007 0.0578  -0.0259 74  LEU B O   
1856 C CB  . LEU B 57  ? 0.4734 0.5303 0.3896 -0.0282 0.0686  -0.0024 74  LEU B CB  
1857 C CG  . LEU B 57  ? 0.4956 0.5333 0.4163 -0.0372 0.0537  0.0074  74  LEU B CG  
1858 C CD1 . LEU B 57  ? 0.5413 0.5572 0.4313 -0.0486 0.0530  0.0215  74  LEU B CD1 
1859 C CD2 . LEU B 57  ? 0.4867 0.5455 0.4439 -0.0434 0.0553  0.0085  74  LEU B CD2 
1860 N N   . VAL B 58  ? 0.3828 0.4108 0.3199 -0.0041 0.0351  -0.0223 75  VAL B N   
1861 C CA  . VAL B 58  ? 0.3804 0.4079 0.3405 0.0012  0.0263  -0.0263 75  VAL B CA  
1862 C C   . VAL B 58  ? 0.3822 0.4029 0.3501 -0.0073 0.0172  -0.0181 75  VAL B C   
1863 O O   . VAL B 58  ? 0.3836 0.3871 0.3353 -0.0122 0.0110  -0.0126 75  VAL B O   
1864 C CB  . VAL B 58  ? 0.4000 0.4099 0.3507 0.0086  0.0171  -0.0348 75  VAL B CB  
1865 C CG1 . VAL B 58  ? 0.3841 0.3922 0.3556 0.0124  0.0099  -0.0370 75  VAL B CG1 
1866 C CG2 . VAL B 58  ? 0.4321 0.4429 0.3718 0.0167  0.0253  -0.0457 75  VAL B CG2 
1867 N N   . ARG B 59  ? 0.3676 0.4004 0.3592 -0.0081 0.0156  -0.0180 76  ARG B N   
1868 C CA  . ARG B 59  ? 0.3579 0.3808 0.3554 -0.0138 0.0055  -0.0148 76  ARG B CA  
1869 C C   . ARG B 59  ? 0.3307 0.3503 0.3366 -0.0057 -0.0013 -0.0206 76  ARG B C   
1870 O O   . ARG B 59  ? 0.3353 0.3676 0.3537 0.0011  0.0012  -0.0236 76  ARG B O   
1871 C CB  . ARG B 59  ? 0.3413 0.3802 0.3553 -0.0241 0.0074  -0.0099 76  ARG B CB  
1872 C CG  . ARG B 59  ? 0.3455 0.3861 0.3512 -0.0354 0.0155  -0.0023 76  ARG B CG  
1873 C CD  . ARG B 59  ? 0.3448 0.3974 0.3674 -0.0497 0.0154  0.0025  76  ARG B CD  
1874 N NE  . ARG B 59  ? 0.3723 0.4251 0.3861 -0.0626 0.0250  0.0113  76  ARG B NE  
1875 C CZ  . ARG B 59  ? 0.3881 0.4677 0.4104 -0.0668 0.0394  0.0140  76  ARG B CZ  
1876 N NH1 . ARG B 59  ? 0.3731 0.4831 0.4151 -0.0561 0.0464  0.0074  76  ARG B NH1 
1877 N NH2 . ARG B 59  ? 0.4201 0.4939 0.4286 -0.0809 0.0483  0.0241  76  ARG B NH2 
1878 N N   . LEU B 60  ? 0.3148 0.3170 0.3134 -0.0056 -0.0089 -0.0216 77  LEU B N   
1879 C CA  . LEU B 60  ? 0.2802 0.2786 0.2848 -0.0010 -0.0138 -0.0256 77  LEU B CA  
1880 C C   . LEU B 60  ? 0.3193 0.3143 0.3274 -0.0063 -0.0188 -0.0245 77  LEU B C   
1881 O O   . LEU B 60  ? 0.3498 0.3323 0.3512 -0.0108 -0.0216 -0.0234 77  LEU B O   
1882 C CB  . LEU B 60  ? 0.2429 0.2282 0.2395 0.0027  -0.0175 -0.0292 77  LEU B CB  
1883 C CG  . LEU B 60  ? 0.2457 0.2295 0.2342 0.0069  -0.0156 -0.0328 77  LEU B CG  
1884 C CD1 . LEU B 60  ? 0.2608 0.2360 0.2474 0.0086  -0.0221 -0.0365 77  LEU B CD1 
1885 C CD2 . LEU B 60  ? 0.2343 0.2236 0.2293 0.0121  -0.0109 -0.0368 77  LEU B CD2 
1886 N N   . GLN B 61  ? 0.3302 0.3346 0.3467 -0.0054 -0.0205 -0.0249 78  GLN B N   
1887 C CA  . GLN B 61  ? 0.3553 0.3554 0.3700 -0.0093 -0.0258 -0.0261 78  GLN B CA  
1888 C C   . GLN B 61  ? 0.3229 0.3126 0.3316 -0.0039 -0.0258 -0.0295 78  GLN B C   
1889 O O   . GLN B 61  ? 0.3257 0.3183 0.3363 0.0010  -0.0249 -0.0286 78  GLN B O   
1890 C CB  . GLN B 61  ? 0.4042 0.4207 0.4280 -0.0108 -0.0294 -0.0239 78  GLN B CB  
1891 C CG  . GLN B 61  ? 0.4769 0.5089 0.5118 -0.0182 -0.0284 -0.0209 78  GLN B CG  
1892 C CD  . GLN B 61  ? 0.5357 0.5910 0.5860 -0.0195 -0.0339 -0.0187 78  GLN B CD  
1893 O OE1 . GLN B 61  ? 0.5843 0.6502 0.6425 -0.0091 -0.0344 -0.0170 78  GLN B OE1 
1894 N NE2 . GLN B 61  ? 0.5392 0.6021 0.5949 -0.0323 -0.0392 -0.0187 78  GLN B NE2 
1895 N N   . LEU B 62  ? 0.2946 0.2721 0.2977 -0.0043 -0.0260 -0.0328 79  LEU B N   
1896 C CA  . LEU B 62  ? 0.2897 0.2620 0.2910 -0.0008 -0.0243 -0.0367 79  LEU B CA  
1897 C C   . LEU B 62  ? 0.2961 0.2659 0.2902 -0.0030 -0.0242 -0.0396 79  LEU B C   
1898 O O   . LEU B 62  ? 0.3139 0.2765 0.3021 -0.0062 -0.0261 -0.0432 79  LEU B O   
1899 C CB  . LEU B 62  ? 0.3141 0.2799 0.3172 0.0024  -0.0244 -0.0394 79  LEU B CB  
1900 C CG  . LEU B 62  ? 0.3177 0.2856 0.3224 0.0046  -0.0255 -0.0372 79  LEU B CG  
1901 C CD1 . LEU B 62  ? 0.3113 0.2706 0.3132 0.0066  -0.0296 -0.0365 79  LEU B CD1 
1902 C CD2 . LEU B 62  ? 0.3098 0.2821 0.3200 0.0069  -0.0239 -0.0399 79  LEU B CD2 
1903 N N   . TRP B 63  ? 0.2862 0.2596 0.2777 -0.0020 -0.0221 -0.0375 80  TRP B N   
1904 C CA  . TRP B 63  ? 0.2923 0.2636 0.2712 -0.0043 -0.0211 -0.0389 80  TRP B CA  
1905 C C   . TRP B 63  ? 0.3108 0.2800 0.2900 -0.0026 -0.0126 -0.0427 80  TRP B C   
1906 O O   . TRP B 63  ? 0.3091 0.2803 0.2930 -0.0022 -0.0088 -0.0391 80  TRP B O   
1907 C CB  . TRP B 63  ? 0.3043 0.2799 0.2779 -0.0043 -0.0243 -0.0317 80  TRP B CB  
1908 C CG  . TRP B 63  ? 0.3136 0.2979 0.2893 -0.0064 -0.0332 -0.0290 80  TRP B CG  
1909 C CD1 . TRP B 63  ? 0.3065 0.2985 0.2960 -0.0066 -0.0354 -0.0281 80  TRP B CD1 
1910 C CD2 . TRP B 63  ? 0.3228 0.3118 0.2874 -0.0090 -0.0410 -0.0261 80  TRP B CD2 
1911 N NE1 . TRP B 63  ? 0.3428 0.3471 0.3351 -0.0103 -0.0436 -0.0257 80  TRP B NE1 
1912 C CE2 . TRP B 63  ? 0.3401 0.3430 0.3176 -0.0111 -0.0487 -0.0243 80  TRP B CE2 
1913 C CE3 . TRP B 63  ? 0.3288 0.3128 0.2722 -0.0102 -0.0421 -0.0243 80  TRP B CE3 
1914 C CZ2 . TRP B 63  ? 0.3351 0.3494 0.3091 -0.0141 -0.0599 -0.0216 80  TRP B CZ2 
1915 C CZ3 . TRP B 63  ? 0.3517 0.3432 0.2859 -0.0126 -0.0534 -0.0210 80  TRP B CZ3 
1916 C CH2 . TRP B 63  ? 0.3459 0.3538 0.2971 -0.0143 -0.0637 -0.0199 80  TRP B CH2 
1917 N N   . ASP B 64  ? 0.3362 0.3014 0.3118 -0.0019 -0.0094 -0.0505 81  ASP B N   
1918 C CA  . ASP B 64  ? 0.3621 0.3304 0.3421 0.0009  0.0003  -0.0564 81  ASP B CA  
1919 C C   . ASP B 64  ? 0.3707 0.3386 0.3317 -0.0027 0.0071  -0.0574 81  ASP B C   
1920 O O   . ASP B 64  ? 0.3756 0.3366 0.3202 -0.0034 0.0072  -0.0641 81  ASP B O   
1921 C CB  . ASP B 64  ? 0.4034 0.3649 0.3881 0.0063  -0.0006 -0.0651 81  ASP B CB  
1922 C CG  . ASP B 64  ? 0.4297 0.3969 0.4231 0.0125  0.0095  -0.0736 81  ASP B CG  
1923 O OD1 . ASP B 64  ? 0.4700 0.4509 0.4703 0.0109  0.0184  -0.0726 81  ASP B OD1 
1924 O OD2 . ASP B 64  ? 0.4549 0.4119 0.4484 0.0189  0.0090  -0.0818 81  ASP B OD2 
1925 N N   . ILE B 65  ? 0.3862 0.3590 0.3462 -0.0060 0.0131  -0.0508 82  ILE B N   
1926 C CA  . ILE B 65  ? 0.3982 0.3688 0.3349 -0.0106 0.0193  -0.0479 82  ILE B CA  
1927 C C   . ILE B 65  ? 0.4102 0.3887 0.3496 -0.0101 0.0347  -0.0561 82  ILE B C   
1928 O O   . ILE B 65  ? 0.4217 0.4111 0.3850 -0.0095 0.0408  -0.0568 82  ILE B O   
1929 C CB  . ILE B 65  ? 0.4132 0.3815 0.3473 -0.0148 0.0195  -0.0346 82  ILE B CB  
1930 C CG1 . ILE B 65  ? 0.4172 0.3810 0.3565 -0.0121 0.0060  -0.0273 82  ILE B CG1 
1931 C CG2 . ILE B 65  ? 0.4360 0.3993 0.3407 -0.0200 0.0254  -0.0288 82  ILE B CG2 
1932 C CD1 . ILE B 65  ? 0.4296 0.3918 0.3540 -0.0112 -0.0052 -0.0257 82  ILE B CD1 
1933 N N   . ALA B 66  ? 0.4248 0.3996 0.3416 -0.0101 0.0405  -0.0640 83  ALA B N   
1934 C CA  . ALA B 66  ? 0.4297 0.4137 0.3485 -0.0078 0.0574  -0.0738 83  ALA B CA  
1935 C C   . ALA B 66  ? 0.4276 0.4228 0.3467 -0.0155 0.0717  -0.0652 83  ALA B C   
1936 O O   . ALA B 66  ? 0.4376 0.4247 0.3370 -0.0229 0.0689  -0.0524 83  ALA B O   
1937 C CB  . ALA B 66  ? 0.4473 0.4213 0.3345 -0.0069 0.0611  -0.0849 83  ALA B CB  
1938 N N   . GLY B 67  ? 0.4040 0.4171 0.3447 -0.0136 0.0868  -0.0723 84  GLY B N   
1939 C CA  . GLY B 67  ? 0.4080 0.4363 0.3568 -0.0231 0.1031  -0.0653 84  GLY B CA  
1940 C C   . GLY B 67  ? 0.4273 0.4488 0.3385 -0.0333 0.1149  -0.0569 84  GLY B C   
1941 O O   . GLY B 67  ? 0.4106 0.4332 0.3229 -0.0444 0.1211  -0.0439 84  GLY B O   
1942 N N   . LEU B 68  ? 0.4309 0.4427 0.3058 -0.0307 0.1172  -0.0633 85  LEU B N   
1943 C CA  . LEU B 68  ? 0.5010 0.5032 0.3319 -0.0405 0.1251  -0.0530 85  LEU B CA  
1944 C C   . LEU B 68  ? 0.5314 0.5121 0.3376 -0.0453 0.1064  -0.0351 85  LEU B C   
1945 O O   . LEU B 68  ? 0.5572 0.5282 0.3257 -0.0532 0.1112  -0.0231 85  LEU B O   
1946 C CB  . LEU B 68  ? 0.5305 0.5292 0.3249 -0.0368 0.1337  -0.0674 85  LEU B CB  
1947 C CG  . LEU B 68  ? 0.5411 0.5615 0.3498 -0.0328 0.1595  -0.0831 85  LEU B CG  
1948 C CD1 . LEU B 68  ? 0.5752 0.5860 0.3481 -0.0259 0.1647  -0.1020 85  LEU B CD1 
1949 C CD2 . LEU B 68  ? 0.5388 0.5750 0.3453 -0.0452 0.1826  -0.0722 85  LEU B CD2 
1950 N N   . GLU B 69  ? 0.5218 0.4955 0.3470 -0.0400 0.0860  -0.0323 86  GLU B N   
1951 C CA  . GLU B 69  ? 0.5839 0.5406 0.3844 -0.0406 0.0675  -0.0193 86  GLU B CA  
1952 C C   . GLU B 69  ? 0.5804 0.5256 0.3702 -0.0479 0.0684  0.0017  86  GLU B C   
1953 O O   . GLU B 69  ? 0.6089 0.5400 0.3668 -0.0484 0.0572  0.0144  86  GLU B O   
1954 C CB  . GLU B 69  ? 0.6236 0.5785 0.4448 -0.0328 0.0474  -0.0231 86  GLU B CB  
1955 C CG  . GLU B 69  ? 0.6695 0.6258 0.4868 -0.0279 0.0419  -0.0403 86  GLU B CG  
1956 C CD  . GLU B 69  ? 0.7701 0.7192 0.5432 -0.0311 0.0410  -0.0450 86  GLU B CD  
1957 O OE1 . GLU B 69  ? 0.8300 0.7724 0.5778 -0.0342 0.0290  -0.0329 86  GLU B OE1 
1958 O OE2 . GLU B 69  ? 0.8276 0.7773 0.5901 -0.0297 0.0513  -0.0611 86  GLU B OE2 
1959 N N   . ARG B 70  ? 0.5529 0.5036 0.3672 -0.0542 0.0817  0.0055  87  ARG B N   
1960 C CA  . ARG B 70  ? 0.5567 0.4918 0.3625 -0.0630 0.0845  0.0249  87  ARG B CA  
1961 C C   . ARG B 70  ? 0.6005 0.5284 0.3636 -0.0723 0.0978  0.0356  87  ARG B C   
1962 O O   . ARG B 70  ? 0.6296 0.5379 0.3761 -0.0790 0.0973  0.0547  87  ARG B O   
1963 C CB  . ARG B 70  ? 0.5248 0.4671 0.3696 -0.0703 0.0941  0.0247  87  ARG B CB  
1964 C CG  . ARG B 70  ? 0.5199 0.4859 0.3799 -0.0791 0.1175  0.0165  87  ARG B CG  
1965 C CD  . ARG B 70  ? 0.5166 0.4890 0.4169 -0.0876 0.1210  0.0176  87  ARG B CD  
1966 N NE  . ARG B 70  ? 0.5178 0.5191 0.4417 -0.0975 0.1431  0.0108  87  ARG B NE  
1967 C CZ  . ARG B 70  ? 0.5546 0.5581 0.4650 -0.1132 0.1636  0.0209  87  ARG B CZ  
1968 N NH1 . ARG B 70  ? 0.5991 0.5727 0.4675 -0.1211 0.1642  0.0404  87  ARG B NH1 
1969 N NH2 . ARG B 70  ? 0.5501 0.5873 0.4905 -0.1211 0.1841  0.0126  87  ARG B NH2 
1970 N N   . PHE B 71  ? 0.6349 0.5762 0.3785 -0.0727 0.1107  0.0235  88  PHE B N   
1971 C CA  . PHE B 71  ? 0.7100 0.6442 0.4041 -0.0816 0.1242  0.0330  88  PHE B CA  
1972 C C   . PHE B 71  ? 0.7622 0.6799 0.4091 -0.0765 0.1052  0.0386  88  PHE B C   
1973 O O   . PHE B 71  ? 0.8147 0.7192 0.4144 -0.0836 0.1096  0.0532  88  PHE B O   
1974 C CB  . PHE B 71  ? 0.7173 0.6746 0.4106 -0.0844 0.1502  0.0161  88  PHE B CB  
1975 C CG  . PHE B 71  ? 0.7071 0.6855 0.4457 -0.0916 0.1698  0.0135  88  PHE B CG  
1976 C CD1 . PHE B 71  ? 0.7357 0.7123 0.4671 -0.1080 0.1879  0.0300  88  PHE B CD1 
1977 C CD2 . PHE B 71  ? 0.6607 0.6609 0.4491 -0.0828 0.1691  -0.0047 88  PHE B CD2 
1978 C CE1 . PHE B 71  ? 0.7201 0.7200 0.4979 -0.1171 0.2049  0.0271  88  PHE B CE1 
1979 C CE2 . PHE B 71  ? 0.6388 0.6623 0.4718 -0.0892 0.1838  -0.0073 88  PHE B CE2 
1980 C CZ  . PHE B 71  ? 0.6700 0.6954 0.4998 -0.1072 0.2019  0.0078  88  PHE B CZ  
1981 N N   . GLY B 72  ? 0.7531 0.6729 0.4130 -0.0653 0.0842  0.0276  89  GLY B N   
1982 C CA  . GLY B 72  ? 0.7981 0.7079 0.4227 -0.0609 0.0627  0.0310  89  GLY B CA  
1983 C C   . GLY B 72  ? 0.8165 0.7112 0.4434 -0.0570 0.0417  0.0522  89  GLY B C   
1984 O O   . GLY B 72  ? 0.8108 0.6950 0.4524 -0.0599 0.0468  0.0670  89  GLY B O   
1985 N N   . ASN B 73  ? 0.8415 0.7356 0.4569 -0.0502 0.0178  0.0523  90  ASN B N   
1986 C CA  . ASN B 73  ? 0.8815 0.7643 0.4977 -0.0432 -0.0043 0.0721  90  ASN B CA  
1987 C C   . ASN B 73  ? 0.8211 0.7173 0.4737 -0.0330 -0.0249 0.0632  90  ASN B C   
1988 O O   . ASN B 73  ? 0.8380 0.7327 0.4883 -0.0254 -0.0465 0.0752  90  ASN B O   
1989 C CB  . ASN B 73  ? 0.9831 0.8549 0.5431 -0.0450 -0.0161 0.0868  90  ASN B CB  
1990 C CG  . ASN B 73  ? 1.0291 0.9134 0.5624 -0.0466 -0.0254 0.0693  90  ASN B CG  
1991 O OD1 . ASN B 73  ? 1.1089 0.9882 0.5936 -0.0542 -0.0164 0.0677  90  ASN B OD1 
1992 N ND2 . ASN B 73  ? 1.0089 0.9084 0.5726 -0.0408 -0.0421 0.0553  90  ASN B ND2 
1993 N N   . MET B 74  ? 0.7527 0.6625 0.4400 -0.0324 -0.0181 0.0439  91  MET B N   
1994 C CA  . MET B 74  ? 0.6866 0.6099 0.4062 -0.0255 -0.0342 0.0348  91  MET B CA  
1995 C C   . MET B 74  ? 0.5990 0.5247 0.3643 -0.0199 -0.0313 0.0346  91  MET B C   
1996 O O   . MET B 74  ? 0.5637 0.5007 0.3550 -0.0141 -0.0436 0.0301  91  MET B O   
1997 C CB  . MET B 74  ? 0.6984 0.6320 0.4162 -0.0294 -0.0330 0.0128  91  MET B CB  
1998 C CG  . MET B 74  ? 0.7672 0.7011 0.4441 -0.0336 -0.0464 0.0098  91  MET B CG  
1999 S SD  . MET B 74  ? 0.8036 0.7502 0.4872 -0.0293 -0.0791 0.0175  91  MET B SD  
2000 C CE  . MET B 74  ? 0.7449 0.7069 0.4847 -0.0265 -0.0820 0.0051  91  MET B CE  
2001 N N   . THR B 75  ? 0.5675 0.4835 0.3419 -0.0225 -0.0157 0.0395  92  THR B N   
2002 C CA  . THR B 75  ? 0.5222 0.4403 0.3369 -0.0184 -0.0128 0.0357  92  THR B CA  
2003 C C   . THR B 75  ? 0.5302 0.4446 0.3604 -0.0081 -0.0283 0.0457  92  THR B C   
2004 O O   . THR B 75  ? 0.4917 0.4154 0.3523 -0.0027 -0.0315 0.0378  92  THR B O   
2005 C CB  . THR B 75  ? 0.5050 0.4147 0.3289 -0.0252 0.0050  0.0378  92  THR B CB  
2006 O OG1 . THR B 75  ? 0.5495 0.4390 0.3499 -0.0290 0.0075  0.0564  92  THR B OG1 
2007 C CG2 . THR B 75  ? 0.4990 0.4203 0.3224 -0.0322 0.0209  0.0249  92  THR B CG2 
2008 N N   . ARG B 76  ? 0.5784 0.4799 0.3876 -0.0042 -0.0376 0.0627  93  ARG B N   
2009 C CA  . ARG B 76  ? 0.6106 0.5107 0.4374 0.0090  -0.0526 0.0714  93  ARG B CA  
2010 C C   . ARG B 76  ? 0.5780 0.5047 0.4252 0.0143  -0.0655 0.0608  93  ARG B C   
2011 O O   . ARG B 76  ? 0.5600 0.4952 0.4387 0.0225  -0.0683 0.0569  93  ARG B O   
2012 C CB  . ARG B 76  ? 0.6877 0.5700 0.4877 0.0149  -0.0642 0.0929  93  ARG B CB  
2013 C CG  . ARG B 76  ? 0.7315 0.6070 0.5558 0.0315  -0.0756 0.1018  93  ARG B CG  
2014 C CD  . ARG B 76  ? 0.8328 0.6845 0.6330 0.0403  -0.0875 0.1254  93  ARG B CD  
2015 N NE  . ARG B 76  ? 0.9128 0.7288 0.6873 0.0311  -0.0741 0.1384  93  ARG B NE  
2016 C CZ  . ARG B 76  ? 0.9548 0.7389 0.7369 0.0356  -0.0697 0.1480  93  ARG B CZ  
2017 N NH1 . ARG B 76  ? 0.9619 0.7434 0.7765 0.0518  -0.0765 0.1448  93  ARG B NH1 
2018 N NH2 . ARG B 76  ? 0.9992 0.7528 0.7564 0.0224  -0.0564 0.1597  93  ARG B NH2 
2019 N N   . VAL B 77  ? 0.5794 0.5190 0.4084 0.0081  -0.0716 0.0546  94  VAL B N   
2020 C CA  . VAL B 77  ? 0.5316 0.4957 0.3805 0.0089  -0.0831 0.0439  94  VAL B CA  
2021 C C   . VAL B 77  ? 0.4563 0.4272 0.3328 0.0058  -0.0715 0.0287  94  VAL B C   
2022 O O   . VAL B 77  ? 0.4152 0.4016 0.3205 0.0102  -0.0767 0.0250  94  VAL B O   
2023 C CB  . VAL B 77  ? 0.5669 0.5393 0.3875 0.0007  -0.0933 0.0387  94  VAL B CB  
2024 C CG1 . VAL B 77  ? 0.5372 0.5338 0.3823 -0.0015 -0.1050 0.0275  94  VAL B CG1 
2025 C CG2 . VAL B 77  ? 0.6112 0.5784 0.4020 0.0047  -0.1082 0.0554  94  VAL B CG2 
2026 N N   . TYR B 78  ? 0.4438 0.4048 0.3122 -0.0012 -0.0560 0.0209  95  TYR B N   
2027 C CA  . TYR B 78  ? 0.4280 0.3940 0.3192 -0.0033 -0.0470 0.0079  95  TYR B CA  
2028 C C   . TYR B 78  ? 0.4061 0.3718 0.3249 0.0032  -0.0437 0.0096  95  TYR B C   
2029 O O   . TYR B 78  ? 0.3877 0.3627 0.3266 0.0036  -0.0432 0.0016  95  TYR B O   
2030 C CB  . TYR B 78  ? 0.4496 0.4075 0.3298 -0.0098 -0.0315 -0.0002 95  TYR B CB  
2031 C CG  . TYR B 78  ? 0.5039 0.4613 0.3562 -0.0159 -0.0312 -0.0077 95  TYR B CG  
2032 C CD1 . TYR B 78  ? 0.5341 0.4983 0.3780 -0.0182 -0.0452 -0.0123 95  TYR B CD1 
2033 C CD2 . TYR B 78  ? 0.5389 0.4900 0.3741 -0.0202 -0.0159 -0.0122 95  TYR B CD2 
2034 C CE1 . TYR B 78  ? 0.5755 0.5356 0.3905 -0.0243 -0.0452 -0.0217 95  TYR B CE1 
2035 C CE2 . TYR B 78  ? 0.5799 0.5289 0.3871 -0.0246 -0.0136 -0.0214 95  TYR B CE2 
2036 C CZ  . TYR B 78  ? 0.5992 0.5505 0.3942 -0.0266 -0.0286 -0.0269 95  TYR B CZ  
2037 O OH  . TYR B 78  ? 0.6371 0.5832 0.4010 -0.0316 -0.0273 -0.0384 95  TYR B OH  
2038 N N   . TYR B 79  ? 0.4237 0.3754 0.3400 0.0071  -0.0406 0.0197  96  TYR B N   
2039 C CA  . TYR B 79  ? 0.3985 0.3448 0.3367 0.0131  -0.0369 0.0196  96  TYR B CA  
2040 C C   . TYR B 79  ? 0.3623 0.3189 0.3186 0.0245  -0.0469 0.0226  96  TYR B C   
2041 O O   . TYR B 79  ? 0.3344 0.2902 0.3090 0.0300  -0.0432 0.0187  96  TYR B O   
2042 C CB  . TYR B 79  ? 0.4331 0.3562 0.3615 0.0127  -0.0311 0.0294  96  TYR B CB  
2043 C CG  . TYR B 79  ? 0.4726 0.3885 0.3896 0.0011  -0.0183 0.0274  96  TYR B CG  
2044 C CD1 . TYR B 79  ? 0.4660 0.3949 0.3893 -0.0048 -0.0113 0.0148  96  TYR B CD1 
2045 C CD2 . TYR B 79  ? 0.5236 0.4190 0.4258 -0.0036 -0.0125 0.0388  96  TYR B CD2 
2046 C CE1 . TYR B 79  ? 0.4935 0.4207 0.4121 -0.0140 0.0017  0.0125  96  TYR B CE1 
2047 C CE2 . TYR B 79  ? 0.5431 0.4361 0.4390 -0.0158 0.0016  0.0373  96  TYR B CE2 
2048 C CZ  . TYR B 79  ? 0.5271 0.4388 0.4332 -0.0202 0.0087  0.0234  96  TYR B CZ  
2049 O OH  . TYR B 79  ? 0.5605 0.4759 0.4652 -0.0305 0.0233  0.0211  96  TYR B OH  
2050 N N   . LYS B 80  ? 0.3810 0.3489 0.3327 0.0282  -0.0594 0.0291  97  LYS B N   
2051 C CA  . LYS B 80  ? 0.4008 0.3813 0.3735 0.0410  -0.0684 0.0335  97  LYS B CA  
2052 C C   . LYS B 80  ? 0.3804 0.3780 0.3806 0.0427  -0.0630 0.0226  97  LYS B C   
2053 O O   . LYS B 80  ? 0.3681 0.3786 0.3717 0.0333  -0.0610 0.0140  97  LYS B O   
2054 C CB  . LYS B 80  ? 0.4293 0.4272 0.3962 0.0423  -0.0847 0.0401  97  LYS B CB  
2055 C CG  . LYS B 80  ? 0.4599 0.4771 0.4525 0.0575  -0.0964 0.0464  97  LYS B CG  
2056 C CD  . LYS B 80  ? 0.5109 0.5452 0.4952 0.0580  -0.1156 0.0544  97  LYS B CD  
2057 C CE  . LYS B 80  ? 0.5131 0.5822 0.5344 0.0697  -0.1273 0.0558  97  LYS B CE  
2058 N NZ  . LYS B 80  ? 0.5160 0.5769 0.5563 0.0907  -0.1255 0.0632  97  LYS B NZ  
2059 N N   . GLU B 81  ? 0.3901 0.3856 0.4076 0.0549  -0.0604 0.0234  98  GLU B N   
2060 C CA  . GLU B 81  ? 0.4095 0.4211 0.4502 0.0585  -0.0537 0.0142  98  GLU B CA  
2061 C C   . GLU B 81  ? 0.3601 0.3575 0.3952 0.0514  -0.0416 0.0046  98  GLU B C   
2062 O O   . GLU B 81  ? 0.3600 0.3663 0.4081 0.0544  -0.0352 -0.0025 98  GLU B O   
2063 C CB  . GLU B 81  ? 0.4843 0.5300 0.5409 0.0523  -0.0582 0.0104  98  GLU B CB  
2064 C CG  . GLU B 81  ? 0.5715 0.6410 0.6383 0.0559  -0.0731 0.0177  98  GLU B CG  
2065 C CD  . GLU B 81  ? 0.6732 0.7607 0.7674 0.0744  -0.0768 0.0223  98  GLU B CD  
2066 O OE1 . GLU B 81  ? 0.7147 0.8024 0.8243 0.0837  -0.0655 0.0169  98  GLU B OE1 
2067 O OE2 . GLU B 81  ? 0.7381 0.8395 0.8376 0.0807  -0.0919 0.0310  98  GLU B OE2 
2068 N N   . ALA B 82  ? 0.3253 0.3034 0.3426 0.0424  -0.0380 0.0041  99  ALA B N   
2069 C CA  . ALA B 82  ? 0.2828 0.2517 0.2990 0.0368  -0.0292 -0.0047 99  ALA B CA  
2070 C C   . ALA B 82  ? 0.2936 0.2496 0.3163 0.0453  -0.0246 -0.0083 99  ALA B C   
2071 O O   . ALA B 82  ? 0.3463 0.2856 0.3673 0.0530  -0.0263 -0.0026 99  ALA B O   
2072 C CB  . ALA B 82  ? 0.2693 0.2234 0.2708 0.0269  -0.0258 -0.0043 99  ALA B CB  
2073 N N   . VAL B 83  ? 0.2807 0.2402 0.3071 0.0436  -0.0191 -0.0179 100 VAL B N   
2074 C CA  . VAL B 83  ? 0.3016 0.2472 0.3294 0.0501  -0.0142 -0.0251 100 VAL B CA  
2075 C C   . VAL B 83  ? 0.3221 0.2528 0.3408 0.0399  -0.0117 -0.0322 100 VAL B C   
2076 O O   . VAL B 83  ? 0.3333 0.2474 0.3492 0.0420  -0.0091 -0.0397 100 VAL B O   
2077 C CB  . VAL B 83  ? 0.3173 0.2801 0.3543 0.0576  -0.0095 -0.0315 100 VAL B CB  
2078 C CG1 . VAL B 83  ? 0.3314 0.3093 0.3844 0.0708  -0.0113 -0.0261 100 VAL B CG1 
2079 C CG2 . VAL B 83  ? 0.3003 0.2822 0.3359 0.0478  -0.0084 -0.0333 100 VAL B CG2 
2080 N N   . GLY B 84  ? 0.3374 0.2731 0.3524 0.0294  -0.0131 -0.0307 101 GLY B N   
2081 C CA  . GLY B 84  ? 0.2619 0.1885 0.2742 0.0201  -0.0120 -0.0366 101 GLY B CA  
2082 C C   . GLY B 84  ? 0.2678 0.2014 0.2798 0.0115  -0.0121 -0.0330 101 GLY B C   
2083 O O   . GLY B 84  ? 0.2683 0.2120 0.2783 0.0123  -0.0132 -0.0278 101 GLY B O   
2084 N N   . ALA B 85  ? 0.2993 0.2293 0.3145 0.0031  -0.0108 -0.0368 102 ALA B N   
2085 C CA  . ALA B 85  ? 0.3048 0.2443 0.3232 -0.0039 -0.0083 -0.0352 102 ALA B CA  
2086 C C   . ALA B 85  ? 0.2983 0.2456 0.3277 -0.0104 -0.0090 -0.0427 102 ALA B C   
2087 O O   . ALA B 85  ? 0.2911 0.2307 0.3238 -0.0139 -0.0111 -0.0478 102 ALA B O   
2088 C CB  . ALA B 85  ? 0.3330 0.2622 0.3457 -0.0088 -0.0033 -0.0268 102 ALA B CB  
2089 N N   . PHE B 86  ? 0.2957 0.2590 0.3315 -0.0112 -0.0081 -0.0441 103 PHE B N   
2090 C CA  . PHE B 86  ? 0.2797 0.2558 0.3314 -0.0171 -0.0073 -0.0490 103 PHE B CA  
2091 C C   . PHE B 86  ? 0.2722 0.2533 0.3282 -0.0239 0.0027  -0.0453 103 PHE B C   
2092 O O   . PHE B 86  ? 0.2718 0.2523 0.3169 -0.0211 0.0074  -0.0411 103 PHE B O   
2093 C CB  . PHE B 86  ? 0.2699 0.2609 0.3280 -0.0106 -0.0118 -0.0529 103 PHE B CB  
2094 C CG  . PHE B 86  ? 0.2845 0.2728 0.3371 -0.0056 -0.0210 -0.0555 103 PHE B CG  
2095 C CD1 . PHE B 86  ? 0.2808 0.2688 0.3370 -0.0093 -0.0272 -0.0607 103 PHE B CD1 
2096 C CD2 . PHE B 86  ? 0.3036 0.2877 0.3441 0.0009  -0.0229 -0.0525 103 PHE B CD2 
2097 C CE1 . PHE B 86  ? 0.3042 0.2893 0.3498 -0.0051 -0.0351 -0.0632 103 PHE B CE1 
2098 C CE2 . PHE B 86  ? 0.3173 0.2986 0.3495 0.0040  -0.0292 -0.0534 103 PHE B CE2 
2099 C CZ  . PHE B 86  ? 0.3250 0.3070 0.3581 0.0017  -0.0352 -0.0587 103 PHE B CZ  
2100 N N   . VAL B 87  ? 0.2868 0.2747 0.3587 -0.0341 0.0060  -0.0476 104 VAL B N   
2101 C CA  . VAL B 87  ? 0.2888 0.2859 0.3676 -0.0427 0.0181  -0.0444 104 VAL B CA  
2102 C C   . VAL B 87  ? 0.2747 0.3003 0.3821 -0.0445 0.0176  -0.0527 104 VAL B C   
2103 O O   . VAL B 87  ? 0.2825 0.3135 0.4047 -0.0486 0.0090  -0.0581 104 VAL B O   
2104 C CB  . VAL B 87  ? 0.3137 0.2930 0.3879 -0.0558 0.0241  -0.0374 104 VAL B CB  
2105 C CG1 . VAL B 87  ? 0.3151 0.3057 0.3933 -0.0664 0.0396  -0.0323 104 VAL B CG1 
2106 C CG2 . VAL B 87  ? 0.3123 0.2631 0.3611 -0.0501 0.0210  -0.0293 104 VAL B CG2 
2107 N N   . VAL B 88  ? 0.2487 0.2922 0.3625 -0.0394 0.0257  -0.0545 105 VAL B N   
2108 C CA  . VAL B 88  ? 0.2423 0.3137 0.3834 -0.0337 0.0236  -0.0626 105 VAL B CA  
2109 C C   . VAL B 88  ? 0.2454 0.3394 0.4053 -0.0418 0.0397  -0.0634 105 VAL B C   
2110 O O   . VAL B 88  ? 0.2762 0.3638 0.4188 -0.0450 0.0537  -0.0588 105 VAL B O   
2111 C CB  . VAL B 88  ? 0.2389 0.3094 0.3719 -0.0169 0.0200  -0.0658 105 VAL B CB  
2112 C CG1 . VAL B 88  ? 0.2187 0.3146 0.3810 -0.0082 0.0154  -0.0730 105 VAL B CG1 
2113 C CG2 . VAL B 88  ? 0.2405 0.2884 0.3519 -0.0114 0.0075  -0.0629 105 VAL B CG2 
2114 N N   . PHE B 89  ? 0.2428 0.3649 0.4377 -0.0468 0.0378  -0.0689 106 PHE B N   
2115 C CA  . PHE B 89  ? 0.2513 0.4067 0.4745 -0.0516 0.0539  -0.0721 106 PHE B CA  
2116 C C   . PHE B 89  ? 0.2604 0.4500 0.5208 -0.0388 0.0459  -0.0815 106 PHE B C   
2117 O O   . PHE B 89  ? 0.2320 0.4175 0.4942 -0.0297 0.0269  -0.0838 106 PHE B O   
2118 C CB  . PHE B 89  ? 0.2580 0.4198 0.4944 -0.0746 0.0633  -0.0677 106 PHE B CB  
2119 C CG  . PHE B 89  ? 0.2547 0.4298 0.5201 -0.0847 0.0485  -0.0724 106 PHE B CG  
2120 C CD1 . PHE B 89  ? 0.2657 0.4110 0.5123 -0.0874 0.0320  -0.0716 106 PHE B CD1 
2121 C CD2 . PHE B 89  ? 0.2536 0.4747 0.5673 -0.0921 0.0518  -0.0788 106 PHE B CD2 
2122 C CE1 . PHE B 89  ? 0.2640 0.4189 0.5320 -0.0973 0.0175  -0.0779 106 PHE B CE1 
2123 C CE2 . PHE B 89  ? 0.2654 0.4994 0.6050 -0.1041 0.0361  -0.0838 106 PHE B CE2 
2124 C CZ  . PHE B 89  ? 0.2589 0.4577 0.5730 -0.1070 0.0183  -0.0838 106 PHE B CZ  
2125 N N   . ASP B 90  ? 0.2783 0.5018 0.5671 -0.0380 0.0616  -0.0862 107 ASP B N   
2126 C CA  . ASP B 90  ? 0.3061 0.5666 0.6352 -0.0235 0.0572  -0.0950 107 ASP B CA  
2127 C C   . ASP B 90  ? 0.3249 0.6252 0.7003 -0.0394 0.0559  -0.0974 107 ASP B C   
2128 O O   . ASP B 90  ? 0.3158 0.6367 0.7074 -0.0549 0.0755  -0.0964 107 ASP B O   
2129 C CB  . ASP B 90  ? 0.3326 0.6052 0.6628 -0.0116 0.0785  -0.1003 107 ASP B CB  
2130 C CG  . ASP B 90  ? 0.3577 0.6711 0.7339 0.0064  0.0785  -0.1104 107 ASP B CG  
2131 O OD1 . ASP B 90  ? 0.3617 0.7025 0.7758 0.0086  0.0620  -0.1125 107 ASP B OD1 
2132 O OD2 . ASP B 90  ? 0.3712 0.6900 0.7458 0.0195  0.0952  -0.1170 107 ASP B OD2 
2133 N N   . ILE B 91  ? 0.3602 0.6717 0.7557 -0.0352 0.0323  -0.1005 108 ILE B N   
2134 C CA  . ILE B 91  ? 0.3934 0.7387 0.8297 -0.0508 0.0226  -0.1038 108 ILE B CA  
2135 C C   . ILE B 91  ? 0.4007 0.8033 0.8919 -0.0527 0.0391  -0.1094 108 ILE B C   
2136 O O   . ILE B 91  ? 0.4037 0.8350 0.9281 -0.0738 0.0406  -0.1107 108 ILE B O   
2137 C CB  . ILE B 91  ? 0.4009 0.7474 0.8425 -0.0401 -0.0087 -0.1067 108 ILE B CB  
2138 C CG1 . ILE B 91  ? 0.4135 0.7787 0.8796 -0.0612 -0.0240 -0.1102 108 ILE B CG1 
2139 C CG2 . ILE B 91  ? 0.3971 0.7754 0.8701 -0.0145 -0.0166 -0.1112 108 ILE B CG2 
2140 C CD1 . ILE B 91  ? 0.4104 0.7631 0.8620 -0.0529 -0.0548 -0.1120 108 ILE B CD1 
2141 N N   . SER B 92  ? 0.3994 0.8159 0.8981 -0.0318 0.0529  -0.1133 109 SER B N   
2142 C CA  . SER B 92  ? 0.4016 0.8718 0.9491 -0.0289 0.0733  -0.1197 109 SER B CA  
2143 C C   . SER B 92  ? 0.3935 0.8645 0.9281 -0.0445 0.1075  -0.1166 109 SER B C   
2144 O O   . SER B 92  ? 0.3893 0.8949 0.9496 -0.0447 0.1234  -0.1167 109 SER B O   
2145 C CB  . SER B 92  ? 0.4199 0.8974 0.9747 0.0052  0.0719  -0.1254 109 SER B CB  
2146 O OG  . SER B 92  ? 0.4220 0.8792 0.9675 0.0241  0.0442  -0.1261 109 SER B OG  
2147 N N   . ARG B 93  ? 0.3909 0.8141 0.8718 -0.0551 0.1154  -0.1088 110 ARG B N   
2148 C CA  . ARG B 93  ? 0.3943 0.8132 0.8541 -0.0687 0.1465  -0.1042 110 ARG B CA  
2149 C C   . ARG B 93  ? 0.4061 0.7893 0.8330 -0.0965 0.1478  -0.0912 110 ARG B C   
2150 O O   . ARG B 93  ? 0.3965 0.7279 0.7723 -0.0945 0.1384  -0.0841 110 ARG B O   
2151 C CB  . ARG B 93  ? 0.3775 0.7664 0.7925 -0.0487 0.1566  -0.1065 110 ARG B CB  
2152 C CG  . ARG B 93  ? 0.3639 0.7824 0.8053 -0.0220 0.1642  -0.1200 110 ARG B CG  
2153 C CD  . ARG B 93  ? 0.3790 0.7649 0.7695 -0.0114 0.1804  -0.1225 110 ARG B CD  
2154 N NE  . ARG B 93  ? 0.3662 0.6997 0.7118 -0.0026 0.1583  -0.1184 110 ARG B NE  
2155 C CZ  . ARG B 93  ? 0.3683 0.6607 0.6593 -0.0016 0.1626  -0.1158 110 ARG B CZ  
2156 N NH1 . ARG B 93  ? 0.3887 0.6795 0.6532 -0.0093 0.1872  -0.1157 110 ARG B NH1 
2157 N NH2 . ARG B 93  ? 0.3499 0.6023 0.6103 0.0055  0.1409  -0.1123 110 ARG B NH2 
2158 N N   . SER B 94  ? 0.4152 0.8251 0.8726 -0.1224 0.1594  -0.0877 111 SER B N   
2159 C CA  . SER B 94  ? 0.4222 0.7967 0.8546 -0.1497 0.1587  -0.0755 111 SER B CA  
2160 C C   . SER B 94  ? 0.4498 0.7801 0.8230 -0.1548 0.1763  -0.0628 111 SER B C   
2161 O O   . SER B 94  ? 0.4716 0.7563 0.8105 -0.1669 0.1684  -0.0522 111 SER B O   
2162 C CB  . SER B 94  ? 0.4241 0.8308 0.8967 -0.1747 0.1639  -0.0722 111 SER B CB  
2163 O OG  . SER B 94  ? 0.4379 0.8790 0.9244 -0.1734 0.1884  -0.0700 111 SER B OG  
2164 N N   . SER B 95  ? 0.4699 0.8117 0.8289 -0.1446 0.1989  -0.0644 112 SER B N   
2165 C CA  . SER B 95  ? 0.4988 0.7983 0.7958 -0.1451 0.2110  -0.0536 112 SER B CA  
2166 C C   . SER B 95  ? 0.4803 0.7277 0.7332 -0.1306 0.1860  -0.0504 112 SER B C   
2167 O O   . SER B 95  ? 0.4966 0.7016 0.7051 -0.1387 0.1850  -0.0372 112 SER B O   
2168 C CB  . SER B 95  ? 0.5221 0.8430 0.8106 -0.1294 0.2332  -0.0620 112 SER B CB  
2169 O OG  . SER B 95  ? 0.5077 0.8348 0.8077 -0.1009 0.2172  -0.0763 112 SER B OG  
2170 N N   . THR B 96  ? 0.4327 0.6849 0.6990 -0.1089 0.1662  -0.0616 113 THR B N   
2171 C CA  . THR B 96  ? 0.4010 0.6105 0.6326 -0.0968 0.1436  -0.0592 113 THR B CA  
2172 C C   . THR B 96  ? 0.3943 0.5784 0.6245 -0.1096 0.1252  -0.0525 113 THR B C   
2173 O O   . THR B 96  ? 0.3949 0.5382 0.5882 -0.1060 0.1138  -0.0458 113 THR B O   
2174 C CB  . THR B 96  ? 0.3559 0.5735 0.5981 -0.0714 0.1289  -0.0713 113 THR B CB  
2175 O OG1 . THR B 96  ? 0.3221 0.5673 0.6095 -0.0700 0.1142  -0.0781 113 THR B OG1 
2176 C CG2 . THR B 96  ? 0.3609 0.5969 0.6018 -0.0571 0.1468  -0.0801 113 THR B CG2 
2177 N N   . PHE B 97  ? 0.4016 0.6099 0.6718 -0.1244 0.1225  -0.0553 114 PHE B N   
2178 C CA  . PHE B 97  ? 0.4202 0.6017 0.6870 -0.1408 0.1090  -0.0502 114 PHE B CA  
2179 C C   . PHE B 97  ? 0.4632 0.6100 0.6987 -0.1598 0.1225  -0.0349 114 PHE B C   
2180 O O   . PHE B 97  ? 0.4621 0.5652 0.6672 -0.1596 0.1109  -0.0284 114 PHE B O   
2181 C CB  . PHE B 97  ? 0.4138 0.6298 0.7308 -0.1543 0.1013  -0.0584 114 PHE B CB  
2182 C CG  . PHE B 97  ? 0.4292 0.6143 0.7402 -0.1701 0.0858  -0.0569 114 PHE B CG  
2183 C CD1 . PHE B 97  ? 0.4128 0.5645 0.6976 -0.1568 0.0649  -0.0597 114 PHE B CD1 
2184 C CD2 . PHE B 97  ? 0.4530 0.6392 0.7819 -0.1988 0.0934  -0.0529 114 PHE B CD2 
2185 C CE1 . PHE B 97  ? 0.4369 0.5574 0.7131 -0.1694 0.0518  -0.0606 114 PHE B CE1 
2186 C CE2 . PHE B 97  ? 0.4692 0.6209 0.7900 -0.2131 0.0786  -0.0537 114 PHE B CE2 
2187 C CZ  . PHE B 97  ? 0.4569 0.5750 0.7503 -0.1973 0.0581  -0.0583 114 PHE B CZ  
2188 N N   . GLU B 98  ? 0.5011 0.6664 0.7432 -0.1751 0.1469  -0.0285 115 GLU B N   
2189 C CA  . GLU B 98  ? 0.5713 0.7013 0.7781 -0.1927 0.1609  -0.0109 115 GLU B CA  
2190 C C   . GLU B 98  ? 0.5666 0.6534 0.7176 -0.1764 0.1555  -0.0020 115 GLU B C   
2191 O O   . GLU B 98  ? 0.6029 0.6455 0.7228 -0.1833 0.1511  0.0115  115 GLU B O   
2192 C CB  . GLU B 98  ? 0.6411 0.8026 0.8597 -0.2098 0.1913  -0.0055 115 GLU B CB  
2193 C CG  . GLU B 98  ? 0.6972 0.8985 0.9716 -0.2337 0.1988  -0.0099 115 GLU B CG  
2194 C CD  . GLU B 98  ? 0.7323 0.9944 1.0423 -0.2343 0.2226  -0.0162 115 GLU B CD  
2195 O OE1 . GLU B 98  ? 0.7603 1.0271 1.0433 -0.2271 0.2438  -0.0122 115 GLU B OE1 
2196 O OE2 . GLU B 98  ? 0.7268 1.0299 1.0878 -0.2365 0.2147  -0.0249 115 GLU B OE2 
2197 N N   . ALA B 99  ? 0.5206 0.6191 0.6608 -0.1541 0.1535  -0.0099 116 ALA B N   
2198 C CA  . ALA B 99  ? 0.4896 0.5538 0.5811 -0.1393 0.1468  -0.0033 116 ALA B CA  
2199 C C   . ALA B 99  ? 0.4675 0.4983 0.5461 -0.1283 0.1220  -0.0027 116 ALA B C   
2200 O O   . ALA B 99  ? 0.4881 0.4891 0.5298 -0.1200 0.1157  0.0057  116 ALA B O   
2201 C CB  . ALA B 99  ? 0.4417 0.5279 0.5276 -0.1213 0.1523  -0.0140 116 ALA B CB  
2202 N N   . VAL B 100 ? 0.4190 0.4579 0.5283 -0.1278 0.1081  -0.0124 117 VAL B N   
2203 C CA  . VAL B 100 ? 0.4036 0.4149 0.5043 -0.1191 0.0875  -0.0140 117 VAL B CA  
2204 C C   . VAL B 100 ? 0.4235 0.3893 0.4938 -0.1247 0.0848  0.0002  117 VAL B C   
2205 O O   . VAL B 100 ? 0.3849 0.3272 0.4342 -0.1101 0.0719  0.0018  117 VAL B O   
2206 C CB  . VAL B 100 ? 0.3935 0.4198 0.5300 -0.1250 0.0764  -0.0254 117 VAL B CB  
2207 C CG1 . VAL B 100 ? 0.3915 0.3820 0.5165 -0.1249 0.0605  -0.0256 117 VAL B CG1 
2208 C CG2 . VAL B 100 ? 0.3814 0.4414 0.5394 -0.1095 0.0693  -0.0384 117 VAL B CG2 
2209 N N   . LEU B 101 ? 0.4652 0.4193 0.5340 -0.1447 0.0970  0.0108  118 LEU B N   
2210 C CA  . LEU B 101 ? 0.5490 0.4563 0.5904 -0.1500 0.0943  0.0255  118 LEU B CA  
2211 C C   . LEU B 101 ? 0.5726 0.4625 0.5735 -0.1404 0.0980  0.0399  118 LEU B C   
2212 O O   . LEU B 101 ? 0.5941 0.4472 0.5705 -0.1319 0.0875  0.0496  118 LEU B O   
2213 C CB  . LEU B 101 ? 0.6197 0.5148 0.6704 -0.1767 0.1062  0.0342  118 LEU B CB  
2214 C CG  . LEU B 101 ? 0.6413 0.5477 0.7310 -0.1901 0.0992  0.0203  118 LEU B CG  
2215 C CD1 . LEU B 101 ? 0.6448 0.5273 0.7311 -0.1753 0.0778  0.0101  118 LEU B CD1 
2216 C CD2 . LEU B 101 ? 0.6206 0.5848 0.7495 -0.1920 0.1042  0.0062  118 LEU B CD2 
2217 N N   . LYS B 102 ? 0.5817 0.4987 0.5756 -0.1404 0.1118  0.0401  119 LYS B N   
2218 C CA  . LYS B 102 ? 0.5918 0.4972 0.5446 -0.1303 0.1130  0.0504  119 LYS B CA  
2219 C C   . LYS B 102 ? 0.5512 0.4522 0.4966 -0.1080 0.0937  0.0435  119 LYS B C   
2220 O O   . LYS B 102 ? 0.5708 0.4447 0.4888 -0.0998 0.0838  0.0548  119 LYS B O   
2221 C CB  . LYS B 102 ? 0.6215 0.5560 0.5661 -0.1348 0.1325  0.0486  119 LYS B CB  
2222 C CG  . LYS B 102 ? 0.6876 0.6272 0.6394 -0.1593 0.1542  0.0579  119 LYS B CG  
2223 C CD  . LYS B 102 ? 0.7589 0.6998 0.6727 -0.1654 0.1733  0.0692  119 LYS B CD  
2224 C CE  . LYS B 102 ? 0.8070 0.7605 0.7313 -0.1913 0.1990  0.0776  119 LYS B CE  
2225 N NZ  . LYS B 102 ? 0.7917 0.7998 0.7546 -0.1923 0.2160  0.0591  119 LYS B NZ  
2226 N N   . TRP B 103 ? 0.5077 0.4355 0.4789 -0.0984 0.0879  0.0260  120 TRP B N   
2227 C CA  . TRP B 103 ? 0.4718 0.3962 0.4399 -0.0802 0.0706  0.0195  120 TRP B CA  
2228 C C   . TRP B 103 ? 0.4780 0.3747 0.4468 -0.0757 0.0569  0.0235  120 TRP B C   
2229 O O   . TRP B 103 ? 0.4642 0.3459 0.4152 -0.0635 0.0463  0.0289  120 TRP B O   
2230 C CB  . TRP B 103 ? 0.4301 0.3835 0.4255 -0.0730 0.0675  0.0024  120 TRP B CB  
2231 C CG  . TRP B 103 ? 0.4198 0.3960 0.4102 -0.0692 0.0774  -0.0041 120 TRP B CG  
2232 C CD1 . TRP B 103 ? 0.4204 0.4237 0.4304 -0.0750 0.0920  -0.0114 120 TRP B CD1 
2233 C CD2 . TRP B 103 ? 0.4070 0.3802 0.3720 -0.0586 0.0733  -0.0052 120 TRP B CD2 
2234 N NE1 . TRP B 103 ? 0.4270 0.4417 0.4235 -0.0670 0.0985  -0.0179 120 TRP B NE1 
2235 C CE2 . TRP B 103 ? 0.4148 0.4101 0.3826 -0.0578 0.0864  -0.0149 120 TRP B CE2 
2236 C CE3 . TRP B 103 ? 0.3951 0.3513 0.3380 -0.0497 0.0595  -0.0004 120 TRP B CE3 
2237 C CZ2 . TRP B 103 ? 0.4202 0.4154 0.3650 -0.0497 0.0861  -0.0204 120 TRP B CZ2 
2238 C CZ3 . TRP B 103 ? 0.4031 0.3634 0.3258 -0.0433 0.0579  -0.0050 120 TRP B CZ3 
2239 C CH2 . TRP B 103 ? 0.4181 0.3955 0.3401 -0.0437 0.0712  -0.0157 120 TRP B CH2 
2240 N N   . LYS B 104 ? 0.4877 0.3787 0.4779 -0.0856 0.0572  0.0197  121 LYS B N   
2241 C CA  . LYS B 104 ? 0.5121 0.3747 0.5028 -0.0811 0.0457  0.0200  121 LYS B CA  
2242 C C   . LYS B 104 ? 0.5732 0.3979 0.5368 -0.0793 0.0442  0.0376  121 LYS B C   
2243 O O   . LYS B 104 ? 0.5800 0.3884 0.5356 -0.0638 0.0328  0.0392  121 LYS B O   
2244 C CB  . LYS B 104 ? 0.5198 0.3832 0.5363 -0.0937 0.0455  0.0100  121 LYS B CB  
2245 C CG  . LYS B 104 ? 0.5547 0.3895 0.5712 -0.0883 0.0342  0.0053  121 LYS B CG  
2246 C CD  . LYS B 104 ? 0.5466 0.3881 0.5607 -0.0682 0.0231  -0.0030 121 LYS B CD  
2247 C CE  . LYS B 104 ? 0.5575 0.3773 0.5762 -0.0657 0.0148  -0.0133 121 LYS B CE  
2248 N NZ  . LYS B 104 ? 0.5779 0.3536 0.5848 -0.0684 0.0152  -0.0055 121 LYS B NZ  
2249 N N   . SER B 105 ? 0.6110 0.4237 0.5602 -0.0936 0.0558  0.0516  122 SER B N   
2250 C CA  . SER B 105 ? 0.6698 0.4451 0.5887 -0.0910 0.0535  0.0715  122 SER B CA  
2251 C C   . SER B 105 ? 0.6457 0.4262 0.5396 -0.0734 0.0449  0.0787  122 SER B C   
2252 O O   . SER B 105 ? 0.6516 0.4057 0.5305 -0.0612 0.0338  0.0897  122 SER B O   
2253 C CB  . SER B 105 ? 0.7467 0.5062 0.6523 -0.1125 0.0688  0.0870  122 SER B CB  
2254 O OG  . SER B 105 ? 0.7633 0.5569 0.6678 -0.1217 0.0833  0.0849  122 SER B OG  
2255 N N   . ASP B 106 ? 0.6311 0.4450 0.5226 -0.0718 0.0489  0.0713  123 ASP B N   
2256 C CA  . ASP B 106 ? 0.6364 0.4590 0.5063 -0.0579 0.0395  0.0742  123 ASP B CA  
2257 C C   . ASP B 106 ? 0.6049 0.4285 0.4894 -0.0400 0.0227  0.0670  123 ASP B C   
2258 O O   . ASP B 106 ? 0.6330 0.4470 0.5037 -0.0280 0.0109  0.0761  123 ASP B O   
2259 C CB  . ASP B 106 ? 0.6297 0.4870 0.5005 -0.0603 0.0478  0.0614  123 ASP B CB  
2260 C CG  . ASP B 106 ? 0.6458 0.5102 0.4894 -0.0509 0.0394  0.0635  123 ASP B CG  
2261 O OD1 . ASP B 106 ? 0.6975 0.5458 0.5075 -0.0525 0.0382  0.0793  123 ASP B OD1 
2262 O OD2 . ASP B 106 ? 0.6293 0.5140 0.4823 -0.0429 0.0332  0.0498  123 ASP B OD2 
2263 N N   . LEU B 107 ? 0.5645 0.4031 0.4778 -0.0389 0.0226  0.0506  124 LEU B N   
2264 C CA  . LEU B 107 ? 0.5571 0.4002 0.4864 -0.0248 0.0110  0.0416  124 LEU B CA  
2265 C C   . LEU B 107 ? 0.5810 0.3939 0.5091 -0.0160 0.0039  0.0495  124 LEU B C   
2266 O O   . LEU B 107 ? 0.5601 0.3733 0.4855 -0.0011 -0.0065 0.0533  124 LEU B O   
2267 C CB  . LEU B 107 ? 0.5410 0.4009 0.4958 -0.0288 0.0142  0.0247  124 LEU B CB  
2268 C CG  . LEU B 107 ? 0.5250 0.3953 0.4952 -0.0176 0.0059  0.0129  124 LEU B CG  
2269 C CD1 . LEU B 107 ? 0.4772 0.3707 0.4450 -0.0105 0.0015  0.0095  124 LEU B CD1 
2270 C CD2 . LEU B 107 ? 0.5168 0.3955 0.5061 -0.0254 0.0091  0.0000  124 LEU B CD2 
2271 N N   . ASP B 108 ? 0.6101 0.3967 0.5409 -0.0253 0.0093  0.0520  125 ASP B N   
2272 C CA  . ASP B 108 ? 0.6755 0.4275 0.6048 -0.0158 0.0030  0.0579  125 ASP B CA  
2273 C C   . ASP B 108 ? 0.6941 0.4233 0.5993 -0.0072 -0.0032 0.0791  125 ASP B C   
2274 O O   . ASP B 108 ? 0.7122 0.4231 0.6193 0.0096  -0.0124 0.0830  125 ASP B O   
2275 C CB  . ASP B 108 ? 0.7284 0.4538 0.6665 -0.0289 0.0089  0.0529  125 ASP B CB  
2276 C CG  . ASP B 108 ? 0.7193 0.4653 0.6806 -0.0323 0.0094  0.0310  125 ASP B CG  
2277 O OD1 . ASP B 108 ? 0.7004 0.4774 0.6704 -0.0222 0.0053  0.0208  125 ASP B OD1 
2278 O OD2 . ASP B 108 ? 0.7534 0.4847 0.7235 -0.0466 0.0132  0.0244  125 ASP B OD2 
2279 N N   . SER B 109 ? 0.7011 0.4342 0.5836 -0.0167 0.0012  0.0921  126 SER B N   
2280 C CA  . SER B 109 ? 0.7435 0.4592 0.5980 -0.0085 -0.0070 0.1131  126 SER B CA  
2281 C C   . SER B 109 ? 0.7240 0.4649 0.5808 0.0110  -0.0224 0.1115  126 SER B C   
2282 O O   . SER B 109 ? 0.7494 0.4764 0.5959 0.0257  -0.0352 0.1256  126 SER B O   
2283 C CB  . SER B 109 ? 0.7748 0.4929 0.6005 -0.0255 0.0034  0.1248  126 SER B CB  
2284 O OG  . SER B 109 ? 0.8488 0.5333 0.6425 -0.0249 -0.0002 0.1491  126 SER B OG  
2285 N N   . LYS B 110 ? 0.6979 0.4762 0.5706 0.0104  -0.0214 0.0944  127 LYS B N   
2286 C CA  . LYS B 110 ? 0.6958 0.5024 0.5682 0.0212  -0.0335 0.0925  127 LYS B CA  
2287 C C   . LYS B 110 ? 0.6605 0.4884 0.5627 0.0347  -0.0407 0.0793  127 LYS B C   
2288 O O   . LYS B 110 ? 0.6641 0.5126 0.5691 0.0443  -0.0526 0.0808  127 LYS B O   
2289 C CB  . LYS B 110 ? 0.6895 0.5207 0.5497 0.0084  -0.0269 0.0850  127 LYS B CB  
2290 C CG  . LYS B 110 ? 0.7488 0.5660 0.5713 -0.0007 -0.0235 0.1008  127 LYS B CG  
2291 C CD  . LYS B 110 ? 0.7569 0.5958 0.5681 -0.0128 -0.0130 0.0904  127 LYS B CD  
2292 C CE  . LYS B 110 ? 0.7956 0.6202 0.5747 -0.0270 0.0008  0.1019  127 LYS B CE  
2293 N NZ  . LYS B 110 ? 0.8473 0.6559 0.5875 -0.0235 -0.0097 0.1217  127 LYS B NZ  
2294 N N   . VAL B 111 ? 0.6217 0.4462 0.5455 0.0348  -0.0339 0.0667  128 VAL B N   
2295 C CA  . VAL B 111 ? 0.5775 0.4216 0.5266 0.0479  -0.0387 0.0552  128 VAL B CA  
2296 C C   . VAL B 111 ? 0.5461 0.3685 0.5088 0.0531  -0.0334 0.0476  128 VAL B C   
2297 O O   . VAL B 111 ? 0.5429 0.3451 0.5012 0.0413  -0.0253 0.0448  128 VAL B O   
2298 C CB  . VAL B 111 ? 0.5499 0.4270 0.5080 0.0401  -0.0355 0.0412  128 VAL B CB  
2299 C CG1 . VAL B 111 ? 0.5344 0.4074 0.4950 0.0266  -0.0240 0.0309  128 VAL B CG1 
2300 C CG2 . VAL B 111 ? 0.5414 0.4411 0.5225 0.0507  -0.0390 0.0317  128 VAL B CG2 
2301 N N   . HIS B 112 ? 0.5104 0.3389 0.4901 0.0703  -0.0381 0.0435  129 HIS B N   
2302 C CA  . HIS B 112 ? 0.5000 0.3077 0.4911 0.0794  -0.0336 0.0340  129 HIS B CA  
2303 C C   . HIS B 112 ? 0.4631 0.3023 0.4759 0.0926  -0.0340 0.0228  129 HIS B C   
2304 O O   . HIS B 112 ? 0.4380 0.3090 0.4587 0.0959  -0.0396 0.0259  129 HIS B O   
2305 C CB  . HIS B 112 ? 0.5265 0.2963 0.5122 0.0931  -0.0384 0.0464  129 HIS B CB  
2306 C CG  . HIS B 112 ? 0.5432 0.3254 0.5287 0.1074  -0.0510 0.0622  129 HIS B CG  
2307 N ND1 . HIS B 112 ? 0.5374 0.3418 0.5456 0.1290  -0.0576 0.0601  129 HIS B ND1 
2308 C CD2 . HIS B 112 ? 0.5633 0.3427 0.5285 0.1026  -0.0588 0.0800  129 HIS B CD2 
2309 C CE1 . HIS B 112 ? 0.5547 0.3701 0.5590 0.1369  -0.0711 0.0762  129 HIS B CE1 
2310 N NE2 . HIS B 112 ? 0.5658 0.3641 0.5411 0.1212  -0.0725 0.0886  129 HIS B NE2 
2311 N N   . LEU B 113 ? 0.4688 0.2986 0.4900 0.0985  -0.0272 0.0090  130 LEU B N   
2312 C CA  . LEU B 113 ? 0.4526 0.3102 0.4928 0.1112  -0.0243 -0.0015 130 LEU B CA  
2313 C C   . LEU B 113 ? 0.4390 0.3020 0.4956 0.1347  -0.0305 0.0062  130 LEU B C   
2314 O O   . LEU B 113 ? 0.4443 0.2815 0.4940 0.1424  -0.0383 0.0201  130 LEU B O   
2315 C CB  . LEU B 113 ? 0.4518 0.2943 0.4904 0.1110  -0.0145 -0.0193 130 LEU B CB  
2316 C CG  . LEU B 113 ? 0.4331 0.2740 0.4589 0.0894  -0.0109 -0.0271 130 LEU B CG  
2317 C CD1 . LEU B 113 ? 0.4614 0.2814 0.4819 0.0904  -0.0045 -0.0441 130 LEU B CD1 
2318 C CD2 . LEU B 113 ? 0.3807 0.2597 0.4105 0.0811  -0.0103 -0.0289 130 LEU B CD2 
2319 N N   . PRO B 114 ? 0.4248 0.3222 0.5038 0.1466  -0.0272 -0.0015 131 PRO B N   
2320 C CA  . PRO B 114 ? 0.4353 0.3441 0.5359 0.1703  -0.0338 0.0057  131 PRO B CA  
2321 C C   . PRO B 114 ? 0.4972 0.3629 0.5964 0.1893  -0.0327 0.0052  131 PRO B C   
2322 O O   . PRO B 114 ? 0.5213 0.3820 0.6306 0.2080  -0.0431 0.0179  131 PRO B O   
2323 C CB  . PRO B 114 ? 0.4043 0.3590 0.5311 0.1768  -0.0258 -0.0056 131 PRO B CB  
2324 C CG  . PRO B 114 ? 0.3579 0.3332 0.4746 0.1526  -0.0229 -0.0089 131 PRO B CG  
2325 C CD  . PRO B 114 ? 0.3724 0.3075 0.4597 0.1372  -0.0202 -0.0118 131 PRO B CD  
2326 N N   . ASN B 115 ? 0.5163 0.3491 0.6018 0.1842  -0.0220 -0.0090 132 ASN B N   
2327 C CA  . ASN B 115 ? 0.5808 0.3630 0.6603 0.1987  -0.0208 -0.0113 132 ASN B CA  
2328 C C   . ASN B 115 ? 0.6083 0.3421 0.6639 0.1875  -0.0283 0.0038  132 ASN B C   
2329 O O   . ASN B 115 ? 0.6484 0.3344 0.6969 0.1962  -0.0274 0.0027  132 ASN B O   
2330 C CB  . ASN B 115 ? 0.6069 0.3740 0.6818 0.1993  -0.0066 -0.0354 132 ASN B CB  
2331 C CG  . ASN B 115 ? 0.6194 0.3713 0.6706 0.1712  -0.0030 -0.0434 132 ASN B CG  
2332 O OD1 . ASN B 115 ? 0.6033 0.3538 0.6431 0.1515  -0.0091 -0.0314 132 ASN B OD1 
2333 N ND2 . ASN B 115 ? 0.6350 0.3767 0.6787 0.1700  0.0069  -0.0646 132 ASN B ND2 
2334 N N   . GLY B 116 ? 0.5840 0.3290 0.6264 0.1676  -0.0343 0.0173  133 GLY B N   
2335 C CA  . GLY B 116 ? 0.6038 0.3083 0.6229 0.1560  -0.0395 0.0341  133 GLY B CA  
2336 C C   . GLY B 116 ? 0.5862 0.2672 0.5871 0.1289  -0.0315 0.0274  133 GLY B C   
2337 O O   . GLY B 116 ? 0.5876 0.2491 0.5706 0.1135  -0.0333 0.0416  133 GLY B O   
2338 N N   . SER B 117 ? 0.5690 0.2555 0.5744 0.1223  -0.0228 0.0062  134 SER B N   
2339 C CA  . SER B 117 ? 0.5815 0.2517 0.5748 0.0974  -0.0173 -0.0018 134 SER B CA  
2340 C C   . SER B 117 ? 0.5410 0.2481 0.5325 0.0780  -0.0163 -0.0003 134 SER B C   
2341 O O   . SER B 117 ? 0.5103 0.2572 0.5093 0.0828  -0.0189 0.0028  134 SER B O   
2342 C CB  . SER B 117 ? 0.6139 0.2745 0.6095 0.0984  -0.0108 -0.0256 134 SER B CB  
2343 O OG  . SER B 117 ? 0.6403 0.3279 0.6491 0.1185  -0.0083 -0.0352 134 SER B OG  
2344 N N   . PRO B 118 ? 0.5371 0.2310 0.5205 0.0554  -0.0127 -0.0027 135 PRO B N   
2345 C CA  . PRO B 118 ? 0.4875 0.2132 0.4710 0.0379  -0.0108 -0.0018 135 PRO B CA  
2346 C C   . PRO B 118 ? 0.4584 0.2234 0.4516 0.0394  -0.0100 -0.0160 135 PRO B C   
2347 O O   . PRO B 118 ? 0.4300 0.1920 0.4265 0.0446  -0.0084 -0.0314 135 PRO B O   
2348 C CB  . PRO B 118 ? 0.5007 0.2027 0.4803 0.0158  -0.0066 -0.0052 135 PRO B CB  
2349 C CG  . PRO B 118 ? 0.5463 0.1986 0.5175 0.0193  -0.0072 0.0016  135 PRO B CG  
2350 C CD  . PRO B 118 ? 0.5584 0.2035 0.5338 0.0453  -0.0105 -0.0043 135 PRO B CD  
2351 N N   . ILE B 119 ? 0.4337 0.2319 0.4285 0.0346  -0.0109 -0.0111 136 ILE B N   
2352 C CA  . ILE B 119 ? 0.4237 0.2535 0.4256 0.0345  -0.0103 -0.0221 136 ILE B CA  
2353 C C   . ILE B 119 ? 0.4245 0.2533 0.4270 0.0191  -0.0083 -0.0333 136 ILE B C   
2354 O O   . ILE B 119 ? 0.4146 0.2346 0.4160 0.0056  -0.0066 -0.0292 136 ILE B O   
2355 C CB  . ILE B 119 ? 0.3959 0.2565 0.3991 0.0341  -0.0126 -0.0148 136 ILE B CB  
2356 C CG1 . ILE B 119 ? 0.3846 0.2510 0.3824 0.0189  -0.0106 -0.0104 136 ILE B CG1 
2357 C CG2 . ILE B 119 ? 0.4181 0.2805 0.4220 0.0478  -0.0176 -0.0038 136 ILE B CG2 
2358 C CD1 . ILE B 119 ? 0.3566 0.2508 0.3543 0.0176  -0.0121 -0.0090 136 ILE B CD1 
2359 N N   . PRO B 120 ? 0.4328 0.2725 0.4371 0.0209  -0.0086 -0.0466 137 PRO B N   
2360 C CA  . PRO B 120 ? 0.4299 0.2729 0.4355 0.0069  -0.0100 -0.0557 137 PRO B CA  
2361 C C   . PRO B 120 ? 0.3970 0.2636 0.4092 -0.0033 -0.0102 -0.0504 137 PRO B C   
2362 O O   . PRO B 120 ? 0.3781 0.2655 0.3911 0.0015  -0.0101 -0.0446 137 PRO B O   
2363 C CB  . PRO B 120 ? 0.4324 0.2845 0.4335 0.0129  -0.0113 -0.0684 137 PRO B CB  
2364 C CG  . PRO B 120 ? 0.4142 0.2806 0.4158 0.0271  -0.0085 -0.0637 137 PRO B CG  
2365 C CD  . PRO B 120 ? 0.4232 0.2721 0.4273 0.0346  -0.0074 -0.0541 137 PRO B CD  
2366 N N   . ALA B 121 ? 0.4095 0.2739 0.4283 -0.0175 -0.0104 -0.0535 138 ALA B N   
2367 C CA  . ALA B 121 ? 0.3911 0.2781 0.4198 -0.0263 -0.0086 -0.0497 138 ALA B CA  
2368 C C   . ALA B 121 ? 0.3883 0.2885 0.4296 -0.0366 -0.0133 -0.0603 138 ALA B C   
2369 O O   . ALA B 121 ? 0.3906 0.2760 0.4346 -0.0460 -0.0156 -0.0669 138 ALA B O   
2370 C CB  . ALA B 121 ? 0.4112 0.2873 0.4388 -0.0342 -0.0017 -0.0383 138 ALA B CB  
2371 N N   . VAL B 122 ? 0.3657 0.2925 0.4145 -0.0340 -0.0164 -0.0623 139 VAL B N   
2372 C CA  . VAL B 122 ? 0.3620 0.3062 0.4238 -0.0399 -0.0238 -0.0711 139 VAL B CA  
2373 C C   . VAL B 122 ? 0.3279 0.2970 0.4105 -0.0458 -0.0194 -0.0678 139 VAL B C   
2374 O O   . VAL B 122 ? 0.3242 0.3022 0.4055 -0.0396 -0.0135 -0.0616 139 VAL B O   
2375 C CB  . VAL B 122 ? 0.3656 0.3176 0.4176 -0.0297 -0.0319 -0.0757 139 VAL B CB  
2376 C CG1 . VAL B 122 ? 0.3655 0.3390 0.4305 -0.0332 -0.0424 -0.0820 139 VAL B CG1 
2377 C CG2 . VAL B 122 ? 0.3661 0.2966 0.3985 -0.0246 -0.0332 -0.0809 139 VAL B CG2 
2378 N N   . LEU B 123 ? 0.3273 0.3083 0.4297 -0.0582 -0.0219 -0.0731 140 LEU B N   
2379 C CA  . LEU B 123 ? 0.3058 0.3138 0.4330 -0.0649 -0.0156 -0.0714 140 LEU B CA  
2380 C C   . LEU B 123 ? 0.2947 0.3320 0.4384 -0.0569 -0.0252 -0.0770 140 LEU B C   
2381 O O   . LEU B 123 ? 0.3115 0.3526 0.4578 -0.0577 -0.0387 -0.0842 140 LEU B O   
2382 C CB  . LEU B 123 ? 0.3143 0.3219 0.4590 -0.0850 -0.0123 -0.0734 140 LEU B CB  
2383 C CG  . LEU B 123 ? 0.2965 0.3320 0.4685 -0.0961 -0.0002 -0.0702 140 LEU B CG  
2384 C CD1 . LEU B 123 ? 0.3092 0.3353 0.4657 -0.0941 0.0165  -0.0586 140 LEU B CD1 
2385 C CD2 . LEU B 123 ? 0.3090 0.3425 0.4985 -0.1185 -0.0001 -0.0733 140 LEU B CD2 
2386 N N   . LEU B 124 ? 0.2796 0.3345 0.4312 -0.0478 -0.0188 -0.0737 141 LEU B N   
2387 C CA  . LEU B 124 ? 0.2578 0.3381 0.4270 -0.0376 -0.0274 -0.0777 141 LEU B CA  
2388 C C   . LEU B 124 ? 0.2548 0.3685 0.4592 -0.0420 -0.0190 -0.0799 141 LEU B C   
2389 O O   . LEU B 124 ? 0.2247 0.3419 0.4296 -0.0409 -0.0036 -0.0767 141 LEU B O   
2390 C CB  . LEU B 124 ? 0.2425 0.3129 0.3927 -0.0214 -0.0268 -0.0736 141 LEU B CB  
2391 C CG  . LEU B 124 ? 0.2608 0.3039 0.3795 -0.0170 -0.0323 -0.0707 141 LEU B CG  
2392 C CD1 . LEU B 124 ? 0.2561 0.2932 0.3618 -0.0042 -0.0318 -0.0667 141 LEU B CD1 
2393 C CD2 . LEU B 124 ? 0.2638 0.3056 0.3786 -0.0182 -0.0470 -0.0755 141 LEU B CD2 
2394 N N   . ALA B 125 ? 0.2282 0.3679 0.4618 -0.0473 -0.0290 -0.0860 142 ALA B N   
2395 C CA  . ALA B 125 ? 0.2510 0.4312 0.5260 -0.0497 -0.0221 -0.0893 142 ALA B CA  
2396 C C   . ALA B 125 ? 0.2166 0.4135 0.5024 -0.0281 -0.0298 -0.0910 142 ALA B C   
2397 O O   . ALA B 125 ? 0.2465 0.4567 0.5443 -0.0218 -0.0489 -0.0941 142 ALA B O   
2398 C CB  . ALA B 125 ? 0.2340 0.4371 0.5393 -0.0668 -0.0316 -0.0953 142 ALA B CB  
2399 N N   . ASN B 126 ? 0.2127 0.4051 0.4905 -0.0165 -0.0159 -0.0889 143 ASN B N   
2400 C CA  . ASN B 126 ? 0.2495 0.4444 0.5292 0.0056  -0.0229 -0.0899 143 ASN B CA  
2401 C C   . ASN B 126 ? 0.2586 0.4953 0.5835 0.0148  -0.0195 -0.0959 143 ASN B C   
2402 O O   . ASN B 126 ? 0.2409 0.5080 0.5958 0.0036  -0.0061 -0.0993 143 ASN B O   
2403 C CB  . ASN B 126 ? 0.2486 0.4112 0.4927 0.0136  -0.0125 -0.0863 143 ASN B CB  
2404 C CG  . ASN B 126 ? 0.2503 0.4010 0.4863 0.0336  -0.0220 -0.0860 143 ASN B CG  
2405 O OD1 . ASN B 126 ? 0.2172 0.3626 0.4497 0.0398  -0.0402 -0.0833 143 ASN B OD1 
2406 N ND2 . ASN B 126 ? 0.2362 0.3810 0.4677 0.0434  -0.0092 -0.0888 143 ASN B ND2 
2407 N N   . LYS B 127 ? 0.2773 0.5165 0.6090 0.0355  -0.0318 -0.0966 144 LYS B N   
2408 C CA  . LYS B 127 ? 0.2820 0.5589 0.6577 0.0513  -0.0326 -0.1022 144 LYS B CA  
2409 C C   . LYS B 127 ? 0.3024 0.6198 0.7188 0.0456  -0.0496 -0.1047 144 LYS B C   
2410 O O   . LYS B 127 ? 0.2818 0.6462 0.7487 0.0507  -0.0457 -0.1107 144 LYS B O   
2411 C CB  . LYS B 127 ? 0.2686 0.5636 0.6612 0.0525  -0.0052 -0.1083 144 LYS B CB  
2412 C CG  . LYS B 127 ? 0.2683 0.5247 0.6179 0.0544  0.0107  -0.1071 144 LYS B CG  
2413 C CD  . LYS B 127 ? 0.2647 0.5377 0.6293 0.0654  0.0335  -0.1158 144 LYS B CD  
2414 C CE  . LYS B 127 ? 0.2556 0.4892 0.5724 0.0635  0.0473  -0.1154 144 LYS B CE  
2415 N NZ  . LYS B 127 ? 0.2614 0.5106 0.5827 0.0650  0.0743  -0.1238 144 LYS B NZ  
2416 N N   . CYS B 128 ? 0.3137 0.6154 0.7097 0.0363  -0.0696 -0.1011 145 CYS B N   
2417 C CA  . CYS B 128 ? 0.3113 0.6483 0.7400 0.0255  -0.0875 -0.1049 145 CYS B CA  
2418 C C   . CYS B 128 ? 0.3034 0.6775 0.7721 0.0460  -0.1060 -0.1064 145 CYS B C   
2419 O O   . CYS B 128 ? 0.2923 0.7030 0.7940 0.0387  -0.1170 -0.1087 145 CYS B O   
2420 C CB  . CYS B 128 ? 0.3481 0.6558 0.7395 0.0125  -0.1047 -0.1027 145 CYS B CB  
2421 S SG  . CYS B 128 ? 0.3885 0.6631 0.7382 0.0315  -0.1282 -0.0952 145 CYS B SG  
2422 N N   . ASP B 129 ? 0.3125 0.6684 0.7689 0.0710  -0.1089 -0.1021 146 ASP B N   
2423 C CA  . ASP B 129 ? 0.3206 0.7036 0.8106 0.0941  -0.1173 -0.1011 146 ASP B CA  
2424 C C   . ASP B 129 ? 0.2992 0.7197 0.8305 0.0937  -0.0921 -0.1074 146 ASP B C   
2425 O O   . ASP B 129 ? 0.3168 0.7713 0.8821 0.1026  -0.0959 -0.1065 146 ASP B O   
2426 C CB  . ASP B 129 ? 0.3349 0.6788 0.7964 0.1192  -0.1230 -0.0951 146 ASP B CB  
2427 C CG  . ASP B 129 ? 0.3131 0.6274 0.7537 0.1226  -0.0961 -0.0984 146 ASP B CG  
2428 O OD1 . ASP B 129 ? 0.3194 0.5942 0.7136 0.1076  -0.0864 -0.0951 146 ASP B OD1 
2429 O OD2 . ASP B 129 ? 0.2942 0.6201 0.7588 0.1408  -0.0842 -0.1034 146 ASP B OD2 
2430 N N   . SER B 137 ? 0.5774 0.9388 1.1003 -0.2279 -0.0396 -0.1124 154 SER B N   
2431 C CA  . SER B 137 ? 0.5898 0.9453 1.1001 -0.2208 -0.0698 -0.1215 154 SER B CA  
2432 C C   . SER B 137 ? 0.6012 0.8981 1.0583 -0.2130 -0.0779 -0.1261 154 SER B C   
2433 O O   . SER B 137 ? 0.6063 0.8630 1.0372 -0.2164 -0.0612 -0.1220 154 SER B O   
2434 C CB  . SER B 137 ? 0.6266 0.9920 1.1530 -0.2461 -0.0852 -0.1244 154 SER B CB  
2435 O OG  . SER B 137 ? 0.6475 0.9574 1.1393 -0.2660 -0.0855 -0.1258 154 SER B OG  
2436 N N   . PRO B 138 ? 0.6188 0.9107 1.0580 -0.2022 -0.1037 -0.1339 155 PRO B N   
2437 C CA  . PRO B 138 ? 0.6294 0.8695 1.0179 -0.1963 -0.1139 -0.1399 155 PRO B CA  
2438 C C   . PRO B 138 ? 0.6489 0.8359 1.0072 -0.2171 -0.1094 -0.1426 155 PRO B C   
2439 O O   . PRO B 138 ? 0.6479 0.7911 0.9732 -0.2106 -0.0997 -0.1418 155 PRO B O   
2440 C CB  . PRO B 138 ? 0.6507 0.9073 1.0332 -0.1881 -0.1422 -0.1466 155 PRO B CB  
2441 C CG  . PRO B 138 ? 0.6273 0.9404 1.0520 -0.1734 -0.1447 -0.1416 155 PRO B CG  
2442 C CD  . PRO B 138 ? 0.6144 0.9537 1.0795 -0.1870 -0.1221 -0.1356 155 PRO B CD  
2443 N N   . SER B 139 ? 0.6644 0.8537 1.0340 -0.2409 -0.1172 -0.1455 156 SER B N   
2444 C CA  . SER B 139 ? 0.6839 0.8196 1.0264 -0.2607 -0.1135 -0.1475 156 SER B CA  
2445 C C   . SER B 139 ? 0.6733 0.7848 1.0161 -0.2678 -0.0868 -0.1356 156 SER B C   
2446 O O   . SER B 139 ? 0.7129 0.7678 1.0202 -0.2697 -0.0809 -0.1352 156 SER B O   
2447 C CB  . SER B 139 ? 0.7085 0.8526 1.0658 -0.2865 -0.1283 -0.1525 156 SER B CB  
2448 O OG  . SER B 139 ? 0.6882 0.8895 1.0980 -0.2967 -0.1247 -0.1457 156 SER B OG  
2449 N N   . GLN B 140 ? 0.6112 0.7632 0.9898 -0.2688 -0.0699 -0.1256 157 GLN B N   
2450 C CA  . GLN B 140 ? 0.5938 0.7242 0.9671 -0.2745 -0.0432 -0.1125 157 GLN B CA  
2451 C C   . GLN B 140 ? 0.5942 0.6934 0.9346 -0.2530 -0.0343 -0.1106 157 GLN B C   
2452 O O   . GLN B 140 ? 0.6039 0.6554 0.9162 -0.2567 -0.0220 -0.1033 157 GLN B O   
2453 C CB  . GLN B 140 ? 0.5561 0.7393 0.9708 -0.2785 -0.0258 -0.1035 157 GLN B CB  
2454 C CG  . GLN B 140 ? 0.5851 0.7965 1.0345 -0.3032 -0.0298 -0.1020 157 GLN B CG  
2455 C CD  . GLN B 140 ? 0.5797 0.8462 1.0707 -0.3052 -0.0104 -0.0935 157 GLN B CD  
2456 O OE1 . GLN B 140 ? 0.5410 0.8518 1.0532 -0.2842 -0.0096 -0.0965 157 GLN B OE1 
2457 N NE2 . GLN B 140 ? 0.6238 0.8879 1.1273 -0.3298 0.0053  -0.0826 157 GLN B NE2 
2458 N N   . VAL B 141 ? 0.5854 0.7128 0.9313 -0.2306 -0.0411 -0.1159 158 VAL B N   
2459 C CA  . VAL B 141 ? 0.5791 0.6795 0.8902 -0.2067 -0.0359 -0.1117 158 VAL B CA  
2460 C C   . VAL B 141 ? 0.6092 0.6546 0.8772 -0.2027 -0.0461 -0.1173 158 VAL B C   
2461 O O   . VAL B 141 ? 0.6104 0.6170 0.8457 -0.1927 -0.0352 -0.1083 158 VAL B O   
2462 C CB  . VAL B 141 ? 0.5287 0.6659 0.8472 -0.1803 -0.0411 -0.1116 158 VAL B CB  
2463 C CG1 . VAL B 141 ? 0.4965 0.6799 0.8522 -0.1804 -0.0246 -0.1054 158 VAL B CG1 
2464 C CG2 . VAL B 141 ? 0.5218 0.6820 0.8516 -0.1753 -0.0665 -0.1240 158 VAL B CG2 
2465 N N   . ASP B 142 ? 0.6584 0.7015 0.9257 -0.2094 -0.0667 -0.1322 159 ASP B N   
2466 C CA  . ASP B 142 ? 0.7264 0.7161 0.9517 -0.2066 -0.0745 -0.1398 159 ASP B CA  
2467 C C   . ASP B 142 ? 0.7475 0.6882 0.9578 -0.2202 -0.0599 -0.1322 159 ASP B C   
2468 O O   . ASP B 142 ? 0.7569 0.6561 0.9372 -0.2079 -0.0527 -0.1291 159 ASP B O   
2469 C CB  . ASP B 142 ? 0.8011 0.7925 1.0175 -0.2135 -0.0966 -0.1528 159 ASP B CB  
2470 C CG  . ASP B 142 ? 0.8151 0.8467 1.0365 -0.1981 -0.1141 -0.1586 159 ASP B CG  
2471 O OD1 . ASP B 142 ? 0.8022 0.8419 1.0166 -0.1766 -0.1126 -0.1562 159 ASP B OD1 
2472 O OD2 . ASP B 142 ? 0.8666 0.9208 1.0980 -0.2082 -0.1309 -0.1648 159 ASP B OD2 
2473 N N   . GLN B 143 ? 0.7496 0.6966 0.9807 -0.2435 -0.0561 -0.1269 160 GLN B N   
2474 C CA  . GLN B 143 ? 0.7653 0.6654 0.9832 -0.2578 -0.0438 -0.1166 160 GLN B CA  
2475 C C   . GLN B 143 ? 0.7033 0.5873 0.9111 -0.2488 -0.0222 -0.1011 160 GLN B C   
2476 O O   . GLN B 143 ? 0.7062 0.5381 0.8838 -0.2432 -0.0167 -0.0953 160 GLN B O   
2477 C CB  . GLN B 143 ? 0.8145 0.7343 1.0630 -0.2854 -0.0428 -0.1113 160 GLN B CB  
2478 C CG  . GLN B 143 ? 0.8974 0.7605 1.1291 -0.3020 -0.0402 -0.1052 160 GLN B CG  
2479 C CD  . GLN B 143 ? 0.9521 0.7615 1.1462 -0.2925 -0.0547 -0.1185 160 GLN B CD  
2480 O OE1 . GLN B 143 ? 0.9667 0.7871 1.1563 -0.2909 -0.0728 -0.1347 160 GLN B OE1 
2481 N NE2 . GLN B 143 ? 0.9830 0.7357 1.1483 -0.2835 -0.0464 -0.1114 160 GLN B NE2 
2482 N N   . PHE B 144 ? 0.6407 0.5702 0.8732 -0.2467 -0.0105 -0.0941 161 PHE B N   
2483 C CA  . PHE B 144 ? 0.6092 0.5304 0.8217 -0.2309 0.0065  -0.0765 161 PHE B CA  
2484 C C   . PHE B 144 ? 0.6031 0.4885 0.7748 -0.2027 0.0012  -0.0755 161 PHE B C   
2485 O O   . PHE B 144 ? 0.6323 0.4805 0.7788 -0.1976 0.0103  -0.0627 161 PHE B O   
2486 C CB  . PHE B 144 ? 0.5538 0.5341 0.7930 -0.2241 0.0143  -0.0731 161 PHE B CB  
2487 C CG  . PHE B 144 ? 0.5165 0.4939 0.7349 -0.2087 0.0306  -0.0577 161 PHE B CG  
2488 C CD1 . PHE B 144 ? 0.5263 0.5021 0.7454 -0.2235 0.0509  -0.0430 161 PHE B CD1 
2489 C CD2 . PHE B 144 ? 0.4579 0.4349 0.6544 -0.1807 0.0254  -0.0579 161 PHE B CD2 
2490 C CE1 . PHE B 144 ? 0.5052 0.4781 0.7002 -0.2093 0.0644  -0.0299 161 PHE B CE1 
2491 C CE2 . PHE B 144 ? 0.4579 0.4318 0.6340 -0.1677 0.0379  -0.0455 161 PHE B CE2 
2492 C CZ  . PHE B 144 ? 0.4834 0.4562 0.6579 -0.1815 0.0568  -0.0321 161 PHE B CZ  
2493 N N   . CYS B 145 ? 0.5823 0.4801 0.7486 -0.1855 -0.0135 -0.0880 162 CYS B N   
2494 C CA  . CYS B 145 ? 0.5941 0.4641 0.7263 -0.1606 -0.0168 -0.0877 162 CYS B CA  
2495 C C   . CYS B 145 ? 0.6455 0.4585 0.7529 -0.1618 -0.0174 -0.0894 162 CYS B C   
2496 O O   . CYS B 145 ? 0.6470 0.4320 0.7319 -0.1467 -0.0111 -0.0793 162 CYS B O   
2497 C CB  . CYS B 145 ? 0.5873 0.4776 0.7162 -0.1463 -0.0319 -0.1014 162 CYS B CB  
2498 S SG  . CYS B 145 ? 0.5657 0.5126 0.7163 -0.1356 -0.0317 -0.0973 162 CYS B SG  
2499 N N   . LYS B 146 ? 0.6956 0.4909 0.8087 -0.1798 -0.0257 -0.1027 163 LYS B N   
2500 C CA  . LYS B 146 ? 0.7567 0.4917 0.8471 -0.1821 -0.0258 -0.1061 163 LYS B CA  
2501 C C   . LYS B 146 ? 0.7692 0.4742 0.8546 -0.1889 -0.0114 -0.0858 163 LYS B C   
2502 O O   . LYS B 146 ? 0.7839 0.4454 0.8448 -0.1744 -0.0083 -0.0792 163 LYS B O   
2503 C CB  . LYS B 146 ? 0.8196 0.5400 0.9123 -0.2007 -0.0387 -0.1219 163 LYS B CB  
2504 C CG  . LYS B 146 ? 0.8502 0.5770 0.9271 -0.1889 -0.0536 -0.1417 163 LYS B CG  
2505 C CD  . LYS B 146 ? 0.8383 0.6249 0.9401 -0.1936 -0.0631 -0.1474 163 LYS B CD  
2506 C CE  . LYS B 146 ? 0.8348 0.6383 0.9208 -0.1733 -0.0731 -0.1591 163 LYS B CE  
2507 N NZ  . LYS B 146 ? 0.7917 0.6536 0.9050 -0.1713 -0.0786 -0.1561 163 LYS B NZ  
2508 N N   . GLU B 147 ? 0.7480 0.4772 0.8554 -0.2090 -0.0023 -0.0749 164 GLU B N   
2509 C CA  . GLU B 147 ? 0.7686 0.4686 0.8670 -0.2183 0.0124  -0.0536 164 GLU B CA  
2510 C C   . GLU B 147 ? 0.7258 0.4270 0.8035 -0.1953 0.0210  -0.0352 164 GLU B C   
2511 O O   . GLU B 147 ? 0.7578 0.4215 0.8166 -0.1967 0.0293  -0.0174 164 GLU B O   
2512 C CB  . GLU B 147 ? 0.7862 0.5183 0.9134 -0.2459 0.0214  -0.0466 164 GLU B CB  
2513 C CG  . GLU B 147 ? 0.8133 0.5452 0.9583 -0.2654 0.0091  -0.0566 164 GLU B CG  
2514 C CD  . GLU B 147 ? 0.8260 0.6023 1.0056 -0.2897 0.0169  -0.0500 164 GLU B CD  
2515 O OE1 . GLU B 147 ? 0.8131 0.6139 0.9986 -0.2914 0.0346  -0.0358 164 GLU B OE1 
2516 O OE2 . GLU B 147 ? 0.8593 0.6459 1.0596 -0.3069 0.0054  -0.0591 164 GLU B OE2 
2517 N N   . HIS B 148 ? 0.6616 0.4050 0.7424 -0.1761 0.0185  -0.0387 165 HIS B N   
2518 C CA  . HIS B 148 ? 0.6447 0.3963 0.7096 -0.1593 0.0263  -0.0227 165 HIS B CA  
2519 C C   . HIS B 148 ? 0.6057 0.3546 0.6534 -0.1300 0.0178  -0.0269 165 HIS B C   
2520 O O   . HIS B 148 ? 0.5935 0.3586 0.6317 -0.1155 0.0211  -0.0175 165 HIS B O   
2521 C CB  . HIS B 148 ? 0.6484 0.4519 0.7324 -0.1659 0.0355  -0.0193 165 HIS B CB  
2522 C CG  . HIS B 148 ? 0.7111 0.5191 0.8112 -0.1942 0.0481  -0.0117 165 HIS B CG  
2523 N ND1 . HIS B 148 ? 0.7566 0.5343 0.8376 -0.2043 0.0608  0.0081  165 HIS B ND1 
2524 C CD2 . HIS B 148 ? 0.7188 0.5583 0.8531 -0.2158 0.0499  -0.0206 165 HIS B CD2 
2525 C CE1 . HIS B 148 ? 0.7775 0.5672 0.8793 -0.2322 0.0721  0.0114  165 HIS B CE1 
2526 N NE2 . HIS B 148 ? 0.7526 0.5821 0.8898 -0.2398 0.0656  -0.0065 165 HIS B NE2 
2527 N N   . GLY B 149 ? 0.5913 0.3212 0.6351 -0.1225 0.0075  -0.0419 166 GLY B N   
2528 C CA  . GLY B 149 ? 0.5580 0.2818 0.5860 -0.0962 0.0021  -0.0452 166 GLY B CA  
2529 C C   . GLY B 149 ? 0.5042 0.2724 0.5381 -0.0836 -0.0016 -0.0515 166 GLY B C   
2530 O O   . GLY B 149 ? 0.4761 0.2491 0.4996 -0.0647 -0.0017 -0.0464 166 GLY B O   
2531 N N   . PHE B 150 ? 0.4734 0.2733 0.5251 -0.0944 -0.0055 -0.0618 167 PHE B N   
2532 C CA  . PHE B 150 ? 0.4429 0.2783 0.4991 -0.0833 -0.0114 -0.0692 167 PHE B CA  
2533 C C   . PHE B 150 ? 0.4478 0.2744 0.4957 -0.0784 -0.0214 -0.0854 167 PHE B C   
2534 O O   . PHE B 150 ? 0.4669 0.2772 0.5172 -0.0914 -0.0263 -0.0958 167 PHE B O   
2535 C CB  . PHE B 150 ? 0.4196 0.2950 0.5001 -0.0949 -0.0113 -0.0705 167 PHE B CB  
2536 C CG  . PHE B 150 ? 0.4074 0.2981 0.4921 -0.0954 0.0004  -0.0566 167 PHE B CG  
2537 C CD1 . PHE B 150 ? 0.3941 0.3035 0.4729 -0.0800 0.0017  -0.0525 167 PHE B CD1 
2538 C CD2 . PHE B 150 ? 0.4235 0.3061 0.5140 -0.1120 0.0108  -0.0475 167 PHE B CD2 
2539 C CE1 . PHE B 150 ? 0.3975 0.3195 0.4760 -0.0803 0.0124  -0.0420 167 PHE B CE1 
2540 C CE2 . PHE B 150 ? 0.4163 0.3113 0.5042 -0.1120 0.0229  -0.0350 167 PHE B CE2 
2541 C CZ  . PHE B 150 ? 0.4042 0.3198 0.4862 -0.0961 0.0235  -0.0335 167 PHE B CZ  
2542 N N   . ALA B 151 ? 0.4564 0.2934 0.4929 -0.0606 -0.0239 -0.0877 168 ALA B N   
2543 C CA  . ALA B 151 ? 0.4702 0.3006 0.4931 -0.0544 -0.0314 -0.1029 168 ALA B CA  
2544 C C   . ALA B 151 ? 0.4431 0.2978 0.4749 -0.0649 -0.0426 -0.1135 168 ALA B C   
2545 O O   . ALA B 151 ? 0.4644 0.3084 0.4840 -0.0671 -0.0506 -0.1279 168 ALA B O   
2546 C CB  . ALA B 151 ? 0.4605 0.2981 0.4698 -0.0348 -0.0288 -0.1004 168 ALA B CB  
2547 N N   . GLY B 152 ? 0.4121 0.2991 0.4645 -0.0703 -0.0435 -0.1067 169 GLY B N   
2548 C CA  . GLY B 152 ? 0.4151 0.3311 0.4827 -0.0785 -0.0555 -0.1144 169 GLY B CA  
2549 C C   . GLY B 152 ? 0.3902 0.3416 0.4835 -0.0793 -0.0525 -0.1052 169 GLY B C   
2550 O O   . GLY B 152 ? 0.3691 0.3198 0.4649 -0.0758 -0.0402 -0.0938 169 GLY B O   
2551 N N   . TRP B 153 ? 0.3927 0.3747 0.5042 -0.0829 -0.0642 -0.1106 170 TRP B N   
2552 C CA  . TRP B 153 ? 0.3791 0.3962 0.5169 -0.0801 -0.0619 -0.1043 170 TRP B CA  
2553 C C   . TRP B 153 ? 0.3600 0.4056 0.5074 -0.0732 -0.0784 -0.1089 170 TRP B C   
2554 O O   . TRP B 153 ? 0.3822 0.4284 0.5245 -0.0780 -0.0935 -0.1182 170 TRP B O   
2555 C CB  . TRP B 153 ? 0.4034 0.4359 0.5722 -0.0972 -0.0544 -0.1031 170 TRP B CB  
2556 C CG  . TRP B 153 ? 0.4396 0.4883 0.6300 -0.1134 -0.0682 -0.1143 170 TRP B CG  
2557 C CD1 . TRP B 153 ? 0.4779 0.5016 0.6577 -0.1272 -0.0755 -0.1240 170 TRP B CD1 
2558 C CD2 . TRP B 153 ? 0.4500 0.5436 0.6757 -0.1158 -0.0788 -0.1184 170 TRP B CD2 
2559 N NE1 . TRP B 153 ? 0.4946 0.5455 0.7014 -0.1420 -0.0903 -0.1342 170 TRP B NE1 
2560 C CE2 . TRP B 153 ? 0.4744 0.5710 0.7112 -0.1343 -0.0933 -0.1303 170 TRP B CE2 
2561 C CE3 . TRP B 153 ? 0.4288 0.5605 0.6799 -0.1037 -0.0777 -0.1138 170 TRP B CE3 
2562 C CZ2 . TRP B 153 ? 0.4829 0.6239 0.7569 -0.1411 -0.1085 -0.1369 170 TRP B CZ2 
2563 C CZ3 . TRP B 153 ? 0.4280 0.6012 0.7160 -0.1077 -0.0907 -0.1197 170 TRP B CZ3 
2564 C CH2 . TRP B 153 ? 0.4579 0.6392 0.7596 -0.1269 -0.1069 -0.1308 170 TRP B CH2 
2565 N N   . PHE B 154 ? 0.3413 0.4088 0.5011 -0.0612 -0.0757 -0.1021 171 PHE B N   
2566 C CA  . PHE B 154 ? 0.3388 0.4302 0.5071 -0.0505 -0.0909 -0.1030 171 PHE B CA  
2567 C C   . PHE B 154 ? 0.3291 0.4537 0.5342 -0.0464 -0.0849 -0.0996 171 PHE B C   
2568 O O   . PHE B 154 ? 0.2864 0.4079 0.4939 -0.0441 -0.0674 -0.0939 171 PHE B O   
2569 C CB  . PHE B 154 ? 0.3442 0.4184 0.4817 -0.0335 -0.0912 -0.0963 171 PHE B CB  
2570 C CG  . PHE B 154 ? 0.3771 0.4222 0.4776 -0.0337 -0.0939 -0.0992 171 PHE B CG  
2571 C CD1 . PHE B 154 ? 0.3901 0.4092 0.4737 -0.0362 -0.0803 -0.0982 171 PHE B CD1 
2572 C CD2 . PHE B 154 ? 0.3967 0.4418 0.4786 -0.0303 -0.1103 -0.1030 171 PHE B CD2 
2573 C CE1 . PHE B 154 ? 0.4133 0.4089 0.4669 -0.0349 -0.0813 -0.1027 171 PHE B CE1 
2574 C CE2 . PHE B 154 ? 0.4200 0.4403 0.4662 -0.0301 -0.1104 -0.1071 171 PHE B CE2 
2575 C CZ  . PHE B 154 ? 0.4344 0.4311 0.4687 -0.0321 -0.0952 -0.1080 171 PHE B CZ  
2576 N N   . GLU B 155 ? 0.3475 0.5044 0.5795 -0.0435 -0.1002 -0.1033 172 GLU B N   
2577 C CA  . GLU B 155 ? 0.3571 0.5461 0.6222 -0.0321 -0.0974 -0.1007 172 GLU B CA  
2578 C C   . GLU B 155 ? 0.3518 0.5266 0.5945 -0.0112 -0.1023 -0.0941 172 GLU B C   
2579 O O   . GLU B 155 ? 0.3763 0.5390 0.5955 -0.0062 -0.1189 -0.0931 172 GLU B O   
2580 C CB  . GLU B 155 ? 0.3934 0.6237 0.6976 -0.0344 -0.1155 -0.1067 172 GLU B CB  
2581 C CG  . GLU B 155 ? 0.4316 0.6810 0.7641 -0.0582 -0.1139 -0.1142 172 GLU B CG  
2582 C CD  . GLU B 155 ? 0.4747 0.7778 0.8596 -0.0593 -0.1285 -0.1196 172 GLU B CD  
2583 O OE1 . GLU B 155 ? 0.4934 0.8132 0.8847 -0.0405 -0.1471 -0.1180 172 GLU B OE1 
2584 O OE2 . GLU B 155 ? 0.4948 0.8240 0.9157 -0.0791 -0.1217 -0.1246 172 GLU B OE2 
2585 N N   . THR B 156 ? 0.3181 0.4930 0.5662 -0.0002 -0.0878 -0.0899 173 THR B N   
2586 C CA  . THR B 156 ? 0.2853 0.4417 0.5122 0.0182  -0.0905 -0.0835 173 THR B CA  
2587 C C   . THR B 156 ? 0.2678 0.4456 0.5240 0.0343  -0.0883 -0.0837 173 THR B C   
2588 O O   . THR B 156 ? 0.2646 0.4681 0.5524 0.0315  -0.0755 -0.0884 173 THR B O   
2589 C CB  . THR B 156 ? 0.2628 0.3852 0.4561 0.0175  -0.0748 -0.0788 173 THR B CB  
2590 O OG1 . THR B 156 ? 0.2551 0.3838 0.4606 0.0124  -0.0551 -0.0804 173 THR B OG1 
2591 C CG2 . THR B 156 ? 0.2605 0.3605 0.4252 0.0062  -0.0765 -0.0785 173 THR B CG2 
2592 N N   . SER B 157 ? 0.2674 0.4316 0.5107 0.0512  -0.0995 -0.0782 174 SER B N   
2593 C CA  . SER B 157 ? 0.2509 0.4203 0.5115 0.0694  -0.0949 -0.0780 174 SER B CA  
2594 C C   . SER B 157 ? 0.2696 0.3976 0.4927 0.0780  -0.0928 -0.0710 174 SER B C   
2595 O O   . SER B 157 ? 0.2848 0.3938 0.4853 0.0835  -0.1082 -0.0632 174 SER B O   
2596 C CB  . SER B 157 ? 0.2568 0.4556 0.5507 0.0844  -0.1142 -0.0782 174 SER B CB  
2597 O OG  . SER B 157 ? 0.2691 0.4673 0.5783 0.1063  -0.1113 -0.0779 174 SER B OG  
2598 N N   . ALA B 158 ? 0.2667 0.3821 0.4842 0.0793  -0.0743 -0.0738 175 ALA B N   
2599 C CA  . ALA B 158 ? 0.2937 0.3735 0.4840 0.0884  -0.0734 -0.0689 175 ALA B CA  
2600 C C   . ALA B 158 ? 0.3040 0.3811 0.5087 0.1102  -0.0842 -0.0671 175 ALA B C   
2601 O O   . ALA B 158 ? 0.3179 0.3624 0.4978 0.1169  -0.0926 -0.0589 175 ALA B O   
2602 C CB  . ALA B 158 ? 0.2933 0.3598 0.4715 0.0829  -0.0532 -0.0737 175 ALA B CB  
2603 N N   . LYS B 159 ? 0.3142 0.4261 0.5606 0.1212  -0.0845 -0.0739 176 LYS B N   
2604 C CA  . LYS B 159 ? 0.3223 0.4362 0.5895 0.1453  -0.0953 -0.0729 176 LYS B CA  
2605 C C   . LYS B 159 ? 0.3626 0.4684 0.6194 0.1520  -0.1217 -0.0608 176 LYS B C   
2606 O O   . LYS B 159 ? 0.3676 0.4389 0.6042 0.1652  -0.1312 -0.0519 176 LYS B O   
2607 C CB  . LYS B 159 ? 0.3197 0.4830 0.6403 0.1543  -0.0890 -0.0835 176 LYS B CB  
2608 C CG  . LYS B 159 ? 0.3406 0.5091 0.6893 0.1831  -0.0971 -0.0848 176 LYS B CG  
2609 C CD  . LYS B 159 ? 0.3575 0.5779 0.7585 0.1899  -0.0865 -0.0952 176 LYS B CD  
2610 C CE  . LYS B 159 ? 0.3929 0.6134 0.8091 0.2135  -0.0949 -0.0901 176 LYS B CE  
2611 N NZ  . LYS B 159 ? 0.4060 0.6716 0.8658 0.2191  -0.0774 -0.0996 176 LYS B NZ  
2612 N N   . ASP B 160 ? 0.3708 0.5056 0.6381 0.1416  -0.1339 -0.0602 177 ASP B N   
2613 C CA  . ASP B 160 ? 0.4152 0.5480 0.6701 0.1456  -0.1605 -0.0499 177 ASP B CA  
2614 C C   . ASP B 160 ? 0.4105 0.5145 0.6158 0.1282  -0.1643 -0.0425 177 ASP B C   
2615 O O   . ASP B 160 ? 0.4493 0.5535 0.6387 0.1277  -0.1846 -0.0355 177 ASP B O   
2616 C CB  . ASP B 160 ? 0.4256 0.6103 0.7232 0.1449  -0.1743 -0.0558 177 ASP B CB  
2617 C CG  . ASP B 160 ? 0.4375 0.6541 0.7857 0.1660  -0.1743 -0.0605 177 ASP B CG  
2618 O OD1 . ASP B 160 ? 0.4754 0.6643 0.8154 0.1851  -0.1715 -0.0553 177 ASP B OD1 
2619 O OD2 . ASP B 160 ? 0.4552 0.7183 0.8425 0.1594  -0.1731 -0.0671 177 ASP B OD2 
2620 N N   . ASN B 161 ? 0.3812 0.4614 0.5614 0.1150  -0.1450 -0.0442 178 ASN B N   
2621 C CA  . ASN B 161 ? 0.3890 0.4461 0.5272 0.0996  -0.1448 -0.0389 178 ASN B CA  
2622 C C   . ASN B 161 ? 0.3826 0.4598 0.5178 0.0869  -0.1560 -0.0424 178 ASN B C   
2623 O O   . ASN B 161 ? 0.4034 0.4692 0.5096 0.0856  -0.1706 -0.0356 178 ASN B O   
2624 C CB  . ASN B 161 ? 0.4315 0.4518 0.5337 0.1066  -0.1535 -0.0248 178 ASN B CB  
2625 C CG  . ASN B 161 ? 0.4459 0.4422 0.5077 0.0905  -0.1445 -0.0207 178 ASN B CG  
2626 O OD1 . ASN B 161 ? 0.4374 0.4382 0.5004 0.0785  -0.1294 -0.0282 178 ASN B OD1 
2627 N ND2 . ASN B 161 ? 0.4897 0.4617 0.5175 0.0910  -0.1528 -0.0083 178 ASN B ND2 
2628 N N   . ILE B 162 ? 0.3598 0.4648 0.5227 0.0766  -0.1488 -0.0535 179 ILE B N   
2629 C CA  . ILE B 162 ? 0.3376 0.4620 0.5034 0.0639  -0.1606 -0.0594 179 ILE B CA  
2630 C C   . ILE B 162 ? 0.3266 0.4360 0.4730 0.0463  -0.1440 -0.0646 179 ILE B C   
2631 O O   . ILE B 162 ? 0.3161 0.4270 0.4762 0.0418  -0.1254 -0.0681 179 ILE B O   
2632 C CB  . ILE B 162 ? 0.3051 0.4736 0.5222 0.0631  -0.1651 -0.0682 179 ILE B CB  
2633 C CG1 . ILE B 162 ? 0.3229 0.5109 0.5650 0.0838  -0.1837 -0.0634 179 ILE B CG1 
2634 C CG2 . ILE B 162 ? 0.2914 0.4758 0.5112 0.0441  -0.1740 -0.0768 179 ILE B CG2 
2635 C CD1 . ILE B 162 ? 0.3103 0.5504 0.6093 0.0836  -0.1906 -0.0721 179 ILE B CD1 
2636 N N   . ASN B 163 ? 0.3466 0.4408 0.4595 0.0378  -0.1512 -0.0647 180 ASN B N   
2637 C CA  . ASN B 163 ? 0.3602 0.4390 0.4532 0.0232  -0.1390 -0.0705 180 ASN B CA  
2638 C C   . ASN B 163 ? 0.3779 0.4341 0.4565 0.0225  -0.1179 -0.0667 180 ASN B C   
2639 O O   . ASN B 163 ? 0.3952 0.4420 0.4650 0.0126  -0.1077 -0.0712 180 ASN B O   
2640 C CB  . ASN B 163 ? 0.3499 0.4496 0.4717 0.0096  -0.1377 -0.0816 180 ASN B CB  
2641 C CG  . ASN B 163 ? 0.3551 0.4758 0.4864 0.0047  -0.1602 -0.0882 180 ASN B CG  
2642 O OD1 . ASN B 163 ? 0.3821 0.4969 0.4874 0.0095  -0.1776 -0.0857 180 ASN B OD1 
2643 N ND2 . ASN B 163 ? 0.3420 0.4891 0.5109 -0.0056 -0.1605 -0.0960 180 ASN B ND2 
2644 N N   . ILE B 164 ? 0.3875 0.4346 0.4647 0.0328  -0.1125 -0.0588 181 ILE B N   
2645 C CA  . ILE B 164 ? 0.4073 0.4363 0.4721 0.0307  -0.0954 -0.0560 181 ILE B CA  
2646 C C   . ILE B 164 ? 0.4146 0.4227 0.4440 0.0265  -0.0929 -0.0523 181 ILE B C   
2647 O O   . ILE B 164 ? 0.4014 0.4028 0.4243 0.0197  -0.0813 -0.0550 181 ILE B O   
2648 C CB  . ILE B 164 ? 0.4258 0.4505 0.5006 0.0409  -0.0902 -0.0517 181 ILE B CB  
2649 C CG1 . ILE B 164 ? 0.4121 0.4598 0.5217 0.0415  -0.0833 -0.0589 181 ILE B CG1 
2650 C CG2 . ILE B 164 ? 0.4288 0.4321 0.4838 0.0378  -0.0774 -0.0478 181 ILE B CG2 
2651 C CD1 . ILE B 164 ? 0.4042 0.4551 0.5304 0.0551  -0.0827 -0.0584 181 ILE B CD1 
2652 N N   . GLU B 165 ? 0.4318 0.4323 0.4397 0.0305  -0.1041 -0.0463 182 GLU B N   
2653 C CA  . GLU B 165 ? 0.4801 0.4647 0.4529 0.0263  -0.1009 -0.0430 182 GLU B CA  
2654 C C   . GLU B 165 ? 0.4471 0.4339 0.4115 0.0180  -0.0987 -0.0537 182 GLU B C   
2655 O O   . GLU B 165 ? 0.4343 0.4117 0.3849 0.0144  -0.0861 -0.0552 182 GLU B O   
2656 C CB  . GLU B 165 ? 0.5864 0.5634 0.5351 0.0316  -0.1151 -0.0339 182 GLU B CB  
2657 C CG  . GLU B 165 ? 0.6554 0.6220 0.6077 0.0409  -0.1189 -0.0220 182 GLU B CG  
2658 C CD  . GLU B 165 ? 0.7172 0.6640 0.6537 0.0372  -0.1046 -0.0140 182 GLU B CD  
2659 O OE1 . GLU B 165 ? 0.7713 0.7105 0.6806 0.0304  -0.0983 -0.0110 182 GLU B OE1 
2660 O OE2 . GLU B 165 ? 0.7483 0.6882 0.6998 0.0408  -0.0998 -0.0116 182 GLU B OE2 
2661 N N   . GLU B 166 ? 0.4240 0.4235 0.3983 0.0154  -0.1114 -0.0616 183 GLU B N   
2662 C CA  . GLU B 166 ? 0.4125 0.4111 0.3815 0.0062  -0.1113 -0.0743 183 GLU B CA  
2663 C C   . GLU B 166 ? 0.3787 0.3736 0.3645 0.0012  -0.0955 -0.0787 183 GLU B C   
2664 O O   . GLU B 166 ? 0.3926 0.3739 0.3635 -0.0022 -0.0871 -0.0845 183 GLU B O   
2665 C CB  . GLU B 166 ? 0.4394 0.4559 0.4251 0.0019  -0.1292 -0.0822 183 GLU B CB  
2666 C CG  . GLU B 166 ? 0.4834 0.5027 0.4465 0.0060  -0.1487 -0.0793 183 GLU B CG  
2667 C CD  . GLU B 166 ? 0.4855 0.5131 0.4589 0.0184  -0.1585 -0.0659 183 GLU B CD  
2668 O OE1 . GLU B 166 ? 0.4578 0.4858 0.4513 0.0247  -0.1487 -0.0591 183 GLU B OE1 
2669 O OE2 . GLU B 166 ? 0.5177 0.5497 0.4768 0.0227  -0.1779 -0.0622 183 GLU B OE2 
2670 N N   . ALA B 167 ? 0.3381 0.3442 0.3537 0.0017  -0.0913 -0.0760 184 ALA B N   
2671 C CA  . ALA B 167 ? 0.3079 0.3097 0.3364 -0.0032 -0.0773 -0.0776 184 ALA B CA  
2672 C C   . ALA B 167 ? 0.3253 0.3115 0.3366 0.0004  -0.0647 -0.0726 184 ALA B C   
2673 O O   . ALA B 167 ? 0.3232 0.2982 0.3300 -0.0027 -0.0567 -0.0761 184 ALA B O   
2674 C CB  . ALA B 167 ? 0.2832 0.3009 0.3414 -0.0029 -0.0736 -0.0751 184 ALA B CB  
2675 N N   . ALA B 168 ? 0.3266 0.3117 0.3301 0.0069  -0.0634 -0.0642 185 ALA B N   
2676 C CA  . ALA B 168 ? 0.3193 0.2946 0.3089 0.0088  -0.0531 -0.0595 185 ALA B CA  
2677 C C   . ALA B 168 ? 0.3399 0.3070 0.3080 0.0083  -0.0501 -0.0638 185 ALA B C   
2678 O O   . ALA B 168 ? 0.3554 0.3180 0.3223 0.0092  -0.0402 -0.0645 185 ALA B O   
2679 C CB  . ALA B 168 ? 0.3173 0.2909 0.3014 0.0129  -0.0536 -0.0501 185 ALA B CB  
2680 N N   . ARG B 169 ? 0.3553 0.3213 0.3053 0.0082  -0.0586 -0.0665 186 ARG B N   
2681 C CA  . ARG B 169 ? 0.3623 0.3206 0.2879 0.0082  -0.0544 -0.0723 186 ARG B CA  
2682 C C   . ARG B 169 ? 0.3706 0.3209 0.3009 0.0057  -0.0512 -0.0847 186 ARG B C   
2683 O O   . ARG B 169 ? 0.3878 0.3302 0.3078 0.0089  -0.0407 -0.0893 186 ARG B O   
2684 C CB  . ARG B 169 ? 0.4034 0.3603 0.3022 0.0078  -0.0652 -0.0733 186 ARG B CB  
2685 C CG  . ARG B 169 ? 0.4326 0.3887 0.3133 0.0103  -0.0655 -0.0598 186 ARG B CG  
2686 C CD  . ARG B 169 ? 0.4747 0.4258 0.3186 0.0095  -0.0730 -0.0612 186 ARG B CD  
2687 N NE  . ARG B 169 ? 0.5064 0.4521 0.3258 0.0086  -0.0598 -0.0702 186 ARG B NE  
2688 C CZ  . ARG B 169 ? 0.5064 0.4515 0.3088 0.0090  -0.0448 -0.0637 186 ARG B CZ  
2689 N NH1 . ARG B 169 ? 0.4972 0.4431 0.3003 0.0079  -0.0429 -0.0475 186 ARG B NH1 
2690 N NH2 . ARG B 169 ? 0.5076 0.4508 0.2893 0.0099  -0.0319 -0.0737 186 ARG B NH2 
2691 N N   . PHE B 170 ? 0.3577 0.3101 0.3045 0.0002  -0.0594 -0.0898 187 PHE B N   
2692 C CA  . PHE B 170 ? 0.3882 0.3287 0.3416 -0.0049 -0.0572 -0.1001 187 PHE B CA  
2693 C C   . PHE B 170 ? 0.3826 0.3150 0.3471 -0.0015 -0.0442 -0.0958 187 PHE B C   
2694 O O   . PHE B 170 ? 0.4133 0.3294 0.3707 0.0007  -0.0381 -0.1026 187 PHE B O   
2695 C CB  . PHE B 170 ? 0.4040 0.3529 0.3782 -0.0144 -0.0680 -0.1039 187 PHE B CB  
2696 C CG  . PHE B 170 ? 0.4723 0.4053 0.4521 -0.0233 -0.0668 -0.1142 187 PHE B CG  
2697 C CD1 . PHE B 170 ? 0.4851 0.4104 0.4820 -0.0260 -0.0572 -0.1095 187 PHE B CD1 
2698 C CD2 . PHE B 170 ? 0.5151 0.4385 0.4808 -0.0302 -0.0763 -0.1286 187 PHE B CD2 
2699 C CE1 . PHE B 170 ? 0.5096 0.4146 0.5100 -0.0354 -0.0562 -0.1174 187 PHE B CE1 
2700 C CE2 . PHE B 170 ? 0.5506 0.4546 0.5211 -0.0402 -0.0759 -0.1387 187 PHE B CE2 
2701 C CZ  . PHE B 170 ? 0.5375 0.4311 0.5261 -0.0429 -0.0654 -0.1324 187 PHE B CZ  
2702 N N   . LEU B 171 ? 0.3468 0.2891 0.3265 0.0003  -0.0405 -0.0849 188 LEU B N   
2703 C CA  . LEU B 171 ? 0.3585 0.2945 0.3455 0.0038  -0.0309 -0.0797 188 LEU B CA  
2704 C C   . LEU B 171 ? 0.3690 0.3037 0.3449 0.0127  -0.0230 -0.0785 188 LEU B C   
2705 O O   . LEU B 171 ? 0.3761 0.3009 0.3542 0.0178  -0.0167 -0.0796 188 LEU B O   
2706 C CB  . LEU B 171 ? 0.3344 0.2811 0.3365 0.0026  -0.0295 -0.0700 188 LEU B CB  
2707 C CG  . LEU B 171 ? 0.3407 0.2818 0.3475 0.0057  -0.0220 -0.0632 188 LEU B CG  
2708 C CD1 . LEU B 171 ? 0.3363 0.2594 0.3456 0.0029  -0.0197 -0.0655 188 LEU B CD1 
2709 C CD2 . LEU B 171 ? 0.3425 0.2945 0.3583 0.0034  -0.0215 -0.0561 188 LEU B CD2 
2710 N N   . VAL B 172 ? 0.3754 0.3204 0.3408 0.0145  -0.0232 -0.0755 189 VAL B N   
2711 C CA  . VAL B 172 ? 0.3862 0.3358 0.3432 0.0207  -0.0141 -0.0741 189 VAL B CA  
2712 C C   . VAL B 172 ? 0.4265 0.3652 0.3695 0.0252  -0.0091 -0.0861 189 VAL B C   
2713 O O   . VAL B 172 ? 0.4048 0.3447 0.3509 0.0334  0.0009  -0.0876 189 VAL B O   
2714 C CB  . VAL B 172 ? 0.3819 0.3418 0.3278 0.0187  -0.0147 -0.0673 189 VAL B CB  
2715 C CG1 . VAL B 172 ? 0.3979 0.3653 0.3352 0.0226  -0.0030 -0.0667 189 VAL B CG1 
2716 C CG2 . VAL B 172 ? 0.3560 0.3224 0.3155 0.0156  -0.0183 -0.0570 189 VAL B CG2 
2717 N N   . GLU B 173 ? 0.4743 0.4034 0.4025 0.0206  -0.0165 -0.0956 190 GLU B N   
2718 C CA  . GLU B 173 ? 0.5625 0.4756 0.4748 0.0235  -0.0133 -0.1104 190 GLU B CA  
2719 C C   . GLU B 173 ? 0.5130 0.4095 0.4393 0.0287  -0.0081 -0.1146 190 GLU B C   
2720 O O   . GLU B 173 ? 0.5409 0.4313 0.4625 0.0389  0.0021  -0.1209 190 GLU B O   
2721 C CB  . GLU B 173 ? 0.6812 0.5860 0.5791 0.0147  -0.0263 -0.1203 190 GLU B CB  
2722 C CG  . GLU B 173 ? 0.7943 0.6835 0.6644 0.0165  -0.0242 -0.1373 190 GLU B CG  
2723 C CD  . GLU B 173 ? 0.9187 0.8092 0.7674 0.0072  -0.0401 -0.1438 190 GLU B CD  
2724 O OE1 . GLU B 173 ? 0.9806 0.8630 0.8388 -0.0017 -0.0515 -0.1512 190 GLU B OE1 
2725 O OE2 . GLU B 173 ? 0.9922 0.8928 0.8161 0.0078  -0.0423 -0.1399 190 GLU B OE2 
2726 N N   . LYS B 174 ? 0.4468 0.3371 0.3906 0.0227  -0.0139 -0.1097 191 LYS B N   
2727 C CA  . LYS B 174 ? 0.4723 0.3439 0.4281 0.0272  -0.0096 -0.1090 191 LYS B CA  
2728 C C   . LYS B 174 ? 0.4407 0.3215 0.4074 0.0397  -0.0012 -0.0999 191 LYS B C   
2729 O O   . LYS B 174 ? 0.4564 0.3224 0.4254 0.0503  0.0043  -0.1036 191 LYS B O   
2730 C CB  . LYS B 174 ? 0.4962 0.3622 0.4671 0.0164  -0.0156 -0.1020 191 LYS B CB  
2731 C CG  . LYS B 174 ? 0.5580 0.4199 0.5278 0.0021  -0.0248 -0.1098 191 LYS B CG  
2732 C CD  . LYS B 174 ? 0.6523 0.4832 0.6124 -0.0008 -0.0256 -0.1242 191 LYS B CD  
2733 C CE  . LYS B 174 ? 0.7014 0.5332 0.6515 -0.0125 -0.0364 -0.1377 191 LYS B CE  
2734 N NZ  . LYS B 174 ? 0.7181 0.5705 0.6511 -0.0074 -0.0393 -0.1400 191 LYS B NZ  
2735 N N   . ILE B 175 ? 0.4029 0.3083 0.3773 0.0391  -0.0010 -0.0884 192 ILE B N   
2736 C CA  . ILE B 175 ? 0.3817 0.3014 0.3691 0.0491  0.0050  -0.0800 192 ILE B CA  
2737 C C   . ILE B 175 ? 0.4164 0.3426 0.3993 0.0604  0.0151  -0.0879 192 ILE B C   
2738 O O   . ILE B 175 ? 0.4501 0.3777 0.4458 0.0738  0.0209  -0.0877 192 ILE B O   
2739 C CB  . ILE B 175 ? 0.3371 0.2796 0.3324 0.0433  0.0021  -0.0680 192 ILE B CB  
2740 C CG1 . ILE B 175 ? 0.2916 0.2280 0.2917 0.0345  -0.0052 -0.0617 192 ILE B CG1 
2741 C CG2 . ILE B 175 ? 0.3289 0.2888 0.3391 0.0515  0.0061  -0.0606 192 ILE B CG2 
2742 C CD1 . ILE B 175 ? 0.2774 0.2294 0.2815 0.0282  -0.0085 -0.0535 192 ILE B CD1 
2743 N N   . LEU B 176 ? 0.4541 0.3858 0.4191 0.0563  0.0178  -0.0948 193 LEU B N   
2744 C CA  . LEU B 176 ? 0.5132 0.4534 0.4701 0.0657  0.0305  -0.1031 193 LEU B CA  
2745 C C   . LEU B 176 ? 0.5728 0.4897 0.5243 0.0773  0.0360  -0.1181 193 LEU B C   
2746 O O   . LEU B 176 ? 0.5956 0.5214 0.5547 0.0914  0.0480  -0.1228 193 LEU B O   
2747 C CB  . LEU B 176 ? 0.5254 0.4727 0.4568 0.0577  0.0320  -0.1062 193 LEU B CB  
2748 C CG  . LEU B 176 ? 0.5121 0.4814 0.4474 0.0491  0.0306  -0.0916 193 LEU B CG  
2749 C CD1 . LEU B 176 ? 0.5239 0.4888 0.4293 0.0404  0.0264  -0.0931 193 LEU B CD1 
2750 C CD2 . LEU B 176 ? 0.5012 0.4968 0.4523 0.0541  0.0436  -0.0855 193 LEU B CD2 
2751 N N   . VAL B 177 ? 0.6013 0.4889 0.5418 0.0718  0.0279  -0.1264 194 VAL B N   
2752 C CA  . VAL B 177 ? 0.6553 0.5133 0.5893 0.0821  0.0325  -0.1418 194 VAL B CA  
2753 C C   . VAL B 177 ? 0.6910 0.5430 0.6499 0.0965  0.0352  -0.1346 194 VAL B C   
2754 O O   . VAL B 177 ? 0.7227 0.5672 0.6847 0.1138  0.0451  -0.1440 194 VAL B O   
2755 C CB  . VAL B 177 ? 0.6620 0.4875 0.5779 0.0701  0.0224  -0.1541 194 VAL B CB  
2756 C CG1 . VAL B 177 ? 0.6614 0.4983 0.5538 0.0572  0.0166  -0.1592 194 VAL B CG1 
2757 C CG2 . VAL B 177 ? 0.6347 0.4441 0.5659 0.0603  0.0119  -0.1447 194 VAL B CG2 
2758 N N   . ASN B 178 ? 0.6989 0.5557 0.6744 0.0908  0.0267  -0.1181 195 ASN B N   
2759 C CA  . ASN B 178 ? 0.7447 0.5976 0.7412 0.1034  0.0259  -0.1073 195 ASN B CA  
2760 C C   . ASN B 178 ? 0.8042 0.6915 0.8196 0.1178  0.0336  -0.1025 195 ASN B C   
2761 O O   . ASN B 178 ? 0.8248 0.7091 0.8567 0.1353  0.0357  -0.1004 195 ASN B O   
2762 C CB  . ASN B 178 ? 0.7040 0.5577 0.7083 0.0919  0.0155  -0.0905 195 ASN B CB  
2763 C CG  . ASN B 178 ? 0.7094 0.5319 0.7022 0.0772  0.0090  -0.0931 195 ASN B CG  
2764 O OD1 . ASN B 178 ? 0.7478 0.5426 0.7285 0.0764  0.0101  -0.1072 195 ASN B OD1 
2765 N ND2 . ASN B 178 ? 0.6767 0.5042 0.6737 0.0651  0.0027  -0.0807 195 ASN B ND2 
2766 N N   . HIS B 179 ? 0.8640 0.7840 0.8785 0.1104  0.0375  -0.1004 196 HIS B N   
2767 C CA  . HIS B 179 ? 0.9248 0.8820 0.9613 0.1192  0.0441  -0.0941 196 HIS B CA  
2768 C C   . HIS B 179 ? 0.9502 0.9160 0.9878 0.1345  0.0599  -0.1080 196 HIS B C   
2769 O O   . HIS B 179 ? 0.9577 0.9418 1.0208 0.1513  0.0653  -0.1064 196 HIS B O   
2770 C CB  . HIS B 179 ? 0.9625 0.9490 0.9991 0.1034  0.0423  -0.0845 196 HIS B CB  
2771 C CG  . HIS B 179 ? 1.0037 1.0270 1.0684 0.1079  0.0440  -0.0745 196 HIS B CG  
2772 N ND1 . HIS B 179 ? 1.0259 1.0583 1.1161 0.1252  0.0436  -0.0719 196 HIS B ND1 
2773 C CD2 . HIS B 179 ? 0.9963 1.0492 1.0689 0.0963  0.0442  -0.0661 196 HIS B CD2 
2774 C CE1 . HIS B 179 ? 1.0102 1.0810 1.1246 0.1236  0.0430  -0.0631 196 HIS B CE1 
2775 N NE2 . HIS B 179 ? 0.9903 1.0724 1.0939 0.1049  0.0437  -0.0597 196 HIS B NE2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   18  ?   ?   ?   A . n 
A 1 2   MET 2   19  ?   ?   ?   A . n 
A 1 3   GLU 3   20  20  GLU GLU A . n 
A 1 4   THR 4   21  21  THR THR A . n 
A 1 5   ARG 5   22  22  ARG ARG A . n 
A 1 6   GLU 6   23  23  GLU GLU A . n 
A 1 7   HIS 7   24  24  HIS HIS A . n 
A 1 8   LEU 8   25  25  LEU LEU A . n 
A 1 9   PHE 9   26  26  PHE PHE A . n 
A 1 10  LYS 10  27  27  LYS LYS A . n 
A 1 11  VAL 11  28  28  VAL VAL A . n 
A 1 12  LEU 12  29  29  LEU LEU A . n 
A 1 13  VAL 13  30  30  VAL VAL A . n 
A 1 14  ILE 14  31  31  ILE ILE A . n 
A 1 15  GLY 15  32  32  GLY GLY A . n 
A 1 16  GLU 16  33  33  GLU GLU A . n 
A 1 17  LEU 17  34  34  LEU LEU A . n 
A 1 18  GLY 18  35  35  GLY GLY A . n 
A 1 19  VAL 19  36  36  VAL VAL A . n 
A 1 20  GLY 20  37  37  GLY GLY A . n 
A 1 21  LYS 21  38  38  LYS LYS A . n 
A 1 22  THR 22  39  39  THR THR A . n 
A 1 23  SER 23  40  40  SER SER A . n 
A 1 24  ILE 24  41  41  ILE ILE A . n 
A 1 25  ILE 25  42  42  ILE ILE A . n 
A 1 26  LYS 26  43  43  LYS LYS A . n 
A 1 27  ARG 27  44  44  ARG ARG A . n 
A 1 28  TYR 28  45  45  TYR TYR A . n 
A 1 29  VAL 29  46  46  VAL VAL A . n 
A 1 30  HIS 30  47  47  HIS HIS A . n 
A 1 31  GLN 31  48  48  GLN GLN A . n 
A 1 32  LEU 32  49  49  LEU LEU A . n 
A 1 33  PHE 33  50  50  PHE PHE A . n 
A 1 34  SER 34  51  51  SER SER A . n 
A 1 35  GLN 35  52  52  GLN GLN A . n 
A 1 36  HIS 36  53  53  HIS HIS A . n 
A 1 37  TYR 37  54  54  TYR TYR A . n 
A 1 38  ARG 38  55  55  ARG ARG A . n 
A 1 39  ALA 39  56  56  ALA ALA A . n 
A 1 40  THR 40  57  57  THR THR A . n 
A 1 41  ILE 41  58  58  ILE ILE A . n 
A 1 42  GLY 42  59  59  GLY GLY A . n 
A 1 43  VAL 43  60  60  VAL VAL A . n 
A 1 44  ASP 44  61  61  ASP ASP A . n 
A 1 45  PHE 45  62  62  PHE PHE A . n 
A 1 46  ALA 46  63  63  ALA ALA A . n 
A 1 47  LEU 47  64  64  LEU LEU A . n 
A 1 48  LYS 48  65  65  LYS LYS A . n 
A 1 49  VAL 49  66  66  VAL VAL A . n 
A 1 50  LEU 50  67  67  LEU LEU A . n 
A 1 51  ASN 51  68  68  ASN ASN A . n 
A 1 52  TRP 52  69  69  TRP TRP A . n 
A 1 53  ASP 53  70  70  ASP ASP A . n 
A 1 54  SER 54  71  71  SER SER A . n 
A 1 55  ARG 55  72  72  ARG ARG A . n 
A 1 56  THR 56  73  73  THR THR A . n 
A 1 57  LEU 57  74  74  LEU LEU A . n 
A 1 58  VAL 58  75  75  VAL VAL A . n 
A 1 59  ARG 59  76  76  ARG ARG A . n 
A 1 60  LEU 60  77  77  LEU LEU A . n 
A 1 61  GLN 61  78  78  GLN GLN A . n 
A 1 62  LEU 62  79  79  LEU LEU A . n 
A 1 63  TRP 63  80  80  TRP TRP A . n 
A 1 64  ASP 64  81  81  ASP ASP A . n 
A 1 65  ILE 65  82  82  ILE ILE A . n 
A 1 66  ALA 66  83  83  ALA ALA A . n 
A 1 67  GLY 67  84  84  GLY GLY A . n 
A 1 68  LEU 68  85  85  LEU LEU A . n 
A 1 69  GLU 69  86  86  GLU GLU A . n 
A 1 70  ARG 70  87  87  ARG ARG A . n 
A 1 71  PHE 71  88  88  PHE PHE A . n 
A 1 72  GLY 72  89  89  GLY GLY A . n 
A 1 73  ASN 73  90  90  ASN ASN A . n 
A 1 74  MET 74  91  91  MET MET A . n 
A 1 75  THR 75  92  92  THR THR A . n 
A 1 76  ARG 76  93  93  ARG ARG A . n 
A 1 77  VAL 77  94  94  VAL VAL A . n 
A 1 78  TYR 78  95  95  TYR TYR A . n 
A 1 79  TYR 79  96  96  TYR TYR A . n 
A 1 80  LYS 80  97  97  LYS LYS A . n 
A 1 81  GLU 81  98  98  GLU GLU A . n 
A 1 82  ALA 82  99  99  ALA ALA A . n 
A 1 83  VAL 83  100 100 VAL VAL A . n 
A 1 84  GLY 84  101 101 GLY GLY A . n 
A 1 85  ALA 85  102 102 ALA ALA A . n 
A 1 86  PHE 86  103 103 PHE PHE A . n 
A 1 87  VAL 87  104 104 VAL VAL A . n 
A 1 88  VAL 88  105 105 VAL VAL A . n 
A 1 89  PHE 89  106 106 PHE PHE A . n 
A 1 90  ASP 90  107 107 ASP ASP A . n 
A 1 91  ILE 91  108 108 ILE ILE A . n 
A 1 92  SER 92  109 109 SER SER A . n 
A 1 93  ARG 93  110 110 ARG ARG A . n 
A 1 94  SER 94  111 111 SER SER A . n 
A 1 95  SER 95  112 112 SER SER A . n 
A 1 96  THR 96  113 113 THR THR A . n 
A 1 97  PHE 97  114 114 PHE PHE A . n 
A 1 98  GLU 98  115 115 GLU GLU A . n 
A 1 99  ALA 99  116 116 ALA ALA A . n 
A 1 100 VAL 100 117 117 VAL VAL A . n 
A 1 101 LEU 101 118 118 LEU LEU A . n 
A 1 102 LYS 102 119 119 LYS LYS A . n 
A 1 103 TRP 103 120 120 TRP TRP A . n 
A 1 104 LYS 104 121 121 LYS LYS A . n 
A 1 105 SER 105 122 122 SER SER A . n 
A 1 106 ASP 106 123 123 ASP ASP A . n 
A 1 107 LEU 107 124 124 LEU LEU A . n 
A 1 108 ASP 108 125 125 ASP ASP A . n 
A 1 109 SER 109 126 126 SER SER A . n 
A 1 110 LYS 110 127 127 LYS LYS A . n 
A 1 111 VAL 111 128 128 VAL VAL A . n 
A 1 112 HIS 112 129 129 HIS HIS A . n 
A 1 113 LEU 113 130 130 LEU LEU A . n 
A 1 114 PRO 114 131 131 PRO PRO A . n 
A 1 115 ASN 115 132 132 ASN ASN A . n 
A 1 116 GLY 116 133 133 GLY GLY A . n 
A 1 117 SER 117 134 134 SER SER A . n 
A 1 118 PRO 118 135 135 PRO PRO A . n 
A 1 119 ILE 119 136 136 ILE ILE A . n 
A 1 120 PRO 120 137 137 PRO PRO A . n 
A 1 121 ALA 121 138 138 ALA ALA A . n 
A 1 122 VAL 122 139 139 VAL VAL A . n 
A 1 123 LEU 123 140 140 LEU LEU A . n 
A 1 124 LEU 124 141 141 LEU LEU A . n 
A 1 125 ALA 125 142 142 ALA ALA A . n 
A 1 126 ASN 126 143 143 ASN ASN A . n 
A 1 127 LYS 127 144 144 LYS LYS A . n 
A 1 128 CYS 128 145 145 CYS CYS A . n 
A 1 129 ASP 129 146 146 ASP ASP A . n 
A 1 130 GLN 130 147 147 GLN GLN A . n 
A 1 131 ASN 131 148 ?   ?   ?   A . n 
A 1 132 LYS 132 149 ?   ?   ?   A . n 
A 1 133 ASP 133 150 ?   ?   ?   A . n 
A 1 134 SER 134 151 ?   ?   ?   A . n 
A 1 135 SER 135 152 152 SER SER A . n 
A 1 136 GLN 136 153 153 GLN GLN A . n 
A 1 137 SER 137 154 154 SER SER A . n 
A 1 138 PRO 138 155 155 PRO PRO A . n 
A 1 139 SER 139 156 156 SER SER A . n 
A 1 140 GLN 140 157 157 GLN GLN A . n 
A 1 141 VAL 141 158 158 VAL VAL A . n 
A 1 142 ASP 142 159 159 ASP ASP A . n 
A 1 143 GLN 143 160 160 GLN GLN A . n 
A 1 144 PHE 144 161 161 PHE PHE A . n 
A 1 145 CYS 145 162 162 CYS CYS A . n 
A 1 146 LYS 146 163 163 LYS LYS A . n 
A 1 147 GLU 147 164 164 GLU GLU A . n 
A 1 148 HIS 148 165 165 HIS HIS A . n 
A 1 149 GLY 149 166 166 GLY GLY A . n 
A 1 150 PHE 150 167 167 PHE PHE A . n 
A 1 151 ALA 151 168 168 ALA ALA A . n 
A 1 152 GLY 152 169 169 GLY GLY A . n 
A 1 153 TRP 153 170 170 TRP TRP A . n 
A 1 154 PHE 154 171 171 PHE PHE A . n 
A 1 155 GLU 155 172 172 GLU GLU A . n 
A 1 156 THR 156 173 173 THR THR A . n 
A 1 157 SER 157 174 174 SER SER A . n 
A 1 158 ALA 158 175 175 ALA ALA A . n 
A 1 159 LYS 159 176 176 LYS LYS A . n 
A 1 160 ASP 160 177 177 ASP ASP A . n 
A 1 161 ASN 161 178 178 ASN ASN A . n 
A 1 162 ILE 162 179 179 ILE ILE A . n 
A 1 163 ASN 163 180 180 ASN ASN A . n 
A 1 164 ILE 164 181 181 ILE ILE A . n 
A 1 165 GLU 165 182 182 GLU GLU A . n 
A 1 166 GLU 166 183 183 GLU GLU A . n 
A 1 167 ALA 167 184 184 ALA ALA A . n 
A 1 168 ALA 168 185 185 ALA ALA A . n 
A 1 169 ARG 169 186 186 ARG ARG A . n 
A 1 170 PHE 170 187 187 PHE PHE A . n 
A 1 171 LEU 171 188 188 LEU LEU A . n 
A 1 172 VAL 172 189 189 VAL VAL A . n 
A 1 173 GLU 173 190 190 GLU GLU A . n 
A 1 174 LYS 174 191 191 LYS LYS A . n 
A 1 175 ILE 175 192 192 ILE ILE A . n 
A 1 176 LEU 176 193 193 LEU LEU A . n 
A 1 177 VAL 177 194 194 VAL VAL A . n 
A 1 178 ASN 178 195 195 ASN ASN A . n 
A 1 179 HIS 179 196 196 HIS HIS A . n 
A 1 180 GLN 180 197 197 GLN GLN A . n 
A 1 181 SER 181 198 198 SER SER A . n 
B 1 1   SER 1   18  ?   ?   ?   B . n 
B 1 2   MET 2   19  ?   ?   ?   B . n 
B 1 3   GLU 3   20  20  GLU GLU B . n 
B 1 4   THR 4   21  21  THR THR B . n 
B 1 5   ARG 5   22  22  ARG ARG B . n 
B 1 6   GLU 6   23  23  GLU GLU B . n 
B 1 7   HIS 7   24  24  HIS HIS B . n 
B 1 8   LEU 8   25  25  LEU LEU B . n 
B 1 9   PHE 9   26  26  PHE PHE B . n 
B 1 10  LYS 10  27  27  LYS LYS B . n 
B 1 11  VAL 11  28  28  VAL VAL B . n 
B 1 12  LEU 12  29  29  LEU LEU B . n 
B 1 13  VAL 13  30  30  VAL VAL B . n 
B 1 14  ILE 14  31  31  ILE ILE B . n 
B 1 15  GLY 15  32  32  GLY GLY B . n 
B 1 16  GLU 16  33  33  GLU GLU B . n 
B 1 17  LEU 17  34  34  LEU LEU B . n 
B 1 18  GLY 18  35  35  GLY GLY B . n 
B 1 19  VAL 19  36  36  VAL VAL B . n 
B 1 20  GLY 20  37  37  GLY GLY B . n 
B 1 21  LYS 21  38  38  LYS LYS B . n 
B 1 22  THR 22  39  39  THR THR B . n 
B 1 23  SER 23  40  40  SER SER B . n 
B 1 24  ILE 24  41  41  ILE ILE B . n 
B 1 25  ILE 25  42  42  ILE ILE B . n 
B 1 26  LYS 26  43  43  LYS LYS B . n 
B 1 27  ARG 27  44  44  ARG ARG B . n 
B 1 28  TYR 28  45  45  TYR TYR B . n 
B 1 29  VAL 29  46  46  VAL VAL B . n 
B 1 30  HIS 30  47  47  HIS HIS B . n 
B 1 31  GLN 31  48  48  GLN GLN B . n 
B 1 32  LEU 32  49  49  LEU LEU B . n 
B 1 33  PHE 33  50  50  PHE PHE B . n 
B 1 34  SER 34  51  51  SER SER B . n 
B 1 35  GLN 35  52  52  GLN GLN B . n 
B 1 36  HIS 36  53  53  HIS HIS B . n 
B 1 37  TYR 37  54  54  TYR TYR B . n 
B 1 38  ARG 38  55  55  ARG ARG B . n 
B 1 39  ALA 39  56  56  ALA ALA B . n 
B 1 40  THR 40  57  57  THR THR B . n 
B 1 41  ILE 41  58  58  ILE ILE B . n 
B 1 42  GLY 42  59  59  GLY GLY B . n 
B 1 43  VAL 43  60  60  VAL VAL B . n 
B 1 44  ASP 44  61  61  ASP ASP B . n 
B 1 45  PHE 45  62  62  PHE PHE B . n 
B 1 46  ALA 46  63  63  ALA ALA B . n 
B 1 47  LEU 47  64  64  LEU LEU B . n 
B 1 48  LYS 48  65  65  LYS LYS B . n 
B 1 49  VAL 49  66  66  VAL VAL B . n 
B 1 50  LEU 50  67  67  LEU LEU B . n 
B 1 51  ASN 51  68  68  ASN ASN B . n 
B 1 52  TRP 52  69  69  TRP TRP B . n 
B 1 53  ASP 53  70  70  ASP ASP B . n 
B 1 54  SER 54  71  71  SER SER B . n 
B 1 55  ARG 55  72  72  ARG ARG B . n 
B 1 56  THR 56  73  73  THR THR B . n 
B 1 57  LEU 57  74  74  LEU LEU B . n 
B 1 58  VAL 58  75  75  VAL VAL B . n 
B 1 59  ARG 59  76  76  ARG ARG B . n 
B 1 60  LEU 60  77  77  LEU LEU B . n 
B 1 61  GLN 61  78  78  GLN GLN B . n 
B 1 62  LEU 62  79  79  LEU LEU B . n 
B 1 63  TRP 63  80  80  TRP TRP B . n 
B 1 64  ASP 64  81  81  ASP ASP B . n 
B 1 65  ILE 65  82  82  ILE ILE B . n 
B 1 66  ALA 66  83  83  ALA ALA B . n 
B 1 67  GLY 67  84  84  GLY GLY B . n 
B 1 68  LEU 68  85  85  LEU LEU B . n 
B 1 69  GLU 69  86  86  GLU GLU B . n 
B 1 70  ARG 70  87  87  ARG ARG B . n 
B 1 71  PHE 71  88  88  PHE PHE B . n 
B 1 72  GLY 72  89  89  GLY GLY B . n 
B 1 73  ASN 73  90  90  ASN ASN B . n 
B 1 74  MET 74  91  91  MET MET B . n 
B 1 75  THR 75  92  92  THR THR B . n 
B 1 76  ARG 76  93  93  ARG ARG B . n 
B 1 77  VAL 77  94  94  VAL VAL B . n 
B 1 78  TYR 78  95  95  TYR TYR B . n 
B 1 79  TYR 79  96  96  TYR TYR B . n 
B 1 80  LYS 80  97  97  LYS LYS B . n 
B 1 81  GLU 81  98  98  GLU GLU B . n 
B 1 82  ALA 82  99  99  ALA ALA B . n 
B 1 83  VAL 83  100 100 VAL VAL B . n 
B 1 84  GLY 84  101 101 GLY GLY B . n 
B 1 85  ALA 85  102 102 ALA ALA B . n 
B 1 86  PHE 86  103 103 PHE PHE B . n 
B 1 87  VAL 87  104 104 VAL VAL B . n 
B 1 88  VAL 88  105 105 VAL VAL B . n 
B 1 89  PHE 89  106 106 PHE PHE B . n 
B 1 90  ASP 90  107 107 ASP ASP B . n 
B 1 91  ILE 91  108 108 ILE ILE B . n 
B 1 92  SER 92  109 109 SER SER B . n 
B 1 93  ARG 93  110 110 ARG ARG B . n 
B 1 94  SER 94  111 111 SER SER B . n 
B 1 95  SER 95  112 112 SER SER B . n 
B 1 96  THR 96  113 113 THR THR B . n 
B 1 97  PHE 97  114 114 PHE PHE B . n 
B 1 98  GLU 98  115 115 GLU GLU B . n 
B 1 99  ALA 99  116 116 ALA ALA B . n 
B 1 100 VAL 100 117 117 VAL VAL B . n 
B 1 101 LEU 101 118 118 LEU LEU B . n 
B 1 102 LYS 102 119 119 LYS LYS B . n 
B 1 103 TRP 103 120 120 TRP TRP B . n 
B 1 104 LYS 104 121 121 LYS LYS B . n 
B 1 105 SER 105 122 122 SER SER B . n 
B 1 106 ASP 106 123 123 ASP ASP B . n 
B 1 107 LEU 107 124 124 LEU LEU B . n 
B 1 108 ASP 108 125 125 ASP ASP B . n 
B 1 109 SER 109 126 126 SER SER B . n 
B 1 110 LYS 110 127 127 LYS LYS B . n 
B 1 111 VAL 111 128 128 VAL VAL B . n 
B 1 112 HIS 112 129 129 HIS HIS B . n 
B 1 113 LEU 113 130 130 LEU LEU B . n 
B 1 114 PRO 114 131 131 PRO PRO B . n 
B 1 115 ASN 115 132 132 ASN ASN B . n 
B 1 116 GLY 116 133 133 GLY GLY B . n 
B 1 117 SER 117 134 134 SER SER B . n 
B 1 118 PRO 118 135 135 PRO PRO B . n 
B 1 119 ILE 119 136 136 ILE ILE B . n 
B 1 120 PRO 120 137 137 PRO PRO B . n 
B 1 121 ALA 121 138 138 ALA ALA B . n 
B 1 122 VAL 122 139 139 VAL VAL B . n 
B 1 123 LEU 123 140 140 LEU LEU B . n 
B 1 124 LEU 124 141 141 LEU LEU B . n 
B 1 125 ALA 125 142 142 ALA ALA B . n 
B 1 126 ASN 126 143 143 ASN ASN B . n 
B 1 127 LYS 127 144 144 LYS LYS B . n 
B 1 128 CYS 128 145 145 CYS CYS B . n 
B 1 129 ASP 129 146 146 ASP ASP B . n 
B 1 130 GLN 130 147 ?   ?   ?   B . n 
B 1 131 ASN 131 148 ?   ?   ?   B . n 
B 1 132 LYS 132 149 ?   ?   ?   B . n 
B 1 133 ASP 133 150 ?   ?   ?   B . n 
B 1 134 SER 134 151 ?   ?   ?   B . n 
B 1 135 SER 135 152 ?   ?   ?   B . n 
B 1 136 GLN 136 153 ?   ?   ?   B . n 
B 1 137 SER 137 154 154 SER SER B . n 
B 1 138 PRO 138 155 155 PRO PRO B . n 
B 1 139 SER 139 156 156 SER SER B . n 
B 1 140 GLN 140 157 157 GLN GLN B . n 
B 1 141 VAL 141 158 158 VAL VAL B . n 
B 1 142 ASP 142 159 159 ASP ASP B . n 
B 1 143 GLN 143 160 160 GLN GLN B . n 
B 1 144 PHE 144 161 161 PHE PHE B . n 
B 1 145 CYS 145 162 162 CYS CYS B . n 
B 1 146 LYS 146 163 163 LYS LYS B . n 
B 1 147 GLU 147 164 164 GLU GLU B . n 
B 1 148 HIS 148 165 165 HIS HIS B . n 
B 1 149 GLY 149 166 166 GLY GLY B . n 
B 1 150 PHE 150 167 167 PHE PHE B . n 
B 1 151 ALA 151 168 168 ALA ALA B . n 
B 1 152 GLY 152 169 169 GLY GLY B . n 
B 1 153 TRP 153 170 170 TRP TRP B . n 
B 1 154 PHE 154 171 171 PHE PHE B . n 
B 1 155 GLU 155 172 172 GLU GLU B . n 
B 1 156 THR 156 173 173 THR THR B . n 
B 1 157 SER 157 174 174 SER SER B . n 
B 1 158 ALA 158 175 175 ALA ALA B . n 
B 1 159 LYS 159 176 176 LYS LYS B . n 
B 1 160 ASP 160 177 177 ASP ASP B . n 
B 1 161 ASN 161 178 178 ASN ASN B . n 
B 1 162 ILE 162 179 179 ILE ILE B . n 
B 1 163 ASN 163 180 180 ASN ASN B . n 
B 1 164 ILE 164 181 181 ILE ILE B . n 
B 1 165 GLU 165 182 182 GLU GLU B . n 
B 1 166 GLU 166 183 183 GLU GLU B . n 
B 1 167 ALA 167 184 184 ALA ALA B . n 
B 1 168 ALA 168 185 185 ALA ALA B . n 
B 1 169 ARG 169 186 186 ARG ARG B . n 
B 1 170 PHE 170 187 187 PHE PHE B . n 
B 1 171 LEU 171 188 188 LEU LEU B . n 
B 1 172 VAL 172 189 189 VAL VAL B . n 
B 1 173 GLU 173 190 190 GLU GLU B . n 
B 1 174 LYS 174 191 191 LYS LYS B . n 
B 1 175 ILE 175 192 192 ILE ILE B . n 
B 1 176 LEU 176 193 193 LEU LEU B . n 
B 1 177 VAL 177 194 194 VAL VAL B . n 
B 1 178 ASN 178 195 195 ASN ASN B . n 
B 1 179 HIS 179 196 196 HIS HIS B . n 
B 1 180 GLN 180 197 ?   ?   ?   B . n 
B 1 181 SER 181 198 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 GTP 1  900  900 GTP GTP A . 
D 3 MG  1  901  901 MG  MG  A . 
E 2 GTP 1  900  900 GTP GTP B . 
F 3 MG  1  901  901 MG  MG  B . 
G 4 HOH 1  1001 90  HOH HOH A . 
G 4 HOH 2  1002 86  HOH HOH A . 
G 4 HOH 3  1003 89  HOH HOH A . 
G 4 HOH 4  1004 21  HOH HOH A . 
G 4 HOH 5  1005 96  HOH HOH A . 
G 4 HOH 6  1006 6   HOH HOH A . 
G 4 HOH 7  1007 64  HOH HOH A . 
G 4 HOH 8  1008 57  HOH HOH A . 
G 4 HOH 9  1009 5   HOH HOH A . 
G 4 HOH 10 1010 7   HOH HOH A . 
G 4 HOH 11 1011 25  HOH HOH A . 
G 4 HOH 12 1012 29  HOH HOH A . 
G 4 HOH 13 1013 11  HOH HOH A . 
G 4 HOH 14 1014 37  HOH HOH A . 
G 4 HOH 15 1015 30  HOH HOH A . 
G 4 HOH 16 1016 39  HOH HOH A . 
G 4 HOH 17 1017 85  HOH HOH A . 
G 4 HOH 18 1018 12  HOH HOH A . 
G 4 HOH 19 1019 56  HOH HOH A . 
G 4 HOH 20 1020 53  HOH HOH A . 
G 4 HOH 21 1021 24  HOH HOH A . 
G 4 HOH 22 1022 22  HOH HOH A . 
G 4 HOH 23 1023 44  HOH HOH A . 
G 4 HOH 24 1024 68  HOH HOH A . 
G 4 HOH 25 1025 18  HOH HOH A . 
G 4 HOH 26 1026 9   HOH HOH A . 
G 4 HOH 27 1027 78  HOH HOH A . 
H 4 HOH 1  1001 34  HOH HOH B . 
H 4 HOH 2  1002 94  HOH HOH B . 
H 4 HOH 3  1003 95  HOH HOH B . 
H 4 HOH 4  1004 47  HOH HOH B . 
H 4 HOH 5  1005 19  HOH HOH B . 
H 4 HOH 6  1006 27  HOH HOH B . 
H 4 HOH 7  1007 76  HOH HOH B . 
H 4 HOH 8  1008 2   HOH HOH B . 
H 4 HOH 9  1009 8   HOH HOH B . 
H 4 HOH 10 1010 4   HOH HOH B . 
H 4 HOH 11 1011 16  HOH HOH B . 
H 4 HOH 12 1012 17  HOH HOH B . 
H 4 HOH 13 1013 93  HOH HOH B . 
H 4 HOH 14 1014 32  HOH HOH B . 
H 4 HOH 15 1015 15  HOH HOH B . 
H 4 HOH 16 1016 33  HOH HOH B . 
H 4 HOH 17 1017 60  HOH HOH B . 
H 4 HOH 18 1018 13  HOH HOH B . 
H 4 HOH 19 1019 41  HOH HOH B . 
H 4 HOH 20 1020 82  HOH HOH B . 
H 4 HOH 21 1021 63  HOH HOH B . 
H 4 HOH 22 1022 51  HOH HOH B . 
H 4 HOH 23 1023 65  HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,G 
2 1 B,E,F,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OG1 ? A THR 22 ? A THR 39   ? 1_555 MG ? D MG . ? A MG 901 ? 1_555 OG1 ? A THR 40 ? A THR 57   ? 1_555 84.5  ? 
2  OG1 ? A THR 22 ? A THR 39   ? 1_555 MG ? D MG . ? A MG 901 ? 1_555 O1G ? C GTP .  ? A GTP 900  ? 1_555 166.9 ? 
3  OG1 ? A THR 40 ? A THR 57   ? 1_555 MG ? D MG . ? A MG 901 ? 1_555 O1G ? C GTP .  ? A GTP 900  ? 1_555 89.0  ? 
4  OG1 ? A THR 22 ? A THR 39   ? 1_555 MG ? D MG . ? A MG 901 ? 1_555 O1B ? C GTP .  ? A GTP 900  ? 1_555 87.5  ? 
5  OG1 ? A THR 40 ? A THR 57   ? 1_555 MG ? D MG . ? A MG 901 ? 1_555 O1B ? C GTP .  ? A GTP 900  ? 1_555 167.7 ? 
6  O1G ? C GTP .  ? A GTP 900  ? 1_555 MG ? D MG . ? A MG 901 ? 1_555 O1B ? C GTP .  ? A GTP 900  ? 1_555 96.9  ? 
7  OG1 ? A THR 22 ? A THR 39   ? 1_555 MG ? D MG . ? A MG 901 ? 1_555 O   ? G HOH .  ? A HOH 1001 ? 1_555 80.0  ? 
8  OG1 ? A THR 40 ? A THR 57   ? 1_555 MG ? D MG . ? A MG 901 ? 1_555 O   ? G HOH .  ? A HOH 1001 ? 1_555 87.5  ? 
9  O1G ? C GTP .  ? A GTP 900  ? 1_555 MG ? D MG . ? A MG 901 ? 1_555 O   ? G HOH .  ? A HOH 1001 ? 1_555 88.4  ? 
10 O1B ? C GTP .  ? A GTP 900  ? 1_555 MG ? D MG . ? A MG 901 ? 1_555 O   ? G HOH .  ? A HOH 1001 ? 1_555 81.8  ? 
11 OG1 ? A THR 22 ? A THR 39   ? 1_555 MG ? D MG . ? A MG 901 ? 1_555 O   ? G HOH .  ? A HOH 1003 ? 1_555 98.1  ? 
12 OG1 ? A THR 40 ? A THR 57   ? 1_555 MG ? D MG . ? A MG 901 ? 1_555 O   ? G HOH .  ? A HOH 1003 ? 1_555 93.4  ? 
13 O1G ? C GTP .  ? A GTP 900  ? 1_555 MG ? D MG . ? A MG 901 ? 1_555 O   ? G HOH .  ? A HOH 1003 ? 1_555 93.6  ? 
14 O1B ? C GTP .  ? A GTP 900  ? 1_555 MG ? D MG . ? A MG 901 ? 1_555 O   ? G HOH .  ? A HOH 1003 ? 1_555 97.0  ? 
15 O   ? G HOH .  ? A HOH 1001 ? 1_555 MG ? D MG . ? A MG 901 ? 1_555 O   ? G HOH .  ? A HOH 1003 ? 1_555 177.8 ? 
16 OG1 ? B THR 22 ? B THR 39   ? 1_555 MG ? F MG . ? B MG 901 ? 1_555 OG1 ? B THR 40 ? B THR 57   ? 1_555 80.1  ? 
17 OG1 ? B THR 22 ? B THR 39   ? 1_555 MG ? F MG . ? B MG 901 ? 1_555 O3G ? E GTP .  ? B GTP 900  ? 1_555 171.8 ? 
18 OG1 ? B THR 40 ? B THR 57   ? 1_555 MG ? F MG . ? B MG 901 ? 1_555 O3G ? E GTP .  ? B GTP 900  ? 1_555 92.3  ? 
19 OG1 ? B THR 22 ? B THR 39   ? 1_555 MG ? F MG . ? B MG 901 ? 1_555 O2B ? E GTP .  ? B GTP 900  ? 1_555 83.2  ? 
20 OG1 ? B THR 40 ? B THR 57   ? 1_555 MG ? F MG . ? B MG 901 ? 1_555 O2B ? E GTP .  ? B GTP 900  ? 1_555 163.0 ? 
21 O3G ? E GTP .  ? B GTP 900  ? 1_555 MG ? F MG . ? B MG 901 ? 1_555 O2B ? E GTP .  ? B GTP 900  ? 1_555 104.2 ? 
22 OG1 ? B THR 22 ? B THR 39   ? 1_555 MG ? F MG . ? B MG 901 ? 1_555 O   ? H HOH .  ? B HOH 1002 ? 1_555 88.8  ? 
23 OG1 ? B THR 40 ? B THR 57   ? 1_555 MG ? F MG . ? B MG 901 ? 1_555 O   ? H HOH .  ? B HOH 1002 ? 1_555 91.9  ? 
24 O3G ? E GTP .  ? B GTP 900  ? 1_555 MG ? F MG . ? B MG 901 ? 1_555 O   ? H HOH .  ? B HOH 1002 ? 1_555 94.5  ? 
25 O2B ? E GTP .  ? B GTP 900  ? 1_555 MG ? F MG . ? B MG 901 ? 1_555 O   ? H HOH .  ? B HOH 1002 ? 1_555 90.9  ? 
26 OG1 ? B THR 22 ? B THR 39   ? 1_555 MG ? F MG . ? B MG 901 ? 1_555 O   ? H HOH .  ? B HOH 1008 ? 1_555 87.6  ? 
27 OG1 ? B THR 40 ? B THR 57   ? 1_555 MG ? F MG . ? B MG 901 ? 1_555 O   ? H HOH .  ? B HOH 1008 ? 1_555 87.8  ? 
28 O3G ? E GTP .  ? B GTP 900  ? 1_555 MG ? F MG . ? B MG 901 ? 1_555 O   ? H HOH .  ? B HOH 1008 ? 1_555 89.1  ? 
29 O2B ? E GTP .  ? B GTP 900  ? 1_555 MG ? F MG . ? B MG 901 ? 1_555 O   ? H HOH .  ? B HOH 1008 ? 1_555 88.3  ? 
30 O   ? H HOH .  ? B HOH 1002 ? 1_555 MG ? F MG . ? B MG 901 ? 1_555 O   ? H HOH .  ? B HOH 1008 ? 1_555 176.4 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2019-01-30 
2 'Structure model' 1 1 2019-11-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_abbrev'          
2 2 'Structure model' '_citation.journal_id_CSD'          
3 2 'Structure model' '_citation.journal_id_ISSN'         
4 2 'Structure model' '_citation.page_first'              
5 2 'Structure model' '_citation.page_last'               
6 2 'Structure model' '_citation.pdbx_database_id_DOI'    
7 2 'Structure model' '_citation.pdbx_database_id_PubMed' 
8 2 'Structure model' '_citation.title'                   
9 2 'Structure model' '_citation.year'                    
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -25.1357 -21.1080 8.0906  0.2008 0.2020 0.2271 -0.0139 -0.0494 -0.0111 2.4314 2.1939 3.5481 
-0.1800 -0.0415 -0.6263 -0.0680 0.0040 -0.1076 -0.0800 0.0494 0.2319  0.0830  -0.2447 0.0232  
'X-RAY DIFFRACTION' 2 ? refined -5.9007  -0.7387  18.5322 0.2190 0.2025 0.2642 -0.0062 -0.0116 -0.0494 2.6859 3.1016 3.2750 0.2302 
0.1302  0.1392  -0.0026 0.0488 0.1559  -0.0495 0.0874 -0.3217 -0.1619 0.2360  -0.0683 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? '(chain A and resseq 19:198)' 
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? '(chain B and resseq 20:196)' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX  ? ? ? '(1.11.1_2575: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS     ? ? ? .                    2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .                    3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .                    4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 76  ? ? CZ A ARG 76  ? ? NH2 A ARG 76  ? ? 117.22 120.30 -3.08 0.50 N 
2 1 NE A ARG 110 ? ? CZ A ARG 110 ? ? NH2 A ARG 110 ? ? 117.03 120.30 -3.27 0.50 N 
3 1 NE A ARG 186 ? ? CZ A ARG 186 ? ? NH2 A ARG 186 ? ? 117.17 120.30 -3.13 0.50 N 
4 1 CA B LEU 67  ? ? CB B LEU 67  ? ? CG  B LEU 67  ? ? 134.24 115.30 18.94 2.30 N 
5 1 NE B ARG 76  ? ? CZ B ARG 76  ? ? NH1 B ARG 76  ? ? 123.69 120.30 3.39  0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 70  ? ? -161.84 -166.82 
2 1 LYS A 144 ? ? 76.65   32.36   
3 1 GLN A 153 ? ? -67.71  92.75   
4 1 ASN A 180 ? ? 57.86   7.92    
5 1 ASP B 70  ? ? -161.24 -166.80 
6 1 GLU B 98  ? ? 79.81   -5.33   
7 1 LYS B 144 ? ? 75.36   32.44   
8 1 ASN B 180 ? ? 56.91   10.03   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 18  ? A SER 1   
2  1 Y 1 A MET 19  ? A MET 2   
3  1 Y 1 A ASN 148 ? A ASN 131 
4  1 Y 1 A LYS 149 ? A LYS 132 
5  1 Y 1 A ASP 150 ? A ASP 133 
6  1 Y 1 A SER 151 ? A SER 134 
7  1 Y 1 B SER 18  ? B SER 1   
8  1 Y 1 B MET 19  ? B MET 2   
9  1 Y 1 B GLN 147 ? B GLN 130 
10 1 Y 1 B ASN 148 ? B ASN 131 
11 1 Y 1 B LYS 149 ? B LYS 132 
12 1 Y 1 B ASP 150 ? B ASP 133 
13 1 Y 1 B SER 151 ? B SER 134 
14 1 Y 1 B SER 152 ? B SER 135 
15 1 Y 1 B GLN 153 ? B GLN 136 
16 1 Y 1 B GLN 197 ? B GLN 180 
17 1 Y 1 B SER 198 ? B SER 181 
# 
_pdbx_audit_support.funding_organization   'Science Foundation Ireland' 
_pdbx_audit_support.country                Ireland 
_pdbx_audit_support.grant_number           12/1A/1239 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "GUANOSINE-5'-TRIPHOSPHATE" GTP 
3 'MAGNESIUM ION'             MG  
4 water                       HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#