data_6GHM
# 
_entry.id   6GHM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.305 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6GHM         
WWPDB D_1200009923 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6GHM 
_pdbx_database_status.recvd_initial_deposition_date   2018-05-08 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Mouilleron, S.' 1 ? 
'Bertran, T.M.'  2 ? 
'Tapon, N.'      3 ? 
'Zhou, Y.'       4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            10 
_citation.language                  ? 
_citation.page_first                771 
_citation.page_last                 771 
_citation.title                     
'ASPP proteins discriminate between PP1 catalytic subunits through their SH3 domain and the PP1 C-tail.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-019-08686-0 
_citation.pdbx_database_id_PubMed   30770806 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bertran, M.T.'  1  ?                   
primary 'Mouilleron, S.' 2  0000-0001-7977-6298 
primary 'Zhou, Y.'       3  ?                   
primary 'Bajaj, R.'      4  ?                   
primary 'Uliana, F.'     5  ?                   
primary 'Kumar, G.S.'    6  ?                   
primary 'van Drogen, A.' 7  ?                   
primary 'Lee, R.'        8  ?                   
primary 'Banerjee, J.J.' 9  ?                   
primary 'Hauri, S.'      10 ?                   
primary 
;O'Reilly, N.
;
11 0000-0002-4204-6491 
primary 'Gstaiger, M.'   12 ?                   
primary 'Page, R.'       13 ?                   
primary 'Peti, W.'       14 ?                   
primary 'Tapon, N.'      15 0000-0001-5267-6510 
# 
_cell.angle_alpha                  91.06 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   91.84 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  103.89 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6GHM 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     46.840 
_cell.length_a_esd                 ? 
_cell.length_b                     81.624 
_cell.length_b_esd                 ? 
_cell.length_c                     87.966 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        2 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6GHM 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Serine/threonine-protein phosphatase PP1-alpha catalytic subunit' 37349.844 2   3.1.3.16 ? ? ? 
2 polymer     man 'Apoptosis-stimulating of p53 protein 2'                           24156.240 2   ?        ? ? ? 
3 non-polymer syn 1,2-ETHANEDIOL                                                     62.068    12  ?        ? ? ? 
4 non-polymer syn GLYCEROL                                                           92.094    4   ?        ? ? ? 
5 non-polymer syn '2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID'                        207.290   6   ?        ? ? ? 
6 non-polymer syn 'MANGANESE (II) ION'                                               54.938    4   ?        ? ? ? 
7 water       nat water                                                              18.015    245 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 PP-1A                                                                                                      
2 'Bcl2-binding protein,Bbp,Renal carcinoma antigen NY-REN-51,Tumor suppressor p53-binding protein 2,p53BP2' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GHMGSLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGF
PPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPI
AAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITP
PRNSAKAKK
;
;GHMGSLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGF
PPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPI
AAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDL
DLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITP
PRNSAKAKK
;
A,B ? 
2 'polypeptide(L)' no no 
;GPLGSMRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWT
PLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDD
ELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRIKPRQRSLA
;
;GPLGSMRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWT
PLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDD
ELPMKEGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRIKPRQRSLA
;
C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   HIS n 
1 3   MET n 
1 4   GLY n 
1 5   SER n 
1 6   LEU n 
1 7   ASN n 
1 8   LEU n 
1 9   ASP n 
1 10  SER n 
1 11  ILE n 
1 12  ILE n 
1 13  GLY n 
1 14  ARG n 
1 15  LEU n 
1 16  LEU n 
1 17  GLU n 
1 18  VAL n 
1 19  GLN n 
1 20  GLY n 
1 21  SER n 
1 22  ARG n 
1 23  PRO n 
1 24  GLY n 
1 25  LYS n 
1 26  ASN n 
1 27  VAL n 
1 28  GLN n 
1 29  LEU n 
1 30  THR n 
1 31  GLU n 
1 32  ASN n 
1 33  GLU n 
1 34  ILE n 
1 35  ARG n 
1 36  GLY n 
1 37  LEU n 
1 38  CYS n 
1 39  LEU n 
1 40  LYS n 
1 41  SER n 
1 42  ARG n 
1 43  GLU n 
1 44  ILE n 
1 45  PHE n 
1 46  LEU n 
1 47  SER n 
1 48  GLN n 
1 49  PRO n 
1 50  ILE n 
1 51  LEU n 
1 52  LEU n 
1 53  GLU n 
1 54  LEU n 
1 55  GLU n 
1 56  ALA n 
1 57  PRO n 
1 58  LEU n 
1 59  LYS n 
1 60  ILE n 
1 61  CYS n 
1 62  GLY n 
1 63  ASP n 
1 64  ILE n 
1 65  HIS n 
1 66  GLY n 
1 67  GLN n 
1 68  TYR n 
1 69  TYR n 
1 70  ASP n 
1 71  LEU n 
1 72  LEU n 
1 73  ARG n 
1 74  LEU n 
1 75  PHE n 
1 76  GLU n 
1 77  TYR n 
1 78  GLY n 
1 79  GLY n 
1 80  PHE n 
1 81  PRO n 
1 82  PRO n 
1 83  GLU n 
1 84  SER n 
1 85  ASN n 
1 86  TYR n 
1 87  LEU n 
1 88  PHE n 
1 89  LEU n 
1 90  GLY n 
1 91  ASP n 
1 92  TYR n 
1 93  VAL n 
1 94  ASP n 
1 95  ARG n 
1 96  GLY n 
1 97  LYS n 
1 98  GLN n 
1 99  SER n 
1 100 LEU n 
1 101 GLU n 
1 102 THR n 
1 103 ILE n 
1 104 CYS n 
1 105 LEU n 
1 106 LEU n 
1 107 LEU n 
1 108 ALA n 
1 109 TYR n 
1 110 LYS n 
1 111 ILE n 
1 112 LYS n 
1 113 TYR n 
1 114 PRO n 
1 115 GLU n 
1 116 ASN n 
1 117 PHE n 
1 118 PHE n 
1 119 LEU n 
1 120 LEU n 
1 121 ARG n 
1 122 GLY n 
1 123 ASN n 
1 124 HIS n 
1 125 GLU n 
1 126 CYS n 
1 127 ALA n 
1 128 SER n 
1 129 ILE n 
1 130 ASN n 
1 131 ARG n 
1 132 ILE n 
1 133 TYR n 
1 134 GLY n 
1 135 PHE n 
1 136 TYR n 
1 137 ASP n 
1 138 GLU n 
1 139 CYS n 
1 140 LYS n 
1 141 ARG n 
1 142 ARG n 
1 143 TYR n 
1 144 ASN n 
1 145 ILE n 
1 146 LYS n 
1 147 LEU n 
1 148 TRP n 
1 149 LYS n 
1 150 THR n 
1 151 PHE n 
1 152 THR n 
1 153 ASP n 
1 154 CYS n 
1 155 PHE n 
1 156 ASN n 
1 157 CYS n 
1 158 LEU n 
1 159 PRO n 
1 160 ILE n 
1 161 ALA n 
1 162 ALA n 
1 163 ILE n 
1 164 VAL n 
1 165 ASP n 
1 166 GLU n 
1 167 LYS n 
1 168 ILE n 
1 169 PHE n 
1 170 CYS n 
1 171 CYS n 
1 172 HIS n 
1 173 GLY n 
1 174 GLY n 
1 175 LEU n 
1 176 SER n 
1 177 PRO n 
1 178 ASP n 
1 179 LEU n 
1 180 GLN n 
1 181 SER n 
1 182 MET n 
1 183 GLU n 
1 184 GLN n 
1 185 ILE n 
1 186 ARG n 
1 187 ARG n 
1 188 ILE n 
1 189 MET n 
1 190 ARG n 
1 191 PRO n 
1 192 THR n 
1 193 ASP n 
1 194 VAL n 
1 195 PRO n 
1 196 ASP n 
1 197 GLN n 
1 198 GLY n 
1 199 LEU n 
1 200 LEU n 
1 201 CYS n 
1 202 ASP n 
1 203 LEU n 
1 204 LEU n 
1 205 TRP n 
1 206 SER n 
1 207 ASP n 
1 208 PRO n 
1 209 ASP n 
1 210 LYS n 
1 211 ASP n 
1 212 VAL n 
1 213 GLN n 
1 214 GLY n 
1 215 TRP n 
1 216 GLY n 
1 217 GLU n 
1 218 ASN n 
1 219 ASP n 
1 220 ARG n 
1 221 GLY n 
1 222 VAL n 
1 223 SER n 
1 224 PHE n 
1 225 THR n 
1 226 PHE n 
1 227 GLY n 
1 228 ALA n 
1 229 GLU n 
1 230 VAL n 
1 231 VAL n 
1 232 ALA n 
1 233 LYS n 
1 234 PHE n 
1 235 LEU n 
1 236 HIS n 
1 237 LYS n 
1 238 HIS n 
1 239 ASP n 
1 240 LEU n 
1 241 ASP n 
1 242 LEU n 
1 243 ILE n 
1 244 CYS n 
1 245 ARG n 
1 246 ALA n 
1 247 HIS n 
1 248 GLN n 
1 249 VAL n 
1 250 VAL n 
1 251 GLU n 
1 252 ASP n 
1 253 GLY n 
1 254 TYR n 
1 255 GLU n 
1 256 PHE n 
1 257 PHE n 
1 258 ALA n 
1 259 LYS n 
1 260 ARG n 
1 261 GLN n 
1 262 LEU n 
1 263 VAL n 
1 264 THR n 
1 265 LEU n 
1 266 PHE n 
1 267 SER n 
1 268 ALA n 
1 269 PRO n 
1 270 ASN n 
1 271 TYR n 
1 272 CYS n 
1 273 GLY n 
1 274 GLU n 
1 275 PHE n 
1 276 ASP n 
1 277 ASN n 
1 278 ALA n 
1 279 GLY n 
1 280 ALA n 
1 281 MET n 
1 282 MET n 
1 283 SER n 
1 284 VAL n 
1 285 ASP n 
1 286 GLU n 
1 287 THR n 
1 288 LEU n 
1 289 MET n 
1 290 CYS n 
1 291 SER n 
1 292 PHE n 
1 293 GLN n 
1 294 ILE n 
1 295 LEU n 
1 296 LYS n 
1 297 PRO n 
1 298 ALA n 
1 299 ASP n 
1 300 LYS n 
1 301 ASN n 
1 302 LYS n 
1 303 GLY n 
1 304 LYS n 
1 305 TYR n 
1 306 GLY n 
1 307 GLN n 
1 308 PHE n 
1 309 SER n 
1 310 GLY n 
1 311 LEU n 
1 312 ASN n 
1 313 PRO n 
1 314 GLY n 
1 315 GLY n 
1 316 ARG n 
1 317 PRO n 
1 318 ILE n 
1 319 THR n 
1 320 PRO n 
1 321 PRO n 
1 322 ARG n 
1 323 ASN n 
1 324 SER n 
1 325 ALA n 
1 326 LYS n 
1 327 ALA n 
1 328 LYS n 
1 329 LYS n 
2 1   GLY n 
2 2   PRO n 
2 3   LEU n 
2 4   GLY n 
2 5   SER n 
2 6   MET n 
2 7   ARG n 
2 8   VAL n 
2 9   LYS n 
2 10  PHE n 
2 11  ASN n 
2 12  PRO n 
2 13  LEU n 
2 14  ALA n 
2 15  LEU n 
2 16  LEU n 
2 17  LEU n 
2 18  ASP n 
2 19  SER n 
2 20  SER n 
2 21  LEU n 
2 22  GLU n 
2 23  GLY n 
2 24  GLU n 
2 25  PHE n 
2 26  ASP n 
2 27  LEU n 
2 28  VAL n 
2 29  GLN n 
2 30  ARG n 
2 31  ILE n 
2 32  ILE n 
2 33  TYR n 
2 34  GLU n 
2 35  VAL n 
2 36  ASP n 
2 37  ASP n 
2 38  PRO n 
2 39  SER n 
2 40  LEU n 
2 41  PRO n 
2 42  ASN n 
2 43  ASP n 
2 44  GLU n 
2 45  GLY n 
2 46  ILE n 
2 47  THR n 
2 48  ALA n 
2 49  LEU n 
2 50  HIS n 
2 51  ASN n 
2 52  ALA n 
2 53  VAL n 
2 54  CYS n 
2 55  ALA n 
2 56  GLY n 
2 57  HIS n 
2 58  THR n 
2 59  GLU n 
2 60  ILE n 
2 61  VAL n 
2 62  LYS n 
2 63  PHE n 
2 64  LEU n 
2 65  VAL n 
2 66  GLN n 
2 67  PHE n 
2 68  GLY n 
2 69  VAL n 
2 70  ASN n 
2 71  VAL n 
2 72  ASN n 
2 73  ALA n 
2 74  ALA n 
2 75  ASP n 
2 76  SER n 
2 77  ASP n 
2 78  GLY n 
2 79  TRP n 
2 80  THR n 
2 81  PRO n 
2 82  LEU n 
2 83  HIS n 
2 84  CYS n 
2 85  ALA n 
2 86  ALA n 
2 87  SER n 
2 88  CYS n 
2 89  ASN n 
2 90  ASN n 
2 91  VAL n 
2 92  GLN n 
2 93  VAL n 
2 94  CYS n 
2 95  LYS n 
2 96  PHE n 
2 97  LEU n 
2 98  VAL n 
2 99  GLU n 
2 100 SER n 
2 101 GLY n 
2 102 ALA n 
2 103 ALA n 
2 104 VAL n 
2 105 PHE n 
2 106 ALA n 
2 107 MET n 
2 108 THR n 
2 109 TYR n 
2 110 SER n 
2 111 ASP n 
2 112 MET n 
2 113 GLN n 
2 114 THR n 
2 115 ALA n 
2 116 ALA n 
2 117 ASP n 
2 118 LYS n 
2 119 CYS n 
2 120 GLU n 
2 121 GLU n 
2 122 MET n 
2 123 GLU n 
2 124 GLU n 
2 125 GLY n 
2 126 TYR n 
2 127 THR n 
2 128 GLN n 
2 129 CYS n 
2 130 SER n 
2 131 GLN n 
2 132 PHE n 
2 133 LEU n 
2 134 TYR n 
2 135 GLY n 
2 136 VAL n 
2 137 GLN n 
2 138 GLU n 
2 139 LYS n 
2 140 MET n 
2 141 GLY n 
2 142 ILE n 
2 143 MET n 
2 144 ASN n 
2 145 LYS n 
2 146 GLY n 
2 147 VAL n 
2 148 ILE n 
2 149 TYR n 
2 150 ALA n 
2 151 LEU n 
2 152 TRP n 
2 153 ASP n 
2 154 TYR n 
2 155 GLU n 
2 156 PRO n 
2 157 GLN n 
2 158 ASN n 
2 159 ASP n 
2 160 ASP n 
2 161 GLU n 
2 162 LEU n 
2 163 PRO n 
2 164 MET n 
2 165 LYS n 
2 166 GLU n 
2 167 GLY n 
2 168 ASP n 
2 169 CYS n 
2 170 MET n 
2 171 THR n 
2 172 ILE n 
2 173 ILE n 
2 174 HIS n 
2 175 ARG n 
2 176 GLU n 
2 177 ASP n 
2 178 GLU n 
2 179 ASP n 
2 180 GLU n 
2 181 ILE n 
2 182 GLU n 
2 183 TRP n 
2 184 TRP n 
2 185 TRP n 
2 186 ALA n 
2 187 ARG n 
2 188 LEU n 
2 189 ASN n 
2 190 ASP n 
2 191 LYS n 
2 192 GLU n 
2 193 GLY n 
2 194 TYR n 
2 195 VAL n 
2 196 PRO n 
2 197 ARG n 
2 198 ASN n 
2 199 LEU n 
2 200 LEU n 
2 201 GLY n 
2 202 LEU n 
2 203 TYR n 
2 204 PRO n 
2 205 ARG n 
2 206 ILE n 
2 207 LYS n 
2 208 PRO n 
2 209 ARG n 
2 210 GLN n 
2 211 ARG n 
2 212 SER n 
2 213 LEU n 
2 214 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 329 Human ? 'PPP1CA, PPP1A'       ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 214 Human ? 'TP53BP2, ASPP2, BBP' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP PP1A_HUMAN  P62136 ?        1 
;LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESN
YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVD
EKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICR
AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSA
KAKK
;
7   
2 UNP ASPP2_HUMAN Q13625 Q13625-3 2 
;MRVKFNPLALLLDSSLEGEFDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQFGVNVNAADSDGWTPLHCA
ASCNNVQVCKFLVESGAAVFAMTYSDMQTAADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYALWDYEPQNDDELPMK
EGDCMTIIHREDEDEIEWWWARLNDKEGYVPRNLLGLYPRIKPRQRSLA
;
926 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6GHM A 6 ? 329 ? P62136 7   ? 330  ? 7   330  
2 1 6GHM B 6 ? 329 ? P62136 7   ? 330  ? 7   330  
3 2 6GHM C 6 ? 214 ? Q13625 926 ? 1134 ? 920 1128 
4 2 6GHM D 6 ? 214 ? Q13625 926 ? 1134 ? 920 1128 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6GHM GLY A 1 ? UNP P62136 ? ? 'expression tag' 2   1  
1 6GHM HIS A 2 ? UNP P62136 ? ? 'expression tag' 3   2  
1 6GHM MET A 3 ? UNP P62136 ? ? 'expression tag' 4   3  
1 6GHM GLY A 4 ? UNP P62136 ? ? 'expression tag' 5   4  
1 6GHM SER A 5 ? UNP P62136 ? ? 'expression tag' 6   5  
2 6GHM GLY B 1 ? UNP P62136 ? ? 'expression tag' 2   6  
2 6GHM HIS B 2 ? UNP P62136 ? ? 'expression tag' 3   7  
2 6GHM MET B 3 ? UNP P62136 ? ? 'expression tag' 4   8  
2 6GHM GLY B 4 ? UNP P62136 ? ? 'expression tag' 5   9  
2 6GHM SER B 5 ? UNP P62136 ? ? 'expression tag' 6   10 
3 6GHM GLY C 1 ? UNP Q13625 ? ? 'expression tag' 915 11 
3 6GHM PRO C 2 ? UNP Q13625 ? ? 'expression tag' 916 12 
3 6GHM LEU C 3 ? UNP Q13625 ? ? 'expression tag' 917 13 
3 6GHM GLY C 4 ? UNP Q13625 ? ? 'expression tag' 918 14 
3 6GHM SER C 5 ? UNP Q13625 ? ? 'expression tag' 919 15 
4 6GHM GLY D 1 ? UNP Q13625 ? ? 'expression tag' 915 16 
4 6GHM PRO D 2 ? UNP Q13625 ? ? 'expression tag' 916 17 
4 6GHM LEU D 3 ? UNP Q13625 ? ? 'expression tag' 917 18 
4 6GHM GLY D 4 ? UNP Q13625 ? ? 'expression tag' 918 19 
4 6GHM SER D 5 ? UNP Q13625 ? ? 'expression tag' 919 20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                     ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                    ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                  ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                             ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                    ?                               'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL                              'ETHYLENE GLYCOL'               'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE                                   ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                             ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                     ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL                                    'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE                                   ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                       ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                  ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                     ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                      ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                  ?                               'C5 H11 N O2 S'  149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                        ?                               'Mn 2'           54.938  
NHE non-polymer         . '2-[N-CYCLOHEXYLAMINO]ETHANE SULFONIC ACID' 'N-CYCLOHEXYLTAURINE; CHES'     'C8 H17 N O3 S'  207.290 
PHE 'L-peptide linking' y PHENYLALANINE                               ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                     ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                      ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                   ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                  ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                    ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                      ?                               'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6GHM 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.67 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         53.89 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;0.1 M TRIS pH 8.5
16 % PEG 8000
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-02-07 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I02' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I02 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6GHM 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.15 
_reflns.d_resolution_low                 59 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       68468 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.9 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            4.3 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.12 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.96 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.15 
_reflns_shell.d_res_low                   2.2 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             0.49 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.58 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6GHM 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.150 
_refine.ls_d_res_low                             59.647 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     68457 
_refine.ls_number_reflns_R_free                  3477 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.62 
_refine.ls_percent_reflns_R_free                 5.08 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1788 
_refine.ls_R_factor_R_free                       0.2145 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1769 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.96 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4MOV 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 22.46 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.26 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7822 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         154 
_refine_hist.number_atoms_solvent             245 
_refine_hist.number_atoms_total               8221 
_refine_hist.d_res_high                       2.150 
_refine_hist.d_res_low                        59.647 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.006 ? 8182  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.747 ? 11080 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 9.249 ? 5993  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.044 ? 1207  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004 ? 1431  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.1500 2.1795  . . 127 2506 97.00  . . . 0.2971 . 0.2678 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1795 2.2106  . . 130 2599 98.00  . . . 0.2885 . 0.2543 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2106 2.2436  . . 140 2586 98.00  . . . 0.3227 . 0.2459 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2436 2.2787  . . 149 2495 99.00  . . . 0.2825 . 0.2390 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2787 2.3160  . . 141 2595 99.00  . . . 0.2860 . 0.2284 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3160 2.3560  . . 134 2622 99.00  . . . 0.2532 . 0.2224 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3560 2.3988  . . 128 2624 100.00 . . . 0.2910 . 0.2217 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3988 2.4450  . . 136 2605 100.00 . . . 0.2594 . 0.2155 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4450 2.4949  . . 128 2597 100.00 . . . 0.2908 . 0.2100 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4949 2.5491  . . 147 2637 100.00 . . . 0.2587 . 0.2008 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5491 2.6084  . . 148 2609 100.00 . . . 0.2592 . 0.2065 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6084 2.6736  . . 148 2575 100.00 . . . 0.2479 . 0.1984 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6736 2.7459  . . 156 2641 100.00 . . . 0.2465 . 0.1781 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7459 2.8267  . . 142 2578 100.00 . . . 0.2609 . 0.1773 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8267 2.9180  . . 123 2656 100.00 . . . 0.1930 . 0.1726 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9180 3.0223  . . 135 2578 100.00 . . . 0.2040 . 0.1626 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0223 3.1433  . . 143 2635 100.00 . . . 0.2323 . 0.1702 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1433 3.2863  . . 120 2601 100.00 . . . 0.2258 . 0.1727 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2863 3.4595  . . 137 2613 100.00 . . . 0.2049 . 0.1617 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4595 3.6763  . . 157 2587 100.00 . . . 0.1912 . 0.1573 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6763 3.9601  . . 176 2591 100.00 . . . 0.2065 . 0.1542 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9601 4.3585  . . 136 2612 100.00 . . . 0.1627 . 0.1440 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3585 4.9889  . . 126 2601 100.00 . . . 0.1736 . 0.1470 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.9889 6.2844  . . 138 2628 100.00 . . . 0.2095 . 0.1871 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.2844 59.6695 . . 132 2609 100.00 . . . 0.1844 . 0.1833 . . . . . . . . . . 
# 
_struct.entry_id                     6GHM 
_struct.title                        'Structure of PP1 alpha phosphatase bound to ASPP2' 
_struct.pdbx_descriptor              
'Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (E.C.3.1.3.16), Apoptosis-stimulating of p53 protein 2' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6GHM 
_struct_keywords.text            'Phosphatase, PP1, ASPP2, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 2 ? 
D  N N 2 ? 
E  N N 3 ? 
F  N N 3 ? 
G  N N 3 ? 
H  N N 3 ? 
I  N N 3 ? 
J  N N 3 ? 
K  N N 4 ? 
L  N N 4 ? 
M  N N 4 ? 
N  N N 5 ? 
O  N N 5 ? 
P  N N 6 ? 
Q  N N 6 ? 
R  N N 3 ? 
S  N N 3 ? 
T  N N 3 ? 
U  N N 3 ? 
V  N N 4 ? 
W  N N 5 ? 
X  N N 5 ? 
Y  N N 5 ? 
Z  N N 6 ? 
AA N N 6 ? 
BA N N 3 ? 
CA N N 3 ? 
DA N N 5 ? 
EA N N 7 ? 
FA N N 7 ? 
GA N N 7 ? 
HA N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASN A 7   ? GLU A 17  ? ASN A 8    GLU A 18   1 ? 11 
HELX_P HELX_P2  AA2 THR A 30  ? GLN A 48  ? THR A 31   GLN A 49   1 ? 19 
HELX_P HELX_P3  AA3 GLN A 67  ? GLY A 79  ? GLN A 68   GLY A 80   1 ? 13 
HELX_P HELX_P4  AA4 GLN A 98  ? TYR A 113 ? GLN A 99   TYR A 114  1 ? 16 
HELX_P HELX_P5  AA5 GLY A 134 ? TYR A 143 ? GLY A 135  TYR A 144  1 ? 10 
HELX_P HELX_P6  AA6 ASN A 144 ? ASN A 156 ? ASN A 145  ASN A 157  1 ? 13 
HELX_P HELX_P7  AA7 SER A 181 ? ARG A 187 ? SER A 182  ARG A 188  1 ? 7  
HELX_P HELX_P8  AA8 GLY A 198 ? SER A 206 ? GLY A 199  SER A 207  1 ? 9  
HELX_P HELX_P9  AA9 GLY A 227 ? ASP A 239 ? GLY A 228  ASP A 240  1 ? 13 
HELX_P HELX_P10 AB1 ASN A 270 ? GLU A 274 ? ASN A 271  GLU A 275  5 ? 5  
HELX_P HELX_P11 AB2 ASN B 7   ? GLU B 17  ? ASN B 8    GLU B 18   1 ? 11 
HELX_P HELX_P12 AB3 THR B 30  ? GLN B 48  ? THR B 31   GLN B 49   1 ? 19 
HELX_P HELX_P13 AB4 GLN B 67  ? GLY B 79  ? GLN B 68   GLY B 80   1 ? 13 
HELX_P HELX_P14 AB5 GLN B 98  ? TYR B 113 ? GLN B 99   TYR B 114  1 ? 16 
HELX_P HELX_P15 AB6 CYS B 126 ? ARG B 131 ? CYS B 127  ARG B 132  1 ? 6  
HELX_P HELX_P16 AB7 GLY B 134 ? TYR B 143 ? GLY B 135  TYR B 144  1 ? 10 
HELX_P HELX_P17 AB8 ASN B 144 ? ASN B 156 ? ASN B 145  ASN B 157  1 ? 13 
HELX_P HELX_P18 AB9 SER B 181 ? ARG B 187 ? SER B 182  ARG B 188  1 ? 7  
HELX_P HELX_P19 AC1 GLY B 198 ? SER B 206 ? GLY B 199  SER B 207  1 ? 9  
HELX_P HELX_P20 AC2 GLY B 227 ? HIS B 238 ? GLY B 228  HIS B 239  1 ? 12 
HELX_P HELX_P21 AC3 ASN B 270 ? GLU B 274 ? ASN B 271  GLU B 275  5 ? 5  
HELX_P HELX_P22 AC4 ASN C 11  ? GLY C 23  ? ASN C 925  GLY C 937  1 ? 13 
HELX_P HELX_P23 AC5 GLU C 24  ? ILE C 32  ? GLU C 938  ILE C 946  1 ? 9  
HELX_P HELX_P24 AC6 THR C 47  ? ALA C 55  ? THR C 961  ALA C 969  1 ? 9  
HELX_P HELX_P25 AC7 HIS C 57  ? GLY C 68  ? HIS C 971  GLY C 982  1 ? 12 
HELX_P HELX_P26 AC8 THR C 80  ? CYS C 88  ? THR C 994  CYS C 1002 1 ? 9  
HELX_P HELX_P27 AC9 ASN C 90  ? GLU C 99  ? ASN C 1004 GLU C 1013 1 ? 10 
HELX_P HELX_P28 AD1 ALA C 115 ? CYS C 119 ? ALA C 1029 CYS C 1033 5 ? 5  
HELX_P HELX_P29 AD2 GLY C 125 ? MET C 140 ? GLY C 1039 MET C 1054 1 ? 16 
HELX_P HELX_P30 AD3 ILE C 142 ? GLY C 146 ? ILE C 1056 GLY C 1060 1 ? 5  
HELX_P HELX_P31 AD4 ASN D 11  ? GLY D 23  ? ASN D 925  GLY D 937  1 ? 13 
HELX_P HELX_P32 AD5 GLU D 24  ? ILE D 32  ? GLU D 938  ILE D 946  1 ? 9  
HELX_P HELX_P33 AD6 TYR D 33  ? VAL D 35  ? TYR D 947  VAL D 949  5 ? 3  
HELX_P HELX_P34 AD7 THR D 47  ? ALA D 55  ? THR D 961  ALA D 969  1 ? 9  
HELX_P HELX_P35 AD8 HIS D 57  ? GLY D 68  ? HIS D 971  GLY D 982  1 ? 12 
HELX_P HELX_P36 AD9 THR D 80  ? CYS D 88  ? THR D 994  CYS D 1002 1 ? 9  
HELX_P HELX_P37 AE1 ASN D 90  ? GLU D 99  ? ASN D 1004 GLU D 1013 1 ? 10 
HELX_P HELX_P38 AE2 ALA D 115 ? CYS D 119 ? ALA D 1029 CYS D 1033 5 ? 5  
HELX_P HELX_P39 AE3 GLY D 125 ? MET D 140 ? GLY D 1039 MET D 1054 1 ? 16 
HELX_P HELX_P40 AE4 MET D 143 ? LYS D 145 ? MET D 1057 LYS D 1059 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A  ASP 63  OD2 ? ? ? 1_555 P  MN  . MN ? ? A ASP 64  A MN  412 1_555 ? ? ? ? ? ? ? 2.106 ? 
metalc2  metalc ? ? A  HIS 65  NE2 ? ? ? 1_555 P  MN  . MN ? ? A HIS 66  A MN  412 1_555 ? ? ? ? ? ? ? 2.180 ? 
metalc3  metalc ? ? A  ASP 91  OD2 ? ? ? 1_555 Q  MN  . MN ? ? A ASP 92  A MN  413 1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc4  metalc ? ? A  ASP 91  OD2 ? ? ? 1_555 P  MN  . MN ? ? A ASP 92  A MN  412 1_555 ? ? ? ? ? ? ? 2.098 ? 
metalc5  metalc ? ? A  ASN 123 OD1 ? ? ? 1_555 Q  MN  . MN ? ? A ASN 124 A MN  413 1_555 ? ? ? ? ? ? ? 2.090 ? 
metalc6  metalc ? ? A  HIS 172 NE2 ? ? ? 1_555 Q  MN  . MN ? ? A HIS 173 A MN  413 1_555 ? ? ? ? ? ? ? 2.194 ? 
metalc7  metalc ? ? A  HIS 247 ND1 ? ? ? 1_555 Q  MN  . MN ? ? A HIS 248 A MN  413 1_555 ? ? ? ? ? ? ? 2.148 ? 
metalc8  metalc ? ? B  ASP 63  OD2 ? ? ? 1_555 Z  MN  . MN ? ? B ASP 64  B MN  409 1_555 ? ? ? ? ? ? ? 2.039 ? 
metalc9  metalc ? ? B  HIS 65  NE2 ? ? ? 1_555 Z  MN  . MN ? ? B HIS 66  B MN  409 1_555 ? ? ? ? ? ? ? 2.153 ? 
metalc10 metalc ? ? B  ASP 91  OD2 ? ? ? 1_555 AA MN  . MN ? ? B ASP 92  B MN  410 1_555 ? ? ? ? ? ? ? 2.259 ? 
metalc11 metalc ? ? B  ASP 91  OD2 ? ? ? 1_555 Z  MN  . MN ? ? B ASP 92  B MN  409 1_555 ? ? ? ? ? ? ? 2.189 ? 
metalc12 metalc ? ? B  ASN 123 OD1 ? ? ? 1_555 AA MN  . MN ? ? B ASN 124 B MN  410 1_555 ? ? ? ? ? ? ? 2.019 ? 
metalc13 metalc ? ? B  HIS 172 NE2 ? ? ? 1_555 AA MN  . MN ? ? B HIS 173 B MN  410 1_555 ? ? ? ? ? ? ? 2.174 ? 
metalc14 metalc ? ? B  HIS 247 ND1 ? ? ? 1_555 AA MN  . MN ? ? B HIS 248 B MN  410 1_555 ? ? ? ? ? ? ? 2.183 ? 
metalc15 metalc ? ? O  NHE .   O1  A ? ? 1_555 Q  MN  . MN ? ? A NHE 411 A MN  413 1_555 ? ? ? ? ? ? ? 2.504 ? 
metalc16 metalc ? ? O  NHE .   O2  A ? ? 1_555 P  MN  . MN ? ? A NHE 411 A MN  412 1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc17 metalc ? ? P  MN  .   MN  ? ? ? 1_555 EA HOH . O  ? ? A MN  412 A HOH 501 1_555 ? ? ? ? ? ? ? 2.187 ? 
metalc18 metalc ? ? P  MN  .   MN  ? ? ? 1_555 EA HOH . O  ? ? A MN  412 A HOH 551 1_555 ? ? ? ? ? ? ? 2.439 ? 
metalc19 metalc ? ? Q  MN  .   MN  ? ? ? 1_555 EA HOH . O  ? ? A MN  413 A HOH 501 1_555 ? ? ? ? ? ? ? 1.809 ? 
metalc20 metalc ? ? W  NHE .   O3  ? ? ? 1_555 Z  MN  . MN ? ? B NHE 406 B MN  409 1_555 ? ? ? ? ? ? ? 2.584 ? 
metalc21 metalc ? ? Z  MN  .   MN  ? ? ? 1_555 FA HOH . O  ? ? B MN  409 B HOH 511 1_555 ? ? ? ? ? ? ? 2.094 ? 
metalc22 metalc ? ? Z  MN  .   MN  ? ? ? 1_555 FA HOH . O  ? ? B MN  409 B HOH 538 1_555 ? ? ? ? ? ? ? 2.130 ? 
metalc23 metalc ? ? AA MN  .   MN  ? ? ? 1_555 FA HOH . O  ? ? B MN  410 B HOH 511 1_555 ? ? ? ? ? ? ? 1.934 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 56  A . ? ALA 57  A PRO 57  A ? PRO 58  A 1 5.13  
2 PRO 81  A . ? PRO 82  A PRO 82  A ? PRO 83  A 1 6.34  
3 ARG 190 A . ? ARG 191 A PRO 191 A ? PRO 192 A 1 1.36  
4 ALA 56  B . ? ALA 57  B PRO 57  B ? PRO 58  B 1 1.59  
5 PRO 81  B . ? PRO 82  B PRO 82  B ? PRO 83  B 1 3.62  
6 ARG 190 B . ? ARG 191 B PRO 191 B ? PRO 192 B 1 -2.60 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 6 ? 
AA3 ? 3 ? 
AA4 ? 6 ? 
AA5 ? 6 ? 
AA6 ? 3 ? 
AA7 ? 5 ? 
AA8 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? anti-parallel 
AA2 1 2 ? parallel      
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? parallel      
AA3 1 2 ? parallel      
AA3 2 3 ? anti-parallel 
AA4 1 2 ? parallel      
AA4 2 3 ? anti-parallel 
AA4 3 4 ? parallel      
AA4 4 5 ? parallel      
AA4 5 6 ? anti-parallel 
AA5 1 2 ? parallel      
AA5 2 3 ? parallel      
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA5 5 6 ? parallel      
AA6 1 2 ? parallel      
AA6 2 3 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA7 4 5 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA8 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 51  ? LEU A 54  ? LEU A 52   LEU A 55   
AA1 2 ALA A 161 ? VAL A 164 ? ALA A 162  VAL A 165  
AA1 3 ILE A 168 ? CYS A 171 ? ILE A 169  CYS A 172  
AA1 4 LEU A 242 ? ARG A 245 ? LEU A 243  ARG A 246  
AA1 5 LEU A 262 ? LEU A 265 ? LEU A 263  LEU A 266  
AA1 6 TYR A 254 ? PHE A 257 ? TYR A 255  PHE A 258  
AA2 1 PHE A 117 ? LEU A 119 ? PHE A 118  LEU A 120  
AA2 2 TYR A 86  ? PHE A 88  ? TYR A 87   PHE A 89   
AA2 3 LEU A 58  ? CYS A 61  ? LEU A 59   CYS A 62   
AA2 4 GLY A 279 ? VAL A 284 ? GLY A 280  VAL A 285  
AA2 5 MET A 289 ? LEU A 295 ? MET A 290  LEU A 296  
AA2 6 LYS D 9   ? PHE D 10  ? LYS D 923  PHE D 924  
AA3 1 ASP A 207 ? PRO A 208 ? ASP A 208  PRO A 209  
AA3 2 PHE A 224 ? PHE A 226 ? PHE A 225  PHE A 227  
AA3 3 TRP A 215 ? GLU A 217 ? TRP A 216  GLU A 218  
AA4 1 LEU B 51  ? LEU B 54  ? LEU B 52   LEU B 55   
AA4 2 ALA B 161 ? VAL B 164 ? ALA B 162  VAL B 165  
AA4 3 ILE B 168 ? CYS B 170 ? ILE B 169  CYS B 171  
AA4 4 LEU B 242 ? ARG B 245 ? LEU B 243  ARG B 246  
AA4 5 LEU B 262 ? LEU B 265 ? LEU B 263  LEU B 266  
AA4 6 TYR B 254 ? PHE B 257 ? TYR B 255  PHE B 258  
AA5 1 PHE B 117 ? LEU B 119 ? PHE B 118  LEU B 120  
AA5 2 TYR B 86  ? PHE B 88  ? TYR B 87   PHE B 89   
AA5 3 LEU B 58  ? CYS B 61  ? LEU B 59   CYS B 62   
AA5 4 GLY B 279 ? VAL B 284 ? GLY B 280  VAL B 285  
AA5 5 MET B 289 ? LEU B 295 ? MET B 290  LEU B 296  
AA5 6 LYS C 9   ? PHE C 10  ? LYS C 923  PHE C 924  
AA6 1 ASP B 207 ? PRO B 208 ? ASP B 208  PRO B 209  
AA6 2 PHE B 224 ? PHE B 226 ? PHE B 225  PHE B 227  
AA6 3 TRP B 215 ? GLU B 217 ? TRP B 216  GLU B 218  
AA7 1 LYS C 191 ? PRO C 196 ? LYS C 1105 PRO C 1110 
AA7 2 TRP C 183 ? LEU C 188 ? TRP C 1097 LEU C 1102 
AA7 3 CYS C 169 ? HIS C 174 ? CYS C 1083 HIS C 1088 
AA7 4 VAL C 147 ? ALA C 150 ? VAL C 1061 ALA C 1064 
AA7 5 LEU C 200 ? GLY C 201 ? LEU C 1114 GLY C 1115 
AA8 1 LYS D 191 ? PRO D 196 ? LYS D 1105 PRO D 1110 
AA8 2 TRP D 183 ? LEU D 188 ? TRP D 1097 LEU D 1102 
AA8 3 CYS D 169 ? ARG D 175 ? CYS D 1083 ARG D 1089 
AA8 4 VAL D 147 ? ALA D 150 ? VAL D 1061 ALA D 1064 
AA8 5 LEU D 200 ? GLY D 201 ? LEU D 1114 GLY D 1115 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 52  ? N LEU A 53   O ILE A 163 ? O ILE A 164  
AA1 2 3 N ALA A 162 ? N ALA A 163  O CYS A 170 ? O CYS A 171  
AA1 3 4 N PHE A 169 ? N PHE A 170  O CYS A 244 ? O CYS A 245  
AA1 4 5 N ARG A 245 ? N ARG A 246  O LEU A 265 ? O LEU A 266  
AA1 5 6 O THR A 264 ? O THR A 265  N GLU A 255 ? N GLU A 256  
AA2 1 2 O PHE A 118 ? O PHE A 119  N PHE A 88  ? N PHE A 89   
AA2 2 3 O LEU A 87  ? O LEU A 88   N LYS A 59  ? N LYS A 60   
AA2 3 4 N ILE A 60  ? N ILE A 61   O MET A 282 ? O MET A 283  
AA2 4 5 N GLY A 279 ? N GLY A 280  O LEU A 295 ? O LEU A 296  
AA2 5 6 N CYS A 290 ? N CYS A 291  O LYS D 9   ? O LYS D 923  
AA3 1 2 N ASP A 207 ? N ASP A 208  O PHE A 226 ? O PHE A 227  
AA3 2 3 O THR A 225 ? O THR A 226  N GLY A 216 ? N GLY A 217  
AA4 1 2 N LEU B 52  ? N LEU B 53   O ILE B 163 ? O ILE B 164  
AA4 2 3 N ALA B 162 ? N ALA B 163  O CYS B 170 ? O CYS B 171  
AA4 3 4 N PHE B 169 ? N PHE B 170  O CYS B 244 ? O CYS B 245  
AA4 4 5 N ARG B 245 ? N ARG B 246  O LEU B 265 ? O LEU B 266  
AA4 5 6 O THR B 264 ? O THR B 265  N GLU B 255 ? N GLU B 256  
AA5 1 2 O PHE B 118 ? O PHE B 119  N PHE B 88  ? N PHE B 89   
AA5 2 3 O LEU B 87  ? O LEU B 88   N LYS B 59  ? N LYS B 60   
AA5 3 4 N LEU B 58  ? N LEU B 59   O VAL B 284 ? O VAL B 285  
AA5 4 5 N GLY B 279 ? N GLY B 280  O LEU B 295 ? O LEU B 296  
AA5 5 6 N CYS B 290 ? N CYS B 291  O LYS C 9   ? O LYS C 923  
AA6 1 2 N ASP B 207 ? N ASP B 208  O PHE B 224 ? O PHE B 225  
AA6 2 3 O THR B 225 ? O THR B 226  N GLY B 216 ? N GLY B 217  
AA7 1 2 O GLY C 193 ? O GLY C 1107 N ALA C 186 ? N ALA C 1100 
AA7 2 3 O TRP C 185 ? O TRP C 1099 N ILE C 173 ? N ILE C 1087 
AA7 3 4 O MET C 170 ? O MET C 1084 N ILE C 148 ? N ILE C 1062 
AA7 4 5 N TYR C 149 ? N TYR C 1063 O GLY C 201 ? O GLY C 1115 
AA8 1 2 O GLY D 193 ? O GLY D 1107 N ALA D 186 ? N ALA D 1100 
AA8 2 3 O TRP D 185 ? O TRP D 1099 N HIS D 174 ? N HIS D 1088 
AA8 3 4 O MET D 170 ? O MET D 1084 N ILE D 148 ? N ILE D 1062 
AA8 4 5 N TYR D 149 ? N TYR D 1063 O GLY D 201 ? O GLY D 1115 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A EDO 401  ? 6  'binding site for residue EDO A 401'  
AC2 Software A EDO 402  ? 7  'binding site for residue EDO A 402'  
AC3 Software A EDO 403  ? 4  'binding site for residue EDO A 403'  
AC4 Software A EDO 404  ? 2  'binding site for residue EDO A 404'  
AC5 Software A EDO 405  ? 3  'binding site for residue EDO A 405'  
AC6 Software A EDO 406  ? 7  'binding site for residue EDO A 406'  
AC7 Software A GOL 407  ? 6  'binding site for residue GOL A 407'  
AC8 Software A GOL 408  ? 4  'binding site for residue GOL A 408'  
AC9 Software A GOL 409  ? 5  'binding site for residue GOL A 409'  
AD1 Software A NHE 410  ? 8  'binding site for residue NHE A 410'  
AD2 Software A NHE 411  ? 13 'binding site for residue NHE A 411'  
AD3 Software A MN  412  ? 7  'binding site for residue MN A 412'   
AD4 Software A MN  413  ? 7  'binding site for residue MN A 413'   
AD5 Software B EDO 401  ? 4  'binding site for residue EDO B 401'  
AD6 Software B EDO 402  ? 4  'binding site for residue EDO B 402'  
AD7 Software B EDO 403  ? 4  'binding site for residue EDO B 403'  
AD8 Software B EDO 404  ? 5  'binding site for residue EDO B 404'  
AD9 Software B GOL 405  ? 3  'binding site for residue GOL B 405'  
AE1 Software B NHE 406  ? 14 'binding site for residue NHE B 406'  
AE2 Software B NHE 407  ? 7  'binding site for residue NHE B 407'  
AE3 Software B NHE 408  ? 5  'binding site for residue NHE B 408'  
AE4 Software B MN  409  ? 7  'binding site for residue MN B 409'   
AE5 Software B MN  410  ? 7  'binding site for residue MN B 410'   
AE6 Software D EDO 1201 ? 5  'binding site for residue EDO D 1201' 
AE7 Software D EDO 1202 ? 4  'binding site for residue EDO D 1202' 
AE8 Software D NHE 1203 ? 6  'binding site for residue NHE D 1203' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 6  ASP A  207 ? ASP A 208  . ? 1_555 ? 
2   AC1 6  GLU A  217 ? GLU A 218  . ? 1_555 ? 
3   AC1 6  ASN A  218 ? ASN A 219  . ? 1_555 ? 
4   AC1 6  ASP A  219 ? ASP A 220  . ? 1_555 ? 
5   AC1 6  THR A  225 ? THR A 226  . ? 1_555 ? 
6   AC1 6  GLN A  248 ? GLN A 249  . ? 1_555 ? 
7   AC2 7  LEU A  6   ? LEU A 7    . ? 1_555 ? 
8   AC2 7  ASN A  7   ? ASN A 8    . ? 1_555 ? 
9   AC2 7  LEU A  8   ? LEU A 9    . ? 1_555 ? 
10  AC2 7  ASP A  9   ? ASP A 10   . ? 1_555 ? 
11  AC2 7  PRO B  81  ? PRO B 82   . ? 1_666 ? 
12  AC2 7  GLU B  83  ? GLU B 84   . ? 1_666 ? 
13  AC2 7  HOH FA .   ? HOH B 502  . ? 1_666 ? 
14  AC3 4  SER A  176 ? SER A 177  . ? 1_555 ? 
15  AC3 4  LEU A  179 ? LEU A 180  . ? 1_555 ? 
16  AC3 4  PHE A  234 ? PHE A 235  . ? 1_555 ? 
17  AC3 4  HOH EA .   ? HOH A 527  . ? 1_555 ? 
18  AC4 2  GLU A  53  ? GLU A 54   . ? 1_555 ? 
19  AC4 2  GLU A  115 ? GLU A 116  . ? 1_555 ? 
20  AC5 3  GLN A  248 ? GLN A 249  . ? 1_555 ? 
21  AC5 3  GLU A  255 ? GLU A 256  . ? 1_555 ? 
22  AC5 3  HOH EA .   ? HOH A 526  . ? 1_555 ? 
23  AC6 7  GLY A  66  ? GLY A 67   . ? 1_555 ? 
24  AC6 7  GLN A  67  ? GLN A 68   . ? 1_555 ? 
25  AC6 7  TYR A  68  ? TYR A 69   . ? 1_555 ? 
26  AC6 7  TYR A  69  ? TYR A 70   . ? 1_555 ? 
27  AC6 7  GLY A  96  ? GLY A 97   . ? 1_555 ? 
28  AC6 7  LYS A  97  ? LYS A 98   . ? 1_555 ? 
29  AC6 7  GLN A  98  ? GLN A 99   . ? 1_555 ? 
30  AC7 6  ASP A  252 ? ASP A 253  . ? 1_555 ? 
31  AC7 6  TYR A  254 ? TYR A 255  . ? 1_555 ? 
32  AC7 6  GLU A  255 ? GLU A 256  . ? 1_555 ? 
33  AC7 6  PHE A  256 ? PHE A 257  . ? 1_555 ? 
34  AC7 6  ASP D  18  ? ASP D 932  . ? 1_555 ? 
35  AC7 6  HOH HA .   ? HOH D 1301 . ? 1_555 ? 
36  AC8 4  GLU A  55  ? GLU A 56   . ? 1_555 ? 
37  AC8 4  ALA A  56  ? ALA A 57   . ? 1_555 ? 
38  AC8 4  ASP A  165 ? ASP A 166  . ? 1_555 ? 
39  AC8 4  GLU A  286 ? GLU A 287  . ? 1_555 ? 
40  AC9 5  ILE A  129 ? ILE A 130  . ? 1_555 ? 
41  AC9 5  TYR A  133 ? TYR A 134  . ? 1_555 ? 
42  AC9 5  ARG A  220 ? ARG A 221  . ? 1_555 ? 
43  AC9 5  PRO B  177 ? PRO B 178  . ? 1_656 ? 
44  AC9 5  ASP B  178 ? ASP B 179  . ? 1_656 ? 
45  AD1 8  SER A  128 ? SER A 129  . ? 1_555 ? 
46  AD1 8  ILE A  129 ? ILE A 130  . ? 1_555 ? 
47  AD1 8  VAL A  194 ? VAL A 195  . ? 1_555 ? 
48  AD1 8  PRO A  195 ? PRO A 196  . ? 1_555 ? 
49  AD1 8  ASP A  196 ? ASP A 197  . ? 1_555 ? 
50  AD1 8  TRP A  205 ? TRP A 206  . ? 1_555 ? 
51  AD1 8  HOH EA .   ? HOH A 506  . ? 1_555 ? 
52  AD1 8  GLN B  180 ? GLN B 181  . ? 1_656 ? 
53  AD2 13 HIS A  65  ? HIS A 66   . ? 1_555 ? 
54  AD2 13 ASP A  91  ? ASP A 92   . ? 1_555 ? 
55  AD2 13 ARG A  95  ? ARG A 96   . ? 1_555 ? 
56  AD2 13 ASN A  123 ? ASN A 124  . ? 1_555 ? 
57  AD2 13 HIS A  124 ? HIS A 125  . ? 1_555 ? 
58  AD2 13 ARG A  220 ? ARG A 221  . ? 1_555 ? 
59  AD2 13 HIS A  247 ? HIS A 248  . ? 1_555 ? 
60  AD2 13 GLN A  248 ? GLN A 249  . ? 1_555 ? 
61  AD2 13 VAL A  249 ? VAL A 250  . ? 1_555 ? 
62  AD2 13 MN  P  .   ? MN  A 412  . ? 1_555 ? 
63  AD2 13 MN  Q  .   ? MN  A 413  . ? 1_555 ? 
64  AD2 13 HOH EA .   ? HOH A 501  . ? 1_555 ? 
65  AD2 13 HOH EA .   ? HOH A 551  . ? 1_555 ? 
66  AD3 7  ASP A  63  ? ASP A 64   . ? 1_555 ? 
67  AD3 7  HIS A  65  ? HIS A 66   . ? 1_555 ? 
68  AD3 7  ASP A  91  ? ASP A 92   . ? 1_555 ? 
69  AD3 7  NHE O  .   ? NHE A 411  . ? 1_555 ? 
70  AD3 7  MN  Q  .   ? MN  A 413  . ? 1_555 ? 
71  AD3 7  HOH EA .   ? HOH A 501  . ? 1_555 ? 
72  AD3 7  HOH EA .   ? HOH A 551  . ? 1_555 ? 
73  AD4 7  ASP A  91  ? ASP A 92   . ? 1_555 ? 
74  AD4 7  ASN A  123 ? ASN A 124  . ? 1_555 ? 
75  AD4 7  HIS A  172 ? HIS A 173  . ? 1_555 ? 
76  AD4 7  HIS A  247 ? HIS A 248  . ? 1_555 ? 
77  AD4 7  NHE O  .   ? NHE A 411  . ? 1_555 ? 
78  AD4 7  MN  P  .   ? MN  A 412  . ? 1_555 ? 
79  AD4 7  HOH EA .   ? HOH A 501  . ? 1_555 ? 
80  AD5 4  LYS B  40  ? LYS B 41   . ? 1_555 ? 
81  AD5 4  GLU B  43  ? GLU B 44   . ? 1_555 ? 
82  AD5 4  ILE B  44  ? ILE B 45   . ? 1_555 ? 
83  AD5 4  SER B  47  ? SER B 48   . ? 1_555 ? 
84  AD6 4  LEU B  46  ? LEU B 47   . ? 1_555 ? 
85  AD6 4  MET B  189 ? MET B 190  . ? 1_555 ? 
86  AD6 4  ARG B  190 ? ARG B 191  . ? 1_555 ? 
87  AD6 4  HOH FA .   ? HOH B 519  . ? 1_555 ? 
88  AD7 4  GLN B  248 ? GLN B 249  . ? 1_555 ? 
89  AD7 4  GLU B  255 ? GLU B 256  . ? 1_555 ? 
90  AD7 4  PHE B  256 ? PHE B 257  . ? 1_555 ? 
91  AD7 4  HOH FA .   ? HOH B 528  . ? 1_555 ? 
92  AD8 5  ASP B  252 ? ASP B 253  . ? 1_555 ? 
93  AD8 5  TYR B  254 ? TYR B 255  . ? 1_555 ? 
94  AD8 5  GLU B  255 ? GLU B 256  . ? 1_555 ? 
95  AD8 5  PHE B  256 ? PHE B 257  . ? 1_555 ? 
96  AD8 5  HOH GA .   ? HOH C 1201 . ? 1_555 ? 
97  AD9 3  GLY A  214 ? GLY A 215  . ? 1_554 ? 
98  AD9 3  TRP A  215 ? TRP A 216  . ? 1_554 ? 
99  AD9 3  SER B  128 ? SER B 129  . ? 1_555 ? 
100 AE1 14 HIS B  65  ? HIS B 66   . ? 1_555 ? 
101 AE1 14 ASP B  91  ? ASP B 92   . ? 1_555 ? 
102 AE1 14 ARG B  95  ? ARG B 96   . ? 1_555 ? 
103 AE1 14 ASN B  123 ? ASN B 124  . ? 1_555 ? 
104 AE1 14 HIS B  124 ? HIS B 125  . ? 1_555 ? 
105 AE1 14 ARG B  220 ? ARG B 221  . ? 1_555 ? 
106 AE1 14 HIS B  247 ? HIS B 248  . ? 1_555 ? 
107 AE1 14 GLN B  248 ? GLN B 249  . ? 1_555 ? 
108 AE1 14 VAL B  249 ? VAL B 250  . ? 1_555 ? 
109 AE1 14 TYR B  271 ? TYR B 272  . ? 1_555 ? 
110 AE1 14 MN  Z  .   ? MN  B 409  . ? 1_555 ? 
111 AE1 14 MN  AA .   ? MN  B 410  . ? 1_555 ? 
112 AE1 14 HOH FA .   ? HOH B 511  . ? 1_555 ? 
113 AE1 14 HOH FA .   ? HOH B 538  . ? 1_555 ? 
114 AE2 7  LYS A  233 ? LYS A 234  . ? 1_554 ? 
115 AE2 7  SER B  128 ? SER B 129  . ? 1_555 ? 
116 AE2 7  VAL B  194 ? VAL B 195  . ? 1_555 ? 
117 AE2 7  PRO B  195 ? PRO B 196  . ? 1_555 ? 
118 AE2 7  ASP B  196 ? ASP B 197  . ? 1_555 ? 
119 AE2 7  TRP B  205 ? TRP B 206  . ? 1_555 ? 
120 AE2 7  HOH FA .   ? HOH B 540  . ? 1_555 ? 
121 AE3 5  ASP B  241 ? ASP B 242  . ? 1_555 ? 
122 AE3 5  LYS B  259 ? LYS B 260  . ? 1_555 ? 
123 AE3 5  ARG B  260 ? ARG B 261  . ? 1_555 ? 
124 AE3 5  VAL C  8   ? VAL C 922  . ? 1_555 ? 
125 AE3 5  PHE C  10  ? PHE C 924  . ? 1_555 ? 
126 AE4 7  ASP B  63  ? ASP B 64   . ? 1_555 ? 
127 AE4 7  HIS B  65  ? HIS B 66   . ? 1_555 ? 
128 AE4 7  ASP B  91  ? ASP B 92   . ? 1_555 ? 
129 AE4 7  NHE W  .   ? NHE B 406  . ? 1_555 ? 
130 AE4 7  MN  AA .   ? MN  B 410  . ? 1_555 ? 
131 AE4 7  HOH FA .   ? HOH B 511  . ? 1_555 ? 
132 AE4 7  HOH FA .   ? HOH B 538  . ? 1_555 ? 
133 AE5 7  ASP B  91  ? ASP B 92   . ? 1_555 ? 
134 AE5 7  ASN B  123 ? ASN B 124  . ? 1_555 ? 
135 AE5 7  HIS B  172 ? HIS B 173  . ? 1_555 ? 
136 AE5 7  HIS B  247 ? HIS B 248  . ? 1_555 ? 
137 AE5 7  NHE W  .   ? NHE B 406  . ? 1_555 ? 
138 AE5 7  MN  Z  .   ? MN  B 409  . ? 1_555 ? 
139 AE5 7  HOH FA .   ? HOH B 511  . ? 1_555 ? 
140 AE6 5  ASN D  144 ? ASN D 1058 . ? 1_555 ? 
141 AE6 5  VAL D  147 ? VAL D 1061 . ? 1_555 ? 
142 AE6 5  TYR D  149 ? TYR D 1063 . ? 1_555 ? 
143 AE6 5  LEU D  202 ? LEU D 1116 . ? 1_555 ? 
144 AE6 5  TYR D  203 ? TYR D 1117 . ? 1_555 ? 
145 AE7 4  CYS D  88  ? CYS D 1002 . ? 1_555 ? 
146 AE7 4  ASN D  89  ? ASN D 1003 . ? 1_555 ? 
147 AE7 4  ASN D  90  ? ASN D 1004 . ? 1_555 ? 
148 AE7 4  GLU D  124 ? GLU D 1038 . ? 1_555 ? 
149 AE8 6  LYS A  149 ? LYS A 150  . ? 1_554 ? 
150 AE8 6  GLY D  141 ? GLY D 1055 . ? 1_555 ? 
151 AE8 6  ILE D  142 ? ILE D 1056 . ? 1_555 ? 
152 AE8 6  ILE D  172 ? ILE D 1086 . ? 1_555 ? 
153 AE8 6  ILE D  173 ? ILE D 1087 . ? 1_555 ? 
154 AE8 6  HIS D  174 ? HIS D 1088 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6GHM 
_atom_sites.fract_transf_matrix[1][1]   0.021349 
_atom_sites.fract_transf_matrix[1][2]   0.005281 
_atom_sites.fract_transf_matrix[1][3]   0.000829 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012621 
_atom_sites.fract_transf_matrix[2][3]   0.000342 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011378 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . LEU A  1 6   ? -15.622 -0.213  -36.579  1.00 62.16  ? 7    LEU A N     1 
ATOM   2    C  CA    . LEU A  1 6   ? -15.634 -0.904  -37.868  1.00 60.73  ? 7    LEU A CA    1 
ATOM   3    C  C     . LEU A  1 6   ? -16.086 0.020   -38.999  1.00 54.76  ? 7    LEU A C     1 
ATOM   4    O  O     . LEU A  1 6   ? -17.267 0.363   -39.093  1.00 49.16  ? 7    LEU A O     1 
ATOM   5    C  CB    . LEU A  1 6   ? -16.545 -2.128  -37.808  1.00 55.19  ? 7    LEU A CB    1 
ATOM   6    C  CG    . LEU A  1 6   ? -16.460 -3.126  -38.966  1.00 54.47  ? 7    LEU A CG    1 
ATOM   7    C  CD1   . LEU A  1 6   ? -15.153 -3.904  -38.924  1.00 52.74  ? 7    LEU A CD1   1 
ATOM   8    C  CD2   . LEU A  1 6   ? -17.650 -4.088  -38.951  1.00 53.56  ? 7    LEU A CD2   1 
ATOM   9    N  N     . ASN A  1 7   ? -15.147 0.407   -39.864  1.00 46.59  ? 8    ASN A N     1 
ATOM   10   C  CA    . ASN A  1 7   ? -15.430 1.325   -40.963  1.00 36.96  ? 8    ASN A CA    1 
ATOM   11   C  C     . ASN A  1 7   ? -15.481 0.560   -42.281  1.00 36.39  ? 8    ASN A C     1 
ATOM   12   O  O     . ASN A  1 7   ? -14.439 0.239   -42.861  1.00 43.66  ? 8    ASN A O     1 
ATOM   13   C  CB    . ASN A  1 7   ? -14.391 2.434   -41.031  1.00 38.07  ? 8    ASN A CB    1 
ATOM   14   C  CG    . ASN A  1 7   ? -14.802 3.538   -41.980  1.00 40.86  ? 8    ASN A CG    1 
ATOM   15   O  OD1   . ASN A  1 7   ? -14.791 3.362   -43.200  1.00 40.89  ? 8    ASN A OD1   1 
ATOM   16   N  ND2   . ASN A  1 7   ? -15.161 4.685   -41.428  1.00 49.62  ? 8    ASN A ND2   1 
ATOM   17   N  N     . LEU A  1 8   ? -16.693 0.334   -42.787  1.00 34.08  ? 9    LEU A N     1 
ATOM   18   C  CA    . LEU A  1 8   ? -16.864 -0.512  -43.964  1.00 34.23  ? 9    LEU A CA    1 
ATOM   19   C  C     . LEU A  1 8   ? -16.315 0.139   -45.221  1.00 40.73  ? 9    LEU A C     1 
ATOM   20   O  O     . LEU A  1 8   ? -15.763 -0.551  -46.088  1.00 41.31  ? 9    LEU A O     1 
ATOM   21   C  CB    . LEU A  1 8   ? -18.338 -0.845  -44.159  1.00 37.92  ? 9    LEU A CB    1 
ATOM   22   C  CG    . LEU A  1 8   ? -18.881 -1.962  -43.272  1.00 38.47  ? 9    LEU A CG    1 
ATOM   23   C  CD1   . LEU A  1 8   ? -20.369 -2.066  -43.503  1.00 41.01  ? 9    LEU A CD1   1 
ATOM   24   C  CD2   . LEU A  1 8   ? -18.174 -3.280  -43.561  1.00 36.31  ? 9    LEU A CD2   1 
ATOM   25   N  N     . ASP A  1 9   ? -16.492 1.456   -45.363  1.00 39.96  ? 10   ASP A N     1 
ATOM   26   C  CA    . ASP A  1 9   ? -15.969 2.136   -46.543  1.00 37.11  ? 10   ASP A CA    1 
ATOM   27   C  C     . ASP A  1 9   ? -14.456 2.013   -46.616  1.00 36.24  ? 10   ASP A C     1 
ATOM   28   O  O     . ASP A  1 9   ? -13.900 1.769   -47.688  1.00 40.01  ? 10   ASP A O     1 
ATOM   29   C  CB    . ASP A  1 9   ? -16.388 3.610   -46.543  1.00 35.02  ? 10   ASP A CB    1 
ATOM   30   C  CG    . ASP A  1 9   ? -17.870 3.791   -46.796  1.00 42.05  ? 10   ASP A CG    1 
ATOM   31   O  OD1   . ASP A  1 9   ? -18.471 2.890   -47.428  1.00 44.22  ? 10   ASP A OD1   1 
ATOM   32   O  OD2   . ASP A  1 9   ? -18.438 4.814   -46.345  1.00 40.81  ? 10   ASP A OD2   1 
ATOM   33   N  N     . SER A  1 10  ? -13.778 2.172   -45.481  1.00 37.21  ? 11   SER A N     1 
ATOM   34   C  CA    . SER A  1 10  ? -12.334 1.980   -45.437  1.00 41.45  ? 11   SER A CA    1 
ATOM   35   C  C     . SER A  1 10  ? -11.960 0.562   -45.855  1.00 40.91  ? 11   SER A C     1 
ATOM   36   O  O     . SER A  1 10  ? -11.074 0.360   -46.695  1.00 38.83  ? 11   SER A O     1 
ATOM   37   C  CB    . SER A  1 10  ? -11.829 2.286   -44.024  1.00 45.05  ? 11   SER A CB    1 
ATOM   38   O  OG    . SER A  1 10  ? -10.455 1.970   -43.872  1.00 50.90  ? 11   SER A OG    1 
ATOM   39   N  N     . ILE A  1 11  ? -12.643 -0.428  -45.275  1.00 32.65  ? 12   ILE A N     1 
ATOM   40   C  CA    . ILE A  1 11  ? -12.362 -1.837  -45.546  1.00 32.20  ? 12   ILE A CA    1 
ATOM   41   C  C     . ILE A  1 11  ? -12.542 -2.152  -47.023  1.00 31.37  ? 12   ILE A C     1 
ATOM   42   O  O     . ILE A  1 11  ? -11.660 -2.734  -47.666  1.00 31.25  ? 12   ILE A O     1 
ATOM   43   C  CB    . ILE A  1 11  ? -13.273 -2.726  -44.675  1.00 31.97  ? 12   ILE A CB    1 
ATOM   44   C  CG1   . ILE A  1 11  ? -12.905 -2.581  -43.197  1.00 32.83  ? 12   ILE A CG1   1 
ATOM   45   C  CG2   . ILE A  1 11  ? -13.237 -4.182  -45.155  1.00 31.33  ? 12   ILE A CG2   1 
ATOM   46   C  CD1   . ILE A  1 11  ? -13.894 -3.298  -42.246  1.00 32.66  ? 12   ILE A CD1   1 
ATOM   47   N  N     . ILE A  1 12  ? -13.711 -1.804  -47.571  1.00 37.43  ? 13   ILE A N     1 
ATOM   48   C  CA    . ILE A  1 12  ? -14.003 -2.073  -48.974  1.00 39.75  ? 13   ILE A CA    1 
ATOM   49   C  C     . ILE A  1 12  ? -13.000 -1.355  -49.865  1.00 41.67  ? 13   ILE A C     1 
ATOM   50   O  O     . ILE A  1 12  ? -12.532 -1.904  -50.871  1.00 40.28  ? 13   ILE A O     1 
ATOM   51   C  CB    . ILE A  1 12  ? -15.454 -1.659  -49.297  1.00 43.13  ? 13   ILE A CB    1 
ATOM   52   C  CG1   . ILE A  1 12  ? -16.447 -2.511  -48.501  1.00 42.90  ? 13   ILE A CG1   1 
ATOM   53   C  CG2   . ILE A  1 12  ? -15.739 -1.765  -50.789  1.00 39.48  ? 13   ILE A CG2   1 
ATOM   54   C  CD1   . ILE A  1 12  ? -17.892 -2.025  -48.615  1.00 28.63  ? 13   ILE A CD1   1 
ATOM   55   N  N     . GLY A  1 13  ? -12.648 -0.119  -49.503  1.00 40.30  ? 14   GLY A N     1 
ATOM   56   C  CA    . GLY A  1 13  ? -11.654 0.609   -50.275  1.00 36.88  ? 14   GLY A CA    1 
ATOM   57   C  C     . GLY A  1 13  ? -10.325 -0.118  -50.338  1.00 37.68  ? 14   GLY A C     1 
ATOM   58   O  O     . GLY A  1 13  ? -9.728  -0.252  -51.407  1.00 40.48  ? 14   GLY A O     1 
ATOM   59   N  N     . ARG A  1 14  ? -9.852  -0.624  -49.199  1.00 35.41  ? 15   ARG A N     1 
ATOM   60   C  CA    . ARG A  1 14  ? -8.592  -1.353  -49.223  1.00 39.82  ? 15   ARG A CA    1 
ATOM   61   C  C     . ARG A  1 14  ? -8.714  -2.663  -49.999  1.00 43.66  ? 15   ARG A C     1 
ATOM   62   O  O     . ARG A  1 14  ? -7.760  -3.071  -50.672  1.00 41.34  ? 15   ARG A O     1 
ATOM   63   C  CB    . ARG A  1 14  ? -8.101  -1.586  -47.795  1.00 39.59  ? 15   ARG A CB    1 
ATOM   64   C  CG    . ARG A  1 14  ? -7.371  -0.364  -47.232  1.00 44.10  ? 15   ARG A CG    1 
ATOM   65   C  CD    . ARG A  1 14  ? -7.001  -0.562  -45.781  1.00 42.74  ? 15   ARG A CD    1 
ATOM   66   N  NE    . ARG A  1 14  ? -8.175  -0.430  -44.929  1.00 43.72  ? 15   ARG A NE    1 
ATOM   67   C  CZ    . ARG A  1 14  ? -8.337  -1.071  -43.774  1.00 42.10  ? 15   ARG A CZ    1 
ATOM   68   N  NH1   . ARG A  1 14  ? -7.401  -1.902  -43.338  1.00 38.56  ? 15   ARG A NH1   1 
ATOM   69   N  NH2   . ARG A  1 14  ? -9.440  -0.883  -43.065  1.00 37.21  ? 15   ARG A NH2   1 
ATOM   70   N  N     . LEU A  1 15  ? -9.881  -3.317  -49.943  1.00 40.89  ? 16   LEU A N     1 
ATOM   71   C  CA    . LEU A  1 15  ? -10.086 -4.543  -50.711  1.00 36.16  ? 16   LEU A CA    1 
ATOM   72   C  C     . LEU A  1 15  ? -10.187 -4.255  -52.203  1.00 36.97  ? 16   LEU A C     1 
ATOM   73   O  O     . LEU A  1 15  ? -9.699  -5.039  -53.024  1.00 38.72  ? 16   LEU A O     1 
ATOM   74   C  CB    . LEU A  1 15  ? -11.342 -5.270  -50.225  1.00 29.48  ? 16   LEU A CB    1 
ATOM   75   C  CG    . LEU A  1 15  ? -11.233 -6.017  -48.889  1.00 30.58  ? 16   LEU A CG    1 
ATOM   76   C  CD1   . LEU A  1 15  ? -12.614 -6.276  -48.288  1.00 29.54  ? 16   LEU A CD1   1 
ATOM   77   C  CD2   . LEU A  1 15  ? -10.452 -7.321  -49.062  1.00 30.23  ? 16   LEU A CD2   1 
ATOM   78   N  N     . LEU A  1 16  ? -10.820 -3.143  -52.577  1.00 39.65  ? 17   LEU A N     1 
ATOM   79   C  CA    . LEU A  1 16  ? -10.968 -2.796  -53.986  1.00 43.01  ? 17   LEU A CA    1 
ATOM   80   C  C     . LEU A  1 16  ? -9.706  -2.192  -54.586  1.00 53.12  ? 17   LEU A C     1 
ATOM   81   O  O     . LEU A  1 16  ? -9.649  -2.022  -55.808  1.00 51.35  ? 17   LEU A O     1 
ATOM   82   C  CB    . LEU A  1 16  ? -12.132 -1.815  -54.187  1.00 36.62  ? 17   LEU A CB    1 
ATOM   83   C  CG    . LEU A  1 16  ? -13.539 -2.375  -53.962  1.00 39.93  ? 17   LEU A CG    1 
ATOM   84   C  CD1   . LEU A  1 16  ? -14.621 -1.404  -54.444  1.00 40.88  ? 17   LEU A CD1   1 
ATOM   85   C  CD2   . LEU A  1 16  ? -13.692 -3.729  -54.625  1.00 40.02  ? 17   LEU A CD2   1 
ATOM   86   N  N     . GLU A  1 17  ? -8.698  -1.868  -53.772  1.00 64.49  ? 18   GLU A N     1 
ATOM   87   C  CA    . GLU A  1 17  ? -7.547  -1.137  -54.293  1.00 75.20  ? 18   GLU A CA    1 
ATOM   88   C  C     . GLU A  1 17  ? -6.670  -1.990  -55.195  1.00 80.28  ? 18   GLU A C     1 
ATOM   89   O  O     . GLU A  1 17  ? -5.832  -1.439  -55.914  1.00 91.42  ? 18   GLU A O     1 
ATOM   90   C  CB    . GLU A  1 17  ? -6.710  -0.565  -53.151  1.00 83.23  ? 18   GLU A CB    1 
ATOM   91   C  CG    . GLU A  1 17  ? -6.423  0.917   -53.299  1.00 93.11  ? 18   GLU A CG    1 
ATOM   92   C  CD    . GLU A  1 17  ? -6.146  1.594   -51.973  1.00 101.29 ? 18   GLU A CD    1 
ATOM   93   O  OE1   . GLU A  1 17  ? -5.119  1.274   -51.337  1.00 103.16 ? 18   GLU A OE1   1 
ATOM   94   O  OE2   . GLU A  1 17  ? -6.955  2.455   -51.570  1.00 102.67 ? 18   GLU A OE2   1 
ATOM   95   N  N     . VAL A  1 18  ? -6.854  -3.308  -55.193  1.00 77.09  ? 19   VAL A N     1 
ATOM   96   C  CA    . VAL A  1 18  ? -6.097  -4.212  -56.054  1.00 77.56  ? 19   VAL A CA    1 
ATOM   97   C  C     . VAL A  1 18  ? -6.676  -4.243  -57.461  1.00 79.69  ? 19   VAL A C     1 
ATOM   98   O  O     . VAL A  1 18  ? -6.238  -5.039  -58.299  1.00 80.41  ? 19   VAL A O     1 
ATOM   99   C  CB    . VAL A  1 18  ? -6.073  -5.633  -55.474  1.00 76.20  ? 19   VAL A CB    1 
ATOM   100  C  CG1   . VAL A  1 18  ? -5.500  -5.607  -54.075  1.00 81.32  ? 19   VAL A CG1   1 
ATOM   101  C  CG2   . VAL A  1 18  ? -7.485  -6.214  -55.468  1.00 71.96  ? 19   VAL A CG2   1 
ATOM   102  N  N     . GLN A  1 19  ? -7.671  -3.401  -57.727  1.00 81.32  ? 20   GLN A N     1 
ATOM   103  C  CA    . GLN A  1 19  ? -8.262  -3.323  -59.058  1.00 83.19  ? 20   GLN A CA    1 
ATOM   104  C  C     . GLN A  1 19  ? -7.243  -2.803  -60.067  1.00 84.62  ? 20   GLN A C     1 
ATOM   105  O  O     . GLN A  1 19  ? -6.279  -2.129  -59.700  1.00 86.11  ? 20   GLN A O     1 
ATOM   106  C  CB    . GLN A  1 19  ? -9.494  -2.421  -59.056  1.00 82.57  ? 20   GLN A CB    1 
ATOM   107  C  CG    . GLN A  1 19  ? -10.800 -3.139  -58.768  1.00 81.16  ? 20   GLN A CG    1 
ATOM   108  C  CD    . GLN A  1 19  ? -12.005 -2.308  -59.157  1.00 83.48  ? 20   GLN A CD    1 
ATOM   109  O  OE1   . GLN A  1 19  ? -12.113 -1.135  -58.790  1.00 81.03  ? 20   GLN A OE1   1 
ATOM   110  N  NE2   . GLN A  1 19  ? -12.914 -2.908  -59.918  1.00 83.52  ? 20   GLN A NE2   1 
ATOM   111  N  N     . LYS A  1 25  ? -2.640  -9.937  -55.616  1.00 84.30  ? 26   LYS A N     1 
ATOM   112  C  CA    . LYS A  1 25  ? -2.046  -9.052  -54.618  1.00 85.45  ? 26   LYS A CA    1 
ATOM   113  C  C     . LYS A  1 25  ? -2.859  -9.088  -53.325  1.00 83.66  ? 26   LYS A C     1 
ATOM   114  O  O     . LYS A  1 25  ? -4.079  -8.917  -53.344  1.00 79.70  ? 26   LYS A O     1 
ATOM   115  C  CB    . LYS A  1 25  ? -1.947  -7.617  -55.152  1.00 84.29  ? 26   LYS A CB    1 
ATOM   116  N  N     . ASN A  1 26  ? -2.167  -9.312  -52.208  1.00 85.41  ? 27   ASN A N     1 
ATOM   117  C  CA    . ASN A  1 26  ? -2.820  -9.453  -50.912  1.00 85.67  ? 27   ASN A CA    1 
ATOM   118  C  C     . ASN A  1 26  ? -3.320  -8.111  -50.397  1.00 82.76  ? 27   ASN A C     1 
ATOM   119  O  O     . ASN A  1 26  ? -2.702  -7.065  -50.618  1.00 86.79  ? 27   ASN A O     1 
ATOM   120  C  CB    . ASN A  1 26  ? -1.856  -10.057 -49.890  1.00 89.65  ? 27   ASN A CB    1 
ATOM   121  C  CG    . ASN A  1 26  ? -1.785  -11.566 -49.975  1.00 95.58  ? 27   ASN A CG    1 
ATOM   122  O  OD1   . ASN A  1 26  ? -2.782  -12.235 -50.254  1.00 97.26  ? 27   ASN A OD1   1 
ATOM   123  N  ND2   . ASN A  1 26  ? -0.599  -12.115 -49.733  1.00 97.27  ? 27   ASN A ND2   1 
ATOM   124  N  N     . VAL A  1 27  ? -4.452  -8.148  -49.695  1.00 74.78  ? 28   VAL A N     1 
ATOM   125  C  CA    . VAL A  1 27  ? -4.978  -6.987  -48.985  1.00 68.62  ? 28   VAL A CA    1 
ATOM   126  C  C     . VAL A  1 27  ? -4.858  -7.257  -47.493  1.00 69.14  ? 28   VAL A C     1 
ATOM   127  O  O     . VAL A  1 27  ? -5.330  -8.292  -47.001  1.00 64.40  ? 28   VAL A O     1 
ATOM   128  C  CB    . VAL A  1 27  ? -6.436  -6.681  -49.369  1.00 62.22  ? 28   VAL A CB    1 
ATOM   129  C  CG1   . VAL A  1 27  ? -7.007  -5.623  -48.427  1.00 62.85  ? 28   VAL A CG1   1 
ATOM   130  C  CG2   . VAL A  1 27  ? -6.526  -6.220  -50.807  1.00 61.31  ? 28   VAL A CG2   1 
ATOM   131  N  N     . GLN A  1 28  ? -4.238  -6.324  -46.773  1.00 69.21  ? 29   GLN A N     1 
ATOM   132  C  CA    . GLN A  1 28  ? -3.966  -6.503  -45.352  1.00 67.18  ? 29   GLN A CA    1 
ATOM   133  C  C     . GLN A  1 28  ? -5.045  -5.760  -44.570  1.00 62.37  ? 29   GLN A C     1 
ATOM   134  O  O     . GLN A  1 28  ? -4.943  -4.562  -44.307  1.00 65.81  ? 29   GLN A O     1 
ATOM   135  C  CB    . GLN A  1 28  ? -2.558  -6.025  -45.009  1.00 76.61  ? 29   GLN A CB    1 
ATOM   136  C  CG    . GLN A  1 28  ? -1.522  -6.228  -46.131  1.00 84.54  ? 29   GLN A CG    1 
ATOM   137  C  CD    . GLN A  1 28  ? -1.085  -7.684  -46.323  1.00 87.68  ? 29   GLN A CD    1 
ATOM   138  O  OE1   . GLN A  1 28  ? -1.704  -8.611  -45.801  1.00 89.17  ? 29   GLN A OE1   1 
ATOM   139  N  NE2   . GLN A  1 28  ? -0.005  -7.880  -47.075  1.00 87.84  ? 29   GLN A NE2   1 
ATOM   140  N  N     . LEU A  1 29  ? -6.114  -6.479  -44.241  1.00 51.53  ? 30   LEU A N     1 
ATOM   141  C  CA    . LEU A  1 29  ? -7.053  -6.056  -43.214  1.00 41.62  ? 30   LEU A CA    1 
ATOM   142  C  C     . LEU A  1 29  ? -6.546  -6.550  -41.865  1.00 41.46  ? 30   LEU A C     1 
ATOM   143  O  O     . LEU A  1 29  ? -5.797  -7.526  -41.785  1.00 48.14  ? 30   LEU A O     1 
ATOM   144  C  CB    . LEU A  1 29  ? -8.456  -6.612  -43.484  1.00 34.97  ? 30   LEU A CB    1 
ATOM   145  C  CG    . LEU A  1 29  ? -9.141  -6.257  -44.804  1.00 37.48  ? 30   LEU A CG    1 
ATOM   146  C  CD1   . LEU A  1 29  ? -10.526 -6.887  -44.876  1.00 33.25  ? 30   LEU A CD1   1 
ATOM   147  C  CD2   . LEU A  1 29  ? -9.240  -4.743  -44.975  1.00 37.83  ? 30   LEU A CD2   1 
ATOM   148  N  N     . THR A  1 30  ? -6.942  -5.867  -40.802  1.00 40.01  ? 31   THR A N     1 
ATOM   149  C  CA    . THR A  1 30  ? -6.513  -6.342  -39.501  1.00 41.50  ? 31   THR A CA    1 
ATOM   150  C  C     . THR A  1 30  ? -7.390  -7.509  -39.054  1.00 41.97  ? 31   THR A C     1 
ATOM   151  O  O     . THR A  1 30  ? -8.528  -7.677  -39.500  1.00 38.71  ? 31   THR A O     1 
ATOM   152  C  CB    . THR A  1 30  ? -6.551  -5.213  -38.472  1.00 43.66  ? 31   THR A CB    1 
ATOM   153  O  OG1   . THR A  1 30  ? -7.902  -4.976  -38.068  1.00 40.07  ? 31   THR A OG1   1 
ATOM   154  C  CG2   . THR A  1 30  ? -5.959  -3.918  -39.065  1.00 37.00  ? 31   THR A CG2   1 
ATOM   155  N  N     . GLU A  1 31  ? -6.829  -8.331  -38.170  1.00 37.82  ? 32   GLU A N     1 
ATOM   156  C  CA    . GLU A  1 31  ? -7.576  -9.457  -37.617  1.00 37.01  ? 32   GLU A CA    1 
ATOM   157  C  C     . GLU A  1 31  ? -8.902  -8.998  -37.020  1.00 39.20  ? 32   GLU A C     1 
ATOM   158  O  O     . GLU A  1 31  ? -9.950  -9.603  -37.273  1.00 37.81  ? 32   GLU A O     1 
ATOM   159  C  CB    . GLU A  1 31  ? -6.718  -10.165 -36.570  1.00 39.36  ? 32   GLU A CB    1 
ATOM   160  C  CG    . GLU A  1 31  ? -7.398  -11.302 -35.837  1.00 49.89  ? 32   GLU A CG    1 
ATOM   161  C  CD    . GLU A  1 31  ? -6.513  -11.894 -34.734  1.00 55.56  ? 32   GLU A CD    1 
ATOM   162  O  OE1   . GLU A  1 31  ? -5.302  -11.598 -34.719  1.00 58.16  ? 32   GLU A OE1   1 
ATOM   163  O  OE2   . GLU A  1 31  ? -7.025  -12.656 -33.885  1.00 59.23  ? 32   GLU A OE2   1 
ATOM   164  N  N     . ASN A  1 32  ? -8.887  -7.895  -36.267  1.00 44.96  ? 33   ASN A N     1 
ATOM   165  C  CA    . ASN A  1 32  ? -10.119 -7.416  -35.647  1.00 44.29  ? 33   ASN A CA    1 
ATOM   166  C  C     . ASN A  1 32  ? -11.118 -6.911  -36.678  1.00 38.61  ? 33   ASN A C     1 
ATOM   167  O  O     . ASN A  1 32  ? -12.325 -7.098  -36.502  1.00 40.61  ? 33   ASN A O     1 
ATOM   168  C  CB    . ASN A  1 32  ? -9.812  -6.333  -34.616  1.00 49.13  ? 33   ASN A CB    1 
ATOM   169  C  CG    . ASN A  1 32  ? -9.293  -6.915  -33.317  1.00 61.61  ? 33   ASN A CG    1 
ATOM   170  O  OD1   . ASN A  1 32  ? -9.831  -7.900  -32.793  1.00 70.65  ? 33   ASN A OD1   1 
ATOM   171  N  ND2   . ASN A  1 32  ? -8.243  -6.316  -32.791  1.00 66.86  ? 33   ASN A ND2   1 
ATOM   172  N  N     . GLU A  1 33  ? -10.646 -6.299  -37.764  1.00 36.91  ? 34   GLU A N     1 
ATOM   173  C  CA    . GLU A  1 33  ? -11.550 -5.919  -38.846  1.00 35.83  ? 34   GLU A CA    1 
ATOM   174  C  C     . GLU A  1 33  ? -12.253 -7.150  -39.424  1.00 36.35  ? 34   GLU A C     1 
ATOM   175  O  O     . GLU A  1 33  ? -13.487 -7.195  -39.530  1.00 31.78  ? 34   GLU A O     1 
ATOM   176  C  CB    . GLU A  1 33  ? -10.763 -5.154  -39.921  1.00 37.23  ? 34   GLU A CB    1 
ATOM   177  C  CG    . GLU A  1 33  ? -10.469 -3.673  -39.537  1.00 39.11  ? 34   GLU A CG    1 
ATOM   178  C  CD    . GLU A  1 33  ? -9.618  -2.891  -40.563  1.00 47.75  ? 34   GLU A CD    1 
ATOM   179  O  OE1   . GLU A  1 33  ? -8.857  -3.495  -41.355  1.00 46.67  ? 34   GLU A OE1   1 
ATOM   180  O  OE2   . GLU A  1 33  ? -9.712  -1.643  -40.567  1.00 50.01  ? 34   GLU A OE2   1 
ATOM   181  N  N     . ILE A  1 34  ? -11.477 -8.183  -39.757  1.00 34.17  ? 35   ILE A N     1 
ATOM   182  C  CA    . ILE A  1 34  ? -12.049 -9.411  -40.297  1.00 36.47  ? 35   ILE A CA    1 
ATOM   183  C  C     . ILE A  1 34  ? -12.999 -10.042 -39.291  1.00 37.16  ? 35   ILE A C     1 
ATOM   184  O  O     . ILE A  1 34  ? -14.101 -10.487 -39.642  1.00 33.20  ? 35   ILE A O     1 
ATOM   185  C  CB    . ILE A  1 34  ? -10.917 -10.371 -40.705  1.00 39.01  ? 35   ILE A CB    1 
ATOM   186  C  CG1   . ILE A  1 34  ? -10.165 -9.764  -41.893  1.00 37.31  ? 35   ILE A CG1   1 
ATOM   187  C  CG2   . ILE A  1 34  ? -11.462 -11.762 -41.019  1.00 36.01  ? 35   ILE A CG2   1 
ATOM   188  C  CD1   . ILE A  1 34  ? -8.955  -10.563 -42.346  1.00 39.12  ? 35   ILE A CD1   1 
ATOM   189  N  N     . ARG A  1 35  ? -12.598 -10.064 -38.021  1.00 40.41  ? 36   ARG A N     1 
ATOM   190  C  CA    . ARG A  1 35  ? -13.487 -10.534 -36.967  1.00 36.45  ? 36   ARG A CA    1 
ATOM   191  C  C     . ARG A  1 35  ? -14.787 -9.735  -36.957  1.00 36.80  ? 36   ARG A C     1 
ATOM   192  O  O     . ARG A  1 35  ? -15.880 -10.312 -36.900  1.00 38.97  ? 36   ARG A O     1 
ATOM   193  C  CB    . ARG A  1 35  ? -12.765 -10.449 -35.622  1.00 36.27  ? 36   ARG A CB    1 
ATOM   194  C  CG    . ARG A  1 35  ? -13.514 -11.072 -34.471  1.00 48.66  ? 36   ARG A CG    1 
ATOM   195  C  CD    . ARG A  1 35  ? -12.745 -10.987 -33.160  1.00 52.22  ? 36   ARG A CD    1 
ATOM   196  N  NE    . ARG A  1 35  ? -11.315 -11.214 -33.318  1.00 54.42  ? 36   ARG A NE    1 
ATOM   197  C  CZ    . ARG A  1 35  ? -10.751 -12.407 -33.426  1.00 60.17  ? 36   ARG A CZ    1 
ATOM   198  N  NH1   . ARG A  1 35  ? -9.438  -12.506 -33.553  1.00 62.18  ? 36   ARG A NH1   1 
ATOM   199  N  NH2   . ARG A  1 35  ? -11.494 -13.505 -33.397  1.00 71.28  ? 36   ARG A NH2   1 
ATOM   200  N  N     . GLY A  1 36  ? -14.693 -8.408  -37.074  1.00 36.07  ? 37   GLY A N     1 
ATOM   201  C  CA    . GLY A  1 36  ? -15.895 -7.593  -37.061  1.00 28.62  ? 37   GLY A CA    1 
ATOM   202  C  C     . GLY A  1 36  ? -16.805 -7.867  -38.243  1.00 38.05  ? 37   GLY A C     1 
ATOM   203  O  O     . GLY A  1 36  ? -18.032 -7.854  -38.108  1.00 37.47  ? 37   GLY A O     1 
ATOM   204  N  N     . LEU A  1 37  ? -16.217 -8.092  -39.424  1.00 33.98  ? 38   LEU A N     1 
ATOM   205  C  CA    . LEU A  1 37  ? -16.998 -8.507  -40.586  1.00 32.66  ? 38   LEU A CA    1 
ATOM   206  C  C     . LEU A  1 37  ? -17.804 -9.759  -40.278  1.00 31.41  ? 38   LEU A C     1 
ATOM   207  O  O     . LEU A  1 37  ? -19.015 -9.806  -40.524  1.00 34.01  ? 38   LEU A O     1 
ATOM   208  C  CB    . LEU A  1 37  ? -16.075 -8.745  -41.787  1.00 31.66  ? 38   LEU A CB    1 
ATOM   209  C  CG    . LEU A  1 37  ? -15.421 -7.471  -42.358  1.00 33.02  ? 38   LEU A CG    1 
ATOM   210  C  CD1   . LEU A  1 37  ? -14.546 -7.747  -43.587  1.00 32.86  ? 38   LEU A CD1   1 
ATOM   211  C  CD2   . LEU A  1 37  ? -16.490 -6.454  -42.683  1.00 29.39  ? 38   LEU A CD2   1 
ATOM   212  N  N     . CYS A  1 38  ? -17.147 -10.786 -39.726  1.00 29.66  ? 39   CYS A N     1 
ATOM   213  C  CA    . CYS A  1 38  ? -17.865 -12.016 -39.395  1.00 35.76  ? 39   CYS A CA    1 
ATOM   214  C  C     . CYS A  1 38  ? -18.956 -11.757 -38.369  1.00 35.15  ? 39   CYS A C     1 
ATOM   215  O  O     . CYS A  1 38  ? -20.070 -12.268 -38.502  1.00 34.16  ? 39   CYS A O     1 
ATOM   216  C  CB    . CYS A  1 38  ? -16.904 -13.086 -38.874  1.00 31.00  ? 39   CYS A CB    1 
ATOM   217  S  SG    . CYS A  1 38  ? -15.635 -13.560 -40.050  1.00 37.89  ? 39   CYS A SG    1 
ATOM   218  N  N     . LEU A  1 39  ? -18.659 -10.944 -37.352  1.00 34.69  ? 40   LEU A N     1 
ATOM   219  C  CA    . LEU A  1 39  ? -19.591 -10.769 -36.244  1.00 34.66  ? 40   LEU A CA    1 
ATOM   220  C  C     . LEU A  1 39  ? -20.821 -9.972  -36.663  1.00 39.84  ? 40   LEU A C     1 
ATOM   221  O  O     . LEU A  1 39  ? -21.950 -10.338 -36.315  1.00 42.02  ? 40   LEU A O     1 
ATOM   222  C  CB    . LEU A  1 39  ? -18.882 -10.092 -35.073  1.00 37.41  ? 40   LEU A CB    1 
ATOM   223  C  CG    . LEU A  1 39  ? -17.823 -10.957 -34.375  1.00 42.04  ? 40   LEU A CG    1 
ATOM   224  C  CD1   . LEU A  1 39  ? -17.085 -10.173 -33.293  1.00 45.04  ? 40   LEU A CD1   1 
ATOM   225  C  CD2   . LEU A  1 39  ? -18.462 -12.191 -33.792  1.00 39.17  ? 40   LEU A CD2   1 
ATOM   226  N  N     . LYS A  1 40  ? -20.629 -8.888  -37.417  1.00 37.23  ? 41   LYS A N     1 
ATOM   227  C  CA    . LYS A  1 40  ? -21.770 -8.092  -37.860  1.00 37.18  ? 41   LYS A CA    1 
ATOM   228  C  C     . LYS A  1 40  ? -22.599 -8.834  -38.907  1.00 36.22  ? 41   LYS A C     1 
ATOM   229  O  O     . LYS A  1 40  ? -23.833 -8.813  -38.855  1.00 36.64  ? 41   LYS A O     1 
ATOM   230  C  CB    . LYS A  1 40  ? -21.290 -6.747  -38.401  1.00 37.56  ? 41   LYS A CB    1 
ATOM   231  C  CG    . LYS A  1 40  ? -20.826 -5.780  -37.319  1.00 50.08  ? 41   LYS A CG    1 
ATOM   232  C  CD    . LYS A  1 40  ? -21.752 -4.570  -37.207  1.00 63.53  ? 41   LYS A CD    1 
ATOM   233  C  CE    . LYS A  1 40  ? -21.210 -3.535  -36.221  1.00 64.57  ? 41   LYS A CE    1 
ATOM   234  N  NZ    . LYS A  1 40  ? -21.077 -4.112  -34.847  1.00 64.62  ? 41   LYS A NZ    1 
ATOM   235  N  N     . SER A  1 41  ? -21.946 -9.506  -39.856  1.00 29.59  ? 42   SER A N     1 
ATOM   236  C  CA    . SER A  1 41  ? -22.702 -10.225 -40.871  1.00 29.41  ? 42   SER A CA    1 
ATOM   237  C  C     . SER A  1 41  ? -23.483 -11.382 -40.254  1.00 31.27  ? 42   SER A C     1 
ATOM   238  O  O     . SER A  1 41  ? -24.628 -11.638 -40.641  1.00 29.20  ? 42   SER A O     1 
ATOM   239  C  CB    . SER A  1 41  ? -21.769 -10.723 -41.986  1.00 30.92  ? 42   SER A CB    1 
ATOM   240  O  OG    . SER A  1 41  ? -20.902 -11.772 -41.547  1.00 32.06  ? 42   SER A OG    1 
ATOM   241  N  N     . ARG A  1 42  ? -22.886 -12.074 -39.279  1.00 36.31  ? 43   ARG A N     1 
ATOM   242  C  CA    . ARG A  1 42  ? -23.570 -13.182 -38.616  1.00 35.09  ? 43   ARG A CA    1 
ATOM   243  C  C     . ARG A  1 42  ? -24.911 -12.744 -38.037  1.00 35.07  ? 43   ARG A C     1 
ATOM   244  O  O     . ARG A  1 42  ? -25.924 -13.430 -38.216  1.00 35.64  ? 43   ARG A O     1 
ATOM   245  C  CB    . ARG A  1 42  ? -22.679 -13.763 -37.524  1.00 35.20  ? 43   ARG A CB    1 
ATOM   246  C  CG    . ARG A  1 42  ? -23.288 -14.947 -36.780  1.00 40.23  ? 43   ARG A CG    1 
ATOM   247  C  CD    . ARG A  1 42  ? -22.499 -15.224 -35.509  1.00 41.60  ? 43   ARG A CD    1 
ATOM   248  N  NE    . ARG A  1 42  ? -22.732 -16.576 -35.019  1.00 40.90  ? 43   ARG A NE    1 
ATOM   249  C  CZ    . ARG A  1 42  ? -23.720 -16.904 -34.203  1.00 37.96  ? 43   ARG A CZ    1 
ATOM   250  N  NH1   . ARG A  1 42  ? -24.557 -15.974 -33.771  1.00 36.50  ? 43   ARG A NH1   1 
ATOM   251  N  NH2   . ARG A  1 42  ? -23.864 -18.161 -33.817  1.00 42.04  ? 43   ARG A NH2   1 
ATOM   252  N  N     . GLU A  1 43  ? -24.944 -11.592 -37.360  1.00 36.54  ? 44   GLU A N     1 
ATOM   253  C  CA    . GLU A  1 43  ? -26.198 -11.110 -36.783  1.00 38.30  ? 44   GLU A CA    1 
ATOM   254  C  C     . GLU A  1 43  ? -27.223 -10.795 -37.868  1.00 34.69  ? 44   GLU A C     1 
ATOM   255  O  O     . GLU A  1 43  ? -28.421 -11.031 -37.685  1.00 37.30  ? 44   GLU A O     1 
ATOM   256  C  CB    . GLU A  1 43  ? -25.937 -9.881  -35.906  1.00 33.71  ? 44   GLU A CB    1 
ATOM   257  N  N     . ILE A  1 44  ? -26.770 -10.288 -39.016  1.00 31.42  ? 45   ILE A N     1 
ATOM   258  C  CA    . ILE A  1 44  ? -27.692 -10.021 -40.113  1.00 28.21  ? 45   ILE A CA    1 
ATOM   259  C  C     . ILE A  1 44  ? -28.232 -11.320 -40.694  1.00 30.16  ? 45   ILE A C     1 
ATOM   260  O  O     . ILE A  1 44  ? -29.429 -11.434 -40.983  1.00 30.93  ? 45   ILE A O     1 
ATOM   261  C  CB    . ILE A  1 44  ? -27.011 -9.166  -41.187  1.00 34.67  ? 45   ILE A CB    1 
ATOM   262  C  CG1   . ILE A  1 44  ? -26.692 -7.774  -40.619  1.00 36.26  ? 45   ILE A CG1   1 
ATOM   263  C  CG2   . ILE A  1 44  ? -27.900 -9.090  -42.422  1.00 32.75  ? 45   ILE A CG2   1 
ATOM   264  C  CD1   . ILE A  1 44  ? -25.926 -6.887  -41.564  1.00 33.88  ? 45   ILE A CD1   1 
ATOM   265  N  N     . PHE A  1 45  ? -27.366 -12.324 -40.864  1.00 28.98  ? 46   PHE A N     1 
ATOM   266  C  CA    . PHE A  1 45  ? -27.830 -13.611 -41.369  1.00 32.62  ? 46   PHE A CA    1 
ATOM   267  C  C     . PHE A  1 45  ? -28.920 -14.175 -40.470  1.00 31.13  ? 46   PHE A C     1 
ATOM   268  O  O     . PHE A  1 45  ? -29.958 -14.643 -40.956  1.00 34.60  ? 46   PHE A O     1 
ATOM   269  C  CB    . PHE A  1 45  ? -26.657 -14.601 -41.498  1.00 32.38  ? 46   PHE A CB    1 
ATOM   270  C  CG    . PHE A  1 45  ? -25.621 -14.205 -42.544  1.00 30.65  ? 46   PHE A CG    1 
ATOM   271  C  CD1   . PHE A  1 45  ? -25.999 -13.589 -43.732  1.00 27.37  ? 46   PHE A CD1   1 
ATOM   272  C  CD2   . PHE A  1 45  ? -24.269 -14.453 -42.324  1.00 27.84  ? 46   PHE A CD2   1 
ATOM   273  C  CE1   . PHE A  1 45  ? -25.052 -13.234 -44.685  1.00 29.90  ? 46   PHE A CE1   1 
ATOM   274  C  CE2   . PHE A  1 45  ? -23.318 -14.084 -43.257  1.00 26.43  ? 46   PHE A CE2   1 
ATOM   275  C  CZ    . PHE A  1 45  ? -23.711 -13.474 -44.447  1.00 28.04  ? 46   PHE A CZ    1 
ATOM   276  N  N     . LEU A  1 46  ? -28.724 -14.095 -39.151  1.00 31.82  ? 47   LEU A N     1 
ATOM   277  C  CA    . LEU A  1 46  ? -29.733 -14.615 -38.228  1.00 34.98  ? 47   LEU A CA    1 
ATOM   278  C  C     . LEU A  1 46  ? -30.994 -13.756 -38.214  1.00 35.54  ? 47   LEU A C     1 
ATOM   279  O  O     . LEU A  1 46  ? -32.081 -14.273 -37.958  1.00 36.11  ? 47   LEU A O     1 
ATOM   280  C  CB    . LEU A  1 46  ? -29.151 -14.731 -36.822  1.00 37.96  ? 47   LEU A CB    1 
ATOM   281  C  CG    . LEU A  1 46  ? -28.130 -15.858 -36.623  1.00 38.72  ? 47   LEU A CG    1 
ATOM   282  C  CD1   . LEU A  1 46  ? -27.651 -15.880 -35.181  1.00 41.29  ? 47   LEU A CD1   1 
ATOM   283  C  CD2   . LEU A  1 46  ? -28.711 -17.215 -37.027  1.00 35.29  ? 47   LEU A CD2   1 
ATOM   284  N  N     . SER A  1 47  ? -30.888 -12.456 -38.504  1.00 37.61  ? 48   SER A N     1 
ATOM   285  C  CA    . SER A  1 47  ? -32.095 -11.637 -38.537  1.00 37.58  ? 48   SER A CA    1 
ATOM   286  C  C     . SER A  1 47  ? -32.918 -11.833 -39.810  1.00 37.92  ? 48   SER A C     1 
ATOM   287  O  O     . SER A  1 47  ? -34.058 -11.365 -39.872  1.00 41.23  ? 48   SER A O     1 
ATOM   288  C  CB    . SER A  1 47  ? -31.736 -10.156 -38.371  1.00 37.74  ? 48   SER A CB    1 
ATOM   289  O  OG    . SER A  1 47  ? -31.267 -9.614  -39.593  1.00 44.43  ? 48   SER A OG    1 
ATOM   290  N  N     . GLN A  1 48  ? -32.387 -12.505 -40.818  1.00 36.12  ? 49   GLN A N     1 
ATOM   291  C  CA    . GLN A  1 48  ? -33.169 -12.818 -42.003  1.00 29.74  ? 49   GLN A CA    1 
ATOM   292  C  C     . GLN A  1 48  ? -33.505 -14.307 -42.043  1.00 31.40  ? 49   GLN A C     1 
ATOM   293  O  O     . GLN A  1 48  ? -32.890 -15.115 -41.338  1.00 29.31  ? 49   GLN A O     1 
ATOM   294  C  CB    . GLN A  1 48  ? -32.423 -12.380 -43.283  1.00 28.41  ? 49   GLN A CB    1 
ATOM   295  C  CG    . GLN A  1 48  ? -32.114 -10.846 -43.286  1.00 28.67  ? 49   GLN A CG    1 
ATOM   296  C  CD    . GLN A  1 48  ? -31.373 -10.325 -44.531  1.00 35.96  ? 49   GLN A CD    1 
ATOM   297  O  OE1   . GLN A  1 48  ? -31.537 -9.151  -44.917  1.00 39.58  ? 49   GLN A OE1   1 
ATOM   298  N  NE2   . GLN A  1 48  ? -30.584 -11.178 -45.168  1.00 28.45  ? 49   GLN A NE2   1 
ATOM   299  N  N     . PRO A  1 49  ? -34.500 -14.705 -42.830  1.00 31.17  ? 50   PRO A N     1 
ATOM   300  C  CA    . PRO A  1 49  ? -34.889 -16.116 -42.852  1.00 30.73  ? 50   PRO A CA    1 
ATOM   301  C  C     . PRO A  1 49  ? -33.810 -16.995 -43.465  1.00 36.38  ? 50   PRO A C     1 
ATOM   302  O  O     . PRO A  1 49  ? -33.009 -16.564 -44.302  1.00 32.12  ? 50   PRO A O     1 
ATOM   303  C  CB    . PRO A  1 49  ? -36.155 -16.125 -43.716  1.00 30.70  ? 50   PRO A CB    1 
ATOM   304  C  CG    . PRO A  1 49  ? -36.614 -14.717 -43.754  1.00 37.40  ? 50   PRO A CG    1 
ATOM   305  C  CD    . PRO A  1 49  ? -35.393 -13.879 -43.659  1.00 32.82  ? 50   PRO A CD    1 
ATOM   306  N  N     . ILE A  1 50  ? -33.810 -18.262 -43.046  1.00 30.22  ? 51   ILE A N     1 
ATOM   307  C  CA    . ILE A  1 50  ? -32.901 -19.225 -43.646  1.00 25.81  ? 51   ILE A CA    1 
ATOM   308  C  C     . ILE A  1 50  ? -33.348 -19.613 -45.045  1.00 27.48  ? 51   ILE A C     1 
ATOM   309  O  O     . ILE A  1 50  ? -32.542 -20.123 -45.826  1.00 33.12  ? 51   ILE A O     1 
ATOM   310  C  CB    . ILE A  1 50  ? -32.786 -20.465 -42.744  1.00 34.10  ? 51   ILE A CB    1 
ATOM   311  C  CG1   . ILE A  1 50  ? -31.532 -21.272 -43.096  1.00 33.93  ? 51   ILE A CG1   1 
ATOM   312  C  CG2   . ILE A  1 50  ? -34.061 -21.305 -42.851  1.00 29.64  ? 51   ILE A CG2   1 
ATOM   313  C  CD1   . ILE A  1 50  ? -31.308 -22.472 -42.183  1.00 36.12  ? 51   ILE A CD1   1 
ATOM   314  N  N     . LEU A  1 51  ? -34.622 -19.411 -45.374  1.00 26.81  ? 52   LEU A N     1 
ATOM   315  C  CA    . LEU A  1 51  ? -35.141 -19.560 -46.730  1.00 30.78  ? 52   LEU A CA    1 
ATOM   316  C  C     . LEU A  1 51  ? -35.498 -18.161 -47.233  1.00 36.28  ? 52   LEU A C     1 
ATOM   317  O  O     . LEU A  1 51  ? -36.565 -17.632 -46.907  1.00 31.45  ? 52   LEU A O     1 
ATOM   318  C  CB    . LEU A  1 51  ? -36.354 -20.483 -46.770  1.00 31.34  ? 52   LEU A CB    1 
ATOM   319  C  CG    . LEU A  1 51  ? -37.053 -20.530 -48.136  1.00 27.60  ? 52   LEU A CG    1 
ATOM   320  C  CD1   . LEU A  1 51  ? -36.112 -21.080 -49.188  1.00 29.79  ? 52   LEU A CD1   1 
ATOM   321  C  CD2   . LEU A  1 51  ? -38.327 -21.338 -48.104  1.00 29.29  ? 52   LEU A CD2   1 
ATOM   322  N  N     . LEU A  1 52  ? -34.605 -17.569 -48.032  1.00 33.72  ? 53   LEU A N     1 
ATOM   323  C  CA    . LEU A  1 52  ? -34.786 -16.189 -48.463  1.00 27.21  ? 53   LEU A CA    1 
ATOM   324  C  C     . LEU A  1 52  ? -35.915 -16.086 -49.479  1.00 25.97  ? 53   LEU A C     1 
ATOM   325  O  O     . LEU A  1 52  ? -36.081 -16.954 -50.335  1.00 27.99  ? 53   LEU A O     1 
ATOM   326  C  CB    . LEU A  1 52  ? -33.488 -15.651 -49.071  1.00 29.99  ? 53   LEU A CB    1 
ATOM   327  C  CG    . LEU A  1 52  ? -32.254 -15.568 -48.169  1.00 29.22  ? 53   LEU A CG    1 
ATOM   328  C  CD1   . LEU A  1 52  ? -31.004 -15.158 -48.962  1.00 22.53  ? 53   LEU A CD1   1 
ATOM   329  C  CD2   . LEU A  1 52  ? -32.519 -14.600 -47.010  1.00 26.03  ? 53   LEU A CD2   1 
ATOM   330  N  N     . GLU A  1 53  ? -36.693 -15.011 -49.385  1.00 30.05  ? 54   GLU A N     1 
ATOM   331  C  CA    . GLU A  1 53  ? -37.735 -14.691 -50.362  1.00 34.42  ? 54   GLU A CA    1 
ATOM   332  C  C     . GLU A  1 53  ? -37.358 -13.371 -51.033  1.00 35.32  ? 54   GLU A C     1 
ATOM   333  O  O     . GLU A  1 53  ? -37.497 -12.296 -50.444  1.00 30.43  ? 54   GLU A O     1 
ATOM   334  C  CB    . GLU A  1 53  ? -39.111 -14.617 -49.699  1.00 37.33  ? 54   GLU A CB    1 
ATOM   335  C  CG    . GLU A  1 53  ? -39.650 -15.991 -49.301  1.00 47.80  ? 54   GLU A CG    1 
ATOM   336  C  CD    . GLU A  1 53  ? -41.038 -15.950 -48.673  1.00 63.89  ? 54   GLU A CD    1 
ATOM   337  O  OE1   . GLU A  1 53  ? -41.549 -14.846 -48.364  1.00 67.92  ? 54   GLU A OE1   1 
ATOM   338  O  OE2   . GLU A  1 53  ? -41.619 -17.040 -48.479  1.00 70.87  ? 54   GLU A OE2   1 
ATOM   339  N  N     . LEU A  1 54  ? -36.888 -13.445 -52.268  1.00 35.76  ? 55   LEU A N     1 
ATOM   340  C  CA    . LEU A  1 54  ? -36.334 -12.284 -52.949  1.00 35.29  ? 55   LEU A CA    1 
ATOM   341  C  C     . LEU A  1 54  ? -37.182 -11.887 -54.154  1.00 34.63  ? 55   LEU A C     1 
ATOM   342  O  O     . LEU A  1 54  ? -38.063 -12.621 -54.612  1.00 34.91  ? 55   LEU A O     1 
ATOM   343  C  CB    . LEU A  1 54  ? -34.889 -12.561 -53.371  1.00 33.16  ? 55   LEU A CB    1 
ATOM   344  C  CG    . LEU A  1 54  ? -34.021 -13.096 -52.223  1.00 31.45  ? 55   LEU A CG    1 
ATOM   345  C  CD1   . LEU A  1 54  ? -32.601 -13.371 -52.708  1.00 28.55  ? 55   LEU A CD1   1 
ATOM   346  C  CD2   . LEU A  1 54  ? -34.022 -12.116 -51.067  1.00 28.23  ? 55   LEU A CD2   1 
ATOM   347  N  N     . GLU A  1 55  ? -36.903 -10.702 -54.673  1.00 39.51  ? 56   GLU A N     1 
ATOM   348  C  CA    . GLU A  1 55  ? -37.583 -10.188 -55.852  1.00 39.78  ? 56   GLU A CA    1 
ATOM   349  C  C     . GLU A  1 55  ? -36.556 -9.801  -56.897  1.00 35.10  ? 56   GLU A C     1 
ATOM   350  O  O     . GLU A  1 55  ? -35.477 -9.309  -56.564  1.00 37.04  ? 56   GLU A O     1 
ATOM   351  C  CB    . GLU A  1 55  ? -38.456 -8.974  -55.506  1.00 40.98  ? 56   GLU A CB    1 
ATOM   352  C  CG    . GLU A  1 55  ? -39.520 -9.287  -54.468  1.00 53.71  ? 56   GLU A CG    1 
ATOM   353  C  CD    . GLU A  1 55  ? -40.171 -8.049  -53.876  1.00 61.55  ? 56   GLU A CD    1 
ATOM   354  O  OE1   . GLU A  1 55  ? -39.807 -6.918  -54.268  1.00 64.32  ? 56   GLU A OE1   1 
ATOM   355  O  OE2   . GLU A  1 55  ? -41.044 -8.218  -53.002  1.00 65.76  ? 56   GLU A OE2   1 
ATOM   356  N  N     . ALA A  1 56  ? -36.885 -10.048 -58.158  1.00 33.94  ? 57   ALA A N     1 
ATOM   357  C  CA    . ALA A  1 56  ? -36.073 -9.536  -59.238  1.00 34.88  ? 57   ALA A CA    1 
ATOM   358  C  C     . ALA A  1 56  ? -36.339 -8.037  -59.366  1.00 39.69  ? 57   ALA A C     1 
ATOM   359  O  O     . ALA A  1 56  ? -37.386 -7.556  -58.937  1.00 37.62  ? 57   ALA A O     1 
ATOM   360  C  CB    . ALA A  1 56  ? -36.407 -10.266 -60.535  1.00 32.84  ? 57   ALA A CB    1 
ATOM   361  N  N     . PRO A  1 57  ? -35.408 -7.271  -59.963  1.00 37.15  ? 58   PRO A N     1 
ATOM   362  C  CA    . PRO A  1 57  ? -34.163 -7.677  -60.628  1.00 33.39  ? 58   PRO A CA    1 
ATOM   363  C  C     . PRO A  1 57  ? -33.024 -8.067  -59.700  1.00 33.24  ? 58   PRO A C     1 
ATOM   364  O  O     . PRO A  1 57  ? -32.875 -7.503  -58.619  1.00 35.72  ? 58   PRO A O     1 
ATOM   365  C  CB    . PRO A  1 57  ? -33.781 -6.432  -61.431  1.00 41.72  ? 58   PRO A CB    1 
ATOM   366  C  CG    . PRO A  1 57  ? -34.318 -5.285  -60.614  1.00 41.68  ? 58   PRO A CG    1 
ATOM   367  C  CD    . PRO A  1 57  ? -35.613 -5.809  -60.018  1.00 38.08  ? 58   PRO A CD    1 
ATOM   368  N  N     . LEU A  1 58  ? -32.207 -9.021  -60.140  1.00 29.99  ? 59   LEU A N     1 
ATOM   369  C  CA    . LEU A  1 58  ? -31.012 -9.373  -59.385  1.00 31.89  ? 59   LEU A CA    1 
ATOM   370  C  C     . LEU A  1 58  ? -30.101 -10.198 -60.282  1.00 34.13  ? 59   LEU A C     1 
ATOM   371  O  O     . LEU A  1 58  ? -30.540 -10.765 -61.285  1.00 33.12  ? 59   LEU A O     1 
ATOM   372  C  CB    . LEU A  1 58  ? -31.359 -10.131 -58.094  1.00 38.28  ? 59   LEU A CB    1 
ATOM   373  C  CG    . LEU A  1 58  ? -31.641 -11.633 -58.122  1.00 41.73  ? 59   LEU A CG    1 
ATOM   374  C  CD1   . LEU A  1 58  ? -31.698 -12.166 -56.707  1.00 40.21  ? 59   LEU A CD1   1 
ATOM   375  C  CD2   . LEU A  1 58  ? -32.948 -11.916 -58.839  1.00 44.45  ? 59   LEU A CD2   1 
ATOM   376  N  N     . LYS A  1 59  ? -28.816 -10.219 -59.928  1.00 34.86  ? 60   LYS A N     1 
ATOM   377  C  CA    . LYS A  1 59  ? -27.829 -11.077 -60.562  1.00 33.38  ? 60   LYS A CA    1 
ATOM   378  C  C     . LYS A  1 59  ? -27.549 -12.249 -59.639  1.00 35.07  ? 60   LYS A C     1 
ATOM   379  O  O     . LYS A  1 59  ? -27.407 -12.068 -58.423  1.00 32.23  ? 60   LYS A O     1 
ATOM   380  C  CB    . LYS A  1 59  ? -26.516 -10.343 -60.833  1.00 32.00  ? 60   LYS A CB    1 
ATOM   381  C  CG    . LYS A  1 59  ? -26.671 -8.926  -61.304  1.00 38.03  ? 60   LYS A CG    1 
ATOM   382  C  CD    . LYS A  1 59  ? -26.936 -8.882  -62.773  1.00 40.32  ? 60   LYS A CD    1 
ATOM   383  C  CE    . LYS A  1 59  ? -26.821 -7.459  -63.296  1.00 40.64  ? 60   LYS A CE    1 
ATOM   384  N  NZ    . LYS A  1 59  ? -26.937 -7.490  -64.769  1.00 43.98  ? 60   LYS A NZ    1 
ATOM   385  N  N     . ILE A  1 60  ? -27.461 -13.444 -60.218  1.00 30.63  ? 61   ILE A N     1 
ATOM   386  C  CA    . ILE A  1 60  ? -27.186 -14.660 -59.464  1.00 29.35  ? 61   ILE A CA    1 
ATOM   387  C  C     . ILE A  1 60  ? -25.849 -15.232 -59.923  1.00 30.36  ? 61   ILE A C     1 
ATOM   388  O  O     . ILE A  1 60  ? -25.599 -15.361 -61.130  1.00 34.94  ? 61   ILE A O     1 
ATOM   389  C  CB    . ILE A  1 60  ? -28.321 -15.686 -59.613  1.00 32.66  ? 61   ILE A CB    1 
ATOM   390  C  CG1   . ILE A  1 60  ? -29.666 -15.006 -59.301  1.00 28.41  ? 61   ILE A CG1   1 
ATOM   391  C  CG2   . ILE A  1 60  ? -28.054 -16.899 -58.704  1.00 22.51  ? 61   ILE A CG2   1 
ATOM   392  C  CD1   . ILE A  1 60  ? -30.893 -15.886 -59.495  1.00 26.63  ? 61   ILE A CD1   1 
ATOM   393  N  N     . CYS A  1 61  ? -24.991 -15.561 -58.955  1.00 29.46  ? 62   CYS A N     1 
ATOM   394  C  CA    . CYS A  1 61  ? -23.641 -16.034 -59.202  1.00 27.44  ? 62   CYS A CA    1 
ATOM   395  C  C     . CYS A  1 61  ? -23.405 -17.372 -58.509  1.00 31.47  ? 62   CYS A C     1 
ATOM   396  O  O     . CYS A  1 61  ? -23.913 -17.621 -57.412  1.00 28.60  ? 62   CYS A O     1 
ATOM   397  C  CB    . CYS A  1 61  ? -22.607 -15.011 -58.704  1.00 29.94  ? 62   CYS A CB    1 
ATOM   398  S  SG    . CYS A  1 61  ? -22.808 -13.335 -59.396  1.00 37.62  ? 62   CYS A SG    1 
ATOM   399  N  N     . GLY A  1 62  ? -22.594 -18.214 -59.147  1.00 33.80  ? 63   GLY A N     1 
ATOM   400  C  CA    . GLY A  1 62  ? -22.176 -19.487 -58.596  1.00 31.23  ? 63   GLY A CA    1 
ATOM   401  C  C     . GLY A  1 62  ? -20.812 -19.441 -57.944  1.00 32.45  ? 63   GLY A C     1 
ATOM   402  O  O     . GLY A  1 62  ? -20.358 -18.397 -57.462  1.00 32.58  ? 63   GLY A O     1 
ATOM   403  N  N     . ASP A  1 63  ? -20.141 -20.596 -57.938  1.00 33.20  ? 64   ASP A N     1 
ATOM   404  C  CA    . ASP A  1 63  ? -18.920 -20.764 -57.152  1.00 33.98  ? 64   ASP A CA    1 
ATOM   405  C  C     . ASP A  1 63  ? -17.873 -19.704 -57.501  1.00 37.96  ? 64   ASP A C     1 
ATOM   406  O  O     . ASP A  1 63  ? -17.686 -19.345 -58.668  1.00 34.84  ? 64   ASP A O     1 
ATOM   407  C  CB    . ASP A  1 63  ? -18.304 -22.153 -57.383  1.00 31.42  ? 64   ASP A CB    1 
ATOM   408  C  CG    . ASP A  1 63  ? -19.246 -23.306 -57.031  1.00 32.84  ? 64   ASP A CG    1 
ATOM   409  O  OD1   . ASP A  1 63  ? -20.481 -23.154 -57.109  1.00 34.21  ? 64   ASP A OD1   1 
ATOM   410  O  OD2   . ASP A  1 63  ? -18.732 -24.388 -56.673  1.00 40.78  ? 64   ASP A OD2   1 
ATOM   411  N  N     . ILE A  1 64  ? -17.174 -19.222 -56.476  1.00 33.50  ? 65   ILE A N     1 
ATOM   412  C  CA    . ILE A  1 64  ? -16.044 -18.322 -56.642  1.00 35.43  ? 65   ILE A CA    1 
ATOM   413  C  C     . ILE A  1 64  ? -14.738 -18.989 -56.231  1.00 37.99  ? 65   ILE A C     1 
ATOM   414  O  O     . ILE A  1 64  ? -13.707 -18.790 -56.879  1.00 33.81  ? 65   ILE A O     1 
ATOM   415  C  CB    . ILE A  1 64  ? -16.246 -17.012 -55.849  1.00 32.73  ? 65   ILE A CB    1 
ATOM   416  C  CG1   . ILE A  1 64  ? -17.672 -16.473 -56.006  1.00 33.35  ? 65   ILE A CG1   1 
ATOM   417  C  CG2   . ILE A  1 64  ? -15.188 -15.985 -56.277  1.00 31.68  ? 65   ILE A CG2   1 
ATOM   418  C  CD1   . ILE A  1 64  ? -18.014 -16.038 -57.426  1.00 36.45  ? 65   ILE A CD1   1 
ATOM   419  N  N     . HIS A  1 65  ? -14.770 -19.761 -55.137  1.00 35.55  ? 66   HIS A N     1 
ATOM   420  C  CA    . HIS A  1 65  ? -13.629 -20.514 -54.599  1.00 38.08  ? 66   HIS A CA    1 
ATOM   421  C  C     . HIS A  1 65  ? -12.350 -19.667 -54.549  1.00 37.64  ? 66   HIS A C     1 
ATOM   422  O  O     . HIS A  1 65  ? -11.303 -20.014 -55.102  1.00 39.30  ? 66   HIS A O     1 
ATOM   423  C  CB    . HIS A  1 65  ? -13.427 -21.809 -55.392  1.00 38.88  ? 66   HIS A CB    1 
ATOM   424  C  CG    . HIS A  1 65  ? -14.350 -22.915 -54.974  1.00 39.48  ? 66   HIS A CG    1 
ATOM   425  N  ND1   . HIS A  1 65  ? -14.346 -23.445 -53.702  1.00 36.75  ? 66   HIS A ND1   1 
ATOM   426  C  CD2   . HIS A  1 65  ? -15.329 -23.565 -55.647  1.00 37.33  ? 66   HIS A CD2   1 
ATOM   427  C  CE1   . HIS A  1 65  ? -15.274 -24.382 -53.613  1.00 37.65  ? 66   HIS A CE1   1 
ATOM   428  N  NE2   . HIS A  1 65  ? -15.887 -24.472 -54.778  1.00 39.73  ? 66   HIS A NE2   1 
ATOM   429  N  N     . GLY A  1 66  ? -12.456 -18.530 -53.862  1.00 34.77  ? 67   GLY A N     1 
ATOM   430  C  CA    . GLY A  1 66  ? -11.302 -17.704 -53.574  1.00 34.39  ? 67   GLY A CA    1 
ATOM   431  C  C     . GLY A  1 66  ? -10.608 -17.086 -54.773  1.00 37.02  ? 67   GLY A C     1 
ATOM   432  O  O     . GLY A  1 66  ? -9.475  -16.610 -54.633  1.00 37.19  ? 67   GLY A O     1 
ATOM   433  N  N     . GLN A  1 67  ? -11.229 -17.109 -55.952  1.00 32.67  ? 68   GLN A N     1 
ATOM   434  C  CA    . GLN A  1 67  ? -10.663 -16.466 -57.139  1.00 34.15  ? 68   GLN A CA    1 
ATOM   435  C  C     . GLN A  1 67  ? -11.081 -15.000 -57.093  1.00 34.16  ? 68   GLN A C     1 
ATOM   436  O  O     . GLN A  1 67  ? -12.003 -14.550 -57.780  1.00 34.49  ? 68   GLN A O     1 
ATOM   437  C  CB    . GLN A  1 67  ? -11.125 -17.177 -58.407  1.00 34.74  ? 68   GLN A CB    1 
ATOM   438  C  CG    . GLN A  1 67  ? -10.696 -18.646 -58.445  1.00 40.55  ? 68   GLN A CG    1 
ATOM   439  C  CD    . GLN A  1 67  ? -10.944 -19.325 -59.787  1.00 40.69  ? 68   GLN A CD    1 
ATOM   440  O  OE1   . GLN A  1 67  ? -10.919 -20.558 -59.881  1.00 41.61  ? 68   GLN A OE1   1 
ATOM   441  N  NE2   . GLN A  1 67  ? -11.183 -18.528 -60.829  1.00 33.82  ? 68   GLN A NE2   1 
ATOM   442  N  N     . TYR A  1 68  ? -10.378 -14.253 -56.243  1.00 32.93  ? 69   TYR A N     1 
ATOM   443  C  CA    . TYR A  1 68  ? -10.785 -12.892 -55.907  1.00 37.02  ? 69   TYR A CA    1 
ATOM   444  C  C     . TYR A  1 68  ? -10.814 -11.980 -57.128  1.00 42.72  ? 69   TYR A C     1 
ATOM   445  O  O     . TYR A  1 68  ? -11.723 -11.150 -57.272  1.00 41.14  ? 69   TYR A O     1 
ATOM   446  C  CB    . TYR A  1 68  ? -9.841  -12.323 -54.851  1.00 32.24  ? 69   TYR A CB    1 
ATOM   447  C  CG    . TYR A  1 68  ? -10.238 -10.947 -54.385  1.00 33.62  ? 69   TYR A CG    1 
ATOM   448  C  CD1   . TYR A  1 68  ? -11.494 -10.722 -53.853  1.00 27.72  ? 69   TYR A CD1   1 
ATOM   449  C  CD2   . TYR A  1 68  ? -9.351  -9.874  -54.467  1.00 34.47  ? 69   TYR A CD2   1 
ATOM   450  C  CE1   . TYR A  1 68  ? -11.872 -9.463  -53.414  1.00 30.53  ? 69   TYR A CE1   1 
ATOM   451  C  CE2   . TYR A  1 68  ? -9.721  -8.605  -54.030  1.00 39.12  ? 69   TYR A CE2   1 
ATOM   452  C  CZ    . TYR A  1 68  ? -10.990 -8.417  -53.502  1.00 34.70  ? 69   TYR A CZ    1 
ATOM   453  O  OH    . TYR A  1 68  ? -11.376 -7.178  -53.054  1.00 36.59  ? 69   TYR A OH    1 
ATOM   454  N  N     . TYR A  1 69  ? -9.819  -12.099 -58.012  1.00 46.45  ? 70   TYR A N     1 
ATOM   455  C  CA    . TYR A  1 69  ? -9.774  -11.187 -59.149  1.00 49.37  ? 70   TYR A CA    1 
ATOM   456  C  C     . TYR A  1 69  ? -10.932 -11.436 -60.103  1.00 45.41  ? 70   TYR A C     1 
ATOM   457  O  O     . TYR A  1 69  ? -11.394 -10.502 -60.770  1.00 44.78  ? 70   TYR A O     1 
ATOM   458  C  CB    . TYR A  1 69  ? -8.427  -11.291 -59.866  1.00 60.03  ? 70   TYR A CB    1 
ATOM   459  C  CG    . TYR A  1 69  ? -7.367  -10.397 -59.245  1.00 76.19  ? 70   TYR A CG    1 
ATOM   460  C  CD1   . TYR A  1 69  ? -6.628  -10.823 -58.143  1.00 81.33  ? 70   TYR A CD1   1 
ATOM   461  C  CD2   . TYR A  1 69  ? -7.119  -9.121  -59.747  1.00 82.63  ? 70   TYR A CD2   1 
ATOM   462  C  CE1   . TYR A  1 69  ? -5.665  -10.010 -57.564  1.00 85.73  ? 70   TYR A CE1   1 
ATOM   463  C  CE2   . TYR A  1 69  ? -6.154  -8.298  -59.174  1.00 86.64  ? 70   TYR A CE2   1 
ATOM   464  C  CZ    . TYR A  1 69  ? -5.433  -8.751  -58.083  1.00 88.81  ? 70   TYR A CZ    1 
ATOM   465  O  OH    . TYR A  1 69  ? -4.474  -7.946  -57.510  1.00 91.40  ? 70   TYR A OH    1 
ATOM   466  N  N     . ASP A  1 70  ? -11.443 -12.672 -60.145  1.00 45.42  ? 71   ASP A N     1 
ATOM   467  C  CA    . ASP A  1 70  ? -12.632 -12.952 -60.939  1.00 41.53  ? 71   ASP A CA    1 
ATOM   468  C  C     . ASP A  1 70  ? -13.897 -12.420 -60.283  1.00 37.74  ? 71   ASP A C     1 
ATOM   469  O  O     . ASP A  1 70  ? -14.833 -12.034 -60.989  1.00 39.95  ? 71   ASP A O     1 
ATOM   470  C  CB    . ASP A  1 70  ? -12.759 -14.452 -61.186  1.00 46.50  ? 71   ASP A CB    1 
ATOM   471  C  CG    . ASP A  1 70  ? -11.617 -14.993 -62.008  1.00 50.49  ? 71   ASP A CG    1 
ATOM   472  O  OD1   . ASP A  1 70  ? -11.252 -14.329 -63.007  1.00 48.37  ? 71   ASP A OD1   1 
ATOM   473  O  OD2   . ASP A  1 70  ? -11.079 -16.062 -61.639  1.00 48.81  ? 71   ASP A OD2   1 
ATOM   474  N  N     . LEU A  1 71  ? -13.950 -12.386 -58.947  1.00 37.38  ? 72   LEU A N     1 
ATOM   475  C  CA    . LEU A  1 71  ? -15.076 -11.727 -58.286  1.00 36.30  ? 72   LEU A CA    1 
ATOM   476  C  C     . LEU A  1 71  ? -15.133 -10.248 -58.654  1.00 33.27  ? 72   LEU A C     1 
ATOM   477  O  O     . LEU A  1 71  ? -16.216 -9.698  -58.887  1.00 35.11  ? 72   LEU A O     1 
ATOM   478  C  CB    . LEU A  1 71  ? -14.985 -11.898 -56.768  1.00 34.73  ? 72   LEU A CB    1 
ATOM   479  C  CG    . LEU A  1 71  ? -16.012 -11.135 -55.928  1.00 37.17  ? 72   LEU A CG    1 
ATOM   480  C  CD1   . LEU A  1 71  ? -17.444 -11.627 -56.202  1.00 33.03  ? 72   LEU A CD1   1 
ATOM   481  C  CD2   . LEU A  1 71  ? -15.700 -11.182 -54.424  1.00 31.98  ? 72   LEU A CD2   1 
ATOM   482  N  N     . LEU A  1 72  ? -13.974 -9.585  -58.719  1.00 34.16  ? 73   LEU A N     1 
ATOM   483  C  CA    . LEU A  1 72  ? -13.963 -8.187  -59.142  1.00 35.10  ? 73   LEU A CA    1 
ATOM   484  C  C     . LEU A  1 72  ? -14.460 -8.050  -60.571  1.00 38.80  ? 73   LEU A C     1 
ATOM   485  O  O     . LEU A  1 72  ? -15.211 -7.114  -60.890  1.00 41.20  ? 73   LEU A O     1 
ATOM   486  C  CB    . LEU A  1 72  ? -12.562 -7.593  -58.994  1.00 29.87  ? 73   LEU A CB    1 
ATOM   487  C  CG    . LEU A  1 72  ? -12.075 -7.493  -57.543  1.00 33.47  ? 73   LEU A CG    1 
ATOM   488  C  CD1   . LEU A  1 72  ? -10.741 -6.793  -57.424  1.00 34.48  ? 73   LEU A CD1   1 
ATOM   489  C  CD2   . LEU A  1 72  ? -13.125 -6.816  -56.651  1.00 32.40  ? 73   LEU A CD2   1 
ATOM   490  N  N     . ARG A  1 73  ? -14.068 -8.981  -61.444  1.00 41.33  ? 74   ARG A N     1 
ATOM   491  C  CA    . ARG A  1 73  ? -14.568 -8.966  -62.817  1.00 44.49  ? 74   ARG A CA    1 
ATOM   492  C  C     . ARG A  1 73  ? -16.081 -9.122  -62.849  1.00 43.46  ? 74   ARG A C     1 
ATOM   493  O  O     . ARG A  1 73  ? -16.762 -8.438  -63.621  1.00 43.61  ? 74   ARG A O     1 
ATOM   494  C  CB    . ARG A  1 73  ? -13.907 -10.074 -63.631  1.00 46.47  ? 74   ARG A CB    1 
ATOM   495  C  CG    . ARG A  1 73  ? -12.553 -9.714  -64.180  1.00 48.75  ? 74   ARG A CG    1 
ATOM   496  C  CD    . ARG A  1 73  ? -12.356 -10.315 -65.564  1.00 55.90  ? 74   ARG A CD    1 
ATOM   497  N  NE    . ARG A  1 73  ? -12.061 -11.742 -65.507  1.00 56.71  ? 74   ARG A NE    1 
ATOM   498  C  CZ    . ARG A  1 73  ? -12.287 -12.597 -66.500  1.00 58.24  ? 74   ARG A CZ    1 
ATOM   499  N  NH1   . ARG A  1 73  ? -12.830 -12.180 -67.638  1.00 61.28  ? 74   ARG A NH1   1 
ATOM   500  N  NH2   . ARG A  1 73  ? -11.969 -13.875 -66.353  1.00 54.90  ? 74   ARG A NH2   1 
ATOM   501  N  N     . LEU A  1 74  ? -16.625 -10.013 -62.012  1.00 38.04  ? 75   LEU A N     1 
ATOM   502  C  CA    . LEU A  1 74  ? -18.075 -10.165 -61.942  1.00 37.41  ? 75   LEU A CA    1 
ATOM   503  C  C     . LEU A  1 74  ? -18.747 -8.836  -61.632  1.00 35.04  ? 75   LEU A C     1 
ATOM   504  O  O     . LEU A  1 74  ? -19.738 -8.465  -62.269  1.00 34.35  ? 75   LEU A O     1 
ATOM   505  C  CB    . LEU A  1 74  ? -18.455 -11.197 -60.883  1.00 41.78  ? 75   LEU A CB    1 
ATOM   506  C  CG    . LEU A  1 74  ? -18.357 -12.677 -61.227  1.00 50.78  ? 75   LEU A CG    1 
ATOM   507  C  CD1   . LEU A  1 74  ? -18.715 -13.504 -60.008  1.00 49.24  ? 75   LEU A CD1   1 
ATOM   508  C  CD2   . LEU A  1 74  ? -19.262 -13.019 -62.405  1.00 55.19  ? 75   LEU A CD2   1 
ATOM   509  N  N     . PHE A  1 75  ? -18.222 -8.114  -60.641  1.00 27.51  ? 76   PHE A N     1 
ATOM   510  C  CA    . PHE A  1 75  ? -18.819 -6.852  -60.239  1.00 33.71  ? 76   PHE A CA    1 
ATOM   511  C  C     . PHE A  1 75  ? -18.600 -5.764  -61.290  1.00 37.94  ? 76   PHE A C     1 
ATOM   512  O  O     . PHE A  1 75  ? -19.481 -4.921  -61.497  1.00 35.96  ? 76   PHE A O     1 
ATOM   513  C  CB    . PHE A  1 75  ? -18.252 -6.427  -58.885  1.00 36.94  ? 76   PHE A CB    1 
ATOM   514  C  CG    . PHE A  1 75  ? -18.801 -7.206  -57.721  1.00 34.86  ? 76   PHE A CG    1 
ATOM   515  C  CD1   . PHE A  1 75  ? -20.114 -7.639  -57.713  1.00 32.46  ? 76   PHE A CD1   1 
ATOM   516  C  CD2   . PHE A  1 75  ? -18.000 -7.497  -56.628  1.00 35.83  ? 76   PHE A CD2   1 
ATOM   517  C  CE1   . PHE A  1 75  ? -20.625 -8.359  -56.628  1.00 28.69  ? 76   PHE A CE1   1 
ATOM   518  C  CE2   . PHE A  1 75  ? -18.500 -8.217  -55.544  1.00 34.26  ? 76   PHE A CE2   1 
ATOM   519  C  CZ    . PHE A  1 75  ? -19.806 -8.644  -55.545  1.00 30.00  ? 76   PHE A CZ    1 
ATOM   520  N  N     . GLU A  1 76  ? -17.451 -5.771  -61.975  1.00 41.88  ? 77   GLU A N     1 
ATOM   521  C  CA    . GLU A  1 76  ? -17.249 -4.813  -63.057  1.00 46.69  ? 77   GLU A CA    1 
ATOM   522  C  C     . GLU A  1 76  ? -18.259 -5.040  -64.170  1.00 42.98  ? 77   GLU A C     1 
ATOM   523  O  O     . GLU A  1 76  ? -18.830 -4.086  -64.706  1.00 50.58  ? 77   GLU A O     1 
ATOM   524  C  CB    . GLU A  1 76  ? -15.822 -4.909  -63.598  1.00 53.64  ? 77   GLU A CB    1 
ATOM   525  C  CG    . GLU A  1 76  ? -14.764 -4.386  -62.644  1.00 60.52  ? 77   GLU A CG    1 
ATOM   526  C  CD    . GLU A  1 76  ? -13.359 -4.827  -63.014  1.00 68.94  ? 77   GLU A CD    1 
ATOM   527  O  OE1   . GLU A  1 76  ? -13.193 -5.487  -64.066  1.00 75.39  ? 77   GLU A OE1   1 
ATOM   528  O  OE2   . GLU A  1 76  ? -12.420 -4.525  -62.241  1.00 67.50  ? 77   GLU A OE2   1 
ATOM   529  N  N     . TYR A  1 77  ? -18.507 -6.301  -64.508  1.00 42.49  ? 78   TYR A N     1 
ATOM   530  C  CA    . TYR A  1 77  ? -19.473 -6.640  -65.547  1.00 44.78  ? 78   TYR A CA    1 
ATOM   531  C  C     . TYR A  1 77  ? -20.903 -6.368  -65.082  1.00 44.43  ? 78   TYR A C     1 
ATOM   532  O  O     . TYR A  1 77  ? -21.708 -5.785  -65.815  1.00 46.71  ? 78   TYR A O     1 
ATOM   533  C  CB    . TYR A  1 77  ? -19.280 -8.114  -65.927  1.00 55.34  ? 78   TYR A CB    1 
ATOM   534  C  CG    . TYR A  1 77  ? -19.802 -8.550  -67.282  1.00 63.71  ? 78   TYR A CG    1 
ATOM   535  C  CD1   . TYR A  1 77  ? -20.682 -7.761  -68.014  1.00 70.32  ? 78   TYR A CD1   1 
ATOM   536  C  CD2   . TYR A  1 77  ? -19.429 -9.775  -67.817  1.00 65.25  ? 78   TYR A CD2   1 
ATOM   537  C  CE1   . TYR A  1 77  ? -21.165 -8.178  -69.248  1.00 70.94  ? 78   TYR A CE1   1 
ATOM   538  C  CE2   . TYR A  1 77  ? -19.910 -10.201 -69.043  1.00 68.64  ? 78   TYR A CE2   1 
ATOM   539  C  CZ    . TYR A  1 77  ? -20.776 -9.400  -69.754  1.00 69.95  ? 78   TYR A CZ    1 
ATOM   540  O  OH    . TYR A  1 77  ? -21.248 -9.825  -70.977  1.00 71.16  ? 78   TYR A OH    1 
ATOM   541  N  N     . GLY A  1 78  ? -21.241 -6.772  -63.863  1.00 38.39  ? 79   GLY A N     1 
ATOM   542  C  CA    . GLY A  1 78  ? -22.624 -6.709  -63.445  1.00 38.05  ? 79   GLY A CA    1 
ATOM   543  C  C     . GLY A  1 78  ? -23.002 -5.412  -62.773  1.00 40.42  ? 79   GLY A C     1 
ATOM   544  O  O     . GLY A  1 78  ? -24.189 -5.098  -62.666  1.00 43.81  ? 79   GLY A O     1 
ATOM   545  N  N     . GLY A  1 79  ? -22.004 -4.650  -62.324  1.00 40.47  ? 80   GLY A N     1 
ATOM   546  C  CA    . GLY A  1 79  ? -22.242 -3.445  -61.553  1.00 37.07  ? 80   GLY A CA    1 
ATOM   547  C  C     . GLY A  1 79  ? -21.968 -3.660  -60.073  1.00 41.26  ? 80   GLY A C     1 
ATOM   548  O  O     . GLY A  1 79  ? -22.571 -4.545  -59.453  1.00 40.08  ? 80   GLY A O     1 
ATOM   549  N  N     . PHE A  1 80  ? -21.059 -2.870  -59.498  1.00 36.23  ? 81   PHE A N     1 
ATOM   550  C  CA    . PHE A  1 80  ? -20.728 -3.024  -58.091  1.00 38.74  ? 81   PHE A CA    1 
ATOM   551  C  C     . PHE A  1 80  ? -21.948 -2.705  -57.229  1.00 40.94  ? 81   PHE A C     1 
ATOM   552  O  O     . PHE A  1 80  ? -22.724 -1.798  -57.554  1.00 39.20  ? 81   PHE A O     1 
ATOM   553  C  CB    . PHE A  1 80  ? -19.563 -2.110  -57.700  1.00 37.27  ? 81   PHE A CB    1 
ATOM   554  C  CG    . PHE A  1 80  ? -18.221 -2.656  -58.065  1.00 37.91  ? 81   PHE A CG    1 
ATOM   555  C  CD1   . PHE A  1 80  ? -17.693 -2.452  -59.332  1.00 37.50  ? 81   PHE A CD1   1 
ATOM   556  C  CD2   . PHE A  1 80  ? -17.483 -3.386  -57.145  1.00 35.16  ? 81   PHE A CD2   1 
ATOM   557  C  CE1   . PHE A  1 80  ? -16.452 -2.976  -59.673  1.00 39.13  ? 81   PHE A CE1   1 
ATOM   558  C  CE2   . PHE A  1 80  ? -16.250 -3.912  -57.477  1.00 33.53  ? 81   PHE A CE2   1 
ATOM   559  C  CZ    . PHE A  1 80  ? -15.735 -3.719  -58.742  1.00 37.93  ? 81   PHE A CZ    1 
ATOM   560  N  N     . PRO A  1 81  ? -22.146 -3.441  -56.133  1.00 39.53  ? 82   PRO A N     1 
ATOM   561  C  CA    . PRO A  1 81  ? -23.211 -3.091  -55.172  1.00 35.05  ? 82   PRO A CA    1 
ATOM   562  C  C     . PRO A  1 81  ? -23.087 -1.639  -54.752  1.00 34.67  ? 82   PRO A C     1 
ATOM   563  O  O     . PRO A  1 81  ? -21.975 -1.157  -54.493  1.00 38.69  ? 82   PRO A O     1 
ATOM   564  C  CB    . PRO A  1 81  ? -22.952 -4.034  -53.984  1.00 32.34  ? 82   PRO A CB    1 
ATOM   565  C  CG    . PRO A  1 81  ? -22.185 -5.180  -54.554  1.00 33.78  ? 82   PRO A CG    1 
ATOM   566  C  CD    . PRO A  1 81  ? -21.333 -4.579  -55.667  1.00 38.22  ? 82   PRO A CD    1 
ATOM   567  N  N     . PRO A  1 82  ? -24.205 -0.907  -54.662  1.00 36.64  ? 83   PRO A N     1 
ATOM   568  C  CA    . PRO A  1 82  ? -25.557 -1.445  -54.813  1.00 36.20  ? 83   PRO A CA    1 
ATOM   569  C  C     . PRO A  1 82  ? -26.170 -1.233  -56.188  1.00 35.32  ? 83   PRO A C     1 
ATOM   570  O  O     . PRO A  1 82  ? -27.387 -1.374  -56.292  1.00 36.90  ? 83   PRO A O     1 
ATOM   571  C  CB    . PRO A  1 82  ? -26.346 -0.644  -53.783  1.00 37.17  ? 83   PRO A CB    1 
ATOM   572  C  CG    . PRO A  1 82  ? -25.735 0.738   -53.899  1.00 35.20  ? 83   PRO A CG    1 
ATOM   573  C  CD    . PRO A  1 82  ? -24.250 0.517   -54.277  1.00 41.59  ? 83   PRO A CD    1 
ATOM   574  N  N     . GLU A  1 83  ? -25.370 -0.892  -57.205  1.00 39.26  ? 84   GLU A N     1 
ATOM   575  C  CA    A GLU A  1 83  ? -25.934 -0.637  -58.528  0.50 41.72  ? 84   GLU A CA    1 
ATOM   576  C  CA    B GLU A  1 83  ? -25.931 -0.640  -58.530  0.50 41.71  ? 84   GLU A CA    1 
ATOM   577  C  C     . GLU A  1 83  ? -26.818 -1.785  -58.992  1.00 38.10  ? 84   GLU A C     1 
ATOM   578  O  O     . GLU A  1 83  ? -27.829 -1.554  -59.659  1.00 38.18  ? 84   GLU A O     1 
ATOM   579  C  CB    A GLU A  1 83  ? -24.816 -0.375  -59.539  0.50 45.12  ? 84   GLU A CB    1 
ATOM   580  C  CB    B GLU A  1 83  ? -24.816 -0.397  -59.549  0.50 45.09  ? 84   GLU A CB    1 
ATOM   581  C  CG    A GLU A  1 83  ? -24.012 0.890   -59.259  0.50 47.19  ? 84   GLU A CG    1 
ATOM   582  C  CG    B GLU A  1 83  ? -25.326 -0.106  -60.957  0.50 49.18  ? 84   GLU A CG    1 
ATOM   583  C  CD    A GLU A  1 83  ? -22.623 0.860   -59.877  0.50 49.71  ? 84   GLU A CD    1 
ATOM   584  C  CD    B GLU A  1 83  ? -24.223 -0.100  -62.000  0.50 50.19  ? 84   GLU A CD    1 
ATOM   585  O  OE1   A GLU A  1 83  ? -22.431 0.181   -60.908  0.50 51.32  ? 84   GLU A OE1   1 
ATOM   586  O  OE1   B GLU A  1 83  ? -23.162 0.509   -61.754  0.50 51.24  ? 84   GLU A OE1   1 
ATOM   587  O  OE2   A GLU A  1 83  ? -21.713 1.504   -59.317  0.50 51.52  ? 84   GLU A OE2   1 
ATOM   588  O  OE2   B GLU A  1 83  ? -24.419 -0.715  -63.065  0.50 48.76  ? 84   GLU A OE2   1 
ATOM   589  N  N     . SER A  1 84  ? -26.460 -3.024  -58.645  1.00 36.67  ? 85   SER A N     1 
ATOM   590  C  CA    . SER A  1 84  ? -27.289 -4.190  -58.923  1.00 37.35  ? 85   SER A CA    1 
ATOM   591  C  C     . SER A  1 84  ? -27.509 -4.973  -57.634  1.00 32.32  ? 85   SER A C     1 
ATOM   592  O  O     . SER A  1 84  ? -26.698 -4.910  -56.709  1.00 34.85  ? 85   SER A O     1 
ATOM   593  C  CB    . SER A  1 84  ? -26.656 -5.104  -59.972  1.00 45.02  ? 85   SER A CB    1 
ATOM   594  O  OG    . SER A  1 84  ? -26.610 -4.477  -61.242  1.00 54.45  ? 85   SER A OG    1 
ATOM   595  N  N     . ASN A  1 85  ? -28.617 -5.703  -57.577  1.00 31.40  ? 86   ASN A N     1 
ATOM   596  C  CA    . ASN A  1 85  ? -28.861 -6.670  -56.513  1.00 29.74  ? 86   ASN A CA    1 
ATOM   597  C  C     . ASN A  1 85  ? -28.188 -7.996  -56.861  1.00 33.27  ? 86   ASN A C     1 
ATOM   598  O  O     . ASN A  1 85  ? -28.165 -8.404  -58.027  1.00 35.68  ? 86   ASN A O     1 
ATOM   599  C  CB    . ASN A  1 85  ? -30.361 -6.883  -56.312  1.00 27.19  ? 86   ASN A CB    1 
ATOM   600  C  CG    . ASN A  1 85  ? -31.099 -5.590  -55.977  1.00 41.67  ? 86   ASN A CG    1 
ATOM   601  O  OD1   . ASN A  1 85  ? -30.608 -4.758  -55.209  1.00 40.48  ? 86   ASN A OD1   1 
ATOM   602  N  ND2   . ASN A  1 85  ? -32.274 -5.410  -56.576  1.00 45.90  ? 86   ASN A ND2   1 
ATOM   603  N  N     . TYR A  1 86  ? -27.656 -8.676  -55.841  1.00 29.37  ? 87   TYR A N     1 
ATOM   604  C  CA    . TYR A  1 86  ? -26.882 -9.897  -56.035  1.00 27.12  ? 87   TYR A CA    1 
ATOM   605  C  C     . TYR A  1 86  ? -27.355 -11.001 -55.105  1.00 30.37  ? 87   TYR A C     1 
ATOM   606  O  O     . TYR A  1 86  ? -27.681 -10.752 -53.938  1.00 30.98  ? 87   TYR A O     1 
ATOM   607  C  CB    . TYR A  1 86  ? -25.385 -9.667  -55.785  1.00 28.17  ? 87   TYR A CB    1 
ATOM   608  C  CG    . TYR A  1 86  ? -24.700 -8.993  -56.943  1.00 29.20  ? 87   TYR A CG    1 
ATOM   609  C  CD1   . TYR A  1 86  ? -24.192 -9.742  -57.992  1.00 24.21  ? 87   TYR A CD1   1 
ATOM   610  C  CD2   . TYR A  1 86  ? -24.594 -7.601  -57.003  1.00 31.45  ? 87   TYR A CD2   1 
ATOM   611  C  CE1   . TYR A  1 86  ? -23.574 -9.148  -59.061  1.00 28.27  ? 87   TYR A CE1   1 
ATOM   612  C  CE2   . TYR A  1 86  ? -23.968 -6.982  -58.081  1.00 30.00  ? 87   TYR A CE2   1 
ATOM   613  C  CZ    . TYR A  1 86  ? -23.468 -7.762  -59.103  1.00 27.79  ? 87   TYR A CZ    1 
ATOM   614  O  OH    . TYR A  1 86  ? -22.853 -7.173  -60.172  1.00 33.65  ? 87   TYR A OH    1 
ATOM   615  N  N     . LEU A  1 87  ? -27.373 -12.221 -55.635  1.00 28.61  ? 88   LEU A N     1 
ATOM   616  C  CA    . LEU A  1 87  ? -27.508 -13.438 -54.846  1.00 30.27  ? 88   LEU A CA    1 
ATOM   617  C  C     . LEU A  1 87  ? -26.369 -14.364 -55.243  1.00 29.96  ? 88   LEU A C     1 
ATOM   618  O  O     . LEU A  1 87  ? -26.257 -14.742 -56.416  1.00 28.87  ? 88   LEU A O     1 
ATOM   619  C  CB    . LEU A  1 87  ? -28.871 -14.104 -55.083  1.00 27.48  ? 88   LEU A CB    1 
ATOM   620  C  CG    . LEU A  1 87  ? -29.068 -15.525 -54.547  1.00 27.58  ? 88   LEU A CG    1 
ATOM   621  C  CD1   . LEU A  1 87  ? -29.087 -15.516 -53.030  1.00 21.80  ? 88   LEU A CD1   1 
ATOM   622  C  CD2   . LEU A  1 87  ? -30.360 -16.123 -55.113  1.00 28.47  ? 88   LEU A CD2   1 
ATOM   623  N  N     . PHE A  1 88  ? -25.507 -14.696 -54.287  1.00 27.52  ? 89   PHE A N     1 
ATOM   624  C  CA    . PHE A  1 88  ? -24.443 -15.670 -54.498  1.00 30.02  ? 89   PHE A CA    1 
ATOM   625  C  C     . PHE A  1 88  ? -24.875 -17.013 -53.914  1.00 35.81  ? 89   PHE A C     1 
ATOM   626  O  O     . PHE A  1 88  ? -25.496 -17.071 -52.849  1.00 31.30  ? 89   PHE A O     1 
ATOM   627  C  CB    . PHE A  1 88  ? -23.127 -15.211 -53.862  1.00 22.00  ? 89   PHE A CB    1 
ATOM   628  C  CG    . PHE A  1 88  ? -22.449 -14.069 -54.601  1.00 25.78  ? 89   PHE A CG    1 
ATOM   629  C  CD1   . PHE A  1 88  ? -22.917 -12.762 -54.474  1.00 22.58  ? 89   PHE A CD1   1 
ATOM   630  C  CD2   . PHE A  1 88  ? -21.343 -14.304 -55.403  1.00 29.93  ? 89   PHE A CD2   1 
ATOM   631  C  CE1   . PHE A  1 88  ? -22.300 -11.711 -55.140  1.00 29.02  ? 89   PHE A CE1   1 
ATOM   632  C  CE2   . PHE A  1 88  ? -20.718 -13.259 -56.076  1.00 32.70  ? 89   PHE A CE2   1 
ATOM   633  C  CZ    . PHE A  1 88  ? -21.203 -11.964 -55.945  1.00 31.59  ? 89   PHE A CZ    1 
ATOM   634  N  N     . LEU A  1 89  ? -24.548 -18.092 -54.618  1.00 37.58  ? 90   LEU A N     1 
ATOM   635  C  CA    . LEU A  1 89  ? -25.035 -19.415 -54.274  1.00 30.61  ? 90   LEU A CA    1 
ATOM   636  C  C     . LEU A  1 89  ? -24.028 -20.253 -53.494  1.00 32.40  ? 90   LEU A C     1 
ATOM   637  O  O     . LEU A  1 89  ? -24.245 -21.457 -53.326  1.00 31.09  ? 90   LEU A O     1 
ATOM   638  C  CB    . LEU A  1 89  ? -25.471 -20.157 -55.536  1.00 26.22  ? 90   LEU A CB    1 
ATOM   639  C  CG    . LEU A  1 89  ? -26.463 -19.410 -56.432  1.00 26.11  ? 90   LEU A CG    1 
ATOM   640  C  CD1   . LEU A  1 89  ? -26.648 -20.102 -57.778  1.00 26.82  ? 90   LEU A CD1   1 
ATOM   641  C  CD2   . LEU A  1 89  ? -27.787 -19.268 -55.695  1.00 21.55  ? 90   LEU A CD2   1 
ATOM   642  N  N     . GLY A  1 90  ? -22.934 -19.665 -53.033  1.00 30.95  ? 91   GLY A N     1 
ATOM   643  C  CA    . GLY A  1 90  ? -22.046 -20.337 -52.102  1.00 31.23  ? 91   GLY A CA    1 
ATOM   644  C  C     . GLY A  1 90  ? -20.699 -20.687 -52.715  1.00 35.79  ? 91   GLY A C     1 
ATOM   645  O  O     . GLY A  1 90  ? -20.375 -20.322 -53.851  1.00 31.52  ? 91   GLY A O     1 
ATOM   646  N  N     . ASP A  1 91  ? -19.907 -21.420 -51.920  1.00 28.95  ? 92   ASP A N     1 
ATOM   647  C  CA    . ASP A  1 91  ? -18.545 -21.828 -52.271  1.00 27.88  ? 92   ASP A CA    1 
ATOM   648  C  C     . ASP A  1 91  ? -17.660 -20.610 -52.570  1.00 32.31  ? 92   ASP A C     1 
ATOM   649  O  O     . ASP A  1 91  ? -17.123 -20.424 -53.666  1.00 33.30  ? 92   ASP A O     1 
ATOM   650  C  CB    . ASP A  1 91  ? -18.555 -22.842 -53.423  1.00 25.07  ? 92   ASP A CB    1 
ATOM   651  C  CG    . ASP A  1 91  ? -18.810 -24.263 -52.925  1.00 31.32  ? 92   ASP A CG    1 
ATOM   652  O  OD1   . ASP A  1 91  ? -19.211 -24.395 -51.745  1.00 32.23  ? 92   ASP A OD1   1 
ATOM   653  O  OD2   . ASP A  1 91  ? -18.614 -25.235 -53.678  1.00 33.49  ? 92   ASP A OD2   1 
ATOM   654  N  N     . TYR A  1 92  ? -17.515 -19.770 -51.550  1.00 32.41  ? 93   TYR A N     1 
ATOM   655  C  CA    . TYR A  1 92  ? -16.662 -18.593 -51.649  1.00 33.64  ? 93   TYR A CA    1 
ATOM   656  C  C     . TYR A  1 92  ? -15.214 -18.895 -51.316  1.00 35.52  ? 93   TYR A C     1 
ATOM   657  O  O     . TYR A  1 92  ? -14.317 -18.203 -51.825  1.00 34.83  ? 93   TYR A O     1 
ATOM   658  C  CB    . TYR A  1 92  ? -17.187 -17.490 -50.723  1.00 29.72  ? 93   TYR A CB    1 
ATOM   659  C  CG    . TYR A  1 92  ? -18.693 -17.408 -50.750  1.00 32.11  ? 93   TYR A CG    1 
ATOM   660  C  CD1   . TYR A  1 92  ? -19.356 -17.032 -51.914  1.00 30.49  ? 93   TYR A CD1   1 
ATOM   661  C  CD2   . TYR A  1 92  ? -19.458 -17.750 -49.634  1.00 29.11  ? 93   TYR A CD2   1 
ATOM   662  C  CE1   . TYR A  1 92  ? -20.740 -16.980 -51.973  1.00 24.31  ? 93   TYR A CE1   1 
ATOM   663  C  CE2   . TYR A  1 92  ? -20.844 -17.681 -49.678  1.00 29.72  ? 93   TYR A CE2   1 
ATOM   664  C  CZ    . TYR A  1 92  ? -21.476 -17.283 -50.860  1.00 28.33  ? 93   TYR A CZ    1 
ATOM   665  O  OH    . TYR A  1 92  ? -22.848 -17.225 -50.939  1.00 24.90  ? 93   TYR A OH    1 
ATOM   666  N  N     . VAL A  1 93  ? -14.972 -19.921 -50.496  1.00 30.75  ? 94   VAL A N     1 
ATOM   667  C  CA    . VAL A  1 93  ? -13.647 -20.184 -49.955  1.00 33.33  ? 94   VAL A CA    1 
ATOM   668  C  C     . VAL A  1 93  ? -13.138 -21.518 -50.477  1.00 33.90  ? 94   VAL A C     1 
ATOM   669  O  O     . VAL A  1 93  ? -13.878 -22.259 -51.134  1.00 32.71  ? 94   VAL A O     1 
ATOM   670  C  CB    . VAL A  1 93  ? -13.668 -20.155 -48.416  1.00 35.22  ? 94   VAL A CB    1 
ATOM   671  C  CG1   . VAL A  1 93  ? -14.242 -18.838 -47.921  1.00 33.39  ? 94   VAL A CG1   1 
ATOM   672  C  CG2   . VAL A  1 93  ? -14.467 -21.338 -47.855  1.00 31.33  ? 94   VAL A CG2   1 
ATOM   673  N  N     . ASP A  1 94  ? -11.867 -21.813 -50.183  1.00 34.97  ? 95   ASP A N     1 
ATOM   674  C  CA    . ASP A  1 94  ? -11.155 -23.041 -50.549  1.00 36.16  ? 95   ASP A CA    1 
ATOM   675  C  C     . ASP A  1 94  ? -10.685 -23.022 -51.997  1.00 36.83  ? 95   ASP A C     1 
ATOM   676  O  O     . ASP A  1 94  ? -11.278 -22.352 -52.854  1.00 34.97  ? 95   ASP A O     1 
ATOM   677  C  CB    . ASP A  1 94  ? -12.008 -24.299 -50.323  1.00 28.27  ? 95   ASP A CB    1 
ATOM   678  C  CG    . ASP A  1 94  ? -12.160 -24.643 -48.869  1.00 33.78  ? 95   ASP A CG    1 
ATOM   679  O  OD1   . ASP A  1 94  ? -11.427 -24.050 -48.050  1.00 39.60  ? 95   ASP A OD1   1 
ATOM   680  O  OD2   . ASP A  1 94  ? -13.018 -25.501 -48.539  1.00 33.24  ? 95   ASP A OD2   1 
ATOM   681  N  N     . ARG A  1 95  ? -9.618  -23.788 -52.250  1.00 37.95  ? 96   ARG A N     1 
ATOM   682  C  CA    . ARG A  1 95  ? -9.035  -24.060 -53.557  1.00 35.65  ? 96   ARG A CA    1 
ATOM   683  C  C     . ARG A  1 95  ? -8.258  -22.863 -54.096  1.00 45.02  ? 96   ARG A C     1 
ATOM   684  O  O     . ARG A  1 95  ? -7.064  -22.980 -54.382  1.00 52.42  ? 96   ARG A O     1 
ATOM   685  C  CB    . ARG A  1 95  ? -10.118 -24.521 -54.531  1.00 37.32  ? 96   ARG A CB    1 
ATOM   686  C  CG    . ARG A  1 95  ? -10.836 -25.795 -54.055  1.00 45.12  ? 96   ARG A CG    1 
ATOM   687  C  CD    . ARG A  1 95  ? -10.962 -26.792 -55.187  1.00 51.97  ? 96   ARG A CD    1 
ATOM   688  N  NE    . ARG A  1 95  ? -11.540 -28.067 -54.777  1.00 59.76  ? 96   ARG A NE    1 
ATOM   689  C  CZ    . ARG A  1 95  ? -12.844 -28.287 -54.627  1.00 58.08  ? 96   ARG A CZ    1 
ATOM   690  N  NH1   . ARG A  1 95  ? -13.283 -29.485 -54.262  1.00 56.80  ? 96   ARG A NH1   1 
ATOM   691  N  NH2   . ARG A  1 95  ? -13.714 -27.303 -54.825  1.00 58.61  ? 96   ARG A NH2   1 
ATOM   692  N  N     . GLY A  1 96  ? -8.908  -21.711 -54.228  1.00 44.74  ? 97   GLY A N     1 
ATOM   693  C  CA    . GLY A  1 96  ? -8.240  -20.539 -54.748  1.00 41.46  ? 97   GLY A CA    1 
ATOM   694  C  C     . GLY A  1 96  ? -7.252  -19.941 -53.763  1.00 38.91  ? 97   GLY A C     1 
ATOM   695  O  O     . GLY A  1 96  ? -7.167  -20.317 -52.597  1.00 41.16  ? 97   GLY A O     1 
ATOM   696  N  N     . LYS A  1 97  ? -6.491  -18.964 -54.252  1.00 41.83  ? 98   LYS A N     1 
ATOM   697  C  CA    . LYS A  1 97  ? -5.413  -18.392 -53.458  1.00 46.20  ? 98   LYS A CA    1 
ATOM   698  C  C     . LYS A  1 97  ? -5.870  -17.270 -52.532  1.00 44.55  ? 98   LYS A C     1 
ATOM   699  O  O     . LYS A  1 97  ? -5.180  -16.987 -51.545  1.00 45.34  ? 98   LYS A O     1 
ATOM   700  C  CB    . LYS A  1 97  ? -4.297  -17.885 -54.381  1.00 52.52  ? 98   LYS A CB    1 
ATOM   701  N  N     . GLN A  1 98  ? -7.019  -16.642 -52.798  1.00 38.37  ? 99   GLN A N     1 
ATOM   702  C  CA    . GLN A  1 98  ? -7.435  -15.438 -52.074  1.00 38.20  ? 99   GLN A CA    1 
ATOM   703  C  C     . GLN A  1 98  ? -8.862  -15.591 -51.539  1.00 39.46  ? 99   GLN A C     1 
ATOM   704  O  O     . GLN A  1 98  ? -9.734  -14.746 -51.769  1.00 35.64  ? 99   GLN A O     1 
ATOM   705  C  CB    . GLN A  1 98  ? -7.322  -14.201 -52.959  1.00 35.04  ? 99   GLN A CB    1 
ATOM   706  C  CG    . GLN A  1 98  ? -5.905  -13.910 -53.413  1.00 40.23  ? 99   GLN A CG    1 
ATOM   707  C  CD    . GLN A  1 98  ? -5.828  -12.674 -54.287  1.00 48.13  ? 99   GLN A CD    1 
ATOM   708  O  OE1   . GLN A  1 98  ? -6.370  -12.640 -55.393  1.00 51.63  ? 99   GLN A OE1   1 
ATOM   709  N  NE2   . GLN A  1 98  ? -5.166  -11.645 -53.789  1.00 51.95  ? 99   GLN A NE2   1 
ATOM   710  N  N     . SER A  1 99  ? -9.085  -16.682 -50.790  1.00 33.27  ? 100  SER A N     1 
ATOM   711  C  CA    . SER A  1 99  ? -10.370 -16.892 -50.136  1.00 30.32  ? 100  SER A CA    1 
ATOM   712  C  C     . SER A  1 99  ? -10.667 -15.796 -49.132  1.00 31.23  ? 100  SER A C     1 
ATOM   713  O  O     . SER A  1 99  ? -11.828 -15.411 -48.972  1.00 33.10  ? 100  SER A O     1 
ATOM   714  C  CB    . SER A  1 99  ? -10.405 -18.251 -49.427  1.00 30.97  ? 100  SER A CB    1 
ATOM   715  O  OG    . SER A  1 99  ? -10.359 -19.314 -50.356  1.00 41.26  ? 100  SER A OG    1 
ATOM   716  N  N     . LEU A  1 100 ? -9.636  -15.268 -48.465  1.00 34.24  ? 101  LEU A N     1 
ATOM   717  C  CA    . LEU A  1 100 ? -9.874  -14.280 -47.419  1.00 34.31  ? 101  LEU A CA    1 
ATOM   718  C  C     . LEU A  1 100 ? -10.399 -12.977 -48.006  1.00 35.47  ? 101  LEU A C     1 
ATOM   719  O  O     . LEU A  1 100 ? -11.371 -12.406 -47.493  1.00 31.54  ? 101  LEU A O     1 
ATOM   720  C  CB    . LEU A  1 100 ? -8.602  -14.036 -46.609  1.00 36.97  ? 101  LEU A CB    1 
ATOM   721  C  CG    . LEU A  1 100 ? -8.400  -15.016 -45.452  1.00 40.98  ? 101  LEU A CG    1 
ATOM   722  C  CD1   . LEU A  1 100 ? -7.145  -14.689 -44.662  1.00 45.63  ? 101  LEU A CD1   1 
ATOM   723  C  CD2   . LEU A  1 100 ? -9.613  -15.030 -44.545  1.00 37.29  ? 101  LEU A CD2   1 
ATOM   724  N  N     . GLU A  1 101 ? -9.768  -12.492 -49.087  1.00 34.14  ? 102  GLU A N     1 
ATOM   725  C  CA    . GLU A  1 101 ? -10.250 -11.276 -49.739  1.00 31.76  ? 102  GLU A CA    1 
ATOM   726  C  C     . GLU A  1 101 ? -11.654 -11.472 -50.285  1.00 33.23  ? 102  GLU A C     1 
ATOM   727  O  O     . GLU A  1 101 ? -12.496 -10.569 -50.195  1.00 33.33  ? 102  GLU A O     1 
ATOM   728  C  CB    . GLU A  1 101 ? -9.310  -10.862 -50.876  1.00 29.94  ? 102  GLU A CB    1 
ATOM   729  C  CG    . GLU A  1 101 ? -7.964  -10.351 -50.430  1.00 33.46  ? 102  GLU A CG    1 
ATOM   730  C  CD    . GLU A  1 101 ? -6.959  -11.471 -50.210  1.00 32.26  ? 102  GLU A CD    1 
ATOM   731  O  OE1   . GLU A  1 101 ? -7.353  -12.659 -50.150  1.00 34.48  ? 102  GLU A OE1   1 
ATOM   732  O  OE2   . GLU A  1 101 ? -5.767  -11.155 -50.089  1.00 37.88  ? 102  GLU A OE2   1 
ATOM   733  N  N     . THR A  1 102 ? -11.913 -12.650 -50.862  1.00 29.35  ? 103  THR A N     1 
ATOM   734  C  CA    . THR A  1 102 ? -13.213 -12.954 -51.451  1.00 29.96  ? 103  THR A CA    1 
ATOM   735  C  C     . THR A  1 102 ? -14.330 -12.852 -50.410  1.00 30.72  ? 103  THR A C     1 
ATOM   736  O  O     . THR A  1 102 ? -15.284 -12.081 -50.568  1.00 26.79  ? 103  THR A O     1 
ATOM   737  C  CB    . THR A  1 102 ? -13.164 -14.358 -52.083  1.00 29.64  ? 103  THR A CB    1 
ATOM   738  O  OG1   . THR A  1 102 ? -12.205 -14.381 -53.153  1.00 28.75  ? 103  THR A OG1   1 
ATOM   739  C  CG2   . THR A  1 102 ? -14.533 -14.786 -52.613  1.00 25.56  ? 103  THR A CG2   1 
ATOM   740  N  N     . ILE A  1 103 ? -14.221 -13.617 -49.323  1.00 29.06  ? 104  ILE A N     1 
ATOM   741  C  CA    . ILE A  1 103 ? -15.295 -13.631 -48.334  1.00 28.52  ? 104  ILE A CA    1 
ATOM   742  C  C     . ILE A  1 103 ? -15.382 -12.299 -47.592  1.00 27.67  ? 104  ILE A C     1 
ATOM   743  O  O     . ILE A  1 103 ? -16.480 -11.847 -47.246  1.00 26.57  ? 104  ILE A O     1 
ATOM   744  C  CB    . ILE A  1 103 ? -15.105 -14.823 -47.372  1.00 29.24  ? 104  ILE A CB    1 
ATOM   745  C  CG1   . ILE A  1 103 ? -16.279 -14.936 -46.403  1.00 26.98  ? 104  ILE A CG1   1 
ATOM   746  C  CG2   . ILE A  1 103 ? -13.787 -14.726 -46.617  1.00 27.74  ? 104  ILE A CG2   1 
ATOM   747  C  CD1   . ILE A  1 103 ? -17.615 -15.233 -47.074  1.00 29.59  ? 104  ILE A CD1   1 
ATOM   748  N  N     . CYS A  1 104 ? -14.250 -11.628 -47.367  1.00 25.19  ? 105  CYS A N     1 
ATOM   749  C  CA    . CYS A  1 104 ? -14.288 -10.350 -46.657  1.00 33.53  ? 105  CYS A CA    1 
ATOM   750  C  C     . CYS A  1 104 ? -15.048 -9.298  -47.446  1.00 32.47  ? 105  CYS A C     1 
ATOM   751  O  O     . CYS A  1 104 ? -15.793 -8.503  -46.869  1.00 29.23  ? 105  CYS A O     1 
ATOM   752  C  CB    . CYS A  1 104 ? -12.873 -9.851  -46.359  1.00 30.85  ? 105  CYS A CB    1 
ATOM   753  S  SG    . CYS A  1 104 ? -12.139 -10.692 -44.958  1.00 37.15  ? 105  CYS A SG    1 
ATOM   754  N  N     . LEU A  1 105 ? -14.880 -9.281  -48.766  1.00 33.20  ? 106  LEU A N     1 
ATOM   755  C  CA    . LEU A  1 105 ? -15.595 -8.291  -49.555  1.00 32.57  ? 106  LEU A CA    1 
ATOM   756  C  C     . LEU A  1 105 ? -17.075 -8.635  -49.635  1.00 29.70  ? 106  LEU A C     1 
ATOM   757  O  O     . LEU A  1 105 ? -17.930 -7.740  -49.551  1.00 29.08  ? 106  LEU A O     1 
ATOM   758  C  CB    . LEU A  1 105 ? -14.981 -8.181  -50.946  1.00 28.45  ? 106  LEU A CB    1 
ATOM   759  C  CG    . LEU A  1 105 ? -15.778 -7.285  -51.887  1.00 30.23  ? 106  LEU A CG    1 
ATOM   760  C  CD1   . LEU A  1 105 ? -15.627 -5.868  -51.391  1.00 26.30  ? 106  LEU A CD1   1 
ATOM   761  C  CD2   . LEU A  1 105 ? -15.257 -7.403  -53.320  1.00 26.80  ? 106  LEU A CD2   1 
ATOM   762  N  N     . LEU A  1 106 ? -17.399 -9.931  -49.756  1.00 27.72  ? 107  LEU A N     1 
ATOM   763  C  CA    . LEU A  1 106 ? -18.799 -10.331 -49.794  1.00 23.62  ? 107  LEU A CA    1 
ATOM   764  C  C     . LEU A  1 106 ? -19.477 -10.029 -48.472  1.00 29.85  ? 107  LEU A C     1 
ATOM   765  O  O     . LEU A  1 106 ? -20.607 -9.538  -48.455  1.00 33.50  ? 107  LEU A O     1 
ATOM   766  C  CB    . LEU A  1 106 ? -18.930 -11.816 -50.143  1.00 25.12  ? 107  LEU A CB    1 
ATOM   767  C  CG    . LEU A  1 106 ? -18.314 -12.237 -51.473  1.00 30.05  ? 107  LEU A CG    1 
ATOM   768  C  CD1   . LEU A  1 106 ? -18.259 -13.734 -51.581  1.00 27.06  ? 107  LEU A CD1   1 
ATOM   769  C  CD2   . LEU A  1 106 ? -19.063 -11.621 -52.676  1.00 27.75  ? 107  LEU A CD2   1 
ATOM   770  N  N     . LEU A  1 107 ? -18.795 -10.284 -47.350  1.00 30.75  ? 108  LEU A N     1 
ATOM   771  C  CA    . LEU A  1 107 ? -19.384 -9.979  -46.049  1.00 28.84  ? 108  LEU A CA    1 
ATOM   772  C  C     . LEU A  1 107 ? -19.527 -8.479  -45.859  1.00 32.07  ? 108  LEU A C     1 
ATOM   773  O  O     . LEU A  1 107 ? -20.535 -8.014  -45.314  1.00 33.29  ? 108  LEU A O     1 
ATOM   774  C  CB    . LEU A  1 107 ? -18.544 -10.589 -44.925  1.00 30.44  ? 108  LEU A CB    1 
ATOM   775  C  CG    . LEU A  1 107 ? -18.559 -12.127 -44.781  1.00 30.19  ? 108  LEU A CG    1 
ATOM   776  C  CD1   . LEU A  1 107 ? -17.684 -12.552 -43.607  1.00 26.81  ? 108  LEU A CD1   1 
ATOM   777  C  CD2   . LEU A  1 107 ? -19.979 -12.671 -44.615  1.00 29.93  ? 108  LEU A CD2   1 
ATOM   778  N  N     . ALA A  1 108 ? -18.540 -7.705  -46.331  1.00 25.90  ? 109  ALA A N     1 
ATOM   779  C  CA    . ALA A  1 108 ? -18.637 -6.255  -46.231  1.00 29.44  ? 109  ALA A CA    1 
ATOM   780  C  C     . ALA A  1 108 ? -19.840 -5.732  -47.004  1.00 32.40  ? 109  ALA A C     1 
ATOM   781  O  O     . ALA A  1 108 ? -20.581 -4.879  -46.504  1.00 32.13  ? 109  ALA A O     1 
ATOM   782  C  CB    . ALA A  1 108 ? -17.346 -5.600  -46.726  1.00 26.41  ? 109  ALA A CB    1 
ATOM   783  N  N     . TYR A  1 109 ? -20.063 -6.243  -48.221  1.00 29.72  ? 110  TYR A N     1 
ATOM   784  C  CA    . TYR A  1 109 ? -21.224 -5.820  -49.002  1.00 27.20  ? 110  TYR A CA    1 
ATOM   785  C  C     . TYR A  1 109 ? -22.532 -6.241  -48.337  1.00 31.22  ? 110  TYR A C     1 
ATOM   786  O  O     . TYR A  1 109 ? -23.520 -5.492  -48.362  1.00 28.94  ? 110  TYR A O     1 
ATOM   787  C  CB    . TYR A  1 109 ? -21.132 -6.383  -50.420  1.00 27.89  ? 110  TYR A CB    1 
ATOM   788  C  CG    . TYR A  1 109 ? -20.274 -5.535  -51.331  1.00 32.48  ? 110  TYR A CG    1 
ATOM   789  C  CD1   . TYR A  1 109 ? -20.234 -4.143  -51.190  1.00 35.82  ? 110  TYR A CD1   1 
ATOM   790  C  CD2   . TYR A  1 109 ? -19.514 -6.114  -52.337  1.00 32.06  ? 110  TYR A CD2   1 
ATOM   791  C  CE1   . TYR A  1 109 ? -19.446 -3.348  -52.033  1.00 35.25  ? 110  TYR A CE1   1 
ATOM   792  C  CE2   . TYR A  1 109 ? -18.721 -5.336  -53.177  1.00 31.47  ? 110  TYR A CE2   1 
ATOM   793  C  CZ    . TYR A  1 109 ? -18.697 -3.957  -53.023  1.00 32.70  ? 110  TYR A CZ    1 
ATOM   794  O  OH    . TYR A  1 109 ? -17.912 -3.202  -53.855  1.00 29.09  ? 110  TYR A OH    1 
ATOM   795  N  N     . LYS A  1 110 ? -22.555 -7.436  -47.742  1.00 26.56  ? 111  LYS A N     1 
ATOM   796  C  CA    . LYS A  1 110 ? -23.744 -7.893  -47.039  1.00 30.74  ? 111  LYS A CA    1 
ATOM   797  C  C     . LYS A  1 110 ? -24.103 -6.951  -45.893  1.00 32.05  ? 111  LYS A C     1 
ATOM   798  O  O     . LYS A  1 110 ? -25.278 -6.634  -45.685  1.00 29.63  ? 111  LYS A O     1 
ATOM   799  C  CB    . LYS A  1 110 ? -23.526 -9.314  -46.520  1.00 30.23  ? 111  LYS A CB    1 
ATOM   800  C  CG    . LYS A  1 110 ? -24.716 -9.877  -45.755  1.00 29.29  ? 111  LYS A CG    1 
ATOM   801  C  CD    . LYS A  1 110 ? -25.911 -9.998  -46.673  1.00 29.06  ? 111  LYS A CD    1 
ATOM   802  C  CE    . LYS A  1 110 ? -27.186 -10.332 -45.918  1.00 28.00  ? 111  LYS A CE    1 
ATOM   803  N  NZ    . LYS A  1 110 ? -28.366 -10.339 -46.813  1.00 28.06  ? 111  LYS A NZ    1 
ATOM   804  N  N     . ILE A  1 111 ? -23.105 -6.485  -45.143  1.00 30.00  ? 112  ILE A N     1 
ATOM   805  C  CA    . ILE A  1 111 ? -23.383 -5.551  -44.056  1.00 30.80  ? 112  ILE A CA    1 
ATOM   806  C  C     . ILE A  1 111 ? -23.831 -4.189  -44.595  1.00 34.16  ? 112  ILE A C     1 
ATOM   807  O  O     . ILE A  1 111 ? -24.721 -3.551  -44.020  1.00 41.77  ? 112  ILE A O     1 
ATOM   808  C  CB    . ILE A  1 111 ? -22.153 -5.434  -43.134  1.00 27.85  ? 112  ILE A CB    1 
ATOM   809  C  CG1   . ILE A  1 111 ? -21.746 -6.814  -42.612  1.00 27.79  ? 112  ILE A CG1   1 
ATOM   810  C  CG2   . ILE A  1 111 ? -22.428 -4.488  -41.952  1.00 27.36  ? 112  ILE A CG2   1 
ATOM   811  C  CD1   . ILE A  1 111 ? -20.402 -6.832  -41.914  1.00 27.92  ? 112  ILE A CD1   1 
ATOM   812  N  N     . LYS A  1 112 ? -23.220 -3.716  -45.691  1.00 30.13  ? 113  LYS A N     1 
ATOM   813  C  CA    . LYS A  1 112 ? -23.591 -2.422  -46.276  1.00 28.52  ? 113  LYS A CA    1 
ATOM   814  C  C     . LYS A  1 112 ? -25.014 -2.429  -46.823  1.00 29.49  ? 113  LYS A C     1 
ATOM   815  O  O     . LYS A  1 112 ? -25.759 -1.456  -46.654  1.00 31.48  ? 113  LYS A O     1 
ATOM   816  C  CB    . LYS A  1 112 ? -22.630 -2.054  -47.415  1.00 33.43  ? 113  LYS A CB    1 
ATOM   817  C  CG    . LYS A  1 112 ? -21.227 -1.676  -47.007  1.00 41.75  ? 113  LYS A CG    1 
ATOM   818  C  CD    . LYS A  1 112 ? -21.123 -0.237  -46.594  1.00 38.26  ? 113  LYS A CD    1 
ATOM   819  C  CE    . LYS A  1 112 ? -21.443 0.679   -47.735  1.00 41.78  ? 113  LYS A CE    1 
ATOM   820  N  NZ    . LYS A  1 112 ? -21.372 2.074   -47.252  1.00 43.71  ? 113  LYS A NZ    1 
ATOM   821  N  N     . TYR A  1 113 ? -25.387 -3.496  -47.532  1.00 29.09  ? 114  TYR A N     1 
ATOM   822  C  CA    . TYR A  1 113 ? -26.647 -3.570  -48.271  1.00 27.96  ? 114  TYR A CA    1 
ATOM   823  C  C     . TYR A  1 113 ? -27.357 -4.877  -47.944  1.00 31.95  ? 114  TYR A C     1 
ATOM   824  O  O     . TYR A  1 113 ? -27.564 -5.731  -48.818  1.00 26.79  ? 114  TYR A O     1 
ATOM   825  C  CB    . TYR A  1 113 ? -26.393 -3.431  -49.773  1.00 30.36  ? 114  TYR A CB    1 
ATOM   826  C  CG    . TYR A  1 113 ? -25.428 -2.309  -50.116  1.00 30.27  ? 114  TYR A CG    1 
ATOM   827  C  CD1   . TYR A  1 113 ? -25.823 -0.975  -50.021  1.00 33.43  ? 114  TYR A CD1   1 
ATOM   828  C  CD2   . TYR A  1 113 ? -24.142 -2.579  -50.544  1.00 31.85  ? 114  TYR A CD2   1 
ATOM   829  C  CE1   . TYR A  1 113 ? -24.952 0.071   -50.333  1.00 31.30  ? 114  TYR A CE1   1 
ATOM   830  C  CE2   . TYR A  1 113 ? -23.263 -1.557  -50.861  1.00 34.75  ? 114  TYR A CE2   1 
ATOM   831  C  CZ    . TYR A  1 113 ? -23.677 -0.229  -50.750  1.00 33.37  ? 114  TYR A CZ    1 
ATOM   832  O  OH    . TYR A  1 113 ? -22.797 0.771   -51.066  1.00 33.99  ? 114  TYR A OH    1 
ATOM   833  N  N     . PRO A  1 114 ? -27.772 -5.051  -46.686  1.00 34.06  ? 115  PRO A N     1 
ATOM   834  C  CA    . PRO A  1 114 ? -28.358 -6.336  -46.278  1.00 30.55  ? 115  PRO A CA    1 
ATOM   835  C  C     . PRO A  1 114 ? -29.667 -6.667  -46.971  1.00 35.65  ? 115  PRO A C     1 
ATOM   836  O  O     . PRO A  1 114 ? -30.083 -7.830  -46.911  1.00 37.40  ? 115  PRO A O     1 
ATOM   837  C  CB    . PRO A  1 114 ? -28.566 -6.160  -44.765  1.00 30.17  ? 115  PRO A CB    1 
ATOM   838  C  CG    . PRO A  1 114 ? -28.764 -4.687  -44.591  1.00 36.82  ? 115  PRO A CG    1 
ATOM   839  C  CD    . PRO A  1 114 ? -27.853 -4.036  -45.617  1.00 35.46  ? 115  PRO A CD    1 
ATOM   840  N  N     . GLU A  1 115 ? -30.347 -5.696  -47.591  1.00 33.91  ? 116  GLU A N     1 
ATOM   841  C  CA    . GLU A  1 115 ? -31.602 -5.958  -48.290  1.00 31.47  ? 116  GLU A CA    1 
ATOM   842  C  C     . GLU A  1 115 ? -31.428 -6.060  -49.794  1.00 31.00  ? 116  GLU A C     1 
ATOM   843  O  O     . GLU A  1 115 ? -32.399 -6.342  -50.500  1.00 32.51  ? 116  GLU A O     1 
ATOM   844  C  CB    . GLU A  1 115 ? -32.645 -4.877  -47.990  1.00 30.29  ? 116  GLU A CB    1 
ATOM   845  C  CG    . GLU A  1 115 ? -32.901 -4.636  -46.529  1.00 40.84  ? 116  GLU A CG    1 
ATOM   846  C  CD    . GLU A  1 115 ? -33.435 -5.861  -45.819  1.00 52.83  ? 116  GLU A CD    1 
ATOM   847  O  OE1   . GLU A  1 115 ? -34.121 -6.692  -46.456  1.00 58.59  ? 116  GLU A OE1   1 
ATOM   848  O  OE2   . GLU A  1 115 ? -33.163 -5.993  -44.610  1.00 59.38  ? 116  GLU A OE2   1 
ATOM   849  N  N     . ASN A  1 116 ? -30.222 -5.842  -50.300  1.00 31.69  ? 117  ASN A N     1 
ATOM   850  C  CA    . ASN A  1 116 ? -29.952 -5.905  -51.727  1.00 34.57  ? 117  ASN A CA    1 
ATOM   851  C  C     . ASN A  1 116 ? -28.804 -6.837  -52.069  1.00 33.72  ? 117  ASN A C     1 
ATOM   852  O  O     . ASN A  1 116 ? -28.409 -6.904  -53.237  1.00 38.56  ? 117  ASN A O     1 
ATOM   853  C  CB    . ASN A  1 116 ? -29.638 -4.503  -52.256  1.00 29.77  ? 117  ASN A CB    1 
ATOM   854  C  CG    . ASN A  1 116 ? -30.785 -3.535  -52.041  1.00 37.94  ? 117  ASN A CG    1 
ATOM   855  O  OD1   . ASN A  1 116 ? -31.634 -3.363  -52.923  1.00 39.36  ? 117  ASN A OD1   1 
ATOM   856  N  ND2   . ASN A  1 116 ? -30.871 -2.971  -50.832  1.00 28.77  ? 117  ASN A ND2   1 
ATOM   857  N  N     . PHE A  1 117 ? -28.249 -7.535  -51.089  1.00 28.73  ? 118  PHE A N     1 
ATOM   858  C  CA    . PHE A  1 117 ? -27.072 -8.366  -51.282  1.00 31.32  ? 118  PHE A CA    1 
ATOM   859  C  C     . PHE A  1 117 ? -27.252 -9.627  -50.452  1.00 33.18  ? 118  PHE A C     1 
ATOM   860  O  O     . PHE A  1 117 ? -27.555 -9.543  -49.260  1.00 27.91  ? 118  PHE A O     1 
ATOM   861  C  CB    . PHE A  1 117 ? -25.807 -7.610  -50.869  1.00 30.72  ? 118  PHE A CB    1 
ATOM   862  C  CG    . PHE A  1 117 ? -24.547 -8.199  -51.412  1.00 35.76  ? 118  PHE A CG    1 
ATOM   863  C  CD1   . PHE A  1 117 ? -24.075 -7.822  -52.671  1.00 34.49  ? 118  PHE A CD1   1 
ATOM   864  C  CD2   . PHE A  1 117 ? -23.828 -9.129  -50.667  1.00 27.93  ? 118  PHE A CD2   1 
ATOM   865  C  CE1   . PHE A  1 117 ? -22.923 -8.365  -53.172  1.00 30.59  ? 118  PHE A CE1   1 
ATOM   866  C  CE2   . PHE A  1 117 ? -22.671 -9.678  -51.158  1.00 26.76  ? 118  PHE A CE2   1 
ATOM   867  C  CZ    . PHE A  1 117 ? -22.213 -9.304  -52.414  1.00 30.92  ? 118  PHE A CZ    1 
ATOM   868  N  N     . PHE A  1 118 ? -27.078 -10.791 -51.069  1.00 28.88  ? 119  PHE A N     1 
ATOM   869  C  CA    . PHE A  1 118 ? -27.454 -12.030 -50.409  1.00 31.35  ? 119  PHE A CA    1 
ATOM   870  C  C     . PHE A  1 118 ? -26.446 -13.119 -50.726  1.00 27.81  ? 119  PHE A C     1 
ATOM   871  O  O     . PHE A  1 118 ? -25.999 -13.261 -51.870  1.00 25.09  ? 119  PHE A O     1 
ATOM   872  C  CB    . PHE A  1 118 ? -28.870 -12.454 -50.814  1.00 22.49  ? 119  PHE A CB    1 
ATOM   873  C  CG    . PHE A  1 118 ? -29.930 -11.502 -50.331  1.00 23.03  ? 119  PHE A CG    1 
ATOM   874  C  CD1   . PHE A  1 118 ? -30.420 -11.591 -49.038  1.00 25.66  ? 119  PHE A CD1   1 
ATOM   875  C  CD2   . PHE A  1 118 ? -30.383 -10.474 -51.153  1.00 30.81  ? 119  PHE A CD2   1 
ATOM   876  C  CE1   . PHE A  1 118 ? -31.385 -10.703 -48.579  1.00 33.39  ? 119  PHE A CE1   1 
ATOM   877  C  CE2   . PHE A  1 118 ? -31.338 -9.564  -50.702  1.00 33.37  ? 119  PHE A CE2   1 
ATOM   878  C  CZ    . PHE A  1 118 ? -31.845 -9.679  -49.413  1.00 34.15  ? 119  PHE A CZ    1 
ATOM   879  N  N     . LEU A  1 119 ? -26.075 -13.856 -49.686  1.00 25.77  ? 120  LEU A N     1 
ATOM   880  C  CA    . LEU A  1 119 ? -25.145 -14.970 -49.768  1.00 28.90  ? 120  LEU A CA    1 
ATOM   881  C  C     . LEU A  1 119 ? -25.853 -16.224 -49.295  1.00 30.49  ? 120  LEU A C     1 
ATOM   882  O  O     . LEU A  1 119 ? -26.425 -16.234 -48.203  1.00 29.58  ? 120  LEU A O     1 
ATOM   883  C  CB    . LEU A  1 119 ? -23.905 -14.732 -48.905  1.00 27.47  ? 120  LEU A CB    1 
ATOM   884  C  CG    . LEU A  1 119 ? -23.207 -13.387 -49.096  1.00 30.19  ? 120  LEU A CG    1 
ATOM   885  C  CD1   . LEU A  1 119 ? -22.159 -13.137 -47.995  1.00 29.75  ? 120  LEU A CD1   1 
ATOM   886  C  CD2   . LEU A  1 119 ? -22.592 -13.337 -50.470  1.00 26.46  ? 120  LEU A CD2   1 
ATOM   887  N  N     . LEU A  1 120 ? -25.821 -17.264 -50.119  1.00 32.18  ? 121  LEU A N     1 
ATOM   888  C  CA    . LEU A  1 120 ? -26.264 -18.585 -49.714  1.00 31.49  ? 121  LEU A CA    1 
ATOM   889  C  C     . LEU A  1 120 ? -25.061 -19.416 -49.276  1.00 33.81  ? 121  LEU A C     1 
ATOM   890  O  O     . LEU A  1 120 ? -23.924 -19.178 -49.682  1.00 33.23  ? 121  LEU A O     1 
ATOM   891  C  CB    . LEU A  1 120 ? -26.988 -19.300 -50.854  1.00 27.68  ? 121  LEU A CB    1 
ATOM   892  C  CG    . LEU A  1 120 ? -28.310 -18.751 -51.383  1.00 27.66  ? 121  LEU A CG    1 
ATOM   893  C  CD1   . LEU A  1 120 ? -28.982 -19.863 -52.213  1.00 30.12  ? 121  LEU A CD1   1 
ATOM   894  C  CD2   . LEU A  1 120 ? -29.194 -18.278 -50.244  1.00 23.14  ? 121  LEU A CD2   1 
ATOM   895  N  N     . ARG A  1 121 ? -25.334 -20.396 -48.431  1.00 29.51  ? 122  ARG A N     1 
ATOM   896  C  CA    . ARG A  1 121 ? -24.320 -21.317 -47.955  1.00 27.52  ? 122  ARG A CA    1 
ATOM   897  C  C     . ARG A  1 121 ? -24.049 -22.393 -49.001  1.00 26.67  ? 122  ARG A C     1 
ATOM   898  O  O     . ARG A  1 121 ? -24.978 -23.038 -49.498  1.00 28.47  ? 122  ARG A O     1 
ATOM   899  C  CB    . ARG A  1 121 ? -24.790 -21.964 -46.649  1.00 30.20  ? 122  ARG A CB    1 
ATOM   900  C  CG    . ARG A  1 121 ? -23.771 -22.871 -46.017  1.00 36.97  ? 122  ARG A CG    1 
ATOM   901  C  CD    . ARG A  1 121 ? -24.227 -23.329 -44.638  1.00 37.89  ? 122  ARG A CD    1 
ATOM   902  N  NE    . ARG A  1 121 ? -23.100 -23.849 -43.876  1.00 35.86  ? 122  ARG A NE    1 
ATOM   903  C  CZ    . ARG A  1 121 ? -23.170 -24.214 -42.603  1.00 35.61  ? 122  ARG A CZ    1 
ATOM   904  N  NH1   . ARG A  1 121 ? -24.323 -24.121 -41.954  1.00 30.57  ? 122  ARG A NH1   1 
ATOM   905  N  NH2   . ARG A  1 121 ? -22.084 -24.660 -41.988  1.00 32.56  ? 122  ARG A NH2   1 
ATOM   906  N  N     . GLY A  1 122 ? -22.778 -22.588 -49.329  1.00 27.05  ? 123  GLY A N     1 
ATOM   907  C  CA    . GLY A  1 122 ? -22.354 -23.721 -50.117  1.00 30.25  ? 123  GLY A CA    1 
ATOM   908  C  C     . GLY A  1 122 ? -21.703 -24.780 -49.240  1.00 30.51  ? 123  GLY A C     1 
ATOM   909  O  O     . GLY A  1 122 ? -21.412 -24.557 -48.070  1.00 26.90  ? 123  GLY A O     1 
ATOM   910  N  N     . ASN A  1 123 ? -21.445 -25.950 -49.837  1.00 30.51  ? 124  ASN A N     1 
ATOM   911  C  CA    . ASN A  1 123 ? -20.881 -27.034 -49.034  1.00 27.70  ? 124  ASN A CA    1 
ATOM   912  C  C     . ASN A  1 123 ? -19.477 -26.723 -48.531  1.00 30.52  ? 124  ASN A C     1 
ATOM   913  O  O     . ASN A  1 123 ? -18.995 -27.410 -47.623  1.00 30.15  ? 124  ASN A O     1 
ATOM   914  C  CB    . ASN A  1 123 ? -20.892 -28.364 -49.813  1.00 28.60  ? 124  ASN A CB    1 
ATOM   915  C  CG    . ASN A  1 123 ? -20.073 -28.316 -51.077  1.00 31.00  ? 124  ASN A CG    1 
ATOM   916  O  OD1   . ASN A  1 123 ? -20.173 -27.372 -51.865  1.00 32.40  ? 124  ASN A OD1   1 
ATOM   917  N  ND2   . ASN A  1 123 ? -19.255 -29.339 -51.288  1.00 30.34  ? 124  ASN A ND2   1 
ATOM   918  N  N     . HIS A  1 124 ? -18.815 -25.703 -49.065  1.00 26.99  ? 125  HIS A N     1 
ATOM   919  C  CA    . HIS A  1 124 ? -17.512 -25.335 -48.537  1.00 26.06  ? 125  HIS A CA    1 
ATOM   920  C  C     . HIS A  1 124 ? -17.609 -24.339 -47.401  1.00 28.27  ? 125  HIS A C     1 
ATOM   921  O  O     . HIS A  1 124 ? -16.599 -24.082 -46.741  1.00 31.08  ? 125  HIS A O     1 
ATOM   922  C  CB    . HIS A  1 124 ? -16.618 -24.795 -49.656  1.00 24.55  ? 125  HIS A CB    1 
ATOM   923  C  CG    . HIS A  1 124 ? -15.998 -25.881 -50.467  1.00 36.56  ? 125  HIS A CG    1 
ATOM   924  N  ND1   . HIS A  1 124 ? -14.677 -26.252 -50.335  1.00 36.08  ? 125  HIS A ND1   1 
ATOM   925  C  CD2   . HIS A  1 124 ? -16.542 -26.738 -51.363  1.00 37.26  ? 125  HIS A CD2   1 
ATOM   926  C  CE1   . HIS A  1 124 ? -14.426 -27.269 -51.142  1.00 39.27  ? 125  HIS A CE1   1 
ATOM   927  N  NE2   . HIS A  1 124 ? -15.541 -27.585 -51.774  1.00 34.13  ? 125  HIS A NE2   1 
ATOM   928  N  N     . GLU A  1 125 ? -18.794 -23.779 -47.147  1.00 29.26  ? 126  GLU A N     1 
ATOM   929  C  CA    . GLU A  1 125 ? -18.993 -22.946 -45.963  1.00 32.36  ? 126  GLU A CA    1 
ATOM   930  C  C     . GLU A  1 125 ? -19.301 -23.856 -44.775  1.00 32.70  ? 126  GLU A C     1 
ATOM   931  O  O     . GLU A  1 125 ? -20.374 -23.817 -44.175  1.00 28.28  ? 126  GLU A O     1 
ATOM   932  C  CB    . GLU A  1 125 ? -20.088 -21.907 -46.189  1.00 26.34  ? 126  GLU A CB    1 
ATOM   933  C  CG    . GLU A  1 125 ? -19.612 -20.720 -47.019  1.00 26.66  ? 126  GLU A CG    1 
ATOM   934  C  CD    . GLU A  1 125 ? -19.320 -21.097 -48.460  1.00 31.75  ? 126  GLU A CD    1 
ATOM   935  O  OE1   . GLU A  1 125 ? -20.236 -21.621 -49.132  1.00 35.14  ? 126  GLU A OE1   1 
ATOM   936  O  OE2   . GLU A  1 125 ? -18.175 -20.891 -48.922  1.00 37.48  ? 126  GLU A OE2   1 
ATOM   937  N  N     . CYS A  1 126 ? -18.306 -24.680 -44.447  1.00 34.11  ? 127  CYS A N     1 
ATOM   938  C  CA    . CYS A  1 126 ? -18.461 -25.806 -43.534  1.00 36.69  ? 127  CYS A CA    1 
ATOM   939  C  C     . CYS A  1 126 ? -17.089 -26.138 -42.960  1.00 33.95  ? 127  CYS A C     1 
ATOM   940  O  O     . CYS A  1 126 ? -16.133 -26.315 -43.719  1.00 32.54  ? 127  CYS A O     1 
ATOM   941  C  CB    . CYS A  1 126 ? -19.061 -27.005 -44.275  1.00 40.92  ? 127  CYS A CB    1 
ATOM   942  S  SG    . CYS A  1 126 ? -18.863 -28.635 -43.495  1.00 40.56  ? 127  CYS A SG    1 
ATOM   943  N  N     . ALA A  1 127 ? -16.986 -26.199 -41.626  1.00 32.11  ? 128  ALA A N     1 
ATOM   944  C  CA    . ALA A  1 127 ? -15.677 -26.362 -40.994  1.00 33.43  ? 128  ALA A CA    1 
ATOM   945  C  C     . ALA A  1 127 ? -15.068 -27.732 -41.259  1.00 37.10  ? 128  ALA A C     1 
ATOM   946  O  O     . ALA A  1 127 ? -13.849 -27.882 -41.144  1.00 41.63  ? 128  ALA A O     1 
ATOM   947  C  CB    . ALA A  1 127 ? -15.765 -26.134 -39.480  1.00 36.41  ? 128  ALA A CB    1 
ATOM   948  N  N     . SER A  1 128 ? -15.884 -28.734 -41.593  1.00 34.62  ? 129  SER A N     1 
ATOM   949  C  CA    . SER A  1 128 ? -15.338 -30.035 -41.959  1.00 41.17  ? 129  SER A CA    1 
ATOM   950  C  C     . SER A  1 128 ? -14.718 -30.011 -43.343  1.00 43.33  ? 129  SER A C     1 
ATOM   951  O  O     . SER A  1 128 ? -13.707 -30.678 -43.574  1.00 47.82  ? 129  SER A O     1 
ATOM   952  C  CB    . SER A  1 128 ? -16.425 -31.113 -41.915  1.00 42.33  ? 129  SER A CB    1 
ATOM   953  O  OG    . SER A  1 128 ? -17.079 -31.122 -40.663  1.00 49.78  ? 129  SER A OG    1 
ATOM   954  N  N     . ILE A  1 129 ? -15.300 -29.260 -44.271  1.00 41.13  ? 130  ILE A N     1 
ATOM   955  C  CA    . ILE A  1 129 ? -14.788 -29.242 -45.636  1.00 39.01  ? 130  ILE A CA    1 
ATOM   956  C  C     . ILE A  1 129 ? -13.652 -28.242 -45.786  1.00 37.27  ? 130  ILE A C     1 
ATOM   957  O  O     . ILE A  1 129 ? -12.593 -28.571 -46.332  1.00 38.97  ? 130  ILE A O     1 
ATOM   958  C  CB    . ILE A  1 129 ? -15.926 -28.955 -46.636  1.00 33.66  ? 130  ILE A CB    1 
ATOM   959  C  CG1   . ILE A  1 129 ? -16.878 -30.149 -46.693  1.00 33.61  ? 130  ILE A CG1   1 
ATOM   960  C  CG2   . ILE A  1 129 ? -15.351 -28.625 -48.015  1.00 26.64  ? 130  ILE A CG2   1 
ATOM   961  C  CD1   . ILE A  1 129 ? -16.169 -31.457 -46.970  1.00 35.75  ? 130  ILE A CD1   1 
ATOM   962  N  N     . ASN A  1 130 ? -13.841 -27.010 -45.308  1.00 30.47  ? 131  ASN A N     1 
ATOM   963  C  CA    . ASN A  1 130 ? -12.764 -26.040 -45.476  1.00 34.40  ? 131  ASN A CA    1 
ATOM   964  C  C     . ASN A  1 130 ? -11.659 -26.227 -44.444  1.00 35.15  ? 131  ASN A C     1 
ATOM   965  O  O     . ASN A  1 130 ? -10.684 -25.481 -44.470  1.00 34.04  ? 131  ASN A O     1 
ATOM   966  C  CB    . ASN A  1 130 ? -13.307 -24.591 -45.497  1.00 32.45  ? 131  ASN A CB    1 
ATOM   967  C  CG    . ASN A  1 130 ? -13.809 -24.097 -44.151  1.00 36.81  ? 131  ASN A CG    1 
ATOM   968  O  OD1   . ASN A  1 130 ? -13.130 -24.219 -43.128  1.00 39.83  ? 131  ASN A OD1   1 
ATOM   969  N  ND2   . ASN A  1 130 ? -14.986 -23.467 -44.160  1.00 33.65  ? 131  ASN A ND2   1 
ATOM   970  N  N     . ARG A  1 131 ? -11.763 -27.239 -43.570  1.00 36.83  ? 132  ARG A N     1 
ATOM   971  C  CA    . ARG A  1 131 ? -10.590 -27.648 -42.801  1.00 39.34  ? 132  ARG A CA    1 
ATOM   972  C  C     . ARG A  1 131 ? -9.504  -28.216 -43.706  1.00 40.33  ? 132  ARG A C     1 
ATOM   973  O  O     . ARG A  1 131 ? -8.312  -28.055 -43.426  1.00 43.30  ? 132  ARG A O     1 
ATOM   974  C  CB    . ARG A  1 131 ? -10.977 -28.683 -41.737  1.00 38.38  ? 132  ARG A CB    1 
ATOM   975  C  CG    . ARG A  1 131 ? -9.808  -29.393 -41.056  1.00 38.04  ? 132  ARG A CG    1 
ATOM   976  C  CD    . ARG A  1 131 ? -8.934  -28.426 -40.282  1.00 39.30  ? 132  ARG A CD    1 
ATOM   977  N  NE    . ARG A  1 131 ? -7.780  -29.106 -39.698  1.00 46.00  ? 132  ARG A NE    1 
ATOM   978  C  CZ    . ARG A  1 131 ? -6.645  -29.356 -40.348  1.00 49.16  ? 132  ARG A CZ    1 
ATOM   979  N  NH1   . ARG A  1 131 ? -6.497  -28.979 -41.611  1.00 48.99  ? 132  ARG A NH1   1 
ATOM   980  N  NH2   . ARG A  1 131 ? -5.653  -29.982 -39.736  1.00 48.51  ? 132  ARG A NH2   1 
ATOM   981  N  N     . ILE A  1 132 ? -9.882  -28.876 -44.795  1.00 44.72  ? 133  ILE A N     1 
ATOM   982  C  CA    . ILE A  1 132 ? -8.924  -29.642 -45.582  1.00 45.68  ? 133  ILE A CA    1 
ATOM   983  C  C     . ILE A  1 132 ? -8.739  -29.114 -46.992  1.00 44.54  ? 133  ILE A C     1 
ATOM   984  O  O     . ILE A  1 132 ? -7.759  -29.497 -47.650  1.00 45.87  ? 133  ILE A O     1 
ATOM   985  C  CB    . ILE A  1 132 ? -9.314  -31.131 -45.625  1.00 50.91  ? 133  ILE A CB    1 
ATOM   986  C  CG1   . ILE A  1 132 ? -10.661 -31.301 -46.313  1.00 54.23  ? 133  ILE A CG1   1 
ATOM   987  C  CG2   . ILE A  1 132 ? -9.381  -31.695 -44.208  1.00 55.92  ? 133  ILE A CG2   1 
ATOM   988  C  CD1   . ILE A  1 132 ? -11.157 -32.742 -46.326  1.00 61.74  ? 133  ILE A CD1   1 
ATOM   989  N  N     . TYR A  1 133 ? -9.625  -28.253 -47.493  1.00 38.71  ? 134  TYR A N     1 
ATOM   990  C  CA    . TYR A  1 133 ? -9.548  -27.828 -48.883  1.00 38.06  ? 134  TYR A CA    1 
ATOM   991  C  C     . TYR A  1 133 ? -8.978  -26.419 -49.052  1.00 37.30  ? 134  TYR A C     1 
ATOM   992  O  O     . TYR A  1 133 ? -9.091  -25.845 -50.138  1.00 39.53  ? 134  TYR A O     1 
ATOM   993  C  CB    . TYR A  1 133 ? -10.923 -27.955 -49.542  1.00 36.09  ? 134  TYR A CB    1 
ATOM   994  C  CG    . TYR A  1 133 ? -11.270 -29.393 -49.872  1.00 41.34  ? 134  TYR A CG    1 
ATOM   995  C  CD1   . TYR A  1 133 ? -10.677 -30.043 -50.948  1.00 48.19  ? 134  TYR A CD1   1 
ATOM   996  C  CD2   . TYR A  1 133 ? -12.179 -30.108 -49.097  1.00 43.23  ? 134  TYR A CD2   1 
ATOM   997  C  CE1   . TYR A  1 133 ? -10.979 -31.363 -51.247  1.00 51.26  ? 134  TYR A CE1   1 
ATOM   998  C  CE2   . TYR A  1 133 ? -12.485 -31.427 -49.384  1.00 54.44  ? 134  TYR A CE2   1 
ATOM   999  C  CZ    . TYR A  1 133 ? -11.879 -32.052 -50.461  1.00 56.79  ? 134  TYR A CZ    1 
ATOM   1000 O  OH    . TYR A  1 133 ? -12.190 -33.361 -50.746  1.00 58.70  ? 134  TYR A OH    1 
ATOM   1001 N  N     . GLY A  1 134 ? -8.356  -25.855 -48.018  1.00 37.89  ? 135  GLY A N     1 
ATOM   1002 C  CA    . GLY A  1 134 ? -7.592  -24.636 -48.211  1.00 37.83  ? 135  GLY A CA    1 
ATOM   1003 C  C     . GLY A  1 134 ? -7.855  -23.515 -47.223  1.00 41.08  ? 135  GLY A C     1 
ATOM   1004 O  O     . GLY A  1 134 ? -6.902  -22.862 -46.785  1.00 43.70  ? 135  GLY A O     1 
ATOM   1005 N  N     . PHE A  1 135 ? -9.120  -23.281 -46.844  1.00 33.48  ? 136  PHE A N     1 
ATOM   1006 C  CA    . PHE A  1 135 ? -9.420  -22.077 -46.068  1.00 37.88  ? 136  PHE A CA    1 
ATOM   1007 C  C     . PHE A  1 135 ? -8.800  -22.130 -44.681  1.00 38.61  ? 136  PHE A C     1 
ATOM   1008 O  O     . PHE A  1 135 ? -8.325  -21.108 -44.173  1.00 37.70  ? 136  PHE A O     1 
ATOM   1009 C  CB    . PHE A  1 135 ? -10.925 -21.852 -45.955  1.00 36.06  ? 136  PHE A CB    1 
ATOM   1010 C  CG    . PHE A  1 135 ? -11.295 -20.505 -45.375  1.00 36.19  ? 136  PHE A CG    1 
ATOM   1011 C  CD1   . PHE A  1 135 ? -10.830 -19.337 -45.962  1.00 34.48  ? 136  PHE A CD1   1 
ATOM   1012 C  CD2   . PHE A  1 135 ? -12.115 -20.406 -44.252  1.00 34.81  ? 136  PHE A CD2   1 
ATOM   1013 C  CE1   . PHE A  1 135 ? -11.178 -18.091 -45.448  1.00 30.78  ? 136  PHE A CE1   1 
ATOM   1014 C  CE2   . PHE A  1 135 ? -12.466 -19.162 -43.728  1.00 34.51  ? 136  PHE A CE2   1 
ATOM   1015 C  CZ    . PHE A  1 135 ? -11.987 -18.000 -44.331  1.00 33.42  ? 136  PHE A CZ    1 
ATOM   1016 N  N     . TYR A  1 136 ? -8.803  -23.306 -44.050  1.00 41.96  ? 137  TYR A N     1 
ATOM   1017 C  CA    . TYR A  1 136 ? -8.148  -23.440 -42.757  1.00 39.13  ? 137  TYR A CA    1 
ATOM   1018 C  C     . TYR A  1 136 ? -6.674  -23.089 -42.866  1.00 42.94  ? 137  TYR A C     1 
ATOM   1019 O  O     . TYR A  1 136 ? -6.142  -22.336 -42.041  1.00 42.91  ? 137  TYR A O     1 
ATOM   1020 C  CB    . TYR A  1 136 ? -8.325  -24.860 -42.223  1.00 44.03  ? 137  TYR A CB    1 
ATOM   1021 C  CG    . TYR A  1 136 ? -7.434  -25.192 -41.046  1.00 48.40  ? 137  TYR A CG    1 
ATOM   1022 C  CD1   . TYR A  1 136 ? -6.149  -25.682 -41.241  1.00 47.63  ? 137  TYR A CD1   1 
ATOM   1023 C  CD2   . TYR A  1 136 ? -7.883  -25.039 -39.743  1.00 52.00  ? 137  TYR A CD2   1 
ATOM   1024 C  CE1   . TYR A  1 136 ? -5.337  -25.998 -40.183  1.00 47.61  ? 137  TYR A CE1   1 
ATOM   1025 C  CE2   . TYR A  1 136 ? -7.072  -25.365 -38.673  1.00 52.53  ? 137  TYR A CE2   1 
ATOM   1026 C  CZ    . TYR A  1 136 ? -5.800  -25.839 -38.906  1.00 50.24  ? 137  TYR A CZ    1 
ATOM   1027 O  OH    . TYR A  1 136 ? -4.971  -26.159 -37.863  1.00 54.82  ? 137  TYR A OH    1 
ATOM   1028 N  N     . ASP A  1 137 ? -6.004  -23.617 -43.894  1.00 43.28  ? 138  ASP A N     1 
ATOM   1029 C  CA    . ASP A  1 137 ? -4.594  -23.309 -44.103  1.00 44.52  ? 138  ASP A CA    1 
ATOM   1030 C  C     . ASP A  1 137 ? -4.383  -21.819 -44.345  1.00 43.36  ? 138  ASP A C     1 
ATOM   1031 O  O     . ASP A  1 137 ? -3.459  -21.216 -43.782  1.00 44.70  ? 138  ASP A O     1 
ATOM   1032 C  CB    . ASP A  1 137 ? -4.056  -24.136 -45.272  1.00 49.80  ? 138  ASP A CB    1 
ATOM   1033 C  CG    . ASP A  1 137 ? -3.925  -25.618 -44.927  1.00 54.73  ? 138  ASP A CG    1 
ATOM   1034 O  OD1   . ASP A  1 137 ? -3.520  -25.932 -43.787  1.00 54.26  ? 138  ASP A OD1   1 
ATOM   1035 O  OD2   . ASP A  1 137 ? -4.233  -26.466 -45.793  1.00 55.56  ? 138  ASP A OD2   1 
ATOM   1036 N  N     . GLU A  1 138 ? -5.231  -21.202 -45.175  1.00 41.17  ? 139  GLU A N     1 
ATOM   1037 C  CA    . GLU A  1 138 ? -5.071  -19.778 -45.451  1.00 40.02  ? 139  GLU A CA    1 
ATOM   1038 C  C     . GLU A  1 138 ? -5.214  -18.967 -44.167  1.00 40.39  ? 139  GLU A C     1 
ATOM   1039 O  O     . GLU A  1 138 ? -4.358  -18.132 -43.855  1.00 45.19  ? 139  GLU A O     1 
ATOM   1040 C  CB    . GLU A  1 138 ? -6.078  -19.321 -46.516  1.00 42.94  ? 139  GLU A CB    1 
ATOM   1041 C  CG    . GLU A  1 138 ? -5.729  -17.978 -47.173  1.00 45.04  ? 139  GLU A CG    1 
ATOM   1042 C  CD    . GLU A  1 138 ? -6.629  -17.591 -48.362  1.00 50.10  ? 139  GLU A CD    1 
ATOM   1043 O  OE1   . GLU A  1 138 ? -7.009  -18.463 -49.182  1.00 50.98  ? 139  GLU A OE1   1 
ATOM   1044 O  OE2   . GLU A  1 138 ? -6.972  -16.388 -48.461  1.00 49.19  ? 139  GLU A OE2   1 
ATOM   1045 N  N     . CYS A  1 139 ? -6.259  -19.242 -43.381  1.00 38.25  ? 140  CYS A N     1 
ATOM   1046 C  CA    . CYS A  1 139 ? -6.424  -18.551 -42.107  1.00 39.56  ? 140  CYS A CA    1 
ATOM   1047 C  C     . CYS A  1 139 ? -5.205  -18.734 -41.210  1.00 44.46  ? 140  CYS A C     1 
ATOM   1048 O  O     . CYS A  1 139 ? -4.667  -17.760 -40.670  1.00 43.65  ? 140  CYS A O     1 
ATOM   1049 C  CB    . CYS A  1 139 ? -7.689  -19.039 -41.405  1.00 38.20  ? 140  CYS A CB    1 
ATOM   1050 S  SG    . CYS A  1 139 ? -9.213  -18.447 -42.182  1.00 41.39  ? 140  CYS A SG    1 
ATOM   1051 N  N     . LYS A  1 140 ? -4.748  -19.978 -41.044  1.00 46.64  ? 141  LYS A N     1 
ATOM   1052 C  CA    . LYS A  1 140 ? -3.597  -20.235 -40.183  1.00 47.86  ? 141  LYS A CA    1 
ATOM   1053 C  C     . LYS A  1 140 ? -2.356  -19.488 -40.668  1.00 52.61  ? 141  LYS A C     1 
ATOM   1054 O  O     . LYS A  1 140 ? -1.602  -18.929 -39.861  1.00 53.56  ? 141  LYS A O     1 
ATOM   1055 C  CB    . LYS A  1 140 ? -3.328  -21.738 -40.114  1.00 47.73  ? 141  LYS A CB    1 
ATOM   1056 C  CG    . LYS A  1 140 ? -2.285  -22.150 -39.095  1.00 52.15  ? 141  LYS A CG    1 
ATOM   1057 C  CD    . LYS A  1 140 ? -2.203  -23.667 -38.981  1.00 59.56  ? 141  LYS A CD    1 
ATOM   1058 C  CE    . LYS A  1 140 ? -1.528  -24.102 -37.687  1.00 65.87  ? 141  LYS A CE    1 
ATOM   1059 N  NZ    . LYS A  1 140 ? -0.090  -23.720 -37.647  1.00 70.18  ? 141  LYS A NZ    1 
ATOM   1060 N  N     . ARG A  1 141 ? -2.139  -19.457 -41.985  1.00 51.21  ? 142  ARG A N     1 
ATOM   1061 C  CA    . ARG A  1 141 ? -0.924  -18.870 -42.539  1.00 51.28  ? 142  ARG A CA    1 
ATOM   1062 C  C     . ARG A  1 141 ? -0.911  -17.352 -42.374  1.00 54.30  ? 142  ARG A C     1 
ATOM   1063 O  O     . ARG A  1 141 ? 0.070   -16.780 -41.888  1.00 54.79  ? 142  ARG A O     1 
ATOM   1064 C  CB    . ARG A  1 141 ? -0.798  -19.253 -44.013  1.00 54.18  ? 142  ARG A CB    1 
ATOM   1065 C  CG    . ARG A  1 141 ? 0.478   -18.795 -44.694  1.00 65.63  ? 142  ARG A CG    1 
ATOM   1066 C  CD    . ARG A  1 141 ? 0.410   -19.027 -46.199  1.00 71.82  ? 142  ARG A CD    1 
ATOM   1067 N  NE    . ARG A  1 141 ? -0.121  -20.349 -46.525  1.00 82.17  ? 142  ARG A NE    1 
ATOM   1068 C  CZ    . ARG A  1 141 ? -1.325  -20.572 -47.051  1.00 86.98  ? 142  ARG A CZ    1 
ATOM   1069 N  NH1   . ARG A  1 141 ? -1.724  -21.814 -47.307  1.00 85.66  ? 142  ARG A NH1   1 
ATOM   1070 N  NH2   . ARG A  1 141 ? -2.130  -19.553 -47.322  1.00 87.71  ? 142  ARG A NH2   1 
ATOM   1071 N  N     . ARG A  1 142 ? -1.995  -16.686 -42.770  1.00 54.64  ? 143  ARG A N     1 
ATOM   1072 C  CA    . ARG A  1 142 ? -2.070  -15.229 -42.759  1.00 47.45  ? 143  ARG A CA    1 
ATOM   1073 C  C     . ARG A  1 142 ? -2.548  -14.653 -41.431  1.00 44.93  ? 143  ARG A C     1 
ATOM   1074 O  O     . ARG A  1 142 ? -2.273  -13.477 -41.148  1.00 43.37  ? 143  ARG A O     1 
ATOM   1075 C  CB    . ARG A  1 142 ? -2.988  -14.748 -43.889  1.00 41.92  ? 143  ARG A CB    1 
ATOM   1076 C  CG    . ARG A  1 142 ? -2.573  -15.260 -45.268  1.00 48.38  ? 143  ARG A CG    1 
ATOM   1077 C  CD    . ARG A  1 142 ? -3.580  -14.890 -46.362  1.00 56.29  ? 143  ARG A CD    1 
ATOM   1078 N  NE    . ARG A  1 142 ? -3.628  -13.448 -46.621  1.00 60.85  ? 143  ARG A NE    1 
ATOM   1079 C  CZ    . ARG A  1 142 ? -4.319  -12.883 -47.609  1.00 58.82  ? 143  ARG A CZ    1 
ATOM   1080 N  NH1   . ARG A  1 142 ? -5.029  -13.635 -48.447  1.00 48.64  ? 143  ARG A NH1   1 
ATOM   1081 N  NH2   . ARG A  1 142 ? -4.299  -11.560 -47.754  1.00 62.26  ? 143  ARG A NH2   1 
ATOM   1082 N  N     . TYR A  1 143 ? -3.265  -15.433 -40.620  1.00 44.95  ? 144  TYR A N     1 
ATOM   1083 C  CA    . TYR A  1 143 ? -3.684  -14.969 -39.303  1.00 43.82  ? 144  TYR A CA    1 
ATOM   1084 C  C     . TYR A  1 143 ? -3.509  -16.071 -38.264  1.00 52.06  ? 144  TYR A C     1 
ATOM   1085 O  O     . TYR A  1 143 ? -2.378  -16.407 -37.901  1.00 55.14  ? 144  TYR A O     1 
ATOM   1086 C  CB    . TYR A  1 143 ? -5.131  -14.471 -39.351  1.00 42.98  ? 144  TYR A CB    1 
ATOM   1087 C  CG    . TYR A  1 143 ? -5.285  -13.252 -40.234  1.00 48.56  ? 144  TYR A CG    1 
ATOM   1088 C  CD1   . TYR A  1 143 ? -5.039  -11.971 -39.738  1.00 47.75  ? 144  TYR A CD1   1 
ATOM   1089 C  CD2   . TYR A  1 143 ? -5.647  -13.379 -41.569  1.00 47.49  ? 144  TYR A CD2   1 
ATOM   1090 C  CE1   . TYR A  1 143 ? -5.161  -10.859 -40.540  1.00 45.18  ? 144  TYR A CE1   1 
ATOM   1091 C  CE2   . TYR A  1 143 ? -5.761  -12.266 -42.381  1.00 47.53  ? 144  TYR A CE2   1 
ATOM   1092 C  CZ    . TYR A  1 143 ? -5.523  -11.012 -41.860  1.00 46.72  ? 144  TYR A CZ    1 
ATOM   1093 O  OH    . TYR A  1 143 ? -5.655  -9.906  -42.673  1.00 49.48  ? 144  TYR A OH    1 
ATOM   1094 N  N     . ASN A  1 144 ? -4.605  -16.652 -37.783  1.00 50.55  ? 145  ASN A N     1 
ATOM   1095 C  CA    . ASN A  1 144 ? -4.500  -17.698 -36.784  1.00 47.83  ? 145  ASN A CA    1 
ATOM   1096 C  C     . ASN A  1 144 ? -5.730  -18.596 -36.853  1.00 47.56  ? 145  ASN A C     1 
ATOM   1097 O  O     . ASN A  1 144 ? -6.653  -18.375 -37.644  1.00 44.36  ? 145  ASN A O     1 
ATOM   1098 C  CB    . ASN A  1 144 ? -4.305  -17.098 -35.384  1.00 46.36  ? 145  ASN A CB    1 
ATOM   1099 C  CG    . ASN A  1 144 ? -5.337  -16.038 -35.047  1.00 46.80  ? 145  ASN A CG    1 
ATOM   1100 O  OD1   . ASN A  1 144 ? -6.535  -16.222 -35.270  1.00 47.49  ? 145  ASN A OD1   1 
ATOM   1101 N  ND2   . ASN A  1 144 ? -4.876  -14.916 -34.515  1.00 48.16  ? 145  ASN A ND2   1 
ATOM   1102 N  N     . ILE A  1 145 ? -5.722  -19.627 -36.005  1.00 47.15  ? 146  ILE A N     1 
ATOM   1103 C  CA    . ILE A  1 145 ? -6.808  -20.600 -35.984  1.00 48.20  ? 146  ILE A CA    1 
ATOM   1104 C  C     . ILE A  1 145 ? -8.069  -19.975 -35.422  1.00 45.04  ? 146  ILE A C     1 
ATOM   1105 O  O     . ILE A  1 145 ? -9.180  -20.284 -35.864  1.00 47.76  ? 146  ILE A O     1 
ATOM   1106 C  CB    . ILE A  1 145 ? -6.393  -21.840 -35.173  1.00 52.32  ? 146  ILE A CB    1 
ATOM   1107 C  CG1   . ILE A  1 145 ? -5.155  -22.479 -35.797  1.00 63.31  ? 146  ILE A CG1   1 
ATOM   1108 C  CG2   . ILE A  1 145 ? -7.532  -22.836 -35.100  1.00 46.86  ? 146  ILE A CG2   1 
ATOM   1109 C  CD1   . ILE A  1 145 ? -5.303  -22.727 -37.270  1.00 65.78  ? 146  ILE A CD1   1 
ATOM   1110 N  N     . LYS A  1 146 ? -7.923  -19.098 -34.431  1.00 42.57  ? 147  LYS A N     1 
ATOM   1111 C  CA    . LYS A  1 146 ? -9.099  -18.543 -33.776  1.00 48.95  ? 147  LYS A CA    1 
ATOM   1112 C  C     . LYS A  1 146 ? -9.962  -17.769 -34.764  1.00 48.00  ? 147  LYS A C     1 
ATOM   1113 O  O     . LYS A  1 146 ? -11.196 -17.795 -34.671  1.00 47.41  ? 147  LYS A O     1 
ATOM   1114 C  CB    . LYS A  1 146 ? -8.669  -17.662 -32.609  1.00 57.38  ? 147  LYS A CB    1 
ATOM   1115 C  CG    . LYS A  1 146 ? -9.736  -16.713 -32.112  1.00 66.03  ? 147  LYS A CG    1 
ATOM   1116 C  CD    . LYS A  1 146 ? -9.315  -16.064 -30.811  1.00 71.33  ? 147  LYS A CD    1 
ATOM   1117 C  CE    . LYS A  1 146 ? -7.990  -15.351 -30.951  1.00 72.06  ? 147  LYS A CE    1 
ATOM   1118 N  NZ    . LYS A  1 146 ? -7.884  -14.250 -29.969  1.00 76.66  ? 147  LYS A NZ    1 
ATOM   1119 N  N     . LEU A  1 147 ? -9.330  -17.091 -35.730  1.00 46.21  ? 148  LEU A N     1 
ATOM   1120 C  CA    . LEU A  1 147 ? -10.084 -16.396 -36.768  1.00 43.40  ? 148  LEU A CA    1 
ATOM   1121 C  C     . LEU A  1 147 ? -10.862 -17.381 -37.631  1.00 42.98  ? 148  LEU A C     1 
ATOM   1122 O  O     . LEU A  1 147 ? -12.012 -17.114 -38.002  1.00 41.67  ? 148  LEU A O     1 
ATOM   1123 C  CB    . LEU A  1 147 ? -9.141  -15.554 -37.631  1.00 42.48  ? 148  LEU A CB    1 
ATOM   1124 C  CG    . LEU A  1 147 ? -9.794  -14.546 -38.580  1.00 40.67  ? 148  LEU A CG    1 
ATOM   1125 C  CD1   . LEU A  1 147 ? -10.627 -13.543 -37.782  1.00 37.28  ? 148  LEU A CD1   1 
ATOM   1126 C  CD2   . LEU A  1 147 ? -8.740  -13.817 -39.436  1.00 36.26  ? 148  LEU A CD2   1 
ATOM   1127 N  N     . TRP A  1 148 ? -10.248 -18.525 -37.957  1.00 38.80  ? 149  TRP A N     1 
ATOM   1128 C  CA    . TRP A  1 148 ? -10.943 -19.560 -38.714  1.00 40.46  ? 149  TRP A CA    1 
ATOM   1129 C  C     . TRP A  1 148 ? -12.177 -20.046 -37.964  1.00 39.60  ? 149  TRP A C     1 
ATOM   1130 O  O     . TRP A  1 148 ? -13.208 -20.341 -38.576  1.00 41.35  ? 149  TRP A O     1 
ATOM   1131 C  CB    . TRP A  1 148 ? -9.988  -20.719 -39.005  1.00 38.43  ? 149  TRP A CB    1 
ATOM   1132 C  CG    . TRP A  1 148 ? -10.618 -21.889 -39.699  1.00 39.96  ? 149  TRP A CG    1 
ATOM   1133 C  CD1   . TRP A  1 148 ? -10.979 -21.959 -41.010  1.00 40.22  ? 149  TRP A CD1   1 
ATOM   1134 C  CD2   . TRP A  1 148 ? -10.932 -23.172 -39.129  1.00 38.02  ? 149  TRP A CD2   1 
ATOM   1135 N  NE1   . TRP A  1 148 ? -11.508 -23.193 -41.292  1.00 36.25  ? 149  TRP A NE1   1 
ATOM   1136 C  CE2   . TRP A  1 148 ? -11.485 -23.959 -40.155  1.00 38.51  ? 149  TRP A CE2   1 
ATOM   1137 C  CE3   . TRP A  1 148 ? -10.792 -23.729 -37.855  1.00 41.41  ? 149  TRP A CE3   1 
ATOM   1138 C  CZ2   . TRP A  1 148 ? -11.918 -25.273 -39.944  1.00 37.68  ? 149  TRP A CZ2   1 
ATOM   1139 C  CZ3   . TRP A  1 148 ? -11.214 -25.041 -37.644  1.00 39.98  ? 149  TRP A CZ3   1 
ATOM   1140 C  CH2   . TRP A  1 148 ? -11.772 -25.794 -38.684  1.00 40.34  ? 149  TRP A CH2   1 
ATOM   1141 N  N     . LYS A  1 149 ? -12.098 -20.122 -36.637  1.00 41.49  ? 150  LYS A N     1 
ATOM   1142 C  CA    . LYS A  1 149 ? -13.258 -20.537 -35.852  1.00 46.28  ? 150  LYS A CA    1 
ATOM   1143 C  C     . LYS A  1 149 ? -14.347 -19.471 -35.847  1.00 47.01  ? 150  LYS A C     1 
ATOM   1144 O  O     . LYS A  1 149 ? -15.536 -19.800 -35.747  1.00 46.20  ? 150  LYS A O     1 
ATOM   1145 C  CB    . LYS A  1 149 ? -12.831 -20.868 -34.424  1.00 46.98  ? 150  LYS A CB    1 
ATOM   1146 C  CG    . LYS A  1 149 ? -11.917 -22.078 -34.307  1.00 50.91  ? 150  LYS A CG    1 
ATOM   1147 C  CD    . LYS A  1 149 ? -11.500 -22.278 -32.857  1.00 54.22  ? 150  LYS A CD    1 
ATOM   1148 C  CE    . LYS A  1 149 ? -10.636 -23.504 -32.679  1.00 59.94  ? 150  LYS A CE    1 
ATOM   1149 N  NZ    . LYS A  1 149 ? -10.202 -23.623 -31.268  1.00 61.18  ? 150  LYS A NZ    1 
ATOM   1150 N  N     . THR A  1 150 ? -13.962 -18.196 -35.941  1.00 44.51  ? 151  THR A N     1 
ATOM   1151 C  CA    . THR A  1 150 ? -14.950 -17.126 -36.031  1.00 39.75  ? 151  THR A CA    1 
ATOM   1152 C  C     . THR A  1 150 ? -15.697 -17.180 -37.357  1.00 37.04  ? 151  THR A C     1 
ATOM   1153 O  O     . THR A  1 150 ? -16.911 -16.948 -37.403  1.00 36.80  ? 151  THR A O     1 
ATOM   1154 C  CB    . THR A  1 150 ? -14.267 -15.768 -35.856  1.00 43.57  ? 151  THR A CB    1 
ATOM   1155 O  OG1   . THR A  1 150 ? -13.665 -15.697 -34.558  1.00 45.92  ? 151  THR A OG1   1 
ATOM   1156 C  CG2   . THR A  1 150 ? -15.275 -14.641 -35.996  1.00 42.10  ? 151  THR A CG2   1 
ATOM   1157 N  N     . PHE A  1 151 ? -14.984 -17.482 -38.445  1.00 33.27  ? 152  PHE A N     1 
ATOM   1158 C  CA    . PHE A  1 151 ? -15.638 -17.672 -39.736  1.00 38.04  ? 152  PHE A CA    1 
ATOM   1159 C  C     . PHE A  1 151 ? -16.644 -18.810 -39.678  1.00 41.66  ? 152  PHE A C     1 
ATOM   1160 O  O     . PHE A  1 151 ? -17.739 -18.718 -40.255  1.00 32.39  ? 152  PHE A O     1 
ATOM   1161 C  CB    . PHE A  1 151 ? -14.600 -17.955 -40.819  1.00 38.33  ? 152  PHE A CB    1 
ATOM   1162 C  CG    . PHE A  1 151 ? -14.043 -16.722 -41.458  1.00 38.70  ? 152  PHE A CG    1 
ATOM   1163 C  CD1   . PHE A  1 151 ? -14.819 -15.968 -42.321  1.00 36.68  ? 152  PHE A CD1   1 
ATOM   1164 C  CD2   . PHE A  1 151 ? -12.737 -16.323 -41.206  1.00 37.61  ? 152  PHE A CD2   1 
ATOM   1165 C  CE1   . PHE A  1 151 ? -14.312 -14.824 -42.911  1.00 36.27  ? 152  PHE A CE1   1 
ATOM   1166 C  CE2   . PHE A  1 151 ? -12.212 -15.191 -41.805  1.00 36.36  ? 152  PHE A CE2   1 
ATOM   1167 C  CZ    . PHE A  1 151 ? -13.005 -14.438 -42.658  1.00 36.42  ? 152  PHE A CZ    1 
ATOM   1168 N  N     . THR A  1 152 ? -16.275 -19.901 -38.993  1.00 35.97  ? 153  THR A N     1 
ATOM   1169 C  CA    . THR A  1 152 ? -17.163 -21.049 -38.863  1.00 33.66  ? 153  THR A CA    1 
ATOM   1170 C  C     . THR A  1 152 ? -18.465 -20.654 -38.182  1.00 31.43  ? 153  THR A C     1 
ATOM   1171 O  O     . THR A  1 152 ? -19.554 -20.979 -38.667  1.00 33.37  ? 153  THR A O     1 
ATOM   1172 C  CB    . THR A  1 152 ? -16.452 -22.149 -38.070  1.00 36.82  ? 153  THR A CB    1 
ATOM   1173 O  OG1   . THR A  1 152 ? -15.304 -22.588 -38.803  1.00 42.72  ? 153  THR A OG1   1 
ATOM   1174 C  CG2   . THR A  1 152 ? -17.392 -23.322 -37.795  1.00 33.27  ? 153  THR A CG2   1 
ATOM   1175 N  N     . ASP A  1 153 ? -18.365 -19.952 -37.047  1.00 39.11  ? 154  ASP A N     1 
ATOM   1176 C  CA    . ASP A  1 153 ? -19.556 -19.459 -36.362  1.00 43.00  ? 154  ASP A CA    1 
ATOM   1177 C  C     . ASP A  1 153 ? -20.421 -18.636 -37.309  1.00 39.57  ? 154  ASP A C     1 
ATOM   1178 O  O     . ASP A  1 153 ? -21.652 -18.742 -37.288  1.00 39.65  ? 154  ASP A O     1 
ATOM   1179 C  CB    . ASP A  1 153 ? -19.148 -18.635 -35.137  1.00 47.98  ? 154  ASP A CB    1 
ATOM   1180 C  CG    . ASP A  1 153 ? -20.229 -18.605 -34.051  1.00 58.81  ? 154  ASP A CG    1 
ATOM   1181 O  OD1   . ASP A  1 153 ? -21.291 -19.248 -34.248  1.00 61.04  ? 154  ASP A OD1   1 
ATOM   1182 O  OD2   . ASP A  1 153 ? -20.008 -17.952 -32.998  1.00 53.19  ? 154  ASP A OD2   1 
ATOM   1183 N  N     . CYS A  1 154 ? -19.787 -17.835 -38.170  1.00 37.49  ? 155  CYS A N     1 
ATOM   1184 C  CA    . CYS A  1 154 ? -20.514 -17.036 -39.152  1.00 35.64  ? 155  CYS A CA    1 
ATOM   1185 C  C     . CYS A  1 154 ? -21.060 -17.904 -40.288  1.00 35.20  ? 155  CYS A C     1 
ATOM   1186 O  O     . CYS A  1 154 ? -22.243 -17.810 -40.634  1.00 36.83  ? 155  CYS A O     1 
ATOM   1187 C  CB    . CYS A  1 154 ? -19.599 -15.929 -39.690  1.00 40.46  ? 155  CYS A CB    1 
ATOM   1188 S  SG    . CYS A  1 154 ? -20.313 -14.966 -41.030  1.00 38.90  ? 155  CYS A SG    1 
ATOM   1189 N  N     . PHE A  1 155 ? -20.225 -18.777 -40.863  1.00 35.19  ? 156  PHE A N     1 
ATOM   1190 C  CA    . PHE A  1 155 ? -20.714 -19.683 -41.906  1.00 34.37  ? 156  PHE A CA    1 
ATOM   1191 C  C     . PHE A  1 155 ? -21.873 -20.534 -41.412  1.00 35.83  ? 156  PHE A C     1 
ATOM   1192 O  O     . PHE A  1 155 ? -22.757 -20.902 -42.203  1.00 33.28  ? 156  PHE A O     1 
ATOM   1193 C  CB    . PHE A  1 155 ? -19.600 -20.607 -42.400  1.00 33.99  ? 156  PHE A CB    1 
ATOM   1194 C  CG    . PHE A  1 155 ? -18.543 -19.912 -43.200  1.00 36.53  ? 156  PHE A CG    1 
ATOM   1195 C  CD1   . PHE A  1 155 ? -18.744 -18.627 -43.681  1.00 34.31  ? 156  PHE A CD1   1 
ATOM   1196 C  CD2   . PHE A  1 155 ? -17.332 -20.541 -43.452  1.00 30.80  ? 156  PHE A CD2   1 
ATOM   1197 C  CE1   . PHE A  1 155 ? -17.763 -17.990 -44.416  1.00 35.58  ? 156  PHE A CE1   1 
ATOM   1198 C  CE2   . PHE A  1 155 ? -16.356 -19.912 -44.187  1.00 29.72  ? 156  PHE A CE2   1 
ATOM   1199 C  CZ    . PHE A  1 155 ? -16.569 -18.629 -44.672  1.00 32.44  ? 156  PHE A CZ    1 
ATOM   1200 N  N     . ASN A  1 156 ? -21.883 -20.872 -40.117  1.00 31.00  ? 157  ASN A N     1 
ATOM   1201 C  CA    . ASN A  1 156 ? -22.940 -21.743 -39.615  1.00 28.74  ? 157  ASN A CA    1 
ATOM   1202 C  C     . ASN A  1 156 ? -24.295 -21.053 -39.596  1.00 34.00  ? 157  ASN A C     1 
ATOM   1203 O  O     . ASN A  1 156 ? -25.307 -21.736 -39.388  1.00 32.08  ? 157  ASN A O     1 
ATOM   1204 C  CB    . ASN A  1 156 ? -22.614 -22.258 -38.206  1.00 29.04  ? 157  ASN A CB    1 
ATOM   1205 C  CG    . ASN A  1 156 ? -21.559 -23.365 -38.201  1.00 36.83  ? 157  ASN A CG    1 
ATOM   1206 O  OD1   . ASN A  1 156 ? -21.052 -23.737 -37.135  1.00 40.10  ? 157  ASN A OD1   1 
ATOM   1207 N  ND2   . ASN A  1 156 ? -21.216 -23.882 -39.372  1.00 29.92  ? 157  ASN A ND2   1 
ATOM   1208 N  N     . CYS A  1 157 ? -24.341 -19.734 -39.820  1.00 28.59  ? 158  CYS A N     1 
ATOM   1209 C  CA    . CYS A  1 157 ? -25.582 -18.971 -39.790  1.00 32.33  ? 158  CYS A CA    1 
ATOM   1210 C  C     . CYS A  1 157 ? -26.057 -18.544 -41.172  1.00 27.70  ? 158  CYS A C     1 
ATOM   1211 O  O     . CYS A  1 157 ? -27.070 -17.843 -41.273  1.00 27.08  ? 158  CYS A O     1 
ATOM   1212 C  CB    . CYS A  1 157 ? -25.424 -17.738 -38.894  1.00 34.14  ? 158  CYS A CB    1 
ATOM   1213 S  SG    . CYS A  1 157 ? -25.045 -18.150 -37.175  1.00 38.65  ? 158  CYS A SG    1 
ATOM   1214 N  N     . LEU A  1 158 ? -25.370 -18.966 -42.235  1.00 25.09  ? 159  LEU A N     1 
ATOM   1215 C  CA    . LEU A  1 158 ? -25.770 -18.585 -43.583  1.00 29.05  ? 159  LEU A CA    1 
ATOM   1216 C  C     . LEU A  1 158 ? -27.135 -19.180 -43.931  1.00 26.46  ? 159  LEU A C     1 
ATOM   1217 O  O     . LEU A  1 158 ? -27.452 -20.293 -43.516  1.00 26.29  ? 159  LEU A O     1 
ATOM   1218 C  CB    . LEU A  1 158 ? -24.728 -19.057 -44.601  1.00 30.72  ? 159  LEU A CB    1 
ATOM   1219 C  CG    . LEU A  1 158 ? -23.461 -18.199 -44.691  1.00 31.59  ? 159  LEU A CG    1 
ATOM   1220 C  CD1   . LEU A  1 158 ? -22.312 -18.946 -45.388  1.00 22.39  ? 159  LEU A CD1   1 
ATOM   1221 C  CD2   . LEU A  1 158 ? -23.779 -16.860 -45.382  1.00 24.30  ? 159  LEU A CD2   1 
ATOM   1222 N  N     . PRO A  1 159 ? -27.970 -18.457 -44.670  1.00 28.29  ? 160  PRO A N     1 
ATOM   1223 C  CA    . PRO A  1 159 ? -29.164 -19.081 -45.244  1.00 24.97  ? 160  PRO A CA    1 
ATOM   1224 C  C     . PRO A  1 159 ? -28.756 -20.112 -46.284  1.00 26.41  ? 160  PRO A C     1 
ATOM   1225 O  O     . PRO A  1 159 ? -27.628 -20.128 -46.780  1.00 29.37  ? 160  PRO A O     1 
ATOM   1226 C  CB    . PRO A  1 159 ? -29.918 -17.911 -45.887  1.00 24.78  ? 160  PRO A CB    1 
ATOM   1227 C  CG    . PRO A  1 159 ? -28.824 -16.892 -46.201  1.00 24.60  ? 160  PRO A CG    1 
ATOM   1228 C  CD    . PRO A  1 159 ? -27.816 -17.047 -45.076  1.00 24.74  ? 160  PRO A CD    1 
ATOM   1229 N  N     . ILE A  1 160 ? -29.685 -21.008 -46.602  1.00 26.82  ? 161  ILE A N     1 
ATOM   1230 C  CA    . ILE A  1 160 ? -29.351 -22.174 -47.413  1.00 33.07  ? 161  ILE A CA    1 
ATOM   1231 C  C     . ILE A  1 160 ? -30.135 -22.254 -48.712  1.00 30.39  ? 161  ILE A C     1 
ATOM   1232 O  O     . ILE A  1 160 ? -29.805 -23.093 -49.564  1.00 28.31  ? 161  ILE A O     1 
ATOM   1233 C  CB    . ILE A  1 160 ? -29.518 -23.478 -46.604  1.00 32.14  ? 161  ILE A CB    1 
ATOM   1234 C  CG1   . ILE A  1 160 ? -30.996 -23.718 -46.299  1.00 34.99  ? 161  ILE A CG1   1 
ATOM   1235 C  CG2   . ILE A  1 160 ? -28.673 -23.392 -45.312  1.00 25.80  ? 161  ILE A CG2   1 
ATOM   1236 C  CD1   . ILE A  1 160 ? -31.260 -24.858 -45.302  1.00 41.22  ? 161  ILE A CD1   1 
ATOM   1237 N  N     . ALA A  1 161 ? -31.163 -21.437 -48.895  1.00 24.95  ? 162  ALA A N     1 
ATOM   1238 C  CA    . ALA A  1 161 ? -31.932 -21.484 -50.125  1.00 30.04  ? 162  ALA A CA    1 
ATOM   1239 C  C     . ALA A  1 161 ? -32.650 -20.155 -50.284  1.00 30.74  ? 162  ALA A C     1 
ATOM   1240 O  O     . ALA A  1 161 ? -32.773 -19.377 -49.339  1.00 31.86  ? 162  ALA A O     1 
ATOM   1241 C  CB    . ALA A  1 161 ? -32.927 -22.655 -50.129  1.00 32.65  ? 162  ALA A CB    1 
ATOM   1242 N  N     . ALA A  1 162 ? -33.114 -19.900 -51.498  1.00 29.53  ? 163  ALA A N     1 
ATOM   1243 C  CA    . ALA A  1 162 ? -33.813 -18.660 -51.780  1.00 27.50  ? 163  ALA A CA    1 
ATOM   1244 C  C     . ALA A  1 162 ? -34.833 -18.933 -52.866  1.00 28.38  ? 163  ALA A C     1 
ATOM   1245 O  O     . ALA A  1 162 ? -34.630 -19.803 -53.720  1.00 33.47  ? 163  ALA A O     1 
ATOM   1246 C  CB    . ALA A  1 162 ? -32.838 -17.556 -52.211  1.00 22.31  ? 163  ALA A CB    1 
ATOM   1247 N  N     . ILE A  1 163 ? -35.937 -18.195 -52.826  1.00 24.44  ? 164  ILE A N     1 
ATOM   1248 C  CA    . ILE A  1 163 ? -36.942 -18.263 -53.874  1.00 28.74  ? 164  ILE A CA    1 
ATOM   1249 C  C     . ILE A  1 163 ? -37.136 -16.860 -54.421  1.00 32.68  ? 164  ILE A C     1 
ATOM   1250 O  O     . ILE A  1 163 ? -37.412 -15.928 -53.656  1.00 30.59  ? 164  ILE A O     1 
ATOM   1251 C  CB    . ILE A  1 163 ? -38.266 -18.842 -53.362  1.00 32.05  ? 164  ILE A CB    1 
ATOM   1252 C  CG1   . ILE A  1 163 ? -38.043 -20.269 -52.834  1.00 28.59  ? 164  ILE A CG1   1 
ATOM   1253 C  CG2   . ILE A  1 163 ? -39.285 -18.842 -54.466  1.00 34.91  ? 164  ILE A CG2   1 
ATOM   1254 C  CD1   . ILE A  1 163 ? -39.308 -20.929 -52.345  1.00 33.38  ? 164  ILE A CD1   1 
ATOM   1255 N  N     . VAL A  1 164 ? -36.978 -16.704 -55.734  1.00 30.08  ? 165  VAL A N     1 
ATOM   1256 C  CA    . VAL A  1 164 ? -37.120 -15.412 -56.397  1.00 35.43  ? 165  VAL A CA    1 
ATOM   1257 C  C     . VAL A  1 164 ? -38.507 -15.347 -57.033  1.00 35.22  ? 165  VAL A C     1 
ATOM   1258 O  O     . VAL A  1 164 ? -38.827 -16.129 -57.941  1.00 28.43  ? 165  VAL A O     1 
ATOM   1259 C  CB    . VAL A  1 164 ? -36.016 -15.183 -57.440  1.00 35.87  ? 165  VAL A CB    1 
ATOM   1260 C  CG1   . VAL A  1 164 ? -36.085 -13.761 -57.973  1.00 31.07  ? 165  VAL A CG1   1 
ATOM   1261 C  CG2   . VAL A  1 164 ? -34.637 -15.478 -56.842  1.00 31.90  ? 165  VAL A CG2   1 
ATOM   1262 N  N     . ASP A  1 165 ? -39.318 -14.390 -56.559  1.00 33.60  ? 166  ASP A N     1 
ATOM   1263 C  CA    . ASP A  1 165 ? -40.663 -14.134 -57.082  1.00 34.42  ? 166  ASP A CA    1 
ATOM   1264 C  C     . ASP A  1 165 ? -41.491 -15.416 -57.188  1.00 37.05  ? 166  ASP A C     1 
ATOM   1265 O  O     . ASP A  1 165 ? -42.257 -15.614 -58.138  1.00 37.60  ? 166  ASP A O     1 
ATOM   1266 C  CB    . ASP A  1 165 ? -40.582 -13.414 -58.425  1.00 38.32  ? 166  ASP A CB    1 
ATOM   1267 C  CG    . ASP A  1 165 ? -40.086 -11.979 -58.284  1.00 45.01  ? 166  ASP A CG    1 
ATOM   1268 O  OD1   . ASP A  1 165 ? -40.631 -11.225 -57.460  1.00 46.87  ? 166  ASP A OD1   1 
ATOM   1269 O  OD2   . ASP A  1 165 ? -39.123 -11.610 -58.970  1.00 50.51  ? 166  ASP A OD2   1 
ATOM   1270 N  N     . GLU A  1 166 ? -41.314 -16.306 -56.207  1.00 37.42  ? 167  GLU A N     1 
ATOM   1271 C  CA    . GLU A  1 166 ? -42.061 -17.568 -56.114  1.00 40.60  ? 167  GLU A CA    1 
ATOM   1272 C  C     . GLU A  1 166 ? -41.931 -18.418 -57.372  1.00 36.37  ? 167  GLU A C     1 
ATOM   1273 O  O     . GLU A  1 166 ? -42.799 -19.241 -57.661  1.00 40.60  ? 167  GLU A O     1 
ATOM   1274 C  CB    . GLU A  1 166 ? -43.541 -17.322 -55.810  1.00 50.86  ? 167  GLU A CB    1 
ATOM   1275 C  CG    . GLU A  1 166 ? -43.800 -16.279 -54.733  1.00 55.58  ? 167  GLU A CG    1 
ATOM   1276 C  CD    . GLU A  1 166 ? -45.260 -16.210 -54.334  1.00 62.63  ? 167  GLU A CD    1 
ATOM   1277 O  OE1   . GLU A  1 166 ? -45.590 -16.650 -53.212  1.00 66.77  ? 167  GLU A OE1   1 
ATOM   1278 O  OE2   . GLU A  1 166 ? -46.077 -15.721 -55.143  1.00 65.25  ? 167  GLU A OE2   1 
ATOM   1279 N  N     . LYS A  1 167 ? -40.854 -18.231 -58.138  1.00 36.89  ? 168  LYS A N     1 
ATOM   1280 C  CA    . LYS A  1 167 ? -40.731 -18.921 -59.418  1.00 37.38  ? 168  LYS A CA    1 
ATOM   1281 C  C     . LYS A  1 167 ? -39.371 -19.590 -59.592  1.00 31.58  ? 168  LYS A C     1 
ATOM   1282 O  O     . LYS A  1 167 ? -39.262 -20.574 -60.322  1.00 35.14  ? 168  LYS A O     1 
ATOM   1283 C  CB    . LYS A  1 167 ? -40.983 -17.951 -60.581  1.00 33.32  ? 168  LYS A CB    1 
ATOM   1284 C  CG    . LYS A  1 167 ? -42.463 -17.690 -60.861  1.00 34.65  ? 168  LYS A CG    1 
ATOM   1285 C  CD    . LYS A  1 167 ? -43.204 -19.002 -61.056  1.00 40.41  ? 168  LYS A CD    1 
ATOM   1286 C  CE    . LYS A  1 167 ? -44.688 -18.768 -61.185  1.00 40.30  ? 168  LYS A CE    1 
ATOM   1287 N  NZ    . LYS A  1 167 ? -45.412 -20.055 -61.193  1.00 50.74  ? 168  LYS A NZ    1 
ATOM   1288 N  N     . ILE A  1 168 ? -38.325 -19.062 -58.962  1.00 29.47  ? 169  ILE A N     1 
ATOM   1289 C  CA    . ILE A  1 168 ? -36.978 -19.596 -59.113  1.00 31.39  ? 169  ILE A CA    1 
ATOM   1290 C  C     . ILE A  1 168 ? -36.519 -20.081 -57.746  1.00 30.26  ? 169  ILE A C     1 
ATOM   1291 O  O     . ILE A  1 168 ? -36.337 -19.281 -56.822  1.00 29.74  ? 169  ILE A O     1 
ATOM   1292 C  CB    . ILE A  1 168 ? -35.989 -18.563 -59.686  1.00 27.71  ? 169  ILE A CB    1 
ATOM   1293 C  CG1   . ILE A  1 168 ? -36.576 -17.823 -60.886  1.00 27.11  ? 169  ILE A CG1   1 
ATOM   1294 C  CG2   . ILE A  1 168 ? -34.707 -19.245 -60.123  1.00 23.69  ? 169  ILE A CG2   1 
ATOM   1295 C  CD1   . ILE A  1 168 ? -35.613 -16.770 -61.451  1.00 29.11  ? 169  ILE A CD1   1 
ATOM   1296 N  N     . PHE A  1 169 ? -36.328 -21.387 -57.617  1.00 32.71  ? 170  PHE A N     1 
ATOM   1297 C  CA    . PHE A  1 169 ? -35.755 -21.971 -56.416  1.00 31.76  ? 170  PHE A CA    1 
ATOM   1298 C  C     . PHE A  1 169 ? -34.237 -22.003 -56.547  1.00 30.50  ? 170  PHE A C     1 
ATOM   1299 O  O     . PHE A  1 169 ? -33.707 -22.616 -57.481  1.00 28.55  ? 170  PHE A O     1 
ATOM   1300 C  CB    . PHE A  1 169 ? -36.274 -23.390 -56.199  1.00 32.16  ? 170  PHE A CB    1 
ATOM   1301 C  CG    . PHE A  1 169 ? -35.792 -24.003 -54.924  1.00 30.77  ? 170  PHE A CG    1 
ATOM   1302 C  CD1   . PHE A  1 169 ? -34.749 -24.918 -54.926  1.00 31.05  ? 170  PHE A CD1   1 
ATOM   1303 C  CD2   . PHE A  1 169 ? -36.415 -23.698 -53.720  1.00 28.97  ? 170  PHE A CD2   1 
ATOM   1304 C  CE1   . PHE A  1 169 ? -34.314 -25.484 -53.744  1.00 26.34  ? 170  PHE A CE1   1 
ATOM   1305 C  CE2   . PHE A  1 169 ? -35.985 -24.259 -52.538  1.00 23.13  ? 170  PHE A CE2   1 
ATOM   1306 C  CZ    . PHE A  1 169 ? -34.946 -25.157 -52.540  1.00 24.52  ? 170  PHE A CZ    1 
ATOM   1307 N  N     . CYS A  1 170 ? -33.532 -21.385 -55.600  1.00 31.17  ? 171  CYS A N     1 
ATOM   1308 C  CA    . CYS A  1 170 ? -32.073 -21.304 -55.647  1.00 29.32  ? 171  CYS A CA    1 
ATOM   1309 C  C     . CYS A  1 170 ? -31.478 -21.990 -54.432  1.00 30.36  ? 171  CYS A C     1 
ATOM   1310 O  O     . CYS A  1 170 ? -31.960 -21.799 -53.309  1.00 28.33  ? 171  CYS A O     1 
ATOM   1311 C  CB    . CYS A  1 170 ? -31.575 -19.861 -55.670  1.00 32.29  ? 171  CYS A CB    1 
ATOM   1312 S  SG    . CYS A  1 170 ? -32.308 -18.807 -56.919  1.00 34.23  ? 171  CYS A SG    1 
ATOM   1313 N  N     . CYS A  1 171 ? -30.431 -22.775 -54.662  1.00 27.11  ? 172  CYS A N     1 
ATOM   1314 C  CA    . CYS A  1 171 ? -29.649 -23.378 -53.595  1.00 31.53  ? 172  CYS A CA    1 
ATOM   1315 C  C     . CYS A  1 171 ? -28.306 -23.769 -54.194  1.00 33.09  ? 172  CYS A C     1 
ATOM   1316 O  O     . CYS A  1 171 ? -28.135 -23.782 -55.412  1.00 36.26  ? 172  CYS A O     1 
ATOM   1317 C  CB    . CYS A  1 171 ? -30.368 -24.584 -52.980  1.00 31.06  ? 172  CYS A CB    1 
ATOM   1318 S  SG    . CYS A  1 171 ? -30.505 -25.955 -54.155  1.00 36.23  ? 172  CYS A SG    1 
ATOM   1319 N  N     . HIS A  1 172 ? -27.344 -24.082 -53.328  1.00 28.72  ? 173  HIS A N     1 
ATOM   1320 C  CA    . HIS A  1 172 ? -26.012 -24.383 -53.832  1.00 30.37  ? 173  HIS A CA    1 
ATOM   1321 C  C     . HIS A  1 172 ? -25.983 -25.710 -54.578  1.00 29.59  ? 173  HIS A C     1 
ATOM   1322 O  O     . HIS A  1 172 ? -25.515 -25.783 -55.721  1.00 27.34  ? 173  HIS A O     1 
ATOM   1323 C  CB    . HIS A  1 172 ? -24.995 -24.414 -52.708  1.00 27.85  ? 173  HIS A CB    1 
ATOM   1324 C  CG    . HIS A  1 172 ? -23.621 -24.730 -53.192  1.00 27.50  ? 173  HIS A CG    1 
ATOM   1325 N  ND1   . HIS A  1 172 ? -22.834 -23.804 -53.839  1.00 25.37  ? 173  HIS A ND1   1 
ATOM   1326 C  CD2   . HIS A  1 172 ? -22.913 -25.885 -53.176  1.00 22.46  ? 173  HIS A CD2   1 
ATOM   1327 C  CE1   . HIS A  1 172 ? -21.685 -24.365 -54.171  1.00 25.94  ? 173  HIS A CE1   1 
ATOM   1328 N  NE2   . HIS A  1 172 ? -21.703 -25.623 -53.772  1.00 28.88  ? 173  HIS A NE2   1 
ATOM   1329 N  N     . GLY A  1 173 ? -26.474 -26.774 -53.941  1.00 22.45  ? 174  GLY A N     1 
ATOM   1330 C  CA    . GLY A  1 173 ? -26.379 -28.109 -54.501  1.00 24.84  ? 174  GLY A CA    1 
ATOM   1331 C  C     . GLY A  1 173 ? -27.573 -28.505 -55.344  1.00 29.95  ? 174  GLY A C     1 
ATOM   1332 O  O     . GLY A  1 173 ? -27.527 -28.407 -56.574  1.00 31.73  ? 174  GLY A O     1 
ATOM   1333 N  N     . GLY A  1 174 ? -28.653 -28.948 -54.702  1.00 28.27  ? 175  GLY A N     1 
ATOM   1334 C  CA    . GLY A  1 174 ? -29.833 -29.348 -55.440  1.00 28.99  ? 175  GLY A CA    1 
ATOM   1335 C  C     . GLY A  1 174 ? -30.948 -29.922 -54.588  1.00 32.77  ? 175  GLY A C     1 
ATOM   1336 O  O     . GLY A  1 174 ? -31.097 -29.571 -53.414  1.00 37.41  ? 175  GLY A O     1 
ATOM   1337 N  N     . LEU A  1 175 ? -31.738 -30.818 -55.169  1.00 32.39  ? 176  LEU A N     1 
ATOM   1338 C  CA    . LEU A  1 175 ? -32.933 -31.308 -54.508  1.00 35.16  ? 176  LEU A CA    1 
ATOM   1339 C  C     . LEU A  1 175 ? -32.591 -32.387 -53.477  1.00 37.45  ? 176  LEU A C     1 
ATOM   1340 O  O     . LEU A  1 175 ? -31.470 -32.899 -53.410  1.00 36.18  ? 176  LEU A O     1 
ATOM   1341 C  CB    . LEU A  1 175 ? -33.926 -31.828 -55.548  1.00 36.62  ? 176  LEU A CB    1 
ATOM   1342 C  CG    . LEU A  1 175 ? -34.340 -30.711 -56.521  1.00 30.51  ? 176  LEU A CG    1 
ATOM   1343 C  CD1   . LEU A  1 175 ? -35.296 -31.215 -57.601  1.00 26.40  ? 176  LEU A CD1   1 
ATOM   1344 C  CD2   . LEU A  1 175 ? -34.947 -29.534 -55.751  1.00 29.07  ? 176  LEU A CD2   1 
ATOM   1345 N  N     . SER A  1 176 ? -33.590 -32.728 -52.662  1.00 35.87  ? 177  SER A N     1 
ATOM   1346 C  CA    . SER A  1 176 ? -33.475 -33.631 -51.519  1.00 35.75  ? 177  SER A CA    1 
ATOM   1347 C  C     . SER A  1 176 ? -34.666 -34.576 -51.459  1.00 34.16  ? 177  SER A C     1 
ATOM   1348 O  O     . SER A  1 176 ? -35.807 -34.138 -51.654  1.00 35.12  ? 177  SER A O     1 
ATOM   1349 C  CB    . SER A  1 176 ? -33.412 -32.837 -50.204  1.00 35.06  ? 177  SER A CB    1 
ATOM   1350 O  OG    . SER A  1 176 ? -33.355 -33.703 -49.088  1.00 33.33  ? 177  SER A OG    1 
ATOM   1351 N  N     . PRO A  1 177 ? -34.444 -35.864 -51.174  1.00 32.83  ? 178  PRO A N     1 
ATOM   1352 C  CA    . PRO A  1 177 ? -35.583 -36.746 -50.876  1.00 30.15  ? 178  PRO A CA    1 
ATOM   1353 C  C     . PRO A  1 177 ? -36.363 -36.283 -49.666  1.00 29.64  ? 178  PRO A C     1 
ATOM   1354 O  O     . PRO A  1 177 ? -37.564 -36.543 -49.586  1.00 31.20  ? 178  PRO A O     1 
ATOM   1355 C  CB    . PRO A  1 177 ? -34.929 -38.114 -50.622  1.00 30.19  ? 178  PRO A CB    1 
ATOM   1356 C  CG    . PRO A  1 177 ? -33.561 -38.007 -51.233  1.00 34.00  ? 178  PRO A CG    1 
ATOM   1357 C  CD    . PRO A  1 177 ? -33.157 -36.574 -51.094  1.00 34.97  ? 178  PRO A CD    1 
ATOM   1358 N  N     . ASP A  1 178 ? -35.721 -35.577 -48.742  1.00 32.32  ? 179  ASP A N     1 
ATOM   1359 C  CA    . ASP A  1 178 ? -36.346 -35.067 -47.531  1.00 37.29  ? 179  ASP A CA    1 
ATOM   1360 C  C     . ASP A  1 178 ? -37.078 -33.734 -47.726  1.00 38.83  ? 179  ASP A C     1 
ATOM   1361 O  O     . ASP A  1 178 ? -37.568 -33.169 -46.742  1.00 41.25  ? 179  ASP A O     1 
ATOM   1362 C  CB    . ASP A  1 178 ? -35.288 -34.917 -46.429  1.00 37.51  ? 179  ASP A CB    1 
ATOM   1363 C  CG    . ASP A  1 178 ? -34.916 -36.258 -45.775  1.00 47.39  ? 179  ASP A CG    1 
ATOM   1364 O  OD1   . ASP A  1 178 ? -35.641 -37.252 -45.978  1.00 52.28  ? 179  ASP A OD1   1 
ATOM   1365 O  OD2   . ASP A  1 178 ? -33.901 -36.319 -45.053  1.00 51.22  ? 179  ASP A OD2   1 
ATOM   1366 N  N     . LEU A  1 179 ? -37.161 -33.211 -48.949  1.00 34.47  ? 180  LEU A N     1 
ATOM   1367 C  CA    . LEU A  1 179 ? -37.765 -31.897 -49.177  1.00 33.20  ? 180  LEU A CA    1 
ATOM   1368 C  C     . LEU A  1 179 ? -39.201 -32.087 -49.654  1.00 34.13  ? 180  LEU A C     1 
ATOM   1369 O  O     . LEU A  1 179 ? -39.454 -32.285 -50.845  1.00 35.50  ? 180  LEU A O     1 
ATOM   1370 C  CB    . LEU A  1 179 ? -36.952 -31.073 -50.172  1.00 35.74  ? 180  LEU A CB    1 
ATOM   1371 C  CG    . LEU A  1 179 ? -37.492 -29.642 -50.416  1.00 36.85  ? 180  LEU A CG    1 
ATOM   1372 C  CD1   . LEU A  1 179 ? -37.803 -28.901 -49.109  1.00 29.82  ? 180  LEU A CD1   1 
ATOM   1373 C  CD2   . LEU A  1 179 ? -36.530 -28.819 -51.276  1.00 40.63  ? 180  LEU A CD2   1 
ATOM   1374 N  N     . GLN A  1 180 ? -40.141 -32.003 -48.715  1.00 30.99  ? 181  GLN A N     1 
ATOM   1375 C  CA    . GLN A  1 180 ? -41.561 -32.110 -49.001  1.00 35.51  ? 181  GLN A CA    1 
ATOM   1376 C  C     . GLN A  1 180 ? -42.263 -30.763 -49.032  1.00 41.50  ? 181  GLN A C     1 
ATOM   1377 O  O     . GLN A  1 180 ? -43.223 -30.587 -49.791  1.00 44.84  ? 181  GLN A O     1 
ATOM   1378 C  CB    . GLN A  1 180 ? -42.235 -32.999 -47.946  1.00 43.19  ? 181  GLN A CB    1 
ATOM   1379 C  CG    . GLN A  1 180 ? -41.510 -34.325 -47.717  1.00 43.46  ? 181  GLN A CG    1 
ATOM   1380 C  CD    . GLN A  1 180 ? -41.448 -35.149 -48.982  1.00 47.76  ? 181  GLN A CD    1 
ATOM   1381 O  OE1   . GLN A  1 180 ? -42.458 -35.324 -49.662  1.00 49.53  ? 181  GLN A OE1   1 
ATOM   1382 N  NE2   . GLN A  1 180 ? -40.262 -35.641 -49.321  1.00 50.28  ? 181  GLN A NE2   1 
ATOM   1383 N  N     . SER A  1 181 ? -41.815 -29.815 -48.216  1.00 37.46  ? 182  SER A N     1 
ATOM   1384 C  CA    . SER A  1 181 ? -42.427 -28.500 -48.161  1.00 43.13  ? 182  SER A CA    1 
ATOM   1385 C  C     . SER A  1 181 ? -41.365 -27.481 -47.780  1.00 43.26  ? 182  SER A C     1 
ATOM   1386 O  O     . SER A  1 181 ? -40.439 -27.783 -47.016  1.00 37.60  ? 182  SER A O     1 
ATOM   1387 C  CB    . SER A  1 181 ? -43.566 -28.444 -47.143  1.00 43.57  ? 182  SER A CB    1 
ATOM   1388 O  OG    . SER A  1 181 ? -43.033 -28.178 -45.867  1.00 47.43  ? 182  SER A OG    1 
ATOM   1389 N  N     . MET A  1 182 ? -41.524 -26.264 -48.308  1.00 35.89  ? 183  MET A N     1 
ATOM   1390 C  CA    . MET A  1 182 ? -40.593 -25.185 -47.998  1.00 34.04  ? 183  MET A CA    1 
ATOM   1391 C  C     . MET A  1 182 ? -40.506 -24.910 -46.497  1.00 32.85  ? 183  MET A C     1 
ATOM   1392 O  O     . MET A  1 182 ? -39.475 -24.415 -46.019  1.00 33.90  ? 183  MET A O     1 
ATOM   1393 C  CB    . MET A  1 182 ? -41.018 -23.937 -48.769  1.00 35.16  ? 183  MET A CB    1 
ATOM   1394 C  CG    . MET A  1 182 ? -41.103 -24.159 -50.272  1.00 33.24  ? 183  MET A CG    1 
ATOM   1395 S  SD    . MET A  1 182 ? -39.498 -24.619 -50.952  1.00 37.80  ? 183  MET A SD    1 
ATOM   1396 C  CE    . MET A  1 182 ? -39.955 -25.109 -52.625  1.00 34.01  ? 183  MET A CE    1 
ATOM   1397 N  N     . GLU A  1 183 ? -41.548 -25.267 -45.744  1.00 30.70  ? 184  GLU A N     1 
ATOM   1398 C  CA    . GLU A  1 183 ? -41.564 -25.057 -44.304  1.00 36.64  ? 184  GLU A CA    1 
ATOM   1399 C  C     . GLU A  1 183 ? -40.522 -25.905 -43.583  1.00 37.49  ? 184  GLU A C     1 
ATOM   1400 O  O     . GLU A  1 183 ? -40.056 -25.517 -42.505  1.00 34.29  ? 184  GLU A O     1 
ATOM   1401 C  CB    . GLU A  1 183 ? -42.964 -25.362 -43.760  1.00 48.20  ? 184  GLU A CB    1 
ATOM   1402 C  CG    . GLU A  1 183 ? -43.171 -24.962 -42.317  1.00 58.05  ? 184  GLU A CG    1 
ATOM   1403 C  CD    . GLU A  1 183 ? -43.011 -23.469 -42.104  1.00 66.77  ? 184  GLU A CD    1 
ATOM   1404 O  OE1   . GLU A  1 183 ? -43.276 -22.690 -43.050  1.00 69.95  ? 184  GLU A OE1   1 
ATOM   1405 O  OE2   . GLU A  1 183 ? -42.608 -23.076 -40.989  1.00 71.35  ? 184  GLU A OE2   1 
ATOM   1406 N  N     . GLN A  1 184 ? -40.146 -27.062 -44.136  1.00 35.07  ? 185  GLN A N     1 
ATOM   1407 C  CA    . GLN A  1 184 ? -39.049 -27.801 -43.519  1.00 37.13  ? 185  GLN A CA    1 
ATOM   1408 C  C     . GLN A  1 184 ? -37.728 -27.076 -43.676  1.00 37.34  ? 185  GLN A C     1 
ATOM   1409 O  O     . GLN A  1 184 ? -36.851 -27.203 -42.816  1.00 37.38  ? 185  GLN A O     1 
ATOM   1410 C  CB    . GLN A  1 184 ? -38.947 -29.212 -44.090  1.00 37.43  ? 185  GLN A CB    1 
ATOM   1411 C  CG    . GLN A  1 184 ? -40.283 -29.783 -44.449  1.00 45.86  ? 185  GLN A CG    1 
ATOM   1412 C  CD    . GLN A  1 184 ? -40.142 -31.037 -45.250  1.00 48.24  ? 185  GLN A CD    1 
ATOM   1413 O  OE1   . GLN A  1 184 ? -40.060 -31.002 -46.475  1.00 52.11  ? 185  GLN A OE1   1 
ATOM   1414 N  NE2   . GLN A  1 184 ? -40.104 -32.164 -44.563  1.00 50.81  ? 185  GLN A NE2   1 
ATOM   1415 N  N     . ILE A  1 185 ? -37.551 -26.314 -44.753  1.00 32.60  ? 186  ILE A N     1 
ATOM   1416 C  CA    . ILE A  1 185 ? -36.364 -25.476 -44.819  1.00 31.97  ? 186  ILE A CA    1 
ATOM   1417 C  C     . ILE A  1 185 ? -36.431 -24.409 -43.731  1.00 25.93  ? 186  ILE A C     1 
ATOM   1418 O  O     . ILE A  1 185 ? -35.491 -24.237 -42.950  1.00 32.25  ? 186  ILE A O     1 
ATOM   1419 C  CB    . ILE A  1 185 ? -36.205 -24.866 -46.226  1.00 33.48  ? 186  ILE A CB    1 
ATOM   1420 C  CG1   . ILE A  1 185 ? -36.274 -25.971 -47.282  1.00 33.28  ? 186  ILE A CG1   1 
ATOM   1421 C  CG2   . ILE A  1 185 ? -34.885 -24.075 -46.324  1.00 35.95  ? 186  ILE A CG2   1 
ATOM   1422 C  CD1   . ILE A  1 185 ? -35.901 -25.540 -48.682  1.00 32.37  ? 186  ILE A CD1   1 
ATOM   1423 N  N     . ARG A  1 186 ? -37.574 -23.721 -43.628  1.00 35.63  ? 187  ARG A N     1 
ATOM   1424 C  CA    . ARG A  1 186 ? -37.711 -22.588 -42.714  1.00 37.11  ? 187  ARG A CA    1 
ATOM   1425 C  C     . ARG A  1 186 ? -37.450 -22.970 -41.264  1.00 42.36  ? 187  ARG A C     1 
ATOM   1426 O  O     . ARG A  1 186 ? -37.001 -22.126 -40.476  1.00 47.69  ? 187  ARG A O     1 
ATOM   1427 C  CB    . ARG A  1 186 ? -39.106 -21.968 -42.837  1.00 36.92  ? 187  ARG A CB    1 
ATOM   1428 C  CG    . ARG A  1 186 ? -39.410 -21.397 -44.211  1.00 43.63  ? 187  ARG A CG    1 
ATOM   1429 C  CD    . ARG A  1 186 ? -40.617 -20.447 -44.216  1.00 45.58  ? 187  ARG A CD    1 
ATOM   1430 N  NE    . ARG A  1 186 ? -41.006 -20.104 -45.586  1.00 47.32  ? 187  ARG A NE    1 
ATOM   1431 C  CZ    . ARG A  1 186 ? -41.969 -20.725 -46.262  1.00 52.25  ? 187  ARG A CZ    1 
ATOM   1432 N  NH1   . ARG A  1 186 ? -42.649 -21.712 -45.691  1.00 53.27  ? 187  ARG A NH1   1 
ATOM   1433 N  NH2   . ARG A  1 186 ? -42.256 -20.362 -47.505  1.00 55.26  ? 187  ARG A NH2   1 
ATOM   1434 N  N     . ARG A  1 187 ? -37.717 -24.223 -40.890  1.00 43.80  ? 188  ARG A N     1 
ATOM   1435 C  CA    . ARG A  1 187 ? -37.623 -24.641 -39.497  1.00 44.38  ? 188  ARG A CA    1 
ATOM   1436 C  C     . ARG A  1 187 ? -36.230 -25.100 -39.090  1.00 44.69  ? 188  ARG A C     1 
ATOM   1437 O  O     . ARG A  1 187 ? -35.992 -25.311 -37.896  1.00 46.19  ? 188  ARG A O     1 
ATOM   1438 C  CB    . ARG A  1 187 ? -38.642 -25.753 -39.211  1.00 47.17  ? 188  ARG A CB    1 
ATOM   1439 C  CG    . ARG A  1 187 ? -40.073 -25.258 -39.347  1.00 54.37  ? 188  ARG A CG    1 
ATOM   1440 C  CD    . ARG A  1 187 ? -41.112 -26.259 -38.898  1.00 61.15  ? 188  ARG A CD    1 
ATOM   1441 N  NE    . ARG A  1 187 ? -42.464 -25.728 -39.087  1.00 69.57  ? 188  ARG A NE    1 
ATOM   1442 C  CZ    . ARG A  1 187 ? -43.573 -26.359 -38.716  1.00 74.85  ? 188  ARG A CZ    1 
ATOM   1443 N  NH1   . ARG A  1 187 ? -43.492 -27.546 -38.130  1.00 74.40  ? 188  ARG A NH1   1 
ATOM   1444 N  NH2   . ARG A  1 187 ? -44.759 -25.804 -38.928  1.00 78.60  ? 188  ARG A NH2   1 
ATOM   1445 N  N     . ILE A  1 188 ? -35.308 -25.263 -40.036  1.00 37.05  ? 189  ILE A N     1 
ATOM   1446 C  CA    . ILE A  1 188 ? -33.929 -25.562 -39.673  1.00 38.13  ? 189  ILE A CA    1 
ATOM   1447 C  C     . ILE A  1 188 ? -33.385 -24.415 -38.835  1.00 41.53  ? 189  ILE A C     1 
ATOM   1448 O  O     . ILE A  1 188 ? -33.426 -23.246 -39.243  1.00 41.95  ? 189  ILE A O     1 
ATOM   1449 C  CB    . ILE A  1 188 ? -33.081 -25.788 -40.922  1.00 39.19  ? 189  ILE A CB    1 
ATOM   1450 C  CG1   . ILE A  1 188 ? -33.605 -26.999 -41.698  1.00 36.59  ? 189  ILE A CG1   1 
ATOM   1451 C  CG2   . ILE A  1 188 ? -31.613 -25.923 -40.530  1.00 39.37  ? 189  ILE A CG2   1 
ATOM   1452 C  CD1   . ILE A  1 188 ? -32.985 -27.164 -43.064  1.00 30.46  ? 189  ILE A CD1   1 
ATOM   1453 N  N     . MET A  1 189 ? -32.877 -24.738 -37.659  1.00 38.29  ? 190  MET A N     1 
ATOM   1454 C  CA    . MET A  1 189 ? -32.417 -23.720 -36.734  1.00 41.01  ? 190  MET A CA    1 
ATOM   1455 C  C     . MET A  1 189 ? -30.924 -23.482 -36.914  1.00 37.14  ? 190  MET A C     1 
ATOM   1456 O  O     . MET A  1 189 ? -30.175 -24.364 -37.341  1.00 38.14  ? 190  MET A O     1 
ATOM   1457 C  CB    . MET A  1 189 ? -32.730 -24.125 -35.289  1.00 46.31  ? 190  MET A CB    1 
ATOM   1458 C  CG    . MET A  1 189 ? -34.236 -24.168 -34.964  1.00 55.39  ? 190  MET A CG    1 
ATOM   1459 S  SD    . MET A  1 189 ? -35.043 -22.543 -34.868  1.00 69.03  ? 190  MET A SD    1 
ATOM   1460 C  CE    . MET A  1 189 ? -35.787 -22.378 -36.494  1.00 70.15  ? 190  MET A CE    1 
ATOM   1461 N  N     . ARG A  1 190 ? -30.501 -22.264 -36.603  1.00 37.38  ? 191  ARG A N     1 
ATOM   1462 C  CA    . ARG A  1 190 ? -29.124 -21.839 -36.757  1.00 35.05  ? 191  ARG A CA    1 
ATOM   1463 C  C     . ARG A  1 190 ? -28.631 -21.304 -35.424  1.00 34.17  ? 191  ARG A C     1 
ATOM   1464 O  O     . ARG A  1 190 ? -29.433 -20.839 -34.616  1.00 36.84  ? 191  ARG A O     1 
ATOM   1465 C  CB    . ARG A  1 190 ? -28.999 -20.756 -37.838  1.00 29.50  ? 191  ARG A CB    1 
ATOM   1466 C  CG    . ARG A  1 190 ? -29.279 -21.268 -39.240  1.00 28.47  ? 191  ARG A CG    1 
ATOM   1467 C  CD    . ARG A  1 190 ? -29.376 -20.111 -40.229  1.00 28.20  ? 191  ARG A CD    1 
ATOM   1468 N  NE    . ARG A  1 190 ? -30.573 -19.304 -40.021  1.00 30.99  ? 191  ARG A NE    1 
ATOM   1469 C  CZ    . ARG A  1 190 ? -30.800 -18.153 -40.651  1.00 33.93  ? 191  ARG A CZ    1 
ATOM   1470 N  NH1   . ARG A  1 190 ? -29.908 -17.688 -41.511  1.00 34.59  ? 191  ARG A NH1   1 
ATOM   1471 N  NH2   . ARG A  1 190 ? -31.909 -17.470 -40.426  1.00 33.81  ? 191  ARG A NH2   1 
ATOM   1472 N  N     . PRO A  1 191 ? -27.316 -21.359 -35.162  1.00 37.63  ? 192  PRO A N     1 
ATOM   1473 C  CA    . PRO A  1 191 ? -26.265 -21.866 -36.050  1.00 38.27  ? 192  PRO A CA    1 
ATOM   1474 C  C     . PRO A  1 191 ? -26.304 -23.388 -36.161  1.00 41.23  ? 192  PRO A C     1 
ATOM   1475 O  O     . PRO A  1 191 ? -26.725 -24.075 -35.231  1.00 38.92  ? 192  PRO A O     1 
ATOM   1476 C  CB    . PRO A  1 191 ? -24.980 -21.407 -35.366  1.00 39.07  ? 192  PRO A CB    1 
ATOM   1477 C  CG    . PRO A  1 191 ? -25.340 -21.400 -33.895  1.00 39.45  ? 192  PRO A CG    1 
ATOM   1478 C  CD    . PRO A  1 191 ? -26.772 -20.919 -33.861  1.00 39.73  ? 192  PRO A CD    1 
ATOM   1479 N  N     . THR A  1 192 ? -25.882 -23.912 -37.307  1.00 40.20  ? 193  THR A N     1 
ATOM   1480 C  CA    . THR A  1 192 ? -25.851 -25.353 -37.480  1.00 40.10  ? 193  THR A CA    1 
ATOM   1481 C  C     . THR A  1 192 ? -24.661 -25.720 -38.351  1.00 41.22  ? 193  THR A C     1 
ATOM   1482 O  O     . THR A  1 192 ? -24.242 -24.948 -39.221  1.00 29.80  ? 193  THR A O     1 
ATOM   1483 C  CB    . THR A  1 192 ? -27.150 -25.875 -38.103  1.00 38.01  ? 193  THR A CB    1 
ATOM   1484 O  OG1   . THR A  1 192 ? -27.037 -27.283 -38.308  1.00 42.36  ? 193  THR A OG1   1 
ATOM   1485 C  CG2   . THR A  1 192 ? -27.418 -25.195 -39.452  1.00 33.64  ? 193  THR A CG2   1 
ATOM   1486 N  N     . ASP A  1 193 ? -24.099 -26.894 -38.079  1.00 37.28  ? 194  ASP A N     1 
ATOM   1487 C  CA    . ASP A  1 193 ? -23.152 -27.502 -38.993  1.00 35.70  ? 194  ASP A CA    1 
ATOM   1488 C  C     . ASP A  1 193 ? -23.906 -28.124 -40.162  1.00 27.51  ? 194  ASP A C     1 
ATOM   1489 O  O     . ASP A  1 193 ? -25.133 -28.235 -40.152  1.00 34.01  ? 194  ASP A O     1 
ATOM   1490 C  CB    . ASP A  1 193 ? -22.316 -28.560 -38.272  1.00 47.59  ? 194  ASP A CB    1 
ATOM   1491 C  CG    . ASP A  1 193 ? -21.574 -27.994 -37.086  1.00 58.49  ? 194  ASP A CG    1 
ATOM   1492 O  OD1   . ASP A  1 193 ? -20.949 -26.925 -37.250  1.00 62.73  ? 194  ASP A OD1   1 
ATOM   1493 O  OD2   . ASP A  1 193 ? -21.620 -28.606 -35.995  1.00 64.61  ? 194  ASP A OD2   1 
ATOM   1494 N  N     . VAL A  1 194 ? -23.169 -28.541 -41.180  1.00 25.65  ? 195  VAL A N     1 
ATOM   1495 C  CA    . VAL A  1 194 ? -23.722 -29.324 -42.280  1.00 35.24  ? 195  VAL A CA    1 
ATOM   1496 C  C     . VAL A  1 194 ? -23.765 -30.787 -41.826  1.00 34.97  ? 195  VAL A C     1 
ATOM   1497 O  O     . VAL A  1 194 ? -22.694 -31.358 -41.557  1.00 32.28  ? 195  VAL A O     1 
ATOM   1498 C  CB    . VAL A  1 194 ? -22.910 -29.144 -43.564  1.00 36.69  ? 195  VAL A CB    1 
ATOM   1499 C  CG1   . VAL A  1 194 ? -23.603 -29.825 -44.740  1.00 37.92  ? 195  VAL A CG1   1 
ATOM   1500 C  CG2   . VAL A  1 194 ? -22.704 -27.643 -43.855  1.00 33.66  ? 195  VAL A CG2   1 
ATOM   1501 N  N     . PRO A  1 195 ? -24.932 -31.396 -41.682  1.00 34.63  ? 196  PRO A N     1 
ATOM   1502 C  CA    . PRO A  1 195 ? -24.990 -32.797 -41.240  1.00 35.40  ? 196  PRO A CA    1 
ATOM   1503 C  C     . PRO A  1 195 ? -24.519 -33.729 -42.342  1.00 33.16  ? 196  PRO A C     1 
ATOM   1504 O  O     . PRO A  1 195 ? -24.418 -33.358 -43.514  1.00 35.65  ? 196  PRO A O     1 
ATOM   1505 C  CB    . PRO A  1 195 ? -26.474 -33.039 -40.929  1.00 37.87  ? 196  PRO A CB    1 
ATOM   1506 C  CG    . PRO A  1 195 ? -27.109 -31.668 -40.928  1.00 41.80  ? 196  PRO A CG    1 
ATOM   1507 C  CD    . PRO A  1 195 ? -26.274 -30.826 -41.867  1.00 35.78  ? 196  PRO A CD    1 
ATOM   1508 N  N     . ASP A  1 196 ? -24.257 -34.976 -41.939  1.00 35.63  ? 197  ASP A N     1 
ATOM   1509 C  CA    . ASP A  1 196 ? -23.779 -35.998 -42.868  1.00 38.67  ? 197  ASP A CA    1 
ATOM   1510 C  C     . ASP A  1 196 ? -24.842 -36.391 -43.885  1.00 34.04  ? 197  ASP A C     1 
ATOM   1511 O  O     . ASP A  1 196 ? -24.506 -36.866 -44.972  1.00 35.19  ? 197  ASP A O     1 
ATOM   1512 C  CB    . ASP A  1 196 ? -23.324 -37.249 -42.101  1.00 42.31  ? 197  ASP A CB    1 
ATOM   1513 C  CG    . ASP A  1 196 ? -22.063 -37.019 -41.285  1.00 52.80  ? 197  ASP A CG    1 
ATOM   1514 O  OD1   . ASP A  1 196 ? -21.248 -36.129 -41.634  1.00 49.18  ? 197  ASP A OD1   1 
ATOM   1515 O  OD2   . ASP A  1 196 ? -21.879 -37.751 -40.286  1.00 63.37  ? 197  ASP A OD2   1 
ATOM   1516 N  N     . GLN A  1 197 ? -26.118 -36.226 -43.548  1.00 36.76  ? 198  GLN A N     1 
ATOM   1517 C  CA    . GLN A  1 197 ? -27.211 -36.566 -44.452  1.00 38.45  ? 198  GLN A CA    1 
ATOM   1518 C  C     . GLN A  1 197 ? -28.436 -35.787 -44.005  1.00 33.70  ? 198  GLN A C     1 
ATOM   1519 O  O     . GLN A  1 197 ? -28.452 -35.203 -42.922  1.00 36.86  ? 198  GLN A O     1 
ATOM   1520 C  CB    . GLN A  1 197 ? -27.503 -38.071 -44.464  1.00 40.20  ? 198  GLN A CB    1 
ATOM   1521 C  CG    . GLN A  1 197 ? -28.258 -38.565 -43.251  1.00 48.76  ? 198  GLN A CG    1 
ATOM   1522 C  CD    . GLN A  1 197 ? -27.436 -38.467 -41.990  1.00 65.93  ? 198  GLN A CD    1 
ATOM   1523 O  OE1   . GLN A  1 197 ? -26.339 -39.025 -41.906  1.00 72.81  ? 198  GLN A OE1   1 
ATOM   1524 N  NE2   . GLN A  1 197 ? -27.954 -37.747 -40.999  1.00 71.44  ? 198  GLN A NE2   1 
ATOM   1525 N  N     . GLY A  1 198 ? -29.471 -35.809 -44.831  1.00 32.01  ? 199  GLY A N     1 
ATOM   1526 C  CA    . GLY A  1 198 ? -30.679 -35.060 -44.550  1.00 33.14  ? 199  GLY A CA    1 
ATOM   1527 C  C     . GLY A  1 198 ? -30.802 -33.821 -45.424  1.00 35.96  ? 199  GLY A C     1 
ATOM   1528 O  O     . GLY A  1 198 ? -30.005 -33.576 -46.335  1.00 29.66  ? 199  GLY A O     1 
ATOM   1529 N  N     . LEU A  1 199 ? -31.820 -33.018 -45.107  1.00 38.01  ? 200  LEU A N     1 
ATOM   1530 C  CA    . LEU A  1 199 ? -32.249 -31.935 -45.990  1.00 32.77  ? 200  LEU A CA    1 
ATOM   1531 C  C     . LEU A  1 199 ? -31.145 -30.906 -46.207  1.00 31.24  ? 200  LEU A C     1 
ATOM   1532 O  O     . LEU A  1 199 ? -30.778 -30.602 -47.346  1.00 29.72  ? 200  LEU A O     1 
ATOM   1533 C  CB    . LEU A  1 199 ? -33.506 -31.280 -45.409  1.00 37.96  ? 200  LEU A CB    1 
ATOM   1534 C  CG    . LEU A  1 199 ? -34.127 -30.060 -46.083  1.00 36.51  ? 200  LEU A CG    1 
ATOM   1535 C  CD1   . LEU A  1 199 ? -34.537 -30.367 -47.518  1.00 33.60  ? 200  LEU A CD1   1 
ATOM   1536 C  CD2   . LEU A  1 199 ? -35.329 -29.592 -45.278  1.00 31.95  ? 200  LEU A CD2   1 
ATOM   1537 N  N     . LEU A  1 200 ? -30.618 -30.339 -45.121  1.00 35.35  ? 201  LEU A N     1 
ATOM   1538 C  CA    . LEU A  1 200 ? -29.577 -29.327 -45.248  1.00 31.23  ? 201  LEU A CA    1 
ATOM   1539 C  C     . LEU A  1 200 ? -28.392 -29.859 -46.044  1.00 31.73  ? 201  LEU A C     1 
ATOM   1540 O  O     . LEU A  1 200 ? -27.840 -29.160 -46.909  1.00 37.74  ? 201  LEU A O     1 
ATOM   1541 C  CB    . LEU A  1 200 ? -29.137 -28.860 -43.861  1.00 29.76  ? 201  LEU A CB    1 
ATOM   1542 C  CG    . LEU A  1 200 ? -27.946 -27.900 -43.765  1.00 37.74  ? 201  LEU A CG    1 
ATOM   1543 C  CD1   . LEU A  1 200 ? -28.127 -26.781 -44.736  1.00 41.14  ? 201  LEU A CD1   1 
ATOM   1544 C  CD2   . LEU A  1 200 ? -27.826 -27.333 -42.356  1.00 46.92  ? 201  LEU A CD2   1 
ATOM   1545 N  N     . CYS A  1 201 ? -28.005 -31.102 -45.786  1.00 27.40  ? 202  CYS A N     1 
ATOM   1546 C  CA    . CYS A  1 201 ? -26.909 -31.717 -46.520  1.00 28.03  ? 202  CYS A CA    1 
ATOM   1547 C  C     . CYS A  1 201 ? -27.202 -31.770 -48.017  1.00 30.79  ? 202  CYS A C     1 
ATOM   1548 O  O     . CYS A  1 201 ? -26.389 -31.327 -48.833  1.00 35.09  ? 202  CYS A O     1 
ATOM   1549 C  CB    . CYS A  1 201 ? -26.660 -33.118 -45.956  1.00 37.73  ? 202  CYS A CB    1 
ATOM   1550 S  SG    . CYS A  1 201 ? -25.447 -34.090 -46.850  1.00 34.57  ? 202  CYS A SG    1 
ATOM   1551 N  N     . ASP A  1 202 ? -28.372 -32.302 -48.397  1.00 29.30  ? 203  ASP A N     1 
ATOM   1552 C  CA    . ASP A  1 202 ? -28.705 -32.430 -49.813  1.00 23.92  ? 203  ASP A CA    1 
ATOM   1553 C  C     . ASP A  1 202 ? -28.772 -31.067 -50.495  1.00 29.54  ? 203  ASP A C     1 
ATOM   1554 O  O     . ASP A  1 202 ? -28.362 -30.917 -51.655  1.00 23.63  ? 203  ASP A O     1 
ATOM   1555 C  CB    . ASP A  1 202 ? -30.035 -33.167 -49.986  1.00 26.81  ? 203  ASP A CB    1 
ATOM   1556 C  CG    . ASP A  1 202 ? -30.023 -34.621 -49.417  1.00 33.44  ? 203  ASP A CG    1 
ATOM   1557 O  OD1   . ASP A  1 202 ? -28.956 -35.268 -49.357  1.00 29.79  ? 203  ASP A OD1   1 
ATOM   1558 O  OD2   . ASP A  1 202 ? -31.112 -35.130 -49.076  1.00 30.30  ? 203  ASP A OD2   1 
ATOM   1559 N  N     . LEU A  1 203 ? -29.300 -30.062 -49.802  1.00 25.95  ? 204  LEU A N     1 
ATOM   1560 C  CA    . LEU A  1 203 ? -29.429 -28.752 -50.423  1.00 30.42  ? 204  LEU A CA    1 
ATOM   1561 C  C     . LEU A  1 203 ? -28.066 -28.195 -50.822  1.00 29.37  ? 204  LEU A C     1 
ATOM   1562 O  O     . LEU A  1 203 ? -27.968 -27.433 -51.783  1.00 29.05  ? 204  LEU A O     1 
ATOM   1563 C  CB    . LEU A  1 203 ? -30.153 -27.802 -49.481  1.00 28.63  ? 204  LEU A CB    1 
ATOM   1564 C  CG    . LEU A  1 203 ? -31.676 -27.969 -49.402  1.00 34.61  ? 204  LEU A CG    1 
ATOM   1565 C  CD1   . LEU A  1 203 ? -32.253 -27.113 -48.267  1.00 31.63  ? 204  LEU A CD1   1 
ATOM   1566 C  CD2   . LEU A  1 203 ? -32.349 -27.624 -50.739  1.00 31.97  ? 204  LEU A CD2   1 
ATOM   1567 N  N     . LEU A  1 204 ? -27.008 -28.598 -50.118  1.00 24.53  ? 205  LEU A N     1 
ATOM   1568 C  CA    . LEU A  1 204 ? -25.660 -28.114 -50.347  1.00 27.10  ? 205  LEU A CA    1 
ATOM   1569 C  C     . LEU A  1 204 ? -24.793 -29.068 -51.165  1.00 26.71  ? 205  LEU A C     1 
ATOM   1570 O  O     . LEU A  1 204 ? -23.703 -28.669 -51.583  1.00 32.18  ? 205  LEU A O     1 
ATOM   1571 C  CB    . LEU A  1 204 ? -24.972 -27.850 -49.004  1.00 25.95  ? 205  LEU A CB    1 
ATOM   1572 C  CG    . LEU A  1 204 ? -25.125 -26.437 -48.420  1.00 32.75  ? 205  LEU A CG    1 
ATOM   1573 C  CD1   . LEU A  1 204 ? -26.587 -26.013 -48.328  1.00 32.76  ? 205  LEU A CD1   1 
ATOM   1574 C  CD2   . LEU A  1 204 ? -24.456 -26.361 -47.064  1.00 35.60  ? 205  LEU A CD2   1 
ATOM   1575 N  N     . TRP A  1 205 ? -25.245 -30.300 -51.411  1.00 26.98  ? 206  TRP A N     1 
ATOM   1576 C  CA    . TRP A  1 205 ? -24.369 -31.360 -51.898  1.00 25.60  ? 206  TRP A CA    1 
ATOM   1577 C  C     . TRP A  1 205 ? -24.885 -32.133 -53.104  1.00 24.04  ? 206  TRP A C     1 
ATOM   1578 O  O     . TRP A  1 205 ? -24.067 -32.733 -53.813  1.00 27.92  ? 206  TRP A O     1 
ATOM   1579 C  CB    . TRP A  1 205 ? -24.077 -32.367 -50.775  1.00 26.29  ? 206  TRP A CB    1 
ATOM   1580 C  CG    . TRP A  1 205 ? -22.989 -31.960 -49.838  1.00 32.20  ? 206  TRP A CG    1 
ATOM   1581 C  CD1   . TRP A  1 205 ? -23.128 -31.290 -48.652  1.00 29.90  ? 206  TRP A CD1   1 
ATOM   1582 C  CD2   . TRP A  1 205 ? -21.584 -32.200 -50.002  1.00 25.07  ? 206  TRP A CD2   1 
ATOM   1583 N  NE1   . TRP A  1 205 ? -21.892 -31.079 -48.081  1.00 30.16  ? 206  TRP A NE1   1 
ATOM   1584 C  CE2   . TRP A  1 205 ? -20.932 -31.645 -48.884  1.00 26.65  ? 206  TRP A CE2   1 
ATOM   1585 C  CE3   . TRP A  1 205 ? -20.818 -32.827 -50.986  1.00 30.56  ? 206  TRP A CE3   1 
ATOM   1586 C  CZ2   . TRP A  1 205 ? -19.553 -31.701 -48.726  1.00 27.67  ? 206  TRP A CZ2   1 
ATOM   1587 C  CZ3   . TRP A  1 205 ? -19.439 -32.877 -50.826  1.00 32.59  ? 206  TRP A CZ3   1 
ATOM   1588 C  CH2   . TRP A  1 205 ? -18.826 -32.328 -49.703  1.00 30.25  ? 206  TRP A CH2   1 
ATOM   1589 N  N     . SER A  1 206 ? -26.185 -32.156 -53.369  1.00 25.48  ? 207  SER A N     1 
ATOM   1590 C  CA    . SER A  1 206 ? -26.678 -33.033 -54.420  1.00 25.69  ? 207  SER A CA    1 
ATOM   1591 C  C     . SER A  1 206 ? -26.431 -32.442 -55.809  1.00 30.01  ? 207  SER A C     1 
ATOM   1592 O  O     . SER A  1 206 ? -26.269 -31.228 -55.981  1.00 31.74  ? 207  SER A O     1 
ATOM   1593 C  CB    . SER A  1 206 ? -28.161 -33.326 -54.225  1.00 24.11  ? 207  SER A CB    1 
ATOM   1594 O  OG    . SER A  1 206 ? -28.949 -32.182 -54.500  1.00 31.62  ? 207  SER A OG    1 
ATOM   1595 N  N     . ASP A  1 207 ? -26.417 -33.329 -56.810  1.00 28.96  ? 208  ASP A N     1 
ATOM   1596 C  CA    . ASP A  1 207 ? -26.155 -33.026 -58.214  1.00 29.48  ? 208  ASP A CA    1 
ATOM   1597 C  C     . ASP A  1 207 ? -27.249 -33.600 -59.100  1.00 35.77  ? 208  ASP A C     1 
ATOM   1598 O  O     . ASP A  1 207 ? -27.764 -34.693 -58.834  1.00 33.78  ? 208  ASP A O     1 
ATOM   1599 C  CB    . ASP A  1 207 ? -24.812 -33.611 -58.685  1.00 27.87  ? 208  ASP A CB    1 
ATOM   1600 C  CG    . ASP A  1 207 ? -23.625 -33.053 -57.922  1.00 33.35  ? 208  ASP A CG    1 
ATOM   1601 O  OD1   . ASP A  1 207 ? -23.424 -31.823 -57.970  1.00 28.64  ? 208  ASP A OD1   1 
ATOM   1602 O  OD2   . ASP A  1 207 ? -22.888 -33.846 -57.283  1.00 37.54  ? 208  ASP A OD2   1 
ATOM   1603 N  N     . PRO A  1 208 ? -27.604 -32.909 -60.176  1.00 33.36  ? 209  PRO A N     1 
ATOM   1604 C  CA    . PRO A  1 208 ? -28.442 -33.532 -61.201  1.00 33.58  ? 209  PRO A CA    1 
ATOM   1605 C  C     . PRO A  1 208 ? -27.610 -34.497 -62.034  1.00 32.84  ? 209  PRO A C     1 
ATOM   1606 O  O     . PRO A  1 208 ? -26.384 -34.412 -62.078  1.00 39.24  ? 209  PRO A O     1 
ATOM   1607 C  CB    . PRO A  1 208 ? -28.915 -32.343 -62.039  1.00 33.46  ? 209  PRO A CB    1 
ATOM   1608 C  CG    . PRO A  1 208 ? -27.770 -31.370 -61.935  1.00 34.50  ? 209  PRO A CG    1 
ATOM   1609 C  CD    . PRO A  1 208 ? -27.193 -31.545 -60.550  1.00 33.90  ? 209  PRO A CD    1 
ATOM   1610 N  N     . ASP A  1 209 ? -28.299 -35.422 -62.704  1.00 34.22  ? 210  ASP A N     1 
ATOM   1611 C  CA    . ASP A  1 209 ? -27.633 -36.399 -63.567  1.00 38.71  ? 210  ASP A CA    1 
ATOM   1612 C  C     . ASP A  1 209 ? -28.595 -36.877 -64.647  1.00 38.33  ? 210  ASP A C     1 
ATOM   1613 O  O     . ASP A  1 209 ? -29.643 -37.457 -64.338  1.00 36.79  ? 210  ASP A O     1 
ATOM   1614 C  CB    . ASP A  1 209 ? -27.116 -37.602 -62.758  1.00 44.37  ? 210  ASP A CB    1 
ATOM   1615 C  CG    . ASP A  1 209 ? -26.210 -38.539 -63.585  1.00 49.59  ? 210  ASP A CG    1 
ATOM   1616 O  OD1   . ASP A  1 209 ? -26.581 -38.911 -64.718  1.00 50.30  ? 210  ASP A OD1   1 
ATOM   1617 O  OD2   . ASP A  1 209 ? -25.142 -38.942 -63.082  1.00 52.69  ? 210  ASP A OD2   1 
ATOM   1618 N  N     . LYS A  1 210 ? -28.201 -36.687 -65.910  1.00 41.00  ? 211  LYS A N     1 
ATOM   1619 C  CA    . LYS A  1 210 ? -29.022 -37.098 -67.046  1.00 48.25  ? 211  LYS A CA    1 
ATOM   1620 C  C     . LYS A  1 210 ? -29.202 -38.610 -67.155  1.00 48.60  ? 211  LYS A C     1 
ATOM   1621 O  O     . LYS A  1 210 ? -30.156 -39.053 -67.799  1.00 56.23  ? 211  LYS A O     1 
ATOM   1622 C  CB    . LYS A  1 210 ? -28.419 -36.568 -68.350  1.00 54.85  ? 211  LYS A CB    1 
ATOM   1623 N  N     . ASP A  1 211 ? -28.325 -39.413 -66.554  1.00 46.05  ? 212  ASP A N     1 
ATOM   1624 C  CA    . ASP A  1 211 ? -28.403 -40.866 -66.671  1.00 53.65  ? 212  ASP A CA    1 
ATOM   1625 C  C     . ASP A  1 211 ? -29.044 -41.531 -65.460  1.00 53.24  ? 212  ASP A C     1 
ATOM   1626 O  O     . ASP A  1 211 ? -28.927 -42.750 -65.300  1.00 48.47  ? 212  ASP A O     1 
ATOM   1627 C  CB    . ASP A  1 211 ? -27.011 -41.447 -66.895  1.00 55.18  ? 212  ASP A CB    1 
ATOM   1628 C  CG    . ASP A  1 211 ? -26.377 -40.932 -68.158  1.00 58.31  ? 212  ASP A CG    1 
ATOM   1629 O  OD1   . ASP A  1 211 ? -27.086 -40.860 -69.181  1.00 60.47  ? 212  ASP A OD1   1 
ATOM   1630 O  OD2   . ASP A  1 211 ? -25.180 -40.581 -68.125  1.00 62.71  ? 212  ASP A OD2   1 
ATOM   1631 N  N     . VAL A  1 212 ? -29.714 -40.765 -64.608  1.00 52.99  ? 213  VAL A N     1 
ATOM   1632 C  CA    . VAL A  1 212 ? -30.303 -41.274 -63.379  1.00 50.90  ? 213  VAL A CA    1 
ATOM   1633 C  C     . VAL A  1 212 ? -31.814 -41.145 -63.485  1.00 54.17  ? 213  VAL A C     1 
ATOM   1634 O  O     . VAL A  1 212 ? -32.332 -40.098 -63.887  1.00 53.67  ? 213  VAL A O     1 
ATOM   1635 C  CB    . VAL A  1 212 ? -29.761 -40.522 -62.151  1.00 52.47  ? 213  VAL A CB    1 
ATOM   1636 C  CG1   . VAL A  1 212 ? -30.743 -40.586 -60.994  1.00 49.95  ? 213  VAL A CG1   1 
ATOM   1637 C  CG2   . VAL A  1 212 ? -28.408 -41.089 -61.744  1.00 52.15  ? 213  VAL A CG2   1 
ATOM   1638 N  N     . GLN A  1 213 ? -32.515 -42.215 -63.156  1.00 61.44  ? 214  GLN A N     1 
ATOM   1639 C  CA    . GLN A  1 213 ? -33.961 -42.180 -62.985  1.00 63.60  ? 214  GLN A CA    1 
ATOM   1640 C  C     . GLN A  1 213 ? -34.217 -42.132 -61.485  1.00 59.52  ? 214  GLN A C     1 
ATOM   1641 O  O     . GLN A  1 213 ? -33.883 -43.079 -60.763  1.00 56.48  ? 214  GLN A O     1 
ATOM   1642 C  CB    . GLN A  1 213 ? -34.626 -43.394 -63.632  1.00 60.23  ? 214  GLN A CB    1 
ATOM   1643 N  N     . GLY A  1 214 ? -34.774 -41.019 -61.017  1.00 49.74  ? 215  GLY A N     1 
ATOM   1644 C  CA    . GLY A  1 214 ? -35.055 -40.858 -59.601  1.00 42.18  ? 215  GLY A CA    1 
ATOM   1645 C  C     . GLY A  1 214 ? -33.840 -40.348 -58.857  1.00 38.21  ? 215  GLY A C     1 
ATOM   1646 O  O     . GLY A  1 214 ? -33.198 -39.390 -59.288  1.00 38.44  ? 215  GLY A O     1 
ATOM   1647 N  N     . TRP A  1 215 ? -33.515 -40.999 -57.749  1.00 35.18  ? 216  TRP A N     1 
ATOM   1648 C  CA    . TRP A  1 215 ? -32.391 -40.619 -56.906  1.00 35.14  ? 216  TRP A CA    1 
ATOM   1649 C  C     . TRP A  1 215 ? -31.278 -41.633 -57.101  1.00 39.50  ? 216  TRP A C     1 
ATOM   1650 O  O     . TRP A  1 215 ? -31.413 -42.794 -56.703  1.00 50.80  ? 216  TRP A O     1 
ATOM   1651 C  CB    . TRP A  1 215 ? -32.811 -40.554 -55.441  1.00 36.30  ? 216  TRP A CB    1 
ATOM   1652 C  CG    . TRP A  1 215 ? -33.903 -39.577 -55.215  1.00 40.07  ? 216  TRP A CG    1 
ATOM   1653 C  CD1   . TRP A  1 215 ? -35.247 -39.831 -55.158  1.00 37.43  ? 216  TRP A CD1   1 
ATOM   1654 C  CD2   . TRP A  1 215 ? -33.752 -38.166 -55.039  1.00 37.98  ? 216  TRP A CD2   1 
ATOM   1655 N  NE1   . TRP A  1 215 ? -35.941 -38.657 -54.955  1.00 37.35  ? 216  TRP A NE1   1 
ATOM   1656 C  CE2   . TRP A  1 215 ? -35.046 -37.624 -54.869  1.00 38.57  ? 216  TRP A CE2   1 
ATOM   1657 C  CE3   . TRP A  1 215 ? -32.649 -37.311 -54.996  1.00 36.40  ? 216  TRP A CE3   1 
ATOM   1658 C  CZ2   . TRP A  1 215 ? -35.261 -36.269 -54.659  1.00 40.65  ? 216  TRP A CZ2   1 
ATOM   1659 C  CZ3   . TRP A  1 215 ? -32.866 -35.960 -54.795  1.00 38.59  ? 216  TRP A CZ3   1 
ATOM   1660 C  CH2   . TRP A  1 215 ? -34.162 -35.451 -54.632  1.00 39.54  ? 216  TRP A CH2   1 
ATOM   1661 N  N     . GLY A  1 216 ? -30.169 -41.194 -57.689  1.00 36.12  ? 217  GLY A N     1 
ATOM   1662 C  CA    . GLY A  1 216 ? -29.013 -42.041 -57.863  1.00 33.41  ? 217  GLY A CA    1 
ATOM   1663 C  C     . GLY A  1 216 ? -27.952 -41.799 -56.803  1.00 35.02  ? 217  GLY A C     1 
ATOM   1664 O  O     . GLY A  1 216 ? -28.067 -40.937 -55.939  1.00 39.05  ? 217  GLY A O     1 
ATOM   1665 N  N     . GLU A  1 217 ? -26.899 -42.600 -56.889  1.00 34.80  ? 218  GLU A N     1 
ATOM   1666 C  CA    . GLU A  1 217 ? -25.735 -42.450 -56.038  1.00 34.77  ? 218  GLU A CA    1 
ATOM   1667 C  C     . GLU A  1 217 ? -24.879 -41.279 -56.509  1.00 36.87  ? 218  GLU A C     1 
ATOM   1668 O  O     . GLU A  1 217 ? -24.870 -40.917 -57.687  1.00 40.41  ? 218  GLU A O     1 
ATOM   1669 C  CB    . GLU A  1 217 ? -24.904 -43.738 -56.042  1.00 38.06  ? 218  GLU A CB    1 
ATOM   1670 C  CG    . GLU A  1 217 ? -25.606 -44.927 -55.392  1.00 42.35  ? 218  GLU A CG    1 
ATOM   1671 C  CD    . GLU A  1 217 ? -24.809 -46.226 -55.509  1.00 49.32  ? 218  GLU A CD    1 
ATOM   1672 O  OE1   . GLU A  1 217 ? -25.356 -47.227 -56.018  1.00 46.93  ? 218  GLU A OE1   1 
ATOM   1673 O  OE2   . GLU A  1 217 ? -23.627 -46.235 -55.101  1.00 53.55  ? 218  GLU A OE2   1 
ATOM   1674 N  N     . ASN A  1 218 ? -24.152 -40.685 -55.572  1.00 35.77  ? 219  ASN A N     1 
ATOM   1675 C  CA    . ASN A  1 218 ? -23.358 -39.494 -55.838  1.00 38.70  ? 219  ASN A CA    1 
ATOM   1676 C  C     . ASN A  1 218 ? -21.900 -39.828 -55.577  1.00 38.05  ? 219  ASN A C     1 
ATOM   1677 O  O     . ASN A  1 218 ? -21.556 -40.250 -54.470  1.00 38.28  ? 219  ASN A O     1 
ATOM   1678 C  CB    . ASN A  1 218 ? -23.816 -38.322 -54.963  1.00 33.74  ? 219  ASN A CB    1 
ATOM   1679 C  CG    . ASN A  1 218 ? -23.202 -37.000 -55.388  1.00 37.49  ? 219  ASN A CG    1 
ATOM   1680 O  OD1   . ASN A  1 218 ? -21.988 -36.905 -55.567  1.00 40.02  ? 219  ASN A OD1   1 
ATOM   1681 N  ND2   . ASN A  1 218 ? -24.036 -35.973 -55.546  1.00 31.27  ? 219  ASN A ND2   1 
ATOM   1682 N  N     . ASP A  1 219 ? -21.044 -39.615 -56.588  1.00 38.79  ? 220  ASP A N     1 
ATOM   1683 C  CA    . ASP A  1 219 ? -19.640 -40.024 -56.499  1.00 43.81  ? 220  ASP A CA    1 
ATOM   1684 C  C     . ASP A  1 219 ? -18.860 -39.245 -55.450  1.00 41.50  ? 220  ASP A C     1 
ATOM   1685 O  O     . ASP A  1 219 ? -17.776 -39.686 -55.050  1.00 38.55  ? 220  ASP A O     1 
ATOM   1686 C  CB    . ASP A  1 219 ? -18.954 -39.871 -57.852  1.00 50.79  ? 220  ASP A CB    1 
ATOM   1687 C  CG    . ASP A  1 219 ? -19.464 -40.860 -58.877  1.00 60.70  ? 220  ASP A CG    1 
ATOM   1688 O  OD1   . ASP A  1 219 ? -19.876 -41.970 -58.487  1.00 65.47  ? 220  ASP A OD1   1 
ATOM   1689 O  OD2   . ASP A  1 219 ? -19.448 -40.526 -60.079  1.00 67.63  ? 220  ASP A OD2   1 
ATOM   1690 N  N     . ARG A  1 220 ? -19.376 -38.095 -55.011  1.00 36.12  ? 221  ARG A N     1 
ATOM   1691 C  CA    . ARG A  1 220 ? -18.773 -37.380 -53.894  1.00 36.31  ? 221  ARG A CA    1 
ATOM   1692 C  C     . ARG A  1 220 ? -18.790 -38.193 -52.606  1.00 36.60  ? 221  ARG A C     1 
ATOM   1693 O  O     . ARG A  1 220 ? -18.053 -37.862 -51.672  1.00 38.12  ? 221  ARG A O     1 
ATOM   1694 C  CB    . ARG A  1 220 ? -19.500 -36.044 -53.666  1.00 38.35  ? 221  ARG A CB    1 
ATOM   1695 C  CG    . ARG A  1 220 ? -19.530 -35.085 -54.859  1.00 35.80  ? 221  ARG A CG    1 
ATOM   1696 C  CD    . ARG A  1 220 ? -20.391 -33.841 -54.526  1.00 37.26  ? 221  ARG A CD    1 
ATOM   1697 N  NE    . ARG A  1 220 ? -20.755 -33.053 -55.700  1.00 36.68  ? 221  ARG A NE    1 
ATOM   1698 C  CZ    . ARG A  1 220 ? -20.112 -31.953 -56.093  1.00 37.95  ? 221  ARG A CZ    1 
ATOM   1699 N  NH1   . ARG A  1 220 ? -19.061 -31.516 -55.410  1.00 31.19  ? 221  ARG A NH1   1 
ATOM   1700 N  NH2   . ARG A  1 220 ? -20.523 -31.285 -57.166  1.00 37.35  ? 221  ARG A NH2   1 
ATOM   1701 N  N     . GLY A  1 221 ? -19.599 -39.251 -52.534  1.00 39.11  ? 222  GLY A N     1 
ATOM   1702 C  CA    . GLY A  1 221 ? -19.761 -39.978 -51.296  1.00 34.97  ? 222  GLY A CA    1 
ATOM   1703 C  C     . GLY A  1 221 ? -20.739 -39.343 -50.342  1.00 36.88  ? 222  GLY A C     1 
ATOM   1704 O  O     . GLY A  1 221 ? -20.898 -39.833 -49.213  1.00 37.42  ? 222  GLY A O     1 
ATOM   1705 N  N     . VAL A  1 222 ? -21.403 -38.273 -50.771  1.00 30.94  ? 223  VAL A N     1 
ATOM   1706 C  CA    . VAL A  1 222 ? -22.362 -37.533 -49.964  1.00 34.61  ? 223  VAL A CA    1 
ATOM   1707 C  C     . VAL A  1 222 ? -23.636 -37.347 -50.777  1.00 34.85  ? 223  VAL A C     1 
ATOM   1708 O  O     . VAL A  1 222 ? -23.570 -37.173 -51.997  1.00 35.94  ? 223  VAL A O     1 
ATOM   1709 C  CB    . VAL A  1 222 ? -21.787 -36.167 -49.546  1.00 33.36  ? 223  VAL A CB    1 
ATOM   1710 C  CG1   . VAL A  1 222 ? -22.829 -35.345 -48.812  1.00 30.75  ? 223  VAL A CG1   1 
ATOM   1711 C  CG2   . VAL A  1 222 ? -20.549 -36.361 -48.693  1.00 37.44  ? 223  VAL A CG2   1 
ATOM   1712 N  N     . SER A  1 223 ? -24.787 -37.392 -50.106  1.00 31.33  ? 224  SER A N     1 
ATOM   1713 C  CA    . SER A  1 223 ? -26.070 -36.987 -50.707  1.00 30.01  ? 224  SER A CA    1 
ATOM   1714 C  C     . SER A  1 223 ? -26.365 -37.897 -51.906  1.00 30.92  ? 224  SER A C     1 
ATOM   1715 O  O     . SER A  1 223 ? -25.941 -39.059 -51.934  1.00 35.49  ? 224  SER A O     1 
ATOM   1716 C  CB    . SER A  1 223 ? -26.052 -35.489 -51.040  1.00 29.33  ? 224  SER A CB    1 
ATOM   1717 O  OG    . SER A  1 223 ? -27.341 -35.055 -51.479  1.00 30.13  ? 224  SER A OG    1 
ATOM   1718 N  N     . PHE A  1 224 ? -27.073 -37.367 -52.908  1.00 34.45  ? 225  PHE A N     1 
ATOM   1719 C  CA    . PHE A  1 224 ? -27.619 -38.147 -54.013  1.00 36.02  ? 225  PHE A CA    1 
ATOM   1720 C  C     . PHE A  1 224 ? -27.425 -37.400 -55.322  1.00 37.84  ? 225  PHE A C     1 
ATOM   1721 O  O     . PHE A  1 224 ? -27.062 -36.220 -55.343  1.00 36.87  ? 225  PHE A O     1 
ATOM   1722 C  CB    . PHE A  1 224 ? -29.118 -38.434 -53.819  1.00 34.74  ? 225  PHE A CB    1 
ATOM   1723 C  CG    . PHE A  1 224 ? -29.456 -38.995 -52.473  1.00 36.25  ? 225  PHE A CG    1 
ATOM   1724 C  CD1   . PHE A  1 224 ? -29.736 -38.160 -51.407  1.00 34.19  ? 225  PHE A CD1   1 
ATOM   1725 C  CD2   . PHE A  1 224 ? -29.458 -40.370 -52.270  1.00 43.57  ? 225  PHE A CD2   1 
ATOM   1726 C  CE1   . PHE A  1 224 ? -30.032 -38.678 -50.159  1.00 41.25  ? 225  PHE A CE1   1 
ATOM   1727 C  CE2   . PHE A  1 224 ? -29.753 -40.910 -51.021  1.00 47.28  ? 225  PHE A CE2   1 
ATOM   1728 C  CZ    . PHE A  1 224 ? -30.040 -40.062 -49.961  1.00 46.84  ? 225  PHE A CZ    1 
ATOM   1729 N  N     . THR A  1 225 ? -27.678 -38.106 -56.423  1.00 34.68  ? 226  THR A N     1 
ATOM   1730 C  CA    . THR A  1 225 ? -27.961 -37.484 -57.706  1.00 31.56  ? 226  THR A CA    1 
ATOM   1731 C  C     . THR A  1 225 ? -29.462 -37.551 -57.944  1.00 35.08  ? 226  THR A C     1 
ATOM   1732 O  O     . THR A  1 225 ? -30.149 -38.415 -57.387  1.00 37.25  ? 226  THR A O     1 
ATOM   1733 C  CB    . THR A  1 225 ? -27.227 -38.169 -58.866  1.00 32.25  ? 226  THR A CB    1 
ATOM   1734 O  OG1   . THR A  1 225 ? -27.357 -39.581 -58.738  1.00 36.15  ? 226  THR A OG1   1 
ATOM   1735 C  CG2   . THR A  1 225 ? -25.742 -37.803 -58.878  1.00 33.65  ? 226  THR A CG2   1 
ATOM   1736 N  N     . PHE A  1 226 ? -29.976 -36.619 -58.749  1.00 29.50  ? 227  PHE A N     1 
ATOM   1737 C  CA    . PHE A  1 226 ? -31.387 -36.631 -59.106  1.00 33.44  ? 227  PHE A CA    1 
ATOM   1738 C  C     . PHE A  1 226 ? -31.541 -36.462 -60.610  1.00 36.08  ? 227  PHE A C     1 
ATOM   1739 O  O     . PHE A  1 226 ? -30.777 -35.733 -61.253  1.00 36.56  ? 227  PHE A O     1 
ATOM   1740 C  CB    . PHE A  1 226 ? -32.191 -35.547 -58.348  1.00 29.95  ? 227  PHE A CB    1 
ATOM   1741 C  CG    . PHE A  1 226 ? -31.622 -34.158 -58.453  1.00 30.92  ? 227  PHE A CG    1 
ATOM   1742 C  CD1   . PHE A  1 226 ? -30.621 -33.735 -57.587  1.00 31.45  ? 227  PHE A CD1   1 
ATOM   1743 C  CD2   . PHE A  1 226 ? -32.127 -33.258 -59.377  1.00 33.74  ? 227  PHE A CD2   1 
ATOM   1744 C  CE1   . PHE A  1 226 ? -30.092 -32.446 -57.671  1.00 33.28  ? 227  PHE A CE1   1 
ATOM   1745 C  CE2   . PHE A  1 226 ? -31.626 -31.963 -59.463  1.00 32.99  ? 227  PHE A CE2   1 
ATOM   1746 C  CZ    . PHE A  1 226 ? -30.604 -31.558 -58.604  1.00 34.14  ? 227  PHE A CZ    1 
ATOM   1747 N  N     . GLY A  1 227 ? -32.542 -37.147 -61.167  1.00 36.19  ? 228  GLY A N     1 
ATOM   1748 C  CA    . GLY A  1 227 ? -32.799 -37.093 -62.589  1.00 33.23  ? 228  GLY A CA    1 
ATOM   1749 C  C     . GLY A  1 227 ? -33.794 -36.009 -62.977  1.00 35.70  ? 228  GLY A C     1 
ATOM   1750 O  O     . GLY A  1 227 ? -34.325 -35.267 -62.145  1.00 29.03  ? 228  GLY A O     1 
ATOM   1751 N  N     . ALA A  1 228 ? -34.061 -35.957 -64.288  1.00 38.39  ? 229  ALA A N     1 
ATOM   1752 C  CA    . ALA A  1 228 ? -34.912 -34.924 -64.869  1.00 38.46  ? 229  ALA A CA    1 
ATOM   1753 C  C     . ALA A  1 228 ? -36.346 -35.000 -64.362  1.00 37.65  ? 229  ALA A C     1 
ATOM   1754 O  O     . ALA A  1 228 ? -37.030 -33.973 -64.275  1.00 36.81  ? 229  ALA A O     1 
ATOM   1755 C  CB    . ALA A  1 228 ? -34.899 -35.047 -66.393  1.00 35.59  ? 229  ALA A CB    1 
ATOM   1756 N  N     . GLU A  1 229 ? -36.827 -36.203 -64.051  1.00 34.54  ? 230  GLU A N     1 
ATOM   1757 C  CA    . GLU A  1 229 ? -38.206 -36.350 -63.602  1.00 32.84  ? 230  GLU A CA    1 
ATOM   1758 C  C     . GLU A  1 229 ? -38.386 -35.779 -62.204  1.00 34.19  ? 230  GLU A C     1 
ATOM   1759 O  O     . GLU A  1 229 ? -39.435 -35.208 -61.887  1.00 35.33  ? 230  GLU A O     1 
ATOM   1760 C  CB    . GLU A  1 229 ? -38.609 -37.824 -63.638  1.00 30.74  ? 230  GLU A CB    1 
ATOM   1761 N  N     . VAL A  1 230 ? -37.376 -35.939 -61.350  1.00 32.55  ? 231  VAL A N     1 
ATOM   1762 C  CA    . VAL A  1 230 ? -37.425 -35.340 -60.022  1.00 34.13  ? 231  VAL A CA    1 
ATOM   1763 C  C     . VAL A  1 230 ? -37.561 -33.825 -60.130  1.00 36.80  ? 231  VAL A C     1 
ATOM   1764 O  O     . VAL A  1 230 ? -38.372 -33.209 -59.425  1.00 36.08  ? 231  VAL A O     1 
ATOM   1765 C  CB    . VAL A  1 230 ? -36.183 -35.751 -59.213  1.00 33.36  ? 231  VAL A CB    1 
ATOM   1766 C  CG1   . VAL A  1 230 ? -36.109 -34.959 -57.927  1.00 37.02  ? 231  VAL A CG1   1 
ATOM   1767 C  CG2   . VAL A  1 230 ? -36.222 -37.250 -58.918  1.00 31.85  ? 231  VAL A CG2   1 
ATOM   1768 N  N     . VAL A  1 231 ? -36.790 -33.208 -61.035  1.00 36.00  ? 232  VAL A N     1 
ATOM   1769 C  CA    . VAL A  1 231 ? -36.900 -31.769 -61.274  1.00 33.06  ? 232  VAL A CA    1 
ATOM   1770 C  C     . VAL A  1 231 ? -38.328 -31.401 -61.661  1.00 34.04  ? 232  VAL A C     1 
ATOM   1771 O  O     . VAL A  1 231 ? -38.957 -30.534 -61.040  1.00 36.18  ? 232  VAL A O     1 
ATOM   1772 C  CB    . VAL A  1 231 ? -35.888 -31.324 -62.352  1.00 29.66  ? 232  VAL A CB    1 
ATOM   1773 C  CG1   . VAL A  1 231 ? -36.193 -29.903 -62.810  1.00 26.58  ? 232  VAL A CG1   1 
ATOM   1774 C  CG2   . VAL A  1 231 ? -34.465 -31.399 -61.817  1.00 27.76  ? 232  VAL A CG2   1 
ATOM   1775 N  N     . ALA A  1 232 ? -38.864 -32.063 -62.691  1.00 35.85  ? 233  ALA A N     1 
ATOM   1776 C  CA    . ALA A  1 232 ? -40.207 -31.745 -63.176  1.00 34.93  ? 233  ALA A CA    1 
ATOM   1777 C  C     . ALA A  1 232 ? -41.255 -31.892 -62.078  1.00 37.15  ? 233  ALA A C     1 
ATOM   1778 O  O     . ALA A  1 232 ? -42.143 -31.041 -61.943  1.00 39.55  ? 233  ALA A O     1 
ATOM   1779 C  CB    . ALA A  1 232 ? -40.556 -32.637 -64.371  1.00 35.90  ? 233  ALA A CB    1 
ATOM   1780 N  N     . LYS A  1 233 ? -41.167 -32.959 -61.278  1.00 35.94  ? 234  LYS A N     1 
ATOM   1781 C  CA    . LYS A  1 233 ? -42.132 -33.154 -60.193  1.00 43.12  ? 234  LYS A CA    1 
ATOM   1782 C  C     . LYS A  1 233 ? -42.018 -32.059 -59.140  1.00 40.15  ? 234  LYS A C     1 
ATOM   1783 O  O     . LYS A  1 233 ? -43.030 -31.587 -58.611  1.00 43.36  ? 234  LYS A O     1 
ATOM   1784 C  CB    . LYS A  1 233 ? -41.932 -34.522 -59.531  1.00 40.82  ? 234  LYS A CB    1 
ATOM   1785 C  CG    . LYS A  1 233 ? -42.390 -35.713 -60.357  1.00 56.26  ? 234  LYS A CG    1 
ATOM   1786 C  CD    . LYS A  1 233 ? -42.132 -37.025 -59.611  1.00 63.03  ? 234  LYS A CD    1 
ATOM   1787 C  CE    . LYS A  1 233 ? -42.610 -38.234 -60.400  1.00 66.86  ? 234  LYS A CE    1 
ATOM   1788 N  NZ    . LYS A  1 233 ? -42.200 -39.511 -59.742  1.00 68.74  ? 234  LYS A NZ    1 
ATOM   1789 N  N     . PHE A  1 234 ? -40.792 -31.670 -58.797  1.00 34.87  ? 235  PHE A N     1 
ATOM   1790 C  CA    . PHE A  1 234 ? -40.604 -30.654 -57.770  1.00 30.59  ? 235  PHE A CA    1 
ATOM   1791 C  C     . PHE A  1 234 ? -41.181 -29.311 -58.219  1.00 30.55  ? 235  PHE A C     1 
ATOM   1792 O  O     . PHE A  1 234 ? -41.900 -28.651 -57.459  1.00 32.78  ? 235  PHE A O     1 
ATOM   1793 C  CB    . PHE A  1 234 ? -39.115 -30.553 -57.439  1.00 31.08  ? 235  PHE A CB    1 
ATOM   1794 C  CG    . PHE A  1 234 ? -38.771 -29.462 -56.467  1.00 36.48  ? 235  PHE A CG    1 
ATOM   1795 C  CD1   . PHE A  1 234 ? -38.917 -29.656 -55.105  1.00 41.93  ? 235  PHE A CD1   1 
ATOM   1796 C  CD2   . PHE A  1 234 ? -38.296 -28.235 -56.920  1.00 35.71  ? 235  PHE A CD2   1 
ATOM   1797 C  CE1   . PHE A  1 234 ? -38.599 -28.653 -54.216  1.00 38.29  ? 235  PHE A CE1   1 
ATOM   1798 C  CE2   . PHE A  1 234 ? -37.967 -27.232 -56.029  1.00 36.57  ? 235  PHE A CE2   1 
ATOM   1799 C  CZ    . PHE A  1 234 ? -38.125 -27.439 -54.677  1.00 33.87  ? 235  PHE A CZ    1 
ATOM   1800 N  N     . LEU A  1 235 ? -40.903 -28.906 -59.459  1.00 30.88  ? 236  LEU A N     1 
ATOM   1801 C  CA    . LEU A  1 235 ? -41.422 -27.633 -59.957  1.00 34.24  ? 236  LEU A CA    1 
ATOM   1802 C  C     . LEU A  1 235 ? -42.944 -27.642 -60.040  1.00 40.04  ? 236  LEU A C     1 
ATOM   1803 O  O     . LEU A  1 235 ? -43.598 -26.635 -59.732  1.00 42.49  ? 236  LEU A O     1 
ATOM   1804 C  CB    . LEU A  1 235 ? -40.834 -27.326 -61.331  1.00 33.12  ? 236  LEU A CB    1 
ATOM   1805 C  CG    . LEU A  1 235 ? -39.322 -27.189 -61.474  1.00 34.96  ? 236  LEU A CG    1 
ATOM   1806 C  CD1   . LEU A  1 235 ? -39.020 -26.836 -62.910  1.00 34.46  ? 236  LEU A CD1   1 
ATOM   1807 C  CD2   . LEU A  1 235 ? -38.764 -26.133 -60.520  1.00 34.48  ? 236  LEU A CD2   1 
ATOM   1808 N  N     . HIS A  1 236 ? -43.525 -28.758 -60.482  1.00 39.24  ? 237  HIS A N     1 
ATOM   1809 C  CA    . HIS A  1 236 ? -44.977 -28.827 -60.604  1.00 40.91  ? 237  HIS A CA    1 
ATOM   1810 C  C     . HIS A  1 236 ? -45.642 -28.748 -59.238  1.00 41.84  ? 237  HIS A C     1 
ATOM   1811 O  O     . HIS A  1 236 ? -46.619 -28.013 -59.058  1.00 43.97  ? 237  HIS A O     1 
ATOM   1812 C  CB    . HIS A  1 236 ? -45.385 -30.110 -61.324  1.00 38.58  ? 237  HIS A CB    1 
ATOM   1813 C  CG    . HIS A  1 236 ? -46.864 -30.301 -61.418  1.00 47.68  ? 237  HIS A CG    1 
ATOM   1814 N  ND1   . HIS A  1 236 ? -47.633 -29.693 -62.388  1.00 50.74  ? 237  HIS A ND1   1 
ATOM   1815 C  CD2   . HIS A  1 236 ? -47.719 -31.030 -60.661  1.00 50.76  ? 237  HIS A CD2   1 
ATOM   1816 C  CE1   . HIS A  1 236 ? -48.897 -30.041 -62.227  1.00 50.42  ? 237  HIS A CE1   1 
ATOM   1817 N  NE2   . HIS A  1 236 ? -48.978 -30.850 -61.186  1.00 51.81  ? 237  HIS A NE2   1 
ATOM   1818 N  N     . LYS A  1 237 ? -45.105 -29.477 -58.258  1.00 37.95  ? 238  LYS A N     1 
ATOM   1819 C  CA    . LYS A  1 237 ? -45.706 -29.494 -56.930  1.00 37.89  ? 238  LYS A CA    1 
ATOM   1820 C  C     . LYS A  1 237 ? -45.688 -28.110 -56.288  1.00 37.35  ? 238  LYS A C     1 
ATOM   1821 O  O     . LYS A  1 237 ? -46.656 -27.708 -55.640  1.00 38.60  ? 238  LYS A O     1 
ATOM   1822 C  CB    . LYS A  1 237 ? -44.971 -30.506 -56.054  1.00 39.88  ? 238  LYS A CB    1 
ATOM   1823 C  CG    . LYS A  1 237 ? -45.477 -30.617 -54.635  1.00 45.44  ? 238  LYS A CG    1 
ATOM   1824 C  CD    . LYS A  1 237 ? -44.669 -31.666 -53.877  1.00 44.58  ? 238  LYS A CD    1 
ATOM   1825 C  CE    . LYS A  1 237 ? -45.069 -31.722 -52.419  1.00 43.03  ? 238  LYS A CE    1 
ATOM   1826 N  NZ    . LYS A  1 237 ? -44.163 -32.618 -51.660  1.00 44.60  ? 238  LYS A NZ    1 
ATOM   1827 N  N     . HIS A  1 238 ? -44.602 -27.361 -56.459  1.00 34.52  ? 239  HIS A N     1 
ATOM   1828 C  CA    . HIS A  1 238 ? -44.454 -26.080 -55.784  1.00 38.46  ? 239  HIS A CA    1 
ATOM   1829 C  C     . HIS A  1 238 ? -44.727 -24.890 -56.697  1.00 38.09  ? 239  HIS A C     1 
ATOM   1830 O  O     . HIS A  1 238 ? -44.460 -23.755 -56.303  1.00 38.46  ? 239  HIS A O     1 
ATOM   1831 C  CB    . HIS A  1 238 ? -43.060 -25.986 -55.159  1.00 31.04  ? 239  HIS A CB    1 
ATOM   1832 C  CG    . HIS A  1 238 ? -42.755 -27.128 -54.247  1.00 30.40  ? 239  HIS A CG    1 
ATOM   1833 N  ND1   . HIS A  1 238 ? -43.260 -27.208 -52.969  1.00 33.42  ? 239  HIS A ND1   1 
ATOM   1834 C  CD2   . HIS A  1 238 ? -42.022 -28.251 -54.434  1.00 32.14  ? 239  HIS A CD2   1 
ATOM   1835 C  CE1   . HIS A  1 238 ? -42.831 -28.320 -52.397  1.00 34.94  ? 239  HIS A CE1   1 
ATOM   1836 N  NE2   . HIS A  1 238 ? -42.083 -28.976 -53.267  1.00 32.22  ? 239  HIS A NE2   1 
ATOM   1837 N  N     . ASP A  1 239 ? -45.285 -25.130 -57.884  1.00 36.31  ? 240  ASP A N     1 
ATOM   1838 C  CA    . ASP A  1 239 ? -45.598 -24.084 -58.859  1.00 39.00  ? 240  ASP A CA    1 
ATOM   1839 C  C     . ASP A  1 239 ? -44.381 -23.212 -59.147  1.00 37.58  ? 240  ASP A C     1 
ATOM   1840 O  O     . ASP A  1 239 ? -44.468 -21.987 -59.225  1.00 40.15  ? 240  ASP A O     1 
ATOM   1841 C  CB    . ASP A  1 239 ? -46.784 -23.232 -58.415  1.00 50.41  ? 240  ASP A CB    1 
ATOM   1842 C  CG    . ASP A  1 239 ? -47.472 -22.550 -59.592  1.00 64.60  ? 240  ASP A CG    1 
ATOM   1843 O  OD1   . ASP A  1 239 ? -48.110 -23.256 -60.407  1.00 70.94  ? 240  ASP A OD1   1 
ATOM   1844 O  OD2   . ASP A  1 239 ? -47.367 -21.311 -59.711  1.00 70.34  ? 240  ASP A OD2   1 
ATOM   1845 N  N     . LEU A  1 240 ? -43.233 -23.855 -59.293  1.00 33.41  ? 241  LEU A N     1 
ATOM   1846 C  CA    . LEU A  1 240 ? -42.004 -23.178 -59.645  1.00 31.48  ? 241  LEU A CA    1 
ATOM   1847 C  C     . LEU A  1 240 ? -41.715 -23.367 -61.128  1.00 36.01  ? 241  LEU A C     1 
ATOM   1848 O  O     . LEU A  1 240 ? -42.160 -24.327 -61.755  1.00 41.72  ? 241  LEU A O     1 
ATOM   1849 C  CB    . LEU A  1 240 ? -40.840 -23.697 -58.797  1.00 32.52  ? 241  LEU A CB    1 
ATOM   1850 C  CG    . LEU A  1 240 ? -40.970 -23.459 -57.285  1.00 33.98  ? 241  LEU A CG    1 
ATOM   1851 C  CD1   . LEU A  1 240 ? -39.998 -24.351 -56.509  1.00 33.23  ? 241  LEU A CD1   1 
ATOM   1852 C  CD2   . LEU A  1 240 ? -40.768 -21.994 -56.928  1.00 34.08  ? 241  LEU A CD2   1 
ATOM   1853 N  N     . ASP A  1 241 ? -40.968 -22.423 -61.686  1.00 33.92  ? 242  ASP A N     1 
ATOM   1854 C  CA    . ASP A  1 241 ? -40.544 -22.515 -63.072  1.00 31.08  ? 242  ASP A CA    1 
ATOM   1855 C  C     . ASP A  1 241 ? -39.106 -22.987 -63.222  1.00 33.64  ? 242  ASP A C     1 
ATOM   1856 O  O     . ASP A  1 241 ? -38.770 -23.582 -64.249  1.00 36.21  ? 242  ASP A O     1 
ATOM   1857 C  CB    . ASP A  1 241 ? -40.692 -21.155 -63.762  1.00 32.14  ? 242  ASP A CB    1 
ATOM   1858 C  CG    . ASP A  1 241 ? -42.155 -20.758 -64.003  1.00 40.95  ? 242  ASP A CG    1 
ATOM   1859 O  OD1   . ASP A  1 241 ? -43.080 -21.530 -63.663  1.00 45.80  ? 242  ASP A OD1   1 
ATOM   1860 O  OD2   . ASP A  1 241 ? -42.376 -19.646 -64.521  1.00 42.49  ? 242  ASP A OD2   1 
ATOM   1861 N  N     . LEU A  1 242 ? -38.244 -22.756 -62.234  1.00 31.93  ? 243  LEU A N     1 
ATOM   1862 C  CA    . LEU A  1 242 ? -36.827 -22.997 -62.469  1.00 24.92  ? 243  LEU A CA    1 
ATOM   1863 C  C     . LEU A  1 242 ? -36.116 -23.332 -61.170  1.00 29.18  ? 243  LEU A C     1 
ATOM   1864 O  O     . LEU A  1 242 ? -36.422 -22.762 -60.123  1.00 32.41  ? 243  LEU A O     1 
ATOM   1865 C  CB    . LEU A  1 242 ? -36.174 -21.763 -63.109  1.00 27.11  ? 243  LEU A CB    1 
ATOM   1866 C  CG    . LEU A  1 242 ? -34.663 -21.762 -63.348  1.00 32.90  ? 243  LEU A CG    1 
ATOM   1867 C  CD1   . LEU A  1 242 ? -34.289 -22.830 -64.378  1.00 31.02  ? 243  LEU A CD1   1 
ATOM   1868 C  CD2   . LEU A  1 242 ? -34.211 -20.386 -63.819  1.00 30.77  ? 243  LEU A CD2   1 
ATOM   1869 N  N     . ILE A  1 243 ? -35.150 -24.239 -61.255  1.00 29.68  ? 244  ILE A N     1 
ATOM   1870 C  CA    . ILE A  1 243 ? -34.153 -24.427 -60.212  1.00 25.70  ? 244  ILE A CA    1 
ATOM   1871 C  C     . ILE A  1 243 ? -32.864 -23.784 -60.687  1.00 29.37  ? 244  ILE A C     1 
ATOM   1872 O  O     . ILE A  1 243 ? -32.445 -23.981 -61.834  1.00 31.88  ? 244  ILE A O     1 
ATOM   1873 C  CB    . ILE A  1 243 ? -33.936 -25.914 -59.894  1.00 31.30  ? 244  ILE A CB    1 
ATOM   1874 C  CG1   . ILE A  1 243 ? -35.219 -26.520 -59.315  1.00 30.89  ? 244  ILE A CG1   1 
ATOM   1875 C  CG2   . ILE A  1 243 ? -32.764 -26.080 -58.919  1.00 26.59  ? 244  ILE A CG2   1 
ATOM   1876 C  CD1   . ILE A  1 243 ? -35.244 -28.008 -59.367  1.00 34.69  ? 244  ILE A CD1   1 
ATOM   1877 N  N     . CYS A  1 244 ? -32.247 -23.000 -59.821  1.00 31.19  ? 245  CYS A N     1 
ATOM   1878 C  CA    . CYS A  1 244 ? -30.994 -22.327 -60.124  1.00 32.02  ? 245  CYS A CA    1 
ATOM   1879 C  C     . CYS A  1 244 ? -29.987 -22.761 -59.077  1.00 31.05  ? 245  CYS A C     1 
ATOM   1880 O  O     . CYS A  1 244 ? -30.162 -22.469 -57.888  1.00 30.42  ? 245  CYS A O     1 
ATOM   1881 C  CB    . CYS A  1 244 ? -31.179 -20.809 -60.120  1.00 38.95  ? 245  CYS A CB    1 
ATOM   1882 S  SG    . CYS A  1 244 ? -29.695 -19.928 -60.574  1.00 40.30  ? 245  CYS A SG    1 
ATOM   1883 N  N     . ARG A  1 245 ? -28.939 -23.461 -59.500  1.00 28.22  ? 246  ARG A N     1 
ATOM   1884 C  CA    . ARG A  1 245 ? -27.981 -23.994 -58.544  1.00 27.55  ? 246  ARG A CA    1 
ATOM   1885 C  C     . ARG A  1 245 ? -26.572 -23.873 -59.118  1.00 28.28  ? 246  ARG A C     1 
ATOM   1886 O  O     . ARG A  1 245 ? -26.369 -23.437 -60.255  1.00 32.54  ? 246  ARG A O     1 
ATOM   1887 C  CB    . ARG A  1 245 ? -28.331 -25.449 -58.168  1.00 28.20  ? 246  ARG A CB    1 
ATOM   1888 C  CG    . ARG A  1 245 ? -28.608 -26.339 -59.387  1.00 29.94  ? 246  ARG A CG    1 
ATOM   1889 C  CD    . ARG A  1 245 ? -27.302 -26.940 -59.960  1.00 28.64  ? 246  ARG A CD    1 
ATOM   1890 N  NE    . ARG A  1 245 ? -26.694 -27.888 -59.038  1.00 30.39  ? 246  ARG A NE    1 
ATOM   1891 C  CZ    . ARG A  1 245 ? -25.699 -28.715 -59.344  1.00 30.52  ? 246  ARG A CZ    1 
ATOM   1892 N  NH1   . ARG A  1 245 ? -25.179 -28.714 -60.565  1.00 31.83  ? 246  ARG A NH1   1 
ATOM   1893 N  NH2   . ARG A  1 245 ? -25.229 -29.552 -58.428  1.00 29.52  ? 246  ARG A NH2   1 
ATOM   1894 N  N     . ALA A  1 246 ? -25.590 -24.277 -58.317  1.00 27.26  ? 247  ALA A N     1 
ATOM   1895 C  CA    . ALA A  1 246 ? -24.193 -24.125 -58.686  1.00 29.92  ? 247  ALA A CA    1 
ATOM   1896 C  C     . ALA A  1 246 ? -23.463 -25.457 -58.506  1.00 31.88  ? 247  ALA A C     1 
ATOM   1897 O  O     . ALA A  1 246 ? -23.890 -26.472 -59.066  1.00 31.09  ? 247  ALA A O     1 
ATOM   1898 C  CB    . ALA A  1 246 ? -23.560 -23.011 -57.853  1.00 24.63  ? 247  ALA A CB    1 
ATOM   1899 N  N     . HIS A  1 247 ? -22.347 -25.453 -57.771  1.00 29.82  ? 248  HIS A N     1 
ATOM   1900 C  CA    . HIS A  1 247 ? -21.767 -26.672 -57.201  1.00 29.10  ? 248  HIS A CA    1 
ATOM   1901 C  C     . HIS A  1 247 ? -20.961 -27.512 -58.194  1.00 31.39  ? 248  HIS A C     1 
ATOM   1902 O  O     . HIS A  1 247 ? -20.096 -28.280 -57.763  1.00 38.65  ? 248  HIS A O     1 
ATOM   1903 C  CB    . HIS A  1 247 ? -22.892 -27.511 -56.564  1.00 29.33  ? 248  HIS A CB    1 
ATOM   1904 C  CG    . HIS A  1 247 ? -22.433 -28.617 -55.665  1.00 30.10  ? 248  HIS A CG    1 
ATOM   1905 N  ND1   . HIS A  1 247 ? -21.362 -28.501 -54.803  1.00 32.68  ? 248  HIS A ND1   1 
ATOM   1906 C  CD2   . HIS A  1 247 ? -22.924 -29.869 -55.491  1.00 29.41  ? 248  HIS A CD2   1 
ATOM   1907 C  CE1   . HIS A  1 247 ? -21.218 -29.633 -54.132  1.00 29.55  ? 248  HIS A CE1   1 
ATOM   1908 N  NE2   . HIS A  1 247 ? -22.160 -30.476 -54.525  1.00 29.55  ? 248  HIS A NE2   1 
ATOM   1909 N  N     . GLN A  1 248 ? -21.208 -27.397 -59.505  1.00 26.88  ? 249  GLN A N     1 
ATOM   1910 C  CA    . GLN A  1 248 ? -20.447 -28.158 -60.504  1.00 31.45  ? 249  GLN A CA    1 
ATOM   1911 C  C     . GLN A  1 248 ? -19.838 -27.234 -61.554  1.00 33.56  ? 249  GLN A C     1 
ATOM   1912 O  O     . GLN A  1 248 ? -20.531 -26.371 -62.111  1.00 35.75  ? 249  GLN A O     1 
ATOM   1913 C  CB    . GLN A  1 248 ? -21.332 -29.211 -61.184  1.00 32.33  ? 249  GLN A CB    1 
ATOM   1914 C  CG    . GLN A  1 248 ? -21.628 -30.388 -60.276  1.00 30.84  ? 249  GLN A CG    1 
ATOM   1915 C  CD    . GLN A  1 248 ? -22.525 -31.426 -60.916  1.00 39.66  ? 249  GLN A CD    1 
ATOM   1916 O  OE1   . GLN A  1 248 ? -23.674 -31.146 -61.263  1.00 37.47  ? 249  GLN A OE1   1 
ATOM   1917 N  NE2   . GLN A  1 248 ? -22.006 -32.644 -61.068  1.00 37.43  ? 249  GLN A NE2   1 
ATOM   1918 N  N     . VAL A  1 249 ? -18.543 -27.407 -61.825  1.00 34.97  ? 250  VAL A N     1 
ATOM   1919 C  CA    . VAL A  1 249 ? -17.904 -26.624 -62.880  1.00 36.64  ? 250  VAL A CA    1 
ATOM   1920 C  C     . VAL A  1 249 ? -18.521 -27.007 -64.219  1.00 39.01  ? 250  VAL A C     1 
ATOM   1921 O  O     . VAL A  1 249 ? -18.637 -28.193 -64.551  1.00 38.45  ? 250  VAL A O     1 
ATOM   1922 C  CB    . VAL A  1 249 ? -16.377 -26.826 -62.871  1.00 34.54  ? 250  VAL A CB    1 
ATOM   1923 C  CG1   . VAL A  1 249 ? -16.008 -28.299 -62.883  1.00 44.59  ? 250  VAL A CG1   1 
ATOM   1924 C  CG2   . VAL A  1 249 ? -15.723 -26.123 -64.047  1.00 34.77  ? 250  VAL A CG2   1 
ATOM   1925 N  N     . VAL A  1 250 ? -18.962 -26.007 -64.984  1.00 38.18  ? 251  VAL A N     1 
ATOM   1926 C  CA    . VAL A  1 250 ? -19.525 -26.269 -66.303  1.00 35.61  ? 251  VAL A CA    1 
ATOM   1927 C  C     . VAL A  1 250 ? -18.744 -25.467 -67.335  1.00 39.46  ? 251  VAL A C     1 
ATOM   1928 O  O     . VAL A  1 250 ? -18.307 -24.340 -67.076  1.00 41.43  ? 251  VAL A O     1 
ATOM   1929 C  CB    . VAL A  1 250 ? -21.034 -25.945 -66.362  1.00 33.87  ? 251  VAL A CB    1 
ATOM   1930 C  CG1   . VAL A  1 250 ? -21.835 -26.931 -65.481  1.00 32.17  ? 251  VAL A CG1   1 
ATOM   1931 C  CG2   . VAL A  1 250 ? -21.295 -24.496 -65.937  1.00 31.00  ? 251  VAL A CG2   1 
ATOM   1932 N  N     . GLU A  1 251 ? -18.588 -26.059 -68.522  1.00 40.05  ? 252  GLU A N     1 
ATOM   1933 C  CA    . GLU A  1 251 ? -17.650 -25.533 -69.513  1.00 46.47  ? 252  GLU A CA    1 
ATOM   1934 C  C     . GLU A  1 251 ? -17.982 -24.099 -69.910  1.00 45.79  ? 252  GLU A C     1 
ATOM   1935 O  O     . GLU A  1 251 ? -17.083 -23.256 -70.018  1.00 42.58  ? 252  GLU A O     1 
ATOM   1936 C  CB    . GLU A  1 251 ? -17.635 -26.436 -70.744  1.00 50.23  ? 252  GLU A CB    1 
ATOM   1937 C  CG    . GLU A  1 251 ? -16.868 -25.850 -71.920  1.00 64.43  ? 252  GLU A CG    1 
ATOM   1938 C  CD    . GLU A  1 251 ? -17.033 -26.665 -73.199  1.00 73.51  ? 252  GLU A CD    1 
ATOM   1939 O  OE1   . GLU A  1 251 ? -17.460 -27.840 -73.103  1.00 72.47  ? 252  GLU A OE1   1 
ATOM   1940 O  OE2   . GLU A  1 251 ? -16.740 -26.126 -74.293  1.00 75.32  ? 252  GLU A OE2   1 
ATOM   1941 N  N     . ASP A  1 252 ? -19.262 -23.802 -70.126  1.00 42.97  ? 253  ASP A N     1 
ATOM   1942 C  CA    . ASP A  1 252 ? -19.688 -22.499 -70.613  1.00 41.95  ? 253  ASP A CA    1 
ATOM   1943 C  C     . ASP A  1 252 ? -20.119 -21.558 -69.501  1.00 40.59  ? 253  ASP A C     1 
ATOM   1944 O  O     . ASP A  1 252 ? -20.716 -20.523 -69.782  1.00 40.76  ? 253  ASP A O     1 
ATOM   1945 C  CB    . ASP A  1 252 ? -20.827 -22.657 -71.618  1.00 48.40  ? 253  ASP A CB    1 
ATOM   1946 C  CG    . ASP A  1 252 ? -20.423 -23.475 -72.816  1.00 54.11  ? 253  ASP A CG    1 
ATOM   1947 O  OD1   . ASP A  1 252 ? -19.230 -23.446 -73.170  1.00 59.10  ? 253  ASP A OD1   1 
ATOM   1948 O  OD2   . ASP A  1 252 ? -21.292 -24.162 -73.389  1.00 59.90  ? 253  ASP A OD2   1 
ATOM   1949 N  N     . GLY A  1 253 ? -19.819 -21.872 -68.250  1.00 39.81  ? 254  GLY A N     1 
ATOM   1950 C  CA    . GLY A  1 253 ? -20.241 -21.046 -67.143  1.00 36.93  ? 254  GLY A CA    1 
ATOM   1951 C  C     . GLY A  1 253 ? -21.674 -21.273 -66.705  1.00 34.74  ? 254  GLY A C     1 
ATOM   1952 O  O     . GLY A  1 253 ? -21.985 -21.084 -65.524  1.00 35.35  ? 254  GLY A O     1 
ATOM   1953 N  N     . TYR A  1 254 ? -22.554 -21.679 -67.623  1.00 36.52  ? 255  TYR A N     1 
ATOM   1954 C  CA    . TYR A  1 254 ? -23.911 -22.061 -67.265  1.00 35.11  ? 255  TYR A CA    1 
ATOM   1955 C  C     . TYR A  1 254 ? -24.342 -23.242 -68.114  1.00 39.27  ? 255  TYR A C     1 
ATOM   1956 O  O     . TYR A  1 254 ? -23.948 -23.366 -69.276  1.00 40.53  ? 255  TYR A O     1 
ATOM   1957 C  CB    . TYR A  1 254 ? -24.919 -20.908 -67.418  1.00 31.21  ? 255  TYR A CB    1 
ATOM   1958 C  CG    . TYR A  1 254 ? -25.253 -20.547 -68.849  1.00 39.62  ? 255  TYR A CG    1 
ATOM   1959 C  CD1   . TYR A  1 254 ? -24.448 -19.657 -69.565  1.00 40.84  ? 255  TYR A CD1   1 
ATOM   1960 C  CD2   . TYR A  1 254 ? -26.376 -21.070 -69.482  1.00 39.57  ? 255  TYR A CD2   1 
ATOM   1961 C  CE1   . TYR A  1 254 ? -24.753 -19.302 -70.874  1.00 39.69  ? 255  TYR A CE1   1 
ATOM   1962 C  CE2   . TYR A  1 254 ? -26.685 -20.724 -70.790  1.00 41.36  ? 255  TYR A CE2   1 
ATOM   1963 C  CZ    . TYR A  1 254 ? -25.871 -19.837 -71.477  1.00 40.26  ? 255  TYR A CZ    1 
ATOM   1964 O  OH    . TYR A  1 254 ? -26.175 -19.490 -72.771  1.00 41.21  ? 255  TYR A OH    1 
ATOM   1965 N  N     . GLU A  1 255 ? -25.151 -24.119 -67.516  1.00 34.54  ? 256  GLU A N     1 
ATOM   1966 C  CA    . GLU A  1 255 ? -25.582 -25.319 -68.217  1.00 35.31  ? 256  GLU A CA    1 
ATOM   1967 C  C     . GLU A  1 255 ? -27.011 -25.659 -67.823  1.00 33.04  ? 256  GLU A C     1 
ATOM   1968 O  O     . GLU A  1 255 ? -27.342 -25.698 -66.633  1.00 30.61  ? 256  GLU A O     1 
ATOM   1969 C  CB    . GLU A  1 255 ? -24.642 -26.486 -67.906  1.00 38.11  ? 256  GLU A CB    1 
ATOM   1970 C  CG    . GLU A  1 255 ? -24.753 -27.658 -68.850  1.00 39.04  ? 256  GLU A CG    1 
ATOM   1971 C  CD    . GLU A  1 255 ? -23.538 -28.546 -68.767  1.00 46.51  ? 256  GLU A CD    1 
ATOM   1972 O  OE1   . GLU A  1 255 ? -22.456 -28.143 -69.247  1.00 55.77  ? 256  GLU A OE1   1 
ATOM   1973 O  OE2   . GLU A  1 255 ? -23.658 -29.630 -68.172  1.00 50.49  ? 256  GLU A OE2   1 
ATOM   1974 N  N     . PHE A  1 256 ? -27.846 -25.900 -68.831  1.00 35.13  ? 257  PHE A N     1 
ATOM   1975 C  CA    . PHE A  1 256 ? -29.235 -26.276 -68.637  1.00 31.66  ? 257  PHE A CA    1 
ATOM   1976 C  C     . PHE A  1 256 ? -29.351 -27.767 -68.355  1.00 34.63  ? 257  PHE A C     1 
ATOM   1977 O  O     . PHE A  1 256 ? -28.514 -28.574 -68.763  1.00 40.14  ? 257  PHE A O     1 
ATOM   1978 C  CB    . PHE A  1 256 ? -30.074 -25.941 -69.874  1.00 35.66  ? 257  PHE A CB    1 
ATOM   1979 C  CG    . PHE A  1 256 ? -30.268 -24.464 -70.105  1.00 38.56  ? 257  PHE A CG    1 
ATOM   1980 C  CD1   . PHE A  1 256 ? -30.794 -23.653 -69.110  1.00 38.13  ? 257  PHE A CD1   1 
ATOM   1981 C  CD2   . PHE A  1 256 ? -29.936 -23.895 -71.328  1.00 39.51  ? 257  PHE A CD2   1 
ATOM   1982 C  CE1   . PHE A  1 256 ? -30.977 -22.295 -69.320  1.00 38.14  ? 257  PHE A CE1   1 
ATOM   1983 C  CE2   . PHE A  1 256 ? -30.123 -22.543 -71.553  1.00 41.12  ? 257  PHE A CE2   1 
ATOM   1984 C  CZ    . PHE A  1 256 ? -30.642 -21.738 -70.539  1.00 38.96  ? 257  PHE A CZ    1 
ATOM   1985 N  N     . PHE A  1 257 ? -30.430 -28.131 -67.675  1.00 35.33  ? 258  PHE A N     1 
ATOM   1986 C  CA    . PHE A  1 257 ? -30.734 -29.522 -67.392  1.00 34.35  ? 258  PHE A CA    1 
ATOM   1987 C  C     . PHE A  1 257 ? -32.247 -29.676 -67.438  1.00 36.21  ? 258  PHE A C     1 
ATOM   1988 O  O     . PHE A  1 257 ? -32.979 -28.738 -67.109  1.00 39.13  ? 258  PHE A O     1 
ATOM   1989 C  CB    . PHE A  1 257 ? -30.151 -29.935 -66.033  1.00 30.64  ? 258  PHE A CB    1 
ATOM   1990 C  CG    . PHE A  1 257 ? -30.452 -31.360 -65.628  1.00 34.79  ? 258  PHE A CG    1 
ATOM   1991 C  CD1   . PHE A  1 257 ? -29.776 -32.424 -66.200  1.00 35.48  ? 258  PHE A CD1   1 
ATOM   1992 C  CD2   . PHE A  1 257 ? -31.390 -31.626 -64.639  1.00 34.16  ? 258  PHE A CD2   1 
ATOM   1993 C  CE1   . PHE A  1 257 ? -30.046 -33.736 -65.802  1.00 37.40  ? 258  PHE A CE1   1 
ATOM   1994 C  CE2   . PHE A  1 257 ? -31.668 -32.937 -64.243  1.00 32.77  ? 258  PHE A CE2   1 
ATOM   1995 C  CZ    . PHE A  1 257 ? -30.996 -33.984 -64.828  1.00 33.37  ? 258  PHE A CZ    1 
ATOM   1996 N  N     . ALA A  1 258 ? -32.704 -30.835 -67.908  1.00 36.87  ? 259  ALA A N     1 
ATOM   1997 C  CA    . ALA A  1 258 ? -34.122 -31.193 -67.902  1.00 38.31  ? 259  ALA A CA    1 
ATOM   1998 C  C     . ALA A  1 258 ? -34.969 -30.163 -68.654  1.00 39.30  ? 259  ALA A C     1 
ATOM   1999 O  O     . ALA A  1 258 ? -35.936 -29.606 -68.126  1.00 47.21  ? 259  ALA A O     1 
ATOM   2000 C  CB    . ALA A  1 258 ? -34.625 -31.368 -66.464  1.00 36.36  ? 259  ALA A CB    1 
ATOM   2001 N  N     . LYS A  1 259 ? -34.591 -29.921 -69.909  1.00 36.62  ? 260  LYS A N     1 
ATOM   2002 C  CA    . LYS A  1 259 ? -35.336 -29.010 -70.780  1.00 42.81  ? 260  LYS A CA    1 
ATOM   2003 C  C     . LYS A  1 259 ? -35.425 -27.611 -70.170  1.00 39.56  ? 260  LYS A C     1 
ATOM   2004 O  O     . LYS A  1 259 ? -36.482 -26.981 -70.154  1.00 39.35  ? 260  LYS A O     1 
ATOM   2005 C  CB    . LYS A  1 259 ? -36.731 -29.565 -71.081  1.00 50.28  ? 260  LYS A CB    1 
ATOM   2006 C  CG    . LYS A  1 259 ? -36.820 -30.390 -72.348  1.00 57.85  ? 260  LYS A CG    1 
ATOM   2007 C  CD    . LYS A  1 259 ? -36.851 -29.493 -73.576  1.00 61.27  ? 260  LYS A CD    1 
ATOM   2008 N  N     . ARG A  1 260 ? -34.295 -27.136 -69.648  1.00 39.35  ? 261  ARG A N     1 
ATOM   2009 C  CA    . ARG A  1 260 ? -34.146 -25.786 -69.107  1.00 32.97  ? 261  ARG A CA    1 
ATOM   2010 C  C     . ARG A  1 260 ? -35.002 -25.550 -67.862  1.00 36.68  ? 261  ARG A C     1 
ATOM   2011 O  O     . ARG A  1 260 ? -35.295 -24.401 -67.509  1.00 37.41  ? 261  ARG A O     1 
ATOM   2012 C  CB    . ARG A  1 260 ? -34.441 -24.730 -70.176  1.00 34.96  ? 261  ARG A CB    1 
ATOM   2013 C  CG    . ARG A  1 260 ? -33.420 -24.723 -71.319  1.00 43.54  ? 261  ARG A CG    1 
ATOM   2014 C  CD    . ARG A  1 260 ? -33.860 -23.851 -72.481  1.00 45.59  ? 261  ARG A CD    1 
ATOM   2015 N  NE    . ARG A  1 260 ? -35.043 -24.407 -73.136  1.00 53.71  ? 261  ARG A NE    1 
ATOM   2016 C  CZ    . ARG A  1 260 ? -35.000 -25.244 -74.166  1.00 52.46  ? 261  ARG A CZ    1 
ATOM   2017 N  NH1   . ARG A  1 260 ? -36.129 -25.695 -74.681  1.00 59.82  ? 261  ARG A NH1   1 
ATOM   2018 N  NH2   . ARG A  1 260 ? -33.835 -25.625 -74.679  1.00 45.51  ? 261  ARG A NH2   1 
ATOM   2019 N  N     . GLN A  1 261 ? -35.413 -26.622 -67.187  1.00 33.63  ? 262  GLN A N     1 
ATOM   2020 C  CA    . GLN A  1 261 ? -36.069 -26.485 -65.898  1.00 32.68  ? 262  GLN A CA    1 
ATOM   2021 C  C     . GLN A  1 261 ? -35.069 -26.299 -64.768  1.00 32.08  ? 262  GLN A C     1 
ATOM   2022 O  O     . GLN A  1 261 ? -35.442 -25.839 -63.687  1.00 33.62  ? 262  GLN A O     1 
ATOM   2023 C  CB    . GLN A  1 261 ? -36.940 -27.714 -65.632  1.00 38.14  ? 262  GLN A CB    1 
ATOM   2024 C  CG    . GLN A  1 261 ? -38.161 -27.786 -66.526  1.00 45.89  ? 262  GLN A CG    1 
ATOM   2025 C  CD    . GLN A  1 261 ? -39.017 -29.002 -66.253  1.00 46.92  ? 262  GLN A CD    1 
ATOM   2026 O  OE1   . GLN A  1 261 ? -38.672 -30.126 -66.622  1.00 46.19  ? 262  GLN A OE1   1 
ATOM   2027 N  NE2   . GLN A  1 261 ? -40.142 -28.781 -65.605  1.00 49.75  ? 262  GLN A NE2   1 
ATOM   2028 N  N     . LEU A  1 262 ? -33.815 -26.655 -64.993  1.00 32.37  ? 263  LEU A N     1 
ATOM   2029 C  CA    . LEU A  1 262 ? -32.739 -26.406 -64.051  1.00 32.65  ? 263  LEU A CA    1 
ATOM   2030 C  C     . LEU A  1 262 ? -31.585 -25.738 -64.791  1.00 32.53  ? 263  LEU A C     1 
ATOM   2031 O  O     . LEU A  1 262 ? -31.372 -25.980 -65.985  1.00 33.15  ? 263  LEU A O     1 
ATOM   2032 C  CB    . LEU A  1 262 ? -32.276 -27.719 -63.392  1.00 28.73  ? 263  LEU A CB    1 
ATOM   2033 C  CG    . LEU A  1 262 ? -31.218 -27.655 -62.290  1.00 27.86  ? 263  LEU A CG    1 
ATOM   2034 C  CD1   . LEU A  1 262 ? -31.440 -28.756 -61.242  1.00 27.25  ? 263  LEU A CD1   1 
ATOM   2035 C  CD2   . LEU A  1 262 ? -29.828 -27.753 -62.885  1.00 25.25  ? 263  LEU A CD2   1 
ATOM   2036 N  N     . VAL A  1 263 ? -30.844 -24.888 -64.083  1.00 29.95  ? 264  VAL A N     1 
ATOM   2037 C  CA    . VAL A  1 263 ? -29.612 -24.308 -64.605  1.00 27.43  ? 264  VAL A CA    1 
ATOM   2038 C  C     . VAL A  1 263 ? -28.526 -24.413 -63.539  1.00 29.86  ? 264  VAL A C     1 
ATOM   2039 O  O     . VAL A  1 263 ? -28.771 -24.172 -62.349  1.00 28.85  ? 264  VAL A O     1 
ATOM   2040 C  CB    . VAL A  1 263 ? -29.805 -22.834 -65.076  1.00 35.17  ? 264  VAL A CB    1 
ATOM   2041 C  CG1   . VAL A  1 263 ? -30.140 -21.887 -63.918  1.00 34.00  ? 264  VAL A CG1   1 
ATOM   2042 C  CG2   . VAL A  1 263 ? -28.583 -22.336 -65.834  1.00 35.82  ? 264  VAL A CG2   1 
ATOM   2043 N  N     . THR A  1 264 ? -27.327 -24.793 -63.971  1.00 26.14  ? 265  THR A N     1 
ATOM   2044 C  CA    . THR A  1 264 ? -26.138 -24.789 -63.134  1.00 26.01  ? 265  THR A CA    1 
ATOM   2045 C  C     . THR A  1 264 ? -25.313 -23.554 -63.479  1.00 32.40  ? 265  THR A C     1 
ATOM   2046 O  O     . THR A  1 264 ? -25.005 -23.320 -64.654  1.00 30.90  ? 265  THR A O     1 
ATOM   2047 C  CB    . THR A  1 264 ? -25.306 -26.052 -63.358  1.00 27.44  ? 265  THR A CB    1 
ATOM   2048 O  OG1   . THR A  1 264 ? -26.063 -27.205 -62.970  1.00 28.71  ? 265  THR A OG1   1 
ATOM   2049 C  CG2   . THR A  1 264 ? -24.017 -25.999 -62.561  1.00 30.95  ? 265  THR A CG2   1 
ATOM   2050 N  N     . LEU A  1 265 ? -24.969 -22.769 -62.463  1.00 25.59  ? 266  LEU A N     1 
ATOM   2051 C  CA    . LEU A  1 265 ? -24.153 -21.574 -62.621  1.00 28.64  ? 266  LEU A CA    1 
ATOM   2052 C  C     . LEU A  1 265 ? -22.810 -21.802 -61.958  1.00 30.45  ? 266  LEU A C     1 
ATOM   2053 O  O     . LEU A  1 265 ? -22.746 -22.287 -60.824  1.00 35.37  ? 266  LEU A O     1 
ATOM   2054 C  CB    . LEU A  1 265 ? -24.821 -20.351 -61.994  1.00 31.45  ? 266  LEU A CB    1 
ATOM   2055 C  CG    . LEU A  1 265 ? -26.181 -19.869 -62.504  1.00 37.82  ? 266  LEU A CG    1 
ATOM   2056 C  CD1   . LEU A  1 265 ? -26.614 -18.618 -61.733  1.00 34.77  ? 266  LEU A CD1   1 
ATOM   2057 C  CD2   . LEU A  1 265 ? -26.143 -19.601 -64.001  1.00 34.93  ? 266  LEU A CD2   1 
ATOM   2058 N  N     . PHE A  1 266 ? -21.743 -21.428 -62.651  1.00 28.35  ? 267  PHE A N     1 
ATOM   2059 C  CA    . PHE A  1 266 ? -20.404 -21.493 -62.089  1.00 32.15  ? 267  PHE A CA    1 
ATOM   2060 C  C     . PHE A  1 266 ? -19.678 -20.211 -62.472  1.00 35.13  ? 267  PHE A C     1 
ATOM   2061 O  O     . PHE A  1 266 ? -19.622 -19.858 -63.653  1.00 35.06  ? 267  PHE A O     1 
ATOM   2062 C  CB    . PHE A  1 266 ? -19.665 -22.733 -62.588  1.00 28.98  ? 267  PHE A CB    1 
ATOM   2063 C  CG    . PHE A  1 266 ? -18.537 -23.169 -61.702  1.00 33.71  ? 267  PHE A CG    1 
ATOM   2064 C  CD1   . PHE A  1 266 ? -18.769 -23.995 -60.612  1.00 34.22  ? 267  PHE A CD1   1 
ATOM   2065 C  CD2   . PHE A  1 266 ? -17.236 -22.782 -61.982  1.00 37.49  ? 267  PHE A CD2   1 
ATOM   2066 C  CE1   . PHE A  1 266 ? -17.730 -24.417 -59.810  1.00 32.25  ? 267  PHE A CE1   1 
ATOM   2067 C  CE2   . PHE A  1 266 ? -16.186 -23.199 -61.180  1.00 40.56  ? 267  PHE A CE2   1 
ATOM   2068 C  CZ    . PHE A  1 266 ? -16.433 -24.019 -60.092  1.00 36.40  ? 267  PHE A CZ    1 
ATOM   2069 N  N     . SER A  1 267 ? -19.135 -19.508 -61.482  1.00 29.81  ? 268  SER A N     1 
ATOM   2070 C  CA    . SER A  1 267 ? -18.600 -18.177 -61.714  1.00 31.65  ? 268  SER A CA    1 
ATOM   2071 C  C     . SER A  1 267 ? -17.087 -18.088 -61.552  1.00 33.77  ? 268  SER A C     1 
ATOM   2072 O  O     . SER A  1 267 ? -16.547 -16.984 -61.555  1.00 41.98  ? 268  SER A O     1 
ATOM   2073 C  CB    . SER A  1 267 ? -19.294 -17.179 -60.788  1.00 33.99  ? 268  SER A CB    1 
ATOM   2074 O  OG    . SER A  1 267 ? -20.691 -17.156 -61.050  1.00 33.22  ? 268  SER A OG    1 
ATOM   2075 N  N     . ALA A  1 268 ? -16.380 -19.209 -61.455  1.00 36.14  ? 269  ALA A N     1 
ATOM   2076 C  CA    . ALA A  1 268 ? -14.922 -19.165 -61.395  1.00 34.61  ? 269  ALA A CA    1 
ATOM   2077 C  C     . ALA A  1 268 ? -14.323 -19.684 -62.697  1.00 37.09  ? 269  ALA A C     1 
ATOM   2078 O  O     . ALA A  1 268 ? -14.222 -20.908 -62.887  1.00 38.06  ? 269  ALA A O     1 
ATOM   2079 C  CB    . ALA A  1 268 ? -14.399 -19.973 -60.207  1.00 32.69  ? 269  ALA A CB    1 
ATOM   2080 N  N     . PRO A  1 269 ? -13.899 -18.801 -63.610  1.00 39.65  ? 270  PRO A N     1 
ATOM   2081 C  CA    . PRO A  1 269 ? -13.253 -19.258 -64.848  1.00 39.35  ? 270  PRO A CA    1 
ATOM   2082 C  C     . PRO A  1 269 ? -11.902 -19.893 -64.559  1.00 41.92  ? 270  PRO A C     1 
ATOM   2083 O  O     . PRO A  1 269 ? -11.265 -19.608 -63.538  1.00 43.30  ? 270  PRO A O     1 
ATOM   2084 C  CB    . PRO A  1 269 ? -13.080 -17.968 -65.672  1.00 43.90  ? 270  PRO A CB    1 
ATOM   2085 C  CG    . PRO A  1 269 ? -13.913 -16.927 -64.995  1.00 46.68  ? 270  PRO A CG    1 
ATOM   2086 C  CD    . PRO A  1 269 ? -13.960 -17.334 -63.537  1.00 43.94  ? 270  PRO A CD    1 
ATOM   2087 N  N     . ASN A  1 270 ? -11.462 -20.740 -65.493  1.00 44.02  ? 271  ASN A N     1 
ATOM   2088 C  CA    . ASN A  1 270 ? -10.302 -21.620 -65.326  1.00 49.91  ? 271  ASN A CA    1 
ATOM   2089 C  C     . ASN A  1 270 ? -10.212 -22.139 -63.902  1.00 47.04  ? 271  ASN A C     1 
ATOM   2090 O  O     . ASN A  1 270 ? -9.236  -21.916 -63.191  1.00 46.99  ? 271  ASN A O     1 
ATOM   2091 C  CB    . ASN A  1 270 ? -8.993  -20.937 -65.715  1.00 61.92  ? 271  ASN A CB    1 
ATOM   2092 C  CG    . ASN A  1 270 ? -8.787  -20.893 -67.197  1.00 72.69  ? 271  ASN A CG    1 
ATOM   2093 O  OD1   . ASN A  1 270 ? -8.020  -21.662 -67.786  1.00 78.38  ? 271  ASN A OD1   1 
ATOM   2094 N  ND2   . ASN A  1 270 ? -9.481  -19.977 -67.816  1.00 69.81  ? 271  ASN A ND2   1 
ATOM   2095 N  N     . TYR A  1 271 ? -11.279 -22.812 -63.491  1.00 49.12  ? 272  TYR A N     1 
ATOM   2096 C  CA    . TYR A  1 271 ? -11.362 -23.365 -62.150  1.00 49.76  ? 272  TYR A CA    1 
ATOM   2097 C  C     . TYR A  1 271 ? -10.128 -24.208 -61.839  1.00 54.87  ? 272  TYR A C     1 
ATOM   2098 O  O     . TYR A  1 271 ? -9.723  -25.056 -62.644  1.00 52.91  ? 272  TYR A O     1 
ATOM   2099 C  CB    . TYR A  1 271 ? -12.641 -24.198 -62.033  1.00 43.20  ? 272  TYR A CB    1 
ATOM   2100 C  CG    . TYR A  1 271 ? -12.865 -24.796 -60.682  1.00 40.06  ? 272  TYR A CG    1 
ATOM   2101 C  CD1   . TYR A  1 271 ? -12.747 -24.021 -59.540  1.00 38.37  ? 272  TYR A CD1   1 
ATOM   2102 C  CD2   . TYR A  1 271 ? -13.225 -26.129 -60.547  1.00 41.23  ? 272  TYR A CD2   1 
ATOM   2103 C  CE1   . TYR A  1 271 ? -12.964 -24.561 -58.291  1.00 36.34  ? 272  TYR A CE1   1 
ATOM   2104 C  CE2   . TYR A  1 271 ? -13.459 -26.683 -59.302  1.00 37.86  ? 272  TYR A CE2   1 
ATOM   2105 C  CZ    . TYR A  1 271 ? -13.320 -25.895 -58.179  1.00 36.91  ? 272  TYR A CZ    1 
ATOM   2106 O  OH    . TYR A  1 271 ? -13.549 -26.436 -56.941  1.00 37.13  ? 272  TYR A OH    1 
ATOM   2107 N  N     . CYS A  1 272 ? -9.507  -23.939 -60.686  1.00 53.11  ? 273  CYS A N     1 
ATOM   2108 C  CA    . CYS A  1 272 ? -8.318  -24.643 -60.207  1.00 61.62  ? 273  CYS A CA    1 
ATOM   2109 C  C     . CYS A  1 272 ? -7.111  -24.467 -61.117  1.00 63.19  ? 273  CYS A C     1 
ATOM   2110 O  O     . CYS A  1 272 ? -6.089  -25.130 -60.909  1.00 69.28  ? 273  CYS A O     1 
ATOM   2111 C  CB    . CYS A  1 272 ? -8.561  -26.155 -60.031  1.00 66.53  ? 273  CYS A CB    1 
ATOM   2112 S  SG    . CYS A  1 272 ? -9.799  -26.686 -58.833  1.00 65.42  ? 273  CYS A SG    1 
ATOM   2113 N  N     . GLY A  1 273 ? -7.198  -23.618 -62.137  1.00 65.13  ? 274  GLY A N     1 
ATOM   2114 C  CA    . GLY A  1 273 ? -6.181  -23.593 -63.170  1.00 68.61  ? 274  GLY A CA    1 
ATOM   2115 C  C     . GLY A  1 273 ? -6.101  -24.847 -64.016  1.00 68.17  ? 274  GLY A C     1 
ATOM   2116 O  O     . GLY A  1 273 ? -5.230  -24.928 -64.890  1.00 63.41  ? 274  GLY A O     1 
ATOM   2117 N  N     . GLU A  1 274 ? -6.985  -25.823 -63.791  1.00 66.28  ? 275  GLU A N     1 
ATOM   2118 C  CA    . GLU A  1 274 ? -6.987  -27.084 -64.522  1.00 67.97  ? 275  GLU A CA    1 
ATOM   2119 C  C     . GLU A  1 274 ? -7.998  -27.129 -65.659  1.00 70.60  ? 275  GLU A C     1 
ATOM   2120 O  O     . GLU A  1 274 ? -7.750  -27.799 -66.667  1.00 80.03  ? 275  GLU A O     1 
ATOM   2121 C  CB    . GLU A  1 274 ? -7.267  -28.249 -63.564  1.00 63.41  ? 275  GLU A CB    1 
ATOM   2122 N  N     . PHE A  1 275 ? -9.133  -26.454 -65.523  1.00 62.96  ? 276  PHE A N     1 
ATOM   2123 C  CA    . PHE A  1 275 ? -10.143 -26.404 -66.566  1.00 59.64  ? 276  PHE A CA    1 
ATOM   2124 C  C     . PHE A  1 275 ? -9.978  -25.139 -67.391  1.00 66.81  ? 276  PHE A C     1 
ATOM   2125 O  O     . PHE A  1 275 ? -9.400  -24.145 -66.943  1.00 69.44  ? 276  PHE A O     1 
ATOM   2126 C  CB    . PHE A  1 275 ? -11.553 -26.443 -65.972  1.00 59.89  ? 276  PHE A CB    1 
ATOM   2127 C  CG    . PHE A  1 275 ? -11.793 -27.597 -65.051  1.00 61.62  ? 276  PHE A CG    1 
ATOM   2128 C  CD1   . PHE A  1 275 ? -11.502 -27.496 -63.699  1.00 62.21  ? 276  PHE A CD1   1 
ATOM   2129 C  CD2   . PHE A  1 275 ? -12.325 -28.781 -65.533  1.00 62.31  ? 276  PHE A CD2   1 
ATOM   2130 C  CE1   . PHE A  1 275 ? -11.728 -28.560 -62.842  1.00 62.25  ? 276  PHE A CE1   1 
ATOM   2131 C  CE2   . PHE A  1 275 ? -12.553 -29.852 -64.684  1.00 62.09  ? 276  PHE A CE2   1 
ATOM   2132 C  CZ    . PHE A  1 275 ? -12.258 -29.740 -63.335  1.00 58.40  ? 276  PHE A CZ    1 
ATOM   2133 N  N     . ASP A  1 276 ? -10.492 -25.186 -68.617  1.00 68.68  ? 277  ASP A N     1 
ATOM   2134 C  CA    . ASP A  1 276 ? -10.572 -23.997 -69.453  1.00 70.27  ? 277  ASP A CA    1 
ATOM   2135 C  C     . ASP A  1 276 ? -11.974 -23.399 -69.446  1.00 59.41  ? 277  ASP A C     1 
ATOM   2136 O  O     . ASP A  1 276 ? -12.402 -22.791 -70.433  1.00 59.91  ? 277  ASP A O     1 
ATOM   2137 C  CB    . ASP A  1 276 ? -10.119 -24.313 -70.877  1.00 81.68  ? 277  ASP A CB    1 
ATOM   2138 C  CG    . ASP A  1 276 ? -9.729  -23.070 -71.642  1.00 93.23  ? 277  ASP A CG    1 
ATOM   2139 O  OD1   . ASP A  1 276 ? -8.908  -22.288 -71.115  1.00 96.20  ? 277  ASP A OD1   1 
ATOM   2140 O  OD2   . ASP A  1 276 ? -10.247 -22.871 -72.762  1.00 98.90  ? 277  ASP A OD2   1 
ATOM   2141 N  N     . ASN A  1 277 ? -12.692 -23.558 -68.338  1.00 48.02  ? 278  ASN A N     1 
ATOM   2142 C  CA    . ASN A  1 277 ? -14.098 -23.197 -68.286  1.00 45.23  ? 278  ASN A CA    1 
ATOM   2143 C  C     . ASN A  1 277 ? -14.273 -21.680 -68.255  1.00 43.07  ? 278  ASN A C     1 
ATOM   2144 O  O     . ASN A  1 277 ? -13.405 -20.938 -67.790  1.00 42.31  ? 278  ASN A O     1 
ATOM   2145 C  CB    . ASN A  1 277 ? -14.749 -23.822 -67.055  1.00 38.02  ? 278  ASN A CB    1 
ATOM   2146 C  CG    . ASN A  1 277 ? -14.233 -23.209 -65.756  1.00 40.59  ? 278  ASN A CG    1 
ATOM   2147 O  OD1   . ASN A  1 277 ? -13.134 -23.526 -65.298  1.00 43.99  ? 278  ASN A OD1   1 
ATOM   2148 N  ND2   . ASN A  1 277 ? -15.022 -22.318 -65.168  1.00 37.39  ? 278  ASN A ND2   1 
ATOM   2149 N  N     . ALA A  1 278 ? -15.408 -21.222 -68.768  1.00 42.88  ? 279  ALA A N     1 
ATOM   2150 C  CA    . ALA A  1 278 ? -15.843 -19.851 -68.547  1.00 43.97  ? 279  ALA A CA    1 
ATOM   2151 C  C     . ALA A  1 278 ? -16.658 -19.779 -67.262  1.00 41.99  ? 279  ALA A C     1 
ATOM   2152 O  O     . ALA A  1 278 ? -17.187 -20.783 -66.778  1.00 39.46  ? 279  ALA A O     1 
ATOM   2153 C  CB    . ALA A  1 278 ? -16.680 -19.334 -69.720  1.00 41.47  ? 279  ALA A CB    1 
ATOM   2154 N  N     . GLY A  1 279 ? -16.724 -18.581 -66.695  1.00 42.79  ? 280  GLY A N     1 
ATOM   2155 C  CA    . GLY A  1 279 ? -17.600 -18.299 -65.578  1.00 38.03  ? 280  GLY A CA    1 
ATOM   2156 C  C     . GLY A  1 279 ? -18.816 -17.560 -66.096  1.00 38.22  ? 280  GLY A C     1 
ATOM   2157 O  O     . GLY A  1 279 ? -18.737 -16.860 -67.099  1.00 40.27  ? 280  GLY A O     1 
ATOM   2158 N  N     . ALA A  1 280 ? -19.957 -17.738 -65.419  1.00 34.51  ? 281  ALA A N     1 
ATOM   2159 C  CA    . ALA A  1 280 ? -21.163 -17.021 -65.808  1.00 35.57  ? 281  ALA A CA    1 
ATOM   2160 C  C     . ALA A  1 280 ? -21.915 -16.529 -64.584  1.00 39.84  ? 281  ALA A C     1 
ATOM   2161 O  O     . ALA A  1 280 ? -21.811 -17.101 -63.496  1.00 40.45  ? 281  ALA A O     1 
ATOM   2162 C  CB    . ALA A  1 280 ? -22.098 -17.883 -66.651  1.00 30.02  ? 281  ALA A CB    1 
ATOM   2163 N  N     . MET A  1 281 ? -22.670 -15.452 -64.780  1.00 43.83  ? 282  MET A N     1 
ATOM   2164 C  CA    . MET A  1 281 ? -23.710 -15.050 -63.850  1.00 44.58  ? 282  MET A CA    1 
ATOM   2165 C  C     . MET A  1 281 ? -24.999 -14.863 -64.633  1.00 39.84  ? 282  MET A C     1 
ATOM   2166 O  O     . MET A  1 281 ? -24.977 -14.607 -65.839  1.00 43.79  ? 282  MET A O     1 
ATOM   2167 C  CB    . MET A  1 281 ? -23.346 -13.771 -63.084  1.00 42.96  ? 282  MET A CB    1 
ATOM   2168 C  CG    . MET A  1 281 ? -23.098 -12.566 -63.940  1.00 54.72  ? 282  MET A CG    1 
ATOM   2169 S  SD    . MET A  1 281 ? -22.778 -11.088 -62.952  1.00 58.04  ? 282  MET A SD    1 
ATOM   2170 C  CE    . MET A  1 281 ? -21.788 -10.169 -64.127  1.00 56.27  ? 282  MET A CE    1 
ATOM   2171 N  N     . MET A  1 282 ? -26.120 -15.032 -63.946  1.00 32.06  ? 283  MET A N     1 
ATOM   2172 C  CA    . MET A  1 282 ? -27.436 -14.919 -64.556  1.00 31.96  ? 283  MET A CA    1 
ATOM   2173 C  C     . MET A  1 282 ? -28.116 -13.632 -64.088  1.00 34.93  ? 283  MET A C     1 
ATOM   2174 O  O     . MET A  1 282 ? -28.232 -13.382 -62.880  1.00 32.76  ? 283  MET A O     1 
ATOM   2175 C  CB    . MET A  1 282 ? -28.289 -16.144 -64.222  1.00 29.86  ? 283  MET A CB    1 
ATOM   2176 C  CG    . MET A  1 282 ? -29.561 -16.232 -65.023  1.00 36.28  ? 283  MET A CG    1 
ATOM   2177 S  SD    . MET A  1 282 ? -30.548 -17.699 -64.668  1.00 35.97  ? 283  MET A SD    1 
ATOM   2178 C  CE    . MET A  1 282 ? -31.065 -17.402 -62.983  1.00 32.89  ? 283  MET A CE    1 
ATOM   2179 N  N     . SER A  1 283 ? -28.543 -12.813 -65.048  1.00 33.40  ? 284  SER A N     1 
ATOM   2180 C  CA    . SER A  1 283 ? -29.313 -11.603 -64.787  1.00 36.98  ? 284  SER A CA    1 
ATOM   2181 C  C     . SER A  1 283 ? -30.795 -11.925 -64.900  1.00 38.26  ? 284  SER A C     1 
ATOM   2182 O  O     . SER A  1 283 ? -31.247 -12.404 -65.946  1.00 37.67  ? 284  SER A O     1 
ATOM   2183 C  CB    . SER A  1 283 ? -28.962 -10.488 -65.774  1.00 39.39  ? 284  SER A CB    1 
ATOM   2184 O  OG    . SER A  1 283 ? -27.642 -10.033 -65.586  1.00 49.03  ? 284  SER A OG    1 
ATOM   2185 N  N     . VAL A  1 284 ? -31.546 -11.646 -63.837  1.00 37.58  ? 285  VAL A N     1 
ATOM   2186 C  CA    . VAL A  1 284 ? -32.996 -11.778 -63.837  1.00 37.26  ? 285  VAL A CA    1 
ATOM   2187 C  C     . VAL A  1 284 ? -33.584 -10.379 -63.768  1.00 36.75  ? 285  VAL A C     1 
ATOM   2188 O  O     . VAL A  1 284 ? -33.300 -9.635  -62.825  1.00 41.52  ? 285  VAL A O     1 
ATOM   2189 C  CB    . VAL A  1 284 ? -33.493 -12.636 -62.665  1.00 40.19  ? 285  VAL A CB    1 
ATOM   2190 C  CG1   . VAL A  1 284 ? -34.998 -12.842 -62.772  1.00 39.20  ? 285  VAL A CG1   1 
ATOM   2191 C  CG2   . VAL A  1 284 ? -32.760 -13.981 -62.639  1.00 40.51  ? 285  VAL A CG2   1 
ATOM   2192 N  N     . ASP A  1 285 ? -34.420 -10.021 -64.744  1.00 39.35  ? 286  ASP A N     1 
ATOM   2193 C  CA    . ASP A  1 285 ? -35.012 -8.689  -64.762  1.00 41.22  ? 286  ASP A CA    1 
ATOM   2194 C  C     . ASP A  1 285 ? -36.404 -8.741  -64.139  1.00 43.41  ? 286  ASP A C     1 
ATOM   2195 O  O     . ASP A  1 285 ? -36.859 -9.786  -63.661  1.00 38.28  ? 286  ASP A O     1 
ATOM   2196 C  CB    . ASP A  1 285 ? -35.020 -8.094  -66.183  1.00 40.59  ? 286  ASP A CB    1 
ATOM   2197 C  CG    . ASP A  1 285 ? -36.093 -8.672  -67.105  1.00 45.30  ? 286  ASP A CG    1 
ATOM   2198 O  OD1   . ASP A  1 285 ? -36.966 -9.464  -66.704  1.00 50.16  ? 286  ASP A OD1   1 
ATOM   2199 O  OD2   . ASP A  1 285 ? -36.054 -8.306  -68.294  1.00 53.22  ? 286  ASP A OD2   1 
ATOM   2200 N  N     . GLU A  1 286 ? -37.087 -7.591  -64.153  1.00 44.19  ? 287  GLU A N     1 
ATOM   2201 C  CA    . GLU A  1 286 ? -38.331 -7.447  -63.401  1.00 46.31  ? 287  GLU A CA    1 
ATOM   2202 C  C     . GLU A  1 286 ? -39.431 -8.354  -63.933  1.00 45.22  ? 287  GLU A C     1 
ATOM   2203 O  O     . GLU A  1 286 ? -40.375 -8.673  -63.205  1.00 41.46  ? 287  GLU A O     1 
ATOM   2204 C  CB    . GLU A  1 286 ? -38.790 -5.989  -63.427  1.00 54.07  ? 287  GLU A CB    1 
ATOM   2205 C  CG    . GLU A  1 286 ? -38.947 -5.440  -64.831  1.00 64.53  ? 287  GLU A CG    1 
ATOM   2206 C  CD    . GLU A  1 286 ? -39.184 -3.941  -64.862  1.00 76.29  ? 287  GLU A CD    1 
ATOM   2207 O  OE1   . GLU A  1 286 ? -38.963 -3.275  -63.827  1.00 80.46  ? 287  GLU A OE1   1 
ATOM   2208 O  OE2   . GLU A  1 286 ? -39.590 -3.431  -65.928  1.00 79.43  ? 287  GLU A OE2   1 
ATOM   2209 N  N     . THR A  1 287 ? -39.329 -8.786  -65.188  1.00 43.22  ? 288  THR A N     1 
ATOM   2210 C  CA    . THR A  1 287 ? -40.314 -9.677  -65.784  1.00 44.89  ? 288  THR A CA    1 
ATOM   2211 C  C     . THR A  1 287 ? -39.878 -11.137 -65.736  1.00 47.19  ? 288  THR A C     1 
ATOM   2212 O  O     . THR A  1 287 ? -40.504 -11.983 -66.387  1.00 41.63  ? 288  THR A O     1 
ATOM   2213 C  CB    . THR A  1 287 ? -40.591 -9.255  -67.235  1.00 47.00  ? 288  THR A CB    1 
ATOM   2214 O  OG1   . THR A  1 287 ? -39.504 -9.661  -68.073  1.00 46.31  ? 288  THR A OG1   1 
ATOM   2215 C  CG2   . THR A  1 287 ? -40.730 -7.741  -67.314  1.00 45.59  ? 288  THR A CG2   1 
ATOM   2216 N  N     . LEU A  1 288 ? -38.814 -11.436 -64.985  1.00 33.91  ? 289  LEU A N     1 
ATOM   2217 C  CA    . LEU A  1 288 ? -38.242 -12.777 -64.874  1.00 33.52  ? 289  LEU A CA    1 
ATOM   2218 C  C     . LEU A  1 288 ? -37.673 -13.264 -66.207  1.00 36.11  ? 289  LEU A C     1 
ATOM   2219 O  O     . LEU A  1 288 ? -37.619 -14.468 -66.472  1.00 42.24  ? 289  LEU A O     1 
ATOM   2220 C  CB    . LEU A  1 288 ? -39.256 -13.781 -64.313  1.00 33.32  ? 289  LEU A CB    1 
ATOM   2221 C  CG    . LEU A  1 288 ? -39.813 -13.496 -62.906  1.00 45.11  ? 289  LEU A CG    1 
ATOM   2222 C  CD1   . LEU A  1 288 ? -40.528 -14.727 -62.349  1.00 41.68  ? 289  LEU A CD1   1 
ATOM   2223 C  CD2   . LEU A  1 288 ? -38.733 -13.009 -61.927  1.00 33.70  ? 289  LEU A CD2   1 
ATOM   2224 N  N     . MET A  1 289 ? -37.242 -12.340 -67.061  1.00 39.53  ? 290  MET A N     1 
ATOM   2225 C  CA    A MET A  1 289 ? -36.468 -12.718 -68.237  0.37 40.67  ? 290  MET A CA    1 
ATOM   2226 C  CA    B MET A  1 289 ? -36.467 -12.696 -68.243  0.63 40.72  ? 290  MET A CA    1 
ATOM   2227 C  C     . MET A  1 289 ? -35.014 -12.895 -67.825  1.00 39.17  ? 290  MET A C     1 
ATOM   2228 O  O     . MET A  1 289 ? -34.399 -11.977 -67.273  1.00 42.50  ? 290  MET A O     1 
ATOM   2229 C  CB    A MET A  1 289 ? -36.582 -11.680 -69.351  0.37 43.05  ? 290  MET A CB    1 
ATOM   2230 C  CB    B MET A  1 289 ? -36.592 -11.602 -69.303  0.63 42.93  ? 290  MET A CB    1 
ATOM   2231 C  CG    A MET A  1 289 ? -35.604 -11.961 -70.492  0.37 44.81  ? 290  MET A CG    1 
ATOM   2232 C  CG    B MET A  1 289 ? -35.548 -11.672 -70.401  0.63 45.17  ? 290  MET A CG    1 
ATOM   2233 S  SD    A MET A  1 289 ? -36.153 -11.424 -72.124  0.37 45.72  ? 290  MET A SD    1 
ATOM   2234 S  SD    B MET A  1 289 ? -35.843 -13.046 -71.526  0.63 43.81  ? 290  MET A SD    1 
ATOM   2235 C  CE    A MET A  1 289 ? -37.602 -12.454 -72.355  0.37 44.30  ? 290  MET A CE    1 
ATOM   2236 C  CE    B MET A  1 289 ? -37.345 -12.507 -72.342  0.63 44.45  ? 290  MET A CE    1 
ATOM   2237 N  N     . CYS A  1 290 ? -34.469 -14.083 -68.077  1.00 36.72  ? 291  CYS A N     1 
ATOM   2238 C  CA    . CYS A  1 290 ? -33.144 -14.455 -67.596  1.00 32.78  ? 291  CYS A CA    1 
ATOM   2239 C  C     . CYS A  1 290 ? -32.148 -14.492 -68.744  1.00 37.13  ? 291  CYS A C     1 
ATOM   2240 O  O     . CYS A  1 290 ? -32.415 -15.092 -69.791  1.00 35.94  ? 291  CYS A O     1 
ATOM   2241 C  CB    . CYS A  1 290 ? -33.171 -15.826 -66.917  1.00 32.46  ? 291  CYS A CB    1 
ATOM   2242 S  SG    . CYS A  1 290 ? -34.274 -15.934 -65.515  1.00 35.94  ? 291  CYS A SG    1 
ATOM   2243 N  N     . SER A  1 291 ? -30.998 -13.872 -68.533  1.00 35.52  ? 292  SER A N     1 
ATOM   2244 C  CA    . SER A  1 291 ? -29.931 -13.836 -69.509  1.00 35.36  ? 292  SER A CA    1 
ATOM   2245 C  C     . SER A  1 291 ? -28.622 -14.094 -68.784  1.00 32.78  ? 292  SER A C     1 
ATOM   2246 O  O     . SER A  1 291 ? -28.542 -14.001 -67.557  1.00 32.87  ? 292  SER A O     1 
ATOM   2247 C  CB    . SER A  1 291 ? -29.887 -12.488 -70.229  1.00 36.43  ? 292  SER A CB    1 
ATOM   2248 O  OG    . SER A  1 291 ? -29.647 -11.471 -69.290  1.00 40.99  ? 292  SER A OG    1 
ATOM   2249 N  N     . PHE A  1 292 ? -27.575 -14.382 -69.546  1.00 32.97  ? 293  PHE A N     1 
ATOM   2250 C  CA    . PHE A  1 292 ? -26.322 -14.827 -68.959  1.00 32.59  ? 293  PHE A CA    1 
ATOM   2251 C  C     . PHE A  1 292 ? -25.191 -13.917 -69.393  1.00 35.95  ? 293  PHE A C     1 
ATOM   2252 O  O     . PHE A  1 292 ? -25.065 -13.597 -70.578  1.00 39.70  ? 293  PHE A O     1 
ATOM   2253 C  CB    . PHE A  1 292 ? -26.046 -16.279 -69.347  1.00 35.31  ? 293  PHE A CB    1 
ATOM   2254 C  CG    . PHE A  1 292 ? -27.092 -17.226 -68.857  1.00 36.29  ? 293  PHE A CG    1 
ATOM   2255 C  CD1   . PHE A  1 292 ? -28.206 -17.508 -69.624  1.00 38.94  ? 293  PHE A CD1   1 
ATOM   2256 C  CD2   . PHE A  1 292 ? -26.984 -17.804 -67.594  1.00 38.33  ? 293  PHE A CD2   1 
ATOM   2257 C  CE1   . PHE A  1 292 ? -29.178 -18.374 -69.154  1.00 35.83  ? 293  PHE A CE1   1 
ATOM   2258 C  CE2   . PHE A  1 292 ? -27.957 -18.659 -67.119  1.00 34.26  ? 293  PHE A CE2   1 
ATOM   2259 C  CZ    . PHE A  1 292 ? -29.056 -18.945 -67.899  1.00 35.85  ? 293  PHE A CZ    1 
ATOM   2260 N  N     . GLN A  1 293 ? -24.388 -13.481 -68.434  1.00 33.44  ? 294  GLN A N     1 
ATOM   2261 C  CA    . GLN A  1 293 ? -23.176 -12.727 -68.722  1.00 38.67  ? 294  GLN A CA    1 
ATOM   2262 C  C     . GLN A  1 293 ? -21.990 -13.651 -68.493  1.00 38.87  ? 294  GLN A C     1 
ATOM   2263 O  O     . GLN A  1 293 ? -21.918 -14.328 -67.462  1.00 38.63  ? 294  GLN A O     1 
ATOM   2264 C  CB    . GLN A  1 293 ? -23.076 -11.478 -67.843  1.00 44.70  ? 294  GLN A CB    1 
ATOM   2265 C  CG    . GLN A  1 293 ? -24.440 -10.846 -67.500  1.00 53.31  ? 294  GLN A CG    1 
ATOM   2266 C  CD    . GLN A  1 293 ? -24.325 -9.386  -67.068  1.00 58.01  ? 294  GLN A CD    1 
ATOM   2267 O  OE1   . GLN A  1 293 ? -23.932 -8.526  -67.857  1.00 64.88  ? 294  GLN A OE1   1 
ATOM   2268 N  NE2   . GLN A  1 293 ? -24.668 -9.105  -65.813  1.00 47.88  ? 294  GLN A NE2   1 
ATOM   2269 N  N     . ILE A  1 294 ? -21.084 -13.705 -69.460  1.00 39.29  ? 295  ILE A N     1 
ATOM   2270 C  CA    . ILE A  1 294 ? -20.002 -14.680 -69.456  1.00 41.57  ? 295  ILE A CA    1 
ATOM   2271 C  C     . ILE A  1 294 ? -18.702 -13.990 -69.081  1.00 44.71  ? 295  ILE A C     1 
ATOM   2272 O  O     . ILE A  1 294 ? -18.367 -12.931 -69.628  1.00 46.08  ? 295  ILE A O     1 
ATOM   2273 C  CB    . ILE A  1 294 ? -19.879 -15.381 -70.818  1.00 41.90  ? 295  ILE A CB    1 
ATOM   2274 C  CG1   . ILE A  1 294 ? -21.224 -16.012 -71.203  1.00 39.62  ? 295  ILE A CG1   1 
ATOM   2275 C  CG2   . ILE A  1 294 ? -18.754 -16.413 -70.787  1.00 37.24  ? 295  ILE A CG2   1 
ATOM   2276 C  CD1   . ILE A  1 294 ? -21.803 -16.935 -70.124  1.00 36.66  ? 295  ILE A CD1   1 
ATOM   2277 N  N     . LEU A  1 295 ? -17.980 -14.584 -68.135  1.00 42.98  ? 296  LEU A N     1 
ATOM   2278 C  CA    . LEU A  1 295 ? -16.615 -14.186 -67.811  1.00 44.01  ? 296  LEU A CA    1 
ATOM   2279 C  C     . LEU A  1 295 ? -15.691 -15.100 -68.593  1.00 48.18  ? 296  LEU A C     1 
ATOM   2280 O  O     . LEU A  1 295 ? -15.477 -16.257 -68.216  1.00 49.86  ? 296  LEU A O     1 
ATOM   2281 C  CB    . LEU A  1 295 ? -16.351 -14.297 -66.317  1.00 46.10  ? 296  LEU A CB    1 
ATOM   2282 C  CG    . LEU A  1 295 ? -16.340 -13.006 -65.518  1.00 52.73  ? 296  LEU A CG    1 
ATOM   2283 C  CD1   . LEU A  1 295 ? -17.692 -12.316 -65.614  1.00 56.66  ? 296  LEU A CD1   1 
ATOM   2284 C  CD2   . LEU A  1 295 ? -15.967 -13.309 -64.071  1.00 52.09  ? 296  LEU A CD2   1 
ATOM   2285 N  N     . LYS A  1 296 ? -15.157 -14.595 -69.693  1.00 49.81  ? 297  LYS A N     1 
ATOM   2286 C  CA    . LYS A  1 296 ? -14.223 -15.401 -70.455  1.00 53.22  ? 297  LYS A CA    1 
ATOM   2287 C  C     . LYS A  1 296 ? -12.962 -15.633 -69.628  1.00 55.63  ? 297  LYS A C     1 
ATOM   2288 O  O     . LYS A  1 296 ? -12.538 -14.744 -68.881  1.00 56.68  ? 297  LYS A O     1 
ATOM   2289 C  CB    . LYS A  1 296 ? -13.880 -14.733 -71.788  1.00 57.21  ? 297  LYS A CB    1 
ATOM   2290 C  CG    . LYS A  1 296 ? -15.017 -14.781 -72.804  1.00 62.40  ? 297  LYS A CG    1 
ATOM   2291 C  CD    . LYS A  1 296 ? -14.521 -14.497 -74.216  1.00 66.89  ? 297  LYS A CD    1 
ATOM   2292 C  CE    . LYS A  1 296 ? -14.181 -13.024 -74.407  1.00 72.82  ? 297  LYS A CE    1 
ATOM   2293 N  NZ    . LYS A  1 296 ? -15.387 -12.153 -74.316  1.00 76.50  ? 297  LYS A NZ    1 
ATOM   2294 N  N     . PRO A  1 297 ? -12.393 -16.836 -69.687  1.00 61.21  ? 298  PRO A N     1 
ATOM   2295 C  CA    . PRO A  1 297 ? -11.073 -17.089 -69.094  1.00 70.28  ? 298  PRO A CA    1 
ATOM   2296 C  C     . PRO A  1 297 ? -10.096 -15.931 -69.277  1.00 77.65  ? 298  PRO A C     1 
ATOM   2297 O  O     . PRO A  1 297 ? -9.734  -15.599 -70.410  1.00 74.56  ? 298  PRO A O     1 
ATOM   2298 C  CB    . PRO A  1 297 ? -10.601 -18.342 -69.847  1.00 70.06  ? 298  PRO A CB    1 
ATOM   2299 C  CG    . PRO A  1 297 ? -11.679 -18.668 -70.862  1.00 67.26  ? 298  PRO A CG    1 
ATOM   2300 C  CD    . PRO A  1 297 ? -12.924 -18.021 -70.373  1.00 62.95  ? 298  PRO A CD    1 
ATOM   2301 N  N     . ALA A  1 298 ? -9.635  -15.345 -68.161  1.00 82.35  ? 299  ALA A N     1 
ATOM   2302 C  CA    . ALA A  1 298 ? -8.873  -14.094 -68.192  1.00 83.78  ? 299  ALA A CA    1 
ATOM   2303 C  C     . ALA A  1 298 ? -7.698  -14.127 -69.165  1.00 90.30  ? 299  ALA A C     1 
ATOM   2304 O  O     . ALA A  1 298 ? -7.322  -13.085 -69.716  1.00 89.76  ? 299  ALA A O     1 
ATOM   2305 C  CB    . ALA A  1 298 ? -8.369  -13.754 -66.788  1.00 81.20  ? 299  ALA A CB    1 
ATOM   2306 N  N     . ASP A  1 299 ? -7.101  -15.295 -69.384  1.00 95.74  ? 300  ASP A N     1 
ATOM   2307 C  CA    . ASP A  1 299 ? -6.018  -15.414 -70.359  1.00 101.46 ? 300  ASP A CA    1 
ATOM   2308 C  C     . ASP A  1 299 ? -6.346  -16.454 -71.427  1.00 101.61 ? 300  ASP A C     1 
ATOM   2309 O  O     . ASP A  1 299 ? -7.279  -17.244 -71.276  1.00 101.45 ? 300  ASP A O     1 
ATOM   2310 C  CB    . ASP A  1 299 ? -4.699  -15.771 -69.665  1.00 105.33 ? 300  ASP A CB    1 
ATOM   2311 C  CG    . ASP A  1 299 ? -4.057  -14.578 -68.976  1.00 107.60 ? 300  ASP A CG    1 
ATOM   2312 O  OD1   . ASP A  1 299 ? -4.770  -13.589 -68.701  1.00 107.99 ? 300  ASP A OD1   1 
ATOM   2313 O  OD2   . ASP A  1 299 ? -2.836  -14.627 -68.714  1.00 108.79 ? 300  ASP A OD2   1 
ATOM   2314 N  N     . ARG A  1 316 ? -16.344 -8.321  -94.452  1.00 90.72  ? 317  ARG A N     1 
ATOM   2315 C  CA    . ARG A  1 316 ? -15.725 -9.320  -95.315  1.00 91.95  ? 317  ARG A CA    1 
ATOM   2316 C  C     . ARG A  1 316 ? -14.420 -9.830  -94.751  1.00 89.32  ? 317  ARG A C     1 
ATOM   2317 O  O     . ARG A  1 316 ? -13.722 -9.110  -94.040  1.00 90.99  ? 317  ARG A O     1 
ATOM   2318 C  CB    . ARG A  1 316 ? -15.453 -8.732  -96.684  1.00 96.17  ? 317  ARG A CB    1 
ATOM   2319 C  CG    . ARG A  1 316 ? -15.336 -7.244  -96.595  1.00 98.77  ? 317  ARG A CG    1 
ATOM   2320 C  CD    . ARG A  1 316 ? -15.272 -6.651  -97.951  1.00 99.49  ? 317  ARG A CD    1 
ATOM   2321 N  NE    . ARG A  1 316 ? -15.725 -5.279  -97.919  1.00 103.53 ? 317  ARG A NE    1 
ATOM   2322 C  CZ    . ARG A  1 316 ? -15.403 -4.388  -98.824  1.00 106.20 ? 317  ARG A CZ    1 
ATOM   2323 N  NH1   . ARG A  1 316 ? -14.597 -4.703  -99.835  1.00 103.94 ? 317  ARG A NH1   1 
ATOM   2324 N  NH2   . ARG A  1 316 ? -15.862 -3.144  -98.738  1.00 108.29 ? 317  ARG A NH2   1 
ATOM   2325 N  N     . PRO A  1 317 ? -14.078 -11.064 -95.098  1.00 85.66  ? 318  PRO A N     1 
ATOM   2326 C  CA    . PRO A  1 317 ? -12.772 -11.603 -94.716  1.00 82.46  ? 318  PRO A CA    1 
ATOM   2327 C  C     . PRO A  1 317 ? -11.641 -10.885 -95.439  1.00 81.91  ? 318  PRO A C     1 
ATOM   2328 O  O     . PRO A  1 317 ? -11.839 -10.191 -96.439  1.00 82.56  ? 318  PRO A O     1 
ATOM   2329 C  CB    . PRO A  1 317 ? -12.857 -13.074 -95.136  1.00 79.29  ? 318  PRO A CB    1 
ATOM   2330 C  CG    . PRO A  1 317 ? -14.333 -13.364 -95.218  1.00 78.13  ? 318  PRO A CG    1 
ATOM   2331 C  CD    . PRO A  1 317 ? -14.957 -12.092 -95.682  1.00 82.44  ? 318  PRO A CD    1 
ATOM   2332 N  N     . ILE A  1 318 ? -10.434 -11.063 -94.901  1.00 80.37  ? 319  ILE A N     1 
ATOM   2333 C  CA    . ILE A  1 318 ? -9.248  -10.432 -95.467  1.00 77.03  ? 319  ILE A CA    1 
ATOM   2334 C  C     . ILE A  1 318 ? -8.916  -11.083 -96.802  1.00 76.74  ? 319  ILE A C     1 
ATOM   2335 O  O     . ILE A  1 318 ? -8.854  -12.315 -96.911  1.00 77.74  ? 319  ILE A O     1 
ATOM   2336 C  CB    . ILE A  1 318 ? -8.068  -10.536 -94.489  1.00 75.34  ? 319  ILE A CB    1 
ATOM   2337 C  CG1   . ILE A  1 318 ? -8.432  -9.916  -93.136  1.00 76.02  ? 319  ILE A CG1   1 
ATOM   2338 C  CG2   . ILE A  1 318 ? -6.822  -9.888  -95.080  1.00 73.50  ? 319  ILE A CG2   1 
ATOM   2339 C  CD1   . ILE A  1 318 ? -7.350  -10.058 -92.087  1.00 75.73  ? 319  ILE A CD1   1 
ATOM   2340 N  N     . THR A  1 319 ? -8.702  -10.256 -97.830  1.00 75.10  ? 320  THR A N     1 
ATOM   2341 C  CA    . THR A  1 319 ? -8.366  -10.803 -99.135  1.00 76.36  ? 320  THR A CA    1 
ATOM   2342 C  C     . THR A  1 319 ? -6.907  -11.258 -99.159  1.00 78.14  ? 320  THR A C     1 
ATOM   2343 O  O     . THR A  1 319 ? -6.089  -10.785 -98.364  1.00 78.64  ? 320  THR A O     1 
ATOM   2344 C  CB    . THR A  1 319 ? -8.613  -9.771  -100.236 1.00 75.95  ? 320  THR A CB    1 
ATOM   2345 O  OG1   . THR A  1 319 ? -8.004  -8.521  -99.888  1.00 79.53  ? 320  THR A OG1   1 
ATOM   2346 C  CG2   . THR A  1 319 ? -10.107 -9.573  -100.451 1.00 72.45  ? 320  THR A CG2   1 
ATOM   2347 N  N     . PRO A  1 320 ? -6.564  -12.198 -100.040 1.00 76.70  ? 321  PRO A N     1 
ATOM   2348 C  CA    . PRO A  1 320 ? -5.178  -12.665 -100.122 1.00 76.15  ? 321  PRO A CA    1 
ATOM   2349 C  C     . PRO A  1 320 ? -4.271  -11.576 -100.659 1.00 79.50  ? 321  PRO A C     1 
ATOM   2350 O  O     . PRO A  1 320 ? -4.739  -10.607 -101.277 1.00 81.40  ? 321  PRO A O     1 
ATOM   2351 C  CB    . PRO A  1 320 ? -5.256  -13.852 -101.097 1.00 72.24  ? 321  PRO A CB    1 
ATOM   2352 C  CG    . PRO A  1 320 ? -6.685  -14.249 -101.116 1.00 72.49  ? 321  PRO A CG    1 
ATOM   2353 C  CD    . PRO A  1 320 ? -7.452  -12.981 -100.916 1.00 73.42  ? 321  PRO A CD    1 
ATOM   2354 N  N     . PRO A  1 321 ? -2.969  -11.688 -100.434 1.00 79.84  ? 322  PRO A N     1 
ATOM   2355 C  CA    . PRO A  1 321 ? -2.031  -10.765 -101.072 1.00 80.38  ? 322  PRO A CA    1 
ATOM   2356 C  C     . PRO A  1 321 ? -1.859  -11.088 -102.550 1.00 78.65  ? 322  PRO A C     1 
ATOM   2357 O  O     . PRO A  1 321 ? -2.160  -12.187 -103.020 1.00 79.16  ? 322  PRO A O     1 
ATOM   2358 C  CB    . PRO A  1 321 ? -0.730  -10.995 -100.294 1.00 81.44  ? 322  PRO A CB    1 
ATOM   2359 C  CG    . PRO A  1 321 ? -0.842  -12.412 -99.813  1.00 79.77  ? 322  PRO A CG    1 
ATOM   2360 C  CD    . PRO A  1 321 ? -2.296  -12.631 -99.521  1.00 78.64  ? 322  PRO A CD    1 
ATOM   2361 N  N     . ARG A  1 322 ? -1.382  -10.092 -103.290 1.00 79.76  ? 323  ARG A N     1 
ATOM   2362 C  CA    . ARG A  1 322 ? -1.051  -10.289 -104.693 1.00 79.73  ? 323  ARG A CA    1 
ATOM   2363 C  C     . ARG A  1 322 ? 0.366   -10.841 -104.814 1.00 84.67  ? 323  ARG A C     1 
ATOM   2364 O  O     . ARG A  1 322 ? 1.282   -10.396 -104.116 1.00 82.63  ? 323  ARG A O     1 
ATOM   2365 C  CB    . ARG A  1 322 ? -1.181  -8.976  -105.467 1.00 71.05  ? 323  ARG A CB    1 
ATOM   2366 C  CG    . ARG A  1 322 ? -2.559  -8.307  -105.393 1.00 69.58  ? 323  ARG A CG    1 
ATOM   2367 C  CD    . ARG A  1 322 ? -3.628  -9.048  -106.215 1.00 67.84  ? 323  ARG A CD    1 
ATOM   2368 N  NE    . ARG A  1 322 ? -3.218  -9.258  -107.602 1.00 67.46  ? 323  ARG A NE    1 
ATOM   2369 C  CZ    . ARG A  1 322 ? -3.497  -8.435  -108.610 1.00 66.59  ? 323  ARG A CZ    1 
ATOM   2370 N  NH1   . ARG A  1 322 ? -3.063  -8.714  -109.830 1.00 65.84  ? 323  ARG A NH1   1 
ATOM   2371 N  NH2   . ARG A  1 322 ? -4.207  -7.335  -108.407 1.00 66.65  ? 323  ARG A NH2   1 
ATOM   2372 N  N     . ASN A  1 323 ? 0.537   -11.830 -105.688 1.00 88.04  ? 324  ASN A N     1 
ATOM   2373 C  CA    . ASN A  1 323 ? 1.844   -12.454 -105.886 1.00 90.05  ? 324  ASN A CA    1 
ATOM   2374 C  C     . ASN A  1 323 ? 2.582   -11.815 -107.057 1.00 89.48  ? 324  ASN A C     1 
ATOM   2375 O  O     . ASN A  1 323 ? 3.633   -11.203 -106.873 1.00 90.29  ? 324  ASN A O     1 
ATOM   2376 C  CB    . ASN A  1 323 ? 1.699   -13.963 -106.111 1.00 89.56  ? 324  ASN A CB    1 
ATOM   2377 N  N     . LEU B  1 6   ? -37.654 -70.494 -149.211 1.00 74.04  ? 7    LEU B N     1 
ATOM   2378 C  CA    . LEU B  1 6   ? -38.132 -69.836 -147.996 1.00 72.67  ? 7    LEU B CA    1 
ATOM   2379 C  C     . LEU B  1 6   ? -38.269 -70.813 -146.819 1.00 71.18  ? 7    LEU B C     1 
ATOM   2380 O  O     . LEU B  1 6   ? -39.373 -71.048 -146.321 1.00 71.82  ? 7    LEU B O     1 
ATOM   2381 C  CB    . LEU B  1 6   ? -39.475 -69.138 -148.268 1.00 77.11  ? 7    LEU B CB    1 
ATOM   2382 C  CG    . LEU B  1 6   ? -40.661 -69.940 -148.836 1.00 81.28  ? 7    LEU B CG    1 
ATOM   2383 C  CD1   . LEU B  1 6   ? -41.975 -69.547 -148.153 1.00 79.51  ? 7    LEU B CD1   1 
ATOM   2384 C  CD2   . LEU B  1 6   ? -40.782 -69.795 -150.347 1.00 81.50  ? 7    LEU B CD2   1 
ATOM   2385 N  N     . ASN B  1 7   ? -37.152 -71.391 -146.366 1.00 64.80  ? 8    ASN B N     1 
ATOM   2386 C  CA    . ASN B  1 7   ? -37.217 -72.307 -145.231 1.00 58.11  ? 8    ASN B CA    1 
ATOM   2387 C  C     . ASN B  1 7   ? -37.410 -71.508 -143.948 1.00 48.40  ? 8    ASN B C     1 
ATOM   2388 O  O     . ASN B  1 7   ? -36.451 -71.182 -143.239 1.00 45.26  ? 8    ASN B O     1 
ATOM   2389 C  CB    . ASN B  1 7   ? -35.973 -73.196 -145.147 1.00 61.39  ? 8    ASN B CB    1 
ATOM   2390 C  CG    . ASN B  1 7   ? -36.239 -74.504 -144.394 1.00 63.18  ? 8    ASN B CG    1 
ATOM   2391 O  OD1   . ASN B  1 7   ? -37.057 -74.547 -143.467 1.00 59.56  ? 8    ASN B OD1   1 
ATOM   2392 N  ND2   . ASN B  1 7   ? -35.546 -75.575 -144.794 1.00 56.38  ? 8    ASN B ND2   1 
ATOM   2393 N  N     . LEU B  1 8   ? -38.671 -71.196 -143.659 1.00 40.73  ? 9    LEU B N     1 
ATOM   2394 C  CA    . LEU B  1 8   ? -39.007 -70.407 -142.486 1.00 38.90  ? 9    LEU B CA    1 
ATOM   2395 C  C     . LEU B  1 8   ? -38.612 -71.114 -141.197 1.00 43.84  ? 9    LEU B C     1 
ATOM   2396 O  O     . LEU B  1 8   ? -38.114 -70.480 -140.257 1.00 41.66  ? 9    LEU B O     1 
ATOM   2397 C  CB    . LEU B  1 8   ? -40.501 -70.125 -142.498 1.00 43.83  ? 9    LEU B CB    1 
ATOM   2398 C  CG    . LEU B  1 8   ? -41.004 -68.939 -141.709 1.00 47.31  ? 9    LEU B CG    1 
ATOM   2399 C  CD1   . LEU B  1 8   ? -40.381 -67.666 -142.245 1.00 45.59  ? 9    LEU B CD1   1 
ATOM   2400 C  CD2   . LEU B  1 8   ? -42.502 -68.929 -141.857 1.00 51.38  ? 9    LEU B CD2   1 
ATOM   2401 N  N     . ASP B  1 9   ? -38.837 -72.432 -141.129 1.00 39.07  ? 10   ASP B N     1 
ATOM   2402 C  CA    . ASP B  1 9   ? -38.517 -73.165 -139.912 1.00 45.55  ? 10   ASP B CA    1 
ATOM   2403 C  C     . ASP B  1 9   ? -37.018 -73.184 -139.658 1.00 43.50  ? 10   ASP B C     1 
ATOM   2404 O  O     . ASP B  1 9   ? -36.575 -72.979 -138.521 1.00 41.22  ? 10   ASP B O     1 
ATOM   2405 C  CB    . ASP B  1 9   ? -39.069 -74.590 -139.996 1.00 52.55  ? 10   ASP B CB    1 
ATOM   2406 C  CG    . ASP B  1 9   ? -40.537 -74.616 -140.357 1.00 58.95  ? 10   ASP B CG    1 
ATOM   2407 O  OD1   . ASP B  1 9   ? -41.330 -74.084 -139.560 1.00 62.56  ? 10   ASP B OD1   1 
ATOM   2408 O  OD2   . ASP B  1 9   ? -40.889 -75.122 -141.448 1.00 58.60  ? 10   ASP B OD2   1 
ATOM   2409 N  N     . SER B  1 10  ? -36.220 -73.441 -140.700 1.00 42.71  ? 11   SER B N     1 
ATOM   2410 C  CA    . SER B  1 10  ? -34.770 -73.389 -140.543 1.00 45.90  ? 11   SER B CA    1 
ATOM   2411 C  C     . SER B  1 10  ? -34.318 -72.008 -140.091 1.00 41.15  ? 11   SER B C     1 
ATOM   2412 O  O     . SER B  1 10  ? -33.391 -71.879 -139.283 1.00 38.24  ? 11   SER B O     1 
ATOM   2413 C  CB    . SER B  1 10  ? -34.085 -73.764 -141.852 1.00 52.93  ? 11   SER B CB    1 
ATOM   2414 O  OG    . SER B  1 10  ? -32.743 -73.317 -141.849 1.00 55.86  ? 11   SER B OG    1 
ATOM   2415 N  N     . ILE B  1 11  ? -34.967 -70.962 -140.594 1.00 40.51  ? 12   ILE B N     1 
ATOM   2416 C  CA    . ILE B  1 11  ? -34.630 -69.614 -140.152 1.00 38.55  ? 12   ILE B CA    1 
ATOM   2417 C  C     . ILE B  1 11  ? -34.909 -69.469 -138.662 1.00 40.96  ? 12   ILE B C     1 
ATOM   2418 O  O     . ILE B  1 11  ? -34.044 -69.039 -137.889 1.00 36.27  ? 12   ILE B O     1 
ATOM   2419 C  CB    . ILE B  1 11  ? -35.393 -68.579 -140.992 1.00 37.25  ? 12   ILE B CB    1 
ATOM   2420 C  CG1   . ILE B  1 11  ? -34.742 -68.496 -142.379 1.00 37.80  ? 12   ILE B CG1   1 
ATOM   2421 C  CG2   . ILE B  1 11  ? -35.428 -67.212 -140.286 1.00 38.22  ? 12   ILE B CG2   1 
ATOM   2422 C  CD1   . ILE B  1 11  ? -35.503 -67.640 -143.395 1.00 37.77  ? 12   ILE B CD1   1 
ATOM   2423 N  N     . ILE B  1 12  ? -36.109 -69.870 -138.237 1.00 39.58  ? 13   ILE B N     1 
ATOM   2424 C  CA    . ILE B  1 12  ? -36.495 -69.762 -136.832 1.00 40.88  ? 13   ILE B CA    1 
ATOM   2425 C  C     . ILE B  1 12  ? -35.576 -70.609 -135.962 1.00 44.66  ? 13   ILE B C     1 
ATOM   2426 O  O     . ILE B  1 12  ? -35.123 -70.171 -134.893 1.00 38.84  ? 13   ILE B O     1 
ATOM   2427 C  CB    . ILE B  1 12  ? -37.969 -70.168 -136.668 1.00 41.62  ? 13   ILE B CB    1 
ATOM   2428 C  CG1   . ILE B  1 12  ? -38.874 -69.119 -137.321 1.00 38.30  ? 13   ILE B CG1   1 
ATOM   2429 C  CG2   . ILE B  1 12  ? -38.304 -70.412 -135.200 1.00 44.44  ? 13   ILE B CG2   1 
ATOM   2430 C  CD1   . ILE B  1 12  ? -40.313 -69.548 -137.471 1.00 38.32  ? 13   ILE B CD1   1 
ATOM   2431 N  N     . GLY B  1 13  ? -35.264 -71.822 -136.424 1.00 36.99  ? 14   GLY B N     1 
ATOM   2432 C  CA    . GLY B  1 13  ? -34.349 -72.668 -135.684 1.00 42.12  ? 14   GLY B CA    1 
ATOM   2433 C  C     . GLY B  1 13  ? -33.008 -72.004 -135.459 1.00 46.22  ? 14   GLY B C     1 
ATOM   2434 O  O     . GLY B  1 13  ? -32.499 -71.976 -134.339 1.00 47.61  ? 14   GLY B O     1 
ATOM   2435 N  N     . ARG B  1 14  ? -32.429 -71.431 -136.518 1.00 36.95  ? 15   ARG B N     1 
ATOM   2436 C  CA    . ARG B  1 14  ? -31.140 -70.766 -136.358 1.00 38.41  ? 15   ARG B CA    1 
ATOM   2437 C  C     . ARG B  1 14  ? -31.255 -69.560 -135.437 1.00 38.19  ? 15   ARG B C     1 
ATOM   2438 O  O     . ARG B  1 14  ? -30.376 -69.330 -134.598 1.00 42.14  ? 15   ARG B O     1 
ATOM   2439 C  CB    . ARG B  1 14  ? -30.583 -70.367 -137.719 1.00 42.11  ? 15   ARG B CB    1 
ATOM   2440 C  CG    . ARG B  1 14  ? -29.791 -71.493 -138.381 1.00 46.75  ? 15   ARG B CG    1 
ATOM   2441 C  CD    . ARG B  1 14  ? -29.404 -71.115 -139.787 1.00 50.77  ? 15   ARG B CD    1 
ATOM   2442 N  NE    . ARG B  1 14  ? -30.536 -71.222 -140.697 1.00 54.61  ? 15   ARG B NE    1 
ATOM   2443 C  CZ    . ARG B  1 14  ? -30.662 -70.514 -141.815 1.00 48.35  ? 15   ARG B CZ    1 
ATOM   2444 N  NH1   . ARG B  1 14  ? -29.725 -69.640 -142.148 1.00 47.98  ? 15   ARG B NH1   1 
ATOM   2445 N  NH2   . ARG B  1 14  ? -31.722 -70.678 -142.594 1.00 43.10  ? 15   ARG B NH2   1 
ATOM   2446 N  N     . LEU B  1 15  ? -32.343 -68.792 -135.554 1.00 38.53  ? 16   LEU B N     1 
ATOM   2447 C  CA    . LEU B  1 15  ? -32.514 -67.627 -134.690 1.00 42.08  ? 16   LEU B CA    1 
ATOM   2448 C  C     . LEU B  1 15  ? -32.626 -68.030 -133.225 1.00 44.68  ? 16   LEU B C     1 
ATOM   2449 O  O     . LEU B  1 15  ? -32.061 -67.365 -132.349 1.00 46.73  ? 16   LEU B O     1 
ATOM   2450 C  CB    . LEU B  1 15  ? -33.748 -66.827 -135.110 1.00 34.09  ? 16   LEU B CB    1 
ATOM   2451 C  CG    . LEU B  1 15  ? -33.649 -65.968 -136.376 1.00 34.18  ? 16   LEU B CG    1 
ATOM   2452 C  CD1   . LEU B  1 15  ? -35.008 -65.441 -136.789 1.00 34.03  ? 16   LEU B CD1   1 
ATOM   2453 C  CD2   . LEU B  1 15  ? -32.658 -64.832 -136.191 1.00 33.60  ? 16   LEU B CD2   1 
ATOM   2454 N  N     . LEU B  1 16  ? -33.361 -69.110 -132.935 1.00 41.78  ? 17   LEU B N     1 
ATOM   2455 C  CA    . LEU B  1 16  ? -33.527 -69.539 -131.550 1.00 41.20  ? 17   LEU B CA    1 
ATOM   2456 C  C     . LEU B  1 16  ? -32.273 -70.182 -130.974 1.00 48.96  ? 17   LEU B C     1 
ATOM   2457 O  O     . LEU B  1 16  ? -32.189 -70.340 -129.752 1.00 52.90  ? 17   LEU B O     1 
ATOM   2458 C  CB    . LEU B  1 16  ? -34.704 -70.507 -131.430 1.00 36.71  ? 17   LEU B CB    1 
ATOM   2459 C  CG    . LEU B  1 16  ? -36.069 -69.929 -131.827 1.00 43.04  ? 17   LEU B CG    1 
ATOM   2460 C  CD1   . LEU B  1 16  ? -37.201 -70.848 -131.427 1.00 41.89  ? 17   LEU B CD1   1 
ATOM   2461 C  CD2   . LEU B  1 16  ? -36.273 -68.537 -131.239 1.00 41.74  ? 17   LEU B CD2   1 
ATOM   2462 N  N     . GLU B  1 17  ? -31.298 -70.531 -131.810 1.00 52.31  ? 18   GLU B N     1 
ATOM   2463 C  CA    . GLU B  1 17  ? -30.086 -71.215 -131.376 1.00 61.19  ? 18   GLU B CA    1 
ATOM   2464 C  C     . GLU B  1 17  ? -28.981 -70.268 -130.923 1.00 70.47  ? 18   GLU B C     1 
ATOM   2465 O  O     . GLU B  1 17  ? -27.914 -70.739 -130.524 1.00 67.91  ? 18   GLU B O     1 
ATOM   2466 C  CB    . GLU B  1 17  ? -29.549 -72.107 -132.501 1.00 62.00  ? 18   GLU B CB    1 
ATOM   2467 C  CG    . GLU B  1 17  ? -30.246 -73.460 -132.607 1.00 73.93  ? 18   GLU B CG    1 
ATOM   2468 C  CD    . GLU B  1 17  ? -30.331 -74.191 -131.274 1.00 83.56  ? 18   GLU B CD    1 
ATOM   2469 O  OE1   . GLU B  1 17  ? -31.411 -74.157 -130.643 1.00 85.87  ? 18   GLU B OE1   1 
ATOM   2470 O  OE2   . GLU B  1 17  ? -29.319 -74.799 -130.860 1.00 86.25  ? 18   GLU B OE2   1 
ATOM   2471 N  N     . VAL B  1 18  ? -29.191 -68.953 -130.986 1.00 86.03  ? 19   VAL B N     1 
ATOM   2472 C  CA    . VAL B  1 18  ? -28.174 -68.037 -130.479 1.00 95.73  ? 19   VAL B CA    1 
ATOM   2473 C  C     . VAL B  1 18  ? -28.057 -68.172 -128.961 1.00 103.04 ? 19   VAL B C     1 
ATOM   2474 O  O     . VAL B  1 18  ? -28.993 -68.581 -128.261 1.00 105.13 ? 19   VAL B O     1 
ATOM   2475 C  CB    . VAL B  1 18  ? -28.478 -66.588 -130.887 1.00 98.05  ? 19   VAL B CB    1 
ATOM   2476 C  CG1   . VAL B  1 18  ? -28.882 -66.512 -132.355 1.00 96.02  ? 19   VAL B CG1   1 
ATOM   2477 C  CG2   . VAL B  1 18  ? -29.550 -66.022 -130.003 1.00 100.25 ? 19   VAL B CG2   1 
ATOM   2478 N  N     . GLN B  1 19  ? -26.875 -67.831 -128.445 1.00 104.30 ? 20   GLN B N     1 
ATOM   2479 C  CA    . GLN B  1 19  ? -26.596 -67.971 -127.020 1.00 101.03 ? 20   GLN B CA    1 
ATOM   2480 C  C     . GLN B  1 19  ? -25.366 -67.170 -126.608 1.00 97.50  ? 20   GLN B C     1 
ATOM   2481 O  O     . GLN B  1 19  ? -24.267 -67.404 -127.126 1.00 100.17 ? 20   GLN B O     1 
ATOM   2482 C  CB    . GLN B  1 19  ? -26.400 -69.447 -126.655 1.00 100.11 ? 20   GLN B CB    1 
ATOM   2483 N  N     . GLY B  1 20  ? -25.544 -66.234 -125.676 1.00 94.28  ? 21   GLY B N     1 
ATOM   2484 C  CA    . GLY B  1 20  ? -24.415 -65.533 -125.085 1.00 89.90  ? 21   GLY B CA    1 
ATOM   2485 C  C     . GLY B  1 20  ? -23.613 -64.741 -126.097 1.00 89.07  ? 21   GLY B C     1 
ATOM   2486 O  O     . GLY B  1 20  ? -24.153 -64.185 -127.060 1.00 88.78  ? 21   GLY B O     1 
ATOM   2487 N  N     . SER B  1 21  ? -22.300 -64.691 -125.872 1.00 88.67  ? 22   SER B N     1 
ATOM   2488 C  CA    . SER B  1 21  ? -21.359 -63.985 -126.742 1.00 89.06  ? 22   SER B CA    1 
ATOM   2489 C  C     . SER B  1 21  ? -21.749 -62.525 -126.924 1.00 90.66  ? 22   SER B C     1 
ATOM   2490 O  O     . SER B  1 21  ? -22.094 -61.847 -125.957 1.00 91.44  ? 22   SER B O     1 
ATOM   2491 C  CB    . SER B  1 21  ? -21.256 -64.677 -128.107 1.00 90.82  ? 22   SER B CB    1 
ATOM   2492 N  N     . GLN B  1 28  ? -26.222 -67.690 -138.189 1.00 65.32  ? 29   GLN B N     1 
ATOM   2493 C  CA    . GLN B  1 28  ? -26.531 -66.440 -138.878 1.00 61.33  ? 29   GLN B CA    1 
ATOM   2494 C  C     . GLN B  1 28  ? -27.374 -66.700 -140.119 1.00 55.49  ? 29   GLN B C     1 
ATOM   2495 O  O     . GLN B  1 28  ? -27.433 -67.824 -140.627 1.00 57.16  ? 29   GLN B O     1 
ATOM   2496 C  CB    . GLN B  1 28  ? -25.252 -65.704 -139.265 1.00 64.32  ? 29   GLN B CB    1 
ATOM   2497 C  CG    . GLN B  1 28  ? -24.253 -65.577 -138.132 1.00 71.73  ? 29   GLN B CG    1 
ATOM   2498 C  CD    . GLN B  1 28  ? -23.033 -64.780 -138.532 1.00 76.09  ? 29   GLN B CD    1 
ATOM   2499 O  OE1   . GLN B  1 28  ? -23.125 -63.861 -139.346 1.00 75.23  ? 29   GLN B OE1   1 
ATOM   2500 N  NE2   . GLN B  1 28  ? -21.877 -65.133 -137.972 1.00 76.81  ? 29   GLN B NE2   1 
ATOM   2501 N  N     . LEU B  1 29  ? -28.027 -65.652 -140.594 1.00 40.46  ? 30   LEU B N     1 
ATOM   2502 C  CA    . LEU B  1 29  ? -28.886 -65.705 -141.763 1.00 40.25  ? 30   LEU B CA    1 
ATOM   2503 C  C     . LEU B  1 29  ? -28.186 -65.055 -142.944 1.00 46.65  ? 30   LEU B C     1 
ATOM   2504 O  O     . LEU B  1 29  ? -27.302 -64.211 -142.783 1.00 48.66  ? 30   LEU B O     1 
ATOM   2505 C  CB    . LEU B  1 29  ? -30.222 -64.992 -141.501 1.00 37.57  ? 30   LEU B CB    1 
ATOM   2506 C  CG    . LEU B  1 29  ? -30.978 -65.364 -140.222 1.00 36.15  ? 30   LEU B CG    1 
ATOM   2507 C  CD1   . LEU B  1 29  ? -32.214 -64.485 -140.027 1.00 35.00  ? 30   LEU B CD1   1 
ATOM   2508 C  CD2   . LEU B  1 29  ? -31.356 -66.848 -140.243 1.00 36.27  ? 30   LEU B CD2   1 
ATOM   2509 N  N     . THR B  1 30  ? -28.600 -65.448 -144.141 1.00 43.66  ? 31   THR B N     1 
ATOM   2510 C  CA    . THR B  1 30  ? -28.062 -64.807 -145.328 1.00 44.61  ? 31   THR B CA    1 
ATOM   2511 C  C     . THR B  1 30  ? -28.878 -63.574 -145.696 1.00 44.77  ? 31   THR B C     1 
ATOM   2512 O  O     . THR B  1 30  ? -30.057 -63.441 -145.358 1.00 41.31  ? 31   THR B O     1 
ATOM   2513 C  CB    . THR B  1 30  ? -28.042 -65.753 -146.524 1.00 51.52  ? 31   THR B CB    1 
ATOM   2514 O  OG1   . THR B  1 30  ? -27.557 -65.038 -147.665 1.00 68.40  ? 31   THR B OG1   1 
ATOM   2515 C  CG2   . THR B  1 30  ? -29.426 -66.195 -146.850 1.00 44.03  ? 31   THR B CG2   1 
ATOM   2516 N  N     . GLU B  1 31  ? -28.218 -62.670 -146.411 1.00 40.77  ? 32   GLU B N     1 
ATOM   2517 C  CA    . GLU B  1 31  ? -28.904 -61.549 -147.034 1.00 41.43  ? 32   GLU B CA    1 
ATOM   2518 C  C     . GLU B  1 31  ? -30.160 -62.006 -147.771 1.00 40.54  ? 32   GLU B C     1 
ATOM   2519 O  O     . GLU B  1 31  ? -31.232 -61.399 -147.638 1.00 38.46  ? 32   GLU B O     1 
ATOM   2520 C  CB    . GLU B  1 31  ? -27.926 -60.874 -147.986 1.00 43.43  ? 32   GLU B CB    1 
ATOM   2521 C  CG    . GLU B  1 31  ? -28.217 -59.476 -148.344 1.00 53.92  ? 32   GLU B CG    1 
ATOM   2522 C  CD    . GLU B  1 31  ? -27.080 -58.900 -149.151 1.00 60.94  ? 32   GLU B CD    1 
ATOM   2523 O  OE1   . GLU B  1 31  ? -25.923 -59.022 -148.696 1.00 62.79  ? 32   GLU B OE1   1 
ATOM   2524 O  OE2   . GLU B  1 31  ? -27.338 -58.367 -150.248 1.00 65.66  ? 32   GLU B OE2   1 
ATOM   2525 N  N     . ASN B  1 32  ? -30.042 -63.094 -148.535 1.00 37.85  ? 33   ASN B N     1 
ATOM   2526 C  CA    A ASN B  1 32  ? -31.184 -63.607 -149.282 0.46 41.39  ? 33   ASN B CA    1 
ATOM   2527 C  CA    B ASN B  1 32  ? -31.176 -63.633 -149.281 0.54 41.47  ? 33   ASN B CA    1 
ATOM   2528 C  C     . ASN B  1 32  ? -32.346 -63.953 -148.354 1.00 42.13  ? 33   ASN B C     1 
ATOM   2529 O  O     . ASN B  1 32  ? -33.499 -63.605 -148.635 1.00 39.99  ? 33   ASN B O     1 
ATOM   2530 C  CB    A ASN B  1 32  ? -30.758 -64.831 -150.098 0.46 44.08  ? 33   ASN B CB    1 
ATOM   2531 C  CB    B ASN B  1 32  ? -30.719 -64.883 -150.043 0.54 44.10  ? 33   ASN B CB    1 
ATOM   2532 C  CG    A ASN B  1 32  ? -29.386 -64.659 -150.740 0.46 48.10  ? 33   ASN B CG    1 
ATOM   2533 C  CG    B ASN B  1 32  ? -31.712 -65.341 -151.091 0.54 46.41  ? 33   ASN B CG    1 
ATOM   2534 O  OD1   A ASN B  1 32  ? -28.377 -64.487 -150.046 0.46 46.66  ? 33   ASN B OD1   1 
ATOM   2535 O  OD1   B ASN B  1 32  ? -32.900 -65.496 -150.818 0.54 45.23  ? 33   ASN B OD1   1 
ATOM   2536 N  ND2   A ASN B  1 32  ? -29.339 -64.720 -152.070 0.46 53.33  ? 33   ASN B ND2   1 
ATOM   2537 N  ND2   B ASN B  1 32  ? -31.218 -65.581 -152.303 0.54 54.92  ? 33   ASN B ND2   1 
ATOM   2538 N  N     . GLU B  1 33  ? -32.066 -64.632 -147.240 1.00 39.89  ? 34   GLU B N     1 
ATOM   2539 C  CA    . GLU B  1 33  ? -33.127 -65.017 -146.317 1.00 38.70  ? 34   GLU B CA    1 
ATOM   2540 C  C     . GLU B  1 33  ? -33.769 -63.796 -145.671 1.00 33.38  ? 34   GLU B C     1 
ATOM   2541 O  O     . GLU B  1 33  ? -34.994 -63.724 -145.550 1.00 35.52  ? 34   GLU B O     1 
ATOM   2542 C  CB    . GLU B  1 33  ? -32.577 -65.963 -145.246 1.00 46.26  ? 34   GLU B CB    1 
ATOM   2543 C  CG    . GLU B  1 33  ? -32.468 -67.420 -145.698 1.00 52.54  ? 34   GLU B CG    1 
ATOM   2544 C  CD    . GLU B  1 33  ? -31.393 -68.211 -144.964 1.00 54.56  ? 34   GLU B CD    1 
ATOM   2545 O  OE1   . GLU B  1 33  ? -30.774 -67.689 -144.015 1.00 52.48  ? 34   GLU B OE1   1 
ATOM   2546 O  OE2   . GLU B  1 33  ? -31.158 -69.370 -145.356 1.00 60.78  ? 34   GLU B OE2   1 
ATOM   2547 N  N     . ILE B  1 34  ? -32.961 -62.827 -145.250 1.00 35.37  ? 35   ILE B N     1 
ATOM   2548 C  CA    . ILE B  1 34  ? -33.514 -61.656 -144.586 1.00 36.92  ? 35   ILE B CA    1 
ATOM   2549 C  C     . ILE B  1 34  ? -34.416 -60.894 -145.538 1.00 40.12  ? 35   ILE B C     1 
ATOM   2550 O  O     . ILE B  1 34  ? -35.465 -60.368 -145.147 1.00 40.79  ? 35   ILE B O     1 
ATOM   2551 C  CB    . ILE B  1 34  ? -32.373 -60.781 -144.048 1.00 41.06  ? 35   ILE B CB    1 
ATOM   2552 C  CG1   . ILE B  1 34  ? -31.635 -61.554 -142.955 1.00 38.73  ? 35   ILE B CG1   1 
ATOM   2553 C  CG2   . ILE B  1 34  ? -32.913 -59.436 -143.548 1.00 39.80  ? 35   ILE B CG2   1 
ATOM   2554 C  CD1   . ILE B  1 34  ? -30.496 -60.796 -142.325 1.00 43.24  ? 35   ILE B CD1   1 
ATOM   2555 N  N     . ARG B  1 35  ? -34.030 -60.846 -146.807 1.00 43.61  ? 36   ARG B N     1 
ATOM   2556 C  CA    . ARG B  1 35  ? -34.854 -60.194 -147.810 1.00 41.50  ? 36   ARG B CA    1 
ATOM   2557 C  C     . ARG B  1 35  ? -36.172 -60.934 -147.992 1.00 37.37  ? 36   ARG B C     1 
ATOM   2558 O  O     . ARG B  1 35  ? -37.219 -60.310 -148.188 1.00 35.63  ? 36   ARG B O     1 
ATOM   2559 C  CB    . ARG B  1 35  ? -34.079 -60.119 -149.120 1.00 44.82  ? 36   ARG B CB    1 
ATOM   2560 C  CG    . ARG B  1 35  ? -34.667 -59.184 -150.130 1.00 52.63  ? 36   ARG B CG    1 
ATOM   2561 C  CD    . ARG B  1 35  ? -33.797 -59.125 -151.365 1.00 57.56  ? 36   ARG B CD    1 
ATOM   2562 N  NE    . ARG B  1 35  ? -32.462 -58.604 -151.088 1.00 61.10  ? 36   ARG B NE    1 
ATOM   2563 C  CZ    . ARG B  1 35  ? -31.345 -59.326 -151.104 1.00 56.48  ? 36   ARG B CZ    1 
ATOM   2564 N  NH1   . ARG B  1 35  ? -30.179 -58.744 -150.844 1.00 52.29  ? 36   ARG B NH1   1 
ATOM   2565 N  NH2   . ARG B  1 35  ? -31.387 -60.619 -151.393 1.00 53.52  ? 36   ARG B NH2   1 
ATOM   2566 N  N     . GLY B  1 36  ? -36.142 -62.268 -147.925 1.00 34.25  ? 37   GLY B N     1 
ATOM   2567 C  CA    . GLY B  1 36  ? -37.385 -63.013 -147.988 1.00 31.42  ? 37   GLY B CA    1 
ATOM   2568 C  C     . GLY B  1 36  ? -38.304 -62.689 -146.824 1.00 37.08  ? 37   GLY B C     1 
ATOM   2569 O  O     . GLY B  1 36  ? -39.514 -62.530 -146.999 1.00 37.26  ? 37   GLY B O     1 
ATOM   2570 N  N     . LEU B  1 37  ? -37.741 -62.572 -145.620 1.00 35.30  ? 38   LEU B N     1 
ATOM   2571 C  CA    . LEU B  1 37  ? -38.558 -62.190 -144.470 1.00 36.22  ? 38   LEU B CA    1 
ATOM   2572 C  C     . LEU B  1 37  ? -39.211 -60.826 -144.687 1.00 33.90  ? 38   LEU B C     1 
ATOM   2573 O  O     . LEU B  1 37  ? -40.409 -60.654 -144.430 1.00 35.67  ? 38   LEU B O     1 
ATOM   2574 C  CB    . LEU B  1 37  ? -37.711 -62.188 -143.195 1.00 33.22  ? 38   LEU B CB    1 
ATOM   2575 C  CG    . LEU B  1 37  ? -37.122 -63.542 -142.750 1.00 33.44  ? 38   LEU B CG    1 
ATOM   2576 C  CD1   . LEU B  1 37  ? -36.203 -63.342 -141.556 1.00 32.84  ? 38   LEU B CD1   1 
ATOM   2577 C  CD2   . LEU B  1 37  ? -38.219 -64.542 -142.421 1.00 26.40  ? 38   LEU B CD2   1 
ATOM   2578 N  N     . CYS B  1 38  ? -38.447 -59.853 -145.189 1.00 31.46  ? 39   CYS B N     1 
ATOM   2579 C  CA    . CYS B  1 38  ? -38.981 -58.503 -145.368 1.00 30.49  ? 39   CYS B CA    1 
ATOM   2580 C  C     . CYS B  1 38  ? -40.060 -58.466 -146.445 1.00 36.69  ? 39   CYS B C     1 
ATOM   2581 O  O     . CYS B  1 38  ? -41.123 -57.866 -146.253 1.00 37.89  ? 39   CYS B O     1 
ATOM   2582 C  CB    . CYS B  1 38  ? -37.852 -57.538 -145.716 1.00 34.22  ? 39   CYS B CB    1 
ATOM   2583 S  SG    . CYS B  1 38  ? -36.706 -57.216 -144.357 1.00 36.64  ? 39   CYS B SG    1 
ATOM   2584 N  N     . LEU B  1 39  ? -39.803 -59.094 -147.593 1.00 35.69  ? 40   LEU B N     1 
ATOM   2585 C  CA    . LEU B  1 39  ? -40.768 -59.036 -148.682 1.00 33.58  ? 40   LEU B CA    1 
ATOM   2586 C  C     . LEU B  1 39  ? -42.028 -59.820 -148.346 1.00 34.36  ? 40   LEU B C     1 
ATOM   2587 O  O     . LEU B  1 39  ? -43.143 -59.335 -148.565 1.00 34.67  ? 40   LEU B O     1 
ATOM   2588 C  CB    . LEU B  1 39  ? -40.140 -59.567 -149.970 1.00 37.32  ? 40   LEU B CB    1 
ATOM   2589 C  CG    . LEU B  1 39  ? -38.954 -58.784 -150.545 1.00 42.95  ? 40   LEU B CG    1 
ATOM   2590 C  CD1   . LEU B  1 39  ? -38.637 -59.328 -151.913 1.00 43.38  ? 40   LEU B CD1   1 
ATOM   2591 C  CD2   . LEU B  1 39  ? -39.247 -57.294 -150.622 1.00 38.69  ? 40   LEU B CD2   1 
ATOM   2592 N  N     . LYS B  1 40  ? -41.875 -61.030 -147.807 1.00 27.48  ? 41   LYS B N     1 
ATOM   2593 C  CA    . LYS B  1 40  ? -43.051 -61.820 -147.476 1.00 34.00  ? 41   LYS B CA    1 
ATOM   2594 C  C     . LYS B  1 40  ? -43.881 -61.154 -146.383 1.00 33.87  ? 41   LYS B C     1 
ATOM   2595 O  O     . LYS B  1 40  ? -45.111 -61.097 -146.478 1.00 38.24  ? 41   LYS B O     1 
ATOM   2596 C  CB    . LYS B  1 40  ? -42.637 -63.230 -147.053 1.00 34.47  ? 41   LYS B CB    1 
ATOM   2597 C  CG    . LYS B  1 40  ? -43.805 -64.126 -146.742 1.00 43.38  ? 41   LYS B CG    1 
ATOM   2598 C  CD    . LYS B  1 40  ? -44.783 -64.146 -147.895 1.00 54.45  ? 41   LYS B CD    1 
ATOM   2599 C  CE    . LYS B  1 40  ? -45.839 -65.213 -147.699 1.00 59.68  ? 41   LYS B CE    1 
ATOM   2600 N  NZ    . LYS B  1 40  ? -46.583 -65.422 -148.974 1.00 63.73  ? 41   LYS B NZ    1 
ATOM   2601 N  N     . SER B  1 41  ? -43.235 -60.642 -145.332 1.00 31.36  ? 42   SER B N     1 
ATOM   2602 C  CA    . SER B  1 41  ? -44.024 -60.044 -144.258 1.00 31.80  ? 42   SER B CA    1 
ATOM   2603 C  C     . SER B  1 41  ? -44.678 -58.743 -144.710 1.00 34.46  ? 42   SER B C     1 
ATOM   2604 O  O     . SER B  1 41  ? -45.802 -58.433 -144.292 1.00 37.24  ? 42   SER B O     1 
ATOM   2605 C  CB    . SER B  1 41  ? -43.153 -59.816 -143.019 1.00 32.70  ? 42   SER B CB    1 
ATOM   2606 O  OG    . SER B  1 41  ? -42.108 -58.879 -143.273 1.00 33.00  ? 42   SER B OG    1 
ATOM   2607 N  N     . ARG B  1 42  ? -44.004 -57.989 -145.582 1.00 34.97  ? 43   ARG B N     1 
ATOM   2608 C  CA    . ARG B  1 42  ? -44.592 -56.782 -146.149 1.00 26.76  ? 43   ARG B CA    1 
ATOM   2609 C  C     . ARG B  1 42  ? -45.915 -57.077 -146.846 1.00 32.46  ? 43   ARG B C     1 
ATOM   2610 O  O     . ARG B  1 42  ? -46.905 -56.361 -146.640 1.00 35.78  ? 43   ARG B O     1 
ATOM   2611 C  CB    . ARG B  1 42  ? -43.599 -56.156 -147.128 1.00 34.13  ? 43   ARG B CB    1 
ATOM   2612 C  CG    . ARG B  1 42  ? -44.090 -54.912 -147.849 1.00 42.73  ? 43   ARG B CG    1 
ATOM   2613 C  CD    . ARG B  1 42  ? -43.067 -54.477 -148.887 1.00 45.22  ? 43   ARG B CD    1 
ATOM   2614 N  NE    . ARG B  1 42  ? -43.304 -53.102 -149.289 1.00 53.64  ? 43   ARG B NE    1 
ATOM   2615 C  CZ    . ARG B  1 42  ? -44.117 -52.737 -150.276 1.00 52.99  ? 43   ARG B CZ    1 
ATOM   2616 N  NH1   . ARG B  1 42  ? -44.768 -53.657 -150.981 1.00 50.23  ? 43   ARG B NH1   1 
ATOM   2617 N  NH2   . ARG B  1 42  ? -44.268 -51.449 -150.555 1.00 48.02  ? 43   ARG B NH2   1 
ATOM   2618 N  N     . GLU B  1 43  ? -45.940 -58.105 -147.705 1.00 28.37  ? 44   GLU B N     1 
ATOM   2619 C  CA    . GLU B  1 43  ? -47.186 -58.507 -148.358 1.00 34.36  ? 44   GLU B CA    1 
ATOM   2620 C  C     . GLU B  1 43  ? -48.276 -58.831 -147.342 1.00 36.47  ? 44   GLU B C     1 
ATOM   2621 O  O     . GLU B  1 43  ? -49.455 -58.534 -147.569 1.00 41.03  ? 44   GLU B O     1 
ATOM   2622 C  CB    . GLU B  1 43  ? -46.953 -59.719 -149.255 1.00 38.46  ? 44   GLU B CB    1 
ATOM   2623 C  CG    . GLU B  1 43  ? -46.085 -59.456 -150.465 1.00 54.36  ? 44   GLU B CG    1 
ATOM   2624 C  CD    . GLU B  1 43  ? -45.876 -60.702 -151.320 1.00 62.27  ? 44   GLU B CD    1 
ATOM   2625 O  OE1   . GLU B  1 43  ? -46.464 -61.758 -150.993 1.00 64.76  ? 44   GLU B OE1   1 
ATOM   2626 O  OE2   . GLU B  1 43  ? -45.114 -60.624 -152.312 1.00 65.03  ? 44   GLU B OE2   1 
ATOM   2627 N  N     . ILE B  1 44  ? -47.908 -59.461 -146.225 1.00 31.30  ? 45   ILE B N     1 
ATOM   2628 C  CA    . ILE B  1 44  ? -48.915 -59.814 -145.229 1.00 31.34  ? 45   ILE B CA    1 
ATOM   2629 C  C     . ILE B  1 44  ? -49.464 -58.565 -144.550 1.00 31.04  ? 45   ILE B C     1 
ATOM   2630 O  O     . ILE B  1 44  ? -50.677 -58.426 -144.385 1.00 33.24  ? 45   ILE B O     1 
ATOM   2631 C  CB    . ILE B  1 44  ? -48.338 -60.806 -144.212 1.00 31.33  ? 45   ILE B CB    1 
ATOM   2632 C  CG1   . ILE B  1 44  ? -47.943 -62.108 -144.928 1.00 38.48  ? 45   ILE B CG1   1 
ATOM   2633 C  CG2   . ILE B  1 44  ? -49.351 -61.056 -143.087 1.00 31.44  ? 45   ILE B CG2   1 
ATOM   2634 C  CD1   . ILE B  1 44  ? -47.330 -63.169 -144.022 1.00 36.10  ? 45   ILE B CD1   1 
ATOM   2635 N  N     . PHE B  1 45  ? -48.580 -57.647 -144.139 1.00 33.32  ? 46   PHE B N     1 
ATOM   2636 C  CA    . PHE B  1 45  ? -49.027 -56.393 -143.532 1.00 32.41  ? 46   PHE B CA    1 
ATOM   2637 C  C     . PHE B  1 45  ? -50.024 -55.675 -144.439 1.00 35.69  ? 46   PHE B C     1 
ATOM   2638 O  O     . PHE B  1 45  ? -51.093 -55.242 -143.988 1.00 36.22  ? 46   PHE B O     1 
ATOM   2639 C  CB    . PHE B  1 45  ? -47.826 -55.487 -143.238 1.00 28.03  ? 46   PHE B CB    1 
ATOM   2640 C  CG    . PHE B  1 45  ? -46.846 -56.059 -142.244 1.00 30.80  ? 46   PHE B CG    1 
ATOM   2641 C  CD1   . PHE B  1 45  ? -47.284 -56.728 -141.106 1.00 27.25  ? 46   PHE B CD1   1 
ATOM   2642 C  CD2   . PHE B  1 45  ? -45.478 -55.920 -142.447 1.00 34.81  ? 46   PHE B CD2   1 
ATOM   2643 C  CE1   . PHE B  1 45  ? -46.374 -57.244 -140.187 1.00 29.02  ? 46   PHE B CE1   1 
ATOM   2644 C  CE2   . PHE B  1 45  ? -44.560 -56.442 -141.536 1.00 31.47  ? 46   PHE B CE2   1 
ATOM   2645 C  CZ    . PHE B  1 45  ? -45.010 -57.110 -140.403 1.00 30.34  ? 46   PHE B CZ    1 
ATOM   2646 N  N     . LEU B  1 46  ? -49.706 -55.578 -145.736 1.00 34.48  ? 47   LEU B N     1 
ATOM   2647 C  CA    . LEU B  1 46  ? -50.571 -54.836 -146.653 1.00 37.55  ? 47   LEU B CA    1 
ATOM   2648 C  C     . LEU B  1 46  ? -51.898 -55.540 -146.886 1.00 35.99  ? 47   LEU B C     1 
ATOM   2649 O  O     . LEU B  1 46  ? -52.902 -54.878 -147.153 1.00 40.86  ? 47   LEU B O     1 
ATOM   2650 C  CB    . LEU B  1 46  ? -49.866 -54.604 -147.988 1.00 34.77  ? 47   LEU B CB    1 
ATOM   2651 C  CG    . LEU B  1 46  ? -48.748 -53.566 -147.908 1.00 30.42  ? 47   LEU B CG    1 
ATOM   2652 C  CD1   . LEU B  1 46  ? -48.038 -53.433 -149.255 1.00 32.99  ? 47   LEU B CD1   1 
ATOM   2653 C  CD2   . LEU B  1 46  ? -49.324 -52.244 -147.454 1.00 28.66  ? 47   LEU B CD2   1 
ATOM   2654 N  N     . SER B  1 47  ? -51.933 -56.862 -146.773 1.00 33.75  ? 48   SER B N     1 
ATOM   2655 C  CA    . SER B  1 47  ? -53.188 -57.593 -146.892 1.00 37.57  ? 48   SER B CA    1 
ATOM   2656 C  C     . SER B  1 47  ? -54.021 -57.557 -145.618 1.00 37.55  ? 48   SER B C     1 
ATOM   2657 O  O     . SER B  1 47  ? -55.189 -57.951 -145.649 1.00 41.92  ? 48   SER B O     1 
ATOM   2658 C  CB    . SER B  1 47  ? -52.917 -59.052 -147.274 1.00 42.49  ? 48   SER B CB    1 
ATOM   2659 O  OG    . SER B  1 47  ? -52.531 -59.804 -146.136 1.00 50.19  ? 48   SER B OG    1 
ATOM   2660 N  N     . GLN B  1 48  ? -53.466 -57.113 -144.505 1.00 32.37  ? 49   GLN B N     1 
ATOM   2661 C  CA    . GLN B  1 48  ? -54.256 -56.984 -143.296 1.00 34.15  ? 49   GLN B CA    1 
ATOM   2662 C  C     . GLN B  1 48  ? -54.548 -55.513 -143.024 1.00 32.44  ? 49   GLN B C     1 
ATOM   2663 O  O     . GLN B  1 48  ? -53.856 -54.630 -143.537 1.00 32.84  ? 49   GLN B O     1 
ATOM   2664 C  CB    . GLN B  1 48  ? -53.523 -57.628 -142.110 1.00 33.45  ? 49   GLN B CB    1 
ATOM   2665 C  CG    . GLN B  1 48  ? -53.492 -59.143 -142.205 1.00 30.95  ? 49   GLN B CG    1 
ATOM   2666 C  CD    . GLN B  1 48  ? -52.783 -59.821 -141.044 1.00 31.69  ? 49   GLN B CD    1 
ATOM   2667 O  OE1   . GLN B  1 48  ? -51.990 -59.204 -140.329 1.00 29.68  ? 49   GLN B OE1   1 
ATOM   2668 N  NE2   . GLN B  1 48  ? -53.043 -61.117 -140.873 1.00 33.61  ? 49   GLN B NE2   1 
ATOM   2669 N  N     . PRO B  1 49  ? -55.598 -55.211 -142.259 1.00 36.61  ? 50   PRO B N     1 
ATOM   2670 C  CA    . PRO B  1 49  ? -55.972 -53.805 -142.051 1.00 33.37  ? 50   PRO B CA    1 
ATOM   2671 C  C     . PRO B  1 49  ? -54.874 -53.028 -141.336 1.00 36.28  ? 50   PRO B C     1 
ATOM   2672 O  O     . PRO B  1 49  ? -54.078 -53.586 -140.577 1.00 34.08  ? 50   PRO B O     1 
ATOM   2673 C  CB    . PRO B  1 49  ? -57.241 -53.899 -141.190 1.00 32.42  ? 50   PRO B CB    1 
ATOM   2674 C  CG    . PRO B  1 49  ? -57.762 -55.274 -141.419 1.00 35.27  ? 50   PRO B CG    1 
ATOM   2675 C  CD    . PRO B  1 49  ? -56.559 -56.139 -141.626 1.00 32.58  ? 50   PRO B CD    1 
ATOM   2676 N  N     . ILE B  1 50  ? -54.829 -51.717 -141.600 1.00 29.81  ? 51   ILE B N     1 
ATOM   2677 C  CA    . ILE B  1 50  ? -53.885 -50.861 -140.897 1.00 26.01  ? 51   ILE B CA    1 
ATOM   2678 C  C     . ILE B  1 50  ? -54.344 -50.627 -139.470 1.00 28.47  ? 51   ILE B C     1 
ATOM   2679 O  O     . ILE B  1 50  ? -53.539 -50.295 -138.591 1.00 30.69  ? 51   ILE B O     1 
ATOM   2680 C  CB    . ILE B  1 50  ? -53.705 -49.529 -141.656 1.00 30.31  ? 51   ILE B CB    1 
ATOM   2681 C  CG1   . ILE B  1 50  ? -52.422 -48.828 -141.192 1.00 30.75  ? 51   ILE B CG1   1 
ATOM   2682 C  CG2   . ILE B  1 50  ? -54.931 -48.624 -141.476 1.00 27.42  ? 51   ILE B CG2   1 
ATOM   2683 C  CD1   . ILE B  1 50  ? -52.128 -47.539 -141.912 1.00 34.81  ? 51   ILE B CD1   1 
ATOM   2684 N  N     . LEU B  1 51  ? -55.623 -50.770 -139.232 1.00 28.48  ? 52   LEU B N     1 
ATOM   2685 C  CA    . LEU B  1 51  ? -56.203 -50.731 -137.904 1.00 32.81  ? 52   LEU B CA    1 
ATOM   2686 C  C     . LEU B  1 51  ? -56.676 -52.155 -137.638 1.00 30.88  ? 52   LEU B C     1 
ATOM   2687 O  O     . LEU B  1 51  ? -57.706 -52.585 -138.163 1.00 33.90  ? 52   LEU B O     1 
ATOM   2688 C  CB    . LEU B  1 51  ? -57.341 -49.717 -137.828 1.00 32.10  ? 52   LEU B CB    1 
ATOM   2689 C  CG    . LEU B  1 51  ? -58.079 -49.655 -136.497 1.00 32.21  ? 52   LEU B CG    1 
ATOM   2690 C  CD1   . LEU B  1 51  ? -57.113 -49.256 -135.387 1.00 32.71  ? 52   LEU B CD1   1 
ATOM   2691 C  CD2   . LEU B  1 51  ? -59.261 -48.702 -136.577 1.00 31.28  ? 52   LEU B CD2   1 
ATOM   2692 N  N     . LEU B  1 52  ? -55.905 -52.890 -136.844 1.00 31.77  ? 53   LEU B N     1 
ATOM   2693 C  CA    . LEU B  1 52  ? -56.217 -54.288 -136.564 1.00 29.94  ? 53   LEU B CA    1 
ATOM   2694 C  C     . LEU B  1 52  ? -57.373 -54.405 -135.584 1.00 31.39  ? 53   LEU B C     1 
ATOM   2695 O  O     . LEU B  1 52  ? -57.460 -53.661 -134.606 1.00 31.87  ? 53   LEU B O     1 
ATOM   2696 C  CB    . LEU B  1 52  ? -54.990 -54.998 -135.994 1.00 31.21  ? 53   LEU B CB    1 
ATOM   2697 C  CG    . LEU B  1 52  ? -53.718 -54.981 -136.856 1.00 31.02  ? 53   LEU B CG    1 
ATOM   2698 C  CD1   . LEU B  1 52  ? -52.527 -55.398 -136.039 1.00 24.98  ? 53   LEU B CD1   1 
ATOM   2699 C  CD2   . LEU B  1 52  ? -53.894 -55.894 -138.079 1.00 30.72  ? 53   LEU B CD2   1 
ATOM   2700 N  N     . GLU B  1 53  ? -58.258 -55.348 -135.838 1.00 30.24  ? 54   GLU B N     1 
ATOM   2701 C  CA    . GLU B  1 53  ? -59.295 -55.700 -134.875 1.00 33.77  ? 54   GLU B CA    1 
ATOM   2702 C  C     . GLU B  1 53  ? -59.031 -57.138 -134.460 1.00 32.00  ? 54   GLU B C     1 
ATOM   2703 O  O     . GLU B  1 53  ? -59.128 -58.065 -135.271 1.00 29.90  ? 54   GLU B O     1 
ATOM   2704 C  CB    . GLU B  1 53  ? -60.708 -55.503 -135.425 1.00 42.56  ? 54   GLU B CB    1 
ATOM   2705 C  CG    . GLU B  1 53  ? -61.289 -54.113 -135.019 1.00 59.70  ? 54   GLU B CG    1 
ATOM   2706 C  CD    . GLU B  1 53  ? -62.134 -54.135 -133.727 1.00 69.56  ? 54   GLU B CD    1 
ATOM   2707 O  OE1   . GLU B  1 53  ? -61.898 -55.021 -132.874 1.00 70.54  ? 54   GLU B OE1   1 
ATOM   2708 O  OE2   . GLU B  1 53  ? -62.988 -53.235 -133.537 1.00 67.91  ? 54   GLU B OE2   1 
ATOM   2709 N  N     . LEU B  1 54  ? -58.661 -57.303 -133.202 1.00 28.96  ? 55   LEU B N     1 
ATOM   2710 C  CA    . LEU B  1 54  ? -58.191 -58.550 -132.643 1.00 35.76  ? 55   LEU B CA    1 
ATOM   2711 C  C     . LEU B  1 54  ? -59.113 -58.960 -131.504 1.00 41.34  ? 55   LEU B C     1 
ATOM   2712 O  O     . LEU B  1 54  ? -59.986 -58.200 -131.068 1.00 43.40  ? 55   LEU B O     1 
ATOM   2713 C  CB    . LEU B  1 54  ? -56.748 -58.428 -132.122 1.00 34.11  ? 55   LEU B CB    1 
ATOM   2714 C  CG    . LEU B  1 54  ? -55.721 -57.759 -133.037 1.00 34.98  ? 55   LEU B CG    1 
ATOM   2715 C  CD1   . LEU B  1 54  ? -54.403 -57.507 -132.290 1.00 30.65  ? 55   LEU B CD1   1 
ATOM   2716 C  CD2   . LEU B  1 54  ? -55.486 -58.611 -134.273 1.00 34.38  ? 55   LEU B CD2   1 
ATOM   2717 N  N     . GLU B  1 55  ? -58.887 -60.172 -131.007 1.00 37.62  ? 56   GLU B N     1 
ATOM   2718 C  CA    . GLU B  1 55  ? -59.664 -60.746 -129.919 1.00 38.07  ? 56   GLU B CA    1 
ATOM   2719 C  C     . GLU B  1 55  ? -58.719 -61.355 -128.900 1.00 39.26  ? 56   GLU B C     1 
ATOM   2720 O  O     . GLU B  1 55  ? -57.678 -61.916 -129.268 1.00 38.44  ? 56   GLU B O     1 
ATOM   2721 C  CB    . GLU B  1 55  ? -60.627 -61.817 -130.429 1.00 37.81  ? 56   GLU B CB    1 
ATOM   2722 C  CG    . GLU B  1 55  ? -61.626 -61.298 -131.437 1.00 45.05  ? 56   GLU B CG    1 
ATOM   2723 N  N     . ALA B  1 56  ? -59.079 -61.225 -127.623 1.00 35.38  ? 57   ALA B N     1 
ATOM   2724 C  CA    . ALA B  1 56  ? -58.388 -61.953 -126.581 1.00 36.94  ? 57   ALA B CA    1 
ATOM   2725 C  C     . ALA B  1 56  ? -58.761 -63.437 -126.680 1.00 37.51  ? 57   ALA B C     1 
ATOM   2726 O  O     . ALA B  1 56  ? -59.763 -63.785 -127.306 1.00 39.23  ? 57   ALA B O     1 
ATOM   2727 C  CB    . ALA B  1 56  ? -58.746 -61.375 -125.219 1.00 32.06  ? 57   ALA B CB    1 
ATOM   2728 N  N     . PRO B  1 57  ? -57.962 -64.343 -126.083 1.00 36.12  ? 58   PRO B N     1 
ATOM   2729 C  CA    . PRO B  1 57  ? -56.747 -64.152 -125.286 1.00 35.44  ? 58   PRO B CA    1 
ATOM   2730 C  C     . PRO B  1 57  ? -55.595 -63.626 -126.119 1.00 35.83  ? 58   PRO B C     1 
ATOM   2731 O  O     . PRO B  1 57  ? -55.492 -63.955 -127.302 1.00 39.46  ? 58   PRO B O     1 
ATOM   2732 C  CB    . PRO B  1 57  ? -56.451 -65.566 -124.739 1.00 40.48  ? 58   PRO B CB    1 
ATOM   2733 C  CG    . PRO B  1 57  ? -57.102 -66.482 -125.698 1.00 36.25  ? 58   PRO B CG    1 
ATOM   2734 C  CD    . PRO B  1 57  ? -58.354 -65.763 -126.130 1.00 33.95  ? 58   PRO B CD    1 
ATOM   2735 N  N     . LEU B  1 58  ? -54.734 -62.831 -125.490 1.00 32.69  ? 59   LEU B N     1 
ATOM   2736 C  CA    A LEU B  1 58  ? -53.660 -62.155 -126.198 0.50 37.75  ? 59   LEU B CA    1 
ATOM   2737 C  CA    B LEU B  1 58  ? -53.660 -62.155 -126.198 0.50 37.75  ? 59   LEU B CA    1 
ATOM   2738 C  C     . LEU B  1 58  ? -52.614 -61.708 -125.187 1.00 35.46  ? 59   LEU B C     1 
ATOM   2739 O  O     . LEU B  1 58  ? -52.956 -61.317 -124.067 1.00 37.12  ? 59   LEU B O     1 
ATOM   2740 C  CB    A LEU B  1 58  ? -54.208 -60.951 -126.977 0.50 41.64  ? 59   LEU B CB    1 
ATOM   2741 C  CB    B LEU B  1 58  ? -54.208 -60.951 -126.977 0.50 41.64  ? 59   LEU B CB    1 
ATOM   2742 C  CG    A LEU B  1 58  ? -53.271 -60.098 -127.821 0.50 46.10  ? 59   LEU B CG    1 
ATOM   2743 C  CG    B LEU B  1 58  ? -53.271 -60.098 -127.821 0.50 46.10  ? 59   LEU B CG    1 
ATOM   2744 C  CD1   A LEU B  1 58  ? -52.685 -60.921 -128.953 0.50 47.76  ? 59   LEU B CD1   1 
ATOM   2745 C  CD1   B LEU B  1 58  ? -52.684 -60.921 -128.952 0.50 47.76  ? 59   LEU B CD1   1 
ATOM   2746 C  CD2   A LEU B  1 58  ? -54.026 -58.910 -128.376 0.50 47.06  ? 59   LEU B CD2   1 
ATOM   2747 C  CD2   B LEU B  1 58  ? -54.026 -58.911 -128.376 0.50 47.06  ? 59   LEU B CD2   1 
ATOM   2748 N  N     . LYS B  1 59  ? -51.351 -61.770 -125.586 1.00 30.29  ? 60   LYS B N     1 
ATOM   2749 C  CA    . LYS B  1 59  ? -50.254 -61.164 -124.843 1.00 32.76  ? 60   LYS B CA    1 
ATOM   2750 C  C     . LYS B  1 59  ? -49.842 -59.904 -125.594 1.00 31.41  ? 60   LYS B C     1 
ATOM   2751 O  O     . LYS B  1 59  ? -49.678 -59.940 -126.814 1.00 35.48  ? 60   LYS B O     1 
ATOM   2752 C  CB    . LYS B  1 59  ? -49.062 -62.112 -124.715 1.00 33.73  ? 60   LYS B CB    1 
ATOM   2753 C  CG    . LYS B  1 59  ? -49.436 -63.506 -124.265 1.00 38.37  ? 60   LYS B CG    1 
ATOM   2754 C  CD    . LYS B  1 59  ? -49.243 -63.694 -122.779 1.00 33.58  ? 60   LYS B CD    1 
ATOM   2755 C  CE    . LYS B  1 59  ? -49.744 -65.069 -122.352 1.00 35.57  ? 60   LYS B CE    1 
ATOM   2756 N  NZ    . LYS B  1 59  ? -49.510 -65.247 -120.911 1.00 40.94  ? 60   LYS B NZ    1 
ATOM   2757 N  N     . ILE B  1 60  ? -49.701 -58.791 -124.878 1.00 32.07  ? 61   ILE B N     1 
ATOM   2758 C  CA    . ILE B  1 60  ? -49.350 -57.506 -125.472 1.00 30.09  ? 61   ILE B CA    1 
ATOM   2759 C  C     . ILE B  1 60  ? -48.031 -57.034 -124.873 1.00 30.91  ? 61   ILE B C     1 
ATOM   2760 O  O     . ILE B  1 60  ? -47.906 -56.927 -123.646 1.00 34.66  ? 61   ILE B O     1 
ATOM   2761 C  CB    . ILE B  1 60  ? -50.454 -56.461 -125.252 1.00 34.03  ? 61   ILE B CB    1 
ATOM   2762 C  CG1   . ILE B  1 60  ? -51.796 -57.014 -125.744 1.00 31.35  ? 61   ILE B CG1   1 
ATOM   2763 C  CG2   . ILE B  1 60  ? -50.077 -55.139 -125.952 1.00 38.22  ? 61   ILE B CG2   1 
ATOM   2764 C  CD1   . ILE B  1 60  ? -52.990 -56.092 -125.496 1.00 35.57  ? 61   ILE B CD1   1 
ATOM   2765 N  N     . CYS B  1 61  ? -47.057 -56.748 -125.739 1.00 23.01  ? 62   CYS B N     1 
ATOM   2766 C  CA    . CYS B  1 61  ? -45.717 -56.344 -125.341 1.00 28.59  ? 62   CYS B CA    1 
ATOM   2767 C  C     . CYS B  1 61  ? -45.361 -54.968 -125.901 1.00 30.15  ? 62   CYS B C     1 
ATOM   2768 O  O     . CYS B  1 61  ? -45.762 -54.605 -127.010 1.00 28.19  ? 62   CYS B O     1 
ATOM   2769 C  CB    . CYS B  1 61  ? -44.667 -57.366 -125.820 1.00 35.26  ? 62   CYS B CB    1 
ATOM   2770 S  SG    . CYS B  1 61  ? -45.087 -59.115 -125.465 1.00 40.94  ? 62   CYS B SG    1 
ATOM   2771 N  N     . GLY B  1 62  ? -44.565 -54.226 -125.138 1.00 32.71  ? 63   GLY B N     1 
ATOM   2772 C  CA    . GLY B  1 62  ? -44.022 -52.934 -125.522 1.00 34.17  ? 63   GLY B CA    1 
ATOM   2773 C  C     . GLY B  1 62  ? -42.602 -53.031 -126.046 1.00 33.26  ? 63   GLY B C     1 
ATOM   2774 O  O     . GLY B  1 62  ? -42.154 -54.097 -126.481 1.00 29.12  ? 63   GLY B O     1 
ATOM   2775 N  N     . ASP B  1 63  ? -41.877 -51.909 -125.958 1.00 34.93  ? 64   ASP B N     1 
ATOM   2776 C  CA    . ASP B  1 63  ? -40.588 -51.728 -126.630 1.00 30.04  ? 64   ASP B CA    1 
ATOM   2777 C  C     . ASP B  1 63  ? -39.617 -52.873 -126.363 1.00 33.28  ? 64   ASP B C     1 
ATOM   2778 O  O     . ASP B  1 63  ? -39.464 -53.330 -125.223 1.00 30.88  ? 64   ASP B O     1 
ATOM   2779 C  CB    . ASP B  1 63  ? -39.916 -50.427 -126.169 1.00 29.36  ? 64   ASP B CB    1 
ATOM   2780 C  CG    . ASP B  1 63  ? -40.728 -49.185 -126.486 1.00 32.27  ? 64   ASP B CG    1 
ATOM   2781 O  OD1   . ASP B  1 63  ? -41.961 -49.292 -126.640 1.00 33.02  ? 64   ASP B OD1   1 
ATOM   2782 O  OD2   . ASP B  1 63  ? -40.127 -48.090 -126.551 1.00 37.97  ? 64   ASP B OD2   1 
ATOM   2783 N  N     . ILE B  1 64  ? -38.918 -53.290 -127.420 1.00 30.34  ? 65   ILE B N     1 
ATOM   2784 C  CA    . ILE B  1 64  ? -37.858 -54.290 -127.347 1.00 34.37  ? 65   ILE B CA    1 
ATOM   2785 C  C     . ILE B  1 64  ? -36.486 -53.656 -127.570 1.00 37.14  ? 65   ILE B C     1 
ATOM   2786 O  O     . ILE B  1 64  ? -35.537 -53.931 -126.835 1.00 39.52  ? 65   ILE B O     1 
ATOM   2787 C  CB    . ILE B  1 64  ? -38.103 -55.433 -128.363 1.00 32.09  ? 65   ILE B CB    1 
ATOM   2788 C  CG1   . ILE B  1 64  ? -39.529 -55.989 -128.252 1.00 35.52  ? 65   ILE B CG1   1 
ATOM   2789 C  CG2   . ILE B  1 64  ? -37.040 -56.531 -128.232 1.00 27.14  ? 65   ILE B CG2   1 
ATOM   2790 C  CD1   . ILE B  1 64  ? -39.861 -56.579 -126.914 1.00 38.47  ? 65   ILE B CD1   1 
ATOM   2791 N  N     . HIS B  1 65  ? -36.359 -52.830 -128.613 1.00 35.09  ? 66   HIS B N     1 
ATOM   2792 C  CA    . HIS B  1 65  ? -35.136 -52.081 -128.905 1.00 26.26  ? 66   HIS B CA    1 
ATOM   2793 C  C     . HIS B  1 65  ? -33.913 -52.998 -128.997 1.00 27.15  ? 66   HIS B C     1 
ATOM   2794 O  O     . HIS B  1 65  ? -32.872 -52.760 -128.381 1.00 25.89  ? 66   HIS B O     1 
ATOM   2795 C  CB    . HIS B  1 65  ? -34.918 -50.971 -127.867 1.00 28.63  ? 66   HIS B CB    1 
ATOM   2796 C  CG    . HIS B  1 65  ? -35.767 -49.755 -128.102 1.00 37.34  ? 66   HIS B CG    1 
ATOM   2797 N  ND1   . HIS B  1 65  ? -35.687 -49.006 -129.255 1.00 35.76  ? 66   HIS B ND1   1 
ATOM   2798 C  CD2   . HIS B  1 65  ? -36.724 -49.169 -127.341 1.00 37.89  ? 66   HIS B CD2   1 
ATOM   2799 C  CE1   . HIS B  1 65  ? -36.557 -48.013 -129.197 1.00 38.95  ? 66   HIS B CE1   1 
ATOM   2800 N  NE2   . HIS B  1 65  ? -37.203 -48.093 -128.048 1.00 41.48  ? 66   HIS B NE2   1 
ATOM   2801 N  N     . GLY B  1 66  ? -34.048 -54.065 -129.775 1.00 27.78  ? 67   GLY B N     1 
ATOM   2802 C  CA    . GLY B  1 66  ? -32.924 -54.939 -130.062 1.00 28.74  ? 67   GLY B CA    1 
ATOM   2803 C  C     . GLY B  1 66  ? -32.379 -55.739 -128.901 1.00 34.44  ? 67   GLY B C     1 
ATOM   2804 O  O     . GLY B  1 66  ? -31.262 -56.256 -128.992 1.00 38.91  ? 67   GLY B O     1 
ATOM   2805 N  N     . GLN B  1 67  ? -33.124 -55.858 -127.804 1.00 34.45  ? 68   GLN B N     1 
ATOM   2806 C  CA    . GLN B  1 67  ? -32.693 -56.678 -126.669 1.00 37.21  ? 68   GLN B CA    1 
ATOM   2807 C  C     . GLN B  1 67  ? -33.206 -58.099 -126.895 1.00 29.78  ? 68   GLN B C     1 
ATOM   2808 O  O     . GLN B  1 67  ? -34.135 -58.580 -126.247 1.00 27.63  ? 68   GLN B O     1 
ATOM   2809 C  CB    . GLN B  1 67  ? -33.168 -56.068 -125.354 1.00 38.62  ? 68   GLN B CB    1 
ATOM   2810 C  CG    . GLN B  1 67  ? -32.533 -54.698 -125.115 1.00 37.37  ? 68   GLN B CG    1 
ATOM   2811 C  CD    . GLN B  1 67  ? -32.849 -54.076 -123.765 1.00 39.13  ? 68   GLN B CD    1 
ATOM   2812 O  OE1   . GLN B  1 67  ? -32.788 -52.854 -123.626 1.00 39.78  ? 68   GLN B OE1   1 
ATOM   2813 N  NE2   . GLN B  1 67  ? -33.168 -54.902 -122.764 1.00 31.84  ? 68   GLN B NE2   1 
ATOM   2814 N  N     . TYR B  1 68  ? -32.565 -58.775 -127.849 1.00 27.43  ? 69   TYR B N     1 
ATOM   2815 C  CA    . TYR B  1 68  ? -33.054 -60.063 -128.336 1.00 33.28  ? 69   TYR B CA    1 
ATOM   2816 C  C     . TYR B  1 68  ? -33.144 -61.107 -127.225 1.00 36.30  ? 69   TYR B C     1 
ATOM   2817 O  O     . TYR B  1 68  ? -34.067 -61.930 -127.211 1.00 38.27  ? 69   TYR B O     1 
ATOM   2818 C  CB    . TYR B  1 68  ? -32.151 -60.557 -129.460 1.00 31.26  ? 69   TYR B CB    1 
ATOM   2819 C  CG    . TYR B  1 68  ? -32.614 -61.845 -130.086 1.00 32.07  ? 69   TYR B CG    1 
ATOM   2820 C  CD1   . TYR B  1 68  ? -33.816 -61.909 -130.777 1.00 32.19  ? 69   TYR B CD1   1 
ATOM   2821 C  CD2   . TYR B  1 68  ? -31.837 -62.996 -130.009 1.00 33.23  ? 69   TYR B CD2   1 
ATOM   2822 C  CE1   . TYR B  1 68  ? -34.238 -63.082 -131.365 1.00 31.47  ? 69   TYR B CE1   1 
ATOM   2823 C  CE2   . TYR B  1 68  ? -32.252 -64.165 -130.594 1.00 35.86  ? 69   TYR B CE2   1 
ATOM   2824 C  CZ    . TYR B  1 68  ? -33.454 -64.204 -131.264 1.00 35.08  ? 69   TYR B CZ    1 
ATOM   2825 O  OH    . TYR B  1 68  ? -33.853 -65.381 -131.844 1.00 38.20  ? 69   TYR B OH    1 
ATOM   2826 N  N     . TYR B  1 69  ? -32.196 -61.105 -126.291 1.00 40.22  ? 70   TYR B N     1 
ATOM   2827 C  CA    . TYR B  1 69  ? -32.266 -62.093 -125.223 1.00 41.79  ? 70   TYR B CA    1 
ATOM   2828 C  C     . TYR B  1 69  ? -33.417 -61.807 -124.270 1.00 40.65  ? 70   TYR B C     1 
ATOM   2829 O  O     . TYR B  1 69  ? -33.947 -62.736 -123.656 1.00 44.84  ? 70   TYR B O     1 
ATOM   2830 C  CB    . TYR B  1 69  ? -30.929 -62.165 -124.480 1.00 45.25  ? 70   TYR B CB    1 
ATOM   2831 C  CG    . TYR B  1 69  ? -29.831 -62.680 -125.384 1.00 59.03  ? 70   TYR B CG    1 
ATOM   2832 C  CD1   . TYR B  1 69  ? -30.057 -63.753 -126.241 1.00 60.30  ? 70   TYR B CD1   1 
ATOM   2833 C  CD2   . TYR B  1 69  ? -28.579 -62.074 -125.411 1.00 67.61  ? 70   TYR B CD2   1 
ATOM   2834 C  CE1   . TYR B  1 69  ? -29.060 -64.222 -127.082 1.00 63.56  ? 70   TYR B CE1   1 
ATOM   2835 C  CE2   . TYR B  1 69  ? -27.576 -62.535 -126.250 1.00 69.58  ? 70   TYR B CE2   1 
ATOM   2836 C  CZ    . TYR B  1 69  ? -27.823 -63.607 -127.084 1.00 68.33  ? 70   TYR B CZ    1 
ATOM   2837 O  OH    . TYR B  1 69  ? -26.825 -64.065 -127.915 1.00 69.09  ? 70   TYR B OH    1 
ATOM   2838 N  N     . ASP B  1 70  ? -33.845 -60.555 -124.156 1.00 38.34  ? 71   ASP B N     1 
ATOM   2839 C  CA    . ASP B  1 70  ? -35.045 -60.296 -123.375 1.00 41.17  ? 71   ASP B CA    1 
ATOM   2840 C  C     . ASP B  1 70  ? -36.311 -60.661 -124.150 1.00 38.35  ? 71   ASP B C     1 
ATOM   2841 O  O     . ASP B  1 70  ? -37.296 -61.105 -123.543 1.00 35.72  ? 71   ASP B O     1 
ATOM   2842 C  CB    . ASP B  1 70  ? -35.050 -58.844 -122.915 1.00 36.26  ? 71   ASP B CB    1 
ATOM   2843 C  CG    . ASP B  1 70  ? -33.991 -58.583 -121.861 1.00 43.82  ? 71   ASP B CG    1 
ATOM   2844 O  OD1   . ASP B  1 70  ? -33.976 -59.305 -120.840 1.00 46.68  ? 71   ASP B OD1   1 
ATOM   2845 O  OD2   . ASP B  1 70  ? -33.142 -57.689 -122.068 1.00 45.87  ? 71   ASP B OD2   1 
ATOM   2846 N  N     . LEU B  1 71  ? -36.292 -60.528 -125.481 1.00 29.81  ? 72   LEU B N     1 
ATOM   2847 C  CA    . LEU B  1 71  ? -37.419 -61.012 -126.272 1.00 29.66  ? 72   LEU B CA    1 
ATOM   2848 C  C     . LEU B  1 71  ? -37.608 -62.516 -126.099 1.00 32.49  ? 72   LEU B C     1 
ATOM   2849 O  O     . LEU B  1 71  ? -38.738 -62.991 -125.952 1.00 36.39  ? 72   LEU B O     1 
ATOM   2850 C  CB    . LEU B  1 71  ? -37.231 -60.663 -127.749 1.00 27.31  ? 72   LEU B CB    1 
ATOM   2851 C  CG    . LEU B  1 71  ? -38.284 -61.251 -128.696 1.00 26.88  ? 72   LEU B CG    1 
ATOM   2852 C  CD1   . LEU B  1 71  ? -39.675 -60.752 -128.344 1.00 27.21  ? 72   LEU B CD1   1 
ATOM   2853 C  CD2   . LEU B  1 71  ? -37.951 -60.930 -130.147 1.00 25.29  ? 72   LEU B CD2   1 
ATOM   2854 N  N     . LEU B  1 72  ? -36.516 -63.284 -126.116 1.00 30.85  ? 73   LEU B N     1 
ATOM   2855 C  CA    . LEU B  1 72  ? -36.634 -64.722 -125.870 1.00 33.52  ? 73   LEU B CA    1 
ATOM   2856 C  C     . LEU B  1 72  ? -37.188 -64.999 -124.477 1.00 39.20  ? 73   LEU B C     1 
ATOM   2857 O  O     . LEU B  1 72  ? -38.008 -65.908 -124.297 1.00 39.44  ? 73   LEU B O     1 
ATOM   2858 C  CB    . LEU B  1 72  ? -35.279 -65.405 -126.046 1.00 29.72  ? 73   LEU B CB    1 
ATOM   2859 C  CG    . LEU B  1 72  ? -34.631 -65.291 -127.420 1.00 33.63  ? 73   LEU B CG    1 
ATOM   2860 C  CD1   . LEU B  1 72  ? -33.321 -66.061 -127.427 1.00 38.19  ? 73   LEU B CD1   1 
ATOM   2861 C  CD2   . LEU B  1 72  ? -35.574 -65.798 -128.508 1.00 28.96  ? 73   LEU B CD2   1 
ATOM   2862 N  N     . ARG B  1 73  ? -36.743 -64.227 -123.478 1.00 38.88  ? 74   ARG B N     1 
ATOM   2863 C  CA    . ARG B  1 73  ? -37.305 -64.339 -122.135 1.00 35.06  ? 74   ARG B CA    1 
ATOM   2864 C  C     . ARG B  1 73  ? -38.812 -64.124 -122.140 1.00 33.42  ? 74   ARG B C     1 
ATOM   2865 O  O     . ARG B  1 73  ? -39.553 -64.872 -121.489 1.00 35.30  ? 74   ARG B O     1 
ATOM   2866 C  CB    . ARG B  1 73  ? -36.628 -63.334 -121.208 1.00 40.90  ? 74   ARG B CB    1 
ATOM   2867 C  CG    . ARG B  1 73  ? -35.281 -63.796 -120.699 1.00 43.53  ? 74   ARG B CG    1 
ATOM   2868 C  CD    . ARG B  1 73  ? -35.071 -63.324 -119.275 1.00 52.17  ? 74   ARG B CD    1 
ATOM   2869 N  NE    . ARG B  1 73  ? -34.869 -61.882 -119.193 1.00 56.33  ? 74   ARG B NE    1 
ATOM   2870 C  CZ    . ARG B  1 73  ? -35.051 -61.167 -118.087 1.00 57.23  ? 74   ARG B CZ    1 
ATOM   2871 N  NH1   . ARG B  1 73  ? -35.451 -61.756 -116.969 1.00 56.17  ? 74   ARG B NH1   1 
ATOM   2872 N  NH2   . ARG B  1 73  ? -34.829 -59.864 -118.095 1.00 58.05  ? 74   ARG B NH2   1 
ATOM   2873 N  N     . LEU B  1 74  ? -39.287 -63.105 -122.864 1.00 30.74  ? 75   LEU B N     1 
ATOM   2874 C  CA    . LEU B  1 74  ? -40.726 -62.885 -122.994 1.00 31.72  ? 75   LEU B CA    1 
ATOM   2875 C  C     . LEU B  1 74  ? -41.420 -64.128 -123.519 1.00 34.84  ? 75   LEU B C     1 
ATOM   2876 O  O     . LEU B  1 74  ? -42.438 -64.563 -122.971 1.00 34.45  ? 75   LEU B O     1 
ATOM   2877 C  CB    . LEU B  1 74  ? -41.021 -61.716 -123.937 1.00 35.02  ? 75   LEU B CB    1 
ATOM   2878 C  CG    . LEU B  1 74  ? -40.800 -60.303 -123.429 1.00 48.23  ? 75   LEU B CG    1 
ATOM   2879 C  CD1   . LEU B  1 74  ? -40.997 -59.300 -124.576 1.00 47.68  ? 75   LEU B CD1   1 
ATOM   2880 C  CD2   . LEU B  1 74  ? -41.732 -60.008 -122.271 1.00 50.28  ? 75   LEU B CD2   1 
ATOM   2881 N  N     . PHE B  1 75  ? -40.901 -64.696 -124.609 1.00 32.69  ? 76   PHE B N     1 
ATOM   2882 C  CA    . PHE B  1 75  ? -41.532 -65.889 -125.163 1.00 36.69  ? 76   PHE B CA    1 
ATOM   2883 C  C     . PHE B  1 75  ? -41.457 -67.061 -124.185 1.00 37.40  ? 76   PHE B C     1 
ATOM   2884 O  O     . PHE B  1 75  ? -42.413 -67.834 -124.063 1.00 37.31  ? 76   PHE B O     1 
ATOM   2885 C  CB    . PHE B  1 75  ? -40.892 -66.231 -126.508 1.00 29.24  ? 76   PHE B CB    1 
ATOM   2886 C  CG    . PHE B  1 75  ? -41.279 -65.275 -127.616 1.00 32.28  ? 76   PHE B CG    1 
ATOM   2887 C  CD1   . PHE B  1 75  ? -42.592 -64.838 -127.749 1.00 32.59  ? 76   PHE B CD1   1 
ATOM   2888 C  CD2   . PHE B  1 75  ? -40.328 -64.794 -128.502 1.00 28.21  ? 76   PHE B CD2   1 
ATOM   2889 C  CE1   . PHE B  1 75  ? -42.956 -63.959 -128.764 1.00 34.18  ? 76   PHE B CE1   1 
ATOM   2890 C  CE2   . PHE B  1 75  ? -40.685 -63.915 -129.519 1.00 32.71  ? 76   PHE B CE2   1 
ATOM   2891 C  CZ    . PHE B  1 75  ? -41.998 -63.499 -129.655 1.00 32.93  ? 76   PHE B CZ    1 
ATOM   2892 N  N     . GLU B  1 76  ? -40.354 -67.190 -123.446 1.00 40.86  ? 77   GLU B N     1 
ATOM   2893 C  CA    . GLU B  1 76  ? -40.261 -68.297 -122.494 1.00 47.83  ? 77   GLU B CA    1 
ATOM   2894 C  C     . GLU B  1 76  ? -41.307 -68.165 -121.392 1.00 47.76  ? 77   GLU B C     1 
ATOM   2895 O  O     . GLU B  1 76  ? -41.932 -69.156 -121.000 1.00 46.78  ? 77   GLU B O     1 
ATOM   2896 C  CB    . GLU B  1 76  ? -38.857 -68.375 -121.900 1.00 54.72  ? 77   GLU B CB    1 
ATOM   2897 C  CG    . GLU B  1 76  ? -38.002 -69.476 -122.509 1.00 69.83  ? 77   GLU B CG    1 
ATOM   2898 C  CD    . GLU B  1 76  ? -38.534 -70.877 -122.205 1.00 81.84  ? 77   GLU B CD    1 
ATOM   2899 O  OE1   . GLU B  1 76  ? -38.728 -71.198 -121.011 1.00 86.25  ? 77   GLU B OE1   1 
ATOM   2900 O  OE2   . GLU B  1 76  ? -38.758 -71.658 -123.160 1.00 84.67  ? 77   GLU B OE2   1 
ATOM   2901 N  N     . TYR B  1 77  ? -41.520 -66.944 -120.899 1.00 44.14  ? 78   TYR B N     1 
ATOM   2902 C  CA    . TYR B  1 77  ? -42.524 -66.698 -119.872 1.00 44.57  ? 78   TYR B CA    1 
ATOM   2903 C  C     . TYR B  1 77  ? -43.935 -66.801 -120.446 1.00 42.50  ? 78   TYR B C     1 
ATOM   2904 O  O     . TYR B  1 77  ? -44.804 -67.452 -119.864 1.00 43.19  ? 78   TYR B O     1 
ATOM   2905 C  CB    . TYR B  1 77  ? -42.281 -65.315 -119.254 1.00 53.22  ? 78   TYR B CB    1 
ATOM   2906 C  CG    . TYR B  1 77  ? -42.861 -65.077 -117.875 1.00 63.56  ? 78   TYR B CG    1 
ATOM   2907 C  CD1   . TYR B  1 77  ? -43.641 -66.033 -117.238 1.00 71.05  ? 78   TYR B CD1   1 
ATOM   2908 C  CD2   . TYR B  1 77  ? -42.639 -63.875 -117.214 1.00 69.88  ? 78   TYR B CD2   1 
ATOM   2909 C  CE1   . TYR B  1 77  ? -44.174 -65.801 -115.975 1.00 73.26  ? 78   TYR B CE1   1 
ATOM   2910 C  CE2   . TYR B  1 77  ? -43.170 -63.633 -115.952 1.00 71.33  ? 78   TYR B CE2   1 
ATOM   2911 C  CZ    . TYR B  1 77  ? -43.935 -64.597 -115.338 1.00 73.23  ? 78   TYR B CZ    1 
ATOM   2912 O  OH    . TYR B  1 77  ? -44.457 -64.359 -114.084 1.00 73.74  ? 78   TYR B OH    1 
ATOM   2913 N  N     . GLY B  1 78  ? -44.187 -66.174 -121.590 1.00 40.07  ? 79   GLY B N     1 
ATOM   2914 C  CA    . GLY B  1 78  ? -45.538 -66.187 -122.117 1.00 37.60  ? 79   GLY B CA    1 
ATOM   2915 C  C     . GLY B  1 78  ? -45.907 -67.367 -122.985 1.00 35.28  ? 79   GLY B C     1 
ATOM   2916 O  O     . GLY B  1 78  ? -47.090 -67.538 -123.309 1.00 33.29  ? 79   GLY B O     1 
ATOM   2917 N  N     . GLY B  1 79  ? -44.934 -68.192 -123.366 1.00 34.98  ? 80   GLY B N     1 
ATOM   2918 C  CA    . GLY B  1 79  ? -45.177 -69.232 -124.349 1.00 34.98  ? 80   GLY B CA    1 
ATOM   2919 C  C     . GLY B  1 79  ? -44.747 -68.808 -125.744 1.00 41.28  ? 80   GLY B C     1 
ATOM   2920 O  O     . GLY B  1 79  ? -45.112 -67.721 -126.205 1.00 40.59  ? 80   GLY B O     1 
ATOM   2921 N  N     . PHE B  1 80  ? -43.960 -69.644 -126.420 1.00 37.25  ? 81   PHE B N     1 
ATOM   2922 C  CA    . PHE B  1 80  ? -43.539 -69.336 -127.775 1.00 38.43  ? 81   PHE B CA    1 
ATOM   2923 C  C     . PHE B  1 80  ? -44.717 -69.451 -128.740 1.00 36.83  ? 81   PHE B C     1 
ATOM   2924 O  O     . PHE B  1 80  ? -45.590 -70.298 -128.559 1.00 40.00  ? 81   PHE B O     1 
ATOM   2925 C  CB    . PHE B  1 80  ? -42.412 -70.268 -128.201 1.00 37.78  ? 81   PHE B CB    1 
ATOM   2926 C  CG    . PHE B  1 80  ? -41.066 -69.804 -127.751 1.00 37.01  ? 81   PHE B CG    1 
ATOM   2927 C  CD1   . PHE B  1 80  ? -40.615 -70.087 -126.472 1.00 33.61  ? 81   PHE B CD1   1 
ATOM   2928 C  CD2   . PHE B  1 80  ? -40.266 -69.048 -128.600 1.00 34.13  ? 81   PHE B CD2   1 
ATOM   2929 C  CE1   . PHE B  1 80  ? -39.381 -69.642 -126.052 1.00 38.77  ? 81   PHE B CE1   1 
ATOM   2930 C  CE2   . PHE B  1 80  ? -39.035 -68.595 -128.196 1.00 36.08  ? 81   PHE B CE2   1 
ATOM   2931 C  CZ    . PHE B  1 80  ? -38.585 -68.885 -126.919 1.00 42.36  ? 81   PHE B CZ    1 
ATOM   2932 N  N     . PRO B  1 81  ? -44.782 -68.594 -129.758 1.00 38.00  ? 82   PRO B N     1 
ATOM   2933 C  CA    . PRO B  1 81  ? -45.879 -68.686 -130.729 1.00 35.23  ? 82   PRO B CA    1 
ATOM   2934 C  C     . PRO B  1 81  ? -45.927 -70.070 -131.348 1.00 36.62  ? 82   PRO B C     1 
ATOM   2935 O  O     . PRO B  1 81  ? -44.877 -70.656 -131.643 1.00 35.62  ? 82   PRO B O     1 
ATOM   2936 C  CB    . PRO B  1 81  ? -45.523 -67.620 -131.772 1.00 32.29  ? 82   PRO B CB    1 
ATOM   2937 C  CG    . PRO B  1 81  ? -44.681 -66.629 -131.026 1.00 30.26  ? 82   PRO B CG    1 
ATOM   2938 C  CD    . PRO B  1 81  ? -43.889 -67.453 -130.039 1.00 32.43  ? 82   PRO B CD    1 
ATOM   2939 N  N     . PRO B  1 82  ? -47.129 -70.622 -131.570 1.00 37.94  ? 83   PRO B N     1 
ATOM   2940 C  CA    . PRO B  1 82  ? -48.416 -69.964 -131.331 1.00 34.34  ? 83   PRO B CA    1 
ATOM   2941 C  C     . PRO B  1 82  ? -49.111 -70.395 -130.034 1.00 41.15  ? 83   PRO B C     1 
ATOM   2942 O  O     . PRO B  1 82  ? -50.345 -70.394 -130.004 1.00 41.01  ? 83   PRO B O     1 
ATOM   2943 C  CB    . PRO B  1 82  ? -49.234 -70.416 -132.524 1.00 36.36  ? 83   PRO B CB    1 
ATOM   2944 C  CG    . PRO B  1 82  ? -48.765 -71.883 -132.690 1.00 38.54  ? 83   PRO B CG    1 
ATOM   2945 C  CD    . PRO B  1 82  ? -47.312 -71.923 -132.240 1.00 39.03  ? 83   PRO B CD    1 
ATOM   2946 N  N     . GLU B  1 83  ? -48.354 -70.765 -128.994 1.00 43.92  ? 84   GLU B N     1 
ATOM   2947 C  CA    A GLU B  1 83  ? -48.979 -71.147 -127.729 0.50 46.47  ? 84   GLU B CA    1 
ATOM   2948 C  CA    B GLU B  1 83  ? -48.986 -71.151 -127.736 0.50 46.46  ? 84   GLU B CA    1 
ATOM   2949 C  C     . GLU B  1 83  ? -49.824 -70.010 -127.173 1.00 41.56  ? 84   GLU B C     1 
ATOM   2950 O  O     . GLU B  1 83  ? -50.916 -70.237 -126.639 1.00 40.75  ? 84   GLU B O     1 
ATOM   2951 C  CB    A GLU B  1 83  ? -47.917 -71.561 -126.711 0.50 47.87  ? 84   GLU B CB    1 
ATOM   2952 C  CB    B GLU B  1 83  ? -47.928 -71.599 -126.727 0.50 47.90  ? 84   GLU B CB    1 
ATOM   2953 C  CG    A GLU B  1 83  ? -47.162 -72.825 -127.067 0.50 51.26  ? 84   GLU B CG    1 
ATOM   2954 C  CG    B GLU B  1 83  ? -47.126 -72.814 -127.176 0.50 51.14  ? 84   GLU B CG    1 
ATOM   2955 C  CD    A GLU B  1 83  ? -46.328 -73.343 -125.910 0.50 53.60  ? 84   GLU B CD    1 
ATOM   2956 C  CD    B GLU B  1 83  ? -48.000 -74.023 -127.467 0.50 49.90  ? 84   GLU B CD    1 
ATOM   2957 O  OE1   A GLU B  1 83  ? -46.667 -73.035 -124.746 0.50 53.12  ? 84   GLU B OE1   1 
ATOM   2958 O  OE1   B GLU B  1 83  ? -48.913 -74.302 -126.661 0.50 47.23  ? 84   GLU B OE1   1 
ATOM   2959 O  OE2   A GLU B  1 83  ? -45.331 -74.050 -126.169 0.50 56.63  ? 84   GLU B OE2   1 
ATOM   2960 O  OE2   B GLU B  1 83  ? -47.776 -74.686 -128.506 0.50 45.63  ? 84   GLU B OE2   1 
ATOM   2961 N  N     . SER B  1 84  ? -49.330 -68.785 -127.277 1.00 32.84  ? 85   SER B N     1 
ATOM   2962 C  CA    . SER B  1 84  ? -50.105 -67.598 -126.971 1.00 36.25  ? 85   SER B CA    1 
ATOM   2963 C  C     . SER B  1 84  ? -50.165 -66.742 -128.225 1.00 37.49  ? 85   SER B C     1 
ATOM   2964 O  O     . SER B  1 84  ? -49.259 -66.791 -129.064 1.00 34.69  ? 85   SER B O     1 
ATOM   2965 C  CB    . SER B  1 84  ? -49.488 -66.793 -125.818 1.00 51.08  ? 85   SER B CB    1 
ATOM   2966 O  OG    . SER B  1 84  ? -49.513 -67.515 -124.594 1.00 59.91  ? 85   SER B OG    1 
ATOM   2967 N  N     . ASN B  1 85  ? -51.251 -65.988 -128.373 1.00 37.41  ? 86   ASN B N     1 
ATOM   2968 C  CA    . ASN B  1 85  ? -51.287 -64.942 -129.379 1.00 34.33  ? 86   ASN B CA    1 
ATOM   2969 C  C     . ASN B  1 85  ? -50.531 -63.733 -128.859 1.00 32.89  ? 86   ASN B C     1 
ATOM   2970 O  O     . ASN B  1 85  ? -50.455 -63.498 -127.648 1.00 37.06  ? 86   ASN B O     1 
ATOM   2971 C  CB    . ASN B  1 85  ? -52.724 -64.557 -129.718 1.00 36.92  ? 86   ASN B CB    1 
ATOM   2972 C  CG    . ASN B  1 85  ? -53.546 -65.743 -130.174 1.00 44.27  ? 86   ASN B CG    1 
ATOM   2973 O  OD1   . ASN B  1 85  ? -53.104 -66.541 -131.002 1.00 42.33  ? 86   ASN B OD1   1 
ATOM   2974 N  ND2   . ASN B  1 85  ? -54.743 -65.880 -129.613 1.00 46.81  ? 86   ASN B ND2   1 
ATOM   2975 N  N     . TYR B  1 86  ? -49.955 -62.967 -129.777 1.00 28.36  ? 87   TYR B N     1 
ATOM   2976 C  CA    . TYR B  1 86  ? -49.091 -61.864 -129.392 1.00 25.19  ? 87   TYR B CA    1 
ATOM   2977 C  C     . TYR B  1 86  ? -49.426 -60.632 -130.206 1.00 29.39  ? 87   TYR B C     1 
ATOM   2978 O  O     . TYR B  1 86  ? -49.702 -60.723 -131.409 1.00 27.20  ? 87   TYR B O     1 
ATOM   2979 C  CB    . TYR B  1 86  ? -47.614 -62.203 -129.589 1.00 27.89  ? 87   TYR B CB    1 
ATOM   2980 C  CG    . TYR B  1 86  ? -47.031 -63.048 -128.485 1.00 30.50  ? 87   TYR B CG    1 
ATOM   2981 C  CD1   . TYR B  1 86  ? -46.495 -62.460 -127.347 1.00 36.19  ? 87   TYR B CD1   1 
ATOM   2982 C  CD2   . TYR B  1 86  ? -47.025 -64.432 -128.574 1.00 30.20  ? 87   TYR B CD2   1 
ATOM   2983 C  CE1   . TYR B  1 86  ? -45.960 -63.235 -126.326 1.00 36.31  ? 87   TYR B CE1   1 
ATOM   2984 C  CE2   . TYR B  1 86  ? -46.494 -65.210 -127.556 1.00 34.22  ? 87   TYR B CE2   1 
ATOM   2985 C  CZ    . TYR B  1 86  ? -45.960 -64.605 -126.440 1.00 35.61  ? 87   TYR B CZ    1 
ATOM   2986 O  OH    . TYR B  1 86  ? -45.440 -65.374 -125.429 1.00 38.74  ? 87   TYR B OH    1 
ATOM   2987 N  N     . LEU B  1 87  ? -49.409 -59.489 -129.531 1.00 26.60  ? 88   LEU B N     1 
ATOM   2988 C  CA    . LEU B  1 87  ? -49.422 -58.181 -130.170 1.00 27.22  ? 88   LEU B CA    1 
ATOM   2989 C  C     . LEU B  1 87  ? -48.250 -57.397 -129.605 1.00 29.94  ? 88   LEU B C     1 
ATOM   2990 O  O     . LEU B  1 87  ? -48.143 -57.223 -128.384 1.00 28.78  ? 88   LEU B O     1 
ATOM   2991 C  CB    . LEU B  1 87  ? -50.741 -57.438 -129.922 1.00 24.08  ? 88   LEU B CB    1 
ATOM   2992 C  CG    . LEU B  1 87  ? -50.748 -55.947 -130.279 1.00 26.51  ? 88   LEU B CG    1 
ATOM   2993 C  CD1   . LEU B  1 87  ? -50.742 -55.753 -131.797 1.00 22.77  ? 88   LEU B CD1   1 
ATOM   2994 C  CD2   . LEU B  1 87  ? -51.938 -55.247 -129.632 1.00 26.90  ? 88   LEU B CD2   1 
ATOM   2995 N  N     . PHE B  1 88  ? -47.362 -56.953 -130.480 1.00 23.48  ? 89   PHE B N     1 
ATOM   2996 C  CA    . PHE B  1 88  ? -46.266 -56.092 -130.073 1.00 25.51  ? 89   PHE B CA    1 
ATOM   2997 C  C     . PHE B  1 88  ? -46.599 -54.667 -130.489 1.00 28.09  ? 89   PHE B C     1 
ATOM   2998 O  O     . PHE B  1 88  ? -47.219 -54.457 -131.535 1.00 25.11  ? 89   PHE B O     1 
ATOM   2999 C  CB    . PHE B  1 88  ? -44.955 -56.543 -130.705 1.00 24.24  ? 89   PHE B CB    1 
ATOM   3000 C  CG    . PHE B  1 88  ? -44.385 -57.780 -130.080 1.00 26.25  ? 89   PHE B CG    1 
ATOM   3001 C  CD1   . PHE B  1 88  ? -44.925 -59.016 -130.364 1.00 25.19  ? 89   PHE B CD1   1 
ATOM   3002 C  CD2   . PHE B  1 88  ? -43.312 -57.701 -129.198 1.00 29.22  ? 89   PHE B CD2   1 
ATOM   3003 C  CE1   . PHE B  1 88  ? -44.405 -60.161 -129.790 1.00 27.13  ? 89   PHE B CE1   1 
ATOM   3004 C  CE2   . PHE B  1 88  ? -42.781 -58.857 -128.619 1.00 27.21  ? 89   PHE B CE2   1 
ATOM   3005 C  CZ    . PHE B  1 88  ? -43.334 -60.076 -128.919 1.00 27.16  ? 89   PHE B CZ    1 
ATOM   3006 N  N     . LEU B  1 89  ? -46.178 -53.696 -129.673 1.00 23.46  ? 90   LEU B N     1 
ATOM   3007 C  CA    . LEU B  1 89  ? -46.567 -52.301 -129.854 1.00 31.95  ? 90   LEU B CA    1 
ATOM   3008 C  C     . LEU B  1 89  ? -45.512 -51.467 -130.579 1.00 32.03  ? 90   LEU B C     1 
ATOM   3009 O  O     . LEU B  1 89  ? -45.710 -50.266 -130.739 1.00 34.46  ? 90   LEU B O     1 
ATOM   3010 C  CB    . LEU B  1 89  ? -46.893 -51.658 -128.493 1.00 26.30  ? 90   LEU B CB    1 
ATOM   3011 C  CG    . LEU B  1 89  ? -47.978 -52.390 -127.694 1.00 27.65  ? 90   LEU B CG    1 
ATOM   3012 C  CD1   . LEU B  1 89  ? -48.228 -51.735 -126.340 1.00 26.36  ? 90   LEU B CD1   1 
ATOM   3013 C  CD2   . LEU B  1 89  ? -49.269 -52.469 -128.507 1.00 26.63  ? 90   LEU B CD2   1 
ATOM   3014 N  N     . GLY B  1 90  ? -44.402 -52.056 -131.000 1.00 28.66  ? 91   GLY B N     1 
ATOM   3015 C  CA    . GLY B  1 90  ? -43.438 -51.368 -131.838 1.00 28.32  ? 91   GLY B CA    1 
ATOM   3016 C  C     . GLY B  1 90  ? -42.106 -51.181 -131.123 1.00 28.35  ? 91   GLY B C     1 
ATOM   3017 O  O     . GLY B  1 90  ? -41.888 -51.680 -130.016 1.00 28.44  ? 91   GLY B O     1 
ATOM   3018 N  N     . ASP B  1 91  ? -41.205 -50.434 -131.786 1.00 25.58  ? 92   ASP B N     1 
ATOM   3019 C  CA    . ASP B  1 91  ? -39.851 -50.144 -131.299 1.00 24.66  ? 92   ASP B CA    1 
ATOM   3020 C  C     . ASP B  1 91  ? -39.060 -51.441 -131.106 1.00 29.49  ? 92   ASP B C     1 
ATOM   3021 O  O     . ASP B  1 91  ? -38.542 -51.750 -130.030 1.00 26.98  ? 92   ASP B O     1 
ATOM   3022 C  CB    . ASP B  1 91  ? -39.905 -49.294 -130.016 1.00 23.04  ? 92   ASP B CB    1 
ATOM   3023 C  CG    . ASP B  1 91  ? -40.043 -47.789 -130.306 1.00 31.89  ? 92   ASP B CG    1 
ATOM   3024 O  OD1   . ASP B  1 91  ? -40.288 -47.427 -131.476 1.00 29.12  ? 92   ASP B OD1   1 
ATOM   3025 O  OD2   . ASP B  1 91  ? -39.896 -46.964 -129.394 1.00 32.02  ? 92   ASP B OD2   1 
ATOM   3026 N  N     . TYR B  1 92  ? -38.989 -52.200 -132.188 1.00 26.58  ? 93   TYR B N     1 
ATOM   3027 C  CA    . TYR B  1 92  ? -38.197 -53.419 -132.244 1.00 30.62  ? 93   TYR B CA    1 
ATOM   3028 C  C     . TYR B  1 92  ? -36.704 -53.168 -132.394 1.00 29.15  ? 93   TYR B C     1 
ATOM   3029 O  O     . TYR B  1 92  ? -35.895 -53.968 -131.888 1.00 31.66  ? 93   TYR B O     1 
ATOM   3030 C  CB    . TYR B  1 92  ? -38.704 -54.313 -133.377 1.00 26.19  ? 93   TYR B CB    1 
ATOM   3031 C  CG    . TYR B  1 92  ? -40.208 -54.317 -133.434 1.00 27.59  ? 93   TYR B CG    1 
ATOM   3032 C  CD1   . TYR B  1 92  ? -40.895 -53.749 -134.504 1.00 27.99  ? 93   TYR B CD1   1 
ATOM   3033 C  CD2   . TYR B  1 92  ? -40.952 -54.856 -132.374 1.00 25.58  ? 93   TYR B CD2   1 
ATOM   3034 C  CE1   . TYR B  1 92  ? -42.276 -53.767 -134.534 1.00 26.80  ? 93   TYR B CE1   1 
ATOM   3035 C  CE2   . TYR B  1 92  ? -42.324 -54.880 -132.389 1.00 23.25  ? 93   TYR B CE2   1 
ATOM   3036 C  CZ    . TYR B  1 92  ? -42.977 -54.339 -133.451 1.00 25.40  ? 93   TYR B CZ    1 
ATOM   3037 O  OH    . TYR B  1 92  ? -44.341 -54.327 -133.497 1.00 25.02  ? 93   TYR B OH    1 
ATOM   3038 N  N     . VAL B  1 93  ? -36.320 -52.090 -133.079 1.00 30.95  ? 94   VAL B N     1 
ATOM   3039 C  CA    . VAL B  1 93  ? -34.916 -51.849 -133.394 1.00 26.63  ? 94   VAL B CA    1 
ATOM   3040 C  C     . VAL B  1 93  ? -34.377 -50.627 -132.656 1.00 33.55  ? 94   VAL B C     1 
ATOM   3041 O  O     . VAL B  1 93  ? -35.092 -49.992 -131.868 1.00 32.10  ? 94   VAL B O     1 
ATOM   3042 C  CB    . VAL B  1 93  ? -34.718 -51.696 -134.912 1.00 28.71  ? 94   VAL B CB    1 
ATOM   3043 C  CG1   . VAL B  1 93  ? -35.118 -52.978 -135.646 1.00 31.55  ? 94   VAL B CG1   1 
ATOM   3044 C  CG2   . VAL B  1 93  ? -35.465 -50.476 -135.456 1.00 28.00  ? 94   VAL B CG2   1 
ATOM   3045 N  N     . ASP B  1 94  ? -33.095 -50.331 -132.893 1.00 33.57  ? 95   ASP B N     1 
ATOM   3046 C  CA    . ASP B  1 94  ? -32.354 -49.202 -132.338 1.00 34.89  ? 95   ASP B CA    1 
ATOM   3047 C  C     . ASP B  1 94  ? -31.958 -49.431 -130.884 1.00 35.56  ? 95   ASP B C     1 
ATOM   3048 O  O     . ASP B  1 94  ? -32.587 -50.230 -130.175 1.00 34.20  ? 95   ASP B O     1 
ATOM   3049 C  CB    . ASP B  1 94  ? -33.149 -47.894 -132.453 1.00 35.17  ? 95   ASP B CB    1 
ATOM   3050 C  CG    . ASP B  1 94  ? -33.195 -47.360 -133.861 1.00 35.57  ? 95   ASP B CG    1 
ATOM   3051 O  OD1   . ASP B  1 94  ? -32.296 -47.692 -134.657 1.00 40.19  ? 95   ASP B OD1   1 
ATOM   3052 O  OD2   . ASP B  1 94  ? -34.137 -46.604 -134.171 1.00 39.81  ? 95   ASP B OD2   1 
ATOM   3053 N  N     . ARG B  1 95  ? -30.898 -48.729 -130.460 1.00 33.16  ? 96   ARG B N     1 
ATOM   3054 C  CA    . ARG B  1 95  ? -30.388 -48.676 -129.089 1.00 38.05  ? 96   ARG B CA    1 
ATOM   3055 C  C     . ARG B  1 95  ? -29.740 -49.988 -128.647 1.00 42.88  ? 96   ARG B C     1 
ATOM   3056 O  O     . ARG B  1 95  ? -28.624 -49.975 -128.119 1.00 46.97  ? 96   ARG B O     1 
ATOM   3057 C  CB    . ARG B  1 95  ? -31.501 -48.264 -128.128 1.00 40.37  ? 96   ARG B CB    1 
ATOM   3058 C  CG    . ARG B  1 95  ? -32.162 -46.948 -128.519 1.00 50.11  ? 96   ARG B CG    1 
ATOM   3059 C  CD    . ARG B  1 95  ? -32.129 -45.943 -127.371 1.00 59.58  ? 96   ARG B CD    1 
ATOM   3060 N  NE    . ARG B  1 95  ? -32.525 -44.590 -127.771 1.00 64.47  ? 96   ARG B NE    1 
ATOM   3061 C  CZ    . ARG B  1 95  ? -33.787 -44.185 -127.924 1.00 67.90  ? 96   ARG B CZ    1 
ATOM   3062 N  NH1   . ARG B  1 95  ? -34.785 -45.039 -127.738 1.00 70.66  ? 96   ARG B NH1   1 
ATOM   3063 N  NH2   . ARG B  1 95  ? -34.056 -42.931 -128.284 1.00 65.95  ? 96   ARG B NH2   1 
ATOM   3064 N  N     . GLY B  1 96  ? -30.411 -51.128 -128.856 1.00 38.54  ? 97   GLY B N     1 
ATOM   3065 C  CA    . GLY B  1 96  ? -29.826 -52.399 -128.490 1.00 35.04  ? 97   GLY B CA    1 
ATOM   3066 C  C     . GLY B  1 96  ? -28.780 -52.860 -129.480 1.00 44.10  ? 97   GLY B C     1 
ATOM   3067 O  O     . GLY B  1 96  ? -28.547 -52.241 -130.517 1.00 55.83  ? 97   GLY B O     1 
ATOM   3068 N  N     . LYS B  1 97  ? -28.143 -53.982 -129.145 1.00 45.21  ? 98   LYS B N     1 
ATOM   3069 C  CA    . LYS B  1 97  ? -27.089 -54.547 -129.971 1.00 45.60  ? 98   LYS B CA    1 
ATOM   3070 C  C     . LYS B  1 97  ? -27.597 -55.586 -130.963 1.00 45.30  ? 98   LYS B C     1 
ATOM   3071 O  O     . LYS B  1 97  ? -26.914 -55.863 -131.956 1.00 42.96  ? 98   LYS B O     1 
ATOM   3072 C  CB    . LYS B  1 97  ? -26.016 -55.195 -129.088 1.00 50.64  ? 98   LYS B CB    1 
ATOM   3073 C  CG    . LYS B  1 97  ? -25.157 -54.222 -128.295 1.00 57.42  ? 98   LYS B CG    1 
ATOM   3074 C  CD    . LYS B  1 97  ? -24.203 -53.458 -129.189 1.00 63.54  ? 98   LYS B CD    1 
ATOM   3075 C  CE    . LYS B  1 97  ? -23.017 -52.924 -128.398 1.00 67.92  ? 98   LYS B CE    1 
ATOM   3076 N  NZ    . LYS B  1 97  ? -22.173 -54.036 -127.866 1.00 74.18  ? 98   LYS B NZ    1 
ATOM   3077 N  N     . GLN B  1 98  ? -28.760 -56.185 -130.717 1.00 38.02  ? 99   GLN B N     1 
ATOM   3078 C  CA    . GLN B  1 98  ? -29.228 -57.253 -131.594 1.00 37.10  ? 99   GLN B CA    1 
ATOM   3079 C  C     . GLN B  1 98  ? -30.585 -56.915 -132.190 1.00 37.54  ? 99   GLN B C     1 
ATOM   3080 O  O     . GLN B  1 98  ? -31.534 -57.702 -132.076 1.00 33.54  ? 99   GLN B O     1 
ATOM   3081 C  CB    . GLN B  1 98  ? -29.281 -58.580 -130.834 1.00 39.33  ? 99   GLN B CB    1 
ATOM   3082 C  CG    . GLN B  1 98  ? -27.919 -59.026 -130.324 1.00 37.89  ? 99   GLN B CG    1 
ATOM   3083 C  CD    . GLN B  1 98  ? -27.971 -60.347 -129.581 1.00 44.26  ? 99   GLN B CD    1 
ATOM   3084 O  OE1   . GLN B  1 98  ? -27.493 -61.368 -130.078 1.00 44.83  ? 99   GLN B OE1   1 
ATOM   3085 N  NE2   . GLN B  1 98  ? -28.536 -60.331 -128.379 1.00 47.28  ? 99   GLN B NE2   1 
ATOM   3086 N  N     . SER B  1 99  ? -30.683 -55.729 -132.808 1.00 35.38  ? 100  SER B N     1 
ATOM   3087 C  CA    . SER B  1 99  ? -31.884 -55.366 -133.550 1.00 33.00  ? 100  SER B CA    1 
ATOM   3088 C  C     . SER B  1 99  ? -32.177 -56.357 -134.669 1.00 29.50  ? 100  SER B C     1 
ATOM   3089 O  O     . SER B  1 99  ? -33.345 -56.618 -134.979 1.00 29.22  ? 100  SER B O     1 
ATOM   3090 C  CB    . SER B  1 99  ? -31.745 -53.954 -134.134 1.00 33.29  ? 100  SER B CB    1 
ATOM   3091 O  OG    . SER B  1 99  ? -31.764 -52.955 -133.126 1.00 35.04  ? 100  SER B OG    1 
ATOM   3092 N  N     . LEU B  1 100 ? -31.142 -56.916 -135.295 1.00 25.46  ? 101  LEU B N     1 
ATOM   3093 C  CA    . LEU B  1 100 ? -31.390 -57.766 -136.456 1.00 33.47  ? 101  LEU B CA    1 
ATOM   3094 C  C     . LEU B  1 100 ? -31.983 -59.108 -136.042 1.00 32.91  ? 101  LEU B C     1 
ATOM   3095 O  O     . LEU B  1 100 ? -32.940 -59.589 -136.660 1.00 33.52  ? 101  LEU B O     1 
ATOM   3096 C  CB    . LEU B  1 100 ? -30.106 -57.955 -137.260 1.00 34.52  ? 101  LEU B CB    1 
ATOM   3097 C  CG    . LEU B  1 100 ? -29.800 -56.775 -138.196 1.00 40.75  ? 101  LEU B CG    1 
ATOM   3098 C  CD1   . LEU B  1 100 ? -28.345 -56.777 -138.611 1.00 37.77  ? 101  LEU B CD1   1 
ATOM   3099 C  CD2   . LEU B  1 100 ? -30.709 -56.774 -139.434 1.00 42.10  ? 101  LEU B CD2   1 
ATOM   3100 N  N     . GLU B  1 101 ? -31.422 -59.739 -135.009 1.00 30.37  ? 102  GLU B N     1 
ATOM   3101 C  CA    . GLU B  1 101 ? -32.032 -60.961 -134.495 1.00 31.45  ? 102  GLU B CA    1 
ATOM   3102 C  C     . GLU B  1 101 ? -33.478 -60.699 -134.096 1.00 30.41  ? 102  GLU B C     1 
ATOM   3103 O  O     . GLU B  1 101 ? -34.386 -61.466 -134.449 1.00 28.84  ? 102  GLU B O     1 
ATOM   3104 C  CB    . GLU B  1 101 ? -31.220 -61.484 -133.306 1.00 30.63  ? 102  GLU B CB    1 
ATOM   3105 C  CG    . GLU B  1 101 ? -29.893 -62.135 -133.689 1.00 31.40  ? 102  GLU B CG    1 
ATOM   3106 C  CD    . GLU B  1 101 ? -28.768 -61.142 -133.875 1.00 34.46  ? 102  GLU B CD    1 
ATOM   3107 O  OE1   . GLU B  1 101 ? -29.033 -59.920 -133.892 1.00 36.53  ? 102  GLU B OE1   1 
ATOM   3108 O  OE2   . GLU B  1 101 ? -27.605 -61.589 -134.014 1.00 41.41  ? 102  GLU B OE2   1 
ATOM   3109 N  N     . THR B  1 102 ? -33.706 -59.572 -133.421 1.00 34.05  ? 103  THR B N     1 
ATOM   3110 C  CA    . THR B  1 102 ? -35.031 -59.216 -132.931 1.00 30.32  ? 103  THR B CA    1 
ATOM   3111 C  C     . THR B  1 102 ? -36.043 -59.127 -134.064 1.00 29.95  ? 103  THR B C     1 
ATOM   3112 O  O     . THR B  1 102 ? -37.057 -59.832 -134.060 1.00 31.65  ? 103  THR B O     1 
ATOM   3113 C  CB    . THR B  1 102 ? -34.965 -57.887 -132.171 1.00 26.61  ? 103  THR B CB    1 
ATOM   3114 O  OG1   . THR B  1 102 ? -34.097 -58.028 -131.039 1.00 30.99  ? 103  THR B OG1   1 
ATOM   3115 C  CG2   . THR B  1 102 ? -36.344 -57.504 -131.688 1.00 26.41  ? 103  THR B CG2   1 
ATOM   3116 N  N     . ILE B  1 103 ? -35.789 -58.261 -135.047 1.00 28.63  ? 104  ILE B N     1 
ATOM   3117 C  CA    . ILE B  1 103 ? -36.809 -58.041 -136.063 1.00 28.35  ? 104  ILE B CA    1 
ATOM   3118 C  C     . ILE B  1 103 ? -36.925 -59.253 -136.979 1.00 27.93  ? 104  ILE B C     1 
ATOM   3119 O  O     . ILE B  1 103 ? -38.021 -59.576 -137.450 1.00 27.99  ? 104  ILE B O     1 
ATOM   3120 C  CB    . ILE B  1 103 ? -36.537 -56.732 -136.847 1.00 33.15  ? 104  ILE B CB    1 
ATOM   3121 C  CG1   . ILE B  1 103 ? -37.726 -56.386 -137.755 1.00 27.04  ? 104  ILE B CG1   1 
ATOM   3122 C  CG2   . ILE B  1 103 ? -35.226 -56.791 -137.663 1.00 28.30  ? 104  ILE B CG2   1 
ATOM   3123 C  CD1   . ILE B  1 103 ? -39.049 -56.217 -137.017 1.00 27.44  ? 104  ILE B CD1   1 
ATOM   3124 N  N     . CYS B  1 104 ? -35.826 -59.972 -137.224 1.00 28.53  ? 105  CYS B N     1 
ATOM   3125 C  CA    . CYS B  1 104 ? -35.933 -61.166 -138.062 1.00 28.28  ? 105  CYS B CA    1 
ATOM   3126 C  C     . CYS B  1 104 ? -36.840 -62.215 -137.418 1.00 26.42  ? 105  CYS B C     1 
ATOM   3127 O  O     . CYS B  1 104 ? -37.688 -62.809 -138.093 1.00 27.93  ? 105  CYS B O     1 
ATOM   3128 C  CB    . CYS B  1 104 ? -34.551 -61.748 -138.342 1.00 29.23  ? 105  CYS B CB    1 
ATOM   3129 S  SG    . CYS B  1 104 ? -33.598 -60.781 -139.541 1.00 39.10  ? 105  CYS B SG    1 
ATOM   3130 N  N     . LEU B  1 105 ? -36.687 -62.445 -136.112 1.00 24.57  ? 106  LEU B N     1 
ATOM   3131 C  CA    . LEU B  1 105 ? -37.542 -63.426 -135.438 1.00 29.58  ? 106  LEU B CA    1 
ATOM   3132 C  C     . LEU B  1 105 ? -39.005 -62.994 -135.448 1.00 27.42  ? 106  LEU B C     1 
ATOM   3133 O  O     . LEU B  1 105 ? -39.896 -63.795 -135.765 1.00 27.36  ? 106  LEU B O     1 
ATOM   3134 C  CB    . LEU B  1 105 ? -37.067 -63.651 -134.006 1.00 28.05  ? 106  LEU B CB    1 
ATOM   3135 C  CG    . LEU B  1 105 ? -37.873 -64.740 -133.293 1.00 27.74  ? 106  LEU B CG    1 
ATOM   3136 C  CD1   . LEU B  1 105 ? -37.748 -66.081 -134.021 1.00 25.92  ? 106  LEU B CD1   1 
ATOM   3137 C  CD2   . LEU B  1 105 ? -37.449 -64.872 -131.847 1.00 28.95  ? 106  LEU B CD2   1 
ATOM   3138 N  N     . LEU B  1 106 ? -39.269 -61.726 -135.131 1.00 29.27  ? 107  LEU B N     1 
ATOM   3139 C  CA    . LEU B  1 106 ? -40.637 -61.217 -135.186 1.00 28.96  ? 107  LEU B CA    1 
ATOM   3140 C  C     . LEU B  1 106 ? -41.227 -61.334 -136.589 1.00 24.70  ? 107  LEU B C     1 
ATOM   3141 O  O     . LEU B  1 106 ? -42.372 -61.766 -136.753 1.00 30.41  ? 107  LEU B O     1 
ATOM   3142 C  CB    . LEU B  1 106 ? -40.677 -59.763 -134.709 1.00 25.43  ? 107  LEU B CB    1 
ATOM   3143 C  CG    . LEU B  1 106 ? -40.231 -59.536 -133.262 1.00 28.23  ? 107  LEU B CG    1 
ATOM   3144 C  CD1   . LEU B  1 106 ? -40.127 -58.050 -132.949 1.00 28.87  ? 107  LEU B CD1   1 
ATOM   3145 C  CD2   . LEU B  1 106 ? -41.159 -60.223 -132.282 1.00 27.15  ? 107  LEU B CD2   1 
ATOM   3146 N  N     . LEU B  1 107 ? -40.470 -60.957 -137.618 1.00 30.01  ? 108  LEU B N     1 
ATOM   3147 C  CA    . LEU B  1 107 ? -40.992 -61.085 -138.979 1.00 31.73  ? 108  LEU B CA    1 
ATOM   3148 C  C     . LEU B  1 107 ? -41.237 -62.550 -139.334 1.00 29.24  ? 108  LEU B C     1 
ATOM   3149 O  O     . LEU B  1 107 ? -42.264 -62.888 -139.940 1.00 27.12  ? 108  LEU B O     1 
ATOM   3150 C  CB    . LEU B  1 107 ? -40.036 -60.436 -139.977 1.00 25.86  ? 108  LEU B CB    1 
ATOM   3151 C  CG    . LEU B  1 107 ? -39.846 -58.906 -139.948 1.00 34.75  ? 108  LEU B CG    1 
ATOM   3152 C  CD1   . LEU B  1 107 ? -38.875 -58.474 -141.046 1.00 27.09  ? 108  LEU B CD1   1 
ATOM   3153 C  CD2   . LEU B  1 107 ? -41.165 -58.130 -140.043 1.00 28.89  ? 108  LEU B CD2   1 
ATOM   3154 N  N     . ALA B  1 108 ? -40.315 -63.439 -138.944 1.00 27.11  ? 109  ALA B N     1 
ATOM   3155 C  CA    . ALA B  1 108 ? -40.505 -64.872 -139.193 1.00 30.70  ? 109  ALA B CA    1 
ATOM   3156 C  C     . ALA B  1 108 ? -41.782 -65.380 -138.539 1.00 30.49  ? 109  ALA B C     1 
ATOM   3157 O  O     . ALA B  1 108 ? -42.545 -66.136 -139.152 1.00 31.93  ? 109  ALA B O     1 
ATOM   3158 C  CB    . ALA B  1 108 ? -39.303 -65.672 -138.679 1.00 26.50  ? 109  ALA B CB    1 
ATOM   3159 N  N     . TYR B  1 109 ? -42.033 -64.966 -137.296 1.00 23.93  ? 110  TYR B N     1 
ATOM   3160 C  CA    . TYR B  1 109 ? -43.243 -65.394 -136.602 1.00 29.51  ? 110  TYR B CA    1 
ATOM   3161 C  C     . TYR B  1 109 ? -44.488 -64.778 -137.209 1.00 28.70  ? 110  TYR B C     1 
ATOM   3162 O  O     . TYR B  1 109 ? -45.556 -65.399 -137.191 1.00 28.36  ? 110  TYR B O     1 
ATOM   3163 C  CB    . TYR B  1 109 ? -43.159 -65.023 -135.126 1.00 30.56  ? 110  TYR B CB    1 
ATOM   3164 C  CG    . TYR B  1 109 ? -42.404 -66.022 -134.285 1.00 35.21  ? 110  TYR B CG    1 
ATOM   3165 C  CD1   . TYR B  1 109 ? -42.443 -67.376 -134.574 1.00 31.93  ? 110  TYR B CD1   1 
ATOM   3166 C  CD2   . TYR B  1 109 ? -41.648 -65.600 -133.195 1.00 36.28  ? 110  TYR B CD2   1 
ATOM   3167 C  CE1   . TYR B  1 109 ? -41.750 -68.287 -133.798 1.00 35.51  ? 110  TYR B CE1   1 
ATOM   3168 C  CE2   . TYR B  1 109 ? -40.961 -66.494 -132.414 1.00 36.70  ? 110  TYR B CE2   1 
ATOM   3169 C  CZ    . TYR B  1 109 ? -41.010 -67.837 -132.722 1.00 39.98  ? 110  TYR B CZ    1 
ATOM   3170 O  OH    . TYR B  1 109 ? -40.317 -68.720 -131.940 1.00 43.74  ? 110  TYR B OH    1 
ATOM   3171 N  N     . LYS B  1 110 ? -44.377 -63.555 -137.739 1.00 28.21  ? 111  LYS B N     1 
ATOM   3172 C  CA    . LYS B  1 110 ? -45.498 -62.962 -138.454 1.00 26.06  ? 111  LYS B CA    1 
ATOM   3173 C  C     . LYS B  1 110 ? -45.851 -63.784 -139.686 1.00 31.50  ? 111  LYS B C     1 
ATOM   3174 O  O     . LYS B  1 110 ? -47.031 -64.010 -139.977 1.00 33.79  ? 111  LYS B O     1 
ATOM   3175 C  CB    . LYS B  1 110 ? -45.164 -61.520 -138.846 1.00 24.99  ? 111  LYS B CB    1 
ATOM   3176 C  CG    . LYS B  1 110 ? -46.286 -60.804 -139.584 1.00 29.86  ? 111  LYS B CG    1 
ATOM   3177 C  CD    . LYS B  1 110 ? -47.557 -60.846 -138.765 1.00 33.01  ? 111  LYS B CD    1 
ATOM   3178 C  CE    . LYS B  1 110 ? -48.682 -60.086 -139.426 1.00 34.01  ? 111  LYS B CE    1 
ATOM   3179 N  NZ    . LYS B  1 110 ? -49.980 -60.304 -138.742 1.00 33.82  ? 111  LYS B NZ    1 
ATOM   3180 N  N     . ILE B  1 111 ? -44.836 -64.242 -140.423 1.00 33.53  ? 112  ILE B N     1 
ATOM   3181 C  CA    . ILE B  1 111 ? -45.082 -65.023 -141.634 1.00 30.12  ? 112  ILE B CA    1 
ATOM   3182 C  C     . ILE B  1 111 ? -45.632 -66.401 -141.286 1.00 32.89  ? 112  ILE B C     1 
ATOM   3183 O  O     . ILE B  1 111 ? -46.502 -66.930 -141.983 1.00 35.08  ? 112  ILE B O     1 
ATOM   3184 C  CB    . ILE B  1 111 ? -43.792 -65.127 -142.463 1.00 32.36  ? 112  ILE B CB    1 
ATOM   3185 C  CG1   . ILE B  1 111 ? -43.288 -63.733 -142.849 1.00 30.74  ? 112  ILE B CG1   1 
ATOM   3186 C  CG2   . ILE B  1 111 ? -44.021 -65.991 -143.700 1.00 34.62  ? 112  ILE B CG2   1 
ATOM   3187 C  CD1   . ILE B  1 111 ? -41.820 -63.729 -143.193 1.00 29.50  ? 112  ILE B CD1   1 
ATOM   3188 N  N     . LYS B  1 112 ? -45.151 -67.002 -140.199 1.00 32.27  ? 113  LYS B N     1 
ATOM   3189 C  CA    . LYS B  1 112 ? -45.613 -68.356 -139.876 1.00 34.35  ? 113  LYS B CA    1 
ATOM   3190 C  C     . LYS B  1 112 ? -46.998 -68.353 -139.242 1.00 34.81  ? 113  LYS B C     1 
ATOM   3191 O  O     . LYS B  1 112 ? -47.770 -69.290 -139.448 1.00 41.96  ? 113  LYS B O     1 
ATOM   3192 C  CB    . LYS B  1 112 ? -44.611 -69.057 -138.953 1.00 32.29  ? 113  LYS B CB    1 
ATOM   3193 C  CG    . LYS B  1 112 ? -44.843 -70.553 -138.825 1.00 40.86  ? 113  LYS B CG    1 
ATOM   3194 C  CD    . LYS B  1 112 ? -43.571 -71.284 -138.425 1.00 45.05  ? 113  LYS B CD    1 
ATOM   3195 C  CE    . LYS B  1 112 ? -43.812 -72.787 -138.257 1.00 40.74  ? 113  LYS B CE    1 
ATOM   3196 N  NZ    . LYS B  1 112 ? -44.270 -73.435 -139.508 1.00 38.76  ? 113  LYS B NZ    1 
ATOM   3197 N  N     . TYR B  1 113 ? -47.345 -67.303 -138.502 1.00 36.87  ? 114  TYR B N     1 
ATOM   3198 C  CA    . TYR B  1 113 ? -48.619 -67.227 -137.793 1.00 35.29  ? 114  TYR B CA    1 
ATOM   3199 C  C     . TYR B  1 113 ? -49.283 -65.884 -138.073 1.00 31.78  ? 114  TYR B C     1 
ATOM   3200 O  O     . TYR B  1 113 ? -49.456 -65.064 -137.164 1.00 32.48  ? 114  TYR B O     1 
ATOM   3201 C  CB    . TYR B  1 113 ? -48.402 -67.449 -136.297 1.00 35.88  ? 114  TYR B CB    1 
ATOM   3202 C  CG    . TYR B  1 113 ? -47.557 -68.671 -136.009 1.00 34.24  ? 114  TYR B CG    1 
ATOM   3203 C  CD1   . TYR B  1 113 ? -48.067 -69.948 -136.216 1.00 34.28  ? 114  TYR B CD1   1 
ATOM   3204 C  CD2   . TYR B  1 113 ? -46.253 -68.547 -135.539 1.00 30.15  ? 114  TYR B CD2   1 
ATOM   3205 C  CE1   . TYR B  1 113 ? -47.304 -71.074 -135.974 1.00 33.91  ? 114  TYR B CE1   1 
ATOM   3206 C  CE2   . TYR B  1 113 ? -45.481 -69.666 -135.280 1.00 32.77  ? 114  TYR B CE2   1 
ATOM   3207 C  CZ    . TYR B  1 113 ? -46.016 -70.933 -135.504 1.00 36.44  ? 114  TYR B CZ    1 
ATOM   3208 O  OH    . TYR B  1 113 ? -45.248 -72.053 -135.266 1.00 37.33  ? 114  TYR B OH    1 
ATOM   3209 N  N     . PRO B  1 114 ? -49.701 -65.642 -139.321 1.00 29.13  ? 115  PRO B N     1 
ATOM   3210 C  CA    . PRO B  1 114 ? -50.183 -64.300 -139.682 1.00 30.82  ? 115  PRO B CA    1 
ATOM   3211 C  C     . PRO B  1 114 ? -51.485 -63.932 -139.012 1.00 35.60  ? 115  PRO B C     1 
ATOM   3212 O  O     . PRO B  1 114 ? -51.790 -62.736 -138.916 1.00 33.81  ? 115  PRO B O     1 
ATOM   3213 C  CB    . PRO B  1 114 ? -50.333 -64.373 -141.211 1.00 33.46  ? 115  PRO B CB    1 
ATOM   3214 C  CG    . PRO B  1 114 ? -50.591 -65.820 -141.488 1.00 33.19  ? 115  PRO B CG    1 
ATOM   3215 C  CD    . PRO B  1 114 ? -49.785 -66.585 -140.455 1.00 31.19  ? 115  PRO B CD    1 
ATOM   3216 N  N     . GLU B  1 115 ? -52.245 -64.909 -138.520 1.00 35.70  ? 116  GLU B N     1 
ATOM   3217 C  CA    . GLU B  1 115 ? -53.493 -64.646 -137.816 1.00 35.56  ? 116  GLU B CA    1 
ATOM   3218 C  C     . GLU B  1 115 ? -53.351 -64.694 -136.306 1.00 34.45  ? 116  GLU B C     1 
ATOM   3219 O  O     . GLU B  1 115 ? -54.335 -64.467 -135.602 1.00 36.30  ? 116  GLU B O     1 
ATOM   3220 C  CB    . GLU B  1 115 ? -54.572 -65.642 -138.246 1.00 36.55  ? 116  GLU B CB    1 
ATOM   3221 C  CG    . GLU B  1 115 ? -54.869 -65.621 -139.736 1.00 43.43  ? 116  GLU B CG    1 
ATOM   3222 C  CD    . GLU B  1 115 ? -55.342 -64.259 -140.223 1.00 57.54  ? 116  GLU B CD    1 
ATOM   3223 O  OE1   . GLU B  1 115 ? -55.930 -63.491 -139.430 1.00 62.82  ? 116  GLU B OE1   1 
ATOM   3224 O  OE2   . GLU B  1 115 ? -55.128 -63.957 -141.414 1.00 67.77  ? 116  GLU B OE2   1 
ATOM   3225 N  N     . ASN B  1 116 ? -52.170 -65.006 -135.783 1.00 34.72  ? 117  ASN B N     1 
ATOM   3226 C  CA    . ASN B  1 116 ? -52.001 -65.153 -134.340 1.00 33.65  ? 117  ASN B CA    1 
ATOM   3227 C  C     . ASN B  1 116 ? -50.880 -64.301 -133.780 1.00 34.97  ? 117  ASN B C     1 
ATOM   3228 O  O     . ASN B  1 116 ? -50.631 -64.347 -132.567 1.00 32.43  ? 117  ASN B O     1 
ATOM   3229 C  CB    . ASN B  1 116 ? -51.762 -66.629 -133.983 1.00 32.76  ? 117  ASN B CB    1 
ATOM   3230 C  CG    . ASN B  1 116 ? -52.957 -67.491 -134.321 1.00 36.37  ? 117  ASN B CG    1 
ATOM   3231 O  OD1   . ASN B  1 116 ? -53.141 -67.900 -135.472 1.00 40.74  ? 117  ASN B OD1   1 
ATOM   3232 N  ND2   . ASN B  1 116 ? -53.790 -67.756 -133.322 1.00 34.43  ? 117  ASN B ND2   1 
ATOM   3233 N  N     . PHE B  1 117 ? -50.222 -63.510 -134.623 1.00 34.88  ? 118  PHE B N     1 
ATOM   3234 C  CA    . PHE B  1 117 ? -49.009 -62.793 -134.265 1.00 30.79  ? 118  PHE B CA    1 
ATOM   3235 C  C     . PHE B  1 117 ? -49.073 -61.444 -134.954 1.00 31.28  ? 118  PHE B C     1 
ATOM   3236 O  O     . PHE B  1 117 ? -49.198 -61.383 -136.180 1.00 28.86  ? 118  PHE B O     1 
ATOM   3237 C  CB    . PHE B  1 117 ? -47.780 -63.585 -134.703 1.00 23.37  ? 118  PHE B CB    1 
ATOM   3238 C  CG    . PHE B  1 117 ? -46.502 -63.113 -134.095 1.00 31.85  ? 118  PHE B CG    1 
ATOM   3239 C  CD1   . PHE B  1 117 ? -46.069 -63.629 -132.877 1.00 29.99  ? 118  PHE B CD1   1 
ATOM   3240 C  CD2   . PHE B  1 117 ? -45.712 -62.167 -134.753 1.00 26.66  ? 118  PHE B CD2   1 
ATOM   3241 C  CE1   . PHE B  1 117 ? -44.871 -63.205 -132.322 1.00 26.37  ? 118  PHE B CE1   1 
ATOM   3242 C  CE2   . PHE B  1 117 ? -44.521 -61.736 -134.208 1.00 26.38  ? 118  PHE B CE2   1 
ATOM   3243 C  CZ    . PHE B  1 117 ? -44.092 -62.255 -132.992 1.00 26.82  ? 118  PHE B CZ    1 
ATOM   3244 N  N     . PHE B  1 118 ? -49.012 -60.368 -134.179 1.00 30.78  ? 119  PHE B N     1 
ATOM   3245 C  CA    . PHE B  1 118 ? -49.223 -59.051 -134.749 1.00 28.20  ? 119  PHE B CA    1 
ATOM   3246 C  C     . PHE B  1 118 ? -48.160 -58.093 -134.257 1.00 28.53  ? 119  PHE B C     1 
ATOM   3247 O  O     . PHE B  1 118 ? -47.747 -58.138 -133.090 1.00 29.12  ? 119  PHE B O     1 
ATOM   3248 C  CB    . PHE B  1 118 ? -50.633 -58.549 -134.430 1.00 22.81  ? 119  PHE B CB    1 
ATOM   3249 C  CG    . PHE B  1 118 ? -51.704 -59.460 -134.946 1.00 28.23  ? 119  PHE B CG    1 
ATOM   3250 C  CD1   . PHE B  1 118 ? -52.224 -60.442 -134.117 1.00 27.67  ? 119  PHE B CD1   1 
ATOM   3251 C  CD2   . PHE B  1 118 ? -52.176 -59.362 -136.257 1.00 29.88  ? 119  PHE B CD2   1 
ATOM   3252 C  CE1   . PHE B  1 118 ? -53.185 -61.329 -134.564 1.00 27.76  ? 119  PHE B CE1   1 
ATOM   3253 C  CE2   . PHE B  1 118 ? -53.157 -60.249 -136.721 1.00 31.04  ? 119  PHE B CE2   1 
ATOM   3254 C  CZ    . PHE B  1 118 ? -53.657 -61.243 -135.864 1.00 28.39  ? 119  PHE B CZ    1 
ATOM   3255 N  N     . LEU B  1 119 ? -47.732 -57.231 -135.172 1.00 24.40  ? 120  LEU B N     1 
ATOM   3256 C  CA    . LEU B  1 119 ? -46.717 -56.225 -134.925 1.00 27.21  ? 120  LEU B CA    1 
ATOM   3257 C  C     . LEU B  1 119 ? -47.282 -54.871 -135.303 1.00 28.94  ? 120  LEU B C     1 
ATOM   3258 O  O     . LEU B  1 119 ? -47.766 -54.699 -136.423 1.00 25.63  ? 120  LEU B O     1 
ATOM   3259 C  CB    . LEU B  1 119 ? -45.459 -56.504 -135.741 1.00 24.82  ? 120  LEU B CB    1 
ATOM   3260 C  CG    . LEU B  1 119 ? -44.833 -57.895 -135.577 1.00 25.93  ? 120  LEU B CG    1 
ATOM   3261 C  CD1   . LEU B  1 119 ? -43.820 -58.148 -136.689 1.00 28.14  ? 120  LEU B CD1   1 
ATOM   3262 C  CD2   . LEU B  1 119 ? -44.184 -57.997 -134.194 1.00 24.96  ? 120  LEU B CD2   1 
ATOM   3263 N  N     . LEU B  1 120 ? -47.212 -53.918 -134.381 1.00 31.78  ? 121  LEU B N     1 
ATOM   3264 C  CA    . LEU B  1 120 ? -47.532 -52.527 -134.666 1.00 30.12  ? 121  LEU B CA    1 
ATOM   3265 C  C     . LEU B  1 120 ? -46.259 -51.742 -134.946 1.00 28.34  ? 121  LEU B C     1 
ATOM   3266 O  O     . LEU B  1 120 ? -45.156 -52.120 -134.536 1.00 23.34  ? 121  LEU B O     1 
ATOM   3267 C  CB    . LEU B  1 120 ? -48.296 -51.889 -133.501 1.00 32.04  ? 121  LEU B CB    1 
ATOM   3268 C  CG    . LEU B  1 120 ? -49.663 -52.486 -133.145 1.00 31.18  ? 121  LEU B CG    1 
ATOM   3269 C  CD1   . LEU B  1 120 ? -50.353 -51.616 -132.089 1.00 29.02  ? 121  LEU B CD1   1 
ATOM   3270 C  CD2   . LEU B  1 120 ? -50.538 -52.619 -134.377 1.00 24.45  ? 121  LEU B CD2   1 
ATOM   3271 N  N     . ARG B  1 121 ? -46.431 -50.641 -135.670 1.00 26.36  ? 122  ARG B N     1 
ATOM   3272 C  CA    . ARG B  1 121 ? -45.345 -49.727 -136.013 1.00 28.18  ? 122  ARG B CA    1 
ATOM   3273 C  C     . ARG B  1 121 ? -45.018 -48.811 -134.837 1.00 27.44  ? 122  ARG B C     1 
ATOM   3274 O  O     . ARG B  1 121 ? -45.887 -48.058 -134.377 1.00 29.83  ? 122  ARG B O     1 
ATOM   3275 C  CB    . ARG B  1 121 ? -45.758 -48.853 -137.194 1.00 22.86  ? 122  ARG B CB    1 
ATOM   3276 C  CG    . ARG B  1 121 ? -44.631 -47.960 -137.680 1.00 25.90  ? 122  ARG B CG    1 
ATOM   3277 C  CD    . ARG B  1 121 ? -44.971 -47.302 -139.009 1.00 27.99  ? 122  ARG B CD    1 
ATOM   3278 N  NE    . ARG B  1 121 ? -43.775 -46.790 -139.660 1.00 34.09  ? 122  ARG B NE    1 
ATOM   3279 C  CZ    . ARG B  1 121 ? -43.753 -46.290 -140.894 1.00 36.04  ? 122  ARG B CZ    1 
ATOM   3280 N  NH1   . ARG B  1 121 ? -44.879 -46.206 -141.594 1.00 31.29  ? 122  ARG B NH1   1 
ATOM   3281 N  NH2   . ARG B  1 121 ? -42.603 -45.873 -141.418 1.00 31.60  ? 122  ARG B NH2   1 
ATOM   3282 N  N     . GLY B  1 122 ? -43.764 -48.815 -134.396 1.00 23.68  ? 123  GLY B N     1 
ATOM   3283 C  CA    . GLY B  1 122 ? -43.337 -47.835 -133.419 1.00 24.82  ? 123  GLY B CA    1 
ATOM   3284 C  C     . GLY B  1 122 ? -42.660 -46.651 -134.104 1.00 26.64  ? 123  GLY B C     1 
ATOM   3285 O  O     . GLY B  1 122 ? -42.471 -46.658 -135.315 1.00 26.53  ? 123  GLY B O     1 
ATOM   3286 N  N     . ASN B  1 123 ? -42.291 -45.630 -133.318 1.00 31.07  ? 124  ASN B N     1 
ATOM   3287 C  CA    . ASN B  1 123 ? -41.646 -44.474 -133.945 1.00 33.94  ? 124  ASN B CA    1 
ATOM   3288 C  C     . ASN B  1 123 ? -40.235 -44.799 -134.430 1.00 34.51  ? 124  ASN B C     1 
ATOM   3289 O  O     . ASN B  1 123 ? -39.732 -44.109 -135.324 1.00 33.41  ? 124  ASN B O     1 
ATOM   3290 C  CB    . ASN B  1 123 ? -41.651 -43.239 -133.014 1.00 31.45  ? 124  ASN B CB    1 
ATOM   3291 C  CG    . ASN B  1 123 ? -40.815 -43.415 -131.742 1.00 31.33  ? 124  ASN B CG    1 
ATOM   3292 O  OD1   . ASN B  1 123 ? -40.999 -44.364 -130.971 1.00 29.15  ? 124  ASN B OD1   1 
ATOM   3293 N  ND2   . ASN B  1 123 ? -39.937 -42.444 -131.488 1.00 27.42  ? 124  ASN B ND2   1 
ATOM   3294 N  N     . HIS B  1 124 ? -39.612 -45.867 -133.921 1.00 32.80  ? 125  HIS B N     1 
ATOM   3295 C  CA    . HIS B  1 124 ? -38.326 -46.296 -134.457 1.00 33.83  ? 125  HIS B CA    1 
ATOM   3296 C  C     . HIS B  1 124 ? -38.441 -47.189 -135.682 1.00 32.13  ? 125  HIS B C     1 
ATOM   3297 O  O     . HIS B  1 124 ? -37.414 -47.494 -136.292 1.00 34.64  ? 125  HIS B O     1 
ATOM   3298 C  CB    . HIS B  1 124 ? -37.512 -47.005 -133.387 1.00 28.57  ? 125  HIS B CB    1 
ATOM   3299 C  CG    . HIS B  1 124 ? -37.001 -46.073 -132.339 1.00 35.20  ? 125  HIS B CG    1 
ATOM   3300 N  ND1   . HIS B  1 124 ? -35.669 -45.735 -132.215 1.00 34.98  ? 125  HIS B ND1   1 
ATOM   3301 C  CD2   . HIS B  1 124 ? -37.661 -45.366 -131.394 1.00 33.32  ? 125  HIS B CD2   1 
ATOM   3302 C  CE1   . HIS B  1 124 ? -35.527 -44.890 -131.208 1.00 36.99  ? 125  HIS B CE1   1 
ATOM   3303 N  NE2   . HIS B  1 124 ? -36.721 -44.649 -130.695 1.00 36.76  ? 125  HIS B NE2   1 
ATOM   3304 N  N     . GLU B  1 125 ? -39.647 -47.592 -136.082 1.00 29.91  ? 126  GLU B N     1 
ATOM   3305 C  CA    . GLU B  1 125 ? -39.817 -48.300 -137.352 1.00 29.85  ? 126  GLU B CA    1 
ATOM   3306 C  C     . GLU B  1 125 ? -39.979 -47.271 -138.467 1.00 25.67  ? 126  GLU B C     1 
ATOM   3307 O  O     . GLU B  1 125 ? -41.027 -47.155 -139.106 1.00 24.32  ? 126  GLU B O     1 
ATOM   3308 C  CB    . GLU B  1 125 ? -41.001 -49.261 -137.302 1.00 27.35  ? 126  GLU B CB    1 
ATOM   3309 C  CG    . GLU B  1 125 ? -40.676 -50.576 -136.609 1.00 28.08  ? 126  GLU B CG    1 
ATOM   3310 C  CD    . GLU B  1 125 ? -40.394 -50.379 -135.128 1.00 33.11  ? 126  GLU B CD    1 
ATOM   3311 O  OE1   . GLU B  1 125 ? -41.287 -49.837 -134.455 1.00 33.06  ? 126  GLU B OE1   1 
ATOM   3312 O  OE2   . GLU B  1 125 ? -39.295 -50.742 -134.638 1.00 35.03  ? 126  GLU B OE2   1 
ATOM   3313 N  N     . CYS B  1 126 ? -38.901 -46.508 -138.665 1.00 30.82  ? 127  CYS B N     1 
ATOM   3314 C  CA    . CYS B  1 126 ? -38.912 -45.294 -139.477 1.00 36.92  ? 127  CYS B CA    1 
ATOM   3315 C  C     . CYS B  1 126 ? -37.486 -44.989 -139.914 1.00 36.95  ? 127  CYS B C     1 
ATOM   3316 O  O     . CYS B  1 126 ? -36.586 -44.927 -139.075 1.00 35.34  ? 127  CYS B O     1 
ATOM   3317 C  CB    . CYS B  1 126 ? -39.504 -44.123 -138.674 1.00 38.48  ? 127  CYS B CB    1 
ATOM   3318 S  SG    . CYS B  1 126 ? -39.077 -42.438 -139.243 1.00 40.05  ? 127  CYS B SG    1 
ATOM   3319 N  N     . ALA B  1 127 ? -37.284 -44.798 -141.220 1.00 38.35  ? 128  ALA B N     1 
ATOM   3320 C  CA    . ALA B  1 127 ? -35.932 -44.565 -141.728 1.00 37.48  ? 128  ALA B CA    1 
ATOM   3321 C  C     . ALA B  1 127 ? -35.296 -43.309 -141.123 1.00 39.60  ? 128  ALA B C     1 
ATOM   3322 O  O     . ALA B  1 127 ? -34.083 -43.286 -140.896 1.00 43.48  ? 128  ALA B O     1 
ATOM   3323 C  CB    . ALA B  1 127 ? -35.941 -44.477 -143.258 1.00 30.41  ? 128  ALA B CB    1 
ATOM   3324 N  N     . SER B  1 128 ? -36.085 -42.271 -140.831 1.00 33.96  ? 129  SER B N     1 
ATOM   3325 C  CA    . SER B  1 128 ? -35.513 -41.070 -140.217 1.00 41.56  ? 129  SER B CA    1 
ATOM   3326 C  C     . SER B  1 128 ? -34.902 -41.386 -138.860 1.00 45.56  ? 129  SER B C     1 
ATOM   3327 O  O     . SER B  1 128 ? -33.793 -40.935 -138.550 1.00 44.92  ? 129  SER B O     1 
ATOM   3328 C  CB    . SER B  1 128 ? -36.573 -39.976 -140.046 1.00 37.68  ? 129  SER B CB    1 
ATOM   3329 O  OG    . SER B  1 128 ? -37.291 -39.740 -141.238 1.00 48.42  ? 129  SER B OG    1 
ATOM   3330 N  N     . ILE B  1 129 ? -35.611 -42.166 -138.043 1.00 40.51  ? 130  ILE B N     1 
ATOM   3331 C  CA    . ILE B  1 129 ? -35.183 -42.382 -136.669 1.00 31.54  ? 130  ILE B CA    1 
ATOM   3332 C  C     . ILE B  1 129 ? -34.104 -43.444 -136.600 1.00 34.58  ? 130  ILE B C     1 
ATOM   3333 O  O     . ILE B  1 129 ? -33.058 -43.235 -135.978 1.00 35.44  ? 130  ILE B O     1 
ATOM   3334 C  CB    . ILE B  1 129 ? -36.382 -42.749 -135.782 1.00 32.60  ? 130  ILE B CB    1 
ATOM   3335 C  CG1   . ILE B  1 129 ? -37.317 -41.545 -135.645 1.00 32.52  ? 130  ILE B CG1   1 
ATOM   3336 C  CG2   . ILE B  1 129 ? -35.902 -43.244 -134.399 1.00 30.16  ? 130  ILE B CG2   1 
ATOM   3337 C  CD1   . ILE B  1 129 ? -36.621 -40.303 -135.085 1.00 36.33  ? 130  ILE B CD1   1 
ATOM   3338 N  N     . ASN B  1 130 ? -34.340 -44.615 -137.208 1.00 35.89  ? 131  ASN B N     1 
ATOM   3339 C  CA    . ASN B  1 130 ? -33.361 -45.683 -137.040 1.00 38.79  ? 131  ASN B CA    1 
ATOM   3340 C  C     . ASN B  1 130 ? -32.160 -45.492 -137.950 1.00 41.10  ? 131  ASN B C     1 
ATOM   3341 O  O     . ASN B  1 130 ? -31.263 -46.341 -137.963 1.00 49.45  ? 131  ASN B O     1 
ATOM   3342 C  CB    . ASN B  1 130 ? -34.000 -47.087 -137.214 1.00 35.91  ? 131  ASN B CB    1 
ATOM   3343 C  CG    . ASN B  1 130 ? -34.487 -47.369 -138.624 1.00 42.38  ? 131  ASN B CG    1 
ATOM   3344 O  OD1   . ASN B  1 130 ? -33.792 -47.122 -139.602 1.00 46.17  ? 131  ASN B OD1   1 
ATOM   3345 N  ND2   . ASN B  1 130 ? -35.676 -47.942 -138.723 1.00 42.32  ? 131  ASN B ND2   1 
ATOM   3346 N  N     . ARG B  1 131 ? -32.126 -44.386 -138.697 1.00 40.24  ? 132  ARG B N     1 
ATOM   3347 C  CA    . ARG B  1 131 ? -30.885 -43.946 -139.311 1.00 39.41  ? 132  ARG B CA    1 
ATOM   3348 C  C     . ARG B  1 131 ? -29.872 -43.516 -138.257 1.00 42.49  ? 132  ARG B C     1 
ATOM   3349 O  O     . ARG B  1 131 ? -28.673 -43.767 -138.423 1.00 47.34  ? 132  ARG B O     1 
ATOM   3350 C  CB    . ARG B  1 131 ? -31.168 -42.802 -140.296 1.00 46.00  ? 132  ARG B CB    1 
ATOM   3351 C  CG    . ARG B  1 131 ? -29.954 -42.022 -140.768 1.00 41.89  ? 132  ARG B CG    1 
ATOM   3352 C  CD    . ARG B  1 131 ? -29.099 -42.879 -141.682 1.00 50.12  ? 132  ARG B CD    1 
ATOM   3353 N  NE    . ARG B  1 131 ? -27.911 -42.169 -142.138 1.00 55.34  ? 132  ARG B NE    1 
ATOM   3354 C  CZ    . ARG B  1 131 ? -26.776 -42.087 -141.449 1.00 55.14  ? 132  ARG B CZ    1 
ATOM   3355 N  NH1   . ARG B  1 131 ? -26.665 -42.680 -140.268 1.00 48.48  ? 132  ARG B NH1   1 
ATOM   3356 N  NH2   . ARG B  1 131 ? -25.747 -41.410 -141.943 1.00 55.87  ? 132  ARG B NH2   1 
ATOM   3357 N  N     . ILE B  1 132 ? -30.317 -42.888 -137.164 1.00 38.83  ? 133  ILE B N     1 
ATOM   3358 C  CA    . ILE B  1 132 ? -29.383 -42.321 -136.200 1.00 39.02  ? 133  ILE B CA    1 
ATOM   3359 C  C     . ILE B  1 132 ? -29.322 -43.070 -134.866 1.00 40.45  ? 133  ILE B C     1 
ATOM   3360 O  O     . ILE B  1 132 ? -28.351 -42.879 -134.119 1.00 43.61  ? 133  ILE B O     1 
ATOM   3361 C  CB    . ILE B  1 132 ? -29.664 -40.821 -135.953 1.00 48.52  ? 133  ILE B CB    1 
ATOM   3362 C  CG1   . ILE B  1 132 ? -30.717 -40.619 -134.876 1.00 52.85  ? 133  ILE B CG1   1 
ATOM   3363 C  CG2   . ILE B  1 132 ? -30.085 -40.110 -137.241 1.00 51.80  ? 133  ILE B CG2   1 
ATOM   3364 C  CD1   . ILE B  1 132 ? -30.659 -39.268 -134.234 1.00 59.12  ? 133  ILE B CD1   1 
ATOM   3365 N  N     . TYR B  1 133 ? -30.307 -43.903 -134.530 1.00 36.09  ? 134  TYR B N     1 
ATOM   3366 C  CA    . TYR B  1 133 ? -30.341 -44.502 -133.200 1.00 36.25  ? 134  TYR B CA    1 
ATOM   3367 C  C     . TYR B  1 133 ? -29.807 -45.932 -133.162 1.00 35.80  ? 134  TYR B C     1 
ATOM   3368 O  O     . TYR B  1 133 ? -29.940 -46.602 -132.132 1.00 40.03  ? 134  TYR B O     1 
ATOM   3369 C  CB    . TYR B  1 133 ? -31.757 -44.434 -132.633 1.00 35.33  ? 134  TYR B CB    1 
ATOM   3370 C  CG    . TYR B  1 133 ? -32.080 -43.053 -132.099 1.00 41.86  ? 134  TYR B CG    1 
ATOM   3371 C  CD1   . TYR B  1 133 ? -31.555 -42.611 -130.887 1.00 42.82  ? 134  TYR B CD1   1 
ATOM   3372 C  CD2   . TYR B  1 133 ? -32.877 -42.178 -132.831 1.00 44.19  ? 134  TYR B CD2   1 
ATOM   3373 C  CE1   . TYR B  1 133 ? -31.840 -41.341 -130.406 1.00 47.28  ? 134  TYR B CE1   1 
ATOM   3374 C  CE2   . TYR B  1 133 ? -33.161 -40.909 -132.367 1.00 53.87  ? 134  TYR B CE2   1 
ATOM   3375 C  CZ    . TYR B  1 133 ? -32.641 -40.493 -131.155 1.00 53.91  ? 134  TYR B CZ    1 
ATOM   3376 O  OH    . TYR B  1 133 ? -32.936 -39.230 -130.698 1.00 56.14  ? 134  TYR B OH    1 
ATOM   3377 N  N     . GLY B  1 134 ? -29.195 -46.410 -134.243 1.00 34.30  ? 135  GLY B N     1 
ATOM   3378 C  CA    . GLY B  1 134 ? -28.447 -47.653 -134.188 1.00 32.61  ? 135  GLY B CA    1 
ATOM   3379 C  C     . GLY B  1 134 ? -28.680 -48.680 -135.280 1.00 34.02  ? 135  GLY B C     1 
ATOM   3380 O  O     . GLY B  1 134 ? -27.762 -49.435 -135.626 1.00 39.37  ? 135  GLY B O     1 
ATOM   3381 N  N     . PHE B  1 135 ? -29.891 -48.732 -135.831 1.00 34.33  ? 136  PHE B N     1 
ATOM   3382 C  CA    . PHE B  1 135 ? -30.234 -49.822 -136.739 1.00 35.39  ? 136  PHE B CA    1 
ATOM   3383 C  C     . PHE B  1 135 ? -29.507 -49.701 -138.067 1.00 33.09  ? 136  PHE B C     1 
ATOM   3384 O  O     . PHE B  1 135 ? -29.097 -50.716 -138.651 1.00 36.58  ? 136  PHE B O     1 
ATOM   3385 C  CB    . PHE B  1 135 ? -31.744 -49.871 -136.980 1.00 30.91  ? 136  PHE B CB    1 
ATOM   3386 C  CG    . PHE B  1 135 ? -32.185 -51.065 -137.774 1.00 30.47  ? 136  PHE B CG    1 
ATOM   3387 C  CD1   . PHE B  1 135 ? -31.762 -52.338 -137.420 1.00 33.27  ? 136  PHE B CD1   1 
ATOM   3388 C  CD2   . PHE B  1 135 ? -33.043 -50.927 -138.852 1.00 30.55  ? 136  PHE B CD2   1 
ATOM   3389 C  CE1   . PHE B  1 135 ? -32.177 -53.445 -138.136 1.00 32.72  ? 136  PHE B CE1   1 
ATOM   3390 C  CE2   . PHE B  1 135 ? -33.463 -52.036 -139.570 1.00 32.99  ? 136  PHE B CE2   1 
ATOM   3391 C  CZ    . PHE B  1 135 ? -33.021 -53.291 -139.216 1.00 33.07  ? 136  PHE B CZ    1 
ATOM   3392 N  N     . TYR B  1 136 ? -29.398 -48.477 -138.586 1.00 31.54  ? 137  TYR B N     1 
ATOM   3393 C  CA    . TYR B  1 136 ? -28.599 -48.229 -139.781 1.00 30.18  ? 137  TYR B CA    1 
ATOM   3394 C  C     . TYR B  1 136 ? -27.173 -48.730 -139.606 1.00 34.06  ? 137  TYR B C     1 
ATOM   3395 O  O     . TYR B  1 136 ? -26.618 -49.373 -140.507 1.00 36.05  ? 137  TYR B O     1 
ATOM   3396 C  CB    . TYR B  1 136 ? -28.609 -46.730 -140.091 1.00 31.93  ? 137  TYR B CB    1 
ATOM   3397 C  CG    . TYR B  1 136 ? -27.709 -46.303 -141.222 1.00 31.33  ? 137  TYR B CG    1 
ATOM   3398 C  CD1   . TYR B  1 136 ? -26.374 -45.982 -140.999 1.00 32.09  ? 137  TYR B CD1   1 
ATOM   3399 C  CD2   . TYR B  1 136 ? -28.201 -46.191 -142.514 1.00 41.25  ? 137  TYR B CD2   1 
ATOM   3400 C  CE1   . TYR B  1 136 ? -25.550 -45.576 -142.039 1.00 35.00  ? 137  TYR B CE1   1 
ATOM   3401 C  CE2   . TYR B  1 136 ? -27.387 -45.781 -143.561 1.00 43.97  ? 137  TYR B CE2   1 
ATOM   3402 C  CZ    . TYR B  1 136 ? -26.066 -45.472 -143.317 1.00 40.11  ? 137  TYR B CZ    1 
ATOM   3403 O  OH    . TYR B  1 136 ? -25.262 -45.074 -144.359 1.00 42.47  ? 137  TYR B OH    1 
ATOM   3404 N  N     . ASP B  1 137 ? -26.566 -48.451 -138.448 1.00 34.36  ? 138  ASP B N     1 
ATOM   3405 C  CA    . ASP B  1 137 ? -25.189 -48.870 -138.203 1.00 34.45  ? 138  ASP B CA    1 
ATOM   3406 C  C     . ASP B  1 137 ? -25.085 -50.380 -138.085 1.00 35.73  ? 138  ASP B C     1 
ATOM   3407 O  O     . ASP B  1 137 ? -24.147 -50.990 -138.614 1.00 33.41  ? 138  ASP B O     1 
ATOM   3408 C  CB    . ASP B  1 137 ? -24.658 -48.199 -136.937 1.00 43.03  ? 138  ASP B CB    1 
ATOM   3409 C  CG    . ASP B  1 137 ? -24.603 -46.680 -137.063 1.00 53.86  ? 138  ASP B CG    1 
ATOM   3410 O  OD1   . ASP B  1 137 ? -24.118 -46.191 -138.106 1.00 53.97  ? 138  ASP B OD1   1 
ATOM   3411 O  OD2   . ASP B  1 137 ? -25.064 -45.986 -136.131 1.00 56.41  ? 138  ASP B OD2   1 
ATOM   3412 N  N     . GLU B  1 138 ? -26.043 -51.001 -137.395 1.00 37.98  ? 139  GLU B N     1 
ATOM   3413 C  CA    . GLU B  1 138 ? -26.018 -52.447 -137.262 1.00 36.68  ? 139  GLU B CA    1 
ATOM   3414 C  C     . GLU B  1 138 ? -26.138 -53.115 -138.627 1.00 35.79  ? 139  GLU B C     1 
ATOM   3415 O  O     . GLU B  1 138 ? -25.365 -54.027 -138.948 1.00 37.60  ? 139  GLU B O     1 
ATOM   3416 C  CB    . GLU B  1 138 ? -27.132 -52.910 -136.315 1.00 33.13  ? 139  GLU B CB    1 
ATOM   3417 C  CG    . GLU B  1 138 ? -26.973 -54.369 -135.899 1.00 32.94  ? 139  GLU B CG    1 
ATOM   3418 C  CD    . GLU B  1 138 ? -28.030 -54.854 -134.919 1.00 35.35  ? 139  GLU B CD    1 
ATOM   3419 O  OE1   . GLU B  1 138 ? -28.481 -54.078 -134.046 1.00 39.72  ? 139  GLU B OE1   1 
ATOM   3420 O  OE2   . GLU B  1 138 ? -28.404 -56.033 -135.031 1.00 37.83  ? 139  GLU B OE2   1 
ATOM   3421 N  N     . CYS B  1 139 ? -27.091 -52.662 -139.448 1.00 35.01  ? 140  CYS B N     1 
ATOM   3422 C  CA    . CYS B  1 139 ? -27.215 -53.177 -140.812 1.00 38.31  ? 140  CYS B CA    1 
ATOM   3423 C  C     . CYS B  1 139 ? -25.914 -53.011 -141.593 1.00 41.29  ? 140  CYS B C     1 
ATOM   3424 O  O     . CYS B  1 139 ? -25.418 -53.969 -142.201 1.00 44.26  ? 140  CYS B O     1 
ATOM   3425 C  CB    . CYS B  1 139 ? -28.368 -52.477 -141.534 1.00 37.48  ? 140  CYS B CB    1 
ATOM   3426 S  SG    . CYS B  1 139 ? -30.003 -53.025 -140.976 1.00 41.00  ? 140  CYS B SG    1 
ATOM   3427 N  N     . LYS B  1 140 ? -25.340 -51.800 -141.579 1.00 38.41  ? 141  LYS B N     1 
ATOM   3428 C  CA    . LYS B  1 140 ? -24.114 -51.541 -142.334 1.00 39.37  ? 141  LYS B CA    1 
ATOM   3429 C  C     . LYS B  1 140 ? -22.950 -52.367 -141.806 1.00 45.22  ? 141  LYS B C     1 
ATOM   3430 O  O     . LYS B  1 140 ? -22.138 -52.877 -142.586 1.00 48.59  ? 141  LYS B O     1 
ATOM   3431 C  CB    . LYS B  1 140 ? -23.755 -50.057 -142.280 1.00 41.16  ? 141  LYS B CB    1 
ATOM   3432 C  CG    . LYS B  1 140 ? -22.555 -49.691 -143.140 1.00 42.74  ? 141  LYS B CG    1 
ATOM   3433 C  CD    . LYS B  1 140 ? -22.084 -48.275 -142.870 1.00 48.24  ? 141  LYS B CD    1 
ATOM   3434 C  CE    . LYS B  1 140 ? -20.957 -47.870 -143.819 1.00 50.09  ? 141  LYS B CE    1 
ATOM   3435 N  NZ    . LYS B  1 140 ? -20.380 -46.563 -143.433 1.00 53.72  ? 141  LYS B NZ    1 
ATOM   3436 N  N     . ARG B  1 141 ? -22.837 -52.484 -140.483 1.00 42.86  ? 142  ARG B N     1 
ATOM   3437 C  CA    . ARG B  1 141 ? -21.771 -53.283 -139.892 1.00 47.92  ? 142  ARG B CA    1 
ATOM   3438 C  C     . ARG B  1 141 ? -21.880 -54.744 -140.323 1.00 50.56  ? 142  ARG B C     1 
ATOM   3439 O  O     . ARG B  1 141 ? -20.928 -55.314 -140.868 1.00 51.29  ? 142  ARG B O     1 
ATOM   3440 C  CB    . ARG B  1 141 ? -21.820 -53.150 -138.366 1.00 58.06  ? 142  ARG B CB    1 
ATOM   3441 C  CG    . ARG B  1 141 ? -20.730 -53.893 -137.600 1.00 69.27  ? 142  ARG B CG    1 
ATOM   3442 C  CD    . ARG B  1 141 ? -21.029 -53.950 -136.088 1.00 77.67  ? 142  ARG B CD    1 
ATOM   3443 N  NE    . ARG B  1 141 ? -21.269 -52.622 -135.511 1.00 84.74  ? 142  ARG B NE    1 
ATOM   3444 C  CZ    . ARG B  1 141 ? -22.367 -52.268 -134.842 1.00 82.15  ? 142  ARG B CZ    1 
ATOM   3445 N  NH1   . ARG B  1 141 ? -23.344 -53.144 -134.639 1.00 77.79  ? 142  ARG B NH1   1 
ATOM   3446 N  NH2   . ARG B  1 141 ? -22.484 -51.035 -134.366 1.00 79.40  ? 142  ARG B NH2   1 
ATOM   3447 N  N     . ARG B  1 142 ? -23.056 -55.357 -140.124 1.00 51.39  ? 143  ARG B N     1 
ATOM   3448 C  CA    . ARG B  1 142 ? -23.207 -56.801 -140.296 1.00 46.48  ? 143  ARG B CA    1 
ATOM   3449 C  C     . ARG B  1 142 ? -23.632 -57.207 -141.701 1.00 43.80  ? 143  ARG B C     1 
ATOM   3450 O  O     . ARG B  1 142 ? -23.289 -58.305 -142.141 1.00 43.25  ? 143  ARG B O     1 
ATOM   3451 C  CB    . ARG B  1 142 ? -24.215 -57.355 -139.286 1.00 43.34  ? 143  ARG B CB    1 
ATOM   3452 C  CG    . ARG B  1 142 ? -23.846 -57.076 -137.846 1.00 46.07  ? 143  ARG B CG    1 
ATOM   3453 C  CD    . ARG B  1 142 ? -24.975 -57.448 -136.896 1.00 48.70  ? 143  ARG B CD    1 
ATOM   3454 N  NE    . ARG B  1 142 ? -25.072 -58.885 -136.636 1.00 51.48  ? 143  ARG B NE    1 
ATOM   3455 C  CZ    . ARG B  1 142 ? -25.945 -59.427 -135.785 1.00 47.99  ? 143  ARG B CZ    1 
ATOM   3456 N  NH1   . ARG B  1 142 ? -26.803 -58.653 -135.111 1.00 38.58  ? 143  ARG B NH1   1 
ATOM   3457 N  NH2   . ARG B  1 142 ? -25.964 -60.740 -135.612 1.00 47.83  ? 143  ARG B NH2   1 
ATOM   3458 N  N     . TYR B  1 143 ? -24.375 -56.369 -142.420 1.00 40.49  ? 144  TYR B N     1 
ATOM   3459 C  CA    . TYR B  1 143 ? -24.684 -56.684 -143.811 1.00 38.67  ? 144  TYR B CA    1 
ATOM   3460 C  C     . TYR B  1 143 ? -24.272 -55.510 -144.687 1.00 36.97  ? 144  TYR B C     1 
ATOM   3461 O  O     . TYR B  1 143 ? -23.083 -55.343 -144.961 1.00 36.73  ? 144  TYR B O     1 
ATOM   3462 C  CB    . TYR B  1 143 ? -26.167 -57.025 -143.988 1.00 34.41  ? 144  TYR B CB    1 
ATOM   3463 C  CG    . TYR B  1 143 ? -26.513 -58.352 -143.363 1.00 35.36  ? 144  TYR B CG    1 
ATOM   3464 C  CD1   . TYR B  1 143 ? -26.901 -58.427 -142.034 1.00 38.17  ? 144  TYR B CD1   1 
ATOM   3465 C  CD2   . TYR B  1 143 ? -26.419 -59.537 -144.094 1.00 35.56  ? 144  TYR B CD2   1 
ATOM   3466 C  CE1   . TYR B  1 143 ? -27.201 -59.640 -141.447 1.00 44.77  ? 144  TYR B CE1   1 
ATOM   3467 C  CE2   . TYR B  1 143 ? -26.717 -60.761 -143.517 1.00 36.55  ? 144  TYR B CE2   1 
ATOM   3468 C  CZ    . TYR B  1 143 ? -27.109 -60.804 -142.188 1.00 43.49  ? 144  TYR B CZ    1 
ATOM   3469 O  OH    . TYR B  1 143 ? -27.423 -62.003 -141.588 1.00 46.01  ? 144  TYR B OH    1 
ATOM   3470 N  N     . ASN B  1 144 ? -25.230 -54.684 -145.102 1.00 39.10  ? 145  ASN B N     1 
ATOM   3471 C  CA    . ASN B  1 144 ? -24.933 -53.512 -145.911 1.00 39.86  ? 145  ASN B CA    1 
ATOM   3472 C  C     . ASN B  1 144 ? -26.120 -52.558 -145.860 1.00 41.81  ? 145  ASN B C     1 
ATOM   3473 O  O     . ASN B  1 144 ? -27.161 -52.843 -145.254 1.00 40.37  ? 145  ASN B O     1 
ATOM   3474 C  CB    . ASN B  1 144 ? -24.618 -53.901 -147.352 1.00 44.63  ? 145  ASN B CB    1 
ATOM   3475 C  CG    . ASN B  1 144 ? -25.669 -54.806 -147.938 1.00 52.15  ? 145  ASN B CG    1 
ATOM   3476 O  OD1   . ASN B  1 144 ? -26.823 -54.410 -148.101 1.00 51.43  ? 145  ASN B OD1   1 
ATOM   3477 N  ND2   . ASN B  1 144 ? -25.281 -56.038 -148.250 1.00 56.68  ? 145  ASN B ND2   1 
ATOM   3478 N  N     . ILE B  1 145 ? -25.954 -51.426 -146.548 1.00 36.87  ? 146  ILE B N     1 
ATOM   3479 C  CA    . ILE B  1 145 ? -26.942 -50.352 -146.529 1.00 39.38  ? 146  ILE B CA    1 
ATOM   3480 C  C     . ILE B  1 145 ? -28.217 -50.771 -147.241 1.00 37.44  ? 146  ILE B C     1 
ATOM   3481 O  O     . ILE B  1 145 ? -29.320 -50.405 -146.821 1.00 38.57  ? 146  ILE B O     1 
ATOM   3482 C  CB    . ILE B  1 145 ? -26.344 -49.082 -147.168 1.00 49.51  ? 146  ILE B CB    1 
ATOM   3483 C  CG1   . ILE B  1 145 ? -25.167 -48.576 -146.341 1.00 57.67  ? 146  ILE B CG1   1 
ATOM   3484 C  CG2   . ILE B  1 145 ? -27.406 -47.991 -147.365 1.00 50.04  ? 146  ILE B CG2   1 
ATOM   3485 C  CD1   . ILE B  1 145 ? -25.480 -48.451 -144.887 1.00 56.28  ? 146  ILE B CD1   1 
ATOM   3486 N  N     . LYS B  1 146 ? -28.093 -51.496 -148.356 1.00 39.88  ? 147  LYS B N     1 
ATOM   3487 C  CA    . LYS B  1 146 ? -29.287 -51.854 -149.115 1.00 48.59  ? 147  LYS B CA    1 
ATOM   3488 C  C     . LYS B  1 146 ? -30.205 -52.749 -148.292 1.00 44.90  ? 147  LYS B C     1 
ATOM   3489 O  O     . LYS B  1 146 ? -31.434 -52.646 -148.390 1.00 46.75  ? 147  LYS B O     1 
ATOM   3490 C  CB    . LYS B  1 146 ? -28.915 -52.537 -150.432 1.00 55.69  ? 147  LYS B CB    1 
ATOM   3491 C  CG    . LYS B  1 146 ? -30.121 -52.969 -151.308 1.00 68.52  ? 147  LYS B CG    1 
ATOM   3492 C  CD    . LYS B  1 146 ? -31.361 -52.038 -151.200 1.00 77.04  ? 147  LYS B CD    1 
ATOM   3493 C  CE    . LYS B  1 146 ? -32.483 -52.462 -152.148 1.00 80.09  ? 147  LYS B CE    1 
ATOM   3494 N  NZ    . LYS B  1 146 ? -33.843 -52.152 -151.596 1.00 77.47  ? 147  LYS B NZ    1 
ATOM   3495 N  N     . LEU B  1 147 ? -29.636 -53.627 -147.464 1.00 39.05  ? 148  LEU B N     1 
ATOM   3496 C  CA    . LEU B  1 147 ? -30.498 -54.418 -146.593 1.00 37.38  ? 148  LEU B CA    1 
ATOM   3497 C  C     . LEU B  1 147 ? -31.280 -53.512 -145.655 1.00 38.10  ? 148  LEU B C     1 
ATOM   3498 O  O     . LEU B  1 147 ? -32.468 -53.745 -145.402 1.00 37.97  ? 148  LEU B O     1 
ATOM   3499 C  CB    . LEU B  1 147 ? -29.682 -55.435 -145.806 1.00 38.70  ? 148  LEU B CB    1 
ATOM   3500 C  CG    . LEU B  1 147 ? -30.580 -56.486 -145.149 1.00 41.36  ? 148  LEU B CG    1 
ATOM   3501 C  CD1   . LEU B  1 147 ? -31.400 -57.190 -146.208 1.00 41.68  ? 148  LEU B CD1   1 
ATOM   3502 C  CD2   . LEU B  1 147 ? -29.744 -57.480 -144.357 1.00 40.46  ? 148  LEU B CD2   1 
ATOM   3503 N  N     . TRP B  1 148 ? -30.635 -52.447 -145.163 1.00 40.45  ? 149  TRP B N     1 
ATOM   3504 C  CA    . TRP B  1 148 ? -31.322 -51.488 -144.305 1.00 35.66  ? 149  TRP B CA    1 
ATOM   3505 C  C     . TRP B  1 148 ? -32.525 -50.879 -145.009 1.00 35.39  ? 149  TRP B C     1 
ATOM   3506 O  O     . TRP B  1 148 ? -33.591 -50.704 -144.399 1.00 30.68  ? 149  TRP B O     1 
ATOM   3507 C  CB    . TRP B  1 148 ? -30.358 -50.391 -143.865 1.00 34.38  ? 149  TRP B CB    1 
ATOM   3508 C  CG    . TRP B  1 148 ? -31.042 -49.315 -143.094 1.00 36.76  ? 149  TRP B CG    1 
ATOM   3509 C  CD1   . TRP B  1 148 ? -31.611 -49.435 -141.854 1.00 33.41  ? 149  TRP B CD1   1 
ATOM   3510 C  CD2   . TRP B  1 148 ? -31.241 -47.949 -143.499 1.00 37.78  ? 149  TRP B CD2   1 
ATOM   3511 N  NE1   . TRP B  1 148 ? -32.144 -48.232 -141.464 1.00 34.61  ? 149  TRP B NE1   1 
ATOM   3512 C  CE2   . TRP B  1 148 ? -31.935 -47.303 -142.450 1.00 35.44  ? 149  TRP B CE2   1 
ATOM   3513 C  CE3   . TRP B  1 148 ? -30.891 -47.208 -144.640 1.00 37.61  ? 149  TRP B CE3   1 
ATOM   3514 C  CZ2   . TRP B  1 148 ? -32.296 -45.952 -142.507 1.00 38.64  ? 149  TRP B CZ2   1 
ATOM   3515 C  CZ3   . TRP B  1 148 ? -31.250 -45.857 -144.698 1.00 35.37  ? 149  TRP B CZ3   1 
ATOM   3516 C  CH2   . TRP B  1 148 ? -31.948 -45.245 -143.637 1.00 37.57  ? 149  TRP B CH2   1 
ATOM   3517 N  N     . LYS B  1 149 ? -32.375 -50.547 -146.296 1.00 35.26  ? 150  LYS B N     1 
ATOM   3518 C  CA    . LYS B  1 149 ? -33.500 -49.984 -147.036 1.00 39.39  ? 150  LYS B CA    1 
ATOM   3519 C  C     . LYS B  1 149 ? -34.579 -51.027 -147.274 1.00 39.48  ? 150  LYS B C     1 
ATOM   3520 O  O     . LYS B  1 149 ? -35.767 -50.685 -147.313 1.00 42.03  ? 150  LYS B O     1 
ATOM   3521 C  CB    . LYS B  1 149 ? -33.021 -49.382 -148.362 1.00 41.84  ? 150  LYS B CB    1 
ATOM   3522 C  CG    . LYS B  1 149 ? -31.823 -48.452 -148.214 1.00 46.99  ? 150  LYS B CG    1 
ATOM   3523 C  CD    . LYS B  1 149 ? -31.695 -47.518 -149.393 1.00 57.28  ? 150  LYS B CD    1 
ATOM   3524 C  CE    . LYS B  1 149 ? -30.300 -46.915 -149.482 1.00 65.22  ? 150  LYS B CE    1 
ATOM   3525 N  NZ    . LYS B  1 149 ? -30.239 -45.549 -148.869 1.00 68.65  ? 150  LYS B NZ    1 
ATOM   3526 N  N     . THR B  1 150 ? -34.193 -52.300 -147.422 1.00 35.19  ? 151  THR B N     1 
ATOM   3527 C  CA    . THR B  1 150 ? -35.196 -53.357 -147.498 1.00 35.06  ? 151  THR B CA    1 
ATOM   3528 C  C     . THR B  1 150 ? -36.080 -53.358 -146.253 1.00 38.77  ? 151  THR B C     1 
ATOM   3529 O  O     . THR B  1 150 ? -37.313 -53.411 -146.353 1.00 38.22  ? 151  THR B O     1 
ATOM   3530 C  CB    . THR B  1 150 ? -34.520 -54.718 -147.683 1.00 40.39  ? 151  THR B CB    1 
ATOM   3531 O  OG1   . THR B  1 150 ? -33.760 -54.716 -148.895 1.00 39.86  ? 151  THR B OG1   1 
ATOM   3532 C  CG2   . THR B  1 150 ? -35.554 -55.842 -147.748 1.00 34.59  ? 151  THR B CG2   1 
ATOM   3533 N  N     . PHE B  1 151 ? -35.468 -53.274 -145.070 1.00 40.24  ? 152  PHE B N     1 
ATOM   3534 C  CA    . PHE B  1 151 ? -36.247 -53.183 -143.837 1.00 37.95  ? 152  PHE B CA    1 
ATOM   3535 C  C     . PHE B  1 151 ? -37.148 -51.958 -143.836 1.00 35.40  ? 152  PHE B C     1 
ATOM   3536 O  O     . PHE B  1 151 ? -38.304 -52.027 -143.400 1.00 38.10  ? 152  PHE B O     1 
ATOM   3537 C  CB    . PHE B  1 151 ? -35.315 -53.157 -142.632 1.00 34.95  ? 152  PHE B CB    1 
ATOM   3538 C  CG    . PHE B  1 151 ? -34.881 -54.522 -142.188 1.00 39.31  ? 152  PHE B CG    1 
ATOM   3539 C  CD1   . PHE B  1 151 ? -35.769 -55.369 -141.545 1.00 34.94  ? 152  PHE B CD1   1 
ATOM   3540 C  CD2   . PHE B  1 151 ? -33.584 -54.958 -142.411 1.00 37.73  ? 152  PHE B CD2   1 
ATOM   3541 C  CE1   . PHE B  1 151 ? -35.365 -56.622 -141.137 1.00 33.38  ? 152  PHE B CE1   1 
ATOM   3542 C  CE2   . PHE B  1 151 ? -33.181 -56.204 -141.997 1.00 36.47  ? 152  PHE B CE2   1 
ATOM   3543 C  CZ    . PHE B  1 151 ? -34.067 -57.038 -141.358 1.00 31.87  ? 152  PHE B CZ    1 
ATOM   3544 N  N     . THR B  1 152 ? -36.638 -50.828 -144.331 1.00 32.58  ? 153  THR B N     1 
ATOM   3545 C  CA    . THR B  1 152 ? -37.425 -49.598 -144.368 1.00 34.71  ? 153  THR B CA    1 
ATOM   3546 C  C     . THR B  1 152 ? -38.731 -49.806 -145.116 1.00 35.51  ? 153  THR B C     1 
ATOM   3547 O  O     . THR B  1 152 ? -39.810 -49.486 -144.604 1.00 36.86  ? 153  THR B O     1 
ATOM   3548 C  CB    . THR B  1 152 ? -36.614 -48.481 -145.030 1.00 40.59  ? 153  THR B CB    1 
ATOM   3549 O  OG1   . THR B  1 152 ? -35.485 -48.175 -144.213 1.00 46.60  ? 153  THR B OG1   1 
ATOM   3550 C  CG2   . THR B  1 152 ? -37.462 -47.225 -145.208 1.00 44.80  ? 153  THR B CG2   1 
ATOM   3551 N  N     . ASP B  1 153 ? -38.646 -50.355 -146.337 1.00 32.82  ? 154  ASP B N     1 
ATOM   3552 C  CA    . ASP B  1 153 ? -39.835 -50.591 -147.147 1.00 36.07  ? 154  ASP B CA    1 
ATOM   3553 C  C     . ASP B  1 153 ? -40.827 -51.507 -146.454 1.00 38.02  ? 154  ASP B C     1 
ATOM   3554 O  O     . ASP B  1 153 ? -42.038 -51.383 -146.667 1.00 40.26  ? 154  ASP B O     1 
ATOM   3555 C  CB    . ASP B  1 153 ? -39.435 -51.178 -148.503 1.00 42.27  ? 154  ASP B CB    1 
ATOM   3556 C  CG    . ASP B  1 153 ? -38.505 -50.260 -149.273 1.00 56.03  ? 154  ASP B CG    1 
ATOM   3557 O  OD1   . ASP B  1 153 ? -38.719 -49.030 -149.196 1.00 61.23  ? 154  ASP B OD1   1 
ATOM   3558 O  OD2   . ASP B  1 153 ? -37.571 -50.757 -149.942 1.00 62.28  ? 154  ASP B OD2   1 
ATOM   3559 N  N     . CYS B  1 154 ? -40.333 -52.435 -145.636 1.00 39.32  ? 155  CYS B N     1 
ATOM   3560 C  CA    . CYS B  1 154 ? -41.194 -53.277 -144.813 1.00 34.09  ? 155  CYS B CA    1 
ATOM   3561 C  C     . CYS B  1 154 ? -41.805 -52.491 -143.650 1.00 30.33  ? 155  CYS B C     1 
ATOM   3562 O  O     . CYS B  1 154 ? -43.020 -52.540 -143.434 1.00 32.93  ? 155  CYS B O     1 
ATOM   3563 C  CB    . CYS B  1 154 ? -40.379 -54.477 -144.310 1.00 36.19  ? 155  CYS B CB    1 
ATOM   3564 S  SG    . CYS B  1 154 ? -41.296 -55.658 -143.319 1.00 35.38  ? 155  CYS B SG    1 
ATOM   3565 N  N     . PHE B  1 155 ? -40.982 -51.747 -142.899 1.00 29.85  ? 156  PHE B N     1 
ATOM   3566 C  CA    . PHE B  1 155 ? -41.512 -50.908 -141.819 1.00 33.67  ? 156  PHE B CA    1 
ATOM   3567 C  C     . PHE B  1 155 ? -42.588 -49.953 -142.328 1.00 36.28  ? 156  PHE B C     1 
ATOM   3568 O  O     . PHE B  1 155 ? -43.546 -49.638 -141.606 1.00 29.14  ? 156  PHE B O     1 
ATOM   3569 C  CB    . PHE B  1 155 ? -40.392 -50.093 -141.165 1.00 31.27  ? 156  PHE B CB    1 
ATOM   3570 C  CG    . PHE B  1 155 ? -39.383 -50.918 -140.413 1.00 32.44  ? 156  PHE B CG    1 
ATOM   3571 C  CD1   . PHE B  1 155 ? -39.712 -52.164 -139.905 1.00 35.34  ? 156  PHE B CD1   1 
ATOM   3572 C  CD2   . PHE B  1 155 ? -38.096 -50.441 -140.219 1.00 28.72  ? 156  PHE B CD2   1 
ATOM   3573 C  CE1   . PHE B  1 155 ? -38.777 -52.925 -139.220 1.00 36.48  ? 156  PHE B CE1   1 
ATOM   3574 C  CE2   . PHE B  1 155 ? -37.153 -51.196 -139.537 1.00 29.37  ? 156  PHE B CE2   1 
ATOM   3575 C  CZ    . PHE B  1 155 ? -37.502 -52.444 -139.031 1.00 31.81  ? 156  PHE B CZ    1 
ATOM   3576 N  N     . ASN B  1 156 ? -42.444 -49.469 -143.567 1.00 31.15  ? 157  ASN B N     1 
ATOM   3577 C  CA    . ASN B  1 156 ? -43.411 -48.513 -144.086 1.00 29.23  ? 157  ASN B CA    1 
ATOM   3578 C  C     . ASN B  1 156 ? -44.786 -49.131 -144.296 1.00 31.73  ? 157  ASN B C     1 
ATOM   3579 O  O     . ASN B  1 156 ? -45.743 -48.391 -144.560 1.00 30.19  ? 157  ASN B O     1 
ATOM   3580 C  CB    . ASN B  1 156 ? -42.896 -47.892 -145.392 1.00 28.73  ? 157  ASN B CB    1 
ATOM   3581 C  CG    . ASN B  1 156 ? -41.825 -46.828 -145.156 1.00 34.84  ? 157  ASN B CG    1 
ATOM   3582 O  OD1   . ASN B  1 156 ? -41.502 -46.494 -144.014 1.00 34.45  ? 157  ASN B OD1   1 
ATOM   3583 N  ND2   . ASN B  1 156 ? -41.273 -46.287 -146.244 1.00 37.76  ? 157  ASN B ND2   1 
ATOM   3584 N  N     . CYS B  1 157 ? -44.919 -50.452 -144.152 1.00 27.81  ? 158  CYS B N     1 
ATOM   3585 C  CA    . CYS B  1 157 ? -46.197 -51.119 -144.341 1.00 28.90  ? 158  CYS B CA    1 
ATOM   3586 C  C     . CYS B  1 157 ? -46.806 -51.648 -143.049 1.00 33.09  ? 158  CYS B C     1 
ATOM   3587 O  O     . CYS B  1 157 ? -47.900 -52.219 -143.092 1.00 33.49  ? 158  CYS B O     1 
ATOM   3588 C  CB    . CYS B  1 157 ? -46.037 -52.257 -145.355 1.00 34.96  ? 158  CYS B CB    1 
ATOM   3589 S  SG    . CYS B  1 157 ? -45.491 -51.652 -146.986 1.00 36.89  ? 158  CYS B SG    1 
ATOM   3590 N  N     . LEU B  1 158 ? -46.138 -51.475 -141.907 1.00 32.82  ? 159  LEU B N     1 
ATOM   3591 C  CA    . LEU B  1 158 ? -46.684 -51.968 -140.650 1.00 30.03  ? 159  LEU B CA    1 
ATOM   3592 C  C     . LEU B  1 158 ? -48.009 -51.280 -140.333 1.00 34.02  ? 159  LEU B C     1 
ATOM   3593 O  O     . LEU B  1 158 ? -48.164 -50.075 -140.585 1.00 28.40  ? 159  LEU B O     1 
ATOM   3594 C  CB    . LEU B  1 158 ? -45.707 -51.754 -139.484 1.00 23.10  ? 159  LEU B CB    1 
ATOM   3595 C  CG    . LEU B  1 158 ? -44.477 -52.660 -139.402 1.00 25.54  ? 159  LEU B CG    1 
ATOM   3596 C  CD1   . LEU B  1 158 ? -43.350 -52.026 -138.596 1.00 23.95  ? 159  LEU B CD1   1 
ATOM   3597 C  CD2   . LEU B  1 158 ? -44.892 -54.021 -138.809 1.00 22.75  ? 159  LEU B CD2   1 
ATOM   3598 N  N     . PRO B  1 159 ? -48.972 -52.003 -139.757 1.00 29.43  ? 160  PRO B N     1 
ATOM   3599 C  CA    . PRO B  1 159 ? -50.176 -51.350 -139.241 1.00 23.64  ? 160  PRO B CA    1 
ATOM   3600 C  C     . PRO B  1 159 ? -49.799 -50.457 -138.074 1.00 25.06  ? 160  PRO B C     1 
ATOM   3601 O  O     . PRO B  1 159 ? -48.729 -50.585 -137.478 1.00 27.54  ? 160  PRO B O     1 
ATOM   3602 C  CB    . PRO B  1 159 ? -51.059 -52.521 -138.789 1.00 25.30  ? 160  PRO B CB    1 
ATOM   3603 C  CG    . PRO B  1 159 ? -50.031 -53.607 -138.398 1.00 28.77  ? 160  PRO B CG    1 
ATOM   3604 C  CD    . PRO B  1 159 ? -48.887 -53.427 -139.373 1.00 28.80  ? 160  PRO B CD    1 
ATOM   3605 N  N     . ILE B  1 160 ? -50.692 -49.536 -137.729 1.00 30.00  ? 161  ILE B N     1 
ATOM   3606 C  CA    . ILE B  1 160 ? -50.339 -48.509 -136.757 1.00 32.68  ? 161  ILE B CA    1 
ATOM   3607 C  C     . ILE B  1 160 ? -51.183 -48.538 -135.495 1.00 32.87  ? 161  ILE B C     1 
ATOM   3608 O  O     . ILE B  1 160 ? -50.811 -47.876 -134.513 1.00 32.67  ? 161  ILE B O     1 
ATOM   3609 C  CB    . ILE B  1 160 ? -50.360 -47.097 -137.388 1.00 36.96  ? 161  ILE B CB    1 
ATOM   3610 C  CG1   . ILE B  1 160 ? -51.773 -46.697 -137.784 1.00 43.09  ? 161  ILE B CG1   1 
ATOM   3611 C  CG2   . ILE B  1 160 ? -49.407 -47.049 -138.599 1.00 29.59  ? 161  ILE B CG2   1 
ATOM   3612 C  CD1   . ILE B  1 160 ? -51.847 -45.282 -138.355 1.00 46.07  ? 161  ILE B CD1   1 
ATOM   3613 N  N     . ALA B  1 161 ? -52.288 -49.279 -135.460 1.00 30.89  ? 162  ALA B N     1 
ATOM   3614 C  CA    . ALA B  1 161 ? -53.066 -49.366 -134.231 1.00 29.93  ? 162  ALA B CA    1 
ATOM   3615 C  C     . ALA B  1 161 ? -53.865 -50.661 -134.227 1.00 29.51  ? 162  ALA B C     1 
ATOM   3616 O  O     . ALA B  1 161 ? -54.068 -51.288 -135.268 1.00 25.11  ? 162  ALA B O     1 
ATOM   3617 C  CB    . ALA B  1 161 ? -53.992 -48.152 -134.075 1.00 35.11  ? 162  ALA B CB    1 
ATOM   3618 N  N     . ALA B  1 162 ? -54.330 -51.049 -133.041 1.00 25.94  ? 163  ALA B N     1 
ATOM   3619 C  CA    . ALA B  1 162 ? -55.163 -52.236 -132.909 1.00 29.05  ? 163  ALA B CA    1 
ATOM   3620 C  C     . ALA B  1 162 ? -56.224 -51.983 -131.856 1.00 29.61  ? 163  ALA B C     1 
ATOM   3621 O  O     . ALA B  1 162 ? -56.008 -51.235 -130.897 1.00 31.57  ? 163  ALA B O     1 
ATOM   3622 C  CB    . ALA B  1 162 ? -54.349 -53.485 -132.535 1.00 28.34  ? 163  ALA B CB    1 
ATOM   3623 N  N     . ILE B  1 163 ? -57.383 -52.596 -132.057 1.00 26.41  ? 164  ILE B N     1 
ATOM   3624 C  CA    . ILE B  1 163 ? -58.449 -52.574 -131.074 1.00 30.09  ? 164  ILE B CA    1 
ATOM   3625 C  C     . ILE B  1 163 ? -58.757 -54.020 -130.701 1.00 31.66  ? 164  ILE B C     1 
ATOM   3626 O  O     . ILE B  1 163 ? -59.042 -54.853 -131.575 1.00 34.41  ? 164  ILE B O     1 
ATOM   3627 C  CB    . ILE B  1 163 ? -59.694 -51.838 -131.586 1.00 37.28  ? 164  ILE B CB    1 
ATOM   3628 C  CG1   . ILE B  1 163 ? -59.323 -50.406 -131.976 1.00 36.19  ? 164  ILE B CG1   1 
ATOM   3629 C  CG2   . ILE B  1 163 ? -60.765 -51.803 -130.498 1.00 39.84  ? 164  ILE B CG2   1 
ATOM   3630 C  CD1   . ILE B  1 163 ? -60.508 -49.546 -132.383 1.00 37.49  ? 164  ILE B CD1   1 
ATOM   3631 N  N     . VAL B  1 164 ? -58.684 -54.320 -129.414 1.00 28.60  ? 165  VAL B N     1 
ATOM   3632 C  CA    . VAL B  1 164 ? -58.895 -55.668 -128.914 1.00 32.29  ? 165  VAL B CA    1 
ATOM   3633 C  C     . VAL B  1 164 ? -60.321 -55.733 -128.390 1.00 35.51  ? 165  VAL B C     1 
ATOM   3634 O  O     . VAL B  1 164 ? -60.683 -55.002 -127.460 1.00 34.96  ? 165  VAL B O     1 
ATOM   3635 C  CB    . VAL B  1 164 ? -57.878 -56.043 -127.830 1.00 31.13  ? 165  VAL B CB    1 
ATOM   3636 C  CG1   . VAL B  1 164 ? -58.171 -57.460 -127.319 1.00 40.01  ? 165  VAL B CG1   1 
ATOM   3637 C  CG2   . VAL B  1 164 ? -56.456 -55.948 -128.373 1.00 29.04  ? 165  VAL B CG2   1 
ATOM   3638 N  N     . ASP B  1 165 ? -61.135 -56.591 -129.014 1.00 37.17  ? 166  ASP B N     1 
ATOM   3639 C  CA    . ASP B  1 165 ? -62.517 -56.848 -128.590 1.00 38.80  ? 166  ASP B CA    1 
ATOM   3640 C  C     . ASP B  1 165 ? -63.313 -55.555 -128.426 1.00 37.62  ? 166  ASP B C     1 
ATOM   3641 O  O     . ASP B  1 165 ? -64.151 -55.433 -127.527 1.00 41.72  ? 166  ASP B O     1 
ATOM   3642 C  CB    . ASP B  1 165 ? -62.546 -57.675 -127.300 1.00 38.45  ? 166  ASP B CB    1 
ATOM   3643 C  CG    . ASP B  1 165 ? -62.145 -59.125 -127.536 1.00 41.52  ? 166  ASP B CG    1 
ATOM   3644 O  OD1   . ASP B  1 165 ? -62.674 -59.739 -128.487 1.00 43.19  ? 166  ASP B OD1   1 
ATOM   3645 O  OD2   . ASP B  1 165 ? -61.265 -59.637 -126.810 1.00 40.80  ? 166  ASP B OD2   1 
ATOM   3646 N  N     . GLU B  1 166 ? -63.035 -54.567 -129.277 1.00 35.71  ? 167  GLU B N     1 
ATOM   3647 C  CA    . GLU B  1 166 ? -63.747 -53.288 -129.267 1.00 35.60  ? 167  GLU B CA    1 
ATOM   3648 C  C     . GLU B  1 166 ? -63.672 -52.595 -127.914 1.00 33.83  ? 167  GLU B C     1 
ATOM   3649 O  O     . GLU B  1 166 ? -64.537 -51.790 -127.576 1.00 35.79  ? 167  GLU B O     1 
ATOM   3650 C  CB    . GLU B  1 166 ? -65.211 -53.463 -129.677 1.00 44.39  ? 167  GLU B CB    1 
ATOM   3651 C  CG    . GLU B  1 166 ? -65.388 -54.007 -131.074 1.00 54.24  ? 167  GLU B CG    1 
ATOM   3652 C  CD    . GLU B  1 166 ? -66.832 -54.280 -131.395 1.00 67.37  ? 167  GLU B CD    1 
ATOM   3653 O  OE1   . GLU B  1 166 ? -67.603 -54.555 -130.450 1.00 72.96  ? 167  GLU B OE1   1 
ATOM   3654 O  OE2   . GLU B  1 166 ? -67.203 -54.207 -132.588 1.00 74.81  ? 167  GLU B OE2   1 
ATOM   3655 N  N     . LYS B  1 167 ? -62.636 -52.890 -127.134 1.00 35.55  ? 168  LYS B N     1 
ATOM   3656 C  CA    . LYS B  1 167 ? -62.534 -52.344 -125.784 1.00 36.25  ? 168  LYS B CA    1 
ATOM   3657 C  C     . LYS B  1 167 ? -61.141 -51.856 -125.413 1.00 36.25  ? 168  LYS B C     1 
ATOM   3658 O  O     . LYS B  1 167 ? -61.032 -50.975 -124.555 1.00 37.57  ? 168  LYS B O     1 
ATOM   3659 C  CB    . LYS B  1 167 ? -62.991 -53.389 -124.752 1.00 39.34  ? 168  LYS B CB    1 
ATOM   3660 C  CG    . LYS B  1 167 ? -64.503 -53.554 -124.653 1.00 45.00  ? 168  LYS B CG    1 
ATOM   3661 C  CD    . LYS B  1 167 ? -65.156 -52.265 -124.213 1.00 51.86  ? 168  LYS B CD    1 
ATOM   3662 C  CE    . LYS B  1 167 ? -66.667 -52.390 -124.145 1.00 59.22  ? 168  LYS B CE    1 
ATOM   3663 N  NZ    . LYS B  1 167 ? -67.273 -51.079 -123.761 1.00 66.72  ? 168  LYS B NZ    1 
ATOM   3664 N  N     . ILE B  1 168 ? -60.075 -52.377 -126.013 1.00 32.29  ? 169  ILE B N     1 
ATOM   3665 C  CA    . ILE B  1 168 ? -58.717 -51.937 -125.735 1.00 28.66  ? 169  ILE B CA    1 
ATOM   3666 C  C     . ILE B  1 168 ? -58.155 -51.354 -127.023 1.00 30.62  ? 169  ILE B C     1 
ATOM   3667 O  O     . ILE B  1 168 ? -58.024 -52.061 -128.032 1.00 34.05  ? 169  ILE B O     1 
ATOM   3668 C  CB    . ILE B  1 168 ? -57.838 -53.080 -125.222 1.00 30.99  ? 169  ILE B CB    1 
ATOM   3669 C  CG1   . ILE B  1 168 ? -58.524 -53.810 -124.072 1.00 33.80  ? 169  ILE B CG1   1 
ATOM   3670 C  CG2   . ILE B  1 168 ? -56.476 -52.538 -124.775 1.00 30.24  ? 169  ILE B CG2   1 
ATOM   3671 C  CD1   . ILE B  1 168 ? -57.698 -54.943 -123.483 1.00 32.65  ? 169  ILE B CD1   1 
ATOM   3672 N  N     . PHE B  1 169 ? -57.852 -50.065 -127.004 1.00 31.59  ? 170  PHE B N     1 
ATOM   3673 C  CA    . PHE B  1 169 ? -57.216 -49.394 -128.131 1.00 28.94  ? 170  PHE B CA    1 
ATOM   3674 C  C     . PHE B  1 169 ? -55.711 -49.437 -127.903 1.00 30.13  ? 170  PHE B C     1 
ATOM   3675 O  O     . PHE B  1 169 ? -55.231 -49.002 -126.849 1.00 28.46  ? 170  PHE B O     1 
ATOM   3676 C  CB    . PHE B  1 169 ? -57.717 -47.952 -128.248 1.00 29.15  ? 170  PHE B CB    1 
ATOM   3677 C  CG    . PHE B  1 169 ? -57.058 -47.161 -129.336 1.00 30.65  ? 170  PHE B CG    1 
ATOM   3678 C  CD1   . PHE B  1 169 ? -57.524 -47.228 -130.641 1.00 32.96  ? 170  PHE B CD1   1 
ATOM   3679 C  CD2   . PHE B  1 169 ? -55.983 -46.327 -129.052 1.00 34.69  ? 170  PHE B CD2   1 
ATOM   3680 C  CE1   . PHE B  1 169 ? -56.918 -46.486 -131.663 1.00 31.91  ? 170  PHE B CE1   1 
ATOM   3681 C  CE2   . PHE B  1 169 ? -55.371 -45.572 -130.061 1.00 34.55  ? 170  PHE B CE2   1 
ATOM   3682 C  CZ    . PHE B  1 169 ? -55.842 -45.652 -131.371 1.00 30.31  ? 170  PHE B CZ    1 
ATOM   3683 N  N     . CYS B  1 170 ? -54.971 -49.969 -128.872 1.00 30.17  ? 171  CYS B N     1 
ATOM   3684 C  CA    . CYS B  1 170 ? -53.532 -50.157 -128.741 1.00 29.48  ? 171  CYS B CA    1 
ATOM   3685 C  C     . CYS B  1 170 ? -52.816 -49.381 -129.831 1.00 29.82  ? 171  CYS B C     1 
ATOM   3686 O  O     . CYS B  1 170 ? -53.204 -49.446 -131.003 1.00 25.94  ? 171  CYS B O     1 
ATOM   3687 C  CB    . CYS B  1 170 ? -53.157 -51.630 -128.849 1.00 29.24  ? 171  CYS B CB    1 
ATOM   3688 S  SG    . CYS B  1 170 ? -54.027 -52.689 -127.697 1.00 34.37  ? 171  CYS B SG    1 
ATOM   3689 N  N     . CYS B  1 171 ? -51.761 -48.678 -129.444 1.00 24.54  ? 172  CYS B N     1 
ATOM   3690 C  CA    . CYS B  1 171 ? -50.859 -48.024 -130.382 1.00 25.98  ? 172  CYS B CA    1 
ATOM   3691 C  C     . CYS B  1 171 ? -49.561 -47.772 -129.636 1.00 28.17  ? 172  CYS B C     1 
ATOM   3692 O  O     . CYS B  1 171 ? -49.514 -47.851 -128.410 1.00 34.01  ? 172  CYS B O     1 
ATOM   3693 C  CB    . CYS B  1 171 ? -51.441 -46.718 -130.931 1.00 25.41  ? 172  CYS B CB    1 
ATOM   3694 S  SG    . CYS B  1 171 ? -51.642 -45.498 -129.645 1.00 36.46  ? 172  CYS B SG    1 
ATOM   3695 N  N     . HIS B  1 172 ? -48.502 -47.481 -130.390 1.00 24.56  ? 173  HIS B N     1 
ATOM   3696 C  CA    . HIS B  1 172 ? -47.200 -47.307 -129.767 1.00 25.47  ? 173  HIS B CA    1 
ATOM   3697 C  C     . HIS B  1 172 ? -47.169 -46.084 -128.855 1.00 30.68  ? 173  HIS B C     1 
ATOM   3698 O  O     . HIS B  1 172 ? -46.852 -46.189 -127.670 1.00 31.97  ? 173  HIS B O     1 
ATOM   3699 C  CB    . HIS B  1 172 ? -46.114 -47.182 -130.828 1.00 24.66  ? 173  HIS B CB    1 
ATOM   3700 C  CG    . HIS B  1 172 ? -44.752 -47.046 -130.233 1.00 30.53  ? 173  HIS B CG    1 
ATOM   3701 N  ND1   . HIS B  1 172 ? -44.156 -48.065 -129.522 1.00 29.75  ? 173  HIS B ND1   1 
ATOM   3702 C  CD2   . HIS B  1 172 ? -43.903 -45.996 -130.173 1.00 28.28  ? 173  HIS B CD2   1 
ATOM   3703 C  CE1   . HIS B  1 172 ? -42.982 -47.656 -129.078 1.00 30.99  ? 173  HIS B CE1   1 
ATOM   3704 N  NE2   . HIS B  1 172 ? -42.804 -46.406 -129.460 1.00 34.24  ? 173  HIS B NE2   1 
ATOM   3705 N  N     . GLY B  1 173 ? -47.456 -44.906 -129.408 1.00 31.77  ? 174  GLY B N     1 
ATOM   3706 C  CA    . GLY B  1 173 ? -47.298 -43.659 -128.688 1.00 35.38  ? 174  GLY B CA    1 
ATOM   3707 C  C     . GLY B  1 173 ? -48.523 -43.254 -127.896 1.00 34.98  ? 174  GLY B C     1 
ATOM   3708 O  O     . GLY B  1 173 ? -48.536 -43.362 -126.667 1.00 33.94  ? 174  GLY B O     1 
ATOM   3709 N  N     . GLY B  1 174 ? -49.557 -42.780 -128.576 1.00 33.77  ? 175  GLY B N     1 
ATOM   3710 C  CA    . GLY B  1 174 ? -50.753 -42.394 -127.846 1.00 36.18  ? 175  GLY B CA    1 
ATOM   3711 C  C     . GLY B  1 174 ? -51.767 -41.693 -128.720 1.00 36.25  ? 175  GLY B C     1 
ATOM   3712 O  O     . GLY B  1 174 ? -51.852 -41.938 -129.930 1.00 38.59  ? 175  GLY B O     1 
ATOM   3713 N  N     . LEU B  1 175 ? -52.531 -40.813 -128.086 1.00 36.79  ? 176  LEU B N     1 
ATOM   3714 C  CA    . LEU B  1 175 ? -53.649 -40.163 -128.740 1.00 37.48  ? 176  LEU B CA    1 
ATOM   3715 C  C     . LEU B  1 175 ? -53.185 -38.985 -129.598 1.00 40.21  ? 176  LEU B C     1 
ATOM   3716 O  O     . LEU B  1 175 ? -52.059 -38.492 -129.495 1.00 43.11  ? 176  LEU B O     1 
ATOM   3717 C  CB    . LEU B  1 175 ? -54.661 -39.698 -127.703 1.00 38.41  ? 176  LEU B CB    1 
ATOM   3718 C  CG    . LEU B  1 175 ? -55.338 -40.841 -126.943 1.00 40.62  ? 176  LEU B CG    1 
ATOM   3719 C  CD1   . LEU B  1 175 ? -56.293 -40.279 -125.896 1.00 40.41  ? 176  LEU B CD1   1 
ATOM   3720 C  CD2   . LEU B  1 175 ? -56.072 -41.772 -127.909 1.00 35.69  ? 176  LEU B CD2   1 
ATOM   3721 N  N     . SER B  1 176 ? -54.093 -38.526 -130.444 1.00 37.57  ? 177  SER B N     1 
ATOM   3722 C  CA    . SER B  1 176 ? -53.841 -37.474 -131.402 1.00 37.40  ? 177  SER B CA    1 
ATOM   3723 C  C     . SER B  1 176 ? -54.982 -36.469 -131.356 1.00 37.51  ? 177  SER B C     1 
ATOM   3724 O  O     . SER B  1 176 ? -56.154 -36.863 -131.382 1.00 40.85  ? 177  SER B O     1 
ATOM   3725 C  CB    . SER B  1 176 ? -53.727 -38.041 -132.825 1.00 37.82  ? 177  SER B CB    1 
ATOM   3726 O  OG    . SER B  1 176 ? -53.669 -36.990 -133.778 1.00 40.64  ? 177  SER B OG    1 
ATOM   3727 N  N     . PRO B  1 177 ? -54.678 -35.173 -131.300 1.00 36.78  ? 178  PRO B N     1 
ATOM   3728 C  CA    . PRO B  1 177 ? -55.745 -34.169 -131.462 1.00 39.69  ? 178  PRO B CA    1 
ATOM   3729 C  C     . PRO B  1 177 ? -56.515 -34.345 -132.751 1.00 39.81  ? 178  PRO B C     1 
ATOM   3730 O  O     . PRO B  1 177 ? -57.694 -33.977 -132.802 1.00 42.80  ? 178  PRO B O     1 
ATOM   3731 C  CB    . PRO B  1 177 ? -54.991 -32.833 -131.437 1.00 37.96  ? 178  PRO B CB    1 
ATOM   3732 C  CG    . PRO B  1 177 ? -53.578 -33.200 -131.801 1.00 40.71  ? 178  PRO B CG    1 
ATOM   3733 C  CD    . PRO B  1 177 ? -53.344 -34.566 -131.223 1.00 35.35  ? 178  PRO B CD    1 
ATOM   3734 N  N     . ASP B  1 178 ? -55.905 -34.933 -133.780 1.00 36.32  ? 179  ASP B N     1 
ATOM   3735 C  CA    . ASP B  1 178 ? -56.606 -35.153 -135.037 1.00 37.10  ? 179  ASP B CA    1 
ATOM   3736 C  C     . ASP B  1 178 ? -57.503 -36.379 -135.013 1.00 40.62  ? 179  ASP B C     1 
ATOM   3737 O  O     . ASP B  1 178 ? -58.320 -36.538 -135.923 1.00 45.50  ? 179  ASP B O     1 
ATOM   3738 C  CB    . ASP B  1 178 ? -55.615 -35.304 -136.195 1.00 42.68  ? 179  ASP B CB    1 
ATOM   3739 C  CG    . ASP B  1 178 ? -54.981 -33.993 -136.608 1.00 50.38  ? 179  ASP B CG    1 
ATOM   3740 O  OD1   . ASP B  1 178 ? -55.640 -32.928 -136.482 1.00 50.87  ? 179  ASP B OD1   1 
ATOM   3741 O  OD2   . ASP B  1 178 ? -53.818 -34.041 -137.065 1.00 53.32  ? 179  ASP B OD2   1 
ATOM   3742 N  N     . LEU B  1 179 ? -57.363 -37.257 -134.020 1.00 38.61  ? 180  LEU B N     1 
ATOM   3743 C  CA    . LEU B  1 179 ? -58.079 -38.532 -134.038 1.00 36.61  ? 180  LEU B CA    1 
ATOM   3744 C  C     . LEU B  1 179 ? -59.498 -38.310 -133.532 1.00 41.05  ? 180  LEU B C     1 
ATOM   3745 O  O     . LEU B  1 179 ? -59.740 -38.226 -132.324 1.00 43.29  ? 180  LEU B O     1 
ATOM   3746 C  CB    . LEU B  1 179 ? -57.348 -39.587 -133.210 1.00 37.67  ? 180  LEU B CB    1 
ATOM   3747 C  CG    . LEU B  1 179 ? -58.006 -40.976 -133.188 1.00 34.96  ? 180  LEU B CG    1 
ATOM   3748 C  CD1   . LEU B  1 179 ? -58.330 -41.415 -134.596 1.00 32.13  ? 180  LEU B CD1   1 
ATOM   3749 C  CD2   . LEU B  1 179 ? -57.138 -42.036 -132.482 1.00 38.33  ? 180  LEU B CD2   1 
ATOM   3750 N  N     . GLN B  1 180 ? -60.448 -38.209 -134.462 1.00 38.12  ? 181  GLN B N     1 
ATOM   3751 C  CA    . GLN B  1 180 ? -61.851 -38.089 -134.099 1.00 36.88  ? 181  GLN B CA    1 
ATOM   3752 C  C     . GLN B  1 180 ? -62.664 -39.329 -134.427 1.00 38.44  ? 181  GLN B C     1 
ATOM   3753 O  O     . GLN B  1 180 ? -63.587 -39.661 -133.684 1.00 41.89  ? 181  GLN B O     1 
ATOM   3754 C  CB    . GLN B  1 180 ? -62.484 -36.871 -134.791 1.00 37.98  ? 181  GLN B CB    1 
ATOM   3755 C  CG    . GLN B  1 180 ? -61.788 -35.552 -134.472 1.00 38.65  ? 181  GLN B CG    1 
ATOM   3756 C  CD    . GLN B  1 180 ? -61.846 -35.209 -132.994 1.00 44.25  ? 181  GLN B CD    1 
ATOM   3757 O  OE1   . GLN B  1 180 ? -62.803 -35.559 -132.301 1.00 50.05  ? 181  GLN B OE1   1 
ATOM   3758 N  NE2   . GLN B  1 180 ? -60.819 -34.528 -132.502 1.00 44.88  ? 181  GLN B NE2   1 
ATOM   3759 N  N     . SER B  1 181 ? -62.325 -40.019 -135.510 1.00 38.14  ? 182  SER B N     1 
ATOM   3760 C  CA    . SER B  1 181 ? -63.008 -41.224 -135.953 1.00 37.97  ? 182  SER B CA    1 
ATOM   3761 C  C     . SER B  1 181 ? -61.964 -42.264 -136.340 1.00 35.58  ? 182  SER B C     1 
ATOM   3762 O  O     . SER B  1 181 ? -60.920 -41.922 -136.905 1.00 35.57  ? 182  SER B O     1 
ATOM   3763 C  CB    . SER B  1 181 ? -63.931 -40.906 -137.131 1.00 34.44  ? 182  SER B CB    1 
ATOM   3764 O  OG    . SER B  1 181 ? -64.343 -42.067 -137.811 1.00 39.39  ? 182  SER B OG    1 
ATOM   3765 N  N     . MET B  1 182 ? -62.228 -43.526 -135.996 1.00 33.54  ? 183  MET B N     1 
ATOM   3766 C  CA    . MET B  1 182 ? -61.322 -44.609 -136.365 1.00 33.19  ? 183  MET B CA    1 
ATOM   3767 C  C     . MET B  1 182 ? -61.182 -44.740 -137.872 1.00 36.31  ? 183  MET B C     1 
ATOM   3768 O  O     . MET B  1 182 ? -60.165 -45.252 -138.348 1.00 37.87  ? 183  MET B O     1 
ATOM   3769 C  CB    . MET B  1 182 ? -61.808 -45.947 -135.776 1.00 35.71  ? 183  MET B CB    1 
ATOM   3770 C  CG    . MET B  1 182 ? -61.904 -45.959 -134.245 1.00 36.36  ? 183  MET B CG    1 
ATOM   3771 S  SD    . MET B  1 182 ? -60.320 -45.649 -133.421 1.00 39.10  ? 183  MET B SD    1 
ATOM   3772 C  CE    . MET B  1 182 ? -60.867 -45.537 -131.718 1.00 37.83  ? 183  MET B CE    1 
ATOM   3773 N  N     . GLU B  1 183 ? -62.188 -44.305 -138.629 1.00 32.38  ? 184  GLU B N     1 
ATOM   3774 C  CA    . GLU B  1 183 ? -62.086 -44.314 -140.078 1.00 38.43  ? 184  GLU B CA    1 
ATOM   3775 C  C     . GLU B  1 183 ? -60.923 -43.462 -140.580 1.00 37.28  ? 184  GLU B C     1 
ATOM   3776 O  O     . GLU B  1 183 ? -60.406 -43.724 -141.675 1.00 35.91  ? 184  GLU B O     1 
ATOM   3777 C  CB    . GLU B  1 183 ? -63.408 -43.840 -140.690 1.00 45.12  ? 184  GLU B CB    1 
ATOM   3778 C  CG    . GLU B  1 183 ? -63.595 -44.266 -142.140 1.00 56.66  ? 184  GLU B CG    1 
ATOM   3779 C  CD    . GLU B  1 183 ? -63.623 -45.783 -142.306 1.00 63.68  ? 184  GLU B CD    1 
ATOM   3780 O  OE1   . GLU B  1 183 ? -64.006 -46.488 -141.339 1.00 57.54  ? 184  GLU B OE1   1 
ATOM   3781 O  OE2   . GLU B  1 183 ? -63.248 -46.265 -143.402 1.00 67.98  ? 184  GLU B OE2   1 
ATOM   3782 N  N     . GLN B  1 184 ? -60.486 -42.466 -139.804 1.00 30.84  ? 185  GLN B N     1 
ATOM   3783 C  CA    . GLN B  1 184 ? -59.315 -41.684 -140.202 1.00 35.75  ? 185  GLN B CA    1 
ATOM   3784 C  C     . GLN B  1 184 ? -58.055 -42.540 -140.213 1.00 32.95  ? 185  GLN B C     1 
ATOM   3785 O  O     . GLN B  1 184 ? -57.193 -42.381 -141.085 1.00 37.71  ? 185  GLN B O     1 
ATOM   3786 C  CB    . GLN B  1 184 ? -59.135 -40.488 -139.267 1.00 29.32  ? 185  GLN B CB    1 
ATOM   3787 C  CG    . GLN B  1 184 ? -60.259 -39.462 -139.352 1.00 37.01  ? 185  GLN B CG    1 
ATOM   3788 C  CD    . GLN B  1 184 ? -60.103 -38.399 -138.287 1.00 36.41  ? 185  GLN B CD    1 
ATOM   3789 O  OE1   . GLN B  1 184 ? -60.617 -38.539 -137.183 1.00 38.96  ? 185  GLN B OE1   1 
ATOM   3790 N  NE2   . GLN B  1 184 ? -59.364 -37.349 -138.605 1.00 42.77  ? 185  GLN B NE2   1 
ATOM   3791 N  N     . ILE B  1 185 ? -57.920 -43.442 -139.242 1.00 36.81  ? 186  ILE B N     1 
ATOM   3792 C  CA    . ILE B  1 185 ? -56.790 -44.366 -139.263 1.00 32.00  ? 186  ILE B CA    1 
ATOM   3793 C  C     . ILE B  1 185 ? -56.901 -45.310 -140.456 1.00 31.97  ? 186  ILE B C     1 
ATOM   3794 O  O     . ILE B  1 185 ? -55.909 -45.581 -141.141 1.00 34.59  ? 186  ILE B O     1 
ATOM   3795 C  CB    . ILE B  1 185 ? -56.701 -45.128 -137.926 1.00 30.44  ? 186  ILE B CB    1 
ATOM   3796 C  CG1   . ILE B  1 185 ? -56.629 -44.129 -136.768 1.00 33.80  ? 186  ILE B CG1   1 
ATOM   3797 C  CG2   . ILE B  1 185 ? -55.484 -46.072 -137.915 1.00 27.43  ? 186  ILE B CG2   1 
ATOM   3798 C  CD1   . ILE B  1 185 ? -56.629 -44.756 -135.372 1.00 31.82  ? 186  ILE B CD1   1 
ATOM   3799 N  N     . ARG B  1 186 ? -58.116 -45.785 -140.756 1.00 33.73  ? 187  ARG B N     1 
ATOM   3800 C  CA    . ARG B  1 186 ? -58.283 -46.798 -141.798 1.00 33.92  ? 187  ARG B CA    1 
ATOM   3801 C  C     . ARG B  1 186 ? -58.007 -46.246 -143.190 1.00 39.65  ? 187  ARG B C     1 
ATOM   3802 O  O     . ARG B  1 186 ? -57.634 -47.009 -144.086 1.00 43.15  ? 187  ARG B O     1 
ATOM   3803 C  CB    . ARG B  1 186 ? -59.693 -47.389 -141.758 1.00 36.11  ? 187  ARG B CB    1 
ATOM   3804 C  CG    . ARG B  1 186 ? -59.993 -48.249 -140.553 1.00 38.79  ? 187  ARG B CG    1 
ATOM   3805 C  CD    . ARG B  1 186 ? -61.304 -48.989 -140.723 1.00 40.80  ? 187  ARG B CD    1 
ATOM   3806 N  NE    . ARG B  1 186 ? -61.770 -49.561 -139.464 1.00 46.26  ? 187  ARG B NE    1 
ATOM   3807 C  CZ    . ARG B  1 186 ? -62.573 -48.933 -138.606 1.00 48.58  ? 187  ARG B CZ    1 
ATOM   3808 N  NH1   . ARG B  1 186 ? -63.007 -47.705 -138.865 1.00 46.72  ? 187  ARG B NH1   1 
ATOM   3809 N  NH2   . ARG B  1 186 ? -62.944 -49.533 -137.486 1.00 49.37  ? 187  ARG B NH2   1 
ATOM   3810 N  N     . ARG B  1 187 ? -58.187 -44.946 -143.401 1.00 40.88  ? 188  ARG B N     1 
ATOM   3811 C  CA    . ARG B  1 187 ? -57.916 -44.352 -144.707 1.00 45.97  ? 188  ARG B CA    1 
ATOM   3812 C  C     . ARG B  1 187 ? -56.455 -43.959 -144.894 1.00 41.06  ? 188  ARG B C     1 
ATOM   3813 O  O     . ARG B  1 187 ? -56.109 -43.403 -145.936 1.00 40.62  ? 188  ARG B O     1 
ATOM   3814 C  CB    . ARG B  1 187 ? -58.817 -43.131 -144.936 1.00 48.73  ? 188  ARG B CB    1 
ATOM   3815 C  CG    . ARG B  1 187 ? -60.288 -43.506 -145.101 1.00 56.88  ? 188  ARG B CG    1 
ATOM   3816 C  CD    . ARG B  1 187 ? -61.059 -42.448 -145.870 1.00 66.91  ? 188  ARG B CD    1 
ATOM   3817 N  NE    . ARG B  1 187 ? -60.617 -41.112 -145.503 1.00 70.33  ? 188  ARG B NE    1 
ATOM   3818 C  CZ    . ARG B  1 187 ? -60.994 -40.474 -144.399 1.00 73.34  ? 188  ARG B CZ    1 
ATOM   3819 N  NH1   . ARG B  1 187 ? -61.839 -41.051 -143.550 1.00 67.91  ? 188  ARG B NH1   1 
ATOM   3820 N  NH2   . ARG B  1 187 ? -60.525 -39.255 -144.146 1.00 76.45  ? 188  ARG B NH2   1 
ATOM   3821 N  N     . ILE B  1 188 ? -55.585 -44.236 -143.928 1.00 38.85  ? 189  ILE B N     1 
ATOM   3822 C  CA    . ILE B  1 188 ? -54.164 -43.984 -144.136 1.00 37.20  ? 189  ILE B CA    1 
ATOM   3823 C  C     . ILE B  1 188 ? -53.618 -45.035 -145.090 1.00 42.93  ? 189  ILE B C     1 
ATOM   3824 O  O     . ILE B  1 188 ? -53.712 -46.242 -144.828 1.00 43.94  ? 189  ILE B O     1 
ATOM   3825 C  CB    . ILE B  1 188 ? -53.402 -43.989 -142.808 1.00 33.39  ? 189  ILE B CB    1 
ATOM   3826 C  CG1   . ILE B  1 188 ? -53.837 -42.789 -141.951 1.00 31.12  ? 189  ILE B CG1   1 
ATOM   3827 C  CG2   . ILE B  1 188 ? -51.893 -43.998 -143.073 1.00 31.79  ? 189  ILE B CG2   1 
ATOM   3828 C  CD1   . ILE B  1 188 ? -53.214 -42.759 -140.583 1.00 30.25  ? 189  ILE B CD1   1 
ATOM   3829 N  N     . MET B  1 189 ? -53.056 -44.590 -146.208 1.00 37.88  ? 190  MET B N     1 
ATOM   3830 C  CA    . MET B  1 189 ? -52.549 -45.537 -147.187 1.00 42.07  ? 190  MET B CA    1 
ATOM   3831 C  C     . MET B  1 189 ? -51.089 -45.886 -146.908 1.00 43.68  ? 190  MET B C     1 
ATOM   3832 O  O     . MET B  1 189 ? -50.306 -45.067 -146.416 1.00 40.85  ? 190  MET B O     1 
ATOM   3833 C  CB    . MET B  1 189 ? -52.700 -44.998 -148.615 1.00 49.72  ? 190  MET B CB    1 
ATOM   3834 C  CG    . MET B  1 189 ? -54.151 -44.938 -149.134 1.00 65.49  ? 190  MET B CG    1 
ATOM   3835 S  SD    . MET B  1 189 ? -55.250 -46.246 -148.516 1.00 81.49  ? 190  MET B SD    1 
ATOM   3836 C  CE    . MET B  1 189 ? -55.282 -47.393 -149.895 1.00 78.72  ? 190  MET B CE    1 
ATOM   3837 N  N     . ARG B  1 190 ? -50.737 -47.125 -147.220 1.00 40.96  ? 191  ARG B N     1 
ATOM   3838 C  CA    . ARG B  1 190 ? -49.393 -47.653 -147.093 1.00 41.73  ? 191  ARG B CA    1 
ATOM   3839 C  C     . ARG B  1 190 ? -48.877 -48.069 -148.463 1.00 39.83  ? 191  ARG B C     1 
ATOM   3840 O  O     . ARG B  1 190 ? -49.673 -48.355 -149.358 1.00 44.93  ? 191  ARG B O     1 
ATOM   3841 C  CB    . ARG B  1 190 ? -49.362 -48.860 -146.148 1.00 38.05  ? 191  ARG B CB    1 
ATOM   3842 C  CG    . ARG B  1 190 ? -49.649 -48.521 -144.707 1.00 36.15  ? 191  ARG B CG    1 
ATOM   3843 C  CD    . ARG B  1 190 ? -49.920 -49.787 -143.914 1.00 32.45  ? 191  ARG B CD    1 
ATOM   3844 N  NE    . ARG B  1 190 ? -51.192 -50.389 -144.284 1.00 30.66  ? 191  ARG B NE    1 
ATOM   3845 C  CZ    . ARG B  1 190 ? -51.592 -51.587 -143.871 1.00 30.94  ? 191  ARG B CZ    1 
ATOM   3846 N  NH1   . ARG B  1 190 ? -50.811 -52.295 -143.059 1.00 29.14  ? 191  ARG B NH1   1 
ATOM   3847 N  NH2   . ARG B  1 190 ? -52.769 -52.060 -144.262 1.00 28.24  ? 191  ARG B NH2   1 
ATOM   3848 N  N     . PRO B  1 191 ? -47.552 -48.106 -148.666 1.00 36.46  ? 192  PRO B N     1 
ATOM   3849 C  CA    . PRO B  1 191 ? -46.507 -47.730 -147.704 1.00 37.95  ? 192  PRO B CA    1 
ATOM   3850 C  C     . PRO B  1 191 ? -46.467 -46.229 -147.444 1.00 40.60  ? 192  PRO B C     1 
ATOM   3851 O  O     . PRO B  1 191 ? -46.867 -45.442 -148.305 1.00 39.65  ? 192  PRO B O     1 
ATOM   3852 C  CB    . PRO B  1 191 ? -45.218 -48.191 -148.390 1.00 40.67  ? 192  PRO B CB    1 
ATOM   3853 C  CG    . PRO B  1 191 ? -45.544 -48.112 -149.844 1.00 43.58  ? 192  PRO B CG    1 
ATOM   3854 C  CD    . PRO B  1 191 ? -46.984 -48.514 -149.960 1.00 37.06  ? 192  PRO B CD    1 
ATOM   3855 N  N     . THR B  1 192 ? -45.999 -45.839 -146.261 1.00 38.90  ? 193  THR B N     1 
ATOM   3856 C  CA    . THR B  1 192 ? -45.866 -44.427 -145.945 1.00 38.85  ? 193  THR B CA    1 
ATOM   3857 C  C     . THR B  1 192 ? -44.685 -44.229 -145.007 1.00 38.27  ? 193  THR B C     1 
ATOM   3858 O  O     . THR B  1 192 ? -44.392 -45.086 -144.169 1.00 37.98  ? 193  THR B O     1 
ATOM   3859 C  CB    . THR B  1 192 ? -47.145 -43.859 -145.311 1.00 36.60  ? 193  THR B CB    1 
ATOM   3860 O  OG1   . THR B  1 192 ? -46.919 -42.497 -144.946 1.00 38.99  ? 193  THR B OG1   1 
ATOM   3861 C  CG2   . THR B  1 192 ? -47.555 -44.649 -144.053 1.00 35.75  ? 193  THR B CG2   1 
ATOM   3862 N  N     . ASP B  1 193 ? -43.990 -43.113 -145.188 1.00 31.98  ? 194  ASP B N     1 
ATOM   3863 C  CA    . ASP B  1 193 ? -43.102 -42.602 -144.161 1.00 37.94  ? 194  ASP B CA    1 
ATOM   3864 C  C     . ASP B  1 193 ? -43.933 -42.103 -142.983 1.00 35.27  ? 194  ASP B C     1 
ATOM   3865 O  O     . ASP B  1 193 ? -45.151 -41.948 -143.076 1.00 33.98  ? 194  ASP B O     1 
ATOM   3866 C  CB    . ASP B  1 193 ? -42.227 -41.476 -144.718 1.00 44.07  ? 194  ASP B CB    1 
ATOM   3867 C  CG    . ASP B  1 193 ? -41.333 -41.942 -145.847 1.00 52.34  ? 194  ASP B CG    1 
ATOM   3868 O  OD1   . ASP B  1 193 ? -40.852 -43.098 -145.795 1.00 56.59  ? 194  ASP B OD1   1 
ATOM   3869 O  OD2   . ASP B  1 193 ? -41.096 -41.153 -146.785 1.00 58.04  ? 194  ASP B OD2   1 
ATOM   3870 N  N     . VAL B  1 194 ? -43.269 -41.865 -141.859 1.00 40.73  ? 195  VAL B N     1 
ATOM   3871 C  CA    . VAL B  1 194 ? -43.900 -41.232 -140.698 1.00 37.44  ? 195  VAL B CA    1 
ATOM   3872 C  C     . VAL B  1 194 ? -43.753 -39.720 -140.855 1.00 33.79  ? 195  VAL B C     1 
ATOM   3873 O  O     . VAL B  1 194 ? -42.623 -39.223 -140.857 1.00 36.83  ? 195  VAL B O     1 
ATOM   3874 C  CB    . VAL B  1 194 ? -43.267 -41.704 -139.387 1.00 31.77  ? 195  VAL B CB    1 
ATOM   3875 C  CG1   . VAL B  1 194 ? -43.955 -41.014 -138.205 1.00 33.28  ? 195  VAL B CG1   1 
ATOM   3876 C  CG2   . VAL B  1 194 ? -43.345 -43.205 -139.266 1.00 29.66  ? 195  VAL B CG2   1 
ATOM   3877 N  N     . PRO B  1 195 ? -44.843 -38.962 -140.963 1.00 33.48  ? 196  PRO B N     1 
ATOM   3878 C  CA    . PRO B  1 195 ? -44.708 -37.513 -141.169 1.00 39.92  ? 196  PRO B CA    1 
ATOM   3879 C  C     . PRO B  1 195 ? -44.298 -36.798 -139.888 1.00 39.22  ? 196  PRO B C     1 
ATOM   3880 O  O     . PRO B  1 195 ? -44.347 -37.350 -138.786 1.00 37.08  ? 196  PRO B O     1 
ATOM   3881 C  CB    . PRO B  1 195 ? -46.111 -37.070 -141.617 1.00 41.88  ? 196  PRO B CB    1 
ATOM   3882 C  CG    . PRO B  1 195 ? -46.867 -38.348 -141.893 1.00 41.85  ? 196  PRO B CG    1 
ATOM   3883 C  CD    . PRO B  1 195 ? -46.252 -39.378 -140.988 1.00 33.45  ? 196  PRO B CD    1 
ATOM   3884 N  N     . ASP B  1 196 ? -43.886 -35.537 -140.063 1.00 37.73  ? 197  ASP B N     1 
ATOM   3885 C  CA    . ASP B  1 196 ? -43.483 -34.681 -138.950 1.00 42.78  ? 197  ASP B CA    1 
ATOM   3886 C  C     . ASP B  1 196 ? -44.652 -34.280 -138.063 1.00 36.94  ? 197  ASP B C     1 
ATOM   3887 O  O     . ASP B  1 196 ? -44.429 -33.778 -136.958 1.00 36.67  ? 197  ASP B O     1 
ATOM   3888 C  CB    . ASP B  1 196 ? -42.824 -33.393 -139.468 1.00 47.19  ? 197  ASP B CB    1 
ATOM   3889 C  CG    . ASP B  1 196 ? -41.436 -33.620 -140.015 1.00 54.74  ? 197  ASP B CG    1 
ATOM   3890 O  OD1   . ASP B  1 196 ? -40.970 -34.785 -140.015 1.00 52.67  ? 197  ASP B OD1   1 
ATOM   3891 O  OD2   . ASP B  1 196 ? -40.806 -32.618 -140.440 1.00 59.61  ? 197  ASP B OD2   1 
ATOM   3892 N  N     . GLN B  1 197 ? -45.881 -34.440 -138.538 1.00 31.65  ? 198  GLN B N     1 
ATOM   3893 C  CA    . GLN B  1 197 ? -47.054 -34.030 -137.783 1.00 34.55  ? 198  GLN B CA    1 
ATOM   3894 C  C     . GLN B  1 197 ? -48.262 -34.701 -138.412 1.00 31.74  ? 198  GLN B C     1 
ATOM   3895 O  O     . GLN B  1 197 ? -48.195 -35.223 -139.522 1.00 33.05  ? 198  GLN B O     1 
ATOM   3896 C  CB    . GLN B  1 197 ? -47.227 -32.500 -137.769 1.00 39.91  ? 198  GLN B CB    1 
ATOM   3897 C  CG    . GLN B  1 197 ? -47.221 -31.884 -139.145 1.00 51.01  ? 198  GLN B CG    1 
ATOM   3898 C  CD    . GLN B  1 197 ? -46.438 -30.575 -139.222 1.00 68.69  ? 198  GLN B CD    1 
ATOM   3899 O  OE1   . GLN B  1 197 ? -46.144 -29.936 -138.204 1.00 70.62  ? 198  GLN B OE1   1 
ATOM   3900 N  NE2   . GLN B  1 197 ? -46.087 -30.177 -140.445 1.00 74.72  ? 198  GLN B NE2   1 
ATOM   3901 N  N     . GLY B  1 198 ? -49.357 -34.681 -137.695 1.00 31.50  ? 199  GLY B N     1 
ATOM   3902 C  CA    . GLY B  1 198 ? -50.561 -35.335 -138.155 1.00 33.64  ? 199  GLY B CA    1 
ATOM   3903 C  C     . GLY B  1 198 ? -50.819 -36.619 -137.385 1.00 36.55  ? 199  GLY B C     1 
ATOM   3904 O  O     . GLY B  1 198 ? -50.055 -37.025 -136.509 1.00 34.50  ? 199  GLY B O     1 
ATOM   3905 N  N     . LEU B  1 199 ? -51.925 -37.256 -137.763 1.00 37.81  ? 200  LEU B N     1 
ATOM   3906 C  CA    . LEU B  1 199 ? -52.495 -38.349 -136.985 1.00 33.78  ? 200  LEU B CA    1 
ATOM   3907 C  C     . LEU B  1 199 ? -51.513 -39.504 -136.839 1.00 32.61  ? 200  LEU B C     1 
ATOM   3908 O  O     . LEU B  1 199 ? -51.300 -40.012 -135.733 1.00 33.86  ? 200  LEU B O     1 
ATOM   3909 C  CB    . LEU B  1 199 ? -53.799 -38.804 -137.649 1.00 30.81  ? 200  LEU B CB    1 
ATOM   3910 C  CG    . LEU B  1 199 ? -54.395 -40.165 -137.262 1.00 34.04  ? 200  LEU B CG    1 
ATOM   3911 C  CD1   . LEU B  1 199 ? -54.737 -40.231 -135.773 1.00 30.77  ? 200  LEU B CD1   1 
ATOM   3912 C  CD2   . LEU B  1 199 ? -55.618 -40.501 -138.131 1.00 32.14  ? 200  LEU B CD2   1 
ATOM   3913 N  N     . LEU B  1 200 ? -50.894 -39.915 -137.948 1.00 33.20  ? 201  LEU B N     1 
ATOM   3914 C  CA    . LEU B  1 200 ? -49.956 -41.031 -137.928 1.00 34.90  ? 201  LEU B CA    1 
ATOM   3915 C  C     . LEU B  1 200 ? -48.763 -40.734 -137.033 1.00 35.24  ? 201  LEU B C     1 
ATOM   3916 O  O     . LEU B  1 200 ? -48.330 -41.594 -136.257 1.00 31.98  ? 201  LEU B O     1 
ATOM   3917 C  CB    . LEU B  1 200 ? -49.495 -41.347 -139.357 1.00 38.74  ? 201  LEU B CB    1 
ATOM   3918 C  CG    . LEU B  1 200 ? -48.340 -42.355 -139.497 1.00 46.89  ? 201  LEU B CG    1 
ATOM   3919 C  CD1   . LEU B  1 200 ? -48.693 -43.623 -138.773 1.00 47.32  ? 201  LEU B CD1   1 
ATOM   3920 C  CD2   . LEU B  1 200 ? -48.033 -42.659 -140.953 1.00 48.71  ? 201  LEU B CD2   1 
ATOM   3921 N  N     . CYS B  1 201 ? -48.218 -39.519 -137.129 1.00 35.88  ? 202  CYS B N     1 
ATOM   3922 C  CA    . CYS B  1 201 ? -47.112 -39.123 -136.267 1.00 33.75  ? 202  CYS B CA    1 
ATOM   3923 C  C     . CYS B  1 201 ? -47.495 -39.235 -134.791 1.00 32.25  ? 202  CYS B C     1 
ATOM   3924 O  O     . CYS B  1 201 ? -46.770 -39.845 -133.997 1.00 34.31  ? 202  CYS B O     1 
ATOM   3925 C  CB    . CYS B  1 201 ? -46.672 -37.698 -136.628 1.00 36.88  ? 202  CYS B CB    1 
ATOM   3926 S  SG    . CYS B  1 201 ? -45.535 -36.918 -135.467 1.00 38.50  ? 202  CYS B SG    1 
ATOM   3927 N  N     . ASP B  1 202 ? -48.653 -38.686 -134.411 1.00 31.13  ? 203  ASP B N     1 
ATOM   3928 C  CA    . ASP B  1 202 ? -49.034 -38.654 -132.997 1.00 33.83  ? 203  ASP B CA    1 
ATOM   3929 C  C     . ASP B  1 202 ? -49.265 -40.054 -132.439 1.00 33.56  ? 203  ASP B C     1 
ATOM   3930 O  O     . ASP B  1 202 ? -48.914 -40.330 -131.288 1.00 32.06  ? 203  ASP B O     1 
ATOM   3931 C  CB    . ASP B  1 202 ? -50.295 -37.819 -132.789 1.00 34.63  ? 203  ASP B CB    1 
ATOM   3932 C  CG    . ASP B  1 202 ? -50.133 -36.370 -133.221 1.00 34.31  ? 203  ASP B CG    1 
ATOM   3933 O  OD1   . ASP B  1 202 ? -49.059 -35.772 -132.997 1.00 35.51  ? 203  ASP B OD1   1 
ATOM   3934 O  OD2   . ASP B  1 202 ? -51.109 -35.832 -133.771 1.00 36.12  ? 203  ASP B OD2   1 
ATOM   3935 N  N     . LEU B  1 203 ? -49.884 -40.939 -133.227 1.00 30.76  ? 204  LEU B N     1 
ATOM   3936 C  CA    . LEU B  1 203 ? -50.101 -42.312 -132.781 1.00 33.37  ? 204  LEU B CA    1 
ATOM   3937 C  C     . LEU B  1 203 ? -48.792 -43.009 -132.430 1.00 32.77  ? 204  LEU B C     1 
ATOM   3938 O  O     . LEU B  1 203 ? -48.787 -43.910 -131.585 1.00 34.45  ? 204  LEU B O     1 
ATOM   3939 C  CB    . LEU B  1 203 ? -50.845 -43.109 -133.861 1.00 30.18  ? 204  LEU B CB    1 
ATOM   3940 C  CG    . LEU B  1 203 ? -52.338 -42.807 -134.018 1.00 34.96  ? 204  LEU B CG    1 
ATOM   3941 C  CD1   . LEU B  1 203 ? -52.936 -43.496 -135.240 1.00 32.55  ? 204  LEU B CD1   1 
ATOM   3942 C  CD2   . LEU B  1 203 ? -53.111 -43.198 -132.755 1.00 35.94  ? 204  LEU B CD2   1 
ATOM   3943 N  N     . LEU B  1 204 ? -47.685 -42.602 -133.050 1.00 31.72  ? 205  LEU B N     1 
ATOM   3944 C  CA    . LEU B  1 204 ? -46.381 -43.199 -132.801 1.00 32.35  ? 205  LEU B CA    1 
ATOM   3945 C  C     . LEU B  1 204 ? -45.524 -42.416 -131.813 1.00 28.84  ? 205  LEU B C     1 
ATOM   3946 O  O     . LEU B  1 204 ? -44.514 -42.956 -131.345 1.00 25.88  ? 205  LEU B O     1 
ATOM   3947 C  CB    . LEU B  1 204 ? -45.616 -43.340 -134.121 1.00 31.49  ? 205  LEU B CB    1 
ATOM   3948 C  CG    . LEU B  1 204 ? -45.835 -44.606 -134.965 1.00 34.25  ? 205  LEU B CG    1 
ATOM   3949 C  CD1   . LEU B  1 204 ? -47.297 -44.950 -135.102 1.00 36.47  ? 205  LEU B CD1   1 
ATOM   3950 C  CD2   . LEU B  1 204 ? -45.193 -44.452 -136.351 1.00 27.81  ? 205  LEU B CD2   1 
ATOM   3951 N  N     . TRP B  1 205 ? -45.897 -41.174 -131.479 1.00 28.21  ? 206  TRP B N     1 
ATOM   3952 C  CA    . TRP B  1 205 ? -44.982 -40.268 -130.787 1.00 28.73  ? 206  TRP B CA    1 
ATOM   3953 C  C     . TRP B  1 205 ? -45.533 -39.604 -129.525 1.00 31.49  ? 206  TRP B C     1 
ATOM   3954 O  O     . TRP B  1 205 ? -44.755 -39.172 -128.671 1.00 29.59  ? 206  TRP B O     1 
ATOM   3955 C  CB    . TRP B  1 205 ? -44.535 -39.161 -131.736 1.00 30.04  ? 206  TRP B CB    1 
ATOM   3956 C  CG    . TRP B  1 205 ? -43.434 -39.543 -132.676 1.00 31.96  ? 206  TRP B CG    1 
ATOM   3957 C  CD1   . TRP B  1 205 ? -43.572 -40.050 -133.931 1.00 29.83  ? 206  TRP B CD1   1 
ATOM   3958 C  CD2   . TRP B  1 205 ? -42.025 -39.425 -132.441 1.00 31.80  ? 206  TRP B CD2   1 
ATOM   3959 N  NE1   . TRP B  1 205 ? -42.338 -40.248 -134.502 1.00 30.81  ? 206  TRP B NE1   1 
ATOM   3960 C  CE2   . TRP B  1 205 ? -41.370 -39.879 -133.606 1.00 29.46  ? 206  TRP B CE2   1 
ATOM   3961 C  CE3   . TRP B  1 205 ? -41.253 -38.983 -131.359 1.00 31.57  ? 206  TRP B CE3   1 
ATOM   3962 C  CZ2   . TRP B  1 205 ? -39.985 -39.911 -133.723 1.00 30.46  ? 206  TRP B CZ2   1 
ATOM   3963 C  CZ3   . TRP B  1 205 ? -39.869 -39.004 -131.480 1.00 34.90  ? 206  TRP B CZ3   1 
ATOM   3964 C  CH2   . TRP B  1 205 ? -39.251 -39.465 -132.661 1.00 35.08  ? 206  TRP B CH2   1 
ATOM   3965 N  N     . SER B  1 206 ? -46.851 -39.485 -129.394 1.00 30.30  ? 207  SER B N     1 
ATOM   3966 C  CA    . SER B  1 206 ? -47.380 -38.688 -128.299 1.00 33.28  ? 207  SER B CA    1 
ATOM   3967 C  C     . SER B  1 206 ? -47.183 -39.405 -126.955 1.00 31.41  ? 207  SER B C     1 
ATOM   3968 O  O     . SER B  1 206 ? -46.864 -40.596 -126.900 1.00 27.13  ? 207  SER B O     1 
ATOM   3969 C  CB    . SER B  1 206 ? -48.855 -38.355 -128.552 1.00 31.93  ? 207  SER B CB    1 
ATOM   3970 O  OG    . SER B  1 206 ? -49.680 -39.490 -128.429 1.00 31.05  ? 207  SER B OG    1 
ATOM   3971 N  N     . ASP B  1 207 ? -47.337 -38.643 -125.859 1.00 31.01  ? 208  ASP B N     1 
ATOM   3972 C  CA    . ASP B  1 207 ? -47.132 -39.124 -124.487 1.00 29.05  ? 208  ASP B CA    1 
ATOM   3973 C  C     . ASP B  1 207 ? -48.204 -38.595 -123.542 1.00 31.87  ? 208  ASP B C     1 
ATOM   3974 O  O     . ASP B  1 207 ? -48.554 -37.408 -123.608 1.00 34.68  ? 208  ASP B O     1 
ATOM   3975 C  CB    . ASP B  1 207 ? -45.771 -38.684 -123.927 1.00 31.25  ? 208  ASP B CB    1 
ATOM   3976 C  CG    . ASP B  1 207 ? -44.605 -39.335 -124.616 1.00 33.19  ? 208  ASP B CG    1 
ATOM   3977 O  OD1   . ASP B  1 207 ? -44.512 -40.578 -124.576 1.00 33.46  ? 208  ASP B OD1   1 
ATOM   3978 O  OD2   . ASP B  1 207 ? -43.777 -38.589 -125.202 1.00 34.15  ? 208  ASP B OD2   1 
ATOM   3979 N  N     . PRO B  1 208 ? -48.696 -39.416 -122.619 1.00 33.22  ? 209  PRO B N     1 
ATOM   3980 C  CA    . PRO B  1 208 ? -49.541 -38.883 -121.547 1.00 33.64  ? 209  PRO B CA    1 
ATOM   3981 C  C     . PRO B  1 208 ? -48.702 -38.053 -120.585 1.00 37.03  ? 209  PRO B C     1 
ATOM   3982 O  O     . PRO B  1 208 ? -47.485 -38.219 -120.477 1.00 39.70  ? 209  PRO B O     1 
ATOM   3983 C  CB    . PRO B  1 208 ? -50.089 -40.142 -120.867 1.00 33.33  ? 209  PRO B CB    1 
ATOM   3984 C  CG    . PRO B  1 208 ? -48.991 -41.155 -121.080 1.00 35.94  ? 209  PRO B CG    1 
ATOM   3985 C  CD    . PRO B  1 208 ? -48.404 -40.851 -122.433 1.00 31.51  ? 209  PRO B CD    1 
ATOM   3986 N  N     . ASP B  1 209 ? -49.367 -37.139 -119.882 1.00 36.94  ? 210  ASP B N     1 
ATOM   3987 C  CA    . ASP B  1 209 ? -48.672 -36.282 -118.925 1.00 43.15  ? 210  ASP B CA    1 
ATOM   3988 C  C     . ASP B  1 209 ? -49.608 -35.913 -117.783 1.00 40.78  ? 210  ASP B C     1 
ATOM   3989 O  O     . ASP B  1 209 ? -50.708 -35.412 -118.028 1.00 39.29  ? 210  ASP B O     1 
ATOM   3990 C  CB    . ASP B  1 209 ? -48.139 -35.008 -119.603 1.00 50.59  ? 210  ASP B CB    1 
ATOM   3991 C  CG    . ASP B  1 209 ? -47.091 -34.288 -118.762 1.00 56.58  ? 210  ASP B CG    1 
ATOM   3992 O  OD1   . ASP B  1 209 ? -47.300 -34.137 -117.540 1.00 57.59  ? 210  ASP B OD1   1 
ATOM   3993 O  OD2   . ASP B  1 209 ? -46.054 -33.868 -119.316 1.00 60.00  ? 210  ASP B OD2   1 
ATOM   3994 N  N     . LYS B  1 210 ? -49.142 -36.130 -116.543 1.00 52.17  ? 211  LYS B N     1 
ATOM   3995 C  CA    . LYS B  1 210 ? -49.928 -35.796 -115.351 1.00 57.54  ? 211  LYS B CA    1 
ATOM   3996 C  C     . LYS B  1 210 ? -50.318 -34.321 -115.313 1.00 57.63  ? 211  LYS B C     1 
ATOM   3997 O  O     . LYS B  1 210 ? -51.432 -33.978 -114.905 1.00 59.15  ? 211  LYS B O     1 
ATOM   3998 C  CB    . LYS B  1 210 ? -49.139 -36.128 -114.081 1.00 64.23  ? 211  LYS B CB    1 
ATOM   3999 C  CG    . LYS B  1 210 ? -48.837 -37.588 -113.851 1.00 70.71  ? 211  LYS B CG    1 
ATOM   4000 C  CD    . LYS B  1 210 ? -47.776 -37.727 -112.763 1.00 75.29  ? 211  LYS B CD    1 
ATOM   4001 N  N     . ASP B  1 211 ? -49.408 -33.435 -115.707 1.00 55.09  ? 212  ASP B N     1 
ATOM   4002 C  CA    . ASP B  1 211 ? -49.535 -32.006 -115.436 1.00 60.38  ? 212  ASP B CA    1 
ATOM   4003 C  C     . ASP B  1 211 ? -50.096 -31.202 -116.601 1.00 60.26  ? 212  ASP B C     1 
ATOM   4004 O  O     . ASP B  1 211 ? -50.026 -29.970 -116.571 1.00 65.68  ? 212  ASP B O     1 
ATOM   4005 C  CB    . ASP B  1 211 ? -48.177 -31.429 -115.048 1.00 61.34  ? 212  ASP B CB    1 
ATOM   4006 C  CG    . ASP B  1 211 ? -47.543 -32.167 -113.906 1.00 66.97  ? 212  ASP B CG    1 
ATOM   4007 O  OD1   . ASP B  1 211 ? -48.256 -32.458 -112.921 1.00 69.28  ? 212  ASP B OD1   1 
ATOM   4008 O  OD2   . ASP B  1 211 ? -46.333 -32.455 -113.993 1.00 71.48  ? 212  ASP B OD2   1 
ATOM   4009 N  N     . VAL B  1 212 ? -50.644 -31.853 -117.622 1.00 55.84  ? 213  VAL B N     1 
ATOM   4010 C  CA    . VAL B  1 212 ? -51.097 -31.177 -118.830 1.00 55.76  ? 213  VAL B CA    1 
ATOM   4011 C  C     . VAL B  1 212 ? -52.617 -31.154 -118.835 1.00 56.02  ? 213  VAL B C     1 
ATOM   4012 O  O     . VAL B  1 212 ? -53.262 -32.186 -118.614 1.00 54.74  ? 213  VAL B O     1 
ATOM   4013 C  CB    . VAL B  1 212 ? -50.545 -31.856 -120.096 1.00 58.67  ? 213  VAL B CB    1 
ATOM   4014 C  CG1   . VAL B  1 212 ? -51.487 -31.653 -121.266 1.00 55.15  ? 213  VAL B CG1   1 
ATOM   4015 C  CG2   . VAL B  1 212 ? -49.166 -31.310 -120.425 1.00 62.05  ? 213  VAL B CG2   1 
ATOM   4016 N  N     . GLN B  1 213 ? -53.187 -29.975 -119.074 1.00 63.07  ? 214  GLN B N     1 
ATOM   4017 C  CA    . GLN B  1 213 ? -54.621 -29.813 -119.293 1.00 66.35  ? 214  GLN B CA    1 
ATOM   4018 C  C     . GLN B  1 213 ? -54.858 -29.734 -120.799 1.00 66.07  ? 214  GLN B C     1 
ATOM   4019 O  O     . GLN B  1 213 ? -54.536 -28.722 -121.436 1.00 65.61  ? 214  GLN B O     1 
ATOM   4020 C  CB    . GLN B  1 213 ? -55.155 -28.570 -118.582 1.00 66.54  ? 214  GLN B CB    1 
ATOM   4021 N  N     . GLY B  1 214 ? -55.409 -30.803 -121.364 1.00 56.74  ? 215  GLY B N     1 
ATOM   4022 C  CA    . GLY B  1 214 ? -55.666 -30.855 -122.794 1.00 51.12  ? 215  GLY B CA    1 
ATOM   4023 C  C     . GLY B  1 214 ? -54.449 -31.354 -123.546 1.00 49.96  ? 215  GLY B C     1 
ATOM   4024 O  O     . GLY B  1 214 ? -53.890 -32.392 -123.208 1.00 51.52  ? 215  GLY B O     1 
ATOM   4025 N  N     . TRP B  1 215 ? -54.041 -30.612 -124.566 1.00 45.30  ? 216  TRP B N     1 
ATOM   4026 C  CA    . TRP B  1 215 ? -52.908 -30.978 -125.397 1.00 43.63  ? 216  TRP B CA    1 
ATOM   4027 C  C     . TRP B  1 215 ? -51.752 -30.037 -125.107 1.00 46.25  ? 216  TRP B C     1 
ATOM   4028 O  O     . TRP B  1 215 ? -51.909 -28.813 -125.165 1.00 51.53  ? 216  TRP B O     1 
ATOM   4029 C  CB    . TRP B  1 215 ? -53.286 -30.937 -126.879 1.00 48.08  ? 216  TRP B CB    1 
ATOM   4030 C  CG    . TRP B  1 215 ? -54.360 -31.940 -127.224 1.00 54.43  ? 216  TRP B CG    1 
ATOM   4031 C  CD1   . TRP B  1 215 ? -55.703 -31.704 -127.333 1.00 57.07  ? 216  TRP B CD1   1 
ATOM   4032 C  CD2   . TRP B  1 215 ? -54.176 -33.341 -127.483 1.00 49.24  ? 216  TRP B CD2   1 
ATOM   4033 N  NE1   . TRP B  1 215 ? -56.362 -32.871 -127.658 1.00 58.11  ? 216  TRP B NE1   1 
ATOM   4034 C  CE2   . TRP B  1 215 ? -55.448 -33.888 -127.754 1.00 49.28  ? 216  TRP B CE2   1 
ATOM   4035 C  CE3   . TRP B  1 215 ? -53.057 -34.183 -127.526 1.00 47.19  ? 216  TRP B CE3   1 
ATOM   4036 C  CZ2   . TRP B  1 215 ? -55.634 -35.239 -128.057 1.00 46.67  ? 216  TRP B CZ2   1 
ATOM   4037 C  CZ3   . TRP B  1 215 ? -53.245 -35.530 -127.826 1.00 40.36  ? 216  TRP B CZ3   1 
ATOM   4038 C  CH2   . TRP B  1 215 ? -54.522 -36.040 -128.082 1.00 40.59  ? 216  TRP B CH2   1 
ATOM   4039 N  N     . GLY B  1 216 ? -50.593 -30.611 -124.784 1.00 45.43  ? 217  GLY B N     1 
ATOM   4040 C  CA    . GLY B  1 216 ? -49.423 -29.844 -124.438 1.00 37.57  ? 217  GLY B CA    1 
ATOM   4041 C  C     . GLY B  1 216 ? -48.305 -30.116 -125.428 1.00 41.31  ? 217  GLY B C     1 
ATOM   4042 O  O     . GLY B  1 216 ? -48.409 -30.976 -126.317 1.00 44.12  ? 217  GLY B O     1 
ATOM   4043 N  N     . GLU B  1 217 ? -47.231 -29.354 -125.270 1.00 39.68  ? 218  GLU B N     1 
ATOM   4044 C  CA    . GLU B  1 217 ? -46.035 -29.590 -126.048 1.00 41.20  ? 218  GLU B CA    1 
ATOM   4045 C  C     . GLU B  1 217 ? -45.319 -30.829 -125.536 1.00 39.78  ? 218  GLU B C     1 
ATOM   4046 O  O     . GLU B  1 217 ? -45.391 -31.180 -124.356 1.00 47.87  ? 218  GLU B O     1 
ATOM   4047 C  CB    . GLU B  1 217 ? -45.107 -28.373 -125.989 1.00 51.36  ? 218  GLU B CB    1 
ATOM   4048 C  CG    . GLU B  1 217 ? -45.552 -27.228 -126.896 1.00 63.70  ? 218  GLU B CG    1 
ATOM   4049 C  CD    . GLU B  1 217 ? -45.029 -25.874 -126.450 1.00 71.15  ? 218  GLU B CD    1 
ATOM   4050 O  OE1   . GLU B  1 217 ? -43.851 -25.809 -126.021 1.00 71.41  ? 218  GLU B OE1   1 
ATOM   4051 O  OE2   . GLU B  1 217 ? -45.796 -24.880 -126.538 1.00 70.84  ? 218  GLU B OE2   1 
ATOM   4052 N  N     . ASN B  1 218 ? -44.638 -31.503 -126.446 1.00 40.01  ? 219  ASN B N     1 
ATOM   4053 C  CA    . ASN B  1 218 ? -43.874 -32.700 -126.146 1.00 41.23  ? 219  ASN B CA    1 
ATOM   4054 C  C     . ASN B  1 218 ? -42.387 -32.372 -126.232 1.00 44.89  ? 219  ASN B C     1 
ATOM   4055 O  O     . ASN B  1 218 ? -41.915 -31.886 -127.265 1.00 43.35  ? 219  ASN B O     1 
ATOM   4056 C  CB    . ASN B  1 218 ? -44.246 -33.823 -127.113 1.00 37.47  ? 219  ASN B CB    1 
ATOM   4057 C  CG    . ASN B  1 218 ? -43.780 -35.181 -126.630 1.00 38.14  ? 219  ASN B CG    1 
ATOM   4058 O  OD1   . ASN B  1 218 ? -42.615 -35.356 -126.269 1.00 37.36  ? 219  ASN B OD1   1 
ATOM   4059 N  ND2   . ASN B  1 218 ? -44.691 -36.144 -126.604 1.00 34.41  ? 219  ASN B ND2   1 
ATOM   4060 N  N     . ASP B  1 219 ? -41.654 -32.651 -125.149 1.00 41.55  ? 220  ASP B N     1 
ATOM   4061 C  CA    . ASP B  1 219 ? -40.215 -32.411 -125.108 1.00 45.89  ? 220  ASP B CA    1 
ATOM   4062 C  C     . ASP B  1 219 ? -39.435 -33.207 -126.147 1.00 46.06  ? 220  ASP B C     1 
ATOM   4063 O  O     . ASP B  1 219 ? -38.262 -32.898 -126.381 1.00 47.21  ? 220  ASP B O     1 
ATOM   4064 C  CB    . ASP B  1 219 ? -39.665 -32.741 -123.727 1.00 50.74  ? 220  ASP B CB    1 
ATOM   4065 C  CG    . ASP B  1 219 ? -40.088 -31.736 -122.684 1.00 66.18  ? 220  ASP B CG    1 
ATOM   4066 O  OD1   . ASP B  1 219 ? -40.513 -30.621 -123.062 1.00 64.79  ? 220  ASP B OD1   1 
ATOM   4067 O  OD2   . ASP B  1 219 ? -39.994 -32.065 -121.480 1.00 77.47  ? 220  ASP B OD2   1 
ATOM   4068 N  N     . ARG B  1 220 ? -40.032 -34.224 -126.765 1.00 44.28  ? 221  ARG B N     1 
ATOM   4069 C  CA    . ARG B  1 220 ? -39.327 -34.915 -127.837 1.00 43.31  ? 221  ARG B CA    1 
ATOM   4070 C  C     . ARG B  1 220 ? -39.076 -34.024 -129.049 1.00 42.47  ? 221  ARG B C     1 
ATOM   4071 O  O     . ARG B  1 220 ? -38.234 -34.367 -129.887 1.00 46.06  ? 221  ARG B O     1 
ATOM   4072 C  CB    . ARG B  1 220 ? -40.109 -36.154 -128.276 1.00 40.54  ? 221  ARG B CB    1 
ATOM   4073 C  CG    . ARG B  1 220 ? -40.291 -37.223 -127.210 1.00 39.50  ? 221  ARG B CG    1 
ATOM   4074 C  CD    . ARG B  1 220 ? -41.305 -38.243 -127.680 1.00 42.18  ? 221  ARG B CD    1 
ATOM   4075 N  NE    . ARG B  1 220 ? -41.735 -39.170 -126.637 1.00 39.89  ? 221  ARG B NE    1 
ATOM   4076 C  CZ    . ARG B  1 220 ? -41.070 -40.264 -126.306 1.00 40.91  ? 221  ARG B CZ    1 
ATOM   4077 N  NH1   . ARG B  1 220 ? -39.944 -40.539 -126.937 1.00 42.84  ? 221  ARG B NH1   1 
ATOM   4078 N  NH2   . ARG B  1 220 ? -41.529 -41.081 -125.360 1.00 40.24  ? 221  ARG B NH2   1 
ATOM   4079 N  N     . GLY B  1 221 ? -39.774 -32.902 -129.166 1.00 42.64  ? 222  GLY B N     1 
ATOM   4080 C  CA    . GLY B  1 221 ? -39.647 -32.063 -130.338 1.00 47.51  ? 222  GLY B CA    1 
ATOM   4081 C  C     . GLY B  1 221 ? -40.612 -32.403 -131.443 1.00 51.37  ? 222  GLY B C     1 
ATOM   4082 O  O     . GLY B  1 221 ? -40.552 -31.782 -132.512 1.00 52.23  ? 222  GLY B O     1 
ATOM   4083 N  N     . VAL B  1 222 ? -41.506 -33.361 -131.213 1.00 47.54  ? 223  VAL B N     1 
ATOM   4084 C  CA    . VAL B  1 222 ? -42.477 -33.815 -132.199 1.00 44.05  ? 223  VAL B CA    1 
ATOM   4085 C  C     . VAL B  1 222 ? -43.750 -34.186 -131.447 1.00 37.49  ? 223  VAL B C     1 
ATOM   4086 O  O     . VAL B  1 222 ? -43.690 -34.638 -130.305 1.00 36.64  ? 223  VAL B O     1 
ATOM   4087 C  CB    . VAL B  1 222 ? -41.878 -34.983 -133.023 1.00 49.05  ? 223  VAL B CB    1 
ATOM   4088 C  CG1   . VAL B  1 222 ? -42.935 -35.897 -133.568 1.00 46.44  ? 223  VAL B CG1   1 
ATOM   4089 C  CG2   . VAL B  1 222 ? -41.025 -34.434 -134.171 1.00 49.38  ? 223  VAL B CG2   1 
ATOM   4090 N  N     . SER B  1 223 ? -44.907 -33.933 -132.060 1.00 34.49  ? 224  SER B N     1 
ATOM   4091 C  CA    . SER B  1 223 ? -46.186 -34.366 -131.508 1.00 32.88  ? 224  SER B CA    1 
ATOM   4092 C  C     . SER B  1 223 ? -46.505 -33.703 -130.167 1.00 39.02  ? 224  SER B C     1 
ATOM   4093 O  O     . SER B  1 223 ? -46.011 -32.611 -129.879 1.00 43.61  ? 224  SER B O     1 
ATOM   4094 C  CB    . SER B  1 223 ? -46.210 -35.895 -131.381 1.00 32.79  ? 224  SER B CB    1 
ATOM   4095 O  OG    . SER B  1 223 ? -47.448 -36.349 -130.873 1.00 35.66  ? 224  SER B OG    1 
ATOM   4096 N  N     . PHE B  1 224 ? -47.334 -34.345 -129.341 1.00 36.75  ? 225  PHE B N     1 
ATOM   4097 C  CA    . PHE B  1 224 ? -47.974 -33.691 -128.207 1.00 34.56  ? 225  PHE B CA    1 
ATOM   4098 C  C     . PHE B  1 224 ? -47.916 -34.550 -126.948 1.00 40.47  ? 225  PHE B C     1 
ATOM   4099 O  O     . PHE B  1 224 ? -47.599 -35.744 -126.975 1.00 40.97  ? 225  PHE B O     1 
ATOM   4100 C  CB    . PHE B  1 224 ? -49.450 -33.373 -128.495 1.00 34.77  ? 225  PHE B CB    1 
ATOM   4101 C  CG    . PHE B  1 224 ? -49.684 -32.628 -129.777 1.00 37.98  ? 225  PHE B CG    1 
ATOM   4102 C  CD1   . PHE B  1 224 ? -49.859 -33.313 -130.973 1.00 40.77  ? 225  PHE B CD1   1 
ATOM   4103 C  CD2   . PHE B  1 224 ? -49.742 -31.238 -129.785 1.00 39.64  ? 225  PHE B CD2   1 
ATOM   4104 C  CE1   . PHE B  1 224 ? -50.076 -32.626 -132.154 1.00 41.15  ? 225  PHE B CE1   1 
ATOM   4105 C  CE2   . PHE B  1 224 ? -49.964 -30.541 -130.963 1.00 38.53  ? 225  PHE B CE2   1 
ATOM   4106 C  CZ    . PHE B  1 224 ? -50.129 -31.235 -132.150 1.00 36.33  ? 225  PHE B CZ    1 
ATOM   4107 N  N     . THR B  1 225 ? -48.257 -33.912 -125.836 1.00 41.05  ? 226  THR B N     1 
ATOM   4108 C  CA    . THR B  1 225 ? -48.658 -34.582 -124.612 1.00 41.87  ? 226  THR B CA    1 
ATOM   4109 C  C     . THR B  1 225 ? -50.169 -34.461 -124.454 1.00 43.91  ? 226  THR B C     1 
ATOM   4110 O  O     . THR B  1 225 ? -50.803 -33.561 -125.014 1.00 43.23  ? 226  THR B O     1 
ATOM   4111 C  CB    . THR B  1 225 ? -47.964 -33.989 -123.380 1.00 38.76  ? 226  THR B CB    1 
ATOM   4112 O  OG1   . THR B  1 225 ? -48.142 -32.567 -123.368 1.00 42.45  ? 226  THR B OG1   1 
ATOM   4113 C  CG2   . THR B  1 225 ? -46.478 -34.321 -123.382 1.00 34.28  ? 226  THR B CG2   1 
ATOM   4114 N  N     . PHE B  1 226 ? -50.753 -35.387 -123.694 1.00 41.67  ? 227  PHE B N     1 
ATOM   4115 C  CA    . PHE B  1 226 ? -52.187 -35.344 -123.441 1.00 41.38  ? 227  PHE B CA    1 
ATOM   4116 C  C     . PHE B  1 226 ? -52.470 -35.708 -121.991 1.00 41.22  ? 227  PHE B C     1 
ATOM   4117 O  O     . PHE B  1 226 ? -51.769 -36.535 -121.395 1.00 38.36  ? 227  PHE B O     1 
ATOM   4118 C  CB    . PHE B  1 226 ? -52.966 -36.273 -124.383 1.00 33.11  ? 227  PHE B CB    1 
ATOM   4119 C  CG    . PHE B  1 226 ? -52.505 -37.702 -124.353 1.00 31.82  ? 227  PHE B CG    1 
ATOM   4120 C  CD1   . PHE B  1 226 ? -51.464 -38.123 -125.166 1.00 29.08  ? 227  PHE B CD1   1 
ATOM   4121 C  CD2   . PHE B  1 226 ? -53.116 -38.625 -123.527 1.00 33.70  ? 227  PHE B CD2   1 
ATOM   4122 C  CE1   . PHE B  1 226 ? -51.033 -39.427 -125.141 1.00 31.12  ? 227  PHE B CE1   1 
ATOM   4123 C  CE2   . PHE B  1 226 ? -52.693 -39.946 -123.516 1.00 38.06  ? 227  PHE B CE2   1 
ATOM   4124 C  CZ    . PHE B  1 226 ? -51.659 -40.345 -124.324 1.00 33.96  ? 227  PHE B CZ    1 
ATOM   4125 N  N     . GLY B  1 227 ? -53.514 -35.084 -121.436 1.00 39.03  ? 228  GLY B N     1 
ATOM   4126 C  CA    . GLY B  1 227 ? -53.828 -35.212 -120.030 1.00 38.13  ? 228  GLY B CA    1 
ATOM   4127 C  C     . GLY B  1 227 ? -54.864 -36.285 -119.766 1.00 38.62  ? 228  GLY B C     1 
ATOM   4128 O  O     . GLY B  1 227 ? -55.417 -36.903 -120.678 1.00 35.77  ? 228  GLY B O     1 
ATOM   4129 N  N     . ALA B  1 228 ? -55.133 -36.489 -118.473 1.00 38.59  ? 229  ALA B N     1 
ATOM   4130 C  CA    . ALA B  1 228 ? -56.073 -37.526 -118.067 1.00 39.76  ? 229  ALA B CA    1 
ATOM   4131 C  C     . ALA B  1 228 ? -57.449 -37.290 -118.663 1.00 39.87  ? 229  ALA B C     1 
ATOM   4132 O  O     . ALA B  1 228 ? -58.133 -38.244 -119.052 1.00 41.96  ? 229  ALA B O     1 
ATOM   4133 C  CB    . ALA B  1 228 ? -56.156 -37.590 -116.544 1.00 39.88  ? 229  ALA B CB    1 
ATOM   4134 N  N     . GLU B  1 229 ? -57.856 -36.027 -118.780 1.00 37.02  ? 230  GLU B N     1 
ATOM   4135 C  CA    . GLU B  1 229 ? -59.195 -35.740 -119.274 1.00 38.69  ? 230  GLU B CA    1 
ATOM   4136 C  C     . GLU B  1 229 ? -59.343 -36.121 -120.738 1.00 39.40  ? 230  GLU B C     1 
ATOM   4137 O  O     . GLU B  1 229 ? -60.417 -36.571 -121.145 1.00 42.98  ? 230  GLU B O     1 
ATOM   4138 C  CB    . GLU B  1 229 ? -59.528 -34.261 -119.064 1.00 43.21  ? 230  GLU B CB    1 
ATOM   4139 C  CG    . GLU B  1 229 ? -61.013 -33.958 -119.127 1.00 52.28  ? 230  GLU B CG    1 
ATOM   4140 N  N     . VAL B  1 230 ? -58.283 -35.955 -121.539 1.00 43.08  ? 231  VAL B N     1 
ATOM   4141 C  CA    . VAL B  1 230 ? -58.335 -36.357 -122.943 1.00 40.56  ? 231  VAL B CA    1 
ATOM   4142 C  C     . VAL B  1 230 ? -58.558 -37.860 -123.062 1.00 38.43  ? 231  VAL B C     1 
ATOM   4143 O  O     . VAL B  1 230 ? -59.338 -38.324 -123.906 1.00 39.53  ? 231  VAL B O     1 
ATOM   4144 C  CB    . VAL B  1 230 ? -57.053 -35.918 -123.672 1.00 41.27  ? 231  VAL B CB    1 
ATOM   4145 C  CG1   . VAL B  1 230 ? -57.037 -36.472 -125.086 1.00 41.35  ? 231  VAL B CG1   1 
ATOM   4146 C  CG2   . VAL B  1 230 ? -56.939 -34.393 -123.690 1.00 42.47  ? 231  VAL B CG2   1 
ATOM   4147 N  N     . VAL B  1 231 ? -57.892 -38.641 -122.210 1.00 40.60  ? 232  VAL B N     1 
ATOM   4148 C  CA    . VAL B  1 231 ? -58.075 -40.089 -122.221 1.00 35.81  ? 232  VAL B CA    1 
ATOM   4149 C  C     . VAL B  1 231 ? -59.522 -40.445 -121.900 1.00 36.66  ? 232  VAL B C     1 
ATOM   4150 O  O     . VAL B  1 231 ? -60.149 -41.254 -122.594 1.00 38.91  ? 232  VAL B O     1 
ATOM   4151 C  CB    . VAL B  1 231 ? -57.098 -40.763 -121.240 1.00 33.86  ? 232  VAL B CB    1 
ATOM   4152 C  CG1   . VAL B  1 231 ? -57.472 -42.234 -121.033 1.00 34.00  ? 232  VAL B CG1   1 
ATOM   4153 C  CG2   . VAL B  1 231 ? -55.670 -40.647 -121.734 1.00 29.25  ? 232  VAL B CG2   1 
ATOM   4154 N  N     . ALA B  1 232 ? -60.078 -39.846 -120.841 1.00 41.07  ? 233  ALA B N     1 
ATOM   4155 C  CA    . ALA B  1 232 ? -61.431 -40.212 -120.419 1.00 41.09  ? 233  ALA B CA    1 
ATOM   4156 C  C     . ALA B  1 232 ? -62.457 -39.860 -121.488 1.00 42.88  ? 233  ALA B C     1 
ATOM   4157 O  O     . ALA B  1 232 ? -63.383 -40.639 -121.751 1.00 44.06  ? 233  ALA B O     1 
ATOM   4158 C  CB    . ALA B  1 232 ? -61.779 -39.533 -119.092 1.00 38.85  ? 233  ALA B CB    1 
ATOM   4159 N  N     . LYS B  1 233 ? -62.297 -38.696 -122.127 1.00 41.44  ? 234  LYS B N     1 
ATOM   4160 C  CA    . LYS B  1 233 ? -63.206 -38.311 -123.203 1.00 38.09  ? 234  LYS B CA    1 
ATOM   4161 C  C     . LYS B  1 233 ? -63.057 -39.233 -124.403 1.00 37.42  ? 234  LYS B C     1 
ATOM   4162 O  O     . LYS B  1 233 ? -64.042 -39.553 -125.079 1.00 40.11  ? 234  LYS B O     1 
ATOM   4163 C  CB    . LYS B  1 233 ? -62.949 -36.861 -123.616 1.00 40.39  ? 234  LYS B CB    1 
ATOM   4164 N  N     . PHE B  1 234 ? -61.830 -39.664 -124.688 1.00 36.93  ? 235  PHE B N     1 
ATOM   4165 C  CA    . PHE B  1 234 ? -61.610 -40.580 -125.801 1.00 39.44  ? 235  PHE B CA    1 
ATOM   4166 C  C     . PHE B  1 234 ? -62.285 -41.922 -125.540 1.00 40.07  ? 235  PHE B C     1 
ATOM   4167 O  O     . PHE B  1 234 ? -62.986 -42.453 -126.413 1.00 39.03  ? 235  PHE B O     1 
ATOM   4168 C  CB    . PHE B  1 234 ? -60.110 -40.756 -126.035 1.00 40.60  ? 235  PHE B CB    1 
ATOM   4169 C  CG    . PHE B  1 234 ? -59.778 -41.721 -127.115 1.00 40.18  ? 235  PHE B CG    1 
ATOM   4170 C  CD1   . PHE B  1 234 ? -59.856 -41.342 -128.440 1.00 36.73  ? 235  PHE B CD1   1 
ATOM   4171 C  CD2   . PHE B  1 234 ? -59.384 -43.015 -126.807 1.00 39.90  ? 235  PHE B CD2   1 
ATOM   4172 C  CE1   . PHE B  1 234 ? -59.556 -42.233 -129.436 1.00 38.24  ? 235  PHE B CE1   1 
ATOM   4173 C  CE2   . PHE B  1 234 ? -59.072 -43.908 -127.801 1.00 38.90  ? 235  PHE B CE2   1 
ATOM   4174 C  CZ    . PHE B  1 234 ? -59.161 -43.520 -129.122 1.00 41.32  ? 235  PHE B CZ    1 
ATOM   4175 N  N     . LEU B  1 235 ? -62.099 -42.473 -124.334 1.00 37.56  ? 236  LEU B N     1 
ATOM   4176 C  CA    . LEU B  1 235 ? -62.707 -43.760 -123.989 1.00 40.29  ? 236  LEU B CA    1 
ATOM   4177 C  C     . LEU B  1 235 ? -64.227 -43.690 -124.023 1.00 42.76  ? 236  LEU B C     1 
ATOM   4178 O  O     . LEU B  1 235 ? -64.890 -44.621 -124.493 1.00 44.78  ? 236  LEU B O     1 
ATOM   4179 C  CB    . LEU B  1 235 ? -62.248 -44.220 -122.601 1.00 43.44  ? 236  LEU B CB    1 
ATOM   4180 C  CG    . LEU B  1 235 ? -60.780 -44.592 -122.370 1.00 44.26  ? 236  LEU B CG    1 
ATOM   4181 C  CD1   . LEU B  1 235 ? -60.625 -45.286 -121.009 1.00 41.26  ? 236  LEU B CD1   1 
ATOM   4182 C  CD2   . LEU B  1 235 ? -60.266 -45.468 -123.504 1.00 41.45  ? 236  LEU B CD2   1 
ATOM   4183 N  N     . HIS B  1 236 ? -64.795 -42.599 -123.513 1.00 47.01  ? 237  HIS B N     1 
ATOM   4184 C  CA    . HIS B  1 236 ? -66.246 -42.456 -123.487 1.00 48.62  ? 237  HIS B CA    1 
ATOM   4185 C  C     . HIS B  1 236 ? -66.810 -42.276 -124.894 1.00 46.57  ? 237  HIS B C     1 
ATOM   4186 O  O     . HIS B  1 236 ? -67.864 -42.832 -125.220 1.00 50.08  ? 237  HIS B O     1 
ATOM   4187 C  CB    . HIS B  1 236 ? -66.617 -41.283 -122.579 1.00 51.39  ? 237  HIS B CB    1 
ATOM   4188 C  CG    . HIS B  1 236 ? -68.052 -40.873 -122.659 1.00 59.39  ? 237  HIS B CG    1 
ATOM   4189 N  ND1   . HIS B  1 236 ? -69.048 -41.500 -121.940 1.00 61.75  ? 237  HIS B ND1   1 
ATOM   4190 C  CD2   . HIS B  1 236 ? -68.657 -39.883 -123.358 1.00 61.98  ? 237  HIS B CD2   1 
ATOM   4191 C  CE1   . HIS B  1 236 ? -70.205 -40.916 -122.197 1.00 63.68  ? 237  HIS B CE1   1 
ATOM   4192 N  NE2   . HIS B  1 236 ? -69.996 -39.935 -123.057 1.00 63.67  ? 237  HIS B NE2   1 
ATOM   4193 N  N     . LYS B  1 237 ? -66.111 -41.531 -125.753 1.00 42.09  ? 238  LYS B N     1 
ATOM   4194 C  CA    . LYS B  1 237 ? -66.631 -41.275 -127.094 1.00 43.05  ? 238  LYS B CA    1 
ATOM   4195 C  C     . LYS B  1 237 ? -66.666 -42.542 -127.945 1.00 42.13  ? 238  LYS B C     1 
ATOM   4196 O  O     . LYS B  1 237 ? -67.607 -42.746 -128.719 1.00 42.56  ? 238  LYS B O     1 
ATOM   4197 C  CB    . LYS B  1 237 ? -65.801 -40.194 -127.785 1.00 47.99  ? 238  LYS B CB    1 
ATOM   4198 C  CG    . LYS B  1 237 ? -66.267 -39.886 -129.197 1.00 48.48  ? 238  LYS B CG    1 
ATOM   4199 C  CD    . LYS B  1 237 ? -65.384 -38.859 -129.859 1.00 49.94  ? 238  LYS B CD    1 
ATOM   4200 C  CE    . LYS B  1 237 ? -65.756 -38.678 -131.322 1.00 49.64  ? 238  LYS B CE    1 
ATOM   4201 N  NZ    . LYS B  1 237 ? -64.810 -37.737 -131.976 1.00 51.75  ? 238  LYS B NZ    1 
ATOM   4202 N  N     . HIS B  1 238 ? -65.655 -43.401 -127.828 1.00 42.74  ? 239  HIS B N     1 
ATOM   4203 C  CA    . HIS B  1 238 ? -65.567 -44.607 -128.643 1.00 39.15  ? 239  HIS B CA    1 
ATOM   4204 C  C     . HIS B  1 238 ? -65.978 -45.869 -127.891 1.00 38.72  ? 239  HIS B C     1 
ATOM   4205 O  O     . HIS B  1 238 ? -65.775 -46.976 -128.403 1.00 37.37  ? 239  HIS B O     1 
ATOM   4206 C  CB    . HIS B  1 238 ? -64.148 -44.758 -129.189 1.00 36.82  ? 239  HIS B CB    1 
ATOM   4207 C  CG    . HIS B  1 238 ? -63.683 -43.561 -129.954 1.00 41.99  ? 239  HIS B CG    1 
ATOM   4208 N  ND1   . HIS B  1 238 ? -64.029 -43.344 -131.271 1.00 41.22  ? 239  HIS B ND1   1 
ATOM   4209 C  CD2   . HIS B  1 238 ? -62.930 -42.499 -129.581 1.00 42.62  ? 239  HIS B CD2   1 
ATOM   4210 C  CE1   . HIS B  1 238 ? -63.498 -42.206 -131.681 1.00 42.09  ? 239  HIS B CE1   1 
ATOM   4211 N  NE2   . HIS B  1 238 ? -62.827 -41.673 -130.675 1.00 42.12  ? 239  HIS B NE2   1 
ATOM   4212 N  N     . ASP B  1 239 ? -66.548 -45.724 -126.692 1.00 34.26  ? 240  ASP B N     1 
ATOM   4213 C  CA    . ASP B  1 239 ? -66.985 -46.861 -125.875 1.00 39.60  ? 240  ASP B CA    1 
ATOM   4214 C  C     . ASP B  1 239 ? -65.853 -47.863 -125.646 1.00 37.02  ? 240  ASP B C     1 
ATOM   4215 O  O     . ASP B  1 239 ? -66.031 -49.075 -125.766 1.00 40.43  ? 240  ASP B O     1 
ATOM   4216 C  CB    . ASP B  1 239 ? -68.200 -47.548 -126.498 1.00 45.25  ? 240  ASP B CB    1 
ATOM   4217 C  CG    . ASP B  1 239 ? -68.957 -48.402 -125.506 1.00 53.06  ? 240  ASP B CG    1 
ATOM   4218 O  OD1   . ASP B  1 239 ? -68.677 -48.298 -124.293 1.00 56.62  ? 240  ASP B OD1   1 
ATOM   4219 O  OD2   . ASP B  1 239 ? -69.822 -49.187 -125.946 1.00 57.83  ? 240  ASP B OD2   1 
ATOM   4220 N  N     . LEU B  1 240 ? -64.679 -47.352 -125.318 1.00 33.07  ? 241  LEU B N     1 
ATOM   4221 C  CA    . LEU B  1 240 ? -63.522 -48.165 -124.997 1.00 32.47  ? 241  LEU B CA    1 
ATOM   4222 C  C     . LEU B  1 240 ? -63.324 -48.181 -123.492 1.00 36.01  ? 241  LEU B C     1 
ATOM   4223 O  O     . LEU B  1 240 ? -63.795 -47.303 -122.773 1.00 40.14  ? 241  LEU B O     1 
ATOM   4224 C  CB    . LEU B  1 240 ? -62.261 -47.619 -125.684 1.00 30.47  ? 241  LEU B CB    1 
ATOM   4225 C  CG    . LEU B  1 240 ? -62.316 -47.542 -127.213 1.00 37.81  ? 241  LEU B CG    1 
ATOM   4226 C  CD1   . LEU B  1 240 ? -61.268 -46.564 -127.764 1.00 36.37  ? 241  LEU B CD1   1 
ATOM   4227 C  CD2   . LEU B  1 240 ? -62.142 -48.932 -127.824 1.00 34.69  ? 241  LEU B CD2   1 
ATOM   4228 N  N     . ASP B  1 241 ? -62.599 -49.185 -123.019 1.00 34.30  ? 242  ASP B N     1 
ATOM   4229 C  CA    . ASP B  1 241 ? -62.299 -49.276 -121.599 1.00 39.52  ? 242  ASP B CA    1 
ATOM   4230 C  C     . ASP B  1 241 ? -60.853 -48.970 -121.254 1.00 40.98  ? 242  ASP B C     1 
ATOM   4231 O  O     . ASP B  1 241 ? -60.576 -48.619 -120.103 1.00 38.57  ? 242  ASP B O     1 
ATOM   4232 C  CB    . ASP B  1 241 ? -62.634 -50.674 -121.075 1.00 37.59  ? 242  ASP B CB    1 
ATOM   4233 C  CG    . ASP B  1 241 ? -64.118 -50.911 -120.980 1.00 43.38  ? 242  ASP B CG    1 
ATOM   4234 O  OD1   . ASP B  1 241 ? -64.896 -49.943 -121.150 1.00 42.41  ? 242  ASP B OD1   1 
ATOM   4235 O  OD2   . ASP B  1 241 ? -64.500 -52.077 -120.740 1.00 46.63  ? 242  ASP B OD2   1 
ATOM   4236 N  N     . LEU B  1 242 ? -59.932 -49.086 -122.211 1.00 36.80  ? 243  LEU B N     1 
ATOM   4237 C  CA    . LEU B  1 242 ? -58.517 -48.978 -121.890 1.00 35.67  ? 243  LEU B CA    1 
ATOM   4238 C  C     . LEU B  1 242 ? -57.737 -48.561 -123.129 1.00 35.70  ? 243  LEU B C     1 
ATOM   4239 O  O     . LEU B  1 242 ? -58.069 -48.962 -124.247 1.00 33.85  ? 243  LEU B O     1 
ATOM   4240 C  CB    . LEU B  1 242 ? -57.988 -50.309 -121.345 1.00 31.19  ? 243  LEU B CB    1 
ATOM   4241 C  CG    . LEU B  1 242 ? -56.493 -50.410 -121.046 1.00 34.28  ? 243  LEU B CG    1 
ATOM   4242 C  CD1   . LEU B  1 242 ? -56.115 -49.548 -119.844 1.00 30.80  ? 243  LEU B CD1   1 
ATOM   4243 C  CD2   . LEU B  1 242 ? -56.112 -51.872 -120.830 1.00 30.37  ? 243  LEU B CD2   1 
ATOM   4244 N  N     . ILE B  1 243 ? -56.725 -47.728 -122.918 1.00 36.03  ? 244  ILE B N     1 
ATOM   4245 C  CA    . ILE B  1 243 ? -55.685 -47.465 -123.903 1.00 32.25  ? 244  ILE B CA    1 
ATOM   4246 C  C     . ILE B  1 243 ? -54.429 -48.197 -123.456 1.00 31.09  ? 244  ILE B C     1 
ATOM   4247 O  O     . ILE B  1 243 ? -53.962 -48.022 -122.323 1.00 33.82  ? 244  ILE B O     1 
ATOM   4248 C  CB    . ILE B  1 243 ? -55.402 -45.962 -124.040 1.00 39.06  ? 244  ILE B CB    1 
ATOM   4249 C  CG1   . ILE B  1 243 ? -56.655 -45.195 -124.450 1.00 33.53  ? 244  ILE B CG1   1 
ATOM   4250 C  CG2   . ILE B  1 243 ? -54.235 -45.726 -125.034 1.00 38.74  ? 244  ILE B CG2   1 
ATOM   4251 C  CD1   . ILE B  1 243 ? -56.411 -43.715 -124.519 1.00 37.33  ? 244  ILE B CD1   1 
ATOM   4252 N  N     . CYS B  1 244 ? -53.872 -49.006 -124.339 1.00 28.18  ? 245  CYS B N     1 
ATOM   4253 C  CA    . CYS B  1 244 ? -52.649 -49.738 -124.051 1.00 27.87  ? 245  CYS B CA    1 
ATOM   4254 C  C     . CYS B  1 244 ? -51.570 -49.248 -125.001 1.00 28.55  ? 245  CYS B C     1 
ATOM   4255 O  O     . CYS B  1 244 ? -51.711 -49.393 -126.217 1.00 31.43  ? 245  CYS B O     1 
ATOM   4256 C  CB    . CYS B  1 244 ? -52.873 -51.233 -124.219 1.00 32.82  ? 245  CYS B CB    1 
ATOM   4257 S  SG    . CYS B  1 244 ? -51.422 -52.171 -123.877 1.00 42.09  ? 245  CYS B SG    1 
ATOM   4258 N  N     . ARG B  1 245 ? -50.501 -48.664 -124.457 1.00 24.46  ? 246  ARG B N     1 
ATOM   4259 C  CA    . ARG B  1 245 ? -49.460 -48.082 -125.297 1.00 27.37  ? 246  ARG B CA    1 
ATOM   4260 C  C     . ARG B  1 245 ? -48.103 -48.376 -124.675 1.00 30.88  ? 246  ARG B C     1 
ATOM   4261 O  O     . ARG B  1 245 ? -48.000 -49.052 -123.646 1.00 28.42  ? 246  ARG B O     1 
ATOM   4262 C  CB    . ARG B  1 245 ? -49.672 -46.567 -125.511 1.00 26.55  ? 246  ARG B CB    1 
ATOM   4263 C  CG    . ARG B  1 245 ? -49.981 -45.775 -124.246 1.00 29.73  ? 246  ARG B CG    1 
ATOM   4264 C  CD    . ARG B  1 245 ? -48.708 -45.285 -123.541 1.00 25.38  ? 246  ARG B CD    1 
ATOM   4265 N  NE    . ARG B  1 245 ? -47.967 -44.282 -124.312 1.00 25.78  ? 246  ARG B NE    1 
ATOM   4266 C  CZ    . ARG B  1 245 ? -46.945 -43.580 -123.830 1.00 30.92  ? 246  ARG B CZ    1 
ATOM   4267 N  NH1   . ARG B  1 245 ? -46.549 -43.784 -122.581 1.00 28.37  ? 246  ARG B NH1   1 
ATOM   4268 N  NH2   . ARG B  1 245 ? -46.321 -42.677 -124.588 1.00 25.02  ? 246  ARG B NH2   1 
ATOM   4269 N  N     . ALA B  1 246 ? -47.044 -47.878 -125.320 1.00 29.04  ? 247  ALA B N     1 
ATOM   4270 C  CA    . ALA B  1 246 ? -45.689 -48.168 -124.865 1.00 32.05  ? 247  ALA B CA    1 
ATOM   4271 C  C     . ALA B  1 246 ? -44.843 -46.899 -124.876 1.00 30.46  ? 247  ALA B C     1 
ATOM   4272 O  O     . ALA B  1 246 ? -45.207 -45.920 -124.212 1.00 30.45  ? 247  ALA B O     1 
ATOM   4273 C  CB    . ALA B  1 246 ? -45.067 -49.262 -125.738 1.00 30.16  ? 247  ALA B CB    1 
ATOM   4274 N  N     . HIS B  1 247 ? -43.701 -46.918 -125.586 1.00 28.72  ? 248  HIS B N     1 
ATOM   4275 C  CA    . HIS B  1 247 ? -43.021 -45.687 -126.015 1.00 31.76  ? 248  HIS B CA    1 
ATOM   4276 C  C     . HIS B  1 247 ? -42.192 -45.022 -124.905 1.00 33.37  ? 248  HIS B C     1 
ATOM   4277 O  O     . HIS B  1 247 ? -41.235 -44.299 -125.197 1.00 31.64  ? 248  HIS B O     1 
ATOM   4278 C  CB    . HIS B  1 247 ? -44.071 -44.704 -126.572 1.00 26.18  ? 248  HIS B CB    1 
ATOM   4279 C  CG    . HIS B  1 247 ? -43.519 -43.527 -127.325 1.00 28.62  ? 248  HIS B CG    1 
ATOM   4280 N  ND1   . HIS B  1 247 ? -42.425 -43.605 -128.165 1.00 28.39  ? 248  HIS B ND1   1 
ATOM   4281 C  CD2   . HIS B  1 247 ? -43.943 -42.240 -127.378 1.00 24.84  ? 248  HIS B CD2   1 
ATOM   4282 C  CE1   . HIS B  1 247 ? -42.199 -42.421 -128.697 1.00 25.18  ? 248  HIS B CE1   1 
ATOM   4283 N  NE2   . HIS B  1 247 ? -43.110 -41.576 -128.241 1.00 28.50  ? 248  HIS B NE2   1 
ATOM   4284 N  N     . GLN B  1 248 ? -42.537 -45.251 -123.636 1.00 33.60  ? 249  GLN B N     1 
ATOM   4285 C  CA    . GLN B  1 248 ? -41.817 -44.652 -122.513 1.00 37.16  ? 249  GLN B CA    1 
ATOM   4286 C  C     . GLN B  1 248 ? -41.375 -45.726 -121.530 1.00 36.00  ? 249  GLN B C     1 
ATOM   4287 O  O     . GLN B  1 248 ? -42.187 -46.557 -121.105 1.00 35.11  ? 249  GLN B O     1 
ATOM   4288 C  CB    . GLN B  1 248 ? -42.684 -43.615 -121.792 1.00 31.29  ? 249  GLN B CB    1 
ATOM   4289 C  CG    . GLN B  1 248 ? -42.716 -42.266 -122.489 1.00 27.26  ? 249  GLN B CG    1 
ATOM   4290 C  CD    . GLN B  1 248 ? -43.617 -41.277 -121.778 1.00 30.04  ? 249  GLN B CD    1 
ATOM   4291 O  OE1   . GLN B  1 248 ? -44.773 -41.584 -121.471 1.00 35.06  ? 249  GLN B OE1   1 
ATOM   4292 N  NE2   . GLN B  1 248 ? -43.097 -40.086 -121.514 1.00 33.24  ? 249  GLN B NE2   1 
ATOM   4293 N  N     . VAL B  1 249 ? -40.090 -45.701 -121.165 1.00 34.67  ? 250  VAL B N     1 
ATOM   4294 C  CA    . VAL B  1 249 ? -39.587 -46.649 -120.179 1.00 38.63  ? 250  VAL B CA    1 
ATOM   4295 C  C     . VAL B  1 249 ? -40.246 -46.349 -118.842 1.00 39.68  ? 250  VAL B C     1 
ATOM   4296 O  O     . VAL B  1 249 ? -40.455 -45.185 -118.483 1.00 36.76  ? 250  VAL B O     1 
ATOM   4297 C  CB    . VAL B  1 249 ? -38.047 -46.598 -120.094 1.00 39.51  ? 250  VAL B CB    1 
ATOM   4298 C  CG1   . VAL B  1 249 ? -37.538 -45.216 -119.666 1.00 39.59  ? 250  VAL B CG1   1 
ATOM   4299 C  CG2   . VAL B  1 249 ? -37.522 -47.673 -119.153 1.00 37.46  ? 250  VAL B CG2   1 
ATOM   4300 N  N     . VAL B  1 250 ? -40.645 -47.399 -118.130 1.00 41.22  ? 251  VAL B N     1 
ATOM   4301 C  CA    . VAL B  1 250 ? -41.308 -47.269 -116.838 1.00 38.81  ? 251  VAL B CA    1 
ATOM   4302 C  C     . VAL B  1 250 ? -40.694 -48.280 -115.884 1.00 41.95  ? 251  VAL B C     1 
ATOM   4303 O  O     . VAL B  1 250 ? -40.480 -49.442 -116.247 1.00 40.69  ? 251  VAL B O     1 
ATOM   4304 C  CB    . VAL B  1 250 ? -42.837 -47.464 -116.941 1.00 39.05  ? 251  VAL B CB    1 
ATOM   4305 C  CG1   . VAL B  1 250 ? -43.471 -46.274 -117.639 1.00 36.34  ? 251  VAL B CG1   1 
ATOM   4306 C  CG2   . VAL B  1 250 ? -43.180 -48.760 -117.664 1.00 44.64  ? 251  VAL B CG2   1 
ATOM   4307 N  N     . GLU B  1 251 ? -40.425 -47.828 -114.656 1.00 44.98  ? 252  GLU B N     1 
ATOM   4308 C  CA    . GLU B  1 251 ? -39.577 -48.579 -113.738 1.00 44.86  ? 252  GLU B CA    1 
ATOM   4309 C  C     . GLU B  1 251 ? -40.109 -49.980 -113.494 1.00 42.77  ? 252  GLU B C     1 
ATOM   4310 O  O     . GLU B  1 251 ? -39.334 -50.939 -113.424 1.00 47.95  ? 252  GLU B O     1 
ATOM   4311 C  CB    . GLU B  1 251 ? -39.446 -47.821 -112.417 1.00 52.83  ? 252  GLU B CB    1 
ATOM   4312 C  CG    . GLU B  1 251 ? -38.607 -48.541 -111.380 1.00 65.52  ? 252  GLU B CG    1 
ATOM   4313 C  CD    . GLU B  1 251 ? -38.559 -47.801 -110.056 1.00 74.31  ? 252  GLU B CD    1 
ATOM   4314 O  OE1   . GLU B  1 251 ? -39.224 -46.744 -109.930 1.00 75.69  ? 252  GLU B OE1   1 
ATOM   4315 O  OE2   . GLU B  1 251 ? -37.847 -48.275 -109.146 1.00 76.17  ? 252  GLU B OE2   1 
ATOM   4316 N  N     . ASP B  1 252 ? -41.423 -50.121 -113.369 1.00 42.87  ? 253  ASP B N     1 
ATOM   4317 C  CA    . ASP B  1 252 ? -42.041 -51.399 -113.051 1.00 39.21  ? 253  ASP B CA    1 
ATOM   4318 C  C     . ASP B  1 252 ? -42.427 -52.201 -114.293 1.00 39.12  ? 253  ASP B C     1 
ATOM   4319 O  O     . ASP B  1 252 ? -43.067 -53.246 -114.165 1.00 43.63  ? 253  ASP B O     1 
ATOM   4320 C  CB    . ASP B  1 252 ? -43.276 -51.176 -112.168 1.00 48.73  ? 253  ASP B CB    1 
ATOM   4321 C  CG    . ASP B  1 252 ? -42.933 -50.555 -110.810 1.00 55.24  ? 253  ASP B CG    1 
ATOM   4322 O  OD1   . ASP B  1 252 ? -41.805 -50.773 -110.319 1.00 57.11  ? 253  ASP B OD1   1 
ATOM   4323 O  OD2   . ASP B  1 252 ? -43.799 -49.849 -110.236 1.00 55.20  ? 253  ASP B OD2   1 
ATOM   4324 N  N     . GLY B  1 253 ? -42.060 -51.744 -115.488 1.00 38.80  ? 254  GLY B N     1 
ATOM   4325 C  CA    . GLY B  1 253 ? -42.437 -52.468 -116.686 1.00 36.97  ? 254  GLY B CA    1 
ATOM   4326 C  C     . GLY B  1 253 ? -43.831 -52.128 -117.180 1.00 38.96  ? 254  GLY B C     1 
ATOM   4327 O  O     . GLY B  1 253 ? -44.091 -52.128 -118.388 1.00 38.40  ? 254  GLY B O     1 
ATOM   4328 N  N     . TYR B  1 254 ? -44.744 -51.846 -116.257 1.00 40.36  ? 255  TYR B N     1 
ATOM   4329 C  CA    . TYR B  1 254 ? -46.044 -51.314 -116.622 1.00 37.76  ? 255  TYR B CA    1 
ATOM   4330 C  C     . TYR B  1 254 ? -46.383 -50.181 -115.672 1.00 39.66  ? 255  TYR B C     1 
ATOM   4331 O  O     . TYR B  1 254 ? -45.876 -50.123 -114.552 1.00 38.30  ? 255  TYR B O     1 
ATOM   4332 C  CB    . TYR B  1 254 ? -47.130 -52.395 -116.608 1.00 37.65  ? 255  TYR B CB    1 
ATOM   4333 C  CG    . TYR B  1 254 ? -47.614 -52.819 -115.241 1.00 39.53  ? 255  TYR B CG    1 
ATOM   4334 C  CD1   . TYR B  1 254 ? -46.914 -53.765 -114.499 1.00 41.71  ? 255  TYR B CD1   1 
ATOM   4335 C  CD2   . TYR B  1 254 ? -48.779 -52.300 -114.703 1.00 41.20  ? 255  TYR B CD2   1 
ATOM   4336 C  CE1   . TYR B  1 254 ? -47.354 -54.165 -113.254 1.00 39.97  ? 255  TYR B CE1   1 
ATOM   4337 C  CE2   . TYR B  1 254 ? -49.229 -52.696 -113.458 1.00 41.20  ? 255  TYR B CE2   1 
ATOM   4338 C  CZ    . TYR B  1 254 ? -48.513 -53.627 -112.743 1.00 41.69  ? 255  TYR B CZ    1 
ATOM   4339 O  OH    . TYR B  1 254 ? -48.961 -54.025 -111.512 1.00 45.43  ? 255  TYR B OH    1 
ATOM   4340 N  N     . GLU B  1 255 ? -47.232 -49.268 -116.130 1.00 40.97  ? 256  GLU B N     1 
ATOM   4341 C  CA    . GLU B  1 255 ? -47.569 -48.115 -115.310 1.00 39.09  ? 256  GLU B CA    1 
ATOM   4342 C  C     . GLU B  1 255 ? -48.921 -47.575 -115.743 1.00 38.06  ? 256  GLU B C     1 
ATOM   4343 O  O     . GLU B  1 255 ? -49.139 -47.321 -116.932 1.00 34.15  ? 256  GLU B O     1 
ATOM   4344 C  CB    . GLU B  1 255 ? -46.489 -47.035 -115.428 1.00 40.48  ? 256  GLU B CB    1 
ATOM   4345 C  CG    . GLU B  1 255 ? -46.576 -45.942 -114.383 1.00 45.66  ? 256  GLU B CG    1 
ATOM   4346 C  CD    . GLU B  1 255 ? -45.371 -45.015 -114.411 1.00 53.67  ? 256  GLU B CD    1 
ATOM   4347 O  OE1   . GLU B  1 255 ? -44.241 -45.480 -114.119 1.00 55.54  ? 256  GLU B OE1   1 
ATOM   4348 O  OE2   . GLU B  1 255 ? -45.556 -43.826 -114.760 1.00 51.83  ? 256  GLU B OE2   1 
ATOM   4349 N  N     . PHE B  1 256 ? -49.819 -47.401 -114.777 1.00 35.19  ? 257  PHE B N     1 
ATOM   4350 C  CA    . PHE B  1 256 ? -51.157 -46.904 -115.054 1.00 34.77  ? 257  PHE B CA    1 
ATOM   4351 C  C     . PHE B  1 256 ? -51.158 -45.384 -115.155 1.00 33.21  ? 257  PHE B C     1 
ATOM   4352 O  O     . PHE B  1 256 ? -50.255 -44.701 -114.672 1.00 35.99  ? 257  PHE B O     1 
ATOM   4353 C  CB    . PHE B  1 256 ? -52.133 -47.351 -113.967 1.00 38.63  ? 257  PHE B CB    1 
ATOM   4354 C  CG    . PHE B  1 256 ? -52.433 -48.824 -113.997 1.00 39.78  ? 257  PHE B CG    1 
ATOM   4355 C  CD1   . PHE B  1 256 ? -52.973 -49.405 -115.125 1.00 37.04  ? 257  PHE B CD1   1 
ATOM   4356 C  CD2   . PHE B  1 256 ? -52.185 -49.617 -112.896 1.00 42.00  ? 257  PHE B CD2   1 
ATOM   4357 C  CE1   . PHE B  1 256 ? -53.258 -50.753 -115.155 1.00 43.46  ? 257  PHE B CE1   1 
ATOM   4358 C  CE2   . PHE B  1 256 ? -52.469 -50.967 -112.920 1.00 43.90  ? 257  PHE B CE2   1 
ATOM   4359 C  CZ    . PHE B  1 256 ? -53.005 -51.535 -114.050 1.00 44.24  ? 257  PHE B CZ    1 
ATOM   4360 N  N     . PHE B  1 257 ? -52.196 -44.862 -115.796 1.00 37.19  ? 258  PHE B N     1 
ATOM   4361 C  CA    . PHE B  1 257 ? -52.395 -43.432 -115.975 1.00 40.18  ? 258  PHE B CA    1 
ATOM   4362 C  C     . PHE B  1 257 ? -53.891 -43.168 -115.995 1.00 41.54  ? 258  PHE B C     1 
ATOM   4363 O  O     . PHE B  1 257 ? -54.657 -43.986 -116.510 1.00 41.14  ? 258  PHE B O     1 
ATOM   4364 C  CB    . PHE B  1 257 ? -51.757 -42.934 -117.279 1.00 39.44  ? 258  PHE B CB    1 
ATOM   4365 C  CG    . PHE B  1 257 ? -52.001 -41.474 -117.568 1.00 40.20  ? 258  PHE B CG    1 
ATOM   4366 C  CD1   . PHE B  1 257 ? -51.308 -40.486 -116.871 1.00 43.60  ? 258  PHE B CD1   1 
ATOM   4367 C  CD2   . PHE B  1 257 ? -52.897 -41.085 -118.549 1.00 37.22  ? 258  PHE B CD2   1 
ATOM   4368 C  CE1   . PHE B  1 257 ? -51.514 -39.128 -117.142 1.00 38.05  ? 258  PHE B CE1   1 
ATOM   4369 C  CE2   . PHE B  1 257 ? -53.107 -39.736 -118.835 1.00 36.95  ? 258  PHE B CE2   1 
ATOM   4370 C  CZ    . PHE B  1 257 ? -52.419 -38.758 -118.126 1.00 38.87  ? 258  PHE B CZ    1 
ATOM   4371 N  N     . ALA B  1 258 ? -54.304 -42.034 -115.423 1.00 39.43  ? 259  ALA B N     1 
ATOM   4372 C  CA    . ALA B  1 258 ? -55.708 -41.616 -115.452 1.00 31.81  ? 259  ALA B CA    1 
ATOM   4373 C  C     . ALA B  1 258 ? -56.638 -42.697 -114.886 1.00 41.90  ? 259  ALA B C     1 
ATOM   4374 O  O     . ALA B  1 258 ? -57.637 -43.077 -115.500 1.00 44.30  ? 259  ALA B O     1 
ATOM   4375 C  CB    . ALA B  1 258 ? -56.119 -41.224 -116.871 1.00 34.92  ? 259  ALA B CB    1 
ATOM   4376 N  N     . LYS B  1 259 ? -56.295 -43.187 -113.693 1.00 46.07  ? 260  LYS B N     1 
ATOM   4377 C  CA    . LYS B  1 259 ? -57.044 -44.214 -112.963 1.00 50.82  ? 260  LYS B CA    1 
ATOM   4378 C  C     . LYS B  1 259 ? -57.210 -45.471 -113.829 1.00 50.01  ? 260  LYS B C     1 
ATOM   4379 O  O     . LYS B  1 259 ? -58.294 -45.876 -114.222 1.00 46.97  ? 260  LYS B O     1 
ATOM   4380 C  CB    . LYS B  1 259 ? -58.369 -43.621 -112.430 1.00 65.19  ? 260  LYS B CB    1 
ATOM   4381 C  CG    . LYS B  1 259 ? -59.484 -44.594 -111.967 1.00 75.69  ? 260  LYS B CG    1 
ATOM   4382 C  CD    . LYS B  1 259 ? -60.496 -44.881 -113.097 1.00 80.94  ? 260  LYS B CD    1 
ATOM   4383 C  CE    . LYS B  1 259 ? -61.302 -46.147 -112.872 1.00 81.08  ? 260  LYS B CE    1 
ATOM   4384 N  NZ    . LYS B  1 259 ? -62.122 -46.404 -114.073 1.00 81.06  ? 260  LYS B NZ    1 
ATOM   4385 N  N     . ARG B  1 260 ? -56.064 -46.074 -114.149 1.00 49.69  ? 261  ARG B N     1 
ATOM   4386 C  CA    . ARG B  1 260 ? -56.026 -47.320 -114.921 1.00 44.75  ? 261  ARG B CA    1 
ATOM   4387 C  C     . ARG B  1 260 ? -56.841 -47.241 -116.218 1.00 42.26  ? 261  ARG B C     1 
ATOM   4388 O  O     . ARG B  1 260 ? -57.277 -48.266 -116.742 1.00 42.27  ? 261  ARG B O     1 
ATOM   4389 C  CB    . ARG B  1 260 ? -56.501 -48.510 -114.076 1.00 39.77  ? 261  ARG B CB    1 
ATOM   4390 C  CG    . ARG B  1 260 ? -55.677 -48.744 -112.811 1.00 40.05  ? 261  ARG B CG    1 
ATOM   4391 C  CD    . ARG B  1 260 ? -56.372 -49.727 -111.882 1.00 42.25  ? 261  ARG B CD    1 
ATOM   4392 N  NE    . ARG B  1 260 ? -57.651 -49.189 -111.432 1.00 47.10  ? 261  ARG B NE    1 
ATOM   4393 C  CZ    . ARG B  1 260 ? -57.786 -48.411 -110.367 1.00 43.93  ? 261  ARG B CZ    1 
ATOM   4394 N  NH1   . ARG B  1 260 ? -56.723 -48.102 -109.638 1.00 37.80  ? 261  ARG B NH1   1 
ATOM   4395 N  NH2   . ARG B  1 260 ? -58.976 -47.944 -110.039 1.00 45.33  ? 261  ARG B NH2   1 
ATOM   4396 N  N     . GLN B  1 261 ? -57.076 -46.036 -116.745 1.00 38.94  ? 262  GLN B N     1 
ATOM   4397 C  CA    . GLN B  1 261 ? -57.708 -45.902 -118.051 1.00 40.39  ? 262  GLN B CA    1 
ATOM   4398 C  C     . GLN B  1 261 ? -56.697 -45.988 -119.185 1.00 39.15  ? 262  GLN B C     1 
ATOM   4399 O  O     . GLN B  1 261 ? -57.079 -46.207 -120.337 1.00 31.44  ? 262  GLN B O     1 
ATOM   4400 C  CB    . GLN B  1 261 ? -58.465 -44.575 -118.136 1.00 36.29  ? 262  GLN B CB    1 
ATOM   4401 C  CG    . GLN B  1 261 ? -59.811 -44.598 -117.423 1.00 38.72  ? 262  GLN B CG    1 
ATOM   4402 C  CD    . GLN B  1 261 ? -60.509 -43.250 -117.445 1.00 45.07  ? 262  GLN B CD    1 
ATOM   4403 O  OE1   . GLN B  1 261 ? -61.547 -43.088 -118.084 1.00 48.60  ? 262  GLN B OE1   1 
ATOM   4404 N  NE2   . GLN B  1 261 ? -59.936 -42.272 -116.748 1.00 41.47  ? 262  GLN B NE2   1 
ATOM   4405 N  N     . LEU B  1 262 ? -55.423 -45.798 -118.883 1.00 38.82  ? 263  LEU B N     1 
ATOM   4406 C  CA    . LEU B  1 262 ? -54.352 -46.010 -119.834 1.00 41.63  ? 263  LEU B CA    1 
ATOM   4407 C  C     . LEU B  1 262 ? -53.257 -46.778 -119.118 1.00 37.11  ? 263  LEU B C     1 
ATOM   4408 O  O     . LEU B  1 262 ? -53.026 -46.587 -117.920 1.00 33.84  ? 263  LEU B O     1 
ATOM   4409 C  CB    . LEU B  1 262 ? -53.804 -44.685 -120.395 1.00 27.99  ? 263  LEU B CB    1 
ATOM   4410 C  CG    . LEU B  1 262 ? -52.573 -44.720 -121.326 1.00 32.41  ? 263  LEU B CG    1 
ATOM   4411 C  CD1   . LEU B  1 262 ? -52.637 -43.523 -122.276 1.00 32.32  ? 263  LEU B CD1   1 
ATOM   4412 C  CD2   . LEU B  1 262 ? -51.227 -44.710 -120.589 1.00 27.61  ? 263  LEU B CD2   1 
ATOM   4413 N  N     . VAL B  1 263 ? -52.586 -47.654 -119.859 1.00 36.24  ? 264  VAL B N     1 
ATOM   4414 C  CA    . VAL B  1 263 ? -51.441 -48.380 -119.331 1.00 31.31  ? 264  VAL B CA    1 
ATOM   4415 C  C     . VAL B  1 263 ? -50.277 -48.228 -120.299 1.00 31.53  ? 264  VAL B C     1 
ATOM   4416 O  O     . VAL B  1 263 ? -50.447 -48.359 -121.516 1.00 30.10  ? 264  VAL B O     1 
ATOM   4417 C  CB    . VAL B  1 263 ? -51.766 -49.866 -119.073 1.00 33.95  ? 264  VAL B CB    1 
ATOM   4418 C  CG1   . VAL B  1 263 ? -52.211 -50.578 -120.354 1.00 29.97  ? 264  VAL B CG1   1 
ATOM   4419 C  CG2   . VAL B  1 263 ? -50.578 -50.555 -118.439 1.00 32.84  ? 264  VAL B CG2   1 
ATOM   4420 N  N     . THR B  1 264 ? -49.106 -47.917 -119.756 1.00 32.36  ? 265  THR B N     1 
ATOM   4421 C  CA    . THR B  1 264 ? -47.859 -47.909 -120.498 1.00 32.59  ? 265  THR B CA    1 
ATOM   4422 C  C     . THR B  1 264 ? -47.150 -49.234 -120.254 1.00 35.31  ? 265  THR B C     1 
ATOM   4423 O  O     . THR B  1 264 ? -46.902 -49.598 -119.100 1.00 30.83  ? 265  THR B O     1 
ATOM   4424 C  CB    . THR B  1 264 ? -46.969 -46.747 -120.057 1.00 30.74  ? 265  THR B CB    1 
ATOM   4425 O  OG1   . THR B  1 264 ? -47.541 -45.520 -120.509 1.00 30.04  ? 265  THR B OG1   1 
ATOM   4426 C  CG2   . THR B  1 264 ? -45.578 -46.893 -120.627 1.00 30.74  ? 265  THR B CG2   1 
ATOM   4427 N  N     . LEU B  1 265 ? -46.827 -49.943 -121.333 1.00 28.78  ? 266  LEU B N     1 
ATOM   4428 C  CA    . LEU B  1 265 ? -46.063 -51.182 -121.273 1.00 30.43  ? 266  LEU B CA    1 
ATOM   4429 C  C     . LEU B  1 265 ? -44.662 -50.946 -121.824 1.00 33.06  ? 266  LEU B C     1 
ATOM   4430 O  O     . LEU B  1 265 ? -44.489 -50.256 -122.833 1.00 38.17  ? 266  LEU B O     1 
ATOM   4431 C  CB    . LEU B  1 265 ? -46.763 -52.299 -122.068 1.00 31.29  ? 266  LEU B CB    1 
ATOM   4432 C  CG    . LEU B  1 265 ? -48.169 -52.725 -121.598 1.00 36.04  ? 266  LEU B CG    1 
ATOM   4433 C  CD1   . LEU B  1 265 ? -48.747 -53.897 -122.404 1.00 31.54  ? 266  LEU B CD1   1 
ATOM   4434 C  CD2   . LEU B  1 265 ? -48.145 -53.070 -120.127 1.00 39.53  ? 266  LEU B CD2   1 
ATOM   4435 N  N     . PHE B  1 266 ? -43.663 -51.519 -121.165 1.00 33.52  ? 267  PHE B N     1 
ATOM   4436 C  CA    . PHE B  1 266 ? -42.285 -51.449 -121.634 1.00 33.96  ? 267  PHE B CA    1 
ATOM   4437 C  C     . PHE B  1 266 ? -41.626 -52.796 -121.373 1.00 36.20  ? 267  PHE B C     1 
ATOM   4438 O  O     . PHE B  1 266 ? -41.524 -53.228 -120.224 1.00 36.45  ? 267  PHE B O     1 
ATOM   4439 C  CB    . PHE B  1 266 ? -41.521 -50.318 -120.946 1.00 29.36  ? 267  PHE B CB    1 
ATOM   4440 C  CG    . PHE B  1 266 ? -40.281 -49.894 -121.674 1.00 29.08  ? 267  PHE B CG    1 
ATOM   4441 C  CD1   . PHE B  1 266 ? -40.349 -48.972 -122.707 1.00 31.28  ? 267  PHE B CD1   1 
ATOM   4442 C  CD2   . PHE B  1 266 ? -39.045 -50.417 -121.325 1.00 33.83  ? 267  PHE B CD2   1 
ATOM   4443 C  CE1   . PHE B  1 266 ? -39.214 -48.571 -123.384 1.00 31.60  ? 267  PHE B CE1   1 
ATOM   4444 C  CE2   . PHE B  1 266 ? -37.899 -50.020 -121.998 1.00 38.96  ? 267  PHE B CE2   1 
ATOM   4445 C  CZ    . PHE B  1 266 ? -37.985 -49.093 -123.029 1.00 36.89  ? 267  PHE B CZ    1 
ATOM   4446 N  N     . SER B  1 267 ? -41.169 -53.456 -122.434 1.00 36.08  ? 268  SER B N     1 
ATOM   4447 C  CA    . SER B  1 267 ? -40.754 -54.849 -122.343 1.00 35.98  ? 268  SER B CA    1 
ATOM   4448 C  C     . SER B  1 267 ? -39.244 -55.049 -122.413 1.00 35.83  ? 268  SER B C     1 
ATOM   4449 O  O     . SER B  1 267 ? -38.794 -56.184 -122.571 1.00 44.68  ? 268  SER B O     1 
ATOM   4450 C  CB    . SER B  1 267 ? -41.437 -55.664 -123.445 1.00 34.33  ? 268  SER B CB    1 
ATOM   4451 O  OG    . SER B  1 267 ? -42.847 -55.589 -123.319 1.00 36.31  ? 268  SER B OG    1 
ATOM   4452 N  N     . ALA B  1 268 ? -38.445 -53.994 -122.302 1.00 36.17  ? 269  ALA B N     1 
ATOM   4453 C  CA    . ALA B  1 268 ? -36.995 -54.160 -122.349 1.00 37.98  ? 269  ALA B CA    1 
ATOM   4454 C  C     . ALA B  1 268 ? -36.380 -53.826 -120.995 1.00 38.88  ? 269  ALA B C     1 
ATOM   4455 O  O     . ALA B  1 268 ? -36.132 -52.646 -120.702 1.00 43.00  ? 269  ALA B O     1 
ATOM   4456 C  CB    . ALA B  1 268 ? -36.385 -53.287 -123.450 1.00 35.98  ? 269  ALA B CB    1 
ATOM   4457 N  N     . PRO B  1 269 ? -36.103 -54.819 -120.146 1.00 40.42  ? 270  PRO B N     1 
ATOM   4458 C  CA    . PRO B  1 269 ? -35.517 -54.533 -118.831 1.00 47.28  ? 270  PRO B CA    1 
ATOM   4459 C  C     . PRO B  1 269 ? -34.085 -54.034 -118.940 1.00 50.86  ? 270  PRO B C     1 
ATOM   4460 O  O     . PRO B  1 269 ? -33.343 -54.399 -119.857 1.00 48.36  ? 270  PRO B O     1 
ATOM   4461 C  CB    . PRO B  1 269 ? -35.572 -55.888 -118.120 1.00 42.81  ? 270  PRO B CB    1 
ATOM   4462 C  CG    . PRO B  1 269 ? -35.530 -56.872 -119.229 1.00 41.45  ? 270  PRO B CG    1 
ATOM   4463 C  CD    . PRO B  1 269 ? -36.293 -56.258 -120.362 1.00 35.49  ? 270  PRO B CD    1 
ATOM   4464 N  N     . ASN B  1 270 ? -33.700 -53.205 -117.969 1.00 53.94  ? 271  ASN B N     1 
ATOM   4465 C  CA    . ASN B  1 270 ? -32.400 -52.536 -117.953 1.00 58.97  ? 271  ASN B CA    1 
ATOM   4466 C  C     . ASN B  1 270 ? -32.150 -51.828 -119.285 1.00 58.34  ? 271  ASN B C     1 
ATOM   4467 O  O     . ASN B  1 270 ? -31.166 -52.072 -119.982 1.00 60.63  ? 271  ASN B O     1 
ATOM   4468 C  CB    . ASN B  1 270 ? -31.274 -53.522 -117.624 1.00 66.38  ? 271  ASN B CB    1 
ATOM   4469 C  CG    . ASN B  1 270 ? -30.242 -52.933 -116.673 1.00 79.41  ? 271  ASN B CG    1 
ATOM   4470 O  OD1   . ASN B  1 270 ? -29.411 -52.109 -117.066 1.00 82.75  ? 271  ASN B OD1   1 
ATOM   4471 N  ND2   . ASN B  1 270 ? -30.300 -53.345 -115.409 1.00 83.32  ? 271  ASN B ND2   1 
ATOM   4472 N  N     . TYR B  1 271 ? -33.084 -50.947 -119.630 1.00 54.68  ? 272  TYR B N     1 
ATOM   4473 C  CA    . TYR B  1 271 ? -33.077 -50.274 -120.920 1.00 49.59  ? 272  TYR B CA    1 
ATOM   4474 C  C     . TYR B  1 271 ? -31.768 -49.521 -121.129 1.00 49.97  ? 272  TYR B C     1 
ATOM   4475 O  O     . TYR B  1 271 ? -31.378 -48.704 -120.289 1.00 47.68  ? 272  TYR B O     1 
ATOM   4476 C  CB    . TYR B  1 271 ? -34.261 -49.321 -120.978 1.00 44.16  ? 272  TYR B CB    1 
ATOM   4477 C  CG    . TYR B  1 271 ? -34.412 -48.568 -122.269 1.00 38.38  ? 272  TYR B CG    1 
ATOM   4478 C  CD1   . TYR B  1 271 ? -34.341 -49.223 -123.488 1.00 35.01  ? 272  TYR B CD1   1 
ATOM   4479 C  CD2   . TYR B  1 271 ? -34.666 -47.208 -122.267 1.00 39.76  ? 272  TYR B CD2   1 
ATOM   4480 C  CE1   . TYR B  1 271 ? -34.493 -48.542 -124.672 1.00 38.04  ? 272  TYR B CE1   1 
ATOM   4481 C  CE2   . TYR B  1 271 ? -34.829 -46.516 -123.448 1.00 41.63  ? 272  TYR B CE2   1 
ATOM   4482 C  CZ    . TYR B  1 271 ? -34.745 -47.185 -124.640 1.00 41.00  ? 272  TYR B CZ    1 
ATOM   4483 O  OH    . TYR B  1 271 ? -34.916 -46.497 -125.805 1.00 42.53  ? 272  TYR B OH    1 
ATOM   4484 N  N     . CYS B  1 272 ? -31.088 -49.819 -122.241 1.00 46.48  ? 273  CYS B N     1 
ATOM   4485 C  CA    . CYS B  1 272 ? -29.815 -49.202 -122.613 1.00 55.73  ? 273  CYS B CA    1 
ATOM   4486 C  C     . CYS B  1 272 ? -28.701 -49.546 -121.634 1.00 63.86  ? 273  CYS B C     1 
ATOM   4487 O  O     . CYS B  1 272 ? -27.569 -49.081 -121.791 1.00 65.41  ? 273  CYS B O     1 
ATOM   4488 C  CB    . CYS B  1 272 ? -29.932 -47.675 -122.705 1.00 58.91  ? 273  CYS B CB    1 
ATOM   4489 S  SG    . CYS B  1 272 ? -31.107 -47.035 -123.884 1.00 61.59  ? 273  CYS B SG    1 
ATOM   4490 N  N     . GLY B  1 273 ? -29.003 -50.355 -120.625 1.00 67.84  ? 274  GLY B N     1 
ATOM   4491 C  CA    . GLY B  1 273 ? -28.098 -50.531 -119.513 1.00 71.12  ? 274  GLY B CA    1 
ATOM   4492 C  C     . GLY B  1 273 ? -28.043 -49.371 -118.545 1.00 80.14  ? 274  GLY B C     1 
ATOM   4493 O  O     . GLY B  1 273 ? -27.364 -49.477 -117.517 1.00 84.17  ? 274  GLY B O     1 
ATOM   4494 N  N     . GLU B  1 274 ? -28.737 -48.267 -118.831 1.00 82.24  ? 275  GLU B N     1 
ATOM   4495 C  CA    . GLU B  1 274 ? -28.692 -47.109 -117.944 1.00 82.85  ? 275  GLU B CA    1 
ATOM   4496 C  C     . GLU B  1 274 ? -29.688 -47.247 -116.796 1.00 82.60  ? 275  GLU B C     1 
ATOM   4497 O  O     . GLU B  1 274 ? -29.332 -47.058 -115.627 1.00 87.28  ? 275  GLU B O     1 
ATOM   4498 C  CB    . GLU B  1 274 ? -28.961 -45.830 -118.740 1.00 81.90  ? 275  GLU B CB    1 
ATOM   4499 N  N     . PHE B  1 275 ? -30.936 -47.580 -117.111 1.00 74.67  ? 276  PHE B N     1 
ATOM   4500 C  CA    . PHE B  1 275 ? -31.977 -47.685 -116.103 1.00 66.33  ? 276  PHE B CA    1 
ATOM   4501 C  C     . PHE B  1 275 ? -31.943 -49.053 -115.436 1.00 63.19  ? 276  PHE B C     1 
ATOM   4502 O  O     . PHE B  1 275 ? -31.327 -50.002 -115.930 1.00 65.08  ? 276  PHE B O     1 
ATOM   4503 C  CB    . PHE B  1 275 ? -33.355 -47.451 -116.721 1.00 64.45  ? 276  PHE B CB    1 
ATOM   4504 C  CG    . PHE B  1 275 ? -33.443 -46.203 -117.542 1.00 64.12  ? 276  PHE B CG    1 
ATOM   4505 C  CD1   . PHE B  1 275 ? -33.121 -46.220 -118.888 1.00 60.02  ? 276  PHE B CD1   1 
ATOM   4506 C  CD2   . PHE B  1 275 ? -33.847 -45.010 -116.966 1.00 64.06  ? 276  PHE B CD2   1 
ATOM   4507 C  CE1   . PHE B  1 275 ? -33.193 -45.068 -119.641 1.00 60.91  ? 276  PHE B CE1   1 
ATOM   4508 C  CE2   . PHE B  1 275 ? -33.925 -43.854 -117.718 1.00 61.57  ? 276  PHE B CE2   1 
ATOM   4509 C  CZ    . PHE B  1 275 ? -33.600 -43.882 -119.054 1.00 58.47  ? 276  PHE B CZ    1 
ATOM   4510 N  N     . ASP B  1 276 ? -32.623 -49.148 -114.296 1.00 58.50  ? 277  ASP B N     1 
ATOM   4511 C  CA    . ASP B  1 276 ? -32.788 -50.412 -113.589 1.00 59.56  ? 277  ASP B CA    1 
ATOM   4512 C  C     . ASP B  1 276 ? -34.223 -50.921 -113.695 1.00 58.79  ? 277  ASP B C     1 
ATOM   4513 O  O     . ASP B  1 276 ? -34.700 -51.650 -112.824 1.00 58.45  ? 277  ASP B O     1 
ATOM   4514 C  CB    . ASP B  1 276 ? -32.374 -50.266 -112.126 1.00 57.66  ? 277  ASP B CB    1 
ATOM   4515 N  N     . ASN B  1 277 ? -34.915 -50.539 -114.763 1.00 54.88  ? 278  ASN B N     1 
ATOM   4516 C  CA    . ASN B  1 277 ? -36.329 -50.848 -114.911 1.00 47.62  ? 278  ASN B CA    1 
ATOM   4517 C  C     . ASN B  1 277 ? -36.549 -52.326 -115.196 1.00 41.33  ? 278  ASN B C     1 
ATOM   4518 O  O     . ASN B  1 277 ? -35.709 -53.003 -115.792 1.00 43.41  ? 278  ASN B O     1 
ATOM   4519 C  CB    . ASN B  1 277 ? -36.918 -50.038 -116.054 1.00 47.18  ? 278  ASN B CB    1 
ATOM   4520 C  CG    . ASN B  1 277 ? -36.455 -50.549 -117.397 1.00 48.35  ? 278  ASN B CG    1 
ATOM   4521 O  OD1   . ASN B  1 277 ? -35.305 -50.344 -117.782 1.00 50.22  ? 278  ASN B OD1   1 
ATOM   4522 N  ND2   . ASN B  1 277 ? -37.336 -51.237 -118.109 1.00 45.31  ? 278  ASN B ND2   1 
ATOM   4523 N  N     . ALA B  1 278 ? -37.702 -52.818 -114.779 1.00 40.73  ? 279  ALA B N     1 
ATOM   4524 C  CA    . ALA B  1 278 ? -38.167 -54.126 -115.206 1.00 41.89  ? 279  ALA B CA    1 
ATOM   4525 C  C     . ALA B  1 278 ? -38.892 -53.999 -116.540 1.00 38.40  ? 279  ALA B C     1 
ATOM   4526 O  O     . ALA B  1 278 ? -39.265 -52.906 -116.971 1.00 40.96  ? 279  ALA B O     1 
ATOM   4527 C  CB    . ALA B  1 278 ? -39.096 -54.752 -114.162 1.00 43.04  ? 279  ALA B CB    1 
ATOM   4528 N  N     . GLY B  1 279 ? -39.068 -55.135 -117.204 1.00 39.26  ? 280  GLY B N     1 
ATOM   4529 C  CA    . GLY B  1 279 ? -39.883 -55.225 -118.398 1.00 40.52  ? 280  GLY B CA    1 
ATOM   4530 C  C     . GLY B  1 279 ? -41.184 -55.926 -118.063 1.00 41.02  ? 280  GLY B C     1 
ATOM   4531 O  O     . GLY B  1 279 ? -41.247 -56.730 -117.128 1.00 46.35  ? 280  GLY B O     1 
ATOM   4532 N  N     . ALA B  1 280 ? -42.233 -55.614 -118.818 1.00 34.83  ? 281  ALA B N     1 
ATOM   4533 C  CA    . ALA B  1 280 ? -43.514 -56.258 -118.570 1.00 33.24  ? 281  ALA B CA    1 
ATOM   4534 C  C     . ALA B  1 280 ? -44.232 -56.538 -119.877 1.00 37.80  ? 281  ALA B C     1 
ATOM   4535 O  O     . ALA B  1 280 ? -44.005 -55.870 -120.891 1.00 42.51  ? 281  ALA B O     1 
ATOM   4536 C  CB    . ALA B  1 280 ? -44.429 -55.407 -117.682 1.00 30.84  ? 281  ALA B CB    1 
ATOM   4537 N  N     . MET B  1 281 ? -45.091 -57.546 -119.830 1.00 33.04  ? 282  MET B N     1 
ATOM   4538 C  CA    A MET B  1 281 ? -46.083 -57.824 -120.853 0.50 36.19  ? 282  MET B CA    1 
ATOM   4539 C  CA    B MET B  1 281 ? -46.097 -57.742 -120.853 0.50 36.12  ? 282  MET B CA    1 
ATOM   4540 C  C     . MET B  1 281 ? -47.430 -57.967 -120.164 1.00 33.80  ? 282  MET B C     1 
ATOM   4541 O  O     . MET B  1 281 ? -47.494 -58.373 -119.000 1.00 39.41  ? 282  MET B O     1 
ATOM   4542 C  CB    A MET B  1 281 ? -45.744 -59.103 -121.633 0.50 37.73  ? 282  MET B CB    1 
ATOM   4543 C  CB    B MET B  1 281 ? -45.754 -58.905 -121.806 0.50 38.15  ? 282  MET B CB    1 
ATOM   4544 C  CG    A MET B  1 281 ? -45.628 -60.333 -120.746 0.50 41.89  ? 282  MET B CG    1 
ATOM   4545 C  CG    B MET B  1 281 ? -46.011 -60.286 -121.272 0.50 41.66  ? 282  MET B CG    1 
ATOM   4546 S  SD    A MET B  1 281 ? -44.751 -61.703 -121.524 0.50 45.71  ? 282  MET B SD    1 
ATOM   4547 S  SD    B MET B  1 281 ? -45.707 -61.547 -122.529 0.50 42.20  ? 282  MET B SD    1 
ATOM   4548 C  CE    A MET B  1 281 ? -45.719 -61.909 -123.017 0.50 40.99  ? 282  MET B CE    1 
ATOM   4549 C  CE    B MET B  1 281 ? -44.969 -62.801 -121.487 0.50 44.15  ? 282  MET B CE    1 
ATOM   4550 N  N     . MET B  1 282 ? -48.495 -57.645 -120.880 1.00 31.26  ? 283  MET B N     1 
ATOM   4551 C  CA    . MET B  1 282 ? -49.846 -57.736 -120.348 1.00 32.09  ? 283  MET B CA    1 
ATOM   4552 C  C     . MET B  1 282 ? -50.564 -58.913 -120.989 1.00 34.09  ? 283  MET B C     1 
ATOM   4553 O  O     . MET B  1 282 ? -50.650 -58.990 -122.221 1.00 32.65  ? 283  MET B O     1 
ATOM   4554 C  CB    . MET B  1 282 ? -50.624 -56.442 -120.592 1.00 29.27  ? 283  MET B CB    1 
ATOM   4555 C  CG    . MET B  1 282 ? -51.965 -56.409 -119.880 1.00 30.47  ? 283  MET B CG    1 
ATOM   4556 S  SD    . MET B  1 282 ? -52.868 -54.857 -120.037 1.00 34.56  ? 283  MET B SD    1 
ATOM   4557 C  CE    . MET B  1 282 ? -53.384 -54.906 -121.754 1.00 32.32  ? 283  MET B CE    1 
ATOM   4558 N  N     . SER B  1 283 ? -51.079 -59.823 -120.150 1.00 33.89  ? 284  SER B N     1 
ATOM   4559 C  CA    . SER B  1 283 ? -51.904 -60.944 -120.593 1.00 33.71  ? 284  SER B CA    1 
ATOM   4560 C  C     . SER B  1 283 ? -53.371 -60.567 -120.475 1.00 33.22  ? 284  SER B C     1 
ATOM   4561 O  O     . SER B  1 283 ? -53.836 -60.209 -119.389 1.00 29.98  ? 284  SER B O     1 
ATOM   4562 C  CB    . SER B  1 283 ? -51.656 -62.207 -119.764 1.00 40.70  ? 284  SER B CB    1 
ATOM   4563 O  OG    . SER B  1 283 ? -50.430 -62.815 -120.085 1.00 52.54  ? 284  SER B OG    1 
ATOM   4564 N  N     . VAL B  1 284 ? -54.100 -60.686 -121.576 1.00 29.36  ? 285  VAL B N     1 
ATOM   4565 C  CA    . VAL B  1 284 ? -55.539 -60.467 -121.604 1.00 37.52  ? 285  VAL B CA    1 
ATOM   4566 C  C     . VAL B  1 284 ? -56.187 -61.819 -121.848 1.00 40.55  ? 285  VAL B C     1 
ATOM   4567 O  O     . VAL B  1 284 ? -55.925 -62.449 -122.878 1.00 41.84  ? 285  VAL B O     1 
ATOM   4568 C  CB    . VAL B  1 284 ? -55.939 -59.466 -122.698 1.00 29.11  ? 285  VAL B CB    1 
ATOM   4569 C  CG1   . VAL B  1 284 ? -57.425 -59.091 -122.575 1.00 29.36  ? 285  VAL B CG1   1 
ATOM   4570 C  CG2   . VAL B  1 284 ? -55.033 -58.248 -122.653 1.00 33.05  ? 285  VAL B CG2   1 
ATOM   4571 N  N     . ASP B  1 285 ? -57.019 -62.276 -120.907 1.00 41.30  ? 286  ASP B N     1 
ATOM   4572 C  CA    . ASP B  1 285 ? -57.662 -63.569 -121.088 1.00 42.77  ? 286  ASP B CA    1 
ATOM   4573 C  C     . ASP B  1 285 ? -58.999 -63.375 -121.797 1.00 44.05  ? 286  ASP B C     1 
ATOM   4574 O  O     . ASP B  1 285 ? -59.387 -62.256 -122.147 1.00 37.81  ? 286  ASP B O     1 
ATOM   4575 C  CB    . ASP B  1 285 ? -57.800 -64.325 -119.757 1.00 43.94  ? 286  ASP B CB    1 
ATOM   4576 C  CG    . ASP B  1 285 ? -58.876 -63.768 -118.829 1.00 44.65  ? 286  ASP B CG    1 
ATOM   4577 O  OD1   . ASP B  1 285 ? -59.693 -62.908 -119.210 1.00 46.16  ? 286  ASP B OD1   1 
ATOM   4578 O  OD2   . ASP B  1 285 ? -58.879 -64.203 -117.663 1.00 48.31  ? 286  ASP B OD2   1 
ATOM   4579 N  N     . GLU B  1 286 ? -59.720 -64.485 -121.996 1.00 42.49  ? 287  GLU B N     1 
ATOM   4580 C  CA    . GLU B  1 286 ? -60.907 -64.474 -122.842 1.00 45.32  ? 287  GLU B CA    1 
ATOM   4581 C  C     . GLU B  1 286 ? -62.032 -63.613 -122.287 1.00 45.13  ? 287  GLU B C     1 
ATOM   4582 O  O     . GLU B  1 286 ? -62.970 -63.304 -123.030 1.00 44.29  ? 287  GLU B O     1 
ATOM   4583 C  CB    . GLU B  1 286 ? -61.403 -65.902 -123.066 1.00 52.35  ? 287  GLU B CB    1 
ATOM   4584 C  CG    . GLU B  1 286 ? -61.548 -66.702 -121.795 1.00 65.70  ? 287  GLU B CG    1 
ATOM   4585 C  CD    . GLU B  1 286 ? -61.569 -68.197 -122.048 1.00 80.45  ? 287  GLU B CD    1 
ATOM   4586 O  OE1   . GLU B  1 286 ? -62.027 -68.611 -123.137 1.00 82.52  ? 287  GLU B OE1   1 
ATOM   4587 O  OE2   . GLU B  1 286 ? -61.140 -68.959 -121.153 1.00 86.10  ? 287  GLU B OE2   1 
ATOM   4588 N  N     . THR B  1 287 ? -61.953 -63.192 -121.025 1.00 43.96  ? 288  THR B N     1 
ATOM   4589 C  CA    . THR B  1 287 ? -62.960 -62.314 -120.443 1.00 46.21  ? 288  THR B CA    1 
ATOM   4590 C  C     . THR B  1 287 ? -62.498 -60.864 -120.319 1.00 46.95  ? 288  THR B C     1 
ATOM   4591 O  O     . THR B  1 287 ? -63.180 -60.064 -119.670 1.00 53.91  ? 288  THR B O     1 
ATOM   4592 C  CB    . THR B  1 287 ? -63.379 -62.840 -119.070 1.00 45.59  ? 288  THR B CB    1 
ATOM   4593 O  OG1   . THR B  1 287 ? -62.262 -62.767 -118.176 1.00 45.80  ? 288  THR B OG1   1 
ATOM   4594 C  CG2   . THR B  1 287 ? -63.845 -64.287 -119.178 1.00 42.98  ? 288  THR B CG2   1 
ATOM   4595 N  N     . LEU B  1 288 ? -61.362 -60.509 -120.921 1.00 43.37  ? 289  LEU B N     1 
ATOM   4596 C  CA    . LEU B  1 288 ? -60.773 -59.172 -120.802 1.00 41.94  ? 289  LEU B CA    1 
ATOM   4597 C  C     . LEU B  1 288 ? -60.306 -58.881 -119.381 1.00 44.42  ? 289  LEU B C     1 
ATOM   4598 O  O     . LEU B  1 288 ? -60.284 -57.731 -118.946 1.00 43.11  ? 289  LEU B O     1 
ATOM   4599 C  CB    . LEU B  1 288 ? -61.733 -58.077 -121.266 1.00 40.12  ? 289  LEU B CB    1 
ATOM   4600 C  CG    . LEU B  1 288 ? -62.252 -58.201 -122.690 1.00 41.05  ? 289  LEU B CG    1 
ATOM   4601 C  CD1   . LEU B  1 288 ? -62.899 -56.879 -123.106 1.00 35.95  ? 289  LEU B CD1   1 
ATOM   4602 C  CD2   . LEU B  1 288 ? -61.120 -58.597 -123.627 1.00 39.45  ? 289  LEU B CD2   1 
ATOM   4603 N  N     . MET B  1 289 ? -59.956 -59.928 -118.650 1.00 44.86  ? 290  MET B N     1 
ATOM   4604 C  CA    . MET B  1 289 ? -59.239 -59.803 -117.390 1.00 42.63  ? 290  MET B CA    1 
ATOM   4605 C  C     . MET B  1 289 ? -57.753 -59.676 -117.696 1.00 38.49  ? 290  MET B C     1 
ATOM   4606 O  O     . MET B  1 289 ? -57.172 -60.564 -118.332 1.00 44.52  ? 290  MET B O     1 
ATOM   4607 C  CB    . MET B  1 289 ? -59.515 -61.028 -116.519 1.00 50.86  ? 290  MET B CB    1 
ATOM   4608 C  CG    . MET B  1 289 ? -58.530 -61.229 -115.401 1.00 58.16  ? 290  MET B CG    1 
ATOM   4609 S  SD    . MET B  1 289 ? -58.727 -59.938 -114.177 1.00 68.44  ? 290  MET B SD    1 
ATOM   4610 C  CE    . MET B  1 289 ? -60.449 -60.163 -113.743 1.00 69.20  ? 290  MET B CE    1 
ATOM   4611 N  N     . CYS B  1 290 ? -57.136 -58.585 -117.259 1.00 32.78  ? 291  CYS B N     1 
ATOM   4612 C  CA    . CYS B  1 290 ? -55.757 -58.277 -117.617 1.00 34.14  ? 291  CYS B CA    1 
ATOM   4613 C  C     . CYS B  1 290 ? -54.840 -58.480 -116.420 1.00 39.80  ? 291  CYS B C     1 
ATOM   4614 O  O     . CYS B  1 290 ? -55.164 -58.075 -115.298 1.00 43.12  ? 291  CYS B O     1 
ATOM   4615 C  CB    . CYS B  1 290 ? -55.627 -56.837 -118.128 1.00 35.89  ? 291  CYS B CB    1 
ATOM   4616 S  SG    . CYS B  1 290 ? -56.650 -56.444 -119.566 1.00 40.13  ? 291  CYS B SG    1 
ATOM   4617 N  N     . SER B  1 291 ? -53.695 -59.098 -116.661 1.00 39.54  ? 292  SER B N     1 
ATOM   4618 C  CA    . SER B  1 291 ? -52.677 -59.257 -115.640 1.00 42.06  ? 292  SER B CA    1 
ATOM   4619 C  C     . SER B  1 291 ? -51.316 -58.985 -116.266 1.00 39.46  ? 292  SER B C     1 
ATOM   4620 O  O     . SER B  1 291 ? -51.160 -58.971 -117.492 1.00 36.32  ? 292  SER B O     1 
ATOM   4621 C  CB    . SER B  1 291 ? -52.717 -60.656 -115.025 1.00 40.86  ? 292  SER B CB    1 
ATOM   4622 O  OG    . SER B  1 291 ? -52.351 -61.614 -115.991 1.00 45.08  ? 292  SER B OG    1 
ATOM   4623 N  N     . PHE B  1 292 ? -50.320 -58.781 -115.414 1.00 35.05  ? 293  PHE B N     1 
ATOM   4624 C  CA    . PHE B  1 292 ? -49.019 -58.348 -115.882 1.00 35.60  ? 293  PHE B CA    1 
ATOM   4625 C  C     . PHE B  1 292 ? -47.965 -59.383 -115.530 1.00 40.36  ? 293  PHE B C     1 
ATOM   4626 O  O     . PHE B  1 292 ? -47.897 -59.841 -114.388 1.00 42.34  ? 293  PHE B O     1 
ATOM   4627 C  CB    . PHE B  1 292 ? -48.687 -56.970 -115.311 1.00 35.60  ? 293  PHE B CB    1 
ATOM   4628 C  CG    . PHE B  1 292 ? -49.645 -55.900 -115.766 1.00 40.88  ? 293  PHE B CG    1 
ATOM   4629 C  CD1   . PHE B  1 292 ? -49.455 -55.247 -116.979 1.00 42.33  ? 293  PHE B CD1   1 
ATOM   4630 C  CD2   . PHE B  1 292 ? -50.754 -55.570 -115.004 1.00 45.22  ? 293  PHE B CD2   1 
ATOM   4631 C  CE1   . PHE B  1 292 ? -50.349 -54.268 -117.414 1.00 40.34  ? 293  PHE B CE1   1 
ATOM   4632 C  CE2   . PHE B  1 292 ? -51.649 -54.594 -115.433 1.00 48.30  ? 293  PHE B CE2   1 
ATOM   4633 C  CZ    . PHE B  1 292 ? -51.445 -53.939 -116.642 1.00 40.55  ? 293  PHE B CZ    1 
ATOM   4634 N  N     . GLN B  1 293 ? -47.181 -59.778 -116.531 1.00 39.16  ? 294  GLN B N     1 
ATOM   4635 C  CA    A GLN B  1 293 ? -46.058 -60.690 -116.351 0.50 41.61  ? 294  GLN B CA    1 
ATOM   4636 C  CA    B GLN B  1 293 ? -46.059 -60.688 -116.347 0.50 41.61  ? 294  GLN B CA    1 
ATOM   4637 C  C     . GLN B  1 293 ? -44.769 -59.880 -116.424 1.00 44.21  ? 294  GLN B C     1 
ATOM   4638 O  O     . GLN B  1 293 ? -44.527 -59.176 -117.416 1.00 40.14  ? 294  GLN B O     1 
ATOM   4639 C  CB    A GLN B  1 293 ? -46.067 -61.791 -117.411 0.50 43.09  ? 294  GLN B CB    1 
ATOM   4640 C  CB    B GLN B  1 293 ? -46.073 -61.796 -117.398 0.50 43.09  ? 294  GLN B CB    1 
ATOM   4641 C  CG    A GLN B  1 293 ? -47.363 -62.597 -117.486 0.50 43.74  ? 294  GLN B CG    1 
ATOM   4642 C  CG    B GLN B  1 293 ? -47.141 -62.863 -117.170 0.50 43.87  ? 294  GLN B CG    1 
ATOM   4643 C  CD    A GLN B  1 293 ? -47.236 -63.837 -118.356 0.50 42.54  ? 294  GLN B CD    1 
ATOM   4644 C  CD    B GLN B  1 293 ? -48.549 -62.344 -117.395 0.50 45.51  ? 294  GLN B CD    1 
ATOM   4645 O  OE1   A GLN B  1 293 ? -47.571 -63.820 -119.540 0.50 40.42  ? 294  GLN B OE1   1 
ATOM   4646 O  OE1   B GLN B  1 293 ? -48.804 -61.609 -118.351 0.50 42.41  ? 294  GLN B OE1   1 
ATOM   4647 N  NE2   A GLN B  1 293 ? -46.742 -64.921 -117.770 0.50 43.30  ? 294  GLN B NE2   1 
ATOM   4648 N  NE2   B GLN B  1 293 ? -49.471 -62.715 -116.508 0.50 48.28  ? 294  GLN B NE2   1 
ATOM   4649 N  N     . ILE B  1 294 ? -43.954 -59.974 -115.380 1.00 42.45  ? 295  ILE B N     1 
ATOM   4650 C  CA    . ILE B  1 294 ? -42.789 -59.119 -115.205 1.00 43.75  ? 295  ILE B CA    1 
ATOM   4651 C  C     . ILE B  1 294 ? -41.532 -59.865 -115.615 1.00 44.86  ? 295  ILE B C     1 
ATOM   4652 O  O     . ILE B  1 294 ? -41.373 -61.051 -115.317 1.00 45.03  ? 295  ILE B O     1 
ATOM   4653 C  CB    . ILE B  1 294 ? -42.695 -58.638 -113.746 1.00 46.09  ? 295  ILE B CB    1 
ATOM   4654 C  CG1   . ILE B  1 294 ? -44.020 -58.007 -113.316 1.00 44.56  ? 295  ILE B CG1   1 
ATOM   4655 C  CG2   . ILE B  1 294 ? -41.539 -57.658 -113.564 1.00 45.24  ? 295  ILE B CG2   1 
ATOM   4656 C  CD1   . ILE B  1 294 ? -44.443 -56.822 -114.183 1.00 41.78  ? 295  ILE B CD1   1 
ATOM   4657 N  N     . LEU B  1 295 ? -40.646 -59.166 -116.319 1.00 44.62  ? 296  LEU B N     1 
ATOM   4658 C  CA    . LEU B  1 295 ? -39.297 -59.633 -116.619 1.00 44.40  ? 296  LEU B CA    1 
ATOM   4659 C  C     . LEU B  1 295 ? -38.350 -58.883 -115.697 1.00 46.88  ? 296  LEU B C     1 
ATOM   4660 O  O     . LEU B  1 295 ? -38.240 -57.656 -115.783 1.00 45.36  ? 296  LEU B O     1 
ATOM   4661 C  CB    . LEU B  1 295 ? -38.936 -59.371 -118.077 1.00 48.01  ? 296  LEU B CB    1 
ATOM   4662 C  CG    . LEU B  1 295 ? -39.054 -60.510 -119.076 1.00 54.91  ? 296  LEU B CG    1 
ATOM   4663 C  CD1   . LEU B  1 295 ? -40.475 -61.029 -119.106 1.00 60.14  ? 296  LEU B CD1   1 
ATOM   4664 C  CD2   . LEU B  1 295 ? -38.610 -60.026 -120.451 1.00 53.89  ? 296  LEU B CD2   1 
ATOM   4665 N  N     . LYS B  1 296 ? -37.697 -59.595 -114.827 1.00 51.92  ? 297  LYS B N     1 
ATOM   4666 C  CA    . LYS B  1 296 ? -36.769 -58.824 -114.016 1.00 59.23  ? 297  LYS B CA    1 
ATOM   4667 C  C     . LYS B  1 296 ? -35.429 -58.697 -114.736 1.00 61.41  ? 297  LYS B C     1 
ATOM   4668 O  O     . LYS B  1 296 ? -35.089 -59.533 -115.578 1.00 60.96  ? 297  LYS B O     1 
ATOM   4669 C  CB    . LYS B  1 296 ? -36.570 -59.490 -112.654 1.00 65.53  ? 297  LYS B CB    1 
ATOM   4670 C  CG    . LYS B  1 296 ? -37.861 -59.709 -111.868 1.00 70.67  ? 297  LYS B CG    1 
ATOM   4671 C  CD    . LYS B  1 296 ? -37.606 -59.841 -110.369 1.00 76.31  ? 297  LYS B CD    1 
ATOM   4672 C  CE    . LYS B  1 296 ? -36.729 -58.705 -109.853 1.00 78.86  ? 297  LYS B CE    1 
ATOM   4673 N  NZ    . LYS B  1 296 ? -37.190 -58.161 -108.541 1.00 79.37  ? 297  LYS B NZ    1 
ATOM   4674 N  N     . PRO B  1 297 ? -34.645 -57.650 -114.446 1.00 67.61  ? 298  PRO B N     1 
ATOM   4675 C  CA    . PRO B  1 297 ? -33.333 -57.475 -115.087 1.00 70.84  ? 298  PRO B CA    1 
ATOM   4676 C  C     . PRO B  1 297 ? -32.371 -58.647 -114.846 1.00 73.28  ? 298  PRO B C     1 
ATOM   4677 O  O     . PRO B  1 297 ? -32.004 -59.358 -115.794 1.00 67.98  ? 298  PRO B O     1 
ATOM   4678 C  CB    . PRO B  1 297 ? -32.798 -56.195 -114.440 1.00 69.14  ? 298  PRO B CB    1 
ATOM   4679 C  CG    . PRO B  1 297 ? -34.020 -55.450 -114.013 1.00 68.05  ? 298  PRO B CG    1 
ATOM   4680 C  CD    . PRO B  1 297 ? -35.002 -56.503 -113.592 1.00 67.31  ? 298  PRO B CD    1 
ATOM   4681 N  N     . ARG B  1 316 ? -39.887 -66.265 -91.633  1.00 88.34  ? 317  ARG B N     1 
ATOM   4682 C  CA    . ARG B  1 316 ? -39.097 -65.924 -90.454  1.00 87.14  ? 317  ARG B CA    1 
ATOM   4683 C  C     . ARG B  1 316 ? -37.784 -65.246 -90.843  1.00 83.89  ? 317  ARG B C     1 
ATOM   4684 O  O     . ARG B  1 316 ? -37.019 -65.786 -91.641  1.00 82.21  ? 317  ARG B O     1 
ATOM   4685 C  CB    . ARG B  1 316 ? -38.812 -67.177 -89.622  1.00 86.20  ? 317  ARG B CB    1 
ATOM   4686 C  CG    . ARG B  1 316 ? -38.384 -66.895 -88.195  1.00 85.48  ? 317  ARG B CG    1 
ATOM   4687 C  CD    . ARG B  1 316 ? -37.371 -67.918 -87.701  1.00 86.88  ? 317  ARG B CD    1 
ATOM   4688 N  NE    . ARG B  1 316 ? -36.009 -67.566 -88.088  1.00 88.55  ? 317  ARG B NE    1 
ATOM   4689 C  CZ    . ARG B  1 316 ? -34.929 -68.267 -87.754  1.00 87.48  ? 317  ARG B CZ    1 
ATOM   4690 N  NH1   . ARG B  1 316 ? -35.049 -69.370 -87.025  1.00 84.33  ? 317  ARG B NH1   1 
ATOM   4691 N  NH2   . ARG B  1 316 ? -33.727 -67.867 -88.154  1.00 87.42  ? 317  ARG B NH2   1 
ATOM   4692 N  N     . PRO B  1 317 ? -37.525 -64.069 -90.278  1.00 80.93  ? 318  PRO B N     1 
ATOM   4693 C  CA    . PRO B  1 317 ? -36.263 -63.375 -90.559  1.00 79.67  ? 318  PRO B CA    1 
ATOM   4694 C  C     . PRO B  1 317 ? -35.070 -64.125 -89.982  1.00 79.77  ? 318  PRO B C     1 
ATOM   4695 O  O     . PRO B  1 317 ? -35.194 -64.959 -89.084  1.00 79.66  ? 318  PRO B O     1 
ATOM   4696 C  CB    . PRO B  1 317 ? -36.442 -62.012 -89.877  1.00 76.81  ? 318  PRO B CB    1 
ATOM   4697 C  CG    . PRO B  1 317 ? -37.915 -61.888 -89.618  1.00 77.85  ? 318  PRO B CG    1 
ATOM   4698 C  CD    . PRO B  1 317 ? -38.405 -63.282 -89.401  1.00 80.50  ? 318  PRO B CD    1 
ATOM   4699 N  N     . ILE B  1 318 ? -33.895 -63.815 -90.517  1.00 76.27  ? 319  ILE B N     1 
ATOM   4700 C  CA    . ILE B  1 318 ? -32.670 -64.464 -90.068  1.00 74.72  ? 319  ILE B CA    1 
ATOM   4701 C  C     . ILE B  1 318 ? -32.221 -63.839 -88.753  1.00 72.60  ? 319  ILE B C     1 
ATOM   4702 O  O     . ILE B  1 318 ? -32.263 -62.615 -88.578  1.00 72.76  ? 319  ILE B O     1 
ATOM   4703 C  CB    . ILE B  1 318 ? -31.579 -64.380 -91.153  1.00 76.59  ? 319  ILE B CB    1 
ATOM   4704 C  CG1   . ILE B  1 318 ? -30.370 -65.234 -90.762  1.00 82.45  ? 319  ILE B CG1   1 
ATOM   4705 C  CG2   . ILE B  1 318 ? -31.166 -62.936 -91.407  1.00 74.85  ? 319  ILE B CG2   1 
ATOM   4706 C  CD1   . ILE B  1 318 ? -30.736 -66.618 -90.226  1.00 86.95  ? 319  ILE B CD1   1 
ATOM   4707 N  N     . THR B  1 319 ? -31.805 -64.692 -87.805  1.00 67.24  ? 320  THR B N     1 
ATOM   4708 C  CA    . THR B  1 319 ? -31.402 -64.211 -86.495  1.00 70.21  ? 320  THR B CA    1 
ATOM   4709 C  C     . THR B  1 319 ? -29.976 -63.665 -86.536  1.00 70.35  ? 320  THR B C     1 
ATOM   4710 O  O     . THR B  1 319 ? -29.170 -64.075 -87.375  1.00 68.93  ? 320  THR B O     1 
ATOM   4711 C  CB    . THR B  1 319 ? -31.495 -65.329 -85.456  1.00 71.35  ? 320  THR B CB    1 
ATOM   4712 O  OG1   . THR B  1 319 ? -30.567 -66.376 -85.779  1.00 71.98  ? 320  THR B OG1   1 
ATOM   4713 C  CG2   . THR B  1 319 ? -32.902 -65.892 -85.411  1.00 69.66  ? 320  THR B CG2   1 
ATOM   4714 N  N     . PRO B  1 320 ? -29.643 -62.738 -85.643  1.00 72.81  ? 321  PRO B N     1 
ATOM   4715 C  CA    . PRO B  1 320 ? -28.273 -62.222 -85.587  1.00 76.06  ? 321  PRO B CA    1 
ATOM   4716 C  C     . PRO B  1 320 ? -27.319 -63.293 -85.093  1.00 79.68  ? 321  PRO B C     1 
ATOM   4717 O  O     . PRO B  1 320 ? -27.749 -64.288 -84.489  1.00 74.79  ? 321  PRO B O     1 
ATOM   4718 C  CB    . PRO B  1 320 ? -28.372 -61.058 -84.586  1.00 74.12  ? 321  PRO B CB    1 
ATOM   4719 C  CG    . PRO B  1 320 ? -29.830 -60.761 -84.461  1.00 71.87  ? 321  PRO B CG    1 
ATOM   4720 C  CD    . PRO B  1 320 ? -30.526 -62.061 -84.680  1.00 69.43  ? 321  PRO B CD    1 
ATOM   4721 N  N     . PRO B  1 321 ? -26.020 -63.138 -85.336  1.00 86.47  ? 322  PRO B N     1 
ATOM   4722 C  CA    . PRO B  1 321 ? -25.053 -64.102 -84.802  1.00 89.40  ? 322  PRO B CA    1 
ATOM   4723 C  C     . PRO B  1 321 ? -24.950 -64.008 -83.287  1.00 90.01  ? 322  PRO B C     1 
ATOM   4724 O  O     . PRO B  1 321 ? -25.231 -62.974 -82.675  1.00 89.27  ? 322  PRO B O     1 
ATOM   4725 C  CB    . PRO B  1 321 ? -23.737 -63.697 -85.473  1.00 89.57  ? 322  PRO B CB    1 
ATOM   4726 C  CG    . PRO B  1 321 ? -23.914 -62.253 -85.800  1.00 88.55  ? 322  PRO B CG    1 
ATOM   4727 C  CD    . PRO B  1 321 ? -25.368 -62.093 -86.145  1.00 87.27  ? 322  PRO B CD    1 
ATOM   4728 N  N     . ARG B  1 322 ? -24.536 -65.122 -82.686  1.00 89.47  ? 323  ARG B N     1 
ATOM   4729 C  CA    . ARG B  1 322 ? -24.320 -65.200 -81.250  1.00 87.17  ? 323  ARG B CA    1 
ATOM   4730 C  C     . ARG B  1 322 ? -22.936 -64.668 -80.886  1.00 92.39  ? 323  ARG B C     1 
ATOM   4731 O  O     . ARG B  1 322 ? -22.062 -64.491 -81.738  1.00 94.99  ? 323  ARG B O     1 
ATOM   4732 C  CB    . ARG B  1 322 ? -24.472 -66.638 -80.764  1.00 83.45  ? 323  ARG B CB    1 
ATOM   4733 C  CG    . ARG B  1 322 ? -25.895 -67.164 -80.789  1.00 81.21  ? 323  ARG B CG    1 
ATOM   4734 C  CD    . ARG B  1 322 ? -26.796 -66.365 -79.865  1.00 77.19  ? 323  ARG B CD    1 
ATOM   4735 N  NE    . ARG B  1 322 ? -26.248 -66.248 -78.518  1.00 73.52  ? 323  ARG B NE    1 
ATOM   4736 C  CZ    . ARG B  1 322 ? -26.482 -67.108 -77.531  1.00 73.85  ? 323  ARG B CZ    1 
ATOM   4737 N  NH1   . ARG B  1 322 ? -25.941 -66.908 -76.336  1.00 73.89  ? 323  ARG B NH1   1 
ATOM   4738 N  NH2   . ARG B  1 322 ? -27.259 -68.164 -77.732  1.00 73.84  ? 323  ARG B NH2   1 
ATOM   4739 N  N     . ASN B  1 323 ? -22.741 -64.433 -79.590  1.00 96.60  ? 324  ASN B N     1 
ATOM   4740 C  CA    . ASN B  1 323 ? -21.497 -63.880 -79.050  1.00 98.58  ? 324  ASN B CA    1 
ATOM   4741 C  C     . ASN B  1 323 ? -21.155 -62.543 -79.705  1.00 101.62 ? 324  ASN B C     1 
ATOM   4742 O  O     . ASN B  1 323 ? -22.042 -61.735 -79.989  1.00 101.62 ? 324  ASN B O     1 
ATOM   4743 C  CB    . ASN B  1 323 ? -20.340 -64.869 -79.222  1.00 94.32  ? 324  ASN B CB    1 
ATOM   4744 N  N     . MET C  2 6   ? -68.710 -57.868 -122.200 1.00 59.78  ? 920  MET C N     1 
ATOM   4745 C  CA    . MET C  2 6   ? -67.314 -57.941 -121.766 1.00 60.71  ? 920  MET C CA    1 
ATOM   4746 C  C     . MET C  2 6   ? -66.752 -56.567 -121.418 1.00 49.68  ? 920  MET C C     1 
ATOM   4747 O  O     . MET C  2 6   ? -66.865 -55.625 -122.198 1.00 51.72  ? 920  MET C O     1 
ATOM   4748 C  CB    . MET C  2 6   ? -66.439 -58.583 -122.845 1.00 65.15  ? 920  MET C CB    1 
ATOM   4749 C  CG    . MET C  2 6   ? -66.484 -60.099 -122.885 1.00 69.01  ? 920  MET C CG    1 
ATOM   4750 S  SD    . MET C  2 6   ? -65.150 -60.773 -123.897 1.00 70.31  ? 920  MET C SD    1 
ATOM   4751 C  CE    . MET C  2 6   ? -65.438 -59.958 -125.467 1.00 62.66  ? 920  MET C CE    1 
ATOM   4752 N  N     . ARG C  2 7   ? -66.146 -56.466 -120.241 1.00 43.59  ? 921  ARG C N     1 
ATOM   4753 C  CA    . ARG C  2 7   ? -65.492 -55.250 -119.793 1.00 46.20  ? 921  ARG C CA    1 
ATOM   4754 C  C     . ARG C  2 7   ? -64.073 -55.583 -119.353 1.00 50.75  ? 921  ARG C C     1 
ATOM   4755 O  O     . ARG C  2 7   ? -63.804 -56.682 -118.862 1.00 42.01  ? 921  ARG C O     1 
ATOM   4756 C  CB    . ARG C  2 7   ? -66.259 -54.582 -118.646 1.00 49.85  ? 921  ARG C CB    1 
ATOM   4757 C  CG    . ARG C  2 7   ? -67.711 -54.272 -118.976 1.00 55.42  ? 921  ARG C CG    1 
ATOM   4758 C  CD    . ARG C  2 7   ? -67.840 -53.198 -120.057 1.00 58.27  ? 921  ARG C CD    1 
ATOM   4759 N  NE    . ARG C  2 7   ? -67.325 -51.905 -119.625 1.00 63.39  ? 921  ARG C NE    1 
ATOM   4760 C  CZ    . ARG C  2 7   ? -67.727 -50.739 -120.118 1.00 69.70  ? 921  ARG C CZ    1 
ATOM   4761 N  NH1   . ARG C  2 7   ? -67.195 -49.608 -119.664 1.00 67.10  ? 921  ARG C NH1   1 
ATOM   4762 N  NH2   . ARG C  2 7   ? -68.662 -50.703 -121.064 1.00 69.77  ? 921  ARG C NH2   1 
ATOM   4763 N  N     . VAL C  2 8   ? -63.166 -54.622 -119.552 1.00 44.25  ? 922  VAL C N     1 
ATOM   4764 C  CA    . VAL C  2 8   ? -61.782 -54.779 -119.120 1.00 42.30  ? 922  VAL C CA    1 
ATOM   4765 C  C     . VAL C  2 8   ? -61.724 -54.738 -117.600 1.00 40.81  ? 922  VAL C C     1 
ATOM   4766 O  O     . VAL C  2 8   ? -62.237 -53.809 -116.967 1.00 48.08  ? 922  VAL C O     1 
ATOM   4767 C  CB    . VAL C  2 8   ? -60.896 -53.681 -119.740 1.00 47.21  ? 922  VAL C CB    1 
ATOM   4768 C  CG1   . VAL C  2 8   ? -59.520 -53.646 -119.080 1.00 38.98  ? 922  VAL C CG1   1 
ATOM   4769 C  CG2   . VAL C  2 8   ? -60.756 -53.887 -121.240 1.00 44.24  ? 922  VAL C CG2   1 
ATOM   4770 N  N     . LYS C  2 9   ? -61.089 -55.740 -117.006 1.00 41.39  ? 923  LYS C N     1 
ATOM   4771 C  CA    . LYS C  2 9   ? -60.849 -55.786 -115.573 1.00 43.84  ? 923  LYS C CA    1 
ATOM   4772 C  C     . LYS C  2 9   ? -59.387 -56.129 -115.338 1.00 42.83  ? 923  LYS C C     1 
ATOM   4773 O  O     . LYS C  2 9   ? -58.759 -56.820 -116.145 1.00 43.14  ? 923  LYS C O     1 
ATOM   4774 C  CB    . LYS C  2 9   ? -61.748 -56.837 -114.862 1.00 48.95  ? 923  LYS C CB    1 
ATOM   4775 C  CG    . LYS C  2 9   ? -63.237 -56.705 -115.162 1.00 50.77  ? 923  LYS C CG    1 
ATOM   4776 C  CD    . LYS C  2 9   ? -63.978 -57.997 -114.868 1.00 57.65  ? 923  LYS C CD    1 
ATOM   4777 C  CE    . LYS C  2 9   ? -63.596 -59.118 -115.841 1.00 58.55  ? 923  LYS C CE    1 
ATOM   4778 N  NZ    . LYS C  2 9   ? -64.190 -58.926 -117.194 1.00 55.44  ? 923  LYS C NZ    1 
ATOM   4779 N  N     . PHE C  2 10  ? -58.844 -55.647 -114.230 1.00 43.56  ? 924  PHE C N     1 
ATOM   4780 C  CA    . PHE C  2 10  ? -57.473 -55.970 -113.877 1.00 44.20  ? 924  PHE C CA    1 
ATOM   4781 C  C     . PHE C  2 10  ? -57.453 -57.011 -112.766 1.00 48.81  ? 924  PHE C C     1 
ATOM   4782 O  O     . PHE C  2 10  ? -58.441 -57.220 -112.061 1.00 49.43  ? 924  PHE C O     1 
ATOM   4783 C  CB    . PHE C  2 10  ? -56.703 -54.705 -113.493 1.00 42.58  ? 924  PHE C CB    1 
ATOM   4784 C  CG    . PHE C  2 10  ? -56.464 -53.795 -114.664 1.00 44.58  ? 924  PHE C CG    1 
ATOM   4785 C  CD1   . PHE C  2 10  ? -55.624 -54.191 -115.697 1.00 44.76  ? 924  PHE C CD1   1 
ATOM   4786 C  CD2   . PHE C  2 10  ? -57.134 -52.590 -114.774 1.00 41.84  ? 924  PHE C CD2   1 
ATOM   4787 C  CE1   . PHE C  2 10  ? -55.434 -53.383 -116.802 1.00 43.86  ? 924  PHE C CE1   1 
ATOM   4788 C  CE2   . PHE C  2 10  ? -56.941 -51.773 -115.868 1.00 43.68  ? 924  PHE C CE2   1 
ATOM   4789 C  CZ    . PHE C  2 10  ? -56.091 -52.167 -116.883 1.00 43.46  ? 924  PHE C CZ    1 
ATOM   4790 N  N     . ASN C  2 11  ? -56.326 -57.697 -112.663 1.00 52.92  ? 925  ASN C N     1 
ATOM   4791 C  CA    . ASN C  2 11  ? -56.163 -58.750 -111.675 1.00 55.99  ? 925  ASN C CA    1 
ATOM   4792 C  C     . ASN C  2 11  ? -56.440 -58.196 -110.276 1.00 51.28  ? 925  ASN C C     1 
ATOM   4793 O  O     . ASN C  2 11  ? -56.060 -57.058 -109.974 1.00 46.15  ? 925  ASN C O     1 
ATOM   4794 C  CB    . ASN C  2 11  ? -54.743 -59.310 -111.775 1.00 56.47  ? 925  ASN C CB    1 
ATOM   4795 C  CG    . ASN C  2 11  ? -54.432 -60.299 -110.701 1.00 65.63  ? 925  ASN C CG    1 
ATOM   4796 O  OD1   . ASN C  2 11  ? -53.664 -60.012 -109.786 1.00 65.96  ? 925  ASN C OD1   1 
ATOM   4797 N  ND2   . ASN C  2 11  ? -55.012 -61.486 -110.806 1.00 76.70  ? 925  ASN C ND2   1 
ATOM   4798 N  N     . PRO C  2 12  ? -57.142 -58.943 -109.419 1.00 50.75  ? 926  PRO C N     1 
ATOM   4799 C  CA    . PRO C  2 12  ? -57.454 -58.420 -108.076 1.00 53.22  ? 926  PRO C CA    1 
ATOM   4800 C  C     . PRO C  2 12  ? -56.239 -57.968 -107.288 1.00 50.45  ? 926  PRO C C     1 
ATOM   4801 O  O     . PRO C  2 12  ? -56.276 -56.894 -106.675 1.00 48.92  ? 926  PRO C O     1 
ATOM   4802 C  CB    . PRO C  2 12  ? -58.158 -59.608 -107.401 1.00 52.64  ? 926  PRO C CB    1 
ATOM   4803 C  CG    . PRO C  2 12  ? -58.809 -60.315 -108.521 1.00 51.36  ? 926  PRO C CG    1 
ATOM   4804 C  CD    . PRO C  2 12  ? -57.859 -60.198 -109.694 1.00 52.73  ? 926  PRO C CD    1 
ATOM   4805 N  N     . LEU C  2 13  ? -55.164 -58.760 -107.281 1.00 47.83  ? 927  LEU C N     1 
ATOM   4806 C  CA    . LEU C  2 13  ? -53.954 -58.342 -106.583 1.00 45.77  ? 927  LEU C CA    1 
ATOM   4807 C  C     . LEU C  2 13  ? -53.401 -57.058 -107.186 1.00 47.87  ? 927  LEU C C     1 
ATOM   4808 O  O     . LEU C  2 13  ? -53.020 -56.133 -106.459 1.00 49.90  ? 927  LEU C O     1 
ATOM   4809 C  CB    . LEU C  2 13  ? -52.918 -59.466 -106.626 1.00 51.45  ? 927  LEU C CB    1 
ATOM   4810 C  CG    . LEU C  2 13  ? -51.581 -59.351 -105.883 1.00 54.62  ? 927  LEU C CG    1 
ATOM   4811 C  CD1   . LEU C  2 13  ? -50.514 -58.721 -106.770 1.00 59.07  ? 927  LEU C CD1   1 
ATOM   4812 C  CD2   . LEU C  2 13  ? -51.749 -58.570 -104.587 1.00 50.38  ? 927  LEU C CD2   1 
ATOM   4813 N  N     . ALA C  2 14  ? -53.376 -56.975 -108.518 1.00 46.72  ? 928  ALA C N     1 
ATOM   4814 C  CA    . ALA C  2 14  ? -52.937 -55.749 -109.173 1.00 47.29  ? 928  ALA C CA    1 
ATOM   4815 C  C     . ALA C  2 14  ? -53.838 -54.572 -108.823 1.00 44.29  ? 928  ALA C C     1 
ATOM   4816 O  O     . ALA C  2 14  ? -53.367 -53.437 -108.741 1.00 46.93  ? 928  ALA C O     1 
ATOM   4817 C  CB    . ALA C  2 14  ? -52.893 -55.951 -110.689 1.00 42.16  ? 928  ALA C CB    1 
ATOM   4818 N  N     . LEU C  2 15  ? -55.129 -54.826 -108.611 1.00 43.89  ? 929  LEU C N     1 
ATOM   4819 C  CA    . LEU C  2 15  ? -56.056 -53.777 -108.196 1.00 49.41  ? 929  LEU C CA    1 
ATOM   4820 C  C     . LEU C  2 15  ? -55.830 -53.371 -106.735 1.00 53.57  ? 929  LEU C C     1 
ATOM   4821 O  O     . LEU C  2 15  ? -55.881 -52.180 -106.400 1.00 41.96  ? 929  LEU C O     1 
ATOM   4822 C  CB    . LEU C  2 15  ? -57.489 -54.270 -108.411 1.00 54.49  ? 929  LEU C CB    1 
ATOM   4823 C  CG    . LEU C  2 15  ? -58.515 -53.371 -109.090 1.00 53.54  ? 929  LEU C CG    1 
ATOM   4824 C  CD1   . LEU C  2 15  ? -57.876 -52.565 -110.205 1.00 55.89  ? 929  LEU C CD1   1 
ATOM   4825 C  CD2   . LEU C  2 15  ? -59.666 -54.195 -109.622 1.00 46.05  ? 929  LEU C CD2   1 
ATOM   4826 N  N     . LEU C  2 16  ? -55.591 -54.351 -105.850 1.00 46.92  ? 930  LEU C N     1 
ATOM   4827 C  CA    . LEU C  2 16  ? -55.318 -54.051 -104.442 1.00 46.71  ? 930  LEU C CA    1 
ATOM   4828 C  C     . LEU C  2 16  ? -54.073 -53.188 -104.294 1.00 44.86  ? 930  LEU C C     1 
ATOM   4829 O  O     . LEU C  2 16  ? -54.076 -52.208 -103.537 1.00 42.51  ? 930  LEU C O     1 
ATOM   4830 C  CB    . LEU C  2 16  ? -55.147 -55.351 -103.642 1.00 47.31  ? 930  LEU C CB    1 
ATOM   4831 C  CG    . LEU C  2 16  ? -55.478 -55.475 -102.143 1.00 51.59  ? 930  LEU C CG    1 
ATOM   4832 C  CD1   . LEU C  2 16  ? -54.430 -56.320 -101.421 1.00 51.11  ? 930  LEU C CD1   1 
ATOM   4833 C  CD2   . LEU C  2 16  ? -55.662 -54.150 -101.437 1.00 53.33  ? 930  LEU C CD2   1 
ATOM   4834 N  N     . LEU C  2 17  ? -52.994 -53.550 -104.995 1.00 42.34  ? 931  LEU C N     1 
ATOM   4835 C  CA    . LEU C  2 17  ? -51.757 -52.776 -104.925 1.00 48.53  ? 931  LEU C CA    1 
ATOM   4836 C  C     . LEU C  2 17  ? -51.956 -51.357 -105.451 1.00 51.17  ? 931  LEU C C     1 
ATOM   4837 O  O     . LEU C  2 17  ? -51.573 -50.381 -104.790 1.00 55.10  ? 931  LEU C O     1 
ATOM   4838 C  CB    . LEU C  2 17  ? -50.646 -53.480 -105.710 1.00 43.01  ? 931  LEU C CB    1 
ATOM   4839 C  CG    . LEU C  2 17  ? -50.231 -54.865 -105.229 1.00 50.18  ? 931  LEU C CG    1 
ATOM   4840 C  CD1   . LEU C  2 17  ? -49.071 -55.407 -106.061 1.00 51.96  ? 931  LEU C CD1   1 
ATOM   4841 C  CD2   . LEU C  2 17  ? -49.889 -54.849 -103.739 1.00 48.69  ? 931  LEU C CD2   1 
ATOM   4842 N  N     . ASP C  2 18  ? -52.553 -51.219 -106.639 1.00 44.70  ? 932  ASP C N     1 
ATOM   4843 C  CA    . ASP C  2 18  ? -52.648 -49.897 -107.254 1.00 43.26  ? 932  ASP C CA    1 
ATOM   4844 C  C     . ASP C  2 18  ? -53.645 -49.004 -106.526 1.00 41.09  ? 932  ASP C C     1 
ATOM   4845 O  O     . ASP C  2 18  ? -53.404 -47.803 -106.373 1.00 40.29  ? 932  ASP C O     1 
ATOM   4846 C  CB    . ASP C  2 18  ? -53.025 -50.009 -108.728 1.00 47.73  ? 932  ASP C CB    1 
ATOM   4847 C  CG    . ASP C  2 18  ? -52.811 -48.698 -109.480 1.00 48.13  ? 932  ASP C CG    1 
ATOM   4848 O  OD1   . ASP C  2 18  ? -51.644 -48.282 -109.622 1.00 48.34  ? 932  ASP C OD1   1 
ATOM   4849 O  OD2   . ASP C  2 18  ? -53.807 -48.084 -109.916 1.00 45.80  ? 932  ASP C OD2   1 
ATOM   4850 N  N     . SER C  2 19  ? -54.777 -49.556 -106.087 1.00 43.57  ? 933  SER C N     1 
ATOM   4851 C  CA    . SER C  2 19  ? -55.713 -48.743 -105.315 1.00 46.42  ? 933  SER C CA    1 
ATOM   4852 C  C     . SER C  2 19  ? -55.092 -48.299 -103.994 1.00 46.33  ? 933  SER C C     1 
ATOM   4853 O  O     . SER C  2 19  ? -55.351 -47.186 -103.528 1.00 46.91  ? 933  SER C O     1 
ATOM   4854 C  CB    . SER C  2 19  ? -57.018 -49.507 -105.068 1.00 47.12  ? 933  SER C CB    1 
ATOM   4855 O  OG    . SER C  2 19  ? -56.817 -50.616 -104.206 1.00 44.99  ? 933  SER C OG    1 
ATOM   4856 N  N     . SER C  2 20  ? -54.266 -49.150 -103.376 1.00 40.97  ? 934  SER C N     1 
ATOM   4857 C  CA    . SER C  2 20  ? -53.595 -48.741 -102.144 1.00 44.85  ? 934  SER C CA    1 
ATOM   4858 C  C     . SER C  2 20  ? -52.570 -47.650 -102.409 1.00 41.18  ? 934  SER C C     1 
ATOM   4859 O  O     . SER C  2 20  ? -52.336 -46.791 -101.553 1.00 44.59  ? 934  SER C O     1 
ATOM   4860 C  CB    . SER C  2 20  ? -52.909 -49.939 -101.478 1.00 48.26  ? 934  SER C CB    1 
ATOM   4861 O  OG    . SER C  2 20  ? -53.835 -50.946 -101.111 1.00 54.79  ? 934  SER C OG    1 
ATOM   4862 N  N     . LEU C  2 21  ? -51.942 -47.683 -103.578 1.00 41.19  ? 935  LEU C N     1 
ATOM   4863 C  CA    . LEU C  2 21  ? -50.922 -46.709 -103.928 1.00 45.62  ? 935  LEU C CA    1 
ATOM   4864 C  C     . LEU C  2 21  ? -51.533 -45.349 -104.237 1.00 48.47  ? 935  LEU C C     1 
ATOM   4865 O  O     . LEU C  2 21  ? -50.957 -44.313 -103.886 1.00 47.73  ? 935  LEU C O     1 
ATOM   4866 C  CB    . LEU C  2 21  ? -50.124 -47.219 -105.130 1.00 45.28  ? 935  LEU C CB    1 
ATOM   4867 C  CG    . LEU C  2 21  ? -49.000 -46.329 -105.650 1.00 40.99  ? 935  LEU C CG    1 
ATOM   4868 C  CD1   . LEU C  2 21  ? -47.929 -46.228 -104.587 1.00 43.97  ? 935  LEU C CD1   1 
ATOM   4869 C  CD2   . LEU C  2 21  ? -48.439 -46.928 -106.926 1.00 36.63  ? 935  LEU C CD2   1 
ATOM   4870 N  N     . GLU C  2 22  ? -52.699 -45.334 -104.878 1.00 49.80  ? 936  GLU C N     1 
ATOM   4871 C  CA    . GLU C  2 22  ? -53.301 -44.103 -105.368 1.00 49.16  ? 936  GLU C CA    1 
ATOM   4872 C  C     . GLU C  2 22  ? -54.370 -43.542 -104.437 1.00 49.93  ? 936  GLU C C     1 
ATOM   4873 O  O     . GLU C  2 22  ? -54.935 -42.485 -104.735 1.00 52.67  ? 936  GLU C O     1 
ATOM   4874 C  CB    . GLU C  2 22  ? -53.892 -44.334 -106.760 1.00 48.74  ? 936  GLU C CB    1 
ATOM   4875 C  CG    . GLU C  2 22  ? -52.879 -44.830 -107.789 1.00 55.81  ? 936  GLU C CG    1 
ATOM   4876 C  CD    . GLU C  2 22  ? -51.851 -43.773 -108.170 1.00 62.73  ? 936  GLU C CD    1 
ATOM   4877 O  OE1   . GLU C  2 22  ? -50.763 -44.138 -108.671 1.00 65.59  ? 936  GLU C OE1   1 
ATOM   4878 O  OE2   . GLU C  2 22  ? -52.129 -42.573 -107.966 1.00 65.04  ? 936  GLU C OE2   1 
ATOM   4879 N  N     . GLY C  2 23  ? -54.658 -44.208 -103.322 1.00 45.47  ? 937  GLY C N     1 
ATOM   4880 C  CA    . GLY C  2 23  ? -55.592 -43.664 -102.356 1.00 46.43  ? 937  GLY C CA    1 
ATOM   4881 C  C     . GLY C  2 23  ? -57.049 -43.940 -102.636 1.00 49.28  ? 937  GLY C C     1 
ATOM   4882 O  O     . GLY C  2 23  ? -57.912 -43.208 -102.141 1.00 47.02  ? 937  GLY C O     1 
ATOM   4883 N  N     . GLU C  2 24  ? -57.355 -44.973 -103.421 1.00 49.95  ? 938  GLU C N     1 
ATOM   4884 C  CA    . GLU C  2 24  ? -58.739 -45.344 -103.713 1.00 51.01  ? 938  GLU C CA    1 
ATOM   4885 C  C     . GLU C  2 24  ? -59.219 -46.260 -102.594 1.00 54.23  ? 938  GLU C C     1 
ATOM   4886 O  O     . GLU C  2 24  ? -59.301 -47.485 -102.721 1.00 52.71  ? 938  GLU C O     1 
ATOM   4887 C  CB    . GLU C  2 24  ? -58.848 -45.999 -105.083 1.00 55.55  ? 938  GLU C CB    1 
ATOM   4888 C  CG    . GLU C  2 24  ? -58.313 -45.126 -106.211 1.00 57.60  ? 938  GLU C CG    1 
ATOM   4889 C  CD    . GLU C  2 24  ? -58.477 -45.766 -107.572 1.00 61.55  ? 938  GLU C CD    1 
ATOM   4890 O  OE1   . GLU C  2 24  ? -59.516 -46.412 -107.818 1.00 65.59  ? 938  GLU C OE1   1 
ATOM   4891 O  OE2   . GLU C  2 24  ? -57.556 -45.627 -108.396 1.00 67.28  ? 938  GLU C OE2   1 
ATOM   4892 N  N     . PHE C  2 25  ? -59.533 -45.628 -101.465 1.00 52.96  ? 939  PHE C N     1 
ATOM   4893 C  CA    . PHE C  2 25  ? -59.914 -46.367 -100.272 1.00 52.54  ? 939  PHE C CA    1 
ATOM   4894 C  C     . PHE C  2 25  ? -61.173 -47.193 -100.509 1.00 51.93  ? 939  PHE C C     1 
ATOM   4895 O  O     . PHE C  2 25  ? -61.255 -48.350 -100.080 1.00 56.90  ? 939  PHE C O     1 
ATOM   4896 C  CB    . PHE C  2 25  ? -60.100 -45.388 -99.112  1.00 52.12  ? 939  PHE C CB    1 
ATOM   4897 C  CG    . PHE C  2 25  ? -60.413 -46.050 -97.814  1.00 53.54  ? 939  PHE C CG    1 
ATOM   4898 C  CD1   . PHE C  2 25  ? -59.788 -47.239 -97.462  1.00 52.61  ? 939  PHE C CD1   1 
ATOM   4899 C  CD2   . PHE C  2 25  ? -61.337 -45.498 -96.949  1.00 50.65  ? 939  PHE C CD2   1 
ATOM   4900 C  CE1   . PHE C  2 25  ? -60.082 -47.859 -96.264  1.00 51.89  ? 939  PHE C CE1   1 
ATOM   4901 C  CE2   . PHE C  2 25  ? -61.631 -46.115 -95.753  1.00 51.55  ? 939  PHE C CE2   1 
ATOM   4902 C  CZ    . PHE C  2 25  ? -61.005 -47.297 -95.409  1.00 49.01  ? 939  PHE C CZ    1 
ATOM   4903 N  N     . ASP C  2 26  ? -62.160 -46.621 -101.201 1.00 52.24  ? 940  ASP C N     1 
ATOM   4904 C  CA    . ASP C  2 26  ? -63.372 -47.374 -101.515 1.00 57.93  ? 940  ASP C CA    1 
ATOM   4905 C  C     . ASP C  2 26  ? -63.042 -48.664 -102.259 1.00 52.70  ? 940  ASP C C     1 
ATOM   4906 O  O     . ASP C  2 26  ? -63.590 -49.726 -101.944 1.00 53.74  ? 940  ASP C O     1 
ATOM   4907 C  CB    . ASP C  2 26  ? -64.329 -46.507 -102.335 1.00 65.92  ? 940  ASP C CB    1 
ATOM   4908 C  CG    . ASP C  2 26  ? -63.669 -45.924 -103.582 1.00 76.77  ? 940  ASP C CG    1 
ATOM   4909 O  OD1   . ASP C  2 26  ? -62.425 -45.774 -103.586 1.00 78.08  ? 940  ASP C OD1   1 
ATOM   4910 O  OD2   . ASP C  2 26  ? -64.391 -45.612 -104.557 1.00 80.52  ? 940  ASP C OD2   1 
ATOM   4911 N  N     . LEU C  2 27  ? -62.140 -48.590 -103.245 1.00 46.13  ? 941  LEU C N     1 
ATOM   4912 C  CA    . LEU C  2 27  ? -61.739 -49.783 -103.982 1.00 49.45  ? 941  LEU C CA    1 
ATOM   4913 C  C     . LEU C  2 27  ? -61.003 -50.770 -103.087 1.00 48.64  ? 941  LEU C C     1 
ATOM   4914 O  O     . LEU C  2 27  ? -61.203 -51.982 -103.202 1.00 51.04  ? 941  LEU C O     1 
ATOM   4915 C  CB    . LEU C  2 27  ? -60.854 -49.405 -105.172 1.00 50.85  ? 941  LEU C CB    1 
ATOM   4916 C  CG    . LEU C  2 27  ? -61.367 -49.765 -106.561 1.00 56.78  ? 941  LEU C CG    1 
ATOM   4917 C  CD1   . LEU C  2 27  ? -60.263 -49.572 -107.585 1.00 54.88  ? 941  LEU C CD1   1 
ATOM   4918 C  CD2   . LEU C  2 27  ? -61.886 -51.188 -106.601 1.00 54.05  ? 941  LEU C CD2   1 
ATOM   4919 N  N     . VAL C  2 28  ? -60.122 -50.272 -102.218 1.00 50.47  ? 942  VAL C N     1 
ATOM   4920 C  CA    . VAL C  2 28  ? -59.377 -51.153 -101.320 1.00 49.30  ? 942  VAL C CA    1 
ATOM   4921 C  C     . VAL C  2 28  ? -60.331 -52.013 -100.502 1.00 50.92  ? 942  VAL C C     1 
ATOM   4922 O  O     . VAL C  2 28  ? -60.156 -53.233 -100.401 1.00 53.19  ? 942  VAL C O     1 
ATOM   4923 C  CB    . VAL C  2 28  ? -58.446 -50.325 -100.416 1.00 46.54  ? 942  VAL C CB    1 
ATOM   4924 C  CG1   . VAL C  2 28  ? -57.828 -51.198 -99.336  1.00 44.84  ? 942  VAL C CG1   1 
ATOM   4925 C  CG2   . VAL C  2 28  ? -57.368 -49.644 -101.244 1.00 45.67  ? 942  VAL C CG2   1 
ATOM   4926 N  N     . GLN C  2 29  ? -61.370 -51.394 -99.931  1.00 53.57  ? 943  GLN C N     1 
ATOM   4927 C  CA    . GLN C  2 29  ? -62.286 -52.116 -99.051  1.00 56.36  ? 943  GLN C CA    1 
ATOM   4928 C  C     . GLN C  2 29  ? -63.002 -53.241 -99.785  1.00 59.06  ? 943  GLN C C     1 
ATOM   4929 O  O     . GLN C  2 29  ? -63.249 -54.304 -99.211  1.00 64.78  ? 943  GLN C O     1 
ATOM   4930 C  CB    . GLN C  2 29  ? -63.303 -51.154 -98.445  1.00 54.36  ? 943  GLN C CB    1 
ATOM   4931 C  CG    . GLN C  2 29  ? -62.684 -50.003 -97.694  1.00 60.23  ? 943  GLN C CG    1 
ATOM   4932 C  CD    . GLN C  2 29  ? -63.713 -49.156 -96.984  1.00 64.61  ? 943  GLN C CD    1 
ATOM   4933 O  OE1   . GLN C  2 29  ? -63.794 -47.946 -97.195  1.00 70.90  ? 943  GLN C OE1   1 
ATOM   4934 N  NE2   . GLN C  2 29  ? -64.503 -49.785 -96.129  1.00 67.72  ? 943  GLN C NE2   1 
ATOM   4935 N  N     . ARG C  2 30  ? -63.346 -53.029 -101.053 1.00 57.11  ? 944  ARG C N     1 
ATOM   4936 C  CA    . ARG C  2 30  ? -64.058 -54.061 -101.799 1.00 60.84  ? 944  ARG C CA    1 
ATOM   4937 C  C     . ARG C  2 30  ? -63.099 -55.124 -102.332 1.00 59.85  ? 944  ARG C C     1 
ATOM   4938 O  O     . ARG C  2 30  ? -63.325 -56.324 -102.142 1.00 62.59  ? 944  ARG C O     1 
ATOM   4939 C  CB    . ARG C  2 30  ? -64.853 -53.424 -102.944 1.00 61.04  ? 944  ARG C CB    1 
ATOM   4940 N  N     . ILE C  2 31  ? -62.007 -54.698 -102.973 1.00 54.67  ? 945  ILE C N     1 
ATOM   4941 C  CA    . ILE C  2 31  ? -61.133 -55.633 -103.669 1.00 54.15  ? 945  ILE C CA    1 
ATOM   4942 C  C     . ILE C  2 31  ? -60.327 -56.499 -102.714 1.00 54.97  ? 945  ILE C C     1 
ATOM   4943 O  O     . ILE C  2 31  ? -59.880 -57.585 -103.105 1.00 55.28  ? 945  ILE C O     1 
ATOM   4944 C  CB    . ILE C  2 31  ? -60.195 -54.878 -104.634 1.00 55.99  ? 945  ILE C CB    1 
ATOM   4945 C  CG1   . ILE C  2 31  ? -59.668 -55.821 -105.722 1.00 57.33  ? 945  ILE C CG1   1 
ATOM   4946 C  CG2   . ILE C  2 31  ? -59.033 -54.260 -103.875 1.00 52.89  ? 945  ILE C CG2   1 
ATOM   4947 C  CD1   . ILE C  2 31  ? -60.750 -56.476 -106.558 1.00 56.33  ? 945  ILE C CD1   1 
ATOM   4948 N  N     . ILE C  2 32  ? -60.129 -56.060 -101.467 1.00 54.07  ? 946  ILE C N     1 
ATOM   4949 C  CA    . ILE C  2 32  ? -59.342 -56.855 -100.533 1.00 55.77  ? 946  ILE C CA    1 
ATOM   4950 C  C     . ILE C  2 32  ? -60.028 -58.176 -100.203 1.00 63.94  ? 946  ILE C C     1 
ATOM   4951 O  O     . ILE C  2 32  ? -59.356 -59.143 -99.822  1.00 68.70  ? 946  ILE C O     1 
ATOM   4952 C  CB    . ILE C  2 32  ? -59.050 -56.049 -99.255  1.00 52.43  ? 946  ILE C CB    1 
ATOM   4953 C  CG1   . ILE C  2 32  ? -57.870 -56.651 -98.498  1.00 53.93  ? 946  ILE C CG1   1 
ATOM   4954 C  CG2   . ILE C  2 32  ? -60.276 -55.977 -98.355  1.00 49.40  ? 946  ILE C CG2   1 
ATOM   4955 C  CD1   . ILE C  2 32  ? -57.531 -55.903 -97.222  1.00 54.38  ? 946  ILE C CD1   1 
ATOM   4956 N  N     . TYR C  2 33  ? -61.351 -58.251 -100.350 1.00 66.18  ? 947  TYR C N     1 
ATOM   4957 C  CA    . TYR C  2 33  ? -62.064 -59.502 -100.132 1.00 67.39  ? 947  TYR C CA    1 
ATOM   4958 C  C     . TYR C  2 33  ? -62.020 -60.421 -101.343 1.00 64.78  ? 947  TYR C C     1 
ATOM   4959 O  O     . TYR C  2 33  ? -62.459 -61.568 -101.243 1.00 66.55  ? 947  TYR C O     1 
ATOM   4960 C  CB    . TYR C  2 33  ? -63.517 -59.221 -99.751  1.00 68.51  ? 947  TYR C CB    1 
ATOM   4961 C  CG    . TYR C  2 33  ? -63.667 -58.615 -98.377  1.00 69.00  ? 947  TYR C CG    1 
ATOM   4962 C  CD1   . TYR C  2 33  ? -63.736 -59.419 -97.242  1.00 75.07  ? 947  TYR C CD1   1 
ATOM   4963 C  CD2   . TYR C  2 33  ? -63.734 -57.239 -98.209  1.00 64.94  ? 947  TYR C CD2   1 
ATOM   4964 C  CE1   . TYR C  2 33  ? -63.870 -58.869 -95.982  1.00 72.96  ? 947  TYR C CE1   1 
ATOM   4965 C  CE2   . TYR C  2 33  ? -63.867 -56.681 -96.956  1.00 70.01  ? 947  TYR C CE2   1 
ATOM   4966 C  CZ    . TYR C  2 33  ? -63.934 -57.502 -95.846  1.00 73.76  ? 947  TYR C CZ    1 
ATOM   4967 O  OH    . TYR C  2 33  ? -64.067 -56.948 -94.598  1.00 79.38  ? 947  TYR C OH    1 
ATOM   4968 N  N     . GLU C  2 34  ? -61.508 -59.951 -102.476 1.00 66.38  ? 948  GLU C N     1 
ATOM   4969 C  CA    . GLU C  2 34  ? -61.334 -60.782 -103.658 1.00 66.57  ? 948  GLU C CA    1 
ATOM   4970 C  C     . GLU C  2 34  ? -59.893 -61.231 -103.848 1.00 62.80  ? 948  GLU C C     1 
ATOM   4971 O  O     . GLU C  2 34  ? -59.605 -61.979 -104.788 1.00 58.21  ? 948  GLU C O     1 
ATOM   4972 C  CB    . GLU C  2 34  ? -61.818 -60.035 -104.903 1.00 68.89  ? 948  GLU C CB    1 
ATOM   4973 C  CG    . GLU C  2 34  ? -63.327 -60.073 -105.084 1.00 75.96  ? 948  GLU C CG    1 
ATOM   4974 C  CD    . GLU C  2 34  ? -63.819 -59.076 -106.113 1.00 80.08  ? 948  GLU C CD    1 
ATOM   4975 O  OE1   . GLU C  2 34  ? -64.961 -58.588 -105.970 1.00 79.38  ? 948  GLU C OE1   1 
ATOM   4976 O  OE2   . GLU C  2 34  ? -63.064 -58.782 -107.068 1.00 81.45  ? 948  GLU C OE2   1 
ATOM   4977 N  N     . VAL C  2 35  ? -58.988 -60.789 -102.988 1.00 65.98  ? 949  VAL C N     1 
ATOM   4978 C  CA    . VAL C  2 35  ? -57.600 -61.230 -103.005 1.00 69.35  ? 949  VAL C CA    1 
ATOM   4979 C  C     . VAL C  2 35  ? -57.489 -62.515 -102.195 1.00 75.76  ? 949  VAL C C     1 
ATOM   4980 O  O     . VAL C  2 35  ? -58.114 -62.653 -101.135 1.00 72.28  ? 949  VAL C O     1 
ATOM   4981 C  CB    . VAL C  2 35  ? -56.675 -60.131 -102.448 1.00 66.36  ? 949  VAL C CB    1 
ATOM   4982 C  CG1   . VAL C  2 35  ? -55.224 -60.583 -102.476 1.00 65.94  ? 949  VAL C CG1   1 
ATOM   4983 C  CG2   . VAL C  2 35  ? -56.847 -58.848 -103.243 1.00 66.42  ? 949  VAL C CG2   1 
ATOM   4984 N  N     . ASP C  2 36  ? -56.708 -63.471 -102.703 1.00 80.02  ? 950  ASP C N     1 
ATOM   4985 C  CA    . ASP C  2 36  ? -56.487 -64.710 -101.964 1.00 87.30  ? 950  ASP C CA    1 
ATOM   4986 C  C     . ASP C  2 36  ? -55.860 -64.423 -100.603 1.00 84.11  ? 950  ASP C C     1 
ATOM   4987 O  O     . ASP C  2 36  ? -56.351 -64.883 -99.564  1.00 83.52  ? 950  ASP C O     1 
ATOM   4988 C  CB    . ASP C  2 36  ? -55.609 -65.654 -102.787 1.00 95.71  ? 950  ASP C CB    1 
ATOM   4989 C  CG    . ASP C  2 36  ? -56.120 -65.839 -104.210 1.00 103.13 ? 950  ASP C CG    1 
ATOM   4990 O  OD1   . ASP C  2 36  ? -57.350 -65.754 -104.420 1.00 105.79 ? 950  ASP C OD1   1 
ATOM   4991 O  OD2   . ASP C  2 36  ? -55.293 -66.067 -105.121 1.00 104.11 ? 950  ASP C OD2   1 
ATOM   4992 N  N     . ASP C  2 37  ? -54.781 -63.644 -100.591 1.00 80.65  ? 951  ASP C N     1 
ATOM   4993 C  CA    . ASP C  2 37  ? -54.103 -63.217 -99.374  1.00 72.37  ? 951  ASP C CA    1 
ATOM   4994 C  C     . ASP C  2 37  ? -53.686 -61.758 -99.537  1.00 60.29  ? 951  ASP C C     1 
ATOM   4995 O  O     . ASP C  2 37  ? -52.863 -61.439 -100.406 1.00 53.39  ? 951  ASP C O     1 
ATOM   4996 C  CB    . ASP C  2 37  ? -52.896 -64.116 -99.092  1.00 69.77  ? 951  ASP C CB    1 
ATOM   4997 C  CG    . ASP C  2 37  ? -52.245 -63.835 -97.745  1.00 76.34  ? 951  ASP C CG    1 
ATOM   4998 O  OD1   . ASP C  2 37  ? -52.370 -62.706 -97.222  1.00 76.50  ? 951  ASP C OD1   1 
ATOM   4999 O  OD2   . ASP C  2 37  ? -51.612 -64.766 -97.196  1.00 79.15  ? 951  ASP C OD2   1 
ATOM   5000 N  N     . PRO C  2 38  ? -54.220 -60.847 -98.716  1.00 61.48  ? 952  PRO C N     1 
ATOM   5001 C  CA    . PRO C  2 38  ? -53.910 -59.418 -98.897  1.00 63.46  ? 952  PRO C CA    1 
ATOM   5002 C  C     . PRO C  2 38  ? -52.466 -59.055 -98.583  1.00 58.98  ? 952  PRO C C     1 
ATOM   5003 O  O     . PRO C  2 38  ? -52.089 -57.894 -98.789  1.00 57.04  ? 952  PRO C O     1 
ATOM   5004 C  CB    . PRO C  2 38  ? -54.881 -58.717 -97.932  1.00 66.03  ? 952  PRO C CB    1 
ATOM   5005 C  CG    . PRO C  2 38  ? -55.916 -59.748 -97.588  1.00 68.11  ? 952  PRO C CG    1 
ATOM   5006 C  CD    . PRO C  2 38  ? -55.196 -61.063 -97.638  1.00 65.59  ? 952  PRO C CD    1 
ATOM   5007 N  N     . SER C  2 39  ? -51.655 -59.998 -98.104  1.00 57.28  ? 953  SER C N     1 
ATOM   5008 C  CA    . SER C  2 39  ? -50.242 -59.775 -97.844  1.00 55.57  ? 953  SER C CA    1 
ATOM   5009 C  C     . SER C  2 39  ? -49.345 -60.236 -98.981  1.00 56.43  ? 953  SER C C     1 
ATOM   5010 O  O     . SER C  2 39  ? -48.118 -60.145 -98.854  1.00 56.28  ? 953  SER C O     1 
ATOM   5011 C  CB    . SER C  2 39  ? -49.819 -60.483 -96.549  1.00 54.27  ? 953  SER C CB    1 
ATOM   5012 O  OG    . SER C  2 39  ? -50.434 -59.898 -95.411  1.00 55.27  ? 953  SER C OG    1 
ATOM   5013 N  N     . LEU C  2 40  ? -49.910 -60.729 -100.074 1.00 59.72  ? 954  LEU C N     1 
ATOM   5014 C  CA    . LEU C  2 40  ? -49.081 -61.261 -101.148 1.00 64.13  ? 954  LEU C CA    1 
ATOM   5015 C  C     . LEU C  2 40  ? -48.411 -60.115 -101.894 1.00 62.92  ? 954  LEU C C     1 
ATOM   5016 O  O     . LEU C  2 40  ? -49.082 -59.140 -102.262 1.00 60.13  ? 954  LEU C O     1 
ATOM   5017 C  CB    . LEU C  2 40  ? -49.925 -62.121 -102.092 1.00 70.45  ? 954  LEU C CB    1 
ATOM   5018 C  CG    . LEU C  2 40  ? -49.228 -63.107 -103.036 1.00 77.21  ? 954  LEU C CG    1 
ATOM   5019 C  CD1   . LEU C  2 40  ? -48.312 -62.419 -104.051 1.00 77.01  ? 954  LEU C CD1   1 
ATOM   5020 C  CD2   . LEU C  2 40  ? -48.426 -64.106 -102.209 1.00 77.19  ? 954  LEU C CD2   1 
ATOM   5021 N  N     . PRO C  2 41  ? -47.096 -60.169 -102.095 1.00 62.33  ? 955  PRO C N     1 
ATOM   5022 C  CA    . PRO C  2 41  ? -46.398 -59.049 -102.734 1.00 62.83  ? 955  PRO C CA    1 
ATOM   5023 C  C     . PRO C  2 41  ? -46.401 -59.132 -104.251 1.00 66.15  ? 955  PRO C C     1 
ATOM   5024 O  O     . PRO C  2 41  ? -46.947 -60.070 -104.836 1.00 65.26  ? 955  PRO C O     1 
ATOM   5025 C  CB    . PRO C  2 41  ? -44.977 -59.171 -102.175 1.00 62.42  ? 955  PRO C CB    1 
ATOM   5026 C  CG    . PRO C  2 41  ? -44.812 -60.641 -101.975 1.00 59.90  ? 955  PRO C CG    1 
ATOM   5027 C  CD    . PRO C  2 41  ? -46.158 -61.181 -101.574 1.00 59.68  ? 955  PRO C CD    1 
ATOM   5028 N  N     . ASN C  2 42  ? -45.793 -58.145 -104.901 1.00 65.84  ? 956  ASN C N     1 
ATOM   5029 C  CA    . ASN C  2 42  ? -45.557 -58.217 -106.333 1.00 63.38  ? 956  ASN C CA    1 
ATOM   5030 C  C     . ASN C  2 42  ? -44.235 -58.956 -106.555 1.00 74.28  ? 956  ASN C C     1 
ATOM   5031 O  O     . ASN C  2 42  ? -43.743 -59.657 -105.665 1.00 75.49  ? 956  ASN C O     1 
ATOM   5032 C  CB    . ASN C  2 42  ? -45.594 -56.810 -106.938 1.00 50.49  ? 956  ASN C CB    1 
ATOM   5033 C  CG    . ASN C  2 42  ? -44.512 -55.904 -106.387 1.00 51.95  ? 956  ASN C CG    1 
ATOM   5034 O  OD1   . ASN C  2 42  ? -43.674 -56.320 -105.591 1.00 57.87  ? 956  ASN C OD1   1 
ATOM   5035 N  ND2   . ASN C  2 42  ? -44.524 -54.652 -106.816 1.00 56.29  ? 956  ASN C ND2   1 
ATOM   5036 N  N     . ASP C  2 43  ? -43.634 -58.799 -107.732 1.00 78.22  ? 957  ASP C N     1 
ATOM   5037 C  CA    . ASP C  2 43  ? -42.404 -59.512 -108.043 1.00 81.97  ? 957  ASP C CA    1 
ATOM   5038 C  C     . ASP C  2 43  ? -41.185 -58.938 -107.336 1.00 78.67  ? 957  ASP C C     1 
ATOM   5039 O  O     . ASP C  2 43  ? -40.109 -59.536 -107.417 1.00 79.19  ? 957  ASP C O     1 
ATOM   5040 C  CB    . ASP C  2 43  ? -42.176 -59.520 -109.555 1.00 87.36  ? 957  ASP C CB    1 
ATOM   5041 C  CG    . ASP C  2 43  ? -43.096 -60.486 -110.270 1.00 93.59  ? 957  ASP C CG    1 
ATOM   5042 O  OD1   . ASP C  2 43  ? -44.330 -60.294 -110.207 1.00 96.60  ? 957  ASP C OD1   1 
ATOM   5043 O  OD2   . ASP C  2 43  ? -42.587 -61.441 -110.892 1.00 95.91  ? 957  ASP C OD2   1 
ATOM   5044 N  N     . GLU C  2 44  ? -41.320 -57.808 -106.645 1.00 75.70  ? 958  GLU C N     1 
ATOM   5045 C  CA    . GLU C  2 44  ? -40.213 -57.230 -105.898 1.00 71.36  ? 958  GLU C CA    1 
ATOM   5046 C  C     . GLU C  2 44  ? -40.425 -57.276 -104.390 1.00 67.94  ? 958  GLU C C     1 
ATOM   5047 O  O     . GLU C  2 44  ? -39.583 -56.766 -103.643 1.00 69.62  ? 958  GLU C O     1 
ATOM   5048 C  CB    . GLU C  2 44  ? -39.968 -55.784 -106.348 1.00 72.66  ? 958  GLU C CB    1 
ATOM   5049 N  N     . GLY C  2 45  ? -41.516 -57.873 -103.921 1.00 64.80  ? 959  GLY C N     1 
ATOM   5050 C  CA    . GLY C  2 45  ? -41.789 -57.927 -102.500 1.00 63.34  ? 959  GLY C CA    1 
ATOM   5051 C  C     . GLY C  2 45  ? -42.628 -56.791 -101.957 1.00 66.09  ? 959  GLY C C     1 
ATOM   5052 O  O     . GLY C  2 45  ? -42.693 -56.620 -100.733 1.00 69.18  ? 959  GLY C O     1 
ATOM   5053 N  N     . ILE C  2 46  ? -43.280 -56.018 -102.818 1.00 64.18  ? 960  ILE C N     1 
ATOM   5054 C  CA    . ILE C  2 46  ? -44.079 -54.874 -102.395 1.00 60.29  ? 960  ILE C CA    1 
ATOM   5055 C  C     . ILE C  2 46  ? -45.508 -55.340 -102.153 1.00 57.18  ? 960  ILE C C     1 
ATOM   5056 O  O     . ILE C  2 46  ? -46.149 -55.893 -103.053 1.00 57.02  ? 960  ILE C O     1 
ATOM   5057 C  CB    . ILE C  2 46  ? -44.035 -53.753 -103.445 1.00 59.54  ? 960  ILE C CB    1 
ATOM   5058 C  CG1   . ILE C  2 46  ? -42.587 -53.440 -103.824 1.00 61.64  ? 960  ILE C CG1   1 
ATOM   5059 C  CG2   . ILE C  2 46  ? -44.752 -52.515 -102.941 1.00 54.56  ? 960  ILE C CG2   1 
ATOM   5060 C  CD1   . ILE C  2 46  ? -41.709 -53.081 -102.647 1.00 62.57  ? 960  ILE C CD1   1 
ATOM   5061 N  N     . THR C  2 47  ? -46.007 -55.118 -100.940 1.00 55.02  ? 961  THR C N     1 
ATOM   5062 C  CA    . THR C  2 47  ? -47.388 -55.415 -100.592 1.00 52.56  ? 961  THR C CA    1 
ATOM   5063 C  C     . THR C  2 47  ? -48.226 -54.143 -100.630 1.00 49.18  ? 961  THR C C     1 
ATOM   5064 O  O     . THR C  2 47  ? -47.714 -53.030 -100.744 1.00 42.03  ? 961  THR C O     1 
ATOM   5065 C  CB    . THR C  2 47  ? -47.483 -56.059 -99.202  1.00 51.45  ? 961  THR C CB    1 
ATOM   5066 O  OG1   . THR C  2 47  ? -47.199 -55.082 -98.188  1.00 43.98  ? 961  THR C OG1   1 
ATOM   5067 C  CG2   . THR C  2 47  ? -46.507 -57.229 -99.078  1.00 55.76  ? 961  THR C CG2   1 
ATOM   5068 N  N     . ALA C  2 48  ? -49.539 -54.330 -100.516 1.00 44.61  ? 962  ALA C N     1 
ATOM   5069 C  CA    . ALA C  2 48  ? -50.452 -53.197 -100.479 1.00 43.12  ? 962  ALA C CA    1 
ATOM   5070 C  C     . ALA C  2 48  ? -50.125 -52.250 -99.324  1.00 45.05  ? 962  ALA C C     1 
ATOM   5071 O  O     . ALA C  2 48  ? -50.183 -51.027 -99.485  1.00 45.13  ? 962  ALA C O     1 
ATOM   5072 C  CB    . ALA C  2 48  ? -51.893 -53.698 -100.383 1.00 43.00  ? 962  ALA C CB    1 
ATOM   5073 N  N     . LEU C  2 49  ? -49.776 -52.792 -98.153  1.00 43.77  ? 963  LEU C N     1 
ATOM   5074 C  CA    . LEU C  2 49  ? -49.432 -51.927 -97.027  1.00 44.09  ? 963  LEU C CA    1 
ATOM   5075 C  C     . LEU C  2 49  ? -48.159 -51.129 -97.306  1.00 47.47  ? 963  LEU C C     1 
ATOM   5076 O  O     . LEU C  2 49  ? -48.034 -49.979 -96.863  1.00 46.12  ? 963  LEU C O     1 
ATOM   5077 C  CB    . LEU C  2 49  ? -49.280 -52.741 -95.746  1.00 45.40  ? 963  LEU C CB    1 
ATOM   5078 C  CG    . LEU C  2 49  ? -48.975 -51.909 -94.490  1.00 47.19  ? 963  LEU C CG    1 
ATOM   5079 C  CD1   . LEU C  2 49  ? -50.097 -50.922 -94.213  1.00 42.72  ? 963  LEU C CD1   1 
ATOM   5080 C  CD2   . LEU C  2 49  ? -48.730 -52.793 -93.266  1.00 48.56  ? 963  LEU C CD2   1 
ATOM   5081 N  N     . HIS C  2 50  ? -47.207 -51.712 -98.050  1.00 43.38  ? 964  HIS C N     1 
ATOM   5082 C  CA    . HIS C  2 50  ? -46.046 -50.941 -98.495  1.00 43.41  ? 964  HIS C CA    1 
ATOM   5083 C  C     . HIS C  2 50  ? -46.487 -49.716 -99.290  1.00 46.28  ? 964  HIS C C     1 
ATOM   5084 O  O     . HIS C  2 50  ? -46.069 -48.591 -99.000  1.00 44.58  ? 964  HIS C O     1 
ATOM   5085 C  CB    . HIS C  2 50  ? -45.125 -51.800 -99.360  1.00 45.61  ? 964  HIS C CB    1 
ATOM   5086 C  CG    . HIS C  2 50  ? -44.270 -52.764 -98.598  1.00 47.53  ? 964  HIS C CG    1 
ATOM   5087 N  ND1   . HIS C  2 50  ? -44.633 -54.079 -98.402  1.00 50.48  ? 964  HIS C ND1   1 
ATOM   5088 C  CD2   . HIS C  2 50  ? -43.052 -52.621 -98.024  1.00 45.90  ? 964  HIS C CD2   1 
ATOM   5089 C  CE1   . HIS C  2 50  ? -43.685 -54.702 -97.728  1.00 48.44  ? 964  HIS C CE1   1 
ATOM   5090 N  NE2   . HIS C  2 50  ? -42.714 -53.840 -97.485  1.00 49.23  ? 964  HIS C NE2   1 
ATOM   5091 N  N     . ASN C  2 51  ? -47.343 -49.927 -100.300 1.00 45.10  ? 965  ASN C N     1 
ATOM   5092 C  CA    . ASN C  2 51  ? -47.808 -48.829 -101.146 1.00 42.99  ? 965  ASN C CA    1 
ATOM   5093 C  C     . ASN C  2 51  ? -48.562 -47.777 -100.338 1.00 43.88  ? 965  ASN C C     1 
ATOM   5094 O  O     . ASN C  2 51  ? -48.346 -46.575 -100.524 1.00 46.66  ? 965  ASN C O     1 
ATOM   5095 C  CB    . ASN C  2 51  ? -48.696 -49.370 -102.268 1.00 42.73  ? 965  ASN C CB    1 
ATOM   5096 C  CG    . ASN C  2 51  ? -47.904 -50.055 -103.383 1.00 47.42  ? 965  ASN C CG    1 
ATOM   5097 O  OD1   . ASN C  2 51  ? -46.685 -49.910 -103.492 1.00 48.48  ? 965  ASN C OD1   1 
ATOM   5098 N  ND2   . ASN C  2 51  ? -48.611 -50.794 -104.227 1.00 42.81  ? 965  ASN C ND2   1 
ATOM   5099 N  N     . ALA C  2 52  ? -49.464 -48.206 -99.446  1.00 45.11  ? 966  ALA C N     1 
ATOM   5100 C  CA    . ALA C  2 52  ? -50.216 -47.247 -98.638  1.00 43.52  ? 966  ALA C CA    1 
ATOM   5101 C  C     . ALA C  2 52  ? -49.288 -46.402 -97.777  1.00 44.96  ? 966  ALA C C     1 
ATOM   5102 O  O     . ALA C  2 52  ? -49.505 -45.195 -97.622  1.00 47.17  ? 966  ALA C O     1 
ATOM   5103 C  CB    . ALA C  2 52  ? -51.239 -47.969 -97.757  1.00 44.01  ? 966  ALA C CB    1 
ATOM   5104 N  N     . VAL C  2 53  ? -48.249 -47.017 -97.209  1.00 45.27  ? 967  VAL C N     1 
ATOM   5105 C  CA    . VAL C  2 53  ? -47.325 -46.280 -96.354  1.00 46.20  ? 967  VAL C CA    1 
ATOM   5106 C  C     . VAL C  2 53  ? -46.537 -45.266 -97.175  1.00 50.86  ? 967  VAL C C     1 
ATOM   5107 O  O     . VAL C  2 53  ? -46.456 -44.082 -96.821  1.00 50.01  ? 967  VAL C O     1 
ATOM   5108 C  CB    . VAL C  2 53  ? -46.393 -47.253 -95.607  1.00 49.40  ? 967  VAL C CB    1 
ATOM   5109 C  CG1   . VAL C  2 53  ? -45.229 -46.507 -94.996  1.00 44.56  ? 967  VAL C CG1   1 
ATOM   5110 C  CG2   . VAL C  2 53  ? -47.159 -48.027 -94.529  1.00 42.53  ? 967  VAL C CG2   1 
ATOM   5111 N  N     . CYS C  2 54  ? -45.956 -45.709 -98.294  1.00 51.80  ? 968  CYS C N     1 
ATOM   5112 C  CA    . CYS C  2 54  ? -45.130 -44.817 -99.101  1.00 51.33  ? 968  CYS C CA    1 
ATOM   5113 C  C     . CYS C  2 54  ? -45.939 -43.667 -99.677  1.00 50.34  ? 968  CYS C C     1 
ATOM   5114 O  O     . CYS C  2 54  ? -45.394 -42.583 -99.912  1.00 52.50  ? 968  CYS C O     1 
ATOM   5115 C  CB    . CYS C  2 54  ? -44.453 -45.592 -100.233 1.00 61.64  ? 968  CYS C CB    1 
ATOM   5116 S  SG    . CYS C  2 54  ? -43.231 -46.819 -99.692  1.00 69.40  ? 968  CYS C SG    1 
ATOM   5117 N  N     . ALA C  2 55  ? -47.227 -43.877 -99.924  1.00 48.43  ? 969  ALA C N     1 
ATOM   5118 C  CA    . ALA C  2 55  ? -48.052 -42.827 -100.502 1.00 50.62  ? 969  ALA C CA    1 
ATOM   5119 C  C     . ALA C  2 55  ? -48.750 -41.975 -99.451  1.00 48.32  ? 969  ALA C C     1 
ATOM   5120 O  O     . ALA C  2 55  ? -49.473 -41.044 -99.817  1.00 50.47  ? 969  ALA C O     1 
ATOM   5121 C  CB    . ALA C  2 55  ? -49.085 -43.430 -101.463 1.00 46.24  ? 969  ALA C CB    1 
ATOM   5122 N  N     . GLY C  2 56  ? -48.547 -42.260 -98.166  1.00 45.37  ? 970  GLY C N     1 
ATOM   5123 C  CA    . GLY C  2 56  ? -49.126 -41.443 -97.116  1.00 45.75  ? 970  GLY C CA    1 
ATOM   5124 C  C     . GLY C  2 56  ? -50.620 -41.591 -96.931  1.00 48.11  ? 970  GLY C C     1 
ATOM   5125 O  O     . GLY C  2 56  ? -51.258 -40.696 -96.370  1.00 45.61  ? 970  GLY C O     1 
ATOM   5126 N  N     . HIS C  2 57  ? -51.205 -42.701 -97.387  1.00 46.67  ? 971  HIS C N     1 
ATOM   5127 C  CA    . HIS C  2 57  ? -52.644 -42.930 -97.248  1.00 46.92  ? 971  HIS C CA    1 
ATOM   5128 C  C     . HIS C  2 57  ? -52.908 -43.567 -95.885  1.00 45.88  ? 971  HIS C C     1 
ATOM   5129 O  O     . HIS C  2 57  ? -53.125 -44.772 -95.746  1.00 45.18  ? 971  HIS C O     1 
ATOM   5130 C  CB    . HIS C  2 57  ? -53.158 -43.779 -98.402  1.00 44.56  ? 971  HIS C CB    1 
ATOM   5131 C  CG    . HIS C  2 57  ? -52.925 -43.160 -99.746  1.00 42.15  ? 971  HIS C CG    1 
ATOM   5132 N  ND1   . HIS C  2 57  ? -53.117 -41.816 -99.991  1.00 43.06  ? 971  HIS C ND1   1 
ATOM   5133 C  CD2   . HIS C  2 57  ? -52.504 -43.699 -100.916 1.00 43.87  ? 971  HIS C CD2   1 
ATOM   5134 C  CE1   . HIS C  2 57  ? -52.829 -41.552 -101.253 1.00 40.54  ? 971  HIS C CE1   1 
ATOM   5135 N  NE2   . HIS C  2 57  ? -52.456 -42.678 -101.837 1.00 45.65  ? 971  HIS C NE2   1 
ATOM   5136 N  N     . THR C  2 58  ? -52.903 -42.712 -94.861  1.00 42.99  ? 972  THR C N     1 
ATOM   5137 C  CA    . THR C  2 58  ? -52.955 -43.174 -93.476  1.00 40.85  ? 972  THR C CA    1 
ATOM   5138 C  C     . THR C  2 58  ? -54.216 -43.983 -93.187  1.00 42.49  ? 972  THR C C     1 
ATOM   5139 O  O     . THR C  2 58  ? -54.155 -45.009 -92.497  1.00 46.73  ? 972  THR C O     1 
ATOM   5140 C  CB    . THR C  2 58  ? -52.857 -41.972 -92.536  1.00 46.80  ? 972  THR C CB    1 
ATOM   5141 O  OG1   . THR C  2 58  ? -51.631 -41.269 -92.786  1.00 44.01  ? 972  THR C OG1   1 
ATOM   5142 C  CG2   . THR C  2 58  ? -52.893 -42.418 -91.083  1.00 50.12  ? 972  THR C CG2   1 
ATOM   5143 N  N     . GLU C  2 59  ? -55.370 -43.547 -93.694  1.00 40.28  ? 973  GLU C N     1 
ATOM   5144 C  CA    . GLU C  2 59  ? -56.592 -44.308 -93.440  1.00 45.74  ? 973  GLU C CA    1 
ATOM   5145 C  C     . GLU C  2 59  ? -56.499 -45.711 -94.033  1.00 48.01  ? 973  GLU C C     1 
ATOM   5146 O  O     . GLU C  2 59  ? -56.959 -46.684 -93.424  1.00 47.93  ? 973  GLU C O     1 
ATOM   5147 C  CB    . GLU C  2 59  ? -57.813 -43.574 -93.996  1.00 44.19  ? 973  GLU C CB    1 
ATOM   5148 C  CG    . GLU C  2 59  ? -59.140 -44.137 -93.466  1.00 48.34  ? 973  GLU C CG    1 
ATOM   5149 C  CD    . GLU C  2 59  ? -60.365 -43.389 -93.970  1.00 48.27  ? 973  GLU C CD    1 
ATOM   5150 O  OE1   . GLU C  2 59  ? -60.257 -42.705 -95.013  1.00 42.98  ? 973  GLU C OE1   1 
ATOM   5151 O  OE2   . GLU C  2 59  ? -61.436 -43.489 -93.318  1.00 47.81  ? 973  GLU C OE2   1 
ATOM   5152 N  N     . ILE C  2 60  ? -55.913 -45.834 -95.224  1.00 46.93  ? 974  ILE C N     1 
ATOM   5153 C  CA    . ILE C  2 60  ? -55.754 -47.152 -95.826  1.00 43.81  ? 974  ILE C CA    1 
ATOM   5154 C  C     . ILE C  2 60  ? -54.745 -47.975 -95.042  1.00 45.40  ? 974  ILE C C     1 
ATOM   5155 O  O     . ILE C  2 60  ? -54.965 -49.164 -94.785  1.00 41.50  ? 974  ILE C O     1 
ATOM   5156 C  CB    . ILE C  2 60  ? -55.356 -47.012 -97.303  1.00 44.44  ? 974  ILE C CB    1 
ATOM   5157 C  CG1   . ILE C  2 60  ? -56.459 -46.264 -98.060  1.00 46.32  ? 974  ILE C CG1   1 
ATOM   5158 C  CG2   . ILE C  2 60  ? -55.101 -48.378 -97.918  1.00 42.21  ? 974  ILE C CG2   1 
ATOM   5159 C  CD1   . ILE C  2 60  ? -56.024 -45.733 -99.412  1.00 49.50  ? 974  ILE C CD1   1 
ATOM   5160 N  N     . VAL C  2 61  ? -53.630 -47.356 -94.638  1.00 41.28  ? 975  VAL C N     1 
ATOM   5161 C  CA    . VAL C  2 61  ? -52.684 -48.022 -93.744  1.00 45.21  ? 975  VAL C CA    1 
ATOM   5162 C  C     . VAL C  2 61  ? -53.414 -48.623 -92.546  1.00 48.58  ? 975  VAL C C     1 
ATOM   5163 O  O     . VAL C  2 61  ? -53.286 -49.822 -92.255  1.00 47.59  ? 975  VAL C O     1 
ATOM   5164 C  CB    . VAL C  2 61  ? -51.587 -47.046 -93.287  1.00 41.57  ? 975  VAL C CB    1 
ATOM   5165 C  CG1   . VAL C  2 61  ? -50.744 -47.690 -92.194  1.00 41.90  ? 975  VAL C CG1   1 
ATOM   5166 C  CG2   . VAL C  2 61  ? -50.717 -46.608 -94.458  1.00 43.04  ? 975  VAL C CG2   1 
ATOM   5167 N  N     . LYS C  2 62  ? -54.190 -47.795 -91.832  1.00 50.29  ? 976  LYS C N     1 
ATOM   5168 C  CA    . LYS C  2 62  ? -54.910 -48.284 -90.657  1.00 48.50  ? 976  LYS C CA    1 
ATOM   5169 C  C     . LYS C  2 62  ? -55.865 -49.407 -91.026  1.00 49.15  ? 976  LYS C C     1 
ATOM   5170 O  O     . LYS C  2 62  ? -55.950 -50.417 -90.315  1.00 55.26  ? 976  LYS C O     1 
ATOM   5171 C  CB    . LYS C  2 62  ? -55.678 -47.149 -89.977  1.00 49.12  ? 976  LYS C CB    1 
ATOM   5172 C  CG    . LYS C  2 62  ? -54.810 -46.123 -89.287  1.00 55.03  ? 976  LYS C CG    1 
ATOM   5173 C  CD    . LYS C  2 62  ? -55.660 -45.096 -88.550  1.00 58.14  ? 976  LYS C CD    1 
ATOM   5174 C  CE    . LYS C  2 62  ? -56.425 -45.724 -87.393  1.00 61.19  ? 976  LYS C CE    1 
ATOM   5175 N  NZ    . LYS C  2 62  ? -57.138 -44.714 -86.558  1.00 61.25  ? 976  LYS C NZ    1 
ATOM   5176 N  N     . PHE C  2 63  ? -56.581 -49.260 -92.143  1.00 46.83  ? 977  PHE C N     1 
ATOM   5177 C  CA    . PHE C  2 63  ? -57.499 -50.309 -92.565  1.00 49.59  ? 977  PHE C CA    1 
ATOM   5178 C  C     . PHE C  2 63  ? -56.759 -51.618 -92.802  1.00 48.33  ? 977  PHE C C     1 
ATOM   5179 O  O     . PHE C  2 63  ? -57.127 -52.659 -92.246  1.00 47.61  ? 977  PHE C O     1 
ATOM   5180 C  CB    . PHE C  2 63  ? -58.253 -49.892 -93.826  1.00 48.75  ? 977  PHE C CB    1 
ATOM   5181 C  CG    . PHE C  2 63  ? -59.077 -51.001 -94.420  1.00 50.11  ? 977  PHE C CG    1 
ATOM   5182 C  CD1   . PHE C  2 63  ? -60.348 -51.267 -93.939  1.00 51.21  ? 977  PHE C CD1   1 
ATOM   5183 C  CD2   . PHE C  2 63  ? -58.572 -51.789 -95.446  1.00 49.83  ? 977  PHE C CD2   1 
ATOM   5184 C  CE1   . PHE C  2 63  ? -61.105 -52.292 -94.479  1.00 54.80  ? 977  PHE C CE1   1 
ATOM   5185 C  CE2   . PHE C  2 63  ? -59.322 -52.813 -95.996  1.00 50.35  ? 977  PHE C CE2   1 
ATOM   5186 C  CZ    . PHE C  2 63  ? -60.590 -53.066 -95.516  1.00 52.57  ? 977  PHE C CZ    1 
ATOM   5187 N  N     . LEU C  2 64  ? -55.708 -51.580 -93.625  1.00 46.44  ? 978  LEU C N     1 
ATOM   5188 C  CA    . LEU C  2 64  ? -54.976 -52.804 -93.941  1.00 48.11  ? 978  LEU C CA    1 
ATOM   5189 C  C     . LEU C  2 64  ? -54.399 -53.439 -92.682  1.00 46.67  ? 978  LEU C C     1 
ATOM   5190 O  O     . LEU C  2 64  ? -54.434 -54.664 -92.523  1.00 48.50  ? 978  LEU C O     1 
ATOM   5191 C  CB    . LEU C  2 64  ? -53.869 -52.515 -94.956  1.00 43.19  ? 978  LEU C CB    1 
ATOM   5192 C  CG    . LEU C  2 64  ? -54.294 -52.131 -96.378  1.00 44.22  ? 978  LEU C CG    1 
ATOM   5193 C  CD1   . LEU C  2 64  ? -53.097 -51.654 -97.181  1.00 43.53  ? 978  LEU C CD1   1 
ATOM   5194 C  CD2   . LEU C  2 64  ? -54.984 -53.293 -97.095  1.00 42.47  ? 978  LEU C CD2   1 
ATOM   5195 N  N     . VAL C  2 65  ? -53.879 -52.621 -91.767  1.00 52.94  ? 979  VAL C N     1 
ATOM   5196 C  CA    . VAL C  2 65  ? -53.353 -53.154 -90.512  1.00 52.10  ? 979  VAL C CA    1 
ATOM   5197 C  C     . VAL C  2 65  ? -54.472 -53.766 -89.673  1.00 51.38  ? 979  VAL C C     1 
ATOM   5198 O  O     . VAL C  2 65  ? -54.305 -54.839 -89.082  1.00 52.52  ? 979  VAL C O     1 
ATOM   5199 C  CB    . VAL C  2 65  ? -52.599 -52.050 -89.752  1.00 50.62  ? 979  VAL C CB    1 
ATOM   5200 C  CG1   . VAL C  2 65  ? -52.354 -52.457 -88.315  1.00 51.63  ? 979  VAL C CG1   1 
ATOM   5201 C  CG2   . VAL C  2 65  ? -51.289 -51.744 -90.449  1.00 52.13  ? 979  VAL C CG2   1 
ATOM   5202 N  N     . GLN C  2 66  ? -55.636 -53.110 -89.629  1.00 55.17  ? 980  GLN C N     1 
ATOM   5203 C  CA    . GLN C  2 66  ? -56.768 -53.645 -88.872  1.00 60.77  ? 980  GLN C CA    1 
ATOM   5204 C  C     . GLN C  2 66  ? -57.301 -54.929 -89.488  1.00 56.78  ? 980  GLN C C     1 
ATOM   5205 O  O     . GLN C  2 66  ? -57.821 -55.794 -88.773  1.00 53.78  ? 980  GLN C O     1 
ATOM   5206 C  CB    . GLN C  2 66  ? -57.889 -52.607 -88.788  1.00 64.48  ? 980  GLN C CB    1 
ATOM   5207 C  CG    . GLN C  2 66  ? -57.706 -51.564 -87.700  1.00 71.61  ? 980  GLN C CG    1 
ATOM   5208 C  CD    . GLN C  2 66  ? -58.630 -50.373 -87.881  1.00 80.90  ? 980  GLN C CD    1 
ATOM   5209 O  OE1   . GLN C  2 66  ? -59.627 -50.447 -88.607  1.00 86.09  ? 980  GLN C OE1   1 
ATOM   5210 N  NE2   . GLN C  2 66  ? -58.300 -49.263 -87.225  1.00 80.15  ? 980  GLN C NE2   1 
ATOM   5211 N  N     . PHE C  2 67  ? -57.191 -55.061 -90.811  1.00 55.52  ? 981  PHE C N     1 
ATOM   5212 C  CA    . PHE C  2 67  ? -57.635 -56.258 -91.514  1.00 53.55  ? 981  PHE C CA    1 
ATOM   5213 C  C     . PHE C  2 67  ? -56.797 -57.481 -91.166  1.00 52.86  ? 981  PHE C C     1 
ATOM   5214 O  O     . PHE C  2 67  ? -57.265 -58.611 -91.351  1.00 54.55  ? 981  PHE C O     1 
ATOM   5215 C  CB    . PHE C  2 67  ? -57.585 -56.005 -93.018  1.00 57.39  ? 981  PHE C CB    1 
ATOM   5216 C  CG    . PHE C  2 67  ? -58.381 -56.982 -93.837  1.00 55.69  ? 981  PHE C CG    1 
ATOM   5217 C  CD1   . PHE C  2 67  ? -59.750 -56.827 -93.985  1.00 55.91  ? 981  PHE C CD1   1 
ATOM   5218 C  CD2   . PHE C  2 67  ? -57.752 -58.034 -94.486  1.00 54.54  ? 981  PHE C CD2   1 
ATOM   5219 C  CE1   . PHE C  2 67  ? -60.482 -57.711 -94.753  1.00 57.46  ? 981  PHE C CE1   1 
ATOM   5220 C  CE2   . PHE C  2 67  ? -58.475 -58.927 -95.256  1.00 57.20  ? 981  PHE C CE2   1 
ATOM   5221 C  CZ    . PHE C  2 67  ? -59.842 -58.766 -95.390  1.00 60.40  ? 981  PHE C CZ    1 
ATOM   5222 N  N     . GLY C  2 68  ? -55.578 -57.290 -90.667  1.00 47.50  ? 982  GLY C N     1 
ATOM   5223 C  CA    . GLY C  2 68  ? -54.721 -58.397 -90.305  1.00 50.99  ? 982  GLY C CA    1 
ATOM   5224 C  C     . GLY C  2 68  ? -53.560 -58.639 -91.236  1.00 50.32  ? 982  GLY C C     1 
ATOM   5225 O  O     . GLY C  2 68  ? -52.920 -59.693 -91.145  1.00 50.00  ? 982  GLY C O     1 
ATOM   5226 N  N     . VAL C  2 69  ? -53.269 -57.696 -92.127  1.00 52.08  ? 983  VAL C N     1 
ATOM   5227 C  CA    . VAL C  2 69  ? -52.183 -57.835 -93.085  1.00 50.78  ? 983  VAL C CA    1 
ATOM   5228 C  C     . VAL C  2 69  ? -50.847 -57.929 -92.355  1.00 47.05  ? 983  VAL C C     1 
ATOM   5229 O  O     . VAL C  2 69  ? -50.687 -57.445 -91.226  1.00 44.54  ? 983  VAL C O     1 
ATOM   5230 C  CB    . VAL C  2 69  ? -52.243 -56.640 -94.060  1.00 49.91  ? 983  VAL C CB    1 
ATOM   5231 C  CG1   . VAL C  2 69  ? -50.879 -56.287 -94.625  1.00 47.49  ? 983  VAL C CG1   1 
ATOM   5232 C  CG2   . VAL C  2 69  ? -53.252 -56.924 -95.166  1.00 44.45  ? 983  VAL C CG2   1 
ATOM   5233 N  N     . ASN C  2 70  ? -49.884 -58.589 -92.992  1.00 47.75  ? 984  ASN C N     1 
ATOM   5234 C  CA    . ASN C  2 70  ? -48.544 -58.691 -92.430  1.00 49.85  ? 984  ASN C CA    1 
ATOM   5235 C  C     . ASN C  2 70  ? -47.886 -57.321 -92.299  1.00 52.70  ? 984  ASN C C     1 
ATOM   5236 O  O     . ASN C  2 70  ? -47.459 -56.726 -93.298  1.00 50.16  ? 984  ASN C O     1 
ATOM   5237 C  CB    . ASN C  2 70  ? -47.689 -59.616 -93.291  1.00 46.90  ? 984  ASN C CB    1 
ATOM   5238 C  CG    . ASN C  2 70  ? -46.329 -59.873 -92.692  1.00 47.20  ? 984  ASN C CG    1 
ATOM   5239 O  OD1   . ASN C  2 70  ? -46.039 -59.472 -91.561  1.00 46.03  ? 984  ASN C OD1   1 
ATOM   5240 N  ND2   . ASN C  2 70  ? -45.484 -60.555 -93.448  1.00 53.47  ? 984  ASN C ND2   1 
ATOM   5241 N  N     . VAL C  2 71  ? -47.787 -56.824 -91.061  1.00 52.00  ? 985  VAL C N     1 
ATOM   5242 C  CA    . VAL C  2 71  ? -47.201 -55.507 -90.807  1.00 47.45  ? 985  VAL C CA    1 
ATOM   5243 C  C     . VAL C  2 71  ? -45.691 -55.500 -91.023  1.00 48.01  ? 985  VAL C C     1 
ATOM   5244 O  O     . VAL C  2 71  ? -45.098 -54.429 -91.202  1.00 47.74  ? 985  VAL C O     1 
ATOM   5245 C  CB    . VAL C  2 71  ? -47.548 -55.045 -89.377  1.00 45.69  ? 985  VAL C CB    1 
ATOM   5246 C  CG1   . VAL C  2 71  ? -46.748 -55.836 -88.348  1.00 44.87  ? 985  VAL C CG1   1 
ATOM   5247 C  CG2   . VAL C  2 71  ? -47.312 -53.542 -89.206  1.00 46.90  ? 985  VAL C CG2   1 
ATOM   5248 N  N     . ASN C  2 72  ? -45.049 -56.669 -91.027  1.00 45.62  ? 986  ASN C N     1 
ATOM   5249 C  CA    . ASN C  2 72  ? -43.600 -56.766 -91.156  1.00 46.69  ? 986  ASN C CA    1 
ATOM   5250 C  C     . ASN C  2 72  ? -43.167 -57.382 -92.481  1.00 48.85  ? 986  ASN C C     1 
ATOM   5251 O  O     . ASN C  2 72  ? -42.027 -57.835 -92.605  1.00 53.60  ? 986  ASN C O     1 
ATOM   5252 C  CB    . ASN C  2 72  ? -43.027 -57.560 -89.985  1.00 46.13  ? 986  ASN C CB    1 
ATOM   5253 C  CG    . ASN C  2 72  ? -43.178 -56.822 -88.669  1.00 49.82  ? 986  ASN C CG    1 
ATOM   5254 O  OD1   . ASN C  2 72  ? -42.926 -55.615 -88.595  1.00 50.70  ? 986  ASN C OD1   1 
ATOM   5255 N  ND2   . ASN C  2 72  ? -43.613 -57.533 -87.629  1.00 48.85  ? 986  ASN C ND2   1 
ATOM   5256 N  N     . ALA C  2 73  ? -44.055 -57.410 -93.468  1.00 45.76  ? 987  ALA C N     1 
ATOM   5257 C  CA    . ALA C  2 73  ? -43.706 -57.937 -94.781  1.00 50.61  ? 987  ALA C CA    1 
ATOM   5258 C  C     . ALA C  2 73  ? -42.486 -57.216 -95.350  1.00 52.32  ? 987  ALA C C     1 
ATOM   5259 O  O     . ALA C  2 73  ? -42.439 -55.984 -95.391  1.00 52.73  ? 987  ALA C O     1 
ATOM   5260 C  CB    . ALA C  2 73  ? -44.898 -57.800 -95.724  1.00 45.67  ? 987  ALA C CB    1 
ATOM   5261 N  N     . ALA C  2 74  ? -41.493 -57.989 -95.781  1.00 53.65  ? 988  ALA C N     1 
ATOM   5262 C  CA    . ALA C  2 74  ? -40.236 -57.453 -96.284  1.00 53.47  ? 988  ALA C CA    1 
ATOM   5263 C  C     . ALA C  2 74  ? -40.166 -57.594 -97.798  1.00 57.77  ? 988  ALA C C     1 
ATOM   5264 O  O     . ALA C  2 74  ? -40.582 -58.614 -98.357  1.00 57.04  ? 988  ALA C O     1 
ATOM   5265 C  CB    . ALA C  2 74  ? -39.041 -58.162 -95.641  1.00 53.76  ? 988  ALA C CB    1 
ATOM   5266 N  N     . ASP C  2 75  ? -39.633 -56.569 -98.457  1.00 61.83  ? 989  ASP C N     1 
ATOM   5267 C  CA    . ASP C  2 75  ? -39.498 -56.574 -99.905  1.00 65.02  ? 989  ASP C CA    1 
ATOM   5268 C  C     . ASP C  2 75  ? -38.196 -57.289 -100.279 1.00 68.66  ? 989  ASP C C     1 
ATOM   5269 O  O     . ASP C  2 75  ? -37.598 -57.980 -99.449  1.00 68.76  ? 989  ASP C O     1 
ATOM   5270 C  CB    . ASP C  2 75  ? -39.595 -55.136 -100.440 1.00 63.39  ? 989  ASP C CB    1 
ATOM   5271 C  CG    . ASP C  2 75  ? -38.285 -54.373 -100.338 1.00 63.52  ? 989  ASP C CG    1 
ATOM   5272 O  OD1   . ASP C  2 75  ? -38.054 -53.478 -101.172 1.00 64.94  ? 989  ASP C OD1   1 
ATOM   5273 O  OD2   . ASP C  2 75  ? -37.478 -54.664 -99.434  1.00 65.52  ? 989  ASP C OD2   1 
ATOM   5274 N  N     . SER C  2 76  ? -37.746 -57.123 -101.530 1.00 68.14  ? 990  SER C N     1 
ATOM   5275 C  CA    . SER C  2 76  ? -36.556 -57.824 -102.004 1.00 70.32  ? 990  SER C CA    1 
ATOM   5276 C  C     . SER C  2 76  ? -35.305 -57.391 -101.253 1.00 69.45  ? 990  SER C C     1 
ATOM   5277 O  O     . SER C  2 76  ? -34.355 -58.173 -101.128 1.00 70.20  ? 990  SER C O     1 
ATOM   5278 C  CB    . SER C  2 76  ? -36.373 -57.586 -103.504 1.00 70.20  ? 990  SER C CB    1 
ATOM   5279 O  OG    . SER C  2 76  ? -36.034 -56.231 -103.758 1.00 72.66  ? 990  SER C OG    1 
ATOM   5280 N  N     . ASP C  2 77  ? -35.277 -56.158 -100.758 1.00 67.37  ? 991  ASP C N     1 
ATOM   5281 C  CA    . ASP C  2 77  ? -34.151 -55.647 -99.991  1.00 69.50  ? 991  ASP C CA    1 
ATOM   5282 C  C     . ASP C  2 77  ? -34.410 -55.672 -98.487  1.00 69.88  ? 991  ASP C C     1 
ATOM   5283 O  O     . ASP C  2 77  ? -33.609 -55.128 -97.720  1.00 69.67  ? 991  ASP C O     1 
ATOM   5284 C  CB    . ASP C  2 77  ? -33.810 -54.227 -100.448 1.00 72.53  ? 991  ASP C CB    1 
ATOM   5285 C  CG    . ASP C  2 77  ? -32.367 -53.855 -100.173 1.00 76.45  ? 991  ASP C CG    1 
ATOM   5286 O  OD1   . ASP C  2 77  ? -31.566 -54.755 -99.840  1.00 77.85  ? 991  ASP C OD1   1 
ATOM   5287 O  OD2   . ASP C  2 77  ? -32.036 -52.657 -100.286 1.00 78.66  ? 991  ASP C OD2   1 
ATOM   5288 N  N     . GLY C  2 78  ? -35.501 -56.300 -98.049  1.00 66.35  ? 992  GLY C N     1 
ATOM   5289 C  CA    . GLY C  2 78  ? -35.821 -56.349 -96.636  1.00 63.02  ? 992  GLY C CA    1 
ATOM   5290 C  C     . GLY C  2 78  ? -36.489 -55.110 -96.085  1.00 57.98  ? 992  GLY C C     1 
ATOM   5291 O  O     . GLY C  2 78  ? -36.472 -54.901 -94.870  1.00 58.10  ? 992  GLY C O     1 
ATOM   5292 N  N     . TRP C  2 79  ? -37.067 -54.272 -96.940  1.00 58.63  ? 993  TRP C N     1 
ATOM   5293 C  CA    . TRP C  2 79  ? -37.766 -53.075 -96.492  1.00 57.34  ? 993  TRP C CA    1 
ATOM   5294 C  C     . TRP C  2 79  ? -39.136 -53.460 -95.951  1.00 51.51  ? 993  TRP C C     1 
ATOM   5295 O  O     . TRP C  2 79  ? -39.960 -54.023 -96.680  1.00 49.02  ? 993  TRP C O     1 
ATOM   5296 C  CB    . TRP C  2 79  ? -37.917 -52.075 -97.636  1.00 59.51  ? 993  TRP C CB    1 
ATOM   5297 C  CG    . TRP C  2 79  ? -36.695 -51.272 -97.896  1.00 65.30  ? 993  TRP C CG    1 
ATOM   5298 C  CD1   . TRP C  2 79  ? -35.501 -51.730 -98.367  1.00 69.93  ? 993  TRP C CD1   1 
ATOM   5299 C  CD2   . TRP C  2 79  ? -36.539 -49.862 -97.705  1.00 63.83  ? 993  TRP C CD2   1 
ATOM   5300 N  NE1   . TRP C  2 79  ? -34.608 -50.691 -98.482  1.00 71.77  ? 993  TRP C NE1   1 
ATOM   5301 C  CE2   . TRP C  2 79  ? -35.223 -49.533 -98.085  1.00 67.50  ? 993  TRP C CE2   1 
ATOM   5302 C  CE3   . TRP C  2 79  ? -37.386 -48.845 -97.258  1.00 60.00  ? 993  TRP C CE3   1 
ATOM   5303 C  CZ2   . TRP C  2 79  ? -34.731 -48.233 -98.021  1.00 65.24  ? 993  TRP C CZ2   1 
ATOM   5304 C  CZ3   . TRP C  2 79  ? -36.898 -47.555 -97.199  1.00 61.18  ? 993  TRP C CZ3   1 
ATOM   5305 C  CH2   . TRP C  2 79  ? -35.581 -47.260 -97.577  1.00 62.28  ? 993  TRP C CH2   1 
ATOM   5306 N  N     . THR C  2 80  ? -39.375 -53.158 -94.684  1.00 46.99  ? 994  THR C N     1 
ATOM   5307 C  CA    . THR C  2 80  ? -40.682 -53.335 -94.071  1.00 49.99  ? 994  THR C CA    1 
ATOM   5308 C  C     . THR C  2 80  ? -41.501 -52.069 -94.249  1.00 53.65  ? 994  THR C C     1 
ATOM   5309 O  O     . THR C  2 80  ? -40.966 -51.013 -94.592  1.00 51.22  ? 994  THR C O     1 
ATOM   5310 C  CB    . THR C  2 80  ? -40.517 -53.665 -92.587  1.00 49.85  ? 994  THR C CB    1 
ATOM   5311 O  OG1   . THR C  2 80  ? -40.019 -52.512 -91.893  1.00 45.26  ? 994  THR C OG1   1 
ATOM   5312 C  CG2   . THR C  2 80  ? -39.549 -54.833 -92.393  1.00 49.25  ? 994  THR C CG2   1 
ATOM   5313 N  N     . PRO C  2 81  ? -42.818 -52.138 -94.033  1.00 54.85  ? 995  PRO C N     1 
ATOM   5314 C  CA    . PRO C  2 81  ? -43.607 -50.898 -93.964  1.00 52.23  ? 995  PRO C CA    1 
ATOM   5315 C  C     . PRO C  2 81  ? -43.041 -49.881 -92.993  1.00 50.13  ? 995  PRO C C     1 
ATOM   5316 O  O     . PRO C  2 81  ? -43.160 -48.678 -93.246  1.00 52.77  ? 995  PRO C O     1 
ATOM   5317 C  CB    . PRO C  2 81  ? -44.988 -51.391 -93.522  1.00 54.69  ? 995  PRO C CB    1 
ATOM   5318 C  CG    . PRO C  2 81  ? -45.066 -52.770 -94.084  1.00 57.86  ? 995  PRO C CG    1 
ATOM   5319 C  CD    . PRO C  2 81  ? -43.674 -53.337 -94.013  1.00 56.30  ? 995  PRO C CD    1 
ATOM   5320 N  N     . LEU C  2 82  ? -42.417 -50.321 -91.894  1.00 46.35  ? 996  LEU C N     1 
ATOM   5321 C  CA    . LEU C  2 82  ? -41.807 -49.365 -90.974  1.00 49.01  ? 996  LEU C CA    1 
ATOM   5322 C  C     . LEU C  2 82  ? -40.595 -48.690 -91.605  1.00 48.16  ? 996  LEU C C     1 
ATOM   5323 O  O     . LEU C  2 82  ? -40.385 -47.485 -91.415  1.00 47.97  ? 996  LEU C O     1 
ATOM   5324 C  CB    . LEU C  2 82  ? -41.421 -50.046 -89.659  1.00 47.64  ? 996  LEU C CB    1 
ATOM   5325 C  CG    . LEU C  2 82  ? -40.876 -49.120 -88.560  1.00 47.63  ? 996  LEU C CG    1 
ATOM   5326 C  CD1   . LEU C  2 82  ? -41.921 -48.131 -88.069  1.00 43.81  ? 996  LEU C CD1   1 
ATOM   5327 C  CD2   . LEU C  2 82  ? -40.294 -49.908 -87.388  1.00 45.29  ? 996  LEU C CD2   1 
ATOM   5328 N  N     . HIS C  2 83  ? -39.789 -49.445 -92.360  1.00 44.99  ? 997  HIS C N     1 
ATOM   5329 C  CA    . HIS C  2 83  ? -38.711 -48.832 -93.133  1.00 47.89  ? 997  HIS C CA    1 
ATOM   5330 C  C     . HIS C  2 83  ? -39.249 -47.749 -94.062  1.00 48.05  ? 997  HIS C C     1 
ATOM   5331 O  O     . HIS C  2 83  ? -38.647 -46.677 -94.194  1.00 52.05  ? 997  HIS C O     1 
ATOM   5332 C  CB    . HIS C  2 83  ? -37.969 -49.891 -93.952  1.00 49.52  ? 997  HIS C CB    1 
ATOM   5333 C  CG    . HIS C  2 83  ? -37.029 -50.743 -93.154  1.00 52.40  ? 997  HIS C CG    1 
ATOM   5334 N  ND1   . HIS C  2 83  ? -37.339 -52.028 -92.768  1.00 50.91  ? 997  HIS C ND1   1 
ATOM   5335 C  CD2   . HIS C  2 83  ? -35.783 -50.500 -92.685  1.00 52.36  ? 997  HIS C CD2   1 
ATOM   5336 C  CE1   . HIS C  2 83  ? -36.328 -52.538 -92.088  1.00 51.08  ? 997  HIS C CE1   1 
ATOM   5337 N  NE2   . HIS C  2 83  ? -35.370 -51.631 -92.024  1.00 52.23  ? 997  HIS C NE2   1 
ATOM   5338 N  N     . CYS C  2 84  ? -40.379 -48.014 -94.720  1.00 44.90  ? 998  CYS C N     1 
ATOM   5339 C  CA    . CYS C  2 84  ? -40.918 -47.052 -95.674  1.00 52.91  ? 998  CYS C CA    1 
ATOM   5340 C  C     . CYS C  2 84  ? -41.409 -45.800 -94.967  1.00 55.37  ? 998  CYS C C     1 
ATOM   5341 O  O     . CYS C  2 84  ? -41.100 -44.679 -95.390  1.00 52.45  ? 998  CYS C O     1 
ATOM   5342 C  CB    . CYS C  2 84  ? -42.051 -47.675 -96.482  1.00 54.59  ? 998  CYS C CB    1 
ATOM   5343 S  SG    . CYS C  2 84  ? -41.523 -49.017 -97.521  1.00 63.46  ? 998  CYS C SG    1 
ATOM   5344 N  N     . ALA C  2 85  ? -42.188 -45.973 -93.894  1.00 43.09  ? 999  ALA C N     1 
ATOM   5345 C  CA    . ALA C  2 85  ? -42.663 -44.817 -93.143  1.00 42.75  ? 999  ALA C CA    1 
ATOM   5346 C  C     . ALA C  2 85  ? -41.500 -43.981 -92.633  1.00 46.43  ? 999  ALA C C     1 
ATOM   5347 O  O     . ALA C  2 85  ? -41.587 -42.748 -92.600  1.00 50.31  ? 999  ALA C O     1 
ATOM   5348 C  CB    . ALA C  2 85  ? -43.552 -45.271 -91.982  1.00 42.70  ? 999  ALA C CB    1 
ATOM   5349 N  N     . ALA C  2 86  ? -40.397 -44.639 -92.268  1.00 45.83  ? 1000 ALA C N     1 
ATOM   5350 C  CA    . ALA C  2 86  ? -39.224 -43.933 -91.767  1.00 45.15  ? 1000 ALA C CA    1 
ATOM   5351 C  C     . ALA C  2 86  ? -38.549 -43.120 -92.864  1.00 45.35  ? 1000 ALA C C     1 
ATOM   5352 O  O     . ALA C  2 86  ? -38.123 -41.985 -92.627  1.00 46.83  ? 1000 ALA C O     1 
ATOM   5353 C  CB    . ALA C  2 86  ? -38.241 -44.935 -91.169  1.00 43.83  ? 1000 ALA C CB    1 
ATOM   5354 N  N     . SER C  2 87  ? -38.434 -43.690 -94.066  1.00 46.76  ? 1001 SER C N     1 
ATOM   5355 C  CA    . SER C  2 87  ? -37.835 -42.977 -95.188  1.00 51.56  ? 1001 SER C CA    1 
ATOM   5356 C  C     . SER C  2 87  ? -38.675 -41.787 -95.624  1.00 50.79  ? 1001 SER C C     1 
ATOM   5357 O  O     . SER C  2 87  ? -38.139 -40.857 -96.229  1.00 55.22  ? 1001 SER C O     1 
ATOM   5358 C  CB    . SER C  2 87  ? -37.632 -43.924 -96.372  1.00 51.90  ? 1001 SER C CB    1 
ATOM   5359 O  OG    . SER C  2 87  ? -38.881 -44.283 -96.928  1.00 53.54  ? 1001 SER C OG    1 
ATOM   5360 N  N     . CYS C  2 88  ? -39.972 -41.796 -95.338  1.00 50.61  ? 1002 CYS C N     1 
ATOM   5361 C  CA    . CYS C  2 88  ? -40.824 -40.630 -95.527  1.00 52.02  ? 1002 CYS C CA    1 
ATOM   5362 C  C     . CYS C  2 88  ? -40.869 -39.714 -94.304  1.00 53.40  ? 1002 CYS C C     1 
ATOM   5363 O  O     . CYS C  2 88  ? -41.634 -38.743 -94.308  1.00 51.51  ? 1002 CYS C O     1 
ATOM   5364 C  CB    . CYS C  2 88  ? -42.249 -41.069 -95.872  1.00 52.15  ? 1002 CYS C CB    1 
ATOM   5365 S  SG    . CYS C  2 88  ? -42.365 -42.177 -97.276  1.00 57.59  ? 1002 CYS C SG    1 
ATOM   5366 N  N     . ASN C  2 89  ? -40.086 -40.004 -93.258  1.00 46.78  ? 1003 ASN C N     1 
ATOM   5367 C  CA    . ASN C  2 89  ? -40.089 -39.203 -92.030  1.00 49.50  ? 1003 ASN C CA    1 
ATOM   5368 C  C     . ASN C  2 89  ? -41.499 -39.055 -91.467  1.00 52.52  ? 1003 ASN C C     1 
ATOM   5369 O  O     . ASN C  2 89  ? -41.842 -38.031 -90.874  1.00 54.32  ? 1003 ASN C O     1 
ATOM   5370 C  CB    . ASN C  2 89  ? -39.464 -37.824 -92.260  1.00 51.40  ? 1003 ASN C CB    1 
ATOM   5371 C  CG    . ASN C  2 89  ? -38.003 -37.897 -92.667  1.00 52.67  ? 1003 ASN C CG    1 
ATOM   5372 O  OD1   . ASN C  2 89  ? -37.327 -38.901 -92.435  1.00 54.68  ? 1003 ASN C OD1   1 
ATOM   5373 N  ND2   . ASN C  2 89  ? -37.502 -36.816 -93.262  1.00 44.89  ? 1003 ASN C ND2   1 
ATOM   5374 N  N     . ASN C  2 90  ? -42.334 -40.072 -91.673  1.00 52.13  ? 1004 ASN C N     1 
ATOM   5375 C  CA    . ASN C  2 90  ? -43.737 -40.041 -91.257  1.00 49.90  ? 1004 ASN C CA    1 
ATOM   5376 C  C     . ASN C  2 90  ? -43.828 -40.579 -89.833  1.00 51.85  ? 1004 ASN C C     1 
ATOM   5377 O  O     . ASN C  2 90  ? -44.023 -41.778 -89.606  1.00 51.63  ? 1004 ASN C O     1 
ATOM   5378 C  CB    . ASN C  2 90  ? -44.595 -40.847 -92.227  1.00 49.29  ? 1004 ASN C CB    1 
ATOM   5379 C  CG    . ASN C  2 90  ? -46.065 -40.509 -92.123  1.00 53.05  ? 1004 ASN C CG    1 
ATOM   5380 O  OD1   . ASN C  2 90  ? -46.547 -40.084 -91.073  1.00 53.44  ? 1004 ASN C OD1   1 
ATOM   5381 N  ND2   . ASN C  2 90  ? -46.792 -40.701 -93.214  1.00 58.80  ? 1004 ASN C ND2   1 
ATOM   5382 N  N     . VAL C  2 91  ? -43.696 -39.679 -88.854  1.00 47.49  ? 1005 VAL C N     1 
ATOM   5383 C  CA    . VAL C  2 91  ? -43.662 -40.125 -87.465  1.00 46.13  ? 1005 VAL C CA    1 
ATOM   5384 C  C     . VAL C  2 91  ? -45.018 -40.675 -87.033  1.00 49.35  ? 1005 VAL C C     1 
ATOM   5385 O  O     . VAL C  2 91  ? -45.085 -41.614 -86.227  1.00 47.62  ? 1005 VAL C O     1 
ATOM   5386 C  CB    . VAL C  2 91  ? -43.178 -38.989 -86.545  1.00 47.79  ? 1005 VAL C CB    1 
ATOM   5387 C  CG1   . VAL C  2 91  ? -44.225 -37.893 -86.422  1.00 49.33  ? 1005 VAL C CG1   1 
ATOM   5388 C  CG2   . VAL C  2 91  ? -42.806 -39.530 -85.167  1.00 48.40  ? 1005 VAL C CG2   1 
ATOM   5389 N  N     . GLN C  2 92  ? -46.115 -40.140 -87.576  1.00 50.84  ? 1006 GLN C N     1 
ATOM   5390 C  CA    . GLN C  2 92  ? -47.432 -40.638 -87.185  1.00 52.77  ? 1006 GLN C CA    1 
ATOM   5391 C  C     . GLN C  2 92  ? -47.649 -42.075 -87.656  1.00 54.21  ? 1006 GLN C C     1 
ATOM   5392 O  O     . GLN C  2 92  ? -48.156 -42.912 -86.896  1.00 53.66  ? 1006 GLN C O     1 
ATOM   5393 C  CB    . GLN C  2 92  ? -48.525 -39.721 -87.729  1.00 58.34  ? 1006 GLN C CB    1 
ATOM   5394 C  CG    . GLN C  2 92  ? -49.591 -39.379 -86.707  1.00 63.79  ? 1006 GLN C CG    1 
ATOM   5395 C  CD    . GLN C  2 92  ? -48.996 -38.823 -85.419  1.00 72.59  ? 1006 GLN C CD    1 
ATOM   5396 O  OE1   . GLN C  2 92  ? -48.135 -37.939 -85.455  1.00 80.33  ? 1006 GLN C OE1   1 
ATOM   5397 N  NE2   . GLN C  2 92  ? -49.445 -39.346 -84.275  1.00 64.95  ? 1006 GLN C NE2   1 
ATOM   5398 N  N     . VAL C  2 93  ? -47.271 -42.385 -88.900  1.00 46.70  ? 1007 VAL C N     1 
ATOM   5399 C  CA    . VAL C  2 93  ? -47.404 -43.757 -89.379  1.00 46.54  ? 1007 VAL C CA    1 
ATOM   5400 C  C     . VAL C  2 93  ? -46.420 -44.676 -88.662  1.00 46.89  ? 1007 VAL C C     1 
ATOM   5401 O  O     . VAL C  2 93  ? -46.780 -45.784 -88.242  1.00 48.51  ? 1007 VAL C O     1 
ATOM   5402 C  CB    . VAL C  2 93  ? -47.234 -43.810 -90.907  1.00 50.56  ? 1007 VAL C CB    1 
ATOM   5403 C  CG1   . VAL C  2 93  ? -47.100 -45.252 -91.379  1.00 47.14  ? 1007 VAL C CG1   1 
ATOM   5404 C  CG2   . VAL C  2 93  ? -48.420 -43.126 -91.577  1.00 49.91  ? 1007 VAL C CG2   1 
ATOM   5405 N  N     . CYS C  2 94  ? -45.169 -44.230 -88.503  1.00 48.47  ? 1008 CYS C N     1 
ATOM   5406 C  CA    . CYS C  2 94  ? -44.196 -44.972 -87.701  1.00 53.42  ? 1008 CYS C CA    1 
ATOM   5407 C  C     . CYS C  2 94  ? -44.768 -45.342 -86.340  1.00 51.87  ? 1008 CYS C C     1 
ATOM   5408 O  O     . CYS C  2 94  ? -44.695 -46.504 -85.916  1.00 51.23  ? 1008 CYS C O     1 
ATOM   5409 C  CB    . CYS C  2 94  ? -42.924 -44.146 -87.516  1.00 51.98  ? 1008 CYS C CB    1 
ATOM   5410 S  SG    . CYS C  2 94  ? -41.873 -44.095 -88.960  1.00 54.98  ? 1008 CYS C SG    1 
ATOM   5411 N  N     . LYS C  2 95  ? -45.343 -44.362 -85.640  1.00 46.53  ? 1009 LYS C N     1 
ATOM   5412 C  CA    . LYS C  2 95  ? -45.894 -44.636 -84.317  1.00 48.86  ? 1009 LYS C CA    1 
ATOM   5413 C  C     . LYS C  2 95  ? -47.023 -45.652 -84.400  1.00 48.71  ? 1009 LYS C C     1 
ATOM   5414 O  O     . LYS C  2 95  ? -47.094 -46.580 -83.586  1.00 48.83  ? 1009 LYS C O     1 
ATOM   5415 C  CB    . LYS C  2 95  ? -46.379 -43.341 -83.664  1.00 52.52  ? 1009 LYS C CB    1 
ATOM   5416 C  CG    . LYS C  2 95  ? -47.126 -43.552 -82.351  1.00 62.08  ? 1009 LYS C CG    1 
ATOM   5417 C  CD    . LYS C  2 95  ? -47.400 -42.233 -81.636  1.00 64.99  ? 1009 LYS C CD    1 
ATOM   5418 C  CE    . LYS C  2 95  ? -48.717 -42.286 -80.873  1.00 70.73  ? 1009 LYS C CE    1 
ATOM   5419 N  NZ    . LYS C  2 95  ? -49.888 -42.335 -81.805  1.00 74.39  ? 1009 LYS C NZ    1 
ATOM   5420 N  N     . PHE C  2 96  ? -47.902 -45.510 -85.393  1.00 44.45  ? 1010 PHE C N     1 
ATOM   5421 C  CA    . PHE C  2 96  ? -49.013 -46.444 -85.513  1.00 44.62  ? 1010 PHE C CA    1 
ATOM   5422 C  C     . PHE C  2 96  ? -48.521 -47.840 -85.870  1.00 48.06  ? 1010 PHE C C     1 
ATOM   5423 O  O     . PHE C  2 96  ? -49.059 -48.841 -85.375  1.00 46.57  ? 1010 PHE C O     1 
ATOM   5424 C  CB    . PHE C  2 96  ? -50.015 -45.952 -86.549  1.00 46.57  ? 1010 PHE C CB    1 
ATOM   5425 C  CG    . PHE C  2 96  ? -51.048 -46.973 -86.902  1.00 51.35  ? 1010 PHE C CG    1 
ATOM   5426 C  CD1   . PHE C  2 96  ? -52.090 -47.249 -86.022  1.00 46.43  ? 1010 PHE C CD1   1 
ATOM   5427 C  CD2   . PHE C  2 96  ? -50.965 -47.682 -88.099  1.00 49.60  ? 1010 PHE C CD2   1 
ATOM   5428 C  CE1   . PHE C  2 96  ? -53.043 -48.198 -86.333  1.00 45.03  ? 1010 PHE C CE1   1 
ATOM   5429 C  CE2   . PHE C  2 96  ? -51.913 -48.638 -88.419  1.00 48.21  ? 1010 PHE C CE2   1 
ATOM   5430 C  CZ    . PHE C  2 96  ? -52.958 -48.899 -87.534  1.00 45.27  ? 1010 PHE C CZ    1 
ATOM   5431 N  N     . LEU C  2 97  ? -47.505 -47.929 -86.730  1.00 44.88  ? 1011 LEU C N     1 
ATOM   5432 C  CA    . LEU C  2 97  ? -46.968 -49.237 -87.083  1.00 45.33  ? 1011 LEU C CA    1 
ATOM   5433 C  C     . LEU C  2 97  ? -46.323 -49.908 -85.876  1.00 48.10  ? 1011 LEU C C     1 
ATOM   5434 O  O     . LEU C  2 97  ? -46.498 -51.114 -85.670  1.00 48.64  ? 1011 LEU C O     1 
ATOM   5435 C  CB    . LEU C  2 97  ? -45.966 -49.106 -88.229  1.00 47.57  ? 1011 LEU C CB    1 
ATOM   5436 C  CG    . LEU C  2 97  ? -46.528 -48.766 -89.616  1.00 49.63  ? 1011 LEU C CG    1 
ATOM   5437 C  CD1   . LEU C  2 97  ? -45.395 -48.526 -90.591  1.00 43.11  ? 1011 LEU C CD1   1 
ATOM   5438 C  CD2   . LEU C  2 97  ? -47.441 -49.879 -90.112  1.00 46.45  ? 1011 LEU C CD2   1 
ATOM   5439 N  N     . VAL C  2 98  ? -45.585 -49.142 -85.063  1.00 47.01  ? 1012 VAL C N     1 
ATOM   5440 C  CA    . VAL C  2 98  ? -44.914 -49.717 -83.896  1.00 49.10  ? 1012 VAL C CA    1 
ATOM   5441 C  C     . VAL C  2 98  ? -45.940 -50.252 -82.905  1.00 48.13  ? 1012 VAL C C     1 
ATOM   5442 O  O     . VAL C  2 98  ? -45.764 -51.333 -82.324  1.00 49.48  ? 1012 VAL C O     1 
ATOM   5443 C  CB    . VAL C  2 98  ? -43.981 -48.680 -83.241  1.00 43.75  ? 1012 VAL C CB    1 
ATOM   5444 C  CG1   . VAL C  2 98  ? -43.694 -49.049 -81.792  1.00 44.20  ? 1012 VAL C CG1   1 
ATOM   5445 C  CG2   . VAL C  2 98  ? -42.687 -48.551 -84.022  1.00 43.93  ? 1012 VAL C CG2   1 
ATOM   5446 N  N     . GLU C  2 99  ? -47.041 -49.515 -82.715  1.00 47.54  ? 1013 GLU C N     1 
ATOM   5447 C  CA    . GLU C  2 99  ? -48.160 -49.961 -81.886  1.00 48.63  ? 1013 GLU C CA    1 
ATOM   5448 C  C     . GLU C  2 99  ? -48.926 -51.130 -82.495  1.00 50.97  ? 1013 GLU C C     1 
ATOM   5449 O  O     . GLU C  2 99  ? -49.829 -51.664 -81.844  1.00 50.04  ? 1013 GLU C O     1 
ATOM   5450 C  CB    . GLU C  2 99  ? -49.112 -48.790 -81.635  1.00 48.08  ? 1013 GLU C CB    1 
ATOM   5451 C  CG    . GLU C  2 99  ? -48.524 -47.725 -80.719  1.00 53.64  ? 1013 GLU C CG    1 
ATOM   5452 C  CD    . GLU C  2 99  ? -49.329 -46.443 -80.681  1.00 58.71  ? 1013 GLU C CD    1 
ATOM   5453 O  OE1   . GLU C  2 99  ? -50.071 -46.165 -81.648  1.00 54.85  ? 1013 GLU C OE1   1 
ATOM   5454 O  OE2   . GLU C  2 99  ? -49.208 -45.709 -79.676  1.00 64.85  ? 1013 GLU C OE2   1 
ATOM   5455 N  N     . SER C  2 100 ? -48.587 -51.552 -83.713  1.00 48.39  ? 1014 SER C N     1 
ATOM   5456 C  CA    . SER C  2 100 ? -49.315 -52.612 -84.395  1.00 45.96  ? 1014 SER C CA    1 
ATOM   5457 C  C     . SER C  2 100 ? -48.443 -53.839 -84.643  1.00 45.96  ? 1014 SER C C     1 
ATOM   5458 O  O     . SER C  2 100 ? -48.788 -54.681 -85.477  1.00 44.31  ? 1014 SER C O     1 
ATOM   5459 C  CB    . SER C  2 100 ? -49.884 -52.081 -85.708  1.00 47.38  ? 1014 SER C CB    1 
ATOM   5460 O  OG    . SER C  2 100 ? -50.751 -50.983 -85.474  1.00 49.82  ? 1014 SER C OG    1 
ATOM   5461 N  N     . GLY C  2 101 ? -47.309 -53.941 -83.961  1.00 48.17  ? 1015 GLY C N     1 
ATOM   5462 C  CA    . GLY C  2 101 ? -46.454 -55.105 -84.060  1.00 47.90  ? 1015 GLY C CA    1 
ATOM   5463 C  C     . GLY C  2 101 ? -45.310 -54.994 -85.042  1.00 50.80  ? 1015 GLY C C     1 
ATOM   5464 O  O     . GLY C  2 101 ? -44.818 -56.029 -85.509  1.00 48.52  ? 1015 GLY C O     1 
ATOM   5465 N  N     . ALA C  2 102 ? -44.881 -53.781 -85.376  1.00 49.93  ? 1016 ALA C N     1 
ATOM   5466 C  CA    . ALA C  2 102 ? -43.763 -53.605 -86.290  1.00 44.90  ? 1016 ALA C CA    1 
ATOM   5467 C  C     . ALA C  2 102 ? -42.463 -54.052 -85.637  1.00 48.73  ? 1016 ALA C C     1 
ATOM   5468 O  O     . ALA C  2 102 ? -42.216 -53.787 -84.456  1.00 50.66  ? 1016 ALA C O     1 
ATOM   5469 C  CB    . ALA C  2 102 ? -43.661 -52.144 -86.723  1.00 44.51  ? 1016 ALA C CB    1 
ATOM   5470 N  N     . ALA C  2 103 ? -41.627 -54.735 -86.418  1.00 47.98  ? 1017 ALA C N     1 
ATOM   5471 C  CA    . ALA C  2 103 ? -40.338 -55.234 -85.942  1.00 48.01  ? 1017 ALA C CA    1 
ATOM   5472 C  C     . ALA C  2 103 ? -39.351 -54.077 -85.907  1.00 47.19  ? 1017 ALA C C     1 
ATOM   5473 O  O     . ALA C  2 103 ? -38.777 -53.707 -86.934  1.00 48.48  ? 1017 ALA C O     1 
ATOM   5474 C  CB    . ALA C  2 103 ? -39.837 -56.362 -86.833  1.00 46.61  ? 1017 ALA C CB    1 
ATOM   5475 N  N     . VAL C  2 104 ? -39.138 -53.520 -84.712  1.00 45.96  ? 1018 VAL C N     1 
ATOM   5476 C  CA    . VAL C  2 104 ? -38.366 -52.283 -84.573  1.00 50.22  ? 1018 VAL C CA    1 
ATOM   5477 C  C     . VAL C  2 104 ? -36.948 -52.455 -85.105  1.00 53.74  ? 1018 VAL C C     1 
ATOM   5478 O  O     . VAL C  2 104 ? -36.414 -51.568 -85.781  1.00 58.47  ? 1018 VAL C O     1 
ATOM   5479 C  CB    . VAL C  2 104 ? -38.360 -51.823 -83.102  1.00 51.40  ? 1018 VAL C CB    1 
ATOM   5480 C  CG1   . VAL C  2 104 ? -37.348 -50.704 -82.891  1.00 50.20  ? 1018 VAL C CG1   1 
ATOM   5481 C  CG2   . VAL C  2 104 ? -39.756 -51.379 -82.671  1.00 49.06  ? 1018 VAL C CG2   1 
ATOM   5482 N  N     . PHE C  2 105 ? -36.311 -53.587 -84.806  1.00 51.88  ? 1019 PHE C N     1 
ATOM   5483 C  CA    . PHE C  2 105 ? -34.920 -53.808 -85.180  1.00 53.70  ? 1019 PHE C CA    1 
ATOM   5484 C  C     . PHE C  2 105 ? -34.777 -54.655 -86.436  1.00 55.52  ? 1019 PHE C C     1 
ATOM   5485 O  O     . PHE C  2 105 ? -33.693 -55.190 -86.690  1.00 57.98  ? 1019 PHE C O     1 
ATOM   5486 C  CB    . PHE C  2 105 ? -34.147 -54.451 -84.028  1.00 55.22  ? 1019 PHE C CB    1 
ATOM   5487 C  CG    . PHE C  2 105 ? -33.801 -53.493 -82.925  1.00 57.06  ? 1019 PHE C CG    1 
ATOM   5488 C  CD1   . PHE C  2 105 ? -32.743 -52.610 -83.066  1.00 55.10  ? 1019 PHE C CD1   1 
ATOM   5489 C  CD2   . PHE C  2 105 ? -34.538 -53.472 -81.748  1.00 57.77  ? 1019 PHE C CD2   1 
ATOM   5490 C  CE1   . PHE C  2 105 ? -32.423 -51.722 -82.055  1.00 54.89  ? 1019 PHE C CE1   1 
ATOM   5491 C  CE2   . PHE C  2 105 ? -34.225 -52.582 -80.726  1.00 59.09  ? 1019 PHE C CE2   1 
ATOM   5492 C  CZ    . PHE C  2 105 ? -33.163 -51.707 -80.881  1.00 58.63  ? 1019 PHE C CZ    1 
ATOM   5493 N  N     . ALA C  2 106 ? -35.844 -54.790 -87.220  1.00 54.52  ? 1020 ALA C N     1 
ATOM   5494 C  CA    . ALA C  2 106 ? -35.734 -55.424 -88.527  1.00 51.76  ? 1020 ALA C CA    1 
ATOM   5495 C  C     . ALA C  2 106 ? -34.740 -54.659 -89.392  1.00 52.52  ? 1020 ALA C C     1 
ATOM   5496 O  O     . ALA C  2 106 ? -34.734 -53.424 -89.419  1.00 52.24  ? 1020 ALA C O     1 
ATOM   5497 C  CB    . ALA C  2 106 ? -37.103 -55.482 -89.205  1.00 46.87  ? 1020 ALA C CB    1 
ATOM   5498 N  N     . MET C  2 107 ? -33.879 -55.395 -90.083  1.00 54.32  ? 1021 MET C N     1 
ATOM   5499 C  CA    . MET C  2 107 ? -32.812 -54.797 -90.871  1.00 59.53  ? 1021 MET C CA    1 
ATOM   5500 C  C     . MET C  2 107 ? -33.001 -55.076 -92.355  1.00 62.26  ? 1021 MET C C     1 
ATOM   5501 O  O     . MET C  2 107 ? -33.498 -56.135 -92.754  1.00 59.59  ? 1021 MET C O     1 
ATOM   5502 C  CB    . MET C  2 107 ? -31.442 -55.320 -90.436  1.00 65.50  ? 1021 MET C CB    1 
ATOM   5503 C  CG    . MET C  2 107 ? -30.893 -54.683 -89.178  1.00 69.62  ? 1021 MET C CG    1 
ATOM   5504 S  SD    . MET C  2 107 ? -29.449 -55.585 -88.586  1.00 78.78  ? 1021 MET C SD    1 
ATOM   5505 C  CE    . MET C  2 107 ? -30.165 -57.185 -88.201  1.00 71.92  ? 1021 MET C CE    1 
ATOM   5506 N  N     . THR C  2 108 ? -32.588 -54.108 -93.168  1.00 66.39  ? 1022 THR C N     1 
ATOM   5507 C  CA    . THR C  2 108 ? -32.501 -54.313 -94.602  1.00 66.80  ? 1022 THR C CA    1 
ATOM   5508 C  C     . THR C  2 108 ? -31.342 -55.251 -94.922  1.00 70.80  ? 1022 THR C C     1 
ATOM   5509 O  O     . THR C  2 108 ? -30.400 -55.408 -94.140  1.00 75.02  ? 1022 THR C O     1 
ATOM   5510 C  CB    . THR C  2 108 ? -32.315 -52.981 -95.323  1.00 67.74  ? 1022 THR C CB    1 
ATOM   5511 O  OG1   . THR C  2 108 ? -31.286 -52.226 -94.670  1.00 67.16  ? 1022 THR C OG1   1 
ATOM   5512 C  CG2   . THR C  2 108 ? -33.607 -52.188 -95.306  1.00 71.30  ? 1022 THR C CG2   1 
ATOM   5513 N  N     . TYR C  2 109 ? -31.418 -55.882 -96.093  1.00 71.34  ? 1023 TYR C N     1 
ATOM   5514 C  CA    . TYR C  2 109 ? -30.454 -56.925 -96.429  1.00 74.51  ? 1023 TYR C CA    1 
ATOM   5515 C  C     . TYR C  2 109 ? -29.101 -56.341 -96.824  1.00 78.32  ? 1023 TYR C C     1 
ATOM   5516 O  O     . TYR C  2 109 ? -28.064 -56.742 -96.282  1.00 76.29  ? 1023 TYR C O     1 
ATOM   5517 C  CB    . TYR C  2 109 ? -31.006 -57.808 -97.551  1.00 72.35  ? 1023 TYR C CB    1 
ATOM   5518 C  CG    . TYR C  2 109 ? -32.318 -58.485 -97.216  1.00 69.57  ? 1023 TYR C CG    1 
ATOM   5519 C  CD1   . TYR C  2 109 ? -32.666 -58.765 -95.899  1.00 68.55  ? 1023 TYR C CD1   1 
ATOM   5520 C  CD2   . TYR C  2 109 ? -33.209 -58.845 -98.220  1.00 67.43  ? 1023 TYR C CD2   1 
ATOM   5521 C  CE1   . TYR C  2 109 ? -33.866 -59.382 -95.593  1.00 65.27  ? 1023 TYR C CE1   1 
ATOM   5522 C  CE2   . TYR C  2 109 ? -34.406 -59.462 -97.927  1.00 64.62  ? 1023 TYR C CE2   1 
ATOM   5523 C  CZ    . TYR C  2 109 ? -34.732 -59.726 -96.612  1.00 66.31  ? 1023 TYR C CZ    1 
ATOM   5524 O  OH    . TYR C  2 109 ? -35.928 -60.339 -96.319  1.00 67.06  ? 1023 TYR C OH    1 
ATOM   5525 N  N     . SER C  2 110 ? -29.093 -55.384 -97.756  1.00 80.01  ? 1024 SER C N     1 
ATOM   5526 C  CA    . SER C  2 110 ? -27.851 -54.912 -98.356  1.00 81.83  ? 1024 SER C CA    1 
ATOM   5527 C  C     . SER C  2 110 ? -27.037 -53.998 -97.447  1.00 81.73  ? 1024 SER C C     1 
ATOM   5528 O  O     . SER C  2 110 ? -25.863 -53.752 -97.744  1.00 83.71  ? 1024 SER C O     1 
ATOM   5529 C  CB    . SER C  2 110 ? -28.147 -54.186 -99.671  1.00 84.35  ? 1024 SER C CB    1 
ATOM   5530 O  OG    . SER C  2 110 ? -26.999 -53.502 -100.140 1.00 87.54  ? 1024 SER C OG    1 
ATOM   5531 N  N     . ASP C  2 111 ? -27.614 -53.490 -96.358  1.00 79.56  ? 1025 ASP C N     1 
ATOM   5532 C  CA    . ASP C  2 111 ? -26.882 -52.586 -95.480  1.00 78.61  ? 1025 ASP C CA    1 
ATOM   5533 C  C     . ASP C  2 111 ? -27.169 -52.789 -94.000  1.00 76.83  ? 1025 ASP C C     1 
ATOM   5534 O  O     . ASP C  2 111 ? -26.599 -52.060 -93.184  1.00 76.54  ? 1025 ASP C O     1 
ATOM   5535 C  CB    . ASP C  2 111 ? -27.175 -51.123 -95.856  1.00 80.85  ? 1025 ASP C CB    1 
ATOM   5536 C  CG    . ASP C  2 111 ? -28.637 -50.887 -96.185  1.00 82.35  ? 1025 ASP C CG    1 
ATOM   5537 O  OD1   . ASP C  2 111 ? -29.446 -51.814 -95.976  1.00 82.40  ? 1025 ASP C OD1   1 
ATOM   5538 O  OD2   . ASP C  2 111 ? -28.974 -49.782 -96.664  1.00 80.79  ? 1025 ASP C OD2   1 
ATOM   5539 N  N     . MET C  2 112 ? -28.033 -53.740 -93.630  1.00 76.52  ? 1026 MET C N     1 
ATOM   5540 C  CA    . MET C  2 112 ? -28.305 -54.081 -92.229  1.00 75.19  ? 1026 MET C CA    1 
ATOM   5541 C  C     . MET C  2 112 ? -28.772 -52.865 -91.427  1.00 70.46  ? 1026 MET C C     1 
ATOM   5542 O  O     . MET C  2 112 ? -28.372 -52.668 -90.278  1.00 68.77  ? 1026 MET C O     1 
ATOM   5543 C  CB    . MET C  2 112 ? -27.081 -54.728 -91.573  1.00 77.82  ? 1026 MET C CB    1 
ATOM   5544 N  N     . GLN C  2 113 ? -29.627 -52.046 -92.035  1.00 66.54  ? 1027 GLN C N     1 
ATOM   5545 C  CA    . GLN C  2 113 ? -30.122 -50.825 -91.411  1.00 65.85  ? 1027 GLN C CA    1 
ATOM   5546 C  C     . GLN C  2 113 ? -31.546 -51.018 -90.899  1.00 61.65  ? 1027 GLN C C     1 
ATOM   5547 O  O     . GLN C  2 113 ? -32.375 -51.653 -91.560  1.00 57.29  ? 1027 GLN C O     1 
ATOM   5548 C  CB    . GLN C  2 113 ? -30.076 -49.651 -92.392  1.00 59.79  ? 1027 GLN C CB    1 
ATOM   5549 C  CG    . GLN C  2 113 ? -28.678 -49.127 -92.673  1.00 63.49  ? 1027 GLN C CG    1 
ATOM   5550 C  CD    . GLN C  2 113 ? -28.685 -47.926 -93.604  1.00 70.42  ? 1027 GLN C CD    1 
ATOM   5551 O  OE1   . GLN C  2 113 ? -29.742 -47.490 -94.063  1.00 72.93  ? 1027 GLN C OE1   1 
ATOM   5552 N  NE2   . GLN C  2 113 ? -27.503 -47.390 -93.895  1.00 70.96  ? 1027 GLN C NE2   1 
ATOM   5553 N  N     . THR C  2 114 ? -31.819 -50.478 -89.709  1.00 57.16  ? 1028 THR C N     1 
ATOM   5554 C  CA    . THR C  2 114 ? -33.167 -50.494 -89.165  1.00 56.13  ? 1028 THR C CA    1 
ATOM   5555 C  C     . THR C  2 114 ? -33.975 -49.337 -89.746  1.00 55.91  ? 1028 THR C C     1 
ATOM   5556 O  O     . THR C  2 114 ? -33.480 -48.538 -90.547  1.00 55.36  ? 1028 THR C O     1 
ATOM   5557 C  CB    . THR C  2 114 ? -33.144 -50.416 -87.641  1.00 58.20  ? 1028 THR C CB    1 
ATOM   5558 O  OG1   . THR C  2 114 ? -32.635 -49.141 -87.233  1.00 59.51  ? 1028 THR C OG1   1 
ATOM   5559 C  CG2   . THR C  2 114 ? -32.285 -51.520 -87.049  1.00 58.41  ? 1028 THR C CG2   1 
ATOM   5560 N  N     . ALA C  2 115 ? -35.242 -49.242 -89.335  1.00 57.37  ? 1029 ALA C N     1 
ATOM   5561 C  CA    . ALA C  2 115 ? -36.082 -48.157 -89.827  1.00 54.72  ? 1029 ALA C CA    1 
ATOM   5562 C  C     . ALA C  2 115 ? -35.528 -46.804 -89.408  1.00 55.26  ? 1029 ALA C C     1 
ATOM   5563 O  O     . ALA C  2 115 ? -35.497 -45.864 -90.212  1.00 56.98  ? 1029 ALA C O     1 
ATOM   5564 C  CB    . ALA C  2 115 ? -37.517 -48.325 -89.338  1.00 51.97  ? 1029 ALA C CB    1 
ATOM   5565 N  N     . ALA C  2 116 ? -35.062 -46.691 -88.160  1.00 51.63  ? 1030 ALA C N     1 
ATOM   5566 C  CA    . ALA C  2 116 ? -34.510 -45.426 -87.684  1.00 55.50  ? 1030 ALA C CA    1 
ATOM   5567 C  C     . ALA C  2 116 ? -33.393 -44.924 -88.591  1.00 55.87  ? 1030 ALA C C     1 
ATOM   5568 O  O     . ALA C  2 116 ? -33.291 -43.719 -88.839  1.00 54.18  ? 1030 ALA C O     1 
ATOM   5569 C  CB    . ALA C  2 116 ? -34.004 -45.576 -86.245  1.00 50.22  ? 1030 ALA C CB    1 
ATOM   5570 N  N     . ASP C  2 117 ? -32.563 -45.830 -89.113  1.00 58.37  ? 1031 ASP C N     1 
ATOM   5571 C  CA    . ASP C  2 117 ? -31.509 -45.435 -90.042  1.00 61.22  ? 1031 ASP C CA    1 
ATOM   5572 C  C     . ASP C  2 117 ? -32.055 -44.921 -91.370  1.00 59.16  ? 1031 ASP C C     1 
ATOM   5573 O  O     . ASP C  2 117 ? -31.327 -44.243 -92.102  1.00 63.99  ? 1031 ASP C O     1 
ATOM   5574 C  CB    . ASP C  2 117 ? -30.569 -46.611 -90.311  1.00 65.11  ? 1031 ASP C CB    1 
ATOM   5575 C  CG    . ASP C  2 117 ? -30.072 -47.267 -89.043  1.00 65.34  ? 1031 ASP C CG    1 
ATOM   5576 O  OD1   . ASP C  2 117 ? -29.948 -46.568 -88.015  1.00 69.08  ? 1031 ASP C OD1   1 
ATOM   5577 O  OD2   . ASP C  2 117 ? -29.806 -48.485 -89.078  1.00 64.50  ? 1031 ASP C OD2   1 
ATOM   5578 N  N     . LYS C  2 118 ? -33.312 -45.221 -91.700  1.00 53.56  ? 1032 LYS C N     1 
ATOM   5579 C  CA    . LYS C  2 118 ? -33.862 -44.836 -92.994  1.00 51.86  ? 1032 LYS C CA    1 
ATOM   5580 C  C     . LYS C  2 118 ? -34.412 -43.418 -93.021  1.00 52.92  ? 1032 LYS C C     1 
ATOM   5581 O  O     . LYS C  2 118 ? -34.752 -42.935 -94.105  1.00 53.70  ? 1032 LYS C O     1 
ATOM   5582 C  CB    . LYS C  2 118 ? -34.965 -45.809 -93.411  1.00 54.60  ? 1032 LYS C CB    1 
ATOM   5583 C  CG    . LYS C  2 118 ? -34.458 -47.206 -93.704  1.00 60.44  ? 1032 LYS C CG    1 
ATOM   5584 C  CD    . LYS C  2 118 ? -33.295 -47.155 -94.673  1.00 65.70  ? 1032 LYS C CD    1 
ATOM   5585 C  CE    . LYS C  2 118 ? -32.722 -48.535 -94.918  1.00 73.41  ? 1032 LYS C CE    1 
ATOM   5586 N  NZ    . LYS C  2 118 ? -31.602 -48.470 -95.893  1.00 81.82  ? 1032 LYS C NZ    1 
ATOM   5587 N  N     . CYS C  2 119 ? -34.526 -42.751 -91.872  1.00 51.25  ? 1033 CYS C N     1 
ATOM   5588 C  CA    . CYS C  2 119 ? -34.996 -41.369 -91.861  1.00 51.59  ? 1033 CYS C CA    1 
ATOM   5589 C  C     . CYS C  2 119 ? -34.096 -40.494 -92.730  1.00 51.84  ? 1033 CYS C C     1 
ATOM   5590 O  O     . CYS C  2 119 ? -32.870 -40.639 -92.727  1.00 54.95  ? 1033 CYS C O     1 
ATOM   5591 C  CB    . CYS C  2 119 ? -35.041 -40.829 -90.430  1.00 50.68  ? 1033 CYS C CB    1 
ATOM   5592 S  SG    . CYS C  2 119 ? -36.298 -41.612 -89.380  1.00 58.47  ? 1033 CYS C SG    1 
ATOM   5593 N  N     . GLU C  2 120 ? -34.712 -39.582 -93.479  1.00 51.67  ? 1034 GLU C N     1 
ATOM   5594 C  CA    . GLU C  2 120 ? -34.001 -38.798 -94.483  1.00 60.55  ? 1034 GLU C CA    1 
ATOM   5595 C  C     . GLU C  2 120 ? -33.611 -37.441 -93.906  1.00 56.58  ? 1034 GLU C C     1 
ATOM   5596 O  O     . GLU C  2 120 ? -34.480 -36.597 -93.647  1.00 52.34  ? 1034 GLU C O     1 
ATOM   5597 C  CB    . GLU C  2 120 ? -34.854 -38.633 -95.741  1.00 59.60  ? 1034 GLU C CB    1 
ATOM   5598 C  CG    . GLU C  2 120 ? -35.094 -39.929 -96.499  1.00 67.36  ? 1034 GLU C CG    1 
ATOM   5599 C  CD    . GLU C  2 120 ? -33.856 -40.425 -97.235  1.00 76.70  ? 1034 GLU C CD    1 
ATOM   5600 O  OE1   . GLU C  2 120 ? -32.884 -39.648 -97.358  1.00 79.64  ? 1034 GLU C OE1   1 
ATOM   5601 O  OE2   . GLU C  2 120 ? -33.861 -41.588 -97.703  1.00 79.43  ? 1034 GLU C OE2   1 
ATOM   5602 N  N     . GLU C  2 121 ? -32.296 -37.231 -93.747  1.00 58.51  ? 1035 GLU C N     1 
ATOM   5603 C  CA    . GLU C  2 121 ? -31.772 -36.061 -93.047  1.00 62.67  ? 1035 GLU C CA    1 
ATOM   5604 C  C     . GLU C  2 121 ? -32.152 -34.758 -93.732  1.00 62.41  ? 1035 GLU C C     1 
ATOM   5605 O  O     . GLU C  2 121 ? -32.418 -33.762 -93.053  1.00 62.72  ? 1035 GLU C O     1 
ATOM   5606 C  CB    . GLU C  2 121 ? -30.255 -36.177 -92.935  1.00 69.30  ? 1035 GLU C CB    1 
ATOM   5607 C  CG    . GLU C  2 121 ? -29.801 -37.152 -91.845  1.00 80.00  ? 1035 GLU C CG    1 
ATOM   5608 C  CD    . GLU C  2 121 ? -29.616 -38.569 -92.376  1.00 86.54  ? 1035 GLU C CD    1 
ATOM   5609 O  OE1   . GLU C  2 121 ? -29.821 -38.763 -93.608  1.00 88.51  ? 1035 GLU C OE1   1 
ATOM   5610 O  OE2   . GLU C  2 121 ? -29.302 -39.467 -91.577  1.00 83.53  ? 1035 GLU C OE2   1 
ATOM   5611 N  N     . MET C  2 122 ? -32.197 -34.746 -95.062  1.00 62.50  ? 1036 MET C N     1 
ATOM   5612 C  CA    . MET C  2 122 ? -32.467 -33.532 -95.823  1.00 65.46  ? 1036 MET C CA    1 
ATOM   5613 C  C     . MET C  2 122 ? -33.946 -33.316 -96.111  1.00 64.44  ? 1036 MET C C     1 
ATOM   5614 O  O     . MET C  2 122 ? -34.294 -32.348 -96.796  1.00 63.96  ? 1036 MET C O     1 
ATOM   5615 C  CB    . MET C  2 122 ? -31.698 -33.557 -97.147  1.00 69.94  ? 1036 MET C CB    1 
ATOM   5616 C  CG    . MET C  2 122 ? -30.305 -34.140 -97.030  1.00 76.85  ? 1036 MET C CG    1 
ATOM   5617 S  SD    . MET C  2 122 ? -29.208 -33.119 -96.032  1.00 83.26  ? 1036 MET C SD    1 
ATOM   5618 C  CE    . MET C  2 122 ? -29.608 -31.486 -96.644  1.00 78.52  ? 1036 MET C CE    1 
ATOM   5619 N  N     . GLU C  2 123 ? -34.819 -34.180 -95.614  1.00 65.30  ? 1037 GLU C N     1 
ATOM   5620 C  CA    . GLU C  2 123 ? -36.242 -34.093 -95.892  1.00 63.08  ? 1037 GLU C CA    1 
ATOM   5621 C  C     . GLU C  2 123 ? -37.006 -33.583 -94.675  1.00 58.21  ? 1037 GLU C C     1 
ATOM   5622 O  O     . GLU C  2 123 ? -36.546 -33.664 -93.531  1.00 57.69  ? 1037 GLU C O     1 
ATOM   5623 C  CB    . GLU C  2 123 ? -36.796 -35.453 -96.325  1.00 67.53  ? 1037 GLU C CB    1 
ATOM   5624 C  CG    . GLU C  2 123 ? -36.278 -35.940 -97.664  1.00 73.29  ? 1037 GLU C CG    1 
ATOM   5625 C  CD    . GLU C  2 123 ? -36.345 -34.872 -98.734  1.00 83.20  ? 1037 GLU C CD    1 
ATOM   5626 O  OE1   . GLU C  2 123 ? -35.344 -34.699 -99.463  1.00 87.58  ? 1037 GLU C OE1   1 
ATOM   5627 O  OE2   . GLU C  2 123 ? -37.395 -34.202 -98.843  1.00 85.05  ? 1037 GLU C OE2   1 
ATOM   5628 N  N     . GLU C  2 124 ? -38.197 -33.061 -94.954  1.00 53.63  ? 1038 GLU C N     1 
ATOM   5629 C  CA    . GLU C  2 124 ? -39.061 -32.499 -93.928  1.00 53.90  ? 1038 GLU C CA    1 
ATOM   5630 C  C     . GLU C  2 124 ? -39.474 -33.564 -92.914  1.00 57.93  ? 1038 GLU C C     1 
ATOM   5631 O  O     . GLU C  2 124 ? -39.685 -34.732 -93.253  1.00 48.76  ? 1038 GLU C O     1 
ATOM   5632 C  CB    . GLU C  2 124 ? -40.297 -31.886 -94.587  1.00 63.34  ? 1038 GLU C CB    1 
ATOM   5633 C  CG    . GLU C  2 124 ? -41.148 -30.988 -93.712  1.00 75.05  ? 1038 GLU C CG    1 
ATOM   5634 C  CD    . GLU C  2 124 ? -42.374 -30.477 -94.457  1.00 83.95  ? 1038 GLU C CD    1 
ATOM   5635 O  OE1   . GLU C  2 124 ? -43.039 -31.288 -95.140  1.00 86.51  ? 1038 GLU C OE1   1 
ATOM   5636 O  OE2   . GLU C  2 124 ? -42.667 -29.266 -94.373  1.00 88.08  ? 1038 GLU C OE2   1 
ATOM   5637 N  N     . GLY C  2 125 ? -39.589 -33.146 -91.654  1.00 48.59  ? 1039 GLY C N     1 
ATOM   5638 C  CA    . GLY C  2 125 ? -40.042 -34.044 -90.609  1.00 48.86  ? 1039 GLY C CA    1 
ATOM   5639 C  C     . GLY C  2 125 ? -38.979 -34.970 -90.072  1.00 56.48  ? 1039 GLY C C     1 
ATOM   5640 O  O     . GLY C  2 125 ? -39.298 -35.893 -89.315  1.00 56.56  ? 1039 GLY C O     1 
ATOM   5641 N  N     . TYR C  2 126 ? -37.713 -34.735 -90.430  1.00 56.84  ? 1040 TYR C N     1 
ATOM   5642 C  CA    . TYR C  2 126 ? -36.648 -35.665 -90.072  1.00 52.81  ? 1040 TYR C CA    1 
ATOM   5643 C  C     . TYR C  2 126 ? -36.345 -35.630 -88.577  1.00 53.86  ? 1040 TYR C C     1 
ATOM   5644 O  O     . TYR C  2 126 ? -36.069 -36.672 -87.972  1.00 49.73  ? 1040 TYR C O     1 
ATOM   5645 C  CB    . TYR C  2 126 ? -35.389 -35.346 -90.876  1.00 50.91  ? 1040 TYR C CB    1 
ATOM   5646 C  CG    . TYR C  2 126 ? -34.140 -35.976 -90.308  1.00 59.34  ? 1040 TYR C CG    1 
ATOM   5647 C  CD1   . TYR C  2 126 ? -33.887 -37.335 -90.468  1.00 54.03  ? 1040 TYR C CD1   1 
ATOM   5648 C  CD2   . TYR C  2 126 ? -33.220 -35.214 -89.590  1.00 60.20  ? 1040 TYR C CD2   1 
ATOM   5649 C  CE1   . TYR C  2 126 ? -32.749 -37.912 -89.944  1.00 58.23  ? 1040 TYR C CE1   1 
ATOM   5650 C  CE2   . TYR C  2 126 ? -32.081 -35.782 -89.062  1.00 59.24  ? 1040 TYR C CE2   1 
ATOM   5651 C  CZ    . TYR C  2 126 ? -31.850 -37.129 -89.236  1.00 60.15  ? 1040 TYR C CZ    1 
ATOM   5652 O  OH    . TYR C  2 126 ? -30.707 -37.688 -88.710  1.00 62.10  ? 1040 TYR C OH    1 
ATOM   5653 N  N     . THR C  2 127 ? -36.349 -34.440 -87.972  1.00 49.72  ? 1041 THR C N     1 
ATOM   5654 C  CA    . THR C  2 127 ? -36.007 -34.344 -86.557  1.00 49.64  ? 1041 THR C CA    1 
ATOM   5655 C  C     . THR C  2 127 ? -36.968 -35.169 -85.705  1.00 48.79  ? 1041 THR C C     1 
ATOM   5656 O  O     . THR C  2 127 ? -36.545 -36.011 -84.908  1.00 50.07  ? 1041 THR C O     1 
ATOM   5657 C  CB    . THR C  2 127 ? -36.002 -32.878 -86.115  1.00 51.41  ? 1041 THR C CB    1 
ATOM   5658 O  OG1   . THR C  2 127 ? -35.125 -32.121 -86.963  1.00 52.09  ? 1041 THR C OG1   1 
ATOM   5659 C  CG2   . THR C  2 127 ? -35.526 -32.763 -84.677  1.00 52.99  ? 1041 THR C CG2   1 
ATOM   5660 N  N     . GLN C  2 128 ? -38.273 -34.968 -85.891  1.00 53.44  ? 1042 GLN C N     1 
ATOM   5661 C  CA    . GLN C  2 128 ? -39.254 -35.651 -85.056  1.00 52.21  ? 1042 GLN C CA    1 
ATOM   5662 C  C     . GLN C  2 128 ? -39.262 -37.161 -85.310  1.00 50.96  ? 1042 GLN C C     1 
ATOM   5663 O  O     . GLN C  2 128 ? -39.328 -37.957 -84.364  1.00 48.27  ? 1042 GLN C O     1 
ATOM   5664 C  CB    . GLN C  2 128 ? -40.638 -35.050 -85.296  1.00 53.60  ? 1042 GLN C CB    1 
ATOM   5665 C  CG    . GLN C  2 128 ? -41.686 -35.496 -84.289  1.00 61.03  ? 1042 GLN C CG    1 
ATOM   5666 C  CD    . GLN C  2 128 ? -43.064 -34.921 -84.568  1.00 68.00  ? 1042 GLN C CD    1 
ATOM   5667 O  OE1   . GLN C  2 128 ? -43.304 -34.349 -85.628  1.00 71.19  ? 1042 GLN C OE1   1 
ATOM   5668 N  NE2   . GLN C  2 128 ? -43.978 -35.079 -83.614  1.00 69.08  ? 1042 GLN C NE2   1 
ATOM   5669 N  N     . CYS C  2 129 ? -39.186 -37.580 -86.573  1.00 49.73  ? 1043 CYS C N     1 
ATOM   5670 C  CA    . CYS C  2 129 ? -39.293 -39.006 -86.865  1.00 47.27  ? 1043 CYS C CA    1 
ATOM   5671 C  C     . CYS C  2 129 ? -38.047 -39.762 -86.421  1.00 50.21  ? 1043 CYS C C     1 
ATOM   5672 O  O     . CYS C  2 129 ? -38.151 -40.868 -85.873  1.00 53.64  ? 1043 CYS C O     1 
ATOM   5673 C  CB    . CYS C  2 129 ? -39.560 -39.227 -88.356  1.00 47.62  ? 1043 CYS C CB    1 
ATOM   5674 S  SG    . CYS C  2 129 ? -40.049 -40.935 -88.800  1.00 49.92  ? 1043 CYS C SG    1 
ATOM   5675 N  N     . SER C  2 130 ? -36.859 -39.193 -86.649  1.00 48.77  ? 1044 SER C N     1 
ATOM   5676 C  CA    . SER C  2 130 ? -35.644 -39.885 -86.233  1.00 49.42  ? 1044 SER C CA    1 
ATOM   5677 C  C     . SER C  2 130 ? -35.522 -39.915 -84.714  1.00 53.55  ? 1044 SER C C     1 
ATOM   5678 O  O     . SER C  2 130 ? -35.081 -40.919 -84.143  1.00 51.91  ? 1044 SER C O     1 
ATOM   5679 C  CB    . SER C  2 130 ? -34.408 -39.243 -86.877  1.00 50.40  ? 1044 SER C CB    1 
ATOM   5680 O  OG    . SER C  2 130 ? -34.269 -37.886 -86.505  1.00 52.53  ? 1044 SER C OG    1 
ATOM   5681 N  N     . GLN C  2 131 ? -35.916 -38.835 -84.036  1.00 48.86  ? 1045 GLN C N     1 
ATOM   5682 C  CA    . GLN C  2 131 ? -35.880 -38.851 -82.577  1.00 52.94  ? 1045 GLN C CA    1 
ATOM   5683 C  C     . GLN C  2 131 ? -36.858 -39.874 -82.008  1.00 54.73  ? 1045 GLN C C     1 
ATOM   5684 O  O     . GLN C  2 131 ? -36.556 -40.530 -81.003  1.00 56.29  ? 1045 GLN C O     1 
ATOM   5685 C  CB    . GLN C  2 131 ? -36.170 -37.450 -82.024  1.00 52.77  ? 1045 GLN C CB    1 
ATOM   5686 C  CG    . GLN C  2 131 ? -34.963 -36.516 -82.081  1.00 56.63  ? 1045 GLN C CG    1 
ATOM   5687 C  CD    . GLN C  2 131 ? -35.312 -35.057 -81.791  1.00 58.61  ? 1045 GLN C CD    1 
ATOM   5688 O  OE1   . GLN C  2 131 ? -36.486 -34.696 -81.668  1.00 54.77  ? 1045 GLN C OE1   1 
ATOM   5689 N  NE2   . GLN C  2 131 ? -34.285 -34.210 -81.692  1.00 55.23  ? 1045 GLN C NE2   1 
ATOM   5690 N  N     . PHE C  2 132 ? -38.020 -40.037 -82.642  1.00 55.55  ? 1046 PHE C N     1 
ATOM   5691 C  CA    . PHE C  2 132 ? -38.981 -41.034 -82.185  1.00 55.00  ? 1046 PHE C CA    1 
ATOM   5692 C  C     . PHE C  2 132 ? -38.446 -42.446 -82.377  1.00 52.28  ? 1046 PHE C C     1 
ATOM   5693 O  O     . PHE C  2 132 ? -38.455 -43.252 -81.443  1.00 56.63  ? 1046 PHE C O     1 
ATOM   5694 C  CB    . PHE C  2 132 ? -40.310 -40.878 -82.923  1.00 55.43  ? 1046 PHE C CB    1 
ATOM   5695 C  CG    . PHE C  2 132 ? -41.273 -42.008 -82.664  1.00 52.49  ? 1046 PHE C CG    1 
ATOM   5696 C  CD1   . PHE C  2 132 ? -42.006 -42.052 -81.482  1.00 47.62  ? 1046 PHE C CD1   1 
ATOM   5697 C  CD2   . PHE C  2 132 ? -41.435 -43.030 -83.591  1.00 47.48  ? 1046 PHE C CD2   1 
ATOM   5698 C  CE1   . PHE C  2 132 ? -42.889 -43.083 -81.233  1.00 45.62  ? 1046 PHE C CE1   1 
ATOM   5699 C  CE2   . PHE C  2 132 ? -42.316 -44.064 -83.352  1.00 49.28  ? 1046 PHE C CE2   1 
ATOM   5700 C  CZ    . PHE C  2 132 ? -43.043 -44.098 -82.164  1.00 46.32  ? 1046 PHE C CZ    1 
ATOM   5701 N  N     . LEU C  2 133 ? -37.988 -42.769 -83.590  1.00 49.99  ? 1047 LEU C N     1 
ATOM   5702 C  CA    . LEU C  2 133 ? -37.570 -44.136 -83.878  1.00 52.96  ? 1047 LEU C CA    1 
ATOM   5703 C  C     . LEU C  2 133 ? -36.313 -44.511 -83.103  1.00 55.20  ? 1047 LEU C C     1 
ATOM   5704 O  O     . LEU C  2 133 ? -36.183 -45.651 -82.644  1.00 57.63  ? 1047 LEU C O     1 
ATOM   5705 C  CB    . LEU C  2 133 ? -37.348 -44.325 -85.379  1.00 47.90  ? 1047 LEU C CB    1 
ATOM   5706 C  CG    . LEU C  2 133 ? -38.603 -44.444 -86.247  1.00 56.44  ? 1047 LEU C CG    1 
ATOM   5707 C  CD1   . LEU C  2 133 ? -38.217 -44.498 -87.710  1.00 52.47  ? 1047 LEU C CD1   1 
ATOM   5708 C  CD2   . LEU C  2 133 ? -39.442 -45.660 -85.874  1.00 56.80  ? 1047 LEU C CD2   1 
ATOM   5709 N  N     . TYR C  2 134 ? -35.369 -43.578 -82.954  1.00 53.45  ? 1048 TYR C N     1 
ATOM   5710 C  CA    . TYR C  2 134 ? -34.195 -43.881 -82.144  1.00 56.03  ? 1048 TYR C CA    1 
ATOM   5711 C  C     . TYR C  2 134 ? -34.546 -43.927 -80.664  1.00 54.83  ? 1048 TYR C C     1 
ATOM   5712 O  O     . TYR C  2 134 ? -33.931 -44.686 -79.906  1.00 51.52  ? 1048 TYR C O     1 
ATOM   5713 C  CB    . TYR C  2 134 ? -33.077 -42.871 -82.414  1.00 55.34  ? 1048 TYR C CB    1 
ATOM   5714 C  CG    . TYR C  2 134 ? -32.295 -43.176 -83.676  1.00 53.15  ? 1048 TYR C CG    1 
ATOM   5715 C  CD1   . TYR C  2 134 ? -31.539 -44.337 -83.786  1.00 51.70  ? 1048 TYR C CD1   1 
ATOM   5716 C  CD2   . TYR C  2 134 ? -32.324 -42.305 -84.762  1.00 51.16  ? 1048 TYR C CD2   1 
ATOM   5717 C  CE1   . TYR C  2 134 ? -30.831 -44.621 -84.947  1.00 55.72  ? 1048 TYR C CE1   1 
ATOM   5718 C  CE2   . TYR C  2 134 ? -31.624 -42.584 -85.929  1.00 54.24  ? 1048 TYR C CE2   1 
ATOM   5719 C  CZ    . TYR C  2 134 ? -30.876 -43.740 -86.016  1.00 57.87  ? 1048 TYR C CZ    1 
ATOM   5720 O  OH    . TYR C  2 134 ? -30.177 -44.015 -87.175  1.00 59.65  ? 1048 TYR C OH    1 
ATOM   5721 N  N     . GLY C  2 135 ? -35.538 -43.143 -80.239  1.00 53.88  ? 1049 GLY C N     1 
ATOM   5722 C  CA    . GLY C  2 135 ? -36.010 -43.253 -78.869  1.00 54.88  ? 1049 GLY C CA    1 
ATOM   5723 C  C     . GLY C  2 135 ? -36.634 -44.606 -78.586  1.00 55.23  ? 1049 GLY C C     1 
ATOM   5724 O  O     . GLY C  2 135 ? -36.492 -45.150 -77.488  1.00 52.59  ? 1049 GLY C O     1 
ATOM   5725 N  N     . VAL C  2 136 ? -37.331 -45.167 -79.574  1.00 55.07  ? 1050 VAL C N     1 
ATOM   5726 C  CA    . VAL C  2 136 ? -37.900 -46.500 -79.417  1.00 55.81  ? 1050 VAL C CA    1 
ATOM   5727 C  C     . VAL C  2 136 ? -36.795 -47.543 -79.346  1.00 59.81  ? 1050 VAL C C     1 
ATOM   5728 O  O     . VAL C  2 136 ? -36.826 -48.442 -78.497  1.00 58.97  ? 1050 VAL C O     1 
ATOM   5729 C  CB    . VAL C  2 136 ? -38.886 -46.804 -80.558  1.00 50.72  ? 1050 VAL C CB    1 
ATOM   5730 C  CG1   . VAL C  2 136 ? -39.228 -48.284 -80.576  1.00 45.56  ? 1050 VAL C CG1   1 
ATOM   5731 C  CG2   . VAL C  2 136 ? -40.140 -45.965 -80.410  1.00 48.51  ? 1050 VAL C CG2   1 
ATOM   5732 N  N     . GLN C  2 137 ? -35.801 -47.444 -80.234  1.00 56.51  ? 1051 GLN C N     1 
ATOM   5733 C  CA    . GLN C  2 137 ? -34.715 -48.419 -80.214  1.00 57.01  ? 1051 GLN C CA    1 
ATOM   5734 C  C     . GLN C  2 137 ? -33.977 -48.409 -78.881  1.00 59.66  ? 1051 GLN C C     1 
ATOM   5735 O  O     . GLN C  2 137 ? -33.522 -49.459 -78.415  1.00 62.87  ? 1051 GLN C O     1 
ATOM   5736 C  CB    . GLN C  2 137 ? -33.745 -48.154 -81.364  1.00 50.16  ? 1051 GLN C CB    1 
ATOM   5737 C  CG    . GLN C  2 137 ? -34.299 -48.559 -82.722  1.00 49.20  ? 1051 GLN C CG    1 
ATOM   5738 C  CD    . GLN C  2 137 ? -33.301 -48.374 -83.850  1.00 52.91  ? 1051 GLN C CD    1 
ATOM   5739 O  OE1   . GLN C  2 137 ? -33.588 -48.695 -85.002  1.00 57.64  ? 1051 GLN C OE1   1 
ATOM   5740 N  NE2   . GLN C  2 137 ? -32.127 -47.849 -83.526  1.00 51.83  ? 1051 GLN C NE2   1 
ATOM   5741 N  N     . GLU C  2 138 ? -33.865 -47.249 -78.244  1.00 57.57  ? 1052 GLU C N     1 
ATOM   5742 C  CA    . GLU C  2 138 ? -33.144 -47.163 -76.985  1.00 65.92  ? 1052 GLU C CA    1 
ATOM   5743 C  C     . GLU C  2 138 ? -34.009 -47.492 -75.777  1.00 65.82  ? 1052 GLU C C     1 
ATOM   5744 O  O     . GLU C  2 138 ? -33.470 -47.919 -74.751  1.00 64.01  ? 1052 GLU C O     1 
ATOM   5745 C  CB    . GLU C  2 138 ? -32.534 -45.769 -76.823  1.00 71.19  ? 1052 GLU C CB    1 
ATOM   5746 C  CG    . GLU C  2 138 ? -31.170 -45.643 -77.472  1.00 81.76  ? 1052 GLU C CG    1 
ATOM   5747 C  CD    . GLU C  2 138 ? -30.637 -44.227 -77.449  1.00 91.73  ? 1052 GLU C CD    1 
ATOM   5748 O  OE1   . GLU C  2 138 ? -31.425 -43.290 -77.708  1.00 94.80  ? 1052 GLU C OE1   1 
ATOM   5749 O  OE2   . GLU C  2 138 ? -29.427 -44.052 -77.177  1.00 95.42  ? 1052 GLU C OE2   1 
ATOM   5750 N  N     . LYS C  2 139 ? -35.329 -47.329 -75.883  1.00 62.77  ? 1053 LYS C N     1 
ATOM   5751 C  CA    . LYS C  2 139 ? -36.238 -47.567 -74.770  1.00 60.74  ? 1053 LYS C CA    1 
ATOM   5752 C  C     . LYS C  2 139 ? -36.963 -48.906 -74.851  1.00 59.18  ? 1053 LYS C C     1 
ATOM   5753 O  O     . LYS C  2 139 ? -37.510 -49.358 -73.838  1.00 55.64  ? 1053 LYS C O     1 
ATOM   5754 C  CB    . LYS C  2 139 ? -37.275 -46.439 -74.685  1.00 65.30  ? 1053 LYS C CB    1 
ATOM   5755 C  CG    . LYS C  2 139 ? -36.888 -45.314 -73.740  1.00 73.57  ? 1053 LYS C CG    1 
ATOM   5756 C  CD    . LYS C  2 139 ? -37.317 -43.960 -74.285  1.00 77.98  ? 1053 LYS C CD    1 
ATOM   5757 C  CE    . LYS C  2 139 ? -38.830 -43.797 -74.243  1.00 79.11  ? 1053 LYS C CE    1 
ATOM   5758 N  NZ    . LYS C  2 139 ? -39.234 -42.477 -73.665  1.00 81.43  ? 1053 LYS C NZ    1 
ATOM   5759 N  N     . MET C  2 140 ? -36.997 -49.535 -76.025  1.00 53.40  ? 1054 MET C N     1 
ATOM   5760 C  CA    . MET C  2 140 ? -37.616 -50.844 -76.159  1.00 56.03  ? 1054 MET C CA    1 
ATOM   5761 C  C     . MET C  2 140 ? -36.886 -51.845 -75.280  1.00 59.86  ? 1054 MET C C     1 
ATOM   5762 O  O     . MET C  2 140 ? -35.654 -51.878 -75.253  1.00 63.34  ? 1054 MET C O     1 
ATOM   5763 C  CB    . MET C  2 140 ? -37.580 -51.292 -77.619  1.00 57.38  ? 1054 MET C CB    1 
ATOM   5764 C  CG    . MET C  2 140 ? -38.176 -52.645 -77.876  1.00 57.47  ? 1054 MET C CG    1 
ATOM   5765 S  SD    . MET C  2 140 ? -38.234 -53.009 -79.642  1.00 56.81  ? 1054 MET C SD    1 
ATOM   5766 C  CE    . MET C  2 140 ? -38.537 -54.770 -79.588  1.00 56.52  ? 1054 MET C CE    1 
ATOM   5767 N  N     . GLY C  2 141 ? -37.646 -52.658 -74.549  1.00 56.78  ? 1055 GLY C N     1 
ATOM   5768 C  CA    . GLY C  2 141 ? -37.076 -53.583 -73.599  1.00 58.92  ? 1055 GLY C CA    1 
ATOM   5769 C  C     . GLY C  2 141 ? -36.876 -53.006 -72.215  1.00 61.74  ? 1055 GLY C C     1 
ATOM   5770 O  O     . GLY C  2 141 ? -36.632 -53.766 -71.271  1.00 64.33  ? 1055 GLY C O     1 
ATOM   5771 N  N     . ILE C  2 142 ? -36.981 -51.689 -72.074  1.00 52.95  ? 1056 ILE C N     1 
ATOM   5772 C  CA    . ILE C  2 142 ? -36.859 -51.008 -70.797  1.00 53.70  ? 1056 ILE C CA    1 
ATOM   5773 C  C     . ILE C  2 142 ? -38.181 -50.377 -70.378  1.00 56.22  ? 1056 ILE C C     1 
ATOM   5774 O  O     . ILE C  2 142 ? -38.622 -50.539 -69.240  1.00 59.35  ? 1056 ILE C O     1 
ATOM   5775 C  CB    . ILE C  2 142 ? -35.732 -49.955 -70.841  1.00 54.94  ? 1056 ILE C CB    1 
ATOM   5776 C  CG1   . ILE C  2 142 ? -34.393 -50.630 -71.133  1.00 58.32  ? 1056 ILE C CG1   1 
ATOM   5777 C  CG2   . ILE C  2 142 ? -35.679 -49.180 -69.526  1.00 56.19  ? 1056 ILE C CG2   1 
ATOM   5778 C  CD1   . ILE C  2 142 ? -33.256 -49.657 -71.345  1.00 60.52  ? 1056 ILE C CD1   1 
ATOM   5779 N  N     . MET C  2 143 ? -38.831 -49.657 -71.289  1.00 54.02  ? 1057 MET C N     1 
ATOM   5780 C  CA    . MET C  2 143 ? -40.109 -49.034 -70.984  1.00 57.32  ? 1057 MET C CA    1 
ATOM   5781 C  C     . MET C  2 143 ? -41.189 -50.103 -70.810  1.00 59.67  ? 1057 MET C C     1 
ATOM   5782 O  O     . MET C  2 143 ? -40.989 -51.283 -71.114  1.00 59.80  ? 1057 MET C O     1 
ATOM   5783 C  CB    . MET C  2 143 ? -40.501 -48.047 -72.088  1.00 57.67  ? 1057 MET C CB    1 
ATOM   5784 C  CG    . MET C  2 143 ? -40.701 -48.689 -73.463  1.00 66.78  ? 1057 MET C CG    1 
ATOM   5785 S  SD    . MET C  2 143 ? -41.029 -47.520 -74.810  1.00 71.81  ? 1057 MET C SD    1 
ATOM   5786 C  CE    . MET C  2 143 ? -42.656 -46.921 -74.351  1.00 73.20  ? 1057 MET C CE    1 
ATOM   5787 N  N     . ASN C  2 144 ? -42.348 -49.671 -70.309  1.00 55.31  ? 1058 ASN C N     1 
ATOM   5788 C  CA    . ASN C  2 144 ? -43.509 -50.545 -70.135  1.00 56.07  ? 1058 ASN C CA    1 
ATOM   5789 C  C     . ASN C  2 144 ? -43.163 -51.765 -69.290  1.00 56.67  ? 1058 ASN C C     1 
ATOM   5790 O  O     . ASN C  2 144 ? -43.624 -52.875 -69.563  1.00 59.07  ? 1058 ASN C O     1 
ATOM   5791 C  CB    . ASN C  2 144 ? -44.091 -50.978 -71.482  1.00 58.78  ? 1058 ASN C CB    1 
ATOM   5792 C  CG    . ASN C  2 144 ? -44.590 -49.813 -72.295  1.00 62.80  ? 1058 ASN C CG    1 
ATOM   5793 O  OD1   . ASN C  2 144 ? -45.013 -48.804 -71.738  1.00 66.57  ? 1058 ASN C OD1   1 
ATOM   5794 N  ND2   . ASN C  2 144 ? -44.547 -49.940 -73.621  1.00 61.71  ? 1058 ASN C ND2   1 
ATOM   5795 N  N     . LYS C  2 145 ? -42.346 -51.550 -68.255  1.00 56.91  ? 1059 LYS C N     1 
ATOM   5796 C  CA    . LYS C  2 145 ? -41.799 -52.621 -67.424  1.00 55.49  ? 1059 LYS C CA    1 
ATOM   5797 C  C     . LYS C  2 145 ? -41.087 -53.678 -68.266  1.00 60.70  ? 1059 LYS C C     1 
ATOM   5798 O  O     . LYS C  2 145 ? -41.111 -54.867 -67.942  1.00 66.35  ? 1059 LYS C O     1 
ATOM   5799 C  CB    . LYS C  2 145 ? -42.885 -53.264 -66.554  1.00 57.71  ? 1059 LYS C CB    1 
ATOM   5800 N  N     . GLY C  2 146 ? -40.459 -53.251 -69.362  1.00 59.30  ? 1060 GLY C N     1 
ATOM   5801 C  CA    . GLY C  2 146 ? -39.711 -54.152 -70.214  1.00 58.11  ? 1060 GLY C CA    1 
ATOM   5802 C  C     . GLY C  2 146 ? -40.527 -55.220 -70.905  1.00 61.50  ? 1060 GLY C C     1 
ATOM   5803 O  O     . GLY C  2 146 ? -39.979 -56.268 -71.261  1.00 59.65  ? 1060 GLY C O     1 
ATOM   5804 N  N     . VAL C  2 147 ? -41.821 -54.987 -71.111  1.00 61.08  ? 1061 VAL C N     1 
ATOM   5805 C  CA    . VAL C  2 147 ? -42.687 -55.959 -71.771  1.00 59.64  ? 1061 VAL C CA    1 
ATOM   5806 C  C     . VAL C  2 147 ? -42.476 -55.875 -73.279  1.00 57.74  ? 1061 VAL C C     1 
ATOM   5807 O  O     . VAL C  2 147 ? -42.622 -54.803 -73.877  1.00 54.91  ? 1061 VAL C O     1 
ATOM   5808 C  CB    . VAL C  2 147 ? -44.159 -55.725 -71.407  1.00 62.28  ? 1061 VAL C CB    1 
ATOM   5809 C  CG1   . VAL C  2 147 ? -45.071 -56.541 -72.315  1.00 61.25  ? 1061 VAL C CG1   1 
ATOM   5810 C  CG2   . VAL C  2 147 ? -44.403 -56.057 -69.946  1.00 63.84  ? 1061 VAL C CG2   1 
ATOM   5811 N  N     . ILE C  2 148 ? -42.151 -57.015 -73.893  1.00 59.11  ? 1062 ILE C N     1 
ATOM   5812 C  CA    . ILE C  2 148 ? -41.886 -57.159 -75.321  1.00 61.00  ? 1062 ILE C CA    1 
ATOM   5813 C  C     . ILE C  2 148 ? -42.767 -58.278 -75.859  1.00 58.65  ? 1062 ILE C C     1 
ATOM   5814 O  O     . ILE C  2 148 ? -43.182 -59.165 -75.109  1.00 60.31  ? 1062 ILE C O     1 
ATOM   5815 C  CB    . ILE C  2 148 ? -40.384 -57.454 -75.561  1.00 70.32  ? 1062 ILE C CB    1 
ATOM   5816 C  CG1   . ILE C  2 148 ? -39.596 -56.152 -75.662  1.00 71.28  ? 1062 ILE C CG1   1 
ATOM   5817 C  CG2   . ILE C  2 148 ? -40.144 -58.394 -76.738  1.00 76.64  ? 1062 ILE C CG2   1 
ATOM   5818 C  CD1   . ILE C  2 148 ? -39.975 -55.179 -74.616  1.00 75.85  ? 1062 ILE C CD1   1 
ATOM   5819 N  N     . TYR C  2 149 ? -43.064 -58.239 -77.158  1.00 56.68  ? 1063 TYR C N     1 
ATOM   5820 C  CA    . TYR C  2 149 ? -43.869 -59.277 -77.788  1.00 57.01  ? 1063 TYR C CA    1 
ATOM   5821 C  C     . TYR C  2 149 ? -43.115 -59.923 -78.943  1.00 57.09  ? 1063 TYR C C     1 
ATOM   5822 O  O     . TYR C  2 149 ? -42.483 -59.237 -79.752  1.00 56.34  ? 1063 TYR C O     1 
ATOM   5823 C  CB    . TYR C  2 149 ? -45.203 -58.717 -78.275  1.00 56.55  ? 1063 TYR C CB    1 
ATOM   5824 C  CG    . TYR C  2 149 ? -46.039 -58.164 -77.147  1.00 59.56  ? 1063 TYR C CG    1 
ATOM   5825 C  CD1   . TYR C  2 149 ? -45.869 -56.858 -76.709  1.00 58.31  ? 1063 TYR C CD1   1 
ATOM   5826 C  CD2   . TYR C  2 149 ? -46.988 -58.954 -76.504  1.00 60.62  ? 1063 TYR C CD2   1 
ATOM   5827 C  CE1   . TYR C  2 149 ? -46.626 -56.350 -75.673  1.00 62.68  ? 1063 TYR C CE1   1 
ATOM   5828 C  CE2   . TYR C  2 149 ? -47.756 -58.450 -75.472  1.00 57.34  ? 1063 TYR C CE2   1 
ATOM   5829 C  CZ    . TYR C  2 149 ? -47.567 -57.152 -75.057  1.00 56.54  ? 1063 TYR C CZ    1 
ATOM   5830 O  OH    . TYR C  2 149 ? -48.322 -56.645 -74.025  1.00 63.77  ? 1063 TYR C OH    1 
ATOM   5831 N  N     . ALA C  2 150 ? -43.172 -61.252 -79.004  1.00 58.03  ? 1064 ALA C N     1 
ATOM   5832 C  CA    . ALA C  2 150 ? -42.609 -61.973 -80.137  1.00 60.81  ? 1064 ALA C CA    1 
ATOM   5833 C  C     . ALA C  2 150 ? -43.473 -61.759 -81.373  1.00 60.97  ? 1064 ALA C C     1 
ATOM   5834 O  O     . ALA C  2 150 ? -44.706 -61.782 -81.301  1.00 60.32  ? 1064 ALA C O     1 
ATOM   5835 C  CB    . ALA C  2 150 ? -42.502 -63.466 -79.823  1.00 59.34  ? 1064 ALA C CB    1 
ATOM   5836 N  N     . LEU C  2 151 ? -42.820 -61.541 -82.515  1.00 60.25  ? 1065 LEU C N     1 
ATOM   5837 C  CA    . LEU C  2 151 ? -43.516 -61.350 -83.780  1.00 57.88  ? 1065 LEU C CA    1 
ATOM   5838 C  C     . LEU C  2 151 ? -43.374 -62.540 -84.721  1.00 60.04  ? 1065 LEU C C     1 
ATOM   5839 O  O     . LEU C  2 151 ? -43.993 -62.548 -85.790  1.00 60.40  ? 1065 LEU C O     1 
ATOM   5840 C  CB    . LEU C  2 151 ? -43.023 -60.071 -84.468  1.00 55.63  ? 1065 LEU C CB    1 
ATOM   5841 C  CG    . LEU C  2 151 ? -42.968 -58.836 -83.568  1.00 55.00  ? 1065 LEU C CG    1 
ATOM   5842 C  CD1   . LEU C  2 151 ? -42.045 -57.774 -84.153  1.00 54.04  ? 1065 LEU C CD1   1 
ATOM   5843 C  CD2   . LEU C  2 151 ? -44.359 -58.281 -83.326  1.00 54.75  ? 1065 LEU C CD2   1 
ATOM   5844 N  N     . TRP C  2 152 ? -42.577 -63.538 -84.353  1.00 60.22  ? 1066 TRP C N     1 
ATOM   5845 C  CA    . TRP C  2 152 ? -42.451 -64.772 -85.113  1.00 58.79  ? 1066 TRP C CA    1 
ATOM   5846 C  C     . TRP C  2 152 ? -42.242 -65.912 -84.131  1.00 59.88  ? 1066 TRP C C     1 
ATOM   5847 O  O     . TRP C  2 152 ? -41.933 -65.695 -82.956  1.00 60.03  ? 1066 TRP C O     1 
ATOM   5848 C  CB    . TRP C  2 152 ? -41.279 -64.724 -86.097  1.00 58.43  ? 1066 TRP C CB    1 
ATOM   5849 C  CG    . TRP C  2 152 ? -41.481 -63.840 -87.274  1.00 63.09  ? 1066 TRP C CG    1 
ATOM   5850 C  CD1   . TRP C  2 152 ? -42.033 -64.183 -88.473  1.00 57.42  ? 1066 TRP C CD1   1 
ATOM   5851 C  CD2   . TRP C  2 152 ? -41.113 -62.457 -87.377  1.00 58.93  ? 1066 TRP C CD2   1 
ATOM   5852 N  NE1   . TRP C  2 152 ? -42.035 -63.099 -89.317  1.00 59.67  ? 1066 TRP C NE1   1 
ATOM   5853 C  CE2   . TRP C  2 152 ? -41.473 -62.028 -88.671  1.00 58.05  ? 1066 TRP C CE2   1 
ATOM   5854 C  CE3   . TRP C  2 152 ? -40.510 -61.545 -86.503  1.00 56.00  ? 1066 TRP C CE3   1 
ATOM   5855 C  CZ2   . TRP C  2 152 ? -41.254 -60.721 -89.112  1.00 54.72  ? 1066 TRP C CZ2   1 
ATOM   5856 C  CZ3   . TRP C  2 152 ? -40.292 -60.249 -86.941  1.00 55.19  ? 1066 TRP C CZ3   1 
ATOM   5857 C  CH2   . TRP C  2 152 ? -40.664 -59.849 -88.234  1.00 54.32  ? 1066 TRP C CH2   1 
ATOM   5858 N  N     . ASP C  2 153 ? -42.411 -67.137 -84.627  1.00 68.00  ? 1067 ASP C N     1 
ATOM   5859 C  CA    . ASP C  2 153 ? -41.982 -68.319 -83.890  1.00 69.05  ? 1067 ASP C CA    1 
ATOM   5860 C  C     . ASP C  2 153 ? -40.479 -68.498 -84.046  1.00 69.80  ? 1067 ASP C C     1 
ATOM   5861 O  O     . ASP C  2 153 ? -39.913 -68.218 -85.108  1.00 69.80  ? 1067 ASP C O     1 
ATOM   5862 C  CB    . ASP C  2 153 ? -42.697 -69.578 -84.389  1.00 69.66  ? 1067 ASP C CB    1 
ATOM   5863 C  CG    . ASP C  2 153 ? -44.205 -69.472 -84.319  1.00 67.08  ? 1067 ASP C CG    1 
ATOM   5864 O  OD1   . ASP C  2 153 ? -44.725 -68.615 -83.575  1.00 66.79  ? 1067 ASP C OD1   1 
ATOM   5865 O  OD2   . ASP C  2 153 ? -44.872 -70.264 -85.015  1.00 67.37  ? 1067 ASP C OD2   1 
ATOM   5866 N  N     . TYR C  2 154 ? -39.830 -68.969 -82.985  1.00 70.80  ? 1068 TYR C N     1 
ATOM   5867 C  CA    . TYR C  2 154 ? -38.391 -69.214 -83.015  1.00 72.87  ? 1068 TYR C CA    1 
ATOM   5868 C  C     . TYR C  2 154 ? -38.072 -70.475 -82.224  1.00 78.98  ? 1068 TYR C C     1 
ATOM   5869 O  O     . TYR C  2 154 ? -38.228 -70.500 -80.999  1.00 78.65  ? 1068 TYR C O     1 
ATOM   5870 C  CB    . TYR C  2 154 ? -37.614 -68.029 -82.455  1.00 71.24  ? 1068 TYR C CB    1 
ATOM   5871 C  CG    . TYR C  2 154 ? -36.122 -68.228 -82.529  1.00 74.26  ? 1068 TYR C CG    1 
ATOM   5872 C  CD1   . TYR C  2 154 ? -35.499 -68.467 -83.751  1.00 73.53  ? 1068 TYR C CD1   1 
ATOM   5873 C  CD2   . TYR C  2 154 ? -35.335 -68.189 -81.383  1.00 73.00  ? 1068 TYR C CD2   1 
ATOM   5874 C  CE1   . TYR C  2 154 ? -34.134 -68.656 -83.831  1.00 74.48  ? 1068 TYR C CE1   1 
ATOM   5875 C  CE2   . TYR C  2 154 ? -33.965 -68.374 -81.453  1.00 75.14  ? 1068 TYR C CE2   1 
ATOM   5876 C  CZ    . TYR C  2 154 ? -33.371 -68.607 -82.684  1.00 76.64  ? 1068 TYR C CZ    1 
ATOM   5877 O  OH    . TYR C  2 154 ? -32.011 -68.794 -82.774  1.00 77.07  ? 1068 TYR C OH    1 
ATOM   5878 N  N     . GLU C  2 155 ? -37.615 -71.517 -82.924  1.00 80.15  ? 1069 GLU C N     1 
ATOM   5879 C  CA    . GLU C  2 155 ? -37.027 -72.677 -82.267  1.00 79.77  ? 1069 GLU C CA    1 
ATOM   5880 C  C     . GLU C  2 155 ? -35.557 -72.400 -81.980  1.00 80.18  ? 1069 GLU C C     1 
ATOM   5881 O  O     . GLU C  2 155 ? -34.819 -72.009 -82.894  1.00 79.10  ? 1069 GLU C O     1 
ATOM   5882 C  CB    . GLU C  2 155 ? -37.158 -73.921 -83.133  1.00 78.99  ? 1069 GLU C CB    1 
ATOM   5883 N  N     . PRO C  2 156 ? -35.102 -72.576 -80.742  1.00 79.18  ? 1070 PRO C N     1 
ATOM   5884 C  CA    . PRO C  2 156 ? -33.722 -72.211 -80.404  1.00 80.10  ? 1070 PRO C CA    1 
ATOM   5885 C  C     . PRO C  2 156 ? -32.711 -73.082 -81.127  1.00 82.68  ? 1070 PRO C C     1 
ATOM   5886 O  O     . PRO C  2 156 ? -32.947 -74.258 -81.400  1.00 80.37  ? 1070 PRO C O     1 
ATOM   5887 C  CB    . PRO C  2 156 ? -33.654 -72.443 -78.888  1.00 77.15  ? 1070 PRO C CB    1 
ATOM   5888 C  CG    . PRO C  2 156 ? -35.071 -72.447 -78.430  1.00 77.74  ? 1070 PRO C CG    1 
ATOM   5889 C  CD    . PRO C  2 156 ? -35.857 -73.029 -79.563  1.00 78.04  ? 1070 PRO C CD    1 
ATOM   5890 N  N     . GLN C  2 157 ? -31.570 -72.481 -81.438  1.00 87.67  ? 1071 GLN C N     1 
ATOM   5891 C  CA    . GLN C  2 157 ? -30.410 -73.193 -81.948  1.00 95.85  ? 1071 GLN C CA    1 
ATOM   5892 C  C     . GLN C  2 157 ? -29.341 -73.405 -80.884  1.00 101.60 ? 1071 GLN C C     1 
ATOM   5893 O  O     . GLN C  2 157 ? -28.288 -73.989 -81.180  1.00 103.40 ? 1071 GLN C O     1 
ATOM   5894 C  CB    . GLN C  2 157 ? -29.812 -72.440 -83.137  1.00 97.83  ? 1071 GLN C CB    1 
ATOM   5895 C  CG    . GLN C  2 157 ? -30.561 -72.668 -84.439  1.00 98.68  ? 1071 GLN C CG    1 
ATOM   5896 C  CD    . GLN C  2 157 ? -31.001 -71.392 -85.092  1.00 99.05  ? 1071 GLN C CD    1 
ATOM   5897 O  OE1   . GLN C  2 157 ? -30.199 -70.484 -85.300  1.00 99.63  ? 1071 GLN C OE1   1 
ATOM   5898 N  NE2   . GLN C  2 157 ? -32.283 -71.304 -85.417  1.00 99.72  ? 1071 GLN C NE2   1 
ATOM   5899 N  N     . ASN C  2 158 ? -29.574 -72.917 -79.667  1.00 103.83 ? 1072 ASN C N     1 
ATOM   5900 C  CA    . ASN C  2 158 ? -28.658 -73.103 -78.555  1.00 103.47 ? 1072 ASN C CA    1 
ATOM   5901 C  C     . ASN C  2 158 ? -29.472 -73.385 -77.299  1.00 99.86  ? 1072 ASN C C     1 
ATOM   5902 O  O     . ASN C  2 158 ? -30.654 -73.038 -77.210  1.00 100.68 ? 1072 ASN C O     1 
ATOM   5903 C  CB    . ASN C  2 158 ? -27.762 -71.873 -78.347  1.00 105.66 ? 1072 ASN C CB    1 
ATOM   5904 C  CG    . ASN C  2 158 ? -26.926 -71.539 -79.566  1.00 108.06 ? 1072 ASN C CG    1 
ATOM   5905 O  OD1   . ASN C  2 158 ? -25.756 -71.911 -79.648  1.00 108.55 ? 1072 ASN C OD1   1 
ATOM   5906 N  ND2   . ASN C  2 158 ? -27.526 -70.844 -80.527  1.00 109.00 ? 1072 ASN C ND2   1 
ATOM   5907 N  N     . ASP C  2 159 ? -28.826 -74.026 -76.322  1.00 95.63  ? 1073 ASP C N     1 
ATOM   5908 C  CA    . ASP C  2 159 ? -29.513 -74.403 -75.091  1.00 90.89  ? 1073 ASP C CA    1 
ATOM   5909 C  C     . ASP C  2 159 ? -29.950 -73.194 -74.271  1.00 85.50  ? 1073 ASP C C     1 
ATOM   5910 O  O     . ASP C  2 159 ? -30.920 -73.290 -73.512  1.00 85.50  ? 1073 ASP C O     1 
ATOM   5911 C  CB    . ASP C  2 159 ? -28.616 -75.308 -74.241  1.00 89.11  ? 1073 ASP C CB    1 
ATOM   5912 N  N     . ASP C  2 160 ? -29.266 -72.062 -74.415  1.00 80.74  ? 1074 ASP C N     1 
ATOM   5913 C  CA    . ASP C  2 160 ? -29.544 -70.868 -73.632  1.00 76.04  ? 1074 ASP C CA    1 
ATOM   5914 C  C     . ASP C  2 160 ? -30.487 -69.904 -74.346  1.00 72.66  ? 1074 ASP C C     1 
ATOM   5915 O  O     . ASP C  2 160 ? -30.548 -68.726 -73.978  1.00 69.95  ? 1074 ASP C O     1 
ATOM   5916 C  CB    . ASP C  2 160 ? -28.236 -70.161 -73.280  1.00 72.15  ? 1074 ASP C CB    1 
ATOM   5917 C  CG    . ASP C  2 160 ? -27.500 -69.670 -74.504  1.00 73.52  ? 1074 ASP C CG    1 
ATOM   5918 O  OD1   . ASP C  2 160 ? -27.753 -70.208 -75.605  1.00 74.24  ? 1074 ASP C OD1   1 
ATOM   5919 O  OD2   . ASP C  2 160 ? -26.673 -68.745 -74.369  1.00 73.79  ? 1074 ASP C OD2   1 
ATOM   5920 N  N     . GLU C  2 161 ? -31.212 -70.372 -75.358  1.00 72.59  ? 1075 GLU C N     1 
ATOM   5921 C  CA    . GLU C  2 161 ? -32.136 -69.543 -76.119  1.00 73.05  ? 1075 GLU C CA    1 
ATOM   5922 C  C     . GLU C  2 161 ? -33.570 -69.967 -75.831  1.00 69.99  ? 1075 GLU C C     1 
ATOM   5923 O  O     . GLU C  2 161 ? -33.853 -71.158 -75.655  1.00 70.24  ? 1075 GLU C O     1 
ATOM   5924 C  CB    . GLU C  2 161 ? -31.850 -69.629 -77.625  1.00 71.26  ? 1075 GLU C CB    1 
ATOM   5925 C  CG    . GLU C  2 161 ? -30.476 -69.103 -78.023  1.00 70.49  ? 1075 GLU C CG    1 
ATOM   5926 C  CD    . GLU C  2 161 ? -30.187 -69.233 -79.516  1.00 70.70  ? 1075 GLU C CD    1 
ATOM   5927 O  OE1   . GLU C  2 161 ? -31.018 -69.816 -80.245  1.00 69.42  ? 1075 GLU C OE1   1 
ATOM   5928 O  OE2   . GLU C  2 161 ? -29.122 -68.754 -79.958  1.00 68.39  ? 1075 GLU C OE2   1 
ATOM   5929 N  N     . LEU C  2 162 ? -34.472 -68.984 -75.784  1.00 64.13  ? 1076 LEU C N     1 
ATOM   5930 C  CA    . LEU C  2 162 ? -35.869 -69.206 -75.426  1.00 64.44  ? 1076 LEU C CA    1 
ATOM   5931 C  C     . LEU C  2 162 ? -36.689 -69.624 -76.646  1.00 67.75  ? 1076 LEU C C     1 
ATOM   5932 O  O     . LEU C  2 162 ? -36.529 -69.054 -77.731  1.00 67.46  ? 1076 LEU C O     1 
ATOM   5933 C  CB    . LEU C  2 162 ? -36.479 -67.945 -74.822  1.00 65.22  ? 1076 LEU C CB    1 
ATOM   5934 C  CG    . LEU C  2 162 ? -36.225 -67.669 -73.340  1.00 65.44  ? 1076 LEU C CG    1 
ATOM   5935 C  CD1   . LEU C  2 162 ? -36.989 -66.425 -72.898  1.00 63.19  ? 1076 LEU C CD1   1 
ATOM   5936 C  CD2   . LEU C  2 162 ? -36.599 -68.871 -72.488  1.00 65.06  ? 1076 LEU C CD2   1 
ATOM   5937 N  N     . PRO C  2 163 ? -37.562 -70.616 -76.490  1.00 66.79  ? 1077 PRO C N     1 
ATOM   5938 C  CA    . PRO C  2 163 ? -38.556 -70.886 -77.532  1.00 67.93  ? 1077 PRO C CA    1 
ATOM   5939 C  C     . PRO C  2 163 ? -39.628 -69.810 -77.534  1.00 68.71  ? 1077 PRO C C     1 
ATOM   5940 O  O     . PRO C  2 163 ? -40.112 -69.385 -76.481  1.00 72.34  ? 1077 PRO C O     1 
ATOM   5941 C  CB    . PRO C  2 163 ? -39.135 -72.250 -77.135  1.00 66.30  ? 1077 PRO C CB    1 
ATOM   5942 C  CG    . PRO C  2 163 ? -38.201 -72.795 -76.110  1.00 67.32  ? 1077 PRO C CG    1 
ATOM   5943 C  CD    . PRO C  2 163 ? -37.608 -71.621 -75.419  1.00 67.62  ? 1077 PRO C CD    1 
ATOM   5944 N  N     . MET C  2 164 ? -40.001 -69.375 -78.731  1.00 68.03  ? 1078 MET C N     1 
ATOM   5945 C  CA    . MET C  2 164 ? -40.960 -68.296 -78.901  1.00 65.72  ? 1078 MET C CA    1 
ATOM   5946 C  C     . MET C  2 164 ? -42.090 -68.735 -79.818  1.00 63.12  ? 1078 MET C C     1 
ATOM   5947 O  O     . MET C  2 164 ? -41.855 -69.364 -80.853  1.00 63.28  ? 1078 MET C O     1 
ATOM   5948 C  CB    . MET C  2 164 ? -40.293 -67.046 -79.486  1.00 63.77  ? 1078 MET C CB    1 
ATOM   5949 C  CG    . MET C  2 164 ? -39.220 -66.418 -78.617  1.00 66.41  ? 1078 MET C CG    1 
ATOM   5950 S  SD    . MET C  2 164 ? -38.889 -64.703 -79.091  1.00 68.63  ? 1078 MET C SD    1 
ATOM   5951 C  CE    . MET C  2 164 ? -38.380 -64.877 -80.801  1.00 65.66  ? 1078 MET C CE    1 
ATOM   5952 N  N     . LYS C  2 165 ? -43.315 -68.401 -79.428  1.00 63.05  ? 1079 LYS C N     1 
ATOM   5953 C  CA    . LYS C  2 165 ? -44.470 -68.432 -80.312  1.00 64.90  ? 1079 LYS C CA    1 
ATOM   5954 C  C     . LYS C  2 165 ? -44.944 -67.003 -80.551  1.00 68.46  ? 1079 LYS C C     1 
ATOM   5955 O  O     . LYS C  2 165 ? -44.893 -66.165 -79.641  1.00 64.76  ? 1079 LYS C O     1 
ATOM   5956 C  CB    . LYS C  2 165 ? -45.603 -69.274 -79.721  1.00 63.72  ? 1079 LYS C CB    1 
ATOM   5957 N  N     . GLU C  2 166 ? -45.395 -66.729 -81.777  1.00 65.56  ? 1080 GLU C N     1 
ATOM   5958 C  CA    . GLU C  2 166 ? -45.834 -65.387 -82.143  1.00 63.07  ? 1080 GLU C CA    1 
ATOM   5959 C  C     . GLU C  2 166 ? -46.926 -64.895 -81.200  1.00 65.27  ? 1080 GLU C C     1 
ATOM   5960 O  O     . GLU C  2 166 ? -47.956 -65.550 -81.021  1.00 68.87  ? 1080 GLU C O     1 
ATOM   5961 C  CB    . GLU C  2 166 ? -46.343 -65.372 -83.584  1.00 64.64  ? 1080 GLU C CB    1 
ATOM   5962 C  CG    . GLU C  2 166 ? -46.964 -64.050 -84.021  1.00 65.74  ? 1080 GLU C CG    1 
ATOM   5963 C  CD    . GLU C  2 166 ? -48.450 -63.958 -83.707  1.00 73.85  ? 1080 GLU C CD    1 
ATOM   5964 O  OE1   . GLU C  2 166 ? -49.110 -65.011 -83.606  1.00 78.41  ? 1080 GLU C OE1   1 
ATOM   5965 O  OE2   . GLU C  2 166 ? -48.958 -62.830 -83.551  1.00 76.50  ? 1080 GLU C OE2   1 
ATOM   5966 N  N     . GLY C  2 167 ? -46.708 -63.722 -80.618  1.00 59.54  ? 1081 GLY C N     1 
ATOM   5967 C  CA    . GLY C  2 167 ? -47.618 -63.170 -79.644  1.00 60.80  ? 1081 GLY C CA    1 
ATOM   5968 C  C     . GLY C  2 167 ? -47.244 -63.449 -78.207  1.00 63.50  ? 1081 GLY C C     1 
ATOM   5969 O  O     . GLY C  2 167 ? -47.990 -63.050 -77.304  1.00 64.64  ? 1081 GLY C O     1 
ATOM   5970 N  N     . ASP C  2 168 ? -46.126 -64.126 -77.966  1.00 61.42  ? 1082 ASP C N     1 
ATOM   5971 C  CA    . ASP C  2 168 ? -45.699 -64.385 -76.601  1.00 65.60  ? 1082 ASP C CA    1 
ATOM   5972 C  C     . ASP C  2 168 ? -45.344 -63.077 -75.911  1.00 71.65  ? 1082 ASP C C     1 
ATOM   5973 O  O     . ASP C  2 168 ? -44.731 -62.184 -76.503  1.00 59.50  ? 1082 ASP C O     1 
ATOM   5974 C  CB    . ASP C  2 168 ? -44.505 -65.340 -76.579  1.00 65.83  ? 1082 ASP C CB    1 
ATOM   5975 C  CG    . ASP C  2 168 ? -44.923 -66.797 -76.723  1.00 72.63  ? 1082 ASP C CG    1 
ATOM   5976 O  OD1   . ASP C  2 168 ? -46.145 -67.060 -76.754  1.00 75.16  ? 1082 ASP C OD1   1 
ATOM   5977 O  OD2   . ASP C  2 168 ? -44.037 -67.676 -76.817  1.00 71.22  ? 1082 ASP C OD2   1 
ATOM   5978 N  N     . CYS C  2 169 ? -45.758 -62.966 -74.655  1.00 66.53  ? 1083 CYS C N     1 
ATOM   5979 C  CA    . CYS C  2 169 ? -45.494 -61.799 -73.833  1.00 66.70  ? 1083 CYS C CA    1 
ATOM   5980 C  C     . CYS C  2 169 ? -44.358 -62.139 -72.879  1.00 68.90  ? 1083 CYS C C     1 
ATOM   5981 O  O     . CYS C  2 169 ? -44.493 -63.038 -72.043  1.00 73.23  ? 1083 CYS C O     1 
ATOM   5982 C  CB    . CYS C  2 169 ? -46.747 -61.388 -73.061  1.00 67.55  ? 1083 CYS C CB    1 
ATOM   5983 S  SG    . CYS C  2 169 ? -46.634 -59.763 -72.310  1.00 72.05  ? 1083 CYS C SG    1 
ATOM   5984 N  N     . MET C  2 170 ? -43.239 -61.436 -73.011  1.00 64.34  ? 1084 MET C N     1 
ATOM   5985 C  CA    . MET C  2 170 ? -42.086 -61.710 -72.172  1.00 66.69  ? 1084 MET C CA    1 
ATOM   5986 C  C     . MET C  2 170 ? -41.529 -60.403 -71.625  1.00 62.90  ? 1084 MET C C     1 
ATOM   5987 O  O     . MET C  2 170 ? -41.772 -59.322 -72.167  1.00 61.90  ? 1084 MET C O     1 
ATOM   5988 C  CB    . MET C  2 170 ? -41.011 -62.482 -72.944  1.00 71.93  ? 1084 MET C CB    1 
ATOM   5989 C  CG    . MET C  2 170 ? -40.485 -61.753 -74.146  1.00 78.64  ? 1084 MET C CG    1 
ATOM   5990 S  SD    . MET C  2 170 ? -39.716 -62.871 -75.324  1.00 87.03  ? 1084 MET C SD    1 
ATOM   5991 C  CE    . MET C  2 170 ? -41.053 -64.033 -75.591  1.00 87.76  ? 1084 MET C CE    1 
ATOM   5992 N  N     . THR C  2 171 ? -40.785 -60.515 -70.530  1.00 57.53  ? 1085 THR C N     1 
ATOM   5993 C  CA    . THR C  2 171 ? -40.158 -59.377 -69.875  1.00 54.75  ? 1085 THR C CA    1 
ATOM   5994 C  C     . THR C  2 171 ? -38.664 -59.409 -70.146  1.00 58.14  ? 1085 THR C C     1 
ATOM   5995 O  O     . THR C  2 171 ? -38.017 -60.448 -69.963  1.00 56.95  ? 1085 THR C O     1 
ATOM   5996 C  CB    . THR C  2 171 ? -40.415 -59.395 -68.366  1.00 54.56  ? 1085 THR C CB    1 
ATOM   5997 O  OG1   . THR C  2 171 ? -41.817 -59.543 -68.126  1.00 54.61  ? 1085 THR C OG1   1 
ATOM   5998 C  CG2   . THR C  2 171 ? -39.934 -58.115 -67.727  1.00 54.26  ? 1085 THR C CG2   1 
ATOM   5999 N  N     . ILE C  2 172 ? -38.121 -58.275 -70.575  1.00 56.77  ? 1086 ILE C N     1 
ATOM   6000 C  CA    . ILE C  2 172 ? -36.695 -58.178 -70.867  1.00 57.52  ? 1086 ILE C CA    1 
ATOM   6001 C  C     . ILE C  2 172 ? -35.947 -57.971 -69.558  1.00 55.12  ? 1086 ILE C C     1 
ATOM   6002 O  O     . ILE C  2 172 ? -36.211 -57.013 -68.825  1.00 55.37  ? 1086 ILE C O     1 
ATOM   6003 C  CB    . ILE C  2 172 ? -36.403 -57.044 -71.860  1.00 56.45  ? 1086 ILE C CB    1 
ATOM   6004 C  CG1   . ILE C  2 172 ? -37.072 -57.338 -73.200  1.00 57.25  ? 1086 ILE C CG1   1 
ATOM   6005 C  CG2   . ILE C  2 172 ? -34.903 -56.874 -72.044  1.00 55.24  ? 1086 ILE C CG2   1 
ATOM   6006 C  CD1   . ILE C  2 172 ? -36.682 -58.681 -73.783  1.00 55.96  ? 1086 ILE C CD1   1 
ATOM   6007 N  N     . ILE C  2 173 ? -35.015 -58.875 -69.259  1.00 54.82  ? 1087 ILE C N     1 
ATOM   6008 C  CA    . ILE C  2 173 ? -34.237 -58.747 -68.033  1.00 57.31  ? 1087 ILE C CA    1 
ATOM   6009 C  C     . ILE C  2 173 ? -33.071 -57.793 -68.240  1.00 56.01  ? 1087 ILE C C     1 
ATOM   6010 O  O     . ILE C  2 173 ? -32.780 -56.960 -67.376  1.00 56.44  ? 1087 ILE C O     1 
ATOM   6011 C  CB    . ILE C  2 173 ? -33.765 -60.130 -67.536  1.00 63.14  ? 1087 ILE C CB    1 
ATOM   6012 C  CG1   . ILE C  2 173 ? -34.941 -61.113 -67.434  1.00 63.01  ? 1087 ILE C CG1   1 
ATOM   6013 C  CG2   . ILE C  2 173 ? -33.075 -60.007 -66.185  1.00 54.11  ? 1087 ILE C CG2   1 
ATOM   6014 C  CD1   . ILE C  2 173 ? -36.196 -60.527 -66.802  1.00 57.55  ? 1087 ILE C CD1   1 
ATOM   6015 N  N     . HIS C  2 174 ? -32.383 -57.889 -69.375  1.00 61.64  ? 1088 HIS C N     1 
ATOM   6016 C  CA    . HIS C  2 174 ? -31.404 -56.866 -69.711  1.00 67.05  ? 1088 HIS C CA    1 
ATOM   6017 C  C     . HIS C  2 174 ? -31.161 -56.858 -71.212  1.00 66.59  ? 1088 HIS C C     1 
ATOM   6018 O  O     . HIS C  2 174 ? -31.274 -57.889 -71.882  1.00 59.30  ? 1088 HIS C O     1 
ATOM   6019 C  CB    . HIS C  2 174 ? -30.087 -57.063 -68.955  1.00 69.72  ? 1088 HIS C CB    1 
ATOM   6020 C  CG    . HIS C  2 174 ? -29.473 -58.410 -69.147  1.00 76.19  ? 1088 HIS C CG    1 
ATOM   6021 N  ND1   . HIS C  2 174 ? -28.938 -58.821 -70.349  1.00 79.20  ? 1088 HIS C ND1   1 
ATOM   6022 C  CD2   . HIS C  2 174 ? -29.306 -59.442 -68.287  1.00 78.68  ? 1088 HIS C CD2   1 
ATOM   6023 C  CE1   . HIS C  2 174 ? -28.461 -60.046 -70.220  1.00 80.00  ? 1088 HIS C CE1   1 
ATOM   6024 N  NE2   . HIS C  2 174 ? -28.676 -60.448 -68.979  1.00 80.20  ? 1088 HIS C NE2   1 
ATOM   6025 N  N     . ARG C  2 175 ? -30.855 -55.666 -71.722  1.00 73.63  ? 1089 ARG C N     1 
ATOM   6026 C  CA    . ARG C  2 175 ? -30.431 -55.460 -73.098  1.00 75.89  ? 1089 ARG C CA    1 
ATOM   6027 C  C     . ARG C  2 175 ? -28.925 -55.264 -73.143  1.00 86.82  ? 1089 ARG C C     1 
ATOM   6028 O  O     . ARG C  2 175 ? -28.360 -54.556 -72.303  1.00 93.06  ? 1089 ARG C O     1 
ATOM   6029 C  CB    . ARG C  2 175 ? -31.087 -54.227 -73.714  1.00 71.30  ? 1089 ARG C CB    1 
ATOM   6030 C  CG    . ARG C  2 175 ? -32.565 -54.067 -73.497  1.00 70.38  ? 1089 ARG C CG    1 
ATOM   6031 C  CD    . ARG C  2 175 ? -32.990 -52.732 -74.079  1.00 68.25  ? 1089 ARG C CD    1 
ATOM   6032 N  NE    . ARG C  2 175 ? -32.024 -52.245 -75.063  1.00 69.28  ? 1089 ARG C NE    1 
ATOM   6033 C  CZ    . ARG C  2 175 ? -32.321 -51.439 -76.078  1.00 68.33  ? 1089 ARG C CZ    1 
ATOM   6034 N  NH1   . ARG C  2 175 ? -31.372 -51.057 -76.927  1.00 69.15  ? 1089 ARG C NH1   1 
ATOM   6035 N  NH2   . ARG C  2 175 ? -33.567 -51.026 -76.252  1.00 67.50  ? 1089 ARG C NH2   1 
ATOM   6036 N  N     . GLU C  2 176 ? -28.287 -55.874 -74.138  1.00 91.31  ? 1090 GLU C N     1 
ATOM   6037 C  CA    . GLU C  2 176 ? -26.891 -55.610 -74.482  1.00 98.12  ? 1090 GLU C CA    1 
ATOM   6038 C  C     . GLU C  2 176 ? -25.999 -55.630 -73.238  1.00 101.42 ? 1090 GLU C C     1 
ATOM   6039 O  O     . GLU C  2 176 ? -25.419 -54.624 -72.828  1.00 104.42 ? 1090 GLU C O     1 
ATOM   6040 C  CB    . GLU C  2 176 ? -26.771 -54.277 -75.229  1.00 101.10 ? 1090 GLU C CB    1 
ATOM   6041 N  N     . ASP C  2 177 ? -25.918 -56.816 -72.638  1.00 102.40 ? 1091 ASP C N     1 
ATOM   6042 C  CA    . ASP C  2 177 ? -25.149 -57.032 -71.418  1.00 100.92 ? 1091 ASP C CA    1 
ATOM   6043 C  C     . ASP C  2 177 ? -23.944 -57.907 -71.739  1.00 103.70 ? 1091 ASP C C     1 
ATOM   6044 O  O     . ASP C  2 177 ? -24.101 -59.077 -72.108  1.00 98.39  ? 1091 ASP C O     1 
ATOM   6045 C  CB    . ASP C  2 177 ? -26.010 -57.672 -70.334  1.00 98.66  ? 1091 ASP C CB    1 
ATOM   6046 N  N     . GLU C  2 178 ? -22.749 -57.332 -71.596  1.00 113.33 ? 1092 GLU C N     1 
ATOM   6047 C  CA    . GLU C  2 178 ? -21.483 -58.048 -71.718  1.00 116.83 ? 1092 GLU C CA    1 
ATOM   6048 C  C     . GLU C  2 178 ? -21.296 -58.681 -73.094  1.00 117.60 ? 1092 GLU C C     1 
ATOM   6049 O  O     . GLU C  2 178 ? -20.887 -58.007 -74.045  1.00 120.18 ? 1092 GLU C O     1 
ATOM   6050 C  CB    . GLU C  2 178 ? -21.369 -59.116 -70.626  1.00 119.55 ? 1092 GLU C CB    1 
ATOM   6051 N  N     . ASP C  2 179 ? -21.595 -59.976 -73.206  1.00 114.44 ? 1093 ASP C N     1 
ATOM   6052 C  CA    . ASP C  2 179 ? -21.237 -60.713 -74.414  1.00 109.32 ? 1093 ASP C CA    1 
ATOM   6053 C  C     . ASP C  2 179 ? -22.132 -60.345 -75.592  1.00 105.56 ? 1093 ASP C C     1 
ATOM   6054 O  O     . ASP C  2 179 ? -21.645 -60.190 -76.719  1.00 107.91 ? 1093 ASP C O     1 
ATOM   6055 C  CB    . ASP C  2 179 ? -21.295 -62.215 -74.139  1.00 108.58 ? 1093 ASP C CB    1 
ATOM   6056 C  CG    . ASP C  2 179 ? -20.516 -62.608 -72.896  1.00 106.28 ? 1093 ASP C CG    1 
ATOM   6057 O  OD1   . ASP C  2 179 ? -20.891 -62.160 -71.793  1.00 104.42 ? 1093 ASP C OD1   1 
ATOM   6058 O  OD2   . ASP C  2 179 ? -19.529 -63.362 -73.021  1.00 104.76 ? 1093 ASP C OD2   1 
ATOM   6059 N  N     . GLU C  2 180 ? -23.433 -60.195 -75.360  1.00 100.61 ? 1094 GLU C N     1 
ATOM   6060 C  CA    . GLU C  2 180 ? -24.392 -60.012 -76.439  1.00 96.94  ? 1094 GLU C CA    1 
ATOM   6061 C  C     . GLU C  2 180 ? -24.855 -58.563 -76.534  1.00 99.72  ? 1094 GLU C C     1 
ATOM   6062 O  O     . GLU C  2 180 ? -24.783 -57.793 -75.572  1.00 98.34  ? 1094 GLU C O     1 
ATOM   6063 C  CB    . GLU C  2 180 ? -25.601 -60.935 -76.258  1.00 88.79  ? 1094 GLU C CB    1 
ATOM   6064 C  CG    . GLU C  2 180 ? -25.238 -62.405 -76.109  1.00 84.65  ? 1094 GLU C CG    1 
ATOM   6065 C  CD    . GLU C  2 180 ? -24.917 -63.082 -77.433  1.00 83.60  ? 1094 GLU C CD    1 
ATOM   6066 O  OE1   . GLU C  2 180 ? -24.866 -64.329 -77.457  1.00 84.09  ? 1094 GLU C OE1   1 
ATOM   6067 O  OE2   . GLU C  2 180 ? -24.718 -62.379 -78.448  1.00 83.02  ? 1094 GLU C OE2   1 
ATOM   6068 N  N     . ILE C  2 181 ? -25.327 -58.203 -77.728  1.00 102.95 ? 1095 ILE C N     1 
ATOM   6069 C  CA    . ILE C  2 181 ? -25.846 -56.870 -78.017  1.00 103.30 ? 1095 ILE C CA    1 
ATOM   6070 C  C     . ILE C  2 181 ? -27.152 -57.011 -78.790  1.00 96.19  ? 1095 ILE C C     1 
ATOM   6071 O  O     . ILE C  2 181 ? -28.132 -56.308 -78.517  1.00 96.37  ? 1095 ILE C O     1 
ATOM   6072 C  CB    . ILE C  2 181 ? -24.824 -56.025 -78.805  1.00 109.55 ? 1095 ILE C CB    1 
ATOM   6073 C  CG1   . ILE C  2 181 ? -23.648 -55.620 -77.913  1.00 112.21 ? 1095 ILE C CG1   1 
ATOM   6074 C  CG2   . ILE C  2 181 ? -25.489 -54.793 -79.402  1.00 110.11 ? 1095 ILE C CG2   1 
ATOM   6075 C  CD1   . ILE C  2 181 ? -22.425 -56.512 -78.057  1.00 114.44 ? 1095 ILE C CD1   1 
ATOM   6076 N  N     . GLU C  2 182 ? -27.175 -57.927 -79.758  1.00 87.95  ? 1096 GLU C N     1 
ATOM   6077 C  CA    . GLU C  2 182 ? -28.366 -58.168 -80.561  1.00 79.66  ? 1096 GLU C CA    1 
ATOM   6078 C  C     . GLU C  2 182 ? -29.265 -59.253 -79.988  1.00 73.60  ? 1096 GLU C C     1 
ATOM   6079 O  O     . GLU C  2 182 ? -30.366 -59.460 -80.507  1.00 77.38  ? 1096 GLU C O     1 
ATOM   6080 C  CB    . GLU C  2 182 ? -27.976 -58.541 -81.993  1.00 75.73  ? 1096 GLU C CB    1 
ATOM   6081 C  CG    . GLU C  2 182 ? -27.186 -57.473 -82.705  1.00 72.48  ? 1096 GLU C CG    1 
ATOM   6082 C  CD    . GLU C  2 182 ? -26.940 -57.814 -84.157  1.00 73.80  ? 1096 GLU C CD    1 
ATOM   6083 O  OE1   . GLU C  2 182 ? -27.918 -57.900 -84.929  1.00 75.35  ? 1096 GLU C OE1   1 
ATOM   6084 O  OE2   . GLU C  2 182 ? -25.764 -58.009 -84.521  1.00 75.82  ? 1096 GLU C OE2   1 
ATOM   6085 N  N     . TRP C  2 183 ? -28.825 -59.948 -78.946  1.00 66.79  ? 1097 TRP C N     1 
ATOM   6086 C  CA    . TRP C  2 183 ? -29.640 -60.916 -78.229  1.00 66.33  ? 1097 TRP C CA    1 
ATOM   6087 C  C     . TRP C  2 183 ? -29.891 -60.391 -76.822  1.00 66.64  ? 1097 TRP C C     1 
ATOM   6088 O  O     . TRP C  2 183 ? -28.969 -59.887 -76.173  1.00 69.72  ? 1097 TRP C O     1 
ATOM   6089 C  CB    . TRP C  2 183 ? -28.953 -62.283 -78.183  1.00 67.79  ? 1097 TRP C CB    1 
ATOM   6090 C  CG    . TRP C  2 183 ? -28.899 -62.954 -79.521  1.00 64.19  ? 1097 TRP C CG    1 
ATOM   6091 C  CD1   . TRP C  2 183 ? -28.066 -62.650 -80.563  1.00 62.00  ? 1097 TRP C CD1   1 
ATOM   6092 C  CD2   . TRP C  2 183 ? -29.721 -64.038 -79.968  1.00 66.81  ? 1097 TRP C CD2   1 
ATOM   6093 N  NE1   . TRP C  2 183 ? -28.317 -63.484 -81.632  1.00 59.68  ? 1097 TRP C NE1   1 
ATOM   6094 C  CE2   . TRP C  2 183 ? -29.328 -64.344 -81.293  1.00 63.34  ? 1097 TRP C CE2   1 
ATOM   6095 C  CE3   . TRP C  2 183 ? -30.748 -64.785 -79.377  1.00 67.10  ? 1097 TRP C CE3   1 
ATOM   6096 C  CZ2   . TRP C  2 183 ? -29.928 -65.359 -82.034  1.00 63.71  ? 1097 TRP C CZ2   1 
ATOM   6097 C  CZ3   . TRP C  2 183 ? -31.343 -65.797 -80.115  1.00 65.71  ? 1097 TRP C CZ3   1 
ATOM   6098 C  CH2   . TRP C  2 183 ? -30.931 -66.073 -81.430  1.00 67.69  ? 1097 TRP C CH2   1 
ATOM   6099 N  N     . TRP C  2 184 ? -31.140 -60.487 -76.367  1.00 61.45  ? 1098 TRP C N     1 
ATOM   6100 C  CA    . TRP C  2 184 ? -31.552 -59.980 -75.066  1.00 60.87  ? 1098 TRP C CA    1 
ATOM   6101 C  C     . TRP C  2 184 ? -31.951 -61.130 -74.154  1.00 59.82  ? 1098 TRP C C     1 
ATOM   6102 O  O     . TRP C  2 184 ? -32.575 -62.098 -74.601  1.00 58.67  ? 1098 TRP C O     1 
ATOM   6103 C  CB    . TRP C  2 184 ? -32.734 -59.018 -75.190  1.00 60.92  ? 1098 TRP C CB    1 
ATOM   6104 C  CG    . TRP C  2 184 ? -32.446 -57.805 -75.983  1.00 58.45  ? 1098 TRP C CG    1 
ATOM   6105 C  CD1   . TRP C  2 184 ? -31.225 -57.372 -76.409  1.00 58.37  ? 1098 TRP C CD1   1 
ATOM   6106 C  CD2   . TRP C  2 184 ? -33.400 -56.853 -76.457  1.00 55.91  ? 1098 TRP C CD2   1 
ATOM   6107 N  NE1   . TRP C  2 184 ? -31.359 -56.202 -77.115  1.00 59.83  ? 1098 TRP C NE1   1 
ATOM   6108 C  CE2   . TRP C  2 184 ? -32.686 -55.863 -77.162  1.00 58.19  ? 1098 TRP C CE2   1 
ATOM   6109 C  CE3   . TRP C  2 184 ? -34.791 -56.739 -76.350  1.00 52.28  ? 1098 TRP C CE3   1 
ATOM   6110 C  CZ2   . TRP C  2 184 ? -33.312 -54.774 -77.763  1.00 58.70  ? 1098 TRP C CZ2   1 
ATOM   6111 C  CZ3   . TRP C  2 184 ? -35.413 -55.651 -76.941  1.00 57.21  ? 1098 TRP C CZ3   1 
ATOM   6112 C  CH2   . TRP C  2 184 ? -34.672 -54.685 -77.644  1.00 60.26  ? 1098 TRP C CH2   1 
ATOM   6113 N  N     . TRP C  2 185 ? -31.605 -61.010 -72.874  1.00 55.65  ? 1099 TRP C N     1 
ATOM   6114 C  CA    . TRP C  2 185 ? -32.038 -61.983 -71.879  1.00 58.23  ? 1099 TRP C CA    1 
ATOM   6115 C  C     . TRP C  2 185 ? -33.440 -61.621 -71.408  1.00 57.10  ? 1099 TRP C C     1 
ATOM   6116 O  O     . TRP C  2 185 ? -33.654 -60.547 -70.833  1.00 57.30  ? 1099 TRP C O     1 
ATOM   6117 C  CB    . TRP C  2 185 ? -31.068 -62.032 -70.702  1.00 60.02  ? 1099 TRP C CB    1 
ATOM   6118 C  CG    . TRP C  2 185 ? -31.275 -63.221 -69.792  1.00 62.28  ? 1099 TRP C CG    1 
ATOM   6119 C  CD1   . TRP C  2 185 ? -31.995 -63.246 -68.636  1.00 59.70  ? 1099 TRP C CD1   1 
ATOM   6120 C  CD2   . TRP C  2 185 ? -30.758 -64.549 -69.971  1.00 63.45  ? 1099 TRP C CD2   1 
ATOM   6121 N  NE1   . TRP C  2 185 ? -31.957 -64.501 -68.078  1.00 68.31  ? 1099 TRP C NE1   1 
ATOM   6122 C  CE2   . TRP C  2 185 ? -31.207 -65.323 -68.879  1.00 69.42  ? 1099 TRP C CE2   1 
ATOM   6123 C  CE3   . TRP C  2 185 ? -29.962 -65.159 -70.946  1.00 69.22  ? 1099 TRP C CE3   1 
ATOM   6124 C  CZ2   . TRP C  2 185 ? -30.885 -66.675 -68.732  1.00 68.65  ? 1099 TRP C CZ2   1 
ATOM   6125 C  CZ3   . TRP C  2 185 ? -29.646 -66.502 -70.801  1.00 73.51  ? 1099 TRP C CZ3   1 
ATOM   6126 C  CH2   . TRP C  2 185 ? -30.106 -67.244 -69.699  1.00 71.27  ? 1099 TRP C CH2   1 
ATOM   6127 N  N     . ALA C  2 186 ? -34.390 -62.510 -71.660  1.00 54.46  ? 1100 ALA C N     1 
ATOM   6128 C  CA    . ALA C  2 186 ? -35.791 -62.273 -71.357  1.00 56.31  ? 1100 ALA C CA    1 
ATOM   6129 C  C     . ALA C  2 186 ? -36.328 -63.363 -70.438  1.00 61.05  ? 1100 ALA C C     1 
ATOM   6130 O  O     . ALA C  2 186 ? -35.707 -64.414 -70.238  1.00 60.09  ? 1100 ALA C O     1 
ATOM   6131 C  CB    . ALA C  2 186 ? -36.628 -62.206 -72.640  1.00 52.39  ? 1100 ALA C CB    1 
ATOM   6132 N  N     . ARG C  2 187 ? -37.500 -63.089 -69.873  1.00 62.35  ? 1101 ARG C N     1 
ATOM   6133 C  CA    . ARG C  2 187 ? -38.246 -64.053 -69.076  1.00 60.54  ? 1101 ARG C CA    1 
ATOM   6134 C  C     . ARG C  2 187 ? -39.584 -64.288 -69.762  1.00 56.81  ? 1101 ARG C C     1 
ATOM   6135 O  O     . ARG C  2 187 ? -40.332 -63.339 -70.018  1.00 51.75  ? 1101 ARG C O     1 
ATOM   6136 C  CB    . ARG C  2 187 ? -38.451 -63.559 -67.638  1.00 58.46  ? 1101 ARG C CB    1 
ATOM   6137 C  CG    . ARG C  2 187 ? -39.076 -64.602 -66.703  1.00 58.25  ? 1101 ARG C CG    1 
ATOM   6138 C  CD    . ARG C  2 187 ? -39.111 -64.125 -65.252  1.00 56.85  ? 1101 ARG C CD    1 
ATOM   6139 N  NE    . ARG C  2 187 ? -39.650 -65.143 -64.347  1.00 53.77  ? 1101 ARG C NE    1 
ATOM   6140 C  CZ    . ARG C  2 187 ? -38.903 -65.982 -63.634  1.00 57.07  ? 1101 ARG C CZ    1 
ATOM   6141 N  NH1   . ARG C  2 187 ? -37.577 -65.928 -63.710  1.00 53.66  ? 1101 ARG C NH1   1 
ATOM   6142 N  NH2   . ARG C  2 187 ? -39.478 -66.884 -62.849  1.00 55.45  ? 1101 ARG C NH2   1 
ATOM   6143 N  N     . LEU C  2 188 ? -39.871 -65.543 -70.088  1.00 56.77  ? 1102 LEU C N     1 
ATOM   6144 C  CA    . LEU C  2 188 ? -41.160 -65.943 -70.634  1.00 63.26  ? 1102 LEU C CA    1 
ATOM   6145 C  C     . LEU C  2 188 ? -41.722 -67.013 -69.714  1.00 67.35  ? 1102 LEU C C     1 
ATOM   6146 O  O     . LEU C  2 188 ? -41.104 -68.070 -69.539  1.00 66.06  ? 1102 LEU C O     1 
ATOM   6147 C  CB    . LEU C  2 188 ? -41.027 -66.444 -72.078  1.00 66.67  ? 1102 LEU C CB    1 
ATOM   6148 C  CG    . LEU C  2 188 ? -42.199 -67.229 -72.676  1.00 67.01  ? 1102 LEU C CG    1 
ATOM   6149 C  CD1   . LEU C  2 188 ? -43.457 -66.384 -72.676  1.00 65.52  ? 1102 LEU C CD1   1 
ATOM   6150 C  CD2   . LEU C  2 188 ? -41.876 -67.665 -74.092  1.00 65.45  ? 1102 LEU C CD2   1 
ATOM   6151 N  N     . ASN C  2 189 ? -42.874 -66.723 -69.112  1.00 73.83  ? 1103 ASN C N     1 
ATOM   6152 C  CA    . ASN C  2 189 ? -43.475 -67.573 -68.083  1.00 78.33  ? 1103 ASN C CA    1 
ATOM   6153 C  C     . ASN C  2 189 ? -42.459 -67.691 -66.954  1.00 77.41  ? 1103 ASN C C     1 
ATOM   6154 O  O     . ASN C  2 189 ? -42.100 -66.655 -66.365  1.00 77.74  ? 1103 ASN C O     1 
ATOM   6155 C  CB    . ASN C  2 189 ? -43.940 -68.882 -68.726  1.00 80.61  ? 1103 ASN C CB    1 
ATOM   6156 C  CG    . ASN C  2 189 ? -44.918 -68.649 -69.862  1.00 86.49  ? 1103 ASN C CG    1 
ATOM   6157 O  OD1   . ASN C  2 189 ? -45.852 -67.856 -69.741  1.00 88.56  ? 1103 ASN C OD1   1 
ATOM   6158 N  ND2   . ASN C  2 189 ? -44.697 -69.329 -70.983  1.00 89.45  ? 1103 ASN C ND2   1 
ATOM   6159 N  N     . ASP C  2 190 ? -41.960 -68.881 -66.631  1.00 76.86  ? 1104 ASP C N     1 
ATOM   6160 C  CA    . ASP C  2 190 ? -40.987 -69.056 -65.561  1.00 77.97  ? 1104 ASP C CA    1 
ATOM   6161 C  C     . ASP C  2 190 ? -39.595 -69.392 -66.085  1.00 75.75  ? 1104 ASP C C     1 
ATOM   6162 O  O     . ASP C  2 190 ? -38.709 -69.735 -65.292  1.00 77.01  ? 1104 ASP C O     1 
ATOM   6163 C  CB    . ASP C  2 190 ? -41.452 -70.143 -64.588  1.00 78.56  ? 1104 ASP C CB    1 
ATOM   6164 N  N     . LYS C  2 191 ? -39.383 -69.302 -67.395  1.00 69.56  ? 1105 LYS C N     1 
ATOM   6165 C  CA    . LYS C  2 191 ? -38.109 -69.623 -68.023  1.00 69.97  ? 1105 LYS C CA    1 
ATOM   6166 C  C     . LYS C  2 191 ? -37.420 -68.353 -68.508  1.00 71.54  ? 1105 LYS C C     1 
ATOM   6167 O  O     . LYS C  2 191 ? -38.072 -67.375 -68.886  1.00 75.46  ? 1105 LYS C O     1 
ATOM   6168 C  CB    . LYS C  2 191 ? -38.302 -70.585 -69.200  1.00 68.30  ? 1105 LYS C CB    1 
ATOM   6169 N  N     . GLU C  2 192 ? -36.088 -68.380 -68.499  1.00 61.98  ? 1106 GLU C N     1 
ATOM   6170 C  CA    . GLU C  2 192 ? -35.284 -67.245 -68.919  1.00 57.47  ? 1106 GLU C CA    1 
ATOM   6171 C  C     . GLU C  2 192 ? -34.264 -67.690 -69.956  1.00 57.12  ? 1106 GLU C C     1 
ATOM   6172 O  O     . GLU C  2 192 ? -33.836 -68.846 -69.971  1.00 61.38  ? 1106 GLU C O     1 
ATOM   6173 C  CB    . GLU C  2 192 ? -34.568 -66.593 -67.736  1.00 53.90  ? 1106 GLU C CB    1 
ATOM   6174 C  CG    . GLU C  2 192 ? -35.498 -65.923 -66.742  1.00 56.59  ? 1106 GLU C CG    1 
ATOM   6175 C  CD    . GLU C  2 192 ? -34.735 -65.167 -65.677  1.00 61.70  ? 1106 GLU C CD    1 
ATOM   6176 O  OE1   . GLU C  2 192 ? -33.498 -65.060 -65.824  1.00 65.59  ? 1106 GLU C OE1   1 
ATOM   6177 O  OE2   . GLU C  2 192 ? -35.358 -64.692 -64.697  1.00 55.90  ? 1106 GLU C OE2   1 
ATOM   6178 N  N     . GLY C  2 193 ? -33.878 -66.760 -70.818  1.00 57.62  ? 1107 GLY C N     1 
ATOM   6179 C  CA    . GLY C  2 193 ? -32.952 -67.074 -71.886  1.00 60.86  ? 1107 GLY C CA    1 
ATOM   6180 C  C     . GLY C  2 193 ? -32.858 -65.936 -72.879  1.00 64.59  ? 1107 GLY C C     1 
ATOM   6181 O  O     . GLY C  2 193 ? -33.498 -64.889 -72.733  1.00 62.06  ? 1107 GLY C O     1 
ATOM   6182 N  N     . TYR C  2 194 ? -32.040 -66.171 -73.903  1.00 68.93  ? 1108 TYR C N     1 
ATOM   6183 C  CA    . TYR C  2 194 ? -31.766 -65.167 -74.919  1.00 70.41  ? 1108 TYR C CA    1 
ATOM   6184 C  C     . TYR C  2 194 ? -32.831 -65.192 -76.007  1.00 70.93  ? 1108 TYR C C     1 
ATOM   6185 O  O     . TYR C  2 194 ? -33.324 -66.256 -76.390  1.00 72.25  ? 1108 TYR C O     1 
ATOM   6186 C  CB    . TYR C  2 194 ? -30.386 -65.398 -75.537  1.00 74.18  ? 1108 TYR C CB    1 
ATOM   6187 C  CG    . TYR C  2 194 ? -29.252 -64.748 -74.775  1.00 77.94  ? 1108 TYR C CG    1 
ATOM   6188 C  CD1   . TYR C  2 194 ? -29.229 -63.375 -74.566  1.00 76.14  ? 1108 TYR C CD1   1 
ATOM   6189 C  CD2   . TYR C  2 194 ? -28.198 -65.508 -74.274  1.00 80.95  ? 1108 TYR C CD2   1 
ATOM   6190 C  CE1   . TYR C  2 194 ? -28.198 -62.775 -73.874  1.00 77.05  ? 1108 TYR C CE1   1 
ATOM   6191 C  CE2   . TYR C  2 194 ? -27.161 -64.916 -73.578  1.00 80.26  ? 1108 TYR C CE2   1 
ATOM   6192 C  CZ    . TYR C  2 194 ? -27.167 -63.548 -73.382  1.00 80.36  ? 1108 TYR C CZ    1 
ATOM   6193 O  OH    . TYR C  2 194 ? -26.138 -62.948 -72.693  1.00 81.79  ? 1108 TYR C OH    1 
ATOM   6194 N  N     . VAL C  2 195 ? -33.182 -64.010 -76.503  1.00 70.07  ? 1109 VAL C N     1 
ATOM   6195 C  CA    . VAL C  2 195 ? -34.149 -63.872 -77.590  1.00 65.13  ? 1109 VAL C CA    1 
ATOM   6196 C  C     . VAL C  2 195 ? -33.552 -62.940 -78.638  1.00 62.22  ? 1109 VAL C C     1 
ATOM   6197 O  O     . VAL C  2 195 ? -32.837 -61.990 -78.285  1.00 62.10  ? 1109 VAL C O     1 
ATOM   6198 C  CB    . VAL C  2 195 ? -35.507 -63.359 -77.078  1.00 64.21  ? 1109 VAL C CB    1 
ATOM   6199 C  CG1   . VAL C  2 195 ? -36.213 -64.439 -76.258  1.00 63.51  ? 1109 VAL C CG1   1 
ATOM   6200 C  CG2   . VAL C  2 195 ? -35.335 -62.087 -76.255  1.00 61.97  ? 1109 VAL C CG2   1 
ATOM   6201 N  N     . PRO C  2 196 ? -33.796 -63.176 -79.929  1.00 57.72  ? 1110 PRO C N     1 
ATOM   6202 C  CA    . PRO C  2 196 ? -33.237 -62.291 -80.960  1.00 59.66  ? 1110 PRO C CA    1 
ATOM   6203 C  C     . PRO C  2 196 ? -34.069 -61.017 -81.083  1.00 59.00  ? 1110 PRO C C     1 
ATOM   6204 O  O     . PRO C  2 196 ? -35.295 -61.066 -81.208  1.00 58.95  ? 1110 PRO C O     1 
ATOM   6205 C  CB    . PRO C  2 196 ? -33.303 -63.142 -82.235  1.00 57.06  ? 1110 PRO C CB    1 
ATOM   6206 C  CG    . PRO C  2 196 ? -34.466 -64.054 -82.006  1.00 58.62  ? 1110 PRO C CG    1 
ATOM   6207 C  CD    . PRO C  2 196 ? -34.571 -64.287 -80.510  1.00 56.88  ? 1110 PRO C CD    1 
ATOM   6208 N  N     . ARG C  2 197 ? -33.393 -59.869 -81.040  1.00 54.59  ? 1111 ARG C N     1 
ATOM   6209 C  CA    . ARG C  2 197 ? -34.117 -58.611 -80.910  1.00 56.91  ? 1111 ARG C CA    1 
ATOM   6210 C  C     . ARG C  2 197 ? -34.890 -58.253 -82.178  1.00 56.82  ? 1111 ARG C C     1 
ATOM   6211 O  O     . ARG C  2 197 ? -35.923 -57.575 -82.096  1.00 51.70  ? 1111 ARG C O     1 
ATOM   6212 C  CB    . ARG C  2 197 ? -33.145 -57.495 -80.522  1.00 62.84  ? 1111 ARG C CB    1 
ATOM   6213 C  CG    . ARG C  2 197 ? -32.730 -56.598 -81.665  1.00 66.30  ? 1111 ARG C CG    1 
ATOM   6214 C  CD    . ARG C  2 197 ? -31.229 -56.503 -81.776  1.00 67.97  ? 1111 ARG C CD    1 
ATOM   6215 N  NE    . ARG C  2 197 ? -30.705 -55.394 -80.994  1.00 70.61  ? 1111 ARG C NE    1 
ATOM   6216 C  CZ    . ARG C  2 197 ? -30.045 -54.364 -81.514  1.00 67.03  ? 1111 ARG C CZ    1 
ATOM   6217 N  NH1   . ARG C  2 197 ? -29.809 -54.313 -82.816  1.00 65.44  ? 1111 ARG C NH1   1 
ATOM   6218 N  NH2   . ARG C  2 197 ? -29.602 -53.394 -80.725  1.00 64.87  ? 1111 ARG C NH2   1 
ATOM   6219 N  N     . ASN C  2 198 ? -34.426 -58.702 -83.350  1.00 53.08  ? 1112 ASN C N     1 
ATOM   6220 C  CA    . ASN C  2 198 ? -35.087 -58.388 -84.613  1.00 53.21  ? 1112 ASN C CA    1 
ATOM   6221 C  C     . ASN C  2 198 ? -36.378 -59.170 -84.827  1.00 51.96  ? 1112 ASN C C     1 
ATOM   6222 O  O     . ASN C  2 198 ? -37.041 -58.967 -85.847  1.00 54.90  ? 1112 ASN C O     1 
ATOM   6223 C  CB    . ASN C  2 198 ? -34.133 -58.642 -85.790  1.00 54.08  ? 1112 ASN C CB    1 
ATOM   6224 C  CG    . ASN C  2 198 ? -33.741 -60.105 -85.923  1.00 54.47  ? 1112 ASN C CG    1 
ATOM   6225 O  OD1   . ASN C  2 198 ? -33.912 -60.892 -84.993  1.00 56.00  ? 1112 ASN C OD1   1 
ATOM   6226 N  ND2   . ASN C  2 198 ? -33.198 -60.471 -87.076  1.00 53.88  ? 1112 ASN C ND2   1 
ATOM   6227 N  N     . LEU C  2 199 ? -36.737 -60.069 -83.918  1.00 52.04  ? 1113 LEU C N     1 
ATOM   6228 C  CA    . LEU C  2 199 ? -38.009 -60.774 -83.975  1.00 54.52  ? 1113 LEU C CA    1 
ATOM   6229 C  C     . LEU C  2 199 ? -39.034 -60.196 -83.010  1.00 53.45  ? 1113 LEU C C     1 
ATOM   6230 O  O     . LEU C  2 199 ? -40.167 -60.682 -82.964  1.00 54.05  ? 1113 LEU C O     1 
ATOM   6231 C  CB    . LEU C  2 199 ? -37.809 -62.270 -83.676  1.00 55.16  ? 1113 LEU C CB    1 
ATOM   6232 C  CG    . LEU C  2 199 ? -36.867 -63.074 -84.590  1.00 62.91  ? 1113 LEU C CG    1 
ATOM   6233 C  CD1   . LEU C  2 199 ? -37.083 -64.576 -84.420  1.00 63.70  ? 1113 LEU C CD1   1 
ATOM   6234 C  CD2   . LEU C  2 199 ? -37.026 -62.671 -86.053  1.00 60.79  ? 1113 LEU C CD2   1 
ATOM   6235 N  N     . LEU C  2 200 ? -38.663 -59.176 -82.241  1.00 53.45  ? 1114 LEU C N     1 
ATOM   6236 C  CA    . LEU C  2 200 ? -39.482 -58.660 -81.158  1.00 50.94  ? 1114 LEU C CA    1 
ATOM   6237 C  C     . LEU C  2 200 ? -40.088 -57.313 -81.526  1.00 54.79  ? 1114 LEU C C     1 
ATOM   6238 O  O     . LEU C  2 200 ? -39.522 -56.545 -82.311  1.00 51.39  ? 1114 LEU C O     1 
ATOM   6239 C  CB    . LEU C  2 200 ? -38.661 -58.518 -79.874  1.00 51.11  ? 1114 LEU C CB    1 
ATOM   6240 C  CG    . LEU C  2 200 ? -37.802 -59.733 -79.534  1.00 52.33  ? 1114 LEU C CG    1 
ATOM   6241 C  CD1   . LEU C  2 200 ? -37.085 -59.524 -78.212  1.00 51.73  ? 1114 LEU C CD1   1 
ATOM   6242 C  CD2   . LEU C  2 200 ? -38.653 -60.992 -79.500  1.00 51.61  ? 1114 LEU C CD2   1 
ATOM   6243 N  N     . GLY C  2 201 ? -41.257 -57.037 -80.946  1.00 53.01  ? 1115 GLY C N     1 
ATOM   6244 C  CA    . GLY C  2 201 ? -41.878 -55.740 -81.073  1.00 51.75  ? 1115 GLY C CA    1 
ATOM   6245 C  C     . GLY C  2 201 ? -42.294 -55.213 -79.713  1.00 56.15  ? 1115 GLY C C     1 
ATOM   6246 O  O     . GLY C  2 201 ? -42.397 -55.959 -78.730  1.00 49.62  ? 1115 GLY C O     1 
ATOM   6247 N  N     . LEU C  2 202 ? -42.525 -53.895 -79.671  1.00 49.20  ? 1116 LEU C N     1 
ATOM   6248 C  CA    . LEU C  2 202 ? -43.057 -53.263 -78.467  1.00 53.45  ? 1116 LEU C CA    1 
ATOM   6249 C  C     . LEU C  2 202 ? -44.482 -53.719 -78.182  1.00 56.67  ? 1116 LEU C C     1 
ATOM   6250 O  O     . LEU C  2 202 ? -44.871 -53.842 -77.014  1.00 57.19  ? 1116 LEU C O     1 
ATOM   6251 C  CB    . LEU C  2 202 ? -43.019 -51.742 -78.603  1.00 53.41  ? 1116 LEU C CB    1 
ATOM   6252 C  CG    . LEU C  2 202 ? -42.051 -50.956 -77.720  1.00 55.08  ? 1116 LEU C CG    1 
ATOM   6253 C  CD1   . LEU C  2 202 ? -42.338 -49.459 -77.835  1.00 55.93  ? 1116 LEU C CD1   1 
ATOM   6254 C  CD2   . LEU C  2 202 ? -42.120 -51.417 -76.268  1.00 49.56  ? 1116 LEU C CD2   1 
ATOM   6255 N  N     . TYR C  2 203 ? -45.263 -53.970 -79.225  1.00 52.06  ? 1117 TYR C N     1 
ATOM   6256 C  CA    . TYR C  2 203 ? -46.634 -54.441 -79.125  1.00 49.19  ? 1117 TYR C CA    1 
ATOM   6257 C  C     . TYR C  2 203 ? -46.803 -55.612 -80.083  1.00 54.06  ? 1117 TYR C C     1 
ATOM   6258 O  O     . TYR C  2 203 ? -46.020 -55.760 -81.028  1.00 61.19  ? 1117 TYR C O     1 
ATOM   6259 C  CB    . TYR C  2 203 ? -47.616 -53.299 -79.430  1.00 48.43  ? 1117 TYR C CB    1 
ATOM   6260 C  CG    . TYR C  2 203 ? -47.460 -52.164 -78.441  1.00 55.26  ? 1117 TYR C CG    1 
ATOM   6261 C  CD1   . TYR C  2 203 ? -46.521 -51.165 -78.645  1.00 57.19  ? 1117 TYR C CD1   1 
ATOM   6262 C  CD2   . TYR C  2 203 ? -48.218 -52.118 -77.278  1.00 56.40  ? 1117 TYR C CD2   1 
ATOM   6263 C  CE1   . TYR C  2 203 ? -46.357 -50.147 -77.734  1.00 58.64  ? 1117 TYR C CE1   1 
ATOM   6264 C  CE2   . TYR C  2 203 ? -48.060 -51.098 -76.359  1.00 54.47  ? 1117 TYR C CE2   1 
ATOM   6265 C  CZ    . TYR C  2 203 ? -47.130 -50.115 -76.594  1.00 56.94  ? 1117 TYR C CZ    1 
ATOM   6266 O  OH    . TYR C  2 203 ? -46.960 -49.088 -75.693  1.00 59.49  ? 1117 TYR C OH    1 
ATOM   6267 N  N     . PRO C  2 204 ? -47.783 -56.481 -79.848  1.00 50.67  ? 1118 PRO C N     1 
ATOM   6268 C  CA    . PRO C  2 204 ? -47.932 -57.675 -80.689  1.00 48.62  ? 1118 PRO C CA    1 
ATOM   6269 C  C     . PRO C  2 204 ? -48.661 -57.357 -81.990  1.00 53.77  ? 1118 PRO C C     1 
ATOM   6270 O  O     . PRO C  2 204 ? -49.245 -56.288 -82.166  1.00 48.96  ? 1118 PRO C O     1 
ATOM   6271 C  CB    . PRO C  2 204 ? -48.753 -58.615 -79.805  1.00 48.58  ? 1118 PRO C CB    1 
ATOM   6272 C  CG    . PRO C  2 204 ? -49.609 -57.681 -79.007  1.00 54.19  ? 1118 PRO C CG    1 
ATOM   6273 C  CD    . PRO C  2 204 ? -48.762 -56.458 -78.746  1.00 48.16  ? 1118 PRO C CD    1 
ATOM   6274 N  N     . ARG C  2 205 ? -48.614 -58.313 -82.915  1.00 51.69  ? 1119 ARG C N     1 
ATOM   6275 C  CA    . ARG C  2 205 ? -49.346 -58.158 -84.165  1.00 56.65  ? 1119 ARG C CA    1 
ATOM   6276 C  C     . ARG C  2 205 ? -50.849 -58.105 -83.906  1.00 62.11  ? 1119 ARG C C     1 
ATOM   6277 O  O     . ARG C  2 205 ? -51.337 -58.503 -82.846  1.00 68.30  ? 1119 ARG C O     1 
ATOM   6278 C  CB    . ARG C  2 205 ? -49.052 -59.314 -85.121  1.00 54.17  ? 1119 ARG C CB    1 
ATOM   6279 C  CG    . ARG C  2 205 ? -47.611 -59.453 -85.550  1.00 49.86  ? 1119 ARG C CG    1 
ATOM   6280 C  CD    . ARG C  2 205 ? -47.417 -60.788 -86.263  1.00 49.82  ? 1119 ARG C CD    1 
ATOM   6281 N  NE    . ARG C  2 205 ? -46.059 -60.948 -86.769  1.00 52.52  ? 1119 ARG C NE    1 
ATOM   6282 C  CZ    . ARG C  2 205 ? -45.670 -60.596 -87.989  1.00 54.04  ? 1119 ARG C CZ    1 
ATOM   6283 N  NH1   . ARG C  2 205 ? -44.409 -60.773 -88.355  1.00 50.35  ? 1119 ARG C NH1   1 
ATOM   6284 N  NH2   . ARG C  2 205 ? -46.539 -60.053 -88.838  1.00 52.72  ? 1119 ARG C NH2   1 
ATOM   6285 N  N     . ILE C  2 206 ? -51.587 -57.620 -84.901  1.00 62.45  ? 1120 ILE C N     1 
ATOM   6286 C  CA    . ILE C  2 206 ? -53.047 -57.632 -84.868  1.00 69.69  ? 1120 ILE C CA    1 
ATOM   6287 C  C     . ILE C  2 206 ? -53.538 -58.850 -85.639  1.00 76.37  ? 1120 ILE C C     1 
ATOM   6288 O  O     . ILE C  2 206 ? -53.095 -59.115 -86.766  1.00 76.54  ? 1120 ILE C O     1 
ATOM   6289 C  CB    . ILE C  2 206 ? -53.635 -56.329 -85.444  1.00 68.18  ? 1120 ILE C CB    1 
ATOM   6290 C  CG1   . ILE C  2 206 ? -53.275 -55.147 -84.550  1.00 66.22  ? 1120 ILE C CG1   1 
ATOM   6291 C  CG2   . ILE C  2 206 ? -55.138 -56.423 -85.576  1.00 66.80  ? 1120 ILE C CG2   1 
ATOM   6292 C  CD1   . ILE C  2 206 ? -52.592 -54.081 -85.246  1.00 65.31  ? 1120 ILE C CD1   1 
ATOM   6293 N  N     . LYS C  2 207 ? -54.450 -59.598 -85.031  1.00 76.14  ? 1121 LYS C N     1 
ATOM   6294 C  CA    . LYS C  2 207 ? -55.022 -60.772 -85.675  1.00 76.05  ? 1121 LYS C CA    1 
ATOM   6295 C  C     . LYS C  2 207 ? -56.419 -60.472 -86.208  1.00 75.46  ? 1121 LYS C C     1 
ATOM   6296 O  O     . LYS C  2 207 ? -56.696 -60.669 -87.393  1.00 74.87  ? 1121 LYS C O     1 
ATOM   6297 C  CB    . LYS C  2 207 ? -55.073 -61.952 -84.701  1.00 76.80  ? 1121 LYS C CB    1 
ATOM   6298 N  N     . MET D  2 6   ? -46.880 -14.090 -64.264  1.00 57.94  ? 920  MET D N     1 
ATOM   6299 C  CA    . MET D  2 6   ? -45.465 -13.829 -64.532  1.00 63.68  ? 920  MET D CA    1 
ATOM   6300 C  C     . MET D  2 6   ? -44.618 -15.105 -64.484  1.00 59.31  ? 920  MET D C     1 
ATOM   6301 O  O     . MET D  2 6   ? -44.536 -15.769 -63.453  1.00 61.56  ? 920  MET D O     1 
ATOM   6302 C  CB    . MET D  2 6   ? -44.915 -12.809 -63.537  1.00 69.46  ? 920  MET D CB    1 
ATOM   6303 C  CG    . MET D  2 6   ? -43.538 -12.285 -63.906  1.00 73.39  ? 920  MET D CG    1 
ATOM   6304 S  SD    . MET D  2 6   ? -43.136 -10.749 -63.048  1.00 77.43  ? 920  MET D SD    1 
ATOM   6305 C  CE    . MET D  2 6   ? -43.198 -11.279 -61.334  1.00 73.47  ? 920  MET D CE    1 
ATOM   6306 N  N     . ARG D  2 7   ? -43.977 -15.436 -65.600  1.00 48.91  ? 921  ARG D N     1 
ATOM   6307 C  CA    . ARG D  2 7   ? -43.262 -16.692 -65.745  1.00 45.87  ? 921  ARG D CA    1 
ATOM   6308 C  C     . ARG D  2 7   ? -41.794 -16.445 -66.068  1.00 46.43  ? 921  ARG D C     1 
ATOM   6309 O  O     . ARG D  2 7   ? -41.412 -15.384 -66.570  1.00 50.59  ? 921  ARG D O     1 
ATOM   6310 C  CB    . ARG D  2 7   ? -43.885 -17.561 -66.846  1.00 47.19  ? 921  ARG D CB    1 
ATOM   6311 C  CG    . ARG D  2 7   ? -45.395 -17.669 -66.790  1.00 58.30  ? 921  ARG D CG    1 
ATOM   6312 C  CD    . ARG D  2 7   ? -45.873 -18.405 -65.544  1.00 63.69  ? 921  ARG D CD    1 
ATOM   6313 N  NE    . ARG D  2 7   ? -45.268 -19.727 -65.395  1.00 68.78  ? 921  ARG D NE    1 
ATOM   6314 C  CZ    . ARG D  2 7   ? -45.629 -20.810 -66.083  1.00 72.36  ? 921  ARG D CZ    1 
ATOM   6315 N  NH1   . ARG D  2 7   ? -45.019 -21.970 -65.863  1.00 70.51  ? 921  ARG D NH1   1 
ATOM   6316 N  NH2   . ARG D  2 7   ? -46.590 -20.736 -66.995  1.00 71.76  ? 921  ARG D NH2   1 
ATOM   6317 N  N     . VAL D  2 8   ? -40.976 -17.449 -65.783  1.00 37.70  ? 922  VAL D N     1 
ATOM   6318 C  CA    . VAL D  2 8   ? -39.565 -17.405 -66.134  1.00 33.80  ? 922  VAL D CA    1 
ATOM   6319 C  C     . VAL D  2 8   ? -39.421 -17.651 -67.630  1.00 43.70  ? 922  VAL D C     1 
ATOM   6320 O  O     . VAL D  2 8   ? -40.012 -18.586 -68.182  1.00 43.24  ? 922  VAL D O     1 
ATOM   6321 C  CB    . VAL D  2 8   ? -38.771 -18.445 -65.330  1.00 35.49  ? 922  VAL D CB    1 
ATOM   6322 C  CG1   . VAL D  2 8   ? -37.400 -18.679 -65.958  1.00 34.35  ? 922  VAL D CG1   1 
ATOM   6323 C  CG2   . VAL D  2 8   ? -38.629 -18.008 -63.896  1.00 37.81  ? 922  VAL D CG2   1 
ATOM   6324 N  N     . LYS D  2 9   ? -38.634 -16.816 -68.292  1.00 38.40  ? 923  LYS D N     1 
ATOM   6325 C  CA    . LYS D  2 9   ? -38.273 -17.087 -69.669  1.00 40.65  ? 923  LYS D CA    1 
ATOM   6326 C  C     . LYS D  2 9   ? -36.817 -16.712 -69.863  1.00 40.11  ? 923  LYS D C     1 
ATOM   6327 O  O     . LYS D  2 9   ? -36.281 -15.842 -69.173  1.00 39.67  ? 923  LYS D O     1 
ATOM   6328 C  CB    . LYS D  2 9   ? -39.179 -16.341 -70.653  1.00 45.08  ? 923  LYS D CB    1 
ATOM   6329 C  CG    . LYS D  2 9   ? -39.297 -14.871 -70.391  1.00 50.67  ? 923  LYS D CG    1 
ATOM   6330 C  CD    . LYS D  2 9   ? -40.538 -14.552 -69.570  1.00 55.17  ? 923  LYS D CD    1 
ATOM   6331 C  CE    . LYS D  2 9   ? -40.631 -13.067 -69.276  1.00 58.46  ? 923  LYS D CE    1 
ATOM   6332 N  NZ    . LYS D  2 9   ? -41.753 -12.791 -68.339  1.00 64.35  ? 923  LYS D NZ    1 
ATOM   6333 N  N     . PHE D  2 10  ? -36.174 -17.401 -70.786  1.00 42.68  ? 924  PHE D N     1 
ATOM   6334 C  CA    . PHE D  2 10  ? -34.780 -17.140 -71.077  1.00 40.05  ? 924  PHE D CA    1 
ATOM   6335 C  C     . PHE D  2 10  ? -34.680 -16.231 -72.294  1.00 44.71  ? 924  PHE D C     1 
ATOM   6336 O  O     . PHE D  2 10  ? -35.606 -16.137 -73.104  1.00 46.27  ? 924  PHE D O     1 
ATOM   6337 C  CB    . PHE D  2 10  ? -34.023 -18.455 -71.281  1.00 34.55  ? 924  PHE D CB    1 
ATOM   6338 C  CG    . PHE D  2 10  ? -33.920 -19.289 -70.019  1.00 38.94  ? 924  PHE D CG    1 
ATOM   6339 C  CD1   . PHE D  2 10  ? -33.018 -18.947 -69.016  1.00 39.45  ? 924  PHE D CD1   1 
ATOM   6340 C  CD2   . PHE D  2 10  ? -34.752 -20.386 -69.820  1.00 38.17  ? 924  PHE D CD2   1 
ATOM   6341 C  CE1   . PHE D  2 10  ? -32.932 -19.694 -67.844  1.00 40.47  ? 924  PHE D CE1   1 
ATOM   6342 C  CE2   . PHE D  2 10  ? -34.665 -21.148 -68.660  1.00 38.54  ? 924  PHE D CE2   1 
ATOM   6343 C  CZ    . PHE D  2 10  ? -33.755 -20.802 -67.668  1.00 39.38  ? 924  PHE D CZ    1 
ATOM   6344 N  N     . ASN D  2 11  ? -33.560 -15.520 -72.377  1.00 47.80  ? 925  ASN D N     1 
ATOM   6345 C  CA    . ASN D  2 11  ? -33.294 -14.620 -73.489  1.00 49.66  ? 925  ASN D CA    1 
ATOM   6346 C  C     . ASN D  2 11  ? -33.497 -15.353 -74.817  1.00 44.13  ? 925  ASN D C     1 
ATOM   6347 O  O     . ASN D  2 11  ? -32.950 -16.449 -75.003  1.00 39.61  ? 925  ASN D O     1 
ATOM   6348 C  CB    . ASN D  2 11  ? -31.863 -14.085 -73.374  1.00 55.71  ? 925  ASN D CB    1 
ATOM   6349 C  CG    . ASN D  2 11  ? -31.364 -13.475 -74.652  1.00 65.02  ? 925  ASN D CG    1 
ATOM   6350 O  OD1   . ASN D  2 11  ? -32.066 -12.708 -75.301  1.00 74.55  ? 925  ASN D OD1   1 
ATOM   6351 N  ND2   . ASN D  2 11  ? -30.142 -13.821 -75.032  1.00 69.57  ? 925  ASN D ND2   1 
ATOM   6352 N  N     . PRO D  2 12  ? -34.294 -14.808 -75.739  1.00 44.16  ? 926  PRO D N     1 
ATOM   6353 C  CA    . PRO D  2 12  ? -34.577 -15.535 -76.991  1.00 47.21  ? 926  PRO D CA    1 
ATOM   6354 C  C     . PRO D  2 12  ? -33.338 -15.948 -77.770  1.00 49.34  ? 926  PRO D C     1 
ATOM   6355 O  O     . PRO D  2 12  ? -33.313 -17.044 -78.343  1.00 45.94  ? 926  PRO D O     1 
ATOM   6356 C  CB    . PRO D  2 12  ? -35.447 -14.543 -77.784  1.00 48.12  ? 926  PRO D CB    1 
ATOM   6357 C  CG    . PRO D  2 12  ? -35.417 -13.250 -77.006  1.00 45.84  ? 926  PRO D CG    1 
ATOM   6358 C  CD    . PRO D  2 12  ? -35.128 -13.604 -75.599  1.00 41.70  ? 926  PRO D CD    1 
ATOM   6359 N  N     . LEU D  2 13  ? -32.309 -15.102 -77.815  1.00 51.39  ? 927  LEU D N     1 
ATOM   6360 C  CA    . LEU D  2 13  ? -31.072 -15.504 -78.473  1.00 52.03  ? 927  LEU D CA    1 
ATOM   6361 C  C     . LEU D  2 13  ? -30.464 -16.713 -77.775  1.00 50.48  ? 927  LEU D C     1 
ATOM   6362 O  O     . LEU D  2 13  ? -30.012 -17.655 -78.431  1.00 47.09  ? 927  LEU D O     1 
ATOM   6363 C  CB    . LEU D  2 13  ? -30.090 -14.330 -78.513  1.00 46.05  ? 927  LEU D CB    1 
ATOM   6364 C  CG    . LEU D  2 13  ? -28.767 -14.416 -79.289  1.00 47.52  ? 927  LEU D CG    1 
ATOM   6365 C  CD1   . LEU D  2 13  ? -27.651 -14.963 -78.413  1.00 51.97  ? 927  LEU D CD1   1 
ATOM   6366 C  CD2   . LEU D  2 13  ? -28.923 -15.260 -80.554  1.00 42.51  ? 927  LEU D CD2   1 
ATOM   6367 N  N     . ALA D  2 14  ? -30.467 -16.712 -76.440  1.00 50.26  ? 928  ALA D N     1 
ATOM   6368 C  CA    . ALA D  2 14  ? -30.001 -17.876 -75.697  1.00 47.71  ? 928  ALA D CA    1 
ATOM   6369 C  C     . ALA D  2 14  ? -30.843 -19.109 -76.003  1.00 45.94  ? 928  ALA D C     1 
ATOM   6370 O  O     . ALA D  2 14  ? -30.320 -20.231 -76.019  1.00 40.33  ? 928  ALA D O     1 
ATOM   6371 C  CB    . ALA D  2 14  ? -30.007 -17.576 -74.196  1.00 44.05  ? 928  ALA D CB    1 
ATOM   6372 N  N     . LEU D  2 15  ? -32.140 -18.916 -76.258  1.00 46.40  ? 929  LEU D N     1 
ATOM   6373 C  CA    . LEU D  2 15  ? -33.017 -20.023 -76.627  1.00 43.93  ? 929  LEU D CA    1 
ATOM   6374 C  C     . LEU D  2 15  ? -32.720 -20.530 -78.040  1.00 43.98  ? 929  LEU D C     1 
ATOM   6375 O  O     . LEU D  2 15  ? -32.770 -21.740 -78.296  1.00 44.89  ? 929  LEU D O     1 
ATOM   6376 C  CB    . LEU D  2 15  ? -34.473 -19.574 -76.506  1.00 45.46  ? 929  LEU D CB    1 
ATOM   6377 C  CG    . LEU D  2 15  ? -35.410 -20.243 -75.495  1.00 46.59  ? 929  LEU D CG    1 
ATOM   6378 C  CD1   . LEU D  2 15  ? -34.644 -20.944 -74.373  1.00 38.54  ? 929  LEU D CD1   1 
ATOM   6379 C  CD2   . LEU D  2 15  ? -36.390 -19.231 -74.934  1.00 35.36  ? 929  LEU D CD2   1 
ATOM   6380 N  N     . LEU D  2 16  ? -32.420 -19.618 -78.969  1.00 41.73  ? 930  LEU D N     1 
ATOM   6381 C  CA    . LEU D  2 16  ? -32.082 -20.016 -80.335  1.00 41.68  ? 930  LEU D CA    1 
ATOM   6382 C  C     . LEU D  2 16  ? -30.805 -20.842 -80.368  1.00 35.41  ? 930  LEU D C     1 
ATOM   6383 O  O     . LEU D  2 16  ? -30.739 -21.870 -81.043  1.00 38.05  ? 930  LEU D O     1 
ATOM   6384 C  CB    . LEU D  2 16  ? -31.924 -18.774 -81.215  1.00 42.44  ? 930  LEU D CB    1 
ATOM   6385 C  CG    . LEU D  2 16  ? -32.412 -18.742 -82.670  1.00 47.37  ? 930  LEU D CG    1 
ATOM   6386 C  CD1   . LEU D  2 16  ? -31.424 -17.974 -83.546  1.00 42.73  ? 930  LEU D CD1   1 
ATOM   6387 C  CD2   . LEU D  2 16  ? -32.682 -20.115 -83.232  1.00 36.90  ? 930  LEU D CD2   1 
ATOM   6388 N  N     . LEU D  2 17  ? -29.778 -20.405 -79.643  1.00 50.24  ? 931  LEU D N     1 
ATOM   6389 C  CA    . LEU D  2 17  ? -28.519 -21.140 -79.606  1.00 46.77  ? 931  LEU D CA    1 
ATOM   6390 C  C     . LEU D  2 17  ? -28.702 -22.515 -78.980  1.00 45.87  ? 931  LEU D C     1 
ATOM   6391 O  O     . LEU D  2 17  ? -28.222 -23.523 -79.513  1.00 49.65  ? 931  LEU D O     1 
ATOM   6392 C  CB    . LEU D  2 17  ? -27.474 -20.343 -78.825  1.00 45.97  ? 931  LEU D CB    1 
ATOM   6393 C  CG    . LEU D  2 17  ? -26.937 -19.069 -79.486  1.00 51.38  ? 931  LEU D CG    1 
ATOM   6394 C  CD1   . LEU D  2 17  ? -26.118 -18.252 -78.495  1.00 53.71  ? 931  LEU D CD1   1 
ATOM   6395 C  CD2   . LEU D  2 17  ? -26.104 -19.432 -80.687  1.00 49.74  ? 931  LEU D CD2   1 
ATOM   6396 N  N     . ASP D  2 18  ? -29.390 -22.573 -77.841  1.00 46.33  ? 932  ASP D N     1 
ATOM   6397 C  CA    . ASP D  2 18  ? -29.500 -23.838 -77.125  1.00 45.99  ? 932  ASP D CA    1 
ATOM   6398 C  C     . ASP D  2 18  ? -30.403 -24.821 -77.855  1.00 38.93  ? 932  ASP D C     1 
ATOM   6399 O  O     . ASP D  2 18  ? -30.074 -26.004 -77.952  1.00 41.78  ? 932  ASP D O     1 
ATOM   6400 C  CB    . ASP D  2 18  ? -30.013 -23.608 -75.704  1.00 46.62  ? 932  ASP D CB    1 
ATOM   6401 C  CG    . ASP D  2 18  ? -29.925 -24.859 -74.851  1.00 46.97  ? 932  ASP D CG    1 
ATOM   6402 O  OD1   . ASP D  2 18  ? -28.792 -25.308 -74.587  1.00 46.19  ? 932  ASP D OD1   1 
ATOM   6403 O  OD2   . ASP D  2 18  ? -30.983 -25.390 -74.453  1.00 47.63  ? 932  ASP D OD2   1 
ATOM   6404 N  N     . SER D  2 19  ? -31.551 -24.359 -78.360  1.00 39.16  ? 933  SER D N     1 
ATOM   6405 C  CA    . SER D  2 19  ? -32.446 -25.261 -79.078  1.00 44.19  ? 933  SER D CA    1 
ATOM   6406 C  C     . SER D  2 19  ? -31.819 -25.759 -80.375  1.00 48.24  ? 933  SER D C     1 
ATOM   6407 O  O     . SER D  2 19  ? -32.061 -26.903 -80.782  1.00 47.15  ? 933  SER D O     1 
ATOM   6408 C  CB    . SER D  2 19  ? -33.776 -24.568 -79.365  1.00 47.33  ? 933  SER D CB    1 
ATOM   6409 O  OG    . SER D  2 19  ? -33.577 -23.352 -80.063  1.00 46.62  ? 933  SER D OG    1 
ATOM   6410 N  N     . SER D  2 20  ? -31.021 -24.918 -81.038  1.00 44.91  ? 934  SER D N     1 
ATOM   6411 C  CA    . SER D  2 20  ? -30.301 -25.368 -82.225  1.00 42.87  ? 934  SER D CA    1 
ATOM   6412 C  C     . SER D  2 20  ? -29.237 -26.389 -81.862  1.00 42.33  ? 934  SER D C     1 
ATOM   6413 O  O     . SER D  2 20  ? -28.965 -27.312 -82.636  1.00 44.51  ? 934  SER D O     1 
ATOM   6414 C  CB    . SER D  2 20  ? -29.657 -24.177 -82.942  1.00 39.33  ? 934  SER D CB    1 
ATOM   6415 O  OG    . SER D  2 20  ? -30.635 -23.330 -83.505  1.00 45.34  ? 934  SER D OG    1 
ATOM   6416 N  N     . LEU D  2 21  ? -28.608 -26.228 -80.695  1.00 45.30  ? 935  LEU D N     1 
ATOM   6417 C  CA    . LEU D  2 21  ? -27.600 -27.191 -80.271  1.00 44.01  ? 935  LEU D CA    1 
ATOM   6418 C  C     . LEU D  2 21  ? -28.235 -28.493 -79.807  1.00 45.78  ? 935  LEU D C     1 
ATOM   6419 O  O     . LEU D  2 21  ? -27.666 -29.568 -80.013  1.00 47.42  ? 935  LEU D O     1 
ATOM   6420 C  CB    . LEU D  2 21  ? -26.736 -26.594 -79.157  1.00 41.87  ? 935  LEU D CB    1 
ATOM   6421 C  CG    . LEU D  2 21  ? -25.795 -27.538 -78.402  1.00 44.26  ? 935  LEU D CG    1 
ATOM   6422 C  CD1   . LEU D  2 21  ? -24.682 -28.031 -79.308  1.00 46.64  ? 935  LEU D CD1   1 
ATOM   6423 C  CD2   . LEU D  2 21  ? -25.228 -26.857 -77.153  1.00 45.12  ? 935  LEU D CD2   1 
ATOM   6424 N  N     . GLU D  2 22  ? -29.416 -28.417 -79.206  1.00 50.12  ? 936  GLU D N     1 
ATOM   6425 C  CA    . GLU D  2 22  ? -30.052 -29.558 -78.572  1.00 51.97  ? 936  GLU D CA    1 
ATOM   6426 C  C     . GLU D  2 22  ? -30.988 -30.316 -79.500  1.00 52.05  ? 936  GLU D C     1 
ATOM   6427 O  O     . GLU D  2 22  ? -31.412 -31.424 -79.155  1.00 54.85  ? 936  GLU D O     1 
ATOM   6428 C  CB    . GLU D  2 22  ? -30.827 -29.097 -77.335  1.00 59.95  ? 936  GLU D CB    1 
ATOM   6429 C  CG    . GLU D  2 22  ? -29.958 -28.855 -76.110  1.00 71.83  ? 936  GLU D CG    1 
ATOM   6430 C  CD    . GLU D  2 22  ? -28.945 -29.965 -75.869  1.00 76.12  ? 936  GLU D CD    1 
ATOM   6431 O  OE1   . GLU D  2 22  ? -29.343 -31.151 -75.875  1.00 76.68  ? 936  GLU D OE1   1 
ATOM   6432 O  OE2   . GLU D  2 22  ? -27.752 -29.647 -75.665  1.00 78.08  ? 936  GLU D OE2   1 
ATOM   6433 N  N     . GLY D  2 23  ? -31.322 -29.756 -80.658  1.00 51.35  ? 937  GLY D N     1 
ATOM   6434 C  CA    . GLY D  2 23  ? -32.172 -30.444 -81.606  1.00 46.26  ? 937  GLY D CA    1 
ATOM   6435 C  C     . GLY D  2 23  ? -33.654 -30.229 -81.419  1.00 42.48  ? 937  GLY D C     1 
ATOM   6436 O  O     . GLY D  2 23  ? -34.446 -31.013 -81.952  1.00 47.04  ? 937  GLY D O     1 
ATOM   6437 N  N     . GLU D  2 24  ? -34.056 -29.194 -80.680  1.00 41.67  ? 938  GLU D N     1 
ATOM   6438 C  CA    . GLU D  2 24  ? -35.470 -28.873 -80.480  1.00 47.07  ? 938  GLU D CA    1 
ATOM   6439 C  C     . GLU D  2 24  ? -35.936 -28.001 -81.642  1.00 49.15  ? 938  GLU D C     1 
ATOM   6440 O  O     . GLU D  2 24  ? -36.073 -26.780 -81.537  1.00 45.41  ? 938  GLU D O     1 
ATOM   6441 C  CB    . GLU D  2 24  ? -35.688 -28.173 -79.140  1.00 48.60  ? 938  GLU D CB    1 
ATOM   6442 C  CG    . GLU D  2 24  ? -35.172 -28.939 -77.947  1.00 55.72  ? 938  GLU D CG    1 
ATOM   6443 C  CD    . GLU D  2 24  ? -35.223 -28.124 -76.665  1.00 66.74  ? 938  GLU D CD    1 
ATOM   6444 O  OE1   . GLU D  2 24  ? -36.016 -27.161 -76.599  1.00 68.34  ? 938  GLU D OE1   1 
ATOM   6445 O  OE2   . GLU D  2 24  ? -34.469 -28.451 -75.722  1.00 70.61  ? 938  GLU D OE2   1 
ATOM   6446 N  N     . PHE D  2 25  ? -36.197 -28.663 -82.771  1.00 49.90  ? 939  PHE D N     1 
ATOM   6447 C  CA    . PHE D  2 25  ? -36.582 -27.962 -83.990  1.00 47.19  ? 939  PHE D CA    1 
ATOM   6448 C  C     . PHE D  2 25  ? -37.873 -27.169 -83.810  1.00 49.93  ? 939  PHE D C     1 
ATOM   6449 O  O     . PHE D  2 25  ? -37.997 -26.059 -84.347  1.00 47.60  ? 939  PHE D O     1 
ATOM   6450 C  CB    . PHE D  2 25  ? -36.716 -28.973 -85.132  1.00 46.68  ? 939  PHE D CB    1 
ATOM   6451 C  CG    . PHE D  2 25  ? -37.058 -28.356 -86.453  1.00 51.57  ? 939  PHE D CG    1 
ATOM   6452 C  CD1   . PHE D  2 25  ? -36.388 -27.230 -86.899  1.00 54.08  ? 939  PHE D CD1   1 
ATOM   6453 C  CD2   . PHE D  2 25  ? -38.044 -28.908 -87.257  1.00 50.80  ? 939  PHE D CD2   1 
ATOM   6454 C  CE1   . PHE D  2 25  ? -36.697 -26.665 -88.118  1.00 56.07  ? 939  PHE D CE1   1 
ATOM   6455 C  CE2   . PHE D  2 25  ? -38.359 -28.343 -88.478  1.00 52.27  ? 939  PHE D CE2   1 
ATOM   6456 C  CZ    . PHE D  2 25  ? -37.687 -27.224 -88.908  1.00 54.69  ? 939  PHE D CZ    1 
ATOM   6457 N  N     . ASP D  2 26  ? -38.836 -27.714 -83.057  1.00 51.23  ? 940  ASP D N     1 
ATOM   6458 C  CA    . ASP D  2 26  ? -40.100 -27.015 -82.828  1.00 54.34  ? 940  ASP D CA    1 
ATOM   6459 C  C     . ASP D  2 26  ? -39.877 -25.656 -82.178  1.00 51.36  ? 940  ASP D C     1 
ATOM   6460 O  O     . ASP D  2 26  ? -40.517 -24.667 -82.558  1.00 51.64  ? 940  ASP D O     1 
ATOM   6461 C  CB    . ASP D  2 26  ? -41.037 -27.867 -81.965  1.00 64.13  ? 940  ASP D CB    1 
ATOM   6462 C  CG    . ASP D  2 26  ? -40.390 -28.337 -80.664  1.00 74.52  ? 940  ASP D CG    1 
ATOM   6463 O  OD1   . ASP D  2 26  ? -39.175 -28.121 -80.468  1.00 78.44  ? 940  ASP D OD1   1 
ATOM   6464 O  OD2   . ASP D  2 26  ? -41.104 -28.931 -79.827  1.00 79.92  ? 940  ASP D OD2   1 
ATOM   6465 N  N     . LEU D  2 27  ? -38.972 -25.583 -81.197  1.00 47.83  ? 941  LEU D N     1 
ATOM   6466 C  CA    . LEU D  2 27  ? -38.696 -24.304 -80.552  1.00 46.60  ? 941  LEU D CA    1 
ATOM   6467 C  C     . LEU D  2 27  ? -37.914 -23.377 -81.475  1.00 45.57  ? 941  LEU D C     1 
ATOM   6468 O  O     . LEU D  2 27  ? -38.155 -22.162 -81.492  1.00 43.57  ? 941  LEU D O     1 
ATOM   6469 C  CB    . LEU D  2 27  ? -37.941 -24.529 -79.246  1.00 47.36  ? 941  LEU D CB    1 
ATOM   6470 C  CG    . LEU D  2 27  ? -37.634 -23.272 -78.435  1.00 45.95  ? 941  LEU D CG    1 
ATOM   6471 C  CD1   . LEU D  2 27  ? -38.908 -22.676 -77.864  1.00 48.10  ? 941  LEU D CD1   1 
ATOM   6472 C  CD2   . LEU D  2 27  ? -36.656 -23.619 -77.329  1.00 41.45  ? 941  LEU D CD2   1 
ATOM   6473 N  N     . VAL D  2 28  ? -36.985 -23.931 -82.260  1.00 46.35  ? 942  VAL D N     1 
ATOM   6474 C  CA    . VAL D  2 28  ? -36.238 -23.110 -83.212  1.00 42.68  ? 942  VAL D CA    1 
ATOM   6475 C  C     . VAL D  2 28  ? -37.193 -22.346 -84.120  1.00 43.18  ? 942  VAL D C     1 
ATOM   6476 O  O     . VAL D  2 28  ? -37.014 -21.145 -84.360  1.00 50.02  ? 942  VAL D O     1 
ATOM   6477 C  CB    . VAL D  2 28  ? -35.252 -23.978 -84.016  1.00 44.10  ? 942  VAL D CB    1 
ATOM   6478 C  CG1   . VAL D  2 28  ? -34.569 -23.143 -85.089  1.00 47.94  ? 942  VAL D CG1   1 
ATOM   6479 C  CG2   . VAL D  2 28  ? -34.204 -24.589 -83.085  1.00 43.02  ? 942  VAL D CG2   1 
ATOM   6480 N  N     . GLN D  2 29  ? -38.248 -23.011 -84.601  1.00 47.18  ? 943  GLN D N     1 
ATOM   6481 C  CA    . GLN D  2 29  ? -39.173 -22.365 -85.531  1.00 54.58  ? 943  GLN D CA    1 
ATOM   6482 C  C     . GLN D  2 29  ? -39.945 -21.232 -84.871  1.00 58.87  ? 943  GLN D C     1 
ATOM   6483 O  O     . GLN D  2 29  ? -40.278 -20.243 -85.535  1.00 60.47  ? 943  GLN D O     1 
ATOM   6484 C  CB    . GLN D  2 29  ? -40.153 -23.388 -86.104  1.00 57.70  ? 943  GLN D CB    1 
ATOM   6485 C  CG    . GLN D  2 29  ? -39.495 -24.525 -86.850  1.00 62.43  ? 943  GLN D CG    1 
ATOM   6486 C  CD    . GLN D  2 29  ? -40.505 -25.530 -87.366  1.00 63.06  ? 943  GLN D CD    1 
ATOM   6487 O  OE1   . GLN D  2 29  ? -40.633 -26.631 -86.824  1.00 59.25  ? 943  GLN D OE1   1 
ATOM   6488 N  NE2   . GLN D  2 29  ? -41.232 -25.155 -88.419  1.00 60.92  ? 943  GLN D NE2   1 
ATOM   6489 N  N     . ARG D  2 30  ? -40.254 -21.361 -83.581  1.00 57.66  ? 944  ARG D N     1 
ATOM   6490 C  CA    . ARG D  2 30  ? -40.976 -20.306 -82.879  1.00 54.68  ? 944  ARG D CA    1 
ATOM   6491 C  C     . ARG D  2 30  ? -40.043 -19.177 -82.466  1.00 51.69  ? 944  ARG D C     1 
ATOM   6492 O  O     . ARG D  2 30  ? -40.286 -18.010 -82.790  1.00 54.48  ? 944  ARG D O     1 
ATOM   6493 C  CB    . ARG D  2 30  ? -41.682 -20.882 -81.648  1.00 52.12  ? 944  ARG D CB    1 
ATOM   6494 N  N     . ILE D  2 31  ? -38.960 -19.511 -81.761  1.00 52.44  ? 945  ILE D N     1 
ATOM   6495 C  CA    . ILE D  2 31  ? -38.157 -18.486 -81.109  1.00 51.34  ? 945  ILE D CA    1 
ATOM   6496 C  C     . ILE D  2 31  ? -37.389 -17.624 -82.102  1.00 48.84  ? 945  ILE D C     1 
ATOM   6497 O  O     . ILE D  2 31  ? -36.972 -16.512 -81.753  1.00 50.24  ? 945  ILE D O     1 
ATOM   6498 C  CB    . ILE D  2 31  ? -37.205 -19.135 -80.090  1.00 49.40  ? 945  ILE D CB    1 
ATOM   6499 C  CG1   . ILE D  2 31  ? -36.771 -18.110 -79.041  1.00 45.65  ? 945  ILE D CG1   1 
ATOM   6500 C  CG2   . ILE D  2 31  ? -35.996 -19.719 -80.789  1.00 56.19  ? 945  ILE D CG2   1 
ATOM   6501 C  CD1   . ILE D  2 31  ? -37.898 -17.636 -78.170  1.00 45.88  ? 945  ILE D CD1   1 
ATOM   6502 N  N     . ILE D  2 32  ? -37.200 -18.091 -83.339  1.00 42.84  ? 946  ILE D N     1 
ATOM   6503 C  CA    . ILE D  2 32  ? -36.416 -17.315 -84.285  1.00 44.84  ? 946  ILE D CA    1 
ATOM   6504 C  C     . ILE D  2 32  ? -37.109 -16.008 -84.665  1.00 53.50  ? 946  ILE D C     1 
ATOM   6505 O  O     . ILE D  2 32  ? -36.434 -15.028 -85.002  1.00 49.83  ? 946  ILE D O     1 
ATOM   6506 C  CB    . ILE D  2 32  ? -36.089 -18.156 -85.535  1.00 47.03  ? 946  ILE D CB    1 
ATOM   6507 C  CG1   . ILE D  2 32  ? -34.958 -17.487 -86.321  1.00 46.54  ? 946  ILE D CG1   1 
ATOM   6508 C  CG2   . ILE D  2 32  ? -37.339 -18.381 -86.397  1.00 39.37  ? 946  ILE D CG2   1 
ATOM   6509 C  CD1   . ILE D  2 32  ? -34.328 -18.360 -87.364  1.00 48.88  ? 946  ILE D CD1   1 
ATOM   6510 N  N     . TYR D  2 33  ? -38.439 -15.956 -84.603  1.00 58.76  ? 947  TYR D N     1 
ATOM   6511 C  CA    . TYR D  2 33  ? -39.154 -14.715 -84.876  1.00 59.83  ? 947  TYR D CA    1 
ATOM   6512 C  C     . TYR D  2 33  ? -39.160 -13.762 -83.689  1.00 57.57  ? 947  TYR D C     1 
ATOM   6513 O  O     . TYR D  2 33  ? -39.796 -12.710 -83.767  1.00 61.28  ? 947  TYR D O     1 
ATOM   6514 C  CB    . TYR D  2 33  ? -40.593 -15.014 -85.297  1.00 61.78  ? 947  TYR D CB    1 
ATOM   6515 C  CG    . TYR D  2 33  ? -40.695 -15.817 -86.569  1.00 65.01  ? 947  TYR D CG    1 
ATOM   6516 C  CD1   . TYR D  2 33  ? -40.681 -15.196 -87.810  1.00 66.26  ? 947  TYR D CD1   1 
ATOM   6517 C  CD2   . TYR D  2 33  ? -40.800 -17.203 -86.527  1.00 66.63  ? 947  TYR D CD2   1 
ATOM   6518 C  CE1   . TYR D  2 33  ? -40.772 -15.935 -88.974  1.00 68.18  ? 947  TYR D CE1   1 
ATOM   6519 C  CE2   . TYR D  2 33  ? -40.893 -17.949 -87.681  1.00 67.15  ? 947  TYR D CE2   1 
ATOM   6520 C  CZ    . TYR D  2 33  ? -40.877 -17.312 -88.904  1.00 71.35  ? 947  TYR D CZ    1 
ATOM   6521 O  OH    . TYR D  2 33  ? -40.967 -18.062 -90.056  1.00 73.91  ? 947  TYR D OH    1 
ATOM   6522 N  N     . GLU D  2 34  ? -38.487 -14.099 -82.594  1.00 58.80  ? 948  GLU D N     1 
ATOM   6523 C  CA    . GLU D  2 34  ? -38.342 -13.193 -81.462  1.00 59.39  ? 948  GLU D CA    1 
ATOM   6524 C  C     . GLU D  2 34  ? -36.912 -12.705 -81.286  1.00 53.33  ? 948  GLU D C     1 
ATOM   6525 O  O     . GLU D  2 34  ? -36.650 -11.899 -80.388  1.00 47.21  ? 948  GLU D O     1 
ATOM   6526 C  CB    . GLU D  2 34  ? -38.829 -13.865 -80.170  1.00 60.66  ? 948  GLU D CB    1 
ATOM   6527 C  CG    . GLU D  2 34  ? -40.103 -14.675 -80.347  1.00 71.32  ? 948  GLU D CG    1 
ATOM   6528 C  CD    . GLU D  2 34  ? -40.948 -14.737 -79.088  1.00 82.67  ? 948  GLU D CD    1 
ATOM   6529 O  OE1   . GLU D  2 34  ? -40.380 -14.903 -77.984  1.00 85.27  ? 948  GLU D OE1   1 
ATOM   6530 O  OE2   . GLU D  2 34  ? -42.189 -14.623 -79.205  1.00 87.09  ? 948  GLU D OE2   1 
ATOM   6531 N  N     . VAL D  2 35  ? -35.987 -13.167 -82.109  1.00 57.40  ? 949  VAL D N     1 
ATOM   6532 C  CA    . VAL D  2 35  ? -34.615 -12.685 -82.066  1.00 62.30  ? 949  VAL D CA    1 
ATOM   6533 C  C     . VAL D  2 35  ? -34.467 -11.567 -83.085  1.00 62.92  ? 949  VAL D C     1 
ATOM   6534 O  O     . VAL D  2 35  ? -35.052 -11.610 -84.174  1.00 63.91  ? 949  VAL D O     1 
ATOM   6535 C  CB    . VAL D  2 35  ? -33.613 -13.830 -82.323  1.00 60.53  ? 949  VAL D CB    1 
ATOM   6536 C  CG1   . VAL D  2 35  ? -33.897 -15.004 -81.391  1.00 56.17  ? 949  VAL D CG1   1 
ATOM   6537 C  CG2   . VAL D  2 35  ? -33.648 -14.276 -83.775  1.00 59.00  ? 949  VAL D CG2   1 
ATOM   6538 N  N     . ASP D  2 36  ? -33.704 -10.540 -82.719  1.00 65.71  ? 950  ASP D N     1 
ATOM   6539 C  CA    . ASP D  2 36  ? -33.473 -9.432  -83.635  1.00 72.09  ? 950  ASP D CA    1 
ATOM   6540 C  C     . ASP D  2 36  ? -32.661 -9.888  -84.841  1.00 73.14  ? 950  ASP D C     1 
ATOM   6541 O  O     . ASP D  2 36  ? -33.086 -9.734  -85.993  1.00 68.21  ? 950  ASP D O     1 
ATOM   6542 C  CB    . ASP D  2 36  ? -32.774 -8.292  -82.894  1.00 80.00  ? 950  ASP D CB    1 
ATOM   6543 C  CG    . ASP D  2 36  ? -33.540 -7.849  -81.659  1.00 86.24  ? 950  ASP D CG    1 
ATOM   6544 O  OD1   . ASP D  2 36  ? -34.776 -8.043  -81.630  1.00 88.65  ? 950  ASP D OD1   1 
ATOM   6545 O  OD2   . ASP D  2 36  ? -32.912 -7.310  -80.720  1.00 86.15  ? 950  ASP D OD2   1 
ATOM   6546 N  N     . ASP D  2 37  ? -31.495 -10.473 -84.592  1.00 74.34  ? 951  ASP D N     1 
ATOM   6547 C  CA    . ASP D  2 37  ? -30.630 -10.988 -85.650  1.00 69.19  ? 951  ASP D CA    1 
ATOM   6548 C  C     . ASP D  2 37  ? -30.291 -12.443 -85.346  1.00 57.91  ? 951  ASP D C     1 
ATOM   6549 O  O     . ASP D  2 37  ? -29.441 -12.710 -84.483  1.00 54.82  ? 951  ASP D O     1 
ATOM   6550 C  CB    . ASP D  2 37  ? -29.356 -10.154 -85.768  1.00 71.74  ? 951  ASP D CB    1 
ATOM   6551 C  CG    . ASP D  2 37  ? -28.419 -10.671 -86.842  1.00 76.11  ? 951  ASP D CG    1 
ATOM   6552 O  OD1   . ASP D  2 37  ? -28.886 -11.403 -87.743  1.00 77.52  ? 951  ASP D OD1   1 
ATOM   6553 O  OD2   . ASP D  2 37  ? -27.211 -10.350 -86.779  1.00 78.68  ? 951  ASP D OD2   1 
ATOM   6554 N  N     . PRO D  2 38  ? -30.916 -13.401 -86.045  1.00 56.31  ? 952  PRO D N     1 
ATOM   6555 C  CA    . PRO D  2 38  ? -30.588 -14.818 -85.798  1.00 55.38  ? 952  PRO D CA    1 
ATOM   6556 C  C     . PRO D  2 38  ? -29.156 -15.190 -86.148  1.00 56.21  ? 952  PRO D C     1 
ATOM   6557 O  O     . PRO D  2 38  ? -28.724 -16.292 -85.778  1.00 56.95  ? 952  PRO D O     1 
ATOM   6558 C  CB    . PRO D  2 38  ? -31.590 -15.570 -86.685  1.00 54.38  ? 952  PRO D CB    1 
ATOM   6559 C  CG    . PRO D  2 38  ? -31.992 -14.570 -87.734  1.00 54.83  ? 952  PRO D CG    1 
ATOM   6560 C  CD    . PRO D  2 38  ? -31.956 -13.231 -87.068  1.00 54.48  ? 952  PRO D CD    1 
ATOM   6561 N  N     . SER D  2 39  ? -28.417 -14.321 -86.849  1.00 52.94  ? 953  SER D N     1 
ATOM   6562 C  CA    . SER D  2 39  ? -26.998 -14.511 -87.130  1.00 50.98  ? 953  SER D CA    1 
ATOM   6563 C  C     . SER D  2 39  ? -26.095 -13.994 -86.020  1.00 55.94  ? 953  SER D C     1 
ATOM   6564 O  O     . SER D  2 39  ? -24.874 -14.146 -86.118  1.00 59.65  ? 953  SER D O     1 
ATOM   6565 C  CB    . SER D  2 39  ? -26.606 -13.816 -88.446  1.00 52.98  ? 953  SER D CB    1 
ATOM   6566 O  OG    . SER D  2 39  ? -27.166 -14.458 -89.581  1.00 55.35  ? 953  SER D OG    1 
ATOM   6567 N  N     . LEU D  2 40  ? -26.654 -13.385 -84.981  1.00 59.67  ? 954  LEU D N     1 
ATOM   6568 C  CA    . LEU D  2 40  ? -25.830 -12.795 -83.933  1.00 61.02  ? 954  LEU D CA    1 
ATOM   6569 C  C     . LEU D  2 40  ? -25.169 -13.894 -83.114  1.00 59.65  ? 954  LEU D C     1 
ATOM   6570 O  O     . LEU D  2 40  ? -25.847 -14.835 -82.686  1.00 55.52  ? 954  LEU D O     1 
ATOM   6571 C  CB    . LEU D  2 40  ? -26.667 -11.896 -83.029  1.00 63.89  ? 954  LEU D CB    1 
ATOM   6572 C  CG    . LEU D  2 40  ? -26.515 -10.393 -83.281  1.00 67.49  ? 954  LEU D CG    1 
ATOM   6573 C  CD1   . LEU D  2 40  ? -27.575 -9.613  -82.523  1.00 67.21  ? 954  LEU D CD1   1 
ATOM   6574 C  CD2   . LEU D  2 40  ? -25.112 -9.912  -82.910  1.00 66.91  ? 954  LEU D CD2   1 
ATOM   6575 N  N     . PRO D  2 41  ? -23.865 -13.822 -82.883  1.00 63.79  ? 955  PRO D N     1 
ATOM   6576 C  CA    . PRO D  2 41  ? -23.187 -14.901 -82.155  1.00 64.24  ? 955  PRO D CA    1 
ATOM   6577 C  C     . PRO D  2 41  ? -23.207 -14.697 -80.649  1.00 70.03  ? 955  PRO D C     1 
ATOM   6578 O  O     . PRO D  2 41  ? -23.761 -13.712 -80.152  1.00 69.29  ? 955  PRO D O     1 
ATOM   6579 C  CB    . PRO D  2 41  ? -21.763 -14.839 -82.713  1.00 60.31  ? 955  PRO D CB    1 
ATOM   6580 C  CG    . PRO D  2 41  ? -21.566 -13.382 -83.011  1.00 62.59  ? 955  PRO D CG    1 
ATOM   6581 C  CD    . PRO D  2 41  ? -22.915 -12.827 -83.411  1.00 62.69  ? 955  PRO D CD    1 
ATOM   6582 N  N     . ASN D  2 42  ? -22.613 -15.630 -79.913  1.00 74.16  ? 956  ASN D N     1 
ATOM   6583 C  CA    . ASN D  2 42  ? -22.456 -15.485 -78.475  1.00 75.42  ? 956  ASN D CA    1 
ATOM   6584 C  C     . ASN D  2 42  ? -21.132 -14.767 -78.200  1.00 82.93  ? 956  ASN D C     1 
ATOM   6585 O  O     . ASN D  2 42  ? -20.605 -14.061 -79.065  1.00 80.55  ? 956  ASN D O     1 
ATOM   6586 C  CB    . ASN D  2 42  ? -22.561 -16.855 -77.793  1.00 69.25  ? 956  ASN D CB    1 
ATOM   6587 C  CG    . ASN D  2 42  ? -21.511 -17.840 -78.278  1.00 70.57  ? 956  ASN D CG    1 
ATOM   6588 O  OD1   . ASN D  2 42  ? -20.573 -17.478 -78.987  1.00 71.52  ? 956  ASN D OD1   1 
ATOM   6589 N  ND2   . ASN D  2 42  ? -21.666 -19.101 -77.889  1.00 67.83  ? 956  ASN D ND2   1 
ATOM   6590 N  N     . ASP D  2 43  ? -20.573 -14.949 -77.006  1.00 88.65  ? 957  ASP D N     1 
ATOM   6591 C  CA    . ASP D  2 43  ? -19.343 -14.272 -76.618  1.00 91.07  ? 957  ASP D CA    1 
ATOM   6592 C  C     . ASP D  2 43  ? -18.092 -14.948 -77.162  1.00 90.08  ? 957  ASP D C     1 
ATOM   6593 O  O     . ASP D  2 43  ? -16.986 -14.565 -76.768  1.00 93.21  ? 957  ASP D O     1 
ATOM   6594 C  CB    . ASP D  2 43  ? -19.263 -14.171 -75.094  1.00 94.40  ? 957  ASP D CB    1 
ATOM   6595 C  CG    . ASP D  2 43  ? -20.388 -13.342 -74.511  1.00 97.94  ? 957  ASP D CG    1 
ATOM   6596 O  OD1   . ASP D  2 43  ? -20.541 -12.174 -74.922  1.00 99.67  ? 957  ASP D OD1   1 
ATOM   6597 O  OD2   . ASP D  2 43  ? -21.129 -13.857 -73.649  1.00 99.57  ? 957  ASP D OD2   1 
ATOM   6598 N  N     . GLU D  2 44  ? -18.240 -15.936 -78.051  1.00 84.70  ? 958  GLU D N     1 
ATOM   6599 C  CA    . GLU D  2 44  ? -17.103 -16.601 -78.675  1.00 80.02  ? 958  GLU D CA    1 
ATOM   6600 C  C     . GLU D  2 44  ? -17.233 -16.686 -80.192  1.00 72.65  ? 958  GLU D C     1 
ATOM   6601 O  O     . GLU D  2 44  ? -16.417 -17.358 -80.834  1.00 73.07  ? 958  GLU D O     1 
ATOM   6602 C  CB    . GLU D  2 44  ? -16.914 -18.011 -78.098  1.00 84.14  ? 958  GLU D CB    1 
ATOM   6603 C  CG    . GLU D  2 44  ? -16.280 -18.044 -76.714  1.00 87.03  ? 958  GLU D CG    1 
ATOM   6604 C  CD    . GLU D  2 44  ? -14.804 -17.691 -76.737  1.00 89.75  ? 958  GLU D CD    1 
ATOM   6605 O  OE1   . GLU D  2 44  ? -14.184 -17.774 -77.822  1.00 90.46  ? 958  GLU D OE1   1 
ATOM   6606 O  OE2   . GLU D  2 44  ? -14.264 -17.329 -75.670  1.00 89.09  ? 958  GLU D OE2   1 
ATOM   6607 N  N     . GLY D  2 45  ? -18.231 -16.031 -80.784  1.00 65.45  ? 959  GLY D N     1 
ATOM   6608 C  CA    . GLY D  2 45  ? -18.447 -16.100 -82.214  1.00 60.74  ? 959  GLY D CA    1 
ATOM   6609 C  C     . GLY D  2 45  ? -19.308 -17.254 -82.683  1.00 57.81  ? 959  GLY D C     1 
ATOM   6610 O  O     . GLY D  2 45  ? -19.487 -17.417 -83.895  1.00 60.10  ? 959  GLY D O     1 
ATOM   6611 N  N     . ILE D  2 46  ? -19.853 -18.049 -81.770  1.00 54.60  ? 960  ILE D N     1 
ATOM   6612 C  CA    . ILE D  2 46  ? -20.675 -19.199 -82.131  1.00 56.92  ? 960  ILE D CA    1 
ATOM   6613 C  C     . ILE D  2 46  ? -22.099 -18.731 -82.399  1.00 53.88  ? 960  ILE D C     1 
ATOM   6614 O  O     . ILE D  2 46  ? -22.704 -18.043 -81.568  1.00 51.81  ? 960  ILE D O     1 
ATOM   6615 C  CB    . ILE D  2 46  ? -20.640 -20.259 -81.014  1.00 57.95  ? 960  ILE D CB    1 
ATOM   6616 C  CG1   . ILE D  2 46  ? -19.209 -20.765 -80.806  1.00 58.85  ? 960  ILE D CG1   1 
ATOM   6617 C  CG2   . ILE D  2 46  ? -21.594 -21.407 -81.315  1.00 49.44  ? 960  ILE D CG2   1 
ATOM   6618 C  CD1   . ILE D  2 46  ? -18.574 -21.306 -82.055  1.00 58.09  ? 960  ILE D CD1   1 
ATOM   6619 N  N     . THR D  2 47  ? -22.642 -19.108 -83.556  1.00 50.43  ? 961  THR D N     1 
ATOM   6620 C  CA    . THR D  2 47  ? -24.009 -18.767 -83.924  1.00 44.96  ? 961  THR D CA    1 
ATOM   6621 C  C     . THR D  2 47  ? -24.903 -19.998 -83.834  1.00 44.68  ? 961  THR D C     1 
ATOM   6622 O  O     . THR D  2 47  ? -24.439 -21.121 -83.628  1.00 47.48  ? 961  THR D O     1 
ATOM   6623 C  CB    . THR D  2 47  ? -24.062 -18.173 -85.335  1.00 43.87  ? 961  THR D CB    1 
ATOM   6624 O  OG1   . THR D  2 47  ? -23.800 -19.201 -86.297  1.00 43.98  ? 961  THR D OG1   1 
ATOM   6625 C  CG2   . THR D  2 47  ? -23.026 -17.073 -85.475  1.00 42.92  ? 961  THR D CG2   1 
ATOM   6626 N  N     . ALA D  2 48  ? -26.208 -19.766 -83.999  1.00 44.18  ? 962  ALA D N     1 
ATOM   6627 C  CA    . ALA D  2 48  ? -27.168 -20.865 -83.996  1.00 42.15  ? 962  ALA D CA    1 
ATOM   6628 C  C     . ALA D  2 48  ? -26.848 -21.887 -85.080  1.00 47.94  ? 962  ALA D C     1 
ATOM   6629 O  O     . ALA D  2 48  ? -26.984 -23.098 -84.854  1.00 48.13  ? 962  ALA D O     1 
ATOM   6630 C  CB    . ALA D  2 48  ? -28.586 -20.327 -84.178  1.00 40.64  ? 962  ALA D CB    1 
ATOM   6631 N  N     . LEU D  2 49  ? -26.431 -21.414 -86.269  1.00 40.64  ? 963  LEU D N     1 
ATOM   6632 C  CA    . LEU D  2 49  ? -26.068 -22.318 -87.359  1.00 40.44  ? 963  LEU D CA    1 
ATOM   6633 C  C     . LEU D  2 49  ? -24.849 -23.159 -86.998  1.00 48.11  ? 963  LEU D C     1 
ATOM   6634 O  O     . LEU D  2 49  ? -24.789 -24.347 -87.338  1.00 48.52  ? 963  LEU D O     1 
ATOM   6635 C  CB    . LEU D  2 49  ? -25.810 -21.525 -88.652  1.00 40.85  ? 963  LEU D CB    1 
ATOM   6636 C  CG    . LEU D  2 49  ? -25.413 -22.338 -89.895  1.00 40.70  ? 963  LEU D CG    1 
ATOM   6637 C  CD1   . LEU D  2 49  ? -26.378 -23.492 -90.124  1.00 40.63  ? 963  LEU D CD1   1 
ATOM   6638 C  CD2   . LEU D  2 49  ? -25.329 -21.475 -91.147  1.00 41.12  ? 963  LEU D CD2   1 
ATOM   6639 N  N     . HIS D  2 50  ? -23.866 -22.558 -86.316  1.00 46.83  ? 964  HIS D N     1 
ATOM   6640 C  CA    . HIS D  2 50  ? -22.725 -23.322 -85.819  1.00 49.28  ? 964  HIS D CA    1 
ATOM   6641 C  C     . HIS D  2 50  ? -23.183 -24.497 -84.966  1.00 48.94  ? 964  HIS D C     1 
ATOM   6642 O  O     . HIS D  2 50  ? -22.772 -25.640 -85.197  1.00 49.94  ? 964  HIS D O     1 
ATOM   6643 C  CB    . HIS D  2 50  ? -21.793 -22.425 -85.004  1.00 48.16  ? 964  HIS D CB    1 
ATOM   6644 C  CG    . HIS D  2 50  ? -20.946 -21.515 -85.831  1.00 47.34  ? 964  HIS D CG    1 
ATOM   6645 N  ND1   . HIS D  2 50  ? -21.281 -20.198 -86.061  1.00 47.71  ? 964  HIS D ND1   1 
ATOM   6646 C  CD2   . HIS D  2 50  ? -19.771 -21.723 -86.471  1.00 47.63  ? 964  HIS D CD2   1 
ATOM   6647 C  CE1   . HIS D  2 50  ? -20.349 -19.633 -86.806  1.00 48.12  ? 964  HIS D CE1   1 
ATOM   6648 N  NE2   . HIS D  2 50  ? -19.423 -20.538 -87.072  1.00 49.26  ? 964  HIS D NE2   1 
ATOM   6649 N  N     . ASN D  2 51  ? -24.041 -24.231 -83.970  1.00 43.85  ? 965  ASN D N     1 
ATOM   6650 C  CA    . ASN D  2 51  ? -24.488 -25.294 -83.071  1.00 40.51  ? 965  ASN D CA    1 
ATOM   6651 C  C     . ASN D  2 51  ? -25.239 -26.383 -83.827  1.00 42.39  ? 965  ASN D C     1 
ATOM   6652 O  O     . ASN D  2 51  ? -25.008 -27.579 -83.601  1.00 41.32  ? 965  ASN D O     1 
ATOM   6653 C  CB    . ASN D  2 51  ? -25.375 -24.729 -81.962  1.00 39.29  ? 965  ASN D CB    1 
ATOM   6654 C  CG    . ASN D  2 51  ? -24.603 -23.902 -80.954  1.00 47.23  ? 965  ASN D CG    1 
ATOM   6655 O  OD1   . ASN D  2 51  ? -23.385 -24.012 -80.842  1.00 46.08  ? 965  ASN D OD1   1 
ATOM   6656 N  ND2   . ASN D  2 51  ? -25.316 -23.071 -80.208  1.00 45.85  ? 965  ASN D ND2   1 
ATOM   6657 N  N     . ALA D  2 52  ? -26.153 -25.989 -84.720  1.00 40.28  ? 966  ALA D N     1 
ATOM   6658 C  CA    . ALA D  2 52  ? -26.917 -26.974 -85.484  1.00 40.98  ? 966  ALA D CA    1 
ATOM   6659 C  C     . ALA D  2 52  ? -26.004 -27.862 -86.315  1.00 45.16  ? 966  ALA D C     1 
ATOM   6660 O  O     . ALA D  2 52  ? -26.251 -29.066 -86.437  1.00 45.65  ? 966  ALA D O     1 
ATOM   6661 C  CB    . ALA D  2 52  ? -27.942 -26.277 -86.387  1.00 38.73  ? 966  ALA D CB    1 
ATOM   6662 N  N     . VAL D  2 53  ? -24.946 -27.287 -86.901  1.00 47.11  ? 967  VAL D N     1 
ATOM   6663 C  CA    . VAL D  2 53  ? -24.052 -28.072 -87.754  1.00 45.73  ? 967  VAL D CA    1 
ATOM   6664 C  C     . VAL D  2 53  ? -23.210 -29.023 -86.911  1.00 48.18  ? 967  VAL D C     1 
ATOM   6665 O  O     . VAL D  2 53  ? -23.113 -30.220 -87.209  1.00 46.92  ? 967  VAL D O     1 
ATOM   6666 C  CB    . VAL D  2 53  ? -23.162 -27.154 -88.612  1.00 47.70  ? 967  VAL D CB    1 
ATOM   6667 C  CG1   . VAL D  2 53  ? -21.986 -27.939 -89.161  1.00 45.25  ? 967  VAL D CG1   1 
ATOM   6668 C  CG2   . VAL D  2 53  ? -23.962 -26.523 -89.757  1.00 39.38  ? 967  VAL D CG2   1 
ATOM   6669 N  N     . CYS D  2 54  ? -22.602 -28.505 -85.835  1.00 45.89  ? 968  CYS D N     1 
ATOM   6670 C  CA    . CYS D  2 54  ? -21.763 -29.336 -84.977  1.00 51.91  ? 968  CYS D CA    1 
ATOM   6671 C  C     . CYS D  2 54  ? -22.547 -30.478 -84.341  1.00 56.51  ? 968  CYS D C     1 
ATOM   6672 O  O     . CYS D  2 54  ? -21.995 -31.567 -84.134  1.00 54.81  ? 968  CYS D O     1 
ATOM   6673 C  CB    . CYS D  2 54  ? -21.117 -28.485 -83.883  1.00 55.30  ? 968  CYS D CB    1 
ATOM   6674 S  SG    . CYS D  2 54  ? -19.967 -27.237 -84.486  1.00 62.07  ? 968  CYS D SG    1 
ATOM   6675 N  N     . ALA D  2 55  ? -23.816 -30.254 -84.008  1.00 54.17  ? 969  ALA D N     1 
ATOM   6676 C  CA    . ALA D  2 55  ? -24.609 -31.286 -83.357  1.00 52.47  ? 969  ALA D CA    1 
ATOM   6677 C  C     . ALA D  2 55  ? -25.317 -32.198 -84.348  1.00 52.56  ? 969  ALA D C     1 
ATOM   6678 O  O     . ALA D  2 55  ? -26.007 -33.129 -83.919  1.00 51.89  ? 969  ALA D O     1 
ATOM   6679 C  CB    . ALA D  2 55  ? -25.630 -30.656 -82.399  1.00 48.57  ? 969  ALA D CB    1 
ATOM   6680 N  N     . GLY D  2 56  ? -25.174 -31.952 -85.651  1.00 49.15  ? 970  GLY D N     1 
ATOM   6681 C  CA    . GLY D  2 56  ? -25.727 -32.851 -86.643  1.00 47.99  ? 970  GLY D CA    1 
ATOM   6682 C  C     . GLY D  2 56  ? -27.223 -32.765 -86.868  1.00 53.43  ? 970  GLY D C     1 
ATOM   6683 O  O     . GLY D  2 56  ? -27.803 -33.692 -87.443  1.00 56.30  ? 970  GLY D O     1 
ATOM   6684 N  N     . HIS D  2 57  ? -27.870 -31.677 -86.453  1.00 47.56  ? 971  HIS D N     1 
ATOM   6685 C  CA    . HIS D  2 57  ? -29.317 -31.540 -86.626  1.00 46.19  ? 971  HIS D CA    1 
ATOM   6686 C  C     . HIS D  2 57  ? -29.581 -30.958 -88.010  1.00 51.92  ? 971  HIS D C     1 
ATOM   6687 O  O     . HIS D  2 57  ? -29.751 -29.745 -88.187  1.00 51.16  ? 971  HIS D O     1 
ATOM   6688 C  CB    . HIS D  2 57  ? -29.908 -30.691 -85.512  1.00 43.95  ? 971  HIS D CB    1 
ATOM   6689 C  CG    . HIS D  2 57  ? -29.606 -31.218 -84.144  1.00 47.92  ? 971  HIS D CG    1 
ATOM   6690 N  ND1   . HIS D  2 57  ? -29.908 -32.506 -83.761  1.00 46.00  ? 971  HIS D ND1   1 
ATOM   6691 C  CD2   . HIS D  2 57  ? -28.998 -30.641 -83.081  1.00 49.96  ? 971  HIS D CD2   1 
ATOM   6692 C  CE1   . HIS D  2 57  ? -29.516 -32.694 -82.515  1.00 49.05  ? 971  HIS D CE1   1 
ATOM   6693 N  NE2   . HIS D  2 57  ? -28.959 -31.579 -82.080  1.00 48.42  ? 971  HIS D NE2   1 
ATOM   6694 N  N     . THR D  2 58  ? -29.644 -31.853 -89.000  1.00 48.91  ? 972  THR D N     1 
ATOM   6695 C  CA    . THR D  2 58  ? -29.674 -31.433 -90.397  1.00 48.26  ? 972  THR D CA    1 
ATOM   6696 C  C     . THR D  2 58  ? -30.910 -30.606 -90.724  1.00 44.20  ? 972  THR D C     1 
ATOM   6697 O  O     . THR D  2 58  ? -30.817 -29.613 -91.453  1.00 44.46  ? 972  THR D O     1 
ATOM   6698 C  CB    . THR D  2 58  ? -29.606 -32.654 -91.308  1.00 49.65  ? 972  THR D CB    1 
ATOM   6699 O  OG1   . THR D  2 58  ? -28.516 -33.479 -90.898  1.00 47.46  ? 972  THR D OG1   1 
ATOM   6700 C  CG2   . THR D  2 58  ? -29.370 -32.214 -92.743  1.00 54.97  ? 972  THR D CG2   1 
ATOM   6701 N  N     . GLU D  2 59  ? -32.080 -31.008 -90.219  1.00 44.68  ? 973  GLU D N     1 
ATOM   6702 C  CA    . GLU D  2 59  ? -33.292 -30.253 -90.520  1.00 44.37  ? 973  GLU D CA    1 
ATOM   6703 C  C     . GLU D  2 59  ? -33.201 -28.831 -89.991  1.00 44.55  ? 973  GLU D C     1 
ATOM   6704 O  O     . GLU D  2 59  ? -33.704 -27.901 -90.629  1.00 42.97  ? 973  GLU D O     1 
ATOM   6705 C  CB    . GLU D  2 59  ? -34.527 -30.950 -89.938  1.00 45.50  ? 973  GLU D CB    1 
ATOM   6706 C  CG    . GLU D  2 59  ? -35.841 -30.306 -90.383  1.00 46.81  ? 973  GLU D CG    1 
ATOM   6707 C  CD    . GLU D  2 59  ? -37.075 -31.098 -89.973  1.00 50.37  ? 973  GLU D CD    1 
ATOM   6708 O  OE1   . GLU D  2 59  ? -36.977 -31.940 -89.053  1.00 49.92  ? 973  GLU D OE1   1 
ATOM   6709 O  OE2   . GLU D  2 59  ? -38.145 -30.872 -90.582  1.00 51.12  ? 973  GLU D OE2   1 
ATOM   6710 N  N     . ILE D  2 60  ? -32.568 -28.645 -88.832  1.00 43.11  ? 974  ILE D N     1 
ATOM   6711 C  CA    . ILE D  2 60  ? -32.363 -27.300 -88.303  1.00 44.44  ? 974  ILE D CA    1 
ATOM   6712 C  C     . ILE D  2 60  ? -31.342 -26.544 -89.149  1.00 46.20  ? 974  ILE D C     1 
ATOM   6713 O  O     . ILE D  2 60  ? -31.499 -25.343 -89.406  1.00 46.57  ? 974  ILE D O     1 
ATOM   6714 C  CB    . ILE D  2 60  ? -31.944 -27.374 -86.822  1.00 45.00  ? 974  ILE D CB    1 
ATOM   6715 C  CG1   . ILE D  2 60  ? -32.975 -28.179 -86.018  1.00 41.50  ? 974  ILE D CG1   1 
ATOM   6716 C  CG2   . ILE D  2 60  ? -31.788 -25.985 -86.245  1.00 46.39  ? 974  ILE D CG2   1 
ATOM   6717 C  CD1   . ILE D  2 60  ? -32.718 -28.206 -84.524  1.00 40.37  ? 974  ILE D CD1   1 
ATOM   6718 N  N     . VAL D  2 61  ? -30.287 -27.231 -89.605  1.00 47.24  ? 975  VAL D N     1 
ATOM   6719 C  CA    . VAL D  2 61  ? -29.297 -26.588 -90.470  1.00 47.82  ? 975  VAL D CA    1 
ATOM   6720 C  C     . VAL D  2 61  ? -29.975 -26.008 -91.704  1.00 46.90  ? 975  VAL D C     1 
ATOM   6721 O  O     . VAL D  2 61  ? -29.778 -24.838 -92.053  1.00 43.47  ? 975  VAL D O     1 
ATOM   6722 C  CB    . VAL D  2 61  ? -28.183 -27.578 -90.860  1.00 46.59  ? 975  VAL D CB    1 
ATOM   6723 C  CG1   . VAL D  2 61  ? -27.237 -26.934 -91.868  1.00 47.79  ? 975  VAL D CG1   1 
ATOM   6724 C  CG2   . VAL D  2 61  ? -27.419 -28.043 -89.627  1.00 42.91  ? 975  VAL D CG2   1 
ATOM   6725 N  N     . LYS D  2 62  ? -30.811 -26.813 -92.363  1.00 48.34  ? 976  LYS D N     1 
ATOM   6726 C  CA    . LYS D  2 62  ? -31.549 -26.328 -93.524  1.00 52.25  ? 976  LYS D CA    1 
ATOM   6727 C  C     . LYS D  2 62  ? -32.433 -25.150 -93.148  1.00 55.65  ? 976  LYS D C     1 
ATOM   6728 O  O     . LYS D  2 62  ? -32.333 -24.075 -93.745  1.00 51.02  ? 976  LYS D O     1 
ATOM   6729 C  CB    . LYS D  2 62  ? -32.387 -27.452 -94.136  1.00 57.04  ? 976  LYS D CB    1 
ATOM   6730 C  CG    . LYS D  2 62  ? -31.576 -28.476 -94.907  1.00 61.18  ? 976  LYS D CG    1 
ATOM   6731 C  CD    . LYS D  2 62  ? -32.465 -29.454 -95.659  1.00 62.29  ? 976  LYS D CD    1 
ATOM   6732 C  CE    . LYS D  2 62  ? -32.996 -28.858 -96.941  1.00 60.73  ? 976  LYS D CE    1 
ATOM   6733 N  NZ    . LYS D  2 62  ? -33.643 -29.892 -97.788  1.00 57.15  ? 976  LYS D NZ    1 
ATOM   6734 N  N     . PHE D  2 63  ? -33.287 -25.328 -92.132  1.00 51.09  ? 977  PHE D N     1 
ATOM   6735 C  CA    . PHE D  2 63  ? -34.241 -24.282 -91.778  1.00 49.97  ? 977  PHE D CA    1 
ATOM   6736 C  C     . PHE D  2 63  ? -33.543 -22.947 -91.555  1.00 49.20  ? 977  PHE D C     1 
ATOM   6737 O  O     . PHE D  2 63  ? -33.950 -21.922 -92.109  1.00 51.43  ? 977  PHE D O     1 
ATOM   6738 C  CB    . PHE D  2 63  ? -35.035 -24.673 -90.533  1.00 49.74  ? 977  PHE D CB    1 
ATOM   6739 C  CG    . PHE D  2 63  ? -35.935 -23.578 -90.037  1.00 48.42  ? 977  PHE D CG    1 
ATOM   6740 C  CD1   . PHE D  2 63  ? -37.163 -23.353 -90.632  1.00 48.18  ? 977  PHE D CD1   1 
ATOM   6741 C  CD2   . PHE D  2 63  ? -35.541 -22.758 -88.998  1.00 48.84  ? 977  PHE D CD2   1 
ATOM   6742 C  CE1   . PHE D  2 63  ? -37.989 -22.346 -90.184  1.00 49.14  ? 977  PHE D CE1   1 
ATOM   6743 C  CE2   . PHE D  2 63  ? -36.362 -21.746 -88.543  1.00 48.30  ? 977  PHE D CE2   1 
ATOM   6744 C  CZ    . PHE D  2 63  ? -37.588 -21.542 -89.134  1.00 48.45  ? 977  PHE D CZ    1 
ATOM   6745 N  N     . LEU D  2 64  ? -32.482 -22.947 -90.745  1.00 48.46  ? 978  LEU D N     1 
ATOM   6746 C  CA    . LEU D  2 64  ? -31.732 -21.719 -90.503  1.00 46.37  ? 978  LEU D CA    1 
ATOM   6747 C  C     . LEU D  2 64  ? -31.167 -21.154 -91.802  1.00 50.10  ? 978  LEU D C     1 
ATOM   6748 O  O     . LEU D  2 64  ? -31.240 -19.943 -92.049  1.00 50.96  ? 978  LEU D O     1 
ATOM   6749 C  CB    . LEU D  2 64  ? -30.613 -21.988 -89.500  1.00 46.73  ? 978  LEU D CB    1 
ATOM   6750 C  CG    . LEU D  2 64  ? -31.067 -22.284 -88.060  1.00 46.92  ? 978  LEU D CG    1 
ATOM   6751 C  CD1   . LEU D  2 64  ? -29.873 -22.525 -87.161  1.00 46.29  ? 978  LEU D CD1   1 
ATOM   6752 C  CD2   . LEU D  2 64  ? -31.931 -21.137 -87.525  1.00 45.16  ? 978  LEU D CD2   1 
ATOM   6753 N  N     . VAL D  2 65  ? -30.619 -22.020 -92.656  1.00 52.05  ? 979  VAL D N     1 
ATOM   6754 C  CA    . VAL D  2 65  ? -30.045 -21.550 -93.912  1.00 49.73  ? 979  VAL D CA    1 
ATOM   6755 C  C     . VAL D  2 65  ? -31.135 -21.052 -94.858  1.00 48.66  ? 979  VAL D C     1 
ATOM   6756 O  O     . VAL D  2 65  ? -30.976 -20.005 -95.500  1.00 44.94  ? 979  VAL D O     1 
ATOM   6757 C  CB    . VAL D  2 65  ? -29.190 -22.655 -94.551  1.00 52.50  ? 979  VAL D CB    1 
ATOM   6758 C  CG1   . VAL D  2 65  ? -28.770 -22.250 -95.953  1.00 54.84  ? 979  VAL D CG1   1 
ATOM   6759 C  CG2   . VAL D  2 65  ? -27.965 -22.930 -93.685  1.00 49.86  ? 979  VAL D CG2   1 
ATOM   6760 N  N     . GLN D  2 66  ? -32.258 -21.786 -94.966  1.00 51.64  ? 980  GLN D N     1 
ATOM   6761 C  CA    . GLN D  2 66  ? -33.387 -21.285 -95.757  1.00 53.25  ? 980  GLN D CA    1 
ATOM   6762 C  C     . GLN D  2 66  ? -33.906 -19.970 -95.200  1.00 50.56  ? 980  GLN D C     1 
ATOM   6763 O  O     . GLN D  2 66  ? -34.461 -19.159 -95.946  1.00 49.14  ? 980  GLN D O     1 
ATOM   6764 C  CB    . GLN D  2 66  ? -34.561 -22.279 -95.802  1.00 62.45  ? 980  GLN D CB    1 
ATOM   6765 C  CG    . GLN D  2 66  ? -34.232 -23.758 -95.798  1.00 74.58  ? 980  GLN D CG    1 
ATOM   6766 C  CD    . GLN D  2 66  ? -33.985 -24.334 -97.169  1.00 79.56  ? 980  GLN D CD    1 
ATOM   6767 O  OE1   . GLN D  2 66  ? -33.010 -23.987 -97.832  1.00 82.89  ? 980  GLN D OE1   1 
ATOM   6768 N  NE2   . GLN D  2 66  ? -34.855 -25.246 -97.594  1.00 80.88  ? 980  GLN D NE2   1 
ATOM   6769 N  N     . PHE D  2 67  ? -33.757 -19.754 -93.888  1.00 52.89  ? 981  PHE D N     1 
ATOM   6770 C  CA    . PHE D  2 67  ? -34.248 -18.536 -93.250  1.00 52.95  ? 981  PHE D CA    1 
ATOM   6771 C  C     . PHE D  2 67  ? -33.403 -17.319 -93.597  1.00 53.60  ? 981  PHE D C     1 
ATOM   6772 O  O     . PHE D  2 67  ? -33.857 -16.184 -93.401  1.00 52.88  ? 981  PHE D O     1 
ATOM   6773 C  CB    . PHE D  2 67  ? -34.284 -18.720 -91.732  1.00 52.45  ? 981  PHE D CB    1 
ATOM   6774 C  CG    . PHE D  2 67  ? -35.138 -17.716 -91.012  1.00 52.10  ? 981  PHE D CG    1 
ATOM   6775 C  CD1   . PHE D  2 67  ? -36.504 -17.910 -90.893  1.00 53.74  ? 981  PHE D CD1   1 
ATOM   6776 C  CD2   . PHE D  2 67  ? -34.570 -16.587 -90.435  1.00 51.72  ? 981  PHE D CD2   1 
ATOM   6777 C  CE1   . PHE D  2 67  ? -37.296 -16.991 -90.217  1.00 55.54  ? 981  PHE D CE1   1 
ATOM   6778 C  CE2   . PHE D  2 67  ? -35.353 -15.664 -89.760  1.00 52.62  ? 981  PHE D CE2   1 
ATOM   6779 C  CZ    . PHE D  2 67  ? -36.720 -15.868 -89.647  1.00 50.98  ? 981  PHE D CZ    1 
ATOM   6780 N  N     . GLY D  2 68  ? -32.192 -17.527 -94.101  1.00 53.07  ? 982  GLY D N     1 
ATOM   6781 C  CA    . GLY D  2 68  ? -31.333 -16.436 -94.491  1.00 55.91  ? 982  GLY D CA    1 
ATOM   6782 C  C     . GLY D  2 68  ? -30.244 -16.073 -93.510  1.00 54.79  ? 982  GLY D C     1 
ATOM   6783 O  O     . GLY D  2 68  ? -29.663 -14.990 -93.638  1.00 51.60  ? 982  GLY D O     1 
ATOM   6784 N  N     . VAL D  2 69  ? -29.942 -16.940 -92.537  1.00 52.34  ? 983  VAL D N     1 
ATOM   6785 C  CA    . VAL D  2 69  ? -28.861 -16.633 -91.607  1.00 48.49  ? 983  VAL D CA    1 
ATOM   6786 C  C     . VAL D  2 69  ? -27.524 -16.625 -92.342  1.00 49.76  ? 983  VAL D C     1 
ATOM   6787 O  O     . VAL D  2 69  ? -27.392 -17.085 -93.488  1.00 50.93  ? 983  VAL D O     1 
ATOM   6788 C  CB    . VAL D  2 69  ? -28.837 -17.611 -90.419  1.00 46.41  ? 983  VAL D CB    1 
ATOM   6789 C  CG1   . VAL D  2 69  ? -30.195 -17.655 -89.752  1.00 44.18  ? 983  VAL D CG1   1 
ATOM   6790 C  CG2   . VAL D  2 69  ? -28.397 -18.996 -90.870  1.00 44.66  ? 983  VAL D CG2   1 
ATOM   6791 N  N     . ASN D  2 70  ? -26.516 -16.076 -91.674  1.00 47.40  ? 984  ASN D N     1 
ATOM   6792 C  CA    . ASN D  2 70  ? -25.215 -15.887 -92.302  1.00 45.65  ? 984  ASN D CA    1 
ATOM   6793 C  C     . ASN D  2 70  ? -24.519 -17.232 -92.404  1.00 47.37  ? 984  ASN D C     1 
ATOM   6794 O  O     . ASN D  2 70  ? -23.922 -17.712 -91.437  1.00 42.70  ? 984  ASN D O     1 
ATOM   6795 C  CB    . ASN D  2 70  ? -24.373 -14.895 -91.514  1.00 46.93  ? 984  ASN D CB    1 
ATOM   6796 C  CG    . ASN D  2 70  ? -23.007 -14.685 -92.135  1.00 47.37  ? 984  ASN D CG    1 
ATOM   6797 O  OD1   . ASN D  2 70  ? -22.756 -15.114 -93.261  1.00 48.65  ? 984  ASN D OD1   1 
ATOM   6798 N  ND2   . ASN D  2 70  ? -22.120 -14.017 -91.410  1.00 48.68  ? 984  ASN D ND2   1 
ATOM   6799 N  N     . VAL D  2 71  ? -24.565 -17.836 -93.593  1.00 42.75  ? 985  VAL D N     1 
ATOM   6800 C  CA    . VAL D  2 71  ? -23.980 -19.159 -93.772  1.00 47.94  ? 985  VAL D CA    1 
ATOM   6801 C  C     . VAL D  2 71  ? -22.471 -19.165 -93.584  1.00 45.67  ? 985  VAL D C     1 
ATOM   6802 O  O     . VAL D  2 71  ? -21.890 -20.235 -93.407  1.00 43.12  ? 985  VAL D O     1 
ATOM   6803 C  CB    . VAL D  2 71  ? -24.354 -19.725 -95.159  1.00 50.60  ? 985  VAL D CB    1 
ATOM   6804 C  CG1   . VAL D  2 71  ? -23.429 -19.178 -96.243  1.00 51.51  ? 985  VAL D CG1   1 
ATOM   6805 C  CG2   . VAL D  2 71  ? -24.335 -21.245 -95.135  1.00 53.16  ? 985  VAL D CG2   1 
ATOM   6806 N  N     . ASN D  2 72  ? -21.820 -17.997 -93.575  1.00 48.55  ? 986  ASN D N     1 
ATOM   6807 C  CA    . ASN D  2 72  ? -20.365 -17.930 -93.476  1.00 50.08  ? 986  ASN D CA    1 
ATOM   6808 C  C     . ASN D  2 72  ? -19.886 -17.230 -92.209  1.00 51.54  ? 986  ASN D C     1 
ATOM   6809 O  O     . ASN D  2 72  ? -18.731 -16.798 -92.149  1.00 51.25  ? 986  ASN D O     1 
ATOM   6810 C  CB    . ASN D  2 72  ? -19.790 -17.243 -94.711  1.00 51.20  ? 986  ASN D CB    1 
ATOM   6811 C  CG    . ASN D  2 72  ? -20.013 -18.050 -95.966  1.00 54.43  ? 986  ASN D CG    1 
ATOM   6812 O  OD1   . ASN D  2 72  ? -19.621 -19.217 -96.035  1.00 57.43  ? 986  ASN D OD1   1 
ATOM   6813 N  ND2   . ASN D  2 72  ? -20.667 -17.449 -96.957  1.00 50.40  ? 986  ASN D ND2   1 
ATOM   6814 N  N     . ALA D  2 73  ? -20.743 -17.111 -91.199  1.00 51.18  ? 987  ALA D N     1 
ATOM   6815 C  CA    . ALA D  2 73  ? -20.348 -16.467 -89.949  1.00 54.96  ? 987  ALA D CA    1 
ATOM   6816 C  C     . ALA D  2 73  ? -19.152 -17.189 -89.339  1.00 54.45  ? 987  ALA D C     1 
ATOM   6817 O  O     . ALA D  2 73  ? -19.151 -18.417 -89.213  1.00 52.13  ? 987  ALA D O     1 
ATOM   6818 C  CB    . ALA D  2 73  ? -21.524 -16.451 -88.970  1.00 43.29  ? 987  ALA D CB    1 
ATOM   6819 N  N     . ALA D  2 74  ? -18.124 -16.427 -88.982  1.00 56.06  ? 988  ALA D N     1 
ATOM   6820 C  CA    . ALA D  2 74  ? -16.892 -16.972 -88.431  1.00 60.48  ? 988  ALA D CA    1 
ATOM   6821 C  C     . ALA D  2 74  ? -16.798 -16.663 -86.941  1.00 67.29  ? 988  ALA D C     1 
ATOM   6822 O  O     . ALA D  2 74  ? -17.193 -15.579 -86.499  1.00 69.69  ? 988  ALA D O     1 
ATOM   6823 C  CB    . ALA D  2 74  ? -15.672 -16.407 -89.167  1.00 57.25  ? 988  ALA D CB    1 
ATOM   6824 N  N     . ASP D  2 75  ? -16.274 -17.621 -86.168  1.00 67.64  ? 989  ASP D N     1 
ATOM   6825 C  CA    . ASP D  2 75  ? -16.090 -17.425 -84.733  1.00 68.74  ? 989  ASP D CA    1 
ATOM   6826 C  C     . ASP D  2 75  ? -14.772 -16.713 -84.455  1.00 75.97  ? 989  ASP D C     1 
ATOM   6827 O  O     . ASP D  2 75  ? -14.185 -16.111 -85.361  1.00 79.61  ? 989  ASP D O     1 
ATOM   6828 C  CB    . ASP D  2 75  ? -16.154 -18.763 -83.982  1.00 67.83  ? 989  ASP D CB    1 
ATOM   6829 C  CG    . ASP D  2 75  ? -14.940 -19.646 -84.235  1.00 67.84  ? 989  ASP D CG    1 
ATOM   6830 O  OD1   . ASP D  2 75  ? -14.252 -19.451 -85.259  1.00 69.58  ? 989  ASP D OD1   1 
ATOM   6831 O  OD2   . ASP D  2 75  ? -14.675 -20.546 -83.413  1.00 65.65  ? 989  ASP D OD2   1 
ATOM   6832 N  N     . SER D  2 76  ? -14.301 -16.777 -83.207  1.00 82.10  ? 990  SER D N     1 
ATOM   6833 C  CA    . SER D  2 76  ? -13.063 -16.092 -82.850  1.00 87.52  ? 990  SER D CA    1 
ATOM   6834 C  C     . SER D  2 76  ? -11.863 -16.683 -83.579  1.00 88.91  ? 990  SER D C     1 
ATOM   6835 O  O     . SER D  2 76  ? -10.936 -15.948 -83.940  1.00 94.51  ? 990  SER D O     1 
ATOM   6836 C  CB    . SER D  2 76  ? -12.848 -16.143 -81.336  1.00 89.39  ? 990  SER D CB    1 
ATOM   6837 O  OG    . SER D  2 76  ? -12.875 -17.475 -80.857  1.00 90.84  ? 990  SER D OG    1 
ATOM   6838 N  N     . ASP D  2 77  ? -11.864 -17.992 -83.818  1.00 83.25  ? 991  ASP D N     1 
ATOM   6839 C  CA    . ASP D  2 77  ? -10.795 -18.641 -84.563  1.00 79.25  ? 991  ASP D CA    1 
ATOM   6840 C  C     . ASP D  2 77  ? -11.013 -18.610 -86.074  1.00 74.23  ? 991  ASP D C     1 
ATOM   6841 O  O     . ASP D  2 77  ? -10.180 -19.138 -86.818  1.00 70.14  ? 991  ASP D O     1 
ATOM   6842 C  CB    . ASP D  2 77  ? -10.636 -20.090 -84.092  1.00 78.36  ? 991  ASP D CB    1 
ATOM   6843 N  N     . GLY D  2 78  ? -12.098 -17.999 -86.544  1.00 70.03  ? 992  GLY D N     1 
ATOM   6844 C  CA    . GLY D  2 78  ? -12.415 -17.982 -87.955  1.00 63.69  ? 992  GLY D CA    1 
ATOM   6845 C  C     . GLY D  2 78  ? -13.188 -19.182 -88.454  1.00 64.14  ? 992  GLY D C     1 
ATOM   6846 O  O     . GLY D  2 78  ? -13.328 -19.343 -89.673  1.00 66.68  ? 992  GLY D O     1 
ATOM   6847 N  N     . TRP D  2 79  ? -13.695 -20.027 -87.558  1.00 62.68  ? 993  TRP D N     1 
ATOM   6848 C  CA    . TRP D  2 79  ? -14.422 -21.223 -87.969  1.00 61.11  ? 993  TRP D CA    1 
ATOM   6849 C  C     . TRP D  2 79  ? -15.786 -20.844 -88.537  1.00 57.33  ? 993  TRP D C     1 
ATOM   6850 O  O     . TRP D  2 79  ? -16.594 -20.202 -87.856  1.00 56.33  ? 993  TRP D O     1 
ATOM   6851 C  CB    . TRP D  2 79  ? -14.575 -22.178 -86.788  1.00 59.28  ? 993  TRP D CB    1 
ATOM   6852 C  CG    . TRP D  2 79  ? -13.341 -22.977 -86.508  1.00 65.63  ? 993  TRP D CG    1 
ATOM   6853 C  CD1   . TRP D  2 79  ? -12.128 -22.495 -86.116  1.00 70.84  ? 993  TRP D CD1   1 
ATOM   6854 C  CD2   . TRP D  2 79  ? -13.192 -24.401 -86.610  1.00 64.91  ? 993  TRP D CD2   1 
ATOM   6855 N  NE1   . TRP D  2 79  ? -11.235 -23.528 -85.958  1.00 72.20  ? 993  TRP D NE1   1 
ATOM   6856 C  CE2   . TRP D  2 79  ? -11.864 -24.708 -86.257  1.00 68.21  ? 993  TRP D CE2   1 
ATOM   6857 C  CE3   . TRP D  2 79  ? -14.056 -25.444 -86.956  1.00 65.62  ? 993  TRP D CE3   1 
ATOM   6858 C  CZ2   . TRP D  2 79  ? -11.376 -26.016 -86.243  1.00 67.92  ? 993  TRP D CZ2   1 
ATOM   6859 C  CZ3   . TRP D  2 79  ? -13.569 -26.743 -86.943  1.00 65.97  ? 993  TRP D CZ3   1 
ATOM   6860 C  CH2   . TRP D  2 79  ? -12.242 -27.016 -86.587  1.00 66.67  ? 993  TRP D CH2   1 
ATOM   6861 N  N     . THR D  2 80  ? -16.029 -21.221 -89.788  1.00 54.26  ? 994  THR D N     1 
ATOM   6862 C  CA    . THR D  2 80  ? -17.338 -21.084 -90.411  1.00 52.34  ? 994  THR D CA    1 
ATOM   6863 C  C     . THR D  2 80  ? -18.141 -22.354 -90.193  1.00 51.84  ? 994  THR D C     1 
ATOM   6864 O  O     . THR D  2 80  ? -17.590 -23.395 -89.827  1.00 49.03  ? 994  THR D O     1 
ATOM   6865 C  CB    . THR D  2 80  ? -17.179 -20.801 -91.906  1.00 51.74  ? 994  THR D CB    1 
ATOM   6866 O  OG1   . THR D  2 80  ? -16.718 -21.980 -92.572  1.00 47.23  ? 994  THR D OG1   1 
ATOM   6867 C  CG2   . THR D  2 80  ? -16.195 -19.661 -92.147  1.00 55.94  ? 994  THR D CG2   1 
ATOM   6868 N  N     . PRO D  2 81  ? -19.459 -22.308 -90.411  1.00 53.10  ? 995  PRO D N     1 
ATOM   6869 C  CA    . PRO D  2 81  ? -20.234 -23.559 -90.415  1.00 51.80  ? 995  PRO D CA    1 
ATOM   6870 C  C     . PRO D  2 81  ? -19.633 -24.634 -91.309  1.00 52.49  ? 995  PRO D C     1 
ATOM   6871 O  O     . PRO D  2 81  ? -19.693 -25.824 -90.956  1.00 44.96  ? 995  PRO D O     1 
ATOM   6872 C  CB    . PRO D  2 81  ? -21.610 -23.110 -90.922  1.00 52.74  ? 995  PRO D CB    1 
ATOM   6873 C  CG    . PRO D  2 81  ? -21.715 -21.693 -90.499  1.00 54.42  ? 995  PRO D CG    1 
ATOM   6874 C  CD    . PRO D  2 81  ? -20.325 -21.127 -90.595  1.00 54.35  ? 995  PRO D CD    1 
ATOM   6875 N  N     . LEU D  2 82  ? -19.047 -24.255 -92.452  1.00 41.77  ? 996  LEU D N     1 
ATOM   6876 C  CA    . LEU D  2 82  ? -18.417 -25.257 -93.307  1.00 45.67  ? 996  LEU D CA    1 
ATOM   6877 C  C     . LEU D  2 82  ? -17.217 -25.891 -92.616  1.00 48.92  ? 996  LEU D C     1 
ATOM   6878 O  O     . LEU D  2 82  ? -17.022 -27.110 -92.700  1.00 52.59  ? 996  LEU D O     1 
ATOM   6879 C  CB    . LEU D  2 82  ? -18.003 -24.648 -94.647  1.00 46.30  ? 996  LEU D CB    1 
ATOM   6880 C  CG    . LEU D  2 82  ? -17.632 -25.653 -95.739  1.00 46.87  ? 996  LEU D CG    1 
ATOM   6881 C  CD1   . LEU D  2 82  ? -18.867 -26.425 -96.196  1.00 43.63  ? 996  LEU D CD1   1 
ATOM   6882 C  CD2   . LEU D  2 82  ? -16.967 -24.950 -96.923  1.00 51.65  ? 996  LEU D CD2   1 
ATOM   6883 N  N     . HIS D  2 83  ? -16.410 -25.083 -91.915  1.00 48.42  ? 997  HIS D N     1 
ATOM   6884 C  CA    . HIS D  2 83  ? -15.328 -25.643 -91.109  1.00 48.83  ? 997  HIS D CA    1 
ATOM   6885 C  C     . HIS D  2 83  ? -15.861 -26.658 -90.106  1.00 47.61  ? 997  HIS D C     1 
ATOM   6886 O  O     . HIS D  2 83  ? -15.252 -27.717 -89.893  1.00 49.59  ? 997  HIS D O     1 
ATOM   6887 C  CB    . HIS D  2 83  ? -14.574 -24.534 -90.377  1.00 52.66  ? 997  HIS D CB    1 
ATOM   6888 C  CG    . HIS D  2 83  ? -13.690 -23.716 -91.264  1.00 55.48  ? 997  HIS D CG    1 
ATOM   6889 N  ND1   . HIS D  2 83  ? -14.018 -22.439 -91.663  1.00 55.86  ? 997  HIS D ND1   1 
ATOM   6890 C  CD2   . HIS D  2 83  ? -12.489 -23.990 -91.825  1.00 56.65  ? 997  HIS D CD2   1 
ATOM   6891 C  CE1   . HIS D  2 83  ? -13.059 -21.963 -92.438  1.00 58.90  ? 997  HIS D CE1   1 
ATOM   6892 N  NE2   . HIS D  2 83  ? -12.117 -22.883 -92.547  1.00 57.91  ? 997  HIS D NE2   1 
ATOM   6893 N  N     . CYS D  2 84  ? -17.000 -26.351 -89.485  1.00 43.48  ? 998  CYS D N     1 
ATOM   6894 C  CA    . CYS D  2 84  ? -17.592 -27.264 -88.515  1.00 47.25  ? 998  CYS D CA    1 
ATOM   6895 C  C     . CYS D  2 84  ? -18.074 -28.545 -89.182  1.00 48.80  ? 998  CYS D C     1 
ATOM   6896 O  O     . CYS D  2 84  ? -17.758 -29.650 -88.719  1.00 46.81  ? 998  CYS D O     1 
ATOM   6897 C  CB    . CYS D  2 84  ? -18.739 -26.574 -87.781  1.00 56.54  ? 998  CYS D CB    1 
ATOM   6898 S  SG    . CYS D  2 84  ? -18.213 -25.162 -86.805  1.00 62.15  ? 998  CYS D SG    1 
ATOM   6899 N  N     . ALA D  2 85  ? -18.848 -28.421 -90.267  1.00 43.37  ? 999  ALA D N     1 
ATOM   6900 C  CA    . ALA D  2 85  ? -19.317 -29.613 -90.967  1.00 45.90  ? 999  ALA D CA    1 
ATOM   6901 C  C     . ALA D  2 85  ? -18.149 -30.487 -91.384  1.00 48.30  ? 999  ALA D C     1 
ATOM   6902 O  O     . ALA D  2 85  ? -18.188 -31.713 -91.221  1.00 56.39  ? 999  ALA D O     1 
ATOM   6903 C  CB    . ALA D  2 85  ? -20.149 -29.229 -92.190  1.00 45.19  ? 999  ALA D CB    1 
ATOM   6904 N  N     . ALA D  2 86  ? -17.088 -29.864 -91.896  1.00 45.79  ? 1000 ALA D N     1 
ATOM   6905 C  CA    . ALA D  2 86  ? -15.933 -30.618 -92.361  1.00 51.67  ? 1000 ALA D CA    1 
ATOM   6906 C  C     . ALA D  2 86  ? -15.265 -31.378 -91.223  1.00 53.16  ? 1000 ALA D C     1 
ATOM   6907 O  O     . ALA D  2 86  ? -14.885 -32.543 -91.391  1.00 52.10  ? 1000 ALA D O     1 
ATOM   6908 C  CB    . ALA D  2 86  ? -14.944 -29.673 -93.024  1.00 53.04  ? 1000 ALA D CB    1 
ATOM   6909 N  N     . SER D  2 87  ? -15.107 -30.732 -90.061  1.00 54.23  ? 1001 SER D N     1 
ATOM   6910 C  CA    . SER D  2 87  ? -14.474 -31.385 -88.923  1.00 56.07  ? 1001 SER D CA    1 
ATOM   6911 C  C     . SER D  2 87  ? -15.305 -32.548 -88.398  1.00 55.83  ? 1001 SER D C     1 
ATOM   6912 O  O     . SER D  2 87  ? -14.762 -33.424 -87.718  1.00 54.80  ? 1001 SER D O     1 
ATOM   6913 C  CB    . SER D  2 87  ? -14.225 -30.374 -87.803  1.00 60.10  ? 1001 SER D CB    1 
ATOM   6914 O  OG    . SER D  2 87  ? -15.441 -30.026 -87.168  1.00 63.88  ? 1001 SER D OG    1 
ATOM   6915 N  N     . CYS D  2 88  ? -16.601 -32.581 -88.702  1.00 55.36  ? 1002 CYS D N     1 
ATOM   6916 C  CA    . CYS D  2 88  ? -17.448 -33.730 -88.412  1.00 57.44  ? 1002 CYS D CA    1 
ATOM   6917 C  C     . CYS D  2 88  ? -17.433 -34.772 -89.527  1.00 57.46  ? 1002 CYS D C     1 
ATOM   6918 O  O     . CYS D  2 88  ? -18.119 -35.796 -89.410  1.00 56.69  ? 1002 CYS D O     1 
ATOM   6919 C  CB    . CYS D  2 88  ? -18.889 -33.272 -88.160  1.00 55.85  ? 1002 CYS D CB    1 
ATOM   6920 S  SG    . CYS D  2 88  ? -19.064 -32.121 -86.786  1.00 58.37  ? 1002 CYS D SG    1 
ATOM   6921 N  N     . ASN D  2 89  ? -16.669 -34.536 -90.598  1.00 53.33  ? 1003 ASN D N     1 
ATOM   6922 C  CA    . ASN D  2 89  ? -16.660 -35.417 -91.770  1.00 55.41  ? 1003 ASN D CA    1 
ATOM   6923 C  C     . ASN D  2 89  ? -18.065 -35.594 -92.336  1.00 55.59  ? 1003 ASN D C     1 
ATOM   6924 O  O     . ASN D  2 89  ? -18.428 -36.670 -92.819  1.00 56.42  ? 1003 ASN D O     1 
ATOM   6925 C  CB    . ASN D  2 89  ? -16.036 -36.778 -91.441  1.00 57.10  ? 1003 ASN D CB    1 
ATOM   6926 C  CG    . ASN D  2 89  ? -14.545 -36.695 -91.223  1.00 54.39  ? 1003 ASN D CG    1 
ATOM   6927 O  OD1   . ASN D  2 89  ? -13.898 -35.753 -91.672  1.00 56.87  ? 1003 ASN D OD1   1 
ATOM   6928 N  ND2   . ASN D  2 89  ? -13.986 -37.692 -90.553  1.00 54.59  ? 1003 ASN D ND2   1 
ATOM   6929 N  N     . ASN D  2 90  ? -18.871 -34.535 -92.272  1.00 53.15  ? 1004 ASN D N     1 
ATOM   6930 C  CA    . ASN D  2 90  ? -20.285 -34.611 -92.634  1.00 45.96  ? 1004 ASN D CA    1 
ATOM   6931 C  C     . ASN D  2 90  ? -20.429 -34.071 -94.051  1.00 56.42  ? 1004 ASN D C     1 
ATOM   6932 O  O     . ASN D  2 90  ? -20.720 -32.891 -94.272  1.00 45.31  ? 1004 ASN D O     1 
ATOM   6933 C  CB    . ASN D  2 90  ? -21.130 -33.851 -91.617  1.00 46.00  ? 1004 ASN D CB    1 
ATOM   6934 C  CG    . ASN D  2 90  ? -22.610 -34.127 -91.765  1.00 48.86  ? 1004 ASN D CG    1 
ATOM   6935 O  OD1   . ASN D  2 90  ? -23.091 -34.451 -92.852  1.00 55.10  ? 1004 ASN D OD1   1 
ATOM   6936 N  ND2   . ASN D  2 90  ? -23.344 -33.983 -90.679  1.00 45.51  ? 1004 ASN D ND2   1 
ATOM   6937 N  N     . VAL D  2 91  ? -20.219 -34.957 -95.029  1.00 46.21  ? 1005 VAL D N     1 
ATOM   6938 C  CA    . VAL D  2 91  ? -20.174 -34.530 -96.419  1.00 50.07  ? 1005 VAL D CA    1 
ATOM   6939 C  C     . VAL D  2 91  ? -21.533 -34.018 -96.876  1.00 48.89  ? 1005 VAL D C     1 
ATOM   6940 O  O     . VAL D  2 91  ? -21.613 -33.085 -97.681  1.00 47.94  ? 1005 VAL D O     1 
ATOM   6941 C  CB    . VAL D  2 91  ? -19.661 -35.685 -97.305  1.00 50.54  ? 1005 VAL D CB    1 
ATOM   6942 C  CG1   . VAL D  2 91  ? -20.606 -36.881 -97.247  1.00 52.11  ? 1005 VAL D CG1   1 
ATOM   6943 C  CG2   . VAL D  2 91  ? -19.471 -35.218 -98.727  1.00 51.53  ? 1005 VAL D CG2   1 
ATOM   6944 N  N     . GLN D  2 92  ? -22.616 -34.594 -96.360  1.00 48.79  ? 1006 GLN D N     1 
ATOM   6945 C  CA    . GLN D  2 92  ? -23.954 -34.208 -96.793  1.00 55.71  ? 1006 GLN D CA    1 
ATOM   6946 C  C     . GLN D  2 92  ? -24.263 -32.768 -96.394  1.00 53.10  ? 1006 GLN D C     1 
ATOM   6947 O  O     . GLN D  2 92  ? -24.713 -31.969 -97.222  1.00 53.27  ? 1006 GLN D O     1 
ATOM   6948 C  CB    . GLN D  2 92  ? -24.990 -35.173 -96.214  1.00 67.56  ? 1006 GLN D CB    1 
ATOM   6949 C  CG    . GLN D  2 92  ? -24.579 -36.665 -96.228  1.00 83.66  ? 1006 GLN D CG    1 
ATOM   6950 C  CD    . GLN D  2 92  ? -23.561 -37.059 -95.146  1.00 91.31  ? 1006 GLN D CD    1 
ATOM   6951 O  OE1   . GLN D  2 92  ? -22.713 -36.262 -94.746  1.00 95.02  ? 1006 GLN D OE1   1 
ATOM   6952 N  NE2   . GLN D  2 92  ? -23.656 -38.298 -94.669  1.00 92.37  ? 1006 GLN D NE2   1 
ATOM   6953 N  N     . VAL D  2 93  ? -24.030 -32.415 -95.127  1.00 46.74  ? 1007 VAL D N     1 
ATOM   6954 C  CA    . VAL D  2 93  ? -24.157 -31.018 -94.722  1.00 46.55  ? 1007 VAL D CA    1 
ATOM   6955 C  C     . VAL D  2 93  ? -23.177 -30.152 -95.505  1.00 49.00  ? 1007 VAL D C     1 
ATOM   6956 O  O     . VAL D  2 93  ? -23.534 -29.071 -95.991  1.00 49.72  ? 1007 VAL D O     1 
ATOM   6957 C  CB    . VAL D  2 93  ? -23.955 -30.878 -93.200  1.00 50.61  ? 1007 VAL D CB    1 
ATOM   6958 C  CG1   . VAL D  2 93  ? -23.875 -29.404 -92.804  1.00 43.69  ? 1007 VAL D CG1   1 
ATOM   6959 C  CG2   . VAL D  2 93  ? -25.083 -31.585 -92.440  1.00 47.21  ? 1007 VAL D CG2   1 
ATOM   6960 N  N     . CYS D  2 94  ? -21.931 -30.622 -95.654  1.00 44.39  ? 1008 CYS D N     1 
ATOM   6961 C  CA    . CYS D  2 94  ? -20.935 -29.889 -96.436  1.00 55.60  ? 1008 CYS D CA    1 
ATOM   6962 C  C     . CYS D  2 94  ? -21.461 -29.531 -97.822  1.00 51.58  ? 1008 CYS D C     1 
ATOM   6963 O  O     . CYS D  2 94  ? -21.291 -28.395 -98.284  1.00 53.74  ? 1008 CYS D O     1 
ATOM   6964 C  CB    . CYS D  2 94  ? -19.644 -30.708 -96.554  1.00 55.24  ? 1008 CYS D CB    1 
ATOM   6965 S  SG    . CYS D  2 94  ? -18.496 -30.516 -95.158  1.00 52.08  ? 1008 CYS D SG    1 
ATOM   6966 N  N     . LYS D  2 95  ? -22.119 -30.478 -98.496  1.00 47.98  ? 1009 LYS D N     1 
ATOM   6967 C  CA    . LYS D  2 95  ? -22.655 -30.191 -99.824  1.00 44.41  ? 1009 LYS D CA    1 
ATOM   6968 C  C     . LYS D  2 95  ? -23.813 -29.208 -99.752  1.00 48.32  ? 1009 LYS D C     1 
ATOM   6969 O  O     . LYS D  2 95  ? -23.945 -28.333 -100.617 1.00 54.03  ? 1009 LYS D O     1 
ATOM   6970 C  CB    . LYS D  2 95  ? -23.090 -31.483 -100.523 1.00 49.16  ? 1009 LYS D CB    1 
ATOM   6971 N  N     . PHE D  2 96  ? -24.660 -29.319 -98.728  1.00 50.57  ? 1010 PHE D N     1 
ATOM   6972 C  CA    . PHE D  2 96  ? -25.782 -28.395 -98.634  1.00 52.04  ? 1010 PHE D CA    1 
ATOM   6973 C  C     . PHE D  2 96  ? -25.306 -26.974 -98.347  1.00 51.72  ? 1010 PHE D C     1 
ATOM   6974 O  O     . PHE D  2 96  ? -25.871 -26.005 -98.870  1.00 42.56  ? 1010 PHE D O     1 
ATOM   6975 C  CB    . PHE D  2 96  ? -26.774 -28.855 -97.566  1.00 43.62  ? 1010 PHE D CB    1 
ATOM   6976 C  CG    . PHE D  2 96  ? -27.812 -27.820 -97.249  1.00 44.06  ? 1010 PHE D CG    1 
ATOM   6977 C  CD1   . PHE D  2 96  ? -28.890 -27.620 -98.104  1.00 43.08  ? 1010 PHE D CD1   1 
ATOM   6978 C  CD2   . PHE D  2 96  ? -27.675 -27.001 -96.137  1.00 42.75  ? 1010 PHE D CD2   1 
ATOM   6979 C  CE1   . PHE D  2 96  ? -29.838 -26.651 -97.831  1.00 45.26  ? 1010 PHE D CE1   1 
ATOM   6980 C  CE2   . PHE D  2 96  ? -28.615 -26.030 -95.851  1.00 42.31  ? 1010 PHE D CE2   1 
ATOM   6981 C  CZ    . PHE D  2 96  ? -29.701 -25.850 -96.699  1.00 42.26  ? 1010 PHE D CZ    1 
ATOM   6982 N  N     . LEU D  2 97  ? -24.277 -26.830 -97.506  1.00 47.50  ? 1011 LEU D N     1 
ATOM   6983 C  CA    . LEU D  2 97  ? -23.709 -25.511 -97.256  1.00 43.12  ? 1011 LEU D CA    1 
ATOM   6984 C  C     . LEU D  2 97  ? -23.088 -24.932 -98.523  1.00 44.53  ? 1011 LEU D C     1 
ATOM   6985 O  O     . LEU D  2 97  ? -23.295 -23.754 -98.839  1.00 43.11  ? 1011 LEU D O     1 
ATOM   6986 C  CB    . LEU D  2 97  ? -22.675 -25.591 -96.133  1.00 42.35  ? 1011 LEU D CB    1 
ATOM   6987 C  CG    . LEU D  2 97  ? -23.219 -25.909 -94.738  1.00 45.82  ? 1011 LEU D CG    1 
ATOM   6988 C  CD1   . LEU D  2 97  ? -22.097 -25.949 -93.712  1.00 48.30  ? 1011 LEU D CD1   1 
ATOM   6989 C  CD2   . LEU D  2 97  ? -24.298 -24.911 -94.334  1.00 41.92  ? 1011 LEU D CD2   1 
ATOM   6990 N  N     . VAL D  2 98  ? -22.330 -25.745 -99.266  1.00 45.47  ? 1012 VAL D N     1 
ATOM   6991 C  CA    . VAL D  2 98  ? -21.714 -25.260 -100.502 1.00 46.59  ? 1012 VAL D CA    1 
ATOM   6992 C  C     . VAL D  2 98  ? -22.784 -24.804 -101.483 1.00 46.94  ? 1012 VAL D C     1 
ATOM   6993 O  O     . VAL D  2 98  ? -22.647 -23.763 -102.138 1.00 46.11  ? 1012 VAL D O     1 
ATOM   6994 C  CB    . VAL D  2 98  ? -20.801 -26.342 -101.112 1.00 46.06  ? 1012 VAL D CB    1 
ATOM   6995 C  CG1   . VAL D  2 98  ? -20.604 -26.120 -102.615 1.00 42.99  ? 1012 VAL D CG1   1 
ATOM   6996 C  CG2   . VAL D  2 98  ? -19.460 -26.362 -100.391 1.00 44.15  ? 1012 VAL D CG2   1 
ATOM   6997 N  N     . GLU D  2 99  ? -23.880 -25.556 -101.576 1.00 48.71  ? 1013 GLU D N     1 
ATOM   6998 C  CA    . GLU D  2 99  ? -24.981 -25.159 -102.442 1.00 52.75  ? 1013 GLU D CA    1 
ATOM   6999 C  C     . GLU D  2 99  ? -25.753 -23.971 -101.892 1.00 52.85  ? 1013 GLU D C     1 
ATOM   7000 O  O     . GLU D  2 99  ? -26.648 -23.461 -102.575 1.00 52.01  ? 1013 GLU D O     1 
ATOM   7001 C  CB    . GLU D  2 99  ? -25.925 -26.338 -102.656 1.00 53.69  ? 1013 GLU D CB    1 
ATOM   7002 C  CG    . GLU D  2 99  ? -25.281 -27.478 -103.403 1.00 55.91  ? 1013 GLU D CG    1 
ATOM   7003 C  CD    . GLU D  2 99  ? -26.169 -28.691 -103.477 1.00 63.96  ? 1013 GLU D CD    1 
ATOM   7004 O  OE1   . GLU D  2 99  ? -26.936 -28.932 -102.517 1.00 65.30  ? 1013 GLU D OE1   1 
ATOM   7005 O  OE2   . GLU D  2 99  ? -26.106 -29.396 -104.505 1.00 70.55  ? 1013 GLU D OE2   1 
ATOM   7006 N  N     . SER D  2 100 ? -25.422 -23.517 -100.687 1.00 49.56  ? 1014 SER D N     1 
ATOM   7007 C  CA    . SER D  2 100 ? -26.113 -22.414 -100.038 1.00 45.64  ? 1014 SER D CA    1 
ATOM   7008 C  C     . SER D  2 100 ? -25.206 -21.205 -99.835  1.00 44.31  ? 1014 SER D C     1 
ATOM   7009 O  O     . SER D  2 100 ? -25.528 -20.317 -99.044  1.00 46.48  ? 1014 SER D O     1 
ATOM   7010 C  CB    . SER D  2 100 ? -26.695 -22.886 -98.707  1.00 43.53  ? 1014 SER D CB    1 
ATOM   7011 O  OG    . SER D  2 100 ? -27.705 -23.859 -98.920  1.00 45.57  ? 1014 SER D OG    1 
ATOM   7012 N  N     . GLY D  2 101 ? -24.073 -21.158 -100.521 1.00 46.98  ? 1015 GLY D N     1 
ATOM   7013 C  CA    . GLY D  2 101 ? -23.230 -19.981 -100.524 1.00 47.34  ? 1015 GLY D CA    1 
ATOM   7014 C  C     . GLY D  2 101 ? -22.034 -20.036 -99.606  1.00 51.34  ? 1015 GLY D C     1 
ATOM   7015 O  O     . GLY D  2 101 ? -21.472 -18.981 -99.297  1.00 51.10  ? 1015 GLY D O     1 
ATOM   7016 N  N     . ALA D  2 102 ? -21.639 -21.222 -99.150  1.00 52.26  ? 1016 ALA D N     1 
ATOM   7017 C  CA    . ALA D  2 102 ? -20.484 -21.351 -98.275  1.00 48.65  ? 1016 ALA D CA    1 
ATOM   7018 C  C     . ALA D  2 102 ? -19.207 -20.900 -98.979  1.00 49.14  ? 1016 ALA D C     1 
ATOM   7019 O  O     . ALA D  2 102 ? -18.944 -21.272 -100.125 1.00 50.31  ? 1016 ALA D O     1 
ATOM   7020 C  CB    . ALA D  2 102 ? -20.339 -22.800 -97.809  1.00 48.67  ? 1016 ALA D CB    1 
ATOM   7021 N  N     . ALA D  2 103 ? -18.408 -20.101 -98.274  1.00 48.88  ? 1017 ALA D N     1 
ATOM   7022 C  CA    . ALA D  2 103 ? -17.085 -19.687 -98.741  1.00 45.68  ? 1017 ALA D CA    1 
ATOM   7023 C  C     . ALA D  2 103 ? -16.142 -20.884 -98.718  1.00 46.12  ? 1017 ALA D C     1 
ATOM   7024 O  O     . ALA D  2 103 ? -15.524 -21.185 -97.697  1.00 53.31  ? 1017 ALA D O     1 
ATOM   7025 C  CB    . ALA D  2 103 ? -16.550 -18.551 -97.874  1.00 43.55  ? 1017 ALA D CB    1 
ATOM   7026 N  N     . VAL D  2 104 ? -16.012 -21.550 -99.865  1.00 47.76  ? 1018 VAL D N     1 
ATOM   7027 C  CA    . VAL D  2 104 ? -15.198 -22.761 -99.970  1.00 51.98  ? 1018 VAL D CA    1 
ATOM   7028 C  C     . VAL D  2 104 ? -13.780 -22.520 -99.458  1.00 54.86  ? 1018 VAL D C     1 
ATOM   7029 O  O     . VAL D  2 104 ? -13.224 -23.335 -98.712  1.00 52.28  ? 1018 VAL D O     1 
ATOM   7030 C  CB    . VAL D  2 104 ? -15.191 -23.258 -101.428 1.00 56.22  ? 1018 VAL D CB    1 
ATOM   7031 C  CG1   . VAL D  2 104 ? -14.126 -24.325 -101.636 1.00 52.59  ? 1018 VAL D CG1   1 
ATOM   7032 C  CG2   . VAL D  2 104 ? -16.575 -23.776 -101.816 1.00 57.65  ? 1018 VAL D CG2   1 
ATOM   7033 N  N     . PHE D  2 105 ? -13.160 -21.414 -99.876  1.00 56.82  ? 1019 PHE D N     1 
ATOM   7034 C  CA    . PHE D  2 105 ? -11.775 -21.119 -99.528  1.00 55.52  ? 1019 PHE D CA    1 
ATOM   7035 C  C     . PHE D  2 105 ? -11.650 -20.238 -98.296  1.00 56.83  ? 1019 PHE D C     1 
ATOM   7036 O  O     . PHE D  2 105 ? -10.614 -19.588 -98.118  1.00 59.64  ? 1019 PHE D O     1 
ATOM   7037 C  CB    . PHE D  2 105 ? -11.053 -20.461 -100.707 1.00 57.53  ? 1019 PHE D CB    1 
ATOM   7038 C  CG    . PHE D  2 105 ? -10.754 -21.402 -101.835 1.00 57.04  ? 1019 PHE D CG    1 
ATOM   7039 C  CD1   . PHE D  2 105 ? -9.643  -22.229 -101.788 1.00 56.96  ? 1019 PHE D CD1   1 
ATOM   7040 C  CD2   . PHE D  2 105 ? -11.592 -21.469 -102.936 1.00 57.04  ? 1019 PHE D CD2   1 
ATOM   7041 C  CE1   . PHE D  2 105 ? -9.367  -23.103 -102.817 1.00 60.12  ? 1019 PHE D CE1   1 
ATOM   7042 C  CE2   . PHE D  2 105 ? -11.326 -22.343 -103.971 1.00 60.69  ? 1019 PHE D CE2   1 
ATOM   7043 C  CZ    . PHE D  2 105 ? -10.208 -23.160 -103.914 1.00 62.65  ? 1019 PHE D CZ    1 
ATOM   7044 N  N     . ALA D  2 106 ? -12.678 -20.184 -97.454  1.00 59.99  ? 1020 ALA D N     1 
ATOM   7045 C  CA    . ALA D  2 106 ? -12.563 -19.466 -96.192  1.00 54.60  ? 1020 ALA D CA    1 
ATOM   7046 C  C     . ALA D  2 106 ? -11.541 -20.160 -95.305  1.00 59.33  ? 1020 ALA D C     1 
ATOM   7047 O  O     . ALA D  2 106 ? -11.565 -21.385 -95.155  1.00 64.47  ? 1020 ALA D O     1 
ATOM   7048 C  CB    . ALA D  2 106 ? -13.913 -19.396 -95.485  1.00 50.12  ? 1020 ALA D CB    1 
ATOM   7049 N  N     . MET D  2 107 ? -10.645 -19.382 -94.717  1.00 61.38  ? 1021 MET D N     1 
ATOM   7050 C  CA    . MET D  2 107 ? -9.562  -19.931 -93.920  1.00 70.42  ? 1021 MET D CA    1 
ATOM   7051 C  C     . MET D  2 107 ? -9.707  -19.516 -92.466  1.00 69.34  ? 1021 MET D C     1 
ATOM   7052 O  O     . MET D  2 107 ? -10.201 -18.429 -92.157  1.00 70.35  ? 1021 MET D O     1 
ATOM   7053 C  CB    . MET D  2 107 ? -8.203  -19.474 -94.449  1.00 79.07  ? 1021 MET D CB    1 
ATOM   7054 C  CG    . MET D  2 107 ? -8.148  -19.359 -95.952  1.00 82.69  ? 1021 MET D CG    1 
ATOM   7055 S  SD    . MET D  2 107 ? -6.502  -18.896 -96.503  1.00 87.44  ? 1021 MET D SD    1 
ATOM   7056 C  CE    . MET D  2 107 ? -5.724  -20.503 -96.648  1.00 89.09  ? 1021 MET D CE    1 
ATOM   7057 N  N     . THR D  2 108 ? -9.272  -20.401 -91.576  1.00 70.20  ? 1022 THR D N     1 
ATOM   7058 C  CA    . THR D  2 108 ? -9.225  -20.086 -90.159  1.00 70.88  ? 1022 THR D CA    1 
ATOM   7059 C  C     . THR D  2 108 ? -8.009  -19.211 -89.863  1.00 75.06  ? 1022 THR D C     1 
ATOM   7060 O  O     . THR D  2 108 ? -7.080  -19.098 -90.668  1.00 77.19  ? 1022 THR D O     1 
ATOM   7061 C  CB    . THR D  2 108 ? -9.191  -21.367 -89.327  1.00 70.59  ? 1022 THR D CB    1 
ATOM   7062 O  OG1   . THR D  2 108 ? -8.238  -22.276 -89.889  1.00 74.03  ? 1022 THR D OG1   1 
ATOM   7063 C  CG2   . THR D  2 108 ? -10.562 -22.027 -89.317  1.00 66.71  ? 1022 THR D CG2   1 
ATOM   7064 N  N     . TYR D  2 109 ? -8.017  -18.588 -88.685  1.00 76.48  ? 1023 TYR D N     1 
ATOM   7065 C  CA    . TYR D  2 109 ? -7.044  -17.545 -88.374  1.00 79.96  ? 1023 TYR D CA    1 
ATOM   7066 C  C     . TYR D  2 109 ? -5.713  -18.107 -87.877  1.00 84.74  ? 1023 TYR D C     1 
ATOM   7067 O  O     . TYR D  2 109 ? -4.657  -17.786 -88.432  1.00 83.37  ? 1023 TYR D O     1 
ATOM   7068 C  CB    . TYR D  2 109 ? -7.629  -16.573 -87.342  1.00 77.76  ? 1023 TYR D CB    1 
ATOM   7069 C  CG    . TYR D  2 109 ? -8.909  -15.902 -87.794  1.00 73.25  ? 1023 TYR D CG    1 
ATOM   7070 C  CD1   . TYR D  2 109 ? -9.204  -15.765 -89.148  1.00 71.82  ? 1023 TYR D CD1   1 
ATOM   7071 C  CD2   . TYR D  2 109 ? -9.824  -15.409 -86.866  1.00 69.78  ? 1023 TYR D CD2   1 
ATOM   7072 C  CE1   . TYR D  2 109 ? -10.372 -15.161 -89.567  1.00 70.96  ? 1023 TYR D CE1   1 
ATOM   7073 C  CE2   . TYR D  2 109 ? -10.999 -14.802 -87.274  1.00 67.97  ? 1023 TYR D CE2   1 
ATOM   7074 C  CZ    . TYR D  2 109 ? -11.265 -14.680 -88.627  1.00 71.86  ? 1023 TYR D CZ    1 
ATOM   7075 O  OH    . TYR D  2 109 ? -12.428 -14.078 -89.050  1.00 74.23  ? 1023 TYR D OH    1 
ATOM   7076 N  N     . SER D  2 110 ? -5.743  -18.945 -86.837  1.00 88.25  ? 1024 SER D N     1 
ATOM   7077 C  CA    . SER D  2 110 ? -4.503  -19.388 -86.205  1.00 92.93  ? 1024 SER D CA    1 
ATOM   7078 C  C     . SER D  2 110 ? -3.655  -20.282 -87.105  1.00 96.02  ? 1024 SER D C     1 
ATOM   7079 O  O     . SER D  2 110 ? -2.439  -20.364 -86.900  1.00 96.37  ? 1024 SER D O     1 
ATOM   7080 C  CB    . SER D  2 110 ? -4.811  -20.123 -84.899  1.00 93.48  ? 1024 SER D CB    1 
ATOM   7081 O  OG    . SER D  2 110 ? -5.475  -21.352 -85.146  1.00 94.47  ? 1024 SER D OG    1 
ATOM   7082 N  N     . ASP D  2 111 ? -4.257  -20.944 -88.097  1.00 96.58  ? 1025 ASP D N     1 
ATOM   7083 C  CA    . ASP D  2 111 ? -3.544  -21.927 -88.904  1.00 94.16  ? 1025 ASP D CA    1 
ATOM   7084 C  C     . ASP D  2 111 ? -3.675  -21.734 -90.405  1.00 92.89  ? 1025 ASP D C     1 
ATOM   7085 O  O     . ASP D  2 111 ? -2.957  -22.411 -91.149  1.00 93.84  ? 1025 ASP D O     1 
ATOM   7086 C  CB    . ASP D  2 111 ? -4.022  -23.346 -88.561  1.00 93.35  ? 1025 ASP D CB    1 
ATOM   7087 C  CG    . ASP D  2 111 ? -5.527  -23.442 -88.481  1.00 91.67  ? 1025 ASP D CG    1 
ATOM   7088 O  OD1   . ASP D  2 111 ? -6.195  -23.067 -89.465  1.00 91.86  ? 1025 ASP D OD1   1 
ATOM   7089 O  OD2   . ASP D  2 111 ? -6.042  -23.877 -87.431  1.00 91.10  ? 1025 ASP D OD2   1 
ATOM   7090 N  N     . MET D  2 112 ? -4.569  -20.863 -90.873  1.00 93.25  ? 1026 MET D N     1 
ATOM   7091 C  CA    . MET D  2 112 ? -4.776  -20.625 -92.303  1.00 92.72  ? 1026 MET D CA    1 
ATOM   7092 C  C     . MET D  2 112 ? -5.203  -21.905 -93.022  1.00 87.05  ? 1026 MET D C     1 
ATOM   7093 O  O     . MET D  2 112 ? -4.675  -22.259 -94.078  1.00 87.38  ? 1026 MET D O     1 
ATOM   7094 C  CB    . MET D  2 112 ? -3.524  -20.023 -92.950  1.00 96.49  ? 1026 MET D CB    1 
ATOM   7095 C  CG    . MET D  2 112 ? -3.808  -18.888 -93.916  1.00 98.79  ? 1026 MET D CG    1 
ATOM   7096 S  SD    . MET D  2 112 ? -3.895  -17.285 -93.094  1.00 101.59 ? 1026 MET D SD    1 
ATOM   7097 C  CE    . MET D  2 112 ? -2.218  -17.126 -92.483  1.00 102.65 ? 1026 MET D CE    1 
ATOM   7098 N  N     . GLN D  2 113 ? -6.175  -22.603 -92.436  1.00 79.04  ? 1027 GLN D N     1 
ATOM   7099 C  CA    . GLN D  2 113 ? -6.714  -23.832 -93.001  1.00 71.51  ? 1027 GLN D CA    1 
ATOM   7100 C  C     . GLN D  2 113 ? -8.139  -23.608 -93.488  1.00 65.88  ? 1027 GLN D C     1 
ATOM   7101 O  O     . GLN D  2 113 ? -8.904  -22.854 -92.879  1.00 61.50  ? 1027 GLN D O     1 
ATOM   7102 C  CB    . GLN D  2 113 ? -6.695  -24.969 -91.977  1.00 71.25  ? 1027 GLN D CB    1 
ATOM   7103 C  CG    . GLN D  2 113 ? -5.312  -25.397 -91.525  1.00 73.96  ? 1027 GLN D CG    1 
ATOM   7104 C  CD    . GLN D  2 113 ? -5.368  -26.492 -90.473  1.00 75.05  ? 1027 GLN D CD    1 
ATOM   7105 O  OE1   . GLN D  2 113 ? -6.308  -26.562 -89.684  1.00 74.00  ? 1027 GLN D OE1   1 
ATOM   7106 N  NE2   . GLN D  2 113 ? -4.358  -27.350 -90.457  1.00 78.85  ? 1027 GLN D NE2   1 
ATOM   7107 N  N     . THR D  2 114 ? -8.490  -24.261 -94.592  1.00 64.92  ? 1028 THR D N     1 
ATOM   7108 C  CA    . THR D  2 114 ? -9.856  -24.235 -95.086  1.00 61.32  ? 1028 THR D CA    1 
ATOM   7109 C  C     . THR D  2 114 ? -10.656 -25.378 -94.461  1.00 58.61  ? 1028 THR D C     1 
ATOM   7110 O  O     . THR D  2 114 ? -10.147 -26.165 -93.660  1.00 56.79  ? 1028 THR D O     1 
ATOM   7111 C  CB    . THR D  2 114 ? -9.892  -24.337 -96.610  1.00 57.26  ? 1028 THR D CB    1 
ATOM   7112 O  OG1   . THR D  2 114 ? -9.411  -25.624 -97.009  1.00 53.18  ? 1028 THR D OG1   1 
ATOM   7113 C  CG2   . THR D  2 114 ? -9.027  -23.261 -97.241  1.00 64.01  ? 1028 THR D CG2   1 
ATOM   7114 N  N     . ALA D  2 115 ? -11.932 -25.469 -94.842  1.00 57.05  ? 1029 ALA D N     1 
ATOM   7115 C  CA    . ALA D  2 115 ? -12.780 -26.544 -94.339  1.00 55.65  ? 1029 ALA D CA    1 
ATOM   7116 C  C     . ALA D  2 115 ? -12.244 -27.907 -94.756  1.00 59.23  ? 1029 ALA D C     1 
ATOM   7117 O  O     . ALA D  2 115 ? -12.212 -28.841 -93.946  1.00 59.03  ? 1029 ALA D O     1 
ATOM   7118 C  CB    . ALA D  2 115 ? -14.217 -26.355 -94.828  1.00 49.16  ? 1029 ALA D CB    1 
ATOM   7119 N  N     . ALA D  2 116 ? -11.804 -28.036 -96.013  1.00 59.49  ? 1030 ALA D N     1 
ATOM   7120 C  CA    . ALA D  2 116 ? -11.235 -29.295 -96.480  1.00 56.08  ? 1030 ALA D CA    1 
ATOM   7121 C  C     . ALA D  2 116 ? -10.101 -29.759 -95.577  1.00 55.47  ? 1030 ALA D C     1 
ATOM   7122 O  O     . ALA D  2 116 ? -9.971  -30.955 -95.290  1.00 58.11  ? 1030 ALA D O     1 
ATOM   7123 C  CB    . ALA D  2 116 ? -10.743 -29.151 -97.919  1.00 61.39  ? 1030 ALA D CB    1 
ATOM   7124 N  N     . ASP D  2 117 ? -9.283  -28.822 -95.097  1.00 56.83  ? 1031 ASP D N     1 
ATOM   7125 C  CA    . ASP D  2 117 ? -8.190  -29.173 -94.198  1.00 59.36  ? 1031 ASP D CA    1 
ATOM   7126 C  C     . ASP D  2 117 ? -8.667  -29.602 -92.814  1.00 56.11  ? 1031 ASP D C     1 
ATOM   7127 O  O     . ASP D  2 117 ? -7.856  -30.114 -92.037  1.00 58.40  ? 1031 ASP D O     1 
ATOM   7128 C  CB    . ASP D  2 117 ? -7.224  -27.994 -94.066  1.00 60.75  ? 1031 ASP D CB    1 
ATOM   7129 C  CG    . ASP D  2 117 ? -6.718  -27.496 -95.412  1.00 61.75  ? 1031 ASP D CG    1 
ATOM   7130 O  OD1   . ASP D  2 117 ? -6.592  -28.311 -96.350  1.00 62.32  ? 1031 ASP D OD1   1 
ATOM   7131 O  OD2   . ASP D  2 117 ? -6.450  -26.286 -95.532  1.00 62.58  ? 1031 ASP D OD2   1 
ATOM   7132 N  N     . LYS D  2 118 ? -9.946  -29.414 -92.484  1.00 53.01  ? 1032 LYS D N     1 
ATOM   7133 C  CA    . LYS D  2 118 ? -10.439 -29.742 -91.154  1.00 55.25  ? 1032 LYS D CA    1 
ATOM   7134 C  C     . LYS D  2 118 ? -10.995 -31.155 -91.045  1.00 56.77  ? 1032 LYS D C     1 
ATOM   7135 O  O     . LYS D  2 118 ? -11.296 -31.596 -89.931  1.00 45.94  ? 1032 LYS D O     1 
ATOM   7136 C  CB    . LYS D  2 118 ? -11.520 -28.745 -90.722  1.00 51.06  ? 1032 LYS D CB    1 
ATOM   7137 C  CG    . LYS D  2 118 ? -11.000 -27.336 -90.516  1.00 55.96  ? 1032 LYS D CG    1 
ATOM   7138 C  CD    . LYS D  2 118 ? -9.908  -27.306 -89.468  1.00 63.39  ? 1032 LYS D CD    1 
ATOM   7139 C  CE    . LYS D  2 118 ? -9.416  -25.887 -89.216  1.00 68.91  ? 1032 LYS D CE    1 
ATOM   7140 N  NZ    . LYS D  2 118 ? -8.513  -25.827 -88.027  1.00 72.03  ? 1032 LYS D NZ    1 
ATOM   7141 N  N     . CYS D  2 119 ? -11.154 -31.865 -92.159  1.00 56.34  ? 1033 CYS D N     1 
ATOM   7142 C  CA    . CYS D  2 119 ? -11.675 -33.223 -92.096  1.00 53.03  ? 1033 CYS D CA    1 
ATOM   7143 C  C     . CYS D  2 119 ? -10.753 -34.087 -91.243  1.00 53.42  ? 1033 CYS D C     1 
ATOM   7144 O  O     . CYS D  2 119 ? -9.527  -33.962 -91.302  1.00 49.00  ? 1033 CYS D O     1 
ATOM   7145 C  CB    . CYS D  2 119 ? -11.827 -33.804 -93.505  1.00 49.21  ? 1033 CYS D CB    1 
ATOM   7146 S  SG    . CYS D  2 119 ? -13.045 -32.935 -94.559  1.00 48.84  ? 1033 CYS D SG    1 
ATOM   7147 N  N     . GLU D  2 120 ? -11.352 -34.951 -90.428  1.00 56.12  ? 1034 GLU D N     1 
ATOM   7148 C  CA    . GLU D  2 120 ? -10.619 -35.654 -89.382  1.00 57.87  ? 1034 GLU D CA    1 
ATOM   7149 C  C     . GLU D  2 120 ? -10.098 -36.983 -89.913  1.00 54.71  ? 1034 GLU D C     1 
ATOM   7150 O  O     . GLU D  2 120 ? -10.878 -37.894 -90.213  1.00 50.31  ? 1034 GLU D O     1 
ATOM   7151 C  CB    . GLU D  2 120 ? -11.496 -35.862 -88.149  1.00 56.96  ? 1034 GLU D CB    1 
ATOM   7152 C  CG    . GLU D  2 120 ? -11.733 -34.590 -87.325  1.00 60.84  ? 1034 GLU D CG    1 
ATOM   7153 C  CD    . GLU D  2 120 ? -10.449 -33.960 -86.790  1.00 67.37  ? 1034 GLU D CD    1 
ATOM   7154 O  OE1   . GLU D  2 120 ? -9.497  -34.701 -86.466  1.00 70.52  ? 1034 GLU D OE1   1 
ATOM   7155 O  OE2   . GLU D  2 120 ? -10.396 -32.713 -86.687  1.00 68.18  ? 1034 GLU D OE2   1 
ATOM   7156 N  N     . GLU D  2 121 ? -8.770  -37.081 -89.993  1.00 58.95  ? 1035 GLU D N     1 
ATOM   7157 C  CA    . GLU D  2 121 ? -8.076  -38.232 -90.564  1.00 61.30  ? 1035 GLU D CA    1 
ATOM   7158 C  C     . GLU D  2 121 ? -8.596  -39.567 -90.033  1.00 60.99  ? 1035 GLU D C     1 
ATOM   7159 O  O     . GLU D  2 121 ? -8.817  -40.507 -90.807  1.00 58.47  ? 1035 GLU D O     1 
ATOM   7160 C  CB    . GLU D  2 121 ? -6.586  -38.090 -90.257  1.00 67.35  ? 1035 GLU D CB    1 
ATOM   7161 C  CG    . GLU D  2 121 ? -5.655  -38.692 -91.256  1.00 73.63  ? 1035 GLU D CG    1 
ATOM   7162 C  CD    . GLU D  2 121 ? -4.205  -38.556 -90.834  1.00 78.66  ? 1035 GLU D CD    1 
ATOM   7163 O  OE1   . GLU D  2 121 ? -3.377  -39.393 -91.263  1.00 78.75  ? 1035 GLU D OE1   1 
ATOM   7164 O  OE2   . GLU D  2 121 ? -3.895  -37.607 -90.075  1.00 78.13  ? 1035 GLU D OE2   1 
ATOM   7165 N  N     . MET D  2 122 ? -8.788  -39.678 -88.719  1.00 56.58  ? 1036 MET D N     1 
ATOM   7166 C  CA    . MET D  2 122 ? -9.029  -40.970 -88.087  1.00 56.84  ? 1036 MET D CA    1 
ATOM   7167 C  C     . MET D  2 122 ? -10.493 -41.254 -87.787  1.00 52.92  ? 1036 MET D C     1 
ATOM   7168 O  O     . MET D  2 122 ? -10.787 -42.264 -87.139  1.00 52.06  ? 1036 MET D O     1 
ATOM   7169 C  CB    . MET D  2 122 ? -8.223  -41.085 -86.793  1.00 59.30  ? 1036 MET D CB    1 
ATOM   7170 C  CG    . MET D  2 122 ? -6.775  -40.681 -86.938  1.00 66.83  ? 1036 MET D CG    1 
ATOM   7171 S  SD    . MET D  2 122 ? -5.767  -42.000 -87.637  1.00 72.87  ? 1036 MET D SD    1 
ATOM   7172 C  CE    . MET D  2 122 ? -6.070  -43.337 -86.482  1.00 71.30  ? 1036 MET D CE    1 
ATOM   7173 N  N     . GLU D  2 123 ? -11.414 -40.412 -88.234  1.00 51.89  ? 1037 GLU D N     1 
ATOM   7174 C  CA    . GLU D  2 123 ? -12.831 -40.629 -87.986  1.00 50.42  ? 1037 GLU D CA    1 
ATOM   7175 C  C     . GLU D  2 123 ? -13.514 -41.074 -89.267  1.00 50.87  ? 1037 GLU D C     1 
ATOM   7176 O  O     . GLU D  2 123 ? -13.029 -40.826 -90.372  1.00 56.17  ? 1037 GLU D O     1 
ATOM   7177 C  CB    . GLU D  2 123 ? -13.495 -39.362 -87.450  1.00 48.52  ? 1037 GLU D CB    1 
ATOM   7178 C  CG    . GLU D  2 123 ? -12.698 -38.647 -86.367  1.00 54.70  ? 1037 GLU D CG    1 
ATOM   7179 C  CD    . GLU D  2 123 ? -12.638 -39.420 -85.066  1.00 65.70  ? 1037 GLU D CD    1 
ATOM   7180 O  OE1   . GLU D  2 123 ? -13.519 -40.280 -84.838  1.00 66.32  ? 1037 GLU D OE1   1 
ATOM   7181 O  OE2   . GLU D  2 123 ? -11.713 -39.158 -84.263  1.00 71.16  ? 1037 GLU D OE2   1 
ATOM   7182 N  N     . GLU D  2 124 ? -14.656 -41.733 -89.111  1.00 51.90  ? 1038 GLU D N     1 
ATOM   7183 C  CA    . GLU D  2 124 ? -15.341 -42.257 -90.278  1.00 57.35  ? 1038 GLU D CA    1 
ATOM   7184 C  C     . GLU D  2 124 ? -15.896 -41.115 -91.128  1.00 53.54  ? 1038 GLU D C     1 
ATOM   7185 O  O     . GLU D  2 124 ? -16.090 -39.989 -90.661  1.00 51.76  ? 1038 GLU D O     1 
ATOM   7186 C  CB    . GLU D  2 124 ? -16.448 -43.222 -89.861  1.00 65.89  ? 1038 GLU D CB    1 
ATOM   7187 C  CG    . GLU D  2 124 ? -17.743 -42.569 -89.446  1.00 77.14  ? 1038 GLU D CG    1 
ATOM   7188 C  CD    . GLU D  2 124 ? -18.884 -43.572 -89.325  1.00 86.05  ? 1038 GLU D CD    1 
ATOM   7189 O  OE1   . GLU D  2 124 ? -18.660 -44.776 -89.596  1.00 85.29  ? 1038 GLU D OE1   1 
ATOM   7190 O  OE2   . GLU D  2 124 ? -20.002 -43.154 -88.950  1.00 90.37  ? 1038 GLU D OE2   1 
ATOM   7191 N  N     . GLY D  2 125 ? -16.129 -41.415 -92.404  1.00 48.70  ? 1039 GLY D N     1 
ATOM   7192 C  CA    . GLY D  2 125 ? -16.577 -40.404 -93.336  1.00 48.56  ? 1039 GLY D CA    1 
ATOM   7193 C  C     . GLY D  2 125 ? -15.487 -39.497 -93.852  1.00 48.54  ? 1039 GLY D C     1 
ATOM   7194 O  O     . GLY D  2 125 ? -15.773 -38.601 -94.655  1.00 46.08  ? 1039 GLY D O     1 
ATOM   7195 N  N     . TYR D  2 126 ? -14.242 -39.721 -93.431  1.00 47.95  ? 1040 TYR D N     1 
ATOM   7196 C  CA    . TYR D  2 126 ? -13.146 -38.829 -93.793  1.00 51.00  ? 1040 TYR D CA    1 
ATOM   7197 C  C     . TYR D  2 126 ? -12.888 -38.826 -95.296  1.00 49.31  ? 1040 TYR D C     1 
ATOM   7198 O  O     . TYR D  2 126 ? -12.668 -37.762 -95.885  1.00 45.24  ? 1040 TYR D O     1 
ATOM   7199 C  CB    . TYR D  2 126 ? -11.885 -39.238 -93.030  1.00 52.86  ? 1040 TYR D CB    1 
ATOM   7200 C  CG    . TYR D  2 126 ? -10.603 -38.644 -93.567  1.00 51.62  ? 1040 TYR D CG    1 
ATOM   7201 C  CD1   . TYR D  2 126 ? -10.351 -37.281 -93.468  1.00 50.22  ? 1040 TYR D CD1   1 
ATOM   7202 C  CD2   . TYR D  2 126 ? -9.634  -39.452 -94.149  1.00 55.32  ? 1040 TYR D CD2   1 
ATOM   7203 C  CE1   . TYR D  2 126 ? -9.178  -36.737 -93.950  1.00 53.66  ? 1040 TYR D CE1   1 
ATOM   7204 C  CE2   . TYR D  2 126 ? -8.457  -38.921 -94.632  1.00 58.38  ? 1040 TYR D CE2   1 
ATOM   7205 C  CZ    . TYR D  2 126 ? -8.234  -37.562 -94.532  1.00 57.17  ? 1040 TYR D CZ    1 
ATOM   7206 O  OH    . TYR D  2 126 ? -7.061  -37.034 -95.017  1.00 57.88  ? 1040 TYR D OH    1 
ATOM   7207 N  N     . THR D  2 127 ? -12.896 -40.004 -95.931  1.00 50.35  ? 1041 THR D N     1 
ATOM   7208 C  CA    . THR D  2 127 ? -12.548 -40.077 -97.349  1.00 50.11  ? 1041 THR D CA    1 
ATOM   7209 C  C     . THR D  2 127 ? -13.548 -39.305 -98.200  1.00 53.99  ? 1041 THR D C     1 
ATOM   7210 O  O     . THR D  2 127 ? -13.166 -38.479 -99.039  1.00 53.29  ? 1041 THR D O     1 
ATOM   7211 C  CB    . THR D  2 127 ? -12.481 -41.529 -97.819  1.00 44.79  ? 1041 THR D CB    1 
ATOM   7212 O  OG1   . THR D  2 127 ? -11.704 -42.308 -96.899  1.00 46.31  ? 1041 THR D OG1   1 
ATOM   7213 C  CG2   . THR D  2 127 ? -11.852 -41.607 -99.213  1.00 46.46  ? 1041 THR D CG2   1 
ATOM   7214 N  N     . GLN D  2 128 ? -14.838 -39.574 -98.005  1.00 52.55  ? 1042 GLN D N     1 
ATOM   7215 C  CA    . GLN D  2 128 ? -15.848 -38.929 -98.831  1.00 51.39  ? 1042 GLN D CA    1 
ATOM   7216 C  C     . GLN D  2 128 ? -15.893 -37.429 -98.575  1.00 47.47  ? 1042 GLN D C     1 
ATOM   7217 O  O     . GLN D  2 128 ? -16.016 -36.638 -99.516  1.00 46.90  ? 1042 GLN D O     1 
ATOM   7218 C  CB    . GLN D  2 128 ? -17.211 -39.565 -98.573  1.00 55.12  ? 1042 GLN D CB    1 
ATOM   7219 C  CG    . GLN D  2 128 ? -18.310 -39.008 -99.449  1.00 63.35  ? 1042 GLN D CG    1 
ATOM   7220 C  CD    . GLN D  2 128 ? -19.577 -39.833 -99.387  1.00 70.02  ? 1042 GLN D CD    1 
ATOM   7221 O  OE1   . GLN D  2 128 ? -19.715 -40.718 -98.542  1.00 66.31  ? 1042 GLN D OE1   1 
ATOM   7222 N  NE2   . GLN D  2 128 ? -20.509 -39.552 -100.292 1.00 73.54  ? 1042 GLN D NE2   1 
ATOM   7223 N  N     . CYS D  2 129 ? -15.775 -37.012 -97.313  1.00 44.72  ? 1043 CYS D N     1 
ATOM   7224 C  CA    . CYS D  2 129 ? -15.916 -35.594 -97.011  1.00 46.26  ? 1043 CYS D CA    1 
ATOM   7225 C  C     . CYS D  2 129 ? -14.720 -34.799 -97.519  1.00 47.44  ? 1043 CYS D C     1 
ATOM   7226 O  O     . CYS D  2 129 ? -14.888 -33.727 -98.110  1.00 44.07  ? 1043 CYS D O     1 
ATOM   7227 C  CB    . CYS D  2 129 ? -16.106 -35.371 -95.510  1.00 50.14  ? 1043 CYS D CB    1 
ATOM   7228 S  SG    . CYS D  2 129 ? -16.752 -33.716 -95.150  1.00 52.39  ? 1043 CYS D SG    1 
ATOM   7229 N  N     . SER D  2 130 ? -13.503 -35.302 -97.305  1.00 43.51  ? 1044 SER D N     1 
ATOM   7230 C  CA    . SER D  2 130 ? -12.334 -34.553 -97.755  1.00 53.25  ? 1044 SER D CA    1 
ATOM   7231 C  C     . SER D  2 130 ? -12.224 -34.560 -99.277  1.00 54.38  ? 1044 SER D C     1 
ATOM   7232 O  O     . SER D  2 130 ? -11.811 -33.560 -99.876  1.00 54.59  ? 1044 SER D O     1 
ATOM   7233 C  CB    . SER D  2 130 ? -11.061 -35.105 -97.118  1.00 48.59  ? 1044 SER D CB    1 
ATOM   7234 O  OG    . SER D  2 130 ? -10.915 -36.479 -97.399  1.00 48.42  ? 1044 SER D OG    1 
ATOM   7235 N  N     . GLN D  2 131 ? -12.607 -35.663 -99.924  1.00 49.57  ? 1045 GLN D N     1 
ATOM   7236 C  CA    . GLN D  2 131 ? -12.539 -35.690 -101.384 1.00 49.87  ? 1045 GLN D CA    1 
ATOM   7237 C  C     . GLN D  2 131 ? -13.593 -34.783 -102.006 1.00 50.68  ? 1045 GLN D C     1 
ATOM   7238 O  O     . GLN D  2 131 ? -13.359 -34.203 -103.073 1.00 50.71  ? 1045 GLN D O     1 
ATOM   7239 C  CB    . GLN D  2 131 ? -12.682 -37.122 -101.902 1.00 44.14  ? 1045 GLN D CB    1 
ATOM   7240 C  CG    . GLN D  2 131 ? -11.412 -37.934 -101.740 1.00 47.12  ? 1045 GLN D CG    1 
ATOM   7241 C  CD    . GLN D  2 131 ? -11.588 -39.386 -102.127 1.00 51.39  ? 1045 GLN D CD    1 
ATOM   7242 O  OE1   . GLN D  2 131 ? -12.703 -39.909 -102.137 1.00 52.63  ? 1045 GLN D OE1   1 
ATOM   7243 N  NE2   . GLN D  2 131 ? -10.484 -40.049 -102.441 1.00 50.84  ? 1045 GLN D NE2   1 
ATOM   7244 N  N     . PHE D  2 132 ? -14.748 -34.637 -101.357 1.00 50.20  ? 1046 PHE D N     1 
ATOM   7245 C  CA    . PHE D  2 132 ? -15.732 -33.678 -101.841 1.00 49.03  ? 1046 PHE D CA    1 
ATOM   7246 C  C     . PHE D  2 132 ? -15.191 -32.258 -101.757 1.00 47.38  ? 1046 PHE D C     1 
ATOM   7247 O  O     . PHE D  2 132 ? -15.247 -31.502 -102.732 1.00 51.49  ? 1046 PHE D O     1 
ATOM   7248 C  CB    . PHE D  2 132 ? -17.038 -33.790 -101.048 1.00 49.94  ? 1046 PHE D CB    1 
ATOM   7249 C  CG    . PHE D  2 132 ? -18.017 -32.694 -101.367 1.00 51.83  ? 1046 PHE D CG    1 
ATOM   7250 C  CD1   . PHE D  2 132 ? -18.729 -32.713 -102.562 1.00 51.02  ? 1046 PHE D CD1   1 
ATOM   7251 C  CD2   . PHE D  2 132 ? -18.206 -31.636 -100.494 1.00 50.22  ? 1046 PHE D CD2   1 
ATOM   7252 C  CE1   . PHE D  2 132 ? -19.623 -31.700 -102.878 1.00 47.09  ? 1046 PHE D CE1   1 
ATOM   7253 C  CE2   . PHE D  2 132 ? -19.098 -30.620 -100.795 1.00 49.41  ? 1046 PHE D CE2   1 
ATOM   7254 C  CZ    . PHE D  2 132 ? -19.806 -30.653 -101.991 1.00 54.79  ? 1046 PHE D CZ    1 
ATOM   7255 N  N     . LEU D  2 133 ? -14.657 -31.883 -100.596 1.00 45.34  ? 1047 LEU D N     1 
ATOM   7256 C  CA    . LEU D  2 133 ? -14.244 -30.500 -100.378 1.00 45.20  ? 1047 LEU D CA    1 
ATOM   7257 C  C     . LEU D  2 133 ? -12.996 -30.163 -101.181 1.00 49.10  ? 1047 LEU D C     1 
ATOM   7258 O  O     . LEU D  2 133 ? -12.931 -29.104 -101.819 1.00 48.41  ? 1047 LEU D O     1 
ATOM   7259 C  CB    . LEU D  2 133 ? -14.019 -30.251 -98.886  1.00 43.22  ? 1047 LEU D CB    1 
ATOM   7260 C  CG    . LEU D  2 133 ? -15.292 -30.120 -98.039  1.00 47.81  ? 1047 LEU D CG    1 
ATOM   7261 C  CD1   . LEU D  2 133 ? -14.968 -29.810 -96.582  1.00 47.58  ? 1047 LEU D CD1   1 
ATOM   7262 C  CD2   . LEU D  2 133 ? -16.217 -29.048 -98.604  1.00 44.26  ? 1047 LEU D CD2   1 
ATOM   7263 N  N     . TYR D  2 134 ? -11.989 -31.041 -101.157 1.00 49.21  ? 1048 TYR D N     1 
ATOM   7264 C  CA    . TYR D  2 134 ? -10.828 -30.818 -102.010 1.00 54.00  ? 1048 TYR D CA    1 
ATOM   7265 C  C     . TYR D  2 134 ? -11.234 -30.833 -103.478 1.00 55.65  ? 1048 TYR D C     1 
ATOM   7266 O  O     . TYR D  2 134 ? -10.749 -30.016 -104.271 1.00 55.89  ? 1048 TYR D O     1 
ATOM   7267 C  CB    . TYR D  2 134 ? -9.746  -31.861 -101.721 1.00 55.69  ? 1048 TYR D CB    1 
ATOM   7268 C  CG    . TYR D  2 134 ? -8.942  -31.550 -100.476 1.00 54.24  ? 1048 TYR D CG    1 
ATOM   7269 C  CD1   . TYR D  2 134 ? -8.196  -30.380 -100.388 1.00 55.15  ? 1048 TYR D CD1   1 
ATOM   7270 C  CD2   . TYR D  2 134 ? -8.937  -32.419 -99.386  1.00 52.72  ? 1048 TYR D CD2   1 
ATOM   7271 C  CE1   . TYR D  2 134 ? -7.463  -30.078 -99.254  1.00 55.79  ? 1048 TYR D CE1   1 
ATOM   7272 C  CE2   . TYR D  2 134 ? -8.203  -32.126 -98.238  1.00 54.06  ? 1048 TYR D CE2   1 
ATOM   7273 C  CZ    . TYR D  2 134 ? -7.467  -30.951 -98.184  1.00 56.78  ? 1048 TYR D CZ    1 
ATOM   7274 O  OH    . TYR D  2 134 ? -6.731  -30.639 -97.064  1.00 59.21  ? 1048 TYR D OH    1 
ATOM   7275 N  N     . GLY D  2 135 ? -12.161 -31.725 -103.844 1.00 54.04  ? 1049 GLY D N     1 
ATOM   7276 C  CA    . GLY D  2 135 ? -12.668 -31.742 -105.209 1.00 56.50  ? 1049 GLY D CA    1 
ATOM   7277 C  C     . GLY D  2 135 ? -13.352 -30.446 -105.602 1.00 57.14  ? 1049 GLY D C     1 
ATOM   7278 O  O     . GLY D  2 135 ? -13.214 -29.979 -106.735 1.00 58.36  ? 1049 GLY D O     1 
ATOM   7279 N  N     . VAL D  2 136 ? -14.102 -29.848 -104.674 1.00 54.20  ? 1050 VAL D N     1 
ATOM   7280 C  CA    . VAL D  2 136 ? -14.730 -28.563 -104.958 1.00 57.60  ? 1050 VAL D CA    1 
ATOM   7281 C  C     . VAL D  2 136 ? -13.673 -27.477 -105.092 1.00 60.14  ? 1050 VAL D C     1 
ATOM   7282 O  O     . VAL D  2 136 ? -13.764 -26.613 -105.971 1.00 55.85  ? 1050 VAL D O     1 
ATOM   7283 C  CB    . VAL D  2 136 ? -15.765 -28.213 -103.874 1.00 56.82  ? 1050 VAL D CB    1 
ATOM   7284 C  CG1   . VAL D  2 136 ? -16.121 -26.734 -103.938 1.00 55.32  ? 1050 VAL D CG1   1 
ATOM   7285 C  CG2   . VAL D  2 136 ? -17.008 -29.067 -104.040 1.00 55.73  ? 1050 VAL D CG2   1 
ATOM   7286 N  N     . GLN D  2 137 ? -12.651 -27.508 -104.231 1.00 60.96  ? 1051 GLN D N     1 
ATOM   7287 C  CA    . GLN D  2 137 ? -11.553 -26.556 -104.352 1.00 60.47  ? 1051 GLN D CA    1 
ATOM   7288 C  C     . GLN D  2 137 ? -10.838 -26.693 -105.691 1.00 64.78  ? 1051 GLN D C     1 
ATOM   7289 O  O     . GLN D  2 137 ? -10.331 -25.699 -106.225 1.00 59.66  ? 1051 GLN D O     1 
ATOM   7290 C  CB    . GLN D  2 137 ? -10.561 -26.746 -103.207 1.00 57.41  ? 1051 GLN D CB    1 
ATOM   7291 C  CG    . GLN D  2 137 ? -11.087 -26.339 -101.850 1.00 59.31  ? 1051 GLN D CG    1 
ATOM   7292 C  CD    . GLN D  2 137 ? -10.010 -26.374 -100.784 1.00 58.86  ? 1051 GLN D CD    1 
ATOM   7293 O  OE1   . GLN D  2 137 ? -8.879  -26.784 -101.039 1.00 60.20  ? 1051 GLN D OE1   1 
ATOM   7294 N  NE2   . GLN D  2 137 ? -10.359 -25.948 -99.580  1.00 55.46  ? 1051 GLN D NE2   1 
ATOM   7295 N  N     . GLU D  2 138 ? -10.794 -27.909 -106.246 1.00 69.69  ? 1052 GLU D N     1 
ATOM   7296 C  CA    . GLU D  2 138 ? -10.100 -28.159 -107.505 1.00 71.15  ? 1052 GLU D CA    1 
ATOM   7297 C  C     . GLU D  2 138 ? -10.908 -27.669 -108.699 1.00 66.77  ? 1052 GLU D C     1 
ATOM   7298 O  O     . GLU D  2 138 ? -10.378 -26.986 -109.580 1.00 71.53  ? 1052 GLU D O     1 
ATOM   7299 C  CB    . GLU D  2 138 ? -9.814  -29.656 -107.660 1.00 77.04  ? 1052 GLU D CB    1 
ATOM   7300 C  CG    . GLU D  2 138 ? -8.636  -30.170 -106.860 1.00 86.17  ? 1052 GLU D CG    1 
ATOM   7301 C  CD    . GLU D  2 138 ? -8.626  -31.686 -106.767 1.00 94.82  ? 1052 GLU D CD    1 
ATOM   7302 O  OE1   . GLU D  2 138 ? -9.423  -32.336 -107.481 1.00 97.57  ? 1052 GLU D OE1   1 
ATOM   7303 O  OE2   . GLU D  2 138 ? -7.824  -32.231 -105.979 1.00 97.44  ? 1052 GLU D OE2   1 
ATOM   7304 N  N     . LYS D  2 139 ? -12.180 -28.033 -108.759 1.00 61.79  ? 1053 LYS D N     1 
ATOM   7305 C  CA    . LYS D  2 139 ? -13.007 -27.769 -109.926 1.00 64.39  ? 1053 LYS D CA    1 
ATOM   7306 C  C     . LYS D  2 139 ? -13.791 -26.465 -109.820 1.00 63.52  ? 1053 LYS D C     1 
ATOM   7307 O  O     . LYS D  2 139 ? -14.547 -26.130 -110.741 1.00 64.33  ? 1053 LYS D O     1 
ATOM   7308 C  CB    . LYS D  2 139 ? -13.961 -28.949 -110.162 1.00 67.44  ? 1053 LYS D CB    1 
ATOM   7309 C  CG    . LYS D  2 139 ? -13.254 -30.263 -110.510 1.00 70.54  ? 1053 LYS D CG    1 
ATOM   7310 C  CD    . LYS D  2 139 ? -12.211 -30.061 -111.603 1.00 77.25  ? 1053 LYS D CD    1 
ATOM   7311 C  CE    . LYS D  2 139 ? -11.755 -31.382 -112.218 1.00 82.38  ? 1053 LYS D CE    1 
ATOM   7312 N  NZ    . LYS D  2 139 ? -12.791 -31.990 -113.104 1.00 83.56  ? 1053 LYS D NZ    1 
ATOM   7313 N  N     . MET D  2 140 ? -13.625 -25.725 -108.730 1.00 60.65  ? 1054 MET D N     1 
ATOM   7314 C  CA    . MET D  2 140 ? -14.258 -24.422 -108.599 1.00 58.29  ? 1054 MET D CA    1 
ATOM   7315 C  C     . MET D  2 140 ? -13.737 -23.462 -109.664 1.00 56.07  ? 1054 MET D C     1 
ATOM   7316 O  O     . MET D  2 140 ? -12.529 -23.241 -109.774 1.00 57.27  ? 1054 MET D O     1 
ATOM   7317 C  CB    . MET D  2 140 ? -13.987 -23.862 -107.212 1.00 57.58  ? 1054 MET D CB    1 
ATOM   7318 C  CG    . MET D  2 140 ? -14.703 -22.598 -106.937 1.00 59.30  ? 1054 MET D CG    1 
ATOM   7319 S  SD    . MET D  2 140 ? -15.026 -22.480 -105.185 1.00 62.61  ? 1054 MET D SD    1 
ATOM   7320 C  CE    . MET D  2 140 ? -15.624 -20.798 -105.114 1.00 58.91  ? 1054 MET D CE    1 
ATOM   7321 N  N     . GLY D  2 141 ? -14.650 -22.879 -110.439 1.00 51.14  ? 1055 GLY D N     1 
ATOM   7322 C  CA    . GLY D  2 141 ? -14.271 -22.034 -111.550 1.00 51.48  ? 1055 GLY D CA    1 
ATOM   7323 C  C     . GLY D  2 141 ? -13.996 -22.784 -112.832 1.00 59.87  ? 1055 GLY D C     1 
ATOM   7324 O  O     . GLY D  2 141 ? -13.615 -22.157 -113.833 1.00 51.98  ? 1055 GLY D O     1 
ATOM   7325 N  N     . ILE D  2 142 ? -14.155 -24.110 -112.822 1.00 54.66  ? 1056 ILE D N     1 
ATOM   7326 C  CA    . ILE D  2 142 ? -14.041 -24.950 -114.008 1.00 55.65  ? 1056 ILE D CA    1 
ATOM   7327 C  C     . ILE D  2 142 ? -15.351 -25.673 -114.292 1.00 53.68  ? 1056 ILE D C     1 
ATOM   7328 O  O     . ILE D  2 142 ? -15.908 -25.571 -115.391 1.00 54.45  ? 1056 ILE D O     1 
ATOM   7329 C  CB    . ILE D  2 142 ? -12.877 -25.958 -113.870 1.00 61.06  ? 1056 ILE D CB    1 
ATOM   7330 C  CG1   . ILE D  2 142 ? -11.565 -25.225 -113.578 1.00 61.10  ? 1056 ILE D CG1   1 
ATOM   7331 C  CG2   . ILE D  2 142 ? -12.745 -26.810 -115.130 1.00 58.43  ? 1056 ILE D CG2   1 
ATOM   7332 C  CD1   . ILE D  2 142 ? -10.418 -26.149 -113.263 1.00 55.07  ? 1056 ILE D CD1   1 
ATOM   7333 N  N     . MET D  2 143 ? -15.865 -26.405 -113.309 1.00 56.22  ? 1057 MET D N     1 
ATOM   7334 C  CA    . MET D  2 143 ? -17.176 -27.019 -113.427 1.00 57.17  ? 1057 MET D CA    1 
ATOM   7335 C  C     . MET D  2 143 ? -18.255 -25.945 -113.567 1.00 58.63  ? 1057 MET D C     1 
ATOM   7336 O  O     . MET D  2 143 ? -18.010 -24.745 -113.389 1.00 53.81  ? 1057 MET D O     1 
ATOM   7337 C  CB    . MET D  2 143 ? -17.469 -27.904 -112.212 1.00 55.51  ? 1057 MET D CB    1 
ATOM   7338 C  CG    . MET D  2 143 ? -17.585 -27.147 -110.892 1.00 59.37  ? 1057 MET D CG    1 
ATOM   7339 S  SD    . MET D  2 143 ? -18.047 -28.191 -109.486 1.00 61.79  ? 1057 MET D SD    1 
ATOM   7340 C  CE    . MET D  2 143 ? -16.729 -27.802 -108.334 1.00 62.14  ? 1057 MET D CE    1 
ATOM   7341 N  N     . ASN D  2 144 ? -19.473 -26.402 -113.875 1.00 58.45  ? 1058 ASN D N     1 
ATOM   7342 C  CA    . ASN D  2 144 ? -20.638 -25.529 -114.018 1.00 54.51  ? 1058 ASN D CA    1 
ATOM   7343 C  C     . ASN D  2 144 ? -20.354 -24.394 -114.996 1.00 55.09  ? 1058 ASN D C     1 
ATOM   7344 O  O     . ASN D  2 144 ? -20.802 -23.262 -114.811 1.00 51.09  ? 1058 ASN D O     1 
ATOM   7345 C  CB    . ASN D  2 144 ? -21.087 -24.981 -112.661 1.00 55.33  ? 1058 ASN D CB    1 
ATOM   7346 C  CG    . ASN D  2 144 ? -21.567 -26.074 -111.727 1.00 59.90  ? 1058 ASN D CG    1 
ATOM   7347 O  OD1   . ASN D  2 144 ? -21.958 -27.149 -112.178 1.00 59.47  ? 1058 ASN D OD1   1 
ATOM   7348 N  ND2   . ASN D  2 144 ? -21.554 -25.802 -110.421 1.00 57.64  ? 1058 ASN D ND2   1 
ATOM   7349 N  N     . LYS D  2 145 ? -19.592 -24.707 -116.043 1.00 56.75  ? 1059 LYS D N     1 
ATOM   7350 C  CA    . LYS D  2 145 ? -19.156 -23.726 -117.032 1.00 58.13  ? 1059 LYS D CA    1 
ATOM   7351 C  C     . LYS D  2 145 ? -18.379 -22.585 -116.378 1.00 56.43  ? 1059 LYS D C     1 
ATOM   7352 O  O     . LYS D  2 145 ? -18.420 -21.444 -116.835 1.00 58.26  ? 1059 LYS D O     1 
ATOM   7353 C  CB    . LYS D  2 145 ? -20.343 -23.200 -117.844 1.00 63.57  ? 1059 LYS D CB    1 
ATOM   7354 C  CG    . LYS D  2 145 ? -21.155 -24.303 -118.524 1.00 67.73  ? 1059 LYS D CG    1 
ATOM   7355 C  CD    . LYS D  2 145 ? -22.199 -23.733 -119.483 1.00 71.29  ? 1059 LYS D CD    1 
ATOM   7356 N  N     . GLY D  2 146 ? -17.665 -22.892 -115.297 1.00 57.07  ? 1060 GLY D N     1 
ATOM   7357 C  CA    . GLY D  2 146 ? -16.857 -21.916 -114.595 1.00 58.00  ? 1060 GLY D CA    1 
ATOM   7358 C  C     . GLY D  2 146 ? -17.635 -20.833 -113.875 1.00 57.77  ? 1060 GLY D C     1 
ATOM   7359 O  O     . GLY D  2 146 ? -17.057 -19.827 -113.448 1.00 51.70  ? 1060 GLY D O     1 
ATOM   7360 N  N     . VAL D  2 147 ? -18.941 -21.026 -113.727 1.00 51.37  ? 1061 VAL D N     1 
ATOM   7361 C  CA    . VAL D  2 147 ? -19.795 -20.001 -113.136 1.00 57.73  ? 1061 VAL D CA    1 
ATOM   7362 C  C     . VAL D  2 147 ? -19.603 -19.994 -111.623 1.00 55.37  ? 1061 VAL D C     1 
ATOM   7363 O  O     . VAL D  2 147 ? -19.581 -21.050 -110.978 1.00 50.80  ? 1061 VAL D O     1 
ATOM   7364 C  CB    . VAL D  2 147 ? -21.264 -20.225 -113.523 1.00 54.97  ? 1061 VAL D CB    1 
ATOM   7365 C  CG1   . VAL D  2 147 ? -22.158 -19.226 -112.818 1.00 51.01  ? 1061 VAL D CG1   1 
ATOM   7366 C  CG2   . VAL D  2 147 ? -21.421 -20.090 -115.032 1.00 51.39  ? 1061 VAL D CG2   1 
ATOM   7367 N  N     . ILE D  2 148 ? -19.456 -18.792 -111.058 1.00 53.84  ? 1062 ILE D N     1 
ATOM   7368 C  CA    . ILE D  2 148 ? -19.107 -18.591 -109.658 1.00 50.91  ? 1062 ILE D CA    1 
ATOM   7369 C  C     . ILE D  2 148 ? -19.874 -17.374 -109.154 1.00 50.88  ? 1062 ILE D C     1 
ATOM   7370 O  O     . ILE D  2 148 ? -20.388 -16.573 -109.937 1.00 54.62  ? 1062 ILE D O     1 
ATOM   7371 C  CB    . ILE D  2 148 ? -17.577 -18.409 -109.491 1.00 59.22  ? 1062 ILE D CB    1 
ATOM   7372 C  CG1   . ILE D  2 148 ? -17.100 -19.122 -108.247 1.00 66.74  ? 1062 ILE D CG1   1 
ATOM   7373 C  CG2   . ILE D  2 148 ? -17.163 -16.930 -109.499 1.00 58.55  ? 1062 ILE D CG2   1 
ATOM   7374 C  CD1   . ILE D  2 148 ? -17.039 -20.598 -108.447 1.00 69.76  ? 1062 ILE D CD1   1 
ATOM   7375 N  N     . TYR D  2 149 ? -19.950 -17.233 -107.832 1.00 50.66  ? 1063 TYR D N     1 
ATOM   7376 C  CA    . TYR D  2 149 ? -20.751 -16.180 -107.216 1.00 50.60  ? 1063 TYR D CA    1 
ATOM   7377 C  C     . TYR D  2 149 ? -19.968 -15.487 -106.110 1.00 51.85  ? 1063 TYR D C     1 
ATOM   7378 O  O     . TYR D  2 149 ? -19.273 -16.138 -105.323 1.00 50.47  ? 1063 TYR D O     1 
ATOM   7379 C  CB    . TYR D  2 149 ? -22.071 -16.734 -106.649 1.00 56.88  ? 1063 TYR D CB    1 
ATOM   7380 C  CG    . TYR D  2 149 ? -22.965 -17.355 -107.703 1.00 62.43  ? 1063 TYR D CG    1 
ATOM   7381 C  CD1   . TYR D  2 149 ? -22.788 -18.676 -108.097 1.00 62.69  ? 1063 TYR D CD1   1 
ATOM   7382 C  CD2   . TYR D  2 149 ? -23.977 -16.619 -108.311 1.00 60.63  ? 1063 TYR D CD2   1 
ATOM   7383 C  CE1   . TYR D  2 149 ? -23.592 -19.249 -109.064 1.00 61.73  ? 1063 TYR D CE1   1 
ATOM   7384 C  CE2   . TYR D  2 149 ? -24.793 -17.190 -109.275 1.00 60.47  ? 1063 TYR D CE2   1 
ATOM   7385 C  CZ    . TYR D  2 149 ? -24.594 -18.506 -109.645 1.00 60.16  ? 1063 TYR D CZ    1 
ATOM   7386 O  OH    . TYR D  2 149 ? -25.387 -19.094 -110.602 1.00 62.47  ? 1063 TYR D OH    1 
ATOM   7387 N  N     . ALA D  2 150 ? -20.078 -14.158 -106.074 1.00 50.76  ? 1064 ALA D N     1 
ATOM   7388 C  CA    . ALA D  2 150 ? -19.473 -13.354 -105.021 1.00 50.77  ? 1064 ALA D CA    1 
ATOM   7389 C  C     . ALA D  2 150 ? -20.308 -13.450 -103.753 1.00 57.74  ? 1064 ALA D C     1 
ATOM   7390 O  O     . ALA D  2 150 ? -21.525 -13.244 -103.783 1.00 52.99  ? 1064 ALA D O     1 
ATOM   7391 C  CB    . ALA D  2 150 ? -19.359 -11.894 -105.456 1.00 51.06  ? 1064 ALA D CB    1 
ATOM   7392 N  N     . LEU D  2 151 ? -19.652 -13.753 -102.637 1.00 59.02  ? 1065 LEU D N     1 
ATOM   7393 C  CA    . LEU D  2 151 ? -20.330 -13.883 -101.357 1.00 58.31  ? 1065 LEU D CA    1 
ATOM   7394 C  C     . LEU D  2 151 ? -20.211 -12.629 -100.496 1.00 61.12  ? 1065 LEU D C     1 
ATOM   7395 O  O     . LEU D  2 151 ? -20.899 -12.531 -99.475  1.00 63.85  ? 1065 LEU D O     1 
ATOM   7396 C  CB    . LEU D  2 151 ? -19.791 -15.109 -100.601 1.00 49.79  ? 1065 LEU D CB    1 
ATOM   7397 C  CG    . LEU D  2 151 ? -19.879 -16.423 -101.389 1.00 56.87  ? 1065 LEU D CG    1 
ATOM   7398 C  CD1   . LEU D  2 151 ? -19.116 -17.566 -100.717 1.00 49.55  ? 1065 LEU D CD1   1 
ATOM   7399 C  CD2   . LEU D  2 151 ? -21.333 -16.832 -101.644 1.00 49.54  ? 1065 LEU D CD2   1 
ATOM   7400 N  N     . TRP D  2 152 ? -19.380 -11.665 -100.888 1.00 59.42  ? 1066 TRP D N     1 
ATOM   7401 C  CA    . TRP D  2 152 ? -19.256 -10.402 -100.172 1.00 59.54  ? 1066 TRP D CA    1 
ATOM   7402 C  C     . TRP D  2 152 ? -19.102 -9.278  -101.186 1.00 64.31  ? 1066 TRP D C     1 
ATOM   7403 O  O     . TRP D  2 152 ? -18.816 -9.514  -102.361 1.00 67.85  ? 1066 TRP D O     1 
ATOM   7404 C  CB    . TRP D  2 152 ? -18.053 -10.399 -99.220  1.00 54.15  ? 1066 TRP D CB    1 
ATOM   7405 C  CG    . TRP D  2 152 ? -18.209 -11.212 -97.986  1.00 56.70  ? 1066 TRP D CG    1 
ATOM   7406 C  CD1   . TRP D  2 152 ? -18.751 -10.809 -96.799  1.00 57.75  ? 1066 TRP D CD1   1 
ATOM   7407 C  CD2   . TRP D  2 152 ? -17.795 -12.572 -97.799  1.00 58.57  ? 1066 TRP D CD2   1 
ATOM   7408 N  NE1   . TRP D  2 152 ? -18.710 -11.841 -95.889  1.00 59.43  ? 1066 TRP D NE1   1 
ATOM   7409 C  CE2   . TRP D  2 152 ? -18.126 -12.932 -96.476  1.00 56.57  ? 1066 TRP D CE2   1 
ATOM   7410 C  CE3   . TRP D  2 152 ? -17.183 -13.523 -98.626  1.00 57.33  ? 1066 TRP D CE3   1 
ATOM   7411 C  CZ2   . TRP D  2 152 ? -17.868 -14.199 -95.959  1.00 56.33  ? 1066 TRP D CZ2   1 
ATOM   7412 C  CZ3   . TRP D  2 152 ? -16.922 -14.783 -98.109  1.00 59.06  ? 1066 TRP D CZ3   1 
ATOM   7413 C  CH2   . TRP D  2 152 ? -17.266 -15.110 -96.787  1.00 59.44  ? 1066 TRP D CH2   1 
ATOM   7414 N  N     . ASP D  2 153 ? -19.285 -8.043  -100.725 1.00 65.25  ? 1067 ASP D N     1 
ATOM   7415 C  CA    . ASP D  2 153 ? -18.904 -6.889  -101.527 1.00 61.38  ? 1067 ASP D CA    1 
ATOM   7416 C  C     . ASP D  2 153 ? -17.384 -6.750  -101.533 1.00 62.15  ? 1067 ASP D C     1 
ATOM   7417 O  O     . ASP D  2 153 ? -16.699 -7.211  -100.615 1.00 65.11  ? 1067 ASP D O     1 
ATOM   7418 C  CB    . ASP D  2 153 ? -19.545 -5.612  -100.984 1.00 60.72  ? 1067 ASP D CB    1 
ATOM   7419 C  CG    . ASP D  2 153 ? -21.052 -5.600  -101.144 1.00 65.61  ? 1067 ASP D CG    1 
ATOM   7420 O  OD1   . ASP D  2 153 ? -21.572 -6.403  -101.943 1.00 65.51  ? 1067 ASP D OD1   1 
ATOM   7421 O  OD2   . ASP D  2 153 ? -21.714 -4.786  -100.467 1.00 67.08  ? 1067 ASP D OD2   1 
ATOM   7422 N  N     . TYR D  2 154 ? -16.852 -6.111  -102.576 1.00 63.08  ? 1068 TYR D N     1 
ATOM   7423 C  CA    . TYR D  2 154 ? -15.413 -5.859  -102.638 1.00 68.89  ? 1068 TYR D CA    1 
ATOM   7424 C  C     . TYR D  2 154 ? -15.159 -4.629  -103.497 1.00 70.03  ? 1068 TYR D C     1 
ATOM   7425 O  O     . TYR D  2 154 ? -15.359 -4.680  -104.712 1.00 72.65  ? 1068 TYR D O     1 
ATOM   7426 C  CB    . TYR D  2 154 ? -14.661 -7.068  -103.202 1.00 67.69  ? 1068 TYR D CB    1 
ATOM   7427 C  CG    . TYR D  2 154 ? -13.159 -6.874  -103.248 1.00 64.56  ? 1068 TYR D CG    1 
ATOM   7428 C  CD1   . TYR D  2 154 ? -12.420 -6.786  -102.071 1.00 60.47  ? 1068 TYR D CD1   1 
ATOM   7429 C  CD2   . TYR D  2 154 ? -12.482 -6.767  -104.460 1.00 67.26  ? 1068 TYR D CD2   1 
ATOM   7430 C  CE1   . TYR D  2 154 ? -11.049 -6.598  -102.099 1.00 63.03  ? 1068 TYR D CE1   1 
ATOM   7431 C  CE2   . TYR D  2 154 ? -11.108 -6.582  -104.501 1.00 71.95  ? 1068 TYR D CE2   1 
ATOM   7432 C  CZ    . TYR D  2 154 ? -10.396 -6.499  -103.310 1.00 70.07  ? 1068 TYR D CZ    1 
ATOM   7433 O  OH    . TYR D  2 154 ? -9.031  -6.313  -103.333 1.00 67.72  ? 1068 TYR D OH    1 
ATOM   7434 N  N     . GLU D  2 155 ? -14.703 -3.541  -102.896 1.00 73.92  ? 1069 GLU D N     1 
ATOM   7435 C  CA    . GLU D  2 155 ? -14.164 -2.472  -103.735 1.00 75.00  ? 1069 GLU D CA    1 
ATOM   7436 C  C     . GLU D  2 155 ? -12.721 -2.800  -104.111 1.00 74.51  ? 1069 GLU D C     1 
ATOM   7437 O  O     . GLU D  2 155 ? -11.937 -3.217  -103.251 1.00 75.48  ? 1069 GLU D O     1 
ATOM   7438 C  CB    . GLU D  2 155 ? -14.240 -1.103  -103.050 1.00 77.48  ? 1069 GLU D CB    1 
ATOM   7439 N  N     . PRO D  2 156 ? -12.347 -2.634  -105.375 1.00 70.76  ? 1070 PRO D N     1 
ATOM   7440 C  CA    . PRO D  2 156 ? -11.009 -3.038  -105.821 1.00 72.97  ? 1070 PRO D CA    1 
ATOM   7441 C  C     . PRO D  2 156 ? -9.916  -2.245  -105.117 1.00 70.33  ? 1070 PRO D C     1 
ATOM   7442 O  O     . PRO D  2 156 ? -10.088 -1.074  -104.768 1.00 58.52  ? 1070 PRO D O     1 
ATOM   7443 C  CB    . PRO D  2 156 ? -11.043 -2.756  -107.329 1.00 71.78  ? 1070 PRO D CB    1 
ATOM   7444 C  CG    . PRO D  2 156 ? -12.535 -2.731  -107.669 1.00 69.86  ? 1070 PRO D CG    1 
ATOM   7445 C  CD    . PRO D  2 156 ? -13.196 -2.156  -106.475 1.00 67.30  ? 1070 PRO D CD    1 
ATOM   7446 N  N     . GLN D  2 157 ? -8.805  -2.926  -104.853 1.00 75.28  ? 1071 GLN D N     1 
ATOM   7447 C  CA    . GLN D  2 157 ? -7.603  -2.295  -104.337 1.00 76.25  ? 1071 GLN D CA    1 
ATOM   7448 C  C     . GLN D  2 157 ? -6.549  -2.106  -105.417 1.00 79.12  ? 1071 GLN D C     1 
ATOM   7449 O  O     . GLN D  2 157 ? -5.564  -1.400  -105.183 1.00 82.07  ? 1071 GLN D O     1 
ATOM   7450 C  CB    . GLN D  2 157 ? -7.024  -3.120  -103.181 1.00 77.43  ? 1071 GLN D CB    1 
ATOM   7451 C  CG    . GLN D  2 157 ? -7.989  -3.326  -102.019 1.00 80.11  ? 1071 GLN D CG    1 
ATOM   7452 C  CD    . GLN D  2 157 ? -7.489  -4.365  -101.028 1.00 79.86  ? 1071 GLN D CD    1 
ATOM   7453 O  OE1   . GLN D  2 157 ? -6.313  -4.372  -100.666 1.00 82.94  ? 1071 GLN D OE1   1 
ATOM   7454 N  NE2   . GLN D  2 157 ? -8.377  -5.257  -100.601 1.00 73.35  ? 1071 GLN D NE2   1 
ATOM   7455 N  N     . ASN D  2 158 ? -6.740  -2.711  -106.587 1.00 80.64  ? 1072 ASN D N     1 
ATOM   7456 C  CA    . ASN D  2 158 ? -5.884  -2.511  -107.747 1.00 80.36  ? 1072 ASN D CA    1 
ATOM   7457 C  C     . ASN D  2 158 ? -6.756  -2.247  -108.970 1.00 84.33  ? 1072 ASN D C     1 
ATOM   7458 O  O     . ASN D  2 158 ? -7.966  -2.494  -108.963 1.00 84.86  ? 1072 ASN D O     1 
ATOM   7459 C  CB    . ASN D  2 158 ? -4.966  -3.719  -107.981 1.00 74.61  ? 1072 ASN D CB    1 
ATOM   7460 C  CG    . ASN D  2 158 ? -3.956  -3.905  -106.865 1.00 73.56  ? 1072 ASN D CG    1 
ATOM   7461 O  OD1   . ASN D  2 158 ? -2.865  -3.343  -106.903 1.00 77.15  ? 1072 ASN D OD1   1 
ATOM   7462 N  ND2   . ASN D  2 158 ? -4.316  -4.699  -105.865 1.00 68.95  ? 1072 ASN D ND2   1 
ATOM   7463 N  N     . ASP D  2 159 ? -6.127  -1.729  -110.031 1.00 85.34  ? 1073 ASP D N     1 
ATOM   7464 C  CA    . ASP D  2 159 ? -6.866  -1.374  -111.241 1.00 85.32  ? 1073 ASP D CA    1 
ATOM   7465 C  C     . ASP D  2 159 ? -7.358  -2.604  -111.997 1.00 80.17  ? 1073 ASP D C     1 
ATOM   7466 O  O     . ASP D  2 159 ? -8.361  -2.526  -112.718 1.00 81.15  ? 1073 ASP D O     1 
ATOM   7467 C  CB    . ASP D  2 159 ? -5.996  -0.517  -112.160 1.00 89.42  ? 1073 ASP D CB    1 
ATOM   7468 C  CG    . ASP D  2 159 ? -5.664  0.828   -111.557 1.00 94.99  ? 1073 ASP D CG    1 
ATOM   7469 O  OD1   . ASP D  2 159 ? -6.128  1.101   -110.429 1.00 94.53  ? 1073 ASP D OD1   1 
ATOM   7470 O  OD2   . ASP D  2 159 ? -4.941  1.612   -112.211 1.00 99.54  ? 1073 ASP D OD2   1 
ATOM   7471 N  N     . ASP D  2 160 ? -6.668  -3.736  -111.860 1.00 72.72  ? 1074 ASP D N     1 
ATOM   7472 C  CA    . ASP D  2 160 ? -7.020  -4.971  -112.550 1.00 67.19  ? 1074 ASP D CA    1 
ATOM   7473 C  C     . ASP D  2 160 ? -7.869  -5.903  -111.684 1.00 65.28  ? 1074 ASP D C     1 
ATOM   7474 O  O     . ASP D  2 160 ? -7.806  -7.127  -111.849 1.00 63.96  ? 1074 ASP D O     1 
ATOM   7475 C  CB    . ASP D  2 160 ? -5.752  -5.685  -113.021 1.00 66.78  ? 1074 ASP D CB    1 
ATOM   7476 C  CG    . ASP D  2 160 ? -4.824  -6.068  -111.868 1.00 70.49  ? 1074 ASP D CG    1 
ATOM   7477 O  OD1   . ASP D  2 160 ? -5.063  -5.635  -110.718 1.00 72.39  ? 1074 ASP D OD1   1 
ATOM   7478 O  OD2   . ASP D  2 160 ? -3.854  -6.811  -112.112 1.00 71.66  ? 1074 ASP D OD2   1 
ATOM   7479 N  N     . GLU D  2 161 ? -8.649  -5.353  -110.753 1.00 62.29  ? 1075 GLU D N     1 
ATOM   7480 C  CA    . GLU D  2 161 ? -9.515  -6.140  -109.881 1.00 63.64  ? 1075 GLU D CA    1 
ATOM   7481 C  C     . GLU D  2 161 ? -10.964 -5.763  -110.138 1.00 65.05  ? 1075 GLU D C     1 
ATOM   7482 O  O     . GLU D  2 161 ? -11.293 -4.575  -110.208 1.00 69.81  ? 1075 GLU D O     1 
ATOM   7483 C  CB    . GLU D  2 161 ? -9.176  -5.920  -108.402 1.00 61.96  ? 1075 GLU D CB    1 
ATOM   7484 C  CG    . GLU D  2 161 ? -7.830  -6.467  -107.984 1.00 64.96  ? 1075 GLU D CG    1 
ATOM   7485 C  CD    . GLU D  2 161 ? -7.475  -6.113  -106.553 1.00 67.83  ? 1075 GLU D CD    1 
ATOM   7486 O  OE1   . GLU D  2 161 ? -8.328  -5.529  -105.849 1.00 66.54  ? 1075 GLU D OE1   1 
ATOM   7487 O  OE2   . GLU D  2 161 ? -6.336  -6.410  -106.136 1.00 67.38  ? 1075 GLU D OE2   1 
ATOM   7488 N  N     . LEU D  2 162 ? -11.830 -6.770  -110.262 1.00 60.26  ? 1076 LEU D N     1 
ATOM   7489 C  CA    . LEU D  2 162 ? -13.235 -6.496  -110.528 1.00 59.29  ? 1076 LEU D CA    1 
ATOM   7490 C  C     . LEU D  2 162 ? -13.934 -6.008  -109.260 1.00 60.53  ? 1076 LEU D C     1 
ATOM   7491 O  O     . LEU D  2 162 ? -13.723 -6.565  -108.180 1.00 61.52  ? 1076 LEU D O     1 
ATOM   7492 C  CB    . LEU D  2 162 ? -13.940 -7.748  -111.042 1.00 57.82  ? 1076 LEU D CB    1 
ATOM   7493 C  CG    . LEU D  2 162 ? -13.711 -8.173  -112.487 1.00 60.01  ? 1076 LEU D CG    1 
ATOM   7494 C  CD1   . LEU D  2 162 ? -14.481 -9.449  -112.774 1.00 58.58  ? 1076 LEU D CD1   1 
ATOM   7495 C  CD2   . LEU D  2 162 ? -14.081 -7.065  -113.486 1.00 60.69  ? 1076 LEU D CD2   1 
ATOM   7496 N  N     . PRO D  2 163 ? -14.772 -4.975  -109.359 1.00 58.18  ? 1077 PRO D N     1 
ATOM   7497 C  CA    . PRO D  2 163 ? -15.671 -4.656  -108.243 1.00 59.12  ? 1077 PRO D CA    1 
ATOM   7498 C  C     . PRO D  2 163 ? -16.751 -5.723  -108.148 1.00 56.85  ? 1077 PRO D C     1 
ATOM   7499 O  O     . PRO D  2 163 ? -17.310 -6.150  -109.160 1.00 52.79  ? 1077 PRO D O     1 
ATOM   7500 C  CB    . PRO D  2 163 ? -16.256 -3.288  -108.624 1.00 53.31  ? 1077 PRO D CB    1 
ATOM   7501 C  CG    . PRO D  2 163 ? -15.501 -2.843  -109.830 1.00 53.68  ? 1077 PRO D CG    1 
ATOM   7502 C  CD    . PRO D  2 163 ? -14.981 -4.069  -110.495 1.00 53.66  ? 1077 PRO D CD    1 
ATOM   7503 N  N     . MET D  2 164 ? -17.026 -6.167  -106.926 1.00 55.83  ? 1078 MET D N     1 
ATOM   7504 C  CA    . MET D  2 164 ? -17.984 -7.233  -106.679 1.00 59.35  ? 1078 MET D CA    1 
ATOM   7505 C  C     . MET D  2 164 ? -19.080 -6.742  -105.747 1.00 59.58  ? 1078 MET D C     1 
ATOM   7506 O  O     . MET D  2 164 ? -18.793 -6.157  -104.696 1.00 62.01  ? 1078 MET D O     1 
ATOM   7507 C  CB    . MET D  2 164 ? -17.299 -8.466  -106.069 1.00 60.97  ? 1078 MET D CB    1 
ATOM   7508 C  CG    . MET D  2 164 ? -16.338 -9.202  -107.008 1.00 54.89  ? 1078 MET D CG    1 
ATOM   7509 S  SD    . MET D  2 164 ? -15.900 -10.847 -106.402 1.00 56.99  ? 1078 MET D SD    1 
ATOM   7510 C  CE    . MET D  2 164 ? -15.281 -10.495 -104.751 1.00 52.70  ? 1078 MET D CE    1 
ATOM   7511 N  N     . LYS D  2 165 ? -20.328 -6.985  -106.132 1.00 58.10  ? 1079 LYS D N     1 
ATOM   7512 C  CA    . LYS D  2 165 ? -21.450 -6.909  -105.209 1.00 62.64  ? 1079 LYS D CA    1 
ATOM   7513 C  C     . LYS D  2 165 ? -21.837 -8.322  -104.786 1.00 61.81  ? 1079 LYS D C     1 
ATOM   7514 O  O     . LYS D  2 165 ? -21.737 -9.267  -105.574 1.00 59.03  ? 1079 LYS D O     1 
ATOM   7515 C  CB    . LYS D  2 165 ? -22.643 -6.195  -105.845 1.00 66.90  ? 1079 LYS D CB    1 
ATOM   7516 N  N     . GLU D  2 166 ? -22.253 -8.466  -103.533 1.00 61.38  ? 1080 GLU D N     1 
ATOM   7517 C  CA    . GLU D  2 166 ? -22.678 -9.764  -103.037 1.00 58.08  ? 1080 GLU D CA    1 
ATOM   7518 C  C     . GLU D  2 166 ? -23.789 -10.319 -103.917 1.00 56.61  ? 1080 GLU D C     1 
ATOM   7519 O  O     . GLU D  2 166 ? -24.758 -9.620  -104.234 1.00 56.01  ? 1080 GLU D O     1 
ATOM   7520 C  CB    . GLU D  2 166 ? -23.145 -9.648  -101.586 1.00 62.02  ? 1080 GLU D CB    1 
ATOM   7521 C  CG    . GLU D  2 166 ? -23.598 -10.969 -100.972 1.00 63.18  ? 1080 GLU D CG    1 
ATOM   7522 C  CD    . GLU D  2 166 ? -25.104 -11.154 -101.026 1.00 68.01  ? 1080 GLU D CD    1 
ATOM   7523 O  OE1   . GLU D  2 166 ? -25.572 -12.098 -101.697 1.00 66.45  ? 1080 GLU D OE1   1 
ATOM   7524 O  OE2   . GLU D  2 166 ? -25.823 -10.350 -100.396 1.00 73.70  ? 1080 GLU D OE2   1 
ATOM   7525 N  N     . GLY D  2 167 ? -23.633 -11.575 -104.327 1.00 51.32  ? 1081 GLY D N     1 
ATOM   7526 C  CA    . GLY D  2 167 ? -24.572 -12.202 -105.229 1.00 53.91  ? 1081 GLY D CA    1 
ATOM   7527 C  C     . GLY D  2 167 ? -24.227 -12.088 -106.696 1.00 58.57  ? 1081 GLY D C     1 
ATOM   7528 O  O     . GLY D  2 167 ? -24.909 -12.714 -107.523 1.00 64.52  ? 1081 GLY D O     1 
ATOM   7529 N  N     . ASP D  2 168 ? -23.196 -11.316 -107.048 1.00 58.26  ? 1082 ASP D N     1 
ATOM   7530 C  CA    . ASP D  2 168 ? -22.784 -11.184 -108.444 1.00 55.62  ? 1082 ASP D CA    1 
ATOM   7531 C  C     . ASP D  2 168 ? -22.430 -12.542 -109.035 1.00 56.42  ? 1082 ASP D C     1 
ATOM   7532 O  O     . ASP D  2 168 ? -21.716 -13.338 -108.418 1.00 55.62  ? 1082 ASP D O     1 
ATOM   7533 C  CB    . ASP D  2 168 ? -21.583 -10.246 -108.562 1.00 59.19  ? 1082 ASP D CB    1 
ATOM   7534 C  CG    . ASP D  2 168 ? -21.989 -8.790  -108.653 1.00 65.97  ? 1082 ASP D CG    1 
ATOM   7535 O  OD1   . ASP D  2 168 ? -23.200 -8.522  -108.795 1.00 68.85  ? 1082 ASP D OD1   1 
ATOM   7536 O  OD2   . ASP D  2 168 ? -21.100 -7.916  -108.581 1.00 65.03  ? 1082 ASP D OD2   1 
ATOM   7537 N  N     . CYS D  2 169 ? -22.933 -12.800 -110.235 1.00 57.27  ? 1083 CYS D N     1 
ATOM   7538 C  CA    . CYS D  2 169 ? -22.680 -14.041 -110.951 1.00 54.70  ? 1083 CYS D CA    1 
ATOM   7539 C  C     . CYS D  2 169 ? -21.602 -13.780 -111.995 1.00 55.21  ? 1083 CYS D C     1 
ATOM   7540 O  O     . CYS D  2 169 ? -21.752 -12.882 -112.830 1.00 55.91  ? 1083 CYS D O     1 
ATOM   7541 C  CB    . CYS D  2 169 ? -23.964 -14.550 -111.605 1.00 60.54  ? 1083 CYS D CB    1 
ATOM   7542 S  SG    . CYS D  2 169 ? -23.811 -16.143 -112.431 1.00 62.02  ? 1083 CYS D SG    1 
ATOM   7543 N  N     . MET D  2 170 ? -20.519 -14.551 -111.944 1.00 55.11  ? 1084 MET D N     1 
ATOM   7544 C  CA    . MET D  2 170 ? -19.386 -14.319 -112.827 1.00 59.57  ? 1084 MET D CA    1 
ATOM   7545 C  C     . MET D  2 170 ? -18.854 -15.645 -113.351 1.00 56.70  ? 1084 MET D C     1 
ATOM   7546 O  O     . MET D  2 170 ? -19.168 -16.714 -112.826 1.00 53.04  ? 1084 MET D O     1 
ATOM   7547 C  CB    . MET D  2 170 ? -18.268 -13.534 -112.122 1.00 68.45  ? 1084 MET D CB    1 
ATOM   7548 C  CG    . MET D  2 170 ? -18.195 -13.744 -110.622 1.00 80.76  ? 1084 MET D CG    1 
ATOM   7549 S  SD    . MET D  2 170 ? -17.007 -12.646 -109.817 1.00 87.15  ? 1084 MET D SD    1 
ATOM   7550 C  CE    . MET D  2 170 ? -17.678 -11.045 -110.250 1.00 84.37  ? 1084 MET D CE    1 
ATOM   7551 N  N     . THR D  2 171 ? -18.044 -15.553 -114.405 1.00 52.64  ? 1085 THR D N     1 
ATOM   7552 C  CA    . THR D  2 171 ? -17.418 -16.700 -115.051 1.00 52.52  ? 1085 THR D CA    1 
ATOM   7553 C  C     . THR D  2 171 ? -15.908 -16.613 -114.873 1.00 52.16  ? 1085 THR D C     1 
ATOM   7554 O  O     . THR D  2 171 ? -15.304 -15.574 -115.158 1.00 51.95  ? 1085 THR D O     1 
ATOM   7555 C  CB    . THR D  2 171 ? -17.753 -16.753 -116.548 1.00 52.54  ? 1085 THR D CB    1 
ATOM   7556 O  OG1   . THR D  2 171 ? -19.172 -16.777 -116.732 1.00 52.87  ? 1085 THR D OG1   1 
ATOM   7557 C  CG2   . THR D  2 171 ? -17.132 -17.987 -117.197 1.00 52.43  ? 1085 THR D CG2   1 
ATOM   7558 N  N     . ILE D  2 172 ? -15.300 -17.708 -114.423 1.00 52.09  ? 1086 ILE D N     1 
ATOM   7559 C  CA    . ILE D  2 172 ? -13.856 -17.766 -114.212 1.00 51.76  ? 1086 ILE D CA    1 
ATOM   7560 C  C     . ILE D  2 172 ? -13.212 -18.051 -115.567 1.00 60.19  ? 1086 ILE D C     1 
ATOM   7561 O  O     . ILE D  2 172 ? -13.259 -19.178 -116.067 1.00 56.91  ? 1086 ILE D O     1 
ATOM   7562 C  CB    . ILE D  2 172 ? -13.479 -18.817 -113.164 1.00 51.78  ? 1086 ILE D CB    1 
ATOM   7563 C  CG1   . ILE D  2 172 ? -14.079 -18.440 -111.805 1.00 51.96  ? 1086 ILE D CG1   1 
ATOM   7564 C  CG2   . ILE D  2 172 ? -11.970 -18.986 -113.079 1.00 51.43  ? 1086 ILE D CG2   1 
ATOM   7565 C  CD1   . ILE D  2 172 ? -13.682 -17.058 -111.307 1.00 51.81  ? 1086 ILE D CD1   1 
ATOM   7566 N  N     . ILE D  2 173 ? -12.628 -17.015 -116.176 1.00 57.91  ? 1087 ILE D N     1 
ATOM   7567 C  CA    . ILE D  2 173 ? -11.954 -17.168 -117.461 1.00 51.15  ? 1087 ILE D CA    1 
ATOM   7568 C  C     . ILE D  2 173 ? -10.623 -17.891 -117.284 1.00 61.61  ? 1087 ILE D C     1 
ATOM   7569 O  O     . ILE D  2 173 ? -10.285 -18.793 -118.059 1.00 50.82  ? 1087 ILE D O     1 
ATOM   7570 C  CB    . ILE D  2 173 ? -11.780 -15.783 -118.123 1.00 53.22  ? 1087 ILE D CB    1 
ATOM   7571 C  CG1   . ILE D  2 173 ? -13.140 -15.098 -118.300 1.00 54.66  ? 1087 ILE D CG1   1 
ATOM   7572 C  CG2   . ILE D  2 173 ? -11.042 -15.878 -119.459 1.00 50.79  ? 1087 ILE D CG2   1 
ATOM   7573 C  CD1   . ILE D  2 173 ? -14.127 -15.870 -119.166 1.00 51.52  ? 1087 ILE D CD1   1 
ATOM   7574 N  N     . HIS D  2 174 ? -9.870  -17.538 -116.245 1.00 67.89  ? 1088 HIS D N     1 
ATOM   7575 C  CA    . HIS D  2 174 ? -8.523  -18.055 -116.042 1.00 75.24  ? 1088 HIS D CA    1 
ATOM   7576 C  C     . HIS D  2 174 ? -8.245  -18.096 -114.547 1.00 76.71  ? 1088 HIS D C     1 
ATOM   7577 O  O     . HIS D  2 174 ? -8.414  -17.081 -113.865 1.00 79.24  ? 1088 HIS D O     1 
ATOM   7578 C  CB    . HIS D  2 174 ? -7.497  -17.165 -116.761 1.00 83.79  ? 1088 HIS D CB    1 
ATOM   7579 C  CG    . HIS D  2 174 ? -6.184  -17.832 -117.026 1.00 91.16  ? 1088 HIS D CG    1 
ATOM   7580 N  ND1   . HIS D  2 174 ? -5.983  -18.687 -118.088 1.00 93.68  ? 1088 HIS D ND1   1 
ATOM   7581 C  CD2   . HIS D  2 174 ? -4.998  -17.752 -116.377 1.00 93.53  ? 1088 HIS D CD2   1 
ATOM   7582 C  CE1   . HIS D  2 174 ? -4.733  -19.116 -118.075 1.00 94.55  ? 1088 HIS D CE1   1 
ATOM   7583 N  NE2   . HIS D  2 174 ? -4.114  -18.562 -117.048 1.00 93.77  ? 1088 HIS D NE2   1 
ATOM   7584 N  N     . ARG D  2 175 ? -7.825  -19.256 -114.037 1.00 75.78  ? 1089 ARG D N     1 
ATOM   7585 C  CA    . ARG D  2 175 ? -7.558  -19.402 -112.613 1.00 78.01  ? 1089 ARG D CA    1 
ATOM   7586 C  C     . ARG D  2 175 ? -6.235  -20.114 -112.375 1.00 86.85  ? 1089 ARG D C     1 
ATOM   7587 O  O     . ARG D  2 175 ? -5.856  -21.015 -113.129 1.00 89.18  ? 1089 ARG D O     1 
ATOM   7588 C  CB    . ARG D  2 175 ? -8.701  -20.163 -111.898 1.00 74.47  ? 1089 ARG D CB    1 
ATOM   7589 C  CG    . ARG D  2 175 ? -8.739  -21.661 -112.138 1.00 68.03  ? 1089 ARG D CG    1 
ATOM   7590 C  CD    . ARG D  2 175 ? -9.556  -22.380 -111.070 1.00 64.45  ? 1089 ARG D CD    1 
ATOM   7591 N  NE    . ARG D  2 175 ? -8.719  -22.927 -110.004 1.00 59.29  ? 1089 ARG D NE    1 
ATOM   7592 C  CZ    . ARG D  2 175 ? -9.169  -23.685 -109.005 1.00 60.17  ? 1089 ARG D CZ    1 
ATOM   7593 N  NH1   . ARG D  2 175 ? -8.330  -24.128 -108.081 1.00 61.64  ? 1089 ARG D NH1   1 
ATOM   7594 N  NH2   . ARG D  2 175 ? -10.456 -23.999 -108.922 1.00 52.90  ? 1089 ARG D NH2   1 
ATOM   7595 N  N     . GLU D  2 176 ? -5.525  -19.670 -111.334 1.00 93.07  ? 1090 GLU D N     1 
ATOM   7596 C  CA    . GLU D  2 176 ? -4.392  -20.375 -110.730 1.00 101.39 ? 1090 GLU D CA    1 
ATOM   7597 C  C     . GLU D  2 176 ? -3.270  -20.682 -111.719 1.00 105.66 ? 1090 GLU D C     1 
ATOM   7598 O  O     . GLU D  2 176 ? -2.425  -21.539 -111.447 1.00 106.92 ? 1090 GLU D O     1 
ATOM   7599 C  CB    . GLU D  2 176 ? -4.852  -21.672 -110.051 1.00 104.05 ? 1090 GLU D CB    1 
ATOM   7600 N  N     . ASP D  2 177 ? -3.224  -19.998 -112.864 1.00 107.86 ? 1091 ASP D N     1 
ATOM   7601 C  CA    . ASP D  2 177 ? -2.199  -20.304 -113.855 1.00 111.55 ? 1091 ASP D CA    1 
ATOM   7602 C  C     . ASP D  2 177 ? -1.572  -19.049 -114.454 1.00 113.45 ? 1091 ASP D C     1 
ATOM   7603 O  O     . ASP D  2 177 ? -1.000  -19.116 -115.548 1.00 117.94 ? 1091 ASP D O     1 
ATOM   7604 C  CB    . ASP D  2 177 ? -2.772  -21.180 -114.976 1.00 114.15 ? 1091 ASP D CB    1 
ATOM   7605 N  N     . GLU D  2 178 ? -1.663  -17.909 -113.772 1.00 112.03 ? 1092 GLU D N     1 
ATOM   7606 C  CA    . GLU D  2 178 ? -1.120  -16.658 -114.280 1.00 109.09 ? 1092 GLU D CA    1 
ATOM   7607 C  C     . GLU D  2 178 ? -0.463  -15.896 -113.128 1.00 111.48 ? 1092 GLU D C     1 
ATOM   7608 O  O     . GLU D  2 178 ? -0.813  -14.762 -112.815 1.00 111.00 ? 1092 GLU D O     1 
ATOM   7609 C  CB    . GLU D  2 178 ? -2.206  -15.825 -114.959 1.00 103.82 ? 1092 GLU D CB    1 
ATOM   7610 N  N     . ASP D  2 179 ? 0.507   -16.546 -112.480 1.00 111.80 ? 1093 ASP D N     1 
ATOM   7611 C  CA    . ASP D  2 179 ? 1.280   -15.972 -111.378 1.00 111.82 ? 1093 ASP D CA    1 
ATOM   7612 C  C     . ASP D  2 179 ? 0.396   -15.491 -110.229 1.00 111.45 ? 1093 ASP D C     1 
ATOM   7613 O  O     . ASP D  2 179 ? 0.805   -14.627 -109.445 1.00 114.25 ? 1093 ASP D O     1 
ATOM   7614 C  CB    . ASP D  2 179 ? 2.178   -14.828 -111.867 1.00 112.32 ? 1093 ASP D CB    1 
ATOM   7615 N  N     . GLU D  2 180 ? -0.818  -16.029 -110.117 1.00 104.91 ? 1094 GLU D N     1 
ATOM   7616 C  CA    . GLU D  2 180 ? -1.733  -15.691 -109.027 1.00 94.57  ? 1094 GLU D CA    1 
ATOM   7617 C  C     . GLU D  2 180 ? -2.450  -16.977 -108.631 1.00 90.15  ? 1094 GLU D C     1 
ATOM   7618 O  O     . GLU D  2 180 ? -3.361  -17.430 -109.330 1.00 91.39  ? 1094 GLU D O     1 
ATOM   7619 C  CB    . GLU D  2 180 ? -2.722  -14.604 -109.432 1.00 90.62  ? 1094 GLU D CB    1 
ATOM   7620 C  CG    . GLU D  2 180 ? -2.108  -13.220 -109.616 1.00 89.92  ? 1094 GLU D CG    1 
ATOM   7621 C  CD    . GLU D  2 180 ? -1.820  -12.510 -108.306 1.00 89.67  ? 1094 GLU D CD    1 
ATOM   7622 O  OE1   . GLU D  2 180 ? -0.956  -12.983 -107.544 1.00 91.38  ? 1094 GLU D OE1   1 
ATOM   7623 O  OE2   . GLU D  2 180 ? -2.450  -11.466 -108.042 1.00 89.55  ? 1094 GLU D OE2   1 
ATOM   7624 N  N     . ILE D  2 181 ? -2.027  -17.567 -107.514 1.00 83.86  ? 1095 ILE D N     1 
ATOM   7625 C  CA    . ILE D  2 181 ? -2.656  -18.790 -107.034 1.00 78.08  ? 1095 ILE D CA    1 
ATOM   7626 C  C     . ILE D  2 181 ? -3.943  -18.510 -106.269 1.00 75.45  ? 1095 ILE D C     1 
ATOM   7627 O  O     . ILE D  2 181 ? -4.836  -19.363 -106.231 1.00 78.80  ? 1095 ILE D O     1 
ATOM   7628 C  CB    . ILE D  2 181 ? -1.678  -19.571 -106.153 1.00 75.28  ? 1095 ILE D CB    1 
ATOM   7629 N  N     . GLU D  2 182 ? -4.065  -17.331 -105.665 1.00 67.59  ? 1096 GLU D N     1 
ATOM   7630 C  CA    . GLU D  2 182 ? -5.213  -17.001 -104.836 1.00 62.54  ? 1096 GLU D CA    1 
ATOM   7631 C  C     . GLU D  2 182 ? -6.158  -15.995 -105.482 1.00 61.87  ? 1096 GLU D C     1 
ATOM   7632 O  O     . GLU D  2 182 ? -7.216  -15.706 -104.913 1.00 62.92  ? 1096 GLU D O     1 
ATOM   7633 C  CB    . GLU D  2 182 ? -4.739  -16.477 -103.476 1.00 62.88  ? 1096 GLU D CB    1 
ATOM   7634 C  CG    . GLU D  2 182 ? -4.106  -17.540 -102.590 1.00 66.18  ? 1096 GLU D CG    1 
ATOM   7635 C  CD    . GLU D  2 182 ? -3.891  -17.056 -101.165 1.00 70.70  ? 1096 GLU D CD    1 
ATOM   7636 O  OE1   . GLU D  2 182 ? -2.961  -16.257 -100.940 1.00 74.00  ? 1096 GLU D OE1   1 
ATOM   7637 O  OE2   . GLU D  2 182 ? -4.661  -17.466 -100.273 1.00 72.95  ? 1096 GLU D OE2   1 
ATOM   7638 N  N     . TRP D  2 183 ? -5.805  -15.448 -106.644 1.00 61.66  ? 1097 TRP D N     1 
ATOM   7639 C  CA    . TRP D  2 183 ? -6.683  -14.576 -107.410 1.00 60.36  ? 1097 TRP D CA    1 
ATOM   7640 C  C     . TRP D  2 183 ? -6.990  -15.231 -108.750 1.00 58.36  ? 1097 TRP D C     1 
ATOM   7641 O  O     . TRP D  2 183 ? -6.119  -15.869 -109.353 1.00 57.89  ? 1097 TRP D O     1 
ATOM   7642 C  CB    . TRP D  2 183 ? -6.049  -13.198 -107.621 1.00 62.27  ? 1097 TRP D CB    1 
ATOM   7643 C  CG    . TRP D  2 183 ? -5.901  -12.411 -106.347 1.00 59.75  ? 1097 TRP D CG    1 
ATOM   7644 C  CD1   . TRP D  2 183 ? -4.973  -12.608 -105.365 1.00 60.52  ? 1097 TRP D CD1   1 
ATOM   7645 C  CD2   . TRP D  2 183 ? -6.707  -11.305 -105.921 1.00 55.87  ? 1097 TRP D CD2   1 
ATOM   7646 N  NE1   . TRP D  2 183 ? -5.151  -11.692 -104.353 1.00 60.78  ? 1097 TRP D NE1   1 
ATOM   7647 C  CE2   . TRP D  2 183 ? -6.208  -10.880 -104.672 1.00 58.78  ? 1097 TRP D CE2   1 
ATOM   7648 C  CE3   . TRP D  2 183 ? -7.801  -10.634 -106.474 1.00 52.85  ? 1097 TRP D CE3   1 
ATOM   7649 C  CZ2   . TRP D  2 183 ? -6.771  -9.817  -103.965 1.00 59.55  ? 1097 TRP D CZ2   1 
ATOM   7650 C  CZ3   . TRP D  2 183 ? -8.355  -9.579  -105.776 1.00 52.93  ? 1097 TRP D CZ3   1 
ATOM   7651 C  CH2   . TRP D  2 183 ? -7.840  -9.178  -104.535 1.00 56.88  ? 1097 TRP D CH2   1 
ATOM   7652 N  N     . TRP D  2 184 ? -8.231  -15.079 -109.210 1.00 53.19  ? 1098 TRP D N     1 
ATOM   7653 C  CA    . TRP D  2 184 ? -8.698  -15.684 -110.450 1.00 52.69  ? 1098 TRP D CA    1 
ATOM   7654 C  C     . TRP D  2 184 ? -9.170  -14.608 -111.422 1.00 53.13  ? 1098 TRP D C     1 
ATOM   7655 O  O     . TRP D  2 184 ? -9.854  -13.654 -111.031 1.00 53.04  ? 1098 TRP D O     1 
ATOM   7656 C  CB    . TRP D  2 184 ? -9.834  -16.680 -110.188 1.00 52.57  ? 1098 TRP D CB    1 
ATOM   7657 C  CG    . TRP D  2 184 ? -9.435  -17.846 -109.319 1.00 60.30  ? 1098 TRP D CG    1 
ATOM   7658 C  CD1   . TRP D  2 184 ? -8.168  -18.205 -108.958 1.00 56.87  ? 1098 TRP D CD1   1 
ATOM   7659 C  CD2   . TRP D  2 184 ? -10.311 -18.810 -108.718 1.00 52.15  ? 1098 TRP D CD2   1 
ATOM   7660 N  NE1   . TRP D  2 184 ? -8.202  -19.326 -108.165 1.00 56.59  ? 1098 TRP D NE1   1 
ATOM   7661 C  CE2   . TRP D  2 184 ? -9.503  -19.719 -108.004 1.00 51.94  ? 1098 TRP D CE2   1 
ATOM   7662 C  CE3   . TRP D  2 184 ? -11.697 -18.990 -108.710 1.00 52.17  ? 1098 TRP D CE3   1 
ATOM   7663 C  CZ2   . TRP D  2 184 ? -10.035 -20.795 -107.288 1.00 51.93  ? 1098 TRP D CZ2   1 
ATOM   7664 C  CZ3   . TRP D  2 184 ? -12.225 -20.066 -107.996 1.00 57.19  ? 1098 TRP D CZ3   1 
ATOM   7665 C  CH2   . TRP D  2 184 ? -11.391 -20.951 -107.295 1.00 51.76  ? 1098 TRP D CH2   1 
ATOM   7666 N  N     . TRP D  2 185 ? -8.816  -14.775 -112.695 1.00 53.09  ? 1099 TRP D N     1 
ATOM   7667 C  CA    . TRP D  2 185 ? -9.269  -13.876 -113.754 1.00 53.34  ? 1099 TRP D CA    1 
ATOM   7668 C  C     . TRP D  2 185 ? -10.697 -14.243 -114.134 1.00 53.39  ? 1099 TRP D C     1 
ATOM   7669 O  O     . TRP D  2 185 ? -10.941 -15.316 -114.693 1.00 53.34  ? 1099 TRP D O     1 
ATOM   7670 C  CB    . TRP D  2 185 ? -8.354  -13.958 -114.971 1.00 53.46  ? 1099 TRP D CB    1 
ATOM   7671 C  CG    . TRP D  2 185 ? -8.616  -12.877 -115.968 1.00 53.73  ? 1099 TRP D CG    1 
ATOM   7672 C  CD1   . TRP D  2 185 ? -9.298  -12.991 -117.150 1.00 54.42  ? 1099 TRP D CD1   1 
ATOM   7673 C  CD2   . TRP D  2 185 ? -8.209  -11.510 -115.870 1.00 53.87  ? 1099 TRP D CD2   1 
ATOM   7674 N  NE1   . TRP D  2 185 ? -9.325  -11.776 -117.801 1.00 54.12  ? 1099 TRP D NE1   1 
ATOM   7675 C  CE2   . TRP D  2 185 ? -8.667  -10.851 -117.032 1.00 63.45  ? 1099 TRP D CE2   1 
ATOM   7676 C  CE3   . TRP D  2 185 ? -7.495  -10.778 -114.917 1.00 60.71  ? 1099 TRP D CE3   1 
ATOM   7677 C  CZ2   . TRP D  2 185 ? -8.432  -9.489  -117.263 1.00 59.54  ? 1099 TRP D CZ2   1 
ATOM   7678 C  CZ3   . TRP D  2 185 ? -7.261  -9.428  -115.149 1.00 57.48  ? 1099 TRP D CZ3   1 
ATOM   7679 C  CH2   . TRP D  2 185 ? -7.731  -8.800  -116.310 1.00 56.19  ? 1099 TRP D CH2   1 
ATOM   7680 N  N     . ALA D  2 186 ? -11.637 -13.347 -113.855 1.00 53.48  ? 1100 ALA D N     1 
ATOM   7681 C  CA    . ALA D  2 186 ? -13.052 -13.609 -114.058 1.00 53.53  ? 1100 ALA D CA    1 
ATOM   7682 C  C     . ALA D  2 186 ? -13.670 -12.568 -114.984 1.00 56.53  ? 1100 ALA D C     1 
ATOM   7683 O  O     . ALA D  2 186 ? -13.101 -11.501 -115.231 1.00 53.93  ? 1100 ALA D O     1 
ATOM   7684 C  CB    . ALA D  2 186 ? -13.806 -13.623 -112.722 1.00 53.38  ? 1100 ALA D CB    1 
ATOM   7685 N  N     . ARG D  2 187 ? -14.850 -12.898 -115.500 1.00 56.96  ? 1101 ARG D N     1 
ATOM   7686 C  CA    . ARG D  2 187 ? -15.674 -11.964 -116.254 1.00 60.59  ? 1101 ARG D CA    1 
ATOM   7687 C  C     . ARG D  2 187 ? -16.938 -11.667 -115.457 1.00 54.10  ? 1101 ARG D C     1 
ATOM   7688 O  O     . ARG D  2 187 ? -17.621 -12.589 -114.999 1.00 53.96  ? 1101 ARG D O     1 
ATOM   7689 C  CB    . ARG D  2 187 ? -16.036 -12.518 -117.641 1.00 54.25  ? 1101 ARG D CB    1 
ATOM   7690 C  CG    . ARG D  2 187 ? -17.054 -11.653 -118.391 1.00 54.50  ? 1101 ARG D CG    1 
ATOM   7691 C  CD    . ARG D  2 187 ? -17.518 -12.266 -119.723 1.00 54.64  ? 1101 ARG D CD    1 
ATOM   7692 N  NE    . ARG D  2 187 ? -18.344 -13.463 -119.544 1.00 58.33  ? 1101 ARG D NE    1 
ATOM   7693 C  CZ    . ARG D  2 187 ? -19.610 -13.449 -119.129 1.00 58.98  ? 1101 ARG D CZ    1 
ATOM   7694 N  NH1   . ARG D  2 187 ? -20.204 -12.301 -118.831 1.00 57.27  ? 1101 ARG D NH1   1 
ATOM   7695 N  NH2   . ARG D  2 187 ? -20.282 -14.585 -118.999 1.00 54.43  ? 1101 ARG D NH2   1 
ATOM   7696 N  N     . LEU D  2 188 ? -17.226 -10.383 -115.276 1.00 54.24  ? 1102 LEU D N     1 
ATOM   7697 C  CA    . LEU D  2 188 ? -18.470 -9.902  -114.679 1.00 55.34  ? 1102 LEU D CA    1 
ATOM   7698 C  C     . LEU D  2 188 ? -19.132 -8.984  -115.700 1.00 58.70  ? 1102 LEU D C     1 
ATOM   7699 O  O     . LEU D  2 188 ? -18.643 -7.874  -115.952 1.00 54.71  ? 1102 LEU D O     1 
ATOM   7700 C  CB    . LEU D  2 188 ? -18.210 -9.174  -113.358 1.00 55.53  ? 1102 LEU D CB    1 
ATOM   7701 C  CG    . LEU D  2 188 ? -19.419 -8.492  -112.706 1.00 60.54  ? 1102 LEU D CG    1 
ATOM   7702 C  CD1   . LEU D  2 188 ? -20.527 -9.491  -112.424 1.00 58.57  ? 1102 LEU D CD1   1 
ATOM   7703 C  CD2   . LEU D  2 188 ? -19.019 -7.752  -111.430 1.00 61.82  ? 1102 LEU D CD2   1 
ATOM   7704 N  N     . ASN D  2 189 ? -20.223 -9.464  -116.303 1.00 55.92  ? 1103 ASN D N     1 
ATOM   7705 C  CA    . ASN D  2 189 ? -20.925 -8.770  -117.380 1.00 58.70  ? 1103 ASN D CA    1 
ATOM   7706 C  C     . ASN D  2 189 ? -19.972 -8.416  -118.518 1.00 59.17  ? 1103 ASN D C     1 
ATOM   7707 O  O     . ASN D  2 189 ? -19.499 -9.307  -119.225 1.00 58.93  ? 1103 ASN D O     1 
ATOM   7708 C  CB    . ASN D  2 189 ? -21.634 -7.523  -116.845 1.00 63.84  ? 1103 ASN D CB    1 
ATOM   7709 C  CG    . ASN D  2 189 ? -22.695 -7.863  -115.806 1.00 70.24  ? 1103 ASN D CG    1 
ATOM   7710 O  OD1   . ASN D  2 189 ? -22.644 -7.389  -114.672 1.00 74.75  ? 1103 ASN D OD1   1 
ATOM   7711 N  ND2   . ASN D  2 189 ? -23.660 -8.690  -116.192 1.00 68.40  ? 1103 ASN D ND2   1 
ATOM   7712 N  N     . ASP D  2 190 ? -19.678 -7.127  -118.703 1.00 59.61  ? 1104 ASP D N     1 
ATOM   7713 C  CA    . ASP D  2 190 ? -18.830 -6.667  -119.798 1.00 65.21  ? 1104 ASP D CA    1 
ATOM   7714 C  C     . ASP D  2 190 ? -17.427 -6.278  -119.334 1.00 62.50  ? 1104 ASP D C     1 
ATOM   7715 O  O     . ASP D  2 190 ? -16.741 -5.516  -120.019 1.00 58.56  ? 1104 ASP D O     1 
ATOM   7716 C  CB    . ASP D  2 190 ? -19.493 -5.494  -120.529 1.00 71.04  ? 1104 ASP D CB    1 
ATOM   7717 C  CG    . ASP D  2 190 ? -19.567 -4.229  -119.677 1.00 77.01  ? 1104 ASP D CG    1 
ATOM   7718 O  OD1   . ASP D  2 190 ? -19.629 -4.344  -118.431 1.00 78.93  ? 1104 ASP D OD1   1 
ATOM   7719 O  OD2   . ASP D  2 190 ? -19.570 -3.118  -120.258 1.00 78.40  ? 1104 ASP D OD2   1 
ATOM   7720 N  N     . LYS D  2 191 ? -16.982 -6.785  -118.188 1.00 59.49  ? 1105 LYS D N     1 
ATOM   7721 C  CA    . LYS D  2 191 ? -15.658 -6.463  -117.681 1.00 59.36  ? 1105 LYS D CA    1 
ATOM   7722 C  C     . LYS D  2 191 ? -14.952 -7.736  -117.227 1.00 59.80  ? 1105 LYS D C     1 
ATOM   7723 O  O     . LYS D  2 191 ? -15.591 -8.732  -116.871 1.00 54.58  ? 1105 LYS D O     1 
ATOM   7724 C  CB    . LYS D  2 191 ? -15.732 -5.447  -116.528 1.00 54.97  ? 1105 LYS D CB    1 
ATOM   7725 N  N     . GLU D  2 192 ? -13.619 -7.690  -117.255 1.00 55.92  ? 1106 GLU D N     1 
ATOM   7726 C  CA    . GLU D  2 192 ? -12.769 -8.769  -116.778 1.00 54.46  ? 1106 GLU D CA    1 
ATOM   7727 C  C     . GLU D  2 192 ? -11.759 -8.218  -115.783 1.00 57.94  ? 1106 GLU D C     1 
ATOM   7728 O  O     . GLU D  2 192 ? -11.354 -7.053  -115.857 1.00 57.48  ? 1106 GLU D O     1 
ATOM   7729 C  CB    . GLU D  2 192 ? -12.036 -9.475  -117.929 1.00 54.50  ? 1106 GLU D CB    1 
ATOM   7730 C  CG    . GLU D  2 192 ? -12.910 -10.451 -118.713 1.00 58.18  ? 1106 GLU D CG    1 
ATOM   7731 C  CD    . GLU D  2 192 ? -12.123 -11.328 -119.682 1.00 55.83  ? 1106 GLU D CD    1 
ATOM   7732 O  OE1   . GLU D  2 192 ? -10.876 -11.356 -119.605 1.00 56.32  ? 1106 GLU D OE1   1 
ATOM   7733 O  OE2   . GLU D  2 192 ? -12.759 -11.980 -120.534 1.00 55.46  ? 1106 GLU D OE2   1 
ATOM   7734 N  N     . GLY D  2 193 ? -11.357 -9.069  -114.850 1.00 54.13  ? 1107 GLY D N     1 
ATOM   7735 C  CA    . GLY D  2 193 ? -10.433 -8.661  -113.813 1.00 54.03  ? 1107 GLY D CA    1 
ATOM   7736 C  C     . GLY D  2 193 ? -10.262 -9.762  -112.794 1.00 61.48  ? 1107 GLY D C     1 
ATOM   7737 O  O     . GLY D  2 193 ? -11.006 -10.753 -112.767 1.00 53.65  ? 1107 GLY D O     1 
ATOM   7738 N  N     . TYR D  2 194 ? -9.254  -9.571  -111.950 1.00 58.27  ? 1108 TYR D N     1 
ATOM   7739 C  CA    . TYR D  2 194 ? -8.973  -10.508 -110.875 1.00 56.85  ? 1108 TYR D CA    1 
ATOM   7740 C  C     . TYR D  2 194 ? -10.020 -10.393 -109.775 1.00 55.10  ? 1108 TYR D C     1 
ATOM   7741 O  O     . TYR D  2 194 ? -10.511 -9.301  -109.477 1.00 53.43  ? 1108 TYR D O     1 
ATOM   7742 C  CB    . TYR D  2 194 ? -7.581  -10.248 -110.297 1.00 60.40  ? 1108 TYR D CB    1 
ATOM   7743 C  CG    . TYR D  2 194 ? -6.471  -10.855 -111.119 1.00 63.66  ? 1108 TYR D CG    1 
ATOM   7744 C  CD1   . TYR D  2 194 ? -6.305  -12.235 -111.178 1.00 64.50  ? 1108 TYR D CD1   1 
ATOM   7745 C  CD2   . TYR D  2 194 ? -5.590  -10.051 -111.837 1.00 65.05  ? 1108 TYR D CD2   1 
ATOM   7746 C  CE1   . TYR D  2 194 ? -5.296  -12.797 -111.928 1.00 67.09  ? 1108 TYR D CE1   1 
ATOM   7747 C  CE2   . TYR D  2 194 ? -4.575  -10.604 -112.590 1.00 66.13  ? 1108 TYR D CE2   1 
ATOM   7748 C  CZ    . TYR D  2 194 ? -4.434  -11.978 -112.632 1.00 69.94  ? 1108 TYR D CZ    1 
ATOM   7749 O  OH    . TYR D  2 194 ? -3.429  -12.543 -113.382 1.00 76.14  ? 1108 TYR D OH    1 
ATOM   7750 N  N     . VAL D  2 195 ? -10.361 -11.532 -109.176 1.00 53.65  ? 1109 VAL D N     1 
ATOM   7751 C  CA    . VAL D  2 195 ? -11.255 -11.580 -108.021 1.00 52.98  ? 1109 VAL D CA    1 
ATOM   7752 C  C     . VAL D  2 195 ? -10.581 -12.431 -106.953 1.00 52.72  ? 1109 VAL D C     1 
ATOM   7753 O  O     . VAL D  2 195 ? -9.865  -13.384 -107.291 1.00 57.30  ? 1109 VAL D O     1 
ATOM   7754 C  CB    . VAL D  2 195 ? -12.645 -12.130 -108.387 1.00 53.95  ? 1109 VAL D CB    1 
ATOM   7755 C  CG1   . VAL D  2 195 ? -13.346 -11.206 -109.381 1.00 53.24  ? 1109 VAL D CG1   1 
ATOM   7756 C  CG2   . VAL D  2 195 ? -12.547 -13.549 -108.936 1.00 52.87  ? 1109 VAL D CG2   1 
ATOM   7757 N  N     . PRO D  2 196 ? -10.756 -12.121 -105.666 1.00 52.62  ? 1110 PRO D N     1 
ATOM   7758 C  CA    . PRO D  2 196 ? -10.123 -12.933 -104.616 1.00 52.38  ? 1110 PRO D CA    1 
ATOM   7759 C  C     . PRO D  2 196 ? -10.915 -14.214 -104.366 1.00 52.20  ? 1110 PRO D C     1 
ATOM   7760 O  O     . PRO D  2 196 ? -12.131 -14.183 -104.152 1.00 52.21  ? 1110 PRO D O     1 
ATOM   7761 C  CB    . PRO D  2 196 ? -10.138 -12.007 -103.394 1.00 52.37  ? 1110 PRO D CB    1 
ATOM   7762 C  CG    . PRO D  2 196 ? -11.325 -11.124 -103.615 1.00 52.54  ? 1110 PRO D CG    1 
ATOM   7763 C  CD    . PRO D  2 196 ? -11.488 -10.966 -105.114 1.00 52.73  ? 1110 PRO D CD    1 
ATOM   7764 N  N     . ARG D  2 197 ? -10.208 -15.347 -104.387 1.00 52.04  ? 1111 ARG D N     1 
ATOM   7765 C  CA    . ARG D  2 197 ? -10.874 -16.646 -104.407 1.00 51.90  ? 1111 ARG D CA    1 
ATOM   7766 C  C     . ARG D  2 197 ? -11.639 -16.921 -103.118 1.00 51.73  ? 1111 ARG D C     1 
ATOM   7767 O  O     . ARG D  2 197 ? -12.677 -17.591 -103.157 1.00 51.68  ? 1111 ARG D O     1 
ATOM   7768 C  CB    . ARG D  2 197 ? -9.847  -17.757 -104.669 1.00 57.72  ? 1111 ARG D CB    1 
ATOM   7769 C  CG    . ARG D  2 197 ? -9.449  -18.551 -103.430 1.00 59.15  ? 1111 ARG D CG    1 
ATOM   7770 C  CD    . ARG D  2 197 ? -7.945  -18.704 -103.303 1.00 60.19  ? 1111 ARG D CD    1 
ATOM   7771 N  NE    . ARG D  2 197 ? -7.481  -19.907 -103.983 1.00 67.18  ? 1111 ARG D NE    1 
ATOM   7772 C  CZ    . ARG D  2 197 ? -6.708  -20.842 -103.434 1.00 63.59  ? 1111 ARG D CZ    1 
ATOM   7773 N  NH1   . ARG D  2 197 ? -6.351  -21.904 -104.152 1.00 62.65  ? 1111 ARG D NH1   1 
ATOM   7774 N  NH2   . ARG D  2 197 ? -6.280  -20.713 -102.185 1.00 55.52  ? 1111 ARG D NH2   1 
ATOM   7775 N  N     . ASN D  2 198 ? -11.163 -16.403 -101.979 1.00 51.65  ? 1112 ASN D N     1 
ATOM   7776 C  CA    . ASN D  2 198 ? -11.750 -16.738 -100.689 1.00 51.48  ? 1112 ASN D CA    1 
ATOM   7777 C  C     . ASN D  2 198 ? -13.053 -16.004 -100.406 1.00 52.45  ? 1112 ASN D C     1 
ATOM   7778 O  O     . ASN D  2 198 ? -13.650 -16.236 -99.354  1.00 53.74  ? 1112 ASN D O     1 
ATOM   7779 C  CB    . ASN D  2 198 ? -10.750 -16.467 -99.560  1.00 59.61  ? 1112 ASN D CB    1 
ATOM   7780 C  CG    . ASN D  2 198 ? -10.486 -14.993 -99.346  1.00 60.91  ? 1112 ASN D CG    1 
ATOM   7781 O  OD1   . ASN D  2 198 ? -10.400 -14.214 -100.298 1.00 63.24  ? 1112 ASN D OD1   1 
ATOM   7782 N  ND2   . ASN D  2 198 ? -10.355 -14.599 -98.083  1.00 56.84  ? 1112 ASN D ND2   1 
ATOM   7783 N  N     . LEU D  2 199 ? -13.519 -15.134 -101.302 1.00 52.84  ? 1113 LEU D N     1 
ATOM   7784 C  CA    . LEU D  2 199 ? -14.836 -14.529 -101.156 1.00 51.90  ? 1113 LEU D CA    1 
ATOM   7785 C  C     . LEU D  2 199 ? -15.836 -15.068 -102.169 1.00 52.59  ? 1113 LEU D C     1 
ATOM   7786 O  O     . LEU D  2 199 ? -16.897 -14.467 -102.360 1.00 52.11  ? 1113 LEU D O     1 
ATOM   7787 C  CB    . LEU D  2 199 ? -14.749 -13.006 -101.268 1.00 60.82  ? 1113 LEU D CB    1 
ATOM   7788 C  CG    . LEU D  2 199 ? -13.604 -12.270 -100.564 1.00 62.19  ? 1113 LEU D CG    1 
ATOM   7789 C  CD1   . LEU D  2 199 ? -13.658 -10.813 -100.959 1.00 62.46  ? 1113 LEU D CD1   1 
ATOM   7790 C  CD2   . LEU D  2 199 ? -13.698 -12.425 -99.057  1.00 60.07  ? 1113 LEU D CD2   1 
ATOM   7791 N  N     . LEU D  2 200 ? -15.528 -16.182 -102.818 1.00 51.90  ? 1114 LEU D N     1 
ATOM   7792 C  CA    . LEU D  2 200 ? -16.343 -16.722 -103.893 1.00 56.39  ? 1114 LEU D CA    1 
ATOM   7793 C  C     . LEU D  2 200 ? -17.009 -18.016 -103.444 1.00 54.68  ? 1114 LEU D C     1 
ATOM   7794 O  O     . LEU D  2 200 ? -16.480 -18.738 -102.597 1.00 51.59  ? 1114 LEU D O     1 
ATOM   7795 C  CB    . LEU D  2 200 ? -15.495 -16.989 -105.144 1.00 52.08  ? 1114 LEU D CB    1 
ATOM   7796 C  CG    . LEU D  2 200 ? -14.725 -15.793 -105.712 1.00 52.27  ? 1114 LEU D CG    1 
ATOM   7797 C  CD1   . LEU D  2 200 ? -13.820 -16.231 -106.863 1.00 52.32  ? 1114 LEU D CD1   1 
ATOM   7798 C  CD2   . LEU D  2 200 ? -15.685 -14.699 -106.156 1.00 52.49  ? 1114 LEU D CD2   1 
ATOM   7799 N  N     . GLY D  2 201 ? -18.174 -18.306 -104.026 1.00 54.56  ? 1115 GLY D N     1 
ATOM   7800 C  CA    . GLY D  2 201 ? -18.862 -19.552 -103.757 1.00 51.74  ? 1115 GLY D CA    1 
ATOM   7801 C  C     . GLY D  2 201 ? -19.279 -20.241 -105.044 1.00 60.40  ? 1115 GLY D C     1 
ATOM   7802 O  O     . GLY D  2 201 ? -19.410 -19.617 -106.102 1.00 52.05  ? 1115 GLY D O     1 
ATOM   7803 N  N     . LEU D  2 202 ? -19.476 -21.558 -104.938 1.00 51.69  ? 1116 LEU D N     1 
ATOM   7804 C  CA    . LEU D  2 202 ? -20.026 -22.304 -106.065 1.00 53.61  ? 1116 LEU D CA    1 
ATOM   7805 C  C     . LEU D  2 202 ? -21.457 -21.880 -106.358 1.00 59.04  ? 1116 LEU D C     1 
ATOM   7806 O  O     . LEU D  2 202 ? -21.909 -21.959 -107.507 1.00 52.12  ? 1116 LEU D O     1 
ATOM   7807 C  CB    . LEU D  2 202 ? -19.970 -23.810 -105.790 1.00 53.66  ? 1116 LEU D CB    1 
ATOM   7808 C  CG    . LEU D  2 202 ? -19.069 -24.687 -106.665 1.00 55.06  ? 1116 LEU D CG    1 
ATOM   7809 C  CD1   . LEU D  2 202 ? -19.417 -26.163 -106.471 1.00 52.32  ? 1116 LEU D CD1   1 
ATOM   7810 C  CD2   . LEU D  2 202 ? -19.131 -24.302 -108.151 1.00 52.40  ? 1116 LEU D CD2   1 
ATOM   7811 N  N     . TYR D  2 203 ? -22.180 -21.439 -105.338 1.00 51.89  ? 1117 TYR D N     1 
ATOM   7812 C  CA    . TYR D  2 203 ? -23.561 -21.005 -105.449 1.00 52.45  ? 1117 TYR D CA    1 
ATOM   7813 C  C     . TYR D  2 203 ? -23.722 -19.767 -104.584 1.00 53.48  ? 1117 TYR D C     1 
ATOM   7814 O  O     . TYR D  2 203 ? -22.880 -19.498 -103.719 1.00 51.93  ? 1117 TYR D O     1 
ATOM   7815 C  CB    . TYR D  2 203 ? -24.522 -22.128 -105.020 1.00 52.26  ? 1117 TYR D CB    1 
ATOM   7816 C  CG    . TYR D  2 203 ? -24.457 -23.330 -105.939 1.00 57.92  ? 1117 TYR D CG    1 
ATOM   7817 C  CD1   . TYR D  2 203 ? -25.196 -23.366 -107.121 1.00 61.97  ? 1117 TYR D CD1   1 
ATOM   7818 C  CD2   . TYR D  2 203 ? -23.642 -24.416 -105.644 1.00 56.44  ? 1117 TYR D CD2   1 
ATOM   7819 C  CE1   . TYR D  2 203 ? -25.137 -24.457 -107.977 1.00 61.96  ? 1117 TYR D CE1   1 
ATOM   7820 C  CE2   . TYR D  2 203 ? -23.578 -25.512 -106.493 1.00 59.00  ? 1117 TYR D CE2   1 
ATOM   7821 C  CZ    . TYR D  2 203 ? -24.326 -25.525 -107.662 1.00 61.86  ? 1117 TYR D CZ    1 
ATOM   7822 O  OH    . TYR D  2 203 ? -24.267 -26.609 -108.513 1.00 61.19  ? 1117 TYR D OH    1 
ATOM   7823 N  N     . PRO D  2 204 ? -24.763 -18.967 -104.814 1.00 52.23  ? 1118 PRO D N     1 
ATOM   7824 C  CA    . PRO D  2 204 ? -24.935 -17.734 -104.040 1.00 52.28  ? 1118 PRO D CA    1 
ATOM   7825 C  C     . PRO D  2 204 ? -25.651 -17.996 -102.721 1.00 52.12  ? 1118 PRO D C     1 
ATOM   7826 O  O     . PRO D  2 204 ? -26.258 -19.045 -102.506 1.00 56.48  ? 1118 PRO D O     1 
ATOM   7827 C  CB    . PRO D  2 204 ? -25.786 -16.858 -104.966 1.00 52.55  ? 1118 PRO D CB    1 
ATOM   7828 C  CG    . PRO D  2 204 ? -26.618 -17.848 -105.723 1.00 52.59  ? 1118 PRO D CG    1 
ATOM   7829 C  CD    . PRO D  2 204 ? -25.755 -19.072 -105.904 1.00 52.42  ? 1118 PRO D CD    1 
ATOM   7830 N  N     . ARG D  2 205 ? -25.573 -17.012 -101.830 1.00 52.12  ? 1119 ARG D N     1 
ATOM   7831 C  CA    . ARG D  2 205 ? -26.296 -17.118 -100.572 1.00 55.65  ? 1119 ARG D CA    1 
ATOM   7832 C  C     . ARG D  2 205 ? -27.802 -17.055 -100.806 1.00 57.25  ? 1119 ARG D C     1 
ATOM   7833 O  O     . ARG D  2 205 ? -28.281 -16.576 -101.838 1.00 60.69  ? 1119 ARG D O     1 
ATOM   7834 C  CB    . ARG D  2 205 ? -25.908 -16.002 -99.600  1.00 51.99  ? 1119 ARG D CB    1 
ATOM   7835 C  CG    . ARG D  2 205 ? -24.465 -15.581 -99.603  1.00 51.97  ? 1119 ARG D CG    1 
ATOM   7836 C  CD    . ARG D  2 205 ? -24.316 -14.340 -98.739  1.00 52.03  ? 1119 ARG D CD    1 
ATOM   7837 N  NE    . ARG D  2 205 ? -22.959 -14.167 -98.235  1.00 52.78  ? 1119 ARG D NE    1 
ATOM   7838 C  CZ    . ARG D  2 205 ? -22.597 -14.330 -96.970  1.00 55.73  ? 1119 ARG D CZ    1 
ATOM   7839 N  NH1   . ARG D  2 205 ? -23.492 -14.686 -96.054  1.00 62.43  ? 1119 ARG D NH1   1 
ATOM   7840 N  NH2   . ARG D  2 205 ? -21.330 -14.143 -96.623  1.00 51.68  ? 1119 ARG D NH2   1 
ATOM   7841 N  N     . ILE D  2 206 ? -28.544 -17.553 -99.821  1.00 59.93  ? 1120 ILE D N     1 
ATOM   7842 C  CA    . ILE D  2 206 ? -29.990 -17.376 -99.741  1.00 66.28  ? 1120 ILE D CA    1 
ATOM   7843 C  C     . ILE D  2 206 ? -30.256 -16.057 -99.025  1.00 75.89  ? 1120 ILE D C     1 
ATOM   7844 O  O     . ILE D  2 206 ? -29.639 -15.768 -97.992  1.00 74.81  ? 1120 ILE D O     1 
ATOM   7845 C  CB    . ILE D  2 206 ? -30.646 -18.562 -99.005  1.00 64.09  ? 1120 ILE D CB    1 
ATOM   7846 C  CG1   . ILE D  2 206 ? -30.616 -19.821 -99.875  1.00 61.25  ? 1120 ILE D CG1   1 
ATOM   7847 C  CG2   . ILE D  2 206 ? -32.082 -18.248 -98.625  1.00 64.75  ? 1120 ILE D CG2   1 
ATOM   7848 C  CD1   . ILE D  2 206 ? -29.450 -20.728 -99.613  1.00 56.04  ? 1120 ILE D CD1   1 
ATOM   7849 N  N     . LYS D  2 207 ? -31.159 -15.247 -99.575  1.00 85.91  ? 1121 LYS D N     1 
ATOM   7850 C  CA    . LYS D  2 207 ? -31.329 -13.881 -99.078  1.00 91.87  ? 1121 LYS D CA    1 
ATOM   7851 C  C     . LYS D  2 207 ? -32.257 -13.860 -97.865  1.00 98.68  ? 1121 LYS D C     1 
ATOM   7852 O  O     . LYS D  2 207 ? -33.358 -14.419 -97.925  1.00 98.81  ? 1121 LYS D O     1 
ATOM   7853 C  CB    . LYS D  2 207 ? -31.884 -12.979 -100.175 1.00 92.78  ? 1121 LYS D CB    1 
ATOM   7854 N  N     . PRO D  2 208 ? -31.852 -13.219 -96.751  1.00 97.87  ? 1122 PRO D N     1 
ATOM   7855 C  CA    . PRO D  2 208 ? -32.659 -13.084 -95.529  1.00 96.82  ? 1122 PRO D CA    1 
ATOM   7856 C  C     . PRO D  2 208 ? -33.863 -12.162 -95.695  1.00 98.37  ? 1122 PRO D C     1 
ATOM   7857 O  O     . PRO D  2 208 ? -33.939 -11.165 -94.975  1.00 99.93  ? 1122 PRO D O     1 
ATOM   7858 C  CB    . PRO D  2 208 ? -31.670 -12.490 -94.520  1.00 94.54  ? 1122 PRO D CB    1 
ATOM   7859 C  CG    . PRO D  2 208 ? -30.662 -11.786 -95.349  1.00 95.26  ? 1122 PRO D CG    1 
ATOM   7860 C  CD    . PRO D  2 208 ? -30.519 -12.610 -96.597  1.00 97.45  ? 1122 PRO D CD    1 
HETATM 7861 C  C1    . EDO E  3 .   ? -21.475 -37.614 -59.115  1.00 56.81  ? 401  EDO A C1    1 
HETATM 7862 O  O1    . EDO E  3 .   ? -22.262 -38.802 -59.029  1.00 53.69  ? 401  EDO A O1    1 
HETATM 7863 C  C2    . EDO E  3 .   ? -22.367 -36.380 -59.086  1.00 57.39  ? 401  EDO A C2    1 
HETATM 7864 O  O2    . EDO E  3 .   ? -21.522 -35.235 -59.223  1.00 65.53  ? 401  EDO A O2    1 
HETATM 7865 C  C1    . EDO F  3 .   ? -20.219 2.700   -42.016  1.00 52.30  ? 402  EDO A C1    1 
HETATM 7866 O  O1    . EDO F  3 .   ? -19.223 1.997   -41.262  1.00 53.47  ? 402  EDO A O1    1 
HETATM 7867 C  C2    . EDO F  3 .   ? -19.785 2.711   -43.476  1.00 52.58  ? 402  EDO A C2    1 
HETATM 7868 O  O2    . EDO F  3 .   ? -18.427 3.164   -43.557  1.00 46.87  ? 402  EDO A O2    1 
HETATM 7869 C  C1    . EDO G  3 .   ? -39.746 -33.290 -55.159  1.00 65.55  ? 403  EDO A C1    1 
HETATM 7870 O  O1    . EDO G  3 .   ? -41.169 -33.237 -54.975  1.00 62.84  ? 403  EDO A O1    1 
HETATM 7871 C  C2    . EDO G  3 .   ? -39.043 -33.737 -53.880  1.00 64.69  ? 403  EDO A C2    1 
HETATM 7872 O  O2    . EDO G  3 .   ? -37.659 -33.371 -53.961  1.00 65.92  ? 403  EDO A O2    1 
HETATM 7873 C  C1    . EDO H  3 .   ? -36.293 -11.438 -47.347  1.00 43.61  ? 404  EDO A C1    1 
HETATM 7874 O  O1    . EDO H  3 .   ? -36.306 -12.875 -47.208  1.00 40.03  ? 404  EDO A O1    1 
HETATM 7875 C  C2    . EDO H  3 .   ? -35.143 -10.831 -46.552  1.00 46.77  ? 404  EDO A C2    1 
HETATM 7876 O  O2    . EDO H  3 .   ? -35.107 -9.417  -46.779  1.00 56.47  ? 404  EDO A O2    1 
HETATM 7877 C  C1    . EDO I  3 .   ? -24.107 -30.630 -64.674  1.00 52.38  ? 405  EDO A C1    1 
HETATM 7878 O  O1    . EDO I  3 .   ? -24.037 -31.511 -63.549  1.00 52.20  ? 405  EDO A O1    1 
HETATM 7879 C  C2    . EDO I  3 .   ? -25.292 -31.030 -65.550  1.00 51.74  ? 405  EDO A C2    1 
HETATM 7880 O  O2    . EDO I  3 .   ? -25.584 -29.950 -66.441  1.00 46.44  ? 405  EDO A O2    1 
HETATM 7881 C  C1    . EDO J  3 .   ? -7.167  -16.968 -56.691  1.00 68.17  ? 406  EDO A C1    1 
HETATM 7882 O  O1    . EDO J  3 .   ? -6.450  -18.200 -56.850  1.00 66.35  ? 406  EDO A O1    1 
HETATM 7883 C  C2    . EDO J  3 .   ? -6.450  -15.799 -57.359  1.00 67.97  ? 406  EDO A C2    1 
HETATM 7884 O  O2    . EDO J  3 .   ? -7.296  -14.640 -57.309  1.00 68.30  ? 406  EDO A O2    1 
HETATM 7885 C  C1    . GOL K  4 .   ? -25.310 -24.908 -73.996  1.00 50.25  ? 407  GOL A C1    1 
HETATM 7886 O  O1    . GOL K  4 .   ? -26.236 -24.047 -74.631  1.00 48.71  ? 407  GOL A O1    1 
HETATM 7887 C  C2    . GOL K  4 .   ? -24.824 -24.181 -72.699  1.00 46.16  ? 407  GOL A C2    1 
HETATM 7888 O  O2    . GOL K  4 .   ? -24.307 -22.919 -73.017  1.00 50.09  ? 407  GOL A O2    1 
HETATM 7889 C  C3    . GOL K  4 .   ? -26.083 -24.081 -71.785  1.00 44.24  ? 407  GOL A C3    1 
HETATM 7890 O  O3    . GOL K  4 .   ? -26.529 -25.380 -71.472  1.00 45.32  ? 407  GOL A O3    1 
HETATM 7891 C  C1    . GOL L  4 .   ? -42.941 -8.508  -58.250  1.00 74.04  ? 408  GOL A C1    1 
HETATM 7892 O  O1    . GOL L  4 .   ? -43.446 -8.292  -56.967  1.00 71.03  ? 408  GOL A O1    1 
HETATM 7893 C  C2    . GOL L  4 .   ? -41.815 -7.467  -58.456  1.00 73.75  ? 408  GOL A C2    1 
HETATM 7894 O  O2    . GOL L  4 .   ? -40.847 -7.569  -57.481  1.00 73.07  ? 408  GOL A O2    1 
HETATM 7895 C  C3    . GOL L  4 .   ? -41.245 -7.727  -59.882  1.00 68.84  ? 408  GOL A C3    1 
HETATM 7896 O  O3    . GOL L  4 .   ? -40.406 -8.833  -59.784  1.00 65.45  ? 408  GOL A O3    1 
HETATM 7897 C  C1    . GOL M  4 .   ? -16.101 -35.394 -48.778  1.00 68.74  ? 409  GOL A C1    1 
HETATM 7898 O  O1    . GOL M  4 .   ? -15.419 -34.980 -47.638  1.00 70.99  ? 409  GOL A O1    1 
HETATM 7899 C  C2    . GOL M  4 .   ? -15.025 -35.879 -49.754  1.00 70.65  ? 409  GOL A C2    1 
HETATM 7900 O  O2    . GOL M  4 .   ? -13.786 -35.338 -49.450  1.00 74.69  ? 409  GOL A O2    1 
HETATM 7901 C  C3    . GOL M  4 .   ? -15.529 -35.425 -51.130  1.00 66.91  ? 409  GOL A C3    1 
HETATM 7902 O  O3    . GOL M  4 .   ? -16.791 -35.973 -51.271  1.00 63.28  ? 409  GOL A O3    1 
HETATM 7903 C  "C3'" . NHE N  5 .   ? -18.027 -33.536 -44.559  1.00 55.30  ? 410  NHE A "C3'" 1 
HETATM 7904 C  "C2'" . NHE N  5 .   ? -18.713 -33.731 -43.219  1.00 55.70  ? 410  NHE A "C2'" 1 
HETATM 7905 C  "C1'" . NHE N  5 .   ? -20.013 -32.938 -43.159  1.00 55.96  ? 410  NHE A "C1'" 1 
HETATM 7906 C  "C6'" . NHE N  5 .   ? -20.928 -33.324 -44.313  1.00 52.48  ? 410  NHE A "C6'" 1 
HETATM 7907 N  N     . NHE N  5 .   ? -20.673 -33.236 -41.908  1.00 56.54  ? 410  NHE A N     1 
HETATM 7908 C  C1    . NHE N  5 .   ? -20.050 -32.871 -40.653  1.00 58.93  ? 410  NHE A C1    1 
HETATM 7909 C  C2    . NHE N  5 .   ? -20.522 -33.769 -39.521  1.00 68.04  ? 410  NHE A C2    1 
HETATM 7910 S  S     . NHE N  5 .   ? -20.223 -33.002 -38.086  1.00 72.71  ? 410  NHE A S     1 
HETATM 7911 O  O1    . NHE N  5 .   ? -18.852 -33.615 -37.445  1.00 74.96  ? 410  NHE A O1    1 
HETATM 7912 O  O2    . NHE N  5 .   ? -20.010 -31.601 -38.330  1.00 74.50  ? 410  NHE A O2    1 
HETATM 7913 O  O3    . NHE N  5 .   ? -21.341 -33.188 -37.210  1.00 70.44  ? 410  NHE A O3    1 
HETATM 7914 C  "C5'" . NHE N  5 .   ? -20.235 -33.190 -45.661  1.00 53.32  ? 410  NHE A "C5'" 1 
HETATM 7915 C  "C4'" . NHE N  5 .   ? -18.942 -33.999 -45.688  1.00 54.64  ? 410  NHE A "C4'" 1 
HETATM 7916 C  "C3'" A NHE O  5 .   ? -17.614 -33.132 -59.358  0.50 38.79  ? 411  NHE A "C3'" 1 
HETATM 7917 C  "C2'" A NHE O  5 .   ? -17.358 -31.901 -58.490  0.50 45.62  ? 411  NHE A "C2'" 1 
HETATM 7918 C  "C1'" A NHE O  5 .   ? -16.829 -30.709 -59.300  0.50 40.54  ? 411  NHE A "C1'" 1 
HETATM 7919 C  "C6'" A NHE O  5 .   ? -17.751 -30.413 -60.480  0.50 35.46  ? 411  NHE A "C6'" 1 
HETATM 7920 N  N     A NHE O  5 .   ? -16.689 -29.511 -58.485  0.50 32.54  ? 411  NHE A N     1 
HETATM 7921 C  C1    A NHE O  5 .   ? -17.309 -29.376 -57.175  0.50 32.94  ? 411  NHE A C1    1 
HETATM 7922 C  C2    A NHE O  5 .   ? -16.369 -29.602 -55.994  0.50 38.53  ? 411  NHE A C2    1 
HETATM 7923 S  S     A NHE O  5 .   ? -16.918 -28.814 -54.629  0.50 40.27  ? 411  NHE A S     1 
HETATM 7924 O  O1    A NHE O  5 .   ? -18.342 -28.760 -54.598  0.50 37.14  ? 411  NHE A O1    1 
HETATM 7925 O  O2    A NHE O  5 .   ? -16.410 -27.465 -54.618  0.50 44.81  ? 411  NHE A O2    1 
HETATM 7926 O  O3    A NHE O  5 .   ? -16.395 -29.603 -53.306  0.50 41.08  ? 411  NHE A O3    1 
HETATM 7927 C  "C5'" A NHE O  5 .   ? -18.079 -31.650 -61.317  0.50 35.72  ? 411  NHE A "C5'" 1 
HETATM 7928 C  "C4'" A NHE O  5 .   ? -18.603 -32.803 -60.466  0.50 36.69  ? 411  NHE A "C4'" 1 
HETATM 7929 MN MN    . MN  P  6 .   ? -17.583 -25.664 -55.454  1.00 32.92  ? 412  MN  A MN    1 
HETATM 7930 MN MN    . MN  Q  6 .   ? -20.043 -27.050 -53.926  1.00 26.79  ? 413  MN  A MN    1 
HETATM 7931 C  C1    . EDO R  3 .   ? -48.641 -62.965 -148.302 1.00 68.75  ? 401  EDO B C1    1 
HETATM 7932 O  O1    . EDO R  3 .   ? -48.471 -62.992 -149.723 1.00 72.28  ? 401  EDO B O1    1 
HETATM 7933 C  C2    . EDO R  3 .   ? -50.080 -63.312 -147.935 1.00 63.89  ? 401  EDO B C2    1 
HETATM 7934 O  O2    . EDO R  3 .   ? -50.958 -62.266 -148.365 1.00 57.76  ? 401  EDO B O2    1 
HETATM 7935 C  C1    . EDO S  3 .   ? -53.006 -51.708 -147.892 1.00 60.77  ? 402  EDO B C1    1 
HETATM 7936 O  O1    . EDO S  3 .   ? -54.306 -51.787 -147.299 1.00 63.41  ? 402  EDO B O1    1 
HETATM 7937 C  C2    . EDO S  3 .   ? -52.952 -50.545 -148.881 1.00 62.77  ? 402  EDO B C2    1 
HETATM 7938 O  O2    . EDO S  3 .   ? -53.122 -49.298 -148.195 1.00 59.07  ? 402  EDO B O2    1 
HETATM 7939 C  C1    . EDO T  3 .   ? -47.088 -42.058 -117.238 1.00 53.17  ? 403  EDO B C1    1 
HETATM 7940 O  O1    . EDO T  3 .   ? -47.397 -43.208 -116.447 1.00 52.52  ? 403  EDO B O1    1 
HETATM 7941 C  C2    . EDO T  3 .   ? -45.891 -42.359 -118.134 1.00 51.34  ? 403  EDO B C2    1 
HETATM 7942 O  O2    . EDO T  3 .   ? -45.630 -41.190 -118.930 1.00 51.66  ? 403  EDO B O2    1 
HETATM 7943 C  C1    . EDO U  3 .   ? -48.501 -49.196 -111.574 1.00 52.39  ? 404  EDO B C1    1 
HETATM 7944 O  O1    . EDO U  3 .   ? -48.742 -47.898 -112.139 1.00 53.60  ? 404  EDO B O1    1 
HETATM 7945 C  C2    . EDO U  3 .   ? -46.999 -49.395 -111.395 1.00 54.83  ? 404  EDO B C2    1 
HETATM 7946 O  O2    . EDO U  3 .   ? -46.741 -50.690 -110.842 1.00 56.39  ? 404  EDO B O2    1 
HETATM 7947 C  C1    . GOL V  4 .   ? -35.577 -39.550 -146.122 1.00 72.41  ? 405  GOL B C1    1 
HETATM 7948 O  O1    . GOL V  4 .   ? -35.957 -38.387 -145.448 1.00 72.12  ? 405  GOL B O1    1 
HETATM 7949 C  C2    . GOL V  4 .   ? -35.210 -40.595 -145.036 1.00 72.89  ? 405  GOL B C2    1 
HETATM 7950 O  O2    . GOL V  4 .   ? -35.687 -40.211 -143.792 1.00 74.02  ? 405  GOL B O2    1 
HETATM 7951 C  C3    . GOL V  4 .   ? -33.640 -40.721 -145.090 1.00 72.00  ? 405  GOL B C3    1 
HETATM 7952 O  O3    . GOL V  4 .   ? -33.189 -41.255 -143.865 1.00 62.75  ? 405  GOL B O3    1 
HETATM 7953 C  "C3'" . NHE W  5 .   ? -39.052 -40.388 -123.236 0.50 49.31  ? 406  NHE B "C3'" 1 
HETATM 7954 C  "C2'" . NHE W  5 .   ? -37.724 -41.125 -123.393 0.50 48.84  ? 406  NHE B "C2'" 1 
HETATM 7955 C  "C1'" . NHE W  5 .   ? -37.802 -42.587 -122.942 0.50 43.79  ? 406  NHE B "C1'" 1 
HETATM 7956 C  "C6'" . NHE W  5 .   ? -38.874 -42.757 -121.872 0.50 44.70  ? 406  NHE B "C6'" 1 
HETATM 7957 N  N     . NHE W  5 .   ? -38.088 -43.484 -124.050 0.50 39.65  ? 406  NHE B N     1 
HETATM 7958 C  C1    . NHE W  5 .   ? -37.381 -43.364 -125.314 0.50 42.48  ? 406  NHE B C1    1 
HETATM 7959 C  C2    . NHE W  5 .   ? -38.314 -42.947 -126.442 0.50 37.34  ? 406  NHE B C2    1 
HETATM 7960 S  S     . NHE W  5 .   ? -37.801 -43.397 -127.964 0.50 41.67  ? 406  NHE B S     1 
HETATM 7961 O  O1    . NHE W  5 .   ? -38.864 -43.271 -128.912 0.50 31.39  ? 406  NHE B O1    1 
HETATM 7962 O  O2    . NHE W  5 .   ? -36.553 -42.439 -128.416 0.50 45.86  ? 406  NHE B O2    1 
HETATM 7963 O  O3    . NHE W  5 .   ? -37.336 -44.759 -127.923 0.50 49.13  ? 406  NHE B O3    1 
HETATM 7964 C  "C5'" . NHE W  5 .   ? -39.013 -41.521 -120.983 0.50 47.11  ? 406  NHE B "C5'" 1 
HETATM 7965 C  "C4'" . NHE W  5 .   ? -39.495 -40.314 -121.778 0.50 46.04  ? 406  NHE B "C4'" 1 
HETATM 7966 C  "C3'" . NHE X  5 .   ? -38.405 -37.672 -137.144 1.00 52.31  ? 407  NHE B "C3'" 1 
HETATM 7967 C  "C2'" . NHE X  5 .   ? -38.796 -37.332 -138.575 1.00 55.70  ? 407  NHE B "C2'" 1 
HETATM 7968 C  "C1'" . NHE X  5 .   ? -40.107 -38.020 -138.945 1.00 57.48  ? 407  NHE B "C1'" 1 
HETATM 7969 C  "C6'" . NHE X  5 .   ? -41.214 -37.670 -137.955 1.00 54.65  ? 407  NHE B "C6'" 1 
HETATM 7970 N  N     . NHE X  5 .   ? -40.514 -37.608 -140.273 1.00 58.47  ? 407  NHE B N     1 
HETATM 7971 C  C1    . NHE X  5 .   ? -39.524 -37.470 -141.313 1.00 66.59  ? 407  NHE B C1    1 
HETATM 7972 C  C2    . NHE X  5 .   ? -39.995 -38.139 -142.593 1.00 75.91  ? 407  NHE B C2    1 
HETATM 7973 S  S     . NHE X  5 .   ? -40.317 -36.976 -143.729 1.00 79.13  ? 407  NHE B S     1 
HETATM 7974 O  O1    . NHE X  5 .   ? -39.192 -36.087 -143.823 1.00 81.26  ? 407  NHE B O1    1 
HETATM 7975 O  O2    . NHE X  5 .   ? -40.567 -37.732 -145.163 1.00 79.96  ? 407  NHE B O2    1 
HETATM 7976 O  O3    . NHE X  5 .   ? -41.481 -36.227 -143.342 1.00 75.66  ? 407  NHE B O3    1 
HETATM 7977 C  "C5'" . NHE X  5 .   ? -40.802 -37.934 -136.516 1.00 54.82  ? 407  NHE B "C5'" 1 
HETATM 7978 C  "C4'" . NHE X  5 .   ? -39.498 -37.216 -136.187 1.00 51.77  ? 407  NHE B "C4'" 1 
HETATM 7979 C  "C3'" . NHE Y  5 .   ? -63.735 -47.009 -119.036 1.00 80.16  ? 408  NHE B "C3'" 1 
HETATM 7980 C  "C2'" . NHE Y  5 .   ? -63.551 -48.395 -118.424 1.00 81.51  ? 408  NHE B "C2'" 1 
HETATM 7981 C  "C1'" . NHE Y  5 .   ? -62.942 -48.267 -117.036 1.00 81.07  ? 408  NHE B "C1'" 1 
HETATM 7982 C  "C6'" . NHE Y  5 .   ? -63.981 -47.549 -116.190 1.00 81.06  ? 408  NHE B "C6'" 1 
HETATM 7983 N  N     . NHE Y  5 .   ? -62.593 -49.563 -116.478 1.00 81.59  ? 408  NHE B N     1 
HETATM 7984 C  C1    . NHE Y  5 .   ? -61.667 -49.631 -115.358 1.00 82.93  ? 408  NHE B C1    1 
HETATM 7985 C  C2    . NHE Y  5 .   ? -61.158 -51.044 -115.081 1.00 85.42  ? 408  NHE B C2    1 
HETATM 7986 S  S     . NHE Y  5 .   ? -60.709 -51.228 -113.482 1.00 88.05  ? 408  NHE B S     1 
HETATM 7987 O  O1    . NHE Y  5 .   ? -60.125 -52.743 -113.267 1.00 83.82  ? 408  NHE B O1    1 
HETATM 7988 O  O2    . NHE Y  5 .   ? -59.696 -50.266 -113.132 1.00 87.45  ? 408  NHE B O2    1 
HETATM 7989 O  O3    . NHE Y  5 .   ? -61.849 -51.041 -112.627 1.00 88.85  ? 408  NHE B O3    1 
HETATM 7990 C  "C5'" . NHE Y  5 .   ? -64.133 -46.122 -116.709 1.00 80.90  ? 408  NHE B "C5'" 1 
HETATM 7991 C  "C4'" . NHE Y  5 .   ? -64.608 -46.117 -118.160 1.00 78.80  ? 408  NHE B "C4'" 1 
HETATM 7992 MN MN    . MN  Z  6 .   ? -38.840 -46.813 -127.483 1.00 32.79  ? 409  MN  B MN    1 
HETATM 7993 MN MN    . MN  AA 6 .   ? -41.116 -45.087 -129.090 1.00 27.65  ? 410  MN  B MN    1 
HETATM 7994 C  C1    . EDO BA 3 .   ? -22.938 -22.939 -110.396 1.00 56.61  ? 1201 EDO D C1    1 
HETATM 7995 O  O1    . EDO BA 3 .   ? -21.568 -22.522 -110.290 1.00 52.47  ? 1201 EDO D O1    1 
HETATM 7996 C  C2    . EDO BA 3 .   ? -23.740 -22.002 -111.288 1.00 56.61  ? 1201 EDO D C2    1 
HETATM 7997 O  O2    . EDO BA 3 .   ? -25.125 -22.357 -111.228 1.00 63.78  ? 1201 EDO D O2    1 
HETATM 7998 C  C1    . EDO CA 3 .   ? -21.525 -38.409 -90.655  1.00 71.18  ? 1202 EDO D C1    1 
HETATM 7999 O  O1    . EDO CA 3 .   ? -22.139 -37.157 -90.324  1.00 72.19  ? 1202 EDO D O1    1 
HETATM 8000 C  C2    . EDO CA 3 .   ? -20.029 -38.325 -90.373  1.00 68.93  ? 1202 EDO D C2    1 
HETATM 8001 O  O2    . EDO CA 3 .   ? -19.407 -39.546 -90.780  1.00 66.37  ? 1202 EDO D O2    1 
HETATM 8002 C  "C3'" . NHE DA 5 .   ? -14.179 -19.770 -121.361 1.00 80.84  ? 1203 NHE D "C3'" 1 
HETATM 8003 C  "C2'" . NHE DA 5 .   ? -13.191 -20.546 -120.492 1.00 80.69  ? 1203 NHE D "C2'" 1 
HETATM 8004 C  "C1'" . NHE DA 5 .   ? -13.484 -20.342 -119.006 1.00 80.96  ? 1203 NHE D "C1'" 1 
HETATM 8005 C  "C6'" . NHE DA 5 .   ? -14.842 -20.951 -118.657 1.00 79.37  ? 1203 NHE D "C6'" 1 
HETATM 8006 N  N     . NHE DA 5 .   ? -12.438 -20.901 -118.164 1.00 79.00  ? 1203 NHE D N     1 
HETATM 8007 C  C1    . NHE DA 5 .   ? -12.616 -22.180 -117.508 1.00 76.72  ? 1203 NHE D C1    1 
HETATM 8008 C  C2    . NHE DA 5 .   ? -11.675 -22.378 -116.322 1.00 77.33  ? 1203 NHE D C2    1 
HETATM 8009 S  S     . NHE DA 5 .   ? -10.099 -22.674 -116.787 1.00 77.07  ? 1203 NHE D S     1 
HETATM 8010 O  O1    . NHE DA 5 .   ? -9.289  -21.502 -116.640 1.00 79.44  ? 1203 NHE D O1    1 
HETATM 8011 O  O2    . NHE DA 5 .   ? -10.073 -23.107 -118.157 1.00 78.86  ? 1203 NHE D O2    1 
HETATM 8012 O  O3    . NHE DA 5 .   ? -9.486  -23.838 -115.822 1.00 79.67  ? 1203 NHE D O3    1 
HETATM 8013 C  "C5'" . NHE DA 5 .   ? -15.891 -20.658 -119.729 1.00 79.72  ? 1203 NHE D "C5'" 1 
HETATM 8014 C  "C4'" . NHE DA 5 .   ? -15.486 -19.485 -120.621 1.00 81.52  ? 1203 NHE D "C4'" 1 
HETATM 8015 O  O     . HOH EA 7 .   ? -19.233 -27.096 -55.543  1.00 32.19  ? 501  HOH A O     1 
HETATM 8016 O  O     . HOH EA 7 .   ? -6.957  -9.142  -45.783  1.00 60.71  ? 502  HOH A O     1 
HETATM 8017 O  O     . HOH EA 7 .   ? -14.578 -2.574  -100.477 1.00 89.08  ? 503  HOH A O     1 
HETATM 8018 O  O     . HOH EA 7 .   ? -18.880 -26.125 -36.859  1.00 52.19  ? 504  HOH A O     1 
HETATM 8019 O  O     . HOH EA 7 .   ? -18.217 -25.020 -75.689  1.00 74.77  ? 505  HOH A O     1 
HETATM 8020 O  O     . HOH EA 7 .   ? -18.551 -29.746 -39.430  1.00 48.08  ? 506  HOH A O     1 
HETATM 8021 O  O     . HOH EA 7 .   ? 1.324   -12.468 -51.192  1.00 62.40  ? 507  HOH A O     1 
HETATM 8022 O  O     . HOH EA 7 .   ? -7.676  -20.371 -70.213  1.00 56.49  ? 508  HOH A O     1 
HETATM 8023 O  O     . HOH EA 7 .   ? -21.599 -12.110 -71.880  1.00 56.24  ? 509  HOH A O     1 
HETATM 8024 O  O     . HOH EA 7 .   ? -29.905 -3.041  -48.534  1.00 35.55  ? 510  HOH A O     1 
HETATM 8025 O  O     . HOH EA 7 .   ? -20.038 -0.507  -61.135  1.00 49.95  ? 511  HOH A O     1 
HETATM 8026 O  O     . HOH EA 7 .   ? -28.298 -3.506  -62.875  1.00 50.34  ? 512  HOH A O     1 
HETATM 8027 O  O     . HOH EA 7 .   ? -28.416 -36.951 -47.492  1.00 36.55  ? 513  HOH A O     1 
HETATM 8028 O  O     . HOH EA 7 .   ? -21.098 -17.978 -55.012  1.00 34.49  ? 514  HOH A O     1 
HETATM 8029 O  O     . HOH EA 7 .   ? -25.457 -37.767 -47.217  1.00 32.43  ? 515  HOH A O     1 
HETATM 8030 O  O     . HOH EA 7 .   ? -22.051 -21.375 -55.550  1.00 29.10  ? 516  HOH A O     1 
HETATM 8031 O  O     . HOH EA 7 .   ? -29.295 -13.454 -45.015  1.00 26.91  ? 517  HOH A O     1 
HETATM 8032 O  O     . HOH EA 7 .   ? -10.358 -21.699 -57.580  1.00 47.72  ? 518  HOH A O     1 
HETATM 8033 O  O     . HOH EA 7 .   ? -12.669 -0.448  -39.627  1.00 47.25  ? 519  HOH A O     1 
HETATM 8034 O  O     . HOH EA 7 .   ? -20.144 0.637   -51.184  1.00 49.51  ? 520  HOH A O     1 
HETATM 8035 O  O     . HOH EA 7 .   ? -31.684 -37.019 -47.284  1.00 36.35  ? 521  HOH A O     1 
HETATM 8036 O  O     . HOH EA 7 .   ? -26.218 -5.098  -54.078  1.00 32.09  ? 522  HOH A O     1 
HETATM 8037 O  O     . HOH EA 7 .   ? -27.373 -23.426 -50.654  1.00 35.56  ? 523  HOH A O     1 
HETATM 8038 O  O     . HOH EA 7 .   ? -32.610 -38.097 -65.658  1.00 56.08  ? 524  HOH A O     1 
HETATM 8039 O  O     . HOH EA 7 .   ? -8.252  -20.858 -49.151  1.00 42.33  ? 525  HOH A O     1 
HETATM 8040 O  O     . HOH EA 7 .   ? -27.156 -28.060 -65.301  1.00 30.31  ? 526  HOH A O     1 
HETATM 8041 O  O     . HOH EA 7 .   ? -41.303 -31.540 -52.806  1.00 37.56  ? 527  HOH A O     1 
HETATM 8042 O  O     . HOH EA 7 .   ? -32.653 -38.641 -44.340  1.00 56.72  ? 528  HOH A O     1 
HETATM 8043 O  O     . HOH EA 7 .   ? -26.664 -22.418 -41.971  1.00 26.27  ? 529  HOH A O     1 
HETATM 8044 O  O     . HOH EA 7 .   ? -1.109  -18.814 -37.158  1.00 50.70  ? 530  HOH A O     1 
HETATM 8045 O  O     . HOH EA 7 .   ? -30.565 -15.511 -43.557  1.00 31.40  ? 531  HOH A O     1 
HETATM 8046 O  O     . HOH EA 7 .   ? -35.792 -38.929 -62.518  1.00 36.63  ? 532  HOH A O     1 
HETATM 8047 O  O     . HOH EA 7 .   ? -21.544 -21.982 -34.667  1.00 43.44  ? 533  HOH A O     1 
HETATM 8048 O  O     . HOH EA 7 .   ? -40.157 -15.492 -53.683  1.00 34.61  ? 534  HOH A O     1 
HETATM 8049 O  O     . HOH EA 7 .   ? -21.436 -25.526 -69.919  1.00 47.25  ? 535  HOH A O     1 
HETATM 8050 O  O     . HOH EA 7 .   ? -32.161 -10.694 -68.339  1.00 37.40  ? 536  HOH A O     1 
HETATM 8051 O  O     . HOH EA 7 .   ? -14.966 -11.847 -70.250  1.00 65.34  ? 537  HOH A O     1 
HETATM 8052 O  O     . HOH EA 7 .   ? -18.587 -0.473  -53.980  1.00 38.46  ? 538  HOH A O     1 
HETATM 8053 O  O     . HOH EA 7 .   ? -25.058 1.173   -45.911  1.00 56.21  ? 539  HOH A O     1 
HETATM 8054 O  O     . HOH EA 7 .   ? -29.626 -11.486 -35.175  1.00 45.96  ? 540  HOH A O     1 
HETATM 8055 O  O     . HOH EA 7 .   ? -44.351 -24.735 -52.154  1.00 47.03  ? 541  HOH A O     1 
HETATM 8056 O  O     . HOH EA 7 .   ? -4.281  -28.638 -43.478  1.00 45.41  ? 542  HOH A O     1 
HETATM 8057 O  O     . HOH EA 7 .   ? -20.615 -29.407 -46.190  1.00 29.01  ? 543  HOH A O     1 
HETATM 8058 O  O     . HOH EA 7 .   ? -44.442 -25.278 -63.139  1.00 63.85  ? 544  HOH A O     1 
HETATM 8059 O  O     . HOH EA 7 .   ? -33.128 -20.421 -39.112  1.00 46.26  ? 545  HOH A O     1 
HETATM 8060 O  O     . HOH EA 7 .   ? -39.217 -17.849 -45.883  1.00 55.87  ? 546  HOH A O     1 
HETATM 8061 O  O     . HOH EA 7 .   ? -7.206  -26.158 -45.420  1.00 42.43  ? 547  HOH A O     1 
HETATM 8062 O  O     . HOH EA 7 .   ? -23.603 -35.079 -61.932  1.00 42.92  ? 548  HOH A O     1 
HETATM 8063 O  O     . HOH EA 7 .   ? -27.464 -13.772 -47.152  1.00 24.07  ? 549  HOH A O     1 
HETATM 8064 O  O     . HOH EA 7 .   ? -4.701  -3.706  -61.522  1.00 61.08  ? 550  HOH A O     1 
HETATM 8065 O  O     . HOH EA 7 .   ? -16.415 -26.481 -57.433  1.00 41.79  ? 551  HOH A O     1 
HETATM 8066 O  O     . HOH EA 7 .   ? -24.289 -41.620 -52.819  1.00 46.60  ? 552  HOH A O     1 
HETATM 8067 O  O     . HOH EA 7 .   ? -44.203 -25.696 -49.301  1.00 40.78  ? 553  HOH A O     1 
HETATM 8068 O  O     . HOH EA 7 .   ? -19.281 -26.026 -39.814  1.00 43.67  ? 554  HOH A O     1 
HETATM 8069 O  O     . HOH EA 7 .   ? -28.235 -14.760 -72.388  1.00 48.84  ? 555  HOH A O     1 
HETATM 8070 O  O     . HOH EA 7 .   ? -33.656 -34.165 -43.064  1.00 42.72  ? 556  HOH A O     1 
HETATM 8071 O  O     . HOH EA 7 .   ? -19.601 -28.830 -68.881  1.00 42.82  ? 557  HOH A O     1 
HETATM 8072 O  O     . HOH EA 7 .   ? -31.255 -33.087 -69.197  1.00 46.21  ? 558  HOH A O     1 
HETATM 8073 O  O     . HOH EA 7 .   ? -26.763 -44.200 -59.391  1.00 47.48  ? 559  HOH A O     1 
HETATM 8074 O  O     . HOH EA 7 .   ? -20.172 -28.251 -41.030  1.00 33.60  ? 560  HOH A O     1 
HETATM 8075 O  O     . HOH EA 7 .   ? -45.854 -32.743 -49.165  1.00 49.70  ? 561  HOH A O     1 
HETATM 8076 O  O     . HOH EA 7 .   ? -17.065 -33.164 -53.845  1.00 46.32  ? 562  HOH A O     1 
HETATM 8077 O  O     . HOH EA 7 .   ? -3.895  -8.035  -37.475  1.00 45.91  ? 563  HOH A O     1 
HETATM 8078 O  O     . HOH EA 7 .   ? -38.801 -38.238 -51.778  1.00 59.49  ? 564  HOH A O     1 
HETATM 8079 O  O     . HOH EA 7 .   ? -31.852 -28.781 -70.609  1.00 48.53  ? 565  HOH A O     1 
HETATM 8080 O  O     . HOH EA 7 .   ? -25.261 -28.492 -35.755  1.00 45.77  ? 566  HOH A O     1 
HETATM 8081 O  O     . HOH EA 7 .   ? -35.409 -9.811  -37.618  1.00 61.40  ? 567  HOH A O     1 
HETATM 8082 O  O     . HOH EA 7 .   ? -2.803  -20.272 -35.376  1.00 55.07  ? 568  HOH A O     1 
HETATM 8083 O  O     . HOH EA 7 .   ? -35.436 -18.955 -40.548  1.00 50.54  ? 569  HOH A O     1 
HETATM 8084 O  O     . HOH EA 7 .   ? -31.166 -31.176 -42.220  1.00 34.35  ? 570  HOH A O     1 
HETATM 8085 O  O     . HOH EA 7 .   ? -33.715 -1.951  -50.250  1.00 54.72  ? 571  HOH A O     1 
HETATM 8086 O  O     . HOH EA 7 .   ? -26.436 -17.732 -32.045  1.00 49.69  ? 572  HOH A O     1 
HETATM 8087 O  O     . HOH EA 7 .   ? -38.970 -39.279 -54.672  1.00 54.25  ? 573  HOH A O     1 
HETATM 8088 O  O     . HOH EA 7 .   ? -24.115 -35.372 -38.853  1.00 56.62  ? 574  HOH A O     1 
HETATM 8089 O  O     . HOH EA 7 .   ? -6.414  -8.805  -32.319  1.00 56.47  ? 575  HOH A O     1 
HETATM 8090 O  O     . HOH EA 7 .   ? -30.363 -5.794  -60.194  1.00 50.82  ? 576  HOH A O     1 
HETATM 8091 O  O     . HOH EA 7 .   ? -6.155  -6.596  -35.268  1.00 58.70  ? 577  HOH A O     1 
HETATM 8092 O  O     . HOH EA 7 .   ? -10.341 -6.942  -62.313  1.00 66.04  ? 578  HOH A O     1 
HETATM 8093 O  O     . HOH EA 7 .   ? -39.701 -10.012 -49.873  1.00 63.21  ? 579  HOH A O     1 
HETATM 8094 O  O     . HOH EA 7 .   ? -41.133 -13.123 -53.501  1.00 44.87  ? 580  HOH A O     1 
HETATM 8095 O  O     . HOH EA 7 .   ? -44.389 -24.383 -47.194  1.00 53.57  ? 581  HOH A O     1 
HETATM 8096 O  O     . HOH EA 7 .   ? -45.655 -28.305 -49.757  1.00 52.12  ? 582  HOH A O     1 
HETATM 8097 O  O     . HOH EA 7 .   ? -30.962 -2.740  -59.767  1.00 48.72  ? 583  HOH A O     1 
HETATM 8098 O  O     . HOH EA 7 .   ? -29.305 -34.778 -39.532  1.00 60.09  ? 584  HOH A O     1 
HETATM 8099 O  O     . HOH EA 7 .   ? -3.193  -6.711  -60.659  1.00 66.24  ? 585  HOH A O     1 
HETATM 8100 O  O     . HOH EA 7 .   ? -17.608 -28.331 -37.479  1.00 59.77  ? 586  HOH A O     1 
HETATM 8101 O  O     . HOH EA 7 .   ? -26.331 -29.274 -71.634  1.00 59.58  ? 587  HOH A O     1 
HETATM 8102 O  O     . HOH EA 7 .   ? -30.414 -39.053 -46.551  1.00 42.80  ? 588  HOH A O     1 
HETATM 8103 O  O     . HOH EA 7 .   ? -2.168  -10.764 -38.489  1.00 64.06  ? 589  HOH A O     1 
HETATM 8104 O  O     . HOH EA 7 .   ? -47.236 -24.692 -53.401  1.00 54.33  ? 590  HOH A O     1 
HETATM 8105 O  O     . HOH EA 7 .   ? -3.057  -12.004 -58.821  1.00 62.52  ? 591  HOH A O     1 
HETATM 8106 O  O     . HOH EA 7 .   ? -38.712 -22.491 -68.165  1.00 67.15  ? 592  HOH A O     1 
HETATM 8107 O  O     . HOH EA 7 .   ? -44.490 -12.091 -57.905  1.00 72.02  ? 593  HOH A O     1 
HETATM 8108 O  O     . HOH EA 7 .   ? -42.809 -19.843 -52.892  1.00 59.74  ? 594  HOH A O     1 
HETATM 8109 O  O     . HOH EA 7 .   ? -23.443 -28.255 -73.876  1.00 62.75  ? 595  HOH A O     1 
HETATM 8110 O  O     . HOH EA 7 .   ? -3.668  -10.601 -61.271  1.00 58.10  ? 596  HOH A O     1 
HETATM 8111 O  O     . HOH EA 7 .   ? -30.709 -29.928 -40.389  1.00 47.31  ? 597  HOH A O     1 
HETATM 8112 O  O     A HOH FA 7 .   ? -61.454 -55.118 -131.084 0.98 50.86  ? 501  HOH B O     1 
HETATM 8113 O  O     . HOH FA 7 .   ? -42.608 -71.059 -131.989 1.00 32.30  ? 502  HOH B O     1 
HETATM 8114 O  O     . HOH FA 7 .   ? -38.680 -43.939 -145.949 1.00 48.74  ? 503  HOH B O     1 
HETATM 8115 O  O     . HOH FA 7 .   ? -21.051 -55.932 -143.906 1.00 70.12  ? 504  HOH B O     1 
HETATM 8116 O  O     . HOH FA 7 .   ? -24.386 -46.386 -133.874 1.00 50.29  ? 505  HOH B O     1 
HETATM 8117 O  O     . HOH FA 7 .   ? -26.116 -43.362 -145.855 1.00 44.13  ? 506  HOH B O     1 
HETATM 8118 O  O     . HOH FA 7 .   ? -29.082 -58.469 -126.894 1.00 66.77  ? 507  HOH B O     1 
HETATM 8119 O  O     . HOH FA 7 .   ? -40.140 -74.293 -143.685 1.00 66.99  ? 508  HOH B O     1 
HETATM 8120 O  O     . HOH FA 7 .   ? -43.517 -50.667 -128.343 1.00 31.08  ? 509  HOH B O     1 
HETATM 8121 O  O     . HOH FA 7 .   ? -29.398 -51.725 -133.542 1.00 46.48  ? 510  HOH B O     1 
HETATM 8122 O  O     . HOH FA 7 .   ? -40.160 -45.189 -127.412 1.00 27.84  ? 511  HOH B O     1 
HETATM 8123 O  O     . HOH FA 7 .   ? -47.355 -47.881 -141.763 1.00 27.51  ? 512  HOH B O     1 
HETATM 8124 O  O     . HOH FA 7 .   ? -33.677 -73.992 -129.338 1.00 67.69  ? 513  HOH B O     1 
HETATM 8125 O  O     . HOH FA 7 .   ? -24.097 -59.229 -146.825 1.00 60.34  ? 514  HOH B O     1 
HETATM 8126 O  O     . HOH FA 7 .   ? -51.579 -68.834 -123.660 1.00 55.30  ? 515  HOH B O     1 
HETATM 8127 O  O     . HOH FA 7 .   ? -61.687 -39.066 -130.775 1.00 39.83  ? 516  HOH B O     1 
HETATM 8128 O  O     . HOH FA 7 .   ? -51.930 -67.730 -137.803 1.00 36.28  ? 517  HOH B O     1 
HETATM 8129 O  O     . HOH FA 7 .   ? -42.866 -33.811 -123.100 1.00 49.83  ? 518  HOH B O     1 
HETATM 8130 O  O     . HOH FA 7 .   ? -53.428 -48.820 -145.393 1.00 44.07  ? 519  HOH B O     1 
HETATM 8131 O  O     . HOH FA 7 .   ? -42.772 -54.098 -129.362 1.00 31.70  ? 520  HOH B O     1 
HETATM 8132 O  O     . HOH FA 7 .   ? -21.752 -52.813 -145.228 1.00 59.34  ? 521  HOH B O     1 
HETATM 8133 O  O     . HOH FA 7 .   ? -45.642 -33.157 -134.654 1.00 45.22  ? 522  HOH B O     1 
HETATM 8134 O  O     . HOH FA 7 .   ? -65.149 -49.667 -129.099 1.00 54.16  ? 523  HOH B O     1 
HETATM 8135 O  O     . HOH FA 7 .   ? -48.428 -47.794 -133.276 1.00 29.64  ? 524  HOH B O     1 
HETATM 8136 O  O     . HOH FA 7 .   ? -51.617 -54.644 -141.418 1.00 32.76  ? 525  HOH B O     1 
HETATM 8137 O  O     . HOH FA 7 .   ? -50.639 -56.909 -139.944 1.00 29.61  ? 526  HOH B O     1 
HETATM 8138 O  O     . HOH FA 7 .   ? -31.592 -57.008 -119.954 1.00 51.96  ? 527  HOH B O     1 
HETATM 8139 O  O     . HOH FA 7 .   ? -48.743 -44.906 -118.152 1.00 39.56  ? 528  HOH B O     1 
HETATM 8140 O  O     . HOH FA 7 .   ? -50.714 -52.619 -109.985 1.00 42.25  ? 529  HOH B O     1 
HETATM 8141 O  O     . HOH FA 7 .   ? -48.387 -33.930 -134.888 1.00 38.28  ? 530  HOH B O     1 
HETATM 8142 O  O     . HOH FA 7 .   ? -50.561 -57.967 -150.009 1.00 59.56  ? 531  HOH B O     1 
HETATM 8143 O  O     . HOH FA 7 .   ? -40.943 -41.911 -136.421 1.00 27.52  ? 532  HOH B O     1 
HETATM 8144 O  O     . HOH FA 7 .   ? -51.722 -33.515 -135.097 1.00 45.77  ? 533  HOH B O     1 
HETATM 8145 O  O     . HOH FA 7 .   ? -28.503 -55.651 -126.976 1.00 52.55  ? 534  HOH B O     1 
HETATM 8146 O  O     . HOH FA 7 .   ? -60.114 -51.909 -139.332 1.00 42.95  ? 535  HOH B O     1 
HETATM 8147 O  O     . HOH FA 7 .   ? -27.863 -45.963 -136.898 1.00 37.70  ? 536  HOH B O     1 
HETATM 8148 O  O     . HOH FA 7 .   ? -50.441 -42.274 -146.492 1.00 47.32  ? 537  HOH B O     1 
HETATM 8149 O  O     . HOH FA 7 .   ? -37.825 -46.344 -125.670 1.00 39.32  ? 538  HOH B O     1 
HETATM 8150 O  O     . HOH FA 7 .   ? -44.724 -37.829 -120.237 1.00 47.36  ? 539  HOH B O     1 
HETATM 8151 O  O     . HOH FA 7 .   ? -43.920 -34.860 -143.095 1.00 46.46  ? 540  HOH B O     1 
HETATM 8152 O  O     . HOH FA 7 .   ? -50.949 -58.593 -112.684 1.00 49.08  ? 541  HOH B O     1 
HETATM 8153 O  O     . HOH FA 7 .   ? -32.161 -51.340 -126.047 1.00 48.81  ? 542  HOH B O     1 
HETATM 8154 O  O     . HOH FA 7 .   ? -43.355 -72.131 -125.213 1.00 42.37  ? 543  HOH B O     1 
HETATM 8155 O  O     . HOH FA 7 .   ? -56.378 -33.019 -119.862 1.00 57.97  ? 544  HOH B O     1 
HETATM 8156 O  O     . HOH FA 7 .   ? -39.402 -44.759 -143.155 1.00 36.21  ? 545  HOH B O     1 
HETATM 8157 O  O     . HOH FA 7 .   ? -56.712 -39.893 -142.439 1.00 50.14  ? 546  HOH B O     1 
HETATM 8158 O  O     . HOH FA 7 .   ? -62.557 -57.791 -132.430 1.00 47.90  ? 547  HOH B O     1 
HETATM 8159 O  O     . HOH FA 7 .   ? -41.377 -45.150 -114.110 1.00 51.71  ? 548  HOH B O     1 
HETATM 8160 O  O     . HOH FA 7 .   ? -48.995 -57.055 -137.758 1.00 24.87  ? 549  HOH B O     1 
HETATM 8161 O  O     . HOH FA 7 .   ? -48.439 -66.089 -131.817 1.00 29.87  ? 550  HOH B O     1 
HETATM 8162 O  O     . HOH FA 7 .   ? -39.240 -55.015 -147.812 1.00 52.88  ? 551  HOH B O     1 
HETATM 8163 O  O     . HOH FA 7 .   ? -44.888 -61.687 -113.024 1.00 52.76  ? 552  HOH B O     1 
HETATM 8164 O  O     . HOH FA 7 .   ? -53.514 -35.572 -139.524 1.00 45.62  ? 553  HOH B O     1 
HETATM 8165 O  O     . HOH FA 7 .   ? -40.417 -42.571 -141.715 1.00 40.37  ? 554  HOH B O     1 
HETATM 8166 O  O     . HOH FA 7 .   ? -27.516 -49.636 -131.476 1.00 45.50  ? 555  HOH B O     1 
HETATM 8167 O  O     . HOH FA 7 .   ? -55.671 -50.742 -144.287 1.00 46.70  ? 556  HOH B O     1 
HETATM 8168 O  O     . HOH FA 7 .   ? -23.002 -50.965 -146.951 1.00 39.57  ? 557  HOH B O     1 
HETATM 8169 O  O     . HOH FA 7 .   ? -41.484 -47.607 -148.969 1.00 44.36  ? 558  HOH B O     1 
HETATM 8170 O  O     . HOH FA 7 .   ? -52.509 -40.278 -113.702 1.00 54.95  ? 559  HOH B O     1 
HETATM 8171 O  O     . HOH FA 7 .   ? -51.293 -38.888 -140.786 1.00 29.01  ? 560  HOH B O     1 
HETATM 8172 O  O     . HOH FA 7 .   ? -58.682 -32.171 -130.518 1.00 59.23  ? 561  HOH B O     1 
HETATM 8173 O  O     . HOH FA 7 .   ? -57.783 -57.154 -138.296 1.00 46.92  ? 562  HOH B O     1 
HETATM 8174 O  O     . HOH FA 7 .   ? -46.694 -37.964 -116.008 1.00 46.72  ? 563  HOH B O     1 
HETATM 8175 O  O     . HOH FA 7 .   ? -53.396 -64.251 -122.797 1.00 50.16  ? 564  HOH B O     1 
HETATM 8176 O  O     . HOH FA 7 .   ? -25.112 -51.593 -149.534 1.00 48.40  ? 565  HOH B O     1 
HETATM 8177 O  O     . HOH FA 7 .   ? -29.076 -45.273 -129.420 1.00 60.71  ? 566  HOH B O     1 
HETATM 8178 O  O     . HOH FA 7 .   ? -47.517 -72.192 -140.656 1.00 57.26  ? 567  HOH B O     1 
HETATM 8179 O  O     . HOH FA 7 .   ? -38.882 -40.862 -143.827 1.00 57.59  ? 568  HOH B O     1 
HETATM 8180 O  O     . HOH FA 7 .   ? -46.324 -51.109 -153.052 1.00 65.00  ? 569  HOH B O     1 
HETATM 8181 O  O     . HOH FA 7 .   ? -48.708 -45.130 -150.993 1.00 60.67  ? 570  HOH B O     1 
HETATM 8182 O  O     . HOH FA 7 .   ? -53.919 -62.251 -144.429 1.00 61.98  ? 571  HOH B O     1 
HETATM 8183 O  O     . HOH FA 7 .   ? -56.184 -69.193 -135.678 1.00 67.29  ? 572  HOH B O     1 
HETATM 8184 O  O     . HOH FA 7 .   ? -46.880 -27.161 -122.798 1.00 56.81  ? 573  HOH B O     1 
HETATM 8185 O  O     . HOH FA 7 .   ? -30.509 -76.821 -128.453 1.00 61.36  ? 574  HOH B O     1 
HETATM 8186 O  O     . HOH FA 7 .   ? -20.306 -54.593 -146.710 1.00 67.99  ? 575  HOH B O     1 
HETATM 8187 O  O     . HOH FA 7 .   ? -64.174 -50.640 -131.711 1.00 56.79  ? 576  HOH B O     1 
HETATM 8188 O  O     . HOH FA 7 .   ? -66.406 -41.573 -140.574 1.00 59.43  ? 577  HOH B O     1 
HETATM 8189 O  O     . HOH FA 7 .   ? -51.957 -71.162 -135.855 1.00 67.46  ? 578  HOH B O     1 
HETATM 8190 O  O     . HOH FA 7 .   ? -24.447 -60.024 -127.785 1.00 69.81  ? 579  HOH B O     1 
HETATM 8191 O  O     . HOH FA 7 .   ? -52.823 -65.721 -124.904 1.00 47.48  ? 580  HOH B O     1 
HETATM 8192 O  O     . HOH FA 7 .   ? -56.581 -59.976 -139.248 1.00 66.84  ? 581  HOH B O     1 
HETATM 8193 O  O     . HOH FA 7 .   ? -42.326 -62.904 -151.825 1.00 60.30  ? 582  HOH B O     1 
HETATM 8194 O  O     . HOH FA 7 .   ? -45.649 -71.057 -121.042 1.00 63.42  ? 583  HOH B O     1 
HETATM 8195 O  O     . HOH FA 7 .   ? -51.719 -30.996 -137.901 1.00 63.41  ? 584  HOH B O     1 
HETATM 8196 O  O     . HOH FA 7 .   ? -35.095 -68.226 -122.813 1.00 65.34  ? 585  HOH B O     1 
HETATM 8197 O  O     . HOH FA 7 .   ? -21.736 -66.017 -133.794 1.00 63.51  ? 586  HOH B O     1 
HETATM 8198 O  O     . HOH FA 7 .   ? -42.715 -45.134 -150.287 1.00 54.42  ? 587  HOH B O     1 
HETATM 8199 O  O     . HOH GA 7 .   ? -50.539 -46.437 -110.280 1.00 48.68  ? 1201 HOH C O     1 
HETATM 8200 O  O     . HOH GA 7 .   ? -34.613 -71.337 -85.529  1.00 60.25  ? 1202 HOH C O     1 
HETATM 8201 O  O     . HOH GA 7 .   ? -28.320 -39.713 -89.406  1.00 94.57  ? 1203 HOH C O     1 
HETATM 8202 O  O     . HOH GA 7 .   ? -36.357 -51.868 -88.554  1.00 46.96  ? 1204 HOH C O     1 
HETATM 8203 O  O     . HOH GA 7 .   ? -44.281 -53.090 -74.309  1.00 46.24  ? 1205 HOH C O     1 
HETATM 8204 O  O     . HOH GA 7 .   ? -37.492 -55.982 -83.572  1.00 49.91  ? 1206 HOH C O     1 
HETATM 8205 O  O     . HOH GA 7 .   ? -51.537 -56.166 -89.303  1.00 49.46  ? 1207 HOH C O     1 
HETATM 8206 O  O     . HOH GA 7 .   ? -43.714 -52.872 -82.204  1.00 44.92  ? 1208 HOH C O     1 
HETATM 8207 O  O     . HOH GA 7 .   ? -34.361 -32.459 -100.534 1.00 58.39  ? 1209 HOH C O     1 
HETATM 8208 O  O     . HOH GA 7 .   ? -50.128 -56.385 -87.056  1.00 44.69  ? 1210 HOH C O     1 
HETATM 8209 O  O     . HOH GA 7 .   ? -43.865 -64.108 -69.641  1.00 55.88  ? 1211 HOH C O     1 
HETATM 8210 O  O     . HOH GA 7 .   ? -36.138 -56.806 -92.730  1.00 54.76  ? 1212 HOH C O     1 
HETATM 8211 O  O     . HOH GA 7 .   ? -42.994 -52.873 -90.438  1.00 48.50  ? 1213 HOH C O     1 
HETATM 8212 O  O     . HOH GA 7 .   ? -40.295 -53.563 -89.372  1.00 48.95  ? 1214 HOH C O     1 
HETATM 8213 O  O     . HOH GA 7 .   ? -48.177 -56.607 -95.977  1.00 47.20  ? 1215 HOH C O     1 
HETATM 8214 O  O     . HOH GA 7 .   ? -62.525 -41.836 -96.364  1.00 54.09  ? 1216 HOH C O     1 
HETATM 8215 O  O     . HOH GA 7 .   ? -32.389 -32.204 -87.498  1.00 49.84  ? 1217 HOH C O     1 
HETATM 8216 O  O     . HOH GA 7 .   ? -40.311 -52.510 -73.656  1.00 54.25  ? 1218 HOH C O     1 
HETATM 8217 O  O     . HOH GA 7 .   ? -54.811 -61.898 -89.328  1.00 63.01  ? 1219 HOH C O     1 
HETATM 8218 O  O     . HOH GA 7 .   ? -49.263 -58.646 -88.776  1.00 48.33  ? 1220 HOH C O     1 
HETATM 8219 O  O     . HOH GA 7 .   ? -54.984 -62.022 -107.630 1.00 50.99  ? 1221 HOH C O     1 
HETATM 8220 O  O     . HOH GA 7 .   ? -45.899 -50.679 -106.604 1.00 62.08  ? 1222 HOH C O     1 
HETATM 8221 O  O     . HOH GA 7 .   ? -64.771 -44.954 -98.249  1.00 65.22  ? 1223 HOH C O     1 
HETATM 8222 O  O     . HOH GA 7 .   ? -34.123 -72.182 -71.731  1.00 62.35  ? 1224 HOH C O     1 
HETATM 8223 O  O     . HOH GA 7 .   ? -65.200 -49.193 -106.242 1.00 64.39  ? 1225 HOH C O     1 
HETATM 8224 O  O     . HOH HA 7 .   ? -27.750 -27.064 -73.360  1.00 52.96  ? 1301 HOH D O     1 
HETATM 8225 O  O     . HOH HA 7 .   ? -13.319 -23.090 -96.301  1.00 50.48  ? 1302 HOH D O     1 
HETATM 8226 O  O     . HOH HA 7 .   ? -12.404 -26.018 -98.232  1.00 47.60  ? 1303 HOH D O     1 
HETATM 8227 O  O     . HOH HA 7 .   ? -27.070 -16.938 -84.083  1.00 43.32  ? 1304 HOH D O     1 
HETATM 8228 O  O     . HOH HA 7 .   ? -27.494 -21.111 -103.416 1.00 42.54  ? 1305 HOH D O     1 
HETATM 8229 O  O     . HOH HA 7 .   ? -20.511 -22.335 -102.356 1.00 40.13  ? 1306 HOH D O     1 
HETATM 8230 O  O     . HOH HA 7 .   ? -38.187 -28.930 -92.337  1.00 47.44  ? 1307 HOH D O     1 
HETATM 8231 O  O     . HOH HA 7 .   ? -37.831 -15.947 -74.471  1.00 50.08  ? 1308 HOH D O     1 
HETATM 8232 O  O     . HOH HA 7 .   ? -19.836 -9.607  -121.896 1.00 40.07  ? 1309 HOH D O     1 
HETATM 8233 O  O     . HOH HA 7 .   ? -28.093 -20.915 -74.615  1.00 48.39  ? 1310 HOH D O     1 
HETATM 8234 O  O     . HOH HA 7 .   ? -10.813 -42.358 -90.946  1.00 47.09  ? 1311 HOH D O     1 
HETATM 8235 O  O     . HOH HA 7 .   ? -6.347  -21.469 -107.085 1.00 54.24  ? 1312 HOH D O     1 
HETATM 8236 O  O     . HOH HA 7 .   ? -8.308  -32.926 -94.322  1.00 57.68  ? 1313 HOH D O     1 
HETATM 8237 O  O     . HOH HA 7 .   ? -1.978  -16.184 -98.363  1.00 63.43  ? 1314 HOH D O     1 
HETATM 8238 O  O     . HOH HA 7 .   ? -17.091 -21.015 -95.413  1.00 55.45  ? 1315 HOH D O     1 
HETATM 8239 O  O     . HOH HA 7 .   ? -29.384 -24.639 -100.998 1.00 52.96  ? 1316 HOH D O     1 
HETATM 8240 O  O     . HOH HA 7 .   ? -39.126 -32.737 -87.470  1.00 46.62  ? 1317 HOH D O     1 
HETATM 8241 O  O     . HOH HA 7 .   ? -26.757 -18.274 -97.580  1.00 41.87  ? 1318 HOH D O     1 
HETATM 8242 O  O     . HOH HA 7 .   ? -30.426 -17.309 -103.482 1.00 55.65  ? 1319 HOH D O     1 
HETATM 8243 O  O     . HOH HA 7 .   ? -17.444 -23.029 -111.243 1.00 47.22  ? 1320 HOH D O     1 
HETATM 8244 O  O     . HOH HA 7 .   ? -8.945  -42.356 -96.378  1.00 37.30  ? 1321 HOH D O     1 
HETATM 8245 O  O     . HOH HA 7 .   ? -4.553  -25.075 -97.223  1.00 70.04  ? 1322 HOH D O     1 
HETATM 8246 O  O     . HOH HA 7 .   ? -31.015 -27.855 -73.087  1.00 51.80  ? 1323 HOH D O     1 
HETATM 8247 O  O     . HOH HA 7 .   ? -27.237 -18.712 -87.070  1.00 44.54  ? 1324 HOH D O     1 
HETATM 8248 O  O     . HOH HA 7 .   ? -31.515 -34.207 -85.614  1.00 45.54  ? 1325 HOH D O     1 
HETATM 8249 O  O     . HOH HA 7 .   ? -10.671 -1.431  -111.044 1.00 63.58  ? 1326 HOH D O     1 
HETATM 8250 O  O     . HOH HA 7 .   ? -9.920  -4.919  -114.161 1.00 57.95  ? 1327 HOH D O     1 
HETATM 8251 O  O     . HOH HA 7 .   ? -20.981 -7.714  -98.157  1.00 46.50  ? 1328 HOH D O     1 
HETATM 8252 O  O     . HOH HA 7 .   ? -29.283 -26.986 -101.716 1.00 51.95  ? 1329 HOH D O     1 
HETATM 8253 O  O     . HOH HA 7 .   ? -38.333 -31.067 -82.503  1.00 58.20  ? 1330 HOH D O     1 
HETATM 8254 O  O     . HOH HA 7 .   ? -39.190 -13.891 -75.149  1.00 62.16  ? 1331 HOH D O     1 
HETATM 8255 O  O     . HOH HA 7 .   ? -36.151 -27.306 -92.980  1.00 50.01  ? 1332 HOH D O     1 
HETATM 8256 O  O     . HOH HA 7 .   ? -26.489 -18.846 -114.091 1.00 66.75  ? 1333 HOH D O     1 
HETATM 8257 O  O     . HOH HA 7 .   ? -18.857 -12.892 -89.902  1.00 56.34  ? 1334 HOH D O     1 
HETATM 8258 O  O     . HOH HA 7 .   ? -28.948 -19.112 -108.641 1.00 66.06  ? 1335 HOH D O     1 
HETATM 8259 O  O     . HOH HA 7 .   ? -17.183 -31.978 -106.949 1.00 63.22  ? 1336 HOH D O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . LEU A 6   ? 0.8370 0.7416 0.7830 -0.0787 -0.0079 -0.0211 7    LEU A N   
2    C CA  . LEU A 6   ? 0.8145 0.7196 0.7735 -0.0704 -0.0025 -0.0158 7    LEU A CA  
3    C C   . LEU A 6   ? 0.7450 0.6314 0.7042 -0.0702 -0.0045 -0.0232 7    LEU A C   
4    O O   . LEU A 6   ? 0.6815 0.5503 0.6360 -0.0665 -0.0023 -0.0350 7    LEU A O   
5    C CB  . LEU A 6   ? 0.7423 0.6481 0.7066 -0.0591 0.0069  -0.0169 7    LEU A CB  
6    C CG  . LEU A 6   ? 0.7267 0.6375 0.7053 -0.0499 0.0134  -0.0093 7    LEU A CG  
7    C CD1 . LEU A 6   ? 0.6945 0.6281 0.6814 -0.0513 0.0132  0.0060  7    LEU A CD1 
8    C CD2 . LEU A 6   ? 0.7160 0.6215 0.6977 -0.0388 0.0223  -0.0141 7    LEU A CD2 
9    N N   . ASN A 7   ? 0.6384 0.5287 0.6032 -0.0740 -0.0085 -0.0162 8    ASN A N   
10   C CA  . ASN A 7   ? 0.5218 0.3955 0.4869 -0.0747 -0.0110 -0.0221 8    ASN A CA  
11   C C   . ASN A 7   ? 0.5099 0.3844 0.4885 -0.0658 -0.0050 -0.0167 8    ASN A C   
12   O O   . ASN A 7   ? 0.5948 0.4822 0.5820 -0.0667 -0.0059 -0.0053 8    ASN A O   
13   C CB  . ASN A 7   ? 0.5365 0.4122 0.4976 -0.0859 -0.0203 -0.0192 8    ASN A CB  
14   C CG  . ASN A 7   ? 0.5790 0.4356 0.5380 -0.0876 -0.0236 -0.0274 8    ASN A CG  
15   O OD1 . ASN A 7   ? 0.5775 0.4306 0.5456 -0.0828 -0.0211 -0.0247 8    ASN A OD1 
16   N ND2 . ASN A 7   ? 0.6980 0.5422 0.6450 -0.0946 -0.0294 -0.0374 8    ASN A ND2 
17   N N   . LEU A 8   ? 0.4849 0.3447 0.4651 -0.0573 0.0008  -0.0251 9    LEU A N   
18   C CA  . LEU A 8   ? 0.4824 0.3428 0.4753 -0.0477 0.0074  -0.0205 9    LEU A CA  
19   C C   . LEU A 8   ? 0.5646 0.4202 0.5628 -0.0502 0.0037  -0.0177 9    LEU A C   
20   O O   . LEU A 8   ? 0.5650 0.4298 0.5747 -0.0458 0.0068  -0.0082 9    LEU A O   
21   C CB  . LEU A 8   ? 0.5345 0.3794 0.5269 -0.0385 0.0141  -0.0309 9    LEU A CB  
22   C CG  . LEU A 8   ? 0.5389 0.3914 0.5314 -0.0321 0.0207  -0.0306 9    LEU A CG  
23   C CD1 . LEU A 8   ? 0.5775 0.4123 0.5684 -0.0240 0.0263  -0.0423 9    LEU A CD1 
24   C CD2 . LEU A 8   ? 0.5010 0.3726 0.5059 -0.0265 0.0257  -0.0171 9    LEU A CD2 
25   N N   . ASP A 9   ? 0.5624 0.4033 0.5525 -0.0568 -0.0026 -0.0261 10   ASP A N   
26   C CA  . ASP A 9   ? 0.5264 0.3624 0.5211 -0.0596 -0.0064 -0.0237 10   ASP A CA  
27   C C   . ASP A 9   ? 0.5074 0.3624 0.5073 -0.0655 -0.0105 -0.0101 10   ASP A C   
28   O O   . ASP A 9   ? 0.5504 0.4097 0.5602 -0.0632 -0.0096 -0.0027 10   ASP A O   
29   C CB  . ASP A 9   ? 0.5096 0.3271 0.4937 -0.0666 -0.0130 -0.0352 10   ASP A CB  
30   C CG  . ASP A 9   ? 0.6067 0.4037 0.5874 -0.0601 -0.0089 -0.0484 10   ASP A CG  
31   O OD1 . ASP A 9   ? 0.6319 0.4272 0.6210 -0.0500 -0.0012 -0.0478 10   ASP A OD1 
32   O OD2 . ASP A 9   ? 0.5993 0.3820 0.5691 -0.0650 -0.0131 -0.0593 10   ASP A OD2 
33   N N   . SER A 10  ? 0.5180 0.3845 0.5113 -0.0731 -0.0150 -0.0067 11   SER A N   
34   C CA  . SER A 10  ? 0.5637 0.4495 0.5617 -0.0787 -0.0187 0.0066  11   SER A CA  
35   C C   . SER A 10  ? 0.5473 0.4487 0.5582 -0.0705 -0.0117 0.0179  11   SER A C   
36   O O   . SER A 10  ? 0.5149 0.4254 0.5350 -0.0707 -0.0124 0.0277  11   SER A O   
37   C CB  . SER A 10  ? 0.6094 0.5045 0.5977 -0.0873 -0.0239 0.0075  11   SER A CB  
38   O OG  . SER A 10  ? 0.6753 0.5905 0.6683 -0.0921 -0.0268 0.0207  11   SER A OG  
39   N N   . ILE A 11  ? 0.4413 0.3460 0.4532 -0.0633 -0.0050 0.0167  12   ILE A N   
40   C CA  . ILE A 11  ? 0.4268 0.3465 0.4503 -0.0552 0.0020  0.0269  12   ILE A CA  
41   C C   . ILE A 11  ? 0.4145 0.3285 0.4491 -0.0478 0.0063  0.0289  12   ILE A C   
42   O O   . ILE A 11  ? 0.4052 0.3324 0.4500 -0.0462 0.0074  0.0403  12   ILE A O   
43   C CB  . ILE A 11  ? 0.4244 0.3448 0.4457 -0.0485 0.0085  0.0228  12   ILE A CB  
44   C CG1 . ILE A 11  ? 0.4352 0.3651 0.4470 -0.0557 0.0046  0.0233  12   ILE A CG1 
45   C CG2 . ILE A 11  ? 0.4082 0.3401 0.4421 -0.0384 0.0168  0.0315  12   ILE A CG2 
46   C CD1 . ILE A 11  ? 0.4348 0.3635 0.4426 -0.0500 0.0103  0.0176  12   ILE A CD1 
47   N N   . ILE A 12  ? 0.4984 0.3928 0.5311 -0.0429 0.0089  0.0178  13   ILE A N   
48   C CA  . ILE A 12  ? 0.5268 0.4141 0.5694 -0.0356 0.0131  0.0186  13   ILE A CA  
49   C C   . ILE A 12  ? 0.5493 0.4385 0.5955 -0.0416 0.0073  0.0244  13   ILE A C   
50   O O   . ILE A 12  ? 0.5258 0.4213 0.5832 -0.0373 0.0101  0.0326  13   ILE A O   
51   C CB  . ILE A 12  ? 0.5786 0.4433 0.6167 -0.0306 0.0159  0.0045  13   ILE A CB  
52   C CG1 . ILE A 12  ? 0.5768 0.4406 0.6127 -0.0234 0.0226  -0.0004 13   ILE A CG1 
53   C CG2 . ILE A 12  ? 0.5323 0.3881 0.5798 -0.0240 0.0194  0.0045  13   ILE A CG2 
54   C CD1 . ILE A 12  ? 0.4055 0.2471 0.4353 -0.0195 0.0247  -0.0150 13   ILE A CD1 
55   N N   . GLY A 13  ? 0.5368 0.4206 0.5737 -0.0518 -0.0010 0.0204  14   GLY A N   
56   C CA  . GLY A 13  ? 0.4918 0.3779 0.5316 -0.0583 -0.0071 0.0260  14   GLY A CA  
57   C C   . GLY A 13  ? 0.4915 0.4001 0.5400 -0.0597 -0.0073 0.0412  14   GLY A C   
58   O O   . GLY A 13  ? 0.5226 0.4352 0.5803 -0.0582 -0.0070 0.0484  14   GLY A O   
59   N N   . ARG A 14  ? 0.4587 0.3824 0.5045 -0.0623 -0.0076 0.0465  15   ARG A N   
60   C CA  . ARG A 14  ? 0.5045 0.4500 0.5586 -0.0635 -0.0076 0.0611  15   ARG A CA  
61   C C   . ARG A 14  ? 0.5464 0.4989 0.6136 -0.0525 0.0009  0.0680  15   ARG A C   
62   O O   . ARG A 14  ? 0.5097 0.4746 0.5864 -0.0522 0.0010  0.0791  15   ARG A O   
63   C CB  . ARG A 14  ? 0.4989 0.4585 0.5468 -0.0688 -0.0099 0.0648  15   ARG A CB  
64   C CG  . ARG A 14  ? 0.5592 0.5189 0.5975 -0.0813 -0.0196 0.0639  15   ARG A CG  
65   C CD  . ARG A 14  ? 0.5402 0.5122 0.5714 -0.0864 -0.0217 0.0663  15   ARG A CD  
66   N NE  . ARG A 14  ? 0.5598 0.5200 0.5815 -0.0846 -0.0198 0.0544  15   ARG A NE  
67   C CZ  . ARG A 14  ? 0.5376 0.5065 0.5556 -0.0837 -0.0174 0.0550  15   ARG A CZ  
68   N NH1 . ARG A 14  ? 0.4841 0.4737 0.5074 -0.0843 -0.0166 0.0670  15   ARG A NH1 
69   N NH2 . ARG A 14  ? 0.4826 0.4395 0.4918 -0.0821 -0.0158 0.0437  15   ARG A NH2 
70   N N   . LEU A 15  ? 0.5138 0.4582 0.5817 -0.0435 0.0080  0.0614  16   LEU A N   
71   C CA  . LEU A 15  ? 0.4480 0.3976 0.5282 -0.0327 0.0163  0.0671  16   LEU A CA  
72   C C   . LEU A 15  ? 0.4592 0.3987 0.5466 -0.0293 0.0171  0.0665  16   LEU A C   
73   O O   . LEU A 15  ? 0.4745 0.4234 0.5734 -0.0241 0.0209  0.0758  16   LEU A O   
74   C CB  . LEU A 15  ? 0.3663 0.3091 0.4446 -0.0242 0.0234  0.0596  16   LEU A CB  
75   C CG  . LEU A 15  ? 0.3768 0.3333 0.4519 -0.0244 0.0253  0.0629  16   LEU A CG  
76   C CD1 . LEU A 15  ? 0.3695 0.3142 0.4387 -0.0185 0.0302  0.0518  16   LEU A CD1 
77   C CD2 . LEU A 15  ? 0.3617 0.3386 0.4485 -0.0194 0.0299  0.0766  16   LEU A CD2 
78   N N   . LEU A 16  ? 0.5019 0.4221 0.5827 -0.0321 0.0136  0.0557  17   LEU A N   
79   C CA  . LEU A 16  ? 0.5459 0.4553 0.6329 -0.0291 0.0141  0.0544  17   LEU A CA  
80   C C   . LEU A 16  ? 0.6703 0.5872 0.7606 -0.0366 0.0077  0.0627  17   LEU A C   
81   O O   . LEU A 16  ? 0.6477 0.5587 0.7447 -0.0341 0.0083  0.0639  17   LEU A O   
82   C CB  . LEU A 16  ? 0.4756 0.3612 0.5545 -0.0293 0.0128  0.0396  17   LEU A CB  
83   C CG  . LEU A 16  ? 0.5219 0.3963 0.5991 -0.0203 0.0199  0.0304  17   LEU A CG  
84   C CD1 . LEU A 16  ? 0.5438 0.3943 0.6150 -0.0199 0.0187  0.0168  17   LEU A CD1 
85   C CD2 . LEU A 16  ? 0.5164 0.3982 0.6060 -0.0094 0.0285  0.0370  17   LEU A CD2 
86   N N   . GLU A 17  ? 0.8116 0.7414 0.8975 -0.0456 0.0017  0.0686  18   GLU A N   
87   C CA  . GLU A 17  ? 0.9449 0.8801 1.0325 -0.0536 -0.0051 0.0753  18   GLU A CA  
88   C C   . GLU A 17  ? 0.9997 0.9496 1.1009 -0.0495 -0.0020 0.0883  18   GLU A C   
89   O O   . GLU A 17  ? 1.1389 1.0913 1.2434 -0.0544 -0.0066 0.0935  18   GLU A O   
90   C CB  . GLU A 17  ? 1.0461 0.9912 1.1251 -0.0644 -0.0125 0.0780  18   GLU A CB  
91   C CG  . GLU A 17  ? 1.1773 1.1120 1.2485 -0.0744 -0.0212 0.0730  18   GLU A CG  
92   C CD  . GLU A 17  ? 1.2840 1.2214 1.3431 -0.0839 -0.0276 0.0701  18   GLU A CD  
93   O OE1 . GLU A 17  ? 1.3014 1.2569 1.3614 -0.0886 -0.0300 0.0798  18   GLU A OE1 
94   O OE2 . GLU A 17  ? 1.3103 1.2317 1.3591 -0.0868 -0.0303 0.0581  18   GLU A OE2 
95   N N   . VAL A 18  ? 0.9536 0.9129 1.0627 -0.0405 0.0057  0.0936  19   VAL A N   
96   C CA  . VAL A 18  ? 0.9505 0.9236 1.0729 -0.0356 0.0094  0.1058  19   VAL A CA  
97   C C   . VAL A 18  ? 0.9792 0.9396 1.1089 -0.0285 0.0134  0.1027  19   VAL A C   
98   O O   . VAL A 18  ? 0.9815 0.9510 1.1228 -0.0229 0.0175  0.1115  19   VAL A O   
99   C CB  . VAL A 18  ? 0.9262 0.9146 1.0543 -0.0288 0.0162  0.1127  19   VAL A CB  
100  C CG1 . VAL A 18  ? 0.9893 0.9904 1.1102 -0.0359 0.0123  0.1157  19   VAL A CG1 
101  C CG2 . VAL A 18  ? 0.8766 0.8528 1.0045 -0.0190 0.0237  0.1036  19   VAL A CG2 
102  N N   . GLN A 19  ? 1.0090 0.9487 1.1323 -0.0285 0.0123  0.0902  20   GLN A N   
103  C CA  . GLN A 19  ? 1.0352 0.9613 1.1645 -0.0222 0.0155  0.0864  20   GLN A CA  
104  C C   . GLN A 19  ? 1.0500 0.9800 1.1851 -0.0268 0.0109  0.0936  20   GLN A C   
105  O O   . GLN A 19  ? 1.0678 1.0052 1.1990 -0.0364 0.0038  0.0979  20   GLN A O   
106  C CB  . GLN A 19  ? 1.0381 0.9411 1.1583 -0.0223 0.0144  0.0713  20   GLN A CB  
107  C CG  . GLN A 19  ? 1.0232 0.9177 1.1427 -0.0130 0.0220  0.0636  20   GLN A CG  
108  C CD  . GLN A 19  ? 1.0626 0.9333 1.1759 -0.0116 0.0217  0.0495  20   GLN A CD  
109  O OE1 . GLN A 19  ? 1.0384 0.8989 1.1417 -0.0194 0.0152  0.0421  20   GLN A OE1 
110  N NE2 . GLN A 19  ? 1.0641 0.9258 1.1835 -0.0016 0.0288  0.0459  20   GLN A NE2 
111  N N   . LYS A 25  ? 0.9894 1.0575 1.1561 -0.0169 0.0289  0.1644  26   LYS A N   
112  C CA  . LYS A 25  ? 1.0062 1.0780 1.1627 -0.0282 0.0209  0.1637  26   LYS A CA  
113  C C   . LYS A 25  ? 0.9882 1.0557 1.1346 -0.0285 0.0217  0.1555  26   LYS A C   
114  O O   . LYS A 25  ? 0.9451 0.9960 1.0870 -0.0241 0.0246  0.1442  26   LYS A O   
115  C CB  . LYS A 25  ? 0.9978 1.0561 1.1486 -0.0358 0.0136  0.1578  26   LYS A CB  
116  N N   . ASN A 26  ? 1.0065 1.0891 1.1494 -0.0338 0.0191  0.1613  27   ASN A N   
117  C CA  . ASN A 26  ? 1.0133 1.0946 1.1472 -0.0342 0.0200  0.1550  27   ASN A CA  
118  C C   . ASN A 26  ? 0.9862 1.0516 1.1067 -0.0419 0.0137  0.1431  27   ASN A C   
119  O O   . ASN A 26  ? 1.0393 1.1022 1.1561 -0.0504 0.0065  0.1432  27   ASN A O   
120  C CB  . ASN A 26  ? 1.0563 1.1591 1.1907 -0.0381 0.0187  0.1653  27   ASN A CB  
121  C CG  . ASN A 26  ? 1.1234 1.2400 1.2684 -0.0288 0.0266  0.1739  27   ASN A CG  
122  O OD1 . ASN A 26  ? 1.1461 1.2551 1.2943 -0.0194 0.0337  0.1691  27   ASN A OD1 
123  N ND2 . ASN A 26  ? 1.1360 1.2731 1.2867 -0.0314 0.0255  0.1866  27   ASN A ND2 
124  N N   . VAL A 27  ? 0.8912 0.9459 1.0042 -0.0390 0.0164  0.1328  28   VAL A N   
125  C CA  . VAL A 27  ? 0.8223 0.8633 0.9217 -0.0460 0.0109  0.1214  28   VAL A CA  
126  C C   . VAL A 27  ? 0.8279 0.8791 0.9201 -0.0497 0.0098  0.1221  28   VAL A C   
127  O O   . VAL A 27  ? 0.7652 0.8220 0.8598 -0.0429 0.0161  0.1230  28   VAL A O   
128  C CB  . VAL A 27  ? 0.7498 0.7687 0.8456 -0.0402 0.0143  0.1078  28   VAL A CB  
129  C CG1 . VAL A 27  ? 0.7668 0.7732 0.8481 -0.0471 0.0092  0.0962  28   VAL A CG1 
130  C CG2 . VAL A 27  ? 0.7402 0.7477 0.8417 -0.0380 0.0142  0.1063  28   VAL A CG2 
131  N N   . GLN A 28  ? 0.8310 0.8845 0.9142 -0.0605 0.0018  0.1217  29   GLN A N   
132  C CA  . GLN A 28  ? 0.8040 0.8684 0.8802 -0.0653 -0.0001 0.1233  29   GLN A CA  
133  C C   . GLN A 28  ? 0.7529 0.8008 0.8162 -0.0675 -0.0017 0.1092  29   GLN A C   
134  O O   . GLN A 28  ? 0.8024 0.8418 0.8563 -0.0761 -0.0088 0.1034  29   GLN A O   
135  C CB  . GLN A 28  ? 0.9190 0.9978 0.9939 -0.0756 -0.0076 0.1325  29   GLN A CB  
136  C CG  . GLN A 28  ? 1.0124 1.1009 1.0987 -0.0753 -0.0082 0.1438  29   GLN A CG  
137  C CD  . GLN A 28  ? 1.0423 1.1484 1.1408 -0.0677 -0.0015 0.1555  29   GLN A CD  
138  O OE1 . GLN A 28  ? 1.0599 1.1689 1.1594 -0.0610 0.0046  0.1544  29   GLN A OE1 
139  N NE2 . GLN A 28  ? 1.0373 1.1553 1.1450 -0.0689 -0.0028 0.1667  29   GLN A NE2 
140  N N   . LEU A 29  ? 0.6175 0.6601 0.6803 -0.0594 0.0050  0.1035  30   LEU A N   
141  C CA  . LEU A 29  ? 0.4995 0.5314 0.5504 -0.0611 0.0043  0.0919  30   LEU A CA  
142  C C   . LEU A 29  ? 0.4934 0.5416 0.5403 -0.0648 0.0034  0.0973  30   LEU A C   
143  O O   . LEU A 29  ? 0.5692 0.6356 0.6243 -0.0625 0.0061  0.1089  30   LEU A O   
144  C CB  . LEU A 29  ? 0.4192 0.4380 0.4716 -0.0505 0.0121  0.0832  30   LEU A CB  
145  C CG  . LEU A 29  ? 0.4553 0.4569 0.5119 -0.0454 0.0143  0.0771  30   LEU A CG  
146  C CD1 . LEU A 29  ? 0.4053 0.3954 0.4626 -0.0351 0.0221  0.0687  30   LEU A CD1 
147  C CD2 . LEU A 29  ? 0.4679 0.4540 0.5153 -0.0535 0.0068  0.0683  30   LEU A CD2 
148  N N   . THR A 30  ? 0.4813 0.5231 0.5158 -0.0706 -0.0004 0.0890  31   THR A N   
149  C CA  . THR A 30  ? 0.4965 0.5534 0.5269 -0.0740 -0.0011 0.0937  31   THR A CA  
150  C C   . THR A 30  ? 0.5010 0.5597 0.5339 -0.0644 0.0073  0.0919  31   THR A C   
151  O O   . THR A 30  ? 0.4641 0.5087 0.4978 -0.0568 0.0124  0.0836  31   THR A O   
152  C CB  . THR A 30  ? 0.5307 0.5813 0.5468 -0.0840 -0.0084 0.0861  31   THR A CB  
153  O OG1 . THR A 30  ? 0.4935 0.5274 0.5017 -0.0806 -0.0058 0.0727  31   THR A OG1 
154  C CG2 . THR A 30  ? 0.4497 0.4932 0.4628 -0.0926 -0.0164 0.0849  31   THR A CG2 
155  N N   . GLU A 31  ? 0.4355 0.3779 0.6237 -0.0963 -0.1209 0.0886  32   GLU A N   
156  C CA  . GLU A 31  ? 0.4290 0.3721 0.6049 -0.0932 -0.1220 0.0873  32   GLU A CA  
157  C C   . GLU A 31  ? 0.4761 0.4046 0.6087 -0.0909 -0.1191 0.0813  32   GLU A C   
158  O O   . GLU A 31  ? 0.4604 0.3948 0.5813 -0.0846 -0.1087 0.0772  32   GLU A O   
159  C CB  . GLU A 31  ? 0.4557 0.3952 0.6446 -0.1003 -0.1410 0.0937  32   GLU A CB  
160  C CG  . GLU A 31  ? 0.5952 0.5316 0.7686 -0.0997 -0.1454 0.0941  32   GLU A CG  
161  C CD  . GLU A 31  ? 0.6665 0.5951 0.8494 -0.1080 -0.1674 0.1014  32   GLU A CD  
162  O OE1 . GLU A 31  ? 0.6895 0.6200 0.9002 -0.1126 -0.1779 0.1061  32   GLU A OE1 
163  O OE2 . GLU A 31  ? 0.7226 0.6426 0.8854 -0.1106 -0.1747 0.1030  32   GLU A OE2 
164  N N   . ASN A 32  ? 0.5628 0.4730 0.6726 -0.0956 -0.1275 0.0798  33   ASN A N   
165  C CA  . ASN A 32  ? 0.5720 0.4688 0.6420 -0.0931 -0.1243 0.0726  33   ASN A CA  
166  C C   . ASN A 32  ? 0.5009 0.4029 0.5631 -0.0836 -0.1072 0.0657  33   ASN A C   
167  O O   . ASN A 32  ? 0.5337 0.4355 0.5740 -0.0783 -0.0995 0.0595  33   ASN A O   
168  C CB  . ASN A 32  ? 0.6483 0.5226 0.6958 -0.1001 -0.1377 0.0716  33   ASN A CB  
169  C CG  . ASN A 32  ? 0.8121 0.6765 0.8523 -0.1093 -0.1549 0.0766  33   ASN A CG  
170  O OD1 . ASN A 32  ? 0.9295 0.7962 0.9588 -0.1096 -0.1549 0.0768  33   ASN A OD1 
171  N ND2 . ASN A 32  ? 0.8808 0.7332 0.9265 -0.1176 -0.1707 0.0811  33   ASN A ND2 
172  N N   . GLU A 33  ? 0.4718 0.3788 0.5518 -0.0818 -0.1015 0.0671  34   GLU A N   
173  C CA  . GLU A 33  ? 0.4586 0.3702 0.5326 -0.0732 -0.0866 0.0618  34   GLU A CA  
174  C C   . GLU A 33  ? 0.4569 0.3857 0.5383 -0.0667 -0.0754 0.0605  34   GLU A C   
175  O O   . GLU A 33  ? 0.4050 0.3344 0.4681 -0.0600 -0.0673 0.0543  34   GLU A O   
176  C CB  . GLU A 33  ? 0.4696 0.3831 0.5619 -0.0749 -0.0833 0.0653  34   GLU A CB  
177  C CG  . GLU A 33  ? 0.5053 0.3982 0.5827 -0.0794 -0.0922 0.0646  34   GLU A CG  
178  C CD  . GLU A 33  ? 0.6085 0.5022 0.7035 -0.0835 -0.0898 0.0694  34   GLU A CD  
179  O OE1 . GLU A 33  ? 0.5795 0.4905 0.7034 -0.0858 -0.0839 0.0745  34   GLU A OE1 
180  O OE2 . GLU A 33  ? 0.6481 0.5245 0.7274 -0.0849 -0.0937 0.0678  34   GLU A OE2 
181  N N   . ILE A 34  ? 0.4154 0.3582 0.5245 -0.0687 -0.0757 0.0659  35   ILE A N   
182  C CA  . ILE A 34  ? 0.4369 0.3945 0.5542 -0.0631 -0.0665 0.0649  35   ILE A CA  
183  C C   . ILE A 34  ? 0.4544 0.4082 0.5495 -0.0628 -0.0694 0.0623  35   ILE A C   
184  O O   . ILE A 34  ? 0.4053 0.3654 0.4908 -0.0568 -0.0598 0.0580  35   ILE A O   
185  C CB  . ILE A 34  ? 0.4528 0.4241 0.6053 -0.0654 -0.0683 0.0705  35   ILE A CB  
186  C CG1 . ILE A 34  ? 0.4222 0.4003 0.5949 -0.0654 -0.0605 0.0718  35   ILE A CG1 
187  C CG2 . ILE A 34  ? 0.4085 0.3919 0.5679 -0.0605 -0.0623 0.0695  35   ILE A CG2 
188  C CD1 . ILE A 34  ? 0.4274 0.4207 0.6383 -0.0675 -0.0606 0.0759  35   ILE A CD1 
189  N N   . ARG A 35  ? 0.5021 0.4451 0.5880 -0.0701 -0.0830 0.0650  36   ARG A N   
190  C CA  . ARG A 35  ? 0.4626 0.3998 0.5225 -0.0719 -0.0856 0.0626  36   ARG A CA  
191  C C   . ARG A 35  ? 0.4777 0.4102 0.5102 -0.0663 -0.0759 0.0537  36   ARG A C   
192  O O   . ARG A 35  ? 0.5070 0.4459 0.5279 -0.0628 -0.0681 0.0498  36   ARG A O   
193  C CB  . ARG A 35  ? 0.4685 0.3910 0.5187 -0.0818 -0.1027 0.0670  36   ARG A CB  
194  C CG  . ARG A 35  ? 0.6367 0.5524 0.6597 -0.0863 -0.1064 0.0661  36   ARG A CG  
195  C CD  . ARG A 35  ? 0.6915 0.5902 0.7024 -0.0973 -0.1248 0.0711  36   ARG A CD  
196  N NE  . ARG A 35  ? 0.7084 0.6086 0.7509 -0.1013 -0.1376 0.0794  36   ARG A NE  
197  C CZ  . ARG A 35  ? 0.7702 0.6790 0.8371 -0.1027 -0.1438 0.0861  36   ARG A CZ  
198  N NH1 . ARG A 35  ? 0.7844 0.6955 0.8827 -0.1058 -0.1553 0.0924  36   ARG A NH1 
199  N NH2 . ARG A 35  ? 0.9105 0.8255 0.9721 -0.1012 -0.1390 0.0863  36   ARG A NH2 
200  N N   . GLY A 36  ? 0.4748 0.3967 0.4988 -0.0650 -0.0763 0.0502  37   GLY A N   
201  C CA  . GLY A 36  ? 0.3901 0.3067 0.3907 -0.0585 -0.0683 0.0409  37   GLY A CA  
202  C C   . GLY A 36  ? 0.5023 0.4328 0.5105 -0.0492 -0.0545 0.0374  37   GLY A C   
203  O O   . GLY A 36  ? 0.4991 0.4324 0.4920 -0.0438 -0.0471 0.0303  37   GLY A O   
204  N N   . LEU A 37  ? 0.4398 0.3794 0.4718 -0.0473 -0.0507 0.0420  38   LEU A N   
205  C CA  . LEU A 37  ? 0.4167 0.3688 0.4556 -0.0395 -0.0388 0.0396  38   LEU A CA  
206  C C   . LEU A 37  ? 0.3978 0.3611 0.4344 -0.0384 -0.0348 0.0385  38   LEU A C   
207  O O   . LEU A 37  ? 0.4323 0.4007 0.4592 -0.0323 -0.0269 0.0327  38   LEU A O   
208  C CB  . LEU A 37  ? 0.3930 0.3530 0.4571 -0.0398 -0.0356 0.0452  38   LEU A CB  
209  C CG  . LEU A 37  ? 0.4127 0.3629 0.4788 -0.0411 -0.0370 0.0465  38   LEU A CG  
210  C CD1 . LEU A 37  ? 0.3995 0.3595 0.4896 -0.0423 -0.0313 0.0515  38   LEU A CD1 
211  C CD2 . LEU A 37  ? 0.3763 0.3177 0.4228 -0.0343 -0.0330 0.0399  38   LEU A CD2 
212  N N   . CYS A 38  ? 0.3714 0.3381 0.4176 -0.0447 -0.0412 0.0444  39   CYS A N   
213  C CA  . CYS A 38  ? 0.4468 0.4222 0.4899 -0.0452 -0.0388 0.0445  39   CYS A CA  
214  C C   . CYS A 38  ? 0.4496 0.4203 0.4654 -0.0462 -0.0375 0.0387  39   CYS A C   
215  O O   . CYS A 38  ? 0.4360 0.4159 0.4460 -0.0428 -0.0295 0.0349  39   CYS A O   
216  C CB  . CYS A 38  ? 0.3816 0.3578 0.4386 -0.0523 -0.0487 0.0523  39   CYS A CB  
217  S SG  . CYS A 38  ? 0.4536 0.4389 0.5470 -0.0506 -0.0485 0.0577  39   CYS A SG  
218  N N   . LEU A 39  ? 0.4542 0.4109 0.4530 -0.0509 -0.0448 0.0373  40   LEU A N   
219  C CA  . LEU A 39  ? 0.4645 0.4163 0.4359 -0.0533 -0.0432 0.0312  40   LEU A CA  
220  C C   . LEU A 39  ? 0.5320 0.4876 0.4941 -0.0439 -0.0319 0.0209  40   LEU A C   
221  O O   . LEU A 39  ? 0.5607 0.5242 0.5117 -0.0427 -0.0243 0.0156  40   LEU A O   
222  C CB  . LEU A 39  ? 0.5111 0.4448 0.4654 -0.0611 -0.0547 0.0320  40   LEU A CB  
223  C CG  . LEU A 39  ? 0.5697 0.4983 0.5292 -0.0716 -0.0681 0.0419  40   LEU A CG  
224  C CD1 . LEU A 39  ? 0.6200 0.5289 0.5623 -0.0794 -0.0809 0.0427  40   LEU A CD1 
225  C CD2 . LEU A 39  ? 0.5346 0.4692 0.4846 -0.0766 -0.0667 0.0441  40   LEU A CD2 
226  N N   . LYS A 40  ? 0.4989 0.4491 0.4666 -0.0376 -0.0311 0.0182  41   LYS A N   
227  C CA  . LYS A 40  ? 0.4998 0.4519 0.4608 -0.0278 -0.0225 0.0085  41   LYS A CA  
228  C C   . LYS A 40  ? 0.4774 0.4467 0.4522 -0.0214 -0.0132 0.0081  41   LYS A C   
229  O O   . LYS A 40  ? 0.4821 0.4594 0.4507 -0.0160 -0.0056 0.0005  41   LYS A O   
230  C CB  . LYS A 40  ? 0.5086 0.4474 0.4709 -0.0237 -0.0263 0.0070  41   LYS A CB  
231  C CG  . LYS A 40  ? 0.6796 0.5996 0.6236 -0.0282 -0.0347 0.0040  41   LYS A CG  
232  C CD  . LYS A 40  ? 0.8576 0.7690 0.7870 -0.0198 -0.0314 -0.0078 41   LYS A CD  
233  C CE  . LYS A 40  ? 0.8842 0.7740 0.7950 -0.0240 -0.0406 -0.0112 41   LYS A CE  
234  N NZ  . LYS A 40  ? 0.8916 0.7786 0.7849 -0.0333 -0.0437 -0.0112 41   LYS A NZ  
235  N N   . SER A 41  ? 0.3849 0.3604 0.3790 -0.0219 -0.0136 0.0156  42   SER A N   
236  C CA  . SER A 41  ? 0.3741 0.3639 0.3794 -0.0163 -0.0058 0.0152  42   SER A CA  
237  C C   . SER A 41  ? 0.3951 0.3964 0.3966 -0.0195 -0.0023 0.0147  42   SER A C   
238  O O   . SER A 41  ? 0.3651 0.3772 0.3672 -0.0144 0.0050  0.0099  42   SER A O   
239  C CB  . SER A 41  ? 0.3856 0.3784 0.4107 -0.0168 -0.0064 0.0225  42   SER A CB  
240  O OG  . SER A 41  ? 0.3960 0.3915 0.4305 -0.0242 -0.0113 0.0294  42   SER A OG  
241  N N   . ARG A 42  ? 0.4613 0.4597 0.4586 -0.0287 -0.0083 0.0198  43   ARG A N   
242  C CA  . ARG A 42  ? 0.4450 0.4521 0.4361 -0.0339 -0.0061 0.0206  43   ARG A CA  
243  C C   . ARG A 42  ? 0.4485 0.4607 0.4232 -0.0315 0.0019  0.0112  43   ARG A C   
244  O O   . ARG A 42  ? 0.4505 0.4762 0.4275 -0.0303 0.0089  0.0091  43   ARG A O   
245  C CB  . ARG A 42  ? 0.4515 0.4500 0.4360 -0.0450 -0.0161 0.0277  43   ARG A CB  
246  C CG  . ARG A 42  ? 0.5162 0.5206 0.4917 -0.0526 -0.0155 0.0302  43   ARG A CG  
247  C CD  . ARG A 42  ? 0.5426 0.5338 0.5042 -0.0642 -0.0269 0.0363  43   ARG A CD  
248  N NE  . ARG A 42  ? 0.5336 0.5282 0.4920 -0.0726 -0.0298 0.0424  43   ARG A NE  
249  C CZ  . ARG A 42  ? 0.5022 0.5001 0.4400 -0.0789 -0.0245 0.0399  43   ARG A CZ  
250  N NH1 . ARG A 42  ? 0.4890 0.4886 0.4092 -0.0766 -0.0153 0.0302  43   ARG A NH1 
251  N NH2 . ARG A 42  ? 0.5542 0.5536 0.4893 -0.0877 -0.0283 0.0468  43   ARG A NH2 
252  N N   . GLU A 43  ? 0.4758 0.4775 0.4349 -0.0305 0.0012  0.0048  44   GLU A N   
253  C CA  . GLU A 43  ? 0.5010 0.5082 0.4460 -0.0273 0.0098  -0.0059 44   GLU A CA  
254  C C   . GLU A 43  ? 0.4468 0.4660 0.4053 -0.0156 0.0177  -0.0124 44   GLU A C   
255  O O   . GLU A 43  ? 0.4758 0.5086 0.4330 -0.0134 0.0263  -0.0189 44   GLU A O   
256  C CB  . GLU A 43  ? 0.4545 0.4457 0.3806 -0.0276 0.0066  -0.0124 44   GLU A CB  
257  N N   . ILE A 44  ? 0.4025 0.4170 0.3742 -0.0087 0.0147  -0.0102 45   ILE A N   
258  C CA  . ILE A 44  ? 0.3550 0.3784 0.3384 0.0017  0.0199  -0.0151 45   ILE A CA  
259  C C   . ILE A 44  ? 0.3703 0.4100 0.3659 0.0005  0.0241  -0.0111 45   ILE A C   
260  O O   . ILE A 44  ? 0.3740 0.4267 0.3747 0.0058  0.0303  -0.0170 45   ILE A O   
261  C CB  . ILE A 44  ? 0.4384 0.4500 0.4290 0.0073  0.0149  -0.0126 45   ILE A CB  
262  C CG1 . ILE A 44  ? 0.4682 0.4631 0.4463 0.0094  0.0105  -0.0180 45   ILE A CG1 
263  C CG2 . ILE A 44  ? 0.4076 0.4272 0.4095 0.0166  0.0185  -0.0155 45   ILE A CG2 
264  C CD1 . ILE A 44  ? 0.4411 0.4221 0.4240 0.0126  0.0047  -0.0144 45   ILE A CD1 
265  N N   . PHE A 45  ? 0.3534 0.3926 0.3552 -0.0064 0.0202  -0.0016 46   PHE A N   
266  C CA  . PHE A 45  ? 0.3916 0.4440 0.4039 -0.0081 0.0230  0.0021  46   PHE A CA  
267  C C   . PHE A 45  ? 0.3711 0.4357 0.3759 -0.0124 0.0287  -0.0017 46   PHE A C   
268  O O   . PHE A 45  ? 0.4078 0.4863 0.4207 -0.0094 0.0341  -0.0044 46   PHE A O   
269  C CB  . PHE A 45  ? 0.3875 0.4357 0.4072 -0.0150 0.0170  0.0121  46   PHE A CB  
270  C CG  . PHE A 45  ? 0.3645 0.4047 0.3952 -0.0112 0.0138  0.0158  46   PHE A CG  
271  C CD1 . PHE A 45  ? 0.3211 0.3618 0.3571 -0.0027 0.0171  0.0125  46   PHE A CD1 
272  C CD2 . PHE A 45  ? 0.3299 0.3621 0.3657 -0.0168 0.0072  0.0226  46   PHE A CD2 
273  C CE1 . PHE A 45  ? 0.3531 0.3863 0.3966 -0.0010 0.0153  0.0161  46   PHE A CE1 
274  C CE2 . PHE A 45  ? 0.3100 0.3371 0.3571 -0.0143 0.0059  0.0255  46   PHE A CE2 
275  C CZ  . PHE A 45  ? 0.3294 0.3569 0.3791 -0.0068 0.0107  0.0223  46   PHE A CZ  
276  N N   . LEU A 46  ? 0.3870 0.4465 0.3756 -0.0201 0.0278  -0.0022 47   LEU A N   
277  C CA  . LEU A 46  ? 0.4264 0.4975 0.4052 -0.0261 0.0346  -0.0058 47   LEU A CA  
278  C C   . LEU A 46  ? 0.4299 0.5116 0.4087 -0.0178 0.0439  -0.0181 47   LEU A C   
279  O O   . LEU A 46  ? 0.4313 0.5292 0.4117 -0.0199 0.0517  -0.0218 47   LEU A O   
280  C CB  . LEU A 46  ? 0.4747 0.5352 0.4325 -0.0376 0.0308  -0.0029 47   LEU A CB  
281  C CG  . LEU A 46  ? 0.4865 0.5395 0.4452 -0.0477 0.0211  0.0094  47   LEU A CG  
282  C CD1 . LEU A 46  ? 0.5309 0.5718 0.4661 -0.0594 0.0160  0.0120  47   LEU A CD1 
283  C CD2 . LEU A 46  ? 0.4353 0.5012 0.4044 -0.0513 0.0232  0.0143  47   LEU A CD2 
284  N N   . SER A 47  ? 0.4591 0.5322 0.4378 -0.0083 0.0429  -0.0247 48   SER A N   
285  C CA  . SER A 47  ? 0.4544 0.5373 0.4364 0.0012  0.0505  -0.0371 48   SER A CA  
286  C C   . SER A 47  ? 0.4473 0.5430 0.4503 0.0100  0.0523  -0.0383 48   SER A C   
287  O O   . SER A 47  ? 0.4828 0.5905 0.4932 0.0176  0.0583  -0.0482 48   SER A O   
288  C CB  . SER A 47  ? 0.4644 0.5313 0.4384 0.0084  0.0473  -0.0442 48   SER A CB  
289  O OG  . SER A 47  ? 0.5484 0.6060 0.5338 0.0164  0.0406  -0.0409 48   SER A OG  
290  N N   . GLN A 48  ? 0.4220 0.5155 0.4350 0.0094  0.0470  -0.0291 49   GLN A N   
291  C CA  . GLN A 48  ? 0.3318 0.4362 0.3618 0.0161  0.0478  -0.0295 49   GLN A CA  
292  C C   . GLN A 48  ? 0.3466 0.4641 0.3824 0.0080  0.0499  -0.0235 49   GLN A C   
293  O O   . GLN A 48  ? 0.3238 0.4384 0.3513 -0.0025 0.0487  -0.0169 49   GLN A O   
294  C CB  . GLN A 48  ? 0.3178 0.4085 0.3533 0.0221  0.0406  -0.0249 49   GLN A CB  
295  C CG  . GLN A 48  ? 0.3282 0.4038 0.3574 0.0296  0.0373  -0.0303 49   GLN A CG  
296  C CD  . GLN A 48  ? 0.4243 0.4854 0.4565 0.0339  0.0306  -0.0252 49   GLN A CD  
297  O OE1 . GLN A 48  ? 0.4739 0.5251 0.5048 0.0419  0.0273  -0.0299 49   GLN A OE1 
298  N NE2 . GLN A 48  ? 0.3286 0.3878 0.3644 0.0287  0.0287  -0.0162 49   GLN A NE2 
299  N N   . PRO A 49  ? 0.3343 0.4655 0.3844 0.0123  0.0519  -0.0255 50   PRO A N   
300  C CA  . PRO A 49  ? 0.3230 0.4662 0.3786 0.0041  0.0534  -0.0200 50   PRO A CA  
301  C C   . PRO A 49  ? 0.3982 0.5301 0.4540 -0.0004 0.0466  -0.0096 50   PRO A C   
302  O O   . PRO A 49  ? 0.3480 0.4672 0.4053 0.0048  0.0418  -0.0072 50   PRO A O   
303  C CB  . PRO A 49  ? 0.3121 0.4701 0.3843 0.0115  0.0553  -0.0251 50   PRO A CB  
304  C CG  . PRO A 49  ? 0.3964 0.5537 0.4710 0.0226  0.0566  -0.0350 50   PRO A CG  
305  C CD  . PRO A 49  ? 0.3496 0.4858 0.4115 0.0243  0.0520  -0.0330 50   PRO A CD  
306  N N   . ILE A 50  ? 0.3188 0.4557 0.3738 -0.0105 0.0465  -0.0035 51   ILE A N   
307  C CA  . ILE A 50  ? 0.2649 0.3926 0.3232 -0.0140 0.0401  0.0052  51   ILE A CA  
308  C C   . ILE A 50  ? 0.2806 0.4119 0.3516 -0.0080 0.0386  0.0052  51   ILE A C   
309  O O   . ILE A 50  ? 0.3541 0.4760 0.4284 -0.0076 0.0341  0.0101  51   ILE A O   
310  C CB  . ILE A 50  ? 0.3710 0.5006 0.4239 -0.0267 0.0386  0.0118  51   ILE A CB  
311  C CG1 . ILE A 50  ? 0.3725 0.4887 0.4281 -0.0298 0.0306  0.0201  51   ILE A CG1 
312  C CG2 . ILE A 50  ? 0.3067 0.4527 0.3667 -0.0305 0.0423  0.0109  51   ILE A CG2 
313  C CD1 . ILE A 50  ? 0.4028 0.5169 0.4526 -0.0423 0.0263  0.0275  51   ILE A CD1 
314  N N   . LEU A 51  ? 0.2652 0.4099 0.3436 -0.0037 0.0421  -0.0006 52   LEU A N   
315  C CA  . LEU A 51  ? 0.3114 0.4580 0.4001 0.0029  0.0394  -0.0016 52   LEU A CA  
316  C C   . LEU A 51  ? 0.3811 0.5257 0.4715 0.0140  0.0395  -0.0085 52   LEU A C   
317  O O   . LEU A 51  ? 0.3138 0.4710 0.4101 0.0177  0.0430  -0.0154 52   LEU A O   
318  C CB  . LEU A 51  ? 0.3098 0.4730 0.4080 -0.0013 0.0408  -0.0021 52   LEU A CB  
319  C CG  . LEU A 51  ? 0.2582 0.4236 0.3667 0.0057  0.0370  -0.0040 52   LEU A CG  
320  C CD1 . LEU A 51  ? 0.2925 0.4419 0.3974 0.0062  0.0315  0.0014  52   LEU A CD1 
321  C CD2 . LEU A 51  ? 0.2698 0.4533 0.3897 0.0013  0.0379  -0.0050 52   LEU A CD2 
322  N N   . LEU A 52  ? 0.3556 0.4841 0.4415 0.0190  0.0357  -0.0066 53   LEU A N   
323  C CA  . LEU A 52  ? 0.2755 0.3978 0.3604 0.0285  0.0342  -0.0119 53   LEU A CA  
324  C C   . LEU A 52  ? 0.2546 0.3831 0.3490 0.0352  0.0311  -0.0154 53   LEU A C   
325  O O   . LEU A 52  ? 0.2788 0.4079 0.3766 0.0335  0.0284  -0.0119 53   LEU A O   
326  C CB  . LEU A 52  ? 0.3199 0.4229 0.3965 0.0298  0.0309  -0.0077 53   LEU A CB  
327  C CG  . LEU A 52  ? 0.3154 0.4104 0.3844 0.0240  0.0319  -0.0041 53   LEU A CG  
328  C CD1 . LEU A 52  ? 0.2375 0.3163 0.3024 0.0248  0.0291  0.0004  53   LEU A CD1 
329  C CD2 . LEU A 52  ? 0.2763 0.3727 0.3400 0.0254  0.0340  -0.0098 53   LEU A CD2 
330  N N   . GLU A 53  ? 0.3036 0.4356 0.4025 0.0433  0.0307  -0.0226 54   GLU A N   
331  C CA  . GLU A 53  ? 0.3544 0.4901 0.4634 0.0511  0.0254  -0.0262 54   GLU A CA  
332  C C   . GLU A 53  ? 0.3743 0.4915 0.4763 0.0593  0.0193  -0.0275 54   GLU A C   
333  O O   . GLU A 53  ? 0.3129 0.4283 0.4150 0.0648  0.0197  -0.0334 54   GLU A O   
334  C CB  . GLU A 53  ? 0.3786 0.5364 0.5034 0.0540  0.0290  -0.0343 54   GLU A CB  
335  C CG  . GLU A 53  ? 0.5026 0.6786 0.6351 0.0449  0.0336  -0.0320 54   GLU A CG  
336  C CD  . GLU A 53  ? 0.6922 0.8929 0.8424 0.0466  0.0387  -0.0400 54   GLU A CD  
337  O OE1 . GLU A 53  ? 0.7396 0.9444 0.8965 0.0553  0.0400  -0.0488 54   GLU A OE1 
338  O OE2 . GLU A 53  ? 0.7727 0.9890 0.9309 0.0389  0.0415  -0.0379 54   GLU A OE2 
339  N N   . LEU A 54  ? 0.3873 0.4896 0.4819 0.0595  0.0135  -0.0220 55   LEU A N   
340  C CA  . LEU A 54  ? 0.3916 0.4734 0.4757 0.0644  0.0078  -0.0210 55   LEU A CA  
341  C C   . LEU A 54  ? 0.3844 0.4603 0.4709 0.0711  -0.0018 -0.0220 55   LEU A C   
342  O O   . LEU A 54  ? 0.3813 0.4679 0.4771 0.0713  -0.0043 -0.0226 55   LEU A O   
343  C CB  . LEU A 54  ? 0.3743 0.4411 0.4445 0.0577  0.0096  -0.0133 55   LEU A CB  
344  C CG  . LEU A 54  ? 0.3511 0.4232 0.4205 0.0506  0.0168  -0.0113 55   LEU A CG  
345  C CD1 . LEU A 54  ? 0.3218 0.3809 0.3821 0.0448  0.0182  -0.0044 55   LEU A CD1 
346  C CD2 . LEU A 54  ? 0.3105 0.3831 0.3792 0.0531  0.0184  -0.0163 55   LEU A CD2 
347  N N   . GLU A 55  ? 0.4555 0.5128 0.5329 0.0760  -0.0083 -0.0217 56   GLU A N   
348  C CA  . GLU A 55  ? 0.4629 0.5094 0.5390 0.0819  -0.0196 -0.0215 56   GLU A CA  
349  C C   . GLU A 55  ? 0.4191 0.4407 0.4738 0.0780  -0.0233 -0.0141 56   GLU A C   
350  O O   . GLU A 55  ? 0.4505 0.4616 0.4951 0.0747  -0.0194 -0.0114 56   GLU A O   
351  C CB  . GLU A 55  ? 0.4745 0.5213 0.5613 0.0926  -0.0263 -0.0292 56   GLU A CB  
352  C CG  . GLU A 55  ? 0.6193 0.6929 0.7286 0.0965  -0.0209 -0.0380 56   GLU A CG  
353  C CD  . GLU A 55  ? 0.7146 0.7892 0.8349 0.1073  -0.0243 -0.0475 56   GLU A CD  
354  O OE1 . GLU A 55  ? 0.7603 0.8130 0.8706 0.1121  -0.0325 -0.0469 56   GLU A OE1 
355  O OE2 . GLU A 55  ? 0.7540 0.8515 0.8931 0.1107  -0.0184 -0.0560 56   GLU A OE2 
356  N N   . ALA A 56  ? 0.4101 0.4222 0.4574 0.0776  -0.0307 -0.0106 57   ALA A N   
357  C CA  . ALA A 56  ? 0.4377 0.4248 0.4627 0.0739  -0.0348 -0.0041 57   ALA A CA  
358  C C   . ALA A 56  ? 0.5055 0.4761 0.5265 0.0807  -0.0455 -0.0053 57   ALA A C   
359  O O   . ALA A 56  ? 0.4712 0.4498 0.5082 0.0896  -0.0519 -0.0118 57   ALA A O   
360  C CB  . ALA A 56  ? 0.4173 0.3979 0.4326 0.0708  -0.0399 -0.0005 57   ALA A CB  
361  N N   . PRO A 57  ? 0.4879 0.4351 0.4885 0.0765  -0.0478 0.0006  58   PRO A N   
362  C CA  . PRO A 57  ? 0.4503 0.3865 0.4319 0.0660  -0.0404 0.0079  58   PRO A CA  
363  C C   . PRO A 57  ? 0.4436 0.3898 0.4295 0.0604  -0.0270 0.0085  58   PRO A C   
364  O O   . PRO A 57  ? 0.4705 0.4214 0.4651 0.0632  -0.0254 0.0053  58   PRO A O   
365  C CB  . PRO A 57  ? 0.5719 0.4802 0.5332 0.0645  -0.0494 0.0132  58   PRO A CB  
366  C CG  . PRO A 57  ? 0.5683 0.4745 0.5407 0.0736  -0.0573 0.0081  58   PRO A CG  
367  C CD  . PRO A 57  ? 0.5072 0.4362 0.5034 0.0825  -0.0590 -0.0002 58   PRO A CD  
368  N N   . LEU A 58  ? 0.4038 0.3521 0.3834 0.0525  -0.0181 0.0123  59   LEU A N   
369  C CA  . LEU A 58  ? 0.4240 0.3796 0.4082 0.0468  -0.0069 0.0137  59   LEU A CA  
370  C C   . LEU A 58  ? 0.4568 0.4088 0.4311 0.0387  0.0010  0.0179  59   LEU A C   
371  O O   . LEU A 58  ? 0.4482 0.3963 0.4139 0.0380  -0.0009 0.0184  59   LEU A O   
372  C CB  . LEU A 58  ? 0.4909 0.4690 0.4946 0.0491  -0.0021 0.0089  59   LEU A CB  
373  C CG  . LEU A 58  ? 0.5265 0.5202 0.5387 0.0470  0.0028  0.0079  59   LEU A CG  
374  C CD1 . LEU A 58  ? 0.4960 0.5080 0.5239 0.0469  0.0077  0.0049  59   LEU A CD1 
375  C CD2 . LEU A 58  ? 0.5601 0.5556 0.5732 0.0514  -0.0047 0.0056  59   LEU A CD2 
376  N N   . LYS A 59  ? 0.4654 0.4182 0.4410 0.0328  0.0095  0.0206  60   LYS A N   
377  C CA  . LYS A 59  ? 0.4476 0.4012 0.4196 0.0258  0.0193  0.0229  60   LYS A CA  
378  C C   . LYS A 59  ? 0.4562 0.4291 0.4473 0.0256  0.0258  0.0205  60   LYS A C   
379  O O   . LYS A 59  ? 0.4134 0.3947 0.4166 0.0269  0.0255  0.0195  60   LYS A O   
380  C CB  . LYS A 59  ? 0.4363 0.3792 0.4004 0.0188  0.0246  0.0276  60   LYS A CB  
381  C CG  . LYS A 59  ? 0.5248 0.4478 0.4723 0.0184  0.0166  0.0310  60   LYS A CG  
382  C CD  . LYS A 59  ? 0.5665 0.4738 0.4918 0.0152  0.0145  0.0337  60   LYS A CD  
383  C CE  . LYS A 59  ? 0.5844 0.4689 0.4909 0.0121  0.0069  0.0389  60   LYS A CE  
384  N NZ  . LYS A 59  ? 0.6408 0.5085 0.5219 0.0067  0.0058  0.0424  60   LYS A NZ  
385  N N   . ILE A 60  ? 0.3981 0.3758 0.3899 0.0236  0.0308  0.0195  61   ILE A N   
386  C CA  . ILE A 60  ? 0.3710 0.3644 0.3798 0.0229  0.0356  0.0176  61   ILE A CA  
387  C C   . ILE A 60  ? 0.3833 0.3762 0.3942 0.0175  0.0453  0.0187  61   ILE A C   
388  O O   . ILE A 60  ? 0.4487 0.4325 0.4465 0.0150  0.0495  0.0187  61   ILE A O   
389  C CB  . ILE A 60  ? 0.4094 0.4101 0.4213 0.0259  0.0319  0.0145  61   ILE A CB  
390  C CG1 . ILE A 60  ? 0.3552 0.3573 0.3669 0.0315  0.0227  0.0128  61   ILE A CG1 
391  C CG2 . ILE A 60  ? 0.2704 0.2856 0.2994 0.0245  0.0353  0.0135  61   ILE A CG2 
392  C CD1 . ILE A 60  ? 0.3285 0.3386 0.3447 0.0341  0.0181  0.0100  61   ILE A CD1 
393  N N   . CYS A 61  ? 0.3631 0.3656 0.3906 0.0157  0.0489  0.0194  62   CYS A N   
394  C CA  . CYS A 61  ? 0.3341 0.3389 0.3698 0.0113  0.0577  0.0199  62   CYS A CA  
395  C C   . CYS A 61  ? 0.3748 0.3919 0.4292 0.0119  0.0587  0.0181  62   CYS A C   
396  O O   . CYS A 61  ? 0.3332 0.3576 0.3959 0.0135  0.0528  0.0184  62   CYS A O   
397  C CB  . CYS A 61  ? 0.3649 0.3677 0.4051 0.0077  0.0593  0.0235  62   CYS A CB  
398  S SG  . CYS A 61  ? 0.4753 0.4608 0.4935 0.0060  0.0562  0.0268  62   CYS A SG  
399  N N   . GLY A 62  ? 0.4016 0.4203 0.4622 0.0103  0.0662  0.0161  63   GLY A N   
400  C CA  . GLY A 62  ? 0.3596 0.3877 0.4393 0.0108  0.0667  0.0143  63   GLY A CA  
401  C C   . GLY A 62  ? 0.3664 0.4007 0.4657 0.0082  0.0697  0.0161  63   GLY A C   
402  O O   . GLY A 62  ? 0.3682 0.4015 0.4681 0.0058  0.0686  0.0196  63   GLY A O   
403  N N   . ASP A 63  ? 0.3682 0.4084 0.4848 0.0087  0.0725  0.0135  64   ASP A N   
404  C CA  . ASP A 63  ? 0.3677 0.4152 0.5080 0.0070  0.0724  0.0152  64   ASP A CA  
405  C C   . ASP A 63  ? 0.4173 0.4648 0.5602 0.0033  0.0795  0.0168  64   ASP A C   
406  O O   . ASP A 63  ? 0.3829 0.4262 0.5147 0.0019  0.0888  0.0146  64   ASP A O   
407  C CB  . ASP A 63  ? 0.3273 0.3798 0.4866 0.0091  0.0752  0.0108  64   ASP A CB  
408  C CG  . ASP A 63  ? 0.3460 0.3975 0.5041 0.0117  0.0674  0.0097  64   ASP A CG  
409  O OD1 . ASP A 63  ? 0.3709 0.4183 0.5106 0.0122  0.0635  0.0104  64   ASP A OD1 
410  O OD2 . ASP A 63  ? 0.4392 0.4941 0.6163 0.0129  0.0645  0.0083  64   ASP A OD2 
411  N N   . ILE A 64  ? 0.3548 0.4063 0.5116 0.0007  0.0746  0.0209  65   ILE A N   
412  C CA  . ILE A 64  ? 0.3760 0.4292 0.5409 -0.0039 0.0801  0.0230  65   ILE A CA  
413  C C   . ILE A 64  ? 0.3941 0.4582 0.5910 -0.0047 0.0812  0.0224  65   ILE A C   
414  O O   . ILE A 64  ? 0.3353 0.4049 0.5446 -0.0073 0.0911  0.0208  65   ILE A O   
415  C CB  . ILE A 64  ? 0.3472 0.3944 0.5018 -0.0068 0.0726  0.0284  65   ILE A CB  
416  C CG1 . ILE A 64  ? 0.3673 0.4048 0.4949 -0.0042 0.0686  0.0283  65   ILE A CG1 
417  C CG2 . ILE A 64  ? 0.3330 0.3795 0.4914 -0.0126 0.0790  0.0309  65   ILE A CG2 
418  C CD1 . ILE A 64  ? 0.4158 0.4454 0.5239 -0.0046 0.0763  0.0267  65   ILE A CD1 
419  N N   . HIS A 65  ? 0.3575 0.4248 0.5683 -0.0029 0.0708  0.0237  66   HIS A N   
420  C CA  . HIS A 65  ? 0.3759 0.4522 0.6187 -0.0028 0.0678  0.0235  66   HIS A CA  
421  C C   . HIS A 65  ? 0.3625 0.4448 0.6230 -0.0076 0.0714  0.0259  66   HIS A C   
422  O O   . HIS A 65  ? 0.3724 0.4644 0.6565 -0.0075 0.0797  0.0224  66   HIS A O   
423  C CB  . HIS A 65  ? 0.3801 0.4610 0.6361 0.0020  0.0745  0.0167  66   HIS A CB  
424  C CG  . HIS A 65  ? 0.3910 0.4675 0.6417 0.0057  0.0657  0.0159  66   HIS A CG  
425  N ND1 . HIS A 65  ? 0.3530 0.4290 0.6142 0.0049  0.0518  0.0203  66   HIS A ND1 
426  C CD2 . HIS A 65  ? 0.3708 0.4422 0.6051 0.0089  0.0682  0.0120  66   HIS A CD2 
427  C CE1 . HIS A 65  ? 0.3690 0.4404 0.6210 0.0072  0.0468  0.0193  66   HIS A CE1 
428  N NE2 . HIS A 65  ? 0.4012 0.4702 0.6380 0.0099  0.0564  0.0141  66   HIS A NE2 
429  N N   . GLY A 66  ? 0.3317 0.4085 0.5809 -0.0119 0.0649  0.0315  67   GLY A N   
430  C CA  . GLY A 66  ? 0.3199 0.4010 0.5857 -0.0175 0.0646  0.0351  67   GLY A CA  
431  C C   . GLY A 66  ? 0.3508 0.4364 0.6194 -0.0211 0.0795  0.0332  67   GLY A C   
432  O O   . GLY A 66  ? 0.3435 0.4363 0.6331 -0.0261 0.0809  0.0355  67   GLY A O   
433  N N   . GLN A 67  ? 0.3040 0.3854 0.5520 -0.0195 0.0905  0.0293  68   GLN A N   
434  C CA  . GLN A 67  ? 0.3235 0.4066 0.5674 -0.0245 0.1052  0.0281  68   GLN A CA  
435  C C   . GLN A 67  ? 0.3365 0.4067 0.5547 -0.0299 0.1015  0.0341  68   GLN A C   
436  O O   . GLN A 67  ? 0.3547 0.4131 0.5429 -0.0295 0.1038  0.0341  68   GLN A O   
437  C CB  . GLN A 67  ? 0.3357 0.4178 0.5666 -0.0211 0.1175  0.0213  68   GLN A CB  
438  C CG  . GLN A 67  ? 0.3968 0.4901 0.6540 -0.0150 0.1205  0.0145  68   GLN A CG  
439  C CD  . GLN A 67  ? 0.4027 0.4950 0.6484 -0.0124 0.1344  0.0065  68   GLN A CD  
440  O OE1 . GLN A 67  ? 0.4081 0.5050 0.6678 -0.0062 0.1353  0.0001  68   GLN A OE1 
441  N NE2 . GLN A 67  ? 0.3272 0.4117 0.5459 -0.0174 0.1444  0.0068  68   GLN A NE2 
442  N N   . TYR A 68  ? 0.3163 0.3877 0.5473 -0.0349 0.0943  0.0394  69   TYR A N   
443  C CA  . TYR A 68  ? 0.3801 0.4375 0.5888 -0.0391 0.0869  0.0450  69   TYR A CA  
444  C C   . TYR A 68  ? 0.4621 0.5113 0.6496 -0.0448 0.0972  0.0463  69   TYR A C   
445  O O   . TYR A 68  ? 0.4571 0.4904 0.6157 -0.0446 0.0923  0.0486  69   TYR A O   
446  C CB  . TYR A 68  ? 0.3119 0.3724 0.5406 -0.0444 0.0778  0.0499  69   TYR A CB  
447  C CG  . TYR A 68  ? 0.3421 0.3866 0.5486 -0.0482 0.0688  0.0549  69   TYR A CG  
448  C CD1 . TYR A 68  ? 0.2799 0.3118 0.4617 -0.0428 0.0596  0.0542  69   TYR A CD1 
449  C CD2 . TYR A 68  ? 0.3521 0.3942 0.5636 -0.0574 0.0693  0.0597  69   TYR A CD2 
450  C CE1 . TYR A 68  ? 0.3269 0.3435 0.4894 -0.0452 0.0512  0.0574  69   TYR A CE1 
451  C CE2 . TYR A 68  ? 0.4236 0.4487 0.6142 -0.0605 0.0598  0.0638  69   TYR A CE2 
452  C CZ  . TYR A 68  ? 0.3801 0.3922 0.5463 -0.0537 0.0508  0.0621  69   TYR A CZ  
453  O OH  . TYR A 68  ? 0.4162 0.4111 0.5629 -0.0556 0.0413  0.0647  69   TYR A OH  
454  N N   . TYR A 69  ? 0.5013 0.5606 0.7028 -0.0503 0.1114  0.0450  70   TYR A N   
455  C CA  . TYR A 69  ? 0.5489 0.5991 0.7280 -0.0580 0.1211  0.0474  70   TYR A CA  
456  C C   . TYR A 69  ? 0.5132 0.5517 0.6605 -0.0537 0.1249  0.0442  70   TYR A C   
457  O O   . TYR A 69  ? 0.5201 0.5427 0.6384 -0.0583 0.1251  0.0478  70   TYR A O   
458  C CB  . TYR A 69  ? 0.6712 0.7368 0.8730 -0.0658 0.1371  0.0461  70   TYR A CB  
459  C CG  . TYR A 69  ? 0.8676 0.9379 1.0894 -0.0747 0.1332  0.0524  70   TYR A CG  
460  C CD1 . TYR A 69  ? 0.9163 1.0002 1.1736 -0.0727 0.1251  0.0524  70   TYR A CD1 
461  C CD2 . TYR A 69  ? 0.9585 1.0181 1.1628 -0.0857 0.1359  0.0587  70   TYR A CD2 
462  C CE1 . TYR A 69  ? 0.9646 1.0523 1.2406 -0.0812 0.1201  0.0583  70   TYR A CE1 
463  C CE2 . TYR A 69  ? 1.0019 1.0651 1.2247 -0.0946 0.1314  0.0647  70   TYR A CE2 
464  C CZ  . TYR A 69  ? 1.0125 1.0903 1.2716 -0.0921 0.1235  0.0643  70   TYR A CZ  
465  O OH  . TYR A 69  ? 1.0379 1.1190 1.3159 -0.1013 0.1178  0.0703  70   TYR A OH  
466  N N   . ASP A 70  ? 0.5100 0.5543 0.6617 -0.0452 0.1259  0.0379  71   ASP A N   
467  C CA  . ASP A 70  ? 0.4743 0.5070 0.5966 -0.0409 0.1268  0.0350  71   ASP A CA  
468  C C   . ASP A 70  ? 0.4375 0.4566 0.5398 -0.0360 0.1113  0.0380  71   ASP A C   
469  O O   . ASP A 70  ? 0.4797 0.4847 0.5535 -0.0353 0.1097  0.0384  71   ASP A O   
470  C CB  . ASP A 70  ? 0.5299 0.5726 0.6641 -0.0338 0.1321  0.0273  71   ASP A CB  
471  C CG  . ASP A 70  ? 0.5704 0.6259 0.7220 -0.0375 0.1492  0.0222  71   ASP A CG  
472  O OD1 . ASP A 70  ? 0.5503 0.6011 0.6864 -0.0455 0.1605  0.0234  71   ASP A OD1 
473  O OD2 . ASP A 70  ? 0.5347 0.6044 0.7155 -0.0326 0.1512  0.0171  71   ASP A OD2 
474  N N   . LEU A 71  ? 0.4270 0.4497 0.5436 -0.0328 0.0998  0.0397  72   LEU A N   
475  C CA  . LEU A 71  ? 0.4234 0.4340 0.5219 -0.0288 0.0867  0.0417  72   LEU A CA  
476  C C   . LEU A 71  ? 0.3971 0.3919 0.4751 -0.0344 0.0841  0.0468  72   LEU A C   
477  O O   . LEU A 71  ? 0.4327 0.4138 0.4874 -0.0312 0.0776  0.0471  72   LEU A O   
478  C CB  . LEU A 71  ? 0.3958 0.4124 0.5114 -0.0262 0.0761  0.0425  72   LEU A CB  
479  C CG  . LEU A 71  ? 0.4357 0.4414 0.5352 -0.0226 0.0638  0.0436  72   LEU A CG  
480  C CD1 . LEU A 71  ? 0.3895 0.3923 0.4731 -0.0152 0.0616  0.0398  72   LEU A CD1 
481  C CD2 . LEU A 71  ? 0.3635 0.3738 0.4776 -0.0225 0.0544  0.0448  72   LEU A CD2 
482  N N   . LEU A 72  ? 0.4048 0.4009 0.4922 -0.0430 0.0882  0.0508  73   LEU A N   
483  C CA  . LEU A 72  ? 0.4291 0.4083 0.4961 -0.0497 0.0856  0.0563  73   LEU A CA  
484  C C   . LEU A 72  ? 0.4886 0.4565 0.5290 -0.0521 0.0924  0.0564  73   LEU A C   
485  O O   . LEU A 72  ? 0.5338 0.4827 0.5488 -0.0523 0.0848  0.0595  73   LEU A O   
486  C CB  . LEU A 72  ? 0.3555 0.3398 0.4395 -0.0601 0.0896  0.0610  73   LEU A CB  
487  C CG  . LEU A 72  ? 0.3915 0.3824 0.4979 -0.0591 0.0795  0.0622  73   LEU A CG  
488  C CD1 . LEU A 72  ? 0.3976 0.3921 0.5204 -0.0701 0.0817  0.0674  73   LEU A CD1 
489  C CD2 . LEU A 72  ? 0.3885 0.3644 0.4780 -0.0532 0.0642  0.0624  73   LEU A CD2 
490  N N   . ARG A 73  ? 0.5158 0.4938 0.5608 -0.0535 0.1061  0.0528  74   ARG A N   
491  C CA  . ARG A 73  ? 0.5691 0.5354 0.5859 -0.0561 0.1126  0.0523  74   ARG A CA  
492  C C   . ARG A 73  ? 0.5664 0.5214 0.5634 -0.0469 0.1017  0.0502  74   ARG A C   
493  O O   . ARG A 73  ? 0.5841 0.5205 0.5525 -0.0489 0.0974  0.0530  74   ARG A O   
494  C CB  . ARG A 73  ? 0.5864 0.5665 0.6129 -0.0580 0.1295  0.0467  74   ARG A CB  
495  C CG  . ARG A 73  ? 0.6099 0.5970 0.6453 -0.0697 0.1439  0.0489  74   ARG A CG  
496  C CD  . ARG A 73  ? 0.7050 0.6928 0.7263 -0.0740 0.1607  0.0442  74   ARG A CD  
497  N NE  . ARG A 73  ? 0.7010 0.7073 0.7465 -0.0668 0.1694  0.0351  74   ARG A NE  
498  C CZ  . ARG A 73  ? 0.7247 0.7305 0.7576 -0.0653 0.1800  0.0283  74   ARG A CZ  
499  N NH1 . ARG A 73  ? 0.7822 0.7695 0.7767 -0.0710 0.1831  0.0299  74   ARG A NH1 
500  N NH2 . ARG A 73  ? 0.6687 0.6907 0.7266 -0.0583 0.1864  0.0197  74   ARG A NH2 
501  N N   . LEU A 74  ? 0.4890 0.4548 0.5014 -0.0374 0.0964  0.0455  75   LEU A N   
502  C CA  . LEU A 74  ? 0.4885 0.4466 0.4864 -0.0289 0.0860  0.0433  75   LEU A CA  
503  C C   . LEU A 74  ? 0.4692 0.4108 0.4513 -0.0281 0.0732  0.0475  75   LEU A C   
504  O O   . LEU A 74  ? 0.4725 0.3999 0.4326 -0.0256 0.0668  0.0479  75   LEU A O   
505  C CB  . LEU A 74  ? 0.5318 0.5049 0.5506 -0.0207 0.0819  0.0388  75   LEU A CB  
506  C CG  . LEU A 74  ? 0.6382 0.6234 0.6680 -0.0179 0.0899  0.0333  75   LEU A CG  
507  C CD1 . LEU A 74  ? 0.6081 0.6053 0.6573 -0.0114 0.0832  0.0308  75   LEU A CD1 
508  C CD2 . LEU A 74  ? 0.7050 0.6805 0.7114 -0.0162 0.0912  0.0308  75   LEU A CD2 
509  N N   . PHE A 75  ? 0.3696 0.3121 0.3634 -0.0297 0.0682  0.0502  76   PHE A N   
510  C CA  . PHE A 75  ? 0.4579 0.3842 0.4387 -0.0281 0.0556  0.0529  76   PHE A CA  
511  C C   . PHE A 75  ? 0.5260 0.4323 0.4834 -0.0363 0.0554  0.0589  76   PHE A C   
512  O O   . PHE A 75  ? 0.5130 0.4015 0.4518 -0.0333 0.0444  0.0604  76   PHE A O   
513  C CB  . PHE A 75  ? 0.4913 0.4228 0.4896 -0.0283 0.0505  0.0537  76   PHE A CB  
514  C CG  . PHE A 75  ? 0.4555 0.4002 0.4688 -0.0199 0.0463  0.0486  76   PHE A CG  
515  C CD1 . PHE A 75  ? 0.4272 0.3724 0.4336 -0.0113 0.0419  0.0441  76   PHE A CD1 
516  C CD2 . PHE A 75  ? 0.4572 0.4132 0.4911 -0.0217 0.0461  0.0486  76   PHE A CD2 
517  C CE1 . PHE A 75  ? 0.3712 0.3288 0.3902 -0.0052 0.0388  0.0398  76   PHE A CE1 
518  C CE2 . PHE A 75  ? 0.4303 0.3966 0.4747 -0.0155 0.0419  0.0447  76   PHE A CE2 
519  C CZ  . PHE A 75  ? 0.3787 0.3461 0.4152 -0.0077 0.0390  0.0403  76   PHE A CZ  
520  N N   . GLU A 76  ? 0.5746 0.4834 0.5330 -0.0469 0.0671  0.0624  77   GLU A N   
521  C CA  . GLU A 76  ? 0.6506 0.5397 0.5836 -0.0567 0.0679  0.0687  77   GLU A CA  
522  C C   . GLU A 76  ? 0.6166 0.4930 0.5233 -0.0542 0.0661  0.0677  77   GLU A C   
523  O O   . GLU A 76  ? 0.7287 0.5824 0.6107 -0.0562 0.0563  0.0723  77   GLU A O   
524  C CB  . GLU A 76  ? 0.7333 0.6310 0.6739 -0.0693 0.0835  0.0717  77   GLU A CB  
525  C CG  . GLU A 76  ? 0.8102 0.7158 0.7736 -0.0744 0.0829  0.0748  77   GLU A CG  
526  C CD  . GLU A 76  ? 0.9048 0.8278 0.8869 -0.0844 0.0998  0.0753  77   GLU A CD  
527  O OE1 . GLU A 76  ? 0.9873 0.9150 0.9621 -0.0877 0.1134  0.0729  77   GLU A OE1 
528  O OE2 . GLU A 76  ? 0.8759 0.8081 0.8809 -0.0888 0.0995  0.0776  77   GLU A OE2 
529  N N   . TYR A 77  ? 0.6044 0.4938 0.5161 -0.0498 0.0740  0.0619  78   TYR A N   
530  C CA  . TYR A 77  ? 0.6454 0.5233 0.5329 -0.0475 0.0717  0.0605  78   TYR A CA  
531  C C   . TYR A 77  ? 0.6449 0.5150 0.5283 -0.0363 0.0546  0.0588  78   TYR A C   
532  O O   . TYR A 77  ? 0.6885 0.5386 0.5476 -0.0362 0.0449  0.0616  78   TYR A O   
533  C CB  . TYR A 77  ? 0.7703 0.6650 0.6673 -0.0457 0.0846  0.0539  78   TYR A CB  
534  C CG  . TYR A 77  ? 0.8895 0.7724 0.7589 -0.0481 0.0878  0.0527  78   TYR A CG  
535  C CD1 . TYR A 77  ? 0.9914 0.8502 0.8301 -0.0495 0.0760  0.0571  78   TYR A CD1 
536  C CD2 . TYR A 77  ? 0.9036 0.7982 0.7774 -0.0487 0.1015  0.0466  78   TYR A CD2 
537  C CE1 . TYR A 77  ? 1.0125 0.8589 0.8240 -0.0524 0.0775  0.0562  78   TYR A CE1 
538  C CE2 . TYR A 77  ? 0.9598 0.8422 0.8061 -0.0512 0.1041  0.0447  78   TYR A CE2 
539  C CZ  . TYR A 77  ? 0.9951 0.8532 0.8095 -0.0535 0.0920  0.0499  78   TYR A CZ  
540  O OH  . TYR A 77  ? 1.0247 0.8690 0.8099 -0.0567 0.0933  0.0484  78   TYR A OH  
541  N N   . GLY A 78  ? 0.5555 0.4408 0.4626 -0.0271 0.0504  0.0542  79   GLY A N   
542  C CA  . GLY A 78  ? 0.5523 0.4348 0.4587 -0.0163 0.0372  0.0509  79   GLY A CA  
543  C C   . GLY A 78  ? 0.5870 0.4572 0.4915 -0.0130 0.0241  0.0530  79   GLY A C   
544  O O   . GLY A 78  ? 0.6336 0.4971 0.5338 -0.0046 0.0122  0.0506  79   GLY A O   
545  N N   . GLY A 79  ? 0.5873 0.4542 0.4960 -0.0194 0.0258  0.0569  80   GLY A N   
546  C CA  . GLY A 79  ? 0.5483 0.4033 0.4568 -0.0163 0.0137  0.0579  80   GLY A CA  
547  C C   . GLY A 79  ? 0.5880 0.4593 0.5203 -0.0120 0.0143  0.0537  80   GLY A C   
548  O O   . GLY A 79  ? 0.5632 0.4507 0.5088 -0.0042 0.0153  0.0478  80   GLY A O   
549  N N   . PHE A 80  ? 0.5246 0.3910 0.4611 -0.0178 0.0132  0.0571  81   PHE A N   
550  C CA  . PHE A 80  ? 0.5456 0.4247 0.5017 -0.0150 0.0126  0.0537  81   PHE A CA  
551  C C   . PHE A 80  ? 0.5741 0.4510 0.5306 -0.0033 0.0021  0.0472  81   PHE A C   
552  O O   . PHE A 80  ? 0.5623 0.4219 0.5052 0.0010  -0.0078 0.0468  81   PHE A O   
553  C CB  . PHE A 80  ? 0.5289 0.3999 0.4873 -0.0240 0.0113  0.0589  81   PHE A CB  
554  C CG  . PHE A 80  ? 0.5293 0.4121 0.4990 -0.0346 0.0236  0.0632  81   PHE A CG  
555  C CD1 . PHE A 80  ? 0.5307 0.4060 0.4880 -0.0441 0.0306  0.0688  81   PHE A CD1 
556  C CD2 . PHE A 80  ? 0.4804 0.3820 0.4735 -0.0354 0.0282  0.0615  81   PHE A CD2 
557  C CE1 . PHE A 80  ? 0.5424 0.4313 0.5130 -0.0535 0.0437  0.0715  81   PHE A CE1 
558  C CE2 . PHE A 80  ? 0.4506 0.3648 0.4585 -0.0441 0.0393  0.0645  81   PHE A CE2 
559  C CZ  . PHE A 80  ? 0.5113 0.4205 0.5092 -0.0528 0.0479  0.0690  81   PHE A CZ  
560  N N   . PRO A 81  ? 0.5452 0.4394 0.5174 0.0017  0.0041  0.0418  82   PRO A N   
561  C CA  . PRO A 81  ? 0.4881 0.3821 0.4617 0.0117  -0.0039 0.0347  82   PRO A CA  
562  C C   . PRO A 81  ? 0.4926 0.3668 0.4577 0.0118  -0.0137 0.0350  82   PRO A C   
563  O O   . PRO A 81  ? 0.5454 0.4135 0.5112 0.0035  -0.0136 0.0397  82   PRO A O   
564  C CB  . PRO A 81  ? 0.4419 0.3554 0.4316 0.0119  0.0012  0.0314  82   PRO A CB  
565  C CG  . PRO A 81  ? 0.4529 0.3793 0.4512 0.0058  0.0111  0.0352  82   PRO A CG  
566  C CD  . PRO A 81  ? 0.5163 0.4301 0.5057 -0.0023 0.0134  0.0420  82   PRO A CD  
567  N N   . PRO A 82  ? 0.5233 0.3870 0.4817 0.0211  -0.0230 0.0297  83   PRO A N   
568  C CA  . PRO A 82  ? 0.5135 0.3868 0.4752 0.0312  -0.0238 0.0234  83   PRO A CA  
569  C C   . PRO A 82  ? 0.5102 0.3715 0.4602 0.0328  -0.0288 0.0265  83   PRO A C   
570  O O   . PRO A 82  ? 0.5278 0.3932 0.4809 0.0422  -0.0332 0.0209  83   PRO A O   
571  C CB  . PRO A 82  ? 0.5265 0.3955 0.4905 0.0407  -0.0315 0.0148  83   PRO A CB  
572  C CG  . PRO A 82  ? 0.5139 0.3574 0.4660 0.0371  -0.0404 0.0186  83   PRO A CG  
573  C CD  . PRO A 82  ? 0.5960 0.4384 0.5459 0.0232  -0.0340 0.0285  83   PRO A CD  
574  N N   . GLU A 83  ? 0.5693 0.4163 0.5062 0.0235  -0.0283 0.0351  84   GLU A N   
575  C CA  A GLU A 83  ? 0.6106 0.4426 0.5319 0.0237  -0.0343 0.0387  84   GLU A CA  
576  C CA  B GLU A 83  ? 0.6105 0.4426 0.5318 0.0236  -0.0342 0.0387  84   GLU A CA  
577  C C   . GLU A 83  ? 0.5580 0.4054 0.4842 0.0288  -0.0307 0.0353  84   GLU A C   
578  O O   . GLU A 83  ? 0.5643 0.4027 0.4835 0.0346  -0.0398 0.0342  84   GLU A O   
579  C CB  A GLU A 83  ? 0.6633 0.4819 0.5690 0.0102  -0.0301 0.0486  84   GLU A CB  
580  C CB  B GLU A 83  ? 0.6628 0.4817 0.5686 0.0102  -0.0300 0.0486  84   GLU A CB  
581  C CG  A GLU A 83  ? 0.6982 0.4978 0.5969 0.0039  -0.0360 0.0534  84   GLU A CG  
582  C CG  B GLU A 83  ? 0.7280 0.5281 0.6125 0.0082  -0.0365 0.0535  84   GLU A CG  
583  C CD  A GLU A 83  ? 0.7332 0.5302 0.6253 -0.0114 -0.0264 0.0622  84   GLU A CD  
584  C CD  B GLU A 83  ? 0.7493 0.5403 0.6175 -0.0066 -0.0284 0.0626  84   GLU A CD  
585  O OE1 A GLU A 83  ? 0.7550 0.5557 0.6393 -0.0172 -0.0180 0.0656  84   GLU A OE1 
586  O OE1 B GLU A 83  ? 0.7648 0.5499 0.6322 -0.0154 -0.0257 0.0674  84   GLU A OE1 
587  O OE2 A GLU A 83  ? 0.7567 0.5488 0.6521 -0.0178 -0.0268 0.0652  84   GLU A OE2 
588  O OE2 B GLU A 83  ? 0.7355 0.5256 0.5915 -0.0098 -0.0245 0.0647  84   GLU A OE2 
589  N N   . SER A 84  ? 0.5284 0.3979 0.4670 0.0265  -0.0188 0.0337  85   SER A N   
590  C CA  . SER A 84  ? 0.5296 0.4148 0.4749 0.0311  -0.0156 0.0300  85   SER A CA  
591  C C   . SER A 84  ? 0.4516 0.3596 0.4167 0.0355  -0.0102 0.0237  85   SER A C   
592  O O   . SER A 84  ? 0.4797 0.3927 0.4519 0.0321  -0.0061 0.0238  85   SER A O   
593  C CB  . SER A 84  ? 0.6283 0.5160 0.5662 0.0229  -0.0062 0.0347  85   SER A CB  
594  O OG  . SER A 84  ? 0.7622 0.6285 0.6782 0.0181  -0.0109 0.0403  85   SER A OG  
595  N N   . ASN A 85  ? 0.4329 0.3540 0.4061 0.0422  -0.0111 0.0187  86   ASN A N   
596  C CA  . ASN A 85  ? 0.3990 0.3423 0.3887 0.0443  -0.0050 0.0138  86   ASN A CA  
597  C C   . ASN A 85  ? 0.4389 0.3931 0.4320 0.0376  0.0046  0.0170  86   ASN A C   
598  O O   . ASN A 85  ? 0.4740 0.4231 0.4586 0.0350  0.0058  0.0199  86   ASN A O   
599  C CB  . ASN A 85  ? 0.3604 0.3140 0.3588 0.0534  -0.0097 0.0071  86   ASN A CB  
600  C CG  . ASN A 85  ? 0.5471 0.4910 0.5453 0.0617  -0.0194 0.0022  86   ASN A CG  
601  O OD1 . ASN A 85  ? 0.5348 0.4717 0.5316 0.0617  -0.0203 0.0010  86   ASN A OD1 
602  N ND2 . ASN A 85  ? 0.6005 0.5428 0.6007 0.0690  -0.0274 -0.0008 86   ASN A ND2 
603  N N   . TYR A 86  ? 0.3809 0.3490 0.3859 0.0349  0.0107  0.0161  87   TYR A N   
604  C CA  . TYR A 86  ? 0.3473 0.3249 0.3584 0.0291  0.0189  0.0188  87   TYR A CA  
605  C C   . TYR A 86  ? 0.3780 0.3737 0.4023 0.0305  0.0212  0.0154  87   TYR A C   
606  O O   . TYR A 86  ? 0.3820 0.3836 0.4115 0.0325  0.0194  0.0124  87   TYR A O   
607  C CB  . TYR A 86  ? 0.3609 0.3350 0.3743 0.0219  0.0234  0.0231  87   TYR A CB  
608  C CG  . TYR A 86  ? 0.3832 0.3423 0.3841 0.0171  0.0248  0.0278  87   TYR A CG  
609  C CD1 . TYR A 86  ? 0.3206 0.2806 0.3188 0.0127  0.0321  0.0299  87   TYR A CD1 
610  C CD2 . TYR A 86  ? 0.4206 0.3634 0.4108 0.0167  0.0187  0.0299  87   TYR A CD2 
611  C CE1 . TYR A 86  ? 0.3810 0.3276 0.3655 0.0070  0.0348  0.0340  87   TYR A CE1 
612  C CE2 . TYR A 86  ? 0.4117 0.3397 0.3884 0.0106  0.0199  0.0351  87   TYR A CE2 
613  C CZ  . TYR A 86  ? 0.3840 0.3146 0.3574 0.0054  0.0285  0.0372  87   TYR A CZ  
614  O OH  . TYR A 86  ? 0.4680 0.3844 0.4260 -0.0019 0.0312  0.0423  87   TYR A OH  
615  N N   . LEU A 87  ? 0.3519 0.3550 0.3801 0.0286  0.0253  0.0160  88   LEU A N   
616  C CA  . LEU A 87  ? 0.3638 0.3821 0.4041 0.0273  0.0279  0.0147  88   LEU A CA  
617  C C   . LEU A 87  ? 0.3578 0.3773 0.4033 0.0220  0.0338  0.0178  88   LEU A C   
618  O O   . LEU A 87  ? 0.3473 0.3622 0.3874 0.0214  0.0366  0.0182  88   LEU A O   
619  C CB  . LEU A 87  ? 0.3251 0.3517 0.3673 0.0312  0.0254  0.0114  88   LEU A CB  
620  C CG  . LEU A 87  ? 0.3183 0.3586 0.3711 0.0285  0.0277  0.0110  88   LEU A CG  
621  C CD1 . LEU A 87  ? 0.2399 0.2891 0.2993 0.0268  0.0278  0.0102  88   LEU A CD1 
622  C CD2 . LEU A 87  ? 0.3274 0.3735 0.3809 0.0314  0.0248  0.0085  88   LEU A CD2 
623  N N   . PHE A 88  ? 0.3216 0.3465 0.3774 0.0183  0.0353  0.0195  89   PHE A N   
624  C CA  . PHE A 88  ? 0.3488 0.3772 0.4148 0.0143  0.0400  0.0215  89   PHE A CA  
625  C C   . PHE A 88  ? 0.4155 0.4543 0.4907 0.0139  0.0387  0.0206  89   PHE A C   
626  O O   . PHE A 88  ? 0.3560 0.4006 0.4325 0.0139  0.0349  0.0200  89   PHE A O   
627  C CB  . PHE A 88  ? 0.2451 0.2719 0.3189 0.0101  0.0407  0.0246  89   PHE A CB  
628  C CG  . PHE A 88  ? 0.2989 0.3154 0.3654 0.0083  0.0431  0.0266  89   PHE A CG  
629  C CD1 . PHE A 88  ? 0.2655 0.2726 0.3198 0.0100  0.0386  0.0266  89   PHE A CD1 
630  C CD2 . PHE A 88  ? 0.3497 0.3656 0.4219 0.0045  0.0500  0.0282  89   PHE A CD2 
631  C CE1 . PHE A 88  ? 0.3536 0.3492 0.3998 0.0072  0.0398  0.0293  89   PHE A CE1 
632  C CE2 . PHE A 88  ? 0.3905 0.3970 0.4550 0.0011  0.0529  0.0306  89   PHE A CE2 
633  C CZ  . PHE A 88  ? 0.3847 0.3803 0.4354 0.0021  0.0472  0.0318  89   PHE A CZ  
634  N N   . LEU A 89  ? 0.4355 0.4760 0.5162 0.0132  0.0421  0.0201  90   LEU A N   
635  C CA  . LEU A 89  ? 0.3425 0.3902 0.4304 0.0127  0.0399  0.0194  90   LEU A CA  
636  C C   . LEU A 89  ? 0.3588 0.4103 0.4619 0.0091  0.0389  0.0218  90   LEU A C   
637  O O   . LEU A 89  ? 0.3389 0.3940 0.4485 0.0081  0.0366  0.0217  90   LEU A O   
638  C CB  . LEU A 89  ? 0.2893 0.3344 0.3726 0.0146  0.0423  0.0167  90   LEU A CB  
639  C CG  . LEU A 89  ? 0.2948 0.3343 0.3627 0.0178  0.0413  0.0149  90   LEU A CG  
640  C CD1 . LEU A 89  ? 0.3082 0.3420 0.3689 0.0186  0.0436  0.0125  90   LEU A CD1 
641  C CD2 . LEU A 89  ? 0.2349 0.2816 0.3024 0.0196  0.0356  0.0140  90   LEU A CD2 
642  N N   . GLY A 90  ? 0.3389 0.3888 0.4483 0.0069  0.0393  0.0241  91   GLY A N   
643  C CA  . GLY A 90  ? 0.3363 0.3894 0.4609 0.0035  0.0355  0.0270  91   GLY A CA  
644  C C   . GLY A 90  ? 0.3889 0.4419 0.5290 0.0032  0.0398  0.0268  91   GLY A C   
645  O O   . GLY A 90  ? 0.3365 0.3872 0.4739 0.0048  0.0474  0.0245  91   GLY A O   
646  N N   . ASP A 91  ? 0.2958 0.3516 0.4527 0.0009  0.0347  0.0292  92   ASP A N   
647  C CA  . ASP A 91  ? 0.2744 0.3326 0.4525 0.0009  0.0375  0.0286  92   ASP A CA  
648  C C   . ASP A 91  ? 0.3297 0.3876 0.5101 -0.0007 0.0427  0.0295  92   ASP A C   
649  O O   . ASP A 91  ? 0.3408 0.3998 0.5246 0.0003  0.0522  0.0266  92   ASP A O   
650  C CB  . ASP A 91  ? 0.2367 0.2958 0.4200 0.0047  0.0439  0.0235  92   ASP A CB  
651  C CG  . ASP A 91  ? 0.3128 0.3721 0.5051 0.0051  0.0363  0.0237  92   ASP A CG  
652  O OD1 . ASP A 91  ? 0.3256 0.3841 0.5149 0.0017  0.0268  0.0283  92   ASP A OD1 
653  O OD2 . ASP A 91  ? 0.3375 0.3966 0.5384 0.0082  0.0395  0.0193  92   ASP A OD2 
654  N N   . TYR A 92  ? 0.3328 0.3886 0.5101 -0.0041 0.0363  0.0335  93   TYR A N   
655  C CA  . TYR A 92  ? 0.3479 0.4022 0.5279 -0.0068 0.0388  0.0353  93   TYR A CA  
656  C C   . TYR A 92  ? 0.3608 0.4207 0.5680 -0.0095 0.0368  0.0373  93   TYR A C   
657  O O   . TYR A 92  ? 0.3486 0.4106 0.5644 -0.0117 0.0426  0.0376  93   TYR A O   
658  C CB  . TYR A 92  ? 0.3061 0.3539 0.4694 -0.0090 0.0323  0.0379  93   TYR A CB  
659  C CG  . TYR A 92  ? 0.3445 0.3893 0.4864 -0.0057 0.0321  0.0355  93   TYR A CG  
660  C CD1 . TYR A 92  ? 0.3291 0.3712 0.4583 -0.0023 0.0389  0.0326  93   TYR A CD1 
661  C CD2 . TYR A 92  ? 0.3086 0.3538 0.4437 -0.0066 0.0250  0.0362  93   TYR A CD2 
662  C CE1 . TYR A 92  ? 0.2565 0.2972 0.3699 0.0011  0.0378  0.0302  93   TYR A CE1 
663  C CE2 . TYR A 92  ? 0.3216 0.3669 0.4407 -0.0037 0.0258  0.0334  93   TYR A CE2 
664  C CZ  . TYR A 92  ? 0.3076 0.3511 0.4176 0.0006  0.0318  0.0303  93   TYR A CZ  
665  O OH  . TYR A 92  ? 0.2679 0.3126 0.3656 0.0039  0.0317  0.0274  93   TYR A OH  
666  N N   . VAL A 93  ? 0.2948 0.3571 0.5163 -0.0097 0.0281  0.0388  94   VAL A N   
667  C CA  . VAL A 93  ? 0.3169 0.3838 0.5657 -0.0122 0.0223  0.0414  94   VAL A CA  
668  C C   . VAL A 93  ? 0.3141 0.3875 0.5865 -0.0082 0.0246  0.0378  94   VAL A C   
669  O O   . VAL A 93  ? 0.3019 0.3746 0.5662 -0.0042 0.0295  0.0338  94   VAL A O   
670  C CB  . VAL A 93  ? 0.3437 0.4049 0.5894 -0.0167 0.0072  0.0470  94   VAL A CB  
671  C CG1 . VAL A 93  ? 0.3313 0.3852 0.5523 -0.0198 0.0058  0.0488  94   VAL A CG1 
672  C CG2 . VAL A 93  ? 0.2975 0.3559 0.5371 -0.0159 0.0000  0.0477  94   VAL A CG2 
673  N N   . ASP A 94  ? 0.3155 0.3951 0.6182 -0.0091 0.0205  0.0389  95   ASP A N   
674  C CA  . ASP A 94  ? 0.3186 0.4049 0.6505 -0.0047 0.0210  0.0349  95   ASP A CA  
675  C C   . ASP A 94  ? 0.3207 0.4157 0.6629 -0.0012 0.0385  0.0275  95   ASP A C   
676  O O   . ASP A 94  ? 0.3056 0.3984 0.6248 -0.0015 0.0499  0.0253  95   ASP A O   
677  C CB  . ASP A 94  ? 0.2231 0.3034 0.5478 -0.0017 0.0143  0.0340  95   ASP A CB  
678  C CG  . ASP A 94  ? 0.2961 0.3689 0.6184 -0.0060 -0.0037 0.0412  95   ASP A CG  
679  O OD1 . ASP A 94  ? 0.3668 0.4396 0.6981 -0.0104 -0.0120 0.0462  95   ASP A OD1 
680  O OD2 . ASP A 94  ? 0.2955 0.3619 0.6057 -0.0058 -0.0099 0.0423  95   ASP A OD2 
681  N N   . ARG A 95  ? 0.3202 0.4246 0.6970 0.0022  0.0402  0.0234  96   ARG A N   
682  C CA  . ARG A 95  ? 0.2829 0.3970 0.6748 0.0061  0.0571  0.0146  96   ARG A CA  
683  C C   . ARG A 95  ? 0.3969 0.5196 0.7939 0.0011  0.0692  0.0149  96   ARG A C   
684  O O   . ARG A 95  ? 0.4752 0.6111 0.9055 0.0016  0.0753  0.0113  96   ARG A O   
685  C CB  . ARG A 95  ? 0.3151 0.4225 0.6804 0.0099  0.0663  0.0090  96   ARG A CB  
686  C CG  . ARG A 95  ? 0.4173 0.5168 0.7803 0.0140  0.0546  0.0086  96   ARG A CG  
687  C CD  . ARG A 95  ? 0.5030 0.6027 0.8688 0.0204  0.0648  -0.0012 96   ARG A CD  
688  N NE  . ARG A 95  ? 0.6041 0.6957 0.9707 0.0240  0.0531  -0.0017 96   ARG A NE  
689  C CZ  . ARG A 95  ? 0.5959 0.6771 0.9336 0.0227  0.0476  0.0011  96   ARG A CZ  
690  N NH1 . ARG A 95  ? 0.5813 0.6552 0.9218 0.0249  0.0369  0.0010  96   ARG A NH1 
691  N NH2 . ARG A 95  ? 0.6138 0.6919 0.9212 0.0189  0.0522  0.0042  96   ARG A NH2 
692  N N   . GLY A 96  ? 0.4064 0.5216 0.7720 -0.0038 0.0723  0.0189  97   GLY A N   
693  C CA  . GLY A 96  ? 0.3627 0.4833 0.7294 -0.0097 0.0827  0.0202  97   GLY A CA  
694  C C   . GLY A 96  ? 0.3207 0.4466 0.7110 -0.0149 0.0726  0.0264  97   GLY A C   
695  O O   . GLY A 96  ? 0.3466 0.4698 0.7475 -0.0145 0.0562  0.0306  97   GLY A O   
696  N N   . LYS A 97  ? 0.3533 0.4858 0.7502 -0.0211 0.0822  0.0275  98   LYS A N   
697  C CA  . LYS A 97  ? 0.3976 0.5370 0.8209 -0.0268 0.0738  0.0328  98   LYS A CA  
698  C C   . LYS A 97  ? 0.3895 0.5148 0.7882 -0.0326 0.0609  0.0412  98   LYS A C   
699  O O   . LYS A 97  ? 0.3931 0.5197 0.8098 -0.0366 0.0479  0.0463  98   LYS A O   
700  C CB  . LYS A 97  ? 0.4652 0.6198 0.9106 -0.0319 0.0902  0.0302  98   LYS A CB  
701  N N   . GLN A 98  ? 0.3292 0.4406 0.6879 -0.0329 0.0631  0.0423  99   GLN A N   
702  C CA  . GLN A 98  ? 0.3396 0.4374 0.6745 -0.0381 0.0534  0.0486  99   GLN A CA  
703  C C   . GLN A 98  ? 0.3709 0.4549 0.6736 -0.0337 0.0453  0.0488  99   GLN A C   
704  O O   . GLN A 98  ? 0.3365 0.4091 0.6087 -0.0343 0.0470  0.0496  99   GLN A O   
705  C CB  . GLN A 98  ? 0.3058 0.4002 0.6255 -0.0442 0.0643  0.0500  99   GLN A CB  
706  C CG  . GLN A 98  ? 0.3563 0.4651 0.7072 -0.0507 0.0726  0.0506  99   GLN A CG  
707  C CD  . GLN A 98  ? 0.4644 0.5677 0.7968 -0.0585 0.0830  0.0532  99   GLN A CD  
708  O OE1 . GLN A 98  ? 0.5169 0.6166 0.8282 -0.0577 0.0957  0.0501  99   GLN A OE1 
709  N NE2 . GLN A 98  ? 0.5115 0.6123 0.8501 -0.0668 0.0764  0.0592  99   GLN A NE2 
710  N N   . SER A 99  ? 0.2893 0.3743 0.6004 -0.0295 0.0359  0.0482  100  SER A N   
711  C CA  . SER A 99  ? 0.2647 0.3387 0.5486 -0.0267 0.0280  0.0488  100  SER A CA  
712  C C   . SER A 99  ? 0.2865 0.3490 0.5512 -0.0312 0.0176  0.0534  100  SER A C   
713  O O   . SER A 99  ? 0.3228 0.3760 0.5588 -0.0295 0.0168  0.0526  100  SER A O   
714  C CB  . SER A 99  ? 0.2676 0.3440 0.5652 -0.0236 0.0185  0.0487  100  SER A CB  
715  O OG  . SER A 99  ? 0.3908 0.4751 0.7017 -0.0181 0.0276  0.0432  100  SER A OG  
716  N N   . LEU A 100 ? 0.3190 0.3820 0.5998 -0.0370 0.0096  0.0576  101  LEU A N   
717  C CA  . LEU A 100 ? 0.3306 0.3807 0.5923 -0.0415 -0.0015 0.0614  101  LEU A CA  
718  C C   . LEU A 100 ? 0.3563 0.3977 0.5938 -0.0424 0.0053  0.0606  101  LEU A C   
719  O O   . LEU A 100 ? 0.3195 0.3492 0.5296 -0.0413 0.0009  0.0600  101  LEU A O   
720  C CB  . LEU A 100 ? 0.3559 0.4076 0.6411 -0.0479 -0.0129 0.0663  101  LEU A CB  
721  C CG  . LEU A 100 ? 0.4034 0.4542 0.6992 -0.0484 -0.0278 0.0689  101  LEU A CG  
722  C CD1 . LEU A 100 ? 0.4547 0.5056 0.7733 -0.0552 -0.0410 0.0741  101  LEU A CD1 
723  C CD2 . LEU A 100 ? 0.3723 0.4099 0.6345 -0.0479 -0.0348 0.0689  101  LEU A CD2 
724  N N   . GLU A 101 ? 0.3344 0.3811 0.5815 -0.0447 0.0160  0.0606  102  GLU A N   
725  C CA  . GLU A 101 ? 0.3157 0.3520 0.5389 -0.0462 0.0216  0.0606  102  GLU A CA  
726  C C   . GLU A 101 ? 0.3447 0.3757 0.5420 -0.0393 0.0270  0.0564  102  GLU A C   
727  O O   . GLU A 101 ? 0.3587 0.3769 0.5308 -0.0382 0.0243  0.0560  102  GLU A O   
728  C CB  . GLU A 101 ? 0.2855 0.3290 0.5229 -0.0513 0.0332  0.0618  102  GLU A CB  
729  C CG  . GLU A 101 ? 0.3205 0.3686 0.5822 -0.0596 0.0281  0.0664  102  GLU A CG  
730  C CD  . GLU A 101 ? 0.2866 0.3525 0.5865 -0.0591 0.0277  0.0658  102  GLU A CD  
731  O OE1 . GLU A 101 ? 0.3111 0.3826 0.6162 -0.0523 0.0281  0.0622  102  GLU A OE1 
732  O OE2 . GLU A 101 ? 0.3465 0.4203 0.6725 -0.0657 0.0261  0.0689  102  GLU A OE2 
733  N N   . THR A 102 ? 0.2900 0.3305 0.4948 -0.0344 0.0341  0.0529  103  THR A N   
734  C CA  . THR A 102 ? 0.3062 0.3430 0.4893 -0.0283 0.0389  0.0490  103  THR A CA  
735  C C   . THR A 102 ? 0.3246 0.3536 0.4890 -0.0252 0.0291  0.0483  103  THR A C   
736  O O   . THR A 102 ? 0.2856 0.3052 0.4273 -0.0228 0.0289  0.0469  103  THR A O   
737  C CB  . THR A 102 ? 0.2937 0.3417 0.4910 -0.0243 0.0461  0.0454  103  THR A CB  
738  O OG1 . THR A 102 ? 0.2749 0.3304 0.4872 -0.0269 0.0577  0.0444  103  THR A OG1 
739  C CG2 . THR A 102 ? 0.2502 0.2944 0.4265 -0.0184 0.0491  0.0416  103  THR A CG2 
740  N N   . ILE A 103 ? 0.2993 0.3318 0.4730 -0.0255 0.0209  0.0493  104  ILE A N   
741  C CA  . ILE A 103 ? 0.3005 0.3272 0.4558 -0.0235 0.0136  0.0481  104  ILE A CA  
742  C C   . ILE A 103 ? 0.2989 0.3138 0.4387 -0.0262 0.0070  0.0491  104  ILE A C   
743  O O   . ILE A 103 ? 0.2940 0.3026 0.4131 -0.0231 0.0056  0.0460  104  ILE A O   
744  C CB  . ILE A 103 ? 0.3040 0.3357 0.4710 -0.0248 0.0060  0.0498  104  ILE A CB  
745  C CG1 . ILE A 103 ? 0.2839 0.3110 0.4302 -0.0240 0.0007  0.0484  104  ILE A CG1 
746  C CG2 . ILE A 103 ? 0.2788 0.3105 0.4645 -0.0307 -0.0027 0.0543  104  ILE A CG2 
747  C CD1 . ILE A 103 ? 0.3206 0.3503 0.4533 -0.0183 0.0079  0.0440  104  ILE A CD1 
748  N N   . CYS A 104 ? 0.2650 0.2769 0.4153 -0.0319 0.0030  0.0528  105  CYS A N   
749  C CA  . CYS A 104 ? 0.3802 0.3787 0.5152 -0.0348 -0.0043 0.0534  105  CYS A CA  
750  C C   . CYS A 104 ? 0.3761 0.3657 0.4919 -0.0313 0.0008  0.0507  105  CYS A C   
751  O O   . CYS A 104 ? 0.3452 0.3238 0.4416 -0.0292 -0.0039 0.0478  105  CYS A O   
752  C CB  . CYS A 104 ? 0.3411 0.3382 0.4930 -0.0424 -0.0101 0.0584  105  CYS A CB  
753  S SG  . CYS A 104 ? 0.4148 0.4148 0.5818 -0.0470 -0.0230 0.0618  105  CYS A SG  
754  N N   . LEU A 105 ? 0.3827 0.3758 0.5030 -0.0307 0.0101  0.0512  106  LEU A N   
755  C CA  . LEU A 105 ? 0.3848 0.3670 0.4856 -0.0280 0.0130  0.0496  106  LEU A CA  
756  C C   . LEU A 105 ? 0.3535 0.3359 0.4392 -0.0198 0.0144  0.0443  106  LEU A C   
757  O O   . LEU A 105 ? 0.3551 0.3266 0.4232 -0.0160 0.0111  0.0415  106  LEU A O   
758  C CB  . LEU A 105 ? 0.3299 0.3144 0.4367 -0.0312 0.0225  0.0522  106  LEU A CB  
759  C CG  . LEU A 105 ? 0.3640 0.3357 0.4488 -0.0288 0.0246  0.0513  106  LEU A CG  
760  C CD1 . LEU A 105 ? 0.3233 0.2788 0.3971 -0.0319 0.0160  0.0533  106  LEU A CD1 
761  C CD2 . LEU A 105 ? 0.3188 0.2933 0.4060 -0.0327 0.0354  0.0537  106  LEU A CD2 
762  N N   . LEU A 106 ? 0.3216 0.3162 0.4153 -0.0170 0.0186  0.0427  107  LEU A N   
763  C CA  . LEU A 106 ? 0.2730 0.2697 0.3549 -0.0102 0.0196  0.0381  107  LEU A CA  
764  C C   . LEU A 106 ? 0.3562 0.3496 0.4282 -0.0087 0.0126  0.0351  107  LEU A C   
765  O O   . LEU A 106 ? 0.4083 0.3979 0.4668 -0.0032 0.0121  0.0306  107  LEU A O   
766  C CB  . LEU A 106 ? 0.2839 0.2934 0.3770 -0.0087 0.0245  0.0374  107  LEU A CB  
767  C CG  . LEU A 106 ? 0.3422 0.3555 0.4440 -0.0097 0.0329  0.0386  107  LEU A CG  
768  C CD1 . LEU A 106 ? 0.2962 0.3207 0.4114 -0.0085 0.0359  0.0375  107  LEU A CD1 
769  C CD2 . LEU A 106 ? 0.3212 0.3268 0.4062 -0.0066 0.0372  0.0370  107  LEU A CD2 
770  N N   . LEU A 107 ? 0.3650 0.3596 0.4436 -0.0136 0.0070  0.0373  108  LEU A N   
771  C CA  . LEU A 107 ? 0.3466 0.3367 0.4125 -0.0134 0.0011  0.0342  108  LEU A CA  
772  C C   . LEU A 107 ? 0.3969 0.3726 0.4488 -0.0122 -0.0027 0.0316  108  LEU A C   
773  O O   . LEU A 107 ? 0.4184 0.3903 0.4561 -0.0078 -0.0038 0.0257  108  LEU A O   
774  C CB  . LEU A 107 ? 0.3637 0.3555 0.4374 -0.0202 -0.0055 0.0380  108  LEU A CB  
775  C CG  . LEU A 107 ? 0.3528 0.3563 0.4378 -0.0214 -0.0047 0.0400  108  LEU A CG  
776  C CD1 . LEU A 107 ? 0.3088 0.3101 0.3997 -0.0286 -0.0142 0.0445  108  LEU A CD1 
777  C CD2 . LEU A 107 ? 0.3515 0.3608 0.4250 -0.0173 -0.0009 0.0355  108  LEU A CD2 
778  N N   . ALA A 108 ? 0.3201 0.2877 0.3764 -0.0161 -0.0045 0.0357  109  ALA A N   
779  C CA  . ALA A 108 ? 0.3748 0.3263 0.4177 -0.0153 -0.0093 0.0338  109  ALA A CA  
780  C C   . ALA A 108 ? 0.4176 0.3649 0.4487 -0.0070 -0.0062 0.0288  109  ALA A C   
781  O O   . ALA A 108 ? 0.4219 0.3594 0.4396 -0.0024 -0.0102 0.0231  109  ALA A O   
782  C CB  . ALA A 108 ? 0.3359 0.2804 0.3870 -0.0223 -0.0113 0.0401  109  ALA A CB  
783  N N   . TYR A 109 ? 0.3798 0.3337 0.4157 -0.0049 0.0004  0.0304  110  TYR A N   
784  C CA  . TYR A 109 ? 0.3527 0.3024 0.3782 0.0028  0.0017  0.0264  110  TYR A CA  
785  C C   . TYR A 109 ? 0.4023 0.3601 0.4240 0.0098  0.0021  0.0191  110  TYR A C   
786  O O   . TYR A 109 ? 0.3784 0.3299 0.3912 0.0168  -0.0004 0.0134  110  TYR A O   
787  C CB  . TYR A 109 ? 0.3585 0.3129 0.3882 0.0023  0.0082  0.0299  110  TYR A CB  
788  C CG  . TYR A 109 ? 0.4218 0.3640 0.4482 -0.0031 0.0082  0.0354  110  TYR A CG  
789  C CD1 . TYR A 109 ? 0.4739 0.3982 0.4890 -0.0036 0.0009  0.0356  110  TYR A CD1 
790  C CD2 . TYR A 109 ? 0.4121 0.3601 0.4460 -0.0083 0.0158  0.0400  110  TYR A CD2 
791  C CE1 . TYR A 109 ? 0.4722 0.3842 0.4829 -0.0102 0.0006  0.0417  110  TYR A CE1 
792  C CE2 . TYR A 109 ? 0.4095 0.3471 0.4392 -0.0148 0.0172  0.0453  110  TYR A CE2 
793  C CZ  . TYR A 109 ? 0.4350 0.3546 0.4528 -0.0163 0.0093  0.0467  110  TYR A CZ  
794  O OH  . TYR A 109 ? 0.3945 0.3032 0.4073 -0.0243 0.0106  0.0528  110  TYR A OH  
795  N N   . LYS A 110 ? 0.3359 0.3079 0.3653 0.0078  0.0052  0.0192  111  LYS A N   
796  C CA  . LYS A 110 ? 0.3869 0.3681 0.4129 0.0124  0.0066  0.0129  111  LYS A CA  
797  C C   . LYS A 110 ? 0.4099 0.3830 0.4247 0.0142  0.0024  0.0069  111  LYS A C   
798  O O   . LYS A 110 ? 0.3803 0.3558 0.3899 0.0212  0.0036  -0.0007 111  LYS A O   
799  C CB  . LYS A 110 ? 0.3731 0.3679 0.4078 0.0076  0.0093  0.0156  111  LYS A CB  
800  C CG  . LYS A 110 ? 0.3588 0.3643 0.3897 0.0100  0.0116  0.0102  111  LYS A CG  
801  C CD  . LYS A 110 ? 0.3532 0.3654 0.3856 0.0174  0.0153  0.0062  111  LYS A CD  
802  C CE  . LYS A 110 ? 0.3367 0.3605 0.3668 0.0201  0.0182  -0.0003 111  LYS A CE  
803  N NZ  . LYS A 110 ? 0.3339 0.3643 0.3680 0.0276  0.0203  -0.0044 111  LYS A NZ  
804  N N   . ILE A 111 ? 0.3883 0.3518 0.3999 0.0082  -0.0026 0.0095  112  ILE A N   
805  C CA  . ILE A 111 ? 0.4062 0.3595 0.4047 0.0096  -0.0069 0.0030  112  ILE A CA  
806  C C   . ILE A 111 ? 0.4559 0.3948 0.4473 0.0167  -0.0102 -0.0016 112  ILE A C   
807  O O   . ILE A 111 ? 0.5564 0.4916 0.5391 0.0231  -0.0109 -0.0107 112  ILE A O   
808  C CB  . ILE A 111 ? 0.3723 0.3172 0.3685 0.0004  -0.0131 0.0076  112  ILE A CB  
809  C CG1 . ILE A 111 ? 0.3648 0.3225 0.3688 -0.0062 -0.0117 0.0124  112  ILE A CG1 
810  C CG2 . ILE A 111 ? 0.3759 0.3082 0.3553 0.0012  -0.0178 0.0002  112  ILE A CG2 
811  C CD1 . ILE A 111 ? 0.3679 0.3185 0.3746 -0.0156 -0.0195 0.0187  112  ILE A CD1 
812  N N   . LYS A 112 ? 0.4067 0.3367 0.4013 0.0154  -0.0124 0.0044  113  LYS A N   
813  C CA  . LYS A 112 ? 0.3944 0.3079 0.3812 0.0212  -0.0175 0.0016  113  LYS A CA  
814  C C   . LYS A 112 ? 0.4047 0.3239 0.3918 0.0317  -0.0152 -0.0050 113  LYS A C   
815  O O   . LYS A 112 ? 0.4355 0.3445 0.4162 0.0395  -0.0197 -0.0125 113  LYS A O   
816  C CB  . LYS A 112 ? 0.4592 0.3630 0.4481 0.0155  -0.0193 0.0107  113  LYS A CB  
817  C CG  . LYS A 112 ? 0.5670 0.4620 0.5572 0.0055  -0.0235 0.0170  113  LYS A CG  
818  C CD  . LYS A 112 ? 0.5342 0.4071 0.5123 0.0062  -0.0328 0.0143  113  LYS A CD  
819  C CE  . LYS A 112 ? 0.5860 0.4440 0.5575 0.0095  -0.0363 0.0158  113  LYS A CE  
820  N NZ  . LYS A 112 ? 0.6221 0.4568 0.5818 0.0106  -0.0467 0.0125  113  LYS A NZ  
821  N N   . TYR A 113 ? 0.3918 0.3262 0.3872 0.0323  -0.0092 -0.0025 114  TYR A N   
822  C CA  . TYR A 113 ? 0.3749 0.3148 0.3727 0.0411  -0.0083 -0.0069 114  TYR A CA  
823  C C   . TYR A 113 ? 0.4152 0.3773 0.4215 0.0419  -0.0011 -0.0095 114  TYR A C   
824  O O   . TYR A 113 ? 0.3448 0.3159 0.3572 0.0415  0.0022  -0.0059 114  TYR A O   
825  C CB  . TYR A 113 ? 0.4084 0.3400 0.4050 0.0401  -0.0101 -0.0001 114  TYR A CB  
826  C CG  . TYR A 113 ? 0.4173 0.3276 0.4052 0.0354  -0.0162 0.0052  114  TYR A CG  
827  C CD1 . TYR A 113 ? 0.4664 0.3582 0.4458 0.0410  -0.0249 0.0009  114  TYR A CD1 
828  C CD2 . TYR A 113 ? 0.4373 0.3459 0.4268 0.0253  -0.0134 0.0141  114  TYR A CD2 
829  C CE1 . TYR A 113 ? 0.4493 0.3200 0.4199 0.0357  -0.0314 0.0064  114  TYR A CE1 
830  C CE2 . TYR A 113 ? 0.4825 0.3727 0.4650 0.0196  -0.0185 0.0194  114  TYR A CE2 
831  C CZ  . TYR A 113 ? 0.4752 0.3457 0.4472 0.0244  -0.0279 0.0160  114  TYR A CZ  
832  O OH  . TYR A 113 ? 0.4919 0.3431 0.4563 0.0176  -0.0337 0.0220  114  TYR A OH  
833  N N   . PRO A 114 ? 0.4395 0.4098 0.4449 0.0425  0.0015  -0.0159 115  PRO A N   
834  C CA  . PRO A 114 ? 0.3858 0.3766 0.3982 0.0408  0.0083  -0.0171 115  PRO A CA  
835  C C   . PRO A 114 ? 0.4438 0.4464 0.4642 0.0483  0.0105  -0.0214 115  PRO A C   
836  O O   . PRO A 114 ? 0.4583 0.4773 0.4855 0.0458  0.0155  -0.0204 115  PRO A O   
837  C CB  . PRO A 114 ? 0.3825 0.3759 0.3879 0.0394  0.0101  -0.0238 115  PRO A CB  
838  C CG  . PRO A 114 ? 0.4745 0.4521 0.4724 0.0463  0.0050  -0.0308 115  PRO A CG  
839  C CD  . PRO A 114 ? 0.4635 0.4239 0.4600 0.0449  -0.0017 -0.0232 115  PRO A CD  
840  N N   . GLU A 115 ? 0.4245 0.4190 0.4449 0.0572  0.0057  -0.0260 116  GLU A N   
841  C CA  . GLU A 115 ? 0.3868 0.3920 0.4167 0.0646  0.0058  -0.0299 116  GLU A CA  
842  C C   . GLU A 115 ? 0.3837 0.3808 0.4132 0.0646  0.0015  -0.0228 116  GLU A C   
843  O O   . GLU A 115 ? 0.3981 0.4023 0.4347 0.0698  -0.0001 -0.0247 116  GLU A O   
844  C CB  . GLU A 115 ? 0.3718 0.3746 0.4046 0.0756  0.0024  -0.0408 116  GLU A CB  
845  C CG  . GLU A 115 ? 0.5038 0.5132 0.5346 0.0763  0.0075  -0.0498 116  GLU A CG  
846  C CD  . GLU A 115 ? 0.6456 0.6788 0.6827 0.0716  0.0172  -0.0516 116  GLU A CD  
847  O OE1 . GLU A 115 ? 0.7100 0.7576 0.7583 0.0724  0.0190  -0.0499 116  GLU A OE1 
848  O OE2 . GLU A 115 ? 0.7301 0.7664 0.7596 0.0664  0.0222  -0.0544 116  GLU A OE2 
849  N N   . ASN A 116 ? 0.4001 0.3828 0.4214 0.0584  -0.0004 -0.0148 117  ASN A N   
850  C CA  . ASN A 116 ? 0.4409 0.4144 0.4582 0.0568  -0.0032 -0.0080 117  ASN A CA  
851  C C   . ASN A 116 ? 0.4294 0.4056 0.4463 0.0472  0.0026  0.0000  117  ASN A C   
852  O O   . ASN A 116 ? 0.4951 0.4632 0.5067 0.0444  0.0022  0.0055  117  ASN A O   
853  C CB  . ASN A 116 ? 0.3914 0.3416 0.3980 0.0588  -0.0115 -0.0064 117  ASN A CB  
854  C CG  . ASN A 116 ? 0.4958 0.4412 0.5045 0.0698  -0.0188 -0.0150 117  ASN A CG  
855  O OD1 . ASN A 116 ? 0.5144 0.4565 0.5244 0.0758  -0.0247 -0.0159 117  ASN A OD1 
856  N ND2 . ASN A 116 ? 0.3791 0.3250 0.3891 0.0729  -0.0184 -0.0221 117  ASN A ND2 
857  N N   . PHE A 117 ? 0.3611 0.3476 0.3831 0.0420  0.0077  0.0006  118  PHE A N   
858  C CA  . PHE A 117 ? 0.3920 0.3810 0.4170 0.0336  0.0122  0.0075  118  PHE A CA  
859  C C   . PHE A 117 ? 0.4070 0.4131 0.4407 0.0310  0.0166  0.0065  118  PHE A C   
860  O O   . PHE A 117 ? 0.3385 0.3497 0.3723 0.0312  0.0164  0.0026  118  PHE A O   
861  C CB  . PHE A 117 ? 0.3894 0.3668 0.4110 0.0280  0.0104  0.0113  118  PHE A CB  
862  C CG  . PHE A 117 ? 0.4514 0.4293 0.4780 0.0204  0.0145  0.0183  118  PHE A CG  
863  C CD1 . PHE A 117 ? 0.4404 0.4085 0.4617 0.0182  0.0155  0.0225  118  PHE A CD1 
864  C CD2 . PHE A 117 ? 0.3455 0.3336 0.3822 0.0151  0.0173  0.0204  118  PHE A CD2 
865  C CE1 . PHE A 117 ? 0.3879 0.3586 0.4156 0.0113  0.0211  0.0277  118  PHE A CE1 
866  C CE2 . PHE A 117 ? 0.3272 0.3174 0.3723 0.0092  0.0211  0.0257  118  PHE A CE2 
867  C CZ  . PHE A 117 ? 0.3835 0.3662 0.4250 0.0074  0.0240  0.0288  118  PHE A CZ  
868  N N   . PHE A 118 ? 0.3479 0.3617 0.3875 0.0281  0.0203  0.0098  119  PHE A N   
869  C CA  . PHE A 118 ? 0.3718 0.4004 0.4190 0.0259  0.0230  0.0090  119  PHE A CA  
870  C C   . PHE A 118 ? 0.3237 0.3549 0.3780 0.0201  0.0259  0.0144  119  PHE A C   
871  O O   . PHE A 118 ? 0.2908 0.3173 0.3450 0.0198  0.0279  0.0168  119  PHE A O   
872  C CB  . PHE A 118 ? 0.2557 0.2937 0.3050 0.0310  0.0232  0.0049  119  PHE A CB  
873  C CG  . PHE A 118 ? 0.2629 0.3020 0.3100 0.0376  0.0209  -0.0019 119  PHE A CG  
874  C CD1 . PHE A 118 ? 0.2924 0.3415 0.3412 0.0369  0.0230  -0.0063 119  PHE A CD1 
875  C CD2 . PHE A 118 ? 0.3663 0.3953 0.4090 0.0441  0.0164  -0.0040 119  PHE A CD2 
876  C CE1 . PHE A 118 ? 0.3897 0.4409 0.4381 0.0436  0.0221  -0.0141 119  PHE A CE1 
877  C CE2 . PHE A 118 ? 0.3983 0.4279 0.4416 0.0514  0.0135  -0.0112 119  PHE A CE2 
878  C CZ  . PHE A 118 ? 0.4029 0.4446 0.4501 0.0516  0.0171  -0.0170 119  PHE A CZ  
879  N N   . LEU A 119 ? 0.2938 0.3317 0.3536 0.0153  0.0258  0.0159  120  LEU A N   
880  C CA  . LEU A 119 ? 0.3291 0.3702 0.3988 0.0103  0.0270  0.0204  120  LEU A CA  
881  C C   . LEU A 119 ? 0.3443 0.3960 0.4180 0.0086  0.0269  0.0200  120  LEU A C   
882  O O   . LEU A 119 ? 0.3326 0.3889 0.4025 0.0068  0.0254  0.0185  120  LEU A O   
883  C CB  . LEU A 119 ? 0.3110 0.3478 0.3847 0.0050  0.0241  0.0240  120  LEU A CB  
884  C CG  . LEU A 119 ? 0.3507 0.3765 0.4199 0.0051  0.0230  0.0247  120  LEU A CG  
885  C CD1 . LEU A 119 ? 0.3452 0.3672 0.4179 -0.0007 0.0183  0.0279  120  LEU A CD1 
886  C CD2 . LEU A 119 ? 0.3033 0.3257 0.3763 0.0054  0.0273  0.0267  120  LEU A CD2 
887  N N   . LEU A 120 ? 0.3626 0.4173 0.4428 0.0085  0.0287  0.0211  121  LEU A N   
888  C CA  . LEU A 120 ? 0.3494 0.4121 0.4348 0.0055  0.0275  0.0220  121  LEU A CA  
889  C C   . LEU A 120 ? 0.3761 0.4371 0.4717 0.0005  0.0250  0.0265  121  LEU A C   
890  O O   . LEU A 120 ? 0.3682 0.4243 0.4703 0.0005  0.0259  0.0280  121  LEU A O   
891  C CB  . LEU A 120 ? 0.3000 0.3654 0.3864 0.0084  0.0293  0.0202  121  LEU A CB  
892  C CG  . LEU A 120 ? 0.3011 0.3692 0.3807 0.0134  0.0297  0.0161  121  LEU A CG  
893  C CD1 . LEU A 120 ? 0.3302 0.4019 0.4125 0.0137  0.0294  0.0154  121  LEU A CD1 
894  C CD2 . LEU A 120 ? 0.2422 0.3179 0.3191 0.0131  0.0289  0.0136  121  LEU A CD2 
895  N N   . ARG A 121 ? 0.3193 0.3847 0.4171 -0.0042 0.0214  0.0286  122  ARG A N   
896  C CA  . ARG A 121 ? 0.2914 0.3544 0.3997 -0.0089 0.0166  0.0331  122  ARG A CA  
897  C C   . ARG A 121 ? 0.2770 0.3401 0.3964 -0.0067 0.0178  0.0327  122  ARG A C   
898  O O   . ARG A 121 ? 0.2997 0.3659 0.4163 -0.0055 0.0190  0.0308  122  ARG A O   
899  C CB  . ARG A 121 ? 0.3264 0.3917 0.4296 -0.0158 0.0112  0.0362  122  ARG A CB  
900  C CG  . ARG A 121 ? 0.4104 0.4709 0.5234 -0.0212 0.0034  0.0417  122  ARG A CG  
901  C CD  . ARG A 121 ? 0.4256 0.4857 0.5283 -0.0297 -0.0026 0.0457  122  ARG A CD  
902  N NE  . ARG A 121 ? 0.4002 0.4524 0.5099 -0.0351 -0.0124 0.0516  122  ARG A NE  
903  C CZ  . ARG A 121 ? 0.4019 0.4497 0.5014 -0.0441 -0.0198 0.0565  122  ARG A CZ  
904  N NH1 . ARG A 121 ? 0.3425 0.3947 0.4243 -0.0488 -0.0165 0.0556  122  ARG A NH1 
905  N NH2 . ARG A 121 ? 0.3636 0.4029 0.4707 -0.0485 -0.0306 0.0623  122  ARG A NH2 
906  N N   . GLY A 122 ? 0.2785 0.3381 0.4110 -0.0061 0.0177  0.0338  123  GLY A N   
907  C CA  . GLY A 122 ? 0.3150 0.3742 0.4601 -0.0042 0.0184  0.0326  123  GLY A CA  
908  C C   . GLY A 122 ? 0.3147 0.3721 0.4726 -0.0084 0.0096  0.0368  123  GLY A C   
909  O O   . GLY A 122 ? 0.2698 0.3256 0.4266 -0.0133 0.0030  0.0412  123  GLY A O   
910  N N   . ASN A 123 ? 0.3112 0.3672 0.4808 -0.0064 0.0087  0.0352  124  ASN A N   
911  C CA  . ASN A 123 ? 0.2725 0.3248 0.4550 -0.0101 -0.0017 0.0394  124  ASN A CA  
912  C C   . ASN A 123 ? 0.3030 0.3543 0.5022 -0.0107 -0.0058 0.0419  124  ASN A C   
913  O O   . ASN A 123 ? 0.2968 0.3438 0.5050 -0.0147 -0.0170 0.0467  124  ASN A O   
914  C CB  . ASN A 123 ? 0.2815 0.3310 0.4743 -0.0069 -0.0025 0.0363  124  ASN A CB  
915  C CG  . ASN A 123 ? 0.3071 0.3579 0.5127 0.0001  0.0065  0.0297  124  ASN A CG  
916  O OD1 . ASN A 123 ? 0.3268 0.3804 0.5239 0.0028  0.0165  0.0262  124  ASN A OD1 
917  N ND2 . ASN A 123 ? 0.2931 0.3411 0.5187 0.0027  0.0030  0.0277  124  ASN A ND2 
918  N N   . HIS A 124 ? 0.2558 0.3103 0.4592 -0.0077 0.0018  0.0394  125  HIS A N   
919  C CA  . HIS A 124 ? 0.2384 0.2930 0.4588 -0.0092 -0.0027 0.0421  125  HIS A CA  
920  C C   . HIS A 124 ? 0.2717 0.3237 0.4787 -0.0147 -0.0081 0.0469  125  HIS A C   
921  O O   . HIS A 124 ? 0.3036 0.3542 0.5229 -0.0175 -0.0150 0.0504  125  HIS A O   
922  C CB  . HIS A 124 ? 0.2130 0.2728 0.4471 -0.0045 0.0082  0.0373  125  HIS A CB  
923  C CG  . HIS A 124 ? 0.3571 0.4193 0.6127 0.0003  0.0111  0.0326  125  HIS A CG  
924  N ND1 . HIS A 124 ? 0.3402 0.4058 0.6250 0.0015  0.0077  0.0324  125  HIS A ND1 
925  C CD2 . HIS A 124 ? 0.3673 0.4283 0.6200 0.0044  0.0160  0.0274  125  HIS A CD2 
926  C CE1 . HIS A 124 ? 0.3752 0.4421 0.6747 0.0069  0.0116  0.0264  125  HIS A CE1 
927  N NE2 . HIS A 124 ? 0.3181 0.3813 0.5972 0.0084  0.0165  0.0234  125  HIS A NE2 
928  N N   . GLU A 125 ? 0.2924 0.3438 0.4755 -0.0163 -0.0055 0.0466  126  GLU A N   
929  C CA  . GLU A 125 ? 0.3378 0.3857 0.5061 -0.0217 -0.0107 0.0500  126  GLU A CA  
930  C C   . GLU A 125 ? 0.3455 0.3889 0.5080 -0.0285 -0.0216 0.0552  126  GLU A C   
931  O O   . GLU A 125 ? 0.2960 0.3394 0.4391 -0.0322 -0.0215 0.0556  126  GLU A O   
932  C CB  . GLU A 125 ? 0.2680 0.3176 0.4153 -0.0197 -0.0028 0.0463  126  GLU A CB  
933  C CG  . GLU A 125 ? 0.2714 0.3211 0.4204 -0.0156 0.0045  0.0435  126  GLU A CG  
934  C CD  . GLU A 125 ? 0.3309 0.3840 0.4913 -0.0104 0.0126  0.0400  126  GLU A CD  
935  O OE1 . GLU A 125 ? 0.3754 0.4305 0.5293 -0.0074 0.0167  0.0370  126  GLU A OE1 
936  O OE2 . GLU A 125 ? 0.3980 0.4520 0.5739 -0.0097 0.0150  0.0401  126  GLU A OE2 
937  N N   . CYS A 126 ? 0.3584 0.3982 0.5394 -0.0304 -0.0313 0.0591  127  CYS A N   
938  C CA  . CYS A 126 ? 0.3939 0.4273 0.5727 -0.0368 -0.0433 0.0647  127  CYS A CA  
939  C C   . CYS A 126 ? 0.3544 0.3819 0.5534 -0.0390 -0.0562 0.0695  127  CYS A C   
940  O O   . CYS A 126 ? 0.3267 0.3582 0.5515 -0.0331 -0.0546 0.0669  127  CYS A O   
941  C CB  . CYS A 126 ? 0.4453 0.4804 0.6291 -0.0339 -0.0412 0.0626  127  CYS A CB  
942  S SG  . CYS A 126 ? 0.4417 0.4665 0.6327 -0.0401 -0.0578 0.0696  127  CYS A SG  
943  N N   . ALA A 127 ? 0.3381 0.3564 0.5256 -0.0479 -0.0690 0.0763  128  ALA A N   
944  C CA  . ALA A 127 ? 0.3508 0.3626 0.5567 -0.0506 -0.0834 0.0815  128  ALA A CA  
945  C C   . ALA A 127 ? 0.3897 0.3987 0.6213 -0.0480 -0.0928 0.0832  128  ALA A C   
946  O O   . ALA A 127 ? 0.4387 0.4465 0.6964 -0.0465 -0.1023 0.0851  128  ALA A O   
947  C CB  . ALA A 127 ? 0.4002 0.3999 0.5832 -0.0618 -0.0962 0.0887  128  ALA A CB  
948  N N   . SER A 128 ? 0.3603 0.3683 0.5868 -0.0474 -0.0913 0.0824  129  SER A N   
949  C CA  . SER A 128 ? 0.4361 0.4404 0.6877 -0.0436 -0.0998 0.0827  129  SER A CA  
950  C C   . SER A 128 ? 0.4505 0.4660 0.7297 -0.0319 -0.0879 0.0737  129  SER A C   
951  O O   . SER A 128 ? 0.4975 0.5124 0.8071 -0.0271 -0.0949 0.0726  129  SER A O   
952  C CB  . SER A 128 ? 0.4579 0.4563 0.6944 -0.0473 -0.1022 0.0846  129  SER A CB  
953  O OG  . SER A 128 ? 0.5646 0.5539 0.7730 -0.0594 -0.1107 0.0925  129  SER A OG  
954  N N   . ILE A 129 ? 0.4229 0.4479 0.6920 -0.0273 -0.0702 0.0671  130  ILE A N   
955  C CA  . ILE A 129 ? 0.3859 0.4204 0.6760 -0.0176 -0.0576 0.0586  130  ILE A CA  
956  C C   . ILE A 129 ? 0.3555 0.3975 0.6633 -0.0156 -0.0535 0.0571  130  ILE A C   
957  O O   . ILE A 129 ? 0.3649 0.4124 0.7036 -0.0100 -0.0524 0.0533  130  ILE A O   
958  C CB  . ILE A 129 ? 0.3231 0.3625 0.5934 -0.0143 -0.0419 0.0527  130  ILE A CB  
959  C CG1 . ILE A 129 ? 0.3276 0.3609 0.5886 -0.0155 -0.0460 0.0531  130  ILE A CG1 
960  C CG2 . ILE A 129 ? 0.2260 0.2743 0.5119 -0.0061 -0.0272 0.0442  130  ILE A CG2 
961  C CD1 . ILE A 129 ? 0.3477 0.3763 0.6344 -0.0112 -0.0539 0.0513  130  ILE A CD1 
962  N N   . ASN A 130 ? 0.2751 0.3176 0.5649 -0.0201 -0.0511 0.0598  131  ASN A N   
963  C CA  . ASN A 130 ? 0.3173 0.3662 0.6236 -0.0192 -0.0477 0.0589  131  ASN A CA  
964  C C   . ASN A 130 ? 0.3213 0.3661 0.6480 -0.0233 -0.0648 0.0651  131  ASN A C   
965  O O   . ASN A 130 ? 0.2998 0.3500 0.6436 -0.0235 -0.0643 0.0652  131  ASN A O   
966  C CB  . ASN A 130 ? 0.3006 0.3505 0.5819 -0.0216 -0.0387 0.0586  131  ASN A CB  
967  C CG  . ASN A 130 ? 0.3672 0.4076 0.6238 -0.0296 -0.0490 0.0647  131  ASN A CG  
968  O OD1 . ASN A 130 ? 0.4053 0.4395 0.6686 -0.0349 -0.0634 0.0705  131  ASN A OD1 
969  N ND2 . ASN A 130 ? 0.3372 0.3764 0.5647 -0.0304 -0.0415 0.0630  131  ASN A ND2 
970  N N   . ARG A 131 ? 0.3463 0.3808 0.6724 -0.0270 -0.0808 0.0705  132  ARG A N   
971  C CA  . ARG A 131 ? 0.3708 0.4011 0.7230 -0.0292 -0.0986 0.0757  132  ARG A CA  
972  C C   . ARG A 131 ? 0.3653 0.4064 0.7606 -0.0203 -0.0953 0.0696  132  ARG A C   
973  O O   . ARG A 131 ? 0.3918 0.4368 0.8165 -0.0202 -0.1036 0.0712  132  ARG A O   
974  C CB  . ARG A 131 ? 0.3676 0.3825 0.7082 -0.0356 -0.1173 0.0833  132  ARG A CB  
975  C CG  . ARG A 131 ? 0.3556 0.3638 0.7259 -0.0367 -0.1384 0.0887  132  ARG A CG  
976  C CD  . ARG A 131 ? 0.3701 0.3774 0.7458 -0.0421 -0.1476 0.0935  132  ARG A CD  
977  N NE  . ARG A 131 ? 0.4460 0.4477 0.8540 -0.0425 -0.1689 0.0984  132  ARG A NE  
978  C CZ  . ARG A 131 ? 0.4667 0.4806 0.9206 -0.0342 -0.1685 0.0934  132  ARG A CZ  
979  N NH1 . ARG A 131 ? 0.4532 0.4849 0.9233 -0.0257 -0.1468 0.0837  132  ARG A NH1 
980  N NH2 . ARG A 131 ? 0.4503 0.4585 0.9343 -0.0345 -0.1899 0.0982  132  ARG A NH2 
981  N N   . ILE A 132 ? 0.4175 0.4637 0.8180 -0.0128 -0.0832 0.0620  133  ILE A N   
982  C CA  . ILE A 132 ? 0.4134 0.4680 0.8541 -0.0040 -0.0808 0.0551  133  ILE A CA  
983  C C   . ILE A 132 ? 0.3913 0.4609 0.8403 0.0026  -0.0577 0.0451  133  ILE A C   
984  O O   . ILE A 132 ? 0.3926 0.4726 0.8776 0.0094  -0.0528 0.0384  133  ILE A O   
985  C CB  . ILE A 132 ? 0.4814 0.5266 0.9263 -0.0005 -0.0895 0.0540  133  ILE A CB  
986  C CG1 . ILE A 132 ? 0.5348 0.5774 0.9481 0.0003  -0.0767 0.0503  133  ILE A CG1 
987  C CG2 . ILE A 132 ? 0.5528 0.5816 0.9902 -0.0084 -0.1139 0.0650  133  ILE A CG2 
988  C CD1 . ILE A 132 ? 0.6336 0.6651 1.0472 0.0023  -0.0858 0.0499  133  ILE A CD1 
989  N N   . TYR A 133 ? 0.3274 0.3984 0.7451 0.0007  -0.0433 0.0437  134  TYR A N   
990  C CA  . TYR A 133 ? 0.3145 0.3966 0.7349 0.0059  -0.0220 0.0348  134  TYR A CA  
991  C C   . TYR A 133 ? 0.3018 0.3924 0.7232 0.0024  -0.0132 0.0356  134  TYR A C   
992  O O   . TYR A 133 ? 0.3302 0.4274 0.7442 0.0042  0.0044  0.0301  134  TYR A O   
993  C CB  . TYR A 133 ? 0.3026 0.3793 0.6895 0.0071  -0.0124 0.0317  134  TYR A CB  
994  C CG  . TYR A 133 ? 0.3689 0.4402 0.7617 0.0122  -0.0158 0.0275  134  TYR A CG  
995  C CD1 . TYR A 133 ? 0.4457 0.5234 0.8619 0.0201  -0.0059 0.0177  134  TYR A CD1 
996  C CD2 . TYR A 133 ? 0.4028 0.4620 0.7778 0.0086  -0.0289 0.0331  134  TYR A CD2 
997  C CE1 . TYR A 133 ? 0.4851 0.5559 0.9066 0.0251  -0.0100 0.0132  134  TYR A CE1 
998  C CE2 . TYR A 133 ? 0.5452 0.5978 0.9256 0.0126  -0.0335 0.0298  134  TYR A CE2 
999  C CZ  . TYR A 133 ? 0.5655 0.6232 0.9693 0.0212  -0.0245 0.0197  134  TYR A CZ  
1000 O OH  . TYR A 133 ? 0.5909 0.6400 0.9993 0.0254  -0.0298 0.0158  134  TYR A OH  
1001 N N   . GLY A 134 ? 0.3070 0.3964 0.7365 -0.0032 -0.0257 0.0427  135  GLY A N   
1002 C CA  . GLY A 134 ? 0.3004 0.3985 0.7385 -0.0065 -0.0186 0.0433  135  GLY A CA  
1003 C C   . GLY A 134 ? 0.3523 0.4419 0.7668 -0.0147 -0.0272 0.0512  135  GLY A C   
1004 O O   . GLY A 134 ? 0.3783 0.4717 0.8103 -0.0188 -0.0329 0.0546  135  GLY A O   
1005 N N   . PHE A 135 ? 0.2725 0.3509 0.6486 -0.0171 -0.0286 0.0536  136  PHE A N   
1006 C CA  . PHE A 135 ? 0.3390 0.4097 0.6905 -0.0238 -0.0333 0.0588  136  PHE A CA  
1007 C C   . PHE A 135 ? 0.3481 0.4115 0.7075 -0.0299 -0.0533 0.0661  136  PHE A C   
1008 O O   . PHE A 135 ? 0.3381 0.3991 0.6952 -0.0353 -0.0579 0.0696  136  PHE A O   
1009 C CB  . PHE A 135 ? 0.3321 0.3942 0.6439 -0.0243 -0.0297 0.0585  136  PHE A CB  
1010 C CG  . PHE A 135 ? 0.3446 0.3995 0.6309 -0.0295 -0.0310 0.0613  136  PHE A CG  
1011 C CD1 . PHE A 135 ? 0.3211 0.3795 0.6095 -0.0302 -0.0225 0.0600  136  PHE A CD1 
1012 C CD2 . PHE A 135 ? 0.3396 0.3837 0.5992 -0.0339 -0.0403 0.0648  136  PHE A CD2 
1013 C CE1 . PHE A 135 ? 0.2849 0.3348 0.5499 -0.0344 -0.0245 0.0619  136  PHE A CE1 
1014 C CE2 . PHE A 135 ? 0.3460 0.3830 0.5823 -0.0377 -0.0409 0.0657  136  PHE A CE2 
1015 C CZ  . PHE A 135 ? 0.3303 0.3695 0.5699 -0.0375 -0.0337 0.0642  136  PHE A CZ  
1016 N N   . TYR A 136 ? 0.3897 0.4478 0.7567 -0.0298 -0.0666 0.0689  137  TYR A N   
1017 C CA  . TYR A 136 ? 0.3542 0.4037 0.7290 -0.0361 -0.0875 0.0765  137  TYR A CA  
1018 C C   . TYR A 136 ? 0.3862 0.4454 0.7998 -0.0361 -0.0912 0.0769  137  TYR A C   
1019 O O   . TYR A 136 ? 0.3880 0.4419 0.8005 -0.0429 -0.1024 0.0823  137  TYR A O   
1020 C CB  . TYR A 136 ? 0.4173 0.4588 0.7967 -0.0357 -0.1013 0.0794  137  TYR A CB  
1021 C CG  . TYR A 136 ? 0.4703 0.5031 0.8655 -0.0414 -0.1247 0.0872  137  TYR A CG  
1022 C CD1 . TYR A 136 ? 0.4427 0.4836 0.8836 -0.0374 -0.1323 0.0866  137  TYR A CD1 
1023 C CD2 . TYR A 136 ? 0.5318 0.5478 0.8962 -0.0509 -0.1396 0.0950  137  TYR A CD2 
1024 C CE1 . TYR A 136 ? 0.4400 0.4722 0.8967 -0.0424 -0.1557 0.0940  137  TYR A CE1 
1025 C CE2 . TYR A 136 ? 0.5380 0.5436 0.9142 -0.0569 -0.1627 0.1027  137  TYR A CE2 
1026 C CZ  . TYR A 136 ? 0.4908 0.5042 0.9138 -0.0524 -0.1715 0.1025  137  TYR A CZ  
1027 O OH  . TYR A 136 ? 0.5477 0.5504 0.9848 -0.0581 -0.1963 0.1104  137  TYR A OH  
1028 N N   . ASP A 137 ? 0.3741 0.4480 0.8224 -0.0289 -0.0816 0.0707  138  ASP A N   
1029 C CA  . ASP A 137 ? 0.3715 0.4585 0.8613 -0.0286 -0.0825 0.0700  138  ASP A CA  
1030 C C   . ASP A 137 ? 0.3588 0.4499 0.8390 -0.0337 -0.0730 0.0706  138  ASP A C   
1031 O O   . ASP A 137 ? 0.3693 0.4620 0.8671 -0.0392 -0.0831 0.0750  138  ASP A O   
1032 C CB  . ASP A 137 ? 0.4212 0.5243 0.9468 -0.0194 -0.0698 0.0612  138  ASP A CB  
1033 C CG  . ASP A 137 ? 0.4784 0.5771 1.0240 -0.0143 -0.0836 0.0610  138  ASP A CG  
1034 O OD1 . ASP A 137 ? 0.4729 0.5620 1.0268 -0.0184 -0.1061 0.0684  138  ASP A OD1 
1035 O OD2 . ASP A 137 ? 0.4856 0.5885 1.0370 -0.0065 -0.0730 0.0535  138  ASP A OD2 
1036 N N   . GLU A 138 ? 0.3400 0.4317 0.7926 -0.0324 -0.0549 0.0665  139  GLU A N   
1037 C CA  . GLU A 138 ? 0.3286 0.4217 0.7703 -0.0374 -0.0466 0.0673  139  GLU A CA  
1038 C C   . GLU A 138 ? 0.3459 0.4239 0.7650 -0.0454 -0.0627 0.0746  139  GLU A C   
1039 O O   . GLU A 138 ? 0.4019 0.4813 0.8338 -0.0512 -0.0682 0.0780  139  GLU A O   
1040 C CB  . GLU A 138 ? 0.3753 0.4682 0.7879 -0.0344 -0.0271 0.0622  139  GLU A CB  
1041 C CG  . GLU A 138 ? 0.4019 0.4987 0.8108 -0.0387 -0.0155 0.0620  139  GLU A CG  
1042 C CD  . GLU A 138 ? 0.4749 0.5710 0.8577 -0.0357 0.0030  0.0571  139  GLU A CD  
1043 O OE1 . GLU A 138 ? 0.4838 0.5851 0.8683 -0.0294 0.0130  0.0514  139  GLU A OE1 
1044 O OE2 . GLU A 138 ? 0.4738 0.5624 0.8330 -0.0398 0.0062  0.0590  139  GLU A OE2 
1045 N N   . CYS A 139 ? 0.3346 0.3980 0.7207 -0.0464 -0.0707 0.0768  140  CYS A N   
1046 C CA  . CYS A 139 ? 0.3644 0.4123 0.7264 -0.0541 -0.0856 0.0827  140  CYS A CA  
1047 C C   . CYS A 139 ? 0.4178 0.4641 0.8074 -0.0594 -0.1052 0.0887  140  CYS A C   
1048 O O   . CYS A 139 ? 0.4099 0.4509 0.7978 -0.0660 -0.1131 0.0923  140  CYS A O   
1049 C CB  . CYS A 139 ? 0.3635 0.3982 0.6896 -0.0546 -0.0902 0.0836  140  CYS A CB  
1050 S SG  . CYS A 139 ? 0.4167 0.4505 0.7056 -0.0503 -0.0708 0.0774  140  CYS A SG  
1051 N N   . LYS A 140 ? 0.4353 0.4853 0.8514 -0.0565 -0.1147 0.0899  141  LYS A N   
1052 C CA  . LYS A 140 ? 0.4420 0.4899 0.8866 -0.0610 -0.1358 0.0959  141  LYS A CA  
1053 C C   . LYS A 140 ? 0.4850 0.5476 0.9662 -0.0623 -0.1324 0.0952  141  LYS A C   
1054 O O   . LYS A 140 ? 0.4961 0.5533 0.9855 -0.0696 -0.1481 0.1009  141  LYS A O   
1055 C CB  . LYS A 140 ? 0.4309 0.4810 0.9016 -0.0560 -0.1454 0.0962  141  LYS A CB  
1056 C CG  . LYS A 140 ? 0.4801 0.5243 0.9770 -0.0606 -0.1712 0.1033  141  LYS A CG  
1057 C CD  . LYS A 140 ? 0.5680 0.6102 1.0849 -0.0554 -0.1822 0.1038  141  LYS A CD  
1058 C CE  . LYS A 140 ? 0.6504 0.6770 1.1753 -0.0617 -0.2119 0.1130  141  LYS A CE  
1059 N NZ  . LYS A 140 ? 0.6932 0.7240 1.2493 -0.0598 -0.2158 0.1131  141  LYS A NZ  
1060 N N   . ARG A 141 ? 0.4542 0.5353 0.9564 -0.0562 -0.1117 0.0883  142  ARG A N   
1061 C CA  . ARG A 141 ? 0.4364 0.5346 0.9773 -0.0579 -0.1061 0.0872  142  ARG A CA  
1062 C C   . ARG A 141 ? 0.4840 0.5757 1.0033 -0.0663 -0.1044 0.0903  142  ARG A C   
1063 O O   . ARG A 141 ? 0.4826 0.5762 1.0231 -0.0730 -0.1158 0.0949  142  ARG A O   
1064 C CB  . ARG A 141 ? 0.4592 0.5773 1.0220 -0.0501 -0.0825 0.0784  142  ARG A CB  
1065 C CG  . ARG A 141 ? 0.5826 0.7220 1.1890 -0.0519 -0.0736 0.0762  142  ARG A CG  
1066 C CD  . ARG A 141 ? 0.6521 0.8083 1.2682 -0.0456 -0.0470 0.0669  142  ARG A CD  
1067 N NE  . ARG A 141 ? 0.7829 0.9391 1.4002 -0.0358 -0.0440 0.0611  142  ARG A NE  
1068 C CZ  . ARG A 141 ? 0.8590 1.0066 1.4394 -0.0317 -0.0328 0.0576  142  ARG A CZ  
1069 N NH1 . ARG A 141 ? 0.8410 0.9881 1.4255 -0.0235 -0.0319 0.0526  142  ARG A NH1 
1070 N NH2 . ARG A 141 ? 0.8845 1.0232 1.4249 -0.0359 -0.0236 0.0589  142  ARG A NH2 
1071 N N   . ARG A 142 ? 0.5049 0.5883 0.9830 -0.0660 -0.0912 0.0880  143  ARG A N   
1072 C CA  . ARG A 142 ? 0.4235 0.4995 0.8798 -0.0727 -0.0880 0.0899  143  ARG A CA  
1073 C C   . ARG A 142 ? 0.4109 0.4642 0.8321 -0.0790 -0.1055 0.0950  143  ARG A C   
1074 O O   . ARG A 142 ? 0.3970 0.4426 0.8084 -0.0858 -0.1095 0.0976  143  ARG A O   
1075 C CB  . ARG A 142 ? 0.3617 0.4389 0.7921 -0.0688 -0.0660 0.0845  143  ARG A CB  
1076 C CG  . ARG A 142 ? 0.4272 0.5250 0.8861 -0.0635 -0.0468 0.0788  143  ARG A CG  
1077 C CD  . ARG A 142 ? 0.5381 0.6339 0.9668 -0.0599 -0.0272 0.0739  143  ARG A CD  
1078 N NE  . ARG A 142 ? 0.6047 0.6934 1.0140 -0.0664 -0.0224 0.0761  143  ARG A NE  
1079 C CZ  . ARG A 142 ? 0.5880 0.6738 0.9732 -0.0651 -0.0070 0.0732  143  ARG A CZ  
1080 N NH1 . ARG A 142 ? 0.4603 0.5504 0.8373 -0.0578 0.0055  0.0677  143  ARG A NH1 
1081 N NH2 . ARG A 142 ? 0.6400 0.7170 1.0086 -0.0715 -0.0056 0.0761  143  ARG A NH2 
1082 N N   . TYR A 143 ? 0.4219 0.4635 0.8225 -0.0774 -0.1157 0.0961  144  TYR A N   
1083 C CA  . TYR A 143 ? 0.4262 0.4462 0.7926 -0.0841 -0.1319 0.1003  144  TYR A CA  
1084 C C   . TYR A 143 ? 0.5314 0.5440 0.9028 -0.0860 -0.1515 0.1051  144  TYR A C   
1085 O O   . TYR A 143 ? 0.5576 0.5742 0.9631 -0.0889 -0.1662 0.1095  144  TYR A O   
1086 C CB  . TYR A 143 ? 0.4348 0.4438 0.7543 -0.0818 -0.1210 0.0962  144  TYR A CB  
1087 C CG  . TYR A 143 ? 0.5075 0.5189 0.8186 -0.0811 -0.1060 0.0927  144  TYR A CG  
1088 C CD1 . TYR A 143 ? 0.5063 0.5052 0.8029 -0.0879 -0.1129 0.0947  144  TYR A CD1 
1089 C CD2 . TYR A 143 ? 0.4877 0.5120 0.8048 -0.0743 -0.0862 0.0877  144  TYR A CD2 
1090 C CE1 . TYR A 143 ? 0.4763 0.4752 0.7651 -0.0879 -0.1009 0.0923  144  TYR A CE1 
1091 C CE2 . TYR A 143 ? 0.4910 0.5155 0.7992 -0.0748 -0.0741 0.0856  144  TYR A CE2 
1092 C CZ  . TYR A 143 ? 0.4897 0.5013 0.7841 -0.0815 -0.0817 0.0881  144  TYR A CZ  
1093 O OH  . TYR A 143 ? 0.5287 0.5382 0.8131 -0.0824 -0.0709 0.0866  144  TYR A OH  
1094 N N   . ASN A 144 ? 0.5267 0.5283 0.8656 -0.0848 -0.1525 0.1046  145  ASN A N   
1095 C CA  . ASN A 144 ? 0.4956 0.4873 0.8344 -0.0881 -0.1716 0.1101  145  ASN A CA  
1096 C C   . ASN A 144 ? 0.5013 0.4901 0.8156 -0.0840 -0.1642 0.1077  145  ASN A C   
1097 O O   . ASN A 144 ? 0.4641 0.4589 0.7625 -0.0785 -0.1451 0.1016  145  ASN A O   
1098 C CB  . ASN A 144 ? 0.4922 0.4630 0.8064 -0.0989 -0.1918 0.1161  145  ASN A CB  
1099 C CG  . ASN A 144 ? 0.5180 0.4759 0.7843 -0.1017 -0.1838 0.1126  145  ASN A CG  
1100 O OD1 . ASN A 144 ? 0.5359 0.4932 0.7752 -0.0978 -0.1707 0.1082  145  ASN A OD1 
1101 N ND2 . ASN A 144 ? 0.5419 0.4894 0.7987 -0.1084 -0.1919 0.1142  145  ASN A ND2 
1102 N N   . ILE A 145 ? 0.5002 0.4790 0.8122 -0.0875 -0.1808 0.1131  146  ILE A N   
1103 C CA  . ILE A 145 ? 0.5217 0.4970 0.8128 -0.0853 -0.1764 0.1122  146  ILE A CA  
1104 C C   . ILE A 145 ? 0.5024 0.4660 0.7430 -0.0899 -0.1700 0.1105  146  ILE A C   
1105 O O   . ILE A 145 ? 0.5414 0.5089 0.7643 -0.0858 -0.1560 0.1062  146  ILE A O   
1106 C CB  . ILE A 145 ? 0.5736 0.5389 0.8752 -0.0894 -0.1982 0.1195  146  ILE A CB  
1107 C CG1 . ILE A 145 ? 0.6900 0.6689 1.0465 -0.0830 -0.2037 0.1195  146  ILE A CG1 
1108 C CG2 . ILE A 145 ? 0.5140 0.4742 0.7921 -0.0889 -0.1945 0.1195  146  ILE A CG2 
1109 C CD1 . ILE A 145 ? 0.7069 0.7062 1.0864 -0.0716 -0.1813 0.1109  146  ILE A CD1 
1110 N N   . LYS A 146 ? 0.4837 0.4328 0.7010 -0.0982 -0.1803 0.1133  147  LYS A N   
1111 C CA  . LYS A 146 ? 0.5843 0.5217 0.7537 -0.1027 -0.1748 0.1108  147  LYS A CA  
1112 C C   . LYS A 146 ? 0.5717 0.5201 0.7319 -0.0947 -0.1516 0.1020  147  LYS A C   
1113 O O   . LYS A 146 ? 0.5745 0.5215 0.7055 -0.0939 -0.1414 0.0980  147  LYS A O   
1114 C CB  . LYS A 146 ? 0.7044 0.6237 0.8522 -0.1126 -0.1898 0.1142  147  LYS A CB  
1115 C CG  . LYS A 146 ? 0.8322 0.7417 0.9349 -0.1153 -0.1806 0.1086  147  LYS A CG  
1116 C CD  . LYS A 146 ? 0.9149 0.8029 0.9925 -0.1263 -0.1979 0.1122  147  LYS A CD  
1117 C CE  . LYS A 146 ? 0.9148 0.8026 1.0206 -0.1274 -0.2087 0.1150  147  LYS A CE  
1118 N NZ  . LYS A 146 ? 0.9901 0.8580 1.0648 -0.1357 -0.2182 0.1144  147  LYS A NZ  
1119 N N   . LEU A 147 ? 0.5369 0.4965 0.7225 -0.0892 -0.1434 0.0991  148  LEU A N   
1120 C CA  . LEU A 147 ? 0.5005 0.4693 0.6791 -0.0817 -0.1230 0.0916  148  LEU A CA  
1121 C C   . LEU A 147 ? 0.4894 0.4701 0.6734 -0.0744 -0.1103 0.0883  148  LEU A C   
1122 O O   . LEU A 147 ? 0.4795 0.4622 0.6418 -0.0704 -0.0971 0.0829  148  LEU A O   
1123 C CB  . LEU A 147 ? 0.4773 0.4545 0.6823 -0.0791 -0.1180 0.0905  148  LEU A CB  
1124 C CG  . LEU A 147 ? 0.4568 0.4383 0.6501 -0.0736 -0.1004 0.0840  148  LEU A CG  
1125 C CD1 . LEU A 147 ? 0.4321 0.3982 0.5861 -0.0766 -0.1016 0.0811  148  LEU A CD1 
1126 C CD2 . LEU A 147 ? 0.3891 0.3786 0.6099 -0.0732 -0.0963 0.0845  148  LEU A CD2 
1127 N N   . TRP A 148 ? 0.4242 0.4123 0.6378 -0.0723 -0.1149 0.0912  149  TRP A N   
1128 C CA  . TRP A 148 ? 0.4406 0.4377 0.6590 -0.0660 -0.1051 0.0883  149  TRP A CA  
1129 C C   . TRP A 148 ? 0.4438 0.4324 0.6286 -0.0697 -0.1064 0.0889  149  TRP A C   
1130 O O   . TRP A 148 ? 0.4672 0.4621 0.6419 -0.0651 -0.0937 0.0845  149  TRP A O   
1131 C CB  . TRP A 148 ? 0.4002 0.4038 0.6562 -0.0635 -0.1129 0.0910  149  TRP A CB  
1132 C CG  . TRP A 148 ? 0.4156 0.4256 0.6770 -0.0576 -0.1055 0.0882  149  TRP A CG  
1133 C CD1 . TRP A 148 ? 0.4122 0.4343 0.6817 -0.0494 -0.0881 0.0815  149  TRP A CD1 
1134 C CD2 . TRP A 148 ? 0.3945 0.3974 0.6527 -0.0601 -0.1165 0.0923  149  TRP A CD2 
1135 N NE1 . TRP A 148 ? 0.3608 0.3839 0.6327 -0.0462 -0.0874 0.0806  149  TRP A NE1 
1136 C CE2 . TRP A 148 ? 0.3953 0.4068 0.6611 -0.0527 -0.1048 0.0874  149  TRP A CE2 
1137 C CE3 . TRP A 148 ? 0.4456 0.4339 0.6937 -0.0687 -0.1360 0.1001  149  TRP A CE3 
1138 C CZ2 . TRP A 148 ? 0.3869 0.3933 0.6516 -0.0535 -0.1118 0.0898  149  TRP A CZ2 
1139 C CZ3 . TRP A 148 ? 0.4299 0.4129 0.6763 -0.0700 -0.1430 0.1032  149  TRP A CZ3 
1140 C CH2 . TRP A 148 ? 0.4284 0.4206 0.6837 -0.0623 -0.1310 0.0980  149  TRP A CH2 
1141 N N   . LYS A 149 ? 0.4785 0.4528 0.6449 -0.0790 -0.1216 0.0945  150  LYS A N   
1142 C CA  . LYS A 149 ? 0.5532 0.5197 0.6856 -0.0845 -0.1218 0.0953  150  LYS A CA  
1143 C C   . LYS A 149 ? 0.5722 0.5393 0.6747 -0.0832 -0.1078 0.0884  150  LYS A C   
1144 O O   . LYS A 149 ? 0.5681 0.5373 0.6499 -0.0836 -0.0998 0.0858  150  LYS A O   
1145 C CB  . LYS A 149 ? 0.5727 0.5219 0.6906 -0.0961 -0.1421 0.1033  150  LYS A CB  
1146 C CG  . LYS A 149 ? 0.6140 0.5605 0.7596 -0.0976 -0.1585 0.1106  150  LYS A CG  
1147 C CD  . LYS A 149 ? 0.6687 0.5952 0.7960 -0.1101 -0.1803 0.1192  150  LYS A CD  
1148 C CE  . LYS A 149 ? 0.7338 0.6553 0.8883 -0.1117 -0.1993 0.1270  150  LYS A CE  
1149 N NZ  . LYS A 149 ? 0.7633 0.6632 0.8981 -0.1247 -0.2223 0.1360  150  LYS A NZ  
1150 N N   . THR A 150 ? 0.5417 0.5069 0.6427 -0.0817 -0.1054 0.0853  151  THR A N   
1151 C CA  . THR A 150 ? 0.4896 0.4548 0.5658 -0.0788 -0.0927 0.0779  151  THR A CA  
1152 C C   . THR A 150 ? 0.4474 0.4271 0.5328 -0.0688 -0.0758 0.0720  151  THR A C   
1153 O O   . THR A 150 ? 0.4501 0.4327 0.5156 -0.0662 -0.0656 0.0665  151  THR A O   
1154 C CB  . THR A 150 ? 0.5414 0.4987 0.6155 -0.0798 -0.0962 0.0765  151  THR A CB  
1155 O OG1 . THR A 150 ? 0.5805 0.5224 0.6418 -0.0898 -0.1129 0.0817  151  THR A OG1 
1156 C CG2 . THR A 150 ? 0.5310 0.4871 0.5814 -0.0754 -0.0840 0.0681  151  THR A CG2 
1157 N N   . PHE A 151 ? 0.3865 0.3756 0.5021 -0.0632 -0.0728 0.0727  152  PHE A N   
1158 C CA  . PHE A 151 ? 0.4402 0.4414 0.5635 -0.0546 -0.0581 0.0677  152  PHE A CA  
1159 C C   . PHE A 151 ? 0.4875 0.4927 0.6027 -0.0545 -0.0554 0.0675  152  PHE A C   
1160 O O   . PHE A 151 ? 0.3713 0.3829 0.4766 -0.0497 -0.0440 0.0623  152  PHE A O   
1161 C CB  . PHE A 151 ? 0.4301 0.4398 0.5864 -0.0501 -0.0556 0.0685  152  PHE A CB  
1162 C CG  . PHE A 151 ? 0.4325 0.4430 0.5949 -0.0480 -0.0501 0.0664  152  PHE A CG  
1163 C CD1 . PHE A 151 ? 0.4099 0.4229 0.5607 -0.0425 -0.0375 0.0610  152  PHE A CD1 
1164 C CD2 . PHE A 151 ? 0.4134 0.4217 0.5941 -0.0520 -0.0585 0.0704  152  PHE A CD2 
1165 C CE1 . PHE A 151 ? 0.4040 0.4156 0.5584 -0.0416 -0.0333 0.0600  152  PHE A CE1 
1166 C CE2 . PHE A 151 ? 0.3954 0.4042 0.5818 -0.0514 -0.0535 0.0691  152  PHE A CE2 
1167 C CZ  . PHE A 151 ? 0.4007 0.4103 0.5726 -0.0464 -0.0408 0.0641  152  PHE A CZ  
1168 N N   . THR A 152 ? 0.4151 0.4162 0.5356 -0.0602 -0.0669 0.0735  153  THR A N   
1169 C CA  . THR A 152 ? 0.3876 0.3908 0.5004 -0.0620 -0.0662 0.0745  153  THR A CA  
1170 C C   . THR A 152 ? 0.3706 0.3723 0.4514 -0.0657 -0.0605 0.0715  153  THR A C   
1171 O O   . THR A 152 ? 0.3943 0.4043 0.4693 -0.0625 -0.0506 0.0677  153  THR A O   
1172 C CB  . THR A 152 ? 0.4278 0.4226 0.5488 -0.0691 -0.0827 0.0826  153  THR A CB  
1173 O OG1 . THR A 152 ? 0.4896 0.4886 0.6451 -0.0640 -0.0866 0.0838  153  THR A OG1 
1174 C CG2 . THR A 152 ? 0.3868 0.3811 0.4962 -0.0731 -0.0836 0.0849  153  THR A CG2 
1175 N N   . ASP A 153 ? 0.4782 0.4696 0.5383 -0.0725 -0.0666 0.0726  154  ASP A N   
1176 C CA  . ASP A 153 ? 0.5377 0.5284 0.5677 -0.0757 -0.0595 0.0680  154  ASP A CA  
1177 C C   . ASP A 153 ? 0.4908 0.4921 0.5207 -0.0658 -0.0442 0.0591  154  ASP A C   
1178 O O   . ASP A 153 ? 0.4934 0.5021 0.5108 -0.0650 -0.0351 0.0546  154  ASP A O   
1179 C CB  . ASP A 153 ? 0.6126 0.5891 0.6213 -0.0832 -0.0678 0.0688  154  ASP A CB  
1180 C CG  . ASP A 153 ? 0.7621 0.7352 0.7373 -0.0909 -0.0641 0.0663  154  ASP A CG  
1181 O OD1 . ASP A 153 ? 0.7882 0.7716 0.7593 -0.0907 -0.0553 0.0644  154  ASP A OD1 
1182 O OD2 . ASP A 153 ? 0.7026 0.6629 0.6556 -0.0977 -0.0699 0.0660  154  ASP A OD2 
1183 N N   . CYS A 154 ? 0.4590 0.4614 0.5041 -0.0586 -0.0416 0.0568  155  CYS A N   
1184 C CA  . CYS A 154 ? 0.4330 0.4427 0.4783 -0.0494 -0.0293 0.0494  155  CYS A CA  
1185 C C   . CYS A 154 ? 0.4189 0.4404 0.4783 -0.0437 -0.0219 0.0485  155  CYS A C   
1186 O O   . CYS A 154 ? 0.4395 0.4685 0.4912 -0.0397 -0.0132 0.0433  155  CYS A O   
1187 C CB  . CYS A 154 ? 0.4925 0.4973 0.5474 -0.0455 -0.0301 0.0486  155  CYS A CB  
1188 S SG  . CYS A 154 ? 0.4705 0.4809 0.5267 -0.0348 -0.0176 0.0414  155  CYS A SG  
1189 N N   . PHE A 155 ? 0.4110 0.4343 0.4916 -0.0433 -0.0258 0.0531  156  PHE A N   
1190 C CA  . PHE A 155 ? 0.3939 0.4262 0.4859 -0.0385 -0.0197 0.0519  156  PHE A CA  
1191 C C   . PHE A 155 ? 0.4150 0.4514 0.4947 -0.0424 -0.0187 0.0520  156  PHE A C   
1192 O O   . PHE A 155 ? 0.3795 0.4240 0.4610 -0.0380 -0.0115 0.0487  156  PHE A O   
1193 C CB  . PHE A 155 ? 0.3808 0.4133 0.4972 -0.0381 -0.0249 0.0561  156  PHE A CB  
1194 C CG  . PHE A 155 ? 0.4074 0.4403 0.5403 -0.0337 -0.0224 0.0551  156  PHE A CG  
1195 C CD1 . PHE A 155 ? 0.3821 0.4147 0.5070 -0.0300 -0.0152 0.0510  156  PHE A CD1 
1196 C CD2 . PHE A 155 ? 0.3264 0.3600 0.4839 -0.0338 -0.0275 0.0582  156  PHE A CD2 
1197 C CE1 . PHE A 155 ? 0.3934 0.4260 0.5323 -0.0277 -0.0126 0.0509  156  PHE A CE1 
1198 C CE2 . PHE A 155 ? 0.3064 0.3425 0.4804 -0.0309 -0.0237 0.0572  156  PHE A CE2 
1199 C CZ  . PHE A 155 ? 0.3445 0.3799 0.5081 -0.0285 -0.0160 0.0539  156  PHE A CZ  
1200 N N   . ASN A 156 ? 0.3604 0.3907 0.4269 -0.0515 -0.0264 0.0562  157  ASN A N   
1201 C CA  . ASN A 156 ? 0.3344 0.3686 0.3889 -0.0572 -0.0253 0.0573  157  ASN A CA  
1202 C C   . ASN A 156 ? 0.4032 0.4461 0.4427 -0.0547 -0.0140 0.0500  157  ASN A C   
1203 O O   . ASN A 156 ? 0.3787 0.4287 0.4116 -0.0586 -0.0105 0.0498  157  ASN A O   
1204 C CB  . ASN A 156 ? 0.3463 0.3702 0.3870 -0.0692 -0.0364 0.0641  157  ASN A CB  
1205 C CG  . ASN A 156 ? 0.4417 0.4581 0.4994 -0.0724 -0.0494 0.0720  157  ASN A CG  
1206 O OD1 . ASN A 156 ? 0.4897 0.4949 0.5389 -0.0817 -0.0615 0.0786  157  ASN A OD1 
1207 N ND2 . ASN A 156 ? 0.3446 0.3663 0.4260 -0.0646 -0.0475 0.0710  157  ASN A ND2 
1208 N N   . CYS A 157 ? 0.3359 0.3788 0.3717 -0.0484 -0.0086 0.0440  158  CYS A N   
1209 C CA  . CYS A 157 ? 0.3844 0.4352 0.4087 -0.0446 0.0012  0.0360  158  CYS A CA  
1210 C C   . CYS A 157 ? 0.3194 0.3775 0.3557 -0.0336 0.0083  0.0308  158  CYS A C   
1211 O O   . CYS A 157 ? 0.3112 0.3759 0.3418 -0.0287 0.0153  0.0237  158  CYS A O   
1212 C CB  . CYS A 157 ? 0.4155 0.4583 0.4233 -0.0457 0.0009  0.0320  158  CYS A CB  
1213 S SG  . CYS A 157 ? 0.4832 0.5155 0.4699 -0.0599 -0.0074 0.0373  158  CYS A SG  
1214 N N   . LEU A 158 ? 0.2813 0.3383 0.3339 -0.0298 0.0065  0.0338  159  LEU A N   
1215 C CA  . LEU A 158 ? 0.3273 0.3887 0.3879 -0.0206 0.0125  0.0296  159  LEU A CA  
1216 C C   . LEU A 158 ? 0.2906 0.3636 0.3511 -0.0191 0.0175  0.0265  159  LEU A C   
1217 O O   . LEU A 158 ? 0.2870 0.3642 0.3478 -0.0253 0.0157  0.0298  159  LEU A O   
1218 C CB  . LEU A 158 ? 0.3443 0.4023 0.4207 -0.0183 0.0106  0.0331  159  LEU A CB  
1219 C CG  . LEU A 158 ? 0.3567 0.4060 0.4376 -0.0175 0.0080  0.0347  159  LEU A CG  
1220 C CD1 . LEU A 158 ? 0.2344 0.2826 0.3336 -0.0176 0.0060  0.0386  159  LEU A CD1 
1221 C CD2 . LEU A 158 ? 0.2672 0.3140 0.3422 -0.0109 0.0130  0.0298  159  LEU A CD2 
1222 N N   . PRO A 159 ? 0.3123 0.3900 0.3727 -0.0115 0.0227  0.0206  160  PRO A N   
1223 C CA  . PRO A 159 ? 0.2650 0.3539 0.3297 -0.0095 0.0261  0.0182  160  PRO A CA  
1224 C C   . PRO A 159 ? 0.2805 0.3676 0.3555 -0.0091 0.0241  0.0220  160  PRO A C   
1225 O O   . PRO A 159 ? 0.3190 0.3977 0.3993 -0.0080 0.0220  0.0247  160  PRO A O   
1226 C CB  . PRO A 159 ? 0.2623 0.3532 0.3260 -0.0004 0.0297  0.0113  160  PRO A CB  
1227 C CG  . PRO A 159 ? 0.2652 0.3428 0.3266 0.0029  0.0276  0.0121  160  PRO A CG  
1228 C CD  . PRO A 159 ? 0.2705 0.3420 0.3277 -0.0045 0.0241  0.0164  160  PRO A CD  
1229 N N   . ILE A 160 ? 0.2816 0.3771 0.3603 -0.0102 0.0249  0.0217  161  ILE A N   
1230 C CA  . ILE A 160 ? 0.3589 0.4518 0.4459 -0.0111 0.0222  0.0249  161  ILE A CA  
1231 C C   . ILE A 160 ? 0.3228 0.4189 0.4131 -0.0051 0.0242  0.0214  161  ILE A C   
1232 O O   . ILE A 160 ? 0.2962 0.3879 0.3916 -0.0046 0.0226  0.0227  161  ILE A O   
1233 C CB  . ILE A 160 ? 0.3459 0.4415 0.4337 -0.0202 0.0183  0.0297  161  ILE A CB  
1234 C CG1 . ILE A 160 ? 0.3785 0.4871 0.4637 -0.0232 0.0212  0.0274  161  ILE A CG1 
1235 C CG2 . ILE A 160 ? 0.2694 0.3591 0.3517 -0.0269 0.0145  0.0340  161  ILE A CG2 
1236 C CD1 . ILE A 160 ? 0.4575 0.5688 0.5398 -0.0345 0.0179  0.0328  161  ILE A CD1 
1237 N N   . ALA A 161 ? 0.2526 0.3553 0.3402 -0.0006 0.0269  0.0165  162  ALA A N   
1238 C CA  . ALA A 161 ? 0.3156 0.4199 0.4058 0.0047  0.0267  0.0136  162  ALA A CA  
1239 C C   . ALA A 161 ? 0.3244 0.4315 0.4120 0.0116  0.0282  0.0084  162  ALA A C   
1240 O O   . ALA A 161 ? 0.3384 0.4488 0.4233 0.0118  0.0302  0.0061  162  ALA A O   
1241 C CB  . ALA A 161 ? 0.3437 0.4578 0.4392 0.0003  0.0251  0.0143  162  ALA A CB  
1242 N N   . ALA A 162 ? 0.3101 0.4141 0.3978 0.0173  0.0264  0.0063  163  ALA A N   
1243 C CA  . ALA A 162 ? 0.2847 0.3890 0.3711 0.0246  0.0255  0.0015  163  ALA A CA  
1244 C C   . ALA A 162 ? 0.2938 0.4008 0.3838 0.0280  0.0216  -0.0003 163  ALA A C   
1245 O O   . ALA A 162 ? 0.3606 0.4622 0.4489 0.0259  0.0197  0.0023  163  ALA A O   
1246 C CB  . ALA A 162 ? 0.2270 0.3159 0.3048 0.0283  0.0252  0.0021  163  ALA A CB  
1247 N N   . ILE A 163 ? 0.2393 0.3543 0.3349 0.0335  0.0198  -0.0052 164  ILE A N   
1248 C CA  . ILE A 163 ? 0.2918 0.4083 0.3917 0.0376  0.0138  -0.0071 164  ILE A CA  
1249 C C   . ILE A 163 ? 0.3462 0.4532 0.4424 0.0462  0.0094  -0.0101 164  ILE A C   
1250 O O   . ILE A 163 ? 0.3167 0.4285 0.4170 0.0504  0.0109  -0.0145 164  ILE A O   
1251 C CB  . ILE A 163 ? 0.3217 0.4591 0.4368 0.0359  0.0140  -0.0101 164  ILE A CB  
1252 C CG1 . ILE A 163 ? 0.2751 0.4192 0.3919 0.0261  0.0172  -0.0059 164  ILE A CG1 
1253 C CG2 . ILE A 163 ? 0.3555 0.4940 0.4767 0.0404  0.0061  -0.0118 164  ILE A CG2 
1254 C CD1 . ILE A 163 ? 0.3241 0.4889 0.4552 0.0222  0.0179  -0.0077 164  ILE A CD1 
1255 N N   . VAL A 164 ? 0.3214 0.4133 0.4082 0.0484  0.0035  -0.0080 165  VAL A N   
1256 C CA  . VAL A 164 ? 0.3957 0.4744 0.4760 0.0554  -0.0028 -0.0094 165  VAL A CA  
1257 C C   . VAL A 164 ? 0.3880 0.4725 0.4778 0.0605  -0.0118 -0.0125 165  VAL A C   
1258 O O   . VAL A 164 ? 0.3038 0.3855 0.3909 0.0581  -0.0164 -0.0104 165  VAL A O   
1259 C CB  . VAL A 164 ? 0.4150 0.4716 0.4762 0.0532  -0.0037 -0.0045 165  VAL A CB  
1260 C CG1 . VAL A 164 ? 0.3623 0.4033 0.4148 0.0591  -0.0105 -0.0049 165  VAL A CG1 
1261 C CG2 . VAL A 164 ? 0.3671 0.4212 0.4237 0.0474  0.0051  -0.0013 165  VAL A CG2 
1262 N N   . ASP A 165 ? 0.3611 0.4530 0.4627 0.0679  -0.0149 -0.0181 166  ASP A N   
1263 C CA  . ASP A 165 ? 0.3648 0.4633 0.4799 0.0744  -0.0247 -0.0219 166  ASP A CA  
1264 C C   . ASP A 165 ? 0.3881 0.5037 0.5160 0.0699  -0.0250 -0.0218 166  ASP A C   
1265 O O   . ASP A 165 ? 0.3947 0.5081 0.5260 0.0716  -0.0352 -0.0213 166  ASP A O   
1266 C CB  . ASP A 165 ? 0.4270 0.5016 0.5273 0.0782  -0.0365 -0.0189 166  ASP A CB  
1267 C CG  . ASP A 165 ? 0.5196 0.5787 0.6117 0.0837  -0.0388 -0.0199 166  ASP A CG  
1268 O OD1 . ASP A 165 ? 0.5350 0.6040 0.6418 0.0907  -0.0386 -0.0264 166  ASP A OD1 
1269 O OD2 . ASP A 165 ? 0.6038 0.6408 0.6744 0.0807  -0.0402 -0.0144 166  ASP A OD2 
1270 N N   . GLU A 166 ? 0.3856 0.5168 0.5195 0.0631  -0.0149 -0.0216 167  GLU A N   
1271 C CA  . GLU A 166 ? 0.4160 0.5642 0.5623 0.0571  -0.0143 -0.0210 167  GLU A CA  
1272 C C   . GLU A 166 ? 0.3706 0.5054 0.5060 0.0532  -0.0216 -0.0160 167  GLU A C   
1273 O O   . GLU A 166 ? 0.4171 0.5622 0.5633 0.0503  -0.0261 -0.0160 167  GLU A O   
1274 C CB  . GLU A 166 ? 0.5301 0.7007 0.7018 0.0619  -0.0174 -0.0274 167  GLU A CB  
1275 C CG  . GLU A 166 ? 0.5824 0.7646 0.7649 0.0681  -0.0111 -0.0346 167  GLU A CG  
1276 C CD  . GLU A 166 ? 0.6532 0.8620 0.8644 0.0720  -0.0114 -0.0420 167  GLU A CD  
1277 O OE1 . GLU A 166 ? 0.6948 0.9252 0.9168 0.0668  -0.0005 -0.0450 167  GLU A OE1 
1278 O OE2 . GLU A 166 ? 0.6826 0.8908 0.9058 0.0797  -0.0228 -0.0447 167  GLU A OE2 
1279 N N   . LYS A 167 ? 0.3921 0.5037 0.5058 0.0526  -0.0225 -0.0121 168  LYS A N   
1280 C CA  . LYS A 167 ? 0.4079 0.5044 0.5080 0.0495  -0.0289 -0.0087 168  LYS A CA  
1281 C C   . LYS A 167 ? 0.3444 0.4278 0.4276 0.0435  -0.0216 -0.0048 168  LYS A C   
1282 O O   . LYS A 167 ? 0.3944 0.4707 0.4700 0.0391  -0.0237 -0.0031 168  LYS A O   
1283 C CB  . LYS A 167 ? 0.3662 0.4447 0.4551 0.0554  -0.0400 -0.0085 168  LYS A CB  
1284 C CG  . LYS A 167 ? 0.3738 0.4625 0.4801 0.0605  -0.0517 -0.0117 168  LYS A CG  
1285 C CD  . LYS A 167 ? 0.4395 0.5400 0.5559 0.0549  -0.0548 -0.0113 168  LYS A CD  
1286 C CE  . LYS A 167 ? 0.4256 0.5407 0.5649 0.0597  -0.0659 -0.0148 168  LYS A CE  
1287 N NZ  . LYS A 167 ? 0.5488 0.6783 0.7007 0.0530  -0.0679 -0.0142 168  LYS A NZ  
1288 N N   . ILE A 168 ? 0.3207 0.4003 0.3986 0.0435  -0.0136 -0.0040 169  ILE A N   
1289 C CA  . ILE A 168 ? 0.3529 0.4213 0.4184 0.0387  -0.0067 -0.0008 169  ILE A CA  
1290 C C   . ILE A 168 ? 0.3307 0.4123 0.4067 0.0348  0.0012  -0.0003 169  ILE A C   
1291 O O   . ILE A 168 ? 0.3210 0.4079 0.4012 0.0367  0.0047  -0.0013 169  ILE A O   
1292 C CB  . ILE A 168 ? 0.3179 0.3679 0.3668 0.0407  -0.0051 0.0008  169  ILE A CB  
1293 C CG1 . ILE A 168 ? 0.3191 0.3550 0.3561 0.0445  -0.0147 0.0007  169  ILE A CG1 
1294 C CG2 . ILE A 168 ? 0.2743 0.3138 0.3122 0.0357  0.0017  0.0031  169  ILE A CG2 
1295 C CD1 . ILE A 168 ? 0.3570 0.3735 0.3758 0.0449  -0.0132 0.0032  169  ILE A CD1 
1296 N N   . PHE A 169 ? 0.3595 0.4446 0.4385 0.0290  0.0030  0.0014  170  PHE A N   
1297 C CA  . PHE A 169 ? 0.3424 0.4359 0.4284 0.0240  0.0089  0.0032  170  PHE A CA  
1298 C C   . PHE A 169 ? 0.3335 0.4142 0.4112 0.0227  0.0138  0.0054  170  PHE A C   
1299 O O   . PHE A 169 ? 0.3147 0.3844 0.3855 0.0218  0.0138  0.0058  170  PHE A O   
1300 C CB  . PHE A 169 ? 0.3421 0.4439 0.4359 0.0179  0.0069  0.0045  170  PHE A CB  
1301 C CG  . PHE A 169 ? 0.3201 0.4293 0.4198 0.0117  0.0111  0.0072  170  PHE A CG  
1302 C CD1 . PHE A 169 ? 0.3275 0.4277 0.4247 0.0078  0.0121  0.0101  170  PHE A CD1 
1303 C CD2 . PHE A 169 ? 0.2895 0.4142 0.3969 0.0095  0.0136  0.0066  170  PHE A CD2 
1304 C CE1 . PHE A 169 ? 0.2647 0.3697 0.3666 0.0018  0.0137  0.0134  170  PHE A CE1 
1305 C CE2 . PHE A 169 ? 0.2134 0.3427 0.3226 0.0026  0.0165  0.0098  170  PHE A CE2 
1306 C CZ  . PHE A 169 ? 0.2355 0.3543 0.3418 -0.0015 0.0156  0.0137  170  PHE A CZ  
1307 N N   . CYS A 170 ? 0.3408 0.4233 0.4201 0.0224  0.0180  0.0064  171  CYS A N   
1308 C CA  . CYS A 170 ? 0.3223 0.3946 0.3972 0.0212  0.0223  0.0086  171  CYS A CA  
1309 C C   . CYS A 170 ? 0.3306 0.4091 0.4137 0.0159  0.0241  0.0112  171  CYS A C   
1310 O O   . CYS A 170 ? 0.3002 0.3886 0.3874 0.0141  0.0240  0.0113  171  CYS A O   
1311 C CB  . CYS A 170 ? 0.3644 0.4298 0.4328 0.0248  0.0240  0.0083  171  CYS A CB  
1312 S SG  . CYS A 170 ? 0.3959 0.4516 0.4530 0.0306  0.0195  0.0062  171  CYS A SG  
1313 N N   . CYS A 171 ? 0.2908 0.3630 0.3761 0.0136  0.0257  0.0130  172  CYS A N   
1314 C CA  . CYS A 171 ? 0.3435 0.4181 0.4365 0.0088  0.0256  0.0162  172  CYS A CA  
1315 C C   . CYS A 171 ? 0.3651 0.4306 0.4614 0.0093  0.0282  0.0165  172  CYS A C   
1316 O O   . CYS A 171 ? 0.4092 0.4679 0.5006 0.0122  0.0308  0.0140  172  CYS A O   
1317 C CB  . CYS A 171 ? 0.3332 0.4150 0.4317 0.0036  0.0216  0.0179  172  CYS A CB  
1318 S SG  . CYS A 171 ? 0.4004 0.4758 0.5003 0.0035  0.0190  0.0166  172  CYS A SG  
1319 N N   . HIS A 172 ? 0.3068 0.3725 0.4117 0.0061  0.0274  0.0195  173  HIS A N   
1320 C CA  . HIS A 172 ? 0.3273 0.3869 0.4398 0.0071  0.0303  0.0191  173  HIS A CA  
1321 C C   . HIS A 172 ? 0.3171 0.3731 0.4342 0.0076  0.0295  0.0168  173  HIS A C   
1322 O O   . HIS A 172 ? 0.2910 0.3413 0.4064 0.0107  0.0347  0.0131  173  HIS A O   
1323 C CB  . HIS A 172 ? 0.2914 0.3521 0.4146 0.0038  0.0276  0.0229  173  HIS A CB  
1324 C CG  . HIS A 172 ? 0.2841 0.3410 0.4199 0.0053  0.0305  0.0220  173  HIS A CG  
1325 N ND1 . HIS A 172 ? 0.2579 0.3127 0.3934 0.0074  0.0372  0.0205  173  HIS A ND1 
1326 C CD2 . HIS A 172 ? 0.2159 0.2712 0.3662 0.0050  0.0279  0.0218  173  HIS A CD2 
1327 C CE1 . HIS A 172 ? 0.2603 0.3145 0.4110 0.0082  0.0398  0.0191  173  HIS A CE1 
1328 N NE2 . HIS A 172 ? 0.2942 0.3485 0.4548 0.0074  0.0339  0.0195  173  HIS A NE2 
1329 N N   . GLY A 173 ? 0.2243 0.2825 0.3460 0.0040  0.0232  0.0189  174  GLY A N   
1330 C CA  . GLY A 173 ? 0.2545 0.3075 0.3818 0.0041  0.0208  0.0170  174  GLY A CA  
1331 C C   . GLY A 173 ? 0.3229 0.3746 0.4405 0.0047  0.0196  0.0142  174  GLY A C   
1332 O O   . GLY A 173 ? 0.3498 0.3955 0.4603 0.0086  0.0239  0.0095  174  GLY A O   
1333 N N   . GLY A 174 ? 0.3002 0.3574 0.4165 0.0002  0.0137  0.0171  175  GLY A N   
1334 C CA  . GLY A 174 ? 0.3116 0.3688 0.4211 0.0000  0.0112  0.0149  175  GLY A CA  
1335 C C   . GLY A 174 ? 0.3560 0.4216 0.4677 -0.0067 0.0051  0.0187  175  GLY A C   
1336 O O   . GLY A 174 ? 0.4113 0.4852 0.5251 -0.0107 0.0049  0.0225  175  GLY A O   
1337 N N   . LEU A 175 ? 0.3523 0.4155 0.4628 -0.0086 0.0004  0.0176  176  LEU A N   
1338 C CA  . LEU A 175 ? 0.3835 0.4562 0.4963 -0.0157 -0.0047 0.0210  176  LEU A CA  
1339 C C   . LEU A 175 ? 0.4111 0.4817 0.5301 -0.0235 -0.0101 0.0265  176  LEU A C   
1340 O O   . LEU A 175 ? 0.3971 0.4573 0.5203 -0.0223 -0.0118 0.0270  176  LEU A O   
1341 C CB  . LEU A 175 ? 0.4037 0.4742 0.5133 -0.0156 -0.0089 0.0182  176  LEU A CB  
1342 C CG  . LEU A 175 ? 0.3286 0.4000 0.4305 -0.0087 -0.0056 0.0137  176  LEU A CG  
1343 C CD1 . LEU A 175 ? 0.2794 0.3466 0.3769 -0.0089 -0.0116 0.0111  176  LEU A CD1 
1344 C CD2 . LEU A 175 ? 0.3044 0.3910 0.4090 -0.0082 -0.0022 0.0148  176  LEU A CD2 
1345 N N   . SER A 176 ? 0.3874 0.4680 0.5076 -0.0319 -0.0132 0.0307  177  SER A N   
1346 C CA  . SER A 176 ? 0.3854 0.4648 0.5080 -0.0418 -0.0189 0.0375  177  SER A CA  
1347 C C   . SER A 176 ? 0.3634 0.4472 0.4871 -0.0507 -0.0246 0.0403  177  SER A C   
1348 O O   . SER A 176 ? 0.3710 0.4683 0.4952 -0.0514 -0.0218 0.0385  177  SER A O   
1349 C CB  . SER A 176 ? 0.3744 0.4637 0.4942 -0.0460 -0.0147 0.0410  177  SER A CB  
1350 O OG  . SER A 176 ? 0.3536 0.4404 0.4723 -0.0571 -0.0207 0.0483  177  SER A OG  
1351 N N   . PRO A 177 ? 0.3496 0.4225 0.4751 -0.0577 -0.0333 0.0449  178  PRO A N   
1352 C CA  . PRO A 177 ? 0.3138 0.3918 0.4399 -0.0690 -0.0390 0.0494  178  PRO A CA  
1353 C C   . PRO A 177 ? 0.3020 0.3979 0.4260 -0.0785 -0.0343 0.0540  178  PRO A C   
1354 O O   . PRO A 177 ? 0.3169 0.4252 0.4434 -0.0860 -0.0344 0.0553  178  PRO A O   
1355 C CB  . PRO A 177 ? 0.3202 0.3796 0.4473 -0.0747 -0.0501 0.0544  178  PRO A CB  
1356 C CG  . PRO A 177 ? 0.3722 0.4174 0.5023 -0.0632 -0.0497 0.0494  178  PRO A CG  
1357 C CD  . PRO A 177 ? 0.3816 0.4370 0.5100 -0.0560 -0.0392 0.0464  178  PRO A CD  
1358 N N   . ASP A 178 ? 0.3367 0.4349 0.4564 -0.0785 -0.0296 0.0557  179  ASP A N   
1359 C CA  . ASP A 178 ? 0.3960 0.5100 0.5109 -0.0873 -0.0236 0.0589  179  ASP A CA  
1360 C C   . ASP A 178 ? 0.4084 0.5411 0.5257 -0.0802 -0.0128 0.0520  179  ASP A C   
1361 O O   . ASP A 178 ? 0.4356 0.5823 0.5494 -0.0857 -0.0060 0.0525  179  ASP A O   
1362 C CB  . ASP A 178 ? 0.4043 0.5095 0.5113 -0.0907 -0.0248 0.0637  179  ASP A CB  
1363 C CG  . ASP A 178 ? 0.5356 0.6259 0.6389 -0.1026 -0.0364 0.0728  179  ASP A CG  
1364 O OD1 . ASP A 178 ? 0.5972 0.6866 0.7026 -0.1104 -0.0420 0.0760  179  ASP A OD1 
1365 O OD2 . ASP A 178 ? 0.5896 0.6682 0.6882 -0.1045 -0.0411 0.0772  179  ASP A OD2 
1366 N N   . LEU A 179 ? 0.3517 0.4840 0.4740 -0.0685 -0.0114 0.0453  180  LEU A N   
1367 C CA  . LEU A 179 ? 0.3299 0.4769 0.4549 -0.0607 -0.0032 0.0388  180  LEU A CA  
1368 C C   . LEU A 179 ? 0.3336 0.4955 0.4678 -0.0629 -0.0038 0.0367  180  LEU A C   
1369 O O   . LEU A 179 ? 0.3515 0.5082 0.4892 -0.0574 -0.0085 0.0338  180  LEU A O   
1370 C CB  . LEU A 179 ? 0.3661 0.5026 0.4893 -0.0471 -0.0019 0.0336  180  LEU A CB  
1371 C CG  . LEU A 179 ? 0.3757 0.5238 0.5006 -0.0385 0.0047  0.0274  180  LEU A CG  
1372 C CD1 . LEU A 179 ? 0.2824 0.4446 0.4062 -0.0422 0.0118  0.0271  180  LEU A CD1 
1373 C CD2 . LEU A 179 ? 0.4296 0.5646 0.5496 -0.0274 0.0058  0.0238  180  LEU A CD2 
1374 N N   . GLN A 180 ? 0.2861 0.4671 0.4242 -0.0715 0.0013  0.0378  181  GLN A N   
1375 C CA  . GLN A 180 ? 0.3330 0.5327 0.4837 -0.0745 0.0018  0.0355  181  GLN A CA  
1376 C C   . GLN A 180 ? 0.4000 0.6178 0.5591 -0.0657 0.0097  0.0278  181  GLN A C   
1377 O O   . GLN A 180 ? 0.4344 0.6628 0.6063 -0.0617 0.0075  0.0238  181  GLN A O   
1378 C CB  . GLN A 180 ? 0.4259 0.6372 0.5779 -0.0912 0.0030  0.0417  181  GLN A CB  
1379 C CG  . GLN A 180 ? 0.4391 0.6306 0.5817 -0.1010 -0.0060 0.0502  181  GLN A CG  
1380 C CD  . GLN A 180 ? 0.4972 0.6740 0.6435 -0.0974 -0.0168 0.0502  181  GLN A CD  
1381 O OE1 . GLN A 180 ? 0.5128 0.6994 0.6696 -0.0978 -0.0193 0.0479  181  GLN A OE1 
1382 N NE2 . GLN A 180 ? 0.5396 0.6929 0.6780 -0.0936 -0.0233 0.0520  181  GLN A NE2 
1383 N N   . SER A 181 ? 0.3500 0.5706 0.5028 -0.0627 0.0177  0.0254  182  SER A N   
1384 C CA  . SER A 181 ? 0.4139 0.6501 0.5747 -0.0537 0.0249  0.0173  182  SER A CA  
1385 C C   . SER A 181 ? 0.4234 0.6484 0.5720 -0.0463 0.0289  0.0152  182  SER A C   
1386 O O   . SER A 181 ? 0.3596 0.5737 0.4954 -0.0523 0.0294  0.0200  182  SER A O   
1387 C CB  . SER A 181 ? 0.4076 0.6699 0.5779 -0.0622 0.0337  0.0152  182  SER A CB  
1388 O OG  . SER A 181 ? 0.4611 0.7230 0.6180 -0.0679 0.0413  0.0164  182  SER A OG  
1389 N N   . MET A 182 ? 0.3278 0.5548 0.4810 -0.0338 0.0306  0.0081  183  MET A N   
1390 C CA  . MET A 182 ? 0.3114 0.5280 0.4540 -0.0266 0.0340  0.0056  183  MET A CA  
1391 C C   . MET A 182 ? 0.2962 0.5205 0.4314 -0.0335 0.0424  0.0052  183  MET A C   
1392 O O   . MET A 182 ? 0.3180 0.5295 0.4405 -0.0321 0.0434  0.0061  183  MET A O   
1393 C CB  . MET A 182 ? 0.3224 0.5412 0.4723 -0.0131 0.0335  -0.0019 183  MET A CB  
1394 C CG  . MET A 182 ? 0.3003 0.5092 0.4536 -0.0072 0.0246  -0.0012 183  MET A CG  
1395 S SD  . MET A 182 ? 0.3727 0.5540 0.5096 -0.0068 0.0198  0.0047  183  MET A SD  
1396 C CE  . MET A 182 ? 0.3264 0.4997 0.4661 -0.0028 0.0106  0.0045  183  MET A CE  
1397 N N   . GLU A 183 ? 0.2599 0.5046 0.4020 -0.0420 0.0484  0.0040  184  GLU A N   
1398 C CA  . GLU A 183 ? 0.3358 0.5883 0.4681 -0.0501 0.0575  0.0031  184  GLU A CA  
1399 C C   . GLU A 183 ? 0.3580 0.5941 0.4722 -0.0616 0.0539  0.0126  184  GLU A C   
1400 O O   . GLU A 183 ? 0.3235 0.5561 0.4232 -0.0660 0.0586  0.0126  184  GLU A O   
1401 C CB  . GLU A 183 ? 0.4691 0.7485 0.6139 -0.0580 0.0655  -0.0001 184  GLU A CB  
1402 C CG  . GLU A 183 ? 0.5935 0.8840 0.7282 -0.0655 0.0776  -0.0037 184  GLU A CG  
1403 C CD  . GLU A 183 ? 0.7046 0.9948 0.8375 -0.0528 0.0832  -0.0138 184  GLU A CD  
1404 O OE1 . GLU A 183 ? 0.7398 1.0311 0.8870 -0.0384 0.0800  -0.0199 184  GLU A OE1 
1405 O OE2 . GLU A 183 ? 0.7695 1.0564 0.8853 -0.0575 0.0899  -0.0153 184  GLU A OE2 
1406 N N   . GLN A 184 ? 0.3311 0.5559 0.4456 -0.0665 0.0449  0.0204  185  GLN A N   
1407 C CA  . GLN A 184 ? 0.3682 0.5749 0.4675 -0.0754 0.0393  0.0291  185  GLN A CA  
1408 C C   . GLN A 184 ? 0.3795 0.5680 0.4711 -0.0664 0.0362  0.0286  185  GLN A C   
1409 O O   . GLN A 184 ? 0.3883 0.5652 0.4667 -0.0726 0.0341  0.0334  185  GLN A O   
1410 C CB  . GLN A 184 ? 0.3738 0.5715 0.4768 -0.0817 0.0297  0.0366  185  GLN A CB  
1411 C CG  . GLN A 184 ? 0.4704 0.6855 0.5864 -0.0865 0.0308  0.0357  185  GLN A CG  
1412 C CD  . GLN A 184 ? 0.5032 0.7065 0.6232 -0.0899 0.0201  0.0416  185  GLN A CD  
1413 O OE1 . GLN A 184 ? 0.5518 0.7488 0.6794 -0.0799 0.0152  0.0386  185  GLN A OE1 
1414 N NE2 . GLN A 184 ? 0.5396 0.7380 0.6529 -0.1044 0.0157  0.0499  185  GLN A NE2 
1415 N N   . ILE A 185 ? 0.3182 0.5032 0.4173 -0.0528 0.0354  0.0233  186  ILE A N   
1416 C CA  . ILE A 185 ? 0.3174 0.4876 0.4096 -0.0453 0.0340  0.0225  186  ILE A CA  
1417 C C   . ILE A 185 ? 0.2422 0.4177 0.3253 -0.0455 0.0412  0.0180  186  ILE A C   
1418 O O   . ILE A 185 ? 0.3301 0.4942 0.4012 -0.0492 0.0397  0.0211  186  ILE A O   
1419 C CB  . ILE A 185 ? 0.3359 0.5005 0.4357 -0.0321 0.0319  0.0183  186  ILE A CB  
1420 C CG1 . ILE A 185 ? 0.3327 0.4925 0.4393 -0.0327 0.0256  0.0215  186  ILE A CG1 
1421 C CG2 . ILE A 185 ? 0.3746 0.5235 0.4677 -0.0260 0.0306  0.0184  186  ILE A CG2 
1422 C CD1 . ILE A 185 ? 0.3236 0.4736 0.4329 -0.0219 0.0230  0.0186  186  ILE A CD1 
1423 N N   . ARG A 186 ? 0.3573 0.5500 0.4466 -0.0418 0.0487  0.0102  187  ARG A N   
1424 C CA  . ARG A 186 ? 0.3769 0.5745 0.4587 -0.0397 0.0563  0.0035  187  ARG A CA  
1425 C C   . ARG A 186 ? 0.4495 0.6457 0.5143 -0.0531 0.0593  0.0073  187  ARG A C   
1426 O O   . ARG A 186 ? 0.5232 0.7135 0.5753 -0.0524 0.0623  0.0040  187  ARG A O   
1427 C CB  . ARG A 186 ? 0.3629 0.5819 0.4581 -0.0338 0.0639  -0.0062 187  ARG A CB  
1428 C CG  . ARG A 186 ? 0.4431 0.6617 0.5530 -0.0202 0.0596  -0.0104 187  ARG A CG  
1429 C CD  . ARG A 186 ? 0.4570 0.6940 0.5808 -0.0117 0.0659  -0.0214 187  ARG A CD  
1430 N NE  . ARG A 186 ? 0.4748 0.7105 0.6126 -0.0005 0.0591  -0.0237 187  ARG A NE  
1431 C CZ  . ARG A 186 ? 0.5276 0.7762 0.6815 -0.0010 0.0566  -0.0236 187  ARG A CZ  
1432 N NH1 . ARG A 186 ? 0.5332 0.7983 0.6926 -0.0123 0.0609  -0.0213 187  ARG A NH1 
1433 N NH2 . ARG A 186 ? 0.5639 0.8083 0.7274 0.0089  0.0490  -0.0253 187  ARG A NH2 
1434 N N   . ARG A 187 ? 0.4673 0.6670 0.5299 -0.0660 0.0577  0.0144  188  ARG A N   
1435 C CA  . ARG A 187 ? 0.4812 0.6797 0.5254 -0.0807 0.0605  0.0187  188  ARG A CA  
1436 C C   . ARG A 187 ? 0.4976 0.6728 0.5276 -0.0865 0.0501  0.0280  188  ARG A C   
1437 O O   . ARG A 187 ? 0.5246 0.6945 0.5358 -0.0985 0.0504  0.0320  188  ARG A O   
1438 C CB  . ARG A 187 ? 0.5104 0.7238 0.5579 -0.0938 0.0635  0.0226  188  ARG A CB  
1439 C CG  . ARG A 187 ? 0.5877 0.8277 0.6502 -0.0899 0.0751  0.0127  188  ARG A CG  
1440 C CD  . ARG A 187 ? 0.6669 0.9241 0.7324 -0.1047 0.0801  0.0161  188  ARG A CD  
1441 N NE  . ARG A 187 ? 0.7579 1.0428 0.8426 -0.0997 0.0912  0.0058  188  ARG A NE  
1442 C CZ  . ARG A 187 ? 0.8151 1.1215 0.9075 -0.1112 0.0986  0.0059  188  ARG A CZ  
1443 N NH1 . ARG A 187 ? 0.8153 1.1169 0.8948 -0.1291 0.0958  0.0167  188  ARG A NH1 
1444 N NH2 . ARG A 187 ? 0.8466 1.1794 0.9605 -0.1050 0.1082  -0.0044 188  ARG A NH2 
1445 N N   . ILE A 188 ? 0.4026 0.5640 0.4412 -0.0787 0.0409  0.0314  189  ILE A N   
1446 C CA  . ILE A 188 ? 0.4261 0.5668 0.4556 -0.0823 0.0310  0.0389  189  ILE A CA  
1447 C C   . ILE A 188 ? 0.4761 0.6104 0.4914 -0.0808 0.0335  0.0352  189  ILE A C   
1448 O O   . ILE A 188 ? 0.4791 0.6162 0.4987 -0.0695 0.0383  0.0273  189  ILE A O   
1449 C CB  . ILE A 188 ? 0.4383 0.5684 0.4824 -0.0725 0.0233  0.0408  189  ILE A CB  
1450 C CG1 . ILE A 188 ? 0.4003 0.5342 0.4558 -0.0747 0.0199  0.0441  189  ILE A CG1 
1451 C CG2 . ILE A 188 ? 0.4486 0.5598 0.4875 -0.0746 0.0138  0.0470  189  ILE A CG2 
1452 C CD1 . ILE A 188 ? 0.3207 0.4465 0.3900 -0.0642 0.0151  0.0435  189  ILE A CD1 
1453 N N   . MET A 189 ? 0.4445 0.5685 0.4416 -0.0928 0.0293  0.0412  190  MET A N   
1454 C CA  . MET A 189 ? 0.4871 0.6038 0.4672 -0.0936 0.0310  0.0378  190  MET A CA  
1455 C C   . MET A 189 ? 0.4439 0.5414 0.4260 -0.0893 0.0197  0.0423  190  MET A C   
1456 O O   . MET A 189 ? 0.4564 0.5448 0.4481 -0.0905 0.0096  0.0500  190  MET A O   
1457 C CB  . MET A 189 ? 0.5629 0.6781 0.5186 -0.1102 0.0328  0.0414  190  MET A CB  
1458 C CG  . MET A 189 ? 0.6714 0.8086 0.6247 -0.1152 0.0470  0.0352  190  MET A CG  
1459 S SD  . MET A 189 ? 0.8389 0.9912 0.7927 -0.1034 0.0625  0.0187  190  MET A SD  
1460 C CE  . MET A 189 ? 0.8366 1.0054 0.8233 -0.0873 0.0655  0.0128  190  MET A CE  
1461 N N   . ARG A 190 ? 0.4512 0.5432 0.4258 -0.0840 0.0215  0.0369  191  ARG A N   
1462 C CA  . ARG A 190 ? 0.4260 0.5020 0.4038 -0.0798 0.0119  0.0401  191  ARG A CA  
1463 C C   . ARG A 190 ? 0.4267 0.4905 0.3812 -0.0881 0.0084  0.0409  191  ARG A C   
1464 O O   . ARG A 190 ? 0.4645 0.5338 0.4014 -0.0923 0.0170  0.0350  191  ARG A O   
1465 C CB  . ARG A 190 ? 0.3500 0.4287 0.3421 -0.0649 0.0161  0.0329  191  ARG A CB  
1466 C CG  . ARG A 190 ? 0.3273 0.4140 0.3404 -0.0569 0.0175  0.0328  191  ARG A CG  
1467 C CD  . ARG A 190 ? 0.3200 0.4092 0.3422 -0.0436 0.0223  0.0254  191  ARG A CD  
1468 N NE  . ARG A 190 ? 0.3533 0.4539 0.3703 -0.0397 0.0317  0.0162  191  ARG A NE  
1469 C CZ  . ARG A 190 ? 0.3887 0.4901 0.4102 -0.0287 0.0352  0.0090  191  ARG A CZ  
1470 N NH1 . ARG A 190 ? 0.3981 0.4893 0.4268 -0.0222 0.0307  0.0108  191  ARG A NH1 
1471 N NH2 . ARG A 190 ? 0.3844 0.4965 0.4038 -0.0245 0.0429  0.0001  191  ARG A NH2 
1472 N N   . PRO A 191 ? 0.4762 0.5233 0.4303 -0.0907 -0.0041 0.0476  192  PRO A N   
1473 C CA  . PRO A 191 ? 0.4787 0.5200 0.4553 -0.0856 -0.0136 0.0536  192  PRO A CA  
1474 C C   . PRO A 191 ? 0.5139 0.5550 0.4976 -0.0923 -0.0201 0.0618  192  PRO A C   
1475 O O   . PRO A 191 ? 0.4911 0.5296 0.4580 -0.1046 -0.0225 0.0665  192  PRO A O   
1476 C CB  . PRO A 191 ? 0.4966 0.5210 0.4671 -0.0891 -0.0251 0.0578  192  PRO A CB  
1477 C CG  . PRO A 191 ? 0.5138 0.5311 0.4540 -0.1022 -0.0264 0.0591  192  PRO A CG  
1478 C CD  . PRO A 191 ? 0.5156 0.5482 0.4458 -0.0999 -0.0102 0.0495  192  PRO A CD  
1479 N N   . THR A 192 ? 0.4923 0.5352 0.4997 -0.0846 -0.0227 0.0633  193  THR A N   
1480 C CA  . THR A 192 ? 0.4891 0.5297 0.5048 -0.0898 -0.0299 0.0703  193  THR A CA  
1481 C C   . THR A 192 ? 0.4972 0.5317 0.5373 -0.0823 -0.0378 0.0728  193  THR A C   
1482 O O   . THR A 192 ? 0.3472 0.3851 0.4001 -0.0717 -0.0328 0.0676  193  THR A O   
1483 C CB  . THR A 192 ? 0.4568 0.5117 0.4758 -0.0886 -0.0207 0.0671  193  THR A CB  
1484 O OG1 . THR A 192 ? 0.5107 0.5608 0.5381 -0.0934 -0.0292 0.0740  193  THR A OG1 
1485 C CG2 . THR A 192 ? 0.3927 0.4578 0.4275 -0.0743 -0.0114 0.0589  193  THR A CG2 
1486 N N   . ASP A 193 ? 0.4486 0.4733 0.4946 -0.0884 -0.0502 0.0807  194  ASP A N   
1487 C CA  . ASP A 193 ? 0.4210 0.4423 0.4932 -0.0809 -0.0564 0.0818  194  ASP A CA  
1488 C C   . ASP A 193 ? 0.3105 0.3411 0.3936 -0.0748 -0.0489 0.0778  194  ASP A C   
1489 O O   . ASP A 193 ? 0.3940 0.4329 0.4655 -0.0778 -0.0416 0.0759  194  ASP A O   
1490 C CB  . ASP A 193 ? 0.5752 0.5817 0.6514 -0.0889 -0.0739 0.0912  194  ASP A CB  
1491 C CG  . ASP A 193 ? 0.7210 0.7164 0.7849 -0.0961 -0.0835 0.0959  194  ASP A CG  
1492 O OD1 . ASP A 193 ? 0.7723 0.7695 0.8417 -0.0901 -0.0804 0.0920  194  ASP A OD1 
1493 O OD2 . ASP A 193 ? 0.8079 0.7917 0.8551 -0.1085 -0.0946 0.1038  194  ASP A OD2 
1494 N N   . VAL A 194 ? 0.2798 0.3093 0.3856 -0.0663 -0.0506 0.0760  195  VAL A N   
1495 C CA  . VAL A 194 ? 0.3963 0.4306 0.5122 -0.0612 -0.0463 0.0728  195  VAL A CA  
1496 C C   . VAL A 194 ? 0.3956 0.4204 0.5127 -0.0692 -0.0586 0.0798  195  VAL A C   
1497 O O   . VAL A 194 ? 0.3610 0.3749 0.4906 -0.0698 -0.0707 0.0841  195  VAL A O   
1498 C CB  . VAL A 194 ? 0.4069 0.4431 0.5439 -0.0492 -0.0419 0.0670  195  VAL A CB  
1499 C CG1 . VAL A 194 ? 0.4194 0.4597 0.5618 -0.0441 -0.0363 0.0624  195  VAL A CG1 
1500 C CG2 . VAL A 194 ? 0.3674 0.4097 0.5017 -0.0434 -0.0322 0.0620  195  VAL A CG2 
1501 N N   . PRO A 195 ? 0.3942 0.4221 0.4995 -0.0759 -0.0571 0.0814  196  PRO A N   
1502 C CA  . PRO A 195 ? 0.4078 0.4245 0.5127 -0.0847 -0.0698 0.0889  196  PRO A CA  
1503 C C   . PRO A 195 ? 0.3738 0.3854 0.5006 -0.0764 -0.0740 0.0862  196  PRO A C   
1504 O O   . PRO A 195 ? 0.3990 0.4177 0.5377 -0.0651 -0.0647 0.0782  196  PRO A O   
1505 C CB  . PRO A 195 ? 0.4423 0.4672 0.5295 -0.0939 -0.0640 0.0902  196  PRO A CB  
1506 C CG  . PRO A 195 ? 0.4904 0.5302 0.5678 -0.0904 -0.0493 0.0836  196  PRO A CG  
1507 C CD  . PRO A 195 ? 0.4084 0.4502 0.5010 -0.0763 -0.0444 0.0767  196  PRO A CD  
1508 N N   . ASP A 196 ? 0.4084 0.4063 0.5389 -0.0828 -0.0885 0.0930  197  ASP A N   
1509 C CA  . ASP A 196 ? 0.4426 0.4328 0.5939 -0.0753 -0.0944 0.0902  197  ASP A CA  
1510 C C   . ASP A 196 ? 0.3823 0.3792 0.5320 -0.0725 -0.0861 0.0848  197  ASP A C   
1511 O O   . ASP A 196 ? 0.3924 0.3867 0.5580 -0.0629 -0.0851 0.0785  197  ASP A O   
1512 C CB  . ASP A 196 ? 0.4939 0.4655 0.6482 -0.0836 -0.1140 0.0994  197  ASP A CB  
1513 C CG  . ASP A 196 ? 0.6272 0.5898 0.7893 -0.0843 -0.1256 0.1042  197  ASP A CG  
1514 O OD1 . ASP A 196 ? 0.5746 0.5443 0.7498 -0.0749 -0.1193 0.0987  197  ASP A OD1 
1515 O OD2 . ASP A 196 ? 0.7686 0.7157 0.9236 -0.0950 -0.1422 0.1141  197  ASP A OD2 
1516 N N   . GLN A 197 ? 0.4200 0.4253 0.5513 -0.0809 -0.0803 0.0868  198  GLN A N   
1517 C CA  . GLN A 197 ? 0.4394 0.4519 0.5695 -0.0794 -0.0736 0.0823  198  GLN A CA  
1518 C C   . GLN A 197 ? 0.3796 0.4079 0.4928 -0.0859 -0.0631 0.0824  198  GLN A C   
1519 O O   . GLN A 197 ? 0.4229 0.4539 0.5236 -0.0931 -0.0621 0.0865  198  GLN A O   
1520 C CB  . GLN A 197 ? 0.4653 0.4648 0.5974 -0.0863 -0.0860 0.0873  198  GLN A CB  
1521 C CG  . GLN A 197 ? 0.5803 0.5773 0.6949 -0.1036 -0.0927 0.0976  198  GLN A CG  
1522 C CD  . GLN A 197 ? 0.8035 0.7903 0.9112 -0.1109 -0.1022 0.1057  198  GLN A CD  
1523 O OE1 . GLN A 197 ? 0.8917 0.8630 1.0116 -0.1077 -0.1150 0.1082  198  GLN A OE1 
1524 N NE2 . GLN A 197 ? 0.8769 0.8721 0.9654 -0.1204 -0.0964 0.1093  198  GLN A NE2 
1525 N N   . GLY A 198 ? 0.3549 0.3931 0.4682 -0.0836 -0.0557 0.0775  199  GLY A N   
1526 C CA  . GLY A 198 ? 0.3671 0.4226 0.4694 -0.0878 -0.0452 0.0759  199  GLY A CA  
1527 C C   . GLY A 198 ? 0.3977 0.4647 0.5039 -0.0753 -0.0332 0.0667  199  GLY A C   
1528 O O   . GLY A 198 ? 0.3165 0.3782 0.4321 -0.0642 -0.0321 0.0617  199  GLY A O   
1529 N N   . LEU A 199 ? 0.4210 0.5037 0.5196 -0.0776 -0.0241 0.0644  200  LEU A N   
1530 C CA  . LEU A 199 ? 0.3498 0.4436 0.4518 -0.0667 -0.0142 0.0560  200  LEU A CA  
1531 C C   . LEU A 199 ? 0.3315 0.4204 0.4352 -0.0570 -0.0111 0.0525  200  LEU A C   
1532 O O   . LEU A 199 ? 0.3110 0.3970 0.4213 -0.0469 -0.0087 0.0474  200  LEU A O   
1533 C CB  . LEU A 199 ? 0.4116 0.5233 0.5072 -0.0713 -0.0060 0.0541  200  LEU A CB  
1534 C CG  . LEU A 199 ? 0.3882 0.5123 0.4869 -0.0612 0.0031  0.0458  200  LEU A CG  
1535 C CD1 . LEU A 199 ? 0.3485 0.4722 0.4560 -0.0540 0.0016  0.0419  200  LEU A CD1 
1536 C CD2 . LEU A 199 ? 0.3256 0.4679 0.4205 -0.0671 0.0105  0.0440  200  LEU A CD2 
1537 N N   . LEU A 200 ? 0.3864 0.4738 0.4828 -0.0608 -0.0112 0.0553  201  LEU A N   
1538 C CA  . LEU A 200 ? 0.3352 0.4181 0.4335 -0.0528 -0.0089 0.0525  201  LEU A CA  
1539 C C   . LEU A 200 ? 0.3410 0.4123 0.4522 -0.0467 -0.0140 0.0526  201  LEU A C   
1540 O O   . LEU A 200 ? 0.4155 0.4861 0.5324 -0.0374 -0.0091 0.0477  201  LEU A O   
1541 C CB  . LEU A 200 ? 0.3210 0.4011 0.4087 -0.0598 -0.0109 0.0566  201  LEU A CB  
1542 C CG  . LEU A 200 ? 0.4235 0.4973 0.5132 -0.0541 -0.0111 0.0554  201  LEU A CG  
1543 C CD1 . LEU A 200 ? 0.4635 0.5435 0.5562 -0.0433 -0.0021 0.0479  201  LEU A CD1 
1544 C CD2 . LEU A 200 ? 0.5453 0.6173 0.6201 -0.0619 -0.0125 0.0583  201  LEU A CD2 
1545 N N   . CYS A 201 ? 0.2877 0.3495 0.4038 -0.0521 -0.0236 0.0577  202  CYS A N   
1546 C CA  . CYS A 201 ? 0.2941 0.3456 0.4252 -0.0458 -0.0283 0.0566  202  CYS A CA  
1547 C C   . CYS A 201 ? 0.3266 0.3801 0.4632 -0.0369 -0.0220 0.0493  202  CYS A C   
1548 O O   . CYS A 201 ? 0.3791 0.4306 0.5235 -0.0284 -0.0175 0.0445  202  CYS A O   
1549 C CB  . CYS A 201 ? 0.4194 0.4597 0.5544 -0.0534 -0.0412 0.0632  202  CYS A CB  
1550 S SG  . CYS A 201 ? 0.3765 0.4042 0.5329 -0.0452 -0.0478 0.0604  202  CYS A SG  
1551 N N   . ASP A 202 ? 0.3081 0.3654 0.4398 -0.0396 -0.0217 0.0485  203  ASP A N   
1552 C CA  . ASP A 202 ? 0.2392 0.2962 0.3735 -0.0322 -0.0175 0.0420  203  ASP A CA  
1553 C C   . ASP A 202 ? 0.3096 0.3733 0.4397 -0.0244 -0.0075 0.0364  203  ASP A C   
1554 O O   . ASP A 202 ? 0.2354 0.2947 0.3679 -0.0169 -0.0034 0.0310  203  ASP A O   
1555 C CB  . ASP A 202 ? 0.2761 0.3367 0.4058 -0.0378 -0.0202 0.0428  203  ASP A CB  
1556 C CG  . ASP A 202 ? 0.3621 0.4135 0.4948 -0.0465 -0.0314 0.0489  203  ASP A CG  
1557 O OD1 . ASP A 202 ? 0.3173 0.3563 0.4583 -0.0449 -0.0378 0.0501  203  ASP A OD1 
1558 O OD2 . ASP A 202 ? 0.3225 0.3787 0.4502 -0.0550 -0.0342 0.0523  203  ASP A OD2 
1559 N N   . LEU A 203 ? 0.2633 0.3366 0.3860 -0.0264 -0.0035 0.0373  204  LEU A N   
1560 C CA  . LEU A 203 ? 0.3198 0.3976 0.4382 -0.0191 0.0043  0.0324  204  LEU A CA  
1561 C C   . LEU A 203 ? 0.3074 0.3782 0.4305 -0.0133 0.0071  0.0307  204  LEU A C   
1562 O O   . LEU A 203 ? 0.3046 0.3743 0.4248 -0.0069 0.0128  0.0264  204  LEU A O   
1563 C CB  . LEU A 203 ? 0.2961 0.3844 0.4073 -0.0219 0.0073  0.0330  204  LEU A CB  
1564 C CG  . LEU A 203 ? 0.3690 0.4688 0.4774 -0.0253 0.0082  0.0320  204  LEU A CG  
1565 C CD1 . LEU A 203 ? 0.3295 0.4402 0.4323 -0.0286 0.0122  0.0318  204  LEU A CD1 
1566 C CD2 . LEU A 203 ? 0.3347 0.4362 0.4436 -0.0179 0.0104  0.0266  204  LEU A CD2 
1567 N N   . LEU A 204 ? 0.2453 0.3108 0.3760 -0.0160 0.0027  0.0344  205  LEU A N   
1568 C CA  . LEU A 204 ? 0.2766 0.3376 0.4155 -0.0117 0.0049  0.0334  205  LEU A CA  
1569 C C   . LEU A 204 ? 0.2697 0.3237 0.4217 -0.0080 0.0039  0.0308  205  LEU A C   
1570 O O   . LEU A 204 ? 0.3365 0.3888 0.4974 -0.0038 0.0080  0.0285  205  LEU A O   
1571 C CB  . LEU A 204 ? 0.2617 0.3217 0.4027 -0.0168 -0.0003 0.0387  205  LEU A CB  
1572 C CG  . LEU A 204 ? 0.3497 0.4141 0.4806 -0.0171 0.0036  0.0387  205  LEU A CG  
1573 C CD1 . LEU A 204 ? 0.3516 0.4237 0.4693 -0.0181 0.0072  0.0368  205  LEU A CD1 
1574 C CD2 . LEU A 204 ? 0.3869 0.4479 0.5178 -0.0234 -0.0034 0.0442  205  LEU A CD2 
1575 N N   . TRP A 205 ? 0.2737 0.3237 0.4278 -0.0096 -0.0010 0.0306  206  TRP A N   
1576 C CA  . TRP A 205 ? 0.2540 0.2961 0.4226 -0.0065 -0.0041 0.0283  206  TRP A CA  
1577 C C   . TRP A 205 ? 0.2369 0.2740 0.4026 -0.0031 -0.0022 0.0225  206  TRP A C   
1578 O O   . TRP A 205 ? 0.2844 0.3154 0.4610 0.0019  -0.0008 0.0175  206  TRP A O   
1579 C CB  . TRP A 205 ? 0.2618 0.2984 0.4387 -0.0126 -0.0164 0.0346  206  TRP A CB  
1580 C CG  . TRP A 205 ? 0.3335 0.3698 0.5201 -0.0141 -0.0205 0.0388  206  TRP A CG  
1581 C CD1 . TRP A 205 ? 0.3064 0.3456 0.4842 -0.0205 -0.0236 0.0449  206  TRP A CD1 
1582 C CD2 . TRP A 205 ? 0.2374 0.2701 0.4449 -0.0093 -0.0223 0.0369  206  TRP A CD2 
1583 N NE1 . TRP A 205 ? 0.3062 0.3427 0.4969 -0.0203 -0.0283 0.0474  206  TRP A NE1 
1584 C CE2 . TRP A 205 ? 0.2561 0.2896 0.4670 -0.0134 -0.0278 0.0428  206  TRP A CE2 
1585 C CE3 . TRP A 205 ? 0.3024 0.3319 0.5267 -0.0019 -0.0194 0.0301  206  TRP A CE3 
1586 C CZ2 . TRP A 205 ? 0.2623 0.2941 0.4950 -0.0104 -0.0317 0.0427  206  TRP A CZ2 
1587 C CZ3 . TRP A 205 ? 0.3206 0.3499 0.5678 0.0016  -0.0217 0.0292  206  TRP A CZ3 
1588 C CH2 . TRP A 205 ? 0.2887 0.3195 0.5411 -0.0027 -0.0284 0.0359  206  TRP A CH2 
1589 N N   . SER A 206 ? 0.2587 0.2983 0.4112 -0.0055 -0.0023 0.0224  207  SER A N   
1590 C CA  . SER A 206 ? 0.2646 0.2975 0.4141 -0.0034 -0.0032 0.0176  207  SER A CA  
1591 C C   . SER A 206 ? 0.3222 0.3527 0.4653 0.0037  0.0067  0.0100  207  SER A C   
1592 O O   . SER A 206 ? 0.3443 0.3799 0.4818 0.0059  0.0139  0.0095  207  SER A O   
1593 C CB  . SER A 206 ? 0.2465 0.2833 0.3861 -0.0094 -0.0080 0.0205  207  SER A CB  
1594 O OG  . SER A 206 ? 0.3423 0.3878 0.4712 -0.0081 -0.0020 0.0195  207  SER A OG  
1595 N N   . ASP A 207 ? 0.3123 0.3334 0.4545 0.0066  0.0065  0.0041  208  ASP A N   
1596 C CA  . ASP A 207 ? 0.3237 0.3393 0.4571 0.0122  0.0156  -0.0038 208  ASP A CA  
1597 C C   . ASP A 207 ? 0.4104 0.4189 0.5298 0.0114  0.0121  -0.0070 208  ASP A C   
1598 O O   . ASP A 207 ? 0.3856 0.3896 0.5083 0.0081  0.0030  -0.0057 208  ASP A O   
1599 C CB  . ASP A 207 ? 0.3009 0.3103 0.4477 0.0174  0.0203  -0.0102 208  ASP A CB  
1600 C CG  . ASP A 207 ? 0.3624 0.3790 0.5258 0.0184  0.0234  -0.0076 208  ASP A CG  
1601 O OD1 . ASP A 207 ? 0.3025 0.3255 0.4604 0.0186  0.0306  -0.0062 208  ASP A OD1 
1602 O OD2 . ASP A 207 ? 0.4097 0.4246 0.5921 0.0189  0.0174  -0.0067 208  ASP A OD2 
1603 N N   . PRO A 208 ? 0.3863 0.3920 0.4893 0.0136  0.0181  -0.0110 209  PRO A N   
1604 C CA  . PRO A 208 ? 0.3971 0.3928 0.4861 0.0134  0.0145  -0.0154 209  PRO A CA  
1605 C C   . PRO A 208 ? 0.3915 0.3743 0.4819 0.0172  0.0179  -0.0239 209  PRO A C   
1606 O O   . PRO A 208 ? 0.4692 0.4523 0.5695 0.0211  0.0259  -0.0275 209  PRO A O   
1607 C CB  . PRO A 208 ? 0.4018 0.3973 0.4722 0.0145  0.0195  -0.0163 209  PRO A CB  
1608 C CG  . PRO A 208 ? 0.4123 0.4120 0.4865 0.0173  0.0299  -0.0165 209  PRO A CG  
1609 C CD  . PRO A 208 ? 0.3945 0.4038 0.4897 0.0160  0.0275  -0.0115 209  PRO A CD  
1610 N N   . ASP A 209 ? 0.4158 0.3874 0.4969 0.0162  0.0116  -0.0277 210  ASP A N   
1611 C CA  . ASP A 209 ? 0.4778 0.4352 0.5579 0.0202  0.0144  -0.0375 210  ASP A CA  
1612 C C   . ASP A 209 ? 0.4845 0.4285 0.5435 0.0186  0.0095  -0.0420 210  ASP A C   
1613 O O   . ASP A 209 ? 0.4655 0.4082 0.5240 0.0139  -0.0026 -0.0378 210  ASP A O   
1614 C CB  . ASP A 209 ? 0.5431 0.4978 0.6449 0.0206  0.0071  -0.0371 210  ASP A CB  
1615 C CG  . ASP A 209 ? 0.6125 0.5536 0.7181 0.0268  0.0116  -0.0488 210  ASP A CG  
1616 O OD1 . ASP A 209 ? 0.6318 0.5599 0.7193 0.0279  0.0129  -0.0565 210  ASP A OD1 
1617 O OD2 . ASP A 209 ? 0.6440 0.5867 0.7713 0.0307  0.0129  -0.0508 210  ASP A OD2 
1618 N N   . LYS A 210 ? 0.5277 0.4609 0.5691 0.0219  0.0187  -0.0508 211  LYS A N   
1619 C CA  . LYS A 210 ? 0.6327 0.5503 0.6503 0.0202  0.0140  -0.0559 211  LYS A CA  
1620 C C   . LYS A 210 ? 0.6402 0.5444 0.6619 0.0202  0.0048  -0.0610 211  LYS A C   
1621 O O   . LYS A 210 ? 0.7462 0.6389 0.7514 0.0169  -0.0040 -0.0625 211  LYS A O   
1622 C CB  . LYS A 210 ? 0.7270 0.6345 0.7224 0.0229  0.0272  -0.0646 211  LYS A CB  
1623 N N   . ASP A 211 ? 0.6006 0.5049 0.6441 0.0235  0.0051  -0.0635 212  ASP A N   
1624 C CA  . ASP A 211 ? 0.7005 0.5896 0.7485 0.0241  -0.0042 -0.0689 212  ASP A CA  
1625 C C   . ASP A 211 ? 0.6881 0.5818 0.7528 0.0184  -0.0196 -0.0588 212  ASP A C   
1626 O O   . ASP A 211 ? 0.6287 0.5104 0.7024 0.0187  -0.0285 -0.0617 212  ASP A O   
1627 C CB  . ASP A 211 ? 0.7173 0.6003 0.7789 0.0321  0.0048  -0.0797 212  ASP A CB  
1628 C CG  . ASP A 211 ? 0.7648 0.6422 0.8084 0.0366  0.0213  -0.0910 212  ASP A CG  
1629 O OD1 . ASP A 211 ? 0.8056 0.6709 0.8210 0.0340  0.0208  -0.0948 212  ASP A OD1 
1630 O OD2 . ASP A 211 ? 0.8133 0.6987 0.8705 0.0418  0.0345  -0.0956 212  ASP A OD2 
1631 N N   . VAL A 212 ? 0.6782 0.5883 0.7467 0.0129  -0.0228 -0.0474 213  VAL A N   
1632 C CA  . VAL A 212 ? 0.6448 0.5616 0.7276 0.0060  -0.0352 -0.0371 213  VAL A CA  
1633 C C   . VAL A 212 ? 0.6888 0.6092 0.7600 -0.0016 -0.0438 -0.0315 213  VAL A C   
1634 O O   . VAL A 212 ? 0.6836 0.6122 0.7433 -0.0016 -0.0390 -0.0304 213  VAL A O   
1635 C CB  . VAL A 212 ? 0.6534 0.5877 0.7525 0.0055  -0.0311 -0.0291 213  VAL A CB  
1636 C CG1 . VAL A 212 ? 0.6160 0.5612 0.7208 -0.0039 -0.0410 -0.0173 213  VAL A CG1 
1637 C CG2 . VAL A 212 ? 0.6447 0.5743 0.7625 0.0108  -0.0294 -0.0324 213  VAL A CG2 
1638 N N   . GLN A 213 ? 0.7819 0.6958 0.8569 -0.0081 -0.0570 -0.0280 214  GLN A N   
1639 C CA  . GLN A 213 ? 0.8081 0.7295 0.8790 -0.0169 -0.0662 -0.0210 214  GLN A CA  
1640 C C   . GLN A 213 ? 0.7454 0.6833 0.8327 -0.0242 -0.0697 -0.0097 214  GLN A C   
1641 O O   . GLN A 213 ? 0.7056 0.6371 0.8034 -0.0278 -0.0769 -0.0063 214  GLN A O   
1642 C CB  . GLN A 213 ? 0.7738 0.6772 0.8373 -0.0211 -0.0787 -0.0243 214  GLN A CB  
1643 N N   . GLY A 214 ? 0.6146 0.5724 0.7030 -0.0262 -0.0648 -0.0041 215  GLY A N   
1644 C CA  . GLY A 214 ? 0.5092 0.4834 0.6100 -0.0335 -0.0662 0.0058  215  GLY A CA  
1645 C C   . GLY A 214 ? 0.4550 0.4334 0.5636 -0.0289 -0.0582 0.0069  215  GLY A C   
1646 O O   . GLY A 214 ? 0.4583 0.4394 0.5631 -0.0210 -0.0480 0.0024  215  GLY A O   
1647 N N   . TRP A 215 ? 0.4134 0.3911 0.5322 -0.0346 -0.0639 0.0134  216  TRP A N   
1648 C CA  . TRP A 215 ? 0.4090 0.3898 0.5364 -0.0317 -0.0593 0.0158  216  TRP A CA  
1649 C C   . TRP A 215 ? 0.4677 0.4301 0.6029 -0.0271 -0.0641 0.0116  216  TRP A C   
1650 O O   . TRP A 215 ? 0.6132 0.5644 0.7527 -0.0331 -0.0760 0.0152  216  TRP A O   
1651 C CB  . TRP A 215 ? 0.4182 0.4111 0.5502 -0.0421 -0.0630 0.0266  216  TRP A CB  
1652 C CG  . TRP A 215 ? 0.4610 0.4734 0.5882 -0.0459 -0.0574 0.0293  216  TRP A CG  
1653 C CD1 . TRP A 215 ? 0.4253 0.4461 0.5507 -0.0543 -0.0618 0.0326  216  TRP A CD1 
1654 C CD2 . TRP A 215 ? 0.4305 0.4569 0.5559 -0.0409 -0.0467 0.0283  216  TRP A CD2 
1655 N NE1 . TRP A 215 ? 0.4182 0.4584 0.5425 -0.0540 -0.0540 0.0330  216  TRP A NE1 
1656 C CE2 . TRP A 215 ? 0.4331 0.4759 0.5565 -0.0457 -0.0450 0.0304  216  TRP A CE2 
1657 C CE3 . TRP A 215 ? 0.4099 0.4366 0.5367 -0.0331 -0.0387 0.0256  216  TRP A CE3 
1658 C CZ2 . TRP A 215 ? 0.4549 0.5127 0.5769 -0.0421 -0.0362 0.0295  216  TRP A CZ2 
1659 C CZ3 . TRP A 215 ? 0.4339 0.4747 0.5576 -0.0304 -0.0302 0.0255  216  TRP A CZ3 
1660 C CH2 . TRP A 215 ? 0.4420 0.4973 0.5629 -0.0345 -0.0292 0.0271  216  TRP A CH2 
1661 N N   . GLY A 216 ? 0.4250 0.3841 0.5631 -0.0166 -0.0552 0.0039  217  GLY A N   
1662 C CA  . GLY A 216 ? 0.3918 0.3362 0.5414 -0.0105 -0.0580 -0.0016 217  GLY A CA  
1663 C C   . GLY A 216 ? 0.4054 0.3546 0.5706 -0.0095 -0.0580 0.0032  217  GLY A C   
1664 O O   . GLY A 216 ? 0.4520 0.4151 0.6167 -0.0137 -0.0552 0.0105  217  GLY A O   
1665 N N   . GLU A 217 ? 0.4020 0.3387 0.5817 -0.0036 -0.0621 -0.0017 218  GLU A N   
1666 C CA  . GLU A 217 ? 0.3947 0.3341 0.5923 -0.0011 -0.0633 0.0013  218  GLU A CA  
1667 C C   . GLU A 217 ? 0.4161 0.3672 0.6176 0.0073  -0.0476 -0.0047 218  GLU A C   
1668 O O   . GLU A 217 ? 0.4636 0.4149 0.6568 0.0133  -0.0363 -0.0140 218  GLU A O   
1669 C CB  . GLU A 217 ? 0.4363 0.3583 0.6515 0.0035  -0.0740 -0.0028 218  GLU A CB  
1670 C CG  . GLU A 217 ? 0.4961 0.4042 0.7089 -0.0061 -0.0920 0.0051  218  GLU A CG  
1671 C CD  . GLU A 217 ? 0.5853 0.4731 0.8154 -0.0004 -0.1039 -0.0001 218  GLU A CD  
1672 O OE1 . GLU A 217 ? 0.5622 0.4344 0.7866 -0.0018 -0.1120 -0.0033 218  GLU A OE1 
1673 O OE2 . GLU A 217 ? 0.6322 0.5196 0.8828 0.0057  -0.1056 -0.0013 218  GLU A OE2 
1674 N N   . ASN A 218 ? 0.3955 0.3552 0.6083 0.0066  -0.0474 0.0010  219  ASN A N   
1675 C CA  . ASN A 218 ? 0.4272 0.3989 0.6442 0.0124  -0.0337 -0.0027 219  ASN A CA  
1676 C C   . ASN A 218 ? 0.4110 0.3804 0.6542 0.0188  -0.0357 -0.0058 219  ASN A C   
1677 O O   . ASN A 218 ? 0.4111 0.3772 0.6662 0.0149  -0.0483 0.0019  219  ASN A O   
1678 C CB  . ASN A 218 ? 0.3632 0.3485 0.5704 0.0058  -0.0315 0.0065  219  ASN A CB  
1679 C CG  . ASN A 218 ? 0.4071 0.4033 0.6140 0.0109  -0.0172 0.0028  219  ASN A CG  
1680 O OD1 . ASN A 218 ? 0.4332 0.4305 0.6571 0.0169  -0.0127 -0.0017 219  ASN A OD1 
1681 N ND2 . ASN A 218 ? 0.3314 0.3361 0.5206 0.0083  -0.0106 0.0048  219  ASN A ND2 
1682 N N   . ASP A 219 ? 0.4167 0.3882 0.6689 0.0280  -0.0232 -0.0169 220  ASP A N   
1683 C CA  . ASP A 219 ? 0.4707 0.4414 0.7523 0.0355  -0.0240 -0.0222 220  ASP A CA  
1684 C C   . ASP A 219 ? 0.4330 0.4145 0.7292 0.0333  -0.0261 -0.0144 220  ASP A C   
1685 O O   . ASP A 219 ? 0.3868 0.3673 0.7104 0.0377  -0.0322 -0.0157 220  ASP A O   
1686 C CB  . ASP A 219 ? 0.5567 0.5298 0.8431 0.0448  -0.0072 -0.0365 220  ASP A CB  
1687 C CG  . ASP A 219 ? 0.6905 0.6493 0.9664 0.0483  -0.0070 -0.0461 220  ASP A CG  
1688 O OD1 . ASP A 219 ? 0.7545 0.7000 1.0330 0.0464  -0.0221 -0.0437 220  ASP A OD1 
1689 O OD2 . ASP A 219 ? 0.7820 0.7416 1.0458 0.0522  0.0079  -0.0560 220  ASP A OD2 
1690 N N   . ARG A 220 ? 0.3672 0.3587 0.6467 0.0271  -0.0218 -0.0070 221  ARG A N   
1691 C CA  . ARG A 220 ? 0.3637 0.3630 0.6530 0.0235  -0.0261 0.0014  221  ARG A CA  
1692 C C   . ARG A 220 ? 0.3680 0.3582 0.6644 0.0174  -0.0456 0.0110  221  ARG A C   
1693 O O   . ARG A 220 ? 0.3821 0.3752 0.6911 0.0152  -0.0523 0.0171  221  ARG A O   
1694 C CB  . ARG A 220 ? 0.3938 0.4029 0.6603 0.0178  -0.0187 0.0069  221  ARG A CB  
1695 C CG  . ARG A 220 ? 0.3626 0.3790 0.6185 0.0221  -0.0010 -0.0006 221  ARG A CG  
1696 C CD  . ARG A 220 ? 0.3862 0.4099 0.6197 0.0165  0.0028  0.0056  221  ARG A CD  
1697 N NE  . ARG A 220 ? 0.3832 0.4098 0.6007 0.0193  0.0164  -0.0002 221  ARG A NE  
1698 C CZ  . ARG A 220 ? 0.3968 0.4301 0.6148 0.0213  0.0273  -0.0022 221  ARG A CZ  
1699 N NH1 . ARG A 220 ? 0.3033 0.3425 0.5391 0.0211  0.0265  0.0007  221  ARG A NH1 
1700 N NH2 . ARG A 220 ? 0.3952 0.4285 0.5954 0.0227  0.0379  -0.0065 221  ARG A NH2 
1701 N N   . GLY A 221 ? 0.4068 0.3849 0.6944 0.0137  -0.0558 0.0131  222  GLY A N   
1702 C CA  . GLY A 221 ? 0.3573 0.3253 0.6459 0.0055  -0.0744 0.0238  222  GLY A CA  
1703 C C   . GLY A 221 ? 0.3879 0.3607 0.6526 -0.0063 -0.0766 0.0347  222  GLY A C   
1704 O O   . GLY A 221 ? 0.3986 0.3635 0.6599 -0.0153 -0.0912 0.0447  222  GLY A O   
1705 N N   . VAL A 222 ? 0.3142 0.2993 0.5619 -0.0067 -0.0625 0.0327  223  VAL A N   
1706 C CA  . VAL A 222 ? 0.3654 0.3577 0.5917 -0.0162 -0.0616 0.0407  223  VAL A CA  
1707 C C   . VAL A 222 ? 0.3728 0.3701 0.5811 -0.0168 -0.0528 0.0370  223  VAL A C   
1708 O O   . VAL A 222 ? 0.3858 0.3847 0.5951 -0.0088 -0.0429 0.0280  223  VAL A O   
1709 C CB  . VAL A 222 ? 0.3459 0.3492 0.5725 -0.0153 -0.0543 0.0420  223  VAL A CB  
1710 C CG1 . VAL A 222 ? 0.3177 0.3287 0.5218 -0.0237 -0.0515 0.0480  223  VAL A CG1 
1711 C CG2 . VAL A 222 ? 0.3930 0.3912 0.6382 -0.0156 -0.0650 0.0464  223  VAL A CG2 
1712 N N   . SER A 223 ? 0.3329 0.3326 0.5248 -0.0267 -0.0565 0.0439  224  SER A N   
1713 C CA  . SER A 223 ? 0.3186 0.3267 0.4949 -0.0280 -0.0484 0.0414  224  SER A CA  
1714 C C   . SER A 223 ? 0.3324 0.3319 0.5104 -0.0234 -0.0490 0.0345  224  SER A C   
1715 O O   . SER A 223 ? 0.3914 0.3778 0.5791 -0.0231 -0.0587 0.0343  224  SER A O   
1716 C CB  . SER A 223 ? 0.3078 0.3285 0.4782 -0.0229 -0.0351 0.0376  224  SER A CB  
1717 O OG  . SER A 223 ? 0.3198 0.3487 0.4764 -0.0245 -0.0294 0.0361  224  SER A OG  
1718 N N   . PHE A 224 ? 0.3785 0.3839 0.5466 -0.0197 -0.0398 0.0287  225  PHE A N   
1719 C CA  . PHE A 224 ? 0.4023 0.3996 0.5666 -0.0174 -0.0409 0.0228  225  PHE A CA  
1720 C C   . PHE A 224 ? 0.4265 0.4257 0.5856 -0.0083 -0.0288 0.0135  225  PHE A C   
1721 O O   . PHE A 224 ? 0.4119 0.4201 0.5691 -0.0050 -0.0196 0.0127  225  PHE A O   
1722 C CB  . PHE A 224 ? 0.3887 0.3900 0.5414 -0.0264 -0.0456 0.0274  225  PHE A CB  
1723 C CG  . PHE A 224 ? 0.4074 0.4090 0.5608 -0.0378 -0.0555 0.0376  225  PHE A CG  
1724 C CD1 . PHE A 224 ? 0.3787 0.3931 0.5273 -0.0438 -0.0524 0.0439  225  PHE A CD1 
1725 C CD2 . PHE A 224 ? 0.5035 0.4908 0.6612 -0.0430 -0.0681 0.0407  225  PHE A CD2 
1726 C CE1 . PHE A 224 ? 0.4693 0.4828 0.6152 -0.0556 -0.0608 0.0533  225  PHE A CE1 
1727 C CE2 . PHE A 224 ? 0.5518 0.5372 0.7075 -0.0551 -0.0780 0.0512  225  PHE A CE2 
1728 C CZ  . PHE A 224 ? 0.5440 0.5429 0.6930 -0.0619 -0.0738 0.0576  225  PHE A CZ  
1729 N N   . THR A 225 ? 0.3913 0.3804 0.5460 -0.0050 -0.0293 0.0066  226  THR A N   
1730 C CA  . THR A 225 ? 0.3560 0.3453 0.4980 0.0003  -0.0199 -0.0008 226  THR A CA  
1731 C C   . THR A 225 ? 0.4042 0.3958 0.5329 -0.0054 -0.0245 0.0015  226  THR A C   
1732 O O   . THR A 225 ? 0.4317 0.4212 0.5625 -0.0125 -0.0347 0.0065  226  THR A O   
1733 C CB  . THR A 225 ? 0.3687 0.3443 0.5122 0.0076  -0.0165 -0.0114 226  THR A CB  
1734 O OG1 . THR A 225 ? 0.4203 0.3833 0.5700 0.0055  -0.0279 -0.0117 226  THR A OG1 
1735 C CG2 . THR A 225 ? 0.3811 0.3587 0.5388 0.0145  -0.0080 -0.0156 226  THR A CG2 
1736 N N   . PHE A 226 ? 0.3364 0.3324 0.4522 -0.0028 -0.0177 -0.0016 227  PHE A N   
1737 C CA  . PHE A 226 ? 0.3888 0.3874 0.4942 -0.0071 -0.0226 -0.0003 227  PHE A CA  
1738 C C   . PHE A 226 ? 0.4308 0.4193 0.5209 -0.0021 -0.0190 -0.0083 227  PHE A C   
1739 O O   . PHE A 226 ? 0.4396 0.4256 0.5238 0.0038  -0.0094 -0.0130 227  PHE A O   
1740 C CB  . PHE A 226 ? 0.3389 0.3552 0.4438 -0.0106 -0.0208 0.0058  227  PHE A CB  
1741 C CG  . PHE A 226 ? 0.3504 0.3726 0.4519 -0.0049 -0.0108 0.0044  227  PHE A CG  
1742 C CD1 . PHE A 226 ? 0.3526 0.3793 0.4630 -0.0039 -0.0066 0.0070  227  PHE A CD1 
1743 C CD2 . PHE A 226 ? 0.3900 0.4127 0.4793 -0.0014 -0.0072 0.0012  227  PHE A CD2 
1744 C CE1 . PHE A 226 ? 0.3753 0.4066 0.4826 0.0005  0.0018  0.0061  227  PHE A CE1 
1745 C CE2 . PHE A 226 ? 0.3806 0.4070 0.4658 0.0030  0.0009  0.0006  227  PHE A CE2 
1746 C CZ  . PHE A 226 ? 0.3905 0.4216 0.4850 0.0038  0.0057  0.0030  227  PHE A CZ  
1747 N N   . GLY A 227 ? 0.4368 0.4189 0.5195 -0.0056 -0.0272 -0.0093 228  GLY A N   
1748 C CA  . GLY A 227 ? 0.4092 0.3791 0.4744 -0.0024 -0.0261 -0.0165 228  GLY A CA  
1749 C C   . GLY A 227 ? 0.4412 0.4192 0.4960 -0.0030 -0.0263 -0.0145 228  GLY A C   
1750 O O   . GLY A 227 ? 0.3486 0.3431 0.4113 -0.0052 -0.0264 -0.0084 228  GLY A O   
1751 N N   . ALA A 228 ? 0.4859 0.4507 0.5221 -0.0010 -0.0270 -0.0203 229  ALA A N   
1752 C CA  . ALA A 228 ? 0.4897 0.4578 0.5138 -0.0007 -0.0287 -0.0192 229  ALA A CA  
1753 C C   . ALA A 228 ? 0.4721 0.4529 0.5056 -0.0062 -0.0396 -0.0134 229  ALA A C   
1754 O O   . ALA A 228 ? 0.4575 0.4494 0.4918 -0.0055 -0.0404 -0.0105 229  ALA A O   
1755 C CB  . ALA A 228 ? 0.4684 0.4161 0.4680 0.0011  -0.0293 -0.0263 229  ALA A CB  
1756 N N   . GLU A 229 ? 0.4305 0.4099 0.4721 -0.0119 -0.0482 -0.0120 230  GLU A N   
1757 C CA  . GLU A 229 ? 0.4009 0.3938 0.4530 -0.0184 -0.0579 -0.0067 230  GLU A CA  
1758 C C   . GLU A 229 ? 0.4043 0.4202 0.4745 -0.0207 -0.0536 -0.0003 230  GLU A C   
1759 O O   . GLU A 229 ? 0.4106 0.4429 0.4890 -0.0229 -0.0564 0.0028  230  GLU A O   
1760 C CB  . GLU A 229 ? 0.3763 0.3602 0.4314 -0.0251 -0.0682 -0.0065 230  GLU A CB  
1761 N N   . VAL A 230 ? 0.3809 0.3980 0.4577 -0.0202 -0.0470 0.0014  231  VAL A N   
1762 C CA  . VAL A 230 ? 0.3901 0.4265 0.4800 -0.0225 -0.0422 0.0070  231  VAL A CA  
1763 C C   . VAL A 230 ? 0.4216 0.4678 0.5088 -0.0166 -0.0359 0.0060  231  VAL A C   
1764 O O   . VAL A 230 ? 0.4034 0.4676 0.5001 -0.0186 -0.0355 0.0090  231  VAL A O   
1765 C CB  . VAL A 230 ? 0.3801 0.4122 0.4751 -0.0226 -0.0378 0.0088  231  VAL A CB  
1766 C CG1 . VAL A 230 ? 0.4179 0.4671 0.5217 -0.0243 -0.0322 0.0138  231  VAL A CG1 
1767 C CG2 . VAL A 230 ? 0.3623 0.3857 0.4624 -0.0295 -0.0465 0.0111  231  VAL A CG2 
1768 N N   . VAL A 231 ? 0.4200 0.4538 0.4940 -0.0094 -0.0308 0.0015  232  VAL A N   
1769 C CA  . VAL A 231 ? 0.3828 0.4218 0.4517 -0.0040 -0.0264 0.0008  232  VAL A CA  
1770 C C   . VAL A 231 ? 0.3921 0.4387 0.4625 -0.0048 -0.0345 0.0011  232  VAL A C   
1771 O O   . VAL A 231 ? 0.4106 0.4733 0.4908 -0.0038 -0.0337 0.0029  232  VAL A O   
1772 C CB  . VAL A 231 ? 0.3513 0.3730 0.4028 0.0017  -0.0205 -0.0038 232  VAL A CB  
1773 C CG1 . VAL A 231 ? 0.3146 0.3375 0.3576 0.0061  -0.0193 -0.0040 232  VAL A CG1 
1774 C CG2 . VAL A 231 ? 0.3265 0.3461 0.3823 0.0034  -0.0114 -0.0040 232  VAL A CG2 
1775 N N   . ALA A 232 ? 0.4219 0.4567 0.4834 -0.0064 -0.0429 -0.0012 233  ALA A N   
1776 C CA  . ALA A 232 ? 0.4076 0.4483 0.4714 -0.0071 -0.0526 -0.0010 233  ALA A CA  
1777 C C   . ALA A 232 ? 0.4200 0.4848 0.5068 -0.0123 -0.0554 0.0028  233  ALA A C   
1778 O O   . ALA A 232 ? 0.4423 0.5214 0.5390 -0.0101 -0.0578 0.0031  233  ALA A O   
1779 C CB  . ALA A 232 ? 0.4304 0.4530 0.4805 -0.0096 -0.0624 -0.0038 233  ALA A CB  
1780 N N   . LYS A 233 ? 0.4000 0.4696 0.4961 -0.0193 -0.0550 0.0057  234  LYS A N   
1781 C CA  . LYS A 233 ? 0.4764 0.5692 0.5928 -0.0262 -0.0561 0.0096  234  LYS A CA  
1782 C C   . LYS A 233 ? 0.4298 0.5403 0.5552 -0.0232 -0.0464 0.0105  234  LYS A C   
1783 O O   . LYS A 233 ? 0.4585 0.5899 0.5991 -0.0246 -0.0463 0.0109  234  LYS A O   
1784 C CB  . LYS A 233 ? 0.4465 0.5373 0.5672 -0.0356 -0.0579 0.0135  234  LYS A CB  
1785 C CG  . LYS A 233 ? 0.6479 0.7252 0.7644 -0.0407 -0.0694 0.0130  234  LYS A CG  
1786 C CD  . LYS A 233 ? 0.7334 0.8070 0.8543 -0.0501 -0.0719 0.0174  234  LYS A CD  
1787 C CE  . LYS A 233 ? 0.7882 0.8471 0.9050 -0.0557 -0.0843 0.0168  234  LYS A CE  
1788 N NZ  . LYS A 233 ? 0.8141 0.8645 0.9332 -0.0639 -0.0879 0.0209  234  LYS A NZ  
1789 N N   . PHE A 234 ? 0.3683 0.4711 0.4855 -0.0193 -0.0381 0.0104  235  PHE A N   
1790 C CA  . PHE A 234 ? 0.3072 0.4242 0.4308 -0.0169 -0.0294 0.0110  235  PHE A CA  
1791 C C   . PHE A 234 ? 0.3043 0.4272 0.4292 -0.0089 -0.0296 0.0075  235  PHE A C   
1792 O O   . PHE A 234 ? 0.3218 0.4640 0.4598 -0.0085 -0.0267 0.0070  235  PHE A O   
1793 C CB  . PHE A 234 ? 0.3205 0.4256 0.4350 -0.0145 -0.0224 0.0117  235  PHE A CB  
1794 C CG  . PHE A 234 ? 0.3844 0.4998 0.5020 -0.0118 -0.0143 0.0121  235  PHE A CG  
1795 C CD1 . PHE A 234 ? 0.4460 0.5752 0.5719 -0.0183 -0.0107 0.0153  235  PHE A CD1 
1796 C CD2 . PHE A 234 ? 0.3790 0.4887 0.4892 -0.0034 -0.0107 0.0092  235  PHE A CD2 
1797 C CE1 . PHE A 234 ? 0.3972 0.5341 0.5236 -0.0160 -0.0036 0.0149  235  PHE A CE1 
1798 C CE2 . PHE A 234 ? 0.3867 0.5039 0.4989 -0.0010 -0.0041 0.0092  235  PHE A CE2 
1799 C CZ  . PHE A 234 ? 0.3453 0.4761 0.4655 -0.0069 -0.0006 0.0116  235  PHE A CZ  
1800 N N   . LEU A 235 ? 0.3188 0.4248 0.4298 -0.0028 -0.0333 0.0049  236  LEU A N   
1801 C CA  . LEU A 235 ? 0.3608 0.4687 0.4713 0.0046  -0.0358 0.0024  236  LEU A CA  
1802 C C   . LEU A 235 ? 0.4234 0.5473 0.5505 0.0034  -0.0442 0.0015  236  LEU A C   
1803 O O   . LEU A 235 ? 0.4461 0.5835 0.5849 0.0083  -0.0442 -0.0005 236  LEU A O   
1804 C CB  . LEU A 235 ? 0.3618 0.4458 0.4507 0.0091  -0.0390 0.0007  236  LEU A CB  
1805 C CG  . LEU A 235 ? 0.3956 0.4640 0.4688 0.0109  -0.0303 0.0006  236  LEU A CG  
1806 C CD1 . LEU A 235 ? 0.4037 0.4506 0.4551 0.0142  -0.0337 -0.0014 236  LEU A CD1 
1807 C CD2 . LEU A 235 ? 0.3851 0.4618 0.4633 0.0144  -0.0219 0.0013  236  LEU A CD2 
1808 N N   . HIS A 236 ? 0.4131 0.5354 0.5425 -0.0028 -0.0521 0.0027  237  HIS A N   
1809 C CA  . HIS A 236 ? 0.4227 0.5612 0.5704 -0.0047 -0.0610 0.0021  237  HIS A CA  
1810 C C   . HIS A 236 ? 0.4170 0.5843 0.5885 -0.0086 -0.0541 0.0026  237  HIS A C   
1811 O O   . HIS A 236 ? 0.4319 0.6175 0.6215 -0.0049 -0.0559 -0.0001 237  HIS A O   
1812 C CB  . HIS A 236 ? 0.3974 0.5266 0.5417 -0.0118 -0.0712 0.0035  237  HIS A CB  
1813 C CG  . HIS A 236 ? 0.4998 0.6467 0.6653 -0.0153 -0.0810 0.0036  237  HIS A CG  
1814 N ND1 . HIS A 236 ? 0.5390 0.6827 0.7061 -0.0101 -0.0926 0.0014  237  HIS A ND1 
1815 C CD2 . HIS A 236 ? 0.5244 0.6928 0.7113 -0.0242 -0.0814 0.0057  237  HIS A CD2 
1816 C CE1 . HIS A 236 ? 0.5203 0.6840 0.7114 -0.0148 -0.1000 0.0018  237  HIS A CE1 
1817 N NE2 . HIS A 236 ? 0.5285 0.7082 0.7320 -0.0238 -0.0926 0.0044  237  HIS A NE2 
1818 N N   . LYS A 237 ? 0.3664 0.5378 0.5378 -0.0159 -0.0463 0.0057  238  LYS A N   
1819 C CA  . LYS A 237 ? 0.3507 0.5482 0.5407 -0.0218 -0.0388 0.0065  238  LYS A CA  
1820 C C   . LYS A 237 ? 0.3380 0.5475 0.5338 -0.0138 -0.0304 0.0025  238  LYS A C   
1821 O O   . LYS A 237 ? 0.3391 0.5728 0.5547 -0.0142 -0.0270 -0.0003 238  LYS A O   
1822 C CB  . LYS A 237 ? 0.3794 0.5732 0.5627 -0.0315 -0.0334 0.0115  238  LYS A CB  
1823 C CG  . LYS A 237 ? 0.4374 0.6550 0.6341 -0.0399 -0.0251 0.0133  238  LYS A CG  
1824 C CD  . LYS A 237 ? 0.4329 0.6414 0.6195 -0.0500 -0.0227 0.0194  238  LYS A CD  
1825 C CE  . LYS A 237 ? 0.4037 0.6331 0.5981 -0.0596 -0.0137 0.0217  238  LYS A CE  
1826 N NZ  . LYS A 237 ? 0.4321 0.6489 0.6137 -0.0688 -0.0129 0.0283  238  LYS A NZ  
1827 N N   . HIS A 238 ? 0.3131 0.5060 0.4925 -0.0065 -0.0267 0.0015  239  HIS A N   
1828 C CA  . HIS A 238 ? 0.3594 0.5603 0.5417 0.0006  -0.0189 -0.0021 239  HIS A CA  
1829 C C   . HIS A 238 ? 0.3571 0.5513 0.5389 0.0120  -0.0251 -0.0063 239  HIS A C   
1830 O O   . HIS A 238 ? 0.3617 0.5568 0.5428 0.0189  -0.0202 -0.0094 239  HIS A O   
1831 C CB  . HIS A 238 ? 0.2748 0.4634 0.4412 -0.0002 -0.0108 0.0002  239  HIS A CB  
1832 C CG  . HIS A 238 ? 0.2656 0.4581 0.4315 -0.0115 -0.0068 0.0049  239  HIS A CG  
1833 N ND1 . HIS A 238 ? 0.2937 0.5064 0.4696 -0.0181 0.0003  0.0052  239  HIS A ND1 
1834 C CD2 . HIS A 238 ? 0.2957 0.4736 0.4518 -0.0175 -0.0095 0.0096  239  HIS A CD2 
1835 C CE1 . HIS A 238 ? 0.3160 0.5249 0.4866 -0.0286 0.0010  0.0109  239  HIS A CE1 
1836 N NE2 . HIS A 238 ? 0.2921 0.4801 0.4521 -0.0278 -0.0055 0.0134  239  HIS A NE2 
1837 N N   . ASP A 239 ? 0.3373 0.5236 0.5188 0.0135  -0.0367 -0.0062 240  ASP A N   
1838 C CA  . ASP A 239 ? 0.3755 0.5521 0.5544 0.0231  -0.0455 -0.0090 240  ASP A CA  
1839 C C   . ASP A 239 ? 0.3719 0.5271 0.5289 0.0290  -0.0419 -0.0087 240  ASP A C   
1840 O O   . ASP A 239 ? 0.4049 0.5579 0.5627 0.0372  -0.0434 -0.0115 240  ASP A O   
1841 C CB  . ASP A 239 ? 0.5036 0.7033 0.7083 0.0290  -0.0470 -0.0141 240  ASP A CB  
1842 C CG  . ASP A 239 ? 0.6854 0.8763 0.8926 0.0367  -0.0618 -0.0159 240  ASP A CG  
1843 O OD1 . ASP A 239 ? 0.7657 0.9541 0.9755 0.0332  -0.0730 -0.0142 240  ASP A OD1 
1844 O OD2 . ASP A 239 ? 0.7609 0.9456 0.9662 0.0461  -0.0635 -0.0188 240  ASP A OD2 
1845 N N   . LEU A 240 ? 0.3306 0.4698 0.4690 0.0246  -0.0373 -0.0053 241  LEU A N   
1846 C CA  . LEU A 240 ? 0.3196 0.4389 0.4377 0.0284  -0.0333 -0.0046 241  LEU A CA  
1847 C C   . LEU A 240 ? 0.3916 0.4872 0.4893 0.0289  -0.0410 -0.0035 241  LEU A C   
1848 O O   . LEU A 240 ? 0.4656 0.5578 0.5618 0.0246  -0.0476 -0.0028 241  LEU A O   
1849 C CB  . LEU A 240 ? 0.3349 0.4530 0.4478 0.0236  -0.0225 -0.0023 241  LEU A CB  
1850 C CG  . LEU A 240 ? 0.3420 0.4798 0.4691 0.0220  -0.0144 -0.0030 241  LEU A CG  
1851 C CD1 . LEU A 240 ? 0.3345 0.4707 0.4575 0.0148  -0.0074 0.0005  241  LEU A CD1 
1852 C CD2 . LEU A 240 ? 0.3436 0.4813 0.4700 0.0295  -0.0112 -0.0058 241  LEU A CD2 
1853 N N   . ASP A 241 ? 0.3766 0.4550 0.4573 0.0334  -0.0401 -0.0032 242  ASP A N   
1854 C CA  . ASP A 241 ? 0.3567 0.4110 0.4134 0.0328  -0.0451 -0.0023 242  ASP A CA  
1855 C C   . ASP A 241 ? 0.3989 0.4400 0.4394 0.0293  -0.0350 -0.0012 242  ASP A C   
1856 O O   . ASP A 241 ? 0.4428 0.4674 0.4657 0.0266  -0.0367 -0.0015 242  ASP A O   
1857 C CB  . ASP A 241 ? 0.3779 0.4193 0.4238 0.0387  -0.0519 -0.0022 242  ASP A CB  
1858 C CG  . ASP A 241 ? 0.4820 0.5315 0.5424 0.0428  -0.0656 -0.0036 242  ASP A CG  
1859 O OD1 . ASP A 241 ? 0.5312 0.5980 0.6109 0.0406  -0.0692 -0.0048 242  ASP A OD1 
1860 O OD2 . ASP A 241 ? 0.5073 0.5460 0.5611 0.0481  -0.0735 -0.0034 242  ASP A OD2 
1861 N N   . LEU A 242 ? 0.3730 0.4209 0.4193 0.0294  -0.0246 -0.0006 243  LEU A N   
1862 C CA  . LEU A 242 ? 0.2929 0.3281 0.3258 0.0272  -0.0156 0.0001  243  LEU A CA  
1863 C C   . LEU A 242 ? 0.3383 0.3857 0.3846 0.0251  -0.0069 0.0011  243  LEU A C   
1864 O O   . LEU A 242 ? 0.3705 0.4316 0.4294 0.0266  -0.0055 0.0015  243  LEU A O   
1865 C CB  . LEU A 242 ? 0.3314 0.3513 0.3472 0.0302  -0.0139 0.0009  243  LEU A CB  
1866 C CG  . LEU A 242 ? 0.4124 0.4213 0.4163 0.0280  -0.0033 0.0014  243  LEU A CG  
1867 C CD1 . LEU A 242 ? 0.3972 0.3937 0.3876 0.0245  -0.0017 -0.0006 243  LEU A CD1 
1868 C CD2 . LEU A 242 ? 0.3944 0.3908 0.3838 0.0299  -0.0026 0.0031  243  LEU A CD2 
1869 N N   . ILE A 243 ? 0.3477 0.3892 0.3908 0.0218  -0.0014 0.0012  244  ILE A N   
1870 C CA  . ILE A 243 ? 0.2923 0.3397 0.3444 0.0201  0.0063  0.0027  244  ILE A CA  
1871 C C   . ILE A 243 ? 0.3463 0.3818 0.3877 0.0216  0.0134  0.0026  244  ILE A C   
1872 O O   . ILE A 243 ? 0.3874 0.4091 0.4148 0.0215  0.0150  0.0008  244  ILE A O   
1873 C CB  . ILE A 243 ? 0.3599 0.4095 0.4198 0.0156  0.0062  0.0030  244  ILE A CB  
1874 C CG1 . ILE A 243 ? 0.3465 0.4094 0.4179 0.0123  -0.0004 0.0040  244  ILE A CG1 
1875 C CG2 . ILE A 243 ? 0.2965 0.3490 0.3648 0.0139  0.0125  0.0049  244  ILE A CG2 
1876 C CD1 . ILE A 243 ? 0.3944 0.4547 0.4692 0.0074  -0.0036 0.0043  244  ILE A CD1 
1877 N N   . CYS A 244 ? 0.3658 0.4062 0.4129 0.0224  0.0178  0.0044  245  CYS A N   
1878 C CA  . CYS A 244 ? 0.3818 0.4132 0.4218 0.0228  0.0247  0.0049  245  CYS A CA  
1879 C C   . CYS A 244 ? 0.3627 0.4009 0.4163 0.0205  0.0296  0.0064  245  CYS A C   
1880 O O   . CYS A 244 ? 0.3483 0.3963 0.4113 0.0199  0.0282  0.0083  245  CYS A O   
1881 C CB  . CYS A 244 ? 0.4728 0.5011 0.5060 0.0257  0.0233  0.0061  245  CYS A CB  
1882 S SG  . CYS A 244 ? 0.4971 0.5136 0.5205 0.0245  0.0313  0.0076  245  CYS A SG  
1883 N N   . ARG A 245 ? 0.3282 0.3609 0.3831 0.0192  0.0348  0.0052  246  ARG A N   
1884 C CA  . ARG A 245 ? 0.3126 0.3511 0.3829 0.0172  0.0373  0.0068  246  ARG A CA  
1885 C C   . ARG A 245 ? 0.3236 0.3560 0.3947 0.0174  0.0455  0.0053  246  ARG A C   
1886 O O   . ARG A 245 ? 0.3850 0.4086 0.4427 0.0181  0.0503  0.0031  246  ARG A O   
1887 C CB  . ARG A 245 ? 0.3165 0.3586 0.3962 0.0151  0.0328  0.0065  246  ARG A CB  
1888 C CG  . ARG A 245 ? 0.3441 0.3775 0.4160 0.0158  0.0323  0.0023  246  ARG A CG  
1889 C CD  . ARG A 245 ? 0.3286 0.3550 0.4045 0.0168  0.0392  -0.0013 246  ARG A CD  
1890 N NE  . ARG A 245 ? 0.3433 0.3740 0.4374 0.0155  0.0368  0.0000  246  ARG A NE  
1891 C CZ  . ARG A 245 ? 0.3432 0.3696 0.4469 0.0169  0.0402  -0.0037 246  ARG A CZ  
1892 N NH1 . ARG A 245 ? 0.3651 0.3838 0.4607 0.0194  0.0482  -0.0097 246  ARG A NH1 
1893 N NH2 . ARG A 245 ? 0.3238 0.3530 0.4447 0.0157  0.0354  -0.0017 246  ARG A NH2 
1894 N N   . ALA A 246 ? 0.3038 0.3410 0.3910 0.0161  0.0470  0.0066  247  ALA A N   
1895 C CA  . ALA A 246 ? 0.3359 0.3710 0.4298 0.0161  0.0550  0.0052  247  ALA A CA  
1896 C C   . ALA A 246 ? 0.3544 0.3912 0.4656 0.0165  0.0551  0.0029  247  ALA A C   
1897 O O   . ALA A 246 ? 0.3466 0.3793 0.4553 0.0176  0.0537  -0.0007 247  ALA A O   
1898 C CB  . ALA A 246 ? 0.2658 0.3048 0.3651 0.0146  0.0555  0.0093  247  ALA A CB  
1899 N N   . HIS A 247 ? 0.3206 0.3624 0.4499 0.0157  0.0559  0.0047  248  HIS A N   
1900 C CA  . HIS A 247 ? 0.3042 0.3481 0.4534 0.0160  0.0517  0.0042  248  HIS A CA  
1901 C C   . HIS A 247 ? 0.3312 0.3719 0.4894 0.0193  0.0588  -0.0030 248  HIS A C   
1902 O O   . HIS A 247 ? 0.4152 0.4583 0.5950 0.0205  0.0566  -0.0040 248  HIS A O   
1903 C CB  . HIS A 247 ? 0.3083 0.3517 0.4543 0.0142  0.0415  0.0067  248  HIS A CB  
1904 C CG  . HIS A 247 ? 0.3119 0.3559 0.4759 0.0128  0.0335  0.0088  248  HIS A CG  
1905 N ND1 . HIS A 247 ? 0.3379 0.3850 0.5189 0.0118  0.0309  0.0120  248  HIS A ND1 
1906 C CD2 . HIS A 247 ? 0.3034 0.3435 0.4704 0.0118  0.0260  0.0088  248  HIS A CD2 
1907 C CE1 . HIS A 247 ? 0.2950 0.3397 0.4883 0.0103  0.0216  0.0140  248  HIS A CE1 
1908 N NE2 . HIS A 247 ? 0.2993 0.3394 0.4840 0.0101  0.0187  0.0123  248  HIS A NE2 
1909 N N   . GLN A 248 ? 0.2815 0.3163 0.4236 0.0207  0.0668  -0.0083 249  GLN A N   
1910 C CA  . GLN A 248 ? 0.3385 0.3700 0.4866 0.0238  0.0755  -0.0167 249  GLN A CA  
1911 C C   . GLN A 248 ? 0.3691 0.3995 0.5065 0.0229  0.0893  -0.0200 249  GLN A C   
1912 O O   . GLN A 248 ? 0.4067 0.4316 0.5200 0.0207  0.0908  -0.0180 249  GLN A O   
1913 C CB  . GLN A 248 ? 0.3567 0.3789 0.4927 0.0254  0.0720  -0.0215 249  GLN A CB  
1914 C CG  . GLN A 248 ? 0.3329 0.3551 0.4836 0.0258  0.0599  -0.0195 249  GLN A CG  
1915 C CD  . GLN A 248 ? 0.4519 0.4642 0.5910 0.0266  0.0553  -0.0238 249  GLN A CD  
1916 O OE1 . GLN A 248 ? 0.4320 0.4407 0.5510 0.0244  0.0520  -0.0220 249  GLN A OE1 
1917 N NE2 . GLN A 248 ? 0.4205 0.4279 0.5737 0.0298  0.0539  -0.0296 249  GLN A NE2 
1918 N N   . VAL A 249 ? 0.3790 0.4148 0.5348 0.0243  0.0990  -0.0248 250  VAL A N   
1919 C CA  . VAL A 249 ? 0.4039 0.4392 0.5493 0.0221  0.1139  -0.0283 250  VAL A CA  
1920 C C   . VAL A 249 ? 0.4467 0.4700 0.5657 0.0225  0.1197  -0.0351 250  VAL A C   
1921 O O   . VAL A 249 ? 0.4398 0.4588 0.5623 0.0262  0.1190  -0.0420 250  VAL A O   
1922 C CB  . VAL A 249 ? 0.3638 0.4101 0.5386 0.0234  0.1240  -0.0331 250  VAL A CB  
1923 C CG1 . VAL A 249 ? 0.4837 0.5308 0.6797 0.0295  0.1229  -0.0411 250  VAL A CG1 
1924 C CG2 . VAL A 249 ? 0.3705 0.4169 0.5336 0.0199  0.1415  -0.0374 250  VAL A CG2 
1925 N N   . VAL A 250 ? 0.4482 0.4638 0.5388 0.0182  0.1240  -0.0328 251  VAL A N   
1926 C CA  . VAL A 250 ? 0.4298 0.4318 0.4915 0.0173  0.1288  -0.0386 251  VAL A CA  
1927 C C   . VAL A 250 ? 0.4843 0.4837 0.5312 0.0124  0.1448  -0.0411 251  VAL A C   
1928 O O   . VAL A 250 ? 0.5075 0.5113 0.5554 0.0082  0.1476  -0.0349 251  VAL A O   
1929 C CB  . VAL A 250 ? 0.4195 0.4112 0.4562 0.0163  0.1159  -0.0332 251  VAL A CB  
1930 C CG1 . VAL A 250 ? 0.3926 0.3871 0.4427 0.0200  0.1020  -0.0320 251  VAL A CG1 
1931 C CG2 . VAL A 250 ? 0.3854 0.3783 0.4142 0.0128  0.1120  -0.0241 251  VAL A CG2 
1932 N N   . GLU A 251 ? 0.4999 0.4908 0.5311 0.0121  0.1552  -0.0503 252  GLU A N   
1933 C CA  . GLU A 251 ? 0.5850 0.5753 0.6052 0.0068  0.1737  -0.0547 252  GLU A CA  
1934 C C   . GLU A 251 ? 0.5888 0.5704 0.5804 -0.0011 0.1734  -0.0460 252  GLU A C   
1935 O O   . GLU A 251 ? 0.5450 0.5327 0.5403 -0.0066 0.1842  -0.0437 252  GLU A O   
1936 C CB  . GLU A 251 ? 0.6424 0.6220 0.6442 0.0075  0.1838  -0.0667 252  GLU A CB  
1937 C CG  . GLU A 251 ? 0.8304 0.8063 0.8113 0.0001  0.2036  -0.0712 252  GLU A CG  
1938 C CD  . GLU A 251 ? 0.9593 0.9207 0.9133 -0.0001 0.2128  -0.0830 252  GLU A CD  
1939 O OE1 . GLU A 251 ? 0.9449 0.9025 0.9061 0.0069  0.2057  -0.0897 252  GLU A OE1 
1940 O OE2 . GLU A 251 ? 0.9950 0.9475 0.9192 -0.0081 0.2267  -0.0855 252  GLU A OE2 
1941 N N   . ASP A 252 ? 0.5671 0.5343 0.5314 -0.0019 0.1605  -0.0411 253  ASP A N   
1942 C CA  . ASP A 252 ? 0.5680 0.5232 0.5026 -0.0088 0.1579  -0.0333 253  ASP A CA  
1943 C C   . ASP A 252 ? 0.5454 0.5057 0.4909 -0.0079 0.1447  -0.0229 253  ASP A C   
1944 O O   . ASP A 252 ? 0.5592 0.5078 0.4815 -0.0118 0.1380  -0.0162 253  ASP A O   
1945 C CB  . ASP A 252 ? 0.6690 0.6037 0.5663 -0.0104 0.1508  -0.0344 253  ASP A CB  
1946 C CG  . ASP A 252 ? 0.7501 0.6762 0.6297 -0.0124 0.1643  -0.0451 253  ASP A CG  
1947 O OD1 . ASP A 252 ? 0.8087 0.7418 0.6949 -0.0157 0.1824  -0.0501 253  ASP A OD1 
1948 O OD2 . ASP A 252 ? 0.8344 0.7472 0.6945 -0.0108 0.1572  -0.0490 253  ASP A OD2 
1949 N N   . GLY A 253 ? 0.5191 0.4952 0.4984 -0.0030 0.1402  -0.0216 254  GLY A N   
1950 C CA  . GLY A 253 ? 0.4780 0.4586 0.4667 -0.0019 0.1281  -0.0130 254  GLY A CA  
1951 C C   . GLY A 253 ? 0.4536 0.4300 0.4364 0.0025  0.1120  -0.0106 254  GLY A C   
1952 O O   . GLY A 253 ? 0.4528 0.4379 0.4525 0.0054  0.1029  -0.0063 254  GLY A O   
1953 N N   . TYR A 254 ? 0.4881 0.4520 0.4475 0.0027  0.1085  -0.0135 255  TYR A N   
1954 C CA  . TYR A 254 ? 0.4715 0.4337 0.4289 0.0066  0.0938  -0.0121 255  TYR A CA  
1955 C C   . TYR A 254 ? 0.5307 0.4848 0.4767 0.0076  0.0938  -0.0189 255  TYR A C   
1956 O O   . TYR A 254 ? 0.5572 0.5002 0.4828 0.0043  0.1029  -0.0236 255  TYR A O   
1957 C CB  . TYR A 254 ? 0.4318 0.3843 0.3697 0.0056  0.0830  -0.0059 255  TYR A CB  
1958 C CG  . TYR A 254 ? 0.5563 0.4893 0.4596 0.0012  0.0835  -0.0064 255  TYR A CG  
1959 C CD1 . TYR A 254 ? 0.5808 0.5046 0.4664 -0.0051 0.0929  -0.0044 255  TYR A CD1 
1960 C CD2 . TYR A 254 ? 0.5646 0.4874 0.4516 0.0024  0.0739  -0.0083 255  TYR A CD2 
1961 C CE1 . TYR A 254 ? 0.5848 0.4884 0.4349 -0.0105 0.0927  -0.0040 255  TYR A CE1 
1962 C CE2 . TYR A 254 ? 0.6053 0.5080 0.4581 -0.0023 0.0727  -0.0082 255  TYR A CE2 
1963 C CZ  . TYR A 254 ? 0.6014 0.4938 0.4345 -0.0089 0.0821  -0.0059 255  TYR A CZ  
1964 O OH  . TYR A 254 ? 0.6332 0.5037 0.4290 -0.0149 0.0804  -0.0052 255  TYR A OH  
1965 N N   . GLU A 255 ? 0.4651 0.4242 0.4233 0.0116  0.0836  -0.0196 256  GLU A N   
1966 C CA  . GLU A 255 ? 0.4803 0.4314 0.4299 0.0125  0.0819  -0.0261 256  GLU A CA  
1967 C C   . GLU A 255 ? 0.4511 0.4027 0.4015 0.0143  0.0661  -0.0232 256  GLU A C   
1968 O O   . GLU A 255 ? 0.4089 0.3736 0.3806 0.0162  0.0596  -0.0192 256  GLU A O   
1969 C CB  . GLU A 255 ? 0.5059 0.4645 0.4778 0.0152  0.0896  -0.0326 256  GLU A CB  
1970 C CG  . GLU A 255 ? 0.5253 0.4726 0.4856 0.0159  0.0916  -0.0414 256  GLU A CG  
1971 C CD  . GLU A 255 ? 0.6110 0.5641 0.5920 0.0189  0.1027  -0.0492 256  GLU A CD  
1972 O OE1 . GLU A 255 ? 0.7280 0.6827 0.7081 0.0175  0.1174  -0.0528 256  GLU A OE1 
1973 O OE2 . GLU A 255 ? 0.6539 0.6106 0.6538 0.0224  0.0962  -0.0514 256  GLU A OE2 
1974 N N   . PHE A 256 ? 0.4902 0.4276 0.4171 0.0128  0.0602  -0.0254 257  PHE A N   
1975 C CA  . PHE A 256 ? 0.4460 0.3835 0.3733 0.0138  0.0452  -0.0233 257  PHE A CA  
1976 C C   . PHE A 256 ? 0.4780 0.4185 0.4193 0.0151  0.0425  -0.0279 257  PHE A C   
1977 O O   . PHE A 256 ? 0.5495 0.4851 0.4908 0.0155  0.0511  -0.0345 257  PHE A O   
1978 C CB  . PHE A 256 ? 0.5131 0.4325 0.4094 0.0112  0.0379  -0.0235 257  PHE A CB  
1979 C CG  . PHE A 256 ? 0.5562 0.4705 0.4385 0.0098  0.0353  -0.0177 257  PHE A CG  
1980 C CD1 . PHE A 256 ? 0.5408 0.4677 0.4401 0.0126  0.0283  -0.0117 257  PHE A CD1 
1981 C CD2 . PHE A 256 ? 0.5849 0.4805 0.4357 0.0055  0.0397  -0.0183 257  PHE A CD2 
1982 C CE1 . PHE A 256 ? 0.5473 0.4676 0.4344 0.0120  0.0246  -0.0068 257  PHE A CE1 
1983 C CE2 . PHE A 256 ? 0.6125 0.5007 0.4493 0.0038  0.0356  -0.0122 257  PHE A CE2 
1984 C CZ  . PHE A 256 ? 0.5746 0.4750 0.4308 0.0075  0.0275  -0.0065 257  PHE A CZ  
1985 N N   . PHE A 257 ? 0.4802 0.4285 0.4335 0.0154  0.0303  -0.0245 258  PHE A N   
1986 C CA  . PHE A 257 ? 0.4635 0.4132 0.4285 0.0153  0.0249  -0.0273 258  PHE A CA  
1987 C C   . PHE A 257 ? 0.4880 0.4379 0.4500 0.0135  0.0103  -0.0244 258  PHE A C   
1988 O O   . PHE A 257 ? 0.5219 0.4793 0.4857 0.0138  0.0048  -0.0192 258  PHE A O   
1989 C CB  . PHE A 257 ? 0.4020 0.3669 0.3955 0.0165  0.0273  -0.0249 258  PHE A CB  
1990 C CG  . PHE A 257 ? 0.4501 0.4155 0.4563 0.0155  0.0203  -0.0265 258  PHE A CG  
1991 C CD1 . PHE A 257 ? 0.4630 0.4173 0.4676 0.0168  0.0241  -0.0338 258  PHE A CD1 
1992 C CD2 . PHE A 257 ? 0.4337 0.4104 0.4539 0.0130  0.0104  -0.0208 258  PHE A CD2 
1993 C CE1 . PHE A 257 ? 0.4841 0.4366 0.5004 0.0157  0.0162  -0.0349 258  PHE A CE1 
1994 C CE2 . PHE A 257 ? 0.4127 0.3886 0.4437 0.0106  0.0033  -0.0211 258  PHE A CE2 
1995 C CZ  . PHE A 257 ? 0.4254 0.3882 0.4542 0.0121  0.0054  -0.0279 258  PHE A CZ  
1996 N N   . ALA A 258 ? 0.5007 0.4418 0.4582 0.0119  0.0039  -0.0282 259  ALA A N   
1997 C CA  . ALA A 258 ? 0.5180 0.4608 0.4768 0.0093  -0.0106 -0.0256 259  ALA A CA  
1998 C C   . ALA A 258 ? 0.5384 0.4754 0.4796 0.0090  -0.0176 -0.0233 259  ALA A C   
1999 O O   . ALA A 258 ? 0.6306 0.5799 0.5832 0.0091  -0.0258 -0.0183 259  ALA A O   
2000 C CB  . ALA A 258 ? 0.4771 0.4407 0.4636 0.0082  -0.0150 -0.0198 259  ALA A CB  
2001 N N   . LYS A 259 ? 0.5203 0.4377 0.4334 0.0085  -0.0144 -0.0273 260  LYS A N   
2002 C CA  . LYS A 259 ? 0.6094 0.5160 0.5011 0.0075  -0.0229 -0.0250 260  LYS A CA  
2003 C C   . LYS A 259 ? 0.5614 0.4796 0.4621 0.0100  -0.0222 -0.0189 260  LYS A C   
2004 O O   . LYS A 259 ? 0.5568 0.4784 0.4600 0.0108  -0.0340 -0.0151 260  LYS A O   
2005 C CB  . LYS A 259 ? 0.7049 0.6090 0.5966 0.0051  -0.0400 -0.0241 260  LYS A CB  
2006 C CG  . LYS A 259 ? 0.8178 0.6982 0.6821 0.0017  -0.0445 -0.0299 260  LYS A CG  
2007 C CD  . LYS A 259 ? 0.8795 0.7391 0.7095 0.0000  -0.0469 -0.0298 260  LYS A CD  
2008 N N   . ARG A 260 ? 0.5545 0.4789 0.4617 0.0117  -0.0088 -0.0186 261  ARG A N   
2009 C CA  . ARG A 260 ? 0.4692 0.4015 0.3821 0.0139  -0.0066 -0.0136 261  ARG A CA  
2010 C C   . ARG A 260 ? 0.4999 0.4533 0.4403 0.0165  -0.0135 -0.0097 261  ARG A C   
2011 O O   . ARG A 260 ? 0.5063 0.4648 0.4506 0.0190  -0.0162 -0.0062 261  ARG A O   
2012 C CB  . ARG A 260 ? 0.5092 0.4241 0.3949 0.0128  -0.0120 -0.0116 261  ARG A CB  
2013 C CG  . ARG A 260 ? 0.6344 0.5294 0.4905 0.0090  -0.0016 -0.0150 261  ARG A CG  
2014 C CD  . ARG A 260 ? 0.6782 0.5519 0.5022 0.0060  -0.0096 -0.0124 261  ARG A CD  
2015 N NE  . ARG A 260 ? 0.7877 0.6517 0.6015 0.0048  -0.0253 -0.0133 261  ARG A NE  
2016 C CZ  . ARG A 260 ? 0.7858 0.6322 0.5754 0.0008  -0.0255 -0.0183 261  ARG A CZ  
2017 N NH1 . ARG A 260 ? 0.8842 0.7223 0.6664 -0.0005 -0.0417 -0.0184 261  ARG A NH1 
2018 N NH2 . ARG A 260 ? 0.7061 0.5435 0.4797 -0.0019 -0.0096 -0.0237 261  ARG A NH2 
2019 N N   . GLN A 261 ? 0.4512 0.4163 0.4103 0.0155  -0.0164 -0.0104 262  GLN A N   
2020 C CA  . GLN A 261 ? 0.4234 0.4100 0.4083 0.0166  -0.0196 -0.0072 262  GLN A CA  
2021 C C   . GLN A 261 ? 0.4072 0.4050 0.4065 0.0175  -0.0088 -0.0058 262  GLN A C   
2022 O O   . GLN A 261 ? 0.4158 0.4296 0.4320 0.0185  -0.0093 -0.0032 262  GLN A O   
2023 C CB  . GLN A 261 ? 0.4860 0.4799 0.4834 0.0133  -0.0275 -0.0076 262  GLN A CB  
2024 C CG  . GLN A 261 ? 0.5891 0.5763 0.5781 0.0123  -0.0409 -0.0080 262  GLN A CG  
2025 C CD  . GLN A 261 ? 0.5952 0.5900 0.5976 0.0079  -0.0489 -0.0080 262  GLN A CD  
2026 O OE1 . GLN A 261 ? 0.5916 0.5760 0.5874 0.0049  -0.0488 -0.0106 262  GLN A OE1 
2027 N NE2 . GLN A 261 ? 0.6182 0.6314 0.6405 0.0075  -0.0558 -0.0054 262  GLN A NE2 
2028 N N   . LEU A 262 ? 0.4155 0.4053 0.4091 0.0170  0.0009  -0.0080 263  LEU A N   
2029 C CA  . LEU A 262 ? 0.4121 0.4103 0.4183 0.0177  0.0103  -0.0066 263  LEU A CA  
2030 C C   . LEU A 262 ? 0.4194 0.4059 0.4108 0.0184  0.0199  -0.0082 263  LEU A C   
2031 O O   . LEU A 262 ? 0.4386 0.4101 0.4109 0.0175  0.0219  -0.0118 263  LEU A O   
2032 C CB  . LEU A 262 ? 0.3557 0.3590 0.3770 0.0158  0.0121  -0.0077 263  LEU A CB  
2033 C CG  . LEU A 262 ? 0.3364 0.3485 0.3736 0.0159  0.0190  -0.0057 263  LEU A CG  
2034 C CD1 . LEU A 262 ? 0.3199 0.3410 0.3744 0.0129  0.0143  -0.0036 263  LEU A CD1 
2035 C CD2 . LEU A 262 ? 0.3078 0.3109 0.3408 0.0172  0.0288  -0.0093 263  LEU A CD2 
2036 N N   . VAL A 263 ? 0.3819 0.3750 0.3812 0.0194  0.0260  -0.0056 264  VAL A N   
2037 C CA  . VAL A 263 ? 0.3556 0.3409 0.3456 0.0189  0.0364  -0.0065 264  VAL A CA  
2038 C C   . VAL A 263 ? 0.3760 0.3722 0.3864 0.0190  0.0433  -0.0054 264  VAL A C   
2039 O O   . VAL A 263 ? 0.3544 0.3623 0.3796 0.0195  0.0396  -0.0019 264  VAL A O   
2040 C CB  . VAL A 263 ? 0.4617 0.4392 0.4355 0.0190  0.0350  -0.0034 264  VAL A CB  
2041 C CG1 . VAL A 263 ? 0.4386 0.4275 0.4258 0.0212  0.0310  0.0007  264  VAL A CG1 
2042 C CG2 . VAL A 263 ? 0.4777 0.4451 0.4380 0.0165  0.0462  -0.0043 264  VAL A CG2 
2043 N N   . THR A 264 ? 0.3298 0.3221 0.3411 0.0183  0.0531  -0.0088 265  THR A N   
2044 C CA  . THR A 264 ? 0.3187 0.3200 0.3494 0.0183  0.0596  -0.0079 265  THR A CA  
204