data_6FQP
# 
_entry.id   6FQP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.296 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6FQP         
WWPDB D_1200007511 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6FQP 
_pdbx_database_status.recvd_initial_deposition_date   2018-02-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Guca, E.'     1 0000-0002-2008-9538 
'Macias, M.J.' 2 0000-0002-6915-963X 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            46 
_citation.language                  ? 
_citation.page_first                9220 
_citation.page_last                 9235 
_citation.title                     'TGIF1 homeodomain interacts with Smad MH1 domain and represses TGF-beta signaling.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gky680 
_citation.pdbx_database_id_PubMed   30060237 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Guca, E.'              1  ? 
primary 'Sunol, D.'             2  ? 
primary 'Ruiz, L.'              3  ? 
primary 'Konkol, A.'            4  ? 
primary 'Cordero, J.'           5  ? 
primary 'Torner, C.'            6  ? 
primary 'Aragon, E.'            7  ? 
primary 'Martin-Malpartida, P.' 8  ? 
primary 'Riera, A.'             9  ? 
primary 'Macias, M.J.'          10 ? 
# 
_cell.length_a           50.851 
_cell.length_b           67.248 
_cell.length_c           102.315 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           6FQP 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         6FQP 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 
;DNA (5'-D(P*AP*TP*TP*GP*AP*CP*AP*GP*CP*TP*GP*TP*CP*AP*AP*T)-3')
;
4897.204  2  ? ? ? ?                                                          
2 polymer     man 'Homeobox protein TGIF1'                                          11729.339 2  ? ? ? 
;N-terminal 'GP' sequence comes from the purification tag
;
3 non-polymer syn 'CALCIUM ION'                                                     40.078    1  ? ? ? ? 
4 water       nat water                                                             18.015    68 ? ? ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        
;5'-TG-3'-interacting factor 1
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DA)(DT)(DT)(DG)(DA)(DC)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DA)(DA)(DT)' ATTGACAGCTGTCAAT L,M ? 
2 'polypeptide(L)'        no no 
;GPMDIPLDLSSSAGSGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDML
RKDGKDPNQFTISRRGAKISE
;
;GPMDIPLDLSSSAGSGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDML
RKDGKDPNQFTISRRGAKISE
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DT  n 
1 3   DT  n 
1 4   DG  n 
1 5   DA  n 
1 6   DC  n 
1 7   DA  n 
1 8   DG  n 
1 9   DC  n 
1 10  DT  n 
1 11  DG  n 
1 12  DT  n 
1 13  DC  n 
1 14  DA  n 
1 15  DA  n 
1 16  DT  n 
2 1   GLY n 
2 2   PRO n 
2 3   MET n 
2 4   ASP n 
2 5   ILE n 
2 6   PRO n 
2 7   LEU n 
2 8   ASP n 
2 9   LEU n 
2 10  SER n 
2 11  SER n 
2 12  SER n 
2 13  ALA n 
2 14  GLY n 
2 15  SER n 
2 16  GLY n 
2 17  LYS n 
2 18  ARG n 
2 19  ARG n 
2 20  ARG n 
2 21  ARG n 
2 22  GLY n 
2 23  ASN n 
2 24  LEU n 
2 25  PRO n 
2 26  LYS n 
2 27  GLU n 
2 28  SER n 
2 29  VAL n 
2 30  GLN n 
2 31  ILE n 
2 32  LEU n 
2 33  ARG n 
2 34  ASP n 
2 35  TRP n 
2 36  LEU n 
2 37  TYR n 
2 38  GLU n 
2 39  HIS n 
2 40  ARG n 
2 41  TYR n 
2 42  ASN n 
2 43  ALA n 
2 44  TYR n 
2 45  PRO n 
2 46  SER n 
2 47  GLU n 
2 48  GLN n 
2 49  GLU n 
2 50  LYS n 
2 51  ALA n 
2 52  LEU n 
2 53  LEU n 
2 54  SER n 
2 55  GLN n 
2 56  GLN n 
2 57  THR n 
2 58  HIS n 
2 59  LEU n 
2 60  SER n 
2 61  THR n 
2 62  LEU n 
2 63  GLN n 
2 64  VAL n 
2 65  CYS n 
2 66  ASN n 
2 67  TRP n 
2 68  PHE n 
2 69  ILE n 
2 70  ASN n 
2 71  ALA n 
2 72  ARG n 
2 73  ARG n 
2 74  ARG n 
2 75  LEU n 
2 76  LEU n 
2 77  PRO n 
2 78  ASP n 
2 79  MET n 
2 80  LEU n 
2 81  ARG n 
2 82  LYS n 
2 83  ASP n 
2 84  GLY n 
2 85  LYS n 
2 86  ASP n 
2 87  PRO n 
2 88  ASN n 
2 89  GLN n 
2 90  PHE n 
2 91  THR n 
2 92  ILE n 
2 93  SER n 
2 94  ARG n 
2 95  ARG n 
2 96  GLY n 
2 97  ALA n 
2 98  LYS n 
2 99  ILE n 
2 100 SER n 
2 101 GLU n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   101 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'TGIF1, TGIF' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       16 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   Human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 PDB 6FQP        6FQP   ? 1 ? 1   
2 UNP TGIF1_HUMAN Q15583 ? 2 
;MDIPLDLSSSAGSGKRRRRGNLPKESVQILRDWLYEHRYNAYPSEQEKALLSQQTHLSTLQVCNWFINARRRLLPDMLRK
DGKDPNQFTISRRGAKISE
;
150 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6FQP L 1 ? 16  ? 6FQP   1   ? 16  ? 1   16  
2 1 6FQP M 1 ? 16  ? 6FQP   1   ? 16  ? 1   16  
3 2 6FQP A 3 ? 101 ? Q15583 150 ? 248 ? 150 248 
4 2 6FQP B 3 ? 101 ? Q15583 150 ? 248 ? 150 248 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3 6FQP GLY A 1 ? UNP Q15583 ? ? 'expression tag' 148 1 
3 6FQP PRO A 2 ? UNP Q15583 ? ? 'expression tag' 149 2 
4 6FQP GLY B 1 ? UNP Q15583 ? ? 'expression tag' 148 3 
4 6FQP PRO B 2 ? UNP Q15583 ? ? 'expression tag' 149 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CA  non-polymer         . 'CALCIUM ION'                        ? 'Ca 2'            40.078  
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6FQP 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.39 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         63.69 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1M sodium acetate trihydrate pH 4.5, 30% v/v PEG 1500' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-05-10 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.972422 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.972422 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6FQP 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.42 
_reflns.d_resolution_low                 67.25 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       13814 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.9 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.0 
_reflns.pdbx_Rmerge_I_obs                0.0275 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            17.3 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.42 
_reflns_shell.d_res_low                   2.51 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        98.7 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.232 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.B_iso_mean                               52.9948 
_refine.B_iso_max                                117.630 
_refine.B_iso_min                                23.840 
_refine.entry_id                                 6FQP 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.4200 
_refine.ls_d_res_low                             45.5370 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     13749 
_refine.ls_number_reflns_R_free                  656 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.6900 
_refine.ls_percent_reflns_R_free                 4.7700 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2069 
_refine.ls_R_factor_R_free                       0.2409 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2050 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4XRM 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 31.2400 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2800 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1083 
_refine_hist.pdbx_number_atoms_nucleic_acid   656 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             68 
_refine_hist.number_atoms_total               1808 
_refine_hist.d_res_high                       . 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                     6FQP 
_struct.title                        'Crystal structure of TALE homeobox domain transcription factor TGIF1 with its consensus DNA' 
_struct.pdbx_descriptor              'Homeobox protein TGIF1/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6FQP 
_struct_keywords.text            'homeobox, three-amino acid loop extension, TGF-beta pathway, TRANSCRIPTION' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 PRO C 25 ? HIS C 39 ? PRO A 172 HIS A 186 1 ? 15 
HELX_P HELX_P2 AA2 SER C 46 ? HIS C 58 ? SER A 193 HIS A 205 1 ? 13 
HELX_P HELX_P3 AA3 SER C 60 ? LEU C 75 ? SER A 207 LEU A 222 1 ? 16 
HELX_P HELX_P4 AA4 LEU C 75 ? LYS C 82 ? LEU A 222 LYS A 229 1 ? 8  
HELX_P HELX_P5 AA5 PRO D 25 ? HIS D 39 ? PRO B 172 HIS B 186 1 ? 15 
HELX_P HELX_P6 AA6 SER D 46 ? HIS D 58 ? SER B 193 HIS B 205 1 ? 13 
HELX_P HELX_P7 AA7 SER D 60 ? LEU D 75 ? SER B 207 LEU B 222 1 ? 16 
HELX_P HELX_P8 AA8 LEU D 75 ? LEU D 80 ? LEU B 222 LEU B 227 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A DG 8  O6 ? ? ? 1_555 E CA .  CA ? ? L DG 8  L CA 101 1_555 ? ? ? ? ? ? ?            2.655 ? 
metalc2  metalc ? ? B DG 8  O6 ? ? ? 1_555 E CA .  CA ? ? M DG 8  L CA 101 1_555 ? ? ? ? ? ? ?            2.336 ? 
hydrog1  hydrog ? ? A DA 1  N1 ? ? ? 1_555 B DT 16 N3 ? ? L DA 1  M DT 16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DA 1  N6 ? ? ? 1_555 B DT 16 O4 ? ? L DA 1  M DT 16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DT 2  N3 ? ? ? 1_555 B DA 15 N1 ? ? L DT 2  M DA 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DT 2  O4 ? ? ? 1_555 B DA 15 N6 ? ? L DT 2  M DA 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DT 3  N3 ? ? ? 1_555 B DA 14 N1 ? ? L DT 3  M DA 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DT 3  O4 ? ? ? 1_555 B DA 14 N6 ? ? L DT 3  M DA 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DG 4  N1 ? ? ? 1_555 B DC 13 N3 ? ? L DG 4  M DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DG 4  N2 ? ? ? 1_555 B DC 13 O2 ? ? L DG 4  M DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DG 4  O6 ? ? ? 1_555 B DC 13 N4 ? ? L DG 4  M DC 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DA 5  N1 ? ? ? 1_555 B DT 12 N3 ? ? L DA 5  M DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DA 5  N6 ? ? ? 1_555 B DT 12 O4 ? ? L DA 5  M DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DC 6  N3 ? ? ? 1_555 B DG 11 N1 ? ? L DC 6  M DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DC 6  N4 ? ? ? 1_555 B DG 11 O6 ? ? L DC 6  M DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DC 6  O2 ? ? ? 1_555 B DG 11 N2 ? ? L DC 6  M DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DA 7  N1 ? ? ? 1_555 B DT 10 N3 ? ? L DA 7  M DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DA 7  N6 ? ? ? 1_555 B DT 10 O4 ? ? L DA 7  M DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DG 8  N1 ? ? ? 1_555 B DC 9  N3 ? ? L DG 8  M DC 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DG 8  N2 ? ? ? 1_555 B DC 9  O2 ? ? L DG 8  M DC 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DG 8  O6 ? ? ? 1_555 B DC 9  N4 ? ? L DG 8  M DC 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DC 9  N3 ? ? ? 1_555 B DG 8  N1 ? ? L DC 9  M DG 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DC 9  N4 ? ? ? 1_555 B DG 8  O6 ? ? L DC 9  M DG 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DC 9  O2 ? ? ? 1_555 B DG 8  N2 ? ? L DC 9  M DG 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A DT 10 N3 ? ? ? 1_555 B DA 7  N1 ? ? L DT 10 M DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A DT 10 O4 ? ? ? 1_555 B DA 7  N6 ? ? L DT 10 M DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DG 11 N1 ? ? ? 1_555 B DC 6  N3 ? ? L DG 11 M DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A DG 11 N2 ? ? ? 1_555 B DC 6  O2 ? ? L DG 11 M DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A DG 11 O6 ? ? ? 1_555 B DC 6  N4 ? ? L DG 11 M DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A DT 12 N3 ? ? ? 1_555 B DA 5  N1 ? ? L DT 12 M DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A DT 12 O4 ? ? ? 1_555 B DA 5  N6 ? ? L DT 12 M DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? A DC 13 N3 ? ? ? 1_555 B DG 4  N1 ? ? L DC 13 M DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? A DC 13 N4 ? ? ? 1_555 B DG 4  O6 ? ? L DC 13 M DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? A DC 13 O2 ? ? ? 1_555 B DG 4  N2 ? ? L DC 13 M DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? A DA 14 N1 ? ? ? 1_555 B DT 3  N3 ? ? L DA 14 M DT 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? A DA 14 N6 ? ? ? 1_555 B DT 3  O4 ? ? L DA 14 M DT 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? A DA 15 N1 ? ? ? 1_555 B DT 2  N3 ? ? L DA 15 M DT 2   1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     ? 
hydrog36 hydrog ? ? A DT 16 N3 ? ? ? 1_555 B DA 1  N1 ? ? L DT 16 M DA 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? A DT 16 O4 ? ? ? 1_555 B DA 1  N6 ? ? L DT 16 M DA 1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    L 
_struct_site.pdbx_auth_comp_id    CA 
_struct_site.pdbx_auth_seq_id     101 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    3 
_struct_site.details              'binding site for residue CA L 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 3 DG A 8 ? DG L 8 . ? 1_555 ? 
2 AC1 3 DC A 9 ? DC L 9 . ? 1_555 ? 
3 AC1 3 DG B 8 ? DG M 8 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6FQP 
_atom_sites.fract_transf_matrix[1][1]   0.019665 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014870 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009774 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CA 
H  
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    P  P      . DA  A 1 1  ? -5.003  -5.566  -31.862 0.00 64.63  ? 1   DA  L P      1 
ATOM   2    O  OP1    . DA  A 1 1  ? -5.571  -4.627  -30.871 1.00 59.16  ? 1   DA  L OP1    1 
ATOM   3    O  OP2    . DA  A 1 1  ? -3.866  -6.461  -31.581 1.00 62.55  ? 1   DA  L OP2    1 
ATOM   4    O  "O5'"  . DA  A 1 1  ? -4.677  -4.788  -33.224 0.58 68.89  ? 1   DA  L "O5'"  1 
ATOM   5    C  "C5'"  . DA  A 1 1  ? -3.421  -4.169  -33.452 0.00 66.09  ? 1   DA  L "C5'"  1 
ATOM   6    C  "C4'"  . DA  A 1 1  ? -3.409  -2.743  -32.944 1.00 70.67  ? 1   DA  L "C4'"  1 
ATOM   7    O  "O4'"  . DA  A 1 1  ? -4.658  -2.081  -33.350 1.00 69.70  ? 1   DA  L "O4'"  1 
ATOM   8    C  "C3'"  . DA  A 1 1  ? -3.326  -2.638  -31.417 1.00 70.27  ? 1   DA  L "C3'"  1 
ATOM   9    O  "O3'"  . DA  A 1 1  ? -2.091  -2.010  -31.009 1.00 82.50  ? 1   DA  L "O3'"  1 
ATOM   10   C  "C2'"  . DA  A 1 1  ? -4.562  -1.817  -31.029 1.00 68.19  ? 1   DA  L "C2'"  1 
ATOM   11   C  "C1'"  . DA  A 1 1  ? -5.045  -1.193  -32.336 1.00 67.18  ? 1   DA  L "C1'"  1 
ATOM   12   N  N9     . DA  A 1 1  ? -6.515  -0.971  -32.350 1.00 56.90  ? 1   DA  L N9     1 
ATOM   13   C  C8     . DA  A 1 1  ? -7.534  -1.893  -32.188 1.00 56.64  ? 1   DA  L C8     1 
ATOM   14   N  N7     . DA  A 1 1  ? -8.756  -1.349  -32.162 1.00 50.85  ? 1   DA  L N7     1 
ATOM   15   C  C5     . DA  A 1 1  ? -8.498  0.004   -32.286 1.00 44.46  ? 1   DA  L C5     1 
ATOM   16   C  C6     . DA  A 1 1  ? -9.332  1.124   -32.328 1.00 50.47  ? 1   DA  L C6     1 
ATOM   17   N  N6     . DA  A 1 1  ? -10.659 1.062   -32.264 1.00 52.66  ? 1   DA  L N6     1 
ATOM   18   N  N1     . DA  A 1 1  ? -8.748  2.329   -32.472 1.00 53.47  ? 1   DA  L N1     1 
ATOM   19   C  C2     . DA  A 1 1  ? -7.407  2.396   -32.531 1.00 52.58  ? 1   DA  L C2     1 
ATOM   20   N  N3     . DA  A 1 1  ? -6.519  1.421   -32.500 1.00 50.48  ? 1   DA  L N3     1 
ATOM   21   C  C4     . DA  A 1 1  ? -7.129  0.244   -32.386 1.00 49.74  ? 1   DA  L C4     1 
ATOM   22   H  "H5'"  . DA  A 1 1  ? -3.235  -4.169  -34.404 1.00 80.18  ? 1   DA  L "H5'"  1 
ATOM   23   H  "H5''" . DA  A 1 1  ? -2.731  -4.675  -32.994 1.00 80.18  ? 1   DA  L "H5''" 1 
ATOM   24   H  "H4'"  . DA  A 1 1  ? -2.657  -2.271  -33.336 1.00 85.68  ? 1   DA  L "H4'"  1 
ATOM   25   H  "H3'"  . DA  A 1 1  ? -3.387  -3.524  -31.026 1.00 85.20  ? 1   DA  L "H3'"  1 
ATOM   26   H  "H2'"  . DA  A 1 1  ? -5.248  -2.394  -30.657 1.00 82.71  ? 1   DA  L "H2'"  1 
ATOM   27   H  "H2''" . DA  A 1 1  ? -4.321  -1.125  -30.393 1.00 82.71  ? 1   DA  L "H2''" 1 
ATOM   28   H  "H1'"  . DA  A 1 1  ? -4.594  -0.344  -32.468 1.00 81.49  ? 1   DA  L "H1'"  1 
ATOM   29   H  H8     . DA  A 1 1  ? -7.384  -2.808  -32.121 1.00 68.84  ? 1   DA  L H8     1 
ATOM   30   H  H61    . DA  A 1 1  ? -11.126 1.783   -32.314 1.00 64.06  ? 1   DA  L H61    1 
ATOM   31   H  H62    . DA  A 1 1  ? -11.051 0.302   -32.172 1.00 64.06  ? 1   DA  L H62    1 
ATOM   32   H  H2     . DA  A 1 1  ? -7.055  3.252   -32.621 1.00 63.97  ? 1   DA  L H2     1 
ATOM   33   P  P      . DT  A 1 2  ? -1.744  -1.725  -29.450 1.00 94.41  ? 2   DT  L P      1 
ATOM   34   O  OP1    . DT  A 1 2  ? -0.278  -1.931  -29.374 1.00 84.99  ? 2   DT  L OP1    1 
ATOM   35   O  OP2    . DT  A 1 2  ? -2.651  -2.366  -28.437 1.00 62.62  ? 2   DT  L OP2    1 
ATOM   36   O  "O5'"  . DT  A 1 2  ? -2.050  -0.173  -29.328 1.00 86.78  ? 2   DT  L "O5'"  1 
ATOM   37   C  "C5'"  . DT  A 1 2  ? -1.595  0.721   -30.332 1.00 78.80  ? 2   DT  L "C5'"  1 
ATOM   38   C  "C4'"  . DT  A 1 2  ? -1.899  2.132   -29.903 1.00 67.13  ? 2   DT  L "C4'"  1 
ATOM   39   O  "O4'"  . DT  A 1 2  ? -3.310  2.421   -30.113 1.00 58.28  ? 2   DT  L "O4'"  1 
ATOM   40   C  "C3'"  . DT  A 1 2  ? -1.614  2.390   -28.429 1.00 60.26  ? 2   DT  L "C3'"  1 
ATOM   41   O  "O3'"  . DT  A 1 2  ? -0.883  3.569   -28.299 1.00 56.11  ? 2   DT  L "O3'"  1 
ATOM   42   C  "C2'"  . DT  A 1 2  ? -2.999  2.443   -27.785 1.00 57.51  ? 2   DT  L "C2'"  1 
ATOM   43   C  "C1'"  . DT  A 1 2  ? -3.895  2.912   -28.927 1.00 52.27  ? 2   DT  L "C1'"  1 
ATOM   44   N  N1     . DT  A 1 2  ? -5.318  2.403   -28.879 1.00 48.26  ? 2   DT  L N1     1 
ATOM   45   C  C2     . DT  A 1 2  ? -6.340  3.311   -28.962 1.00 43.78  ? 2   DT  L C2     1 
ATOM   46   O  O2     . DT  A 1 2  ? -6.155  4.516   -29.035 1.00 48.33  ? 2   DT  L O2     1 
ATOM   47   N  N3     . DT  A 1 2  ? -7.594  2.772   -28.977 1.00 48.48  ? 2   DT  L N3     1 
ATOM   48   C  C4     . DT  A 1 2  ? -7.941  1.436   -28.881 1.00 50.21  ? 2   DT  L C4     1 
ATOM   49   O  O4     . DT  A 1 2  ? -9.140  1.052   -28.867 1.00 46.90  ? 2   DT  L O4     1 
ATOM   50   C  C5     . DT  A 1 2  ? -6.819  0.524   -28.788 1.00 46.74  ? 2   DT  L C5     1 
ATOM   51   C  C7     . DT  A 1 2  ? -7.063  -0.948  -28.685 1.00 48.48  ? 2   DT  L C7     1 
ATOM   52   C  C6     . DT  A 1 2  ? -5.571  1.043   -28.802 1.00 47.47  ? 2   DT  L C6     1 
ATOM   53   H  "H5'"  . DT  A 1 2  ? -2.049  0.530   -31.168 1.00 95.44  ? 2   DT  L "H5'"  1 
ATOM   54   H  "H5''" . DT  A 1 2  ? -0.638  0.617   -30.450 1.00 95.44  ? 2   DT  L "H5''" 1 
ATOM   55   H  "H4'"  . DT  A 1 2  ? -1.370  2.745   -30.437 1.00 81.43  ? 2   DT  L "H4'"  1 
ATOM   56   H  "H3'"  . DT  A 1 2  ? -1.109  1.649   -28.059 1.00 73.18  ? 2   DT  L "H3'"  1 
ATOM   57   H  "H2'"  . DT  A 1 2  ? -3.268  1.563   -27.479 1.00 69.89  ? 2   DT  L "H2'"  1 
ATOM   58   H  "H2''" . DT  A 1 2  ? -3.013  3.082   -27.055 1.00 69.89  ? 2   DT  L "H2''" 1 
ATOM   59   H  "H1'"  . DT  A 1 2  ? -3.902  3.881   -28.951 1.00 63.60  ? 2   DT  L "H1'"  1 
ATOM   60   H  H3     . DT  A 1 2  ? -8.247  3.331   -29.006 1.00 59.05  ? 2   DT  L H3     1 
ATOM   61   H  H71    . DT  A 1 2  ? -8.018  -1.118  -28.695 1.00 59.04  ? 2   DT  L H71    1 
ATOM   62   H  H72    . DT  A 1 2  ? -6.647  -1.398  -29.437 1.00 59.04  ? 2   DT  L H72    1 
ATOM   63   H  H73    . DT  A 1 2  ? -6.684  -1.282  -27.857 1.00 59.04  ? 2   DT  L H73    1 
ATOM   64   H  H6     . DT  A 1 2  ? -4.848  0.460   -28.752 1.00 57.83  ? 2   DT  L H6     1 
ATOM   65   P  P      . DT  A 1 3  ? -0.382  4.036   -26.864 1.00 56.59  ? 3   DT  L P      1 
ATOM   66   O  OP1    . DT  A 1 3  ? 0.646   5.074   -27.124 1.00 56.43  ? 3   DT  L OP1    1 
ATOM   67   O  OP2    . DT  A 1 3  ? -0.068  2.832   -26.040 1.00 57.10  ? 3   DT  L OP2    1 
ATOM   68   O  "O5'"  . DT  A 1 3  ? -1.628  4.867   -26.335 1.00 54.72  ? 3   DT  L "O5'"  1 
ATOM   69   C  "C5'"  . DT  A 1 3  ? -2.093  5.944   -27.130 1.00 44.09  ? 3   DT  L "C5'"  1 
ATOM   70   C  "C4'"  . DT  A 1 3  ? -3.242  6.651   -26.468 1.00 50.27  ? 3   DT  L "C4'"  1 
ATOM   71   O  "O4'"  . DT  A 1 3  ? -4.458  5.888   -26.636 1.00 38.09  ? 3   DT  L "O4'"  1 
ATOM   72   C  "C3'"  . DT  A 1 3  ? -3.079  6.872   -24.941 1.00 48.81  ? 3   DT  L "C3'"  1 
ATOM   73   O  "O3'"  . DT  A 1 3  ? -3.162  8.231   -24.683 1.00 47.85  ? 3   DT  L "O3'"  1 
ATOM   74   C  "C2'"  . DT  A 1 3  ? -4.230  6.088   -24.317 1.00 38.31  ? 3   DT  L "C2'"  1 
ATOM   75   C  "C1'"  . DT  A 1 3  ? -5.242  6.028   -25.462 1.00 42.10  ? 3   DT  L "C1'"  1 
ATOM   76   N  N1     . DT  A 1 3  ? -6.171  4.906   -25.438 1.00 39.03  ? 3   DT  L N1     1 
ATOM   77   C  C2     . DT  A 1 3  ? -7.524  5.154   -25.560 1.00 45.03  ? 3   DT  L C2     1 
ATOM   78   O  O2     . DT  A 1 3  ? -8.003  6.279   -25.653 1.00 43.45  ? 3   DT  L O2     1 
ATOM   79   N  N3     . DT  A 1 3  ? -8.302  4.033   -25.597 1.00 44.15  ? 3   DT  L N3     1 
ATOM   80   C  C4     . DT  A 1 3  ? -7.882  2.712   -25.491 1.00 45.35  ? 3   DT  L C4     1 
ATOM   81   O  O4     . DT  A 1 3  ? -8.668  1.745   -25.530 1.00 37.53  ? 3   DT  L O4     1 
ATOM   82   C  C5     . DT  A 1 3  ? -6.461  2.534   -25.349 1.00 45.49  ? 3   DT  L C5     1 
ATOM   83   C  C7     . DT  A 1 3  ? -5.899  1.149   -25.227 1.00 44.01  ? 3   DT  L C7     1 
ATOM   84   C  C6     . DT  A 1 3  ? -5.678  3.629   -25.346 1.00 38.89  ? 3   DT  L C6     1 
ATOM   85   H  "H5'"  . DT  A 1 3  ? -2.384  5.602   -27.990 1.00 53.78  ? 3   DT  L "H5'"  1 
ATOM   86   H  "H5''" . DT  A 1 3  ? -1.369  6.574   -27.266 1.00 53.78  ? 3   DT  L "H5''" 1 
ATOM   87   H  "H4'"  . DT  A 1 3  ? -3.358  7.515   -26.894 1.00 61.19  ? 3   DT  L "H4'"  1 
ATOM   88   H  "H3'"  . DT  A 1 3  ? -2.227  6.520   -24.638 1.00 59.45  ? 3   DT  L "H3'"  1 
ATOM   89   H  "H2'"  . DT  A 1 3  ? -3.943  5.197   -24.064 1.00 46.85  ? 3   DT  L "H2'"  1 
ATOM   90   H  "H2''" . DT  A 1 3  ? -4.598  6.564   -23.556 1.00 46.85  ? 3   DT  L "H2''" 1 
ATOM   91   H  "H1'"  . DT  A 1 3  ? -5.738  6.861   -25.501 1.00 51.40  ? 3   DT  L "H1'"  1 
ATOM   92   H  H3     . DT  A 1 3  ? -9.150  4.160   -25.665 1.00 53.85  ? 3   DT  L H3     1 
ATOM   93   H  H71    . DT  A 1 3  ? -5.283  0.984   -25.957 1.00 53.68  ? 3   DT  L H71    1 
ATOM   94   H  H72    . DT  A 1 3  ? -5.430  1.064   -24.382 1.00 53.68  ? 3   DT  L H72    1 
ATOM   95   H  H73    . DT  A 1 3  ? -6.622  0.502   -25.261 1.00 53.68  ? 3   DT  L H73    1 
ATOM   96   H  H6     . DT  A 1 3  ? -4.759  3.515   -25.263 1.00 47.54  ? 3   DT  L H6     1 
ATOM   97   P  P      . DG  A 1 4  ? -2.525  8.879   -23.386 1.00 43.86  ? 4   DG  L P      1 
ATOM   98   O  OP1    . DG  A 1 4  ? -1.822  10.109  -23.826 1.00 37.61  ? 4   DG  L OP1    1 
ATOM   99   O  OP2    . DG  A 1 4  ? -1.857  7.808   -22.604 1.00 48.67  ? 4   DG  L OP2    1 
ATOM   100  O  "O5'"  . DG  A 1 4  ? -3.835  9.304   -22.574 1.00 43.53  ? 4   DG  L "O5'"  1 
ATOM   101  C  "C5'"  . DG  A 1 4  ? -4.697  10.256  -23.145 1.00 42.42  ? 4   DG  L "C5'"  1 
ATOM   102  C  "C4'"  . DG  A 1 4  ? -6.058  10.223  -22.501 1.00 46.67  ? 4   DG  L "C4'"  1 
ATOM   103  O  "O4'"  . DG  A 1 4  ? -6.703  8.973   -22.766 1.00 39.54  ? 4   DG  L "O4'"  1 
ATOM   104  C  "C3'"  . DG  A 1 4  ? -6.041  10.376  -20.990 1.00 36.67  ? 4   DG  L "C3'"  1 
ATOM   105  O  "O3'"  . DG  A 1 4  ? -6.768  11.530  -20.667 1.00 42.71  ? 4   DG  L "O3'"  1 
ATOM   106  C  "C2'"  . DG  A 1 4  ? -6.672  9.087   -20.459 1.00 36.69  ? 4   DG  L "C2'"  1 
ATOM   107  C  "C1'"  . DG  A 1 4  ? -7.450  8.589   -21.647 1.00 38.97  ? 4   DG  L "C1'"  1 
ATOM   108  N  N9     . DG  A 1 4  ? -7.637  7.151   -21.716 1.00 39.41  ? 4   DG  L N9     1 
ATOM   109  C  C8     . DG  A 1 4  ? -6.668  6.176   -21.619 1.00 45.02  ? 4   DG  L C8     1 
ATOM   110  N  N7     . DG  A 1 4  ? -7.136  4.959   -21.793 1.00 47.49  ? 4   DG  L N7     1 
ATOM   111  C  C5     . DG  A 1 4  ? -8.502  5.151   -22.055 1.00 46.45  ? 4   DG  L C5     1 
ATOM   112  C  C6     . DG  A 1 4  ? -9.541  4.205   -22.324 1.00 42.53  ? 4   DG  L C6     1 
ATOM   113  O  O6     . DG  A 1 4  ? -9.465  2.959   -22.387 1.00 38.67  ? 4   DG  L O6     1 
ATOM   114  N  N1     . DG  A 1 4  ? -10.768 4.835   -22.518 1.00 38.47  ? 4   DG  L N1     1 
ATOM   115  C  C2     . DG  A 1 4  ? -10.970 6.201   -22.468 1.00 39.09  ? 4   DG  L C2     1 
ATOM   116  N  N2     . DG  A 1 4  ? -12.218 6.631   -22.673 1.00 39.48  ? 4   DG  L N2     1 
ATOM   117  N  N3     . DG  A 1 4  ? -10.018 7.087   -22.221 1.00 40.33  ? 4   DG  L N3     1 
ATOM   118  C  C4     . DG  A 1 4  ? -8.815  6.495   -22.014 1.00 41.63  ? 4   DG  L C4     1 
ATOM   119  H  "H5'"  . DG  A 1 4  ? -4.791  10.071  -24.093 1.00 51.77  ? 4   DG  L "H5'"  1 
ATOM   120  H  "H5''" . DG  A 1 4  ? -4.313  11.139  -23.031 1.00 51.77  ? 4   DG  L "H5''" 1 
ATOM   121  H  "H4'"  . DG  A 1 4  ? -6.596  10.936  -22.878 1.00 56.88  ? 4   DG  L "H4'"  1 
ATOM   122  H  "H3'"  . DG  A 1 4  ? -5.128  10.456  -20.674 1.00 44.87  ? 4   DG  L "H3'"  1 
ATOM   123  H  "H2'"  . DG  A 1 4  ? -5.988  8.448   -20.205 1.00 44.90  ? 4   DG  L "H2'"  1 
ATOM   124  H  "H2''" . DG  A 1 4  ? -7.264  9.275   -19.715 1.00 44.90  ? 4   DG  L "H2''" 1 
ATOM   125  H  "H1'"  . DG  A 1 4  ? -8.315  9.027   -21.672 1.00 47.63  ? 4   DG  L "H1'"  1 
ATOM   126  H  H8     . DG  A 1 4  ? -5.775  6.359   -21.435 1.00 54.89  ? 4   DG  L H8     1 
ATOM   127  H  H1     . DG  A 1 4  ? -11.450 4.337   -22.682 1.00 47.03  ? 4   DG  L H1     1 
ATOM   128  H  H21    . DG  A 1 4  ? -12.394 7.473   -22.645 1.00 48.24  ? 4   DG  L H21    1 
ATOM   129  H  H22    . DG  A 1 4  ? -12.847 6.066   -22.834 1.00 48.24  ? 4   DG  L H22    1 
ATOM   130  P  P      . DA  A 1 5  ? -7.039  11.946  -19.153 1.00 45.43  ? 5   DA  L P      1 
ATOM   131  O  OP1    . DA  A 1 5  ? -7.199  13.427  -19.171 1.00 35.58  ? 5   DA  L OP1    1 
ATOM   132  O  OP2    . DA  A 1 5  ? -5.995  11.350  -18.270 1.00 43.19  ? 5   DA  L OP2    1 
ATOM   133  O  "O5'"  . DA  A 1 5  ? -8.388  11.178  -18.848 1.00 45.06  ? 5   DA  L "O5'"  1 
ATOM   134  C  "C5'"  . DA  A 1 5  ? -9.463  11.331  -19.729 1.00 40.57  ? 5   DA  L "C5'"  1 
ATOM   135  C  "C4'"  . DA  A 1 5  ? -10.617 10.431  -19.330 1.00 39.09  ? 5   DA  L "C4'"  1 
ATOM   136  O  "O4'"  . DA  A 1 5  ? -10.280 9.071   -19.647 1.00 33.52  ? 5   DA  L "O4'"  1 
ATOM   137  C  "C3'"  . DA  A 1 5  ? -10.948 10.430  -17.829 1.00 35.53  ? 5   DA  L "C3'"  1 
ATOM   138  O  "O3'"  . DA  A 1 5  ? -12.152 11.109  -17.640 1.00 36.67  ? 5   DA  L "O3'"  1 
ATOM   139  C  "C2'"  . DA  A 1 5  ? -11.035 8.929   -17.456 1.00 37.61  ? 5   DA  L "C2'"  1 
ATOM   140  C  "C1'"  . DA  A 1 5  ? -11.020 8.223   -18.819 1.00 40.62  ? 5   DA  L "C1'"  1 
ATOM   141  N  N9     . DA  A 1 5  ? -10.374 6.908   -18.806 1.00 38.18  ? 5   DA  L N9     1 
ATOM   142  C  C8     . DA  A 1 5  ? -9.044  6.651   -18.610 1.00 41.93  ? 5   DA  L C8     1 
ATOM   143  N  N7     . DA  A 1 5  ? -8.736  5.369   -18.653 1.00 45.17  ? 5   DA  L N7     1 
ATOM   144  C  C5     . DA  A 1 5  ? -9.941  4.747   -18.928 1.00 38.57  ? 5   DA  L C5     1 
ATOM   145  C  C6     . DA  A 1 5  ? -10.300 3.393   -19.089 1.00 41.25  ? 5   DA  L C6     1 
ATOM   146  N  N6     . DA  A 1 5  ? -9.434  2.372   -19.011 1.00 41.07  ? 5   DA  L N6     1 
ATOM   147  N  N1     . DA  A 1 5  ? -11.590 3.127   -19.334 1.00 41.19  ? 5   DA  L N1     1 
ATOM   148  C  C2     . DA  A 1 5  ? -12.459 4.138   -19.396 1.00 39.70  ? 5   DA  L C2     1 
ATOM   149  N  N3     . DA  A 1 5  ? -12.242 5.437   -19.267 1.00 37.83  ? 5   DA  L N3     1 
ATOM   150  C  C4     . DA  A 1 5  ? -10.959 5.683   -19.030 1.00 37.72  ? 5   DA  L C4     1 
ATOM   151  H  "H5'"  . DA  A 1 5  ? -9.176  11.102  -20.627 1.00 49.55  ? 5   DA  L "H5'"  1 
ATOM   152  H  "H5''" . DA  A 1 5  ? -9.759  12.255  -19.714 1.00 49.55  ? 5   DA  L "H5''" 1 
ATOM   153  H  "H4'"  . DA  A 1 5  ? -11.408 10.688  -19.829 1.00 47.79  ? 5   DA  L "H4'"  1 
ATOM   154  H  "H3'"  . DA  A 1 5  ? -10.237 10.860  -17.329 1.00 43.51  ? 5   DA  L "H3'"  1 
ATOM   155  H  "H2'"  . DA  A 1 5  ? -10.268 8.664   -16.925 1.00 46.01  ? 5   DA  L "H2'"  1 
ATOM   156  H  "H2''" . DA  A 1 5  ? -11.861 8.742   -16.984 1.00 46.01  ? 5   DA  L "H2''" 1 
ATOM   157  H  "H1'"  . DA  A 1 5  ? -11.925 8.142   -19.157 1.00 49.61  ? 5   DA  L "H1'"  1 
ATOM   158  H  H8     . DA  A 1 5  ? -8.418  7.318   -18.443 1.00 51.19  ? 5   DA  L H8     1 
ATOM   159  H  H61    . DA  A 1 5  ? -9.711  1.564   -19.118 1.00 50.16  ? 5   DA  L H61    1 
ATOM   160  H  H62    . DA  A 1 5  ? -8.603  2.524   -18.855 1.00 50.16  ? 5   DA  L H62    1 
ATOM   161  H  H2     . DA  A 1 5  ? -13.338 3.897   -19.576 1.00 48.51  ? 5   DA  L H2     1 
ATOM   162  P  P      . DC  A 1 6  ? -12.639 11.567  -16.193 1.00 38.59  ? 6   DC  L P      1 
ATOM   163  O  OP1    . DC  A 1 6  ? -13.526 12.726  -16.394 1.00 35.00  ? 6   DC  L OP1    1 
ATOM   164  O  OP2    . DC  A 1 6  ? -11.509 11.679  -15.186 1.00 43.37  ? 6   DC  L OP2    1 
ATOM   165  O  "O5'"  . DC  A 1 6  ? -13.535 10.320  -15.747 1.00 42.63  ? 6   DC  L "O5'"  1 
ATOM   166  C  "C5'"  . DC  A 1 6  ? -14.657 9.976   -16.523 1.00 33.47  ? 6   DC  L "C5'"  1 
ATOM   167  C  "C4'"  . DC  A 1 6  ? -15.343 8.717   -15.979 1.00 41.33  ? 6   DC  L "C4'"  1 
ATOM   168  O  "O4'"  . DC  A 1 6  ? -14.593 7.520   -16.379 1.00 41.60  ? 6   DC  L "O4'"  1 
ATOM   169  C  "C3'"  . DC  A 1 6  ? -15.447 8.608   -14.444 1.00 41.30  ? 6   DC  L "C3'"  1 
ATOM   170  O  "O3'"  . DC  A 1 6  ? -16.642 7.970   -14.122 1.00 54.21  ? 6   DC  L "O3'"  1 
ATOM   171  C  "C2'"  . DC  A 1 6  ? -14.275 7.713   -14.103 1.00 37.71  ? 6   DC  L "C2'"  1 
ATOM   172  C  "C1'"  . DC  A 1 6  ? -14.398 6.712   -15.239 1.00 39.45  ? 6   DC  L "C1'"  1 
ATOM   173  N  N1     . DC  A 1 6  ? -13.209 5.826   -15.435 1.00 43.10  ? 6   DC  L N1     1 
ATOM   174  C  C2     . DC  A 1 6  ? -13.399 4.515   -15.854 1.00 40.76  ? 6   DC  L C2     1 
ATOM   175  O  O2     . DC  A 1 6  ? -14.547 4.105   -16.026 1.00 45.07  ? 6   DC  L O2     1 
ATOM   176  N  N3     . DC  A 1 6  ? -12.332 3.704   -15.988 1.00 41.18  ? 6   DC  L N3     1 
ATOM   177  C  C4     . DC  A 1 6  ? -11.114 4.170   -15.747 1.00 38.66  ? 6   DC  L C4     1 
ATOM   178  N  N4     . DC  A 1 6  ? -10.080 3.342   -15.940 1.00 42.31  ? 6   DC  L N4     1 
ATOM   179  C  C5     . DC  A 1 6  ? -10.893 5.517   -15.341 1.00 38.47  ? 6   DC  L C5     1 
ATOM   180  C  C6     . DC  A 1 6  ? -11.957 6.298   -15.184 1.00 42.53  ? 6   DC  L C6     1 
ATOM   181  H  "H5'"  . DC  A 1 6  ? -14.374 9.814   -17.437 1.00 41.04  ? 6   DC  L "H5'"  1 
ATOM   182  H  "H5''" . DC  A 1 6  ? -15.288 10.712  -16.512 1.00 41.04  ? 6   DC  L "H5''" 1 
ATOM   183  H  "H4'"  . DC  A 1 6  ? -16.235 8.664   -16.355 1.00 50.47  ? 6   DC  L "H4'"  1 
ATOM   184  H  "H3'"  . DC  A 1 6  ? -15.373 9.476   -14.017 1.00 50.43  ? 6   DC  L "H3'"  1 
ATOM   185  H  "H2'"  . DC  A 1 6  ? -13.436 8.197   -14.148 1.00 46.13  ? 6   DC  L "H2'"  1 
ATOM   186  H  "H2''" . DC  A 1 6  ? -14.396 7.285   -13.241 1.00 46.13  ? 6   DC  L "H2''" 1 
ATOM   187  H  "H1'"  . DC  A 1 6  ? -15.186 6.163   -15.098 1.00 48.21  ? 6   DC  L "H1'"  1 
ATOM   188  H  H41    . DC  A 1 6  ? -9.278  3.614   -15.792 1.00 51.65  ? 6   DC  L H41    1 
ATOM   189  H  H42    . DC  A 1 6  ? -10.219 2.537   -16.211 1.00 51.65  ? 6   DC  L H42    1 
ATOM   190  H  H5     . DC  A 1 6  ? -10.034 5.836   -15.182 1.00 47.04  ? 6   DC  L H5     1 
ATOM   191  H  H6     . DC  A 1 6  ? -11.843 7.181   -14.915 1.00 51.91  ? 6   DC  L H6     1 
ATOM   192  P  P      . DA  A 1 7  ? -17.775 8.635   -13.219 1.00 45.62  ? 7   DA  L P      1 
ATOM   193  O  OP1    . DA  A 1 7  ? -18.436 9.696   -14.012 1.00 53.32  ? 7   DA  L OP1    1 
ATOM   194  O  OP2    . DA  A 1 7  ? -17.186 8.908   -11.873 1.00 52.13  ? 7   DA  L OP2    1 
ATOM   195  O  "O5'"  . DA  A 1 7  ? -18.788 7.422   -13.063 1.00 42.43  ? 7   DA  L "O5'"  1 
ATOM   196  C  "C5'"  . DA  A 1 7  ? -19.409 6.903   -14.201 1.00 39.75  ? 7   DA  L "C5'"  1 
ATOM   197  C  "C4'"  . DA  A 1 7  ? -19.749 5.445   -13.990 1.00 44.06  ? 7   DA  L "C4'"  1 
ATOM   198  O  "O4'"  . DA  A 1 7  ? -18.561 4.632   -14.155 1.00 39.47  ? 7   DA  L "O4'"  1 
ATOM   199  C  "C3'"  . DA  A 1 7  ? -20.295 5.104   -12.608 1.00 46.79  ? 7   DA  L "C3'"  1 
ATOM   200  O  "O3'"  . DA  A 1 7  ? -21.365 4.159   -12.738 1.00 42.99  ? 7   DA  L "O3'"  1 
ATOM   201  C  "C2'"  . DA  A 1 7  ? -19.072 4.530   -11.876 1.00 44.63  ? 7   DA  L "C2'"  1 
ATOM   202  C  "C1'"  . DA  A 1 7  ? -18.318 3.851   -13.006 1.00 40.64  ? 7   DA  L "C1'"  1 
ATOM   203  N  N9     . DA  A 1 7  ? -16.888 3.803   -12.870 1.00 39.16  ? 7   DA  L N9     1 
ATOM   204  C  C8     . DA  A 1 7  ? -16.057 4.859   -12.631 1.00 39.31  ? 7   DA  L C8     1 
ATOM   205  N  N7     . DA  A 1 7  ? -14.779 4.538   -12.634 1.00 36.50  ? 7   DA  L N7     1 
ATOM   206  C  C5     . DA  A 1 7  ? -14.778 3.184   -12.928 1.00 40.29  ? 7   DA  L C5     1 
ATOM   207  C  C6     . DA  A 1 7  ? -13.739 2.262   -13.092 1.00 42.67  ? 7   DA  L C6     1 
ATOM   208  N  N6     . DA  A 1 7  ? -12.458 2.590   -12.940 1.00 46.77  ? 7   DA  L N6     1 
ATOM   209  N  N1     . DA  A 1 7  ? -14.064 0.986   -13.409 1.00 47.10  ? 7   DA  L N1     1 
ATOM   210  C  C2     . DA  A 1 7  ? -15.357 0.662   -13.528 1.00 45.80  ? 7   DA  L C2     1 
ATOM   211  N  N3     . DA  A 1 7  ? -16.431 1.443   -13.388 1.00 44.77  ? 7   DA  L N3     1 
ATOM   212  C  C4     . DA  A 1 7  ? -16.066 2.712   -13.093 1.00 44.40  ? 7   DA  L C4     1 
ATOM   213  H  "H5'"  . DA  A 1 7  ? -18.810 6.986   -14.960 1.00 48.57  ? 7   DA  L "H5'"  1 
ATOM   214  H  "H5''" . DA  A 1 7  ? -20.223 7.400   -14.378 1.00 48.57  ? 7   DA  L "H5''" 1 
ATOM   215  H  "H4'"  . DA  A 1 7  ? -20.403 5.180   -14.655 1.00 53.74  ? 7   DA  L "H4'"  1 
ATOM   216  H  "H3'"  . DA  A 1 7  ? -20.607 5.907   -12.162 1.00 57.02  ? 7   DA  L "H3'"  1 
ATOM   217  H  "H2'"  . DA  A 1 7  ? -18.540 5.239   -11.483 1.00 54.43  ? 7   DA  L "H2'"  1 
ATOM   218  H  "H2''" . DA  A 1 7  ? -19.342 3.884   -11.204 1.00 54.43  ? 7   DA  L "H2''" 1 
ATOM   219  H  "H1'"  . DA  A 1 7  ? -18.665 2.956   -13.141 1.00 49.64  ? 7   DA  L "H1'"  1 
ATOM   220  H  H8     . DA  A 1 7  ? -16.365 5.718   -12.450 1.00 48.05  ? 7   DA  L H8     1 
ATOM   221  H  H61    . DA  A 1 7  ? -11.846 1.994   -13.042 1.00 57.00  ? 7   DA  L H61    1 
ATOM   222  H  H62    . DA  A 1 7  ? -12.242 3.398   -12.739 1.00 57.00  ? 7   DA  L H62    1 
ATOM   223  H  H2     . DA  A 1 7  ? -15.531 -0.228  -13.735 1.00 55.83  ? 7   DA  L H2     1 
ATOM   224  P  P      . DG  A 1 8  ? -22.247 3.734   -11.463 1.00 44.25  ? 8   DG  L P      1 
ATOM   225  O  OP1    . DG  A 1 8  ? -23.492 3.148   -12.027 1.00 48.12  ? 8   DG  L OP1    1 
ATOM   226  O  OP2    . DG  A 1 8  ? -22.270 4.812   -10.433 1.00 40.38  ? 8   DG  L OP2    1 
ATOM   227  O  "O5'"  . DG  A 1 8  ? -21.428 2.535   -10.850 1.00 39.97  ? 8   DG  L "O5'"  1 
ATOM   228  C  "C5'"  . DG  A 1 8  ? -21.512 1.309   -11.495 1.00 36.78  ? 8   DG  L "C5'"  1 
ATOM   229  C  "C4'"  . DG  A 1 8  ? -20.533 0.319   -10.892 1.00 43.24  ? 8   DG  L "C4'"  1 
ATOM   230  O  "O4'"  . DG  A 1 8  ? -19.184 0.828   -11.048 1.00 42.47  ? 8   DG  L "O4'"  1 
ATOM   231  C  "C3'"  . DG  A 1 8  ? -20.709 0.042   -9.386  1.00 41.18  ? 8   DG  L "C3'"  1 
ATOM   232  O  "O3'"  . DG  A 1 8  ? -20.904 -1.332  -9.189  1.00 42.61  ? 8   DG  L "O3'"  1 
ATOM   233  C  "C2'"  . DG  A 1 8  ? -19.392 0.535   -8.760  1.00 43.46  ? 8   DG  L "C2'"  1 
ATOM   234  C  "C1'"  . DG  A 1 8  ? -18.435 0.423   -9.937  1.00 43.74  ? 8   DG  L "C1'"  1 
ATOM   235  N  N9     . DG  A 1 8  ? -17.251 1.254   -9.845  1.00 41.81  ? 8   DG  L N9     1 
ATOM   236  C  C8     . DG  A 1 8  ? -17.189 2.611   -9.599  1.00 44.59  ? 8   DG  L C8     1 
ATOM   237  N  N7     . DG  A 1 8  ? -15.971 3.076   -9.586  1.00 42.87  ? 8   DG  L N7     1 
ATOM   238  C  C5     . DG  A 1 8  ? -15.189 1.961   -9.835  1.00 41.84  ? 8   DG  L C5     1 
ATOM   239  C  C6     . DG  A 1 8  ? -13.795 1.841   -9.904  1.00 43.55  ? 8   DG  L C6     1 
ATOM   240  O  O6     . DG  A 1 8  ? -12.943 2.745   -9.774  1.00 39.62  ? 8   DG  L O6     1 
ATOM   241  N  N1     . DG  A 1 8  ? -13.409 0.518   -10.168 1.00 44.25  ? 8   DG  L N1     1 
ATOM   242  C  C2     . DG  A 1 8  ? -14.283 -0.539  -10.323 1.00 42.45  ? 8   DG  L C2     1 
ATOM   243  N  N2     . DG  A 1 8  ? -13.746 -1.742  -10.566 1.00 42.53  ? 8   DG  L N2     1 
ATOM   244  N  N3     . DG  A 1 8  ? -15.588 -0.428  -10.239 1.00 45.23  ? 8   DG  L N3     1 
ATOM   245  C  C4     . DG  A 1 8  ? -15.967 0.837   -9.998  1.00 41.90  ? 8   DG  L C4     1 
ATOM   246  H  "H5'"  . DG  A 1 8  ? -21.307 1.428   -12.435 1.00 45.01  ? 8   DG  L "H5'"  1 
ATOM   247  H  "H5''" . DG  A 1 8  ? -22.413 0.962   -11.405 1.00 45.01  ? 8   DG  L "H5''" 1 
ATOM   248  H  "H4'"  . DG  A 1 8  ? -20.606 -0.520  -11.373 1.00 52.76  ? 8   DG  L "H4'"  1 
ATOM   249  H  "H3'"  . DG  A 1 8  ? -21.461 0.545   -9.035  1.00 50.29  ? 8   DG  L "H3'"  1 
ATOM   250  H  "H2'"  . DG  A 1 8  ? -19.472 1.456   -8.465  1.00 53.03  ? 8   DG  L "H2'"  1 
ATOM   251  H  "H2''" . DG  A 1 8  ? -19.116 -0.043  -8.032  1.00 53.03  ? 8   DG  L "H2''" 1 
ATOM   252  H  "H1'"  . DG  A 1 8  ? -18.170 -0.503  -10.049 1.00 53.36  ? 8   DG  L "H1'"  1 
ATOM   253  H  H8     . DG  A 1 8  ? -17.941 3.143   -9.471  1.00 54.38  ? 8   DG  L H8     1 
ATOM   254  H  H1     . DG  A 1 8  ? -12.568 0.354   -10.240 1.00 53.97  ? 8   DG  L H1     1 
ATOM   255  H  H21    . DG  A 1 8  ? -14.255 -2.428  -10.664 1.00 51.91  ? 8   DG  L H21    1 
ATOM   256  H  H22    . DG  A 1 8  ? -12.893 -1.829  -10.623 1.00 51.91  ? 8   DG  L H22    1 
ATOM   257  P  P      . DC  A 1 9  ? -20.975 -1.979  -7.721  1.00 40.01  ? 9   DC  L P      1 
ATOM   258  O  OP1    . DC  A 1 9  ? -22.056 -2.982  -7.854  1.00 46.53  ? 9   DC  L OP1    1 
ATOM   259  O  OP2    . DC  A 1 9  ? -21.106 -0.962  -6.654  1.00 44.29  ? 9   DC  L OP2    1 
ATOM   260  O  "O5'"  . DC  A 1 9  ? -19.588 -2.782  -7.608  1.00 50.19  ? 9   DC  L "O5'"  1 
ATOM   261  C  "C5'"  . DC  A 1 9  ? -19.226 -3.689  -8.652  1.00 45.20  ? 9   DC  L "C5'"  1 
ATOM   262  C  "C4'"  . DC  A 1 9  ? -17.935 -4.442  -8.336  1.00 48.84  ? 9   DC  L "C4'"  1 
ATOM   263  O  "O4'"  . DC  A 1 9  ? -16.802 -3.539  -8.454  1.00 43.20  ? 9   DC  L "O4'"  1 
ATOM   264  C  "C3'"  . DC  A 1 9  ? -17.857 -5.036  -6.933  1.00 49.41  ? 9   DC  L "C3'"  1 
ATOM   265  O  "O3'"  . DC  A 1 9  ? -17.251 -6.315  -6.972  1.00 50.41  ? 9   DC  L "O3'"  1 
ATOM   266  C  "C2'"  . DC  A 1 9  ? -17.027 -4.019  -6.169  1.00 49.05  ? 9   DC  L "C2'"  1 
ATOM   267  C  "C1'"  . DC  A 1 9  ? -16.083 -3.494  -7.244  1.00 48.12  ? 9   DC  L "C1'"  1 
ATOM   268  N  N1     . DC  A 1 9  ? -15.638 -2.087  -7.048  1.00 50.36  ? 9   DC  L N1     1 
ATOM   269  C  C2     . DC  A 1 9  ? -14.259 -1.778  -7.016  1.00 45.14  ? 9   DC  L C2     1 
ATOM   270  O  O2     . DC  A 1 9  ? -13.417 -2.690  -7.130  1.00 44.00  ? 9   DC  L O2     1 
ATOM   271  N  N3     . DC  A 1 9  ? -13.886 -0.488  -6.852  1.00 43.40  ? 9   DC  L N3     1 
ATOM   272  C  C4     . DC  A 1 9  ? -14.808 0.467   -6.733  1.00 44.36  ? 9   DC  L C4     1 
ATOM   273  N  N4     . DC  A 1 9  ? -14.380 1.722   -6.590  1.00 43.14  ? 9   DC  L N4     1 
ATOM   274  C  C5     . DC  A 1 9  ? -16.212 0.179   -6.767  1.00 47.60  ? 9   DC  L C5     1 
ATOM   275  C  C6     . DC  A 1 9  ? -16.577 -1.098  -6.933  1.00 50.12  ? 9   DC  L C6     1 
ATOM   276  H  "H5'"  . DC  A 1 9  ? -19.106 -3.190  -9.475  1.00 55.12  ? 9   DC  L "H5'"  1 
ATOM   277  H  "H5''" . DC  A 1 9  ? -19.943 -4.331  -8.774  1.00 55.12  ? 9   DC  L "H5''" 1 
ATOM   278  H  "H4'"  . DC  A 1 9  ? -17.829 -5.158  -8.982  1.00 59.48  ? 9   DC  L "H4'"  1 
ATOM   279  H  "H3'"  . DC  A 1 9  ? -18.745 -5.098  -6.548  1.00 60.17  ? 9   DC  L "H3'"  1 
ATOM   280  H  "H2'"  . DC  A 1 9  ? -17.588 -3.306  -5.824  1.00 59.73  ? 9   DC  L "H2'"  1 
ATOM   281  H  "H2''" . DC  A 1 9  ? -16.530 -4.447  -5.454  1.00 59.73  ? 9   DC  L "H2''" 1 
ATOM   282  H  "H1'"  . DC  A 1 9  ? -15.308 -4.073  -7.306  1.00 58.62  ? 9   DC  L "H1'"  1 
ATOM   283  H  H41    . DC  A 1 9  ? -14.947 2.364   -6.511  1.00 52.64  ? 9   DC  L H41    1 
ATOM   284  H  H42    . DC  A 1 9  ? -13.537 1.890   -6.578  1.00 52.64  ? 9   DC  L H42    1 
ATOM   285  H  H5     . DC  A 1 9  ? -16.845 0.855   -6.688  1.00 57.99  ? 9   DC  L H5     1 
ATOM   286  H  H6     . DC  A 1 9  ? -17.480 -1.318  -6.961  1.00 61.02  ? 9   DC  L H6     1 
ATOM   287  P  P      . DT  A 1 10 ? -17.232 -7.237  -5.652  1.00 55.77  ? 10  DT  L P      1 
ATOM   288  O  OP1    . DT  A 1 10 ? -17.330 -8.633  -6.146  1.00 78.69  ? 10  DT  L OP1    1 
ATOM   289  O  OP2    . DT  A 1 10 ? -18.217 -6.696  -4.686  1.00 57.76  ? 10  DT  L OP2    1 
ATOM   290  O  "O5'"  . DT  A 1 10 ? -15.732 -7.067  -5.091  1.00 52.49  ? 10  DT  L "O5'"  1 
ATOM   291  C  "C5'"  . DT  A 1 10 ? -14.666 -7.370  -5.969  1.00 60.09  ? 10  DT  L "C5'"  1 
ATOM   292  C  "C4'"  . DT  A 1 10 ? -13.319 -7.237  -5.305  1.00 49.97  ? 10  DT  L "C4'"  1 
ATOM   293  O  "O4'"  . DT  A 1 10 ? -12.954 -5.840  -5.241  1.00 51.29  ? 10  DT  L "O4'"  1 
ATOM   294  C  "C3'"  . DT  A 1 10 ? -13.227 -7.766  -3.884  1.00 53.05  ? 10  DT  L "C3'"  1 
ATOM   295  O  "O3'"  . DT  A 1 10 ? -12.031 -8.527  -3.745  1.00 56.29  ? 10  DT  L "O3'"  1 
ATOM   296  C  "C2'"  . DT  A 1 10 ? -13.235 -6.507  -3.014  1.00 51.79  ? 10  DT  L "C2'"  1 
ATOM   297  C  "C1'"  . DT  A 1 10 ? -12.566 -5.490  -3.933  1.00 51.53  ? 10  DT  L "C1'"  1 
ATOM   298  N  N1     . DT  A 1 10 ? -12.943 -4.076  -3.733  1.00 40.63  ? 10  DT  L N1     1 
ATOM   299  C  C2     . DT  A 1 10 ? -11.951 -3.133  -3.702  1.00 35.89  ? 10  DT  L C2     1 
ATOM   300  O  O2     . DT  A 1 10 ? -10.759 -3.393  -3.788  1.00 40.87  ? 10  DT  L O2     1 
ATOM   301  N  N3     . DT  A 1 10 ? -12.391 -1.862  -3.576  1.00 36.59  ? 10  DT  L N3     1 
ATOM   302  C  C4     . DT  A 1 10 ? -13.689 -1.443  -3.439  1.00 35.10  ? 10  DT  L C4     1 
ATOM   303  O  O4     . DT  A 1 10 ? -13.980 -0.268  -3.320  1.00 40.98  ? 10  DT  L O4     1 
ATOM   304  C  C5     . DT  A 1 10 ? -14.677 -2.461  -3.475  1.00 38.26  ? 10  DT  L C5     1 
ATOM   305  C  C7     . DT  A 1 10 ? -16.105 -2.091  -3.339  1.00 43.12  ? 10  DT  L C7     1 
ATOM   306  C  C6     . DT  A 1 10 ? -14.272 -3.726  -3.629  1.00 42.77  ? 10  DT  L C6     1 
ATOM   307  H  "H5'"  . DT  A 1 10 ? -14.703 -6.767  -6.727  1.00 72.98  ? 10  DT  L "H5'"  1 
ATOM   308  H  "H5''" . DT  A 1 10 ? -14.771 -8.281  -6.286  1.00 72.98  ? 10  DT  L "H5''" 1 
ATOM   309  H  "H4'"  . DT  A 1 10 ? -12.663 -7.702  -5.848  1.00 60.83  ? 10  DT  L "H4'"  1 
ATOM   310  H  "H3'"  . DT  A 1 10 ? -14.000 -8.316  -3.683  1.00 64.53  ? 10  DT  L "H3'"  1 
ATOM   311  H  "H2'"  . DT  A 1 10 ? -14.142 -6.238  -2.802  1.00 63.02  ? 10  DT  L "H2'"  1 
ATOM   312  H  "H2''" . DT  A 1 10 ? -12.713 -6.641  -2.207  1.00 63.02  ? 10  DT  L "H2''" 1 
ATOM   313  H  "H1'"  . DT  A 1 10 ? -11.603 -5.576  -3.854  1.00 62.71  ? 10  DT  L "H1'"  1 
ATOM   314  H  H3     . DT  A 1 10 ? -11.787 -1.252  -3.536  1.00 44.78  ? 10  DT  L H3     1 
ATOM   315  H  H71    . DT  A 1 10 ? -16.182 -1.130  -3.235  1.00 52.62  ? 10  DT  L H71    1 
ATOM   316  H  H72    . DT  A 1 10 ? -16.589 -2.371  -4.132  1.00 52.62  ? 10  DT  L H72    1 
ATOM   317  H  H73    . DT  A 1 10 ? -16.480 -2.531  -2.560  1.00 52.62  ? 10  DT  L H73    1 
ATOM   318  H  H6     . DT  A 1 10 ? -14.914 -4.399  -3.655  1.00 52.20  ? 10  DT  L H6     1 
ATOM   319  P  P      . DG  A 1 11 ? -11.726 -9.286  -2.366  1.00 60.57  ? 11  DG  L P      1 
ATOM   320  O  OP1    . DG  A 1 11 ? -10.913 -10.477 -2.708  1.00 62.73  ? 11  DG  L OP1    1 
ATOM   321  O  OP2    . DG  A 1 11 ? -12.997 -9.398  -1.588  1.00 50.67  ? 11  DG  L OP2    1 
ATOM   322  O  "O5'"  . DG  A 1 11 ? -10.777 -8.281  -1.597  1.00 48.99  ? 11  DG  L "O5'"  1 
ATOM   323  C  "C5'"  . DG  A 1 11 ? -9.705  -7.674  -2.265  1.00 50.71  ? 11  DG  L "C5'"  1 
ATOM   324  C  "C4'"  . DG  A 1 11 ? -9.065  -6.668  -1.347  1.00 53.16  ? 11  DG  L "C4'"  1 
ATOM   325  O  "O4'"  . DG  A 1 11 ? -9.803  -5.410  -1.409  1.00 52.75  ? 11  DG  L "O4'"  1 
ATOM   326  C  "C3'"  . DG  A 1 11 ? -9.065  -7.102  0.130   1.00 60.48  ? 11  DG  L "C3'"  1 
ATOM   327  O  "O3'"  . DG  A 1 11 ? -7.730  -7.029  0.642   1.00 69.14  ? 11  DG  L "O3'"  1 
ATOM   328  C  "C2'"  . DG  A 1 11 ? -10.059 -6.132  0.823   1.00 46.25  ? 11  DG  L "C2'"  1 
ATOM   329  C  "C1'"  . DG  A 1 11 ? -10.006 -4.903  -0.091  1.00 48.23  ? 11  DG  L "C1'"  1 
ATOM   330  N  N9     . DG  A 1 11 ? -11.213 -4.061  -0.102  1.00 42.24  ? 11  DG  L N9     1 
ATOM   331  C  C8     . DG  A 1 11 ? -12.535 -4.464  -0.177  1.00 41.24  ? 11  DG  L C8     1 
ATOM   332  N  N7     . DG  A 1 11 ? -13.384 -3.456  -0.221  1.00 39.02  ? 11  DG  L N7     1 
ATOM   333  C  C5     . DG  A 1 11 ? -12.571 -2.331  -0.223  1.00 34.69  ? 11  DG  L C5     1 
ATOM   334  C  C6     . DG  A 1 11 ? -12.908 -0.971  -0.251  1.00 32.60  ? 11  DG  L C6     1 
ATOM   335  O  O6     . DG  A 1 11 ? -14.019 -0.470  -0.268  1.00 38.76  ? 11  DG  L O6     1 
ATOM   336  N  N1     . DG  A 1 11 ? -11.785 -0.154  -0.242  1.00 35.89  ? 11  DG  L N1     1 
ATOM   337  C  C2     . DG  A 1 11 ? -10.484 -0.613  -0.156  1.00 33.89  ? 11  DG  L C2     1 
ATOM   338  N  N2     . DG  A 1 11 ? -9.516  0.312   -0.135  1.00 34.12  ? 11  DG  L N2     1 
ATOM   339  N  N3     . DG  A 1 11 ? -10.156 -1.888  -0.110  1.00 30.63  ? 11  DG  L N3     1 
ATOM   340  C  C4     . DG  A 1 11 ? -11.238 -2.687  -0.154  1.00 36.58  ? 11  DG  L C4     1 
ATOM   341  H  "H5'"  . DG  A 1 11 ? -10.030 -7.227  -3.062  1.00 61.73  ? 11  DG  L "H5'"  1 
ATOM   342  H  "H5''" . DG  A 1 11 ? -9.053  -8.348  -2.513  1.00 61.73  ? 11  DG  L "H5''" 1 
ATOM   343  H  "H4'"  . DG  A 1 11 ? -8.151  -6.514  -1.633  1.00 64.67  ? 11  DG  L "H4'"  1 
ATOM   344  H  "H3'"  . DG  A 1 11 ? -9.393  -8.011  0.203   1.00 73.45  ? 11  DG  L "H3'"  1 
ATOM   345  H  "H2'"  . DG  A 1 11 ? -10.952 -6.509  0.843   1.00 56.37  ? 11  DG  L "H2'"  1 
ATOM   346  H  "H2''" . DG  A 1 11 ? -9.756  -5.909  1.718   1.00 56.37  ? 11  DG  L "H2''" 1 
ATOM   347  H  "H1'"  . DG  A 1 11 ? -9.243  -4.358  0.157   1.00 58.75  ? 11  DG  L "H1'"  1 
ATOM   348  H  H8     . DG  A 1 11 ? -12.800 -5.356  -0.168  1.00 50.36  ? 11  DG  L H8     1 
ATOM   349  H  H1     . DG  A 1 11 ? -11.910 0.697   -0.232  1.00 43.94  ? 11  DG  L H1     1 
ATOM   350  H  H21    . DG  A 1 11 ? -8.692  0.070   -0.093  1.00 41.81  ? 11  DG  L H21    1 
ATOM   351  H  H22    . DG  A 1 11 ? -9.719  1.147   -0.164  1.00 41.81  ? 11  DG  L H22    1 
ATOM   352  P  P      . DT  A 1 12 ? -7.368  -7.574  2.110   1.00 62.66  ? 12  DT  L P      1 
ATOM   353  O  OP1    . DT  A 1 12 ? -5.984  -8.095  1.922   1.00 61.37  ? 12  DT  L OP1    1 
ATOM   354  O  OP2    . DT  A 1 12 ? -8.507  -8.367  2.641   1.00 55.77  ? 12  DT  L OP2    1 
ATOM   355  O  "O5'"  . DT  A 1 12 ? -7.217  -6.244  2.975   1.00 54.19  ? 12  DT  L "O5'"  1 
ATOM   356  C  "C5'"  . DT  A 1 12 ? -6.451  -5.177  2.423   1.00 55.26  ? 12  DT  L "C5'"  1 
ATOM   357  C  "C4'"  . DT  A 1 12 ? -6.898  -3.853  2.978   1.00 54.60  ? 12  DT  L "C4'"  1 
ATOM   358  O  "O4'"  . DT  A 1 12 ? -8.251  -3.571  2.580   1.00 51.68  ? 12  DT  L "O4'"  1 
ATOM   359  C  "C3'"  . DT  A 1 12 ? -6.919  -3.766  4.499   1.00 61.14  ? 12  DT  L "C3'"  1 
ATOM   360  O  "O3'"  . DT  A 1 12 ? -5.769  -3.062  4.937   1.00 70.08  ? 12  DT  L "O3'"  1 
ATOM   361  C  "C2'"  . DT  A 1 12 ? -8.228  -3.031  4.816   1.00 50.65  ? 12  DT  L "C2'"  1 
ATOM   362  C  "C1'"  . DT  A 1 12 ? -8.694  -2.569  3.435   1.00 46.38  ? 12  DT  L "C1'"  1 
ATOM   363  N  N1     . DT  A 1 12 ? -10.203 -2.373  3.298   1.00 41.61  ? 12  DT  L N1     1 
ATOM   364  C  C2     . DT  A 1 12 ? -10.678 -1.089  3.140   1.00 43.93  ? 12  DT  L C2     1 
ATOM   365  O  O2     . DT  A 1 12 ? -9.930  -0.106  3.071   1.00 47.71  ? 12  DT  L O2     1 
ATOM   366  N  N3     . DT  A 1 12 ? -12.050 -0.979  3.058   1.00 43.43  ? 12  DT  L N3     1 
ATOM   367  C  C4     . DT  A 1 12 ? -12.973 -2.004  3.137   1.00 44.27  ? 12  DT  L C4     1 
ATOM   368  O  O4     . DT  A 1 12 ? -14.198 -1.804  3.051   1.00 45.62  ? 12  DT  L O4     1 
ATOM   369  C  C5     . DT  A 1 12 ? -12.400 -3.331  3.328   1.00 43.44  ? 12  DT  L C5     1 
ATOM   370  C  C7     . DT  A 1 12 ? -13.296 -4.525  3.426   1.00 43.53  ? 12  DT  L C7     1 
ATOM   371  C  C6     . DT  A 1 12 ? -11.061 -3.452  3.379   1.00 38.31  ? 12  DT  L C6     1 
ATOM   372  H  "H5'"  . DT  A 1 12 ? -6.559  -5.172  1.460   1.00 67.18  ? 12  DT  L "H5'"  1 
ATOM   373  H  "H5''" . DT  A 1 12 ? -5.515  -5.312  2.638   1.00 67.18  ? 12  DT  L "H5''" 1 
ATOM   374  H  "H4'"  . DT  A 1 12 ? -6.318  -3.156  2.632   1.00 66.39  ? 12  DT  L "H4'"  1 
ATOM   375  H  "H3'"  . DT  A 1 12 ? -6.934  -4.657  4.883   1.00 74.25  ? 12  DT  L "H3'"  1 
ATOM   376  H  "H2'"  . DT  A 1 12 ? -8.875  -3.636  5.213   1.00 61.65  ? 12  DT  L "H2'"  1 
ATOM   377  H  "H2''" . DT  A 1 12 ? -8.064  -2.271  5.396   1.00 61.65  ? 12  DT  L "H2''" 1 
ATOM   378  H  "H1'"  . DT  A 1 12 ? -8.245  -1.739  3.210   1.00 56.53  ? 12  DT  L "H1'"  1 
ATOM   379  H  H3     . DT  A 1 12 ? -12.366 -0.186  2.952   1.00 52.99  ? 12  DT  L H3     1 
ATOM   380  H  H71    . DT  A 1 12 ? -13.083 -5.148  2.714   1.00 53.11  ? 12  DT  L H71    1 
ATOM   381  H  H72    . DT  A 1 12 ? -13.166 -4.958  4.284   1.00 53.11  ? 12  DT  L H72    1 
ATOM   382  H  H73    . DT  A 1 12 ? -14.221 -4.243  3.343   1.00 53.11  ? 12  DT  L H73    1 
ATOM   383  H  H6     . DT  A 1 12 ? -10.698 -4.296  3.519   1.00 46.84  ? 12  DT  L H6     1 
ATOM   384  P  P      . DC  A 1 13 ? -5.323  -3.057  6.478   1.00 66.23  ? 13  DC  L P      1 
ATOM   385  O  OP1    . DC  A 1 13 ? -3.889  -3.410  6.316   1.00 66.83  ? 13  DC  L OP1    1 
ATOM   386  O  OP2    . DC  A 1 13 ? -6.260  -3.780  7.394   1.00 51.81  ? 13  DC  L OP2    1 
ATOM   387  O  "O5'"  . DC  A 1 13 ? -5.460  -1.518  6.880   1.00 57.33  ? 13  DC  L "O5'"  1 
ATOM   388  C  "C5'"  . DC  A 1 13 ? -5.207  -0.527  5.899   1.00 49.32  ? 13  DC  L "C5'"  1 
ATOM   389  C  "C4'"  . DC  A 1 13 ? -5.844  0.770   6.304   1.00 53.79  ? 13  DC  L "C4'"  1 
ATOM   390  O  "O4'"  . DC  A 1 13 ? -7.227  0.741   5.892   1.00 49.76  ? 13  DC  L "O4'"  1 
ATOM   391  C  "C3'"  . DC  A 1 13 ? -5.862  1.040   7.820   1.00 54.03  ? 13  DC  L "C3'"  1 
ATOM   392  O  "O3'"  . DC  A 1 13 ? -5.534  2.391   8.082   1.00 59.73  ? 13  DC  L "O3'"  1 
ATOM   393  C  "C2'"  . DC  A 1 13 ? -7.289  0.727   8.203   1.00 51.05  ? 13  DC  L "C2'"  1 
ATOM   394  C  "C1'"  . DC  A 1 13 ? -8.031  1.144   6.940   1.00 49.49  ? 13  DC  L "C1'"  1 
ATOM   395  N  N1     . DC  A 1 13 ? -9.372  0.541   6.788   1.00 48.03  ? 13  DC  L N1     1 
ATOM   396  C  C2     . DC  A 1 13 ? -10.431 1.353   6.420   1.00 49.43  ? 13  DC  L C2     1 
ATOM   397  O  O2     . DC  A 1 13 ? -10.206 2.558   6.200   1.00 48.80  ? 13  DC  L O2     1 
ATOM   398  N  N3     . DC  A 1 13 ? -11.682 0.803   6.321   1.00 44.57  ? 13  DC  L N3     1 
ATOM   399  C  C4     . DC  A 1 13 ? -11.855 -0.492  6.568   1.00 40.44  ? 13  DC  L C4     1 
ATOM   400  N  N4     . DC  A 1 13 ? -13.076 -0.983  6.473   1.00 43.72  ? 13  DC  L N4     1 
ATOM   401  C  C5     . DC  A 1 13 ? -10.780 -1.339  6.937   1.00 44.56  ? 13  DC  L C5     1 
ATOM   402  C  C6     . DC  A 1 13 ? -9.568  -0.785  7.046   1.00 51.03  ? 13  DC  L C6     1 
ATOM   403  H  "H5'"  . DC  A 1 13 ? -5.574  -0.814  5.048   1.00 60.06  ? 13  DC  L "H5'"  1 
ATOM   404  H  "H5''" . DC  A 1 13 ? -4.249  -0.400  5.809   1.00 60.06  ? 13  DC  L "H5''" 1 
ATOM   405  H  "H4'"  . DC  A 1 13 ? -5.393  1.501   5.855   1.00 65.43  ? 13  DC  L "H4'"  1 
ATOM   406  H  "H3'"  . DC  A 1 13 ? -5.248  0.445   8.278   1.00 65.71  ? 13  DC  L "H3'"  1 
ATOM   407  H  "H2'"  . DC  A 1 13 ? -7.402  -0.221  8.375   1.00 62.13  ? 13  DC  L "H2'"  1 
ATOM   408  H  "H2''" . DC  A 1 13 ? -7.570  1.259   8.963   1.00 62.13  ? 13  DC  L "H2''" 1 
ATOM   409  H  "H1'"  . DC  A 1 13 ? -8.113  2.111   6.925   1.00 60.26  ? 13  DC  L "H1'"  1 
ATOM   410  H  H41    . DC  A 1 13 ? -13.217 -1.817  6.627   1.00 53.33  ? 13  DC  L H41    1 
ATOM   411  H  H42    . DC  A 1 13 ? -13.730 -0.469  6.256   1.00 53.33  ? 13  DC  L H42    1 
ATOM   412  H  H5     . DC  A 1 13 ? -10.918 -2.240  7.122   1.00 54.35  ? 13  DC  L H5     1 
ATOM   413  H  H6     . DC  A 1 13 ? -8.845  -1.313  7.299   1.00 62.11  ? 13  DC  L H6     1 
ATOM   414  P  P      . DA  A 1 14 ? -5.141  2.911   9.559   1.00 64.78  ? 14  DA  L P      1 
ATOM   415  O  OP1    . DA  A 1 14 ? -4.010  3.847   9.307   1.00 57.55  ? 14  DA  L OP1    1 
ATOM   416  O  OP2    . DA  A 1 14 ? -5.133  1.815   10.561  1.00 50.17  ? 14  DA  L OP2    1 
ATOM   417  O  "O5'"  . DA  A 1 14 ? -6.373  3.826   9.942   1.00 62.11  ? 14  DA  L "O5'"  1 
ATOM   418  C  "C5'"  . DA  A 1 14 ? -6.767  4.821   9.025   1.00 64.09  ? 14  DA  L "C5'"  1 
ATOM   419  C  "C4'"  . DA  A 1 14 ? -8.092  5.377   9.426   1.00 66.46  ? 14  DA  L "C4'"  1 
ATOM   420  O  "O4'"  . DA  A 1 14 ? -9.116  4.397   9.103   1.00 65.08  ? 14  DA  L "O4'"  1 
ATOM   421  C  "C3'"  . DA  A 1 14 ? -8.204  5.669   10.925  1.00 66.88  ? 14  DA  L "C3'"  1 
ATOM   422  O  "O3'"  . DA  A 1 14 ? -8.827  6.931   11.143  1.00 67.46  ? 14  DA  L "O3'"  1 
ATOM   423  C  "C2'"  . DA  A 1 14 ? -9.020  4.497   11.460  1.00 57.95  ? 14  DA  L "C2'"  1 
ATOM   424  C  "C1'"  . DA  A 1 14 ? -9.862  4.091   10.254  1.00 59.46  ? 14  DA  L "C1'"  1 
ATOM   425  N  N9     . DA  A 1 14 ? -10.226 2.685   10.241  1.00 55.72  ? 14  DA  L N9     1 
ATOM   426  C  C8     . DA  A 1 14 ? -9.464  1.578   10.552  1.00 57.11  ? 14  DA  L C8     1 
ATOM   427  N  N7     . DA  A 1 14 ? -10.131 0.430   10.462  1.00 47.33  ? 14  DA  L N7     1 
ATOM   428  C  C5     . DA  A 1 14 ? -11.385 0.843   10.077  1.00 47.24  ? 14  DA  L C5     1 
ATOM   429  C  C6     . DA  A 1 14 ? -12.557 0.151   9.812   1.00 46.74  ? 14  DA  L C6     1 
ATOM   430  N  N6     . DA  A 1 14 ? -12.663 -1.182  9.887   1.00 46.19  ? 14  DA  L N6     1 
ATOM   431  N  N1     . DA  A 1 14 ? -13.625 0.882   9.449   1.00 48.80  ? 14  DA  L N1     1 
ATOM   432  C  C2     . DA  A 1 14 ? -13.494 2.216   9.349   1.00 48.80  ? 14  DA  L C2     1 
ATOM   433  N  N3     . DA  A 1 14 ? -12.450 2.967   9.583   1.00 45.28  ? 14  DA  L N3     1 
ATOM   434  C  C4     . DA  A 1 14 ? -11.433 2.225   9.934   1.00 45.87  ? 14  DA  L C4     1 
ATOM   435  H  "H5'"  . DA  A 1 14 ? -6.835  4.433   8.138   1.00 77.78  ? 14  DA  L "H5'"  1 
ATOM   436  H  "H5''" . DA  A 1 14 ? -6.107  5.532   9.016   1.00 77.78  ? 14  DA  L "H5''" 1 
ATOM   437  H  "H4'"  . DA  A 1 14 ? -8.261  6.192   8.928   1.00 80.62  ? 14  DA  L "H4'"  1 
ATOM   438  H  "H3'"  . DA  A 1 14 ? -7.321  5.664   11.326  1.00 81.13  ? 14  DA  L "H3'"  1 
ATOM   439  H  "H2'"  . DA  A 1 14 ? -8.438  3.771   11.733  1.00 70.41  ? 14  DA  L "H2'"  1 
ATOM   440  H  "H2''" . DA  A 1 14 ? -9.587  4.781   12.195  1.00 70.41  ? 14  DA  L "H2''" 1 
ATOM   441  H  "H1'"  . DA  A 1 14 ? -10.674 4.623   10.249  1.00 72.22  ? 14  DA  L "H1'"  1 
ATOM   442  H  H8     . DA  A 1 14 ? -8.571  1.629   10.808  1.00 69.40  ? 14  DA  L H8     1 
ATOM   443  H  H61    . DA  A 1 14 ? -13.411 -1.565  9.702   1.00 56.30  ? 14  DA  L H61    1 
ATOM   444  H  H62    . DA  A 1 14 ? -11.983 -1.655  10.119  1.00 56.30  ? 14  DA  L H62    1 
ATOM   445  H  H2     . DA  A 1 14 ? -14.265 2.674   9.102   1.00 59.44  ? 14  DA  L H2     1 
ATOM   446  P  P      . DA  A 1 15 ? -9.111  7.460   12.636  1.00 80.67  ? 15  DA  L P      1 
ATOM   447  O  OP1    . DA  A 1 15 ? -9.186  8.944   12.493  1.00 67.60  ? 15  DA  L OP1    1 
ATOM   448  O  OP2    . DA  A 1 15 ? -8.192  6.782   13.621  1.00 45.93  ? 15  DA  L OP2    1 
ATOM   449  O  "O5'"  . DA  A 1 15 ? -10.620 7.101   12.802  1.00 59.69  ? 15  DA  L "O5'"  1 
ATOM   450  C  "C5'"  . DA  A 1 15 ? -11.407 7.321   11.698  1.00 64.25  ? 15  DA  L "C5'"  1 
ATOM   451  C  "C4'"  . DA  A 1 15 ? -12.845 7.307   12.067  1.00 62.85  ? 15  DA  L "C4'"  1 
ATOM   452  O  "O4'"  . DA  A 1 15 ? -13.334 5.960   11.907  1.00 54.12  ? 15  DA  L "O4'"  1 
ATOM   453  C  "C3'"  . DA  A 1 15 ? -13.104 7.732   13.513  1.00 62.51  ? 15  DA  L "C3'"  1 
ATOM   454  O  "O3'"  . DA  A 1 15 ? -14.182 8.613   13.565  1.00 64.92  ? 15  DA  L "O3'"  1 
ATOM   455  C  "C2'"  . DA  A 1 15 ? -13.345 6.411   14.247  1.00 49.04  ? 15  DA  L "C2'"  1 
ATOM   456  C  "C1'"  . DA  A 1 15 ? -13.703 5.414   13.145  1.00 62.98  ? 15  DA  L "C1'"  1 
ATOM   457  N  N9     . DA  A 1 15 ? -13.001 4.137   13.271  1.00 59.93  ? 15  DA  L N9     1 
ATOM   458  C  C8     . DA  A 1 15 ? -11.671 3.894   13.619  1.00 58.57  ? 15  DA  L C8     1 
ATOM   459  N  N7     . DA  A 1 15 ? -11.345 2.606   13.620  1.00 45.32  ? 15  DA  L N7     1 
ATOM   460  C  C5     . DA  A 1 15 ? -12.530 1.996   13.240  1.00 49.75  ? 15  DA  L C5     1 
ATOM   461  C  C6     . DA  A 1 15 ? -12.869 0.659   13.045  1.00 51.93  ? 15  DA  L C6     1 
ATOM   462  N  N6     . DA  A 1 15 ? -11.994 -0.343  13.238  1.00 52.51  ? 15  DA  L N6     1 
ATOM   463  N  N1     . DA  A 1 15 ? -14.152 0.396   12.650  1.00 50.95  ? 15  DA  L N1     1 
ATOM   464  C  C2     . DA  A 1 15 ? -14.999 1.450   12.467  1.00 49.29  ? 15  DA  L C2     1 
ATOM   465  N  N3     . DA  A 1 15 ? -14.783 2.733   12.624  1.00 47.19  ? 15  DA  L N3     1 
ATOM   466  C  C4     . DA  A 1 15 ? -13.537 2.942   13.006  1.00 50.15  ? 15  DA  L C4     1 
ATOM   467  H  "H5'"  . DA  A 1 15 ? -11.240 6.626   11.042  1.00 77.97  ? 15  DA  L "H5'"  1 
ATOM   468  H  "H5''" . DA  A 1 15 ? -11.185 8.183   11.313  1.00 77.97  ? 15  DA  L "H5''" 1 
ATOM   469  H  "H4'"  . DA  A 1 15 ? -13.333 7.896   11.470  1.00 76.30  ? 15  DA  L "H4'"  1 
ATOM   470  H  "H3'"  . DA  A 1 15 ? -12.312 8.164   13.871  1.00 75.88  ? 15  DA  L "H3'"  1 
ATOM   471  H  "H2'"  . DA  A 1 15 ? -12.540 6.129   14.709  1.00 59.72  ? 15  DA  L "H2'"  1 
ATOM   472  H  "H2''" . DA  A 1 15 ? -14.081 6.502   14.873  1.00 59.72  ? 15  DA  L "H2''" 1 
ATOM   473  H  "H1'"  . DA  A 1 15 ? -14.660 5.256   13.153  1.00 76.44  ? 15  DA  L "H1'"  1 
ATOM   474  H  H8     . DA  A 1 15 ? -11.074 4.569   13.851  1.00 71.16  ? 15  DA  L H8     1 
ATOM   475  H  H61    . DA  A 1 15 ? -12.239 -1.158  13.114  1.00 63.88  ? 15  DA  L H61    1 
ATOM   476  H  H62    . DA  A 1 15 ? -11.189 -0.169  13.486  1.00 63.88  ? 15  DA  L H62    1 
ATOM   477  H  H2     . DA  A 1 15 ? -15.862 1.223   12.204  1.00 60.02  ? 15  DA  L H2     1 
ATOM   478  P  P      . DT  A 1 16 ? -14.988 8.854   14.919  1.00 49.86  ? 16  DT  L P      1 
ATOM   479  O  OP1    . DT  A 1 16 ? -15.670 10.161  14.796  1.00 50.58  ? 16  DT  L OP1    1 
ATOM   480  O  OP2    . DT  A 1 16 ? -14.105 8.606   16.087  1.00 64.10  ? 16  DT  L OP2    1 
ATOM   481  O  "O5'"  . DT  A 1 16 ? -16.060 7.717   14.825  1.00 52.07  ? 16  DT  L "O5'"  1 
ATOM   482  C  "C5'"  . DT  A 1 16 ? -16.985 7.681   15.760  1.00 61.62  ? 16  DT  L "C5'"  1 
ATOM   483  C  "C4'"  . DT  A 1 16 ? -18.098 6.760   15.392  1.00 53.83  ? 16  DT  L "C4'"  1 
ATOM   484  O  "O4'"  . DT  A 1 16 ? -17.579 5.489   14.904  1.00 52.67  ? 16  DT  L "O4'"  1 
ATOM   485  C  "C3'"  . DT  A 1 16 ? -18.930 6.405   16.591  1.00 60.43  ? 16  DT  L "C3'"  1 
ATOM   486  O  "O3'"  . DT  A 1 16 ? -20.255 6.076   16.200  1.00 60.83  ? 16  DT  L "O3'"  1 
ATOM   487  C  "C2'"  . DT  A 1 16 ? -18.134 5.225   17.131  1.00 55.24  ? 16  DT  L "C2'"  1 
ATOM   488  C  "C1'"  . DT  A 1 16 ? -17.926 4.480   15.863  1.00 53.10  ? 16  DT  L "C1'"  1 
ATOM   489  N  N1     . DT  A 1 16 ? -16.904 3.447   15.932  1.00 51.03  ? 16  DT  L N1     1 
ATOM   490  C  C2     . DT  A 1 16 ? -17.273 2.181   15.642  1.00 50.07  ? 16  DT  L C2     1 
ATOM   491  O  O2     . DT  A 1 16 ? -18.424 1.878   15.350  1.00 49.90  ? 16  DT  L O2     1 
ATOM   492  N  N3     . DT  A 1 16 ? -16.261 1.262   15.714  1.00 49.75  ? 16  DT  L N3     1 
ATOM   493  C  C4     . DT  A 1 16 ? -14.956 1.481   16.032  1.00 43.71  ? 16  DT  L C4     1 
ATOM   494  O  O4     . DT  A 1 16 ? -14.126 0.567   16.061  1.00 43.73  ? 16  DT  L O4     1 
ATOM   495  C  C5     . DT  A 1 16 ? -14.630 2.843   16.329  1.00 44.33  ? 16  DT  L C5     1 
ATOM   496  C  C7     . DT  A 1 16 ? -13.235 3.206   16.697  1.00 50.86  ? 16  DT  L C7     1 
ATOM   497  C  C6     . DT  A 1 16 ? -15.611 3.759   16.266  1.00 49.22  ? 16  DT  L C6     1 
ATOM   498  H  "H5'"  . DT  A 1 16 ? -17.342 8.574   15.887  1.00 74.82  ? 16  DT  L "H5'"  1 
ATOM   499  H  "H5''" . DT  A 1 16 ? -16.585 7.379   16.590  1.00 74.82  ? 16  DT  L "H5''" 1 
ATOM   500  H  "H4'"  . DT  A 1 16 ? -18.657 7.171   14.714  1.00 65.47  ? 16  DT  L "H4'"  1 
ATOM   501  H  "H3'"  . DT  A 1 16 ? -18.932 7.134   17.230  1.00 73.39  ? 16  DT  L "H3'"  1 
ATOM   502  H  "HO3'" . DT  A 1 16 ? -20.902 6.522   16.495  1.00 73.87  ? 16  DT  L "HO3'" 1 
ATOM   503  H  "H2'"  . DT  A 1 16 ? -17.291 5.513   17.514  1.00 67.16  ? 16  DT  L "H2'"  1 
ATOM   504  H  "H2''" . DT  A 1 16 ? -18.656 4.707   17.763  1.00 67.16  ? 16  DT  L "H2''" 1 
ATOM   505  H  "H1'"  . DT  A 1 16 ? -18.765 4.072   15.599  1.00 64.59  ? 16  DT  L "H1'"  1 
ATOM   506  H  H3     . DT  A 1 16 ? -16.475 0.449   15.535  1.00 60.57  ? 16  DT  L H3     1 
ATOM   507  H  H71    . DT  A 1 16 ? -12.888 3.847   16.058  1.00 61.90  ? 16  DT  L H71    1 
ATOM   508  H  H72    . DT  A 1 16 ? -13.226 3.596   17.585  1.00 61.90  ? 16  DT  L H72    1 
ATOM   509  H  H73    . DT  A 1 16 ? -12.681 2.409   16.689  1.00 61.90  ? 16  DT  L H73    1 
ATOM   510  H  H6     . DT  A 1 16 ? -15.402 4.646   16.453  1.00 59.94  ? 16  DT  L H6     1 
ATOM   511  P  P      . DA  B 1 1  ? -22.118 -6.230  19.181  0.00 65.64  ? 1   DA  M P      1 
ATOM   512  O  OP1    . DA  B 1 1  ? -20.643 -6.038  19.327  1.00 65.17  ? 1   DA  M OP1    1 
ATOM   513  O  OP2    . DA  B 1 1  ? -22.968 -5.030  18.991  1.00 68.89  ? 1   DA  M OP2    1 
ATOM   514  O  "O5'"  . DA  B 1 1  ? -22.610 -7.349  18.108  0.65 73.78  ? 1   DA  M "O5'"  1 
ATOM   515  C  "C5'"  . DA  B 1 1  ? -21.999 -7.473  16.775  0.57 72.98  ? 1   DA  M "C5'"  1 
ATOM   516  C  "C4'"  . DA  B 1 1  ? -21.807 -6.108  16.147  0.00 64.35  ? 1   DA  M "C4'"  1 
ATOM   517  O  "O4'"  . DA  B 1 1  ? -20.474 -5.650  16.436  1.00 59.12  ? 1   DA  M "O4'"  1 
ATOM   518  C  "C3'"  . DA  B 1 1  ? -21.930 -6.043  14.612  1.00 68.71  ? 1   DA  M "C3'"  1 
ATOM   519  O  "O3'"  . DA  B 1 1  ? -23.017 -5.189  14.219  1.00 76.08  ? 1   DA  M "O3'"  1 
ATOM   520  C  "C2'"  . DA  B 1 1  ? -20.602 -5.490  14.135  1.00 61.82  ? 1   DA  M "C2'"  1 
ATOM   521  C  "C1'"  . DA  B 1 1  ? -20.059 -4.849  15.381  1.00 60.64  ? 1   DA  M "C1'"  1 
ATOM   522  N  N9     . DA  B 1 1  ? -18.632 -4.664  15.380  1.00 51.41  ? 1   DA  M N9     1 
ATOM   523  C  C8     . DA  B 1 1  ? -17.623 -5.595  15.252  1.00 54.17  ? 1   DA  M C8     1 
ATOM   524  N  N7     . DA  B 1 1  ? -16.402 -5.056  15.214  1.00 47.29  ? 1   DA  M N7     1 
ATOM   525  C  C5     . DA  B 1 1  ? -16.669 -3.698  15.318  1.00 46.34  ? 1   DA  M C5     1 
ATOM   526  C  C6     . DA  B 1 1  ? -15.841 -2.577  15.363  1.00 46.16  ? 1   DA  M C6     1 
ATOM   527  N  N6     . DA  B 1 1  ? -14.512 -2.644  15.279  1.00 44.16  ? 1   DA  M N6     1 
ATOM   528  N  N1     . DA  B 1 1  ? -16.444 -1.366  15.477  1.00 51.46  ? 1   DA  M N1     1 
ATOM   529  C  C2     . DA  B 1 1  ? -17.802 -1.309  15.532  1.00 49.28  ? 1   DA  M C2     1 
ATOM   530  N  N3     . DA  B 1 1  ? -18.679 -2.296  15.510  1.00 42.17  ? 1   DA  M N3     1 
ATOM   531  C  C4     . DA  B 1 1  ? -18.043 -3.465  15.404  1.00 45.69  ? 1   DA  M C4     1 
ATOM   532  H  "H5'"  . DA  B 1 1  ? -22.575 -8.008  16.207  1.00 88.44  ? 1   DA  M "H5'"  1 
ATOM   533  H  "H5''" . DA  B 1 1  ? -21.137 -7.911  16.857  1.00 88.44  ? 1   DA  M "H5''" 1 
ATOM   534  H  "H4'"  . DA  B 1 1  ? -22.443 -5.490  16.539  1.00 78.09  ? 1   DA  M "H4'"  1 
ATOM   535  H  "H3'"  . DA  B 1 1  ? -22.063 -6.934  14.254  1.00 83.32  ? 1   DA  M "H3'"  1 
ATOM   536  H  "H2'"  . DA  B 1 1  ? -20.020 -6.204  13.832  1.00 75.05  ? 1   DA  M "H2'"  1 
ATOM   537  H  "H2''" . DA  B 1 1  ? -20.735 -4.829  13.437  1.00 75.05  ? 1   DA  M "H2''" 1 
ATOM   538  H  "H1'"  . DA  B 1 1  ? -20.476 -3.979  15.480  1.00 73.64  ? 1   DA  M "H1'"  1 
ATOM   539  H  H8     . DA  B 1 1  ? -17.778 -6.510  15.189  1.00 65.88  ? 1   DA  M H8     1 
ATOM   540  H  H61    . DA  B 1 1  ? -14.043 -1.924  15.298  1.00 53.86  ? 1   DA  M H61    1 
ATOM   541  H  H62    . DA  B 1 1  ? -14.124 -3.408  15.207  1.00 53.86  ? 1   DA  M H62    1 
ATOM   542  H  H2     . DA  B 1 1  ? -18.163 -0.455  15.608  1.00 60.01  ? 1   DA  M H2     1 
ATOM   543  P  P      . DT  B 1 2  ? -23.269 -4.845  12.661  1.00 85.78  ? 2   DT  M P      1 
ATOM   544  O  OP1    . DT  B 1 2  ? -24.738 -4.819  12.553  1.00 77.40  ? 2   DT  M OP1    1 
ATOM   545  O  OP2    . DT  B 1 2  ? -22.413 -5.662  11.730  1.00 58.60  ? 2   DT  M OP2    1 
ATOM   546  O  "O5'"  . DT  B 1 2  ? -22.768 -3.338  12.526  1.00 74.39  ? 2   DT  M "O5'"  1 
ATOM   547  C  "C5'"  . DT  B 1 2  ? -23.169 -2.396  13.490  1.00 61.91  ? 2   DT  M "C5'"  1 
ATOM   548  C  "C4'"  . DT  B 1 2  ? -22.747 -1.001  13.090  1.00 57.20  ? 2   DT  M "C4'"  1 
ATOM   549  O  "O4'"  . DT  B 1 2  ? -21.323 -0.837  13.348  1.00 52.79  ? 2   DT  M "O4'"  1 
ATOM   550  C  "C3'"  . DT  B 1 2  ? -22.974 -0.681  11.604  1.00 60.57  ? 2   DT  M "C3'"  1 
ATOM   551  O  "O3'"  . DT  B 1 2  ? -23.691 0.550   11.476  1.00 54.01  ? 2   DT  M "O3'"  1 
ATOM   552  C  "C2'"  . DT  B 1 2  ? -21.555 -0.645  11.000  1.00 54.47  ? 2   DT  M "C2'"  1 
ATOM   553  C  "C1'"  . DT  B 1 2  ? -20.664 -0.326  12.208  1.00 48.04  ? 2   DT  M "C1'"  1 
ATOM   554  N  N1     . DT  B 1 2  ? -19.271 -0.924  12.138  1.00 44.62  ? 2   DT  M N1     1 
ATOM   555  C  C2     . DT  B 1 2  ? -18.194 -0.093  12.247  1.00 46.99  ? 2   DT  M C2     1 
ATOM   556  O  O2     . DT  B 1 2  ? -18.297 1.121   12.398  1.00 47.00  ? 2   DT  M O2     1 
ATOM   557  N  N3     . DT  B 1 2  ? -16.971 -0.722  12.165  1.00 45.88  ? 2   DT  M N3     1 
ATOM   558  C  C4     . DT  B 1 2  ? -16.706 -2.049  11.992  1.00 45.45  ? 2   DT  M C4     1 
ATOM   559  O  O4     . DT  B 1 2  ? -15.524 -2.493  11.936  1.00 41.79  ? 2   DT  M O4     1 
ATOM   560  C  C5     . DT  B 1 2  ? -17.879 -2.883  11.883  1.00 42.67  ? 2   DT  M C5     1 
ATOM   561  C  C7     . DT  B 1 2  ? -17.726 -4.368  11.684  1.00 41.22  ? 2   DT  M C7     1 
ATOM   562  C  C6     . DT  B 1 2  ? -19.098 -2.290  11.970  1.00 45.70  ? 2   DT  M C6     1 
ATOM   563  H  "H5'"  . DT  B 1 2  ? -22.764 -2.620  14.342  1.00 75.17  ? 2   DT  M "H5'"  1 
ATOM   564  H  "H5''" . DT  B 1 2  ? -24.135 -2.423  13.580  1.00 75.17  ? 2   DT  M "H5''" 1 
ATOM   565  H  "H4'"  . DT  B 1 2  ? -23.238 -0.359  13.627  1.00 69.52  ? 2   DT  M "H4'"  1 
ATOM   566  H  "H3'"  . DT  B 1 2  ? -23.483 -1.397  11.193  1.00 73.56  ? 2   DT  M "H3'"  1 
ATOM   567  H  "H2'"  . DT  B 1 2  ? -21.323 -1.508  10.623  1.00 66.23  ? 2   DT  M "H2'"  1 
ATOM   568  H  "H2''" . DT  B 1 2  ? -21.486 0.053   10.331  1.00 66.23  ? 2   DT  M "H2''" 1 
ATOM   569  H  "H1'"  . DT  B 1 2  ? -20.587 0.637   12.295  1.00 58.52  ? 2   DT  M "H1'"  1 
ATOM   570  H  H3     . DT  B 1 2  ? -16.283 -0.210  12.231  1.00 55.93  ? 2   DT  M H3     1 
ATOM   571  H  H71    . DT  B 1 2  ? -18.147 -4.838  12.421  1.00 50.34  ? 2   DT  M H71    1 
ATOM   572  H  H72    . DT  B 1 2  ? -18.150 -4.629  10.851  1.00 50.34  ? 2   DT  M H72    1 
ATOM   573  H  H73    . DT  B 1 2  ? -16.784 -4.595  11.653  1.00 50.34  ? 2   DT  M H73    1 
ATOM   574  H  H6     . DT  B 1 2  ? -19.855 -2.824  11.890  1.00 55.72  ? 2   DT  M H6     1 
ATOM   575  P  P      . DT  B 1 3  ? -24.108 1.109   10.034  1.00 56.41  ? 3   DT  M P      1 
ATOM   576  O  OP1    . DT  B 1 3  ? -25.177 2.110   10.266  1.00 48.52  ? 3   DT  M OP1    1 
ATOM   577  O  OP2    . DT  B 1 3  ? -24.250 -0.032  9.088   1.00 51.19  ? 3   DT  M OP2    1 
ATOM   578  O  "O5'"  . DT  B 1 3  ? -22.828 1.952   9.647   1.00 53.44  ? 3   DT  M "O5'"  1 
ATOM   579  C  "C5'"  . DT  B 1 3  ? -22.409 2.892   10.587  1.00 49.75  ? 3   DT  M "C5'"  1 
ATOM   580  C  "C4'"  . DT  B 1 3  ? -21.234 3.666   10.107  1.00 42.62  ? 3   DT  M "C4'"  1 
ATOM   581  O  "O4'"  . DT  B 1 3  ? -20.048 2.846   10.207  1.00 40.94  ? 3   DT  M "O4'"  1 
ATOM   582  C  "C3'"  . DT  B 1 3  ? -21.330 4.121   8.657   1.00 49.15  ? 3   DT  M "C3'"  1 
ATOM   583  O  "O3'"  . DT  B 1 3  ? -21.269 5.492   8.648   1.00 47.03  ? 3   DT  M "O3'"  1 
ATOM   584  C  "C2'"  . DT  B 1 3  ? -20.123 3.464   7.962   1.00 43.82  ? 3   DT  M "C2'"  1 
ATOM   585  C  "C1'"  . DT  B 1 3  ? -19.196 3.164   9.150   1.00 44.42  ? 3   DT  M "C1'"  1 
ATOM   586  N  N1     . DT  B 1 3  ? -18.291 2.038   8.987   1.00 39.73  ? 3   DT  M N1     1 
ATOM   587  C  C2     . DT  B 1 3  ? -16.958 2.243   9.128   1.00 43.04  ? 3   DT  M C2     1 
ATOM   588  O  O2     . DT  B 1 3  ? -16.469 3.353   9.322   1.00 41.66  ? 3   DT  M O2     1 
ATOM   589  N  N3     . DT  B 1 3  ? -16.199 1.109   8.991   1.00 39.40  ? 3   DT  M N3     1 
ATOM   590  C  C4     . DT  B 1 3  ? -16.633 -0.172  8.776   1.00 43.11  ? 3   DT  M C4     1 
ATOM   591  O  O4     . DT  B 1 3  ? -15.854 -1.128  8.689   1.00 43.17  ? 3   DT  M O4     1 
ATOM   592  C  C5     . DT  B 1 3  ? -18.049 -0.318  8.661   1.00 42.87  ? 3   DT  M C5     1 
ATOM   593  C  C7     . DT  B 1 3  ? -18.647 -1.673  8.434   1.00 48.78  ? 3   DT  M C7     1 
ATOM   594  C  C6     . DT  B 1 3  ? -18.808 0.777   8.799   1.00 44.92  ? 3   DT  M C6     1 
ATOM   595  H  "H5'"  . DT  B 1 3  ? -22.171 2.433   11.408  1.00 60.57  ? 3   DT  M "H5'"  1 
ATOM   596  H  "H5''" . DT  B 1 3  ? -23.139 3.505   10.768  1.00 60.57  ? 3   DT  M "H5''" 1 
ATOM   597  H  "H4'"  . DT  B 1 3  ? -21.122 4.447   10.673  1.00 52.02  ? 3   DT  M "H4'"  1 
ATOM   598  H  "H3'"  . DT  B 1 3  ? -22.160 3.814   8.260   1.00 59.85  ? 3   DT  M "H3'"  1 
ATOM   599  H  "H2'"  . DT  B 1 3  ? -20.387 2.645   7.515   1.00 53.45  ? 3   DT  M "H2'"  1 
ATOM   600  H  "H2''" . DT  B 1 3  ? -19.703 4.080   7.343   1.00 53.45  ? 3   DT  M "H2''" 1 
ATOM   601  H  "H1'"  . DT  B 1 3  ? -18.688 3.959   9.372   1.00 54.18  ? 3   DT  M "H1'"  1 
ATOM   602  H  H3     . DT  B 1 3  ? -15.348 1.213   9.062   1.00 48.15  ? 3   DT  M H3     1 
ATOM   603  H  H71    . DT  B 1 3  ? -19.246 -1.889  9.165   1.00 59.40  ? 3   DT  M H71    1 
ATOM   604  H  H72    . DT  B 1 3  ? -19.142 -1.672  7.600   1.00 59.40  ? 3   DT  M H72    1 
ATOM   605  H  H73    . DT  B 1 3  ? -17.939 -2.335  8.389   1.00 59.40  ? 3   DT  M H73    1 
ATOM   606  H  H6     . DT  B 1 3  ? -19.731 0.686   8.725   1.00 54.78  ? 3   DT  M H6     1 
ATOM   607  P  P      . DG  B 1 4  ? -21.951 6.333   7.484   1.00 47.51  ? 4   DG  M P      1 
ATOM   608  O  OP1    . DG  B 1 4  ? -22.639 7.445   8.234   1.00 41.55  ? 4   DG  M OP1    1 
ATOM   609  O  OP2    . DG  B 1 4  ? -22.691 5.416   6.550   1.00 48.56  ? 4   DG  M OP2    1 
ATOM   610  O  "O5'"  . DG  B 1 4  ? -20.674 6.932   6.723   1.00 48.90  ? 4   DG  M "O5'"  1 
ATOM   611  C  "C5'"  . DG  B 1 4  ? -19.830 7.830   7.444   1.00 48.48  ? 4   DG  M "C5'"  1 
ATOM   612  C  "C4'"  . DG  B 1 4  ? -18.467 7.960   6.799   1.00 44.72  ? 4   DG  M "C4'"  1 
ATOM   613  O  "O4'"  . DG  B 1 4  ? -17.771 6.711   6.894   1.00 43.45  ? 4   DG  M "O4'"  1 
ATOM   614  C  "C3'"  . DG  B 1 4  ? -18.469 8.339   5.329   1.00 31.20  ? 4   DG  M "C3'"  1 
ATOM   615  O  "O3'"  . DG  B 1 4  ? -17.768 9.525   5.201   1.00 33.16  ? 4   DG  M "O3'"  1 
ATOM   616  C  "C2'"  . DG  B 1 4  ? -17.796 7.175   4.630   1.00 37.32  ? 4   DG  M "C2'"  1 
ATOM   617  C  "C1'"  . DG  B 1 4  ? -17.011 6.520   5.738   1.00 44.76  ? 4   DG  M "C1'"  1 
ATOM   618  N  N9     . DG  B 1 4  ? -16.821 5.096   5.625   1.00 37.92  ? 4   DG  M N9     1 
ATOM   619  C  C8     . DG  B 1 4  ? -17.792 4.148   5.436   1.00 38.70  ? 4   DG  M C8     1 
ATOM   620  N  N7     . DG  B 1 4  ? -17.331 2.931   5.429   1.00 39.76  ? 4   DG  M N7     1 
ATOM   621  C  C5     . DG  B 1 4  ? -15.967 3.094   5.654   1.00 41.97  ? 4   DG  M C5     1 
ATOM   622  C  C6     . DG  B 1 4  ? -14.937 2.125   5.745   1.00 44.00  ? 4   DG  M C6     1 
ATOM   623  O  O6     . DG  B 1 4  ? -15.049 0.884   5.658   1.00 42.24  ? 4   DG  M O6     1 
ATOM   624  N  N1     . DG  B 1 4  ? -13.678 2.717   5.991   1.00 41.58  ? 4   DG  M N1     1 
ATOM   625  C  C2     . DG  B 1 4  ? -13.471 4.076   6.114   1.00 45.27  ? 4   DG  M C2     1 
ATOM   626  N  N2     . DG  B 1 4  ? -12.207 4.476   6.343   1.00 43.90  ? 4   DG  M N2     1 
ATOM   627  N  N3     . DG  B 1 4  ? -14.448 4.992   6.015   1.00 41.45  ? 4   DG  M N3     1 
ATOM   628  C  C4     . DG  B 1 4  ? -15.653 4.425   5.796   1.00 37.84  ? 4   DG  M C4     1 
ATOM   629  H  "H5'"  . DG  B 1 4  ? -19.720 7.502   8.350   1.00 59.05  ? 4   DG  M "H5'"  1 
ATOM   630  H  "H5''" . DG  B 1 4  ? -20.250 8.704   7.473   1.00 59.05  ? 4   DG  M "H5''" 1 
ATOM   631  H  "H4'"  . DG  B 1 4  ? -17.962 8.630   7.286   1.00 54.53  ? 4   DG  M "H4'"  1 
ATOM   632  H  "H3'"  . DG  B 1 4  ? -19.378 8.447   5.009   1.00 38.32  ? 4   DG  M "H3'"  1 
ATOM   633  H  "H2'"  . DG  B 1 4  ? -18.458 6.563   4.271   1.00 45.65  ? 4   DG  M "H2'"  1 
ATOM   634  H  "H2''" . DG  B 1 4  ? -17.203 7.491   3.931   1.00 45.65  ? 4   DG  M "H2''" 1 
ATOM   635  H  "H1'"  . DG  B 1 4  ? -16.152 6.959   5.835   1.00 54.58  ? 4   DG  M "H1'"  1 
ATOM   636  H  H8     . DG  B 1 4  ? -18.689 4.355   5.307   1.00 47.31  ? 4   DG  M H8     1 
ATOM   637  H  H1     . DG  B 1 4  ? -12.996 2.198   6.063   1.00 50.77  ? 4   DG  M H1     1 
ATOM   638  H  H21    . DG  B 1 4  ? -12.029 5.313   6.425   1.00 53.55  ? 4   DG  M H21    1 
ATOM   639  H  H22    . DG  B 1 4  ? -11.577 3.894   6.407   1.00 53.55  ? 4   DG  M H22    1 
ATOM   640  P  P      . DA  B 1 5  ? -17.419 10.168  3.771   1.00 41.39  ? 5   DA  M P      1 
ATOM   641  O  OP1    . DA  B 1 5  ? -17.192 11.614  4.023   1.00 33.76  ? 5   DA  M OP1    1 
ATOM   642  O  OP2    . DA  B 1 5  ? -18.464 9.769   2.761   1.00 41.99  ? 5   DA  M OP2    1 
ATOM   643  O  "O5'"  . DA  B 1 5  ? -16.059 9.447   3.385   1.00 38.57  ? 5   DA  M "O5'"  1 
ATOM   644  C  "C5'"  . DA  B 1 5  ? -15.005 9.435   4.270   1.00 33.96  ? 5   DA  M "C5'"  1 
ATOM   645  C  "C4'"  . DA  B 1 5  ? -13.877 8.601   3.743   1.00 37.64  ? 5   DA  M "C4'"  1 
ATOM   646  O  "O4'"  . DA  B 1 5  ? -14.230 7.221   3.826   1.00 39.12  ? 5   DA  M "O4'"  1 
ATOM   647  C  "C3'"  . DA  B 1 5  ? -13.511 8.841   2.266   1.00 48.12  ? 5   DA  M "C3'"  1 
ATOM   648  O  "O3'"  . DA  B 1 5  ? -12.284 9.481   2.230   1.00 53.82  ? 5   DA  M "O3'"  1 
ATOM   649  C  "C2'"  . DA  B 1 5  ? -13.460 7.442   1.639   1.00 39.22  ? 5   DA  M "C2'"  1 
ATOM   650  C  "C1'"  . DA  B 1 5  ? -13.488 6.527   2.840   1.00 41.85  ? 5   DA  M "C1'"  1 
ATOM   651  N  N9     . DA  B 1 5  ? -14.147 5.266   2.638   1.00 38.56  ? 5   DA  M N9     1 
ATOM   652  C  C8     . DA  B 1 5  ? -15.472 5.073   2.439   1.00 33.75  ? 5   DA  M C8     1 
ATOM   653  N  N7     . DA  B 1 5  ? -15.811 3.811   2.365   1.00 36.83  ? 5   DA  M N7     1 
ATOM   654  C  C5     . DA  B 1 5  ? -14.624 3.136   2.560   1.00 37.59  ? 5   DA  M C5     1 
ATOM   655  C  C6     . DA  B 1 5  ? -14.306 1.769   2.601   1.00 40.93  ? 5   DA  M C6     1 
ATOM   656  N  N6     . DA  B 1 5  ? -15.207 0.801   2.437   1.00 37.34  ? 5   DA  M N6     1 
ATOM   657  N  N1     . DA  B 1 5  ? -13.017 1.432   2.850   1.00 39.47  ? 5   DA  M N1     1 
ATOM   658  C  C2     . DA  B 1 5  ? -12.124 2.413   3.029   1.00 36.48  ? 5   DA  M C2     1 
ATOM   659  N  N3     . DA  B 1 5  ? -12.312 3.730   3.004   1.00 39.15  ? 5   DA  M N3     1 
ATOM   660  C  C4     . DA  B 1 5  ? -13.592 4.023   2.762   1.00 38.83  ? 5   DA  M C4     1 
ATOM   661  H  "H5'"  . DA  B 1 5  ? -15.304 9.069   5.117   1.00 41.63  ? 5   DA  M "H5'"  1 
ATOM   662  H  "H5''" . DA  B 1 5  ? -14.693 10.343  4.407   1.00 41.63  ? 5   DA  M "H5''" 1 
ATOM   663  H  "H4'"  . DA  B 1 5  ? -13.090 8.756   4.290   1.00 46.04  ? 5   DA  M "H4'"  1 
ATOM   664  H  "H3'"  . DA  B 1 5  ? -14.190 9.383   1.834   1.00 58.62  ? 5   DA  M "H3'"  1 
ATOM   665  H  "H2'"  . DA  B 1 5  ? -14.236 7.292   1.075   1.00 47.93  ? 5   DA  M "H2'"  1 
ATOM   666  H  "H2''" . DA  B 1 5  ? -12.640 7.322   1.136   1.00 47.93  ? 5   DA  M "H2''" 1 
ATOM   667  H  "H1'"  . DA  B 1 5  ? -12.584 6.377   3.158   1.00 51.10  ? 5   DA  M "H1'"  1 
ATOM   668  H  H8     . DA  B 1 5  ? -16.077 5.771   2.326   1.00 41.37  ? 5   DA  M H8     1 
ATOM   669  H  H61    . DA  B 1 5  ? -14.968 -0.023  2.490   1.00 45.69  ? 5   DA  M H61    1 
ATOM   670  H  H62    . DA  B 1 5  ? -16.029 1.001   2.279   1.00 45.69  ? 5   DA  M H62    1 
ATOM   671  H  H2     . DA  B 1 5  ? -11.249 2.136   3.182   1.00 44.65  ? 5   DA  M H2     1 
ATOM   672  P  P      . DC  B 1 6  ? -11.735 10.196  0.911   1.00 55.55  ? 6   DC  M P      1 
ATOM   673  O  OP1    . DC  B 1 6  ? -10.802 11.188  1.502   1.00 59.60  ? 6   DC  M OP1    1 
ATOM   674  O  OP2    . DC  B 1 6  ? -12.812 10.634  -0.017  1.00 48.17  ? 6   DC  M OP2    1 
ATOM   675  O  "O5'"  . DC  B 1 6  ? -10.879 9.018   0.233   1.00 58.33  ? 6   DC  M "O5'"  1 
ATOM   676  C  "C5'"  . DC  B 1 6  ? -9.804  8.474   0.960   1.00 47.55  ? 6   DC  M "C5'"  1 
ATOM   677  C  "C4'"  . DC  B 1 6  ? -9.190  7.285   0.255   1.00 45.64  ? 6   DC  M "C4'"  1 
ATOM   678  O  "O4'"  . DC  B 1 6  ? -10.000 6.092   0.499   1.00 42.43  ? 6   DC  M "O4'"  1 
ATOM   679  C  "C3'"  . DC  B 1 6  ? -9.087  7.403   -1.265  1.00 41.45  ? 6   DC  M "C3'"  1 
ATOM   680  O  "O3'"  . DC  B 1 6  ? -7.904  6.800   -1.728  1.00 47.76  ? 6   DC  M "O3'"  1 
ATOM   681  C  "C2'"  . DC  B 1 6  ? -10.290 6.618   -1.715  1.00 40.03  ? 6   DC  M "C2'"  1 
ATOM   682  C  "C1'"  . DC  B 1 6  ? -10.224 5.470   -0.736  1.00 41.21  ? 6   DC  M "C1'"  1 
ATOM   683  N  N1     . DC  B 1 6  ? -11.443 4.625   -0.695  1.00 38.27  ? 6   DC  M N1     1 
ATOM   684  C  C2     . DC  B 1 6  ? -11.301 3.286   -0.412  1.00 36.77  ? 6   DC  M C2     1 
ATOM   685  O  O2     . DC  B 1 6  ? -10.170 2.862   -0.158  1.00 43.92  ? 6   DC  M O2     1 
ATOM   686  N  N3     . DC  B 1 6  ? -12.402 2.484   -0.404  1.00 36.21  ? 6   DC  M N3     1 
ATOM   687  C  C4     . DC  B 1 6  ? -13.598 3.002   -0.703  1.00 39.42  ? 6   DC  M C4     1 
ATOM   688  N  N4     . DC  B 1 6  ? -14.660 2.188   -0.695  1.00 40.83  ? 6   DC  M N4     1 
ATOM   689  C  C5     . DC  B 1 6  ? -13.759 4.385   -1.004  1.00 38.75  ? 6   DC  M C5     1 
ATOM   690  C  C6     . DC  B 1 6  ? -12.660 5.148   -1.010  1.00 36.58  ? 6   DC  M C6     1 
ATOM   691  H  "H5'"  . DC  B 1 6  ? -10.123 8.194   1.832   1.00 57.93  ? 6   DC  M "H5'"  1 
ATOM   692  H  "H5''" . DC  B 1 6  ? -9.125  9.157   1.077   1.00 57.93  ? 6   DC  M "H5''" 1 
ATOM   693  H  "H4'"  . DC  B 1 6  ? -8.302  7.136   0.615   1.00 55.64  ? 6   DC  M "H4'"  1 
ATOM   694  H  "H3'"  . DC  B 1 6  ? -9.146  8.329   -1.549  1.00 50.61  ? 6   DC  M "H3'"  1 
ATOM   695  H  "H2'"  . DC  B 1 6  ? -11.106 7.130   -1.602  1.00 48.91  ? 6   DC  M "H2'"  1 
ATOM   696  H  "H2''" . DC  B 1 6  ? -10.187 6.308   -2.628  1.00 48.91  ? 6   DC  M "H2''" 1 
ATOM   697  H  "H1'"  . DC  B 1 6  ? -9.460  4.913   -0.953  1.00 50.32  ? 6   DC  M "H1'"  1 
ATOM   698  H  H41    . DC  B 1 6  ? -15.440 2.497   -0.883  1.00 49.86  ? 6   DC  M H41    1 
ATOM   699  H  H42    . DC  B 1 6  ? -14.562 1.356   -0.501  1.00 49.86  ? 6   DC  M H42    1 
ATOM   700  H  H5     . DC  B 1 6  ? -14.594 4.740   -1.210  1.00 47.37  ? 6   DC  M H5     1 
ATOM   701  H  H6     . DC  B 1 6  ? -12.732 6.054   -1.210  1.00 44.77  ? 6   DC  M H6     1 
ATOM   702  P  P      . DA  B 1 7  ? -6.795  7.635   -2.526  1.00 43.67  ? 7   DA  M P      1 
ATOM   703  O  OP1    . DA  B 1 7  ? -6.242  8.429   -1.394  1.00 56.92  ? 7   DA  M OP1    1 
ATOM   704  O  OP2    . DA  B 1 7  ? -7.270  8.330   -3.731  1.00 41.67  ? 7   DA  M OP2    1 
ATOM   705  O  "O5'"  . DA  B 1 7  ? -5.784  6.503   -2.956  1.00 37.90  ? 7   DA  M "O5'"  1 
ATOM   706  C  "C5'"  . DA  B 1 7  ? -5.075  5.841   -1.937  1.00 32.65  ? 7   DA  M "C5'"  1 
ATOM   707  C  "C4'"  . DA  B 1 7  ? -4.743  4.417   -2.310  1.00 40.50  ? 7   DA  M "C4'"  1 
ATOM   708  O  "O4'"  . DA  B 1 7  ? -5.951  3.615   -2.168  1.00 36.91  ? 7   DA  M "O4'"  1 
ATOM   709  C  "C3'"  . DA  B 1 7  ? -4.246  4.216   -3.755  1.00 45.37  ? 7   DA  M "C3'"  1 
ATOM   710  O  "O3'"  . DA  B 1 7  ? -3.145  3.310   -3.763  1.00 43.44  ? 7   DA  M "O3'"  1 
ATOM   711  C  "C2'"  . DA  B 1 7  ? -5.484  3.685   -4.481  1.00 40.01  ? 7   DA  M "C2'"  1 
ATOM   712  C  "C1'"  . DA  B 1 7  ? -6.247  2.944   -3.370  1.00 42.89  ? 7   DA  M "C1'"  1 
ATOM   713  N  N9     . DA  B 1 7  ? -7.699  2.963   -3.527  1.00 37.80  ? 7   DA  M N9     1 
ATOM   714  C  C8     . DA  B 1 7  ? -8.491  4.076   -3.685  1.00 37.28  ? 7   DA  M C8     1 
ATOM   715  N  N7     . DA  B 1 7  ? -9.783  3.806   -3.756  1.00 36.40  ? 7   DA  M N7     1 
ATOM   716  C  C5     . DA  B 1 7  ? -9.836  2.421   -3.635  1.00 34.85  ? 7   DA  M C5     1 
ATOM   717  C  C6     . DA  B 1 7  ? -10.914 1.519   -3.627  1.00 35.78  ? 7   DA  M C6     1 
ATOM   718  N  N6     . DA  B 1 7  ? -12.195 1.916   -3.756  1.00 34.51  ? 7   DA  M N6     1 
ATOM   719  N  N1     . DA  B 1 7  ? -10.635 0.188   -3.477  1.00 34.45  ? 7   DA  M N1     1 
ATOM   720  C  C2     . DA  B 1 7  ? -9.357  -0.185  -3.314  1.00 40.15  ? 7   DA  M C2     1 
ATOM   721  N  N3     . DA  B 1 7  ? -8.241  0.587   -3.300  1.00 41.25  ? 7   DA  M N3     1 
ATOM   722  C  C4     . DA  B 1 7  ? -8.560  1.888   -3.467  1.00 36.83  ? 7   DA  M C4     1 
ATOM   723  H  "H5'"  . DA  B 1 7  ? -5.613  5.838   -1.130  1.00 40.05  ? 7   DA  M "H5'"  1 
ATOM   724  H  "H5''" . DA  B 1 7  ? -4.250  6.322   -1.764  1.00 40.05  ? 7   DA  M "H5''" 1 
ATOM   725  H  "H4'"  . DA  B 1 7  ? -4.070  4.081   -1.698  1.00 49.47  ? 7   DA  M "H4'"  1 
ATOM   726  H  "H3'"  . DA  B 1 7  ? -3.978  5.068   -4.134  1.00 55.32  ? 7   DA  M "H3'"  1 
ATOM   727  H  "H2'"  . DA  B 1 7  ? -6.015  4.416   -4.833  1.00 48.89  ? 7   DA  M "H2'"  1 
ATOM   728  H  "H2''" . DA  B 1 7  ? -5.229  3.072   -5.189  1.00 48.89  ? 7   DA  M "H2''" 1 
ATOM   729  H  "H1'"  . DA  B 1 7  ? -5.936  2.027   -3.316  1.00 52.34  ? 7   DA  M "H1'"  1 
ATOM   730  H  H8     . DA  B 1 7  ? -8.148  4.939   -3.744  1.00 45.61  ? 7   DA  M H8     1 
ATOM   731  H  H61    . DA  B 1 7  ? -12.829 1.335   -3.743  1.00 42.28  ? 7   DA  M H61    1 
ATOM   732  H  H62    . DA  B 1 7  ? -12.379 2.751   -3.851  1.00 42.28  ? 7   DA  M H62    1 
ATOM   733  H  H2     . DA  B 1 7  ? -9.214  -1.099  -3.216  1.00 49.06  ? 7   DA  M H2     1 
ATOM   734  P  P      . DG  B 1 8  ? -2.257  3.101   -5.089  1.00 33.17  ? 8   DG  M P      1 
ATOM   735  O  OP1    . DG  B 1 8  ? -0.947  2.477   -4.731  1.00 38.55  ? 8   DG  M OP1    1 
ATOM   736  O  OP2    . DG  B 1 8  ? -2.242  4.379   -5.849  1.00 32.33  ? 8   DG  M OP2    1 
ATOM   737  O  "O5'"  . DG  B 1 8  ? -3.071  1.972   -5.856  1.00 35.95  ? 8   DG  M "O5'"  1 
ATOM   738  C  "C5'"  . DG  B 1 8  ? -2.981  0.655   -5.383  1.00 35.04  ? 8   DG  M "C5'"  1 
ATOM   739  C  "C4'"  . DG  B 1 8  ? -3.969  -0.219  -6.114  1.00 41.62  ? 8   DG  M "C4'"  1 
ATOM   740  O  "O4'"  . DG  B 1 8  ? -5.302  0.266   -5.868  1.00 44.30  ? 8   DG  M "O4'"  1 
ATOM   741  C  "C3'"  . DG  B 1 8  ? -3.806  -0.236  -7.651  1.00 44.63  ? 8   DG  M "C3'"  1 
ATOM   742  O  "O3'"  . DG  B 1 8  ? -3.638  -1.586  -8.093  1.00 45.76  ? 8   DG  M "O3'"  1 
ATOM   743  C  "C2'"  . DG  B 1 8  ? -5.096  0.418   -8.159  1.00 41.41  ? 8   DG  M "C2'"  1 
ATOM   744  C  "C1'"  . DG  B 1 8  ? -6.054  0.080   -7.050  1.00 45.84  ? 8   DG  M "C1'"  1 
ATOM   745  N  N9     . DG  B 1 8  ? -7.265  0.899   -7.025  1.00 42.72  ? 8   DG  M N9     1 
ATOM   746  C  C8     . DG  B 1 8  ? -7.367  2.272   -7.060  1.00 38.90  ? 8   DG  M C8     1 
ATOM   747  N  N7     . DG  B 1 8  ? -8.610  2.702   -7.026  1.00 35.21  ? 8   DG  M N7     1 
ATOM   748  C  C5     . DG  B 1 8  ? -9.358  1.541   -6.935  1.00 36.83  ? 8   DG  M C5     1 
ATOM   749  C  C6     . DG  B 1 8  ? -10.747 1.373   -6.856  1.00 36.50  ? 8   DG  M C6     1 
ATOM   750  O  O6     . DG  B 1 8  ? -11.624 2.260   -6.847  1.00 35.47  ? 8   DG  M O6     1 
ATOM   751  N  N1     . DG  B 1 8  ? -11.098 0.026   -6.797  1.00 34.29  ? 8   DG  M N1     1 
ATOM   752  C  C2     . DG  B 1 8  ? -10.202 -1.022  -6.799  1.00 43.96  ? 8   DG  M C2     1 
ATOM   753  N  N2     . DG  B 1 8  ? -10.721 -2.258  -6.719  1.00 47.25  ? 8   DG  M N2     1 
ATOM   754  N  N3     . DG  B 1 8  ? -8.886  -0.872  -6.852  1.00 42.09  ? 8   DG  M N3     1 
ATOM   755  C  C4     . DG  B 1 8  ? -8.543  0.429   -6.918  1.00 37.66  ? 8   DG  M C4     1 
ATOM   756  H  "H5'"  . DG  B 1 8  ? -3.178  0.640   -4.433  1.00 42.92  ? 8   DG  M "H5'"  1 
ATOM   757  H  "H5''" . DG  B 1 8  ? -2.083  0.320   -5.531  1.00 42.92  ? 8   DG  M "H5''" 1 
ATOM   758  H  "H4'"  . DG  B 1 8  ? -3.896  -1.126  -5.779  1.00 50.82  ? 8   DG  M "H4'"  1 
ATOM   759  H  "H3'"  . DG  B 1 8  ? -3.039  0.298   -7.909  1.00 54.43  ? 8   DG  M "H3'"  1 
ATOM   760  H  "H2'"  . DG  B 1 8  ? -4.989  1.379   -8.244  1.00 50.57  ? 8   DG  M "H2'"  1 
ATOM   761  H  "H2''" . DG  B 1 8  ? -5.380  0.021   -8.997  1.00 50.57  ? 8   DG  M "H2''" 1 
ATOM   762  H  "H1'"  . DG  B 1 8  ? -6.305  -0.854  -7.122  1.00 55.88  ? 8   DG  M "H1'"  1 
ATOM   763  H  H8     . DG  B 1 8  ? -6.632  2.838   -7.124  1.00 47.56  ? 8   DG  M H8     1 
ATOM   764  H  H1     . DG  B 1 8  ? -11.934 -0.165  -6.738  1.00 42.02  ? 8   DG  M H1     1 
ATOM   765  H  H21    . DG  B 1 8  ? -10.200 -2.942  -6.703  1.00 57.58  ? 8   DG  M H21    1 
ATOM   766  H  H22    . DG  B 1 8  ? -11.573 -2.365  -6.684  1.00 57.58  ? 8   DG  M H22    1 
ATOM   767  P  P      . DC  B 1 9  ? -3.613  -1.962  -9.654  1.00 42.12  ? 9   DC  M P      1 
ATOM   768  O  OP1    . DC  B 1 9  ? -2.497  -2.909  -9.902  1.00 47.55  ? 9   DC  M OP1    1 
ATOM   769  O  OP2    . DC  B 1 9  ? -3.586  -0.716  -10.455 1.00 40.27  ? 9   DC  M OP2    1 
ATOM   770  O  "O5'"  . DC  B 1 9  ? -4.992  -2.721  -9.825  1.00 41.13  ? 9   DC  M "O5'"  1 
ATOM   771  C  "C5'"  . DC  B 1 9  ? -5.329  -3.774  -8.922  1.00 44.92  ? 9   DC  M "C5'"  1 
ATOM   772  C  "C4'"  . DC  B 1 9  ? -6.639  -4.450  -9.329  1.00 46.08  ? 9   DC  M "C4'"  1 
ATOM   773  O  "O4'"  . DC  B 1 9  ? -7.770  -3.576  -9.027  1.00 46.28  ? 9   DC  M "O4'"  1 
ATOM   774  C  "C3'"  . DC  B 1 9  ? -6.739  -4.763  -10.822 1.00 48.74  ? 9   DC  M "C3'"  1 
ATOM   775  O  "O3'"  . DC  B 1 9  ? -7.345  -5.998  -11.037 1.00 59.15  ? 9   DC  M "O3'"  1 
ATOM   776  C  "C2'"  . DC  B 1 9  ? -7.560  -3.630  -11.371 1.00 45.41  ? 9   DC  M "C2'"  1 
ATOM   777  C  "C1'"  . DC  B 1 9  ? -8.494  -3.305  -10.220 1.00 47.05  ? 9   DC  M "C1'"  1 
ATOM   778  N  N1     . DC  B 1 9  ? -8.932  -1.875  -10.220 1.00 47.86  ? 9   DC  M N1     1 
ATOM   779  C  C2     . DC  B 1 9  ? -10.290 -1.566  -10.240 1.00 43.29  ? 9   DC  M C2     1 
ATOM   780  O  O2     . DC  B 1 9  ? -11.128 -2.489  -10.228 1.00 50.91  ? 9   DC  M O2     1 
ATOM   781  N  N3     . DC  B 1 9  ? -10.656 -0.273  -10.261 1.00 36.33  ? 9   DC  M N3     1 
ATOM   782  C  C4     . DC  B 1 9  ? -9.742  0.681   -10.276 1.00 39.42  ? 9   DC  M C4     1 
ATOM   783  N  N4     . DC  B 1 9  ? -10.167 1.942   -10.279 1.00 41.16  ? 9   DC  M N4     1 
ATOM   784  C  C5     . DC  B 1 9  ? -8.345  0.393   -10.281 1.00 43.37  ? 9   DC  M C5     1 
ATOM   785  C  C6     . DC  B 1 9  ? -7.990  -0.882  -10.245 1.00 43.76  ? 9   DC  M C6     1 
ATOM   786  H  "H5'"  . DC  B 1 9  ? -5.424  -3.408  -8.028  1.00 54.77  ? 9   DC  M "H5'"  1 
ATOM   787  H  "H5''" . DC  B 1 9  ? -4.618  -4.433  -8.922  1.00 54.77  ? 9   DC  M "H5''" 1 
ATOM   788  H  "H4'"  . DC  B 1 9  ? -6.736  -5.274  -8.827  1.00 56.17  ? 9   DC  M "H4'"  1 
ATOM   789  H  "H3'"  . DC  B 1 9  ? -5.855  -4.754  -11.221 1.00 59.37  ? 9   DC  M "H3'"  1 
ATOM   790  H  "H2'"  . DC  B 1 9  ? -6.997  -2.869  -11.582 1.00 55.37  ? 9   DC  M "H2'"  1 
ATOM   791  H  "H2''" . DC  B 1 9  ? -8.062  -3.916  -12.151 1.00 55.37  ? 9   DC  M "H2''" 1 
ATOM   792  H  "H1'"  . DC  B 1 9  ? -9.273  -3.881  -10.264 1.00 57.34  ? 9   DC  M "H1'"  1 
ATOM   793  H  H41    . DC  B 1 9  ? -9.599  2.588   -10.289 1.00 50.26  ? 9   DC  M H41    1 
ATOM   794  H  H42    . DC  B 1 9  ? -11.011 2.111   -10.272 1.00 50.26  ? 9   DC  M H42    1 
ATOM   795  H  H5     . DC  B 1 9  ? -7.710  1.073   -10.277 1.00 52.92  ? 9   DC  M H5     1 
ATOM   796  H  H6     . DC  B 1 9  ? -7.087  -1.107  -10.247 1.00 53.39  ? 9   DC  M H6     1 
ATOM   797  P  P      . DT  B 1 10 ? -7.455  -6.565  -12.534 1.00 59.87  ? 10  DT  M P      1 
ATOM   798  O  OP1    . DT  B 1 10 ? -7.147  -8.008  -12.412 1.00 69.34  ? 10  DT  M OP1    1 
ATOM   799  O  OP2    . DT  B 1 10 ? -6.719  -5.692  -13.482 1.00 56.97  ? 10  DT  M OP2    1 
ATOM   800  O  "O5'"  . DT  B 1 10 ? -8.990  -6.318  -12.900 1.00 51.89  ? 10  DT  M "O5'"  1 
ATOM   801  C  "C5'"  . DT  B 1 10 ? -10.008 -6.812  -12.025 1.00 61.17  ? 10  DT  M "C5'"  1 
ATOM   802  C  "C4'"  . DT  B 1 10 ? -11.374 -6.657  -12.660 1.00 51.62  ? 10  DT  M "C4'"  1 
ATOM   803  O  "O4'"  . DT  B 1 10 ? -11.797 -5.280  -12.536 1.00 54.91  ? 10  DT  M "O4'"  1 
ATOM   804  C  "C3'"  . DT  B 1 10 ? -11.403 -6.996  -14.143 1.00 52.30  ? 10  DT  M "C3'"  1 
ATOM   805  O  "O3'"  . DT  B 1 10 ? -12.531 -7.795  -14.438 1.00 55.28  ? 10  DT  M "O3'"  1 
ATOM   806  C  "C2'"  . DT  B 1 10 ? -11.427 -5.625  -14.828 1.00 49.86  ? 10  DT  M "C2'"  1 
ATOM   807  C  "C1'"  . DT  B 1 10 ? -12.142 -4.758  -13.791 1.00 50.06  ? 10  DT  M "C1'"  1 
ATOM   808  N  N1     . DT  B 1 10 ? -11.746 -3.322  -13.803 1.00 46.72  ? 10  DT  M N1     1 
ATOM   809  C  C2     . DT  B 1 10 ? -12.729 -2.371  -13.786 1.00 47.87  ? 10  DT  M C2     1 
ATOM   810  O  O2     . DT  B 1 10 ? -13.925 -2.649  -13.798 1.00 47.78  ? 10  DT  M O2     1 
ATOM   811  N  N3     . DT  B 1 10 ? -12.276 -1.077  -13.776 1.00 46.36  ? 10  DT  M N3     1 
ATOM   812  C  C4     . DT  B 1 10 ? -10.969 -0.654  -13.779 1.00 43.12  ? 10  DT  M C4     1 
ATOM   813  O  O4     . DT  B 1 10 ? -10.663 0.542   -13.785 1.00 40.42  ? 10  DT  M O4     1 
ATOM   814  C  C5     . DT  B 1 10 ? -9.980  -1.708  -13.788 1.00 45.97  ? 10  DT  M C5     1 
ATOM   815  C  C7     . DT  B 1 10 ? -8.522  -1.362  -13.824 1.00 44.60  ? 10  DT  M C7     1 
ATOM   816  C  C6     . DT  B 1 10 ? -10.409 -2.981  -13.788 1.00 43.35  ? 10  DT  M C6     1 
ATOM   817  H  "H5'"  . DT  B 1 10 ? -9.984  -6.315  -11.193 1.00 74.27  ? 10  DT  M "H5'"  1 
ATOM   818  H  "H5''" . DT  B 1 10 ? -9.845  -7.751  -11.843 1.00 74.27  ? 10  DT  M "H5''" 1 
ATOM   819  H  "H4'"  . DT  B 1 10 ? -12.006 -7.226  -12.193 1.00 62.82  ? 10  DT  M "H4'"  1 
ATOM   820  H  "H3'"  . DT  B 1 10 ? -10.592 -7.470  -14.386 1.00 63.63  ? 10  DT  M "H3'"  1 
ATOM   821  H  "H2'"  . DT  B 1 10 ? -10.526 -5.302  -14.985 1.00 60.70  ? 10  DT  M "H2'"  1 
ATOM   822  H  "H2''" . DT  B 1 10 ? -11.933 -5.661  -15.654 1.00 60.70  ? 10  DT  M "H2''" 1 
ATOM   823  H  "H1'"  . DT  B 1 10 ? -13.101 -4.829  -13.917 1.00 60.94  ? 10  DT  M "H1'"  1 
ATOM   824  H  H3     . DT  B 1 10 ? -12.877 -0.462  -13.779 1.00 56.50  ? 10  DT  M H3     1 
ATOM   825  H  H71    . DT  B 1 10 ? -8.419  -0.397  -13.839 1.00 54.39  ? 10  DT  M H71    1 
ATOM   826  H  H72    . DT  B 1 10 ? -8.085  -1.722  -13.037 1.00 54.39  ? 10  DT  M H72    1 
ATOM   827  H  H73    . DT  B 1 10 ? -8.120  -1.742  -14.621 1.00 54.39  ? 10  DT  M H73    1 
ATOM   828  H  H6     . DT  B 1 10 ? -9.776  -3.662  -13.805 1.00 52.90  ? 10  DT  M H6     1 
ATOM   829  P  P      . DG  B 1 11 ? -12.773 -8.380  -15.919 1.00 57.26  ? 11  DG  M P      1 
ATOM   830  O  OP1    . DG  B 1 11 ? -13.580 -9.592  -15.626 1.00 60.23  ? 11  DG  M OP1    1 
ATOM   831  O  OP2    . DG  B 1 11 ? -11.537 -8.456  -16.745 1.00 54.10  ? 11  DG  M OP2    1 
ATOM   832  O  "O5'"  . DG  B 1 11 ? -13.725 -7.282  -16.569 1.00 50.20  ? 11  DG  M "O5'"  1 
ATOM   833  C  "C5'"  . DG  B 1 11 ? -14.813 -6.796  -15.805 1.00 48.44  ? 11  DG  M "C5'"  1 
ATOM   834  C  "C4'"  . DG  B 1 11 ? -15.475 -5.651  -16.510 1.00 48.93  ? 11  DG  M "C4'"  1 
ATOM   835  O  "O4'"  . DG  B 1 11 ? -14.746 -4.423  -16.249 1.00 50.79  ? 11  DG  M "O4'"  1 
ATOM   836  C  "C3'"  . DG  B 1 11 ? -15.541 -5.794  -18.034 1.00 45.13  ? 11  DG  M "C3'"  1 
ATOM   837  O  "O3'"  . DG  B 1 11 ? -16.890 -5.601  -18.464 1.00 55.47  ? 11  DG  M "O3'"  1 
ATOM   838  C  "C2'"  . DG  B 1 11 ? -14.588 -4.721  -18.549 1.00 44.33  ? 11  DG  M "C2'"  1 
ATOM   839  C  "C1'"  . DG  B 1 11 ? -14.614 -3.692  -17.451 1.00 47.53  ? 11  DG  M "C1'"  1 
ATOM   840  N  N9     . DG  B 1 11 ? -13.426 -2.848  -17.369 1.00 45.52  ? 11  DG  M N9     1 
ATOM   841  C  C8     . DG  B 1 11 ? -12.105 -3.248  -17.420 1.00 49.29  ? 11  DG  M C8     1 
ATOM   842  N  N7     . DG  B 1 11 ? -11.251 -2.259  -17.297 1.00 44.22  ? 11  DG  M N7     1 
ATOM   843  C  C5     . DG  B 1 11 ? -12.057 -1.140  -17.156 1.00 46.64  ? 11  DG  M C5     1 
ATOM   844  C  C6     . DG  B 1 11 ? -11.706 0.216   -16.998 1.00 42.03  ? 11  DG  M C6     1 
ATOM   845  O  O6     . DG  B 1 11 ? -10.578 0.716   -16.944 1.00 44.86  ? 11  DG  M O6     1 
ATOM   846  N  N1     . DG  B 1 11 ? -12.831 1.027   -16.906 1.00 51.67  ? 11  DG  M N1     1 
ATOM   847  C  C2     . DG  B 1 11 ? -14.132 0.573   -16.960 1.00 49.17  ? 11  DG  M C2     1 
ATOM   848  N  N2     . DG  B 1 11 ? -15.084 1.493   -16.838 1.00 47.42  ? 11  DG  M N2     1 
ATOM   849  N  N3     . DG  B 1 11 ? -14.468 -0.691  -17.091 1.00 44.03  ? 11  DG  M N3     1 
ATOM   850  C  C4     . DG  B 1 11 ? -13.396 -1.488  -17.194 1.00 47.01  ? 11  DG  M C4     1 
ATOM   851  H  "H5'"  . DG  B 1 11 ? -14.489 -6.496  -14.941 1.00 59.00  ? 11  DG  M "H5'"  1 
ATOM   852  H  "H5''" . DG  B 1 11 ? -15.458 -7.509  -15.676 1.00 59.00  ? 11  DG  M "H5''" 1 
ATOM   853  H  "H4'"  . DG  B 1 11 ? -16.378 -5.555  -16.168 1.00 59.59  ? 11  DG  M "H4'"  1 
ATOM   854  H  "H3'"  . DG  B 1 11 ? -15.228 -6.673  -18.299 1.00 55.03  ? 11  DG  M "H3'"  1 
ATOM   855  H  "H2'"  . DG  B 1 11 ? -13.695 -5.081  -18.661 1.00 54.07  ? 11  DG  M "H2'"  1 
ATOM   856  H  "H2''" . DG  B 1 11 ? -14.915 -4.343  -19.381 1.00 54.07  ? 11  DG  M "H2''" 1 
ATOM   857  H  "H1'"  . DG  B 1 11 ? -15.395 -3.128  -17.564 1.00 57.91  ? 11  DG  M "H1'"  1 
ATOM   858  H  H8     . DG  B 1 11 ? -11.846 -4.136  -17.519 1.00 60.03  ? 11  DG  M H8     1 
ATOM   859  H  H1     . DG  B 1 11 ? -12.707 1.872   -16.801 1.00 62.88  ? 11  DG  M H1     1 
ATOM   860  H  H21    . DG  B 1 11 ? -15.912 1.259   -16.847 1.00 57.78  ? 11  DG  M H21    1 
ATOM   861  H  H22    . DG  B 1 11 ? -14.872 2.322   -16.752 1.00 57.78  ? 11  DG  M H22    1 
ATOM   862  P  P      . DT  B 1 12 ? -17.369 -5.869  -19.984 1.00 59.36  ? 12  DT  M P      1 
ATOM   863  O  OP1    . DT  B 1 12 ? -18.739 -6.402  -19.791 1.00 72.69  ? 12  DT  M OP1    1 
ATOM   864  O  OP2    . DT  B 1 12 ? -16.354 -6.578  -20.806 1.00 48.09  ? 12  DT  M OP2    1 
ATOM   865  O  "O5'"  . DT  B 1 12 ? -17.470 -4.402  -20.590 1.00 49.53  ? 12  DT  M "O5'"  1 
ATOM   866  C  "C5'"  . DT  B 1 12 ? -18.064 -3.371  -19.812 1.00 54.69  ? 12  DT  M "C5'"  1 
ATOM   867  C  "C4'"  . DT  B 1 12 ? -17.536 -2.000  -20.216 1.00 61.87  ? 12  DT  M "C4'"  1 
ATOM   868  O  "O4'"  . DT  B 1 12 ? -16.137 -1.819  -19.857 1.00 59.17  ? 12  DT  M "O4'"  1 
ATOM   869  C  "C3'"  . DT  B 1 12 ? -17.586 -1.724  -21.707 1.00 46.97  ? 12  DT  M "C3'"  1 
ATOM   870  O  "O3'"  . DT  B 1 12 ? -18.748 -0.934  -21.991 1.00 71.62  ? 12  DT  M "O3'"  1 
ATOM   871  C  "C2'"  . DT  B 1 12 ? -16.253 -0.999  -22.005 1.00 51.95  ? 12  DT  M "C2'"  1 
ATOM   872  C  "C1'"  . DT  B 1 12 ? -15.697 -0.724  -20.623 1.00 54.21  ? 12  DT  M "C1'"  1 
ATOM   873  N  N1     . DT  B 1 12 ? -14.189 -0.581  -20.529 1.00 53.55  ? 12  DT  M N1     1 
ATOM   874  C  C2     . DT  B 1 12 ? -13.666 0.658   -20.227 1.00 50.81  ? 12  DT  M C2     1 
ATOM   875  O  O2     . DT  B 1 12 ? -14.362 1.645   -20.056 1.00 53.89  ? 12  DT  M O2     1 
ATOM   876  N  N3     . DT  B 1 12 ? -12.292 0.709   -20.135 1.00 46.28  ? 12  DT  M N3     1 
ATOM   877  C  C4     . DT  B 1 12 ? -11.400 -0.340  -20.303 1.00 51.12  ? 12  DT  M C4     1 
ATOM   878  O  O4     . DT  B 1 12 ? -10.153 -0.200  -20.188 1.00 42.82  ? 12  DT  M O4     1 
ATOM   879  C  C5     . DT  B 1 12 ? -12.018 -1.615  -20.615 1.00 51.29  ? 12  DT  M C5     1 
ATOM   880  C  C7     . DT  B 1 12 ? -11.159 -2.819  -20.817 1.00 47.87  ? 12  DT  M C7     1 
ATOM   881  C  C6     . DT  B 1 12 ? -13.367 -1.675  -20.711 1.00 52.83  ? 12  DT  M C6     1 
ATOM   882  H  "H5'"  . DT  B 1 12 ? -17.865 -3.524  -18.875 1.00 66.51  ? 12  DT  M "H5'"  1 
ATOM   883  H  "H5''" . DT  B 1 12 ? -19.026 -3.391  -19.939 1.00 66.51  ? 12  DT  M "H5''" 1 
ATOM   884  H  "H4'"  . DT  B 1 12 ? -18.061 -1.323  -19.761 1.00 75.12  ? 12  DT  M "H4'"  1 
ATOM   885  H  "H3'"  . DT  B 1 12 ? -17.625 -2.560  -22.197 1.00 57.23  ? 12  DT  M "H3'"  1 
ATOM   886  H  "H2'"  . DT  B 1 12 ? -15.655 -1.575  -22.506 1.00 63.22  ? 12  DT  M "H2'"  1 
ATOM   887  H  "H2''" . DT  B 1 12 ? -16.413 -0.170  -22.482 1.00 63.22  ? 12  DT  M "H2''" 1 
ATOM   888  H  "H1'"  . DT  B 1 12 ? -16.108 0.084   -20.278 1.00 65.93  ? 12  DT  M "H1'"  1 
ATOM   889  H  H3     . DT  B 1 12 ? -11.950 1.476   -19.948 1.00 56.41  ? 12  DT  M H3     1 
ATOM   890  H  H71    . DT  B 1 12 ? -11.395 -3.498  -20.165 1.00 58.32  ? 12  DT  M H71    1 
ATOM   891  H  H72    . DT  B 1 12 ? -11.295 -3.168  -21.711 1.00 58.32  ? 12  DT  M H72    1 
ATOM   892  H  H73    . DT  B 1 12 ? -10.227 -2.574  -20.704 1.00 58.32  ? 12  DT  M H73    1 
ATOM   893  H  H6     . DT  B 1 12 ? -13.760 -2.496  -20.903 1.00 64.27  ? 12  DT  M H6     1 
ATOM   894  P  P      . DC  B 1 13 ? -19.289 -0.718  -23.499 1.00 61.94  ? 13  DC  M P      1 
ATOM   895  O  OP1    . DC  B 1 13 ? -20.711 -1.105  -23.438 1.00 75.47  ? 13  DC  M OP1    1 
ATOM   896  O  OP2    . DC  B 1 13 ? -18.383 -1.316  -24.524 1.00 52.86  ? 13  DC  M OP2    1 
ATOM   897  O  "O5'"  . DC  B 1 13 ? -19.183 0.864   -23.690 1.00 55.35  ? 13  DC  M "O5'"  1 
ATOM   898  C  "C5'"  . DC  B 1 13 ? -19.400 1.724   -22.577 1.00 48.27  ? 13  DC  M "C5'"  1 
ATOM   899  C  "C4'"  . DC  B 1 13 ? -18.791 3.065   -22.864 1.00 51.37  ? 13  DC  M "C4'"  1 
ATOM   900  O  "O4'"  . DC  B 1 13 ? -17.397 3.053   -22.458 1.00 55.15  ? 13  DC  M "O4'"  1 
ATOM   901  C  "C3'"  . DC  B 1 13 ? -18.801 3.426   -24.345 1.00 55.52  ? 13  DC  M "C3'"  1 
ATOM   902  O  "O3'"  . DC  B 1 13 ? -19.211 4.744   -24.531 1.00 62.17  ? 13  DC  M "O3'"  1 
ATOM   903  C  "C2'"  . DC  B 1 13 ? -17.367 3.210   -24.769 1.00 57.16  ? 13  DC  M "C2'"  1 
ATOM   904  C  "C1'"  . DC  B 1 13 ? -16.614 3.562   -23.492 1.00 54.04  ? 13  DC  M "C1'"  1 
ATOM   905  N  N1     . DC  B 1 13 ? -15.274 2.977   -23.402 1.00 48.12  ? 13  DC  M N1     1 
ATOM   906  C  C2     . DC  B 1 13 ? -14.210 3.764   -22.959 1.00 47.65  ? 13  DC  M C2     1 
ATOM   907  O  O2     . DC  B 1 13 ? -14.428 4.932   -22.641 1.00 48.39  ? 13  DC  M O2     1 
ATOM   908  N  N3     . DC  B 1 13 ? -12.969 3.218   -22.887 1.00 44.56  ? 13  DC  M N3     1 
ATOM   909  C  C4     . DC  B 1 13 ? -12.786 1.949   -23.247 1.00 45.66  ? 13  DC  M C4     1 
ATOM   910  N  N4     . DC  B 1 13 ? -11.551 1.450   -23.186 1.00 43.20  ? 13  DC  M N4     1 
ATOM   911  C  C5     . DC  B 1 13 ? -13.863 1.138   -23.715 1.00 49.73  ? 13  DC  M C5     1 
ATOM   912  C  C6     . DC  B 1 13 ? -15.075 1.689   -23.775 1.00 48.95  ? 13  DC  M C6     1 
ATOM   913  H  "H5'"  . DC  B 1 13 ? -18.987 1.342   -21.787 1.00 58.80  ? 13  DC  M "H5'"  1 
ATOM   914  H  "H5''" . DC  B 1 13 ? -20.353 1.827   -22.428 1.00 58.80  ? 13  DC  M "H5''" 1 
ATOM   915  H  "H4'"  . DC  B 1 13 ? -19.265 3.747   -22.363 1.00 62.52  ? 13  DC  M "H4'"  1 
ATOM   916  H  "H3'"  . DC  B 1 13 ? -19.386 2.823   -24.830 1.00 67.49  ? 13  DC  M "H3'"  1 
ATOM   917  H  "H2'"  . DC  B 1 13 ? -17.215 2.285   -25.017 1.00 69.47  ? 13  DC  M "H2'"  1 
ATOM   918  H  "H2''" . DC  B 1 13 ? -17.125 3.811   -25.491 1.00 69.47  ? 13  DC  M "H2''" 1 
ATOM   919  H  "H1'"  . DC  B 1 13 ? -16.554 4.526   -23.407 1.00 65.72  ? 13  DC  M "H1'"  1 
ATOM   920  H  H41    . DC  B 1 13 ? -11.406 0.633   -23.412 1.00 52.71  ? 13  DC  M H41    1 
ATOM   921  H  H42    . DC  B 1 13 ? -10.900 1.945   -22.920 1.00 52.71  ? 13  DC  M H42    1 
ATOM   922  H  H5     . DC  B 1 13 ? -13.725 0.253   -23.965 1.00 60.55  ? 13  DC  M H5     1 
ATOM   923  H  H6     . DC  B 1 13 ? -15.795 1.181   -24.072 1.00 59.61  ? 13  DC  M H6     1 
ATOM   924  P  P      . DA  B 1 14 ? -19.637 5.244   -25.996 1.00 76.30  ? 14  DA  M P      1 
ATOM   925  O  OP1    . DA  B 1 14 ? -20.943 5.913   -25.786 1.00 83.57  ? 14  DA  M OP1    1 
ATOM   926  O  OP2    . DA  B 1 14 ? -19.500 4.192   -27.046 1.00 55.31  ? 14  DA  M OP2    1 
ATOM   927  O  "O5'"  . DA  B 1 14 ? -18.567 6.346   -26.310 1.00 68.61  ? 14  DA  M "O5'"  1 
ATOM   928  C  "C5'"  . DA  B 1 14 ? -18.376 7.360   -25.395 1.00 64.56  ? 14  DA  M "C5'"  1 
ATOM   929  C  "C4'"  . DA  B 1 14 ? -17.209 8.185   -25.819 1.00 73.83  ? 14  DA  M "C4'"  1 
ATOM   930  O  "O4'"  . DA  B 1 14 ? -16.001 7.449   -25.523 1.00 62.81  ? 14  DA  M "O4'"  1 
ATOM   931  C  "C3'"  . DA  B 1 14 ? -17.182 8.505   -27.324 1.00 73.43  ? 14  DA  M "C3'"  1 
ATOM   932  O  "O3'"  . DA  B 1 14 ? -16.828 9.868   -27.545 1.00 82.57  ? 14  DA  M "O3'"  1 
ATOM   933  C  "C2'"  . DA  B 1 14 ? -16.160 7.522   -27.884 1.00 70.61  ? 14  DA  M "C2'"  1 
ATOM   934  C  "C1'"  . DA  B 1 14 ? -15.226 7.287   -26.700 1.00 60.75  ? 14  DA  M "C1'"  1 
ATOM   935  N  N9     . DA  B 1 14 ? -14.622 5.955   -26.663 1.00 52.83  ? 14  DA  M N9     1 
ATOM   936  C  C8     . DA  B 1 14 ? -15.237 4.745   -26.892 1.00 53.73  ? 14  DA  M C8     1 
ATOM   937  N  N7     . DA  B 1 14 ? -14.435 3.708   -26.780 1.00 46.53  ? 14  DA  M N7     1 
ATOM   938  C  C5     . DA  B 1 14 ? -13.219 4.284   -26.443 1.00 47.84  ? 14  DA  M C5     1 
ATOM   939  C  C6     . DA  B 1 14 ? -11.954 3.739   -26.188 1.00 41.87  ? 14  DA  M C6     1 
ATOM   940  N  N6     . DA  B 1 14 ? -11.674 2.415   -26.226 1.00 39.31  ? 14  DA  M N6     1 
ATOM   941  N  N1     . DA  B 1 14 ? -10.973 4.599   -25.910 1.00 45.19  ? 14  DA  M N1     1 
ATOM   942  C  C2     . DA  B 1 14 ? -11.235 5.908   -25.874 1.00 48.00  ? 14  DA  M C2     1 
ATOM   943  N  N3     . DA  B 1 14 ? -12.372 6.535   -26.093 1.00 48.48  ? 14  DA  M N3     1 
ATOM   944  C  C4     . DA  B 1 14 ? -13.328 5.665   -26.375 1.00 46.82  ? 14  DA  M C4     1 
ATOM   945  H  "H5'"  . DA  B 1 14 ? -18.203 6.979   -24.520 1.00 78.35  ? 14  DA  M "H5'"  1 
ATOM   946  H  "H5''" . DA  B 1 14 ? -19.170 7.915   -25.357 1.00 78.35  ? 14  DA  M "H5''" 1 
ATOM   947  H  "H4'"  . DA  B 1 14 ? -17.207 9.016   -25.318 1.00 89.47  ? 14  DA  M "H4'"  1 
ATOM   948  H  "H3'"  . DA  B 1 14 ? -18.053 8.326   -27.711 1.00 88.99  ? 14  DA  M "H3'"  1 
ATOM   949  H  "H2'"  . DA  B 1 14 ? -16.591 6.694   -28.150 1.00 85.61  ? 14  DA  M "H2'"  1 
ATOM   950  H  "H2''" . DA  B 1 14 ? -15.678 7.915   -28.629 1.00 85.61  ? 14  DA  M "H2''" 1 
ATOM   951  H  "H1'"  . DA  B 1 14 ? -14.523 7.955   -26.712 1.00 73.77  ? 14  DA  M "H1'"  1 
ATOM   952  H  H8     . DA  B 1 14 ? -16.139 4.667   -27.105 1.00 65.35  ? 14  DA  M H8     1 
ATOM   953  H  H61    . DA  B 1 14 ? -10.874 2.139   -26.073 1.00 48.05  ? 14  DA  M H61    1 
ATOM   954  H  H62    . DA  B 1 14 ? -12.297 1.849   -26.405 1.00 48.05  ? 14  DA  M H62    1 
ATOM   955  H  H2     . DA  B 1 14 ? -10.512 6.454   -25.664 1.00 58.47  ? 14  DA  M H2     1 
ATOM   956  P  P      . DA  B 1 15 ? -16.529 10.424  -29.024 1.00 86.17  ? 15  DA  M P      1 
ATOM   957  O  OP1    . DA  B 1 15 ? -17.002 11.829  -29.092 1.00 84.32  ? 15  DA  M OP1    1 
ATOM   958  O  OP2    . DA  B 1 15 ? -17.032 9.462   -30.034 1.00 86.45  ? 15  DA  M OP2    1 
ATOM   959  O  "O5'"  . DA  B 1 15 ? -14.933 10.366  -29.055 1.00 75.85  ? 15  DA  M "O5'"  1 
ATOM   960  C  "C5'"  . DA  B 1 15 ? -14.212 10.705  -27.893 1.00 72.51  ? 15  DA  M "C5'"  1 
ATOM   961  C  "C4'"  . DA  B 1 15 ? -12.736 10.842  -28.193 1.00 87.89  ? 15  DA  M "C4'"  1 
ATOM   962  O  "O4'"  . DA  B 1 15 ? -12.051 9.564   -28.026 1.00 77.17  ? 15  DA  M "O4'"  1 
ATOM   963  C  "C3'"  . DA  B 1 15 ? -12.401 11.300  -29.601 1.00 92.56  ? 15  DA  M "C3'"  1 
ATOM   964  O  "O3'"  . DA  B 1 15 ? -11.255 12.153  -29.541 1.00 107.58 ? 15  DA  M "O3'"  1 
ATOM   965  C  "C2'"  . DA  B 1 15 ? -12.157 9.995   -30.361 1.00 79.53  ? 15  DA  M "C2'"  1 
ATOM   966  C  "C1'"  . DA  B 1 15 ? -11.585 9.081   -29.286 1.00 72.16  ? 15  DA  M "C1'"  1 
ATOM   967  N  N9     . DA  B 1 15 ? -11.936 7.665   -29.425 1.00 57.80  ? 15  DA  M N9     1 
ATOM   968  C  C8     . DA  B 1 15 ? -13.158 7.106   -29.702 1.00 54.33  ? 15  DA  M C8     1 
ATOM   969  N  N7     . DA  B 1 15 ? -13.136 5.780   -29.761 1.00 45.26  ? 15  DA  M N7     1 
ATOM   970  C  C5     . DA  B 1 15 ? -11.812 5.474   -29.504 1.00 40.67  ? 15  DA  M C5     1 
ATOM   971  C  C6     . DA  B 1 15 ? -11.120 4.258   -29.420 1.00 42.03  ? 15  DA  M C6     1 
ATOM   972  N  N6     . DA  B 1 15 ? -11.695 3.060   -29.596 1.00 40.98  ? 15  DA  M N6     1 
ATOM   973  N  N1     . DA  B 1 15 ? -9.803  4.313   -29.148 1.00 42.31  ? 15  DA  M N1     1 
ATOM   974  C  C2     . DA  B 1 15 ? -9.221  5.513   -28.983 1.00 48.45  ? 15  DA  M C2     1 
ATOM   975  N  N3     . DA  B 1 15 ? -9.767  6.720   -29.037 1.00 52.22  ? 15  DA  M N3     1 
ATOM   976  C  C4     . DA  B 1 15 ? -11.069 6.628   -29.306 1.00 48.91  ? 15  DA  M C4     1 
ATOM   977  H  "H5'"  . DA  B 1 15 ? -14.338 10.012  -27.226 1.00 87.88  ? 15  DA  M "H5'"  1 
ATOM   978  H  "H5''" . DA  B 1 15 ? -14.546 11.546  -27.545 1.00 87.88  ? 15  DA  M "H5''" 1 
ATOM   979  H  "H4'"  . DA  B 1 15 ? -12.355 11.477  -27.567 1.00 106.34 ? 15  DA  M "H4'"  1 
ATOM   980  H  "H3'"  . DA  B 1 15 ? -13.154 11.775  -29.985 1.00 111.95 ? 15  DA  M "H3'"  1 
ATOM   981  H  "H2'"  . DA  B 1 15 ? -12.990 9.638   -30.708 1.00 96.30  ? 15  DA  M "H2'"  1 
ATOM   982  H  "H2''" . DA  B 1 15 ? -11.515 10.129  -31.076 1.00 96.30  ? 15  DA  M "H2''" 1 
ATOM   983  H  "H1'"  . DA  B 1 15 ? -10.619 9.157   -29.304 1.00 87.46  ? 15  DA  M "H1'"  1 
ATOM   984  H  H8     . DA  B 1 15 ? -13.930 7.608   -29.833 1.00 66.07  ? 15  DA  M H8     1 
ATOM   985  H  H61    . DA  B 1 15 ? -11.224 2.343   -29.535 1.00 50.05  ? 15  DA  M H61    1 
ATOM   986  H  H62    . DA  B 1 15 ? -12.536 3.008   -29.770 1.00 50.05  ? 15  DA  M H62    1 
ATOM   987  H  H2     . DA  B 1 15 ? -8.310  5.494   -28.797 1.00 59.01  ? 15  DA  M H2     1 
ATOM   988  P  P      . DT  B 1 16 ? -10.299 12.358  -30.813 1.00 99.73  ? 16  DT  M P      1 
ATOM   989  O  OP1    . DT  B 1 16 ? -9.483  13.576  -30.569 1.00 93.02  ? 16  DT  M OP1    1 
ATOM   990  O  OP2    . DT  B 1 16 ? -11.174 12.238  -32.024 1.00 77.60  ? 16  DT  M OP2    1 
ATOM   991  O  "O5'"  . DT  B 1 16 ? -9.253  11.150  -30.701 1.00 66.50  ? 16  DT  M "O5'"  1 
ATOM   992  C  "C5'"  . DT  B 1 16 ? -8.234  11.130  -31.627 1.00 79.84  ? 16  DT  M "C5'"  1 
ATOM   993  C  "C4'"  . DT  B 1 16 ? -7.142  10.113  -31.345 1.00 76.99  ? 16  DT  M "C4'"  1 
ATOM   994  O  "O4'"  . DT  B 1 16 ? -7.730  8.795   -31.090 1.00 72.40  ? 16  DT  M "O4'"  1 
ATOM   995  C  "C3'"  . DT  B 1 16 ? -6.233  9.915   -32.568 1.00 78.75  ? 16  DT  M "C3'"  1 
ATOM   996  O  "O3'"  . DT  B 1 16 ? -4.902  9.508   -32.197 1.00 76.74  ? 16  DT  M "O3'"  1 
ATOM   997  C  "C2'"  . DT  B 1 16 ? -7.008  8.835   -33.331 1.00 72.17  ? 16  DT  M "C2'"  1 
ATOM   998  C  "C1'"  . DT  B 1 16 ? -7.384  7.911   -32.180 1.00 69.72  ? 16  DT  M "C1'"  1 
ATOM   999  N  N1     . DT  B 1 16 ? -8.555  6.918   -32.454 1.00 50.72  ? 16  DT  M N1     1 
ATOM   1000 C  C2     . DT  B 1 16 ? -8.305  5.579   -32.302 1.00 50.50  ? 16  DT  M C2     1 
ATOM   1001 O  O2     . DT  B 1 16 ? -7.196  5.146   -31.984 1.00 52.18  ? 16  DT  M O2     1 
ATOM   1002 N  N3     . DT  B 1 16 ? -9.387  4.752   -32.501 1.00 40.70  ? 16  DT  M N3     1 
ATOM   1003 C  C4     . DT  B 1 16 ? -10.663 5.118   -32.819 1.00 48.27  ? 16  DT  M C4     1 
ATOM   1004 O  O4     . DT  B 1 16 ? -11.563 4.278   -32.976 1.00 46.82  ? 16  DT  M O4     1 
ATOM   1005 C  C5     . DT  B 1 16 ? -10.868 6.551   -32.977 1.00 45.78  ? 16  DT  M C5     1 
ATOM   1006 C  C7     . DT  B 1 16 ? -12.214 7.075   -33.356 1.00 58.75  ? 16  DT  M C7     1 
ATOM   1007 C  C6     . DT  B 1 16 ? -9.814  7.375   -32.789 1.00 50.42  ? 16  DT  M C6     1 
ATOM   1008 H  "H5'"  . DT  B 1 16 ? -7.831  12.011  -31.658 1.00 96.68  ? 16  DT  M "H5'"  1 
ATOM   1009 H  "H5''" . DT  B 1 16 ? -8.615  10.936  -32.498 1.00 96.68  ? 16  DT  M "H5''" 1 
ATOM   1010 H  "H4'"  . DT  B 1 16 ? -6.615  10.394  -30.581 1.00 93.27  ? 16  DT  M "H4'"  1 
ATOM   1011 H  "H3'"  . DT  B 1 16 ? -6.199  10.731  -33.091 1.00 95.37  ? 16  DT  M "H3'"  1 
ATOM   1012 H  "HO3'" . DT  B 1 16 ? -4.243  9.985   -32.407 1.00 92.96  ? 16  DT  M "HO3'" 1 
ATOM   1013 H  "H2'"  . DT  B 1 16 ? -7.798  9.205   -33.755 1.00 87.48  ? 16  DT  M "H2'"  1 
ATOM   1014 H  "H2''" . DT  B 1 16 ? -6.439  8.383   -33.972 1.00 87.48  ? 16  DT  M "H2''" 1 
ATOM   1015 H  "H1'"  . DT  B 1 16 ? -6.600  7.400   -31.927 1.00 84.54  ? 16  DT  M "H1'"  1 
ATOM   1016 H  H3     . DT  B 1 16 ? -9.246  3.910   -32.401 1.00 49.71  ? 16  DT  M H3     1 
ATOM   1017 H  H71    . DT  B 1 16 ? -12.535 7.673   -32.662 1.00 71.37  ? 16  DT  M H71    1 
ATOM   1018 H  H72    . DT  B 1 16 ? -12.148 7.559   -34.194 1.00 71.37  ? 16  DT  M H72    1 
ATOM   1019 H  H73    . DT  B 1 16 ? -12.832 6.335   -33.457 1.00 71.37  ? 16  DT  M H73    1 
ATOM   1020 H  H6     . DT  B 1 16 ? -9.946  8.292   -32.871 1.00 61.37  ? 16  DT  M H6     1 
ATOM   1021 N  N      . ARG C 2 21 ? -10.859 15.651  -28.128 1.00 89.76  ? 168 ARG A N      1 
ATOM   1022 C  CA     . ARG C 2 21 ? -10.247 15.263  -26.863 1.00 83.42  ? 168 ARG A CA     1 
ATOM   1023 C  C      . ARG C 2 21 ? -8.738  15.517  -26.892 0.54 85.20  ? 168 ARG A C      1 
ATOM   1024 O  O      . ARG C 2 21 ? -8.276  16.548  -26.404 1.00 86.00  ? 168 ARG A O      1 
ATOM   1025 C  CB     . ARG C 2 21 ? -10.531 13.782  -26.542 1.00 86.52  ? 168 ARG A CB     1 
ATOM   1026 C  CG     . ARG C 2 21 ? -9.934  13.303  -25.201 1.00 87.10  ? 168 ARG A CG     1 
ATOM   1027 C  CD     . ARG C 2 21 ? -9.842  11.778  -25.085 0.19 79.06  ? 168 ARG A CD     1 
ATOM   1028 N  NE     . ARG C 2 21 ? -8.653  11.234  -25.746 0.85 97.01  ? 168 ARG A NE     1 
ATOM   1029 C  CZ     . ARG C 2 21 ? -8.278  9.956   -25.700 0.75 61.39  ? 168 ARG A CZ     1 
ATOM   1030 N  NH1    . ARG C 2 21 ? -7.189  9.552   -26.343 0.47 55.95  ? 168 ARG A NH1    1 
ATOM   1031 N  NH2    . ARG C 2 21 ? -8.998  9.072   -25.024 1.00 52.94  ? 168 ARG A NH2    1 
ATOM   1032 H  HA     . ARG C 2 21 ? -10.627 15.801  -26.151 1.00 100.98 ? 168 ARG A HA     1 
ATOM   1033 H  HB2    . ARG C 2 21 ? -11.491 13.651  -26.502 1.00 104.70 ? 168 ARG A HB2    1 
ATOM   1034 H  HB3    . ARG C 2 21 ? -10.154 13.233  -27.247 1.00 104.70 ? 168 ARG A HB3    1 
ATOM   1035 H  HG2    . ARG C 2 21 ? -9.038  13.664  -25.110 1.00 105.40 ? 168 ARG A HG2    1 
ATOM   1036 H  HG3    . ARG C 2 21 ? -10.494 13.624  -24.477 1.00 105.40 ? 168 ARG A HG3    1 
ATOM   1037 H  HD2    . ARG C 2 21 ? -9.802  11.534  -24.147 1.00 95.74  ? 168 ARG A HD2    1 
ATOM   1038 H  HD3    . ARG C 2 21 ? -10.624 11.381  -25.500 1.00 95.74  ? 168 ARG A HD3    1 
ATOM   1039 H  HE     . ARG C 2 21 ? -8.161  11.779  -26.195 1.00 117.28 ? 168 ARG A HE     1 
ATOM   1040 H  HH11   . ARG C 2 21 ? -6.715  10.118  -26.784 1.00 68.01  ? 168 ARG A HH11   1 
ATOM   1041 H  HH12   . ARG C 2 21 ? -6.950  8.726   -26.308 1.00 68.01  ? 168 ARG A HH12   1 
ATOM   1042 H  HH21   . ARG C 2 21 ? -9.708  9.324   -24.608 1.00 64.40  ? 168 ARG A HH21   1 
ATOM   1043 H  HH22   . ARG C 2 21 ? -8.753  8.248   -24.997 1.00 64.40  ? 168 ARG A HH22   1 
ATOM   1044 N  N      . GLY C 2 22 ? -7.981  14.583  -27.457 1.00 87.19  ? 169 GLY A N      1 
ATOM   1045 C  CA     . GLY C 2 22 ? -6.539  14.695  -27.543 1.00 78.53  ? 169 GLY A CA     1 
ATOM   1046 C  C      . GLY C 2 22 ? -5.836  13.745  -26.582 1.00 72.01  ? 169 GLY A C      1 
ATOM   1047 O  O      . GLY C 2 22 ? -6.438  13.132  -25.697 1.00 71.86  ? 169 GLY A O      1 
ATOM   1048 H  H      . GLY C 2 22 ? -8.291  13.860  -27.804 1.00 105.50 ? 169 GLY A H      1 
ATOM   1049 H  HA2    . GLY C 2 22 ? -6.251  14.490  -28.446 1.00 95.11  ? 169 GLY A HA2    1 
ATOM   1050 H  HA3    . GLY C 2 22 ? -6.270  15.603  -27.332 1.00 95.11  ? 169 GLY A HA3    1 
ATOM   1051 N  N      . ASN C 2 23 ? -4.529  13.638  -26.773 1.00 67.27  ? 170 ASN A N      1 
ATOM   1052 C  CA     . ASN C 2 23 ? -3.697  12.760  -25.970 1.00 57.42  ? 170 ASN A CA     1 
ATOM   1053 C  C      . ASN C 2 23 ? -2.775  13.565  -25.061 1.00 56.62  ? 170 ASN A C      1 
ATOM   1054 O  O      . ASN C 2 23 ? -2.678  14.792  -25.152 1.00 54.95  ? 170 ASN A O      1 
ATOM   1055 C  CB     . ASN C 2 23 ? -2.888  11.812  -26.861 1.00 60.58  ? 170 ASN A CB     1 
ATOM   1056 C  CG     . ASN C 2 23 ? -3.755  10.736  -27.505 1.00 70.64  ? 170 ASN A CG     1 
ATOM   1057 O  OD1    . ASN C 2 23 ? -4.980  10.676  -27.295 1.00 72.77  ? 170 ASN A OD1    1 
ATOM   1058 N  ND2    . ASN C 2 23 ? -3.120  9.859   -28.265 1.00 61.86  ? 170 ASN A ND2    1 
ATOM   1059 H  H      . ASN C 2 23 ? -4.094  14.073  -27.374 1.00 81.60  ? 170 ASN A H      1 
ATOM   1060 H  HA     . ASN C 2 23 ? -4.271  12.218  -25.405 1.00 69.77  ? 170 ASN A HA     1 
ATOM   1061 H  HB2    . ASN C 2 23 ? -2.468  12.324  -27.569 1.00 73.57  ? 170 ASN A HB2    1 
ATOM   1062 H  HB3    . ASN C 2 23 ? -2.212  11.371  -26.323 1.00 73.57  ? 170 ASN A HB3    1 
ATOM   1063 H  HD21   . ASN C 2 23 ? -3.558  9.230   -28.654 1.00 75.11  ? 170 ASN A HD21   1 
ATOM   1064 H  HD22   . ASN C 2 23 ? -2.268  9.919   -28.371 1.00 75.11  ? 170 ASN A HD22   1 
ATOM   1065 N  N      . LEU C 2 24 ? -2.145  12.854  -24.124 1.00 53.28  ? 171 LEU A N      1 
ATOM   1066 C  CA     . LEU C 2 24 ? -1.297  13.507  -23.140 1.00 53.27  ? 171 LEU A CA     1 
ATOM   1067 C  C      . LEU C 2 24 ? 0.012   13.982  -23.766 1.00 50.13  ? 171 LEU A C      1 
ATOM   1068 O  O      . LEU C 2 24 ? 0.557   13.327  -24.658 1.00 56.16  ? 171 LEU A O      1 
ATOM   1069 C  CB     . LEU C 2 24 ? -0.976  12.564  -21.995 1.00 64.29  ? 171 LEU A CB     1 
ATOM   1070 C  CG     . LEU C 2 24 ? -2.124  12.087  -21.093 1.00 60.63  ? 171 LEU A CG     1 
ATOM   1071 C  CD1    . LEU C 2 24 ? -1.567  11.158  -20.039 1.00 52.57  ? 171 LEU A CD1    1 
ATOM   1072 C  CD2    . LEU C 2 24 ? -2.872  13.236  -20.450 1.00 62.29  ? 171 LEU A CD2    1 
ATOM   1073 H  H      . LEU C 2 24 ? -2.195  11.999  -24.040 1.00 64.81  ? 171 LEU A H      1 
ATOM   1074 H  HA     . LEU C 2 24 ? -1.760  14.279  -22.780 1.00 64.80  ? 171 LEU A HA     1 
ATOM   1075 H  HB2    . LEU C 2 24 ? -0.567  11.769  -22.371 1.00 78.02  ? 171 LEU A HB2    1 
ATOM   1076 H  HB3    . LEU C 2 24 ? -0.333  13.006  -21.419 1.00 78.02  ? 171 LEU A HB3    1 
ATOM   1077 H  HG     . LEU C 2 24 ? -2.756  11.584  -21.629 1.00 73.63  ? 171 LEU A HG     1 
ATOM   1078 H  HD11   . LEU C 2 24 ? -2.292  10.857  -19.469 1.00 63.96  ? 171 LEU A HD11   1 
ATOM   1079 H  HD12   . LEU C 2 24 ? -1.152  10.398  -20.476 1.00 63.96  ? 171 LEU A HD12   1 
ATOM   1080 H  HD13   . LEU C 2 24 ? -0.909  11.637  -19.512 1.00 63.96  ? 171 LEU A HD13   1 
ATOM   1081 H  HD21   . LEU C 2 24 ? -3.582  12.878  -19.894 1.00 75.62  ? 171 LEU A HD21   1 
ATOM   1082 H  HD22   . LEU C 2 24 ? -2.254  13.750  -19.907 1.00 75.62  ? 171 LEU A HD22   1 
ATOM   1083 H  HD23   . LEU C 2 24 ? -3.247  13.797  -21.146 1.00 75.62  ? 171 LEU A HD23   1 
ATOM   1084 N  N      . PRO C 2 25 ? 0.566   15.088  -23.280 1.00 45.97  ? 172 PRO A N      1 
ATOM   1085 C  CA     . PRO C 2 25 ? 1.808   15.598  -23.866 1.00 36.54  ? 172 PRO A CA     1 
ATOM   1086 C  C      . PRO C 2 25 ? 2.894   14.536  -23.871 1.00 43.69  ? 172 PRO A C      1 
ATOM   1087 O  O      . PRO C 2 25 ? 3.051   13.768  -22.919 1.00 48.00  ? 172 PRO A O      1 
ATOM   1088 C  CB     . PRO C 2 25 ? 2.180   16.770  -22.962 1.00 39.90  ? 172 PRO A CB     1 
ATOM   1089 C  CG     . PRO C 2 25 ? 0.949   17.112  -22.204 1.00 40.62  ? 172 PRO A CG     1 
ATOM   1090 C  CD     . PRO C 2 25 ? 0.162   15.853  -22.087 1.00 44.66  ? 172 PRO A CD     1 
ATOM   1091 H  HA     . PRO C 2 25 ? 1.656   15.916  -24.769 1.00 44.72  ? 172 PRO A HA     1 
ATOM   1092 H  HB2    . PRO C 2 25 ? 2.888   16.502  -22.357 1.00 48.75  ? 172 PRO A HB2    1 
ATOM   1093 H  HB3    . PRO C 2 25 ? 2.463   17.522  -23.507 1.00 48.75  ? 172 PRO A HB3    1 
ATOM   1094 H  HG2    . PRO C 2 25 ? 1.193   17.442  -21.325 1.00 49.61  ? 172 PRO A HG2    1 
ATOM   1095 H  HG3    . PRO C 2 25 ? 0.446   17.783  -22.691 1.00 49.61  ? 172 PRO A HG3    1 
ATOM   1096 H  HD2    . PRO C 2 25 ? 0.406   15.375  -21.279 1.00 54.47  ? 172 PRO A HD2    1 
ATOM   1097 H  HD3    . PRO C 2 25 ? -0.789  16.045  -22.114 1.00 54.47  ? 172 PRO A HD3    1 
ATOM   1098 N  N      . LYS C 2 26 ? 3.667   14.521  -24.952 1.00 49.17  ? 173 LYS A N      1 
ATOM   1099 C  CA     . LYS C 2 26 ? 4.645   13.463  -25.146 1.00 50.62  ? 173 LYS A CA     1 
ATOM   1100 C  C      . LYS C 2 26 ? 5.747   13.527  -24.098 1.00 45.27  ? 173 LYS A C      1 
ATOM   1101 O  O      . LYS C 2 26 ? 6.264   12.486  -23.681 1.00 50.79  ? 173 LYS A O      1 
ATOM   1102 C  CB     . LYS C 2 26 ? 5.211   13.539  -26.567 1.00 66.02  ? 173 LYS A CB     1 
ATOM   1103 C  CG     . LYS C 2 26 ? 4.127   13.525  -27.642 1.00 55.97  ? 173 LYS A CG     1 
ATOM   1104 H  H      . LYS C 2 26 ? 3.645   15.107  -25.580 1.00 59.87  ? 173 LYS A H      1 
ATOM   1105 H  HA     . LYS C 2 26 ? 4.198   12.607  -25.052 1.00 61.61  ? 173 LYS A HA     1 
ATOM   1106 H  HB2    . LYS C 2 26 ? 5.716   14.362  -26.662 1.00 80.10  ? 173 LYS A HB2    1 
ATOM   1107 H  HB3    . LYS C 2 26 ? 5.790   12.776  -26.717 1.00 80.10  ? 173 LYS A HB3    1 
ATOM   1108 N  N      . GLU C 2 27 ? 6.153   14.725  -23.678 1.00 41.43  ? 174 GLU A N      1 
ATOM   1109 C  CA     . GLU C 2 27 ? 7.146   14.795  -22.608 1.00 48.99  ? 174 GLU A CA     1 
ATOM   1110 C  C      . GLU C 2 27 ? 6.543   14.361  -21.271 1.00 51.79  ? 174 GLU A C      1 
ATOM   1111 O  O      . GLU C 2 27 ? 7.205   13.680  -20.483 1.00 46.69  ? 174 GLU A O      1 
ATOM   1112 C  CB     . GLU C 2 27 ? 7.739   16.197  -22.510 1.00 54.47  ? 174 GLU A CB     1 
ATOM   1113 C  CG     . GLU C 2 27 ? 9.156   16.207  -21.920 1.00 64.84  ? 174 GLU A CG     1 
ATOM   1114 H  H      . GLU C 2 27 ? 5.883   15.483  -23.983 1.00 50.59  ? 174 GLU A H      1 
ATOM   1115 H  HA     . GLU C 2 27 ? 7.870   14.183  -22.816 1.00 59.66  ? 174 GLU A HA     1 
ATOM   1116 H  HB2    . GLU C 2 27 ? 7.782   16.584  -23.399 1.00 66.24  ? 174 GLU A HB2    1 
ATOM   1117 H  HB3    . GLU C 2 27 ? 7.173   16.740  -21.939 1.00 66.24  ? 174 GLU A HB3    1 
ATOM   1118 N  N      . SER C 2 28 ? 5.276   14.704  -21.012 1.00 46.43  ? 175 SER A N      1 
ATOM   1119 C  CA     . SER C 2 28 ? 4.628   14.212  -19.801 1.00 44.19  ? 175 SER A CA     1 
ATOM   1120 C  C      . SER C 2 28 ? 4.647   12.696  -19.775 1.00 51.09  ? 175 SER A C      1 
ATOM   1121 O  O      . SER C 2 28 ? 4.971   12.073  -18.749 1.00 48.01  ? 175 SER A O      1 
ATOM   1122 C  CB     . SER C 2 28 ? 3.170   14.674  -19.740 1.00 45.76  ? 175 SER A CB     1 
ATOM   1123 O  OG     . SER C 2 28 ? 3.031   16.083  -19.863 1.00 46.48  ? 175 SER A OG     1 
ATOM   1124 H  H      . SER C 2 28 ? 4.785   15.206  -21.509 1.00 56.59  ? 175 SER A H      1 
ATOM   1125 H  HA     . SER C 2 28 ? 5.095   14.544  -19.019 1.00 53.90  ? 175 SER A HA     1 
ATOM   1126 H  HB2    . SER C 2 28 ? 2.681   14.252  -20.464 1.00 55.79  ? 175 SER A HB2    1 
ATOM   1127 H  HB3    . SER C 2 28 ? 2.794   14.400  -18.889 1.00 55.79  ? 175 SER A HB3    1 
ATOM   1128 H  HG     . SER C 2 28 ? 3.444   16.468  -19.241 1.00 56.64  ? 175 SER A HG     1 
ATOM   1129 N  N      . VAL C 2 29 ? 4.318   12.082  -20.910 1.00 39.89  ? 176 VAL A N      1 
ATOM   1130 C  CA     . VAL C 2 29 ? 4.234   10.635  -20.953 1.00 44.40  ? 176 VAL A CA     1 
ATOM   1131 C  C      . VAL C 2 29 ? 5.628   10.039  -20.932 1.00 44.92  ? 176 VAL A C      1 
ATOM   1132 O  O      . VAL C 2 29 ? 5.829   8.907   -20.466 1.00 45.99  ? 176 VAL A O      1 
ATOM   1133 C  CB     . VAL C 2 29 ? 3.419   10.211  -22.185 1.00 51.57  ? 176 VAL A CB     1 
ATOM   1134 C  CG1    . VAL C 2 29 ? 3.339   8.699   -22.294 1.00 48.32  ? 176 VAL A CG1    1 
ATOM   1135 C  CG2    . VAL C 2 29 ? 2.036   10.811  -22.085 1.00 46.57  ? 176 VAL A CG2    1 
ATOM   1136 H  H      . VAL C 2 29 ? 4.143   12.477  -21.654 1.00 48.74  ? 176 VAL A H      1 
ATOM   1137 H  HA     . VAL C 2 29 ? 3.765   10.324  -20.163 1.00 54.15  ? 176 VAL A HA     1 
ATOM   1138 H  HB     . VAL C 2 29 ? 3.844   10.554  -22.987 1.00 62.76  ? 176 VAL A HB     1 
ATOM   1139 H  HG11   . VAL C 2 29 ? 2.819   8.467   -23.079 1.00 58.85  ? 176 VAL A HG11   1 
ATOM   1140 H  HG12   . VAL C 2 29 ? 4.237   8.341   -22.372 1.00 58.85  ? 176 VAL A HG12   1 
ATOM   1141 H  HG13   . VAL C 2 29 ? 2.911   8.348   -21.497 1.00 58.85  ? 176 VAL A HG13   1 
ATOM   1142 H  HG21   . VAL C 2 29 ? 1.519   10.545  -22.861 1.00 56.76  ? 176 VAL A HG21   1 
ATOM   1143 H  HG22   . VAL C 2 29 ? 1.609   10.487  -21.276 1.00 56.76  ? 176 VAL A HG22   1 
ATOM   1144 H  HG23   . VAL C 2 29 ? 2.113   11.778  -22.054 1.00 56.76  ? 176 VAL A HG23   1 
ATOM   1145 N  N      . GLN C 2 30 ? 6.622   10.780  -21.413 1.00 41.67  ? 177 GLN A N      1 
ATOM   1146 C  CA     . GLN C 2 30 ? 7.974   10.248  -21.355 1.00 47.21  ? 177 GLN A CA     1 
ATOM   1147 C  C      . GLN C 2 30 ? 8.401   10.051  -19.913 1.00 46.24  ? 177 GLN A C      1 
ATOM   1148 O  O      . GLN C 2 30 ? 9.002   9.025   -19.567 1.00 47.74  ? 177 GLN A O      1 
ATOM   1149 C  CB     . GLN C 2 30 ? 8.963   11.190  -22.048 1.00 51.20  ? 177 GLN A CB     1 
ATOM   1150 C  CG     . GLN C 2 30 ? 10.322  10.532  -22.310 1.00 55.04  ? 177 GLN A CG     1 
ATOM   1151 C  CD     . GLN C 2 30 ? 10.174  9.278   -23.163 1.00 60.61  ? 177 GLN A CD     1 
ATOM   1152 O  OE1    . GLN C 2 30 ? 9.639   9.348   -24.264 1.00 55.61  ? 177 GLN A OE1    1 
ATOM   1153 N  NE2    . GLN C 2 30 ? 10.589  8.125   -22.637 1.00 60.66  ? 177 GLN A NE2    1 
ATOM   1154 H  H      . GLN C 2 30 ? 6.545   11.561  -21.765 1.00 50.87  ? 177 GLN A H      1 
ATOM   1155 H  HA     . GLN C 2 30 ? 8.003   9.389   -21.804 1.00 57.52  ? 177 GLN A HA     1 
ATOM   1156 H  HB2    . GLN C 2 30 ? 8.593   11.464  -22.902 1.00 62.31  ? 177 GLN A HB2    1 
ATOM   1157 H  HB3    . GLN C 2 30 ? 9.109   11.966  -21.485 1.00 62.31  ? 177 GLN A HB3    1 
ATOM   1158 H  HG2    . GLN C 2 30 ? 10.895  11.156  -22.782 1.00 66.92  ? 177 GLN A HG2    1 
ATOM   1159 H  HG3    . GLN C 2 30 ? 10.724  10.279  -21.464 1.00 66.92  ? 177 GLN A HG3    1 
ATOM   1160 H  HE21   . GLN C 2 30 ? 10.925  8.110   -21.845 1.00 73.66  ? 177 GLN A HE21   1 
ATOM   1161 H  HE22   . GLN C 2 30 ? 10.522  7.397   -23.089 1.00 73.66  ? 177 GLN A HE22   1 
ATOM   1162 N  N      . ILE C 2 31 ? 8.064   11.018  -19.053 1.00 43.77  ? 178 ILE A N      1 
ATOM   1163 C  CA     . ILE C 2 31 ? 8.454   10.971  -17.645 1.00 42.30  ? 178 ILE A CA     1 
ATOM   1164 C  C      . ILE C 2 31 ? 7.786   9.792   -16.958 1.00 36.70  ? 178 ILE A C      1 
ATOM   1165 O  O      . ILE C 2 31 ? 8.445   8.955   -16.343 1.00 37.70  ? 178 ILE A O      1 
ATOM   1166 C  CB     . ILE C 2 31 ? 8.096   12.302  -16.972 1.00 34.37  ? 178 ILE A CB     1 
ATOM   1167 C  CG1    . ILE C 2 31 ? 8.922   13.421  -17.576 1.00 37.13  ? 178 ILE A CG1    1 
ATOM   1168 C  CG2    . ILE C 2 31 ? 8.373   12.234  -15.513 1.00 51.84  ? 178 ILE A CG2    1 
ATOM   1169 C  CD1    . ILE C 2 31 ? 8.451   14.787  -17.222 1.00 36.92  ? 178 ILE A CD1    1 
ATOM   1170 H  H      . ILE C 2 31 ? 7.607   11.715  -19.265 1.00 53.40  ? 178 ILE A H      1 
ATOM   1171 H  HA     . ILE C 2 31 ? 9.415   10.851  -17.585 1.00 51.63  ? 178 ILE A HA     1 
ATOM   1172 H  HB     . ILE C 2 31 ? 7.154   12.487  -17.111 1.00 42.11  ? 178 ILE A HB     1 
ATOM   1173 H  HG12   . ILE C 2 31 ? 9.837   13.335  -17.266 1.00 45.43  ? 178 ILE A HG12   1 
ATOM   1174 H  HG13   . ILE C 2 31 ? 8.894   13.341  -18.542 1.00 45.43  ? 178 ILE A HG13   1 
ATOM   1175 H  HG21   . ILE C 2 31 ? 8.139   13.084  -15.109 1.00 63.08  ? 178 ILE A HG21   1 
ATOM   1176 H  HG22   . ILE C 2 31 ? 7.839   11.524  -15.124 1.00 63.08  ? 178 ILE A HG22   1 
ATOM   1177 H  HG23   . ILE C 2 31 ? 9.316   12.051  -15.380 1.00 63.08  ? 178 ILE A HG23   1 
ATOM   1178 H  HD11   . ILE C 2 31 ? 9.030   15.440  -17.646 1.00 45.18  ? 178 ILE A HD11   1 
ATOM   1179 H  HD12   . ILE C 2 31 ? 7.540   14.898  -17.536 1.00 45.18  ? 178 ILE A HD12   1 
ATOM   1180 H  HD13   . ILE C 2 31 ? 8.484   14.892  -16.258 1.00 45.18  ? 178 ILE A HD13   1 
ATOM   1181 N  N      . LEU C 2 32 ? 6.470   9.672   -17.114 1.00 37.03  ? 179 LEU A N      1 
ATOM   1182 C  CA     . LEU C 2 32 ? 5.765   8.553   -16.517 1.00 40.26  ? 179 LEU A CA     1 
ATOM   1183 C  C      . LEU C 2 32 ? 6.347   7.220   -16.977 1.00 41.69  ? 179 LEU A C      1 
ATOM   1184 O  O      . LEU C 2 32 ? 6.522   6.290   -16.168 1.00 34.33  ? 179 LEU A O      1 
ATOM   1185 C  CB     . LEU C 2 32 ? 4.283   8.645   -16.870 1.00 45.05  ? 179 LEU A CB     1 
ATOM   1186 C  CG     . LEU C 2 32 ? 3.543   9.891   -16.387 1.00 54.08  ? 179 LEU A CG     1 
ATOM   1187 C  CD1    . LEU C 2 32 ? 2.152   9.899   -16.984 1.00 43.35  ? 179 LEU A CD1    1 
ATOM   1188 C  CD2    . LEU C 2 32 ? 3.465   9.941   -14.811 1.00 44.20  ? 179 LEU A CD2    1 
ATOM   1189 H  H      . LEU C 2 32 ? 5.973   10.218  -17.554 1.00 45.31  ? 179 LEU A H      1 
ATOM   1190 H  HA     . LEU C 2 32 ? 5.849   8.601   -15.552 1.00 49.19  ? 179 LEU A HA     1 
ATOM   1191 H  HB2    . LEU C 2 32 ? 4.199   8.618   -17.836 1.00 54.94  ? 179 LEU A HB2    1 
ATOM   1192 H  HB3    . LEU C 2 32 ? 3.831   7.877   -16.488 1.00 54.94  ? 179 LEU A HB3    1 
ATOM   1193 H  HG     . LEU C 2 32 ? 4.012   10.683  -16.694 1.00 65.76  ? 179 LEU A HG     1 
ATOM   1194 H  HD11   . LEU C 2 32 ? 1.682   10.690  -16.677 1.00 52.90  ? 179 LEU A HD11   1 
ATOM   1195 H  HD12   . LEU C 2 32 ? 2.224   9.911   -17.951 1.00 52.90  ? 179 LEU A HD12   1 
ATOM   1196 H  HD13   . LEU C 2 32 ? 1.681   9.102   -16.696 1.00 52.90  ? 179 LEU A HD13   1 
ATOM   1197 H  HD21   . LEU C 2 32 ? 2.990   10.744  -14.544 1.00 53.92  ? 179 LEU A HD21   1 
ATOM   1198 H  HD22   . LEU C 2 32 ? 2.992   9.156   -14.494 1.00 53.92  ? 179 LEU A HD22   1 
ATOM   1199 H  HD23   . LEU C 2 32 ? 4.365   9.954   -14.451 1.00 53.92  ? 179 LEU A HD23   1 
ATOM   1200 N  N      . ARG C 2 33 ? 6.636   7.100   -18.276 1.00 40.94  ? 180 ARG A N      1 
ATOM   1201 C  CA     . ARG C 2 33 ? 7.178   5.851   -18.800 1.00 41.06  ? 180 ARG A CA     1 
ATOM   1202 C  C      . ARG C 2 33 ? 8.538   5.545   -18.176 1.00 43.77  ? 180 ARG A C      1 
ATOM   1203 O  O      . ARG C 2 33 ? 8.793   4.416   -17.733 1.00 42.45  ? 180 ARG A O      1 
ATOM   1204 C  CB     . ARG C 2 33 ? 7.310   5.954   -20.318 1.00 49.76  ? 180 ARG A CB     1 
ATOM   1205 C  CG     . ARG C 2 33 ? 6.397   5.042   -21.116 1.00 61.21  ? 180 ARG A CG     1 
ATOM   1206 C  CD     . ARG C 2 33 ? 6.740   5.062   -22.619 1.00 51.40  ? 180 ARG A CD     1 
ATOM   1207 N  NE     . ARG C 2 33 ? 5.805   4.222   -23.376 0.98 70.70  ? 180 ARG A NE     1 
ATOM   1208 H  H      . ARG C 2 33 ? 6.528   7.719   -18.863 1.00 50.00  ? 180 ARG A H      1 
ATOM   1209 H  HA     . ARG C 2 33 ? 6.572   5.122   -18.592 1.00 50.14  ? 180 ARG A HA     1 
ATOM   1210 H  HB2    . ARG C 2 33 ? 7.113   6.866   -20.582 1.00 60.59  ? 180 ARG A HB2    1 
ATOM   1211 H  HB3    . ARG C 2 33 ? 8.223   5.737   -20.562 1.00 60.59  ? 180 ARG A HB3    1 
ATOM   1212 H  HG2    . ARG C 2 33 ? 6.494   4.132   -20.795 1.00 74.32  ? 180 ARG A HG2    1 
ATOM   1213 H  HG3    . ARG C 2 33 ? 5.479   5.338   -21.011 1.00 74.32  ? 180 ARG A HG3    1 
ATOM   1214 H  HD2    . ARG C 2 33 ? 6.675   5.971   -22.953 1.00 62.56  ? 180 ARG A HD2    1 
ATOM   1215 H  HD3    . ARG C 2 33 ? 7.637   4.717   -22.749 1.00 62.56  ? 180 ARG A HD3    1 
ATOM   1216 H  HE     . ARG C 2 33 ? 5.160   4.611   -23.791 1.00 85.72  ? 180 ARG A HE     1 
ATOM   1217 N  N      . ASP C 2 34 ? 9.426   6.551   -18.114 1.00 47.64  ? 181 ASP A N      1 
ATOM   1218 C  CA     . ASP C 2 34 ? 10.743  6.346   -17.506 1.00 45.78  ? 181 ASP A CA     1 
ATOM   1219 C  C      . ASP C 2 34 ? 10.596  5.886   -16.054 1.00 42.47  ? 181 ASP A C      1 
ATOM   1220 O  O      . ASP C 2 34 ? 11.294  4.969   -15.604 1.00 42.57  ? 181 ASP A O      1 
ATOM   1221 C  CB     . ASP C 2 34 ? 11.568  7.639   -17.587 1.00 43.82  ? 181 ASP A CB     1 
ATOM   1222 C  CG     . ASP C 2 34 ? 11.904  8.051   -19.025 1.00 51.30  ? 181 ASP A CG     1 
ATOM   1223 O  OD1    . ASP C 2 34 ? 11.911  7.164   -19.905 1.00 49.86  ? 181 ASP A OD1    1 
ATOM   1224 O  OD2    . ASP C 2 34 ? 12.151  9.264   -19.282 1.00 47.90  ? 181 ASP A OD2    1 
ATOM   1225 H  H      . ASP C 2 34 ? 9.289   7.346   -18.412 1.00 58.04  ? 181 ASP A H      1 
ATOM   1226 H  HA     . ASP C 2 34 ? 11.216  5.655   -17.996 1.00 55.81  ? 181 ASP A HA     1 
ATOM   1227 H  HB2    . ASP C 2 34 ? 11.064  8.361   -17.180 1.00 53.46  ? 181 ASP A HB2    1 
ATOM   1228 H  HB3    . ASP C 2 34 ? 12.403  7.510   -17.111 1.00 53.46  ? 181 ASP A HB3    1 
ATOM   1229 N  N      . TRP C 2 35 ? 9.681   6.503   -15.305 1.00 39.42  ? 182 TRP A N      1 
ATOM   1230 C  CA     . TRP C 2 35 ? 9.488   6.115   -13.901 1.00 42.39  ? 182 TRP A CA     1 
ATOM   1231 C  C      . TRP C 2 35 ? 8.998   4.678   -13.802 1.00 36.18  ? 182 TRP A C      1 
ATOM   1232 O  O      . TRP C 2 35 ? 9.446   3.911   -12.945 1.00 32.19  ? 182 TRP A O      1 
ATOM   1233 C  CB     . TRP C 2 35 ? 8.474   7.052   -13.230 1.00 37.32  ? 182 TRP A CB     1 
ATOM   1234 C  CG     . TRP C 2 35 ? 8.440   6.915   -11.748 1.00 44.56  ? 182 TRP A CG     1 
ATOM   1235 C  CD1    . TRP C 2 35 ? 9.034   7.743   -10.856 1.00 37.60  ? 182 TRP A CD1    1 
ATOM   1236 C  CD2    . TRP C 2 35 ? 7.802   5.889   -10.984 1.00 38.65  ? 182 TRP A CD2    1 
ATOM   1237 N  NE1    . TRP C 2 35 ? 8.830   7.287   -9.579  1.00 44.31  ? 182 TRP A NE1    1 
ATOM   1238 C  CE2    . TRP C 2 35 ? 8.067   6.154   -9.631  1.00 42.36  ? 182 TRP A CE2    1 
ATOM   1239 C  CE3    . TRP C 2 35 ? 7.032   4.773   -11.310 1.00 42.00  ? 182 TRP A CE3    1 
ATOM   1240 C  CZ2    . TRP C 2 35 ? 7.582   5.354   -8.599  1.00 42.88  ? 182 TRP A CZ2    1 
ATOM   1241 C  CZ3    . TRP C 2 35 ? 6.552   3.976   -10.281 1.00 43.14  ? 182 TRP A CZ3    1 
ATOM   1242 C  CH2    . TRP C 2 35 ? 6.838   4.266   -8.944  1.00 44.29  ? 182 TRP A CH2    1 
ATOM   1243 H  H      . TRP C 2 35 ? 9.167   7.137   -15.577 1.00 48.18  ? 182 TRP A H      1 
ATOM   1244 H  HA     . TRP C 2 35 ? 10.332  6.186   -13.428 1.00 51.75  ? 182 TRP A HA     1 
ATOM   1245 H  HB2    . TRP C 2 35 ? 8.706   7.970   -13.440 1.00 45.66  ? 182 TRP A HB2    1 
ATOM   1246 H  HB3    . TRP C 2 35 ? 7.587   6.850   -13.569 1.00 45.66  ? 182 TRP A HB3    1 
ATOM   1247 H  HD1    . TRP C 2 35 ? 9.542   8.490   -11.079 1.00 46.00  ? 182 TRP A HD1    1 
ATOM   1248 H  HE1    . TRP C 2 35 ? 9.117   7.664   -8.862  1.00 54.05  ? 182 TRP A HE1    1 
ATOM   1249 H  HE3    . TRP C 2 35 ? 6.846   4.567   -12.198 1.00 51.27  ? 182 TRP A HE3    1 
ATOM   1250 H  HZ2    . TRP C 2 35 ? 7.765   5.552   -7.709  1.00 52.33  ? 182 TRP A HZ2    1 
ATOM   1251 H  HZ3    . TRP C 2 35 ? 6.043   3.225   -10.486 1.00 52.65  ? 182 TRP A HZ3    1 
ATOM   1252 H  HH2    . TRP C 2 35 ? 6.500   3.715   -8.275  1.00 54.02  ? 182 TRP A HH2    1 
ATOM   1253 N  N      . LEU C 2 36 ? 8.073   4.292   -14.684 1.00 37.62  ? 183 LEU A N      1 
ATOM   1254 C  CA     . LEU C 2 36 ? 7.522   2.945   -14.626 1.00 37.59  ? 183 LEU A CA     1 
ATOM   1255 C  C      . LEU C 2 36 ? 8.602   1.907   -14.916 1.00 43.12  ? 183 LEU A C      1 
ATOM   1256 O  O      . LEU C 2 36 ? 8.647   0.843   -14.286 1.00 46.03  ? 183 LEU A O      1 
ATOM   1257 C  CB     . LEU C 2 36 ? 6.340   2.825   -15.592 1.00 36.81  ? 183 LEU A CB     1 
ATOM   1258 C  CG     . LEU C 2 36 ? 5.683   1.439   -15.684 1.00 37.97  ? 183 LEU A CG     1 
ATOM   1259 C  CD1    . LEU C 2 36 ? 5.119   0.952   -14.375 1.00 40.63  ? 183 LEU A CD1    1 
ATOM   1260 C  CD2    . LEU C 2 36 ? 4.573   1.495   -16.701 1.00 49.08  ? 183 LEU A CD2    1 
ATOM   1261 H  H      . LEU C 2 36 ? 7.755   4.785   -15.313 1.00 46.02  ? 183 LEU A H      1 
ATOM   1262 H  HA     . LEU C 2 36 ? 7.189   2.782   -13.729 1.00 45.98  ? 183 LEU A HA     1 
ATOM   1263 H  HB2    . LEU C 2 36 ? 5.654   3.452   -15.315 1.00 45.04  ? 183 LEU A HB2    1 
ATOM   1264 H  HB3    . LEU C 2 36 ? 6.648   3.058   -16.482 1.00 45.04  ? 183 LEU A HB3    1 
ATOM   1265 H  HG     . LEU C 2 36 ? 6.341   0.795   -15.989 1.00 46.43  ? 183 LEU A HG     1 
ATOM   1266 H  HD11   . LEU C 2 36 ? 4.723   0.077   -14.509 1.00 49.62  ? 183 LEU A HD11   1 
ATOM   1267 H  HD12   . LEU C 2 36 ? 5.836   0.896   -13.724 1.00 49.62  ? 183 LEU A HD12   1 
ATOM   1268 H  HD13   . LEU C 2 36 ? 4.444   1.578   -14.070 1.00 49.62  ? 183 LEU A HD13   1 
ATOM   1269 H  HD21   . LEU C 2 36 ? 4.157   0.621   -16.761 1.00 59.76  ? 183 LEU A HD21   1 
ATOM   1270 H  HD22   . LEU C 2 36 ? 3.920   2.154   -16.418 1.00 59.76  ? 183 LEU A HD22   1 
ATOM   1271 H  HD23   . LEU C 2 36 ? 4.945   1.744   -17.561 1.00 59.76  ? 183 LEU A HD23   1 
ATOM   1272 N  N      . TYR C 2 37 ? 9.492   2.191   -15.855 1.00 42.16  ? 184 TYR A N      1 
ATOM   1273 C  CA     . TYR C 2 37 ? 10.564  1.234   -16.111 1.00 54.64  ? 184 TYR A CA     1 
ATOM   1274 C  C      . TYR C 2 37 ? 11.458  1.100   -14.879 1.00 45.92  ? 184 TYR A C      1 
ATOM   1275 O  O      . TYR C 2 37 ? 11.668  -0.005  -14.359 1.00 39.76  ? 184 TYR A O      1 
ATOM   1276 C  CB     . TYR C 2 37 ? 11.386  1.649   -17.349 1.00 41.33  ? 184 TYR A CB     1 
ATOM   1277 C  CG     . TYR C 2 37 ? 12.389  0.590   -17.762 1.00 57.97  ? 184 TYR A CG     1 
ATOM   1278 C  CD1    . TYR C 2 37 ? 11.966  -0.639  -18.279 1.00 56.71  ? 184 TYR A CD1    1 
ATOM   1279 C  CD2    . TYR C 2 37 ? 13.764  0.797   -17.605 1.00 64.43  ? 184 TYR A CD2    1 
ATOM   1280 C  CE1    . TYR C 2 37 ? 12.887  -1.617  -18.659 1.00 55.58  ? 184 TYR A CE1    1 
ATOM   1281 C  CE2    . TYR C 2 37 ? 14.695  -0.185  -17.974 1.00 62.10  ? 184 TYR A CE2    1 
ATOM   1282 C  CZ     . TYR C 2 37 ? 14.249  -1.385  -18.497 1.00 65.92  ? 184 TYR A CZ     1 
ATOM   1283 O  OH     . TYR C 2 37 ? 15.168  -2.351  -18.859 1.00 72.44  ? 184 TYR A OH     1 
ATOM   1284 H  H      . TYR C 2 37 ? 9.503   2.901   -16.342 1.00 51.46  ? 184 TYR A H      1 
ATOM   1285 H  HA     . TYR C 2 37 ? 10.172  0.365   -16.291 1.00 66.45  ? 184 TYR A HA     1 
ATOM   1286 H  HB2    . TYR C 2 37 ? 10.783  1.798   -18.093 1.00 50.47  ? 184 TYR A HB2    1 
ATOM   1287 H  HB3    . TYR C 2 37 ? 11.873  2.463   -17.147 1.00 50.47  ? 184 TYR A HB3    1 
ATOM   1288 H  HD1    . TYR C 2 37 ? 11.056  -0.799  -18.392 1.00 68.92  ? 184 TYR A HD1    1 
ATOM   1289 H  HD2    . TYR C 2 37 ? 14.066  1.603   -17.256 1.00 78.19  ? 184 TYR A HD2    1 
ATOM   1290 H  HE1    . TYR C 2 37 ? 12.591  -2.428  -19.006 1.00 67.57  ? 184 TYR A HE1    1 
ATOM   1291 H  HE2    . TYR C 2 37 ? 15.606  -0.029  -17.870 1.00 75.39  ? 184 TYR A HE2    1 
ATOM   1292 H  HH     . TYR C 2 37 ? 15.947  -2.078  -18.707 1.00 87.81  ? 184 TYR A HH     1 
ATOM   1293 N  N      . GLU C 2 38 ? 11.931  2.233   -14.355 1.00 45.18  ? 185 GLU A N      1 
ATOM   1294 C  CA     . GLU C 2 38 ? 12.865  2.195   -13.236 1.00 47.61  ? 185 GLU A CA     1 
ATOM   1295 C  C      . GLU C 2 38 ? 12.273  1.464   -12.038 1.00 42.13  ? 185 GLU A C      1 
ATOM   1296 O  O      . GLU C 2 38 ? 12.986  0.722   -11.354 1.00 52.29  ? 185 GLU A O      1 
ATOM   1297 C  CB     . GLU C 2 38 ? 13.289  3.616   -12.846 1.00 42.59  ? 185 GLU A CB     1 
ATOM   1298 C  CG     . GLU C 2 38 ? 14.649  3.618   -12.182 1.00 48.74  ? 185 GLU A CG     1 
ATOM   1299 C  CD     . GLU C 2 38 ? 15.126  4.991   -11.740 1.00 52.37  ? 185 GLU A CD     1 
ATOM   1300 O  OE1    . GLU C 2 38 ? 14.660  6.026   -12.270 1.00 49.60  ? 185 GLU A OE1    1 
ATOM   1301 O  OE2    . GLU C 2 38 ? 16.047  5.011   -10.896 1.00 57.03  ? 185 GLU A OE2    1 
ATOM   1302 H  H      . GLU C 2 38 ? 11.728  3.024   -14.626 1.00 55.09  ? 185 GLU A H      1 
ATOM   1303 H  HA     . GLU C 2 38 ? 13.661  1.714   -13.511 1.00 58.00  ? 185 GLU A HA     1 
ATOM   1304 H  HB2    . GLU C 2 38 ? 13.338  4.167   -13.643 1.00 51.99  ? 185 GLU A HB2    1 
ATOM   1305 H  HB3    . GLU C 2 38 ? 12.645  3.984   -12.221 1.00 51.99  ? 185 GLU A HB3    1 
ATOM   1306 H  HG2    . GLU C 2 38 ? 14.612  3.051   -11.396 1.00 59.36  ? 185 GLU A HG2    1 
ATOM   1307 H  HG3    . GLU C 2 38 ? 15.301  3.267   -12.809 1.00 59.36  ? 185 GLU A HG3    1 
ATOM   1308 N  N      . HIS C 2 39 ? 10.968  1.612   -11.792 1.00 44.18  ? 186 HIS A N      1 
ATOM   1309 C  CA     . HIS C 2 39 ? 10.325  0.970   -10.650 1.00 43.17  ? 186 HIS A CA     1 
ATOM   1310 C  C      . HIS C 2 39 ? 9.453   -0.223  -11.065 1.00 46.28  ? 186 HIS A C      1 
ATOM   1311 O  O      . HIS C 2 39 ? 8.514   -0.585  -10.347 1.00 48.73  ? 186 HIS A O      1 
ATOM   1312 C  CB     . HIS C 2 39 ? 9.483   1.989   -9.883  1.00 43.61  ? 186 HIS A CB     1 
ATOM   1313 C  CG     . HIS C 2 39 ? 10.246  3.172   -9.374  1.00 39.54  ? 186 HIS A CG     1 
ATOM   1314 N  ND1    . HIS C 2 39 ? 10.556  4.258   -10.166 1.00 41.26  ? 186 HIS A ND1    1 
ATOM   1315 C  CD2    . HIS C 2 39 ? 10.717  3.465   -8.139  1.00 45.52  ? 186 HIS A CD2    1 
ATOM   1316 C  CE1    . HIS C 2 39 ? 11.202  5.159   -9.444  1.00 42.69  ? 186 HIS A CE1    1 
ATOM   1317 N  NE2    . HIS C 2 39 ? 11.323  4.697   -8.214  1.00 43.67  ? 186 HIS A NE2    1 
ATOM   1318 H  H      . HIS C 2 39 ? 10.434  2.082   -12.276 1.00 53.89  ? 186 HIS A H      1 
ATOM   1319 H  HA     . HIS C 2 39 ? 11.012  0.640   -10.049 1.00 52.67  ? 186 HIS A HA     1 
ATOM   1320 H  HB2    . HIS C 2 39 ? 8.785   2.319   -10.470 1.00 53.20  ? 186 HIS A HB2    1 
ATOM   1321 H  HB3    . HIS C 2 39 ? 9.082   1.547   -9.118  1.00 53.20  ? 186 HIS A HB3    1 
ATOM   1322 H  HD1    . HIS C 2 39 ? 10.361  4.336   -11.000 1.00 50.39  ? 186 HIS A HD1    1 
ATOM   1323 H  HD2    . HIS C 2 39 ? 10.660  2.923   -7.385  1.00 55.50  ? 186 HIS A HD2    1 
ATOM   1324 H  HE1    . HIS C 2 39 ? 11.530  5.973   -9.755  1.00 52.10  ? 186 HIS A HE1    1 
ATOM   1325 N  N      . ARG C 2 40 ? 9.756   -0.851  -12.200 1.00 42.77  ? 187 ARG A N      1 
ATOM   1326 C  CA     . ARG C 2 40 ? 8.904   -1.895  -12.777 1.00 48.83  ? 187 ARG A CA     1 
ATOM   1327 C  C      . ARG C 2 40 ? 8.660   -3.091  -11.850 1.00 45.04  ? 187 ARG A C      1 
ATOM   1328 O  O      . ARG C 2 40 ? 7.768   -3.901  -12.136 1.00 48.09  ? 187 ARG A O      1 
ATOM   1329 C  CB     . ARG C 2 40 ? 9.519   -2.367  -14.107 1.00 43.15  ? 187 ARG A CB     1 
ATOM   1330 C  CG     . ARG C 2 40 ? 10.627  -3.380  -13.955 1.00 50.97  ? 187 ARG A CG     1 
ATOM   1331 C  CD     . ARG C 2 40 ? 11.347  -3.626  -15.275 1.00 55.67  ? 187 ARG A CD     1 
ATOM   1332 N  NE     . ARG C 2 40 ? 12.398  -2.627  -15.442 1.00 62.15  ? 187 ARG A NE     1 
ATOM   1333 C  CZ     . ARG C 2 40 ? 13.707  -2.853  -15.327 1.00 58.70  ? 187 ARG A CZ     1 
ATOM   1334 N  NH1    . ARG C 2 40 ? 14.554  -1.853  -15.476 1.00 61.71  ? 187 ARG A NH1    1 
ATOM   1335 N  NH2    . ARG C 2 40 ? 14.182  -4.061  -15.070 1.00 62.63  ? 187 ARG A NH2    1 
ATOM   1336 H  H      . ARG C 2 40 ? 10.462  -0.688  -12.665 1.00 52.19  ? 187 ARG A H      1 
ATOM   1337 H  HA     . ARG C 2 40 ? 8.039   -1.505  -12.979 1.00 59.47  ? 187 ARG A HA     1 
ATOM   1338 H  HB2    . ARG C 2 40 ? 8.821   -2.772  -14.645 1.00 52.66  ? 187 ARG A HB2    1 
ATOM   1339 H  HB3    . ARG C 2 40 ? 9.885   -1.597  -14.570 1.00 52.66  ? 187 ARG A HB3    1 
ATOM   1340 H  HG2    . ARG C 2 40 ? 11.275  -3.051  -13.312 1.00 62.03  ? 187 ARG A HG2    1 
ATOM   1341 H  HG3    . ARG C 2 40 ? 10.251  -4.221  -13.652 1.00 62.03  ? 187 ARG A HG3    1 
ATOM   1342 H  HD2    . ARG C 2 40 ? 11.753  -4.507  -15.267 1.00 67.68  ? 187 ARG A HD2    1 
ATOM   1343 H  HD3    . ARG C 2 40 ? 10.719  -3.544  -16.010 1.00 67.68  ? 187 ARG A HD3    1 
ATOM   1344 H  HE     . ARG C 2 40 ? 12.152  -1.824  -15.630 1.00 75.46  ? 187 ARG A HE     1 
ATOM   1345 H  HH11   . ARG C 2 40 ? 14.261  -1.064  -15.650 1.00 74.92  ? 187 ARG A HH11   1 
ATOM   1346 H  HH12   . ARG C 2 40 ? 15.400  -1.994  -15.416 1.00 74.92  ? 187 ARG A HH12   1 
ATOM   1347 H  HH21   . ARG C 2 40 ? 13.642  -4.722  -14.963 1.00 76.02  ? 187 ARG A HH21   1 
ATOM   1348 H  HH22   . ARG C 2 40 ? 15.031  -4.184  -15.005 1.00 76.02  ? 187 ARG A HH22   1 
ATOM   1349 N  N      . TYR C 2 41 ? 9.455   -3.272  -10.798 1.00 51.02  ? 188 TYR A N      1 
ATOM   1350 C  CA     . TYR C 2 41 ? 9.257   -4.380  -9.867  1.00 58.08  ? 188 TYR A CA     1 
ATOM   1351 C  C      . TYR C 2 41 ? 8.461   -3.978  -8.641  1.00 50.55  ? 188 TYR A C      1 
ATOM   1352 O  O      . TYR C 2 41 ? 8.149   -4.835  -7.809  1.00 52.93  ? 188 TYR A O      1 
ATOM   1353 C  CB     . TYR C 2 41 ? 10.601  -4.959  -9.427  1.00 78.22  ? 188 TYR A CB     1 
ATOM   1354 C  CG     . TYR C 2 41 ? 11.357  -5.555  -10.568 1.00 63.27  ? 188 TYR A CG     1 
ATOM   1355 C  CD1    . TYR C 2 41 ? 10.797  -6.565  -11.335 1.00 64.57  ? 188 TYR A CD1    1 
ATOM   1356 C  CD2    . TYR C 2 41 ? 12.615  -5.099  -10.899 1.00 61.43  ? 188 TYR A CD2    1 
ATOM   1357 C  CE1    . TYR C 2 41 ? 11.470  -7.107  -12.396 1.00 60.78  ? 188 TYR A CE1    1 
ATOM   1358 C  CE2    . TYR C 2 41 ? 13.299  -5.634  -11.961 1.00 71.66  ? 188 TYR A CE2    1 
ATOM   1359 C  CZ     . TYR C 2 41 ? 12.718  -6.637  -12.706 1.00 68.33  ? 188 TYR A CZ     1 
ATOM   1360 O  OH     . TYR C 2 41 ? 13.397  -7.177  -13.762 1.00 71.75  ? 188 TYR A OH     1 
ATOM   1361 H  H      . TYR C 2 41 ? 10.120  -2.764  -10.601 1.00 62.09  ? 188 TYR A H      1 
ATOM   1362 H  HA     . TYR C 2 41 ? 8.766   -5.083  -10.320 1.00 70.57  ? 188 TYR A HA     1 
ATOM   1363 H  HB2    . TYR C 2 41 ? 11.143  -4.251  -9.044  1.00 94.74  ? 188 TYR A HB2    1 
ATOM   1364 H  HB3    . TYR C 2 41 ? 10.448  -5.655  -8.769  1.00 94.74  ? 188 TYR A HB3    1 
ATOM   1365 H  HD1    . TYR C 2 41 ? 9.946   -6.878  -11.126 1.00 78.36  ? 188 TYR A HD1    1 
ATOM   1366 H  HD2    . TYR C 2 41 ? 13.003  -4.418  -10.399 1.00 74.59  ? 188 TYR A HD2    1 
ATOM   1367 H  HE1    . TYR C 2 41 ? 11.084  -7.786  -12.901 1.00 73.80  ? 188 TYR A HE1    1 
ATOM   1368 H  HE2    . TYR C 2 41 ? 14.148  -5.322  -12.176 1.00 86.86  ? 188 TYR A HE2    1 
ATOM   1369 H  HH     . TYR C 2 41 ? 14.144  -6.803  -13.844 1.00 86.97  ? 188 TYR A HH     1 
ATOM   1370 N  N      . ASN C 2 42 ? 8.146   -2.700  -8.505  1.00 47.67  ? 189 ASN A N      1 
ATOM   1371 C  CA     . ASN C 2 42 ? 7.189   -2.236  -7.536  1.00 56.36  ? 189 ASN A CA     1 
ATOM   1372 C  C      . ASN C 2 42 ? 6.575   -0.983  -8.156  1.00 51.17  ? 189 ASN A C      1 
ATOM   1373 O  O      . ASN C 2 42 ? 6.835   0.163   -7.782  1.00 50.75  ? 189 ASN A O      1 
ATOM   1374 C  CB     . ASN C 2 42 ? 7.814   -1.940  -6.177  1.00 87.85  ? 189 ASN A CB     1 
ATOM   1375 C  CG     . ASN C 2 42 ? 6.787   -1.618  -5.164  1.00 56.79  ? 189 ASN A CG     1 
ATOM   1376 O  OD1    . ASN C 2 42 ? 5.679   -2.124  -5.225  1.00 58.23  ? 189 ASN A OD1    1 
ATOM   1377 N  ND2    . ASN C 2 42 ? 7.123   -0.761  -4.233  1.00 62.70  ? 189 ASN A ND2    1 
ATOM   1378 H  H      . ASN C 2 42 ? 8.487   -2.069  -8.980  1.00 58.08  ? 189 ASN A H      1 
ATOM   1379 H  HA     . ASN C 2 42 ? 6.492   -2.900  -7.419  1.00 68.50  ? 189 ASN A HA     1 
ATOM   1380 H  HB2    . ASN C 2 42 ? 8.306   -2.720  -5.874  1.00 106.29 ? 189 ASN A HB2    1 
ATOM   1381 H  HB3    . ASN C 2 42 ? 8.410   -1.178  -6.258  1.00 106.29 ? 189 ASN A HB3    1 
ATOM   1382 H  HD21   . ASN C 2 42 ? 6.556   -0.544  -3.623  1.00 76.11  ? 189 ASN A HD21   1 
ATOM   1383 H  HD22   . ASN C 2 42 ? 7.910   -0.415  -4.231  1.00 76.11  ? 189 ASN A HD22   1 
ATOM   1384 N  N      . ALA C 2 43 ? 5.735   -1.209  -9.152  1.00 50.80  ? 190 ALA A N      1 
ATOM   1385 C  CA     . ALA C 2 43 ? 5.267   -0.137  -10.015 1.00 43.62  ? 190 ALA A CA     1 
ATOM   1386 C  C      . ALA C 2 43 ? 4.147   0.663   -9.388  1.00 50.08  ? 190 ALA A C      1 
ATOM   1387 O  O      . ALA C 2 43 ? 3.164   0.975   -10.068 1.00 42.77  ? 190 ALA A O      1 
ATOM   1388 C  CB     . ALA C 2 43 ? 4.818   -0.757  -11.327 1.00 51.47  ? 190 ALA A CB     1 
ATOM   1389 H  H      . ALA C 2 43 ? 5.418   -1.983  -9.353  1.00 61.83  ? 190 ALA A H      1 
ATOM   1390 H  HA     . ALA C 2 43 ? 6.002   0.467   -10.201 1.00 53.22  ? 190 ALA A HA     1 
ATOM   1391 H  HB1    . ALA C 2 43 ? 4.501   -0.055  -11.916 1.00 62.63  ? 190 ALA A HB1    1 
ATOM   1392 H  HB2    . ALA C 2 43 ? 5.570   -1.216  -11.732 1.00 62.63  ? 190 ALA A HB2    1 
ATOM   1393 H  HB3    . ALA C 2 43 ? 4.103   -1.388  -11.149 1.00 62.63  ? 190 ALA A HB3    1 
ATOM   1394 N  N      . TYR C 2 44 ? 4.289   1.013   -8.103  1.00 43.83  ? 191 TYR A N      1 
ATOM   1395 C  CA     . TYR C 2 44 ? 3.245   1.686   -7.341  1.00 42.29  ? 191 TYR A CA     1 
ATOM   1396 C  C      . TYR C 2 44 ? 3.855   2.899   -6.651  1.00 44.29  ? 191 TYR A C      1 
ATOM   1397 O  O      . TYR C 2 44 ? 4.335   2.800   -5.522  1.00 43.70  ? 191 TYR A O      1 
ATOM   1398 C  CB     . TYR C 2 44 ? 2.623   0.738   -6.314  1.00 46.08  ? 191 TYR A CB     1 
ATOM   1399 C  CG     . TYR C 2 44 ? 1.905   -0.406  -6.943  1.00 45.20  ? 191 TYR A CG     1 
ATOM   1400 C  CD1    . TYR C 2 44 ? 0.538   -0.356  -7.122  1.00 46.21  ? 191 TYR A CD1    1 
ATOM   1401 C  CD2    . TYR C 2 44 ? 2.584   -1.513  -7.405  1.00 41.66  ? 191 TYR A CD2    1 
ATOM   1402 C  CE1    . TYR C 2 44 ? -0.145  -1.390  -7.726  1.00 42.13  ? 191 TYR A CE1    1 
ATOM   1403 C  CE2    . TYR C 2 44 ? 1.898   -2.572  -8.000  1.00 45.19  ? 191 TYR A CE2    1 
ATOM   1404 C  CZ     . TYR C 2 44 ? 0.526   -2.498  -8.152  1.00 42.06  ? 191 TYR A CZ     1 
ATOM   1405 O  OH     . TYR C 2 44 ? -0.203  -3.506  -8.763  1.00 40.24  ? 191 TYR A OH     1 
ATOM   1406 H  H      . TYR C 2 44 ? 5.001   0.863   -7.645  1.00 53.47  ? 191 TYR A H      1 
ATOM   1407 H  HA     . TYR C 2 44 ? 2.548   1.990   -7.943  1.00 51.62  ? 191 TYR A HA     1 
ATOM   1408 H  HB2    . TYR C 2 44 ? 3.325   0.377   -5.751  1.00 56.17  ? 191 TYR A HB2    1 
ATOM   1409 H  HB3    . TYR C 2 44 ? 1.985   1.231   -5.775  1.00 56.17  ? 191 TYR A HB3    1 
ATOM   1410 H  HD1    . TYR C 2 44 ? 0.067   0.391   -6.829  1.00 56.32  ? 191 TYR A HD1    1 
ATOM   1411 H  HD2    . TYR C 2 44 ? 3.506   -1.567  -7.294  1.00 50.86  ? 191 TYR A HD2    1 
ATOM   1412 H  HE1    . TYR C 2 44 ? -1.068  -1.339  -7.827  1.00 51.43  ? 191 TYR A HE1    1 
ATOM   1413 H  HE2    . TYR C 2 44 ? 2.363   -3.318  -8.302  1.00 55.11  ? 191 TYR A HE2    1 
ATOM   1414 H  HH     . TYR C 2 44 ? -1.015  -3.294  -8.795  1.00 49.16  ? 191 TYR A HH     1 
ATOM   1415 N  N      . PRO C 2 45 ? 3.798   4.071   -7.272  1.00 42.72  ? 192 PRO A N      1 
ATOM   1416 C  CA     . PRO C 2 45 ? 4.392   5.243   -6.632  1.00 42.61  ? 192 PRO A CA     1 
ATOM   1417 C  C      . PRO C 2 45 ? 3.608   5.629   -5.388  1.00 42.95  ? 192 PRO A C      1 
ATOM   1418 O  O      . PRO C 2 45 ? 2.375   5.625   -5.387  1.00 41.68  ? 192 PRO A O      1 
ATOM   1419 C  CB     . PRO C 2 45 ? 4.275   6.329   -7.701  1.00 41.90  ? 192 PRO A CB     1 
ATOM   1420 C  CG     . PRO C 2 45 ? 3.116   5.899   -8.541  1.00 40.23  ? 192 PRO A CG     1 
ATOM   1421 C  CD     . PRO C 2 45 ? 3.179   4.407   -8.561  1.00 42.80  ? 192 PRO A CD     1 
ATOM   1422 H  HA     . PRO C 2 45 ? 5.324   5.089   -6.410  1.00 52.00  ? 192 PRO A HA     1 
ATOM   1423 H  HB2    . PRO C 2 45 ? 4.098   7.186   -7.282  1.00 51.15  ? 192 PRO A HB2    1 
ATOM   1424 H  HB3    . PRO C 2 45 ? 5.089   6.363   -8.227  1.00 51.15  ? 192 PRO A HB3    1 
ATOM   1425 H  HG2    . PRO C 2 45 ? 2.288   6.202   -8.135  1.00 49.15  ? 192 PRO A HG2    1 
ATOM   1426 H  HG3    . PRO C 2 45 ? 3.210   6.258   -9.437  1.00 49.15  ? 192 PRO A HG3    1 
ATOM   1427 H  HD2    . PRO C 2 45 ? 2.286   4.031   -8.615  1.00 52.23  ? 192 PRO A HD2    1 
ATOM   1428 H  HD3    . PRO C 2 45 ? 3.737   4.102   -9.293  1.00 52.23  ? 192 PRO A HD3    1 
ATOM   1429 N  N      . SER C 2 46 ? 4.342   6.024   -4.355  1.00 39.55  ? 193 SER A N      1 
ATOM   1430 C  CA     . SER C 2 46 ? 3.781   6.581   -3.138  1.00 40.42  ? 193 SER A CA     1 
ATOM   1431 C  C      . SER C 2 46 ? 3.108   7.920   -3.415  1.00 43.55  ? 193 SER A C      1 
ATOM   1432 O  O      . SER C 2 46 ? 3.339   8.558   -4.453  1.00 44.35  ? 193 SER A O      1 
ATOM   1433 C  CB     . SER C 2 46 ? 4.892   6.836   -2.139  1.00 42.39  ? 193 SER A CB     1 
ATOM   1434 O  OG     . SER C 2 46 ? 5.656   7.899   -2.667  1.00 43.40  ? 193 SER A OG     1 
ATOM   1435 H  H      . SER C 2 46 ? 5.200   5.977   -4.339  1.00 48.33  ? 193 SER A H      1 
ATOM   1436 H  HA     . SER C 2 46 ? 3.135   5.969   -2.752  1.00 49.38  ? 193 SER A HA     1 
ATOM   1437 H  HB2    . SER C 2 46 ? 4.515   7.093   -1.283  1.00 51.74  ? 193 SER A HB2    1 
ATOM   1438 H  HB3    . SER C 2 46 ? 5.445   6.044   -2.050  1.00 51.74  ? 193 SER A HB3    1 
ATOM   1439 H  HG     . SER C 2 46 ? 6.291   8.083   -2.148  1.00 52.95  ? 193 SER A HG     1 
ATOM   1440 N  N      . GLU C 2 47 ? 2.309   8.378   -2.438  1.00 38.62  ? 194 GLU A N      1 
ATOM   1441 C  CA     . GLU C 2 47 ? 1.635   9.671   -2.571  1.00 36.99  ? 194 GLU A CA     1 
ATOM   1442 C  C      . GLU C 2 47 ? 2.609   10.763  -2.952  1.00 35.54  ? 194 GLU A C      1 
ATOM   1443 O  O      . GLU C 2 47 ? 2.308   11.602  -3.808  1.00 36.73  ? 194 GLU A O      1 
ATOM   1444 C  CB     . GLU C 2 47 ? 0.940   10.056  -1.260  1.00 45.35  ? 194 GLU A CB     1 
ATOM   1445 C  CG     . GLU C 2 47 ? -0.128  11.179  -1.361  1.00 44.65  ? 194 GLU A CG     1 
ATOM   1446 C  CD     . GLU C 2 47 ? -0.649  11.656  -0.005  1.00 53.01  ? 194 GLU A CD     1 
ATOM   1447 O  OE1    . GLU C 2 47 ? -0.970  12.854  0.104   1.00 59.52  ? 194 GLU A OE1    1 
ATOM   1448 O  OE2    . GLU C 2 47 ? -0.740  10.854  0.954   1.00 61.30  ? 194 GLU A OE2    1 
ATOM   1449 H  H      . GLU C 2 47 ? 2.147   7.964   -1.702  1.00 47.21  ? 194 GLU A H      1 
ATOM   1450 H  HA     . GLU C 2 47 ? 0.960   9.610   -3.265  1.00 45.26  ? 194 GLU A HA     1 
ATOM   1451 H  HB2    . GLU C 2 47 ? 0.499   9.268   -0.906  1.00 55.29  ? 194 GLU A HB2    1 
ATOM   1452 H  HB3    . GLU C 2 47 ? 1.617   10.355  -0.633  1.00 55.29  ? 194 GLU A HB3    1 
ATOM   1453 H  HG2    . GLU C 2 47 ? 0.262   11.943  -1.814  1.00 54.46  ? 194 GLU A HG2    1 
ATOM   1454 H  HG3    . GLU C 2 47 ? -0.885  10.847  -1.869  1.00 54.46  ? 194 GLU A HG3    1 
ATOM   1455 N  N      . GLN C 2 48 ? 3.804   10.751  -2.360  1.00 40.84  ? 195 GLN A N      1 
ATOM   1456 C  CA     . GLN C 2 48 ? 4.750   11.831  -2.617  1.00 40.37  ? 195 GLN A CA     1 
ATOM   1457 C  C      . GLN C 2 48 ? 5.359   11.698  -3.982  1.00 40.89  ? 195 GLN A C      1 
ATOM   1458 O  O      . GLN C 2 48 ? 5.683   12.708  -4.627  1.00 38.66  ? 195 GLN A O      1 
ATOM   1459 C  CB     . GLN C 2 48 ? 5.863   11.853  -1.559  1.00 39.90  ? 195 GLN A CB     1 
ATOM   1460 C  CG     . GLN C 2 48 ? 5.367   12.259  -0.162  1.00 49.85  ? 195 GLN A CG     1 
ATOM   1461 C  CD     . GLN C 2 48 ? 4.437   11.223  0.465   1.00 54.77  ? 195 GLN A CD     1 
ATOM   1462 O  OE1    . GLN C 2 48 ? 4.561   10.006  0.198   1.00 51.81  ? 195 GLN A OE1    1 
ATOM   1463 N  NE2    . GLN C 2 48 ? 3.460   11.702  1.262   1.00 56.53  ? 195 GLN A NE2    1 
ATOM   1464 H  H      . GLN C 2 48 ? 4.084   10.144  -1.819  1.00 49.88  ? 195 GLN A H      1 
ATOM   1465 H  HA     . GLN C 2 48 ? 4.281   12.679  -2.578  1.00 49.31  ? 195 GLN A HA     1 
ATOM   1466 H  HB2    . GLN C 2 48 ? 6.249   10.966  -1.491  1.00 48.75  ? 195 GLN A HB2    1 
ATOM   1467 H  HB3    . GLN C 2 48 ? 6.542   12.489  -1.831  1.00 48.75  ? 195 GLN A HB3    1 
ATOM   1468 H  HG2    . GLN C 2 48 ? 6.132   12.369  0.425   1.00 60.69  ? 195 GLN A HG2    1 
ATOM   1469 H  HG3    . GLN C 2 48 ? 4.880   13.095  -0.231  1.00 60.69  ? 195 GLN A HG3    1 
ATOM   1470 H  HE21   . GLN C 2 48 ? 3.389   12.549  1.393   1.00 68.71  ? 195 GLN A HE21   1 
ATOM   1471 H  HE22   . GLN C 2 48 ? 2.909   11.161  1.640   1.00 68.71  ? 195 GLN A HE22   1 
ATOM   1472 N  N      . GLU C 2 49 ? 5.560   10.465  -4.426  1.00 41.36  ? 196 GLU A N      1 
ATOM   1473 C  CA     . GLU C 2 49 ? 6.066   10.271  -5.770  1.00 42.09  ? 196 GLU A CA     1 
ATOM   1474 C  C      . GLU C 2 49 ? 5.000   10.680  -6.783  1.00 42.17  ? 196 GLU A C      1 
ATOM   1475 O  O      . GLU C 2 49 ? 5.252   11.523  -7.649  1.00 39.07  ? 196 GLU A O      1 
ATOM   1476 C  CB     . GLU C 2 49 ? 6.494   8.813   -5.923  1.00 45.46  ? 196 GLU A CB     1 
ATOM   1477 C  CG     . GLU C 2 49 ? 7.685   8.461   -5.042  1.00 43.79  ? 196 GLU A CG     1 
ATOM   1478 C  CD     . GLU C 2 49 ? 7.925   6.971   -4.949  1.00 44.06  ? 196 GLU A CD     1 
ATOM   1479 O  OE1    . GLU C 2 49 ? 6.927   6.217   -4.946  1.00 39.75  ? 196 GLU A OE1    1 
ATOM   1480 O  OE2    . GLU C 2 49 ? 9.113   6.558   -4.915  1.00 48.53  ? 196 GLU A OE2    1 
ATOM   1481 H  H      . GLU C 2 49 ? 5.414   9.744   -3.981  1.00 50.51  ? 196 GLU A H      1 
ATOM   1482 H  HA     . GLU C 2 49 ? 6.845   10.834  -5.904  1.00 51.38  ? 196 GLU A HA     1 
ATOM   1483 H  HB2    . GLU C 2 49 ? 5.754   8.238   -5.672  1.00 55.42  ? 196 GLU A HB2    1 
ATOM   1484 H  HB3    . GLU C 2 49 ? 6.744   8.651   -6.846  1.00 55.42  ? 196 GLU A HB3    1 
ATOM   1485 H  HG2    . GLU C 2 49 ? 8.483   8.870   -5.412  1.00 53.43  ? 196 GLU A HG2    1 
ATOM   1486 H  HG3    . GLU C 2 49 ? 7.525   8.795   -4.146  1.00 53.43  ? 196 GLU A HG3    1 
ATOM   1487 N  N      . LYS C 2 50 ? 3.762   10.216  -6.602  1.00 36.11  ? 197 LYS A N      1 
ATOM   1488 C  CA     . LYS C 2 50 ? 2.690   10.693  -7.475  1.00 42.31  ? 197 LYS A CA     1 
ATOM   1489 C  C      . LYS C 2 50 ? 2.636   12.213  -7.495  1.00 41.39  ? 197 LYS A C      1 
ATOM   1490 O  O      . LYS C 2 50 ? 2.324   12.826  -8.521  1.00 46.20  ? 197 LYS A O      1 
ATOM   1491 C  CB     . LYS C 2 50 ? 1.329   10.181  -7.036  1.00 41.39  ? 197 LYS A CB     1 
ATOM   1492 C  CG     . LYS C 2 50 ? 1.163   8.703   -7.012  1.00 47.04  ? 197 LYS A CG     1 
ATOM   1493 C  CD     . LYS C 2 50 ? -0.290  8.375   -6.800  1.00 37.71  ? 197 LYS A CD     1 
ATOM   1494 C  CE     . LYS C 2 50 ? -0.450  6.938   -6.379  1.00 39.14  ? 197 LYS A CE     1 
ATOM   1495 N  NZ     . LYS C 2 50 ? -1.874  6.755   -6.006  1.00 35.28  ? 197 LYS A NZ     1 
ATOM   1496 H  H      . LYS C 2 50 ? 3.524   9.645   -6.005  1.00 44.20  ? 197 LYS A H      1 
ATOM   1497 H  HA     . LYS C 2 50 ? 2.853   10.383  -8.380  1.00 51.64  ? 197 LYS A HA     1 
ATOM   1498 H  HB2    . LYS C 2 50 ? 1.157   10.505  -6.138  1.00 50.54  ? 197 LYS A HB2    1 
ATOM   1499 H  HB3    . LYS C 2 50 ? 0.660   10.537  -7.641  1.00 50.54  ? 197 LYS A HB3    1 
ATOM   1500 H  HG2    . LYS C 2 50 ? 1.446   8.328   -7.861  1.00 57.32  ? 197 LYS A HG2    1 
ATOM   1501 H  HG3    . LYS C 2 50 ? 1.677   8.327   -6.281  1.00 57.32  ? 197 LYS A HG3    1 
ATOM   1502 H  HD2    . LYS C 2 50 ? -0.650  8.942   -6.100  1.00 46.12  ? 197 LYS A HD2    1 
ATOM   1503 H  HD3    . LYS C 2 50 ? -0.776  8.508   -7.629  1.00 46.12  ? 197 LYS A HD3    1 
ATOM   1504 H  HE2    . LYS C 2 50 ? -0.237  6.347   -7.118  1.00 47.84  ? 197 LYS A HE2    1 
ATOM   1505 H  HE3    . LYS C 2 50 ? 0.108   6.751   -5.608  1.00 47.84  ? 197 LYS A HE3    1 
ATOM   1506 H  HZ1    . LYS C 2 50 ? -2.015  5.914   -5.749  1.00 43.20  ? 197 LYS A HZ1    1 
ATOM   1507 H  HZ2    . LYS C 2 50 ? -2.085  7.301   -5.336  1.00 43.20  ? 197 LYS A HZ2    1 
ATOM   1508 H  HZ3    . LYS C 2 50 ? -2.397  6.936   -6.703  1.00 43.20  ? 197 LYS A HZ3    1 
ATOM   1509 N  N      . ALA C 2 51 ? 2.898   12.843  -6.365  1.00 32.07  ? 198 ALA A N      1 
ATOM   1510 C  CA     . ALA C 2 51 ? 2.837   14.301  -6.329  1.00 40.60  ? 198 ALA A CA     1 
ATOM   1511 C  C      . ALA C 2 51 ? 3.968   14.907  -7.138  1.00 33.92  ? 198 ALA A C      1 
ATOM   1512 O  O      . ALA C 2 51 ? 3.793   15.928  -7.811  1.00 32.58  ? 198 ALA A O      1 
ATOM   1513 C  CB     . ALA C 2 51 ? 2.906   14.789  -4.883  1.00 28.65  ? 198 ALA A CB     1 
ATOM   1514 H  H      . ALA C 2 51 ? 3.109   12.467  -5.621  1.00 39.36  ? 198 ALA A H      1 
ATOM   1515 H  HA     . ALA C 2 51 ? 1.996   14.597  -6.711  1.00 49.59  ? 198 ALA A HA     1 
ATOM   1516 H  HB1    . ALA C 2 51 ? 2.864   15.758  -4.875  1.00 35.25  ? 198 ALA A HB1    1 
ATOM   1517 H  HB2    . ALA C 2 51 ? 2.156   14.421  -4.390  1.00 35.25  ? 198 ALA A HB2    1 
ATOM   1518 H  HB3    . ALA C 2 51 ? 3.740   14.490  -4.489  1.00 35.25  ? 198 ALA A HB3    1 
ATOM   1519 N  N      . LEU C 2 52 ? 5.148   14.314  -7.047  1.00 31.12  ? 199 LEU A N      1 
ATOM   1520 C  CA     . LEU C 2 52 ? 6.277   14.801  -7.829  1.00 39.97  ? 199 LEU A CA     1 
ATOM   1521 C  C      . LEU C 2 52 ? 6.022   14.602  -9.318  1.00 41.66  ? 199 LEU A C      1 
ATOM   1522 O  O      . LEU C 2 52 ? 6.350   15.460  -10.151 1.00 34.82  ? 199 LEU A O      1 
ATOM   1523 C  CB     . LEU C 2 52 ? 7.534   14.071  -7.366  1.00 33.62  ? 199 LEU A CB     1 
ATOM   1524 C  CG     . LEU C 2 52 ? 8.823   14.313  -8.128  1.00 44.19  ? 199 LEU A CG     1 
ATOM   1525 C  CD1    . LEU C 2 52 ? 9.109   15.805  -8.218  1.00 42.21  ? 199 LEU A CD1    1 
ATOM   1526 C  CD2    . LEU C 2 52 ? 9.962   13.584  -7.394  1.00 51.18  ? 199 LEU A CD2    1 
ATOM   1527 H  H      . LEU C 2 52 ? 5.322   13.636  -6.547  1.00 38.21  ? 199 LEU A H      1 
ATOM   1528 H  HA     . LEU C 2 52 ? 6.397   15.750  -7.664  1.00 48.84  ? 199 LEU A HA     1 
ATOM   1529 H  HB2    . LEU C 2 52 ? 7.701   14.322  -6.444  1.00 41.22  ? 199 LEU A HB2    1 
ATOM   1530 H  HB3    . LEU C 2 52 ? 7.356   13.118  -7.407  1.00 41.22  ? 199 LEU A HB3    1 
ATOM   1531 H  HG     . LEU C 2 52 ? 8.748   13.953  -9.026  1.00 53.90  ? 199 LEU A HG     1 
ATOM   1532 H  HD11   . LEU C 2 52 ? 9.936   15.939  -8.708  1.00 51.52  ? 199 LEU A HD11   1 
ATOM   1533 H  HD12   . LEU C 2 52 ? 8.376   16.240  -8.681  1.00 51.52  ? 199 LEU A HD12   1 
ATOM   1534 H  HD13   . LEU C 2 52 ? 9.194   16.165  -7.321  1.00 51.52  ? 199 LEU A HD13   1 
ATOM   1535 H  HD21   . LEU C 2 52 ? 10.792  13.732  -7.874  1.00 62.29  ? 199 LEU A HD21   1 
ATOM   1536 H  HD22   . LEU C 2 52 ? 10.033  13.937  -6.493  1.00 62.29  ? 199 LEU A HD22   1 
ATOM   1537 H  HD23   . LEU C 2 52 ? 9.762   12.636  -7.363  1.00 62.29  ? 199 LEU A HD23   1 
ATOM   1538 N  N      . LEU C 2 53 ? 5.436   13.463  -9.663  1.00 33.12  ? 200 LEU A N      1 
ATOM   1539 C  CA     . LEU C 2 53 ? 5.139   13.173  -11.043 1.00 41.26  ? 200 LEU A CA     1 
ATOM   1540 C  C      . LEU C 2 53 ? 4.099   14.140  -11.588 1.00 42.18  ? 200 LEU A C      1 
ATOM   1541 O  O      . LEU C 2 53 ? 4.232   14.639  -12.720 1.00 40.88  ? 200 LEU A O      1 
ATOM   1542 C  CB     . LEU C 2 53 ? 4.671   11.729  -11.138 1.00 36.46  ? 200 LEU A CB     1 
ATOM   1543 C  CG     . LEU C 2 53 ? 5.814   10.714  -11.002 1.00 36.96  ? 200 LEU A CG     1 
ATOM   1544 C  CD1    . LEU C 2 53 ? 5.269   9.289   -10.952 1.00 31.55  ? 200 LEU A CD1    1 
ATOM   1545 C  CD2    . LEU C 2 53 ? 6.876   10.851  -12.139 1.00 48.64  ? 200 LEU A CD2    1 
ATOM   1546 H  H      . LEU C 2 53 ? 5.203   12.845  -9.112  1.00 40.62  ? 200 LEU A H      1 
ATOM   1547 H  HA     . LEU C 2 53 ? 5.948   13.266  -11.571 1.00 50.39  ? 200 LEU A HA     1 
ATOM   1548 H  HB2    . LEU C 2 53 ? 4.033   11.558  -10.427 1.00 44.63  ? 200 LEU A HB2    1 
ATOM   1549 H  HB3    . LEU C 2 53 ? 4.250   11.591  -12.001 1.00 44.63  ? 200 LEU A HB3    1 
ATOM   1550 H  HG     . LEU C 2 53 ? 6.269   10.879  -10.161 1.00 45.23  ? 200 LEU A HG     1 
ATOM   1551 H  HD11   . LEU C 2 53 ? 6.012   8.671   -10.866 1.00 38.73  ? 200 LEU A HD11   1 
ATOM   1552 H  HD12   . LEU C 2 53 ? 4.677   9.205   -10.188 1.00 38.73  ? 200 LEU A HD12   1 
ATOM   1553 H  HD13   . LEU C 2 53 ? 4.782   9.109   -11.771 1.00 38.73  ? 200 LEU A HD13   1 
ATOM   1554 H  HD21   . LEU C 2 53 ? 7.571   10.188  -12.003 1.00 59.24  ? 200 LEU A HD21   1 
ATOM   1555 H  HD22   . LEU C 2 53 ? 6.443   10.705  -12.995 1.00 59.24  ? 200 LEU A HD22   1 
ATOM   1556 H  HD23   . LEU C 2 53 ? 7.258   11.742  -12.109 1.00 59.24  ? 200 LEU A HD23   1 
ATOM   1557 N  N      . SER C 2 54 ? 3.048   14.403  -10.811 1.00 33.13  ? 201 SER A N      1 
ATOM   1558 C  CA     . SER C 2 54 ? 2.058   15.393  -11.228 1.00 35.73  ? 201 SER A CA     1 
ATOM   1559 C  C      . SER C 2 54 ? 2.725   16.704  -11.553 1.00 40.47  ? 201 SER A C      1 
ATOM   1560 O  O      . SER C 2 54 ? 2.494   17.291  -12.611 1.00 44.11  ? 201 SER A O      1 
ATOM   1561 C  CB     . SER C 2 54 ? 1.035   15.658  -10.118 1.00 39.95  ? 201 SER A CB     1 
ATOM   1562 O  OG     . SER C 2 54 ? 0.229   14.517  -9.865  1.00 39.71  ? 201 SER A OG     1 
ATOM   1563 H  H      . SER C 2 54 ? 2.888   14.030  -10.053 1.00 40.63  ? 201 SER A H      1 
ATOM   1564 H  HA     . SER C 2 54 ? 1.589   15.077  -12.016 1.00 43.75  ? 201 SER A HA     1 
ATOM   1565 H  HB2    . SER C 2 54 ? 1.509   15.893  -9.305  1.00 48.81  ? 201 SER A HB2    1 
ATOM   1566 H  HB3    . SER C 2 54 ? 0.461   16.392  -10.389 1.00 48.81  ? 201 SER A HB3    1 
ATOM   1567 H  HG     . SER C 2 54 ? 0.712   13.872  -9.626  1.00 48.52  ? 201 SER A HG     1 
ATOM   1568 N  N      . GLN C 2 55 ? 3.559   17.180  -10.636 1.00 39.99  ? 202 GLN A N      1 
ATOM   1569 C  CA     . GLN C 2 55 ? 4.201   18.466  -10.837 1.00 41.57  ? 202 GLN A CA     1 
ATOM   1570 C  C      . GLN C 2 55 ? 5.174   18.394  -11.989 1.00 41.89  ? 202 GLN A C      1 
ATOM   1571 O  O      . GLN C 2 55 ? 5.208   19.288  -12.841 1.00 46.60  ? 202 GLN A O      1 
ATOM   1572 C  CB     . GLN C 2 55 ? 4.901   18.876  -9.548  1.00 45.69  ? 202 GLN A CB     1 
ATOM   1573 C  CG     . GLN C 2 55 ? 6.132   19.749  -9.710  1.00 54.83  ? 202 GLN A CG     1 
ATOM   1574 C  CD     . GLN C 2 55 ? 6.747   20.126  -8.348  1.00 55.09  ? 202 GLN A CD     1 
ATOM   1575 O  OE1    . GLN C 2 55 ? 6.315   19.641  -7.299  1.00 44.36  ? 202 GLN A OE1    1 
ATOM   1576 N  NE2    . GLN C 2 55 ? 7.763   20.981  -8.373  1.00 69.39  ? 202 GLN A NE2    1 
ATOM   1577 H  H      . GLN C 2 55 ? 3.767   16.784  -9.902  1.00 48.86  ? 202 GLN A H      1 
ATOM   1578 H  HA     . GLN C 2 55 ? 3.529   19.132  -11.046 1.00 50.75  ? 202 GLN A HA     1 
ATOM   1579 H  HB2    . GLN C 2 55 ? 4.268   19.367  -9.001  1.00 55.70  ? 202 GLN A HB2    1 
ATOM   1580 H  HB3    . GLN C 2 55 ? 5.175   18.072  -9.081  1.00 55.70  ? 202 GLN A HB3    1 
ATOM   1581 H  HG2    . GLN C 2 55 ? 6.800   19.267  -10.221 1.00 66.67  ? 202 GLN A HG2    1 
ATOM   1582 H  HG3    . GLN C 2 55 ? 5.885   20.568  -10.168 1.00 66.67  ? 202 GLN A HG3    1 
ATOM   1583 H  HE21   . GLN C 2 55 ? 8.044   21.293  -9.124  1.00 84.14  ? 202 GLN A HE21   1 
ATOM   1584 H  HE22   . GLN C 2 55 ? 8.140   21.223  -7.639  1.00 84.14  ? 202 GLN A HE22   1 
ATOM   1585 N  N      . GLN C 2 56 ? 5.919   17.302  -12.086 1.00 39.26  ? 203 GLN A N      1 
ATOM   1586 C  CA     . GLN C 2 56 ? 6.862   17.211  -13.189 1.00 45.46  ? 203 GLN A CA     1 
ATOM   1587 C  C      . GLN C 2 56 ? 6.128   17.139  -14.515 1.00 44.19  ? 203 GLN A C      1 
ATOM   1588 O  O      . GLN C 2 56 ? 6.502   17.833  -15.457 1.00 46.89  ? 203 GLN A O      1 
ATOM   1589 C  CB     . GLN C 2 56 ? 7.783   16.002  -13.038 1.00 40.43  ? 203 GLN A CB     1 
ATOM   1590 C  CG     . GLN C 2 56 ? 8.942   16.193  -12.111 1.00 44.91  ? 203 GLN A CG     1 
ATOM   1591 C  CD     . GLN C 2 56 ? 9.720   14.897  -11.903 1.00 55.41  ? 203 GLN A CD     1 
ATOM   1592 O  OE1    . GLN C 2 56 ? 9.393   13.852  -12.483 1.00 53.01  ? 203 GLN A OE1    1 
ATOM   1593 N  NE2    . GLN C 2 56 ? 10.750  14.957  -11.058 1.00 46.97  ? 203 GLN A NE2    1 
ATOM   1594 H  H      . GLN C 2 56 ? 5.902   16.629  -11.551 1.00 47.98  ? 203 GLN A H      1 
ATOM   1595 H  HA     . GLN C 2 56 ? 7.415   18.008  -13.197 1.00 55.43  ? 203 GLN A HA     1 
ATOM   1596 H  HB2    . GLN C 2 56 ? 7.260   15.258  -12.701 1.00 49.38  ? 203 GLN A HB2    1 
ATOM   1597 H  HB3    . GLN C 2 56 ? 8.141   15.778  -13.911 1.00 49.38  ? 203 GLN A HB3    1 
ATOM   1598 H  HG2    . GLN C 2 56 ? 9.546   16.852  -12.487 1.00 54.76  ? 203 GLN A HG2    1 
ATOM   1599 H  HG3    . GLN C 2 56 ? 8.615   16.492  -11.248 1.00 54.76  ? 203 GLN A HG3    1 
ATOM   1600 H  HE21   . GLN C 2 56 ? 10.943  15.698  -10.666 1.00 57.23  ? 203 GLN A HE21   1 
ATOM   1601 H  HE22   . GLN C 2 56 ? 11.222  14.255  -10.904 1.00 57.23  ? 203 GLN A HE22   1 
ATOM   1602 N  N      . THR C 2 57 ? 5.058   16.344  -14.603 1.00 39.50  ? 204 THR A N      1 
ATOM   1603 C  CA     . THR C 2 57 ? 4.394   16.139  -15.891 1.00 45.02  ? 204 THR A CA     1 
ATOM   1604 C  C      . THR C 2 57 ? 3.365   17.220  -16.224 1.00 46.80  ? 204 THR A C      1 
ATOM   1605 O  O      . THR C 2 57 ? 2.809   17.193  -17.315 1.00 38.47  ? 204 THR A O      1 
ATOM   1606 C  CB     . THR C 2 57 ? 3.690   14.777  -15.938 1.00 42.34  ? 204 THR A CB     1 
ATOM   1607 O  OG1    . THR C 2 57 ? 2.613   14.746  -14.987 1.00 36.84  ? 204 THR A OG1    1 
ATOM   1608 C  CG2    . THR C 2 57 ? 4.639   13.650  -15.627 1.00 37.31  ? 204 THR A CG2    1 
ATOM   1609 H  H      . THR C 2 57 ? 4.704   15.920  -13.945 1.00 48.28  ? 204 THR A H      1 
ATOM   1610 H  HA     . THR C 2 57 ? 5.066   16.148  -16.591 1.00 54.90  ? 204 THR A HA     1 
ATOM   1611 H  HB     . THR C 2 57 ? 3.333   14.633  -16.828 1.00 51.68  ? 204 THR A HB     1 
ATOM   1612 H  HG1    . THR C 2 57 ? 2.911   14.872  -14.212 1.00 45.08  ? 204 THR A HG1    1 
ATOM   1613 H  HG21   . THR C 2 57 ? 4.169   12.802  -15.663 1.00 45.65  ? 204 THR A HG21   1 
ATOM   1614 H  HG22   . THR C 2 57 ? 5.362   13.637  -16.273 1.00 45.65  ? 204 THR A HG22   1 
ATOM   1615 H  HG23   . THR C 2 57 ? 5.012   13.766  -14.739 1.00 45.65  ? 204 THR A HG23   1 
ATOM   1616 N  N      . HIS C 2 58 ? 3.081   18.156  -15.313 1.00 46.07  ? 205 HIS A N      1 
ATOM   1617 C  CA     . HIS C 2 58 ? 2.000   19.129  -15.482 1.00 42.81  ? 205 HIS A CA     1 
ATOM   1618 C  C      . HIS C 2 58 ? 0.637   18.460  -15.648 1.00 45.93  ? 205 HIS A C      1 
ATOM   1619 O  O      . HIS C 2 58 ? -0.281  19.054  -16.214 1.00 46.74  ? 205 HIS A O      1 
ATOM   1620 C  CB     . HIS C 2 58 ? 2.244   20.033  -16.694 1.00 44.75  ? 205 HIS A CB     1 
ATOM   1621 C  CG     . HIS C 2 58 ? 3.614   20.631  -16.745 1.00 54.31  ? 205 HIS A CG     1 
ATOM   1622 N  ND1    . HIS C 2 58 ? 4.464   20.441  -17.814 1.00 59.08  ? 205 HIS A ND1    1 
ATOM   1623 C  CD2    . HIS C 2 58 ? 4.290   21.401  -15.861 1.00 56.15  ? 205 HIS A CD2    1 
ATOM   1624 C  CE1    . HIS C 2 58 ? 5.599   21.075  -17.591 1.00 64.48  ? 205 HIS A CE1    1 
ATOM   1625 N  NE2    . HIS C 2 58 ? 5.522   21.662  -16.410 1.00 58.37  ? 205 HIS A NE2    1 
ATOM   1626 H  H      . HIS C 2 58 ? 3.511   18.248  -14.574 1.00 56.15  ? 205 HIS A H      1 
ATOM   1627 H  HA     . HIS C 2 58 ? 1.961   19.692  -14.694 1.00 52.25  ? 205 HIS A HA     1 
ATOM   1628 H  HB2    . HIS C 2 58 ? 2.119   19.511  -17.502 1.00 54.58  ? 205 HIS A HB2    1 
ATOM   1629 H  HB3    . HIS C 2 58 ? 1.604   20.761  -16.673 1.00 54.58  ? 205 HIS A HB3    1 
ATOM   1630 H  HD2    . HIS C 2 58 ? 3.978   21.698  -15.036 1.00 68.25  ? 205 HIS A HD2    1 
ATOM   1631 H  HE1    . HIS C 2 58 ? 6.331   21.099  -18.165 1.00 78.25  ? 205 HIS A HE1    1 
ATOM   1632 H  HE2    . HIS C 2 58 ? 6.141   22.136  -16.047 1.00 70.92  ? 205 HIS A HE2    1 
ATOM   1633 N  N      . LEU C 2 59 ? 0.467   17.248  -15.135 1.00 46.50  ? 206 LEU A N      1 
ATOM   1634 C  CA     . LEU C 2 59 ? -0.826  16.565  -15.124 1.00 48.95  ? 206 LEU A CA     1 
ATOM   1635 C  C      . LEU C 2 59 ? -1.414  16.615  -13.720 1.00 42.91  ? 206 LEU A C      1 
ATOM   1636 O  O      . LEU C 2 59 ? -0.690  16.788  -12.744 1.00 37.90  ? 206 LEU A O      1 
ATOM   1637 C  CB     . LEU C 2 59 ? -0.686  15.096  -15.532 1.00 43.78  ? 206 LEU A CB     1 
ATOM   1638 C  CG     . LEU C 2 59 ? 0.119   14.806  -16.784 1.00 43.35  ? 206 LEU A CG     1 
ATOM   1639 C  CD1    . LEU C 2 59 ? 0.411   13.331  -16.813 1.00 37.04  ? 206 LEU A CD1    1 
ATOM   1640 C  CD2    . LEU C 2 59 ? -0.678  15.224  -17.957 1.00 48.14  ? 206 LEU A CD2    1 
ATOM   1641 H  H      . LEU C 2 59 ? 1.100   16.787  -14.779 1.00 56.67  ? 206 LEU A H      1 
ATOM   1642 H  HA     . LEU C 2 59 ? -1.436  17.005  -15.737 1.00 59.61  ? 206 LEU A HA     1 
ATOM   1643 H  HB2    . LEU C 2 59 ? -0.260  14.619  -14.802 1.00 53.41  ? 206 LEU A HB2    1 
ATOM   1644 H  HB3    . LEU C 2 59 ? -1.575  14.736  -15.674 1.00 53.41  ? 206 LEU A HB3    1 
ATOM   1645 H  HG     . LEU C 2 59 ? 0.954   15.299  -16.769 1.00 52.89  ? 206 LEU A HG     1 
ATOM   1646 H  HD11   . LEU C 2 59 ? 0.926   13.128  -17.610 1.00 45.32  ? 206 LEU A HD11   1 
ATOM   1647 H  HD12   . LEU C 2 59 ? 0.918   13.094  -16.021 1.00 45.32  ? 206 LEU A HD12   1 
ATOM   1648 H  HD13   . LEU C 2 59 ? -0.427  12.844  -16.828 1.00 45.32  ? 206 LEU A HD13   1 
ATOM   1649 H  HD21   . LEU C 2 59 ? -0.170  15.042  -18.763 1.00 58.65  ? 206 LEU A HD21   1 
ATOM   1650 H  HD22   . LEU C 2 59 ? -1.509  14.724  -17.968 1.00 58.65  ? 206 LEU A HD22   1 
ATOM   1651 H  HD23   . LEU C 2 59 ? -0.864  16.174  -17.890 1.00 58.65  ? 206 LEU A HD23   1 
ATOM   1652 N  N      . SER C 2 60 ? -2.734  16.433  -13.626 1.00 42.19  ? 207 SER A N      1 
ATOM   1653 C  CA     . SER C 2 60 ? -3.370  16.294  -12.326 1.00 40.32  ? 207 SER A CA     1 
ATOM   1654 C  C      . SER C 2 60 ? -3.029  14.954  -11.691 1.00 41.62  ? 207 SER A C      1 
ATOM   1655 O  O      . SER C 2 60 ? -2.654  13.980  -12.359 1.00 40.42  ? 207 SER A O      1 
ATOM   1656 C  CB     . SER C 2 60 ? -4.887  16.390  -12.432 1.00 38.22  ? 207 SER A CB     1 
ATOM   1657 O  OG     . SER C 2 60 ? -5.423  15.193  -13.016 1.00 47.18  ? 207 SER A OG     1 
ATOM   1658 H  H      . SER C 2 60 ? -3.273  16.387  -14.294 1.00 51.50  ? 207 SER A H      1 
ATOM   1659 H  HA     . SER C 2 60 ? -3.059  16.999  -11.738 1.00 49.25  ? 207 SER A HA     1 
ATOM   1660 H  HB2    . SER C 2 60 ? -5.261  16.505  -11.545 1.00 46.73  ? 207 SER A HB2    1 
ATOM   1661 H  HB3    . SER C 2 60 ? -5.118  17.147  -12.992 1.00 46.73  ? 207 SER A HB3    1 
ATOM   1662 H  HG     . SER C 2 60 ? -6.259  15.250  -13.072 1.00 57.49  ? 207 SER A HG     1 
ATOM   1663 N  N      . THR C 2 61 ? -3.217  14.900  -10.378 1.00 36.53  ? 208 THR A N      1 
ATOM   1664 C  CA     . THR C 2 61 ? -3.063  13.633  -9.683  1.00 39.01  ? 208 THR A CA     1 
ATOM   1665 C  C      . THR C 2 61 ? -3.940  12.560  -10.312 1.00 37.04  ? 208 THR A C      1 
ATOM   1666 O  O      . THR C 2 61 ? -3.496  11.416  -10.501 1.00 35.43  ? 208 THR A O      1 
ATOM   1667 C  CB     . THR C 2 61 ? -3.396  13.801  -8.194  1.00 42.17  ? 208 THR A CB     1 
ATOM   1668 O  OG1    . THR C 2 61 ? -2.564  14.822  -7.650  1.00 47.44  ? 208 THR A OG1    1 
ATOM   1669 C  CG2    . THR C 2 61 ? -3.181  12.493  -7.379  1.00 40.26  ? 208 THR A CG2    1 
ATOM   1670 H  H      . THR C 2 61 ? -3.428  15.566  -9.877  1.00 44.71  ? 208 THR A H      1 
ATOM   1671 H  HA     . THR C 2 61 ? -2.140  13.344  -9.753  1.00 47.68  ? 208 THR A HA     1 
ATOM   1672 H  HB     . THR C 2 61 ? -4.325  14.064  -8.102  1.00 51.47  ? 208 THR A HB     1 
ATOM   1673 H  HG1    . THR C 2 61 ? -2.734  14.926  -6.834  1.00 57.80  ? 208 THR A HG1    1 
ATOM   1674 H  HG21   . THR C 2 61 ? -3.402  12.643  -6.447  1.00 49.18  ? 208 THR A HG21   1 
ATOM   1675 H  HG22   . THR C 2 61 ? -3.748  11.788  -7.728  1.00 49.18  ? 208 THR A HG22   1 
ATOM   1676 H  HG23   . THR C 2 61 ? -2.254  12.212  -7.442  1.00 49.18  ? 208 THR A HG23   1 
ATOM   1677 N  N      . LEU C 2 62 ? -5.200  12.894  -10.624 1.00 40.09  ? 209 LEU A N      1 
ATOM   1678 C  CA     . LEU C 2 62 ? -6.102  11.865  -11.130 1.00 37.64  ? 209 LEU A CA     1 
ATOM   1679 C  C      . LEU C 2 62 ? -5.559  11.338  -12.439 1.00 37.21  ? 209 LEU A C      1 
ATOM   1680 O  O      . LEU C 2 62 ? -5.578  10.127  -12.700 1.00 36.57  ? 209 LEU A O      1 
ATOM   1681 C  CB     . LEU C 2 62 ? -7.513  12.429  -11.319 1.00 37.12  ? 209 LEU A CB     1 
ATOM   1682 C  CG     . LEU C 2 62 ? -8.606  11.543  -11.934 1.00 38.76  ? 209 LEU A CG     1 
ATOM   1683 C  CD1    . LEU C 2 62 ? -8.776  10.223  -11.175 1.00 31.04  ? 209 LEU A CD1    1 
ATOM   1684 C  CD2    . LEU C 2 62 ? -9.915  12.279  -11.866 1.00 23.84  ? 209 LEU A CD2    1 
ATOM   1685 H  H      . LEU C 2 62 ? -5.541  13.681  -10.553 1.00 48.98  ? 209 LEU A H      1 
ATOM   1686 H  HA     . LEU C 2 62 ? -6.145  11.132  -10.497 1.00 46.04  ? 209 LEU A HA     1 
ATOM   1687 H  HB2    . LEU C 2 62 ? -7.838  12.703  -10.447 1.00 45.42  ? 209 LEU A HB2    1 
ATOM   1688 H  HB3    . LEU C 2 62 ? -7.441  13.213  -11.885 1.00 45.42  ? 209 LEU A HB3    1 
ATOM   1689 H  HG     . LEU C 2 62 ? -8.398  11.351  -12.862 1.00 47.39  ? 209 LEU A HG     1 
ATOM   1690 H  HD11   . LEU C 2 62 ? -9.474  9.702   -11.602 1.00 38.13  ? 209 LEU A HD11   1 
ATOM   1691 H  HD12   . LEU C 2 62 ? -7.938  9.735   -11.199 1.00 38.13  ? 209 LEU A HD12   1 
ATOM   1692 H  HD13   . LEU C 2 62 ? -9.021  10.417  -10.257 1.00 38.13  ? 209 LEU A HD13   1 
ATOM   1693 H  HD21   . LEU C 2 62 ? -10.609 11.723  -12.254 1.00 29.48  ? 209 LEU A HD21   1 
ATOM   1694 H  HD22   . LEU C 2 62 ? -10.122 12.468  -10.937 1.00 29.48  ? 209 LEU A HD22   1 
ATOM   1695 H  HD23   . LEU C 2 62 ? -9.837  13.108  -12.364 1.00 29.48  ? 209 LEU A HD23   1 
ATOM   1696 N  N      . GLN C 2 63 ? -5.039  12.245  -13.263 1.00 37.51  ? 210 GLN A N      1 
ATOM   1697 C  CA     . GLN C 2 63 ? -4.445  11.852  -14.536 1.00 45.51  ? 210 GLN A CA     1 
ATOM   1698 C  C      . GLN C 2 63 ? -3.275  10.913  -14.323 1.00 42.26  ? 210 GLN A C      1 
ATOM   1699 O  O      . GLN C 2 63 ? -3.177  9.860   -14.971 1.00 37.34  ? 210 GLN A O      1 
ATOM   1700 C  CB     . GLN C 2 63 ? -4.003  13.100  -15.281 1.00 47.39  ? 210 GLN A CB     1 
ATOM   1701 C  CG     . GLN C 2 63 ? -5.210  13.845  -15.786 1.00 49.82  ? 210 GLN A CG     1 
ATOM   1702 C  CD     . GLN C 2 63 ? -4.869  15.109  -16.518 1.00 52.36  ? 210 GLN A CD     1 
ATOM   1703 O  OE1    . GLN C 2 63 ? -4.268  16.046  -15.939 1.00 42.22  ? 210 GLN A OE1    1 
ATOM   1704 N  NE2    . GLN C 2 63 ? -5.276  15.167  -17.808 1.00 38.61  ? 210 GLN A NE2    1 
ATOM   1705 H  H      . GLN C 2 63 ? -5.018  13.091  -13.108 1.00 45.89  ? 210 GLN A H      1 
ATOM   1706 H  HA     . GLN C 2 63 ? -5.110  11.394  -15.074 1.00 55.48  ? 210 GLN A HA     1 
ATOM   1707 H  HB2    . GLN C 2 63 ? -3.509  13.680  -14.680 1.00 57.74  ? 210 GLN A HB2    1 
ATOM   1708 H  HB3    . GLN C 2 63 ? -3.454  12.848  -16.040 1.00 57.74  ? 210 GLN A HB3    1 
ATOM   1709 H  HG2    . GLN C 2 63 ? -5.700  13.272  -16.395 1.00 60.65  ? 210 GLN A HG2    1 
ATOM   1710 H  HG3    . GLN C 2 63 ? -5.771  14.081  -15.031 1.00 60.65  ? 210 GLN A HG3    1 
ATOM   1711 H  HE21   . GLN C 2 63 ? -5.701  14.505  -18.156 1.00 47.20  ? 210 GLN A HE21   1 
ATOM   1712 H  HE22   . GLN C 2 63 ? -5.111  15.866  -18.281 1.00 47.20  ? 210 GLN A HE22   1 
ATOM   1713 N  N      . VAL C 2 64 ? -2.405  11.249  -13.373 1.00 42.74  ? 211 VAL A N      1 
ATOM   1714 C  CA     . VAL C 2 64 ? -1.272  10.382  -13.082 1.00 38.63  ? 211 VAL A CA     1 
ATOM   1715 C  C      . VAL C 2 64 ? -1.763  9.025   -12.584 1.00 39.18  ? 211 VAL A C      1 
ATOM   1716 O  O      . VAL C 2 64 ? -1.304  7.972   -13.045 1.00 36.76  ? 211 VAL A O      1 
ATOM   1717 C  CB     . VAL C 2 64 ? -0.333  11.066  -12.081 1.00 37.83  ? 211 VAL A CB     1 
ATOM   1718 C  CG1    . VAL C 2 64 ? 0.837   10.144  -11.731 1.00 33.50  ? 211 VAL A CG1    1 
ATOM   1719 C  CG2    . VAL C 2 64 ? 0.163   12.398  -12.666 1.00 33.31  ? 211 VAL A CG2    1 
ATOM   1720 H  H      . VAL C 2 64 ? -2.448  11.960  -12.892 1.00 52.16  ? 211 VAL A H      1 
ATOM   1721 H  HA     . VAL C 2 64 ? -0.774  10.234  -13.901 1.00 47.23  ? 211 VAL A HA     1 
ATOM   1722 H  HB     . VAL C 2 64 ? -0.822  11.257  -11.265 1.00 46.27  ? 211 VAL A HB     1 
ATOM   1723 H  HG11   . VAL C 2 64 ? 1.416   10.596  -11.098 1.00 41.07  ? 211 VAL A HG11   1 
ATOM   1724 H  HG12   . VAL C 2 64 ? 0.489   9.328   -11.338 1.00 41.07  ? 211 VAL A HG12   1 
ATOM   1725 H  HG13   . VAL C 2 64 ? 1.329   9.937   -12.542 1.00 41.07  ? 211 VAL A HG13   1 
ATOM   1726 H  HG21   . VAL C 2 64 ? 0.756   12.822  -12.025 1.00 40.85  ? 211 VAL A HG21   1 
ATOM   1727 H  HG22   . VAL C 2 64 ? 0.640   12.222  -13.492 1.00 40.85  ? 211 VAL A HG22   1 
ATOM   1728 H  HG23   . VAL C 2 64 ? -0.601  12.970  -12.839 1.00 40.85  ? 211 VAL A HG23   1 
ATOM   1729 N  N      . CYS C 2 65 ? -2.702  9.023   -11.629 1.00 37.71  ? 212 CYS A N      1 
ATOM   1730 C  CA     . CYS C 2 65 ? -3.257  7.751   -11.185 1.00 39.08  ? 212 CYS A CA     1 
ATOM   1731 C  C      . CYS C 2 65 ? -3.809  6.959   -12.368 1.00 36.37  ? 212 CYS A C      1 
ATOM   1732 O  O      . CYS C 2 65 ? -3.440  5.797   -12.592 1.00 35.73  ? 212 CYS A O      1 
ATOM   1733 C  CB     . CYS C 2 65 ? -4.351  7.990   -10.156 1.00 40.15  ? 212 CYS A CB     1 
ATOM   1734 S  SG     . CYS C 2 65 ? -3.759  8.467   -8.568  1.00 48.97  ? 212 CYS A SG     1 
ATOM   1735 H  H      . CYS C 2 65 ? -3.022  9.720   -11.239 1.00 46.13  ? 212 CYS A H      1 
ATOM   1736 H  HA     . CYS C 2 65 ? -2.557  7.226   -10.768 1.00 47.77  ? 212 CYS A HA     1 
ATOM   1737 H  HB2    . CYS C 2 65 ? -4.932  8.697   -10.478 1.00 49.05  ? 212 CYS A HB2    1 
ATOM   1738 H  HB3    . CYS C 2 65 ? -4.860  7.172   -10.047 1.00 49.05  ? 212 CYS A HB3    1 
ATOM   1739 H  HG     . CYS C 2 65 ? -4.695  8.629   -7.835  1.00 59.64  ? 212 CYS A HG     1 
ATOM   1740 N  N      . ASN C 2 66 ? -4.652  7.583   -13.180 1.00 34.36  ? 213 ASN A N      1 
ATOM   1741 C  CA     . ASN C 2 66 ? -5.254  6.820   -14.260 1.00 40.64  ? 213 ASN A CA     1 
ATOM   1742 C  C      . ASN C 2 66 ? -4.185  6.258   -15.189 1.00 31.15  ? 213 ASN A C      1 
ATOM   1743 O  O      . ASN C 2 66 ? -4.274  5.107   -15.650 1.00 33.07  ? 213 ASN A O      1 
ATOM   1744 C  CB     . ASN C 2 66 ? -6.240  7.695   -15.025 1.00 49.90  ? 213 ASN A CB     1 
ATOM   1745 C  CG     . ASN C 2 66 ? -7.592  7.748   -14.353 1.00 37.31  ? 213 ASN A CG     1 
ATOM   1746 O  OD1    . ASN C 2 66 ? -7.984  6.810   -13.647 1.00 34.95  ? 213 ASN A OD1    1 
ATOM   1747 N  ND2    . ASN C 2 66 ? -8.316  8.840   -14.570 1.00 32.64  ? 213 ASN A ND2    1 
ATOM   1748 H  H      . ASN C 2 66 ? -4.883  8.410   -13.131 1.00 42.11  ? 213 ASN A H      1 
ATOM   1749 H  HA     . ASN C 2 66 ? -5.746  6.073   -13.883 1.00 49.65  ? 213 ASN A HA     1 
ATOM   1750 H  HB2    . ASN C 2 66 ? -5.892  8.598   -15.074 1.00 60.75  ? 213 ASN A HB2    1 
ATOM   1751 H  HB3    . ASN C 2 66 ? -6.360  7.333   -15.917 1.00 60.75  ? 213 ASN A HB3    1 
ATOM   1752 H  HD21   . ASN C 2 66 ? -9.093  8.919   -14.211 1.00 40.04  ? 213 ASN A HD21   1 
ATOM   1753 H  HD22   . ASN C 2 66 ? -8.008  9.467   -15.071 1.00 40.04  ? 213 ASN A HD22   1 
ATOM   1754 N  N      . TRP C 2 67 ? -3.151  7.039   -15.468 1.00 27.93  ? 214 TRP A N      1 
ATOM   1755 C  CA     . TRP C 2 67 ? -2.121  6.519   -16.355 1.00 33.06  ? 214 TRP A CA     1 
ATOM   1756 C  C      . TRP C 2 67 ? -1.492  5.271   -15.767 1.00 37.56  ? 214 TRP A C      1 
ATOM   1757 O  O      . TRP C 2 67 ? -1.160  4.332   -16.498 1.00 38.29  ? 214 TRP A O      1 
ATOM   1758 C  CB     . TRP C 2 67 ? -1.080  7.590   -16.639 1.00 31.08  ? 214 TRP A CB     1 
ATOM   1759 C  CG     . TRP C 2 67 ? -0.112  7.212   -17.729 1.00 40.53  ? 214 TRP A CG     1 
ATOM   1760 C  CD1    . TRP C 2 67 ? -0.223  7.475   -19.080 1.00 38.75  ? 214 TRP A CD1    1 
ATOM   1761 C  CD2    . TRP C 2 67 ? 1.115   6.494   -17.566 1.00 40.14  ? 214 TRP A CD2    1 
ATOM   1762 N  NE1    . TRP C 2 67 ? 0.869   6.967   -19.743 1.00 42.11  ? 214 TRP A NE1    1 
ATOM   1763 C  CE2    . TRP C 2 67 ? 1.702   6.365   -18.845 1.00 40.03  ? 214 TRP A CE2    1 
ATOM   1764 C  CE3    . TRP C 2 67 ? 1.769   5.947   -16.470 1.00 36.63  ? 214 TRP A CE3    1 
ATOM   1765 C  CZ2    . TRP C 2 67 ? 2.905   5.717   -19.042 1.00 42.31  ? 214 TRP A CZ2    1 
ATOM   1766 C  CZ3    . TRP C 2 67 ? 2.975   5.305   -16.666 1.00 40.94  ? 214 TRP A CZ3    1 
ATOM   1767 C  CH2    . TRP C 2 67 ? 3.530   5.194   -17.939 1.00 45.18  ? 214 TRP A CH2    1 
ATOM   1768 H  H      . TRP C 2 67 ? -3.024  7.837   -15.173 1.00 34.39  ? 214 TRP A H      1 
ATOM   1769 H  HA     . TRP C 2 67 ? -2.531  6.274   -17.199 1.00 40.55  ? 214 TRP A HA     1 
ATOM   1770 H  HB2    . TRP C 2 67 ? -1.533  8.403   -16.913 1.00 38.17  ? 214 TRP A HB2    1 
ATOM   1771 H  HB3    . TRP C 2 67 ? -0.570  7.753   -15.831 1.00 38.17  ? 214 TRP A HB3    1 
ATOM   1772 H  HD1    . TRP C 2 67 ? -0.925  7.937   -19.479 1.00 47.37  ? 214 TRP A HD1    1 
ATOM   1773 H  HE1    . TRP C 2 67 ? 1.008   7.023   -20.590 1.00 51.41  ? 214 TRP A HE1    1 
ATOM   1774 H  HE3    . TRP C 2 67 ? 1.407   6.024   -15.617 1.00 44.83  ? 214 TRP A HE3    1 
ATOM   1775 H  HZ2    . TRP C 2 67 ? 3.277   5.638   -19.890 1.00 51.65  ? 214 TRP A HZ2    1 
ATOM   1776 H  HZ3    . TRP C 2 67 ? 3.423   4.940   -15.937 1.00 50.00  ? 214 TRP A HZ3    1 
ATOM   1777 H  HH2    . TRP C 2 67 ? 4.342   4.752   -18.043 1.00 55.09  ? 214 TRP A HH2    1 
ATOM   1778 N  N      . PHE C 2 68 ? -1.319  5.233   -14.444 1.00 41.32  ? 215 PHE A N      1 
ATOM   1779 C  CA     . PHE C 2 68 ? -0.649  4.085   -13.848 1.00 41.95  ? 215 PHE A CA     1 
ATOM   1780 C  C      . PHE C 2 68 ? -1.573  2.888   -13.816 1.00 41.66  ? 215 PHE A C      1 
ATOM   1781 O  O      . PHE C 2 68 ? -1.134  1.756   -14.052 1.00 41.61  ? 215 PHE A O      1 
ATOM   1782 C  CB     . PHE C 2 68 ? -0.148  4.419   -12.444 1.00 37.60  ? 215 PHE A CB     1 
ATOM   1783 C  CG     . PHE C 2 68 ? 1.236   5.011   -12.442 1.00 38.38  ? 215 PHE A CG     1 
ATOM   1784 C  CD1    . PHE C 2 68 ? 2.353   4.194   -12.560 1.00 36.84  ? 215 PHE A CD1    1 
ATOM   1785 C  CD2    . PHE C 2 68 ? 1.416   6.379   -12.359 1.00 29.47  ? 215 PHE A CD2    1 
ATOM   1786 C  CE1    . PHE C 2 68 ? 3.616   4.736   -12.598 1.00 33.53  ? 215 PHE A CE1    1 
ATOM   1787 C  CE2    . PHE C 2 68 ? 2.671   6.924   -12.383 1.00 36.02  ? 215 PHE A CE2    1 
ATOM   1788 C  CZ     . PHE C 2 68 ? 3.776   6.098   -12.508 1.00 42.55  ? 215 PHE A CZ     1 
ATOM   1789 H  H      . PHE C 2 68 ? -1.571  5.840   -13.889 1.00 50.46  ? 215 PHE A H      1 
ATOM   1790 H  HA     . PHE C 2 68 ? 0.121   3.853   -14.391 1.00 51.21  ? 215 PHE A HA     1 
ATOM   1791 H  HB2    . PHE C 2 68 ? -0.750  5.063   -12.040 1.00 46.00  ? 215 PHE A HB2    1 
ATOM   1792 H  HB3    . PHE C 2 68 ? -0.128  3.607   -11.914 1.00 46.00  ? 215 PHE A HB3    1 
ATOM   1793 H  HD1    . PHE C 2 68 ? 2.245   3.273   -12.631 1.00 45.08  ? 215 PHE A HD1    1 
ATOM   1794 H  HD2    . PHE C 2 68 ? 0.675   6.936   -12.285 1.00 36.23  ? 215 PHE A HD2    1 
ATOM   1795 H  HE1    . PHE C 2 68 ? 4.360   4.182   -12.671 1.00 41.11  ? 215 PHE A HE1    1 
ATOM   1796 H  HE2    . PHE C 2 68 ? 2.782   7.846   -12.323 1.00 44.09  ? 215 PHE A HE2    1 
ATOM   1797 H  HZ     . PHE C 2 68 ? 4.631   6.465   -12.518 1.00 51.94  ? 215 PHE A HZ     1 
ATOM   1798 N  N      . ILE C 2 69 ? -2.863  3.119   -13.558 1.00 32.69  ? 216 ILE A N      1 
ATOM   1799 C  CA     . ILE C 2 69 ? -3.806  2.008   -13.603 1.00 40.01  ? 216 ILE A CA     1 
ATOM   1800 C  C      . ILE C 2 69 ? -3.854  1.393   -15.003 1.00 40.94  ? 216 ILE A C      1 
ATOM   1801 O  O      . ILE C 2 69 ? -3.943  0.167   -15.144 1.00 40.01  ? 216 ILE A O      1 
ATOM   1802 C  CB     . ILE C 2 69 ? -5.196  2.464   -13.143 1.00 39.31  ? 216 ILE A CB     1 
ATOM   1803 C  CG1    . ILE C 2 69 ? -5.103  3.038   -11.745 1.00 32.69  ? 216 ILE A CG1    1 
ATOM   1804 C  CG2    . ILE C 2 69 ? -6.159  1.287   -13.227 1.00 45.57  ? 216 ILE A CG2    1 
ATOM   1805 C  CD1    . ILE C 2 69 ? -6.442  3.561   -11.117 1.00 35.61  ? 216 ILE A CD1    1 
ATOM   1806 H  H      . ILE C 2 69 ? -3.205  3.883   -13.362 1.00 40.10  ? 216 ILE A H      1 
ATOM   1807 H  HA     . ILE C 2 69 ? -3.505  1.319   -12.990 1.00 48.89  ? 216 ILE A HA     1 
ATOM   1808 H  HB     . ILE C 2 69 ? -5.506  3.160   -13.743 1.00 48.05  ? 216 ILE A HB     1 
ATOM   1809 H  HG12   . ILE C 2 69 ? -4.759  2.349   -11.155 1.00 40.10  ? 216 ILE A HG12   1 
ATOM   1810 H  HG13   . ILE C 2 69 ? -4.484  3.784   -11.763 1.00 40.10  ? 216 ILE A HG13   1 
ATOM   1811 H  HG21   . ILE C 2 69 ? -7.037  1.577   -12.936 1.00 55.55  ? 216 ILE A HG21   1 
ATOM   1812 H  HG22   . ILE C 2 69 ? -6.200  0.978   -14.145 1.00 55.55  ? 216 ILE A HG22   1 
ATOM   1813 H  HG23   . ILE C 2 69 ? -5.837  0.575   -12.652 1.00 55.55  ? 216 ILE A HG23   1 
ATOM   1814 H  HD11   . ILE C 2 69 ? -6.262  3.902   -10.228 1.00 43.61  ? 216 ILE A HD11   1 
ATOM   1815 H  HD12   . ILE C 2 69 ? -6.798  4.268   -11.678 1.00 43.61  ? 216 ILE A HD12   1 
ATOM   1816 H  HD13   . ILE C 2 69 ? -7.075  2.827   -11.068 1.00 43.61  ? 216 ILE A HD13   1 
ATOM   1817 N  N      . ASN C 2 70 ? -3.798  2.226   -16.058 1.00 34.47  ? 217 ASN A N      1 
ATOM   1818 C  CA     . ASN C 2 70 ? -3.775  1.701   -17.440 1.00 44.40  ? 217 ASN A CA     1 
ATOM   1819 C  C      . ASN C 2 70 ? -2.431  1.053   -17.774 1.00 42.04  ? 217 ASN A C      1 
ATOM   1820 O  O      . ASN C 2 70 ? -2.381  -0.023  -18.385 1.00 38.26  ? 217 ASN A O      1 
ATOM   1821 C  CB     . ASN C 2 70 ? -4.019  2.817   -18.471 1.00 33.59  ? 217 ASN A CB     1 
ATOM   1822 C  CG     . ASN C 2 70 ? -5.444  3.375   -18.451 1.00 40.81  ? 217 ASN A CG     1 
ATOM   1823 O  OD1    . ASN C 2 70 ? -6.424  2.626   -18.474 1.00 45.15  ? 217 ASN A OD1    1 
ATOM   1824 N  ND2    . ASN C 2 70 ? -5.558  4.707   -18.427 1.00 43.06  ? 217 ASN A ND2    1 
ATOM   1825 H  H      . ASN C 2 70 ? -3.773  3.084   -16.003 1.00 42.24  ? 217 ASN A H      1 
ATOM   1826 H  HA     . ASN C 2 70 ? -4.471  1.032   -17.542 1.00 54.16  ? 217 ASN A HA     1 
ATOM   1827 H  HB2    . ASN C 2 70 ? -3.411  3.551   -18.288 1.00 41.18  ? 217 ASN A HB2    1 
ATOM   1828 H  HB3    . ASN C 2 70 ? -3.851  2.465   -19.359 1.00 41.18  ? 217 ASN A HB3    1 
ATOM   1829 H  HD21   . ASN C 2 70 ? -6.337  5.071   -18.415 1.00 52.54  ? 217 ASN A HD21   1 
ATOM   1830 H  HD22   . ASN C 2 70 ? -4.853  5.199   -18.423 1.00 52.54  ? 217 ASN A HD22   1 
ATOM   1831 N  N      . ALA C 2 71 ? -1.331  1.712   -17.397 1.00 41.51  ? 218 ALA A N      1 
ATOM   1832 C  CA     . ALA C 2 71 ? -0.008  1.275   -17.818 1.00 40.67  ? 218 ALA A CA     1 
ATOM   1833 C  C      . ALA C 2 71 ? 0.420   0.003   -17.103 1.00 43.01  ? 218 ALA A C      1 
ATOM   1834 O  O      . ALA C 2 71 ? 1.173   -0.794  -17.673 1.00 44.60  ? 218 ALA A O      1 
ATOM   1835 C  CB     . ALA C 2 71 ? 1.013   2.388   -17.600 1.00 32.85  ? 218 ALA A CB     1 
ATOM   1836 H  H      . ALA C 2 71 ? -1.329  2.413   -16.898 1.00 50.69  ? 218 ALA A H      1 
ATOM   1837 H  HA     . ALA C 2 71 ? -0.034  1.082   -18.768 1.00 49.67  ? 218 ALA A HA     1 
ATOM   1838 H  HB1    . ALA C 2 71 ? 1.885   2.076   -17.887 1.00 40.29  ? 218 ALA A HB1    1 
ATOM   1839 H  HB2    . ALA C 2 71 ? 0.750   3.163   -18.122 1.00 40.29  ? 218 ALA A HB2    1 
ATOM   1840 H  HB3    . ALA C 2 71 ? 1.035   2.616   -16.658 1.00 40.29  ? 218 ALA A HB3    1 
ATOM   1841 N  N      . ARG C 2 72 ? -0.015  -0.203  -15.856 1.00 37.44  ? 219 ARG A N      1 
ATOM   1842 C  CA     . ARG C 2 72 ? 0.268   -1.482  -15.215 1.00 44.28  ? 219 ARG A CA     1 
ATOM   1843 C  C      . ARG C 2 72 ? -0.390  -2.615  -15.981 1.00 42.02  ? 219 ARG A C      1 
ATOM   1844 O  O      . ARG C 2 72 ? 0.121   -3.739  -15.988 1.00 46.42  ? 219 ARG A O      1 
ATOM   1845 C  CB     . ARG C 2 72 ? -0.191  -1.502  -13.739 1.00 41.34  ? 219 ARG A CB     1 
ATOM   1846 C  CG     . ARG C 2 72 ? 0.732   -0.730  -12.757 1.00 37.49  ? 219 ARG A CG     1 
ATOM   1847 C  CD     . ARG C 2 72 ? 0.426   -0.950  -11.236 1.00 43.79  ? 219 ARG A CD     1 
ATOM   1848 N  NE     . ARG C 2 72 ? -0.817  -0.294  -10.809 1.00 41.25  ? 219 ARG A NE     1 
ATOM   1849 C  CZ     . ARG C 2 72 ? -0.895  0.983   -10.443 1.00 41.31  ? 219 ARG A CZ     1 
ATOM   1850 N  NH1    . ARG C 2 72 ? 0.205   1.736   -10.445 1.00 38.82  ? 219 ARG A NH1    1 
ATOM   1851 N  NH2    . ARG C 2 72 ? -2.063  1.512   -10.068 1.00 41.62  ? 219 ARG A NH2    1 
ATOM   1852 H  H      . ARG C 2 72 ? -0.458  0.360   -15.379 1.00 45.81  ? 219 ARG A H      1 
ATOM   1853 H  HA     . ARG C 2 72 ? 1.226   -1.632  -15.229 1.00 54.01  ? 219 ARG A HA     1 
ATOM   1854 H  HB2    . ARG C 2 72 ? -1.074  -1.105  -13.684 1.00 50.48  ? 219 ARG A HB2    1 
ATOM   1855 H  HB3    . ARG C 2 72 ? -0.230  -2.424  -13.440 1.00 50.48  ? 219 ARG A HB3    1 
ATOM   1856 H  HG2    . ARG C 2 72 ? 1.648   -1.008  -12.913 1.00 45.87  ? 219 ARG A HG2    1 
ATOM   1857 H  HG3    . ARG C 2 72 ? 0.646   0.220   -12.937 1.00 45.87  ? 219 ARG A HG3    1 
ATOM   1858 H  HD2    . ARG C 2 72 ? 0.338   -1.901  -11.065 1.00 53.42  ? 219 ARG A HD2    1 
ATOM   1859 H  HD3    . ARG C 2 72 ? 1.155   -0.585  -10.710 1.00 53.42  ? 219 ARG A HD3    1 
ATOM   1860 H  HE     . ARG C 2 72 ? -1.518  -0.783  -10.714 1.00 50.37  ? 219 ARG A HE     1 
ATOM   1861 H  HH11   . ARG C 2 72 ? 0.957   1.397   -10.687 1.00 47.45  ? 219 ARG A HH11   1 
ATOM   1862 H  HH12   . ARG C 2 72 ? 0.161   2.562   -10.209 1.00 47.45  ? 219 ARG A HH12   1 
ATOM   1863 H  HH21   . ARG C 2 72 ? -2.773  1.027   -10.064 1.00 50.82  ? 219 ARG A HH21   1 
ATOM   1864 H  HH22   . ARG C 2 72 ? -2.105  2.337   -9.830  1.00 50.82  ? 219 ARG A HH22   1 
ATOM   1865 N  N      . ARG C 2 73 ? -1.511  -2.342  -16.648 1.00 49.39  ? 220 ARG A N      1 
ATOM   1866 C  CA     . ARG C 2 73 ? -2.153  -3.368  -17.475 1.00 47.00  ? 220 ARG A CA     1 
ATOM   1867 C  C      . ARG C 2 73 ? -1.559  -3.449  -18.890 1.00 41.56  ? 220 ARG A C      1 
ATOM   1868 O  O      . ARG C 2 73 ? -1.435  -4.546  -19.444 1.00 39.50  ? 220 ARG A O      1 
ATOM   1869 C  CB     . ARG C 2 73 ? -3.665  -3.104  -17.565 1.00 39.11  ? 220 ARG A CB     1 
ATOM   1870 C  CG     . ARG C 2 73 ? -4.405  -3.045  -16.273 1.00 50.08  ? 220 ARG A CG     1 
ATOM   1871 C  CD     . ARG C 2 73 ? -5.900  -2.904  -16.553 1.00 50.86  ? 220 ARG A CD     1 
ATOM   1872 N  NE     . ARG C 2 73 ? -6.318  -1.548  -16.925 1.00 45.33  ? 220 ARG A NE     1 
ATOM   1873 C  CZ     . ARG C 2 73 ? -7.577  -1.215  -17.208 1.00 42.56  ? 220 ARG A CZ     1 
ATOM   1874 N  NH1    . ARG C 2 73 ? -8.529  -2.144  -17.185 1.00 37.78  ? 220 ARG A NH1    1 
ATOM   1875 N  NH2    . ARG C 2 73 ? -7.888  0.037   -17.515 1.00 40.48  ? 220 ARG A NH2    1 
ATOM   1876 H  H      . ARG C 2 73 ? -1.915  -1.583  -16.641 1.00 60.14  ? 220 ARG A H      1 
ATOM   1877 H  HA     . ARG C 2 73 ? -2.028  -4.232  -17.052 1.00 57.27  ? 220 ARG A HA     1 
ATOM   1878 H  HB2    . ARG C 2 73 ? -3.799  -2.253  -18.012 1.00 47.80  ? 220 ARG A HB2    1 
ATOM   1879 H  HB3    . ARG C 2 73 ? -4.066  -3.811  -18.094 1.00 47.80  ? 220 ARG A HB3    1 
ATOM   1880 H  HG2    . ARG C 2 73 ? -4.258  -3.864  -15.775 1.00 60.97  ? 220 ARG A HG2    1 
ATOM   1881 H  HG3    . ARG C 2 73 ? -4.110  -2.275  -15.762 1.00 60.97  ? 220 ARG A HG3    1 
ATOM   1882 H  HD2    . ARG C 2 73 ? -6.137  -3.497  -17.283 1.00 61.91  ? 220 ARG A HD2    1 
ATOM   1883 H  HD3    . ARG C 2 73 ? -6.391  -3.156  -15.755 1.00 61.91  ? 220 ARG A HD3    1 
ATOM   1884 H  HE     . ARG C 2 73 ? -5.742  -0.914  -16.849 1.00 55.26  ? 220 ARG A HE     1 
ATOM   1885 H  HH11   . ARG C 2 73 ? -8.332  -2.956  -16.980 1.00 46.20  ? 220 ARG A HH11   1 
ATOM   1886 H  HH12   . ARG C 2 73 ? -9.341  -1.932  -17.370 1.00 46.20  ? 220 ARG A HH12   1 
ATOM   1887 H  HH21   . ARG C 2 73 ? -7.275  0.639   -17.537 1.00 49.45  ? 220 ARG A HH21   1 
ATOM   1888 H  HH22   . ARG C 2 73 ? -8.700  0.244   -17.707 1.00 49.45  ? 220 ARG A HH22   1 
ATOM   1889 N  N      . ARG C 2 74 ? -1.176  -2.314  -19.488 1.00 42.64  ? 221 ARG A N      1 
ATOM   1890 C  CA     . ARG C 2 74 ? -0.905  -2.243  -20.924 1.00 44.43  ? 221 ARG A CA     1 
ATOM   1891 C  C      . ARG C 2 74 ? 0.568   -2.179  -21.288 1.00 51.27  ? 221 ARG A C      1 
ATOM   1892 O  O      . ARG C 2 74 ? 0.937   -2.535  -22.414 1.00 60.70  ? 221 ARG A O      1 
ATOM   1893 C  CB     . ARG C 2 74 ? -1.606  -1.024  -21.544 1.00 43.32  ? 221 ARG A CB     1 
ATOM   1894 C  CG     . ARG C 2 74 ? -3.109  -1.047  -21.358 1.00 41.20  ? 221 ARG A CG     1 
ATOM   1895 C  CD     . ARG C 2 74 ? -3.801  0.236   -21.804 1.00 34.45  ? 221 ARG A CD     1 
ATOM   1896 N  NE     . ARG C 2 74 ? -5.244  0.126   -21.597 1.00 42.50  ? 221 ARG A NE     1 
ATOM   1897 C  CZ     . ARG C 2 74 ? -6.075  1.159   -21.599 1.00 42.52  ? 221 ARG A CZ     1 
ATOM   1898 N  NH1    . ARG C 2 74 ? -5.618  2.392   -21.799 1.00 41.36  ? 221 ARG A NH1    1 
ATOM   1899 N  NH2    . ARG C 2 74 ? -7.365  0.954   -21.401 1.00 53.04  ? 221 ARG A NH2    1 
ATOM   1900 H  H      . ARG C 2 74 ? -1.067  -1.566  -19.078 1.00 52.04  ? 221 ARG A H      1 
ATOM   1901 H  HA     . ARG C 2 74 ? -1.274  -3.036  -21.344 1.00 54.19  ? 221 ARG A HA     1 
ATOM   1902 H  HB2    . ARG C 2 74 ? -1.265  -0.218  -21.125 1.00 52.85  ? 221 ARG A HB2    1 
ATOM   1903 H  HB3    . ARG C 2 74 ? -1.423  -1.005  -22.496 1.00 52.85  ? 221 ARG A HB3    1 
ATOM   1904 H  HG2    . ARG C 2 74 ? -3.478  -1.779  -21.877 1.00 50.31  ? 221 ARG A HG2    1 
ATOM   1905 H  HG3    . ARG C 2 74 ? -3.306  -1.179  -20.417 1.00 50.31  ? 221 ARG A HG3    1 
ATOM   1906 H  HD2    . ARG C 2 74 ? -3.470  0.982   -21.280 1.00 42.21  ? 221 ARG A HD2    1 
ATOM   1907 H  HD3    . ARG C 2 74 ? -3.636  0.382   -22.748 1.00 42.21  ? 221 ARG A HD3    1 
ATOM   1908 H  HE     . ARG C 2 74 ? -5.579  -0.661  -21.512 1.00 51.88  ? 221 ARG A HE     1 
ATOM   1909 H  HH11   . ARG C 2 74 ? -4.778  2.523   -21.928 1.00 50.51  ? 221 ARG A HH11   1 
ATOM   1910 H  HH12   . ARG C 2 74 ? -6.162  3.058   -21.800 1.00 50.51  ? 221 ARG A HH12   1 
ATOM   1911 H  HH21   . ARG C 2 74 ? -7.659  0.156   -21.272 1.00 64.52  ? 221 ARG A HH21   1 
ATOM   1912 H  HH22   . ARG C 2 74 ? -7.911  1.618   -21.402 1.00 64.52  ? 221 ARG A HH22   1 
ATOM   1913 N  N      . LEU C 2 75 ? 1.410   -1.681  -20.407 1.00 54.63  ? 222 LEU A N      1 
ATOM   1914 C  CA     . LEU C 2 75 ? 2.831   -1.560  -20.695 1.00 48.64  ? 222 LEU A CA     1 
ATOM   1915 C  C      . LEU C 2 75 ? 3.676   -2.485  -19.842 1.00 49.27  ? 222 LEU A C      1 
ATOM   1916 O  O      . LEU C 2 75 ? 4.657   -3.052  -20.314 1.00 59.12  ? 222 LEU A O      1 
ATOM   1917 C  CB     . LEU C 2 75 ? 3.289   -0.127  -20.454 1.00 49.50  ? 222 LEU A CB     1 
ATOM   1918 C  CG     . LEU C 2 75 ? 3.201   0.834   -21.622 1.00 55.33  ? 222 LEU A CG     1 
ATOM   1919 C  CD1    . LEU C 2 75 ? 1.859   0.693   -22.301 1.00 60.20  ? 222 LEU A CD1    1 
ATOM   1920 C  CD2    . LEU C 2 75 ? 3.446   2.264   -21.142 1.00 48.78  ? 222 LEU A CD2    1 
ATOM   1921 H  H      . LEU C 2 75 ? 1.186   -1.401  -19.625 1.00 66.43  ? 222 LEU A H      1 
ATOM   1922 H  HA     . LEU C 2 75 ? 2.989   -1.778  -21.627 1.00 59.25  ? 222 LEU A HA     1 
ATOM   1923 H  HB2    . LEU C 2 75 ? 2.750   0.245   -19.738 1.00 60.27  ? 222 LEU A HB2    1 
ATOM   1924 H  HB3    . LEU C 2 75 ? 4.218   -0.151  -20.174 1.00 60.27  ? 222 LEU A HB3    1 
ATOM   1925 H  HG     . LEU C 2 75 ? 3.890   0.612   -22.268 1.00 67.27  ? 222 LEU A HG     1 
ATOM   1926 H  HD11   . LEU C 2 75 ? 1.816   1.312   -23.045 1.00 73.11  ? 222 LEU A HD11   1 
ATOM   1927 H  HD12   . LEU C 2 75 ? 1.762   -0.218  -22.621 1.00 73.11  ? 222 LEU A HD12   1 
ATOM   1928 H  HD13   . LEU C 2 75 ? 1.159   0.895   -21.660 1.00 73.11  ? 222 LEU A HD13   1 
ATOM   1929 H  HD21   . LEU C 2 75 ? 3.387   2.866   -21.900 1.00 59.41  ? 222 LEU A HD21   1 
ATOM   1930 H  HD22   . LEU C 2 75 ? 2.774   2.494   -20.482 1.00 59.41  ? 222 LEU A HD22   1 
ATOM   1931 H  HD23   . LEU C 2 75 ? 4.330   2.316   -20.746 1.00 59.41  ? 222 LEU A HD23   1 
ATOM   1932 N  N      . LEU C 2 76 ? 3.294   -2.666  -18.601 1.00 48.18  ? 223 LEU A N      1 
ATOM   1933 C  CA     . LEU C 2 76 ? 4.204   -3.294  -17.652 1.00 60.24  ? 223 LEU A CA     1 
ATOM   1934 C  C      . LEU C 2 76 ? 4.562   -4.726  -18.016 1.00 57.91  ? 223 LEU A C      1 
ATOM   1935 O  O      . LEU C 2 76 ? 5.756   -5.061  -17.971 1.00 60.60  ? 223 LEU A O      1 
ATOM   1936 C  CB     . LEU C 2 76 ? 3.596   -3.203  -16.254 1.00 43.64  ? 223 LEU A CB     1 
ATOM   1937 C  CG     . LEU C 2 76 ? 4.451   -3.735  -15.138 1.00 52.86  ? 223 LEU A CG     1 
ATOM   1938 C  CD1    . LEU C 2 76 ? 5.750   -3.012  -15.112 1.00 55.39  ? 223 LEU A CD1    1 
ATOM   1939 C  CD2    . LEU C 2 76 ? 3.715   -3.515  -13.830 1.00 45.63  ? 223 LEU A CD2    1 
ATOM   1940 H  H      . LEU C 2 76 ? 2.530   -2.441  -18.278 1.00 58.68  ? 223 LEU A H      1 
ATOM   1941 H  HA     . LEU C 2 76 ? 5.030   -2.786  -17.641 1.00 73.16  ? 223 LEU A HA     1 
ATOM   1942 H  HB2    . LEU C 2 76 ? 3.412   -2.270  -16.060 1.00 53.24  ? 223 LEU A HB2    1 
ATOM   1943 H  HB3    . LEU C 2 76 ? 2.765   -3.704  -16.248 1.00 53.24  ? 223 LEU A HB3    1 
ATOM   1944 H  HG     . LEU C 2 76 ? 4.613   -4.684  -15.260 1.00 64.31  ? 223 LEU A HG     1 
ATOM   1945 H  HD11   . LEU C 2 76 ? 6.292   -3.364  -14.388 1.00 67.34  ? 223 LEU A HD11   1 
ATOM   1946 H  HD12   . LEU C 2 76 ? 6.202   -3.145  -15.959 1.00 67.34  ? 223 LEU A HD12   1 
ATOM   1947 H  HD13   . LEU C 2 76 ? 5.582   -2.067  -14.970 1.00 67.34  ? 223 LEU A HD13   1 
ATOM   1948 H  HD21   . LEU C 2 76 ? 4.258   -3.855  -13.102 1.00 55.62  ? 223 LEU A HD21   1 
ATOM   1949 H  HD22   . LEU C 2 76 ? 3.560   -2.565  -13.712 1.00 55.62  ? 223 LEU A HD22   1 
ATOM   1950 H  HD23   . LEU C 2 76 ? 2.869   -3.988  -13.861 1.00 55.62  ? 223 LEU A HD23   1 
ATOM   1951 N  N      . PRO C 2 77 ? 3.617   -5.631  -18.315 1.00 51.94  ? 224 PRO A N      1 
ATOM   1952 C  CA     . PRO C 2 77 ? 4.024   -7.014  -18.605 1.00 55.01  ? 224 PRO A CA     1 
ATOM   1953 C  C      . PRO C 2 77 ? 5.047   -7.073  -19.738 1.00 63.56  ? 224 PRO A C      1 
ATOM   1954 O  O      . PRO C 2 77 ? 6.153   -7.594  -19.543 1.00 61.91  ? 224 PRO A O      1 
ATOM   1955 C  CB     . PRO C 2 77 ? 2.704   -7.706  -18.954 1.00 54.82  ? 224 PRO A CB     1 
ATOM   1956 C  CG     . PRO C 2 77 ? 1.663   -6.881  -18.257 1.00 44.80  ? 224 PRO A CG     1 
ATOM   1957 C  CD     . PRO C 2 77 ? 2.151   -5.472  -18.364 1.00 45.00  ? 224 PRO A CD     1 
ATOM   1958 H  HA     . PRO C 2 77 ? 4.401   -7.426  -17.812 1.00 66.89  ? 224 PRO A HA     1 
ATOM   1959 H  HB2    . PRO C 2 77 ? 2.570   -7.694  -19.914 1.00 66.66  ? 224 PRO A HB2    1 
ATOM   1960 H  HB3    . PRO C 2 77 ? 2.709   -8.615  -18.616 1.00 66.66  ? 224 PRO A HB3    1 
ATOM   1961 H  HG2    . PRO C 2 77 ? 0.809   -6.984  -18.706 1.00 54.64  ? 224 PRO A HG2    1 
ATOM   1962 H  HG3    . PRO C 2 77 ? 1.598   -7.152  -17.328 1.00 54.64  ? 224 PRO A HG3    1 
ATOM   1963 H  HD2    . PRO C 2 77 ? 1.880   -5.081  -19.210 1.00 54.88  ? 224 PRO A HD2    1 
ATOM   1964 H  HD3    . PRO C 2 77 ? 1.840   -4.946  -17.611 1.00 54.88  ? 224 PRO A HD3    1 
ATOM   1965 N  N      . ASP C 2 78 ? 4.722   -6.513  -20.911 1.00 59.01  ? 225 ASP A N      1 
ATOM   1966 C  CA     . ASP C 2 78 ? 5.703   -6.484  -21.997 1.00 62.82  ? 225 ASP A CA     1 
ATOM   1967 C  C      . ASP C 2 78 ? 7.076   -6.043  -21.499 1.00 69.32  ? 225 ASP A C      1 
ATOM   1968 O  O      . ASP C 2 78 ? 8.095   -6.477  -22.049 1.00 79.22  ? 225 ASP A O      1 
ATOM   1969 C  CB     . ASP C 2 78 ? 5.232   -5.568  -23.131 1.00 61.44  ? 225 ASP A CB     1 
ATOM   1970 C  CG     . ASP C 2 78 ? 4.069   -6.175  -23.939 1.00 49.59  ? 225 ASP A CG     1 
ATOM   1971 H  H      . ASP C 2 78 ? 3.963   -6.154  -21.097 1.00 71.69  ? 225 ASP A H      1 
ATOM   1972 H  HA     . ASP C 2 78 ? 5.793   -7.380  -22.358 1.00 76.26  ? 225 ASP A HA     1 
ATOM   1973 H  HB2    . ASP C 2 78 ? 4.929   -4.727  -22.754 1.00 74.60  ? 225 ASP A HB2    1 
ATOM   1974 H  HB3    . ASP C 2 78 ? 5.971   -5.412  -23.740 1.00 74.60  ? 225 ASP A HB3    1 
ATOM   1975 N  N      . MET C 2 79 ? 7.125   -5.170  -20.481 1.00 63.64  ? 226 MET A N      1 
ATOM   1976 C  CA     . MET C 2 79 ? 8.400   -4.763  -19.887 1.00 56.77  ? 226 MET A CA     1 
ATOM   1977 C  C      . MET C 2 79 ? 9.024   -5.893  -19.075 1.00 62.94  ? 226 MET A C      1 
ATOM   1978 O  O      . MET C 2 79 ? 10.223  -6.166  -19.193 1.00 62.64  ? 226 MET A O      1 
ATOM   1979 C  CB     . MET C 2 79 ? 8.203   -3.563  -18.963 1.00 60.97  ? 226 MET A CB     1 
ATOM   1980 C  CG     . MET C 2 79 ? 8.119   -2.199  -19.576 1.00 57.24  ? 226 MET A CG     1 
ATOM   1981 S  SD     . MET C 2 79 ? 7.779   -1.017  -18.223 1.00 52.84  ? 226 MET A SD     1 
ATOM   1982 C  CE     . MET C 2 79 ? 7.809   0.528   -19.156 1.00 37.94  ? 226 MET A CE     1 
ATOM   1983 H  H      . MET C 2 79 ? 6.435   -4.803  -20.121 1.00 77.24  ? 226 MET A H      1 
ATOM   1984 H  HA     . MET C 2 79 ? 9.012   -4.503  -20.593 1.00 69.00  ? 226 MET A HA     1 
ATOM   1985 H  HB2    . MET C 2 79 ? 7.380   -3.701  -18.469 1.00 74.04  ? 226 MET A HB2    1 
ATOM   1986 H  HB3    . MET C 2 79 ? 8.946   -3.545  -18.338 1.00 74.04  ? 226 MET A HB3    1 
ATOM   1987 H  HG2    . MET C 2 79 ? 8.963   -1.968  -19.994 1.00 69.56  ? 226 MET A HG2    1 
ATOM   1988 H  HG3    . MET C 2 79 ? 7.391   -2.166  -20.216 1.00 69.56  ? 226 MET A HG3    1 
ATOM   1989 H  HE1    . MET C 2 79 ? 7.639   1.266   -18.550 1.00 46.41  ? 226 MET A HE1    1 
ATOM   1990 H  HE2    . MET C 2 79 ? 8.682   0.632   -19.567 1.00 46.41  ? 226 MET A HE2    1 
ATOM   1991 H  HE3    . MET C 2 79 ? 7.123   0.497   -19.841 1.00 46.41  ? 226 MET A HE3    1 
ATOM   1992 N  N      . LEU C 2 80 ? 8.234   -6.515  -18.186 1.00 67.46  ? 227 LEU A N      1 
ATOM   1993 C  CA     . LEU C 2 80 ? 8.730   -7.601  -17.340 1.00 64.32  ? 227 LEU A CA     1 
ATOM   1994 C  C      . LEU C 2 80 ? 8.937   -8.910  -18.087 1.00 73.04  ? 227 LEU A C      1 
ATOM   1995 O  O      . LEU C 2 80 ? 9.696   -9.761  -17.605 1.00 76.10  ? 227 LEU A O      1 
ATOM   1996 C  CB     . LEU C 2 80 ? 7.742   -7.890  -16.205 1.00 60.73  ? 227 LEU A CB     1 
ATOM   1997 C  CG     . LEU C 2 80 ? 7.423   -6.765  -15.233 1.00 62.97  ? 227 LEU A CG     1 
ATOM   1998 C  CD1    . LEU C 2 80 ? 6.548   -7.253  -14.104 1.00 59.99  ? 227 LEU A CD1    1 
ATOM   1999 C  CD2    . LEU C 2 80 ? 8.692   -6.165  -14.676 1.00 58.78  ? 227 LEU A CD2    1 
ATOM   2000 H  H      . LEU C 2 80 ? 7.406   -6.323  -18.057 1.00 81.82  ? 227 LEU A H      1 
ATOM   2001 H  HA     . LEU C 2 80 ? 9.577   -7.338  -16.947 1.00 78.06  ? 227 LEU A HA     1 
ATOM   2002 H  HB2    . LEU C 2 80 ? 6.902   -8.166  -16.603 1.00 73.75  ? 227 LEU A HB2    1 
ATOM   2003 H  HB3    . LEU C 2 80 ? 8.099   -8.624  -15.680 1.00 73.75  ? 227 LEU A HB3    1 
ATOM   2004 H  HG     . LEU C 2 80 ? 6.943   -6.066  -15.705 1.00 76.44  ? 227 LEU A HG     1 
ATOM   2005 H  HD11   . LEU C 2 80 ? 6.364   -6.513  -13.504 1.00 72.87  ? 227 LEU A HD11   1 
ATOM   2006 H  HD12   . LEU C 2 80 ? 5.719   -7.595  -14.473 1.00 72.87  ? 227 LEU A HD12   1 
ATOM   2007 H  HD13   . LEU C 2 80 ? 7.014   -7.958  -13.627 1.00 72.87  ? 227 LEU A HD13   1 
ATOM   2008 H  HD21   . LEU C 2 80 ? 8.460   -5.451  -14.061 1.00 71.41  ? 227 LEU A HD21   1 
ATOM   2009 H  HD22   . LEU C 2 80 ? 9.189   -6.855  -14.210 1.00 71.41  ? 227 LEU A HD22   1 
ATOM   2010 H  HD23   . LEU C 2 80 ? 9.222   -5.812  -15.408 1.00 71.41  ? 227 LEU A HD23   1 
ATOM   2011 N  N      . ARG C 2 81 ? 8.316   -9.083  -19.258 1.00 67.24  ? 228 ARG A N      1 
ATOM   2012 C  CA     . ARG C 2 81 ? 8.600   -10.258 -20.060 1.00 63.43  ? 228 ARG A CA     1 
ATOM   2013 C  C      . ARG C 2 81 ? 9.985   -10.137 -20.652 1.00 70.60  ? 228 ARG A C      1 
ATOM   2014 O  O      . ARG C 2 81 ? 10.822  -11.042 -20.505 1.00 64.31  ? 228 ARG A O      1 
ATOM   2015 C  CB     . ARG C 2 81 ? 7.543   -10.419 -21.153 0.48 66.11  ? 228 ARG A CB     1 
ATOM   2016 C  CG     . ARG C 2 81 ? 6.385   -11.298 -20.719 0.50 62.59  ? 228 ARG A CG     1 
ATOM   2017 C  CD     . ARG C 2 81 ? 5.477   -11.629 -21.876 1.00 64.98  ? 228 ARG A CD     1 
ATOM   2018 N  NE     . ARG C 2 81 ? 4.849   -10.433 -22.423 0.41 59.81  ? 228 ARG A NE     1 
ATOM   2019 C  CZ     . ARG C 2 81 ? 3.714   -9.902  -21.973 1.00 60.89  ? 228 ARG A CZ     1 
ATOM   2020 N  NH1    . ARG C 2 81 ? 3.054   -10.458 -20.954 1.00 62.23  ? 228 ARG A NH1    1 
ATOM   2021 N  NH2    . ARG C 2 81 ? 3.228   -8.813  -22.560 1.00 66.81  ? 228 ARG A NH2    1 
ATOM   2022 H  H      . ARG C 2 81 ? 7.740   -8.543  -19.598 1.00 81.57  ? 228 ARG A H      1 
ATOM   2023 H  HA     . ARG C 2 81 ? 8.578   -11.046 -19.495 1.00 76.99  ? 228 ARG A HA     1 
ATOM   2024 H  HB2    . ARG C 2 81 ? 7.188   -9.545  -21.381 0.00 80.20  ? 228 ARG A HB2    1 
ATOM   2025 H  HB3    . ARG C 2 81 ? 7.953   -10.825 -21.933 1.00 80.20  ? 228 ARG A HB3    1 
ATOM   2026 H  HG2    . ARG C 2 81 ? 6.732   -12.129 -20.357 1.00 75.98  ? 228 ARG A HG2    1 
ATOM   2027 H  HG3    . ARG C 2 81 ? 5.863   -10.832 -20.047 1.00 75.98  ? 228 ARG A HG3    1 
ATOM   2028 H  HD2    . ARG C 2 81 ? 5.996   -12.049 -22.580 0.98 78.84  ? 228 ARG A HD2    1 
ATOM   2029 H  HD3    . ARG C 2 81 ? 4.777   -12.228 -21.572 1.00 78.84  ? 228 ARG A HD3    1 
ATOM   2030 H  HE     . ARG C 2 81 ? 5.238   -10.042 -23.083 1.00 72.65  ? 228 ARG A HE     1 
ATOM   2031 H  HH11   . ARG C 2 81 ? 3.364   -11.166 -20.576 1.00 75.55  ? 228 ARG A HH11   1 
ATOM   2032 H  HH12   . ARG C 2 81 ? 2.321   -10.106 -20.673 1.00 75.55  ? 228 ARG A HH12   1 
ATOM   2033 H  HH21   . ARG C 2 81 ? 3.652   -8.453  -23.217 1.00 81.05  ? 228 ARG A HH21   1 
ATOM   2034 H  HH22   . ARG C 2 81 ? 2.497   -8.461  -22.276 1.00 81.05  ? 228 ARG A HH22   1 
ATOM   2035 N  N      . LYS C 2 82 ? 10.263  -8.980  -21.260 1.00 72.49  ? 229 LYS A N      1 
ATOM   2036 C  CA     . LYS C 2 82 ? 11.571  -8.684  -21.823 1.00 71.75  ? 229 LYS A CA     1 
ATOM   2037 C  C      . LYS C 2 82 ? 12.651  -8.919  -20.766 1.00 75.29  ? 229 LYS A C      1 
ATOM   2038 O  O      . LYS C 2 82 ? 13.839  -9.000  -21.097 1.00 81.38  ? 229 LYS A O      1 
ATOM   2039 C  CB     . LYS C 2 82 ? 11.596  -7.241  -22.350 1.00 65.93  ? 229 LYS A CB     1 
ATOM   2040 C  CG     . LYS C 2 82 ? 10.473  -6.923  -23.351 1.00 53.93  ? 229 LYS A CG     1 
ATOM   2041 H  H      . LYS C 2 82 ? 9.695   -8.342  -21.357 1.00 87.86  ? 229 LYS A H      1 
ATOM   2042 H  HA     . LYS C 2 82 ? 11.741  -9.282  -22.568 1.00 86.97  ? 229 LYS A HA     1 
ATOM   2043 H  HB2    . LYS C 2 82 ? 11.504  -6.633  -21.600 1.00 79.99  ? 229 LYS A HB2    1 
ATOM   2044 H  HB3    . LYS C 2 82 ? 12.443  -7.086  -22.797 1.00 79.99  ? 229 LYS A HB3    1 
ATOM   2045 N  N      . ASP C 2 83 ? 12.232  -9.053  -19.497 0.63 73.07  ? 230 ASP A N      1 
ATOM   2046 C  CA     . ASP C 2 83 ? 13.102  -9.206  -18.338 0.60 72.98  ? 230 ASP A CA     1 
ATOM   2047 C  C      . ASP C 2 83 ? 13.249  -10.634 -17.825 1.00 76.55  ? 230 ASP A C      1 
ATOM   2048 O  O      . ASP C 2 83 ? 14.145  -10.887 -17.010 0.55 71.28  ? 230 ASP A O      1 
ATOM   2049 C  CB     . ASP C 2 83 ? 12.552  -8.372  -17.177 1.00 73.91  ? 230 ASP A CB     1 
ATOM   2050 C  CG     . ASP C 2 83 ? 13.493  -7.273  -16.749 1.00 76.67  ? 230 ASP A CG     1 
ATOM   2051 O  OD1    . ASP C 2 83 ? 14.732  -7.445  -16.896 1.00 74.12  ? 230 ASP A OD1    1 
ATOM   2052 O  OD2    . ASP C 2 83 ? 12.984  -6.239  -16.249 1.00 74.63  ? 230 ASP A OD2    1 
ATOM   2053 H  H      . ASP C 2 83 ? 11.399  -9.057  -19.283 0.05 88.56  ? 230 ASP A H      1 
ATOM   2054 H  HA     . ASP C 2 83 ? 13.986  -8.872  -18.558 0.68 88.45  ? 230 ASP A HA     1 
ATOM   2055 H  HB2    . ASP C 2 83 ? 11.717  -7.961  -17.451 1.00 89.57  ? 230 ASP A HB2    1 
ATOM   2056 H  HB3    . ASP C 2 83 ? 12.402  -8.952  -16.414 1.00 89.57  ? 230 ASP A HB3    1 
ATOM   2057 N  N      . GLY C 2 84 ? 12.366  -11.551 -18.217 1.00 83.43  ? 231 GLY A N      1 
ATOM   2058 C  CA     . GLY C 2 84 ? 12.397  -12.912 -17.706 1.00 80.88  ? 231 GLY A CA     1 
ATOM   2059 C  C      . GLY C 2 84 ? 11.294  -13.224 -16.708 1.00 89.14  ? 231 GLY A C      1 
ATOM   2060 O  O      . GLY C 2 84 ? 10.705  -14.312 -16.740 1.00 85.22  ? 231 GLY A O      1 
ATOM   2061 H  H      . GLY C 2 84 ? 11.735  -11.405 -18.782 1.00 100.99 ? 231 GLY A H      1 
ATOM   2062 H  HA2    . GLY C 2 84 ? 12.317  -13.532 -18.448 1.00 97.93  ? 231 GLY A HA2    1 
ATOM   2063 H  HA3    . GLY C 2 84 ? 13.250  -13.069 -17.271 1.00 97.93  ? 231 GLY A HA3    1 
ATOM   2064 N  N      . LYS C 2 85 ? 11.015  -12.289 -15.801 1.00 96.97  ? 232 LYS A N      1 
ATOM   2065 C  CA     . LYS C 2 85 ? 9.950   -12.488 -14.824 1.00 97.30  ? 232 LYS A CA     1 
ATOM   2066 C  C      . LYS C 2 85 ? 8.583   -12.444 -15.514 1.00 99.24  ? 232 LYS A C      1 
ATOM   2067 O  O      . LYS C 2 85 ? 8.387   -11.751 -16.519 1.00 88.24  ? 232 LYS A O      1 
ATOM   2068 C  CB     . LYS C 2 85 ? 10.039  -11.429 -13.714 1.00 84.66  ? 232 LYS A CB     1 
ATOM   2069 H  H      . LYS C 2 85 ? 11.424  -11.536 -15.732 1.00 117.23 ? 232 LYS A H      1 
ATOM   2070 H  HA     . LYS C 2 85 ? 10.054  -13.361 -14.415 1.00 117.63 ? 232 LYS A HA     1 
ATOM   2071 N  N      . ASP C 2 86 ? 7.637   -13.213 -14.980 1.00 88.35  ? 233 ASP A N      1 
ATOM   2072 C  CA     . ASP C 2 86 ? 6.322   -13.373 -15.602 1.00 86.69  ? 233 ASP A CA     1 
ATOM   2073 C  C      . ASP C 2 86 ? 5.236   -12.839 -14.676 1.00 86.56  ? 233 ASP A C      1 
ATOM   2074 O  O      . ASP C 2 86 ? 4.771   -13.562 -13.775 1.00 82.91  ? 233 ASP A O      1 
ATOM   2075 C  CB     . ASP C 2 86 ? 6.064   -14.842 -15.943 1.00 83.43  ? 233 ASP A CB     1 
ATOM   2076 H  H      . ASP C 2 86 ? 7.732   -13.657 -14.249 1.00 106.89 ? 233 ASP A H      1 
ATOM   2077 H  HA     . ASP C 2 86 ? 6.295   -12.863 -16.426 1.00 104.90 ? 233 ASP A HA     1 
ATOM   2078 N  N      . PRO C 2 87 ? 4.780   -11.586 -14.872 1.00 83.84  ? 234 PRO A N      1 
ATOM   2079 C  CA     . PRO C 2 87 ? 3.770   -10.723 -14.243 1.00 75.61  ? 234 PRO A CA     1 
ATOM   2080 C  C      . PRO C 2 87 ? 2.702   -11.473 -13.434 1.00 79.54  ? 234 PRO A C      1 
ATOM   2081 O  O      . PRO C 2 87 ? 2.540   -11.201 -12.226 1.00 86.64  ? 234 PRO A O      1 
ATOM   2082 C  CB     . PRO C 2 87 ? 3.145   -10.008 -15.445 1.00 68.95  ? 234 PRO A CB     1 
ATOM   2083 H  HA     . PRO C 2 87 ? 4.200   -10.068 -13.672 1.00 91.61  ? 234 PRO A HA     1 
ATOM   2084 N  N      . LYS D 2 17 ? -4.572  9.065   5.619   0.75 80.56  ? 164 LYS B N      1 
ATOM   2085 C  CA     . LYS D 2 17 ? -5.691  9.055   4.680   0.75 95.38  ? 164 LYS B CA     1 
ATOM   2086 C  C      . LYS D 2 17 ? -6.947  8.427   5.297   0.75 85.75  ? 164 LYS B C      1 
ATOM   2087 O  O      . LYS D 2 17 ? -6.868  7.718   6.308   0.75 82.33  ? 164 LYS B O      1 
ATOM   2088 C  CB     . LYS D 2 17 ? -5.313  8.308   3.398   0.75 74.00  ? 164 LYS B CB     1 
ATOM   2089 H  HA     . LYS D 2 17 ? -5.905  9.970   4.439   0.75 115.33 ? 164 LYS B HA     1 
ATOM   2090 N  N      . ARG D 2 18 ? -8.089  8.690   4.645   1.00 81.13  ? 165 ARG B N      1 
ATOM   2091 C  CA     . ARG D 2 18 ? -9.449  8.314   5.060   1.00 70.30  ? 165 ARG B CA     1 
ATOM   2092 C  C      . ARG D 2 18 ? -9.692  8.332   6.573   0.40 77.09  ? 165 ARG B C      1 
ATOM   2093 O  O      . ARG D 2 18 ? -10.394 7.455   7.108   1.00 70.46  ? 165 ARG B O      1 
ATOM   2094 C  CB     . ARG D 2 18 ? -9.830  6.937   4.479   1.00 66.59  ? 165 ARG B CB     1 
ATOM   2095 C  CG     . ARG D 2 18 ? -8.817  5.808   4.586   0.14 67.35  ? 165 ARG B CG     1 
ATOM   2096 C  CD     . ARG D 2 18 ? -8.760  5.043   3.266   0.71 68.38  ? 165 ARG B CD     1 
ATOM   2097 N  NE     . ARG D 2 18 ? -8.219  3.696   3.427   1.00 66.78  ? 165 ARG B NE     1 
ATOM   2098 C  CZ     . ARG D 2 18 ? -7.612  3.000   2.464   0.47 60.38  ? 165 ARG B CZ     1 
ATOM   2099 N  NH1    . ARG D 2 18 ? -7.169  1.766   2.733   1.00 55.01  ? 165 ARG B NH1    1 
ATOM   2100 N  NH2    . ARG D 2 18 ? -7.438  3.534   1.242   1.00 49.70  ? 165 ARG B NH2    1 
ATOM   2101 H  H      . ARG D 2 18 ? -8.095  9.119   3.900   1.00 98.23  ? 165 ARG B H      1 
ATOM   2102 H  HA     . ARG D 2 18 ? -10.061 8.959   4.674   1.00 85.23  ? 165 ARG B HA     1 
ATOM   2103 H  HB2    . ARG D 2 18 ? -10.635 6.637   4.930   1.00 80.78  ? 165 ARG B HB2    1 
ATOM   2104 H  HB3    . ARG D 2 18 ? -10.022 7.055   3.536   1.00 80.78  ? 165 ARG B HB3    1 
ATOM   2105 H  HG2    . ARG D 2 18 ? -7.938  6.175   4.770   1.00 81.69  ? 165 ARG B HG2    1 
ATOM   2106 H  HG3    . ARG D 2 18 ? -9.086  5.194   5.288   1.00 81.69  ? 165 ARG B HG3    1 
ATOM   2107 H  HD2    . ARG D 2 18 ? -9.656  4.966   2.904   1.00 82.93  ? 165 ARG B HD2    1 
ATOM   2108 H  HD3    . ARG D 2 18 ? -8.190  5.524   2.645   1.00 82.93  ? 165 ARG B HD3    1 
ATOM   2109 H  HE     . ARG D 2 18 ? -8.296  3.325   4.199   1.00 81.01  ? 165 ARG B HE     1 
ATOM   2110 H  HH11   . ARG D 2 18 ? -7.279  1.431   3.517   0.91 66.88  ? 165 ARG B HH11   1 
ATOM   2111 H  HH12   . ARG D 2 18 ? -6.770  1.310   2.123   0.81 66.88  ? 165 ARG B HH12   1 
ATOM   2112 H  HH21   . ARG D 2 18 ? -7.727  4.326   1.074   1.00 60.51  ? 165 ARG B HH21   1 
ATOM   2113 H  HH22   . ARG D 2 18 ? -7.044  3.081   0.627   1.00 60.51  ? 165 ARG B HH22   1 
ATOM   2114 N  N      . ARG D 2 19 ? -9.202  9.385   7.234   1.00 83.26  ? 166 ARG B N      1 
ATOM   2115 C  CA     . ARG D 2 19 ? -9.208  9.518   8.699   1.00 71.68  ? 166 ARG B CA     1 
ATOM   2116 C  C      . ARG D 2 19 ? -10.238 10.563  9.133   0.50 74.64  ? 166 ARG B C      1 
ATOM   2117 O  O      . ARG D 2 19 ? -9.910  11.617  9.686   1.00 78.68  ? 166 ARG B O      1 
ATOM   2118 C  CB     . ARG D 2 19 ? -7.786  9.898   9.183   1.00 79.30  ? 166 ARG B CB     1 
ATOM   2119 C  CG     . ARG D 2 19 ? -6.936  8.735   9.675   0.17 75.21  ? 166 ARG B CG     1 
ATOM   2120 C  CD     . ARG D 2 19 ? -5.745  9.184   10.513  1.00 73.66  ? 166 ARG B CD     1 
ATOM   2121 N  NE     . ARG D 2 19 ? -6.135  10.124  11.571  1.00 79.30  ? 166 ARG B NE     1 
ATOM   2122 C  CZ     . ARG D 2 19 ? -6.451  9.791   12.828  0.53 85.13  ? 166 ARG B CZ     1 
ATOM   2123 N  NH1    . ARG D 2 19 ? -6.797  10.742  13.698  1.00 90.53  ? 166 ARG B NH1    1 
ATOM   2124 N  NH2    . ARG D 2 19 ? -6.425  8.521   13.234  1.00 87.29  ? 166 ARG B NH2    1 
ATOM   2125 H  H      . ARG D 2 19 ? -8.848  10.063  6.841   1.00 100.79 ? 166 ARG B H      1 
ATOM   2126 H  HA     . ARG D 2 19 ? -9.449  8.668   9.098   1.00 86.89  ? 166 ARG B HA     1 
ATOM   2127 H  HB2    . ARG D 2 19 ? -7.312  10.316  8.447   1.00 96.03  ? 166 ARG B HB2    1 
ATOM   2128 H  HB3    . ARG D 2 19 ? -7.869  10.529  9.915   1.00 96.03  ? 166 ARG B HB3    1 
ATOM   2129 H  HG2    . ARG D 2 19 ? -7.485  8.152   10.223  1.00 91.13  ? 166 ARG B HG2    1 
ATOM   2130 H  HG3    . ARG D 2 19 ? -6.596  8.246   8.909   1.00 91.13  ? 166 ARG B HG3    1 
ATOM   2131 H  HD2    . ARG D 2 19 ? -5.340  8.409   10.932  1.00 89.27  ? 166 ARG B HD2    1 
ATOM   2132 H  HD3    . ARG D 2 19 ? -5.101  9.627   9.939   1.00 89.27  ? 166 ARG B HD3    1 
ATOM   2133 H  HE     . ARG D 2 19 ? -6.163  10.959  11.366  1.00 96.03  ? 166 ARG B HE     1 
ATOM   2134 H  HH11   . ARG D 2 19 ? -6.817  11.565  13.450  0.00 109.51 ? 166 ARG B HH11   1 
ATOM   2135 H  HH12   . ARG D 2 19 ? -6.998  10.532  14.508  0.00 109.51 ? 166 ARG B HH12   1 
ATOM   2136 H  HH21   . ARG D 2 19 ? -6.205  7.898   12.683  1.00 105.62 ? 166 ARG B HH21   1 
ATOM   2137 H  HH22   . ARG D 2 19 ? -6.630  8.325   14.046  0.52 105.62 ? 166 ARG B HH22   1 
ATOM   2138 N  N      . ARG D 2 20 ? -11.508 10.249  8.916   1.00 69.73  ? 167 ARG B N      1 
ATOM   2139 C  CA     . ARG D 2 20 ? -12.586 11.206  9.172   1.00 77.57  ? 167 ARG B CA     1 
ATOM   2140 C  C      . ARG D 2 20 ? -12.801 11.423  10.679  1.00 77.83  ? 167 ARG B C      1 
ATOM   2141 O  O      . ARG D 2 20 ? -12.071 10.907  11.532  1.00 83.84  ? 167 ARG B O      1 
ATOM   2142 C  CB     . ARG D 2 20 ? -13.888 10.718  8.545   1.00 67.02  ? 167 ARG B CB     1 
ATOM   2143 C  CG     . ARG D 2 20 ? -14.730 9.857   9.521   1.00 61.40  ? 167 ARG B CG     1 
ATOM   2144 C  CD     . ARG D 2 20 ? -15.564 8.890   8.750   1.00 56.46  ? 167 ARG B CD     1 
ATOM   2145 N  NE     . ARG D 2 20 ? -16.422 8.032   9.573   1.00 51.86  ? 167 ARG B NE     1 
ATOM   2146 C  CZ     . ARG D 2 20 ? -16.252 6.723   9.734   1.00 49.33  ? 167 ARG B CZ     1 
ATOM   2147 N  NH1    . ARG D 2 20 ? -15.225 6.088   9.160   1.00 50.43  ? 167 ARG B NH1    1 
ATOM   2148 N  NH2    . ARG D 2 20 ? -17.116 6.048   10.478  1.00 52.31  ? 167 ARG B NH2    1 
ATOM   2149 H  H      . ARG D 2 20 ? -11.777 9.488   8.620   0.50 84.54  ? 167 ARG B H      1 
ATOM   2150 H  HA     . ARG D 2 20 ? -12.357 12.059  8.772   0.50 93.96  ? 167 ARG B HA     1 
ATOM   2151 H  HB2    . ARG D 2 20 ? -14.422 11.485  8.285   0.50 81.29  ? 167 ARG B HB2    1 
ATOM   2152 H  HB3    . ARG D 2 20 ? -13.682 10.176  7.767   1.00 81.29  ? 167 ARG B HB3    1 
ATOM   2153 H  HG2    . ARG D 2 20 ? -14.139 9.357   10.106  1.00 74.55  ? 167 ARG B HG2    1 
ATOM   2154 H  HG3    . ARG D 2 20 ? -15.318 10.430  10.037  1.00 74.55  ? 167 ARG B HG3    1 
ATOM   2155 H  HD2    . ARG D 2 20 ? -16.138 9.388   8.147   1.00 68.63  ? 167 ARG B HD2    1 
ATOM   2156 H  HD3    . ARG D 2 20 ? -14.976 8.313   8.238   1.00 68.63  ? 167 ARG B HD3    1 
ATOM   2157 H  HE     . ARG D 2 20 ? -17.082 8.402   9.981   1.00 63.11  ? 167 ARG B HE     1 
ATOM   2158 H  HH11   . ARG D 2 20 ? -14.669 6.523   8.670   1.00 61.39  ? 167 ARG B HH11   1 
ATOM   2159 H  HH12   . ARG D 2 20 ? -15.124 5.242   9.277   1.00 61.39  ? 167 ARG B HH12   1 
ATOM   2160 H  HH21   . ARG D 2 20 ? -17.771 6.458   10.854  1.00 63.64  ? 167 ARG B HH21   1 
ATOM   2161 H  HH22   . ARG D 2 20 ? -17.008 5.204   10.603  1.00 63.64  ? 167 ARG B HH22   1 
ATOM   2162 N  N      . ARG D 2 21 ? -13.838 12.206  11.001  1.00 67.77  ? 168 ARG B N      1 
ATOM   2163 C  CA     . ARG D 2 21 ? -14.426 12.275  12.336  1.00 60.51  ? 168 ARG B CA     1 
ATOM   2164 C  C      . ARG D 2 21 ? -15.934 12.440  12.156  1.00 62.24  ? 168 ARG B C      1 
ATOM   2165 O  O      . ARG D 2 21 ? -16.403 13.469  11.646  1.00 50.58  ? 168 ARG B O      1 
ATOM   2166 C  CB     . ARG D 2 21 ? -13.842 13.425  13.164  1.00 58.81  ? 168 ARG B CB     1 
ATOM   2167 C  CG     . ARG D 2 21 ? -12.555 13.080  13.991  1.00 69.63  ? 168 ARG B CG     1 
ATOM   2168 C  CD     . ARG D 2 21 ? -12.879 12.496  15.405  1.00 64.38  ? 168 ARG B CD     1 
ATOM   2169 H  H      . ARG D 2 21 ? -14.229 12.725  10.437  1.00 82.20  ? 168 ARG B H      1 
ATOM   2170 H  HA     . ARG D 2 21 ? -14.261 11.443  12.806  1.00 73.49  ? 168 ARG B HA     1 
ATOM   2171 H  HB2    . ARG D 2 21 ? -13.615 14.151  12.562  1.00 71.44  ? 168 ARG B HB2    1 
ATOM   2172 H  HB3    . ARG D 2 21 ? -14.519 13.725  13.791  1.00 71.44  ? 168 ARG B HB3    1 
ATOM   2173 H  HG2    . ARG D 2 21 ? -12.036 12.420  13.506  1.00 84.43  ? 168 ARG B HG2    1 
ATOM   2174 H  HG3    . ARG D 2 21 ? -12.033 13.888  14.113  1.00 84.43  ? 168 ARG B HG3    1 
ATOM   2175 N  N      . GLY D 2 22 ? -16.691 11.423  12.543  1.00 58.66  ? 169 GLY B N      1 
ATOM   2176 C  CA     . GLY D 2 22 ? -18.138 11.476  12.513  1.00 52.67  ? 169 GLY B CA     1 
ATOM   2177 C  C      . GLY D 2 22 ? -18.742 10.605  11.420  1.00 52.97  ? 169 GLY B C      1 
ATOM   2178 O  O      . GLY D 2 22 ? -18.071 10.128  10.507  1.00 62.90  ? 169 GLY B O      1 
ATOM   2179 H  H      . GLY D 2 22 ? -16.380 10.675  12.832  1.00 71.27  ? 169 GLY B H      1 
ATOM   2180 H  HA2    . GLY D 2 22 ? -18.488 11.180  13.368  1.00 64.08  ? 169 GLY B HA2    1 
ATOM   2181 H  HA3    . GLY D 2 22 ? -18.423 12.392  12.367  1.00 64.08  ? 169 GLY B HA3    1 
ATOM   2182 N  N      . ASN D 2 23 ? -20.046 10.400  11.554  1.00 49.78  ? 170 ASN B N      1 
ATOM   2183 C  CA     . ASN D 2 23 ? -20.848 9.613   10.639  1.00 45.55  ? 170 ASN B CA     1 
ATOM   2184 C  C      . ASN D 2 23 ? -21.829 10.533  9.926   1.00 48.99  ? 170 ASN B C      1 
ATOM   2185 O  O      . ASN D 2 23 ? -22.037 11.679  10.330  1.00 39.19  ? 170 ASN B O      1 
ATOM   2186 C  CB     . ASN D 2 23 ? -21.589 8.503   11.380  1.00 58.37  ? 170 ASN B CB     1 
ATOM   2187 C  CG     . ASN D 2 23 ? -20.643 7.417   11.877  1.00 54.56  ? 170 ASN B CG     1 
ATOM   2188 O  OD1    . ASN D 2 23 ? -19.432 7.484   11.645  1.00 54.22  ? 170 ASN B OD1    1 
ATOM   2189 N  ND2    . ASN D 2 23 ? -21.188 6.419   12.571  1.00 56.92  ? 170 ASN B ND2    1 
ATOM   2190 H  H      . ASN D 2 23 ? -20.506 10.726  12.203  1.00 60.60  ? 170 ASN B H      1 
ATOM   2191 H  HA     . ASN D 2 23 ? -20.272 9.206   9.973   1.00 55.53  ? 170 ASN B HA     1 
ATOM   2192 H  HB2    . ASN D 2 23 ? -22.043 8.882   12.149  1.00 70.92  ? 170 ASN B HB2    1 
ATOM   2193 H  HB3    . ASN D 2 23 ? -22.231 8.093   10.780  1.00 70.92  ? 170 ASN B HB3    1 
ATOM   2194 H  HD21   . ASN D 2 23 ? -20.693 5.783   12.871  1.00 69.18  ? 170 ASN B HD21   1 
ATOM   2195 H  HD22   . ASN D 2 23 ? -22.036 6.410   12.719  1.00 69.18  ? 170 ASN B HD22   1 
ATOM   2196 N  N      . LEU D 2 24 ? -22.432 10.032  8.849   1.00 41.08  ? 171 LEU B N      1 
ATOM   2197 C  CA     . LEU D 2 24 ? -23.261 10.909  8.056   1.00 42.70  ? 171 LEU B CA     1 
ATOM   2198 C  C      . LEU D 2 24 ? -24.544 11.163  8.826   1.00 42.37  ? 171 LEU B C      1 
ATOM   2199 O  O      . LEU D 2 24 ? -24.972 10.312  9.612   1.00 46.53  ? 171 LEU B O      1 
ATOM   2200 C  CB     . LEU D 2 24 ? -23.568 10.303  6.681   1.00 45.86  ? 171 LEU B CB     1 
ATOM   2201 C  CG     . LEU D 2 24 ? -22.350 10.061  5.760   1.00 43.45  ? 171 LEU B CG     1 
ATOM   2202 C  CD1    . LEU D 2 24 ? -22.757 9.429   4.482   1.00 43.87  ? 171 LEU B CD1    1 
ATOM   2203 C  CD2    . LEU D 2 24 ? -21.616 11.312  5.435   1.00 43.50  ? 171 LEU B CD2    1 
ATOM   2204 H  H      . LEU D 2 24 ? -22.377 9.219   8.572   1.00 50.17  ? 171 LEU B H      1 
ATOM   2205 H  HA     . LEU D 2 24 ? -22.807 11.756  7.925   1.00 52.11  ? 171 LEU B HA     1 
ATOM   2206 H  HB2    . LEU D 2 24 ? -24.004 9.447   6.815   1.00 55.91  ? 171 LEU B HB2    1 
ATOM   2207 H  HB3    . LEU D 2 24 ? -24.171 10.901  6.212   1.00 55.91  ? 171 LEU B HB3    1 
ATOM   2208 H  HG     . LEU D 2 24 ? -21.733 9.461   6.207   1.00 53.02  ? 171 LEU B HG     1 
ATOM   2209 H  HD11   . LEU D 2 24 ? -21.969 9.293   3.933   1.00 53.51  ? 171 LEU B HD11   1 
ATOM   2210 H  HD12   . LEU D 2 24 ? -23.179 8.576   4.672   1.00 53.51  ? 171 LEU B HD12   1 
ATOM   2211 H  HD13   . LEU D 2 24 ? -23.382 10.014  4.025   1.00 53.51  ? 171 LEU B HD13   1 
ATOM   2212 H  HD21   . LEU D 2 24 ? -20.867 11.097  4.858   1.00 53.07  ? 171 LEU B HD21   1 
ATOM   2213 H  HD22   . LEU D 2 24 ? -22.219 11.922  4.982   1.00 53.07  ? 171 LEU B HD22   1 
ATOM   2214 H  HD23   . LEU D 2 24 ? -21.296 11.713  6.258   1.00 53.07  ? 171 LEU B HD23   1 
ATOM   2215 N  N      . PRO D 2 25 ? -25.153 12.330  8.651   1.00 44.14  ? 172 PRO B N      1 
ATOM   2216 C  CA     . PRO D 2 25 ? -26.402 12.638  9.374   1.00 38.88  ? 172 PRO B CA     1 
ATOM   2217 C  C      . PRO D 2 25 ? -27.450 11.553  9.195   1.00 41.98  ? 172 PRO B C      1 
ATOM   2218 O  O      . PRO D 2 25 ? -27.585 10.960  8.119   1.00 38.88  ? 172 PRO B O      1 
ATOM   2219 C  CB     . PRO D 2 25 ? -26.870 13.953  8.745   1.00 38.76  ? 172 PRO B CB     1 
ATOM   2220 C  CG     . PRO D 2 25 ? -25.629 14.562  8.113   1.00 38.01  ? 172 PRO B CG     1 
ATOM   2221 C  CD     . PRO D 2 25 ? -24.725 13.409  7.751   1.00 36.24  ? 172 PRO B CD     1 
ATOM   2222 H  HA     . PRO D 2 25 ? -26.228 12.772  10.319  1.00 47.53  ? 172 PRO B HA     1 
ATOM   2223 H  HB2    . PRO D 2 25 ? -27.543 13.771  8.071   1.00 47.38  ? 172 PRO B HB2    1 
ATOM   2224 H  HB3    . PRO D 2 25 ? -27.224 14.537  9.434   1.00 47.38  ? 172 PRO B HB3    1 
ATOM   2225 H  HG2    . PRO D 2 25 ? -25.881 15.058  7.318   1.00 46.49  ? 172 PRO B HG2    1 
ATOM   2226 H  HG3    . PRO D 2 25 ? -25.193 15.146  8.754   1.00 46.49  ? 172 PRO B HG3    1 
ATOM   2227 H  HD2    . PRO D 2 25 ? -24.863 13.151  6.826   1.00 44.36  ? 172 PRO B HD2    1 
ATOM   2228 H  HD3    . PRO D 2 25 ? -23.799 13.642  7.920   1.00 44.36  ? 172 PRO B HD3    1 
ATOM   2229 N  N      . LYS D 2 26 ? -28.210 11.309  10.268  1.00 45.25  ? 173 LYS B N      1 
ATOM   2230 C  CA     . LYS D 2 26 ? -29.187 10.227  10.265  1.00 42.21  ? 173 LYS B CA     1 
ATOM   2231 C  C      . LYS D 2 26 ? -30.253 10.463  9.214   1.00 38.89  ? 173 LYS B C      1 
ATOM   2232 O  O      . LYS D 2 26 ? -30.735 9.508   8.604   1.00 34.55  ? 173 LYS B O      1 
ATOM   2233 C  CB     . LYS D 2 26 ? -29.862 10.102  11.630  1.00 36.13  ? 173 LYS B CB     1 
ATOM   2234 C  CG     . LYS D 2 26 ? -29.053 9.314   12.706  1.00 40.76  ? 173 LYS B CG     1 
ATOM   2235 H  H      . LYS D 2 26 ? -28.176 11.755  11.002  1.00 55.17  ? 173 LYS B H      1 
ATOM   2236 H  HA     . LYS D 2 26 ? -28.740 9.389   10.066  1.00 51.53  ? 173 LYS B HA     1 
ATOM   2237 H  HB2    . LYS D 2 26 ? -30.018 10.993  11.978  1.00 44.23  ? 173 LYS B HB2    1 
ATOM   2238 H  HB3    . LYS D 2 26 ? -30.710 9.646   11.512  1.00 44.23  ? 173 LYS B HB3    1 
ATOM   2239 N  N      . GLU D 2 27 ? -30.649 11.727  9.010   1.00 38.36  ? 174 GLU B N      1 
ATOM   2240 C  CA     . GLU D 2 27 ? -31.631 12.056  7.984   1.00 38.47  ? 174 GLU B CA     1 
ATOM   2241 C  C      . GLU D 2 27 ? -31.054 11.878  6.587   1.00 43.81  ? 174 GLU B C      1 
ATOM   2242 O  O      . GLU D 2 27 ? -31.775 11.477  5.669   1.00 38.21  ? 174 GLU B O      1 
ATOM   2243 C  CB     . GLU D 2 27 ? -32.130 13.491  8.162   1.00 31.12  ? 174 GLU B CB     1 
ATOM   2244 H  H      . GLU D 2 27 ? -30.361 12.405  9.453   1.00 46.90  ? 174 GLU B H      1 
ATOM   2245 H  HA     . GLU D 2 27 ? -32.392 11.461  8.073   1.00 47.04  ? 174 GLU B HA     1 
ATOM   2246 N  N      . SER D 2 28 ? -29.768 12.197  6.390   1.00 39.98  ? 175 SER B N      1 
ATOM   2247 C  CA     . SER D 2 28 ? -29.163 11.956  5.084   1.00 40.24  ? 175 SER B CA     1 
ATOM   2248 C  C      . SER D 2 28 ? -29.188 10.480  4.748   1.00 43.75  ? 175 SER B C      1 
ATOM   2249 O  O      . SER D 2 28 ? -29.495 10.088  3.607   1.00 47.29  ? 175 SER B O      1 
ATOM   2250 C  CB     . SER D 2 28 ? -27.731 12.494  5.035   1.00 42.12  ? 175 SER B CB     1 
ATOM   2251 O  OG     . SER D 2 28 ? -27.674 13.892  5.281   1.00 38.13  ? 175 SER B OG     1 
ATOM   2252 H  H      . SER D 2 28 ? -29.244 12.542  6.978   1.00 48.85  ? 175 SER B H      1 
ATOM   2253 H  HA     . SER D 2 28 ? -29.679 12.424  4.409   1.00 49.16  ? 175 SER B HA     1 
ATOM   2254 H  HB2    . SER D 2 28 ? -27.203 12.038  5.709   1.00 51.41  ? 175 SER B HB2    1 
ATOM   2255 H  HB3    . SER D 2 28 ? -27.362 12.318  4.155   1.00 51.41  ? 175 SER B HB3    1 
ATOM   2256 H  HG     . SER D 2 28 ? -28.123 14.304  4.703   1.00 46.63  ? 175 SER B HG     1 
ATOM   2257 N  N      . VAL D 2 29 ? -28.876 9.643   5.733   1.00 37.58  ? 176 VAL B N      1 
ATOM   2258 C  CA     . VAL D 2 29 ? -28.808 8.205   5.490   1.00 45.53  ? 176 VAL B CA     1 
ATOM   2259 C  C      . VAL D 2 29 ? -30.205 7.614   5.358   1.00 43.39  ? 176 VAL B C      1 
ATOM   2260 O  O      . VAL D 2 29 ? -30.410 6.647   4.611   1.00 42.18  ? 176 VAL B O      1 
ATOM   2261 C  CB     . VAL D 2 29 ? -28.017 7.518   6.624   1.00 45.79  ? 176 VAL B CB     1 
ATOM   2262 C  CG1    . VAL D 2 29 ? -28.073 6.005   6.479   1.00 48.27  ? 176 VAL B CG1    1 
ATOM   2263 C  CG2    . VAL D 2 29 ? -26.557 8.004   6.647   1.00 47.25  ? 176 VAL B CG2    1 
ATOM   2264 H  H      . VAL D 2 29 ? -28.701 9.878   6.541   1.00 45.97  ? 176 VAL B H      1 
ATOM   2265 H  HA     . VAL D 2 29 ? -28.336 8.047   4.657   1.00 55.51  ? 176 VAL B HA     1 
ATOM   2266 H  HB     . VAL D 2 29 ? -28.421 7.751   7.475   1.00 55.82  ? 176 VAL B HB     1 
ATOM   2267 H  HG11   . VAL D 2 29 ? -27.570 5.600   7.203   1.00 58.80  ? 176 VAL B HG11   1 
ATOM   2268 H  HG12   . VAL D 2 29 ? -28.999 5.719   6.520   1.00 58.80  ? 176 VAL B HG12   1 
ATOM   2269 H  HG13   . VAL D 2 29 ? -27.686 5.755   5.626   1.00 58.80  ? 176 VAL B HG13   1 
ATOM   2270 H  HG21   . VAL D 2 29 ? -26.087 7.556   7.367   1.00 57.58  ? 176 VAL B HG21   1 
ATOM   2271 H  HG22   . VAL D 2 29 ? -26.141 7.791   5.797   1.00 57.58  ? 176 VAL B HG22   1 
ATOM   2272 H  HG23   . VAL D 2 29 ? -26.547 8.963   6.790   1.00 57.58  ? 176 VAL B HG23   1 
ATOM   2273 N  N      . GLN D 2 30 ? -31.198 8.182   6.051   1.00 39.29  ? 177 GLN B N      1 
ATOM   2274 C  CA     . GLN D 2 30 ? -32.554 7.655   5.906   1.00 47.82  ? 177 GLN B CA     1 
ATOM   2275 C  C      . GLN D 2 30 ? -33.034 7.837   4.470   1.00 45.37  ? 177 GLN B C      1 
ATOM   2276 O  O      . GLN D 2 30 ? -33.742 6.984   3.914   1.00 43.45  ? 177 GLN B O      1 
ATOM   2277 C  CB     . GLN D 2 30 ? -33.500 8.316   6.907   1.00 43.04  ? 177 GLN B CB     1 
ATOM   2278 C  CG     . GLN D 2 30 ? -34.887 7.629   6.977   1.00 47.79  ? 177 GLN B CG     1 
ATOM   2279 C  CD     . GLN D 2 30 ? -34.781 6.127   7.235   1.00 45.88  ? 177 GLN B CD     1 
ATOM   2280 H  H      . GLN D 2 30 ? -31.117 8.847   6.590   1.00 48.02  ? 177 GLN B H      1 
ATOM   2281 H  HA     . GLN D 2 30 ? -32.540 6.704   6.096   1.00 58.26  ? 177 GLN B HA     1 
ATOM   2282 H  HB2    . GLN D 2 30 ? -33.102 8.277   7.790   1.00 52.52  ? 177 GLN B HB2    1 
ATOM   2283 H  HB3    . GLN D 2 30 ? -33.638 9.241   6.647   1.00 52.52  ? 177 GLN B HB3    1 
ATOM   2284 H  HG2    . GLN D 2 30 ? -35.400 8.023   7.700   1.00 58.22  ? 177 GLN B HG2    1 
ATOM   2285 H  HG3    . GLN D 2 30 ? -35.348 7.757   6.133   1.00 58.22  ? 177 GLN B HG3    1 
ATOM   2286 N  N      . ILE D 2 31 ? -32.661 8.953   3.859   1.00 39.37  ? 178 ILE B N      1 
ATOM   2287 C  CA     . ILE D 2 31 ? -33.006 9.187   2.470   1.00 43.74  ? 178 ILE B CA     1 
ATOM   2288 C  C      . ILE D 2 31 ? -32.326 8.158   1.581   1.00 39.04  ? 178 ILE B C      1 
ATOM   2289 O  O      . ILE D 2 31 ? -32.963 7.536   0.733   1.00 40.32  ? 178 ILE B O      1 
ATOM   2290 C  CB     . ILE D 2 31 ? -32.615 10.618  2.086   1.00 44.67  ? 178 ILE B CB     1 
ATOM   2291 C  CG1    . ILE D 2 31 ? -33.519 11.596  2.842   1.00 33.89  ? 178 ILE B CG1    1 
ATOM   2292 C  CG2    . ILE D 2 31 ? -32.692 10.789  0.614   1.00 39.78  ? 178 ILE B CG2    1 
ATOM   2293 C  CD1    . ILE D 2 31 ? -33.010 13.041  2.811   1.00 35.81  ? 178 ILE B CD1    1 
ATOM   2294 H  H      . ILE D 2 31 ? -32.210 9.587   4.227   1.00 48.11  ? 178 ILE B H      1 
ATOM   2295 H  HA     . ILE D 2 31 ? -33.965 9.095   2.360   1.00 53.36  ? 178 ILE B HA     1 
ATOM   2296 H  HB     . ILE D 2 31 ? -31.699 10.770  2.365   1.00 54.48  ? 178 ILE B HB     1 
ATOM   2297 H  HG12   . ILE D 2 31 ? -34.402 11.582  2.441   1.00 41.55  ? 178 ILE B HG12   1 
ATOM   2298 H  HG13   . ILE D 2 31 ? -33.574 11.319  3.770   1.00 41.55  ? 178 ILE B HG13   1 
ATOM   2299 H  HG21   . ILE D 2 31 ? -32.442 11.699  0.388   1.00 48.60  ? 178 ILE B HG21   1 
ATOM   2300 H  HG22   . ILE D 2 31 ? -32.083 10.164  0.191   1.00 48.60  ? 178 ILE B HG22   1 
ATOM   2301 H  HG23   . ILE D 2 31 ? -33.601 10.613  0.323   1.00 48.60  ? 178 ILE B HG23   1 
ATOM   2302 H  HD11   . ILE D 2 31 ? -33.626 13.604  3.305   1.00 43.85  ? 178 ILE B HD11   1 
ATOM   2303 H  HD12   . ILE D 2 31 ? -32.130 13.075  3.219   1.00 43.85  ? 178 ILE B HD12   1 
ATOM   2304 H  HD13   . ILE D 2 31 ? -32.958 13.338  1.888   1.00 43.85  ? 178 ILE B HD13   1 
ATOM   2305 N  N      . LEU D 2 32 ? -31.017 7.977   1.748   1.00 37.11  ? 179 LEU B N      1 
ATOM   2306 C  CA     . LEU D 2 32 ? -30.280 7.016   0.920   1.00 40.22  ? 179 LEU B CA     1 
ATOM   2307 C  C      . LEU D 2 32 ? -30.849 5.613   1.079   1.00 38.73  ? 179 LEU B C      1 
ATOM   2308 O  O      . LEU D 2 32 ? -31.076 4.889   0.094   1.00 37.01  ? 179 LEU B O      1 
ATOM   2309 C  CB     . LEU D 2 32 ? -28.784 7.041   1.284   1.00 37.90  ? 179 LEU B CB     1 
ATOM   2310 C  CG     . LEU D 2 32 ? -28.096 8.417   1.124   1.00 41.64  ? 179 LEU B CG     1 
ATOM   2311 C  CD1    . LEU D 2 32 ? -26.633 8.475   1.602   1.00 43.16  ? 179 LEU B CD1    1 
ATOM   2312 C  CD2    . LEU D 2 32 ? -28.157 8.844   -0.331  1.00 46.22  ? 179 LEU B CD2    1 
ATOM   2313 H  H      . LEU D 2 32 ? -30.535 8.391   2.327   1.00 45.40  ? 179 LEU B H      1 
ATOM   2314 H  HA     . LEU D 2 32 ? -30.366 7.271   -0.012  1.00 49.14  ? 179 LEU B HA     1 
ATOM   2315 H  HB2    . LEU D 2 32 ? -28.688 6.772   2.211   1.00 46.35  ? 179 LEU B HB2    1 
ATOM   2316 H  HB3    . LEU D 2 32 ? -28.317 6.412   0.713   1.00 46.35  ? 179 LEU B HB3    1 
ATOM   2317 H  HG     . LEU D 2 32 ? -28.595 9.070   1.639   1.00 50.84  ? 179 LEU B HG     1 
ATOM   2318 H  HD11   . LEU D 2 32 ? -26.291 9.372   1.462   1.00 52.67  ? 179 LEU B HD11   1 
ATOM   2319 H  HD12   . LEU D 2 32 ? -26.600 8.252   2.545   1.00 52.67  ? 179 LEU B HD12   1 
ATOM   2320 H  HD13   . LEU D 2 32 ? -26.109 7.837   1.092   1.00 52.67  ? 179 LEU B HD13   1 
ATOM   2321 H  HD21   . LEU D 2 32 ? -27.724 9.707   -0.424  1.00 56.33  ? 179 LEU B HD21   1 
ATOM   2322 H  HD22   . LEU D 2 32 ? -27.699 8.183   -0.873  1.00 56.33  ? 179 LEU B HD22   1 
ATOM   2323 H  HD23   . LEU D 2 32 ? -29.086 8.909   -0.601  1.00 56.33  ? 179 LEU B HD23   1 
ATOM   2324 N  N      . ARG D 2 33 ? -31.122 5.235   2.313   1.00 37.41  ? 180 ARG B N      1 
ATOM   2325 C  CA     . ARG D 2 33 ? -31.670 3.922   2.607   1.00 44.65  ? 180 ARG B CA     1 
ATOM   2326 C  C      . ARG D 2 33 ? -33.066 3.766   1.985   1.00 43.31  ? 180 ARG B C      1 
ATOM   2327 O  O      . ARG D 2 33 ? -33.402 2.707   1.428   1.00 38.66  ? 180 ARG B O      1 
ATOM   2328 C  CB     . ARG D 2 33 ? -31.685 3.730   4.137   1.00 46.96  ? 180 ARG B CB     1 
ATOM   2329 C  CG     . ARG D 2 33 ? -31.813 2.280   4.605   1.00 55.09  ? 180 ARG B CG     1 
ATOM   2330 C  CD     . ARG D 2 33 ? -30.715 1.884   5.612   1.00 60.32  ? 180 ARG B CD     1 
ATOM   2331 N  NE     . ARG D 2 33 ? -30.560 2.807   6.742   1.00 59.21  ? 180 ARG B NE     1 
ATOM   2332 C  CZ     . ARG D 2 33 ? -29.449 2.901   7.498   1.00 64.48  ? 180 ARG B CZ     1 
ATOM   2333 N  NH1    . ARG D 2 33 ? -28.370 2.134   7.251   0.80 54.91  ? 180 ARG B NH1    1 
ATOM   2334 N  NH2    . ARG D 2 33 ? -29.404 3.773   8.506   0.35 48.40  ? 180 ARG B NH2    1 
ATOM   2335 H  H      . ARG D 2 33 ? -30.998 5.725   3.009   1.00 45.77  ? 180 ARG B H      1 
ATOM   2336 H  HA     . ARG D 2 33 ? -31.093 3.243   2.223   1.00 54.46  ? 180 ARG B HA     1 
ATOM   2337 H  HB2    . ARG D 2 33 ? -30.857 4.083   4.500   1.00 57.22  ? 180 ARG B HB2    1 
ATOM   2338 H  HB3    . ARG D 2 33 ? -32.436 4.223   4.502   1.00 57.22  ? 180 ARG B HB3    1 
ATOM   2339 H  HG2    . ARG D 2 33 ? -32.674 2.161   5.037   1.00 66.98  ? 180 ARG B HG2    1 
ATOM   2340 H  HG3    . ARG D 2 33 ? -31.743 1.691   3.837   1.00 66.98  ? 180 ARG B HG3    1 
ATOM   2341 H  HD2    . ARG D 2 33 ? -30.928 1.009   5.974   1.00 73.26  ? 180 ARG B HD2    1 
ATOM   2342 H  HD3    . ARG D 2 33 ? -29.866 1.846   5.144   1.00 73.26  ? 180 ARG B HD3    1 
ATOM   2343 H  HE     . ARG D 2 33 ? -31.221 3.321   6.935   1.00 71.92  ? 180 ARG B HE     1 
ATOM   2344 H  HH11   . ARG D 2 33 ? -28.385 1.568   6.603   1.00 66.77  ? 180 ARG B HH11   1 
ATOM   2345 H  HH12   . ARG D 2 33 ? -27.669 2.208   7.742   1.00 66.77  ? 180 ARG B HH12   1 
ATOM   2346 H  HH21   . ARG D 2 33 ? -30.085 4.271   8.675   1.00 58.95  ? 180 ARG B HH21   1 
ATOM   2347 H  HH22   . ARG D 2 33 ? -28.695 3.836   8.989   1.00 58.95  ? 180 ARG B HH22   1 
ATOM   2348 N  N      . ASP D 2 34 ? -33.908 4.804   2.076   1.00 39.54  ? 181 ASP B N      1 
ATOM   2349 C  CA     . ASP D 2 34 ? -35.227 4.697   1.455   1.00 38.44  ? 181 ASP B CA     1 
ATOM   2350 C  C      . ASP D 2 34 ? -35.086 4.484   -0.037  1.00 42.54  ? 181 ASP B C      1 
ATOM   2351 O  O      . ASP D 2 34 ? -35.734 3.609   -0.615  1.00 38.53  ? 181 ASP B O      1 
ATOM   2352 C  CB     . ASP D 2 34 ? -36.064 5.949   1.740   1.00 41.86  ? 181 ASP B CB     1 
ATOM   2353 C  CG     . ASP D 2 34 ? -36.413 6.101   3.216   1.00 47.14  ? 181 ASP B CG     1 
ATOM   2354 O  OD1    . ASP D 2 34 ? -36.348 5.093   3.947   1.00 47.97  ? 181 ASP B OD1    1 
ATOM   2355 O  OD2    . ASP D 2 34 ? -36.786 7.220   3.634   1.00 49.42  ? 181 ASP B OD2    1 
ATOM   2356 H  H      . ASP D 2 34 ? -33.747 5.548   2.476   1.00 48.32  ? 181 ASP B H      1 
ATOM   2357 H  HA     . ASP D 2 34 ? -35.692 3.931   1.827   1.00 47.00  ? 181 ASP B HA     1 
ATOM   2358 H  HB2    . ASP D 2 34 ? -35.563 6.733   1.468   1.00 51.10  ? 181 ASP B HB2    1 
ATOM   2359 H  HB3    . ASP D 2 34 ? -36.894 5.895   1.240   1.00 51.10  ? 181 ASP B HB3    1 
ATOM   2360 N  N      . TRP D 2 35 ? -34.205 5.259   -0.679  1.00 39.07  ? 182 TRP B N      1 
ATOM   2361 C  CA     . TRP D 2 35 ? -34.051 5.147   -2.118  1.00 38.67  ? 182 TRP B CA     1 
ATOM   2362 C  C      . TRP D 2 35 ? -33.524 3.775   -2.478  1.00 41.26  ? 182 TRP B C      1 
ATOM   2363 O  O      . TRP D 2 35 ? -33.957 3.171   -3.470  1.00 38.14  ? 182 TRP B O      1 
ATOM   2364 C  CB     . TRP D 2 35 ? -33.113 6.228   -2.632  1.00 37.90  ? 182 TRP B CB     1 
ATOM   2365 C  CG     . TRP D 2 35 ? -33.055 6.297   -4.150  1.00 44.25  ? 182 TRP B CG     1 
ATOM   2366 C  CD1    . TRP D 2 35 ? -33.656 7.223   -4.943  1.00 38.33  ? 182 TRP B CD1    1 
ATOM   2367 C  CD2    . TRP D 2 35 ? -32.368 5.390   -5.038  1.00 39.53  ? 182 TRP B CD2    1 
ATOM   2368 N  NE1    . TRP D 2 35 ? -33.388 6.955   -6.256  1.00 44.09  ? 182 TRP B NE1    1 
ATOM   2369 C  CE2    . TRP D 2 35 ? -32.598 5.843   -6.345  1.00 38.09  ? 182 TRP B CE2    1 
ATOM   2370 C  CE3    . TRP D 2 35 ? -31.574 4.250   -4.847  1.00 39.36  ? 182 TRP B CE3    1 
ATOM   2371 C  CZ2    . TRP D 2 35 ? -32.087 5.189   -7.474  1.00 42.83  ? 182 TRP B CZ2    1 
ATOM   2372 C  CZ3    . TRP D 2 35 ? -31.051 3.602   -5.963  1.00 43.90  ? 182 TRP B CZ3    1 
ATOM   2373 C  CH2    . TRP D 2 35 ? -31.317 4.077   -7.270  1.00 40.57  ? 182 TRP B CH2    1 
ATOM   2374 H  H      . TRP D 2 35 ? -33.698 5.844   -0.306  1.00 47.76  ? 182 TRP B H      1 
ATOM   2375 H  HA     . TRP D 2 35 ? -34.914 5.264   -2.545  1.00 47.28  ? 182 TRP B HA     1 
ATOM   2376 H  HB2    . TRP D 2 35 ? -33.416 7.089   -2.305  1.00 46.35  ? 182 TRP B HB2    1 
ATOM   2377 H  HB3    . TRP D 2 35 ? -32.217 6.047   -2.307  1.00 46.35  ? 182 TRP B HB3    1 
ATOM   2378 H  HD1    . TRP D 2 35 ? -34.176 7.932   -4.638  1.00 46.87  ? 182 TRP B HD1    1 
ATOM   2379 H  HE1    . TRP D 2 35 ? -33.674 7.416   -6.924  1.00 53.78  ? 182 TRP B HE1    1 
ATOM   2380 H  HE3    . TRP D 2 35 ? -31.405 3.928   -3.991  1.00 48.10  ? 182 TRP B HE3    1 
ATOM   2381 H  HZ2    . TRP D 2 35 ? -32.251 5.510   -8.331  1.00 52.27  ? 182 TRP B HZ2    1 
ATOM   2382 H  HZ3    . TRP D 2 35 ? -30.528 2.841   -5.849  1.00 53.55  ? 182 TRP B HZ3    1 
ATOM   2383 H  HH2    . TRP D 2 35 ? -30.953 3.632   -8.001  1.00 49.56  ? 182 TRP B HH2    1 
ATOM   2384 N  N      . LEU D 2 36 ? -32.574 3.275   -1.677  1.00 44.71  ? 183 LEU B N      1 
ATOM   2385 C  CA     . LEU D 2 36 ? -31.983 1.967   -1.941  1.00 44.52  ? 183 LEU B CA     1 
ATOM   2386 C  C      . LEU D 2 36 ? -33.037 0.886   -1.821  1.00 41.48  ? 183 LEU B C      1 
ATOM   2387 O  O      . LEU D 2 36 ? -33.098 -0.041  -2.641  1.00 40.07  ? 183 LEU B O      1 
ATOM   2388 C  CB     . LEU D 2 36 ? -30.854 1.686   -0.947  1.00 43.18  ? 183 LEU B CB     1 
ATOM   2389 C  CG     . LEU D 2 36 ? -30.196 0.308   -1.096  1.00 39.60  ? 183 LEU B CG     1 
ATOM   2390 C  CD1    . LEU D 2 36 ? -29.519 0.208   -2.444  1.00 43.49  ? 183 LEU B CD1    1 
ATOM   2391 C  CD2    . LEU D 2 36 ? -29.229 0.015   0.024   1.00 49.80  ? 183 LEU B CD2    1 
ATOM   2392 H  H      . LEU D 2 36 ? -32.261 3.672   -0.982  1.00 54.53  ? 183 LEU B H      1 
ATOM   2393 H  HA     . LEU D 2 36 ? -31.618 1.948   -2.839  1.00 54.30  ? 183 LEU B HA     1 
ATOM   2394 H  HB2    . LEU D 2 36 ? -30.163 2.356   -1.067  1.00 52.69  ? 183 LEU B HB2    1 
ATOM   2395 H  HB3    . LEU D 2 36 ? -31.212 1.745   -0.047  1.00 52.69  ? 183 LEU B HB3    1 
ATOM   2396 H  HG     . LEU D 2 36 ? -30.890 -0.370  -1.066  1.00 48.40  ? 183 LEU B HG     1 
ATOM   2397 H  HD11   . LEU D 2 36 ? -29.108 -0.667  -2.527  1.00 53.06  ? 183 LEU B HD11   1 
ATOM   2398 H  HD12   . LEU D 2 36 ? -30.184 0.328   -3.141  1.00 53.06  ? 183 LEU B HD12   1 
ATOM   2399 H  HD13   . LEU D 2 36 ? -28.843 0.900   -2.509  1.00 53.06  ? 183 LEU B HD13   1 
ATOM   2400 H  HD21   . LEU D 2 36 ? -28.842 -0.864  -0.115  1.00 60.63  ? 183 LEU B HD21   1 
ATOM   2401 H  HD22   . LEU D 2 36 ? -28.531 0.688   0.022   1.00 60.63  ? 183 LEU B HD22   1 
ATOM   2402 H  HD23   . LEU D 2 36 ? -29.707 0.036   0.868   1.00 60.63  ? 183 LEU B HD23   1 
ATOM   2403 N  N      . TYR D 2 37 ? -33.897 1.012   -0.815  1.00 41.21  ? 184 TYR B N      1 
ATOM   2404 C  CA     . TYR D 2 37 ? -34.964 0.040   -0.638  1.00 50.77  ? 184 TYR B CA     1 
ATOM   2405 C  C      . TYR D 2 37 ? -35.936 0.094   -1.811  1.00 45.33  ? 184 TYR B C      1 
ATOM   2406 O  O      . TYR D 2 37 ? -36.208 -0.924  -2.453  1.00 52.33  ? 184 TYR B O      1 
ATOM   2407 C  CB     . TYR D 2 37 ? -35.672 0.259   0.706   1.00 47.78  ? 184 TYR B CB     1 
ATOM   2408 C  CG     . TYR D 2 37 ? -36.681 -0.826  0.908   1.00 45.22  ? 184 TYR B CG     1 
ATOM   2409 C  CD1    . TYR D 2 37 ? -36.267 -2.134  1.045   1.00 52.67  ? 184 TYR B CD1    1 
ATOM   2410 C  CD2    . TYR D 2 37 ? -38.034 -0.566  0.877   1.00 56.88  ? 184 TYR B CD2    1 
ATOM   2411 C  CE1    . TYR D 2 37 ? -37.170 -3.156  1.167   1.00 60.97  ? 184 TYR B CE1    1 
ATOM   2412 C  CE2    . TYR D 2 37 ? -38.958 -1.592  1.004   1.00 58.56  ? 184 TYR B CE2    1 
ATOM   2413 C  CZ     . TYR D 2 37 ? -38.512 -2.886  1.151   1.00 59.89  ? 184 TYR B CZ     1 
ATOM   2414 O  OH     . TYR D 2 37 ? -39.390 -3.935  1.283   1.00 69.02  ? 184 TYR B OH     1 
ATOM   2415 H  H      . TYR D 2 37 ? -33.884 1.642   -0.229  1.00 50.33  ? 184 TYR B H      1 
ATOM   2416 H  HA     . TYR D 2 37 ? -34.573 -0.848  -0.623  1.00 61.80  ? 184 TYR B HA     1 
ATOM   2417 H  HB2    . TYR D 2 37 ? -35.026 0.221   1.428   1.00 58.21  ? 184 TYR B HB2    1 
ATOM   2418 H  HB3    . TYR D 2 37 ? -36.131 1.113   0.700   1.00 58.21  ? 184 TYR B HB3    1 
ATOM   2419 H  HD1    . TYR D 2 37 ? -35.358 -2.326  1.046   1.00 64.07  ? 184 TYR B HD1    1 
ATOM   2420 H  HD2    . TYR D 2 37 ? -38.331 0.309   0.768   1.00 69.12  ? 184 TYR B HD2    1 
ATOM   2421 H  HE1    . TYR D 2 37 ? -36.871 -4.031  1.270   1.00 74.04  ? 184 TYR B HE1    1 
ATOM   2422 H  HE2    . TYR D 2 37 ? -39.869 -1.408  0.994   1.00 71.15  ? 184 TYR B HE2    1 
ATOM   2423 H  HH     . TYR D 2 37 ? -40.181 -3.652  1.260   1.00 83.69  ? 184 TYR B HH     1 
ATOM   2424 N  N      . GLU D 2 38 ? -36.420 1.288   -2.150  1.00 41.96  ? 185 GLU B N      1 
ATOM   2425 C  CA     . GLU D 2 38 ? -37.345 1.404   -3.275  1.00 45.02  ? 185 GLU B CA     1 
ATOM   2426 C  C      . GLU D 2 38 ? -36.736 0.897   -4.578  1.00 46.12  ? 185 GLU B C      1 
ATOM   2427 O  O      . GLU D 2 38 ? -37.448 0.335   -5.417  1.00 44.95  ? 185 GLU B O      1 
ATOM   2428 C  CB     . GLU D 2 38 ? -37.796 2.856   -3.462  1.00 47.82  ? 185 GLU B CB     1 
ATOM   2429 C  CG     . GLU D 2 38 ? -39.125 2.961   -4.251  1.00 49.89  ? 185 GLU B CG     1 
ATOM   2430 C  CD     . GLU D 2 38 ? -39.623 4.380   -4.450  1.00 43.74  ? 185 GLU B CD     1 
ATOM   2431 O  OE1    . GLU D 2 38 ? -40.369 4.607   -5.407  1.00 49.00  ? 185 GLU B OE1    1 
ATOM   2432 O  OE2    . GLU D 2 38 ? -39.298 5.274   -3.644  1.00 55.67  ? 185 GLU B OE2    1 
ATOM   2433 H  H      . GLU D 2 38 ? -36.235 2.029   -1.755  1.00 51.22  ? 185 GLU B H      1 
ATOM   2434 H  HA     . GLU D 2 38 ? -38.133 0.870   -3.088  1.00 54.90  ? 185 GLU B HA     1 
ATOM   2435 H  HB2    . GLU D 2 38 ? -37.931 3.262   -2.591  1.00 58.26  ? 185 GLU B HB2    1 
ATOM   2436 H  HB3    . GLU D 2 38 ? -37.115 3.340   -3.953  1.00 58.26  ? 185 GLU B HB3    1 
ATOM   2437 H  HG2    . GLU D 2 38 ? -38.996 2.568   -5.129  1.00 60.74  ? 185 GLU B HG2    1 
ATOM   2438 H  HG3    . GLU D 2 38 ? -39.811 2.472   -3.771  1.00 60.74  ? 185 GLU B HG3    1 
ATOM   2439 N  N      . HIS D 2 39 ? -35.439 1.091   -4.788  1.00 45.57  ? 186 HIS B N      1 
ATOM   2440 C  CA     . HIS D 2 39 ? -34.819 0.668   -6.031  1.00 40.67  ? 186 HIS B CA     1 
ATOM   2441 C  C      . HIS D 2 39 ? -33.963 -0.577  -5.835  1.00 41.77  ? 186 HIS B C      1 
ATOM   2442 O  O      . HIS D 2 39 ? -33.040 -0.835  -6.618  1.00 43.19  ? 186 HIS B O      1 
ATOM   2443 C  CB     . HIS D 2 39 ? -33.997 1.797   -6.642  1.00 41.92  ? 186 HIS B CB     1 
ATOM   2444 C  CG     . HIS D 2 39 ? -34.800 3.014   -6.998  1.00 39.05  ? 186 HIS B CG     1 
ATOM   2445 N  ND1    . HIS D 2 39 ? -35.156 3.974   -6.079  1.00 44.11  ? 186 HIS B ND1    1 
ATOM   2446 C  CD2    . HIS D 2 39 ? -35.281 3.438   -8.186  1.00 43.94  ? 186 HIS B CD2    1 
ATOM   2447 C  CE1    . HIS D 2 39 ? -35.846 4.927   -6.684  1.00 42.42  ? 186 HIS B CE1    1 
ATOM   2448 N  NE2    . HIS D 2 39 ? -35.937 4.625   -7.961  1.00 43.06  ? 186 HIS B NE2    1 
ATOM   2449 H  H      . HIS D 2 39 ? -34.902 1.464   -4.229  1.00 55.56  ? 186 HIS B H      1 
ATOM   2450 H  HA     . HIS D 2 39 ? -35.520 0.442   -6.663  1.00 49.68  ? 186 HIS B HA     1 
ATOM   2451 H  HB2    . HIS D 2 39 ? -33.317 2.068   -6.006  1.00 51.18  ? 186 HIS B HB2    1 
ATOM   2452 H  HB3    . HIS D 2 39 ? -33.576 1.473   -7.454  1.00 51.18  ? 186 HIS B HB3    1 
ATOM   2453 H  HD1    . HIS D 2 39 ? -34.971 3.951   -5.239  1.00 53.80  ? 186 HIS B HD1    1 
ATOM   2454 H  HD2    . HIS D 2 39 ? -35.199 3.000   -9.002  1.00 53.60  ? 186 HIS B HD2    1 
ATOM   2455 H  HE1    . HIS D 2 39 ? -36.203 5.683   -6.277  1.00 51.78  ? 186 HIS B HE1    1 
ATOM   2456 N  N      . ARG D 2 40 ? -34.293 -1.378  -4.818  1.00 37.27  ? 187 ARG B N      1 
ATOM   2457 C  CA     . ARG D 2 40 ? -33.475 -2.528  -4.449  1.00 44.09  ? 187 ARG B CA     1 
ATOM   2458 C  C      . ARG D 2 40 ? -33.244 -3.529  -5.585  1.00 45.96  ? 187 ARG B C      1 
ATOM   2459 O  O      . ARG D 2 40 ? -32.319 -4.337  -5.484  1.00 53.90  ? 187 ARG B O      1 
ATOM   2460 C  CB     . ARG D 2 40 ? -34.106 -3.259  -3.262  1.00 50.54  ? 187 ARG B CB     1 
ATOM   2461 C  CG     . ARG D 2 40 ? -35.195 -4.244  -3.630  1.00 56.62  ? 187 ARG B CG     1 
ATOM   2462 C  CD     . ARG D 2 40 ? -35.873 -4.783  -2.368  1.00 59.11  ? 187 ARG B CD     1 
ATOM   2463 N  NE     . ARG D 2 40 ? -36.956 -3.894  -2.017  1.00 67.26  ? 187 ARG B NE     1 
ATOM   2464 C  CZ     . ARG D 2 40 ? -38.248 -4.172  -2.153  1.00 59.48  ? 187 ARG B CZ     1 
ATOM   2465 N  NH1    . ARG D 2 40 ? -38.660 -5.354  -2.588  1.00 59.81  ? 187 ARG B NH1    1 
ATOM   2466 N  NH2    . ARG D 2 40 ? -39.132 -3.262  -1.800  1.00 66.53  ? 187 ARG B NH2    1 
ATOM   2467 H  H      . ARG D 2 40 ? -34.991 -1.273  -4.326  1.00 45.60  ? 187 ARG B H      1 
ATOM   2468 H  HA     . ARG D 2 40 ? -32.605 -2.206  -4.164  1.00 53.78  ? 187 ARG B HA     1 
ATOM   2469 H  HB2    . ARG D 2 40 ? -33.411 -3.750  -2.796  1.00 61.52  ? 187 ARG B HB2    1 
ATOM   2470 H  HB3    . ARG D 2 40 ? -34.496 -2.601  -2.666  1.00 61.52  ? 187 ARG B HB3    1 
ATOM   2471 H  HG2    . ARG D 2 40 ? -35.865 -3.800  -4.173  1.00 68.82  ? 187 ARG B HG2    1 
ATOM   2472 H  HG3    . ARG D 2 40 ? -34.807 -4.991  -4.113  1.00 68.82  ? 187 ARG B HG3    1 
ATOM   2473 H  HD2    . ARG D 2 40 ? -36.235 -5.666  -2.540  1.00 71.80  ? 187 ARG B HD2    1 
ATOM   2474 H  HD3    . ARG D 2 40 ? -35.237 -4.806  -1.636  1.00 71.80  ? 187 ARG B HD3    1 
ATOM   2475 H  HE     . ARG D 2 40 ? -36.749 -3.124  -1.694  1.00 81.59  ? 187 ARG B HE     1 
ATOM   2476 H  HH11   . ARG D 2 40 ? -38.086 -5.952  -2.819  1.00 72.64  ? 187 ARG B HH11   1 
ATOM   2477 H  HH12   . ARG D 2 40 ? -39.502 -5.516  -2.660  1.00 72.64  ? 187 ARG B HH12   1 
ATOM   2478 H  HH21   . ARG D 2 40 ? -38.869 -2.497  -1.507  1.00 80.71  ? 187 ARG B HH21   1 
ATOM   2479 H  HH22   . ARG D 2 40 ? -39.973 -3.430  -1.868  1.00 80.71  ? 187 ARG B HH22   1 
ATOM   2480 N  N      . TYR D 2 41 ? -34.039 -3.526  -6.651  1.00 47.65  ? 188 TYR B N      1 
ATOM   2481 C  CA     . TYR D 2 41 ? -33.791 -4.453  -7.759  1.00 48.12  ? 188 TYR B CA     1 
ATOM   2482 C  C      . TYR D 2 41 ? -32.967 -3.825  -8.865  1.00 44.98  ? 188 TYR B C      1 
ATOM   2483 O  O      . TYR D 2 41 ? -32.614 -4.508  -9.835  1.00 49.04  ? 188 TYR B O      1 
ATOM   2484 C  CB     . TYR D 2 41 ? -35.112 -4.972  -8.348  1.00 58.33  ? 188 TYR B CB     1 
ATOM   2485 C  CG     . TYR D 2 41 ? -35.883 -5.812  -7.364  1.00 58.14  ? 188 TYR B CG     1 
ATOM   2486 C  CD1    . TYR D 2 41 ? -35.301 -6.946  -6.804  1.00 56.66  ? 188 TYR B CD1    1 
ATOM   2487 C  CD2    . TYR D 2 41 ? -37.173 -5.470  -6.978  1.00 53.36  ? 188 TYR B CD2    1 
ATOM   2488 C  CE1    . TYR D 2 41 ? -35.982 -7.715  -5.892  1.00 61.38  ? 188 TYR B CE1    1 
ATOM   2489 C  CE2    . TYR D 2 41 ? -37.858 -6.239  -6.062  1.00 56.64  ? 188 TYR B CE2    1 
ATOM   2490 C  CZ     . TYR D 2 41 ? -37.251 -7.360  -5.530  1.00 55.73  ? 188 TYR B CZ     1 
ATOM   2491 O  OH     . TYR D 2 41 ? -37.906 -8.138  -4.620  1.00 72.52  ? 188 TYR B OH     1 
ATOM   2492 H  H      . TYR D 2 41 ? -34.718 -3.010  -6.759  1.00 58.05  ? 188 TYR B H      1 
ATOM   2493 H  HA     . TYR D 2 41 ? -33.298 -5.216  -7.420  1.00 58.62  ? 188 TYR B HA     1 
ATOM   2494 H  HB2    . TYR D 2 41 ? -35.666 -4.217  -8.599  1.00 70.87  ? 188 TYR B HB2    1 
ATOM   2495 H  HB3    . TYR D 2 41 ? -34.919 -5.518  -9.126  1.00 70.87  ? 188 TYR B HB3    1 
ATOM   2496 H  HD1    . TYR D 2 41 ? -34.437 -7.185  -7.048  1.00 68.86  ? 188 TYR B HD1    1 
ATOM   2497 H  HD2    . TYR D 2 41 ? -37.577 -4.713  -7.337  1.00 64.91  ? 188 TYR B HD2    1 
ATOM   2498 H  HE1    . TYR D 2 41 ? -35.584 -8.471  -5.525  1.00 74.53  ? 188 TYR B HE1    1 
ATOM   2499 H  HE2    . TYR D 2 41 ? -38.722 -6.008  -5.808  1.00 68.84  ? 188 TYR B HE2    1 
ATOM   2500 H  HH     . TYR D 2 41 ? -38.672 -7.827  -4.475  1.00 87.90  ? 188 TYR B HH     1 
ATOM   2501 N  N      . ASN D 2 42 ? -32.658 -2.545  -8.747  1.00 43.35  ? 189 ASN B N      1 
ATOM   2502 C  CA     . ASN D 2 42 ? -31.695 -1.912  -9.626  1.00 44.16  ? 189 ASN B CA     1 
ATOM   2503 C  C      . ASN D 2 42 ? -31.098 -0.758  -8.818  1.00 47.54  ? 189 ASN B C      1 
ATOM   2504 O  O      . ASN D 2 42 ? -31.475 0.411   -8.981  1.00 45.19  ? 189 ASN B O      1 
ATOM   2505 C  CB     . ASN D 2 42 ? -32.326 -1.445  -10.932 1.00 50.86  ? 189 ASN B CB     1 
ATOM   2506 C  CG     . ASN D 2 42 ? -31.310 -0.909  -11.889 1.00 44.02  ? 189 ASN B CG     1 
ATOM   2507 O  OD1    . ASN D 2 42 ? -30.157 -1.339  -11.910 1.00 47.95  ? 189 ASN B OD1    1 
ATOM   2508 N  ND2    . ASN D 2 42 ? -31.702 0.093   -12.633 1.00 39.77  ? 189 ASN B ND2    1 
ATOM   2509 H  H      . ASN D 2 42 ? -32.997 -2.016  -8.160  1.00 52.89  ? 189 ASN B H      1 
ATOM   2510 H  HA     . ASN D 2 42 ? -30.986 -2.540  -9.835  1.00 53.86  ? 189 ASN B HA     1 
ATOM   2511 H  HB2    . ASN D 2 42 ? -32.773 -2.195  -11.354 1.00 61.91  ? 189 ASN B HB2    1 
ATOM   2512 H  HB3    . ASN D 2 42 ? -32.965 -0.740  -10.742 1.00 61.91  ? 189 ASN B HB3    1 
ATOM   2513 H  HD21   . ASN D 2 42 ? -31.161 0.444   -13.202 1.00 48.60  ? 189 ASN B HD21   1 
ATOM   2514 H  HD22   . ASN D 2 42 ? -32.501 0.402   -12.552 1.00 48.60  ? 189 ASN B HD22   1 
ATOM   2515 N  N      . ALA D 2 43 ? -30.200 -1.119  -7.896  1.00 40.84  ? 190 ALA B N      1 
ATOM   2516 C  CA     . ALA D 2 43 ? -29.708 -0.203  -6.878  1.00 43.33  ? 190 ALA B CA     1 
ATOM   2517 C  C      . ALA D 2 43 ? -28.593 0.687   -7.415  1.00 44.81  ? 190 ALA B C      1 
ATOM   2518 O  O      . ALA D 2 43 ? -27.536 0.835   -6.777  1.00 46.38  ? 190 ALA B O      1 
ATOM   2519 C  CB     . ALA D 2 43 ? -29.211 -0.979  -5.651  1.00 43.86  ? 190 ALA B CB     1 
ATOM   2520 H  H      . ALA D 2 43 ? -29.858 -1.907  -7.843  1.00 49.89  ? 190 ALA B H      1 
ATOM   2521 H  HA     . ALA D 2 43 ? -30.436 0.371   -6.593  1.00 52.87  ? 190 ALA B HA     1 
ATOM   2522 H  HB1    . ALA D 2 43 ? -28.889 -0.349  -4.988  1.00 53.50  ? 190 ALA B HB1    1 
ATOM   2523 H  HB2    . ALA D 2 43 ? -29.946 -1.497  -5.286  1.00 53.50  ? 190 ALA B HB2    1 
ATOM   2524 H  HB3    . ALA D 2 43 ? -28.492 -1.571  -5.922  1.00 53.50  ? 190 ALA B HB3    1 
ATOM   2525 N  N      . TYR D 2 44 ? -28.813 1.266   -8.591  1.00 37.34  ? 191 TYR B N      1 
ATOM   2526 C  CA     . TYR D 2 44 ? -27.822 2.101   -9.264  1.00 38.88  ? 191 TYR B CA     1 
ATOM   2527 C  C      . TYR D 2 44 ? -28.467 3.413   -9.700  1.00 44.30  ? 191 TYR B C      1 
ATOM   2528 O  O      . TYR D 2 44 ? -29.132 3.472   -10.751 1.00 44.05  ? 191 TYR B O      1 
ATOM   2529 C  CB     . TYR D 2 44 ? -27.240 1.361   -10.456 1.00 43.20  ? 191 TYR B CB     1 
ATOM   2530 C  CG     . TYR D 2 44 ? -26.490 0.147   -10.036 1.00 41.53  ? 191 TYR B CG     1 
ATOM   2531 C  CD1    . TYR D 2 44 ? -25.113 0.177   -9.885  1.00 34.20  ? 191 TYR B CD1    1 
ATOM   2532 C  CD2    . TYR D 2 44 ? -27.158 -1.024  -9.726  1.00 41.03  ? 191 TYR B CD2    1 
ATOM   2533 C  CE1    . TYR D 2 44 ? -24.421 -0.957  -9.487  1.00 33.51  ? 191 TYR B CE1    1 
ATOM   2534 C  CE2    . TYR D 2 44 ? -26.467 -2.161  -9.311  1.00 38.85  ? 191 TYR B CE2    1 
ATOM   2535 C  CZ     . TYR D 2 44 ? -25.105 -2.120  -9.200  1.00 37.05  ? 191 TYR B CZ     1 
ATOM   2536 O  OH     . TYR D 2 44 ? -24.419 -3.245  -8.803  1.00 37.74  ? 191 TYR B OH     1 
ATOM   2537 H  H      . TYR D 2 44 ? -29.548 1.188   -9.030  1.00 45.69  ? 191 TYR B H      1 
ATOM   2538 H  HA     . TYR D 2 44 ? -27.100 2.305   -8.649  1.00 47.53  ? 191 TYR B HA     1 
ATOM   2539 H  HB2    . TYR D 2 44 ? -27.961 1.084   -11.043 1.00 52.71  ? 191 TYR B HB2    1 
ATOM   2540 H  HB3    . TYR D 2 44 ? -26.629 1.947   -10.929 1.00 52.71  ? 191 TYR B HB3    1 
ATOM   2541 H  HD1    . TYR D 2 44 ? -24.644 0.955   -10.086 1.00 41.92  ? 191 TYR B HD1    1 
ATOM   2542 H  HD2    . TYR D 2 44 ? -28.084 -1.057  -9.809  1.00 50.11  ? 191 TYR B HD2    1 
ATOM   2543 H  HE1    . TYR D 2 44 ? -23.496 -0.931  -9.404  1.00 41.09  ? 191 TYR B HE1    1 
ATOM   2544 H  HE2    . TYR D 2 44 ? -26.929 -2.947  -9.124  1.00 47.50  ? 191 TYR B HE2    1 
ATOM   2545 H  HH     . TYR D 2 44 ? -23.595 -3.085  -8.778  1.00 46.16  ? 191 TYR B HH     1 
ATOM   2546 N  N      . PRO D 2 45 ? -28.348 4.469   -8.902  1.00 44.60  ? 192 PRO B N      1 
ATOM   2547 C  CA     . PRO D 2 45 ? -28.986 5.723   -9.297  1.00 51.15  ? 192 PRO B CA     1 
ATOM   2548 C  C      . PRO D 2 45 ? -28.280 6.298   -10.518 1.00 51.44  ? 192 PRO B C      1 
ATOM   2549 O  O      . PRO D 2 45 ? -27.070 6.158   -10.683 1.00 51.01  ? 192 PRO B O      1 
ATOM   2550 C  CB     . PRO D 2 45 ? -28.850 6.601   -8.037  1.00 40.34  ? 192 PRO B CB     1 
ATOM   2551 C  CG     . PRO D 2 45 ? -27.772 6.035   -7.307  1.00 42.73  ? 192 PRO B CG     1 
ATOM   2552 C  CD     . PRO D 2 45 ? -27.815 4.559   -7.542  1.00 41.28  ? 192 PRO B CD     1 
ATOM   2553 H  HA     . PRO D 2 45 ? -29.925 5.582   -9.498  1.00 62.26  ? 192 PRO B HA     1 
ATOM   2554 H  HB2    . PRO D 2 45 ? -28.649 7.514   -8.295  1.00 49.28  ? 192 PRO B HB2    1 
ATOM   2555 H  HB3    . PRO D 2 45 ? -29.671 6.562   -7.522  1.00 49.28  ? 192 PRO B HB3    1 
ATOM   2556 H  HG2    . PRO D 2 45 ? -26.935 6.405   -7.630  1.00 52.15  ? 192 PRO B HG2    1 
ATOM   2557 H  HG3    . PRO D 2 45 ? -27.885 6.230   -6.363  1.00 52.15  ? 192 PRO B HG3    1 
ATOM   2558 H  HD2    . PRO D 2 45 ? -26.923 4.181   -7.500  1.00 50.41  ? 192 PRO B HD2    1 
ATOM   2559 H  HD3    . PRO D 2 45 ? -28.416 4.131   -6.912  1.00 50.41  ? 192 PRO B HD3    1 
ATOM   2560 N  N      . SER D 2 46 ? -29.063 6.870   -11.419 1.00 49.24  ? 193 SER B N      1 
ATOM   2561 C  CA     . SER D 2 46 ? -28.479 7.564   -12.547 1.00 44.16  ? 193 SER B CA     1 
ATOM   2562 C  C      . SER D 2 46 ? -27.800 8.831   -12.083 1.00 44.76  ? 193 SER B C      1 
ATOM   2563 O  O      . SER D 2 46 ? -28.021 9.326   -10.980 1.00 42.61  ? 193 SER B O      1 
ATOM   2564 C  CB     . SER D 2 46 ? -29.545 7.946   -13.573 1.00 49.57  ? 193 SER B CB     1 
ATOM   2565 O  OG     . SER D 2 46 ? -30.381 8.959   -13.026 1.00 48.50  ? 193 SER B OG     1 
ATOM   2566 H  H      . SER D 2 46 ? -29.923 6.871   -11.399 1.00 59.96  ? 193 SER B H      1 
ATOM   2567 H  HA     . SER D 2 46 ? -27.821 6.995   -12.977 1.00 53.87  ? 193 SER B HA     1 
ATOM   2568 H  HB2    . SER D 2 46 ? -29.113 8.283   -14.373 1.00 60.35  ? 193 SER B HB2    1 
ATOM   2569 H  HB3    . SER D 2 46 ? -30.082 7.166   -13.783 1.00 60.35  ? 193 SER B HB3    1 
ATOM   2570 H  HG     . SER D 2 46 ? -30.970 9.176   -13.583 1.00 59.07  ? 193 SER B HG     1 
ATOM   2571 N  N      . GLU D 2 47 ? -26.989 9.381   -12.973 1.00 47.33  ? 194 GLU B N      1 
ATOM   2572 C  CA     . GLU D 2 47 ? -26.316 10.641  -12.692 1.00 47.72  ? 194 GLU B CA     1 
ATOM   2573 C  C      . GLU D 2 47 ? -27.353 11.671  -12.273 1.00 39.71  ? 194 GLU B C      1 
ATOM   2574 O  O      . GLU D 2 47 ? -27.136 12.458  -11.352 1.00 45.86  ? 194 GLU B O      1 
ATOM   2575 C  CB     . GLU D 2 47 ? -25.504 11.051  -13.940 1.00 53.36  ? 194 GLU B CB     1 
ATOM   2576 C  CG     . GLU D 2 47 ? -24.344 12.051  -13.780 1.00 60.20  ? 194 GLU B CG     1 
ATOM   2577 C  CD     . GLU D 2 47 ? -23.748 12.441  -15.141 0.50 47.68  ? 194 GLU B CD     1 
ATOM   2578 O  OE1    . GLU D 2 47 ? -23.744 11.582  -16.046 0.25 42.12  ? 194 GLU B OE1    1 
ATOM   2579 O  OE2    . GLU D 2 47 ? -23.311 13.603  -15.307 0.25 44.76  ? 194 GLU B OE2    1 
ATOM   2580 H  H      . GLU D 2 47 ? -26.811 9.047   -13.746 1.00 57.67  ? 194 GLU B H      1 
ATOM   2581 H  HA     . GLU D 2 47 ? -25.698 10.516  -11.955 1.00 58.14  ? 194 GLU B HA     1 
ATOM   2582 H  HB2    . GLU D 2 47 ? -25.126 10.245  -14.324 1.00 64.90  ? 194 GLU B HB2    1 
ATOM   2583 H  HB3    . GLU D 2 47 ? -26.122 11.442  -14.578 1.00 64.90  ? 194 GLU B HB3    1 
ATOM   2584 H  HG2    . GLU D 2 47 ? -24.672 12.856  -13.349 0.25 73.11  ? 194 GLU B HG2    1 
ATOM   2585 H  HG3    . GLU D 2 47 ? -23.643 11.645  -13.246 0.25 73.11  ? 194 GLU B HG3    1 
ATOM   2586 N  N      . GLN D 2 48 ? -28.525 11.632  -12.885 1.00 45.08  ? 195 GLN B N      1 
ATOM   2587 C  CA     . GLN D 2 48 ? -29.543 12.608  -12.513 1.00 42.19  ? 195 GLN B CA     1 
ATOM   2588 C  C      . GLN D 2 48 ? -30.108 12.285  -11.142 1.00 40.17  ? 195 GLN B C      1 
ATOM   2589 O  O      . GLN D 2 48 ? -30.424 13.186  -10.363 1.00 36.38  ? 195 GLN B O      1 
ATOM   2590 C  CB     . GLN D 2 48 ? -30.655 12.645  -13.572 1.00 52.18  ? 195 GLN B CB     1 
ATOM   2591 C  CG     . GLN D 2 48 ? -30.235 13.171  -14.991 0.75 44.52  ? 195 GLN B CG     1 
ATOM   2592 H  H      . GLN D 2 48 ? -28.754 11.074  -13.497 1.00 54.97  ? 195 GLN B H      1 
ATOM   2593 H  HA     . GLN D 2 48 ? -29.138 13.489  -12.471 1.00 51.50  ? 195 GLN B HA     1 
ATOM   2594 H  HB2    . GLN D 2 48 ? -30.997 11.744  -13.686 1.00 63.49  ? 195 GLN B HB2    1 
ATOM   2595 H  HB3    . GLN D 2 48 ? -31.365 13.221  -13.248 1.00 63.49  ? 195 GLN B HB3    1 
ATOM   2596 H  HG2    . GLN D 2 48 ? -31.028 13.238  -15.546 1.00 54.30  ? 195 GLN B HG2    1 
ATOM   2597 H  HG3    . GLN D 2 48 ? -29.831 14.047  -14.892 1.00 54.30  ? 195 GLN B HG3    1 
ATOM   2598 N  N      . GLU D 2 49 ? -30.227 11.009  -10.811 1.00 40.84  ? 196 GLU B N      1 
ATOM   2599 C  CA     . GLU D 2 49 ? -30.669 10.665  -9.468  1.00 43.78  ? 196 GLU B CA     1 
ATOM   2600 C  C      . GLU D 2 49 ? -29.578 10.949  -8.424  1.00 45.19  ? 196 GLU B C      1 
ATOM   2601 O  O      . GLU D 2 49 ? -29.853 11.516  -7.369  1.00 41.69  ? 196 GLU B O      1 
ATOM   2602 C  CB     . GLU D 2 49 ? -31.110 9.206   -9.463  1.00 45.36  ? 196 GLU B CB     1 
ATOM   2603 C  CG     . GLU D 2 49 ? -32.327 9.014   -10.347 1.00 45.94  ? 196 GLU B CG     1 
ATOM   2604 C  CD     . GLU D 2 49 ? -32.652 7.581   -10.574 1.00 47.22  ? 196 GLU B CD     1 
ATOM   2605 O  OE1    . GLU D 2 49 ? -31.704 6.760   -10.616 1.00 50.05  ? 196 GLU B OE1    1 
ATOM   2606 O  OE2    . GLU D 2 49 ? -33.852 7.296   -10.737 1.00 42.22  ? 196 GLU B OE2    1 
ATOM   2607 H  H      . GLU D 2 49 ? -30.064 10.340  -11.327 1.00 49.88  ? 196 GLU B H      1 
ATOM   2608 H  HA     . GLU D 2 49 ? -31.441 11.208  -9.244  1.00 53.41  ? 196 GLU B HA     1 
ATOM   2609 H  HB2    . GLU D 2 49 ? -30.392 8.650   -9.804  1.00 55.31  ? 196 GLU B HB2    1 
ATOM   2610 H  HB3    . GLU D 2 49 ? -31.343 8.942   -8.559  1.00 55.31  ? 196 GLU B HB3    1 
ATOM   2611 H  HG2    . GLU D 2 49 ? -33.094 9.433   -9.925  1.00 56.00  ? 196 GLU B HG2    1 
ATOM   2612 H  HG3    . GLU D 2 49 ? -32.158 9.424   -11.210 1.00 56.00  ? 196 GLU B HG3    1 
ATOM   2613 N  N      . LYS D 2 50 ? -28.325 10.585  -8.695  1.00 48.17  ? 197 LYS B N      1 
ATOM   2614 C  CA     . LYS D 2 50 ? -27.263 10.952  -7.767  1.00 41.80  ? 197 LYS B CA     1 
ATOM   2615 C  C      . LYS D 2 50 ? -27.289 12.439  -7.462  1.00 42.89  ? 197 LYS B C      1 
ATOM   2616 O  O      . LYS D 2 50 ? -27.041 12.850  -6.331  1.00 40.48  ? 197 LYS B O      1 
ATOM   2617 C  CB     . LYS D 2 50 ? -25.905 10.556  -8.336  1.00 33.85  ? 197 LYS B CB     1 
ATOM   2618 C  CG     . LYS D 2 50 ? -25.725 9.052   -8.566  1.00 41.33  ? 197 LYS B CG     1 
ATOM   2619 C  CD     . LYS D 2 50 ? -24.273 8.734   -8.850  1.00 36.09  ? 197 LYS B CD     1 
ATOM   2620 C  CE     . LYS D 2 50 ? -24.094 7.320   -9.363  1.00 36.40  ? 197 LYS B CE     1 
ATOM   2621 N  NZ     . LYS D 2 50 ? -22.655 7.170   -9.782  1.00 38.12  ? 197 LYS B NZ     1 
ATOM   2622 H  H      . LYS D 2 50 ? -28.072 10.141  -9.386  1.00 58.68  ? 197 LYS B H      1 
ATOM   2623 H  HA     . LYS D 2 50 ? -27.392 10.472  -6.934  1.00 51.03  ? 197 LYS B HA     1 
ATOM   2624 H  HB2    . LYS D 2 50 ? -25.785 11.001  -9.190  1.00 41.49  ? 197 LYS B HB2    1 
ATOM   2625 H  HB3    . LYS D 2 50 ? -25.215 10.844  -7.718  1.00 41.49  ? 197 LYS B HB3    1 
ATOM   2626 H  HG2    . LYS D 2 50 ? -25.997 8.568   -7.771  1.00 50.47  ? 197 LYS B HG2    1 
ATOM   2627 H  HG3    . LYS D 2 50 ? -26.256 8.776   -9.330  1.00 50.47  ? 197 LYS B HG3    1 
ATOM   2628 H  HD2    . LYS D 2 50 ? -23.939 9.345   -9.526  1.00 44.18  ? 197 LYS B HD2    1 
ATOM   2629 H  HD3    . LYS D 2 50 ? -23.760 8.826   -8.032  1.00 44.18  ? 197 LYS B HD3    1 
ATOM   2630 H  HE2    . LYS D 2 50 ? -24.285 6.683   -8.656  1.00 44.55  ? 197 LYS B HE2    1 
ATOM   2631 H  HE3    . LYS D 2 50 ? -24.665 7.169   -10.132 1.00 44.55  ? 197 LYS B HE3    1 
ATOM   2632 H  HZ1    . LYS D 2 50 ? -22.512 6.348   -10.090 1.00 46.62  ? 197 LYS B HZ1    1 
ATOM   2633 H  HZ2    . LYS D 2 50 ? -22.463 7.757   -10.424 1.00 46.62  ? 197 LYS B HZ2    1 
ATOM   2634 H  HZ3    . LYS D 2 50 ? -22.119 7.316   -9.087  1.00 46.62  ? 197 LYS B HZ3    1 
ATOM   2635 N  N      . ALA D 2 51 ? -27.594 13.270  -8.449  1.00 41.05  ? 198 ALA B N      1 
ATOM   2636 C  CA     . ALA D 2 51 ? -27.579 14.708  -8.192  1.00 39.63  ? 198 ALA B CA     1 
ATOM   2637 C  C      . ALA D 2 51 ? -28.709 15.109  -7.271  1.00 46.26  ? 198 ALA B C      1 
ATOM   2638 O  O      . ALA D 2 51 ? -28.509 15.905  -6.339  1.00 42.74  ? 198 ALA B O      1 
ATOM   2639 C  CB     . ALA D 2 51 ? -27.679 15.480  -9.498  1.00 38.50  ? 198 ALA B CB     1 
ATOM   2640 H  H      . ALA D 2 51 ? -27.806 13.042  -9.251  1.00 50.13  ? 198 ALA B H      1 
ATOM   2641 H  HA     . ALA D 2 51 ? -26.742 14.946  -7.764  1.00 48.43  ? 198 ALA B HA     1 
ATOM   2642 H  HB1    . ALA D 2 51 ? -27.668 16.430  -9.305  1.00 47.08  ? 198 ALA B HB1    1 
ATOM   2643 H  HB2    . ALA D 2 51 ? -26.924 15.247  -10.060 1.00 47.08  ? 198 ALA B HB2    1 
ATOM   2644 H  HB3    . ALA D 2 51 ? -28.508 15.242  -9.942  1.00 47.08  ? 198 ALA B HB3    1 
ATOM   2645 N  N      . LEU D 2 52 ? -29.898 14.536  -7.494  1.00 45.60  ? 199 LEU B N      1 
ATOM   2646 C  CA     . LEU D 2 52 ? -31.043 14.843  -6.639  1.00 44.11  ? 199 LEU B CA     1 
ATOM   2647 C  C      . LEU D 2 52 ? -30.775 14.448  -5.202  1.00 40.89  ? 199 LEU B C      1 
ATOM   2648 O  O      . LEU D 2 52 ? -31.101 15.191  -4.263  1.00 41.29  ? 199 LEU B O      1 
ATOM   2649 C  CB     . LEU D 2 52 ? -32.260 14.082  -7.161  1.00 40.77  ? 199 LEU B CB     1 
ATOM   2650 C  CG     . LEU D 2 52 ? -33.501 14.146  -6.273  1.00 56.24  ? 199 LEU B CG     1 
ATOM   2651 C  CD1    . LEU D 2 52 ? -33.930 15.594  -6.070  1.00 56.28  ? 199 LEU B CD1    1 
ATOM   2652 C  CD2    . LEU D 2 52 ? -34.648 13.298  -6.825  1.00 56.88  ? 199 LEU B CD2    1 
ATOM   2653 H  H      . LEU D 2 52 ? -30.063 13.975  -8.124  1.00 55.60  ? 199 LEU B H      1 
ATOM   2654 H  HA     . LEU D 2 52 ? -31.231 15.794  -6.672  1.00 53.81  ? 199 LEU B HA     1 
ATOM   2655 H  HB2    . LEU D 2 52 ? -32.503 14.446  -8.026  1.00 49.80  ? 199 LEU B HB2    1 
ATOM   2656 H  HB3    . LEU D 2 52 ? -32.020 13.148  -7.258  1.00 49.80  ? 199 LEU B HB3    1 
ATOM   2657 H  HG     . LEU D 2 52 ? -33.270 13.787  -5.402  1.00 68.36  ? 199 LEU B HG     1 
ATOM   2658 H  HD11   . LEU D 2 52 ? -34.718 15.613  -5.504  1.00 68.41  ? 199 LEU B HD11   1 
ATOM   2659 H  HD12   . LEU D 2 52 ? -33.206 16.080  -5.645  1.00 68.41  ? 199 LEU B HD12   1 
ATOM   2660 H  HD13   . LEU D 2 52 ? -34.132 15.987  -6.933  1.00 68.41  ? 199 LEU B HD13   1 
ATOM   2661 H  HD21   . LEU D 2 52 ? -35.410 13.372  -6.228  1.00 69.13  ? 199 LEU B HD21   1 
ATOM   2662 H  HD22   . LEU D 2 52 ? -34.886 13.625  -7.707  1.00 69.13  ? 199 LEU B HD22   1 
ATOM   2663 H  HD23   . LEU D 2 52 ? -34.359 12.374  -6.881  1.00 69.13  ? 199 LEU B HD23   1 
ATOM   2664 N  N      . LEU D 2 53 ? -30.186 13.267  -5.016  1.00 35.34  ? 200 LEU B N      1 
ATOM   2665 C  CA     . LEU D 2 53 ? -29.953 12.732  -3.690  1.00 44.67  ? 200 LEU B CA     1 
ATOM   2666 C  C      . LEU D 2 53 ? -28.943 13.588  -2.942  1.00 42.45  ? 200 LEU B C      1 
ATOM   2667 O  O      . LEU D 2 53 ? -29.143 13.953  -1.768  1.00 37.10  ? 200 LEU B O      1 
ATOM   2668 C  CB     . LEU D 2 53 ? -29.480 11.291  -3.832  1.00 41.92  ? 200 LEU B CB     1 
ATOM   2669 C  CG     . LEU D 2 53 ? -30.541 10.217  -4.126  1.00 33.14  ? 200 LEU B CG     1 
ATOM   2670 C  CD1    . LEU D 2 53 ? -29.845 8.857   -4.442  1.00 32.58  ? 200 LEU B CD1    1 
ATOM   2671 C  CD2    . LEU D 2 53 ? -31.525 10.012  -2.922  1.00 39.39  ? 200 LEU B CD2    1 
ATOM   2672 H  H      . LEU D 2 53 ? -29.912 12.757  -5.651  1.00 43.28  ? 200 LEU B H      1 
ATOM   2673 H  HA     . LEU D 2 53 ? -30.785 12.734  -3.191  1.00 54.48  ? 200 LEU B HA     1 
ATOM   2674 H  HB2    . LEU D 2 53 ? -28.835 11.258  -4.556  1.00 51.17  ? 200 LEU B HB2    1 
ATOM   2675 H  HB3    . LEU D 2 53 ? -29.042 11.038  -3.005  1.00 51.17  ? 200 LEU B HB3    1 
ATOM   2676 H  HG     . LEU D 2 53 ? -31.059 10.481  -4.903  1.00 40.64  ? 200 LEU B HG     1 
ATOM   2677 H  HD11   . LEU D 2 53 ? -30.525 8.190   -4.625  1.00 39.97  ? 200 LEU B HD11   1 
ATOM   2678 H  HD12   . LEU D 2 53 ? -29.273 8.968   -5.217  1.00 39.97  ? 200 LEU B HD12   1 
ATOM   2679 H  HD13   . LEU D 2 53 ? -29.316 8.588   -3.675  1.00 39.97  ? 200 LEU B HD13   1 
ATOM   2680 H  HD21   . LEU D 2 53 ? -32.172 9.328   -3.155  1.00 48.14  ? 200 LEU B HD21   1 
ATOM   2681 H  HD22   . LEU D 2 53 ? -31.018 9.736   -2.143  1.00 48.14  ? 200 LEU B HD22   1 
ATOM   2682 H  HD23   . LEU D 2 53 ? -31.980 10.850  -2.741  1.00 48.14  ? 200 LEU B HD23   1 
ATOM   2683 N  N      . SER D 2 54 ? -27.869 13.937  -3.631  1.00 35.20  ? 201 SER B N      1 
ATOM   2684 C  CA     . SER D 2 54 ? -26.875 14.844  -3.091  1.00 36.83  ? 201 SER B CA     1 
ATOM   2685 C  C      . SER D 2 54 ? -27.517 16.131  -2.614  1.00 40.36  ? 201 SER B C      1 
ATOM   2686 O  O      . SER D 2 54 ? -27.187 16.634  -1.532  1.00 40.38  ? 201 SER B O      1 
ATOM   2687 C  CB     . SER D 2 54 ? -25.824 15.148  -4.145  1.00 40.79  ? 201 SER B CB     1 
ATOM   2688 O  OG     . SER D 2 54 ? -24.923 16.106  -3.638  1.00 54.80  ? 201 SER B OG     1 
ATOM   2689 H  H      . SER D 2 54 ? -27.692 13.657  -4.424  1.00 43.12  ? 201 SER B H      1 
ATOM   2690 H  HA     . SER D 2 54 ? -26.435 14.425  -2.335  1.00 45.07  ? 201 SER B HA     1 
ATOM   2691 H  HB2    . SER D 2 54 ? -25.340 14.335  -4.360  1.00 49.82  ? 201 SER B HB2    1 
ATOM   2692 H  HB3    . SER D 2 54 ? -26.257 15.503  -4.938  1.00 49.82  ? 201 SER B HB3    1 
ATOM   2693 H  HG     . SER D 2 54 ? -24.548 15.810  -2.948  1.00 66.63  ? 201 SER B HG     1 
ATOM   2694 N  N      . GLN D 2 55 ? -28.434 16.695  -3.409  1.00 35.98  ? 202 GLN B N      1 
ATOM   2695 C  CA     . GLN D 2 55 ? -29.068 17.937  -2.975  1.00 42.64  ? 202 GLN B CA     1 
ATOM   2696 C  C      . GLN D 2 55 ? -29.920 17.682  -1.744  1.00 42.45  ? 202 GLN B C      1 
ATOM   2697 O  O      . GLN D 2 55 ? -29.958 18.513  -0.834  1.00 49.08  ? 202 GLN B O      1 
ATOM   2698 C  CB     . GLN D 2 55 ? -29.900 18.560  -4.096  1.00 42.14  ? 202 GLN B CB     1 
ATOM   2699 C  CG     . GLN D 2 55 ? -30.448 19.963  -3.799  1.00 64.40  ? 202 GLN B CG     1 
ATOM   2700 C  CD     . GLN D 2 55 ? -29.379 21.059  -3.820  1.00 61.40  ? 202 GLN B CD     1 
ATOM   2701 H  H      . GLN D 2 55 ? -28.694 16.393  -4.171  1.00 44.05  ? 202 GLN B H      1 
ATOM   2702 H  HA     . GLN D 2 55 ? -28.377 18.572  -2.731  1.00 52.04  ? 202 GLN B HA     1 
ATOM   2703 H  HB2    . GLN D 2 55 ? -29.347 18.625  -4.891  1.00 51.44  ? 202 GLN B HB2    1 
ATOM   2704 H  HB3    . GLN D 2 55 ? -30.658 17.982  -4.275  1.00 51.44  ? 202 GLN B HB3    1 
ATOM   2705 H  HG2    . GLN D 2 55 ? -31.116 20.186  -4.467  1.00 78.15  ? 202 GLN B HG2    1 
ATOM   2706 H  HG3    . GLN D 2 55 ? -30.853 19.961  -2.917  1.00 78.15  ? 202 GLN B HG3    1 
ATOM   2707 N  N      . GLN D 2 56 ? -30.591 16.524  -1.699  1.00 41.44  ? 203 GLN B N      1 
ATOM   2708 C  CA     . GLN D 2 56 ? -31.482 16.168  -0.592  1.00 41.18  ? 203 GLN B CA     1 
ATOM   2709 C  C      . GLN D 2 56 ? -30.704 15.850  0.666   1.00 45.57  ? 203 GLN B C      1 
ATOM   2710 O  O      . GLN D 2 56 ? -31.102 16.236  1.760   1.00 47.38  ? 203 GLN B O      1 
ATOM   2711 C  CB     . GLN D 2 56 ? -32.356 14.979  -1.001  1.00 43.35  ? 203 GLN B CB     1 
ATOM   2712 C  CG     . GLN D 2 56 ? -33.471 15.395  -1.963  1.00 48.82  ? 203 GLN B CG     1 
ATOM   2713 C  CD     . GLN D 2 56 ? -34.315 14.245  -2.615  1.00 51.63  ? 203 GLN B CD     1 
ATOM   2714 O  OE1    . GLN D 2 56 ? -35.204 14.518  -3.439  1.00 54.42  ? 203 GLN B OE1    1 
ATOM   2715 N  NE2    . GLN D 2 56 ? -34.016 12.992  -2.283  1.00 43.28  ? 203 GLN B NE2    1 
ATOM   2716 H  H      . GLN D 2 56 ? -30.545 15.920  -2.309  1.00 50.60  ? 203 GLN B H      1 
ATOM   2717 H  HA     . GLN D 2 56 ? -32.066 16.919  -0.402  1.00 50.29  ? 203 GLN B HA     1 
ATOM   2718 H  HB2    . GLN D 2 56 ? -31.804 14.316  -1.446  1.00 52.90  ? 203 GLN B HB2    1 
ATOM   2719 H  HB3    . GLN D 2 56 ? -32.766 14.597  -0.209  1.00 52.90  ? 203 GLN B HB3    1 
ATOM   2720 H  HG2    . GLN D 2 56 ? -34.090 15.964  -1.479  1.00 59.46  ? 203 GLN B HG2    1 
ATOM   2721 H  HG3    . GLN D 2 56 ? -33.072 15.901  -2.688  1.00 59.46  ? 203 GLN B HG3    1 
ATOM   2722 H  HE21   . GLN D 2 56 ? -33.378 12.835  -1.729  1.00 52.81  ? 203 GLN B HE21   1 
ATOM   2723 H  HE22   . GLN D 2 56 ? -34.461 12.340  -2.624  1.00 52.81  ? 203 GLN B HE22   1 
ATOM   2724 N  N      . THR D 2 57 ? -29.612 15.120  0.536   1.00 47.38  ? 204 THR B N      1 
ATOM   2725 C  CA     . THR D 2 57 ? -28.848 14.678  1.683   1.00 39.32  ? 204 THR B CA     1 
ATOM   2726 C  C      . THR D 2 57 ? -27.823 15.705  2.142   1.00 39.53  ? 204 THR B C      1 
ATOM   2727 O  O      . THR D 2 57 ? -27.286 15.568  3.246   1.00 43.19  ? 204 THR B O      1 
ATOM   2728 C  CB     . THR D 2 57 ? -28.128 13.384  1.324   1.00 44.73  ? 204 THR B CB     1 
ATOM   2729 O  OG1    . THR D 2 57 ? -27.163 13.651  0.282   1.00 39.14  ? 204 THR B OG1    1 
ATOM   2730 C  CG2    . THR D 2 57 ? -29.122 12.353  0.799   1.00 39.57  ? 204 THR B CG2    1 
ATOM   2731 H  H      . THR D 2 57 ? -29.288 14.863  -0.218  1.00 57.73  ? 204 THR B H      1 
ATOM   2732 H  HA     . THR D 2 57 ? -29.451 14.498  2.421   1.00 48.06  ? 204 THR B HA     1 
ATOM   2733 H  HB     . THR D 2 57 ? -27.681 13.023  2.106   1.00 54.55  ? 204 THR B HB     1 
ATOM   2734 H  HG1    . THR D 2 57 ? -27.551 13.952  -0.399  1.00 47.84  ? 204 THR B HG1    1 
ATOM   2735 H  HG21   . THR D 2 57 ? -28.658 11.532  0.572   1.00 48.36  ? 204 THR B HG21   1 
ATOM   2736 H  HG22   . THR D 2 57 ? -29.789 12.161  1.476   1.00 48.36  ? 204 THR B HG22   1 
ATOM   2737 H  HG23   . THR D 2 57 ? -29.565 12.694  0.007   1.00 48.36  ? 204 THR B HG23   1 
ATOM   2738 N  N      . HIS D 2 58 ? -27.597 16.757  1.358   1.00 41.72  ? 205 HIS B N      1 
ATOM   2739 C  CA     . HIS D 2 58 ? -26.518 17.715  1.599   1.00 41.62  ? 205 HIS B CA     1 
ATOM   2740 C  C      . HIS D 2 58 ? -25.155 17.042  1.633   1.00 40.31  ? 205 HIS B C      1 
ATOM   2741 O  O      . HIS D 2 58 ? -24.253 17.479  2.348   1.00 52.88  ? 205 HIS B O      1 
ATOM   2742 C  CB     . HIS D 2 58 ? -26.764 18.518  2.861   1.00 46.38  ? 205 HIS B CB     1 
ATOM   2743 C  CG     . HIS D 2 58 ? -28.088 19.187  2.854   1.00 50.01  ? 205 HIS B CG     1 
ATOM   2744 N  ND1    . HIS D 2 58 ? -29.044 18.965  3.819   1.00 52.87  ? 205 HIS B ND1    1 
ATOM   2745 C  CD2    . HIS D 2 58 ? -28.631 20.057  1.975   1.00 48.27  ? 205 HIS B CD2    1 
ATOM   2746 C  CE1    . HIS D 2 58 ? -30.118 19.682  3.540   1.00 54.66  ? 205 HIS B CE1    1 
ATOM   2747 N  NE2    . HIS D 2 58 ? -29.890 20.359  2.428   1.00 65.81  ? 205 HIS B NE2    1 
ATOM   2748 H  H      . HIS D 2 58 ? -28.068 16.942  0.662   1.00 50.93  ? 205 HIS B H      1 
ATOM   2749 H  HA     . HIS D 2 58 ? -26.505 18.344  0.861   1.00 50.81  ? 205 HIS B HA     1 
ATOM   2750 H  HB2    . HIS D 2 58 ? -26.732 17.923  3.627   1.00 56.53  ? 205 HIS B HB2    1 
ATOM   2751 H  HB3    . HIS D 2 58 ? -26.081 19.202  2.941   1.00 56.53  ? 205 HIS B HB3    1 
ATOM   2752 H  HD2    . HIS D 2 58 ? -28.223 20.398  1.212   1.00 58.80  ? 205 HIS B HD2    1 
ATOM   2753 H  HE1    . HIS D 2 58 ? -30.899 19.711  4.044   1.00 66.46  ? 205 HIS B HE1    1 
ATOM   2754 H  HE2    . HIS D 2 58 ? -30.444 20.895  2.047   1.00 79.84  ? 205 HIS B HE2    1 
ATOM   2755 N  N      . LEU D 2 59 ? -25.017 15.957  0.889   1.00 37.76  ? 206 LEU B N      1 
ATOM   2756 C  CA     . LEU D 2 59 ? -23.747 15.297  0.670   1.00 32.01  ? 206 LEU B CA     1 
ATOM   2757 C  C      . LEU D 2 59 ? -23.212 15.624  -0.708  1.00 44.87  ? 206 LEU B C      1 
ATOM   2758 O  O      . LEU D 2 59 ? -23.962 15.927  -1.645  1.00 41.78  ? 206 LEU B O      1 
ATOM   2759 C  CB     . LEU D 2 59 ? -23.905 13.784  0.801   1.00 29.93  ? 206 LEU B CB     1 
ATOM   2760 C  CG     . LEU D 2 59 ? -24.543 13.379  2.130   1.00 39.36  ? 206 LEU B CG     1 
ATOM   2761 C  CD1    . LEU D 2 59 ? -24.965 11.898  2.186   1.00 35.25  ? 206 LEU B CD1    1 
ATOM   2762 C  CD2    . LEU D 2 59 ? -23.539 13.674  3.221   1.00 39.53  ? 206 LEU B CD2    1 
ATOM   2763 H  H      . LEU D 2 59 ? -25.672 15.572  0.486   1.00 46.19  ? 206 LEU B H      1 
ATOM   2764 H  HA     . LEU D 2 59 ? -23.105 15.599  1.331   1.00 39.29  ? 206 LEU B HA     1 
ATOM   2765 H  HB2    . LEU D 2 59 ? -24.472 13.461  0.083   1.00 36.79  ? 206 LEU B HB2    1 
ATOM   2766 H  HB3    . LEU D 2 59 ? -23.030 13.369  0.747   1.00 36.79  ? 206 LEU B HB3    1 
ATOM   2767 H  HG     . LEU D 2 59 ? -25.329 13.925  2.286   1.00 48.10  ? 206 LEU B HG     1 
ATOM   2768 H  HD11   . LEU D 2 59 ? -25.359 11.715  3.053   1.00 43.17  ? 206 LEU B HD11   1 
ATOM   2769 H  HD12   . LEU D 2 59 ? -25.614 11.729  1.485   1.00 43.17  ? 206 LEU B HD12   1 
ATOM   2770 H  HD13   . LEU D 2 59 ? -24.182 11.342  2.054   1.00 43.17  ? 206 LEU B HD13   1 
ATOM   2771 H  HD21   . LEU D 2 59 ? -23.921 13.424  4.077   1.00 48.31  ? 206 LEU B HD21   1 
ATOM   2772 H  HD22   . LEU D 2 59 ? -22.733 13.160  3.056   1.00 48.31  ? 206 LEU B HD22   1 
ATOM   2773 H  HD23   . LEU D 2 59 ? -23.335 14.622  3.213   1.00 48.31  ? 206 LEU B HD23   1 
ATOM   2774 N  N      . SER D 2 60 ? -21.901 15.520  -0.838  1.00 37.72  ? 207 SER B N      1 
ATOM   2775 C  CA     . SER D 2 60 ? -21.324 15.615  -2.159  1.00 44.19  ? 207 SER B CA     1 
ATOM   2776 C  C      . SER D 2 60 ? -21.702 14.383  -2.962  1.00 43.44  ? 207 SER B C      1 
ATOM   2777 O  O      . SER D 2 60 ? -22.147 13.357  -2.419  1.00 36.00  ? 207 SER B O      1 
ATOM   2778 C  CB     . SER D 2 60 ? -19.815 15.681  -2.097  1.00 43.67  ? 207 SER B CB     1 
ATOM   2779 O  OG     . SER D 2 60 ? -19.331 14.371  -1.809  1.00 39.83  ? 207 SER B OG     1 
ATOM   2780 H  H      . SER D 2 60 ? -21.340 15.397  -0.198  1.00 46.13  ? 207 SER B H      1 
ATOM   2781 H  HA     . SER D 2 60 ? -21.658 16.405  -2.613  1.00 53.90  ? 207 SER B HA     1 
ATOM   2782 H  HB2    . SER D 2 60 ? -19.467 15.975  -2.953  1.00 53.27  ? 207 SER B HB2    1 
ATOM   2783 H  HB3    . SER D 2 60 ? -19.545 16.290  -1.391  1.00 53.27  ? 207 SER B HB3    1 
ATOM   2784 H  HG     . SER D 2 60 ? -18.492 14.378  -1.768  1.00 48.66  ? 207 SER B HG     1 
ATOM   2785 N  N      . THR D 2 61 ? -21.528 14.505  -4.275  1.00 39.13  ? 208 THR B N      1 
ATOM   2786 C  CA     . THR D 2 61 ? -21.714 13.374  -5.176  1.00 36.65  ? 208 THR B CA     1 
ATOM   2787 C  C      . THR D 2 61 ? -20.837 12.209  -4.768  1.00 34.87  ? 208 THR B C      1 
ATOM   2788 O  O      . THR D 2 61 ? -21.273 11.047  -4.768  1.00 37.14  ? 208 THR B O      1 
ATOM   2789 C  CB     . THR D 2 61 ? -21.340 13.783  -6.600  1.00 62.24  ? 208 THR B CB     1 
ATOM   2790 O  OG1    . THR D 2 61 ? -22.051 14.957  -6.965  1.00 49.11  ? 208 THR B OG1    1 
ATOM   2791 C  CG2    . THR D 2 61 ? -21.659 12.681  -7.567  1.00 60.12  ? 208 THR B CG2    1 
ATOM   2792 H  H      . THR D 2 61 ? -21.302 15.235  -4.670  1.00 47.83  ? 208 THR B H      1 
ATOM   2793 H  HA     . THR D 2 61 ? -22.641 13.090  -5.163  1.00 44.85  ? 208 THR B HA     1 
ATOM   2794 H  HB     . THR D 2 61 ? -20.387 13.959  -6.643  1.00 75.57  ? 208 THR B HB     1 
ATOM   2795 H  HG1    . THR D 2 61 ? -21.848 15.184  -7.748  1.00 59.81  ? 208 THR B HG1    1 
ATOM   2796 H  HG21   . THR D 2 61 ? -21.418 12.950  -8.468  1.00 73.02  ? 208 THR B HG21   1 
ATOM   2797 H  HG22   . THR D 2 61 ? -21.162 11.881  -7.334  1.00 73.02  ? 208 THR B HG22   1 
ATOM   2798 H  HG23   . THR D 2 61 ? -22.608 12.481  -7.541  1.00 73.02  ? 208 THR B HG23   1 
ATOM   2799 N  N      . LEU D 2 62 ? -19.564 12.494  -4.491  1.00 33.75  ? 209 LEU B N      1 
ATOM   2800 C  CA     . LEU D 2 62 ? -18.638 11.422  -4.168  1.00 39.14  ? 209 LEU B CA     1 
ATOM   2801 C  C      . LEU D 2 62 ? -19.087 10.712  -2.902  1.00 35.03  ? 209 LEU B C      1 
ATOM   2802 O  O      . LEU D 2 62 ? -19.053 9.478   -2.824  1.00 33.66  ? 209 LEU B O      1 
ATOM   2803 C  CB     . LEU D 2 62 ? -17.247 12.003  -4.004  1.00 37.91  ? 209 LEU B CB     1 
ATOM   2804 C  CG     . LEU D 2 62 ? -16.165 11.053  -3.502  1.00 39.62  ? 209 LEU B CG     1 
ATOM   2805 C  CD1    . LEU D 2 62 ? -16.026 9.805   -4.368  1.00 38.07  ? 209 LEU B CD1    1 
ATOM   2806 C  CD2    . LEU D 2 62 ? -14.886 11.834  -3.506  1.00 32.90  ? 209 LEU B CD2    1 
ATOM   2807 H  H      . LEU D 2 62 ? -19.222 13.283  -4.484  1.00 41.37  ? 209 LEU B H      1 
ATOM   2808 H  HA     . LEU D 2 62 ? -18.621 10.779  -4.894  1.00 47.84  ? 209 LEU B HA     1 
ATOM   2809 H  HB2    . LEU D 2 62 ? -16.956 12.340  -4.866  1.00 46.36  ? 209 LEU B HB2    1 
ATOM   2810 H  HB3    . LEU D 2 62 ? -17.298 12.738  -3.373  1.00 46.36  ? 209 LEU B HB3    1 
ATOM   2811 H  HG     . LEU D 2 62 ? -16.363 10.782  -2.592  1.00 48.42  ? 209 LEU B HG     1 
ATOM   2812 H  HD11   . LEU D 2 62 ? -15.326 9.243   -4.001  1.00 46.56  ? 209 LEU B HD11   1 
ATOM   2813 H  HD12   . LEU D 2 62 ? -16.870 9.326   -4.369  1.00 46.56  ? 209 LEU B HD12   1 
ATOM   2814 H  HD13   . LEU D 2 62 ? -15.796 10.072  -5.272  1.00 46.56  ? 209 LEU B HD13   1 
ATOM   2815 H  HD21   . LEU D 2 62 ? -14.167 11.263  -3.192  1.00 40.35  ? 209 LEU B HD21   1 
ATOM   2816 H  HD22   . LEU D 2 62 ? -14.701 12.132  -4.410  1.00 40.35  ? 209 LEU B HD22   1 
ATOM   2817 H  HD23   . LEU D 2 62 ? -14.982 12.600  -2.918  1.00 40.35  ? 209 LEU B HD23   1 
ATOM   2818 N  N      . GLN D 2 63 ? -19.563 11.477  -1.918  1.00 34.02  ? 210 GLN B N      1 
ATOM   2819 C  CA     . GLN D 2 63 ? -20.127 10.867  -0.713  1.00 36.49  ? 210 GLN B CA     1 
ATOM   2820 C  C      . GLN D 2 63 ? -21.289 9.958   -1.057  1.00 38.30  ? 210 GLN B C      1 
ATOM   2821 O  O      . GLN D 2 63 ? -21.368 8.825   -0.556  1.00 38.48  ? 210 GLN B O      1 
ATOM   2822 C  CB     . GLN D 2 63 ? -20.558 11.950  0.268   1.00 37.94  ? 210 GLN B CB     1 
ATOM   2823 C  CG     . GLN D 2 63 ? -19.321 12.600  0.920   1.00 41.31  ? 210 GLN B CG     1 
ATOM   2824 C  CD     . GLN D 2 63 ? -19.642 13.718  1.896   1.00 48.00  ? 210 GLN B CD     1 
ATOM   2825 O  OE1    . GLN D 2 63 ? -20.231 14.753  1.532   1.00 47.96  ? 210 GLN B OE1    1 
ATOM   2826 N  NE2    . GLN D 2 63 ? -19.200 13.541  3.132   1.00 31.47  ? 210 GLN B NE2    1 
ATOM   2827 H  H      . GLN D 2 63 ? -19.572 12.337  -1.923  1.00 41.70  ? 210 GLN B H      1 
ATOM   2828 H  HA     . GLN D 2 63 ? -19.443 10.330  -0.283  1.00 44.66  ? 210 GLN B HA     1 
ATOM   2829 H  HB2    . GLN D 2 63 ? -21.054 12.637  -0.205  1.00 46.40  ? 210 GLN B HB2    1 
ATOM   2830 H  HB3    . GLN D 2 63 ? -21.104 11.556  0.966   1.00 46.40  ? 210 GLN B HB3    1 
ATOM   2831 H  HG2    . GLN D 2 63 ? -18.832 11.917  1.405   1.00 50.45  ? 210 GLN B HG2    1 
ATOM   2832 H  HG3    . GLN D 2 63 ? -18.760 12.970  0.221   1.00 50.45  ? 210 GLN B HG3    1 
ATOM   2833 H  HE21   . GLN D 2 63 ? -18.764 12.828  3.335   1.00 38.64  ? 210 GLN B HE21   1 
ATOM   2834 H  HE22   . GLN D 2 63 ? -19.349 14.139  3.732   1.00 38.64  ? 210 GLN B HE22   1 
ATOM   2835 N  N      . VAL D 2 64 ? -22.180 10.410  -1.949  1.00 38.37  ? 211 VAL B N      1 
ATOM   2836 C  CA     . VAL D 2 64 ? -23.304 9.564   -2.355  1.00 36.76  ? 211 VAL B CA     1 
ATOM   2837 C  C      . VAL D 2 64 ? -22.802 8.282   -3.020  1.00 36.38  ? 211 VAL B C      1 
ATOM   2838 O  O      . VAL D 2 64 ? -23.232 7.172   -2.676  1.00 34.38  ? 211 VAL B O      1 
ATOM   2839 C  CB     . VAL D 2 64 ? -24.246 10.329  -3.298  1.00 37.14  ? 211 VAL B CB     1 
ATOM   2840 C  CG1    . VAL D 2 64 ? -25.323 9.398   -3.785  1.00 40.38  ? 211 VAL B CG1    1 
ATOM   2841 C  CG2    . VAL D 2 64 ? -24.850 11.543  -2.615  1.00 31.15  ? 211 VAL B CG2    1 
ATOM   2842 H  H      . VAL D 2 64 ? -22.156 11.183  -2.325  1.00 46.92  ? 211 VAL B H      1 
ATOM   2843 H  HA     . VAL D 2 64 ? -23.810 9.313   -1.567  1.00 44.98  ? 211 VAL B HA     1 
ATOM   2844 H  HB     . VAL D 2 64 ? -23.743 10.637  -4.068  1.00 45.44  ? 211 VAL B HB     1 
ATOM   2845 H  HG11   . VAL D 2 64 ? -25.916 9.885   -4.379  1.00 49.33  ? 211 VAL B HG11   1 
ATOM   2846 H  HG12   . VAL D 2 64 ? -24.911 8.660   -4.260  1.00 49.33  ? 211 VAL B HG12   1 
ATOM   2847 H  HG13   . VAL D 2 64 ? -25.821 9.065   -3.022  1.00 49.33  ? 211 VAL B HG13   1 
ATOM   2848 H  HG21   . VAL D 2 64 ? -25.436 11.998  -3.241  1.00 38.25  ? 211 VAL B HG21   1 
ATOM   2849 H  HG22   . VAL D 2 64 ? -25.355 11.251  -1.841  1.00 38.25  ? 211 VAL B HG22   1 
ATOM   2850 H  HG23   . VAL D 2 64 ? -24.135 12.138  -2.339  1.00 38.25  ? 211 VAL B HG23   1 
ATOM   2851 N  N      . CYS D 2 65 ? -21.897 8.413   -3.994  1.00 33.05  ? 212 CYS B N      1 
ATOM   2852 C  CA     . CYS D 2 65 ? -21.382 7.215   -4.653  1.00 37.98  ? 212 CYS B CA     1 
ATOM   2853 C  C      . CYS D 2 65 ? -20.799 6.267   -3.613  1.00 40.03  ? 212 CYS B C      1 
ATOM   2854 O  O      . CYS D 2 65 ? -21.052 5.054   -3.634  1.00 37.31  ? 212 CYS B O      1 
ATOM   2855 C  CB     . CYS D 2 65 ? -20.341 7.587   -5.707  1.00 40.77  ? 212 CYS B CB     1 
ATOM   2856 S  SG     . CYS D 2 65 ? -21.042 8.432   -7.231  1.00 46.36  ? 212 CYS B SG     1 
ATOM   2857 H  H      . CYS D 2 65 ? -21.577 9.157   -4.282  1.00 40.54  ? 212 CYS B H      1 
ATOM   2858 H  HA     . CYS D 2 65 ? -22.113 6.759   -5.099  1.00 46.45  ? 212 CYS B HA     1 
ATOM   2859 H  HB2    . CYS D 2 65 ? -19.696 8.191   -5.307  1.00 49.80  ? 212 CYS B HB2    1 
ATOM   2860 H  HB3    . CYS D 2 65 ? -19.893 6.778   -6.000  1.00 49.80  ? 212 CYS B HB3    1 
ATOM   2861 H  HG     . CYS D 2 65 ? -20.145 8.678   -7.989  1.00 56.51  ? 212 CYS B HG     1 
ATOM   2862 N  N      . ASN D 2 66 ? -19.997 6.798   -2.690  1.00 35.47  ? 213 ASN B N      1 
ATOM   2863 C  CA     . ASN D 2 66 ? -19.361 5.902   -1.739  1.00 37.60  ? 213 ASN B CA     1 
ATOM   2864 C  C      . ASN D 2 66 ? -20.411 5.206   -0.903  1.00 33.51  ? 213 ASN B C      1 
ATOM   2865 O  O      . ASN D 2 66 ? -20.335 3.991   -0.664  1.00 32.37  ? 213 ASN B O      1 
ATOM   2866 C  CB     . ASN D 2 66 ? -18.355 6.675   -0.893  1.00 37.16  ? 213 ASN B CB     1 
ATOM   2867 C  CG     . ASN D 2 66 ? -17.006 6.783   -1.585  1.00 39.41  ? 213 ASN B CG     1 
ATOM   2868 O  OD1    . ASN D 2 66 ? -16.636 5.900   -2.357  1.00 39.78  ? 213 ASN B OD1    1 
ATOM   2869 N  ND2    . ASN D 2 66 ? -16.292 7.880   -1.357  1.00 34.85  ? 213 ASN B ND2    1 
ATOM   2870 H  H      . ASN D 2 66 ? -19.814 7.633   -2.599  1.00 43.43  ? 213 ASN B H      1 
ATOM   2871 H  HA     . ASN D 2 66 ? -18.874 5.221   -2.228  1.00 46.00  ? 213 ASN B HA     1 
ATOM   2872 H  HB2    . ASN D 2 66 ? -18.690 7.572   -0.739  1.00 45.47  ? 213 ASN B HB2    1 
ATOM   2873 H  HB3    . ASN D 2 66 ? -18.227 6.215   -0.049  1.00 45.47  ? 213 ASN B HB3    1 
ATOM   2874 H  HD21   . ASN D 2 66 ? -15.523 7.977   -1.731  1.00 42.69  ? 213 ASN B HD21   1 
ATOM   2875 H  HD22   . ASN D 2 66 ? -16.598 8.492   -0.837  1.00 42.69  ? 213 ASN B HD22   1 
ATOM   2876 N  N      . TRP D 2 67 ? -21.443 5.936   -0.494  1.00 34.65  ? 214 TRP B N      1 
ATOM   2877 C  CA     . TRP D 2 67 ? -22.448 5.276   0.319   1.00 36.57  ? 214 TRP B CA     1 
ATOM   2878 C  C      . TRP D 2 67 ? -23.043 4.115   -0.455  1.00 37.76  ? 214 TRP B C      1 
ATOM   2879 O  O      . TRP D 2 67 ? -23.249 3.031   0.103   1.00 36.87  ? 214 TRP B O      1 
ATOM   2880 C  CB     . TRP D 2 67 ? -23.521 6.268   0.746   1.00 33.90  ? 214 TRP B CB     1 
ATOM   2881 C  CG     . TRP D 2 67 ? -24.418 5.732   1.799   1.00 38.62  ? 214 TRP B CG     1 
ATOM   2882 C  CD1    . TRP D 2 67 ? -24.257 5.855   3.155   1.00 49.17  ? 214 TRP B CD1    1 
ATOM   2883 C  CD2    . TRP D 2 67 ? -25.600 4.966   1.607   1.00 38.24  ? 214 TRP B CD2    1 
ATOM   2884 N  NE1    . TRP D 2 67 ? -25.269 5.212   3.818   1.00 42.75  ? 214 TRP B NE1    1 
ATOM   2885 C  CE2    . TRP D 2 67 ? -26.112 4.659   2.885   1.00 49.07  ? 214 TRP B CE2    1 
ATOM   2886 C  CE3    . TRP D 2 67 ? -26.277 4.505   0.483   1.00 37.58  ? 214 TRP B CE3    1 
ATOM   2887 C  CZ2    . TRP D 2 67 ? -27.277 3.919   3.061   1.00 44.94  ? 214 TRP B CZ2    1 
ATOM   2888 C  CZ3    . TRP D 2 67 ? -27.427 3.783   0.653   1.00 42.63  ? 214 TRP B CZ3    1 
ATOM   2889 C  CH2    . TRP D 2 67 ? -27.922 3.495   1.939   1.00 50.90  ? 214 TRP B CH2    1 
ATOM   2890 H  H      . TRP D 2 67 ? -21.578 6.768   -0.663  1.00 42.46  ? 214 TRP B H      1 
ATOM   2891 H  HA     . TRP D 2 67 ? -22.029 4.923   1.119   1.00 44.76  ? 214 TRP B HA     1 
ATOM   2892 H  HB2    . TRP D 2 67 ? -23.093 7.066   1.094   1.00 41.55  ? 214 TRP B HB2    1 
ATOM   2893 H  HB3    . TRP D 2 67 ? -24.066 6.494   -0.024  1.00 41.55  ? 214 TRP B HB3    1 
ATOM   2894 H  HD1    . TRP D 2 67 ? -23.554 6.305   3.567   1.00 59.88  ? 214 TRP B HD1    1 
ATOM   2895 H  HE1    . TRP D 2 67 ? -25.365 5.171   4.672   1.00 52.17  ? 214 TRP B HE1    1 
ATOM   2896 H  HE3    . TRP D 2 67 ? -25.961 4.697   -0.371  1.00 45.97  ? 214 TRP B HE3    1 
ATOM   2897 H  HZ2    . TRP D 2 67 ? -27.606 3.728   3.910   1.00 54.80  ? 214 TRP B HZ2    1 
ATOM   2898 H  HZ3    . TRP D 2 67 ? -27.887 3.474   -0.094  1.00 52.03  ? 214 TRP B HZ3    1 
ATOM   2899 H  HH2    . TRP D 2 67 ? -28.702 2.995   2.024   1.00 61.96  ? 214 TRP B HH2    1 
ATOM   2900 N  N      . PHE D 2 68 ? -23.230 4.286   -1.769  1.00 32.30  ? 215 PHE B N      1 
ATOM   2901 C  CA     . PHE D 2 68 ? -23.924 3.247   -2.520  1.00 34.77  ? 215 PHE B CA     1 
ATOM   2902 C  C      . PHE D 2 68 ? -23.013 2.057   -2.766  1.00 35.86  ? 215 PHE B C      1 
ATOM   2903 O  O      . PHE D 2 68 ? -23.466 0.908   -2.689  1.00 38.38  ? 215 PHE B O      1 
ATOM   2904 C  CB     . PHE D 2 68 ? -24.481 3.804   -3.838  1.00 41.72  ? 215 PHE B CB     1 
ATOM   2905 C  CG     . PHE D 2 68 ? -25.865 4.419   -3.718  1.00 39.97  ? 215 PHE B CG     1 
ATOM   2906 C  CD1    . PHE D 2 68 ? -27.000 3.617   -3.699  1.00 43.52  ? 215 PHE B CD1    1 
ATOM   2907 C  CD2    . PHE D 2 68 ? -26.031 5.794   -3.617  1.00 37.64  ? 215 PHE B CD2    1 
ATOM   2908 C  CE1    . PHE D 2 68 ? -28.262 4.177   -3.584  1.00 38.26  ? 215 PHE B CE1    1 
ATOM   2909 C  CE2    . PHE D 2 68 ? -27.302 6.364   -3.512  1.00 37.04  ? 215 PHE B CE2    1 
ATOM   2910 C  CZ     . PHE D 2 68 ? -28.410 5.557   -3.505  1.00 37.60  ? 215 PHE B CZ     1 
ATOM   2911 H  H      . PHE D 2 68 ? -22.976 4.967   -2.229  1.00 39.63  ? 215 PHE B H      1 
ATOM   2912 H  HA     . PHE D 2 68 ? -24.677 2.935   -1.993  1.00 42.60  ? 215 PHE B HA     1 
ATOM   2913 H  HB2    . PHE D 2 68 ? -23.879 4.492   -4.164  1.00 50.94  ? 215 PHE B HB2    1 
ATOM   2914 H  HB3    . PHE D 2 68 ? -24.533 3.082   -4.484  1.00 50.94  ? 215 PHE B HB3    1 
ATOM   2915 H  HD1    . PHE D 2 68 ? -26.911 2.694   -3.761  1.00 53.10  ? 215 PHE B HD1    1 
ATOM   2916 H  HD2    . PHE D 2 68 ? -25.283 6.346   -3.632  1.00 46.04  ? 215 PHE B HD2    1 
ATOM   2917 H  HE1    . PHE D 2 68 ? -29.013 3.629   -3.579  1.00 46.78  ? 215 PHE B HE1    1 
ATOM   2918 H  HE2    . PHE D 2 68 ? -27.396 7.287   -3.450  1.00 45.32  ? 215 PHE B HE2    1 
ATOM   2919 H  HZ     . PHE D 2 68 ? -29.258 5.930   -3.424  1.00 46.00  ? 215 PHE B HZ     1 
ATOM   2920 N  N      . ILE D 2 69 ? -21.721 2.300   -3.021  1.00 31.54  ? 216 ILE B N      1 
ATOM   2921 C  CA     . ILE D 2 69 ? -20.787 1.182   -3.126  1.00 33.85  ? 216 ILE B CA     1 
ATOM   2922 C  C      . ILE D 2 69 ? -20.748 0.402   -1.818  1.00 43.24  ? 216 ILE B C      1 
ATOM   2923 O  O      . ILE D 2 69 ? -20.635 -0.830  -1.822  1.00 46.35  ? 216 ILE B O      1 
ATOM   2924 C  CB     . ILE D 2 69 ? -19.379 1.674   -3.488  1.00 38.50  ? 216 ILE B CB     1 
ATOM   2925 C  CG1    . ILE D 2 69 ? -19.393 2.479   -4.771  1.00 38.43  ? 216 ILE B CG1    1 
ATOM   2926 C  CG2    . ILE D 2 69 ? -18.446 0.478   -3.604  1.00 41.19  ? 216 ILE B CG2    1 
ATOM   2927 C  CD1    . ILE D 2 69 ? -18.068 3.034   -5.196  1.00 49.08  ? 216 ILE B CD1    1 
ATOM   2928 H  H      . ILE D 2 69 ? -21.373 3.078   -3.133  1.00 38.72  ? 216 ILE B H      1 
ATOM   2929 H  HA     . ILE D 2 69 ? -21.087 0.582   -3.826  1.00 41.49  ? 216 ILE B HA     1 
ATOM   2930 H  HB     . ILE D 2 69 ? -19.060 2.245   -2.772  1.00 47.08  ? 216 ILE B HB     1 
ATOM   2931 H  HG12   . ILE D 2 69 ? -19.714 1.909   -5.488  1.00 46.99  ? 216 ILE B HG12   1 
ATOM   2932 H  HG13   . ILE D 2 69 ? -20.000 3.228   -4.658  1.00 46.99  ? 216 ILE B HG13   1 
ATOM   2933 H  HG21   . ILE D 2 69 ? -17.557 0.792   -3.833  1.00 50.30  ? 216 ILE B HG21   1 
ATOM   2934 H  HG22   . ILE D 2 69 ? -18.423 0.012   -2.753  1.00 50.30  ? 216 ILE B HG22   1 
ATOM   2935 H  HG23   . ILE D 2 69 ? -18.776 -0.115  -4.297  1.00 50.30  ? 216 ILE B HG23   1 
ATOM   2936 H  HD11   . ILE D 2 69 ? -18.184 3.529   -6.022  1.00 59.78  ? 216 ILE B HD11   1 
ATOM   2937 H  HD12   . ILE D 2 69 ? -17.735 3.623   -4.501  1.00 59.78  ? 216 ILE B HD12   1 
ATOM   2938 H  HD13   . ILE D 2 69 ? -17.449 2.301   -5.334  1.00 59.78  ? 216 ILE B HD13   1 
ATOM   2939 N  N      . ASN D 2 70 ? -20.789 1.098   -0.673  1.00 35.76  ? 217 ASN B N      1 
ATOM   2940 C  CA     . ASN D 2 70 ? -20.786 0.353   0.582   1.00 47.22  ? 217 ASN B CA     1 
ATOM   2941 C  C      . ASN D 2 70 ? -22.139 -0.300  0.810   1.00 41.13  ? 217 ASN B C      1 
ATOM   2942 O  O      . ASN D 2 70 ? -22.218 -1.461  1.237   1.00 39.65  ? 217 ASN B O      1 
ATOM   2943 C  CB     . ASN D 2 70 ? -20.393 1.256   1.763   1.00 39.67  ? 217 ASN B CB     1 
ATOM   2944 C  CG     . ASN D 2 70 ? -18.921 1.701   1.685   1.00 42.65  ? 217 ASN B CG     1 
ATOM   2945 O  OD1    . ASN D 2 70 ? -18.010 0.873   1.480   1.00 36.20  ? 217 ASN B OD1    1 
ATOM   2946 N  ND2    . ASN D 2 70 ? -18.687 3.014   1.809   1.00 38.79  ? 217 ASN B ND2    1 
ATOM   2947 H  H      . ASN D 2 70 ? -20.818 1.954   -0.601  1.00 43.79  ? 217 ASN B H      1 
ATOM   2948 H  HA     . ASN D 2 70 ? -20.126 -0.355  0.521   1.00 57.54  ? 217 ASN B HA     1 
ATOM   2949 H  HB2    . ASN D 2 70 ? -20.950 2.050   1.755   1.00 48.48  ? 217 ASN B HB2    1 
ATOM   2950 H  HB3    . ASN D 2 70 ? -20.518 0.768   2.592   1.00 48.48  ? 217 ASN B HB3    1 
ATOM   2951 H  HD21   . ASN D 2 70 ? -17.881 3.312   1.773   1.00 47.42  ? 217 ASN B HD21   1 
ATOM   2952 H  HD22   . ASN D 2 70 ? -19.342 3.558   1.925   1.00 47.42  ? 217 ASN B HD22   1 
ATOM   2953 N  N      . ALA D 2 71 ? -23.219 0.418   0.502   1.00 39.17  ? 218 ALA B N      1 
ATOM   2954 C  CA     . ALA D 2 71 ? -24.536 -0.075  0.887   1.00 40.72  ? 218 ALA B CA     1 
ATOM   2955 C  C      . ALA D 2 71 ? -24.924 -1.296  0.074   1.00 42.80  ? 218 ALA B C      1 
ATOM   2956 O  O      . ALA D 2 71 ? -25.574 -2.205  0.595   1.00 46.53  ? 218 ALA B O      1 
ATOM   2957 C  CB     . ALA D 2 71 ? -25.571 1.031   0.709   1.00 38.70  ? 218 ALA B CB     1 
ATOM   2958 H  H      . ALA D 2 71 ? -23.217 1.169   0.083   1.00 47.88  ? 218 ALA B H      1 
ATOM   2959 H  HA     . ALA D 2 71 ? -24.521 -0.328  1.824   1.00 49.73  ? 218 ALA B HA     1 
ATOM   2960 H  HB1    . ALA D 2 71 ? -26.442 0.693   0.968   1.00 47.31  ? 218 ALA B HB1    1 
ATOM   2961 H  HB2    . ALA D 2 71 ? -25.327 1.784   1.270   1.00 47.31  ? 218 ALA B HB2    1 
ATOM   2962 H  HB3    . ALA D 2 71 ? -25.584 1.303   -0.222  1.00 47.31  ? 218 ALA B HB3    1 
ATOM   2963 N  N      . ARG D 2 72 ? -24.512 -1.354  -1.191  1.00 41.31  ? 219 ARG B N      1 
ATOM   2964 C  CA     . ARG D 2 72 ? -24.800 -2.535  -1.997  1.00 46.07  ? 219 ARG B CA     1 
ATOM   2965 C  C      . ARG D 2 72 ? -24.125 -3.782  -1.425  1.00 46.15  ? 219 ARG B C      1 
ATOM   2966 O  O      . ARG D 2 72 ? -24.621 -4.896  -1.619  1.00 45.82  ? 219 ARG B O      1 
ATOM   2967 C  CB     . ARG D 2 72 ? -24.375 -2.289  -3.459  1.00 44.36  ? 219 ARG B CB     1 
ATOM   2968 C  CG     . ARG D 2 72 ? -25.334 -1.337  -4.268  1.00 43.88  ? 219 ARG B CG     1 
ATOM   2969 C  CD     . ARG D 2 72 ? -25.037 -1.258  -5.786  1.00 43.69  ? 219 ARG B CD     1 
ATOM   2970 N  NE     . ARG D 2 72 ? -23.805 -0.532  -6.081  1.00 40.54  ? 219 ARG B NE     1 
ATOM   2971 C  CZ     . ARG D 2 72 ? -23.715 0.782   -6.276  1.00 38.89  ? 219 ARG B CZ     1 
ATOM   2972 N  NH1    . ARG D 2 72 ? -24.787 1.570   -6.245  1.00 36.47  ? 219 ARG B NH1    1 
ATOM   2973 N  NH2    . ARG D 2 72 ? -22.522 1.311   -6.498  1.00 37.52  ? 219 ARG B NH2    1 
ATOM   2974 H  H      . ARG D 2 72 ? -24.073 -0.736  -1.598  1.00 50.45  ? 219 ARG B H      1 
ATOM   2975 H  HA     . ARG D 2 72 ? -25.757 -2.689  -1.990  1.00 56.16  ? 219 ARG B HA     1 
ATOM   2976 H  HB2    . ARG D 2 72 ? -23.492 -1.888  -3.462  1.00 54.11  ? 219 ARG B HB2    1 
ATOM   2977 H  HB3    . ARG D 2 72 ? -24.348 -3.142  -3.922  1.00 54.11  ? 219 ARG B HB3    1 
ATOM   2978 H  HG2    . ARG D 2 72 ? -26.245 -1.654  -4.163  1.00 53.53  ? 219 ARG B HG2    1 
ATOM   2979 H  HG3    . ARG D 2 72 ? -25.257 -0.440  -3.907  1.00 53.53  ? 219 ARG B HG3    1 
ATOM   2980 H  HD2    . ARG D 2 72 ? -24.947 -2.158  -6.138  1.00 53.30  ? 219 ARG B HD2    1 
ATOM   2981 H  HD3    . ARG D 2 72 ? -25.769 -0.800  -6.229  1.00 53.30  ? 219 ARG B HD3    1 
ATOM   2982 H  HE     . ARG D 2 72 ? -23.079 -0.990  -6.132  1.00 49.52  ? 219 ARG B HE     1 
ATOM   2983 H  HH11   . ARG D 2 72 ? -25.564 1.234   -6.091  1.00 44.64  ? 219 ARG B HH11   1 
ATOM   2984 H  HH12   . ARG D 2 72 ? -24.703 2.416   -6.378  1.00 44.64  ? 219 ARG B HH12   1 
ATOM   2985 H  HH21   . ARG D 2 72 ? -21.826 0.807   -6.526  1.00 45.89  ? 219 ARG B HH21   1 
ATOM   2986 H  HH22   . ARG D 2 72 ? -22.446 2.156   -6.641  1.00 45.89  ? 219 ARG B HH22   1 
ATOM   2987 N  N      . ARG D 2 73 ? -22.985 -3.630  -0.745  1.00 44.83  ? 220 ARG B N      1 
ATOM   2988 C  CA     . ARG D 2 73 ? -22.363 -4.765  -0.064  1.00 49.35  ? 220 ARG B CA     1 
ATOM   2989 C  C      . ARG D 2 73 ? -22.926 -5.006  1.339   1.00 51.92  ? 220 ARG B C      1 
ATOM   2990 O  O      . ARG D 2 73 ? -23.007 -6.158  1.786   1.00 48.83  ? 220 ARG B O      1 
ATOM   2991 C  CB     . ARG D 2 73 ? -20.870 -4.538  0.066   1.00 53.33  ? 220 ARG B CB     1 
ATOM   2992 C  CG     . ARG D 2 73 ? -20.192 -4.271  -1.230  1.00 50.56  ? 220 ARG B CG     1 
ATOM   2993 C  CD     . ARG D 2 73 ? -18.673 -4.185  -0.987  1.00 59.55  ? 220 ARG B CD     1 
ATOM   2994 N  NE     . ARG D 2 73 ? -18.267 -2.917  -0.373  1.00 52.88  ? 220 ARG B NE     1 
ATOM   2995 C  CZ     . ARG D 2 73 ? -17.008 -2.583  -0.104  1.00 49.43  ? 220 ARG B CZ     1 
ATOM   2996 N  NH1    . ARG D 2 73 ? -16.022 -3.432  -0.382  1.00 51.78  ? 220 ARG B NH1    1 
ATOM   2997 N  NH2    . ARG D 2 73 ? -16.731 -1.393  0.426   1.00 48.38  ? 220 ARG B NH2    1 
ATOM   2998 H  H      . ARG D 2 73 ? -22.557 -2.888  -0.665  1.00 54.67  ? 220 ARG B H      1 
ATOM   2999 H  HA     . ARG D 2 73 ? -22.504 -5.569  -0.589  1.00 60.09  ? 220 ARG B HA     1 
ATOM   3000 H  HB2    . ARG D 2 73 ? -20.719 -3.774  0.644   1.00 64.87  ? 220 ARG B HB2    1 
ATOM   3001 H  HB3    . ARG D 2 73 ? -20.466 -5.330  0.456   1.00 64.87  ? 220 ARG B HB3    1 
ATOM   3002 H  HG2    . ARG D 2 73 ? -20.369 -4.997  -1.849  1.00 61.54  ? 220 ARG B HG2    1 
ATOM   3003 H  HG3    . ARG D 2 73 ? -20.499 -3.426  -1.593  1.00 61.54  ? 220 ARG B HG3    1 
ATOM   3004 H  HD2    . ARG D 2 73 ? -18.407 -4.904  -0.394  1.00 72.33  ? 220 ARG B HD2    1 
ATOM   3005 H  HD3    . ARG D 2 73 ? -18.213 -4.268  -1.837  1.00 72.33  ? 220 ARG B HD3    1 
ATOM   3006 H  HE     . ARG D 2 73 ? -18.884 -2.351  -0.174  1.00 64.32  ? 220 ARG B HE     1 
ATOM   3007 H  HH11   . ARG D 2 73 ? -16.199 -4.196  -0.734  1.00 63.01  ? 220 ARG B HH11   1 
ATOM   3008 H  HH12   . ARG D 2 73 ? -15.208 -3.217  -0.207  1.00 63.01  ? 220 ARG B HH12   1 
ATOM   3009 H  HH21   . ARG D 2 73 ? -17.368 -0.845  0.610   1.00 58.93  ? 220 ARG B HH21   1 
ATOM   3010 H  HH22   . ARG D 2 73 ? -15.917 -1.183  0.608   1.00 58.93  ? 220 ARG B HH22   1 
ATOM   3011 N  N      . ARG D 2 74 ? -23.296 -3.945  2.056   1.00 42.76  ? 221 ARG B N      1 
ATOM   3012 C  CA     . ARG D 2 74 ? -23.603 -4.071  3.467   1.00 46.15  ? 221 ARG B CA     1 
ATOM   3013 C  C      . ARG D 2 74 ? -25.089 -4.069  3.752   1.00 52.08  ? 221 ARG B C      1 
ATOM   3014 O  O      . ARG D 2 74 ? -25.503 -4.649  4.755   1.00 47.20  ? 221 ARG B O      1 
ATOM   3015 C  CB     . ARG D 2 74 ? -22.947 -2.926  4.258   1.00 47.39  ? 221 ARG B CB     1 
ATOM   3016 C  CG     . ARG D 2 74 ? -21.433 -2.855  4.063   1.00 42.00  ? 221 ARG B CG     1 
ATOM   3017 C  CD     . ARG D 2 74 ? -20.785 -1.651  4.738   1.00 50.35  ? 221 ARG B CD     1 
ATOM   3018 N  NE     . ARG D 2 74 ? -19.333 -1.664  4.551   1.00 41.76  ? 221 ARG B NE     1 
ATOM   3019 C  CZ     . ARG D 2 74 ? -18.544 -0.610  4.754   1.00 42.10  ? 221 ARG B CZ     1 
ATOM   3020 N  NH1    . ARG D 2 74 ? -19.056 0.553   5.154   1.00 52.46  ? 221 ARG B NH1    1 
ATOM   3021 N  NH2    . ARG D 2 74 ? -17.240 -0.704  4.542   1.00 40.95  ? 221 ARG B NH2    1 
ATOM   3022 H  H      . ARG D 2 74 ? -23.374 -3.147  1.745   1.00 52.19  ? 221 ARG B H      1 
ATOM   3023 H  HA     . ARG D 2 74 ? -23.237 -4.908  3.794   1.00 56.26  ? 221 ARG B HA     1 
ATOM   3024 H  HB2    . ARG D 2 74 ? -23.327 -2.083  3.965   1.00 57.75  ? 221 ARG B HB2    1 
ATOM   3025 H  HB3    . ARG D 2 74 ? -23.121 -3.056  5.203   1.00 57.75  ? 221 ARG B HB3    1 
ATOM   3026 H  HG2    . ARG D 2 74 ? -21.032 -3.656  4.435   1.00 51.28  ? 221 ARG B HG2    1 
ATOM   3027 H  HG3    . ARG D 2 74 ? -21.242 -2.802  3.113   1.00 51.28  ? 221 ARG B HG3    1 
ATOM   3028 H  HD2    . ARG D 2 74 ? -21.136 -0.836  4.347   1.00 61.29  ? 221 ARG B HD2    1 
ATOM   3029 H  HD3    . ARG D 2 74 ? -20.971 -1.677  5.689   1.00 61.29  ? 221 ARG B HD3    1 
ATOM   3030 H  HE     . ARG D 2 74 ? -18.961 -2.409  4.334   1.00 50.98  ? 221 ARG B HE     1 
ATOM   3031 H  HH11   . ARG D 2 74 ? -19.903 0.626   5.288   1.00 63.82  ? 221 ARG B HH11   1 
ATOM   3032 H  HH12   . ARG D 2 74 ? -18.541 1.229   5.283   1.00 63.82  ? 221 ARG B HH12   1 
ATOM   3033 H  HH21   . ARG D 2 74 ? -16.899 -1.451  4.285   1.00 50.01  ? 221 ARG B HH21   1 
ATOM   3034 H  HH22   . ARG D 2 74 ? -16.732 -0.024  4.678   1.00 50.01  ? 221 ARG B HH22   1 
ATOM   3035 N  N      . LEU D 2 75 ? -25.913 -3.448  2.907   1.00 55.34  ? 222 LEU B N      1 
ATOM   3036 C  CA     . LEU D 2 75 ? -27.344 -3.346  3.171   1.00 48.46  ? 222 LEU B CA     1 
ATOM   3037 C  C      . LEU D 2 75 ? -28.208 -4.108  2.197   1.00 51.18  ? 222 LEU B C      1 
ATOM   3038 O  O      . LEU D 2 75 ? -29.241 -4.661  2.594   1.00 52.89  ? 222 LEU B O      1 
ATOM   3039 C  CB     . LEU D 2 75 ? -27.772 -1.883  3.133   1.00 48.89  ? 222 LEU B CB     1 
ATOM   3040 C  CG     . LEU D 2 75 ? -27.790 -1.121  4.448   1.00 58.50  ? 222 LEU B CG     1 
ATOM   3041 C  CD1    . LEU D 2 75 ? -26.616 -1.473  5.297   1.00 53.65  ? 222 LEU B CD1    1 
ATOM   3042 C  CD2    . LEU D 2 75 ? -27.797 0.373   4.116   1.00 51.49  ? 222 LEU B CD2    1 
ATOM   3043 H  H      . LEU D 2 75 ? -25.664 -3.077  2.172   1.00 67.28  ? 222 LEU B H      1 
ATOM   3044 H  HA     . LEU D 2 75 ? -27.525 -3.687  4.061   1.00 59.02  ? 222 LEU B HA     1 
ATOM   3045 H  HB2    . LEU D 2 75 ? -27.168 -1.410  2.539   1.00 59.54  ? 222 LEU B HB2    1 
ATOM   3046 H  HB3    . LEU D 2 75 ? -28.670 -1.843  2.770   1.00 59.54  ? 222 LEU B HB3    1 
ATOM   3047 H  HG     . LEU D 2 75 ? -28.600 -1.333  4.937   1.00 71.08  ? 222 LEU B HG     1 
ATOM   3048 H  HD11   . LEU D 2 75 ? -26.662 -0.969  6.124   1.00 65.26  ? 222 LEU B HD11   1 
ATOM   3049 H  HD12   . LEU D 2 75 ? -26.638 -2.424  5.488   1.00 65.26  ? 222 LEU B HD12   1 
ATOM   3050 H  HD13   . LEU D 2 75 ? -25.802 -1.251  4.819   1.00 65.26  ? 222 LEU B HD13   1 
ATOM   3051 H  HD21   . LEU D 2 75 ? -27.808 0.879   4.943   1.00 62.66  ? 222 LEU B HD21   1 
ATOM   3052 H  HD22   . LEU D 2 75 ? -26.999 0.586   3.608   1.00 62.66  ? 222 LEU B HD22   1 
ATOM   3053 H  HD23   . LEU D 2 75 ? -28.588 0.575   3.592   1.00 62.66  ? 222 LEU B HD23   1 
ATOM   3054 N  N      . LEU D 2 76 ? -27.841 -4.087  0.926   1.00 50.11  ? 223 LEU B N      1 
ATOM   3055 C  CA     . LEU D 2 76 ? -28.740 -4.599  -0.107  1.00 49.20  ? 223 LEU B CA     1 
ATOM   3056 C  C      . LEU D 2 76 ? -29.018 -6.085  0.072   1.00 49.93  ? 223 LEU B C      1 
ATOM   3057 O  O      . LEU D 2 76 ? -30.200 -6.469  0.093   1.00 54.06  ? 223 LEU B O      1 
ATOM   3058 C  CB     . LEU D 2 76 ? -28.150 -4.293  -1.492  1.00 50.00  ? 223 LEU B CB     1 
ATOM   3059 C  CG     . LEU D 2 76 ? -29.002 -4.686  -2.699  1.00 50.37  ? 223 LEU B CG     1 
ATOM   3060 C  CD1    . LEU D 2 76 ? -30.356 -4.013  -2.623  1.00 46.98  ? 223 LEU B CD1    1 
ATOM   3061 C  CD2    . LEU D 2 76 ? -28.312 -4.329  -4.033  1.00 48.85  ? 223 LEU B CD2    1 
ATOM   3062 H  H      . LEU D 2 76 ? -27.090 -3.787  0.633   1.00 61.00  ? 223 LEU B H      1 
ATOM   3063 H  HA     . LEU D 2 76 ? -29.588 -4.132  -0.039  1.00 59.92  ? 223 LEU B HA     1 
ATOM   3064 H  HB2    . LEU D 2 76 ? -27.993 -3.338  -1.551  1.00 60.87  ? 223 LEU B HB2    1 
ATOM   3065 H  HB3    . LEU D 2 76 ? -27.305 -4.763  -1.572  1.00 60.87  ? 223 LEU B HB3    1 
ATOM   3066 H  HG     . LEU D 2 76 ? -29.144 -5.645  -2.684  1.00 61.32  ? 223 LEU B HG     1 
ATOM   3067 H  HD11   . LEU D 2 76 ? -30.881 -4.273  -3.395  1.00 57.25  ? 223 LEU B HD11   1 
ATOM   3068 H  HD12   . LEU D 2 76 ? -30.802 -4.294  -1.809  1.00 57.25  ? 223 LEU B HD12   1 
ATOM   3069 H  HD13   . LEU D 2 76 ? -30.230 -3.051  -2.616  1.00 57.25  ? 223 LEU B HD13   1 
ATOM   3070 H  HD21   . LEU D 2 76 ? -28.888 -4.596  -4.767  1.00 59.49  ? 223 LEU B HD21   1 
ATOM   3071 H  HD22   . LEU D 2 76 ? -28.159 -3.372  -4.063  1.00 59.49  ? 223 LEU B HD22   1 
ATOM   3072 H  HD23   . LEU D 2 76 ? -27.466 -4.801  -4.087  1.00 59.49  ? 223 LEU B HD23   1 
ATOM   3073 N  N      . PRO D 2 77 ? -28.014 -6.964  0.236   1.00 48.34  ? 224 PRO B N      1 
ATOM   3074 C  CA     . PRO D 2 77 ? -28.298 -8.406  0.332   1.00 52.93  ? 224 PRO B CA     1 
ATOM   3075 C  C      . PRO D 2 77 ? -29.362 -8.728  1.374   1.00 61.99  ? 224 PRO B C      1 
ATOM   3076 O  O      . PRO D 2 77 ? -30.396 -9.309  1.020   1.00 67.01  ? 224 PRO B O      1 
ATOM   3077 C  CB     . PRO D 2 77 ? -26.938 -8.998  0.726   1.00 52.04  ? 224 PRO B CB     1 
ATOM   3078 C  CG     . PRO D 2 77 ? -25.942 -8.005  0.220   1.00 50.02  ? 224 PRO B CG     1 
ATOM   3079 C  CD     . PRO D 2 77 ? -26.577 -6.673  0.402   1.00 52.57  ? 224 PRO B CD     1 
ATOM   3080 H  HA     . PRO D 2 77 ? -28.568 -8.759  -0.530  1.00 64.39  ? 224 PRO B HA     1 
ATOM   3081 H  HB2    . PRO D 2 77 ? -26.882 -9.082  1.691   1.00 63.32  ? 224 PRO B HB2    1 
ATOM   3082 H  HB3    . PRO D 2 77 ? -26.816 -9.859  0.297   1.00 63.32  ? 224 PRO B HB3    1 
ATOM   3083 H  HG2    . PRO D 2 77 ? -25.126 -8.068  0.740   1.00 60.90  ? 224 PRO B HG2    1 
ATOM   3084 H  HG3    . PRO D 2 77 ? -25.764 -8.173  -0.719  1.00 60.90  ? 224 PRO B HG3    1 
ATOM   3085 H  HD2    . PRO D 2 77 ? -26.400 -6.332  1.293   1.00 63.96  ? 224 PRO B HD2    1 
ATOM   3086 H  HD3    . PRO D 2 77 ? -26.274 -6.057  -0.283  1.00 63.96  ? 224 PRO B HD3    1 
ATOM   3087 N  N      . ASP D 2 78 ? -29.131 -8.360  2.645   1.00 54.69  ? 225 ASP B N      1 
ATOM   3088 C  CA     . ASP D 2 78 ? -30.158 -8.531  3.680   1.00 57.09  ? 225 ASP B CA     1 
ATOM   3089 C  C      . ASP D 2 78 ? -31.515 -7.993  3.235   1.00 61.98  ? 225 ASP B C      1 
ATOM   3090 O  O      . ASP D 2 78 ? -32.556 -8.545  3.613   1.00 61.26  ? 225 ASP B O      1 
ATOM   3091 C  CB     . ASP D 2 78 ? -29.742 -7.831  4.982   1.00 54.84  ? 225 ASP B CB     1 
ATOM   3092 C  CG     . ASP D 2 78 ? -28.902 -8.727  5.910   1.00 45.48  ? 225 ASP B CG     1 
ATOM   3093 H  H      . ASP D 2 78 ? -28.396 -8.015  2.928   1.00 66.50  ? 225 ASP B H      1 
ATOM   3094 H  HA     . ASP D 2 78 ? -30.259 -9.477  3.868   1.00 69.38  ? 225 ASP B HA     1 
ATOM   3095 H  HB2    . ASP D 2 78 ? -29.213 -7.048  4.763   1.00 66.68  ? 225 ASP B HB2    1 
ATOM   3096 H  HB3    . ASP D 2 78 ? -30.541 -7.567  5.465   1.00 66.68  ? 225 ASP B HB3    1 
ATOM   3097 N  N      . MET D 2 79 ? -31.532 -6.920  2.431   1.00 63.19  ? 226 MET B N      1 
ATOM   3098 C  CA     . MET D 2 79 ? -32.804 -6.384  1.945   1.00 60.41  ? 226 MET B CA     1 
ATOM   3099 C  C      . MET D 2 79 ? -33.459 -7.350  0.976   1.00 54.91  ? 226 MET B C      1 
ATOM   3100 O  O      . MET D 2 79 ? -34.677 -7.552  1.022   1.00 63.03  ? 226 MET B O      1 
ATOM   3101 C  CB     . MET D 2 79 ? -32.619 -5.036  1.248   1.00 57.59  ? 226 MET B CB     1 
ATOM   3102 C  CG     . MET D 2 79 ? -32.479 -3.815  2.138   1.00 52.42  ? 226 MET B CG     1 
ATOM   3103 S  SD     . MET D 2 79 ? -32.268 -2.390  1.020   1.00 55.17  ? 226 MET B SD     1 
ATOM   3104 C  CE     . MET D 2 79 ? -32.219 -1.108  2.283   1.00 44.60  ? 226 MET B CE     1 
ATOM   3105 H  H      . MET D 2 79 ? -30.835 -6.495  2.160   1.00 76.71  ? 226 MET B H      1 
ATOM   3106 H  HA     . MET D 2 79 ? -33.396 -6.249  2.702   1.00 73.37  ? 226 MET B HA     1 
ATOM   3107 H  HB2    . MET D 2 79 ? -31.817 -5.086  0.704   1.00 69.98  ? 226 MET B HB2    1 
ATOM   3108 H  HB3    . MET D 2 79 ? -33.386 -4.885  0.674   1.00 69.98  ? 226 MET B HB3    1 
ATOM   3109 H  HG2    . MET D 2 79 ? -33.283 -3.690  2.667   1.00 63.78  ? 226 MET B HG2    1 
ATOM   3110 H  HG3    . MET D 2 79 ? -31.695 -3.898  2.703   1.00 63.78  ? 226 MET B HG3    1 
ATOM   3111 H  HE1    . MET D 2 79 ? -32.107 -0.246  1.853   1.00 54.39  ? 226 MET B HE1    1 
ATOM   3112 H  HE2    . MET D 2 79 ? -33.051 -1.124  2.781   1.00 54.39  ? 226 MET B HE2    1 
ATOM   3113 H  HE3    . MET D 2 79 ? -31.473 -1.281  2.879   1.00 54.39  ? 226 MET B HE3    1 
ATOM   3114 N  N      . LEU D 2 80 ? -32.672 -7.926  0.070   1.00 58.27  ? 227 LEU B N      1 
ATOM   3115 C  CA     . LEU D 2 80 ? -33.167 -8.855  -0.942  1.00 62.95  ? 227 LEU B CA     1 
ATOM   3116 C  C      . LEU D 2 80 ? -33.625 -10.186 -0.352  1.00 69.30  ? 227 LEU B C      1 
ATOM   3117 O  O      . LEU D 2 80 ? -33.996 -11.074 -1.148  1.00 66.17  ? 227 LEU B O      1 
ATOM   3118 C  CB     . LEU D 2 80 ? -32.102 -9.099  -2.010  1.00 60.02  ? 227 LEU B CB     1 
ATOM   3119 C  CG     . LEU D 2 80 ? -31.659 -7.829  -2.759  1.00 62.40  ? 227 LEU B CG     1 
ATOM   3120 C  CD1    . LEU D 2 80 ? -30.679 -8.121  -3.850  1.00 54.49  ? 227 LEU B CD1    1 
ATOM   3121 C  CD2    . LEU D 2 80 ? -32.824 -7.088  -3.369  1.00 64.66  ? 227 LEU B CD2    1 
ATOM   3122 H  H      . LEU D 2 80 ? -31.824 -7.789  0.020   1.00 70.80  ? 227 LEU B H      1 
ATOM   3123 H  HA     . LEU D 2 80 ? -33.933 -8.453  -1.381  1.00 76.42  ? 227 LEU B HA     1 
ATOM   3124 H  HB2    . LEU D 2 80 ? -31.317 -9.480  -1.585  1.00 72.90  ? 227 LEU B HB2    1 
ATOM   3125 H  HB3    . LEU D 2 80 ? -32.454 -9.721  -2.665  1.00 72.90  ? 227 LEU B HB3    1 
ATOM   3126 H  HG     . LEU D 2 80 ? -31.228 -7.231  -2.128  1.00 75.76  ? 227 LEU B HG     1 
ATOM   3127 H  HD11   . LEU D 2 80 ? -30.436 -7.289  -4.286  1.00 66.27  ? 227 LEU B HD11   1 
ATOM   3128 H  HD12   . LEU D 2 80 ? -29.891 -8.535  -3.464  1.00 66.27  ? 227 LEU B HD12   1 
ATOM   3129 H  HD13   . LEU D 2 80 ? -31.090 -8.722  -4.490  1.00 66.27  ? 227 LEU B HD13   1 
ATOM   3130 H  HD21   . LEU D 2 80 ? -32.492 -6.300  -3.826  1.00 78.47  ? 227 LEU B HD21   1 
ATOM   3131 H  HD22   . LEU D 2 80 ? -33.274 -7.673  -3.999  1.00 78.47  ? 227 LEU B HD22   1 
ATOM   3132 H  HD23   . LEU D 2 80 ? -33.437 -6.828  -2.663  1.00 78.47  ? 227 LEU B HD23   1 
ATOM   3133 N  N      . ARG D 2 81 ? -33.474 -10.382 0.974   1.00 70.05  ? 228 ARG B N      1 
ATOM   3134 C  CA     . ARG D 2 81 ? -34.124 -11.476 1.718   1.00 68.90  ? 228 ARG B CA     1 
ATOM   3135 C  C      . ARG D 2 81 ? -35.617 -11.159 1.842   1.00 70.13  ? 228 ARG B C      1 
ATOM   3136 O  O      . ARG D 2 81 ? -36.113 -10.703 2.881   1.00 70.11  ? 228 ARG B O      1 
ATOM   3137 C  CB     . ARG D 2 81 ? -33.491 -11.657 3.094   1.00 68.05  ? 228 ARG B CB     1 
ATOM   3138 H  H      . ARG D 2 81 ? -32.986 -9.880  1.474   1.00 84.94  ? 228 ARG B H      1 
ATOM   3139 H  HA     . ARG D 2 81 ? -34.026 -12.305 1.224   1.00 83.56  ? 228 ARG B HA     1 
ATOM   3140 N  N      . LYS D 2 82 ? -36.345 -11.411 0.749   1.00 70.29  ? 229 LYS B N      1 
ATOM   3141 C  CA     . LYS D 2 82 ? -37.792 -11.156 0.668   1.00 74.19  ? 229 LYS B CA     1 
ATOM   3142 C  C      . LYS D 2 82 ? -38.457 -12.122 -0.337  1.00 73.86  ? 229 LYS B C      1 
ATOM   3143 O  O      . LYS D 2 82 ? -38.025 -12.241 -1.507  1.00 76.47  ? 229 LYS B O      1 
ATOM   3144 C  CB     . LYS D 2 82 ? -38.058 -9.695  0.252   1.00 73.62  ? 229 LYS B CB     1 
ATOM   3145 C  CG     . LYS D 2 82 ? -37.756 -9.418  -1.256  1.00 71.75  ? 229 LYS B CG     1 
ATOM   3146 C  CD     . LYS D 2 82 ? -37.512 -7.939  -1.564  1.00 60.14  ? 229 LYS B CD     1 
ATOM   3147 H  H      . LYS D 2 82 ? -36.017 -11.738 0.024   1.00 85.22  ? 229 LYS B H      1 
ATOM   3148 H  HA     . LYS D 2 82 ? -38.192 -11.302 1.539   1.00 89.90  ? 229 LYS B HA     1 
ATOM   3149 H  HB2    . LYS D 2 82 ? -38.992 -9.488  0.413   1.00 89.22  ? 229 LYS B HB2    1 
ATOM   3150 H  HB3    . LYS D 2 82 ? -37.494 -9.110  0.782   1.00 89.22  ? 229 LYS B HB3    1 
ATOM   3151 H  HG2    . LYS D 2 82 ? -36.961 -9.911  -1.513  1.00 86.98  ? 229 LYS B HG2    1 
ATOM   3152 H  HG3    . LYS D 2 82 ? -38.513 -9.712  -1.787  1.00 86.98  ? 229 LYS B HG3    1 
ATOM   3153 H  HD2    . LYS D 2 82 ? -37.973 -7.399  -0.904  1.00 73.04  ? 229 LYS B HD2    1 
ATOM   3154 H  HD3    . LYS D 2 82 ? -36.558 -7.763  -1.530  1.00 73.04  ? 229 LYS B HD3    1 
HETATM 3155 CA CA     . CA  E 3 .  ? -12.243 4.321   -7.755  1.00 87.16  ? 101 CA  L CA     1 
HETATM 3156 O  O      . HOH F 4 .  ? -1.864  2.253   -24.770 1.00 53.33  ? 201 HOH L O      1 
HETATM 3157 O  O      . HOH F 4 .  ? -9.319  12.871  -15.371 1.00 42.28  ? 202 HOH L O      1 
HETATM 3158 O  O      . HOH F 4 .  ? -9.108  -0.647  -24.877 1.00 49.26  ? 203 HOH L O      1 
HETATM 3159 O  O      . HOH F 4 .  ? -4.377  9.452   -17.727 1.00 30.27  ? 204 HOH L O      1 
HETATM 3160 O  O      . HOH F 4 .  ? -8.484  -4.620  -4.222  1.00 48.62  ? 205 HOH L O      1 
HETATM 3161 O  O      . HOH F 4 .  ? -11.127 9.362   -13.904 1.00 37.33  ? 206 HOH L O      1 
HETATM 3162 O  O      . HOH F 4 .  ? -15.372 5.699   -9.284  1.00 42.86  ? 207 HOH L O      1 
HETATM 3163 O  O      . HOH F 4 .  ? -20.299 -2.138  -4.334  1.00 39.69  ? 208 HOH L O      1 
HETATM 3164 O  O      . HOH F 4 .  ? -2.993  5.724   -21.158 1.00 41.78  ? 209 HOH L O      1 
HETATM 3165 O  O      . HOH F 4 .  ? -12.283 5.405   -11.464 1.00 45.90  ? 210 HOH L O      1 
HETATM 3166 O  O      . HOH F 4 .  ? -20.201 4.464   -8.293  1.00 47.02  ? 211 HOH L O      1 
HETATM 3167 O  O      . HOH F 4 .  ? -15.529 -9.248  -9.058  1.00 46.19  ? 212 HOH L O      1 
HETATM 3168 O  O      . HOH F 4 .  ? -17.976 6.308   -8.289  1.00 48.10  ? 213 HOH L O      1 
HETATM 3169 O  O      . HOH F 4 .  ? -20.686 -7.462  -8.734  1.00 59.26  ? 214 HOH L O      1 
HETATM 3170 O  O      . HOH F 4 .  ? -12.082 16.487  -14.329 1.00 52.90  ? 215 HOH L O      1 
HETATM 3171 O  O      . HOH G 4 .  ? -26.010 4.092   9.255   1.00 55.44  ? 201 HOH M O      1 
HETATM 3172 O  O      . HOH G 4 .  ? -20.857 -4.540  10.183  1.00 50.36  ? 202 HOH M O      1 
HETATM 3173 O  O      . HOH G 4 .  ? 0.533   3.716   -6.302  1.00 41.14  ? 203 HOH M O      1 
HETATM 3174 O  O      . HOH G 4 .  ? -8.759  10.992  2.950   1.00 56.85  ? 204 HOH M O      1 
HETATM 3175 O  O      . HOH G 4 .  ? -13.598 7.208   6.920   1.00 50.39  ? 205 HOH M O      1 
HETATM 3176 O  O      . HOH G 4 .  ? -6.071  -0.595  -2.633  1.00 45.60  ? 206 HOH M O      1 
HETATM 3177 O  O      . HOH G 4 .  ? -13.379 8.738   -1.691  1.00 45.38  ? 207 HOH M O      1 
HETATM 3178 O  O      . HOH G 4 .  ? -7.386  -2.535  -5.506  1.00 45.23  ? 208 HOH M O      1 
HETATM 3179 O  O      . HOH G 4 .  ? -12.195 4.565   -4.479  1.00 39.98  ? 209 HOH M O      1 
HETATM 3180 O  O      . HOH G 4 .  ? -16.991 9.925   0.566   1.00 40.12  ? 210 HOH M O      1 
HETATM 3181 O  O      . HOH G 4 .  ? -25.002 4.093   6.631   1.00 47.05  ? 211 HOH M O      1 
HETATM 3182 O  O      . HOH G 4 .  ? -4.201  -1.462  -12.972 1.00 47.61  ? 212 HOH M O      1 
HETATM 3183 O  O      . HOH G 4 .  ? -21.336 3.866   4.787   1.00 39.43  ? 213 HOH M O      1 
HETATM 3184 O  O      . HOH G 4 .  ? -15.179 11.914  0.423   1.00 44.37  ? 214 HOH M O      1 
HETATM 3185 O  O      . HOH G 4 .  ? -9.251  4.575   -9.704  1.00 36.83  ? 215 HOH M O      1 
HETATM 3186 O  O      . HOH G 4 .  ? -8.099  11.953  -0.668  1.00 43.87  ? 216 HOH M O      1 
HETATM 3187 O  O      . HOH G 4 .  ? -22.265 -3.121  7.629   1.00 48.60  ? 217 HOH M O      1 
HETATM 3188 O  O      . HOH G 4 .  ? -12.331 14.589  -1.911  1.00 51.27  ? 218 HOH M O      1 
HETATM 3189 O  O      . HOH G 4 .  ? -3.565  -8.333  -8.986  1.00 65.76  ? 219 HOH M O      1 
HETATM 3190 O  O      . HOH H 4 .  ? 5.430   16.900  -24.596 1.00 51.18  ? 301 HOH A O      1 
HETATM 3191 O  O      . HOH H 4 .  ? -7.582  10.987  -15.743 1.00 36.67  ? 302 HOH A O      1 
HETATM 3192 O  O      . HOH H 4 .  ? 0.316   19.214  -12.242 1.00 42.71  ? 303 HOH A O      1 
HETATM 3193 O  O      . HOH H 4 .  ? -0.084  4.054   -8.847  1.00 35.77  ? 304 HOH A O      1 
HETATM 3194 O  O      . HOH H 4 .  ? -8.128  15.072  -13.878 1.00 44.80  ? 305 HOH A O      1 
HETATM 3195 O  O      . HOH H 4 .  ? -7.432  4.472   -15.331 1.00 45.55  ? 306 HOH A O      1 
HETATM 3196 O  O      . HOH H 4 .  ? 10.125  9.104   -7.587  1.00 49.95  ? 307 HOH A O      1 
HETATM 3197 O  O      . HOH H 4 .  ? 12.168  -1.776  -9.850  1.00 47.77  ? 308 HOH A O      1 
HETATM 3198 O  O      . HOH H 4 .  ? -1.008  4.553   -19.914 1.00 42.48  ? 309 HOH A O      1 
HETATM 3199 O  O      . HOH H 4 .  ? 2.117   6.343   0.225   1.00 36.75  ? 310 HOH A O      1 
HETATM 3200 O  O      . HOH H 4 .  ? -2.332  3.185   -22.095 1.00 45.23  ? 311 HOH A O      1 
HETATM 3201 O  O      . HOH H 4 .  ? 4.634   -5.432  -5.340  1.00 59.04  ? 312 HOH A O      1 
HETATM 3202 O  O      . HOH H 4 .  ? 13.201  13.136  -9.333  1.00 46.30  ? 313 HOH A O      1 
HETATM 3203 O  O      . HOH H 4 .  ? 8.586   -3.123  -23.188 1.00 53.15  ? 314 HOH A O      1 
HETATM 3204 O  O      . HOH H 4 .  ? 6.863   -7.476  -9.988  1.00 67.64  ? 315 HOH A O      1 
HETATM 3205 O  O      . HOH H 4 .  ? 5.226   14.347  3.266   1.00 49.44  ? 316 HOH A O      1 
HETATM 3206 O  O      . HOH H 4 .  ? 14.601  9.107   -16.135 1.00 54.78  ? 317 HOH A O      1 
HETATM 3207 O  O      . HOH H 4 .  ? 10.168  0.945   -1.837  1.00 52.75  ? 318 HOH A O      1 
HETATM 3208 O  O      . HOH H 4 .  ? 13.758  -9.539  -9.559  1.00 61.13  ? 319 HOH A O      1 
HETATM 3209 O  O      . HOH I 4 .  ? -10.158 13.821  10.388  1.00 72.69  ? 301 HOH B O      1 
HETATM 3210 O  O      . HOH I 4 .  ? -33.219 1.713   -10.006 1.00 47.53  ? 302 HOH B O      1 
HETATM 3211 O  O      . HOH I 4 .  ? -35.254 10.908  -2.654  1.00 41.13  ? 303 HOH B O      1 
HETATM 3212 O  O      . HOH I 4 .  ? -31.710 4.343   -11.139 1.00 39.79  ? 304 HOH B O      1 
HETATM 3213 O  O      . HOH I 4 .  ? -30.124 13.582  10.683  1.00 37.04  ? 305 HOH B O      1 
HETATM 3214 O  O      . HOH I 4 .  ? -25.702 4.227   -9.683  1.00 35.79  ? 306 HOH B O      1 
HETATM 3215 O  O      . HOH I 4 .  ? -21.618 3.853   -6.327  1.00 30.75  ? 307 HOH B O      1 
HETATM 3216 O  O      . HOH I 4 .  ? -19.957 5.302   2.541   1.00 36.11  ? 308 HOH B O      1 
HETATM 3217 O  O      . HOH I 4 .  ? -20.311 7.835   1.806   1.00 29.25  ? 309 HOH B O      1 
HETATM 3218 O  O      . HOH I 4 .  ? -17.165 3.398   -1.200  1.00 44.63  ? 310 HOH B O      1 
HETATM 3219 O  O      . HOH I 4 .  ? -20.883 17.378  -5.004  1.00 53.46  ? 311 HOH B O      1 
HETATM 3220 O  O      . HOH I 4 .  ? -32.565 -13.050 -3.385  1.00 61.84  ? 312 HOH B O      1 
HETATM 3221 O  O      . HOH I 4 .  ? -35.954 10.045  -5.465  1.00 44.89  ? 313 HOH B O      1 
HETATM 3222 O  O      . HOH I 4 .  ? -35.708 -3.869  4.796   1.00 58.35  ? 314 HOH B O      1 
HETATM 3223 O  O      . HOH I 4 .  ? -30.833 -14.633 -3.671  1.00 52.49  ? 315 HOH B O      1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   1   1   DA  DA  L . n 
A 1 2   DT  2   2   2   DT  DT  L . n 
A 1 3   DT  3   3   3   DT  DT  L . n 
A 1 4   DG  4   4   4   DG  DG  L . n 
A 1 5   DA  5   5   5   DA  DA  L . n 
A 1 6   DC  6   6   6   DC  DC  L . n 
A 1 7   DA  7   7   7   DA  DA  L . n 
A 1 8   DG  8   8   8   DG  DG  L . n 
A 1 9   DC  9   9   9   DC  DC  L . n 
A 1 10  DT  10  10  10  DT  DT  L . n 
A 1 11  DG  11  11  11  DG  DG  L . n 
A 1 12  DT  12  12  12  DT  DT  L . n 
A 1 13  DC  13  13  13  DC  DC  L . n 
A 1 14  DA  14  14  14  DA  DA  L . n 
A 1 15  DA  15  15  15  DA  DA  L . n 
A 1 16  DT  16  16  16  DT  DT  L . n 
B 1 1   DA  1   1   1   DA  DA  M . n 
B 1 2   DT  2   2   2   DT  DT  M . n 
B 1 3   DT  3   3   3   DT  DT  M . n 
B 1 4   DG  4   4   4   DG  DG  M . n 
B 1 5   DA  5   5   5   DA  DA  M . n 
B 1 6   DC  6   6   6   DC  DC  M . n 
B 1 7   DA  7   7   7   DA  DA  M . n 
B 1 8   DG  8   8   8   DG  DG  M . n 
B 1 9   DC  9   9   9   DC  DC  M . n 
B 1 10  DT  10  10  10  DT  DT  M . n 
B 1 11  DG  11  11  11  DG  DG  M . n 
B 1 12  DT  12  12  12  DT  DT  M . n 
B 1 13  DC  13  13  13  DC  DC  M . n 
B 1 14  DA  14  14  14  DA  DA  M . n 
B 1 15  DA  15  15  15  DA  DA  M . n 
B 1 16  DT  16  16  16  DT  DT  M . n 
C 2 1   GLY 1   148 ?   ?   ?   A . n 
C 2 2   PRO 2   149 ?   ?   ?   A . n 
C 2 3   MET 3   150 ?   ?   ?   A . n 
C 2 4   ASP 4   151 ?   ?   ?   A . n 
C 2 5   ILE 5   152 ?   ?   ?   A . n 
C 2 6   PRO 6   153 ?   ?   ?   A . n 
C 2 7   LEU 7   154 ?   ?   ?   A . n 
C 2 8   ASP 8   155 ?   ?   ?   A . n 
C 2 9   LEU 9   156 ?   ?   ?   A . n 
C 2 10  SER 10  157 ?   ?   ?   A . n 
C 2 11  SER 11  158 ?   ?   ?   A . n 
C 2 12  SER 12  159 ?   ?   ?   A . n 
C 2 13  ALA 13  160 ?   ?   ?   A . n 
C 2 14  GLY 14  161 ?   ?   ?   A . n 
C 2 15  SER 15  162 ?   ?   ?   A . n 
C 2 16  GLY 16  163 ?   ?   ?   A . n 
C 2 17  LYS 17  164 ?   ?   ?   A . n 
C 2 18  ARG 18  165 ?   ?   ?   A . n 
C 2 19  ARG 19  166 ?   ?   ?   A . n 
C 2 20  ARG 20  167 ?   ?   ?   A . n 
C 2 21  ARG 21  168 168 ARG ARG A . n 
C 2 22  GLY 22  169 169 GLY GLY A . n 
C 2 23  ASN 23  170 170 ASN ASN A . n 
C 2 24  LEU 24  171 171 LEU LEU A . n 
C 2 25  PRO 25  172 172 PRO PRO A . n 
C 2 26  LYS 26  173 173 LYS LYS A . n 
C 2 27  GLU 27  174 174 GLU GLU A . n 
C 2 28  SER 28  175 175 SER SER A . n 
C 2 29  VAL 29  176 176 VAL VAL A . n 
C 2 30  GLN 30  177 177 GLN GLN A . n 
C 2 31  ILE 31  178 178 ILE ILE A . n 
C 2 32  LEU 32  179 179 LEU LEU A . n 
C 2 33  ARG 33  180 180 ARG ARG A . n 
C 2 34  ASP 34  181 181 ASP ASP A . n 
C 2 35  TRP 35  182 182 TRP TRP A . n 
C 2 36  LEU 36  183 183 LEU LEU A . n 
C 2 37  TYR 37  184 184 TYR TYR A . n 
C 2 38  GLU 38  185 185 GLU GLU A . n 
C 2 39  HIS 39  186 186 HIS HIS A . n 
C 2 40  ARG 40  187 187 ARG ARG A . n 
C 2 41  TYR 41  188 188 TYR TYR A . n 
C 2 42  ASN 42  189 189 ASN ASN A . n 
C 2 43  ALA 43  190 190 ALA ALA A . n 
C 2 44  TYR 44  191 191 TYR TYR A . n 
C 2 45  PRO 45  192 192 PRO PRO A . n 
C 2 46  SER 46  193 193 SER SER A . n 
C 2 47  GLU 47  194 194 GLU GLU A . n 
C 2 48  GLN 48  195 195 GLN GLN A . n 
C 2 49  GLU 49  196 196 GLU GLU A . n 
C 2 50  LYS 50  197 197 LYS LYS A . n 
C 2 51  ALA 51  198 198 ALA ALA A . n 
C 2 52  LEU 52  199 199 LEU LEU A . n 
C 2 53  LEU 53  200 200 LEU LEU A . n 
C 2 54  SER 54  201 201 SER SER A . n 
C 2 55  GLN 55  202 202 GLN GLN A . n 
C 2 56  GLN 56  203 203 GLN GLN A . n 
C 2 57  THR 57  204 204 THR THR A . n 
C 2 58  HIS 58  205 205 HIS HIS A . n 
C 2 59  LEU 59  206 206 LEU LEU A . n 
C 2 60  SER 60  207 207 SER SER A . n 
C 2 61  THR 61  208 208 THR THR A . n 
C 2 62  LEU 62  209 209 LEU LEU A . n 
C 2 63  GLN 63  210 210 GLN GLN A . n 
C 2 64  VAL 64  211 211 VAL VAL A . n 
C 2 65  CYS 65  212 212 CYS CYS A . n 
C 2 66  ASN 66  213 213 ASN ASN A . n 
C 2 67  TRP 67  214 214 TRP TRP A . n 
C 2 68  PHE 68  215 215 PHE PHE A . n 
C 2 69  ILE 69  216 216 ILE ILE A . n 
C 2 70  ASN 70  217 217 ASN ASN A . n 
C 2 71  ALA 71  218 218 ALA ALA A . n 
C 2 72  ARG 72  219 219 ARG ARG A . n 
C 2 73  ARG 73  220 220 ARG ARG A . n 
C 2 74  ARG 74  221 221 ARG ARG A . n 
C 2 75  LEU 75  222 222 LEU LEU A . n 
C 2 76  LEU 76  223 223 LEU LEU A . n 
C 2 77  PRO 77  224 224 PRO PRO A . n 
C 2 78  ASP 78  225 225 ASP ASP A . n 
C 2 79  MET 79  226 226 MET MET A . n 
C 2 80  LEU 80  227 227 LEU LEU A . n 
C 2 81  ARG 81  228 228 ARG ARG A . n 
C 2 82  LYS 82  229 229 LYS LYS A . n 
C 2 83  ASP 83  230 230 ASP ASP A . n 
C 2 84  GLY 84  231 231 GLY GLY A . n 
C 2 85  LYS 85  232 232 LYS LYS A . n 
C 2 86  ASP 86  233 233 ASP ASP A . n 
C 2 87  PRO 87  234 234 PRO PRO A . n 
C 2 88  ASN 88  235 ?   ?   ?   A . n 
C 2 89  GLN 89  236 ?   ?   ?   A . n 
C 2 90  PHE 90  237 ?   ?   ?   A . n 
C 2 91  THR 91  238 ?   ?   ?   A . n 
C 2 92  ILE 92  239 ?   ?   ?   A . n 
C 2 93  SER 93  240 ?   ?   ?   A . n 
C 2 94  ARG 94  241 ?   ?   ?   A . n 
C 2 95  ARG 95  242 ?   ?   ?   A . n 
C 2 96  GLY 96  243 ?   ?   ?   A . n 
C 2 97  ALA 97  244 ?   ?   ?   A . n 
C 2 98  LYS 98  245 ?   ?   ?   A . n 
C 2 99  ILE 99  246 ?   ?   ?   A . n 
C 2 100 SER 100 247 ?   ?   ?   A . n 
C 2 101 GLU 101 248 ?   ?   ?   A . n 
D 2 1   GLY 1   148 ?   ?   ?   B . n 
D 2 2   PRO 2   149 ?   ?   ?   B . n 
D 2 3   MET 3   150 ?   ?   ?   B . n 
D 2 4   ASP 4   151 ?   ?   ?   B . n 
D 2 5   ILE 5   152 ?   ?   ?   B . n 
D 2 6   PRO 6   153 ?   ?   ?   B . n 
D 2 7   LEU 7   154 ?   ?   ?   B . n 
D 2 8   ASP 8   155 ?   ?   ?   B . n 
D 2 9   LEU 9   156 ?   ?   ?   B . n 
D 2 10  SER 10  157 ?   ?   ?   B . n 
D 2 11  SER 11  158 ?   ?   ?   B . n 
D 2 12  SER 12  159 ?   ?   ?   B . n 
D 2 13  ALA 13  160 ?   ?   ?   B . n 
D 2 14  GLY 14  161 ?   ?   ?   B . n 
D 2 15  SER 15  162 ?   ?   ?   B . n 
D 2 16  GLY 16  163 ?   ?   ?   B . n 
D 2 17  LYS 17  164 164 LYS LYS B . n 
D 2 18  ARG 18  165 165 ARG ARG B . n 
D 2 19  ARG 19  166 166 ARG ARG B . n 
D 2 20  ARG 20  167 167 ARG ARG B . n 
D 2 21  ARG 21  168 168 ARG ARG B . n 
D 2 22  GLY 22  169 169 GLY GLY B . n 
D 2 23  ASN 23  170 170 ASN ASN B . n 
D 2 24  LEU 24  171 171 LEU LEU B . n 
D 2 25  PRO 25  172 172 PRO PRO B . n 
D 2 26  LYS 26  173 173 LYS LYS B . n 
D 2 27  GLU 27  174 174 GLU GLU B . n 
D 2 28  SER 28  175 175 SER SER B . n 
D 2 29  VAL 29  176 176 VAL VAL B . n 
D 2 30  GLN 30  177 177 GLN GLN B . n 
D 2 31  ILE 31  178 178 ILE ILE B . n 
D 2 32  LEU 32  179 179 LEU LEU B . n 
D 2 33  ARG 33  180 180 ARG ARG B . n 
D 2 34  ASP 34  181 181 ASP ASP B . n 
D 2 35  TRP 35  182 182 TRP TRP B . n 
D 2 36  LEU 36  183 183 LEU LEU B . n 
D 2 37  TYR 37  184 184 TYR TYR B . n 
D 2 38  GLU 38  185 185 GLU GLU B . n 
D 2 39  HIS 39  186 186 HIS HIS B . n 
D 2 40  ARG 40  187 187 ARG ARG B . n 
D 2 41  TYR 41  188 188 TYR TYR B . n 
D 2 42  ASN 42  189 189 ASN ASN B . n 
D 2 43  ALA 43  190 190 ALA ALA B . n 
D 2 44  TYR 44  191 191 TYR TYR B . n 
D 2 45  PRO 45  192 192 PRO PRO B . n 
D 2 46  SER 46  193 193 SER SER B . n 
D 2 47  GLU 47  194 194 GLU GLU B . n 
D 2 48  GLN 48  195 195 GLN GLN B . n 
D 2 49  GLU 49  196 196 GLU GLU B . n 
D 2 50  LYS 50  197 197 LYS LYS B . n 
D 2 51  ALA 51  198 198 ALA ALA B . n 
D 2 52  LEU 52  199 199 LEU LEU B . n 
D 2 53  LEU 53  200 200 LEU LEU B . n 
D 2 54  SER 54  201 201 SER SER B . n 
D 2 55  GLN 55  202 202 GLN GLN B . n 
D 2 56  GLN 56  203 203 GLN GLN B . n 
D 2 57  THR 57  204 204 THR THR B . n 
D 2 58  HIS 58  205 205 HIS HIS B . n 
D 2 59  LEU 59  206 206 LEU LEU B . n 
D 2 60  SER 60  207 207 SER SER B . n 
D 2 61  THR 61  208 208 THR THR B . n 
D 2 62  LEU 62  209 209 LEU LEU B . n 
D 2 63  GLN 63  210 210 GLN GLN B . n 
D 2 64  VAL 64  211 211 VAL VAL B . n 
D 2 65  CYS 65  212 212 CYS CYS B . n 
D 2 66  ASN 66  213 213 ASN ASN B . n 
D 2 67  TRP 67  214 214 TRP TRP B . n 
D 2 68  PHE 68  215 215 PHE PHE B . n 
D 2 69  ILE 69  216 216 ILE ILE B . n 
D 2 70  ASN 70  217 217 ASN ASN B . n 
D 2 71  ALA 71  218 218 ALA ALA B . n 
D 2 72  ARG 72  219 219 ARG ARG B . n 
D 2 73  ARG 73  220 220 ARG ARG B . n 
D 2 74  ARG 74  221 221 ARG ARG B . n 
D 2 75  LEU 75  222 222 LEU LEU B . n 
D 2 76  LEU 76  223 223 LEU LEU B . n 
D 2 77  PRO 77  224 224 PRO PRO B . n 
D 2 78  ASP 78  225 225 ASP ASP B . n 
D 2 79  MET 79  226 226 MET MET B . n 
D 2 80  LEU 80  227 227 LEU LEU B . n 
D 2 81  ARG 81  228 228 ARG ARG B . n 
D 2 82  LYS 82  229 229 LYS LYS B . n 
D 2 83  ASP 83  230 ?   ?   ?   B . n 
D 2 84  GLY 84  231 ?   ?   ?   B . n 
D 2 85  LYS 85  232 ?   ?   ?   B . n 
D 2 86  ASP 86  233 ?   ?   ?   B . n 
D 2 87  PRO 87  234 ?   ?   ?   B . n 
D 2 88  ASN 88  235 ?   ?   ?   B . n 
D 2 89  GLN 89  236 ?   ?   ?   B . n 
D 2 90  PHE 90  237 ?   ?   ?   B . n 
D 2 91  THR 91  238 ?   ?   ?   B . n 
D 2 92  ILE 92  239 ?   ?   ?   B . n 
D 2 93  SER 93  240 ?   ?   ?   B . n 
D 2 94  ARG 94  241 ?   ?   ?   B . n 
D 2 95  ARG 95  242 ?   ?   ?   B . n 
D 2 96  GLY 96  243 ?   ?   ?   B . n 
D 2 97  ALA 97  244 ?   ?   ?   B . n 
D 2 98  LYS 98  245 ?   ?   ?   B . n 
D 2 99  ILE 99  246 ?   ?   ?   B . n 
D 2 100 SER 100 247 ?   ?   ?   B . n 
D 2 101 GLU 101 248 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 CA  1  101 1  CA  CA  L . 
F 4 HOH 1  201 46 HOH HOH L . 
F 4 HOH 2  202 8  HOH HOH L . 
F 4 HOH 3  203 37 HOH HOH L . 
F 4 HOH 4  204 9  HOH HOH L . 
F 4 HOH 5  205 3  HOH HOH L . 
F 4 HOH 6  206 6  HOH HOH L . 
F 4 HOH 7  207 66 HOH HOH L . 
F 4 HOH 8  208 19 HOH HOH L . 
F 4 HOH 9  209 25 HOH HOH L . 
F 4 HOH 10 210 67 HOH HOH L . 
F 4 HOH 11 211 64 HOH HOH L . 
F 4 HOH 12 212 35 HOH HOH L . 
F 4 HOH 13 213 57 HOH HOH L . 
F 4 HOH 14 214 53 HOH HOH L . 
F 4 HOH 15 215 38 HOH HOH L . 
G 4 HOH 1  201 22 HOH HOH M . 
G 4 HOH 2  202 4  HOH HOH M . 
G 4 HOH 3  203 32 HOH HOH M . 
G 4 HOH 4  204 56 HOH HOH M . 
G 4 HOH 5  205 55 HOH HOH M . 
G 4 HOH 6  206 59 HOH HOH M . 
G 4 HOH 7  207 1  HOH HOH M . 
G 4 HOH 8  208 18 HOH HOH M . 
G 4 HOH 9  209 31 HOH HOH M . 
G 4 HOH 10 210 10 HOH HOH M . 
G 4 HOH 11 211 51 HOH HOH M . 
G 4 HOH 12 212 20 HOH HOH M . 
G 4 HOH 13 213 12 HOH HOH M . 
G 4 HOH 14 214 21 HOH HOH M . 
G 4 HOH 15 215 68 HOH HOH M . 
G 4 HOH 16 216 36 HOH HOH M . 
G 4 HOH 17 217 30 HOH HOH M . 
G 4 HOH 18 218 28 HOH HOH M . 
G 4 HOH 19 219 63 HOH HOH M . 
H 4 HOH 1  301 15 HOH HOH A . 
H 4 HOH 2  302 16 HOH HOH A . 
H 4 HOH 3  303 2  HOH HOH A . 
H 4 HOH 4  304 47 HOH HOH A . 
H 4 HOH 5  305 14 HOH HOH A . 
H 4 HOH 6  306 61 HOH HOH A . 
H 4 HOH 7  307 42 HOH HOH A . 
H 4 HOH 8  308 23 HOH HOH A . 
H 4 HOH 9  309 27 HOH HOH A . 
H 4 HOH 10 310 33 HOH HOH A . 
H 4 HOH 11 311 26 HOH HOH A . 
H 4 HOH 12 312 50 HOH HOH A . 
H 4 HOH 13 313 48 HOH HOH A . 
H 4 HOH 14 314 43 HOH HOH A . 
H 4 HOH 15 315 58 HOH HOH A . 
H 4 HOH 16 316 24 HOH HOH A . 
H 4 HOH 17 317 49 HOH HOH A . 
H 4 HOH 18 318 45 HOH HOH A . 
H 4 HOH 19 319 34 HOH HOH A . 
I 4 HOH 1  301 60 HOH HOH B . 
I 4 HOH 2  302 39 HOH HOH B . 
I 4 HOH 3  303 54 HOH HOH B . 
I 4 HOH 4  304 5  HOH HOH B . 
I 4 HOH 5  305 11 HOH HOH B . 
I 4 HOH 6  306 13 HOH HOH B . 
I 4 HOH 7  307 29 HOH HOH B . 
I 4 HOH 8  308 17 HOH HOH B . 
I 4 HOH 9  309 7  HOH HOH B . 
I 4 HOH 10 310 65 HOH HOH B . 
I 4 HOH 11 311 62 HOH HOH B . 
I 4 HOH 12 312 52 HOH HOH B . 
I 4 HOH 13 313 40 HOH HOH B . 
I 4 HOH 14 314 44 HOH HOH B . 
I 4 HOH 15 315 41 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5670  ? 
1 MORE         -32   ? 
1 'SSA (A^2)'  11800 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_conn_angle.id                    1 
_pdbx_struct_conn_angle.ptnr1_label_atom_id   O6 
_pdbx_struct_conn_angle.ptnr1_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr1_label_asym_id   A 
_pdbx_struct_conn_angle.ptnr1_label_comp_id   DG 
_pdbx_struct_conn_angle.ptnr1_label_seq_id    8 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id    L 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id    DG 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id     8 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr1_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr2_label_atom_id   CA 
_pdbx_struct_conn_angle.ptnr2_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr2_label_asym_id   E 
_pdbx_struct_conn_angle.ptnr2_label_comp_id   CA 
_pdbx_struct_conn_angle.ptnr2_label_seq_id    . 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id    L 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id    CA 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id     101 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr2_symmetry        1_555 
_pdbx_struct_conn_angle.ptnr3_label_atom_id   O6 
_pdbx_struct_conn_angle.ptnr3_label_alt_id    ? 
_pdbx_struct_conn_angle.ptnr3_label_asym_id   B 
_pdbx_struct_conn_angle.ptnr3_label_comp_id   DG 
_pdbx_struct_conn_angle.ptnr3_label_seq_id    8 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id    ? 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id    M 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id    DG 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id     8 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code    ? 
_pdbx_struct_conn_angle.ptnr3_symmetry        1_555 
_pdbx_struct_conn_angle.value                 80.9 
_pdbx_struct_conn_angle.value_esd             ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-07-25 
2 'Structure model' 1 1 2018-08-29 
3 'Structure model' 1 2 2018-10-10 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
3 3 'Structure model' 'Data collection'     
4 3 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
3 3 'Structure model' citation        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                 
2  2 'Structure model' '_citation.journal_abbrev'          
3  2 'Structure model' '_citation.journal_id_ASTM'         
4  2 'Structure model' '_citation.journal_id_CSD'          
5  2 'Structure model' '_citation.journal_id_ISSN'         
6  2 'Structure model' '_citation.pdbx_database_id_DOI'    
7  2 'Structure model' '_citation.pdbx_database_id_PubMed' 
8  2 'Structure model' '_citation.title'                   
9  2 'Structure model' '_citation.year'                    
10 3 'Structure model' '_citation.journal_volume'          
11 3 'Structure model' '_citation.page_first'              
12 3 'Structure model' '_citation.page_last'               
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? .    1 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.22 2 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .    3 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALA       ? ? ? .    4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .    5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 HG  B SER 201 ? ? O   B LEU 206 ? ? 1.43 
2 1 OP2 M DG  8   ? ? HZ1 A LYS 197 ? ? 1.55 
3 1 OP2 L DG  8   ? ? HZ1 B LYS 197 ? ? 1.59 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 N3    L DA 14 ? ? C4    L DA 14 ? ? 1.307 1.344 -0.037 0.006 N 
2 1 N9    L DA 14 ? ? C4    L DA 14 ? ? 1.328 1.374 -0.046 0.006 N 
3 1 N9    L DA 15 ? ? C4    L DA 15 ? ? 1.336 1.374 -0.038 0.006 N 
4 1 N9    M DA 1  ? ? C4    M DA 1  ? ? 1.336 1.374 -0.038 0.006 N 
5 1 "O3'" M DT 3  ? ? "C3'" M DT 3  ? ? 1.372 1.419 -0.047 0.006 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" L DA  1   ? ? "C1'" L DA  1   ? ? N9 L DA  1   ? ? 111.14 108.30 2.84  0.30 N 
2 1 "O4'" L DT  12  ? ? "C1'" L DT  12  ? ? N1 L DT  12  ? ? 110.62 108.30 2.32  0.30 N 
3 1 "O4'" L DT  16  ? ? "C1'" L DT  16  ? ? N1 L DT  16  ? ? 111.17 108.30 2.87  0.30 N 
4 1 "O4'" M DA  1   ? ? "C1'" M DA  1   ? ? N9 M DA  1   ? ? 111.79 108.30 3.49  0.30 N 
5 1 "O4'" M DC  6   ? ? "C1'" M DC  6   ? ? N1 M DC  6   ? ? 111.09 108.30 2.79  0.30 N 
6 1 "O4'" M DG  8   ? ? "C1'" M DG  8   ? ? N9 M DG  8   ? ? 110.65 108.30 2.35  0.30 N 
7 1 "O4'" M DT  12  ? ? "C1'" M DT  12  ? ? N1 M DT  12  ? ? 110.51 108.30 2.21  0.30 N 
8 1 C     A ASP 233 ? ? N     A PRO 234 ? ? CA A PRO 234 ? ? 135.73 119.30 16.43 1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 189 ? ? -150.35 73.51 
2 1 ALA A 190 ? ? -80.24  44.51 
3 1 ARG B 165 ? ? 34.72   43.93 
4 1 ARG B 166 ? ? -107.76 66.84 
5 1 ASN B 189 ? ? -152.53 76.53 
6 1 ALA B 190 ? ? -82.06  47.30 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 173 ? CD  ? C LYS 26 CD  
2  1 Y 1 A LYS 173 ? CE  ? C LYS 26 CE  
3  1 Y 1 A LYS 173 ? NZ  ? C LYS 26 NZ  
4  1 Y 1 A GLU 174 ? CD  ? C GLU 27 CD  
5  1 Y 1 A GLU 174 ? OE1 ? C GLU 27 OE1 
6  1 Y 1 A GLU 174 ? OE2 ? C GLU 27 OE2 
7  1 Y 1 A ARG 180 ? CZ  ? C ARG 33 CZ  
8  1 Y 1 A ARG 180 ? NH1 ? C ARG 33 NH1 
9  1 Y 1 A ARG 180 ? NH2 ? C ARG 33 NH2 
10 1 Y 1 A ASP 225 ? OD1 ? C ASP 78 OD1 
11 1 Y 1 A ASP 225 ? OD2 ? C ASP 78 OD2 
12 1 Y 1 A LYS 229 ? CD  ? C LYS 82 CD  
13 1 Y 1 A LYS 229 ? CE  ? C LYS 82 CE  
14 1 Y 1 A LYS 229 ? NZ  ? C LYS 82 NZ  
15 1 Y 1 A LYS 232 ? CG  ? C LYS 85 CG  
16 1 Y 1 A LYS 232 ? CD  ? C LYS 85 CD  
17 1 Y 1 A LYS 232 ? CE  ? C LYS 85 CE  
18 1 Y 1 A LYS 232 ? NZ  ? C LYS 85 NZ  
19 1 Y 1 A ASP 233 ? CG  ? C ASP 86 CG  
20 1 Y 1 A ASP 233 ? OD1 ? C ASP 86 OD1 
21 1 Y 1 A ASP 233 ? OD2 ? C ASP 86 OD2 
22 1 Y 1 A PRO 234 ? CG  ? C PRO 87 CG  
23 1 Y 1 A PRO 234 ? CD  ? C PRO 87 CD  
24 1 Y 1 B LYS 164 ? CG  ? D LYS 17 CG  
25 1 Y 1 B LYS 164 ? CD  ? D LYS 17 CD  
26 1 Y 1 B LYS 164 ? CE  ? D LYS 17 CE  
27 1 Y 1 B LYS 164 ? NZ  ? D LYS 17 NZ  
28 1 Y 1 B ARG 168 ? NE  ? D ARG 21 NE  
29 1 Y 1 B ARG 168 ? CZ  ? D ARG 21 CZ  
30 1 Y 1 B ARG 168 ? NH1 ? D ARG 21 NH1 
31 1 Y 1 B ARG 168 ? NH2 ? D ARG 21 NH2 
32 1 Y 1 B LYS 173 ? CD  ? D LYS 26 CD  
33 1 Y 1 B LYS 173 ? CE  ? D LYS 26 CE  
34 1 Y 1 B LYS 173 ? NZ  ? D LYS 26 NZ  
35 1 Y 1 B GLU 174 ? CG  ? D GLU 27 CG  
36 1 Y 1 B GLU 174 ? CD  ? D GLU 27 CD  
37 1 Y 1 B GLU 174 ? OE1 ? D GLU 27 OE1 
38 1 Y 1 B GLU 174 ? OE2 ? D GLU 27 OE2 
39 1 Y 1 B GLN 177 ? OE1 ? D GLN 30 OE1 
40 1 Y 1 B GLN 177 ? NE2 ? D GLN 30 NE2 
41 1 Y 1 B GLN 195 ? CD  ? D GLN 48 CD  
42 1 Y 1 B GLN 195 ? OE1 ? D GLN 48 OE1 
43 1 Y 1 B GLN 195 ? NE2 ? D GLN 48 NE2 
44 1 Y 1 B GLN 202 ? OE1 ? D GLN 55 OE1 
45 1 Y 1 B GLN 202 ? NE2 ? D GLN 55 NE2 
46 1 Y 1 B ASP 225 ? OD1 ? D ASP 78 OD1 
47 1 Y 1 B ASP 225 ? OD2 ? D ASP 78 OD2 
48 1 Y 1 B ARG 228 ? CG  ? D ARG 81 CG  
49 1 Y 1 B ARG 228 ? CD  ? D ARG 81 CD  
50 1 Y 1 B ARG 228 ? NE  ? D ARG 81 NE  
51 1 Y 1 B ARG 228 ? CZ  ? D ARG 81 CZ  
52 1 Y 1 B ARG 228 ? NH1 ? D ARG 81 NH1 
53 1 Y 1 B ARG 228 ? NH2 ? D ARG 81 NH2 
54 1 Y 1 B LYS 229 ? CE  ? D LYS 82 CE  
55 1 Y 1 B LYS 229 ? NZ  ? D LYS 82 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 148 ? C GLY 1   
2  1 Y 1 A PRO 149 ? C PRO 2   
3  1 Y 1 A MET 150 ? C MET 3   
4  1 Y 1 A ASP 151 ? C ASP 4   
5  1 Y 1 A ILE 152 ? C ILE 5   
6  1 Y 1 A PRO 153 ? C PRO 6   
7  1 Y 1 A LEU 154 ? C LEU 7   
8  1 Y 1 A ASP 155 ? C ASP 8   
9  1 Y 1 A LEU 156 ? C LEU 9   
10 1 Y 1 A SER 157 ? C SER 10  
11 1 Y 1 A SER 158 ? C SER 11  
12 1 Y 1 A SER 159 ? C SER 12  
13 1 Y 1 A ALA 160 ? C ALA 13  
14 1 Y 1 A GLY 161 ? C GLY 14  
15 1 Y 1 A SER 162 ? C SER 15  
16 1 Y 1 A GLY 163 ? C GLY 16  
17 1 Y 1 A LYS 164 ? C LYS 17  
18 1 Y 1 A ARG 165 ? C ARG 18  
19 1 Y 1 A ARG 166 ? C ARG 19  
20 1 Y 1 A ARG 167 ? C ARG 20  
21 1 Y 1 A ASN 235 ? C ASN 88  
22 1 Y 1 A GLN 236 ? C GLN 89  
23 1 Y 1 A PHE 237 ? C PHE 90  
24 1 Y 1 A THR 238 ? C THR 91  
25 1 Y 1 A ILE 239 ? C ILE 92  
26 1 Y 1 A SER 240 ? C SER 93  
27 1 Y 1 A ARG 241 ? C ARG 94  
28 1 Y 1 A ARG 242 ? C ARG 95  
29 1 Y 1 A GLY 243 ? C GLY 96  
30 1 Y 1 A ALA 244 ? C ALA 97  
31 1 Y 1 A LYS 245 ? C LYS 98  
32 1 Y 1 A ILE 246 ? C ILE 99  
33 1 Y 1 A SER 247 ? C SER 100 
34 1 Y 1 A GLU 248 ? C GLU 101 
35 1 Y 1 B GLY 148 ? D GLY 1   
36 1 Y 1 B PRO 149 ? D PRO 2   
37 1 Y 1 B MET 150 ? D MET 3   
38 1 Y 1 B ASP 151 ? D ASP 4   
39 1 Y 1 B ILE 152 ? D ILE 5   
40 1 Y 1 B PRO 153 ? D PRO 6   
41 1 Y 1 B LEU 154 ? D LEU 7   
42 1 Y 1 B ASP 155 ? D ASP 8   
43 1 Y 1 B LEU 156 ? D LEU 9   
44 1 Y 1 B SER 157 ? D SER 10  
45 1 Y 1 B SER 158 ? D SER 11  
46 1 Y 1 B SER 159 ? D SER 12  
47 1 Y 1 B ALA 160 ? D ALA 13  
48 1 Y 1 B GLY 161 ? D GLY 14  
49 1 Y 1 B SER 162 ? D SER 15  
50 1 Y 1 B GLY 163 ? D GLY 16  
51 1 Y 1 B ASP 230 ? D ASP 83  
52 1 Y 1 B GLY 231 ? D GLY 84  
53 1 Y 1 B LYS 232 ? D LYS 85  
54 1 Y 1 B ASP 233 ? D ASP 86  
55 1 Y 1 B PRO 234 ? D PRO 87  
56 1 Y 1 B ASN 235 ? D ASN 88  
57 1 Y 1 B GLN 236 ? D GLN 89  
58 1 Y 1 B PHE 237 ? D PHE 90  
59 1 Y 1 B THR 238 ? D THR 91  
60 1 Y 1 B ILE 239 ? D ILE 92  
61 1 Y 1 B SER 240 ? D SER 93  
62 1 Y 1 B ARG 241 ? D ARG 94  
63 1 Y 1 B ARG 242 ? D ARG 95  
64 1 Y 1 B GLY 243 ? D GLY 96  
65 1 Y 1 B ALA 244 ? D ALA 97  
66 1 Y 1 B LYS 245 ? D LYS 98  
67 1 Y 1 B ILE 246 ? D ILE 99  
68 1 Y 1 B SER 247 ? D SER 100 
69 1 Y 1 B GLU 248 ? D GLU 101 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
6FQP 'double helix'        
6FQP 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA 1  1_555 B DT 16 1_555 0.020  -0.228 -0.051 -3.764  -16.069 20.997 1  L_DA1:DT16_M L 1  ? M 16 ? 20 1 
1 A DT 2  1_555 B DA 15 1_555 -0.450 -0.138 0.099  -3.144  -11.343 13.731 2  L_DT2:DA15_M L 2  ? M 15 ? 20 1 
1 A DT 3  1_555 B DA 14 1_555 0.009  -0.151 0.089  -7.282  -7.362  7.965  3  L_DT3:DA14_M L 3  ? M 14 ? 20 1 
1 A DG 4  1_555 B DC 13 1_555 -0.051 -0.264 -0.341 -5.736  -11.744 -0.796 4  L_DG4:DC13_M L 4  ? M 13 ? 19 1 
1 A DA 5  1_555 B DT 12 1_555 -0.207 -0.346 0.377  -3.544  -9.098  3.287  5  L_DA5:DT12_M L 5  ? M 12 ? 20 1 
1 A DC 6  1_555 B DG 11 1_555 0.196  -0.181 0.226  9.728   -4.862  -0.727 6  L_DC6:DG11_M L 6  ? M 11 ? 19 1 
1 A DA 7  1_555 B DT 10 1_555 0.267  -0.214 0.382  8.312   -9.139  -3.050 7  L_DA7:DT10_M L 7  ? M 10 ? 20 1 
1 A DG 8  1_555 B DC 9  1_555 0.091  -0.134 0.157  6.653   -9.883  0.794  8  L_DG8:DC9_M  L 8  ? M 9  ? 19 1 
1 A DC 9  1_555 B DG 8  1_555 0.201  -0.208 0.053  -6.009  -7.844  -0.884 9  L_DC9:DG8_M  L 9  ? M 8  ? 19 1 
1 A DT 10 1_555 B DA 7  1_555 -0.294 -0.250 0.078  -3.635  -13.374 -1.439 10 L_DT10:DA7_M L 10 ? M 7  ? 20 1 
1 A DG 11 1_555 B DC 6  1_555 -0.366 -0.342 -0.275 -10.206 -6.105  0.603  11 L_DG11:DC6_M L 11 ? M 6  ? 19 1 
1 A DT 12 1_555 B DA 5  1_555 -0.124 -0.310 0.023  2.566   -10.219 2.645  12 L_DT12:DA5_M L 12 ? M 5  ? 20 1 
1 A DC 13 1_555 B DG 4  1_555 0.393  -0.272 -0.156 8.482   -13.133 -0.364 13 L_DC13:DG4_M L 13 ? M 4  ? 19 1 
1 A DA 14 1_555 B DT 3  1_555 0.763  -0.261 0.364  9.795   -15.345 16.906 14 L_DA14:DT3_M L 14 ? M 3  ? 20 1 
1 A DA 15 1_555 B DT 2  1_555 1.151  0.214  0.327  8.852   -14.147 32.266 15 L_DA15:DT2_M L 15 ? M 2  ? ?  1 
1 A DT 16 1_555 B DA 1  1_555 -0.709 -0.233 -0.080 9.707   -12.781 14.892 16 L_DT16:DA1_M L 16 ? M 1  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DA 1  1_555 B DT 16 1_555 A DT 2  1_555 B DA 15 1_555 -0.604 -0.916 3.293 -2.284 3.169 33.888 -2.065 0.667  3.230 5.415  3.901 
34.106 1  LL_DA1DT2:DA15DT16_MM L 1  ? M 16 ? L 2  ? M 15 ? 
1 A DT 2  1_555 B DA 15 1_555 A DT 3  1_555 B DA 14 1_555 -0.014 -0.374 3.410 1.857  2.311 34.625 -0.993 0.318  3.374 3.874  
-3.113 34.748 2  LL_DT2DT3:DA14DA15_MM L 2  ? M 15 ? L 3  ? M 14 ? 
1 A DT 3  1_555 B DA 14 1_555 A DG 4  1_555 B DC 13 1_555 -0.355 0.406  3.355 3.743  9.402 34.464 -0.739 1.133  3.295 15.461 
-6.155 35.876 3  LL_DT3DG4:DC13DA14_MM L 3  ? M 14 ? L 4  ? M 13 ? 
1 A DG 4  1_555 B DC 13 1_555 A DA 5  1_555 B DT 12 1_555 0.901  -0.456 3.139 -4.669 1.395 32.636 -1.025 -2.330 2.963 2.465  8.252 
32.988 4  LL_DG4DA5:DT12DC13_MM L 4  ? M 13 ? L 5  ? M 12 ? 
1 A DA 5  1_555 B DT 12 1_555 A DC 6  1_555 B DG 11 1_555 -0.642 -0.588 2.946 2.110  5.032 27.709 -2.235 1.748  2.743 10.381 
-4.352 28.230 5  LL_DA5DC6:DG11DT12_MM L 5  ? M 12 ? L 6  ? M 11 ? 
1 A DC 6  1_555 B DG 11 1_555 A DA 7  1_555 B DT 10 1_555 -1.206 0.312  3.252 -4.527 2.779 37.417 0.117  1.267  3.383 4.305  7.013 
37.779 6  LL_DC6DA7:DT10DG11_MM L 6  ? M 11 ? L 7  ? M 10 ? 
1 A DA 7  1_555 B DT 10 1_555 A DG 8  1_555 B DC 9  1_555 0.678  -0.411 3.346 0.776  3.024 32.449 -1.269 -1.070 3.310 5.396  
-1.385 32.594 7  LL_DA7DG8:DC9DT10_MM  L 7  ? M 10 ? L 8  ? M 9  ? 
1 A DG 8  1_555 B DC 9  1_555 A DC 9  1_555 B DG 8  1_555 -0.169 -0.659 3.510 0.054  2.157 41.471 -1.175 0.244  3.473 3.044  
-0.077 41.524 8  LL_DG8DC9:DG8DC9_MM   L 8  ? M 9  ? L 9  ? M 8  ? 
1 A DC 9  1_555 B DG 8  1_555 A DT 10 1_555 B DA 7  1_555 -0.598 -0.289 3.251 -0.012 3.323 30.449 -1.195 1.130  3.203 6.303  0.024 
30.625 9  LL_DC9DT10:DA7DG8_MM  L 9  ? M 8  ? L 10 ? M 7  ? 
1 A DT 10 1_555 B DA 7  1_555 A DG 11 1_555 B DC 6  1_555 1.116  0.452  3.426 4.138  6.839 37.603 -0.233 -1.140 3.550 10.466 
-6.332 38.413 10 LL_DT10DG11:DC6DA7_MM L 10 ? M 7  ? L 11 ? M 6  ? 
1 A DG 11 1_555 B DC 6  1_555 A DT 12 1_555 B DA 5  1_555 0.352  -0.325 3.010 -3.116 1.481 27.136 -1.023 -1.450 2.930 3.140  6.607 
27.351 11 LL_DG11DT12:DA5DC6_MM L 11 ? M 6  ? L 12 ? M 5  ? 
1 A DT 12 1_555 B DA 5  1_555 A DC 13 1_555 B DG 4  1_555 -0.587 -0.355 3.140 3.016  1.512 34.413 -0.818 1.430  3.062 2.548  
-5.082 34.573 12 LL_DT12DC13:DG4DA5_MM L 12 ? M 5  ? L 13 ? M 4  ? 
1 A DC 13 1_555 B DG 4  1_555 A DA 14 1_555 B DT 3  1_555 1.208  0.574  3.361 -0.946 5.874 38.053 0.116  -1.953 3.379 8.942  1.441 
38.499 13 LL_DC13DA14:DT3DG4_MM L 13 ? M 4  ? L 14 ? M 3  ? 
1 A DA 14 1_555 B DT 3  1_555 A DA 15 1_555 B DT 2  1_555 0.326  -0.075 3.276 0.532  4.233 36.835 -0.685 -0.441 3.252 6.672  
-0.839 37.073 14 LL_DA14DA15:DT2DT3_MM L 14 ? M 3  ? L 15 ? M 2  ? 
1 A DA 15 1_555 B DT 2  1_555 A DT 16 1_555 B DA 1  1_555 -0.796 -1.343 3.150 -1.103 3.358 25.983 -3.815 1.473  2.986 7.425  2.440 
26.219 15 LL_DA15DT16:DA1DT2_MM L 15 ? M 2  ? L 16 ? M 1  ? 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'Spanish Ministry of Economy and Competitiveness' Spain BFU2014-53787-P        1 
'COFUND Marie Sklodowska Curie'                   Spain 'IRBPostPro2.0 600404' 2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'CALCIUM ION' CA  
4 water         HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'native gel electrophoresis' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#