data_6GR2
# 
_entry.id   6GR2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6GR2         
WWPDB D_1200010428 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          1WUU 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6GR2 
_pdbx_database_status.recvd_initial_deposition_date   2018-06-08 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bezerra, G.A.'                        1  ? 
'Mackinnon, S.'                        2  ? 
'Williams, E.'                         3  ? 
'Zhang, M.'                            4  ? 
'Arrowsmith, C.'                       5  ? 
'Edwards, A.'                          6  ? 
'Bountra, C.'                          7  ? 
'Lai, K.'                              8  ? 
'Yue, W.W.'                            9  ? 
'Structural Genomics Consortium (SGC)' 10 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Structure of human galactokinase in complex with galactose and ADP' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bezerra, G.A.'  1 ? 
primary 'Mackinnon, S.'  2 ? 
primary 'Williams, E.'   3 ? 
primary 'Zhang, M.'      4 ? 
primary 'Arrowsmith, C.' 5 ? 
primary 'Edwards, A.'    6 ? 
primary 'Bountra, C.'    7 ? 
primary 'Lai, K.'        8 ? 
primary 'Yue, W.W.'      9 ? 
# 
_cell.angle_alpha                  113.850 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   102.260 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  101.290 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6GR2 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     78.217 
_cell.length_a_esd                 ? 
_cell.length_b                     110.320 
_cell.length_b_esd                 ? 
_cell.length_c                     118.234 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6GR2 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Galactokinase              43102.977 8   2.7.1.6 ? ? ? 
2 non-polymer man beta-D-galactopyranose     180.156   8   ?       ? ? ? 
3 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE" 427.201   8   ?       ? ? ? 
4 non-polymer syn 'SULFATE ION'              96.063    5   ?       ? ? ? 
5 water       nat water                      18.015    103 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Galactose kinase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAHHHHHHAALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVGSPRKDGLV
SLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVATYTFL
QQLCPDSGTIAARAQVCQQAEHSFAGMPCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLAS
SEYPVRRRQCEEVARALGAASLREVQLEELEAARDLVSKEGFRRARHVVGEIRRTAQAAAALRRGDYRAFGRLMVESHRS
LRDDYEVSCPELDQLVEAALAVPGVYGSRMTGGGFGGCTVTLLEASAAPHAMRHIQEHYGGTATFYLSQAADGAKVLCL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAHHHHHHAALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVGSPRKDGLV
SLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVATYTFL
QQLCPDSGTIAARAQVCQQAEHSFAGMPCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLAS
SEYPVRRRQCEEVARALGAASLREVQLEELEAARDLVSKEGFRRARHVVGEIRRTAQAAAALRRGDYRAFGRLMVESHRS
LRDDYEVSCPELDQLVEAALAVPGVYGSRMTGGGFGGCTVTLLEASAAPHAMRHIQEHYGGTATFYLSQAADGAKVLCL
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   ALA n 
1 10  ALA n 
1 11  LEU n 
1 12  ARG n 
1 13  GLN n 
1 14  PRO n 
1 15  GLN n 
1 16  VAL n 
1 17  ALA n 
1 18  GLU n 
1 19  LEU n 
1 20  LEU n 
1 21  ALA n 
1 22  GLU n 
1 23  ALA n 
1 24  ARG n 
1 25  ARG n 
1 26  ALA n 
1 27  PHE n 
1 28  ARG n 
1 29  GLU n 
1 30  GLU n 
1 31  PHE n 
1 32  GLY n 
1 33  ALA n 
1 34  GLU n 
1 35  PRO n 
1 36  GLU n 
1 37  LEU n 
1 38  ALA n 
1 39  VAL n 
1 40  SER n 
1 41  ALA n 
1 42  PRO n 
1 43  GLY n 
1 44  ARG n 
1 45  VAL n 
1 46  ASN n 
1 47  LEU n 
1 48  ILE n 
1 49  GLY n 
1 50  GLU n 
1 51  HIS n 
1 52  THR n 
1 53  ASP n 
1 54  TYR n 
1 55  ASN n 
1 56  GLN n 
1 57  GLY n 
1 58  LEU n 
1 59  VAL n 
1 60  LEU n 
1 61  PRO n 
1 62  MET n 
1 63  ALA n 
1 64  LEU n 
1 65  GLU n 
1 66  LEU n 
1 67  MET n 
1 68  THR n 
1 69  VAL n 
1 70  LEU n 
1 71  VAL n 
1 72  GLY n 
1 73  SER n 
1 74  PRO n 
1 75  ARG n 
1 76  LYS n 
1 77  ASP n 
1 78  GLY n 
1 79  LEU n 
1 80  VAL n 
1 81  SER n 
1 82  LEU n 
1 83  LEU n 
1 84  THR n 
1 85  THR n 
1 86  SER n 
1 87  GLU n 
1 88  GLY n 
1 89  ALA n 
1 90  ASP n 
1 91  GLU n 
1 92  PRO n 
1 93  GLN n 
1 94  ARG n 
1 95  LEU n 
1 96  GLN n 
1 97  PHE n 
1 98  PRO n 
1 99  LEU n 
1 100 PRO n 
1 101 THR n 
1 102 ALA n 
1 103 GLN n 
1 104 ARG n 
1 105 SER n 
1 106 LEU n 
1 107 GLU n 
1 108 PRO n 
1 109 GLY n 
1 110 THR n 
1 111 PRO n 
1 112 ARG n 
1 113 TRP n 
1 114 ALA n 
1 115 ASN n 
1 116 TYR n 
1 117 VAL n 
1 118 LYS n 
1 119 GLY n 
1 120 VAL n 
1 121 ILE n 
1 122 GLN n 
1 123 TYR n 
1 124 TYR n 
1 125 PRO n 
1 126 ALA n 
1 127 ALA n 
1 128 PRO n 
1 129 LEU n 
1 130 PRO n 
1 131 GLY n 
1 132 PHE n 
1 133 SER n 
1 134 ALA n 
1 135 VAL n 
1 136 VAL n 
1 137 VAL n 
1 138 SER n 
1 139 SER n 
1 140 VAL n 
1 141 PRO n 
1 142 LEU n 
1 143 GLY n 
1 144 GLY n 
1 145 GLY n 
1 146 LEU n 
1 147 SER n 
1 148 SER n 
1 149 SER n 
1 150 ALA n 
1 151 SER n 
1 152 LEU n 
1 153 GLU n 
1 154 VAL n 
1 155 ALA n 
1 156 THR n 
1 157 TYR n 
1 158 THR n 
1 159 PHE n 
1 160 LEU n 
1 161 GLN n 
1 162 GLN n 
1 163 LEU n 
1 164 CYS n 
1 165 PRO n 
1 166 ASP n 
1 167 SER n 
1 168 GLY n 
1 169 THR n 
1 170 ILE n 
1 171 ALA n 
1 172 ALA n 
1 173 ARG n 
1 174 ALA n 
1 175 GLN n 
1 176 VAL n 
1 177 CYS n 
1 178 GLN n 
1 179 GLN n 
1 180 ALA n 
1 181 GLU n 
1 182 HIS n 
1 183 SER n 
1 184 PHE n 
1 185 ALA n 
1 186 GLY n 
1 187 MET n 
1 188 PRO n 
1 189 CYS n 
1 190 GLY n 
1 191 ILE n 
1 192 MET n 
1 193 ASP n 
1 194 GLN n 
1 195 PHE n 
1 196 ILE n 
1 197 SER n 
1 198 LEU n 
1 199 MET n 
1 200 GLY n 
1 201 GLN n 
1 202 LYS n 
1 203 GLY n 
1 204 HIS n 
1 205 ALA n 
1 206 LEU n 
1 207 LEU n 
1 208 ILE n 
1 209 ASP n 
1 210 CYS n 
1 211 ARG n 
1 212 SER n 
1 213 LEU n 
1 214 GLU n 
1 215 THR n 
1 216 SER n 
1 217 LEU n 
1 218 VAL n 
1 219 PRO n 
1 220 LEU n 
1 221 SER n 
1 222 ASP n 
1 223 PRO n 
1 224 LYS n 
1 225 LEU n 
1 226 ALA n 
1 227 VAL n 
1 228 LEU n 
1 229 ILE n 
1 230 THR n 
1 231 ASN n 
1 232 SER n 
1 233 ASN n 
1 234 VAL n 
1 235 ARG n 
1 236 HIS n 
1 237 SER n 
1 238 LEU n 
1 239 ALA n 
1 240 SER n 
1 241 SER n 
1 242 GLU n 
1 243 TYR n 
1 244 PRO n 
1 245 VAL n 
1 246 ARG n 
1 247 ARG n 
1 248 ARG n 
1 249 GLN n 
1 250 CYS n 
1 251 GLU n 
1 252 GLU n 
1 253 VAL n 
1 254 ALA n 
1 255 ARG n 
1 256 ALA n 
1 257 LEU n 
1 258 GLY n 
1 259 ALA n 
1 260 ALA n 
1 261 SER n 
1 262 LEU n 
1 263 ARG n 
1 264 GLU n 
1 265 VAL n 
1 266 GLN n 
1 267 LEU n 
1 268 GLU n 
1 269 GLU n 
1 270 LEU n 
1 271 GLU n 
1 272 ALA n 
1 273 ALA n 
1 274 ARG n 
1 275 ASP n 
1 276 LEU n 
1 277 VAL n 
1 278 SER n 
1 279 LYS n 
1 280 GLU n 
1 281 GLY n 
1 282 PHE n 
1 283 ARG n 
1 284 ARG n 
1 285 ALA n 
1 286 ARG n 
1 287 HIS n 
1 288 VAL n 
1 289 VAL n 
1 290 GLY n 
1 291 GLU n 
1 292 ILE n 
1 293 ARG n 
1 294 ARG n 
1 295 THR n 
1 296 ALA n 
1 297 GLN n 
1 298 ALA n 
1 299 ALA n 
1 300 ALA n 
1 301 ALA n 
1 302 LEU n 
1 303 ARG n 
1 304 ARG n 
1 305 GLY n 
1 306 ASP n 
1 307 TYR n 
1 308 ARG n 
1 309 ALA n 
1 310 PHE n 
1 311 GLY n 
1 312 ARG n 
1 313 LEU n 
1 314 MET n 
1 315 VAL n 
1 316 GLU n 
1 317 SER n 
1 318 HIS n 
1 319 ARG n 
1 320 SER n 
1 321 LEU n 
1 322 ARG n 
1 323 ASP n 
1 324 ASP n 
1 325 TYR n 
1 326 GLU n 
1 327 VAL n 
1 328 SER n 
1 329 CYS n 
1 330 PRO n 
1 331 GLU n 
1 332 LEU n 
1 333 ASP n 
1 334 GLN n 
1 335 LEU n 
1 336 VAL n 
1 337 GLU n 
1 338 ALA n 
1 339 ALA n 
1 340 LEU n 
1 341 ALA n 
1 342 VAL n 
1 343 PRO n 
1 344 GLY n 
1 345 VAL n 
1 346 TYR n 
1 347 GLY n 
1 348 SER n 
1 349 ARG n 
1 350 MET n 
1 351 THR n 
1 352 GLY n 
1 353 GLY n 
1 354 GLY n 
1 355 PHE n 
1 356 GLY n 
1 357 GLY n 
1 358 CYS n 
1 359 THR n 
1 360 VAL n 
1 361 THR n 
1 362 LEU n 
1 363 LEU n 
1 364 GLU n 
1 365 ALA n 
1 366 SER n 
1 367 ALA n 
1 368 ALA n 
1 369 PRO n 
1 370 HIS n 
1 371 ALA n 
1 372 MET n 
1 373 ARG n 
1 374 HIS n 
1 375 ILE n 
1 376 GLN n 
1 377 GLU n 
1 378 HIS n 
1 379 TYR n 
1 380 GLY n 
1 381 GLY n 
1 382 THR n 
1 383 ALA n 
1 384 THR n 
1 385 PHE n 
1 386 TYR n 
1 387 LEU n 
1 388 SER n 
1 389 GLN n 
1 390 ALA n 
1 391 ALA n 
1 392 ASP n 
1 393 GLY n 
1 394 ALA n 
1 395 LYS n 
1 396 VAL n 
1 397 LEU n 
1 398 CYS n 
1 399 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   399 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'GALK1, GALK' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GALK1_HUMAN 
_struct_ref.pdbx_db_accession          P51570 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVGSPRKDGLVSLLTTSEG
ADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVATYTFLQQLCPDSG
TIAARAQVCQQAEHSFAGMPCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRRR
QCEEVARALGKESLREVQLEELEAARDLVSKEGFRRARHVVGEIRRTAQAAAALRRGDYRAFGRLMVESHRSLRDDYEVS
CPELDQLVEAALAVPGVYGSRMTGGGFGGCTVTLLEASAAPHAMRHIQEHYGGTATFYLSQAADGAKVLCL
;
_struct_ref.pdbx_align_begin           2 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6GR2 A 9 ? 399 ? P51570 2 ? 392 ? 2 392 
2 1 6GR2 B 9 ? 399 ? P51570 2 ? 392 ? 2 392 
3 1 6GR2 C 9 ? 399 ? P51570 2 ? 392 ? 2 392 
4 1 6GR2 D 9 ? 399 ? P51570 2 ? 392 ? 2 392 
5 1 6GR2 E 9 ? 399 ? P51570 2 ? 392 ? 2 392 
6 1 6GR2 F 9 ? 399 ? P51570 2 ? 392 ? 2 392 
7 1 6GR2 G 9 ? 399 ? P51570 2 ? 392 ? 2 392 
8 1 6GR2 H 9 ? 399 ? P51570 2 ? 392 ? 2 392 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6GR2 MET A 1   ? UNP P51570 ?   ?   'initiating methionine' -6  1  
1 6GR2 ALA A 2   ? UNP P51570 ?   ?   'expression tag'        -5  2  
1 6GR2 HIS A 3   ? UNP P51570 ?   ?   'expression tag'        -4  3  
1 6GR2 HIS A 4   ? UNP P51570 ?   ?   'expression tag'        -3  4  
1 6GR2 HIS A 5   ? UNP P51570 ?   ?   'expression tag'        -2  5  
1 6GR2 HIS A 6   ? UNP P51570 ?   ?   'expression tag'        -1  6  
1 6GR2 HIS A 7   ? UNP P51570 ?   ?   'expression tag'        0   7  
1 6GR2 HIS A 8   ? UNP P51570 ?   ?   'expression tag'        1   8  
1 6GR2 ALA A 259 ? UNP P51570 LYS 252 conflict                252 9  
1 6GR2 ALA A 260 ? UNP P51570 GLU 253 conflict                253 10 
2 6GR2 MET B 1   ? UNP P51570 ?   ?   'initiating methionine' -6  11 
2 6GR2 ALA B 2   ? UNP P51570 ?   ?   'expression tag'        -5  12 
2 6GR2 HIS B 3   ? UNP P51570 ?   ?   'expression tag'        -4  13 
2 6GR2 HIS B 4   ? UNP P51570 ?   ?   'expression tag'        -3  14 
2 6GR2 HIS B 5   ? UNP P51570 ?   ?   'expression tag'        -2  15 
2 6GR2 HIS B 6   ? UNP P51570 ?   ?   'expression tag'        -1  16 
2 6GR2 HIS B 7   ? UNP P51570 ?   ?   'expression tag'        0   17 
2 6GR2 HIS B 8   ? UNP P51570 ?   ?   'expression tag'        1   18 
2 6GR2 ALA B 259 ? UNP P51570 LYS 252 conflict                252 19 
2 6GR2 ALA B 260 ? UNP P51570 GLU 253 conflict                253 20 
3 6GR2 MET C 1   ? UNP P51570 ?   ?   'initiating methionine' -6  21 
3 6GR2 ALA C 2   ? UNP P51570 ?   ?   'expression tag'        -5  22 
3 6GR2 HIS C 3   ? UNP P51570 ?   ?   'expression tag'        -4  23 
3 6GR2 HIS C 4   ? UNP P51570 ?   ?   'expression tag'        -3  24 
3 6GR2 HIS C 5   ? UNP P51570 ?   ?   'expression tag'        -2  25 
3 6GR2 HIS C 6   ? UNP P51570 ?   ?   'expression tag'        -1  26 
3 6GR2 HIS C 7   ? UNP P51570 ?   ?   'expression tag'        0   27 
3 6GR2 HIS C 8   ? UNP P51570 ?   ?   'expression tag'        1   28 
3 6GR2 ALA C 259 ? UNP P51570 LYS 252 conflict                252 29 
3 6GR2 ALA C 260 ? UNP P51570 GLU 253 conflict                253 30 
4 6GR2 MET D 1   ? UNP P51570 ?   ?   'initiating methionine' -6  31 
4 6GR2 ALA D 2   ? UNP P51570 ?   ?   'expression tag'        -5  32 
4 6GR2 HIS D 3   ? UNP P51570 ?   ?   'expression tag'        -4  33 
4 6GR2 HIS D 4   ? UNP P51570 ?   ?   'expression tag'        -3  34 
4 6GR2 HIS D 5   ? UNP P51570 ?   ?   'expression tag'        -2  35 
4 6GR2 HIS D 6   ? UNP P51570 ?   ?   'expression tag'        -1  36 
4 6GR2 HIS D 7   ? UNP P51570 ?   ?   'expression tag'        0   37 
4 6GR2 HIS D 8   ? UNP P51570 ?   ?   'expression tag'        1   38 
4 6GR2 ALA D 259 ? UNP P51570 LYS 252 conflict                252 39 
4 6GR2 ALA D 260 ? UNP P51570 GLU 253 conflict                253 40 
5 6GR2 MET E 1   ? UNP P51570 ?   ?   'initiating methionine' -6  41 
5 6GR2 ALA E 2   ? UNP P51570 ?   ?   'expression tag'        -5  42 
5 6GR2 HIS E 3   ? UNP P51570 ?   ?   'expression tag'        -4  43 
5 6GR2 HIS E 4   ? UNP P51570 ?   ?   'expression tag'        -3  44 
5 6GR2 HIS E 5   ? UNP P51570 ?   ?   'expression tag'        -2  45 
5 6GR2 HIS E 6   ? UNP P51570 ?   ?   'expression tag'        -1  46 
5 6GR2 HIS E 7   ? UNP P51570 ?   ?   'expression tag'        0   47 
5 6GR2 HIS E 8   ? UNP P51570 ?   ?   'expression tag'        1   48 
5 6GR2 ALA E 259 ? UNP P51570 LYS 252 conflict                252 49 
5 6GR2 ALA E 260 ? UNP P51570 GLU 253 conflict                253 50 
6 6GR2 MET F 1   ? UNP P51570 ?   ?   'initiating methionine' -6  51 
6 6GR2 ALA F 2   ? UNP P51570 ?   ?   'expression tag'        -5  52 
6 6GR2 HIS F 3   ? UNP P51570 ?   ?   'expression tag'        -4  53 
6 6GR2 HIS F 4   ? UNP P51570 ?   ?   'expression tag'        -3  54 
6 6GR2 HIS F 5   ? UNP P51570 ?   ?   'expression tag'        -2  55 
6 6GR2 HIS F 6   ? UNP P51570 ?   ?   'expression tag'        -1  56 
6 6GR2 HIS F 7   ? UNP P51570 ?   ?   'expression tag'        0   57 
6 6GR2 HIS F 8   ? UNP P51570 ?   ?   'expression tag'        1   58 
6 6GR2 ALA F 259 ? UNP P51570 LYS 252 conflict                252 59 
6 6GR2 ALA F 260 ? UNP P51570 GLU 253 conflict                253 60 
7 6GR2 MET G 1   ? UNP P51570 ?   ?   'initiating methionine' -6  61 
7 6GR2 ALA G 2   ? UNP P51570 ?   ?   'expression tag'        -5  62 
7 6GR2 HIS G 3   ? UNP P51570 ?   ?   'expression tag'        -4  63 
7 6GR2 HIS G 4   ? UNP P51570 ?   ?   'expression tag'        -3  64 
7 6GR2 HIS G 5   ? UNP P51570 ?   ?   'expression tag'        -2  65 
7 6GR2 HIS G 6   ? UNP P51570 ?   ?   'expression tag'        -1  66 
7 6GR2 HIS G 7   ? UNP P51570 ?   ?   'expression tag'        0   67 
7 6GR2 HIS G 8   ? UNP P51570 ?   ?   'expression tag'        1   68 
7 6GR2 ALA G 259 ? UNP P51570 LYS 252 conflict                252 69 
7 6GR2 ALA G 260 ? UNP P51570 GLU 253 conflict                253 70 
8 6GR2 MET H 1   ? UNP P51570 ?   ?   'initiating methionine' -6  71 
8 6GR2 ALA H 2   ? UNP P51570 ?   ?   'expression tag'        -5  72 
8 6GR2 HIS H 3   ? UNP P51570 ?   ?   'expression tag'        -4  73 
8 6GR2 HIS H 4   ? UNP P51570 ?   ?   'expression tag'        -3  74 
8 6GR2 HIS H 5   ? UNP P51570 ?   ?   'expression tag'        -2  75 
8 6GR2 HIS H 6   ? UNP P51570 ?   ?   'expression tag'        -1  76 
8 6GR2 HIS H 7   ? UNP P51570 ?   ?   'expression tag'        0   77 
8 6GR2 HIS H 8   ? UNP P51570 ?   ?   'expression tag'        1   78 
8 6GR2 ALA H 259 ? UNP P51570 LYS 252 conflict                252 79 
8 6GR2 ALA H 260 ? UNP P51570 GLU 253 conflict                253 80 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer                  n "ADENOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking'          y ALANINE                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking'          y ARGININE                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking'          y ASPARAGINE                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'            ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking'          y CYSTEINE                   ? 'C3 H7 N O2 S'      121.158 
GAL 'D-saccharide, beta linking' . beta-D-galactopyranose     ? 'C6 H12 O6'         180.156 
GLN 'L-peptide linking'          y GLUTAMINE                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'            y GLYCINE                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking'          y HISTIDINE                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer                  . WATER                      ? 'H2 O'              18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking'          y LEUCINE                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking'          y LYSINE                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking'          y METHIONINE                 ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking'          y PHENYLALANINE              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking'          y PROLINE                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking'          y SERINE                     ? 'C3 H7 N O3'        105.093 
SO4 non-polymer                  . 'SULFATE ION'              ? 'O4 S -2'           96.063  
THR 'L-peptide linking'          y THREONINE                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking'          y TYROSINE                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking'          y VALINE                     ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6GR2 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.51 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         50.97 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1M cacodylate pH 6.3, 17.5% PEG8K -- 0.2M ammonium sulfate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-04-13 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97619 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I03' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97619 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I03 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            43.670 
_reflns.entry_id                         6GR2 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.490 
_reflns.d_resolution_low                 95.760 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       114333 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             97.500 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.500 
_reflns.pdbx_Rmerge_I_obs                0.125 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            4.200 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             46 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.156 
_reflns.pdbx_Rpim_I_all                  0.093 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         281718 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.949 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.490  2.550  ? ? 20892 ? ? ? 8425 97.300 ? ? ? ? 0.690 ? ? ? ? ? ? ? ? 2.500 ? ? ? 1.500 0.870 0.522 ? 1 1 0.603 ? 
11.140 95.760 ? ? 3253  ? ? ? 1294 99.400 ? ? ? ? 0.066 ? ? ? ? ? ? ? ? 2.500 ? ? ? 7.900 0.084 0.051 ? 2 1 0.965 ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                165.920 
_refine.B_iso_mean                               58.7349 
_refine.B_iso_min                                20.950 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6GR2 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.4900 
_refine.ls_d_res_low                             54.0920 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     114213 
_refine.ls_number_reflns_R_free                  5727 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    97.2700 
_refine.ls_percent_reflns_R_free                 5.0100 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2230 
_refine.ls_R_factor_R_free                       0.2556 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2213 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.960 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1WUU 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 30.3200 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3600 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.4900 
_refine_hist.d_res_low                        54.0920 
_refine_hist.pdbx_number_atoms_ligand         433 
_refine_hist.number_atoms_solvent             103 
_refine_hist.number_atoms_total               23001 
_refine_hist.pdbx_number_residues_total       3066 
_refine_hist.pdbx_B_iso_mean_ligand           62.01 
_refine_hist.pdbx_B_iso_mean_solvent          44.23 
_refine_hist.pdbx_number_atoms_protein        22465 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 'X-RAY DIFFRACTION' 1 1 TORSIONAL A 12906 10.180 ? ? ? ? ? 
2 'X-RAY DIFFRACTION' 1 2 TORSIONAL B 12906 10.180 ? ? ? ? ? 
3 'X-RAY DIFFRACTION' 1 3 TORSIONAL C 12906 10.180 ? ? ? ? ? 
4 'X-RAY DIFFRACTION' 1 4 TORSIONAL D 12906 10.180 ? ? ? ? ? 
5 'X-RAY DIFFRACTION' 1 5 TORSIONAL E 12906 10.180 ? ? ? ? ? 
6 'X-RAY DIFFRACTION' 1 6 TORSIONAL F 12906 10.180 ? ? ? ? ? 
7 'X-RAY DIFFRACTION' 1 7 TORSIONAL G 12906 10.180 ? ? ? ? ? 
8 'X-RAY DIFFRACTION' 1 8 TORSIONAL H 12906 10.180 ? ? ? ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.4898 2.5181  3664 . 185 3479 94.0000 . . . 0.3281 0.0000 0.3175 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.5181 2.5477  3816 . 178 3638 97.0000 . . . 0.3610 0.0000 0.3134 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.5477 2.5788  3754 . 190 3564 97.0000 . . . 0.3338 0.0000 0.3023 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.5788 2.6114  3854 . 193 3661 97.0000 . . . 0.3780 0.0000 0.3124 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.6114 2.6458  3749 . 187 3562 97.0000 . . . 0.3111 0.0000 0.3032 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.6458 2.6820  3803 . 197 3606 97.0000 . . . 0.3529 0.0000 0.3072 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.6820 2.7203  3827 . 184 3643 97.0000 . . . 0.3602 0.0000 0.2964 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.7203 2.7609  3802 . 180 3622 97.0000 . . . 0.3377 0.0000 0.2951 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.7609 2.8041  3799 . 208 3591 97.0000 . . . 0.3357 0.0000 0.3004 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.8041 2.8500  3798 . 198 3600 97.0000 . . . 0.3319 0.0000 0.2887 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.8500 2.8992  3861 . 181 3680 97.0000 . . . 0.3494 0.0000 0.2861 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.8992 2.9519  3753 . 182 3571 97.0000 . . . 0.2966 0.0000 0.2726 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 2.9519 3.0087  3838 . 188 3650 97.0000 . . . 0.3013 0.0000 0.2641 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.0087 3.0701  3792 . 190 3602 97.0000 . . . 0.2978 0.0000 0.2483 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.0701 3.1368  3819 . 231 3588 97.0000 . . . 0.2901 0.0000 0.2576 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.1368 3.2098  3799 . 209 3590 97.0000 . . . 0.2709 0.0000 0.2563 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.2098 3.2900  3785 . 195 3590 97.0000 . . . 0.2971 0.0000 0.2595 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.2900 3.3790  3824 . 180 3644 97.0000 . . . 0.3089 0.0000 0.2556 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.3790 3.4784  3805 . 221 3584 97.0000 . . . 0.2771 0.0000 0.2430 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.4784 3.5906  3804 . 192 3612 97.0000 . . . 0.2438 0.0000 0.2302 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.5906 3.7189  3792 . 198 3594 97.0000 . . . 0.2662 0.0000 0.2083 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.7189 3.8678  3779 . 171 3608 97.0000 . . . 0.2677 0.0000 0.2088 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 3.8678 4.0438  3825 . 147 3678 98.0000 . . . 0.2171 0.0000 0.2023 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 4.0438 4.2569  3875 . 206 3669 98.0000 . . . 0.2320 0.0000 0.1856 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 4.2569 4.5235  3855 . 229 3626 99.0000 . . . 0.1969 0.0000 0.1728 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 4.5235 4.8725  3862 . 245 3617 98.0000 . . . 0.2106 0.0000 0.1655 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 4.8725 5.3625  3820 . 177 3643 98.0000 . . . 0.1913 0.0000 0.1743 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 5.3625 6.1375  3869 . 174 3695 98.0000 . . . 0.2191 0.0000 0.1899 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 6.1375 7.7290  3816 . 145 3671 97.0000 . . . 0.2137 0.0000 0.1854 . . . . . . 30 . . . 
'X-RAY DIFFRACTION' 7.7290 54.1050 3774 . 166 3608 97.0000 . . . 0.1826 0.0000 0.1695 . . . . . . 30 . . . 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 
;(chain A and (resid 6 through 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or (resid 84 and (name N or name CA or name C or name O or name CB )) or resid 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 95 or (resid 96 through 97 and (name N or name CA or name C or name O or name CB )) or resid 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 104 or (resid 105 and (name N or name CA or name C or name O or name CB )) or resid 106 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 216 or (resid 217 and (name N or name CA or name C or name O or name CB )) or resid 218 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 247 or (resid 248 through 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 362 or (resid 363 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
1 2 
;(chain B and (resid 6 through 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 or (resid 18 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 69 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or resid 84 through 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 104 or (resid 105 and (name N or name CA or name C or name O or name CB )) or resid 106 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 216 or (resid 217 and (name N or name CA or name C or name O or name CB )) or resid 218 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 247 or (resid 248 through 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 362 or (resid 363 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
1 3 
;(chain C and ((resid 6 and (name N or name CA or name C or name O or name CB )) or resid 7 through 8 or (resid 9 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 69 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or (resid 84 and (name N or name CA or name C or name O or name CB )) or resid 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 104 or (resid 105 and (name N or name CA or name C or name O or name CB )) or resid 106 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 247 or (resid 248 through 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 356 or (resid 357 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 364 or (resid 365 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
1 4 
;(chain D and (resid 6 through 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 17 or (resid 18 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 69 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or (resid 84 and (name N or name CA or name C or name O or name CB )) or resid 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 104 or (resid 105 and (name N or name CA or name C or name O or name CB )) or resid 106 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 249 or (resid 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 364 or (resid 365 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
1 5 
;(chain E and ((resid 6 and (name N or name CA or name C or name O or name CB )) or resid 7 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or (resid 84 and (name N or name CA or name C or name O or name CB )) or resid 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or resid 234 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 247 or (resid 248 through 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 362 or (resid 363 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
1 6 
;(chain F and ((resid 6 and (name N or name CA or name C or name O or name CB )) or resid 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 17 or (resid 18 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or resid 84 through 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 104 or (resid 105 and (name N or name CA or name C or name O or name CB )) or resid 106 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 249 or (resid 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 362 or (resid 363 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
1 7 
;(chain G and (resid 6 through 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 69 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or (resid 84 and (name N or name CA or name C or name O or name CB )) or resid 85 through 86 or (resid 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 249 or (resid 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 through 329 or (resid 330 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 370 or (resid 371 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 401))
;
1 8 
;(chain H and (resid 6 through 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 or (resid 18 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 82 or resid 84 through 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 244 or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 249 or (resid 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 364 or (resid 365 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 1 ? A 6 A 7   
;(chain A and (resid 6 through 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or (resid 84 and (name N or name CA or name C or name O or name CB )) or resid 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 95 or (resid 96 through 97 and (name N or name CA or name C or name O or name CB )) or resid 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 104 or (resid 105 and (name N or name CA or name C or name O or name CB )) or resid 106 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 216 or (resid 217 and (name N or name CA or name C or name O or name CB )) or resid 218 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 247 or (resid 248 through 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 362 or (resid 363 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 1 2 ? A 8 A 10  
;(chain A and (resid 6 through 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or (resid 84 and (name N or name CA or name C or name O or name CB )) or resid 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 95 or (resid 96 through 97 and (name N or name CA or name C or name O or name CB )) or resid 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 104 or (resid 105 and (name N or name CA or name C or name O or name CB )) or resid 106 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 216 or (resid 217 and (name N or name CA or name C or name O or name CB )) or resid 218 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 247 or (resid 248 through 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 362 or (resid 363 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 1 3 ? A 4 A 401 
;(chain A and (resid 6 through 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or (resid 84 and (name N or name CA or name C or name O or name CB )) or resid 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 95 or (resid 96 through 97 and (name N or name CA or name C or name O or name CB )) or resid 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 104 or (resid 105 and (name N or name CA or name C or name O or name CB )) or resid 106 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 216 or (resid 217 and (name N or name CA or name C or name O or name CB )) or resid 218 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 247 or (resid 248 through 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 362 or (resid 363 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 1 4 ? A 4 A 401 
;(chain A and (resid 6 through 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or (resid 84 and (name N or name CA or name C or name O or name CB )) or resid 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 95 or (resid 96 through 97 and (name N or name CA or name C or name O or name CB )) or resid 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 104 or (resid 105 and (name N or name CA or name C or name O or name CB )) or resid 106 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 216 or (resid 217 and (name N or name CA or name C or name O or name CB )) or resid 218 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 247 or (resid 248 through 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 362 or (resid 363 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 1 5 ? A 4 A 401 
;(chain A and (resid 6 through 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or (resid 84 and (name N or name CA or name C or name O or name CB )) or resid 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 95 or (resid 96 through 97 and (name N or name CA or name C or name O or name CB )) or resid 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 104 or (resid 105 and (name N or name CA or name C or name O or name CB )) or resid 106 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 216 or (resid 217 and (name N or name CA or name C or name O or name CB )) or resid 218 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 247 or (resid 248 through 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 362 or (resid 363 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 1 6 ? A 4 A 401 
;(chain A and (resid 6 through 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or (resid 84 and (name N or name CA or name C or name O or name CB )) or resid 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 95 or (resid 96 through 97 and (name N or name CA or name C or name O or name CB )) or resid 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 104 or (resid 105 and (name N or name CA or name C or name O or name CB )) or resid 106 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 216 or (resid 217 and (name N or name CA or name C or name O or name CB )) or resid 218 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 247 or (resid 248 through 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 362 or (resid 363 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 2 1 ? B 6 B 7   
;(chain B and (resid 6 through 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 or (resid 18 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 69 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or resid 84 through 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 104 or (resid 105 and (name N or name CA or name C or name O or name CB )) or resid 106 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 216 or (resid 217 and (name N or name CA or name C or name O or name CB )) or resid 218 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 247 or (resid 248 through 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 362 or (resid 363 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 2 2 ? B 8 B 10  
;(chain B and (resid 6 through 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 or (resid 18 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 69 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or resid 84 through 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 104 or (resid 105 and (name N or name CA or name C or name O or name CB )) or resid 106 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 216 or (resid 217 and (name N or name CA or name C or name O or name CB )) or resid 218 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 247 or (resid 248 through 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 362 or (resid 363 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 2 3 ? B 6 B 401 
;(chain B and (resid 6 through 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 or (resid 18 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 69 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or resid 84 through 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 104 or (resid 105 and (name N or name CA or name C or name O or name CB )) or resid 106 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 216 or (resid 217 and (name N or name CA or name C or name O or name CB )) or resid 218 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 247 or (resid 248 through 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 362 or (resid 363 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 3 1 ? C 6 C 6   
;(chain C and ((resid 6 and (name N or name CA or name C or name O or name CB )) or resid 7 through 8 or (resid 9 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 69 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or (resid 84 and (name N or name CA or name C or name O or name CB )) or resid 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 104 or (resid 105 and (name N or name CA or name C or name O or name CB )) or resid 106 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 247 or (resid 248 through 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 356 or (resid 357 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 364 or (resid 365 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 3 2 ? C 4 C 401 
;(chain C and ((resid 6 and (name N or name CA or name C or name O or name CB )) or resid 7 through 8 or (resid 9 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 69 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or (resid 84 and (name N or name CA or name C or name O or name CB )) or resid 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 104 or (resid 105 and (name N or name CA or name C or name O or name CB )) or resid 106 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 247 or (resid 248 through 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 356 or (resid 357 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 364 or (resid 365 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 3 3 ? C 4 C 401 
;(chain C and ((resid 6 and (name N or name CA or name C or name O or name CB )) or resid 7 through 8 or (resid 9 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 69 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or (resid 84 and (name N or name CA or name C or name O or name CB )) or resid 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 104 or (resid 105 and (name N or name CA or name C or name O or name CB )) or resid 106 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 247 or (resid 248 through 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 356 or (resid 357 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 364 or (resid 365 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 3 4 ? C 4 C 401 
;(chain C and ((resid 6 and (name N or name CA or name C or name O or name CB )) or resid 7 through 8 or (resid 9 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 69 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or (resid 84 and (name N or name CA or name C or name O or name CB )) or resid 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 104 or (resid 105 and (name N or name CA or name C or name O or name CB )) or resid 106 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 247 or (resid 248 through 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 356 or (resid 357 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 364 or (resid 365 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 3 5 ? C 4 C 401 
;(chain C and ((resid 6 and (name N or name CA or name C or name O or name CB )) or resid 7 through 8 or (resid 9 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 69 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or (resid 84 and (name N or name CA or name C or name O or name CB )) or resid 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 104 or (resid 105 and (name N or name CA or name C or name O or name CB )) or resid 106 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 247 or (resid 248 through 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 356 or (resid 357 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 364 or (resid 365 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 4 1 ? D 6 D 7   
;(chain D and (resid 6 through 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 17 or (resid 18 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 69 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or (resid 84 and (name N or name CA or name C or name O or name CB )) or resid 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 104 or (resid 105 and (name N or name CA or name C or name O or name CB )) or resid 106 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 249 or (resid 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 364 or (resid 365 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 4 2 ? D 8 D 10  
;(chain D and (resid 6 through 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 17 or (resid 18 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 69 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or (resid 84 and (name N or name CA or name C or name O or name CB )) or resid 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 104 or (resid 105 and (name N or name CA or name C or name O or name CB )) or resid 106 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 249 or (resid 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 364 or (resid 365 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 4 3 ? D 4 D 401 
;(chain D and (resid 6 through 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 17 or (resid 18 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 69 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or (resid 84 and (name N or name CA or name C or name O or name CB )) or resid 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 104 or (resid 105 and (name N or name CA or name C or name O or name CB )) or resid 106 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 249 or (resid 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 364 or (resid 365 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 5 1 ? E 6 E 6   
;(chain E and ((resid 6 and (name N or name CA or name C or name O or name CB )) or resid 7 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or (resid 84 and (name N or name CA or name C or name O or name CB )) or resid 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or resid 234 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 247 or (resid 248 through 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 362 or (resid 363 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 5 2 ? E 5 E 401 
;(chain E and ((resid 6 and (name N or name CA or name C or name O or name CB )) or resid 7 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or (resid 84 and (name N or name CA or name C or name O or name CB )) or resid 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or resid 234 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 247 or (resid 248 through 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 362 or (resid 363 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 5 3 ? E 5 E 401 
;(chain E and ((resid 6 and (name N or name CA or name C or name O or name CB )) or resid 7 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or (resid 84 and (name N or name CA or name C or name O or name CB )) or resid 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or resid 234 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 247 or (resid 248 through 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 362 or (resid 363 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 5 4 ? E 5 E 401 
;(chain E and ((resid 6 and (name N or name CA or name C or name O or name CB )) or resid 7 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or (resid 84 and (name N or name CA or name C or name O or name CB )) or resid 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or resid 234 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 247 or (resid 248 through 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 362 or (resid 363 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 5 5 ? E 5 E 401 
;(chain E and ((resid 6 and (name N or name CA or name C or name O or name CB )) or resid 7 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or (resid 84 and (name N or name CA or name C or name O or name CB )) or resid 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 96 or (resid 97 and (name N or name CA or name C or name O or name CB )) or resid 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or resid 234 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 247 or (resid 248 through 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 362 or (resid 363 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 6 1 ? F 6 F 6   
;(chain F and ((resid 6 and (name N or name CA or name C or name O or name CB )) or resid 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 17 or (resid 18 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or resid 84 through 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 104 or (resid 105 and (name N or name CA or name C or name O or name CB )) or resid 106 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 249 or (resid 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 362 or (resid 363 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 6 2 ? F 6 F 401 
;(chain F and ((resid 6 and (name N or name CA or name C or name O or name CB )) or resid 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 17 or (resid 18 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or resid 84 through 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 104 or (resid 105 and (name N or name CA or name C or name O or name CB )) or resid 106 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 249 or (resid 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 362 or (resid 363 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 6 3 ? F 6 F 401 
;(chain F and ((resid 6 and (name N or name CA or name C or name O or name CB )) or resid 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 17 or (resid 18 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or resid 84 through 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 104 or (resid 105 and (name N or name CA or name C or name O or name CB )) or resid 106 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 249 or (resid 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 362 or (resid 363 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 6 4 ? F 6 F 401 
;(chain F and ((resid 6 and (name N or name CA or name C or name O or name CB )) or resid 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 17 or (resid 18 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or resid 84 through 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 104 or (resid 105 and (name N or name CA or name C or name O or name CB )) or resid 106 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 249 or (resid 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 362 or (resid 363 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 6 5 ? F 6 F 401 
;(chain F and ((resid 6 and (name N or name CA or name C or name O or name CB )) or resid 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 17 or (resid 18 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or (resid 69 and (name N or name CA or name C or name O or name CB )) or resid 70 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or resid 84 through 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 104 or (resid 105 and (name N or name CA or name C or name O or name CB )) or resid 106 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 249 or (resid 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 311 or (resid 312 and (name N or name CA or name C or name O or name CB )) or resid 313 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 362 or (resid 363 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 7 1 ? G 6 G 7   
;(chain G and (resid 6 through 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 69 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or (resid 84 and (name N or name CA or name C or name O or name CB )) or resid 85 through 86 or (resid 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 249 or (resid 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 through 329 or (resid 330 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 370 or (resid 371 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 401))
;
? ? ? ? ? ? ? ? 
1 7 2 ? G 8 G 10  
;(chain G and (resid 6 through 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 69 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or (resid 84 and (name N or name CA or name C or name O or name CB )) or resid 85 through 86 or (resid 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 249 or (resid 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 through 329 or (resid 330 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 370 or (resid 371 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 401))
;
? ? ? ? ? ? ? ? 
1 7 3 ? G 5 G 401 
;(chain G and (resid 6 through 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 36 or (resid 37 and (name N or name CA or name C or name O or name CB )) or resid 38 through 67 or (resid 68 and (name N or name CA or name C or name O or name CB or name CG or name CD )) or resid 69 through 71 or (resid 72 and (name N or name CA or name C or name O or name CB )) or resid 73 or (resid 74 and (name N or name CA or name C or name O or name CB )) or resid 75 through 78 or (resid 79 through 80 and (name N or name CA or name C or name O or name CB )) or resid 81 through 82 or (resid 84 and (name N or name CA or name C or name O or name CB )) or resid 85 through 86 or (resid 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 98 or (resid 99 through 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 110 or (resid 111 and (name N or name CA or name C or name O or name CB )) or resid 112 through 113 or (resid 114 through 115 and (name N or name CA or name C or name O or name CB )) or resid 116 through 159 or (resid 160 and (name N or name CA or name C or name O or name CB )) or resid 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 167 or (resid 168 and (name N or name CA or name C or name O or name CB )) or resid 169 through 194 or (resid 195 and (name N or name CA or name C or name O or name CB )) or resid 196 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 243 or (resid 244 through 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 249 or (resid 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 323 or (resid 324 and (name N or name CA or name C or name O or name CB )) or resid 325 through 329 or (resid 330 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 370 or (resid 371 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 401))
;
? ? ? ? ? ? ? ? 
1 8 1 ? H 6 H 7   
;(chain H and (resid 6 through 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 or (resid 18 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 82 or resid 84 through 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 244 or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 249 or (resid 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 364 or (resid 365 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 8 2 ? H 8 H 10  
;(chain H and (resid 6 through 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 or (resid 18 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 82 or resid 84 through 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 244 or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 249 or (resid 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 364 or (resid 365 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 8 3 ? H 6 H 401 
;(chain H and (resid 6 through 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 or (resid 18 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 82 or resid 84 through 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 244 or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 249 or (resid 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 364 or (resid 365 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 8 4 ? H 6 H 401 
;(chain H and (resid 6 through 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 or (resid 18 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 82 or resid 84 through 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 244 or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 249 or (resid 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 364 or (resid 365 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 8 5 ? H 6 H 401 
;(chain H and (resid 6 through 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 or (resid 18 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 82 or resid 84 through 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 244 or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 249 or (resid 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 364 or (resid 365 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
1 8 6 ? H 6 H 401 
;(chain H and (resid 6 through 7 or (resid 8 through 10 and (name N or name CA or name C or name O or name CB )) or resid 11 through 14 or (resid 15 through 16 and (name N or name CA or name C or name O or name CB )) or resid 17 or (resid 18 through 19 and (name N or name CA or name C or name O or name CB )) or resid 20 or (resid 21 through 22 and (name N or name CA or name C or name O or name CB )) or resid 23 through 26 or (resid 27 and (name N or name CA or name C or name O or name CB or name CG )) or resid 28 through 82 or resid 84 through 85 or (resid 86 through 87 and (name N or name CA or name C or name O or name CB )) or resid 88 through 99 or (resid 100 and (name N or name CA or name C or name O or name CB )) or resid 101 through 139 or (resid 140 and (name N or name CA or name C or name O or name CB )) or resid 141 through 161 or (resid 162 and (name N or name CA or name C or name O or name CB )) or resid 163 through 206 or resid 208 through 213 or (resid 214 and (name N or name CA or name C or name O or name CB )) or resid 215 through 220 or (resid 221 and (name N or name CA or name C or name O or name CB )) or resid 222 through 226 or (resid 234 and (name N or name CA or name C or name O or name CB )) or resid 235 through 240 or (resid 241 and (name N or name CA or name C or name O or name CB )) or resid 242 through 244 or (resid 245 and (name N or name CA or name C or name O or name CB )) or resid 246 through 249 or (resid 250 and (name N or name CA or name C or name O or name CB )) or resid 251 through 256 or (resid 257 and (name N or name CA or name C or name O or name CB )) or resid 258 through 269 or (resid 270 and (name N or name CA or name C or name O or name CB )) or resid 271 or (resid 272 and (name N or name CA or name C or name O or name CB )) or resid 273 through 285 or resid 287 through 295 or resid 297 through 300 or resid 302 through 318 or (resid 319 and (name N or name CA or name C or name O or name CB )) or resid 320 through 325 or (resid 326 through 327 and (name N or name CA or name C or name O or name CB )) or (resid 328 and (name N or name CA or name C or name O or name CB or name CG )) or (resid 329 through 332 and (name N or name CA or name C or name O or name CB )) or resid 333 through 347 or (resid 348 and (name N or name CA or name C or name O or name CB )) or resid 349 through 355 or (resid 356 through 358 and (name N or name CA or name C or name O or name CB )) or resid 359 through 364 or (resid 365 through 372 and (name N or name CA or name C or name O or name CB )) or resid 373 through 374 or (resid 375 through 376 and (name N or name CA or name C or name O or name CB )) or resid 377 through 379 or (resid 380 and (name N or name CA or name C or name O or name CB )) or resid 381 or (resid 382 through 384 and (name N or name CA or name C or name O or name CB )) or resid 385 through 401))
;
? ? ? ? ? ? ? ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                     6GR2 
_struct.title                        'Structure of human galactokinase in complex with galactose and ADP' 
_struct.pdbx_descriptor              'Galactokinase (E.C.2.7.1.6)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6GR2 
_struct_keywords.text            
'Leloir pathway, GHMP kinase, galactose, ADP, Structural Genomics, Structural Genomics Consortium, SGC, transferase' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 2 ? 
J  N N 3 ? 
K  N N 2 ? 
L  N N 3 ? 
M  N N 4 ? 
N  N N 4 ? 
O  N N 2 ? 
P  N N 3 ? 
Q  N N 4 ? 
R  N N 2 ? 
S  N N 3 ? 
T  N N 2 ? 
U  N N 3 ? 
V  N N 2 ? 
W  N N 3 ? 
X  N N 4 ? 
Y  N N 2 ? 
Z  N N 3 ? 
AA N N 2 ? 
BA N N 3 ? 
CA N N 4 ? 
DA N N 5 ? 
EA N N 5 ? 
FA N N 5 ? 
GA N N 5 ? 
HA N N 5 ? 
IA N N 5 ? 
JA N N 5 ? 
KA N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLN A 15  ? GLY A 32  ? GLN A 8   GLY A 25  1 ? 18 
HELX_P HELX_P2   AA2 THR A 52  ? GLN A 56  ? THR A 45  GLN A 49  5 ? 5  
HELX_P HELX_P3   AA3 TRP A 113 ? TYR A 124 ? TRP A 106 TYR A 117 1 ? 12 
HELX_P HELX_P4   AA4 SER A 147 ? CYS A 164 ? SER A 140 CYS A 157 1 ? 18 
HELX_P HELX_P5   AA5 THR A 169 ? GLY A 186 ? THR A 162 GLY A 179 1 ? 18 
HELX_P HELX_P6   AA6 ILE A 191 ? GLY A 200 ? ILE A 184 GLY A 193 1 ? 10 
HELX_P HELX_P7   AA7 GLU A 242 ? LEU A 257 ? GLU A 235 LEU A 250 1 ? 16 
HELX_P HELX_P8   AA8 SER A 261 ? VAL A 265 ? SER A 254 VAL A 258 5 ? 5  
HELX_P HELX_P9   AA9 GLN A 266 ? ALA A 273 ? GLN A 259 ALA A 266 1 ? 8  
HELX_P HELX_P10  AB1 ARG A 274 ? LEU A 276 ? ARG A 267 LEU A 269 5 ? 3  
HELX_P HELX_P11  AB2 SER A 278 ? ARG A 304 ? SER A 271 ARG A 297 1 ? 27 
HELX_P HELX_P12  AB3 ASP A 306 ? ASP A 324 ? ASP A 299 ASP A 317 1 ? 19 
HELX_P HELX_P13  AB4 CYS A 329 ? VAL A 342 ? CYS A 322 VAL A 335 1 ? 14 
HELX_P HELX_P14  AB5 ALA A 367 ? HIS A 378 ? ALA A 360 HIS A 371 1 ? 12 
HELX_P HELX_P15  AB6 GLN B 15  ? GLY B 32  ? GLN B 8   GLY B 25  1 ? 18 
HELX_P HELX_P16  AB7 THR B 52  ? GLN B 56  ? THR B 45  GLN B 49  5 ? 5  
HELX_P HELX_P17  AB8 TRP B 113 ? TYR B 124 ? TRP B 106 TYR B 117 1 ? 12 
HELX_P HELX_P18  AB9 SER B 147 ? CYS B 164 ? SER B 140 CYS B 157 1 ? 18 
HELX_P HELX_P19  AC1 THR B 169 ? GLY B 186 ? THR B 162 GLY B 179 1 ? 18 
HELX_P HELX_P20  AC2 ILE B 191 ? GLY B 200 ? ILE B 184 GLY B 193 1 ? 10 
HELX_P HELX_P21  AC3 GLU B 242 ? LEU B 257 ? GLU B 235 LEU B 250 1 ? 16 
HELX_P HELX_P22  AC4 SER B 261 ? VAL B 265 ? SER B 254 VAL B 258 5 ? 5  
HELX_P HELX_P23  AC5 GLN B 266 ? ALA B 273 ? GLN B 259 ALA B 266 1 ? 8  
HELX_P HELX_P24  AC6 ARG B 274 ? VAL B 277 ? ARG B 267 VAL B 270 5 ? 4  
HELX_P HELX_P25  AC7 SER B 278 ? ARG B 304 ? SER B 271 ARG B 297 1 ? 27 
HELX_P HELX_P26  AC8 ASP B 306 ? ASP B 324 ? ASP B 299 ASP B 317 1 ? 19 
HELX_P HELX_P27  AC9 CYS B 329 ? VAL B 342 ? CYS B 322 VAL B 335 1 ? 14 
HELX_P HELX_P28  AD1 ALA B 367 ? HIS B 378 ? ALA B 360 HIS B 371 1 ? 12 
HELX_P HELX_P29  AD2 GLN C 15  ? GLY C 32  ? GLN C 8   GLY C 25  1 ? 18 
HELX_P HELX_P30  AD3 THR C 52  ? GLN C 56  ? THR C 45  GLN C 49  5 ? 5  
HELX_P HELX_P31  AD4 TRP C 113 ? TYR C 124 ? TRP C 106 TYR C 117 1 ? 12 
HELX_P HELX_P32  AD5 SER C 147 ? CYS C 164 ? SER C 140 CYS C 157 1 ? 18 
HELX_P HELX_P33  AD6 THR C 169 ? PHE C 184 ? THR C 162 PHE C 177 1 ? 16 
HELX_P HELX_P34  AD7 ILE C 191 ? GLY C 200 ? ILE C 184 GLY C 193 1 ? 10 
HELX_P HELX_P35  AD8 GLU C 242 ? LEU C 257 ? GLU C 235 LEU C 250 1 ? 16 
HELX_P HELX_P36  AD9 SER C 261 ? VAL C 265 ? SER C 254 VAL C 258 5 ? 5  
HELX_P HELX_P37  AE1 GLN C 266 ? ALA C 273 ? GLN C 259 ALA C 266 1 ? 8  
HELX_P HELX_P38  AE2 ARG C 274 ? VAL C 277 ? ARG C 267 VAL C 270 5 ? 4  
HELX_P HELX_P39  AE3 SER C 278 ? ARG C 304 ? SER C 271 ARG C 297 1 ? 27 
HELX_P HELX_P40  AE4 ASP C 306 ? ASP C 324 ? ASP C 299 ASP C 317 1 ? 19 
HELX_P HELX_P41  AE5 CYS C 329 ? VAL C 342 ? CYS C 322 VAL C 335 1 ? 14 
HELX_P HELX_P42  AE6 ALA C 367 ? HIS C 378 ? ALA C 360 HIS C 371 1 ? 12 
HELX_P HELX_P43  AE7 GLN D 15  ? GLY D 32  ? GLN D 8   GLY D 25  1 ? 18 
HELX_P HELX_P44  AE8 THR D 52  ? GLN D 56  ? THR D 45  GLN D 49  5 ? 5  
HELX_P HELX_P45  AE9 TRP D 113 ? TYR D 124 ? TRP D 106 TYR D 117 1 ? 12 
HELX_P HELX_P46  AF1 SER D 147 ? CYS D 164 ? SER D 140 CYS D 157 1 ? 18 
HELX_P HELX_P47  AF2 THR D 169 ? GLY D 186 ? THR D 162 GLY D 179 1 ? 18 
HELX_P HELX_P48  AF3 ILE D 191 ? GLY D 200 ? ILE D 184 GLY D 193 1 ? 10 
HELX_P HELX_P49  AF4 GLU D 242 ? LEU D 257 ? GLU D 235 LEU D 250 1 ? 16 
HELX_P HELX_P50  AF5 SER D 261 ? VAL D 265 ? SER D 254 VAL D 258 5 ? 5  
HELX_P HELX_P51  AF6 GLN D 266 ? ALA D 273 ? GLN D 259 ALA D 266 1 ? 8  
HELX_P HELX_P52  AF7 ARG D 274 ? VAL D 277 ? ARG D 267 VAL D 270 5 ? 4  
HELX_P HELX_P53  AF8 SER D 278 ? ARG D 304 ? SER D 271 ARG D 297 1 ? 27 
HELX_P HELX_P54  AF9 ASP D 306 ? ASP D 324 ? ASP D 299 ASP D 317 1 ? 19 
HELX_P HELX_P55  AG1 CYS D 329 ? VAL D 342 ? CYS D 322 VAL D 335 1 ? 14 
HELX_P HELX_P56  AG2 ALA D 367 ? HIS D 378 ? ALA D 360 HIS D 371 1 ? 12 
HELX_P HELX_P57  AG3 GLN E 15  ? GLY E 32  ? GLN E 8   GLY E 25  1 ? 18 
HELX_P HELX_P58  AG4 THR E 52  ? GLN E 56  ? THR E 45  GLN E 49  5 ? 5  
HELX_P HELX_P59  AG5 TRP E 113 ? TYR E 124 ? TRP E 106 TYR E 117 1 ? 12 
HELX_P HELX_P60  AG6 SER E 147 ? CYS E 164 ? SER E 140 CYS E 157 1 ? 18 
HELX_P HELX_P61  AG7 THR E 169 ? GLY E 186 ? THR E 162 GLY E 179 1 ? 18 
HELX_P HELX_P62  AG8 ILE E 191 ? GLY E 200 ? ILE E 184 GLY E 193 1 ? 10 
HELX_P HELX_P63  AG9 ALA E 239 ? SER E 241 ? ALA E 232 SER E 234 5 ? 3  
HELX_P HELX_P64  AH1 GLU E 242 ? LEU E 257 ? GLU E 235 LEU E 250 1 ? 16 
HELX_P HELX_P65  AH2 SER E 261 ? VAL E 265 ? SER E 254 VAL E 258 5 ? 5  
HELX_P HELX_P66  AH3 GLN E 266 ? ALA E 273 ? GLN E 259 ALA E 266 1 ? 8  
HELX_P HELX_P67  AH4 ARG E 274 ? VAL E 277 ? ARG E 267 VAL E 270 5 ? 4  
HELX_P HELX_P68  AH5 SER E 278 ? ARG E 304 ? SER E 271 ARG E 297 1 ? 27 
HELX_P HELX_P69  AH6 ASP E 306 ? ASP E 324 ? ASP E 299 ASP E 317 1 ? 19 
HELX_P HELX_P70  AH7 CYS E 329 ? VAL E 342 ? CYS E 322 VAL E 335 1 ? 14 
HELX_P HELX_P71  AH8 ALA E 367 ? HIS E 378 ? ALA E 360 HIS E 371 1 ? 12 
HELX_P HELX_P72  AH9 GLN F 15  ? GLY F 32  ? GLN F 8   GLY F 25  1 ? 18 
HELX_P HELX_P73  AI1 THR F 52  ? GLN F 56  ? THR F 45  GLN F 49  5 ? 5  
HELX_P HELX_P74  AI2 ARG F 112 ? TYR F 124 ? ARG F 105 TYR F 117 1 ? 13 
HELX_P HELX_P75  AI3 SER F 147 ? CYS F 164 ? SER F 140 CYS F 157 1 ? 18 
HELX_P HELX_P76  AI4 THR F 169 ? PHE F 184 ? THR F 162 PHE F 177 1 ? 16 
HELX_P HELX_P77  AI5 ILE F 191 ? GLY F 200 ? ILE F 184 GLY F 193 1 ? 10 
HELX_P HELX_P78  AI6 GLU F 242 ? LEU F 257 ? GLU F 235 LEU F 250 1 ? 16 
HELX_P HELX_P79  AI7 SER F 261 ? VAL F 265 ? SER F 254 VAL F 258 5 ? 5  
HELX_P HELX_P80  AI8 GLN F 266 ? ALA F 273 ? GLN F 259 ALA F 266 1 ? 8  
HELX_P HELX_P81  AI9 ARG F 274 ? VAL F 277 ? ARG F 267 VAL F 270 5 ? 4  
HELX_P HELX_P82  AJ1 SER F 278 ? ARG F 304 ? SER F 271 ARG F 297 1 ? 27 
HELX_P HELX_P83  AJ2 ASP F 306 ? ASP F 324 ? ASP F 299 ASP F 317 1 ? 19 
HELX_P HELX_P84  AJ3 CYS F 329 ? VAL F 342 ? CYS F 322 VAL F 335 1 ? 14 
HELX_P HELX_P85  AJ4 ALA F 367 ? HIS F 378 ? ALA F 360 HIS F 371 1 ? 12 
HELX_P HELX_P86  AJ5 GLN G 15  ? GLY G 32  ? GLN G 8   GLY G 25  1 ? 18 
HELX_P HELX_P87  AJ6 THR G 52  ? GLN G 56  ? THR G 45  GLN G 49  5 ? 5  
HELX_P HELX_P88  AJ7 ARG G 112 ? TYR G 123 ? ARG G 105 TYR G 116 1 ? 12 
HELX_P HELX_P89  AJ8 SER G 147 ? CYS G 164 ? SER G 140 CYS G 157 1 ? 18 
HELX_P HELX_P90  AJ9 THR G 169 ? GLY G 186 ? THR G 162 GLY G 179 1 ? 18 
HELX_P HELX_P91  AK1 ILE G 191 ? GLY G 200 ? ILE G 184 GLY G 193 1 ? 10 
HELX_P HELX_P92  AK2 GLU G 242 ? LEU G 257 ? GLU G 235 LEU G 250 1 ? 16 
HELX_P HELX_P93  AK3 SER G 261 ? VAL G 265 ? SER G 254 VAL G 258 5 ? 5  
HELX_P HELX_P94  AK4 GLN G 266 ? ALA G 273 ? GLN G 259 ALA G 266 1 ? 8  
HELX_P HELX_P95  AK5 SER G 278 ? ARG G 304 ? SER G 271 ARG G 297 1 ? 27 
HELX_P HELX_P96  AK6 ASP G 306 ? ASP G 324 ? ASP G 299 ASP G 317 1 ? 19 
HELX_P HELX_P97  AK7 CYS G 329 ? VAL G 342 ? CYS G 322 VAL G 335 1 ? 14 
HELX_P HELX_P98  AK8 ALA G 367 ? HIS G 378 ? ALA G 360 HIS G 371 1 ? 12 
HELX_P HELX_P99  AK9 GLN H 15  ? GLY H 32  ? GLN H 8   GLY H 25  1 ? 18 
HELX_P HELX_P100 AL1 THR H 52  ? GLN H 56  ? THR H 45  GLN H 49  5 ? 5  
HELX_P HELX_P101 AL2 PRO H 111 ? TYR H 123 ? PRO H 104 TYR H 116 1 ? 13 
HELX_P HELX_P102 AL3 SER H 147 ? CYS H 164 ? SER H 140 CYS H 157 1 ? 18 
HELX_P HELX_P103 AL4 THR H 169 ? GLY H 186 ? THR H 162 GLY H 179 1 ? 18 
HELX_P HELX_P104 AL5 ILE H 191 ? GLY H 200 ? ILE H 184 GLY H 193 1 ? 10 
HELX_P HELX_P105 AL6 GLU H 242 ? LEU H 257 ? GLU H 235 LEU H 250 1 ? 16 
HELX_P HELX_P106 AL7 SER H 261 ? VAL H 265 ? SER H 254 VAL H 258 5 ? 5  
HELX_P HELX_P107 AL8 GLN H 266 ? ALA H 273 ? GLN H 259 ALA H 266 1 ? 8  
HELX_P HELX_P108 AL9 ARG H 274 ? LEU H 276 ? ARG H 267 LEU H 269 5 ? 3  
HELX_P HELX_P109 AM1 SER H 278 ? ARG H 304 ? SER H 271 ARG H 297 1 ? 27 
HELX_P HELX_P110 AM2 ASP H 306 ? ASP H 324 ? ASP H 299 ASP H 317 1 ? 19 
HELX_P HELX_P111 AM3 CYS H 329 ? ALA H 341 ? CYS H 322 ALA H 334 1 ? 13 
HELX_P HELX_P112 AM4 ALA H 367 ? HIS H 378 ? ALA H 360 HIS H 371 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ? ? A CYS 398 SG ? ? ? 1_555 F CYS 398 SG ? ? A CYS 391 F CYS 391 1_555 ? ? ? ? ? ? ? 2.031 ? ? 
disulf2 disulf ? ? B CYS 398 SG ? ? ? 1_555 C CYS 398 SG ? ? B CYS 391 C CYS 391 1_455 ? ? ? ? ? ? ? 2.032 ? ? 
disulf3 disulf ? ? D CYS 398 SG ? ? ? 1_555 G CYS 398 SG ? ? D CYS 391 G CYS 391 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
disulf4 disulf ? ? E CYS 398 SG ? ? ? 1_555 H CYS 398 SG ? ? E CYS 391 H CYS 391 1_555 ? ? ? ? ? ? ? 2.034 ? ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  GLU 91  A . ? GLU 84  A PRO 92  A ? PRO 85  A 1 3.96  
2  THR 110 A . ? THR 103 A PRO 111 A ? PRO 104 A 1 0.74  
3  ALA 127 A . ? ALA 120 A PRO 128 A ? PRO 121 A 1 0.98  
4  GLU 91  B . ? GLU 84  B PRO 92  B ? PRO 85  B 1 4.69  
5  THR 110 B . ? THR 103 B PRO 111 B ? PRO 104 B 1 2.43  
6  ALA 127 B . ? ALA 120 B PRO 128 B ? PRO 121 B 1 1.56  
7  GLU 91  C . ? GLU 84  C PRO 92  C ? PRO 85  C 1 3.86  
8  THR 110 C . ? THR 103 C PRO 111 C ? PRO 104 C 1 1.93  
9  ALA 127 C . ? ALA 120 C PRO 128 C ? PRO 121 C 1 2.94  
10 GLU 91  D . ? GLU 84  D PRO 92  D ? PRO 85  D 1 3.85  
11 THR 110 D . ? THR 103 D PRO 111 D ? PRO 104 D 1 2.11  
12 ALA 127 D . ? ALA 120 D PRO 128 D ? PRO 121 D 1 0.49  
13 GLU 91  E . ? GLU 84  E PRO 92  E ? PRO 85  E 1 0.55  
14 THR 110 E . ? THR 103 E PRO 111 E ? PRO 104 E 1 1.85  
15 ALA 127 E . ? ALA 120 E PRO 128 E ? PRO 121 E 1 1.47  
16 GLU 91  F . ? GLU 84  F PRO 92  F ? PRO 85  F 1 4.53  
17 THR 110 F . ? THR 103 F PRO 111 F ? PRO 104 F 1 2.07  
18 ALA 127 F . ? ALA 120 F PRO 128 F ? PRO 121 F 1 1.28  
19 GLU 91  G . ? GLU 84  G PRO 92  G ? PRO 85  G 1 4.30  
20 THR 110 G . ? THR 103 G PRO 111 G ? PRO 104 G 1 -0.01 
21 ALA 127 G . ? ALA 120 G PRO 128 G ? PRO 121 G 1 -0.16 
22 GLU 91  H . ? GLU 84  H PRO 92  H ? PRO 85  H 1 3.89  
23 THR 110 H . ? THR 103 H PRO 111 H ? PRO 104 H 1 2.03  
24 ALA 127 H . ? ALA 120 H PRO 128 H ? PRO 121 H 1 0.26  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 9 ? 
AA3 ? 8 ? 
AA4 ? 4 ? 
AA5 ? 6 ? 
AA6 ? 3 ? 
AA7 ? 4 ? 
AA8 ? 6 ? 
AA9 ? 3 ? 
AB1 ? 4 ? 
AB2 ? 6 ? 
AB3 ? 9 ? 
AB4 ? 8 ? 
AB5 ? 4 ? 
AB6 ? 6 ? 
AB7 ? 6 ? 
AB8 ? 4 ? 
AB9 ? 4 ? 
AC1 ? 4 ? 
AC2 ? 6 ? 
AC3 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? parallel      
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA2 6 7 ? anti-parallel 
AA2 7 8 ? parallel      
AA2 8 9 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA3 5 6 ? anti-parallel 
AA3 6 7 ? anti-parallel 
AA3 7 8 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? parallel      
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA5 5 6 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? parallel      
AA8 3 4 ? anti-parallel 
AA8 4 5 ? anti-parallel 
AA8 5 6 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? parallel      
AB2 3 4 ? anti-parallel 
AB2 4 5 ? anti-parallel 
AB2 5 6 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB3 4 5 ? anti-parallel 
AB3 5 6 ? anti-parallel 
AB3 6 7 ? anti-parallel 
AB3 7 8 ? parallel      
AB3 8 9 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB4 4 5 ? anti-parallel 
AB4 5 6 ? anti-parallel 
AB4 6 7 ? anti-parallel 
AB4 7 8 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? parallel      
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB6 5 6 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB7 4 5 ? anti-parallel 
AB7 5 6 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB8 3 4 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? parallel      
AC2 3 4 ? anti-parallel 
AC2 4 5 ? anti-parallel 
AC2 5 6 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 94  ? PRO A 98  ? ARG A 87  PRO A 91  
AA1 2 LEU A 79  ? THR A 84  ? LEU A 72  THR A 77  
AA1 3 GLY A 131 ? SER A 138 ? GLY A 124 SER A 131 
AA1 4 PRO A 61  ? ARG A 75  ? PRO A 54  ARG A 68  
AA1 5 LEU A 37  ? ASN A 46  ? LEU A 30  ASN A 39  
AA1 6 LYS A 395 ? LEU A 397 ? LYS A 388 LEU A 390 
AA2 1 LEU A 58  ? VAL A 59  ? LEU A 51  VAL A 52  
AA2 2 HIS A 204 ? ASP A 209 ? HIS A 197 ASP A 202 
AA2 3 THR A 215 ? PRO A 219 ? THR A 208 PRO A 212 
AA2 4 THR F 215 ? PRO F 219 ? THR F 208 PRO F 212 
AA2 5 HIS F 204 ? ASP F 209 ? HIS F 197 ASP F 202 
AA2 6 LEU F 58  ? ARG F 75  ? LEU F 51  ARG F 68  
AA2 7 GLY F 131 ? SER F 138 ? GLY F 124 SER F 131 
AA2 8 LEU F 79  ? THR F 84  ? LEU F 72  THR F 77  
AA2 9 ARG F 94  ? PRO F 98  ? ARG F 87  PRO F 91  
AA3 1 LEU A 58  ? VAL A 59  ? LEU A 51  VAL A 52  
AA3 2 HIS A 204 ? ASP A 209 ? HIS A 197 ASP A 202 
AA3 3 THR A 215 ? PRO A 219 ? THR A 208 PRO A 212 
AA3 4 THR F 215 ? PRO F 219 ? THR F 208 PRO F 212 
AA3 5 HIS F 204 ? ASP F 209 ? HIS F 197 ASP F 202 
AA3 6 LEU F 58  ? ARG F 75  ? LEU F 51  ARG F 68  
AA3 7 LEU F 37  ? ILE F 48  ? LEU F 30  ILE F 41  
AA3 8 LYS F 395 ? LEU F 397 ? LYS F 388 LEU F 390 
AA4 1 VAL A 345 ? MET A 350 ? VAL A 338 MET A 343 
AA4 2 CYS A 358 ? GLU A 364 ? CYS A 351 GLU A 357 
AA4 3 LEU A 225 ? ASN A 231 ? LEU A 218 ASN A 224 
AA4 4 THR A 384 ? SER A 388 ? THR A 377 SER A 381 
AA5 1 ARG B 94  ? PRO B 98  ? ARG B 87  PRO B 91  
AA5 2 LEU B 79  ? THR B 84  ? LEU B 72  THR B 77  
AA5 3 GLY B 131 ? SER B 138 ? GLY B 124 SER B 131 
AA5 4 PRO B 61  ? ARG B 75  ? PRO B 54  ARG B 68  
AA5 5 LEU B 37  ? ASN B 46  ? LEU B 30  ASN B 39  
AA5 6 LYS B 395 ? LEU B 397 ? LYS B 388 LEU B 390 
AA6 1 LEU B 58  ? VAL B 59  ? LEU B 51  VAL B 52  
AA6 2 HIS B 204 ? ASP B 209 ? HIS B 197 ASP B 202 
AA6 3 THR B 215 ? PRO B 219 ? THR B 208 PRO B 212 
AA7 1 VAL B 345 ? THR B 351 ? VAL B 338 THR B 344 
AA7 2 CYS B 358 ? GLU B 364 ? CYS B 351 GLU B 357 
AA7 3 LEU B 225 ? ASN B 231 ? LEU B 218 ASN B 224 
AA7 4 THR B 384 ? SER B 388 ? THR B 377 SER B 381 
AA8 1 ARG C 94  ? PRO C 98  ? ARG C 87  PRO C 91  
AA8 2 LEU C 79  ? THR C 84  ? LEU C 72  THR C 77  
AA8 3 GLY C 131 ? SER C 138 ? GLY C 124 SER C 131 
AA8 4 PRO C 61  ? ARG C 75  ? PRO C 54  ARG C 68  
AA8 5 LEU C 37  ? ASN C 46  ? LEU C 30  ASN C 39  
AA8 6 LYS C 395 ? LEU C 397 ? LYS C 388 LEU C 390 
AA9 1 LEU C 58  ? VAL C 59  ? LEU C 51  VAL C 52  
AA9 2 HIS C 204 ? ASP C 209 ? HIS C 197 ASP C 202 
AA9 3 THR C 215 ? PRO C 219 ? THR C 208 PRO C 212 
AB1 1 VAL C 345 ? MET C 350 ? VAL C 338 MET C 343 
AB1 2 GLY C 356 ? GLU C 364 ? GLY C 349 GLU C 357 
AB1 3 LEU C 225 ? ARG C 235 ? LEU C 218 ARG C 228 
AB1 4 THR C 384 ? LEU C 387 ? THR C 377 LEU C 380 
AB2 1 ARG D 94  ? PRO D 98  ? ARG D 87  PRO D 91  
AB2 2 LEU D 79  ? THR D 84  ? LEU D 72  THR D 77  
AB2 3 GLY D 131 ? SER D 138 ? GLY D 124 SER D 131 
AB2 4 PRO D 61  ? ARG D 75  ? PRO D 54  ARG D 68  
AB2 5 LEU D 37  ? ASN D 46  ? LEU D 30  ASN D 39  
AB2 6 LYS D 395 ? LEU D 397 ? LYS D 388 LEU D 390 
AB3 1 LEU D 58  ? VAL D 59  ? LEU D 51  VAL D 52  
AB3 2 HIS D 204 ? ASP D 209 ? HIS D 197 ASP D 202 
AB3 3 THR D 215 ? PRO D 219 ? THR D 208 PRO D 212 
AB3 4 THR G 215 ? PRO G 219 ? THR G 208 PRO G 212 
AB3 5 HIS G 204 ? ASP G 209 ? HIS G 197 ASP G 202 
AB3 6 LEU G 58  ? PRO G 74  ? LEU G 51  PRO G 67  
AB3 7 PHE G 132 ? SER G 138 ? PHE G 125 SER G 131 
AB3 8 LEU G 79  ? THR G 84  ? LEU G 72  THR G 77  
AB3 9 ARG G 94  ? PRO G 98  ? ARG G 87  PRO G 91  
AB4 1 LEU D 58  ? VAL D 59  ? LEU D 51  VAL D 52  
AB4 2 HIS D 204 ? ASP D 209 ? HIS D 197 ASP D 202 
AB4 3 THR D 215 ? PRO D 219 ? THR D 208 PRO D 212 
AB4 4 THR G 215 ? PRO G 219 ? THR G 208 PRO G 212 
AB4 5 HIS G 204 ? ASP G 209 ? HIS G 197 ASP G 202 
AB4 6 LEU G 58  ? PRO G 74  ? LEU G 51  PRO G 67  
AB4 7 LEU G 37  ? ILE G 48  ? LEU G 30  ILE G 41  
AB4 8 LYS G 395 ? LEU G 397 ? LYS G 388 LEU G 390 
AB5 1 VAL D 345 ? MET D 350 ? VAL D 338 MET D 343 
AB5 2 CYS D 358 ? GLU D 364 ? CYS D 351 GLU D 357 
AB5 3 LEU D 225 ? ASN D 231 ? LEU D 218 ASN D 224 
AB5 4 THR D 384 ? SER D 388 ? THR D 377 SER D 381 
AB6 1 ARG E 94  ? PRO E 98  ? ARG E 87  PRO E 91  
AB6 2 LEU E 79  ? THR E 84  ? LEU E 72  THR E 77  
AB6 3 GLY E 131 ? SER E 138 ? GLY E 124 SER E 131 
AB6 4 PRO E 61  ? ARG E 75  ? PRO E 54  ARG E 68  
AB6 5 LEU E 37  ? ASN E 46  ? LEU E 30  ASN E 39  
AB6 6 LYS E 395 ? LEU E 397 ? LYS E 388 LEU E 390 
AB7 1 LEU E 58  ? VAL E 59  ? LEU E 51  VAL E 52  
AB7 2 HIS E 204 ? ASP E 209 ? HIS E 197 ASP E 202 
AB7 3 THR E 215 ? PRO E 219 ? THR E 208 PRO E 212 
AB7 4 THR H 215 ? PRO H 219 ? THR H 208 PRO H 212 
AB7 5 HIS H 204 ? ASP H 209 ? HIS H 197 ASP H 202 
AB7 6 LEU H 58  ? VAL H 59  ? LEU H 51  VAL H 52  
AB8 1 VAL E 345 ? MET E 350 ? VAL E 338 MET E 343 
AB8 2 CYS E 358 ? GLU E 364 ? CYS E 351 GLU E 357 
AB8 3 LEU E 225 ? ASN E 231 ? LEU E 218 ASN E 224 
AB8 4 THR E 384 ? LEU E 387 ? THR E 377 LEU E 380 
AB9 1 VAL F 345 ? MET F 350 ? VAL F 338 MET F 343 
AB9 2 GLY F 356 ? GLU F 364 ? GLY F 349 GLU F 357 
AB9 3 LEU F 225 ? ARG F 235 ? LEU F 218 ARG F 228 
AB9 4 THR F 384 ? SER F 388 ? THR F 377 SER F 381 
AC1 1 VAL G 345 ? MET G 350 ? VAL G 338 MET G 343 
AC1 2 CYS G 358 ? GLU G 364 ? CYS G 351 GLU G 357 
AC1 3 LEU G 225 ? ASN G 231 ? LEU G 218 ASN G 224 
AC1 4 THR G 384 ? LEU G 387 ? THR G 377 LEU G 380 
AC2 1 ARG H 94  ? PRO H 98  ? ARG H 87  PRO H 91  
AC2 2 LEU H 79  ? THR H 84  ? LEU H 72  THR H 77  
AC2 3 GLY H 131 ? SER H 138 ? GLY H 124 SER H 131 
AC2 4 PRO H 61  ? ARG H 75  ? PRO H 54  ARG H 68  
AC2 5 LEU H 37  ? ASN H 46  ? LEU H 30  ASN H 39  
AC2 6 LYS H 395 ? LEU H 397 ? LYS H 388 LEU H 390 
AC3 1 VAL H 345 ? MET H 350 ? VAL H 338 MET H 343 
AC3 2 CYS H 358 ? GLU H 364 ? CYS H 351 GLU H 357 
AC3 3 LEU H 225 ? ASN H 231 ? LEU H 218 ASN H 224 
AC3 4 THR H 384 ? SER H 388 ? THR H 377 SER H 381 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O LEU A 95  ? O LEU A 88  N LEU A 82  ? N LEU A 75  
AA1 2 3 N LEU A 83  ? N LEU A 76  O VAL A 136 ? O VAL A 129 
AA1 3 4 O VAL A 137 ? O VAL A 130 N VAL A 69  ? N VAL A 62  
AA1 4 5 O GLY A 72  ? O GLY A 65  N LEU A 37  ? N LEU A 30  
AA1 5 6 N ALA A 38  ? N ALA A 31  O LEU A 397 ? O LEU A 390 
AA2 1 2 N VAL A 59  ? N VAL A 52  O ILE A 208 ? O ILE A 201 
AA2 2 3 N ALA A 205 ? N ALA A 198 O VAL A 218 ? O VAL A 211 
AA2 3 4 N LEU A 217 ? N LEU A 210 O THR F 215 ? O THR F 208 
AA2 4 5 O VAL F 218 ? O VAL F 211 N ALA F 205 ? N ALA F 198 
AA2 5 6 O LEU F 206 ? O LEU F 199 N PRO F 61  ? N PRO F 54  
AA2 6 7 N ARG F 75  ? N ARG F 68  O GLY F 131 ? O GLY F 124 
AA2 7 8 O VAL F 136 ? O VAL F 129 N LEU F 83  ? N LEU F 76  
AA2 8 9 N LEU F 82  ? N LEU F 75  O LEU F 95  ? O LEU F 88  
AA3 1 2 N VAL A 59  ? N VAL A 52  O ILE A 208 ? O ILE A 201 
AA3 2 3 N ALA A 205 ? N ALA A 198 O VAL A 218 ? O VAL A 211 
AA3 3 4 N LEU A 217 ? N LEU A 210 O THR F 215 ? O THR F 208 
AA3 4 5 O VAL F 218 ? O VAL F 211 N ALA F 205 ? N ALA F 198 
AA3 5 6 O LEU F 206 ? O LEU F 199 N PRO F 61  ? N PRO F 54  
AA3 6 7 O LEU F 70  ? O LEU F 63  N VAL F 39  ? N VAL F 32  
AA3 7 8 N ALA F 38  ? N ALA F 31  O LEU F 397 ? O LEU F 390 
AA4 1 2 N TYR A 346 ? N TYR A 339 O LEU A 362 ? O LEU A 355 
AA4 2 3 O THR A 361 ? O THR A 354 N LEU A 228 ? N LEU A 221 
AA4 3 4 N ASN A 231 ? N ASN A 224 O THR A 384 ? O THR A 377 
AA5 1 2 O LEU B 95  ? O LEU B 88  N LEU B 82  ? N LEU B 75  
AA5 2 3 N LEU B 83  ? N LEU B 76  O VAL B 136 ? O VAL B 129 
AA5 3 4 O VAL B 137 ? O VAL B 130 N VAL B 69  ? N VAL B 62  
AA5 4 5 O GLY B 72  ? O GLY B 65  N LEU B 37  ? N LEU B 30  
AA5 5 6 N ALA B 38  ? N ALA B 31  O LEU B 397 ? O LEU B 390 
AA6 1 2 N VAL B 59  ? N VAL B 52  O ILE B 208 ? O ILE B 201 
AA6 2 3 N LEU B 207 ? N LEU B 200 O SER B 216 ? O SER B 209 
AA7 1 2 N TYR B 346 ? N TYR B 339 O LEU B 362 ? O LEU B 355 
AA7 2 3 O THR B 361 ? O THR B 354 N LEU B 228 ? N LEU B 221 
AA7 3 4 N ASN B 231 ? N ASN B 224 O THR B 384 ? O THR B 377 
AA8 1 2 O LEU C 95  ? O LEU C 88  N LEU C 82  ? N LEU C 75  
AA8 2 3 N LEU C 83  ? N LEU C 76  O VAL C 136 ? O VAL C 129 
AA8 3 4 O VAL C 137 ? O VAL C 130 N VAL C 69  ? N VAL C 62  
AA8 4 5 O LEU C 64  ? O LEU C 57  N GLY C 43  ? N GLY C 36  
AA8 5 6 N ALA C 38  ? N ALA C 31  O LEU C 397 ? O LEU C 390 
AA9 1 2 N VAL C 59  ? N VAL C 52  O ILE C 208 ? O ILE C 201 
AA9 2 3 N ALA C 205 ? N ALA C 198 O VAL C 218 ? O VAL C 211 
AB1 1 2 N TYR C 346 ? N TYR C 339 O LEU C 362 ? O LEU C 355 
AB1 2 3 O THR C 359 ? O THR C 352 N THR C 230 ? N THR C 223 
AB1 3 4 N ASN C 231 ? N ASN C 224 O THR C 384 ? O THR C 377 
AB2 1 2 O LEU D 95  ? O LEU D 88  N LEU D 82  ? N LEU D 75  
AB2 2 3 N LEU D 83  ? N LEU D 76  O VAL D 136 ? O VAL D 129 
AB2 3 4 O GLY D 131 ? O GLY D 124 N ARG D 75  ? N ARG D 68  
AB2 4 5 O THR D 68  ? O THR D 61  N ALA D 41  ? N ALA D 34  
AB2 5 6 N ALA D 38  ? N ALA D 31  O LEU D 397 ? O LEU D 390 
AB3 1 2 N VAL D 59  ? N VAL D 52  O ILE D 208 ? O ILE D 201 
AB3 2 3 N ALA D 205 ? N ALA D 198 O VAL D 218 ? O VAL D 211 
AB3 3 4 N LEU D 217 ? N LEU D 210 O THR G 215 ? O THR G 208 
AB3 4 5 O VAL G 218 ? O VAL G 211 N ALA G 205 ? N ALA G 198 
AB3 5 6 O LEU G 206 ? O LEU G 199 N PRO G 61  ? N PRO G 54  
AB3 6 7 N VAL G 69  ? N VAL G 62  O VAL G 137 ? O VAL G 130 
AB3 7 8 O VAL G 136 ? O VAL G 129 N LEU G 83  ? N LEU G 76  
AB3 8 9 N LEU G 82  ? N LEU G 75  O LEU G 95  ? O LEU G 88  
AB4 1 2 N VAL D 59  ? N VAL D 52  O ILE D 208 ? O ILE D 201 
AB4 2 3 N ALA D 205 ? N ALA D 198 O VAL D 218 ? O VAL D 211 
AB4 3 4 N LEU D 217 ? N LEU D 210 O THR G 215 ? O THR G 208 
AB4 4 5 O VAL G 218 ? O VAL G 211 N ALA G 205 ? N ALA G 198 
AB4 5 6 O LEU G 206 ? O LEU G 199 N PRO G 61  ? N PRO G 54  
AB4 6 7 O LEU G 64  ? O LEU G 57  N GLY G 43  ? N GLY G 36  
AB4 7 8 N ALA G 38  ? N ALA G 31  O LEU G 397 ? O LEU G 390 
AB5 1 2 N TYR D 346 ? N TYR D 339 O LEU D 362 ? O LEU D 355 
AB5 2 3 O LEU D 363 ? O LEU D 356 N ALA D 226 ? N ALA D 219 
AB5 3 4 N ILE D 229 ? N ILE D 222 O TYR D 386 ? O TYR D 379 
AB6 1 2 O LEU E 95  ? O LEU E 88  N LEU E 82  ? N LEU E 75  
AB6 2 3 N LEU E 83  ? N LEU E 76  O VAL E 136 ? O VAL E 129 
AB6 3 4 O GLY E 131 ? O GLY E 124 N ARG E 75  ? N ARG E 68  
AB6 4 5 O LEU E 70  ? O LEU E 63  N VAL E 39  ? N VAL E 32  
AB6 5 6 N ALA E 38  ? N ALA E 31  O LEU E 397 ? O LEU E 390 
AB7 1 2 N VAL E 59  ? N VAL E 52  O ILE E 208 ? O ILE E 201 
AB7 2 3 N ALA E 205 ? N ALA E 198 O VAL E 218 ? O VAL E 211 
AB7 3 4 N THR E 215 ? N THR E 208 O LEU H 217 ? O LEU H 210 
AB7 4 5 O VAL H 218 ? O VAL H 211 N ALA H 205 ? N ALA H 198 
AB7 5 6 O ILE H 208 ? O ILE H 201 N VAL H 59  ? N VAL H 52  
AB8 1 2 N TYR E 346 ? N TYR E 339 O LEU E 362 ? O LEU E 355 
AB8 2 3 O THR E 359 ? O THR E 352 N THR E 230 ? N THR E 223 
AB8 3 4 N ASN E 231 ? N ASN E 224 O THR E 384 ? O THR E 377 
AB9 1 2 N TYR F 346 ? N TYR F 339 O LEU F 362 ? O LEU F 355 
AB9 2 3 O THR F 361 ? O THR F 354 N LEU F 228 ? N LEU F 221 
AB9 3 4 N ASN F 231 ? N ASN F 224 O THR F 384 ? O THR F 377 
AC1 1 2 N TYR G 346 ? N TYR G 339 O LEU G 362 ? O LEU G 355 
AC1 2 3 O LEU G 363 ? O LEU G 356 N ALA G 226 ? N ALA G 219 
AC1 3 4 N ILE G 229 ? N ILE G 222 O TYR G 386 ? O TYR G 379 
AC2 1 2 O LEU H 95  ? O LEU H 88  N LEU H 82  ? N LEU H 75  
AC2 2 3 N LEU H 83  ? N LEU H 76  O VAL H 136 ? O VAL H 129 
AC2 3 4 O GLY H 131 ? O GLY H 124 N ARG H 75  ? N ARG H 68  
AC2 4 5 O THR H 68  ? O THR H 61  N ALA H 41  ? N ALA H 34  
AC2 5 6 N ALA H 38  ? N ALA H 31  O LEU H 397 ? O LEU H 390 
AC3 1 2 N TYR H 346 ? N TYR H 339 O LEU H 362 ? O LEU H 355 
AC3 2 3 O THR H 361 ? O THR H 354 N LEU H 228 ? N LEU H 221 
AC3 3 4 N ASN H 231 ? N ASN H 224 O THR H 384 ? O THR H 377 
# 
_atom_sites.entry_id                    6GR2 
_atom_sites.fract_transf_matrix[1][1]   0.012785 
_atom_sites.fract_transf_matrix[1][2]   0.002552 
_atom_sites.fract_transf_matrix[1][3]   0.004481 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009243 
_atom_sites.fract_transf_matrix[2][3]   0.004859 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009778 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N      . LEU A  1 11  ? -39.143  18.200  29.380  1.00 103.08 ? 4   LEU A N      1 
ATOM   2     C CA     . LEU A  1 11  ? -40.510  18.676  29.200  1.00 102.92 ? 4   LEU A CA     1 
ATOM   3     C C      . LEU A  1 11  ? -41.268  17.759  28.237  1.00 108.50 ? 4   LEU A C      1 
ATOM   4     O O      . LEU A  1 11  ? -40.949  17.691  27.049  1.00 112.04 ? 4   LEU A O      1 
ATOM   5     C CB     . LEU A  1 11  ? -40.507  20.120  28.693  1.00 99.39  ? 4   LEU A CB     1 
ATOM   6     C CG     . LEU A  1 11  ? -41.636  21.017  29.201  1.00 93.59  ? 4   LEU A CG     1 
ATOM   7     C CD1    . LEU A  1 11  ? -41.816  20.845  30.697  1.00 88.00  ? 4   LEU A CD1    1 
ATOM   8     C CD2    . LEU A  1 11  ? -41.351  22.473  28.869  1.00 94.47  ? 4   LEU A CD2    1 
ATOM   9     N N      . ARG A  1 12  ? -42.282  17.064  28.761  1.00 112.42 ? 5   ARG A N      1 
ATOM   10    C CA     . ARG A  1 12  ? -42.942  15.985  28.032  1.00 111.84 ? 5   ARG A CA     1 
ATOM   11    C C      . ARG A  1 12  ? -44.115  15.423  28.830  1.00 109.96 ? 5   ARG A C      1 
ATOM   12    O O      . ARG A  1 12  ? -44.021  15.299  30.055  1.00 110.56 ? 5   ARG A O      1 
ATOM   13    C CB     . ARG A  1 12  ? -41.930  14.878  27.729  1.00 112.14 ? 5   ARG A CB     1 
ATOM   14    C CG     . ARG A  1 12  ? -41.247  14.332  28.983  1.00 111.11 ? 5   ARG A CG     1 
ATOM   15    C CD     . ARG A  1 12  ? -39.773  14.038  28.748  1.00 112.67 ? 5   ARG A CD     1 
ATOM   16    N N      . GLN A  1 13  ? -45.225  15.065  28.159  1.00 100.61 ? 6   GLN A N      1 
ATOM   17    C CA     . GLN A  1 13  ? -46.362  14.537  28.913  1.00 92.86  ? 6   GLN A CA     1 
ATOM   18    C C      . GLN A  1 13  ? -47.517  14.041  28.041  1.00 84.62  ? 6   GLN A C      1 
ATOM   19    O O      . GLN A  1 13  ? -48.313  14.846  27.544  1.00 85.06  ? 6   GLN A O      1 
ATOM   20    C CB     . GLN A  1 13  ? -46.876  15.605  29.880  1.00 93.69  ? 6   GLN A CB     1 
ATOM   21    N N      . PRO A  1 14  ? -47.643  12.727  27.844  1.00 77.27  ? 7   PRO A N      1 
ATOM   22    C CA     . PRO A  1 14  ? -48.722  12.189  26.998  1.00 72.50  ? 7   PRO A CA     1 
ATOM   23    C C      . PRO A  1 14  ? -50.113  12.416  27.583  1.00 67.00  ? 7   PRO A C      1 
ATOM   24    O O      . PRO A  1 14  ? -50.288  12.533  28.798  1.00 69.60  ? 7   PRO A O      1 
ATOM   25    C CB     . PRO A  1 14  ? -48.405  10.692  26.911  1.00 70.51  ? 7   PRO A CB     1 
ATOM   26    C CG     . PRO A  1 14  ? -47.453  10.401  28.010  1.00 72.05  ? 7   PRO A CG     1 
ATOM   27    C CD     . PRO A  1 14  ? -46.880  11.680  28.544  1.00 75.63  ? 7   PRO A CD     1 
ATOM   28    N N      . GLN A  1 15  ? -51.110  12.469  26.694  1.00 63.17  ? 8   GLN A N      1 
ATOM   29    C CA     . GLN A  1 15  ? -52.510  12.655  27.066  1.00 59.42  ? 8   GLN A CA     1 
ATOM   30    C C      . GLN A  1 15  ? -53.257  11.321  27.164  1.00 56.83  ? 8   GLN A C      1 
ATOM   31    O O      . GLN A  1 15  ? -52.798  10.280  26.688  1.00 55.63  ? 8   GLN A O      1 
ATOM   32    C CB     . GLN A  1 15  ? -53.208  13.562  26.047  1.00 64.87  ? 8   GLN A CB     1 
ATOM   33    C CG     . GLN A  1 15  ? -54.533  14.135  26.521  1.00 67.83  ? 8   GLN A CG     1 
ATOM   34    C CD     . GLN A  1 15  ? -54.363  15.047  27.716  1.00 69.76  ? 8   GLN A CD     1 
ATOM   35    O OE1    . GLN A  1 15  ? -54.434  14.605  28.865  1.00 69.27  ? 8   GLN A OE1    1 
ATOM   36    N NE2    . GLN A  1 15  ? -54.127  16.330  27.453  1.00 71.43  ? 8   GLN A NE2    1 
ATOM   37    N N      . VAL A  1 16  ? -54.441  11.376  27.792  1.00 52.26  ? 9   VAL A N      1 
ATOM   38    C CA     . VAL A  1 16  ? -55.217  10.164  28.070  1.00 48.43  ? 9   VAL A CA     1 
ATOM   39    C C      . VAL A  1 16  ? -55.659  9.492   26.774  1.00 53.47  ? 9   VAL A C      1 
ATOM   40    O O      . VAL A  1 16  ? -55.532  8.272   26.610  1.00 52.82  ? 9   VAL A O      1 
ATOM   41    C CB     . VAL A  1 16  ? -56.426  10.488  28.968  1.00 43.70  ? 9   VAL A CB     1 
ATOM   42    C CG1    . VAL A  1 16  ? -56.994  9.216   29.583  1.00 36.55  ? 9   VAL A CG1    1 
ATOM   43    C CG2    . VAL A  1 16  ? -56.044  11.480  30.051  1.00 49.50  ? 9   VAL A CG2    1 
ATOM   44    N N      . ALA A  1 17  ? -56.194  10.279  25.836  1.00 54.25  ? 10  ALA A N      1 
ATOM   45    C CA     . ALA A  1 17  ? -56.681  9.706   24.585  1.00 52.61  ? 10  ALA A CA     1 
ATOM   46    C C      . ALA A  1 17  ? -55.546  9.044   23.821  1.00 52.00  ? 10  ALA A C      1 
ATOM   47    O O      . ALA A  1 17  ? -55.714  7.958   23.253  1.00 51.96  ? 10  ALA A O      1 
ATOM   48    C CB     . ALA A  1 17  ? -57.353  10.783  23.734  1.00 53.62  ? 10  ALA A CB     1 
ATOM   49    N N      . GLU A  1 18  ? -54.383  9.695   23.791  1.00 55.24  ? 11  GLU A N      1 
ATOM   50    C CA     . GLU A  1 18  ? -53.221  9.115   23.134  1.00 56.98  ? 11  GLU A CA     1 
ATOM   51    C C      . GLU A  1 18  ? -52.835  7.797   23.794  1.00 55.43  ? 11  GLU A C      1 
ATOM   52    O O      . GLU A  1 18  ? -52.531  6.814   23.108  1.00 57.41  ? 11  GLU A O      1 
ATOM   53    C CB     . GLU A  1 18  ? -52.064  10.113  23.171  1.00 62.17  ? 11  GLU A CB     1 
ATOM   54    C CG     . GLU A  1 18  ? -50.851  9.726   22.354  1.00 69.68  ? 11  GLU A CG     1 
ATOM   55    C CD     . GLU A  1 18  ? -49.769  10.786  22.412  1.00 75.37  ? 11  GLU A CD     1 
ATOM   56    O OE1    . GLU A  1 18  ? -48.584  10.443  22.220  1.00 77.45  ? 11  GLU A OE1    1 
ATOM   57    O OE2    . GLU A  1 18  ? -50.106  11.964  22.660  1.00 77.76  ? 11  GLU A OE2    1 
ATOM   58    N N      . LEU A  1 19  ? -52.843  7.758   25.129  1.00 50.56  ? 12  LEU A N      1 
ATOM   59    C CA     . LEU A  1 19  ? -52.531  6.518   25.833  1.00 48.11  ? 12  LEU A CA     1 
ATOM   60    C C      . LEU A  1 19  ? -53.590  5.452   25.573  1.00 47.47  ? 12  LEU A C      1 
ATOM   61    O O      . LEU A  1 19  ? -53.257  4.286   25.327  1.00 47.08  ? 12  LEU A O      1 
ATOM   62    C CB     . LEU A  1 19  ? -52.391  6.792   27.330  1.00 44.07  ? 12  LEU A CB     1 
ATOM   63    C CG     . LEU A  1 19  ? -51.107  7.523   27.724  1.00 43.75  ? 12  LEU A CG     1 
ATOM   64    C CD1    . LEU A  1 19  ? -51.085  7.812   29.213  1.00 39.92  ? 12  LEU A CD1    1 
ATOM   65    C CD2    . LEU A  1 19  ? -49.893  6.702   27.316  1.00 44.96  ? 12  LEU A CD2    1 
ATOM   66    N N      . LEU A  1 20  ? -54.871  5.827   25.632  1.00 46.39  ? 13  LEU A N      1 
ATOM   67    C CA     . LEU A  1 20  ? -55.933  4.862   25.358  1.00 44.57  ? 13  LEU A CA     1 
ATOM   68    C C      . LEU A  1 20  ? -55.825  4.312   23.942  1.00 47.19  ? 13  LEU A C      1 
ATOM   69    O O      . LEU A  1 20  ? -56.020  3.112   23.718  1.00 44.38  ? 13  LEU A O      1 
ATOM   70    C CB     . LEU A  1 20  ? -57.302  5.505   25.582  1.00 46.20  ? 13  LEU A CB     1 
ATOM   71    C CG     . LEU A  1 20  ? -58.525  4.598   25.417  1.00 47.25  ? 13  LEU A CG     1 
ATOM   72    C CD1    . LEU A  1 20  ? -58.434  3.396   26.346  1.00 44.99  ? 13  LEU A CD1    1 
ATOM   73    C CD2    . LEU A  1 20  ? -59.806  5.380   25.665  1.00 46.73  ? 13  LEU A CD2    1 
ATOM   74    N N      . ALA A  1 21  ? -55.512  5.175   22.972  1.00 53.33  ? 14  ALA A N      1 
ATOM   75    C CA     . ALA A  1 21  ? -55.367  4.713   21.595  1.00 54.33  ? 14  ALA A CA     1 
ATOM   76    C C      . ALA A  1 21  ? -54.141  3.822   21.436  1.00 53.64  ? 14  ALA A C      1 
ATOM   77    O O      . ALA A  1 21  ? -54.195  2.802   20.740  1.00 54.19  ? 14  ALA A O      1 
ATOM   78    C CB     . ALA A  1 21  ? -55.296  5.909   20.645  1.00 40.18  ? 14  ALA A CB     1 
ATOM   79    N N      . GLU A  1 22  ? -53.023  4.193   22.068  1.00 52.27  ? 15  GLU A N      1 
ATOM   80    C CA     . GLU A  1 22  ? -51.836  3.345   22.024  1.00 52.36  ? 15  GLU A CA     1 
ATOM   81    C C      . GLU A  1 22  ? -52.103  1.993   22.669  1.00 52.10  ? 15  GLU A C      1 
ATOM   82    O O      . GLU A  1 22  ? -51.647  0.956   22.174  1.00 52.91  ? 15  GLU A O      1 
ATOM   83    C CB     . GLU A  1 22  ? -50.659  4.036   22.713  1.00 56.25  ? 15  GLU A CB     1 
ATOM   84    C CG     . GLU A  1 22  ? -49.447  3.131   22.893  1.00 61.96  ? 15  GLU A CG     1 
ATOM   85    C CD     . GLU A  1 22  ? -48.381  3.743   23.782  1.00 66.07  ? 15  GLU A CD     1 
ATOM   86    O OE1    . GLU A  1 22  ? -48.508  4.935   24.135  1.00 66.27  ? 15  GLU A OE1    1 
ATOM   87    O OE2    . GLU A  1 22  ? -47.416  3.030   24.131  1.00 67.57  ? 15  GLU A OE2    1 
ATOM   88    N N      . ALA A  1 23  ? -52.849  1.986   23.775  1.00 50.34  ? 16  ALA A N      1 
ATOM   89    C CA     . ALA A  1 23  ? -53.116  0.736   24.471  1.00 49.15  ? 16  ALA A CA     1 
ATOM   90    C C      . ALA A  1 23  ? -54.019  -0.185  23.662  1.00 50.17  ? 16  ALA A C      1 
ATOM   91    O O      . ALA A  1 23  ? -53.876  -1.409  23.743  1.00 45.72  ? 16  ALA A O      1 
ATOM   92    C CB     . ALA A  1 23  ? -53.744  1.017   25.835  1.00 46.19  ? 16  ALA A CB     1 
ATOM   93    N N      . ARG A  1 24  ? -54.953  0.367   22.884  1.00 52.94  ? 17  ARG A N      1 
ATOM   94    C CA     . ARG A  1 24  ? -55.831  -0.509  22.116  1.00 54.50  ? 17  ARG A CA     1 
ATOM   95    C C      . ARG A  1 24  ? -55.088  -1.116  20.932  1.00 58.26  ? 17  ARG A C      1 
ATOM   96    O O      . ARG A  1 24  ? -55.261  -2.301  20.625  1.00 61.49  ? 17  ARG A O      1 
ATOM   97    C CB     . ARG A  1 24  ? -57.074  0.233   21.628  1.00 55.00  ? 17  ARG A CB     1 
ATOM   98    C CG     . ARG A  1 24  ? -58.067  0.579   22.725  1.00 56.72  ? 17  ARG A CG     1 
ATOM   99    C CD     . ARG A  1 24  ? -59.384  1.079   22.157  1.00 60.54  ? 17  ARG A CD     1 
ATOM   100   N NE     . ARG A  1 24  ? -59.206  1.810   20.909  1.00 67.69  ? 17  ARG A NE     1 
ATOM   101   C CZ     . ARG A  1 24  ? -59.537  1.306   19.726  1.00 74.34  ? 17  ARG A CZ     1 
ATOM   102   N NH1    . ARG A  1 24  ? -60.088  0.101   19.673  1.00 77.93  ? 17  ARG A NH1    1 
ATOM   103   N NH2    . ARG A  1 24  ? -59.346  2.002   18.611  1.00 76.16  ? 17  ARG A NH2    1 
ATOM   104   N N      . ARG A  1 25  ? -54.269  -0.312  20.246  1.00 56.51  ? 18  ARG A N      1 
ATOM   105   C CA     . ARG A  1 25  ? -53.475  -0.827  19.134  1.00 57.64  ? 18  ARG A CA     1 
ATOM   106   C C      . ARG A  1 25  ? -52.620  -2.002  19.580  1.00 57.95  ? 18  ARG A C      1 
ATOM   107   O O      . ARG A  1 25  ? -52.546  -3.031  18.896  1.00 61.36  ? 18  ARG A O      1 
ATOM   108   C CB     . ARG A  1 25  ? -52.595  0.285   18.561  1.00 59.08  ? 18  ARG A CB     1 
ATOM   109   N N      . ALA A  1 26  ? -51.959  -1.864  20.729  1.00 53.80  ? 19  ALA A N      1 
ATOM   110   C CA     . ALA A  1 26  ? -51.156  -2.964  21.245  1.00 49.94  ? 19  ALA A CA     1 
ATOM   111   C C      . ALA A  1 26  ? -52.038  -4.153  21.602  1.00 46.60  ? 19  ALA A C      1 
ATOM   112   O O      . ALA A  1 26  ? -51.681  -5.305  21.329  1.00 47.47  ? 19  ALA A O      1 
ATOM   113   C CB     . ALA A  1 26  ? -50.349  -2.502  22.456  1.00 43.83  ? 19  ALA A CB     1 
ATOM   114   N N      . PHE A  1 27  ? -53.200  -3.892  22.204  1.00 42.96  ? 20  PHE A N      1 
ATOM   115   C CA     . PHE A  1 27  ? -54.112  -4.980  22.540  1.00 44.96  ? 20  PHE A CA     1 
ATOM   116   C C      . PHE A  1 27  ? -54.634  -5.671  21.285  1.00 44.23  ? 20  PHE A C      1 
ATOM   117   O O      . PHE A  1 27  ? -54.772  -6.900  21.253  1.00 42.93  ? 20  PHE A O      1 
ATOM   118   C CB     . PHE A  1 27  ? -55.267  -4.450  23.388  1.00 45.66  ? 20  PHE A CB     1 
ATOM   119   C CG     . PHE A  1 27  ? -56.184  -5.522  23.900  1.00 50.04  ? 20  PHE A CG     1 
ATOM   120   C CD1    . PHE A  1 27  ? -57.192  -6.036  23.099  1.00 52.56  ? 20  PHE A CD1    1 
ATOM   121   C CD2    . PHE A  1 27  ? -56.032  -6.023  25.182  1.00 50.23  ? 20  PHE A CD2    1 
ATOM   122   C CE1    . PHE A  1 27  ? -58.035  -7.022  23.572  1.00 53.04  ? 20  PHE A CE1    1 
ATOM   123   C CE2    . PHE A  1 27  ? -56.871  -7.009  25.659  1.00 51.98  ? 20  PHE A CE2    1 
ATOM   124   C CZ     . PHE A  1 27  ? -57.874  -7.509  24.854  1.00 53.90  ? 20  PHE A CZ     1 
ATOM   125   N N      . ARG A  1 28  ? -54.934  -4.898  20.240  1.00 43.29  ? 21  ARG A N      1 
ATOM   126   C CA     . ARG A  1 28  ? -55.406  -5.491  18.994  1.00 42.91  ? 21  ARG A CA     1 
ATOM   127   C C      . ARG A  1 28  ? -54.326  -6.361  18.362  1.00 51.27  ? 21  ARG A C      1 
ATOM   128   O O      . ARG A  1 28  ? -54.572  -7.522  18.010  1.00 56.00  ? 21  ARG A O      1 
ATOM   129   C CB     . ARG A  1 28  ? -55.855  -4.396  18.027  1.00 43.73  ? 21  ARG A CB     1 
ATOM   130   N N      . GLU A  1 29  ? -53.118  -5.812  18.207  1.00 52.20  ? 22  GLU A N      1 
ATOM   131   C CA     . GLU A  1 29  ? -52.022  -6.573  17.618  1.00 58.35  ? 22  GLU A CA     1 
ATOM   132   C C      . GLU A  1 29  ? -51.749  -7.863  18.383  1.00 61.46  ? 22  GLU A C      1 
ATOM   133   O O      . GLU A  1 29  ? -51.330  -8.860  17.784  1.00 66.48  ? 22  GLU A O      1 
ATOM   134   C CB     . GLU A  1 29  ? -50.758  -5.713  17.565  1.00 57.19  ? 22  GLU A CB     1 
ATOM   135   N N      . GLU A  1 30  ? -51.976  -7.865  19.697  1.00 61.88  ? 23  GLU A N      1 
ATOM   136   C CA     . GLU A  1 30  ? -51.604  -8.996  20.540  1.00 61.39  ? 23  GLU A CA     1 
ATOM   137   C C      . GLU A  1 30  ? -52.712  -10.029 20.691  1.00 56.76  ? 23  GLU A C      1 
ATOM   138   O O      . GLU A  1 30  ? -52.417  -11.224 20.813  1.00 55.39  ? 23  GLU A O      1 
ATOM   139   C CB     . GLU A  1 30  ? -51.192  -8.499  21.932  1.00 63.93  ? 23  GLU A CB     1 
ATOM   140   C CG     . GLU A  1 30  ? -50.900  -9.609  22.938  1.00 65.93  ? 23  GLU A CG     1 
ATOM   141   C CD     . GLU A  1 30  ? -49.520  -10.214 22.762  1.00 67.87  ? 23  GLU A CD     1 
ATOM   142   O OE1    . GLU A  1 30  ? -48.750  -9.701  21.922  1.00 69.63  ? 23  GLU A OE1    1 
ATOM   143   O OE2    . GLU A  1 30  ? -49.203  -11.201 23.462  1.00 67.79  ? 23  GLU A OE2    1 
ATOM   144   N N      . PHE A  1 31  ? -53.978  -9.605  20.675  1.00 54.64  ? 24  PHE A N      1 
ATOM   145   C CA     . PHE A  1 31  ? -55.086  -10.496 20.981  1.00 53.21  ? 24  PHE A CA     1 
ATOM   146   C C      . PHE A  1 31  ? -56.118  -10.627 19.868  1.00 50.11  ? 24  PHE A C      1 
ATOM   147   O O      . PHE A  1 31  ? -57.011  -11.476 19.979  1.00 44.67  ? 24  PHE A O      1 
ATOM   148   C CB     . PHE A  1 31  ? -55.769  -10.035 22.277  1.00 51.18  ? 24  PHE A CB     1 
ATOM   149   C CG     . PHE A  1 31  ? -54.868  -10.113 23.476  1.00 54.47  ? 24  PHE A CG     1 
ATOM   150   C CD1    . PHE A  1 31  ? -54.525  -11.336 24.026  1.00 57.09  ? 24  PHE A CD1    1 
ATOM   151   C CD2    . PHE A  1 31  ? -54.321  -8.964  24.023  1.00 53.63  ? 24  PHE A CD2    1 
ATOM   152   C CE1    . PHE A  1 31  ? -53.681  -11.409 25.118  1.00 55.02  ? 24  PHE A CE1    1 
ATOM   153   C CE2    . PHE A  1 31  ? -53.474  -9.032  25.112  1.00 52.91  ? 24  PHE A CE2    1 
ATOM   154   C CZ     . PHE A  1 31  ? -53.156  -10.255 25.660  1.00 52.03  ? 24  PHE A CZ     1 
ATOM   155   N N      . GLY A  1 32  ? -56.034  -9.817  18.812  1.00 50.74  ? 25  GLY A N      1 
ATOM   156   C CA     . GLY A  1 32  ? -56.853  -9.994  17.632  1.00 52.52  ? 25  GLY A CA     1 
ATOM   157   C C      . GLY A  1 32  ? -58.213  -9.334  17.664  1.00 51.91  ? 25  GLY A C      1 
ATOM   158   O O      . GLY A  1 32  ? -58.888  -9.299  16.627  1.00 54.51  ? 25  GLY A O      1 
ATOM   159   N N      . ALA A  1 33  ? -58.645  -8.816  18.808  1.00 49.32  ? 26  ALA A N      1 
ATOM   160   C CA     . ALA A  1 33  ? -59.941  -8.169  18.918  1.00 52.13  ? 26  ALA A CA     1 
ATOM   161   C C      . ALA A  1 33  ? -59.774  -6.813  19.586  1.00 53.82  ? 26  ALA A C      1 
ATOM   162   O O      . ALA A  1 33  ? -58.693  -6.453  20.060  1.00 54.66  ? 26  ALA A O      1 
ATOM   163   C CB     . ALA A  1 33  ? -60.931  -9.036  19.708  1.00 48.48  ? 26  ALA A CB     1 
ATOM   164   N N      . GLU A  1 34  ? -60.861  -6.061  19.618  1.00 53.87  ? 27  GLU A N      1 
ATOM   165   C CA     . GLU A  1 34  ? -60.848  -4.814  20.363  1.00 51.23  ? 27  GLU A CA     1 
ATOM   166   C C      . GLU A  1 34  ? -61.013  -5.109  21.851  1.00 48.38  ? 27  GLU A C      1 
ATOM   167   O O      . GLU A  1 34  ? -61.805  -5.978  22.228  1.00 48.86  ? 27  GLU A O      1 
ATOM   168   C CB     . GLU A  1 34  ? -61.967  -3.888  19.891  1.00 55.34  ? 27  GLU A CB     1 
ATOM   169   C CG     . GLU A  1 34  ? -61.996  -3.655  18.390  1.00 60.46  ? 27  GLU A CG     1 
ATOM   170   N N      . PRO A  1 35  ? -60.288  -4.404  22.716  1.00 46.93  ? 28  PRO A N      1 
ATOM   171   C CA     . PRO A  1 35  ? -60.529  -4.555  24.151  1.00 46.32  ? 28  PRO A CA     1 
ATOM   172   C C      . PRO A  1 35  ? -61.921  -4.060  24.503  1.00 46.36  ? 28  PRO A C      1 
ATOM   173   O O      . PRO A  1 35  ? -62.473  -3.168  23.855  1.00 48.40  ? 28  PRO A O      1 
ATOM   174   C CB     . PRO A  1 35  ? -59.435  -3.694  24.791  1.00 44.47  ? 28  PRO A CB     1 
ATOM   175   C CG     . PRO A  1 35  ? -59.106  -2.681  23.748  1.00 44.59  ? 28  PRO A CG     1 
ATOM   176   C CD     . PRO A  1 35  ? -59.260  -3.390  22.429  1.00 45.40  ? 28  PRO A CD     1 
ATOM   177   N N      . GLU A  1 36  ? -62.492  -4.661  25.542  1.00 48.57  ? 29  GLU A N      1 
ATOM   178   C CA     . GLU A  1 36  ? -63.842  -4.333  25.970  1.00 49.73  ? 29  GLU A CA     1 
ATOM   179   C C      . GLU A  1 36  ? -63.873  -3.365  27.143  1.00 48.30  ? 29  GLU A C      1 
ATOM   180   O O      . GLU A  1 36  ? -64.876  -2.666  27.325  1.00 49.25  ? 29  GLU A O      1 
ATOM   181   C CB     . GLU A  1 36  ? -64.595  -5.620  26.328  1.00 55.76  ? 29  GLU A CB     1 
ATOM   182   C CG     . GLU A  1 36  ? -64.670  -6.609  25.161  1.00 61.83  ? 29  GLU A CG     1 
ATOM   183   C CD     . GLU A  1 36  ? -65.394  -7.897  25.507  1.00 67.47  ? 29  GLU A CD     1 
ATOM   184   O OE1    . GLU A  1 36  ? -65.817  -8.051  26.671  1.00 69.46  ? 29  GLU A OE1    1 
ATOM   185   O OE2    . GLU A  1 36  ? -65.534  -8.762  24.614  1.00 70.50  ? 29  GLU A OE2    1 
ATOM   186   N N      . LEU A  1 37  ? -62.809  -3.313  27.937  1.00 44.75  ? 30  LEU A N      1 
ATOM   187   C CA     . LEU A  1 37  ? -62.764  -2.502  29.142  1.00 39.37  ? 30  LEU A CA     1 
ATOM   188   C C      . LEU A  1 37  ? -61.494  -1.664  29.162  1.00 38.35  ? 30  LEU A C      1 
ATOM   189   O O      . LEU A  1 37  ? -60.442  -2.087  28.673  1.00 37.66  ? 30  LEU A O      1 
ATOM   190   C CB     . LEU A  1 37  ? -62.842  -3.374  30.393  1.00 35.21  ? 30  LEU A CB     1 
ATOM   191   C CG     . LEU A  1 37  ? -64.053  -4.307  30.410  1.00 39.46  ? 30  LEU A CG     1 
ATOM   192   C CD1    . LEU A  1 37  ? -63.881  -5.424  31.430  1.00 32.70  ? 30  LEU A CD1    1 
ATOM   193   C CD2    . LEU A  1 37  ? -65.312  -3.505  30.694  1.00 32.63  ? 30  LEU A CD2    1 
ATOM   194   N N      . ALA A  1 38  ? -61.608  -0.467  29.735  1.00 38.44  ? 31  ALA A N      1 
ATOM   195   C CA     . ALA A  1 38  ? -60.496  0.467   29.834  1.00 35.72  ? 31  ALA A CA     1 
ATOM   196   C C      . ALA A  1 38  ? -60.522  1.126   31.206  1.00 32.36  ? 31  ALA A C      1 
ATOM   197   O O      . ALA A  1 38  ? -61.587  1.321   31.797  1.00 31.61  ? 31  ALA A O      1 
ATOM   198   C CB     . ALA A  1 38  ? -60.547  1.529   28.724  1.00 39.23  ? 31  ALA A CB     1 
ATOM   199   N N      . VAL A  1 39  ? -59.333  1.465   31.706  1.00 33.57  ? 32  VAL A N      1 
ATOM   200   C CA     . VAL A  1 39  ? -59.166  1.941   33.076  1.00 31.22  ? 32  VAL A CA     1 
ATOM   201   C C      . VAL A  1 39  ? -57.883  2.755   33.134  1.00 36.12  ? 32  VAL A C      1 
ATOM   202   O O      . VAL A  1 39  ? -56.948  2.519   32.363  1.00 40.35  ? 32  VAL A O      1 
ATOM   203   C CB     . VAL A  1 39  ? -59.139  0.760   34.080  1.00 29.06  ? 32  VAL A CB     1 
ATOM   204   C CG1    . VAL A  1 39  ? -57.784  0.677   34.770  1.00 29.47  ? 32  VAL A CG1    1 
ATOM   205   C CG2    . VAL A  1 39  ? -60.271  0.888   35.094  1.00 29.63  ? 32  VAL A CG2    1 
ATOM   206   N N      . SER A  1 40  ? -57.839  3.721   34.054  1.00 36.17  ? 33  SER A N      1 
ATOM   207   C CA     . SER A  1 40  ? -56.646  4.534   34.244  1.00 38.32  ? 33  SER A CA     1 
ATOM   208   C C      . SER A  1 40  ? -56.417  4.802   35.727  1.00 38.89  ? 33  SER A C      1 
ATOM   209   O O      . SER A  1 40  ? -57.358  4.829   36.526  1.00 39.44  ? 33  SER A O      1 
ATOM   210   C CB     . SER A  1 40  ? -56.742  5.866   33.480  1.00 39.28  ? 33  SER A CB     1 
ATOM   211   O OG     . SER A  1 40  ? -57.839  6.645   33.923  1.00 44.72  ? 33  SER A OG     1 
ATOM   212   N N      . ALA A  1 41  ? -55.145  5.013   36.080  1.00 36.76  ? 34  ALA A N      1 
ATOM   213   C CA     . ALA A  1 41  ? -54.702  5.290   37.445  1.00 35.57  ? 34  ALA A CA     1 
ATOM   214   C C      . ALA A  1 41  ? -53.420  6.111   37.378  1.00 34.88  ? 34  ALA A C      1 
ATOM   215   O O      . ALA A  1 41  ? -52.500  5.739   36.633  1.00 35.73  ? 34  ALA A O      1 
ATOM   216   C CB     . ALA A  1 41  ? -54.462  4.012   38.248  1.00 35.57  ? 34  ALA A CB     1 
ATOM   217   N N      . PRO A  1 42  ? -53.324  7.207   38.125  1.00 31.39  ? 35  PRO A N      1 
ATOM   218   C CA     . PRO A  1 42  ? -52.183  8.116   37.984  1.00 31.97  ? 35  PRO A CA     1 
ATOM   219   C C      . PRO A  1 42  ? -50.989  7.746   38.855  1.00 36.45  ? 35  PRO A C      1 
ATOM   220   O O      . PRO A  1 42  ? -51.084  6.970   39.809  1.00 39.47  ? 35  PRO A O      1 
ATOM   221   C CB     . PRO A  1 42  ? -52.773  9.462   38.427  1.00 30.22  ? 35  PRO A CB     1 
ATOM   222   C CG     . PRO A  1 42  ? -53.764  9.074   39.477  1.00 32.01  ? 35  PRO A CG     1 
ATOM   223   C CD     . PRO A  1 42  ? -54.360  7.756   39.018  1.00 32.74  ? 35  PRO A CD     1 
ATOM   224   N N      . GLY A  1 43  ? -49.845  8.323   38.493  1.00 38.16  ? 36  GLY A N      1 
ATOM   225   C CA     . GLY A  1 43  ? -48.692  8.379   39.366  1.00 36.96  ? 36  GLY A CA     1 
ATOM   226   C C      . GLY A  1 43  ? -48.857  9.460   40.417  1.00 38.83  ? 36  GLY A C      1 
ATOM   227   O O      . GLY A  1 43  ? -49.900  10.105  40.535  1.00 41.92  ? 36  GLY A O      1 
ATOM   228   N N      . ARG A  1 44  ? -47.799  9.657   41.201  1.00 40.85  ? 37  ARG A N      1 
ATOM   229   C CA     . ARG A  1 44  ? -47.895  10.576  42.323  1.00 42.54  ? 37  ARG A CA     1 
ATOM   230   C C      . ARG A  1 44  ? -46.563  11.268  42.579  1.00 41.54  ? 37  ARG A C      1 
ATOM   231   O O      . ARG A  1 44  ? -45.492  10.726  42.290  1.00 39.74  ? 37  ARG A O      1 
ATOM   232   C CB     . ARG A  1 44  ? -48.371  9.828   43.577  1.00 43.91  ? 37  ARG A CB     1 
ATOM   233   C CG     . ARG A  1 44  ? -47.977  10.459  44.893  1.00 48.13  ? 37  ARG A CG     1 
ATOM   234   C CD     . ARG A  1 44  ? -46.958  9.586   45.608  1.00 45.77  ? 37  ARG A CD     1 
ATOM   235   N NE     . ARG A  1 44  ? -45.623  9.740   45.039  1.00 46.11  ? 37  ARG A NE     1 
ATOM   236   C CZ     . ARG A  1 44  ? -44.571  8.999   45.370  1.00 45.41  ? 37  ARG A CZ     1 
ATOM   237   N NH1    . ARG A  1 44  ? -43.397  9.228   44.798  1.00 43.27  ? 37  ARG A NH1    1 
ATOM   238   N NH2    . ARG A  1 44  ? -44.688  8.027   46.265  1.00 46.74  ? 37  ARG A NH2    1 
ATOM   239   N N      . VAL A  1 45  ? -46.653  12.485  43.117  1.00 40.68  ? 38  VAL A N      1 
ATOM   240   C CA     . VAL A  1 45  ? -45.521  13.215  43.679  1.00 38.20  ? 38  VAL A CA     1 
ATOM   241   C C      . VAL A  1 45  ? -45.921  13.711  45.062  1.00 37.44  ? 38  VAL A C      1 
ATOM   242   O O      . VAL A  1 45  ? -47.011  14.268  45.233  1.00 40.50  ? 38  VAL A O      1 
ATOM   243   C CB     . VAL A  1 45  ? -45.089  14.394  42.784  1.00 38.53  ? 38  VAL A CB     1 
ATOM   244   C CG1    . VAL A  1 45  ? -46.153  15.487  42.782  1.00 37.68  ? 38  VAL A CG1    1 
ATOM   245   C CG2    . VAL A  1 45  ? -43.753  14.952  43.254  1.00 40.94  ? 38  VAL A CG2    1 
ATOM   246   N N      . ASN A  1 46  ? -45.048  13.506  46.045  1.00 36.56  ? 39  ASN A N      1 
ATOM   247   C CA     . ASN A  1 46  ? -45.296  13.962  47.407  1.00 36.22  ? 39  ASN A CA     1 
ATOM   248   C C      . ASN A  1 46  ? -44.700  15.351  47.603  1.00 35.00  ? 39  ASN A C      1 
ATOM   249   O O      . ASN A  1 46  ? -43.478  15.519  47.548  1.00 33.12  ? 39  ASN A O      1 
ATOM   250   C CB     . ASN A  1 46  ? -44.718  12.987  48.430  1.00 37.25  ? 39  ASN A CB     1 
ATOM   251   C CG     . ASN A  1 46  ? -45.183  13.288  49.840  1.00 42.72  ? 39  ASN A CG     1 
ATOM   252   O OD1    . ASN A  1 46  ? -46.109  14.076  50.042  1.00 45.31  ? 39  ASN A OD1    1 
ATOM   253   N ND2    . ASN A  1 46  ? -44.569  12.636  50.823  1.00 46.78  ? 39  ASN A ND2    1 
ATOM   254   N N      . LEU A  1 47  ? -45.558  16.341  47.847  1.00 33.32  ? 40  LEU A N      1 
ATOM   255   C CA     . LEU A  1 47  ? -45.064  17.695  48.063  1.00 35.80  ? 40  LEU A CA     1 
ATOM   256   C C      . LEU A  1 47  ? -44.247  17.786  49.343  1.00 36.76  ? 40  LEU A C      1 
ATOM   257   O O      . LEU A  1 47  ? -43.201  18.439  49.381  1.00 32.20  ? 40  LEU A O      1 
ATOM   258   C CB     . LEU A  1 47  ? -46.233  18.677  48.098  1.00 33.82  ? 40  LEU A CB     1 
ATOM   259   C CG     . LEU A  1 47  ? -47.123  18.669  46.853  1.00 39.87  ? 40  LEU A CG     1 
ATOM   260   C CD1    . LEU A  1 47  ? -48.200  19.738  46.949  1.00 30.61  ? 40  LEU A CD1    1 
ATOM   261   C CD2    . LEU A  1 47  ? -46.289  18.832  45.593  1.00 36.82  ? 40  LEU A CD2    1 
ATOM   262   N N      . ILE A  1 48  ? -44.706  17.120  50.413  1.00 37.18  ? 41  ILE A N      1 
ATOM   263   C CA     . ILE A  1 48  ? -43.978  17.097  51.674  1.00 37.77  ? 41  ILE A CA     1 
ATOM   264   C C      . ILE A  1 48  ? -44.579  16.007  52.544  1.00 40.86  ? 41  ILE A C      1 
ATOM   265   O O      . ILE A  1 48  ? -45.743  15.629  52.366  1.00 39.33  ? 41  ILE A O      1 
ATOM   266   C CB     . ILE A  1 48  ? -44.040  18.486  52.365  1.00 39.80  ? 41  ILE A CB     1 
ATOM   267   C CG1    . ILE A  1 48  ? -43.028  18.558  53.511  1.00 42.26  ? 41  ILE A CG1    1 
ATOM   268   C CG2    . ILE A  1 48  ? -45.446  18.762  52.870  1.00 38.21  ? 41  ILE A CG2    1 
ATOM   269   C CD1    . ILE A  1 48  ? -42.908  19.934  54.139  1.00 41.03  ? 41  ILE A CD1    1 
ATOM   270   N N      . GLY A  1 49  ? -43.787  15.498  53.485  1.00 43.80  ? 42  GLY A N      1 
ATOM   271   C CA     . GLY A  1 49  ? -44.247  14.445  54.367  1.00 42.46  ? 42  GLY A CA     1 
ATOM   272   C C      . GLY A  1 49  ? -43.641  13.105  54.006  1.00 45.45  ? 42  GLY A C      1 
ATOM   273   O O      . GLY A  1 49  ? -44.356  12.109  53.866  1.00 46.59  ? 42  GLY A O      1 
ATOM   274   N N      . GLU A  1 50  ? -42.320  13.070  53.850  1.00 44.53  ? 43  GLU A N      1 
ATOM   275   C CA     . GLU A  1 50  ? -41.631  11.890  53.352  1.00 43.57  ? 43  GLU A CA     1 
ATOM   276   C C      . GLU A  1 50  ? -41.306  10.934  54.492  1.00 44.62  ? 43  GLU A C      1 
ATOM   277   O O      . GLU A  1 50  ? -40.914  11.359  55.583  1.00 46.49  ? 43  GLU A O      1 
ATOM   278   C CB     . GLU A  1 50  ? -40.346  12.299  52.630  1.00 44.07  ? 43  GLU A CB     1 
ATOM   279   C CG     . GLU A  1 50  ? -40.112  11.609  51.299  1.00 45.23  ? 43  GLU A CG     1 
ATOM   280   C CD     . GLU A  1 50  ? -41.239  11.849  50.312  1.00 48.27  ? 43  GLU A CD     1 
ATOM   281   O OE1    . GLU A  1 50  ? -42.263  11.137  50.394  1.00 46.78  ? 43  GLU A OE1    1 
ATOM   282   O OE2    . GLU A  1 50  ? -41.109  12.757  49.461  1.00 50.02  ? 43  GLU A OE2    1 
ATOM   283   N N      . HIS A  1 51  ? -41.480  9.636   54.229  1.00 47.60  ? 44  HIS A N      1 
ATOM   284   C CA     . HIS A  1 51  ? -41.164  8.582   55.197  1.00 47.01  ? 44  HIS A CA     1 
ATOM   285   C C      . HIS A  1 51  ? -41.871  8.801   56.530  1.00 46.02  ? 44  HIS A C      1 
ATOM   286   O O      . HIS A  1 51  ? -41.370  8.419   57.590  1.00 50.62  ? 44  HIS A O      1 
ATOM   287   C CB     . HIS A  1 51  ? -39.653  8.442   55.392  1.00 51.01  ? 44  HIS A CB     1 
ATOM   288   C CG     . HIS A  1 51  ? -38.957  7.793   54.235  1.00 56.78  ? 44  HIS A CG     1 
ATOM   289   N ND1    . HIS A  1 51  ? -38.879  6.424   54.091  1.00 58.88  ? 44  HIS A ND1    1 
ATOM   290   C CD2    . HIS A  1 51  ? -38.323  8.320   53.161  1.00 58.26  ? 44  HIS A CD2    1 
ATOM   291   C CE1    . HIS A  1 51  ? -38.218  6.136   52.985  1.00 59.83  ? 44  HIS A CE1    1 
ATOM   292   N NE2    . HIS A  1 51  ? -37.870  7.269   52.401  1.00 59.62  ? 44  HIS A NE2    1 
ATOM   293   N N      . THR A  1 52  ? -43.044  9.431   56.486  1.00 43.39  ? 45  THR A N      1 
ATOM   294   C CA     . THR A  1 52  ? -43.904  9.533   57.653  1.00 46.53  ? 45  THR A CA     1 
ATOM   295   C C      . THR A  1 52  ? -45.129  8.639   57.581  1.00 46.02  ? 45  THR A C      1 
ATOM   296   O O      . THR A  1 52  ? -45.760  8.403   58.616  1.00 47.81  ? 45  THR A O      1 
ATOM   297   C CB     . THR A  1 52  ? -44.368  10.982  57.853  1.00 46.00  ? 45  THR A CB     1 
ATOM   298   O OG1    . THR A  1 52  ? -45.075  11.422  56.687  1.00 45.53  ? 45  THR A OG1    1 
ATOM   299   C CG2    . THR A  1 52  ? -43.176  11.890  58.095  1.00 46.50  ? 45  THR A CG2    1 
ATOM   300   N N      . ASP A  1 53  ? -45.476  8.133   56.397  1.00 44.83  ? 46  ASP A N      1 
ATOM   301   C CA     . ASP A  1 53  ? -46.744  7.427   56.245  1.00 44.90  ? 46  ASP A CA     1 
ATOM   302   C C      . ASP A  1 53  ? -46.761  6.115   57.025  1.00 47.40  ? 46  ASP A C      1 
ATOM   303   O O      . ASP A  1 53  ? -47.731  5.823   57.734  1.00 51.64  ? 46  ASP A O      1 
ATOM   304   C CB     . ASP A  1 53  ? -47.057  7.214   54.760  1.00 42.60  ? 46  ASP A CB     1 
ATOM   305   C CG     . ASP A  1 53  ? -46.083  6.283   54.075  1.00 43.88  ? 46  ASP A CG     1 
ATOM   306   O OD1    . ASP A  1 53  ? -44.925  6.186   54.528  1.00 47.50  ? 46  ASP A OD1    1 
ATOM   307   O OD2    . ASP A  1 53  ? -46.479  5.653   53.072  1.00 40.97  ? 46  ASP A OD2    1 
ATOM   308   N N      . TYR A  1 54  ? -45.709  5.303   56.909  1.00 46.58  ? 47  TYR A N      1 
ATOM   309   C CA     . TYR A  1 54  ? -45.687  4.080   57.705  1.00 49.27  ? 47  TYR A CA     1 
ATOM   310   C C      . TYR A  1 54  ? -45.379  4.337   59.176  1.00 50.88  ? 47  TYR A C      1 
ATOM   311   O O      . TYR A  1 54  ? -45.369  3.386   59.967  1.00 56.58  ? 47  TYR A O      1 
ATOM   312   C CB     . TYR A  1 54  ? -44.695  3.082   57.099  1.00 51.48  ? 47  TYR A CB     1 
ATOM   313   C CG     . TYR A  1 54  ? -43.280  3.584   56.924  1.00 52.42  ? 47  TYR A CG     1 
ATOM   314   C CD1    . TYR A  1 54  ? -42.568  4.106   57.996  1.00 55.79  ? 47  TYR A CD1    1 
ATOM   315   C CD2    . TYR A  1 54  ? -42.664  3.558   55.679  1.00 51.35  ? 47  TYR A CD2    1 
ATOM   316   C CE1    . TYR A  1 54  ? -41.277  4.562   57.844  1.00 56.44  ? 47  TYR A CE1    1 
ATOM   317   C CE2    . TYR A  1 54  ? -41.373  4.021   55.514  1.00 54.10  ? 47  TYR A CE2    1 
ATOM   318   C CZ     . TYR A  1 54  ? -40.684  4.521   56.602  1.00 56.23  ? 47  TYR A CZ     1 
ATOM   319   O OH     . TYR A  1 54  ? -39.399  4.983   56.442  1.00 55.79  ? 47  TYR A OH     1 
ATOM   320   N N      . ASN A  1 55  ? -45.142  5.592   59.555  1.00 51.92  ? 48  ASN A N      1 
ATOM   321   C CA     . ASN A  1 55  ? -45.037  6.006   60.946  1.00 52.48  ? 48  ASN A CA     1 
ATOM   322   C C      . ASN A  1 55  ? -46.321  6.663   61.439  1.00 56.02  ? 48  ASN A C      1 
ATOM   323   O O      . ASN A  1 55  ? -46.309  7.349   62.467  1.00 58.44  ? 48  ASN A O      1 
ATOM   324   C CB     . ASN A  1 55  ? -43.842  6.943   61.137  1.00 53.75  ? 48  ASN A CB     1 
ATOM   325   C CG     . ASN A  1 55  ? -42.518  6.203   61.141  1.00 56.47  ? 48  ASN A CG     1 
ATOM   326   O OD1    . ASN A  1 55  ? -42.317  5.286   61.938  1.00 58.52  ? 48  ASN A OD1    1 
ATOM   327   N ND2    . ASN A  1 55  ? -41.605  6.604   60.261  1.00 53.55  ? 48  ASN A ND2    1 
ATOM   328   N N      . GLN A  1 56  ? -47.428  6.461   60.723  1.00 53.80  ? 49  GLN A N      1 
ATOM   329   C CA     . GLN A  1 56  ? -48.725  7.028   61.089  1.00 51.44  ? 49  GLN A CA     1 
ATOM   330   C C      . GLN A  1 56  ? -48.703  8.552   61.077  1.00 50.06  ? 49  GLN A C      1 
ATOM   331   O O      . GLN A  1 56  ? -49.366  9.196   61.891  1.00 51.46  ? 49  GLN A O      1 
ATOM   332   C CB     . GLN A  1 56  ? -49.178  6.529   62.464  1.00 51.31  ? 49  GLN A CB     1 
ATOM   333   C CG     . GLN A  1 56  ? -49.366  5.032   62.561  1.00 53.50  ? 49  GLN A CG     1 
ATOM   334   C CD     . GLN A  1 56  ? -50.391  4.636   63.609  1.00 60.44  ? 49  GLN A CD     1 
ATOM   335   O OE1    . GLN A  1 56  ? -51.593  4.836   63.429  1.00 66.33  ? 49  GLN A OE1    1 
ATOM   336   N NE2    . GLN A  1 56  ? -49.918  4.060   64.708  1.00 61.16  ? 49  GLN A NE2    1 
ATOM   337   N N      . GLY A  1 57  ? -47.958  9.144   60.156  1.00 48.88  ? 50  GLY A N      1 
ATOM   338   C CA     . GLY A  1 57  ? -47.797  10.582  60.088  1.00 50.54  ? 50  GLY A CA     1 
ATOM   339   C C      . GLY A  1 57  ? -48.715  11.245  59.082  1.00 49.73  ? 50  GLY A C      1 
ATOM   340   O O      . GLY A  1 57  ? -49.807  10.751  58.773  1.00 49.48  ? 50  GLY A O      1 
ATOM   341   N N      . LEU A  1 58  ? -48.265  12.386  58.564  1.00 48.56  ? 51  LEU A N      1 
ATOM   342   C CA     . LEU A  1 58  ? -49.006  13.182  57.598  1.00 47.89  ? 51  LEU A CA     1 
ATOM   343   C C      . LEU A  1 58  ? -48.287  13.187  56.255  1.00 45.30  ? 51  LEU A C      1 
ATOM   344   O O      . LEU A  1 58  ? -47.056  13.137  56.187  1.00 46.67  ? 51  LEU A O      1 
ATOM   345   C CB     . LEU A  1 58  ? -49.174  14.626  58.086  1.00 48.96  ? 51  LEU A CB     1 
ATOM   346   C CG     . LEU A  1 58  ? -49.885  14.872  59.417  1.00 47.11  ? 51  LEU A CG     1 
ATOM   347   C CD1    . LEU A  1 58  ? -49.869  16.356  59.752  1.00 44.56  ? 51  LEU A CD1    1 
ATOM   348   C CD2    . LEU A  1 58  ? -51.316  14.351  59.370  1.00 48.47  ? 51  LEU A CD2    1 
ATOM   349   N N      . VAL A  1 59  ? -49.071  13.251  55.180  1.00 42.95  ? 52  VAL A N      1 
ATOM   350   C CA     . VAL A  1 59  ? -48.530  13.347  53.831  1.00 38.60  ? 52  VAL A CA     1 
ATOM   351   C C      . VAL A  1 59  ? -49.335  14.376  53.049  1.00 34.94  ? 52  VAL A C      1 
ATOM   352   O O      . VAL A  1 59  ? -50.511  14.622  53.336  1.00 36.05  ? 52  VAL A O      1 
ATOM   353   C CB     . VAL A  1 59  ? -48.538  11.981  53.112  1.00 40.23  ? 52  VAL A CB     1 
ATOM   354   C CG1    . VAL A  1 59  ? -47.652  10.988  53.848  1.00 39.83  ? 52  VAL A CG1    1 
ATOM   355   C CG2    . VAL A  1 59  ? -49.960  11.452  52.999  1.00 44.25  ? 52  VAL A CG2    1 
ATOM   356   N N      . LEU A  1 60  ? -48.687  14.985  52.057  1.00 31.83  ? 53  LEU A N      1 
ATOM   357   C CA     . LEU A  1 60  ? -49.310  15.990  51.196  1.00 30.81  ? 53  LEU A CA     1 
ATOM   358   C C      . LEU A  1 60  ? -48.951  15.692  49.745  1.00 30.91  ? 53  LEU A C      1 
ATOM   359   O O      . LEU A  1 60  ? -48.211  16.447  49.103  1.00 29.86  ? 53  LEU A O      1 
ATOM   360   C CB     . LEU A  1 60  ? -48.874  17.401  51.595  1.00 33.18  ? 53  LEU A CB     1 
ATOM   361   C CG     . LEU A  1 60  ? -49.678  18.555  50.996  1.00 37.03  ? 53  LEU A CG     1 
ATOM   362   C CD1    . LEU A  1 60  ? -51.156  18.364  51.298  1.00 38.21  ? 53  LEU A CD1    1 
ATOM   363   C CD2    . LEU A  1 60  ? -49.189  19.882  51.547  1.00 38.66  ? 53  LEU A CD2    1 
ATOM   364   N N      . PRO A  1 61  ? -49.461  14.592  49.198  1.00 31.77  ? 54  PRO A N      1 
ATOM   365   C CA     . PRO A  1 61  ? -49.232  14.274  47.787  1.00 32.94  ? 54  PRO A CA     1 
ATOM   366   C C      . PRO A  1 61  ? -50.298  14.850  46.867  1.00 37.24  ? 54  PRO A C      1 
ATOM   367   O O      . PRO A  1 61  ? -51.389  15.241  47.287  1.00 41.92  ? 54  PRO A O      1 
ATOM   368   C CB     . PRO A  1 61  ? -49.303  12.743  47.772  1.00 32.79  ? 54  PRO A CB     1 
ATOM   369   C CG     . PRO A  1 61  ? -50.306  12.435  48.837  1.00 25.92  ? 54  PRO A CG     1 
ATOM   370   C CD     . PRO A  1 61  ? -50.112  13.478  49.912  1.00 33.34  ? 54  PRO A CD     1 
ATOM   371   N N      . MET A  1 62  ? -49.957  14.882  45.582  1.00 36.67  ? 55  MET A N      1 
ATOM   372   C CA     . MET A  1 62  ? -50.914  15.178  44.528  1.00 38.29  ? 55  MET A CA     1 
ATOM   373   C C      . MET A  1 62  ? -50.772  14.154  43.411  1.00 38.70  ? 55  MET A C      1 
ATOM   374   O O      . MET A  1 62  ? -49.672  13.677  43.116  1.00 37.57  ? 55  MET A O      1 
ATOM   375   C CB     . MET A  1 62  ? -50.729  16.594  43.964  1.00 38.81  ? 55  MET A CB     1 
ATOM   376   C CG     . MET A  1 62  ? -49.561  16.744  43.008  1.00 37.92  ? 55  MET A CG     1 
ATOM   377   S SD     . MET A  1 62  ? -49.466  18.409  42.325  1.00 43.32  ? 55  MET A SD     1 
ATOM   378   C CE     . MET A  1 62  ? -48.370  18.139  40.935  1.00 42.75  ? 55  MET A CE     1 
ATOM   379   N N      . ALA A  1 63  ? -51.900  13.819  42.791  1.00 39.81  ? 56  ALA A N      1 
ATOM   380   C CA     . ALA A  1 63  ? -51.876  12.922  41.645  1.00 38.01  ? 56  ALA A CA     1 
ATOM   381   C C      . ALA A  1 63  ? -51.310  13.640  40.427  1.00 41.42  ? 56  ALA A C      1 
ATOM   382   O O      . ALA A  1 63  ? -51.569  14.827  40.208  1.00 42.65  ? 56  ALA A O      1 
ATOM   383   C CB     . ALA A  1 63  ? -53.278  12.395  41.346  1.00 36.16  ? 56  ALA A CB     1 
ATOM   384   N N      . LEU A  1 64  ? -50.528  12.916  39.639  1.00 42.01  ? 57  LEU A N      1 
ATOM   385   C CA     . LEU A  1 64  ? -49.881  13.475  38.464  1.00 45.42  ? 57  LEU A CA     1 
ATOM   386   C C      . LEU A  1 64  ? -50.682  13.181  37.199  1.00 48.74  ? 57  LEU A C      1 
ATOM   387   O O      . LEU A  1 64  ? -51.581  12.336  37.175  1.00 50.87  ? 57  LEU A O      1 
ATOM   388   C CB     . LEU A  1 64  ? -48.457  12.926  38.334  1.00 44.51  ? 57  LEU A CB     1 
ATOM   389   C CG     . LEU A  1 64  ? -47.472  13.355  39.421  1.00 43.72  ? 57  LEU A CG     1 
ATOM   390   C CD1    . LEU A  1 64  ? -46.111  12.702  39.222  1.00 44.93  ? 57  LEU A CD1    1 
ATOM   391   C CD2    . LEU A  1 64  ? -47.345  14.872  39.449  1.00 46.38  ? 57  LEU A CD2    1 
ATOM   392   N N      . GLU A  1 65  ? -50.345  13.914  36.136  1.00 51.88  ? 58  GLU A N      1 
ATOM   393   C CA     . GLU A  1 65  ? -50.879  13.617  34.814  1.00 53.68  ? 58  GLU A CA     1 
ATOM   394   C C      . GLU A  1 65  ? -50.185  12.421  34.178  1.00 52.58  ? 58  GLU A C      1 
ATOM   395   O O      . GLU A  1 65  ? -50.710  11.857  33.212  1.00 56.16  ? 58  GLU A O      1 
ATOM   396   C CB     . GLU A  1 65  ? -50.765  14.841  33.901  1.00 59.68  ? 58  GLU A CB     1 
ATOM   397   C CG     . GLU A  1 65  ? -51.832  15.899  34.150  1.00 67.73  ? 58  GLU A CG     1 
ATOM   398   C CD     . GLU A  1 65  ? -51.446  17.268  33.610  1.00 75.33  ? 58  GLU A CD     1 
ATOM   399   O OE1    . GLU A  1 65  ? -50.324  17.733  33.910  1.00 75.35  ? 58  GLU A OE1    1 
ATOM   400   O OE2    . GLU A  1 65  ? -52.264  17.872  32.880  1.00 78.39  ? 58  GLU A OE2    1 
ATOM   401   N N      . LEU A  1 66  ? -49.031  12.018  34.706  1.00 48.37  ? 59  LEU A N      1 
ATOM   402   C CA     . LEU A  1 66  ? -48.416  10.760  34.306  1.00 46.20  ? 59  LEU A CA     1 
ATOM   403   C C      . LEU A  1 66  ? -49.289  9.603   34.773  1.00 46.70  ? 59  LEU A C      1 
ATOM   404   O O      . LEU A  1 66  ? -49.829  9.620   35.883  1.00 51.48  ? 59  LEU A O      1 
ATOM   405   C CB     . LEU A  1 66  ? -47.008  10.653  34.886  1.00 44.38  ? 59  LEU A CB     1 
ATOM   406   C CG     . LEU A  1 66  ? -46.118  11.852  34.553  1.00 43.20  ? 59  LEU A CG     1 
ATOM   407   C CD1    . LEU A  1 66  ? -44.721  11.665  35.119  1.00 43.30  ? 59  LEU A CD1    1 
ATOM   408   C CD2    . LEU A  1 66  ? -46.061  12.076  33.049  1.00 32.94  ? 59  LEU A CD2    1 
ATOM   409   N N      . MET A  1 67  ? -49.426  8.589   33.922  1.00 47.09  ? 60  MET A N      1 
ATOM   410   C CA     . MET A  1 67  ? -50.569  7.699   34.042  1.00 44.78  ? 60  MET A CA     1 
ATOM   411   C C      . MET A  1 67  ? -50.236  6.285   33.588  1.00 41.68  ? 60  MET A C      1 
ATOM   412   O O      . MET A  1 67  ? -49.340  6.068   32.768  1.00 39.68  ? 60  MET A O      1 
ATOM   413   C CB     . MET A  1 67  ? -51.722  8.262   33.204  1.00 46.20  ? 60  MET A CB     1 
ATOM   414   C CG     . MET A  1 67  ? -53.106  7.775   33.533  1.00 48.11  ? 60  MET A CG     1 
ATOM   415   S SD     . MET A  1 67  ? -54.237  8.618   32.415  1.00 50.31  ? 60  MET A SD     1 
ATOM   416   C CE     . MET A  1 67  ? -53.326  10.138  32.142  1.00 49.08  ? 60  MET A CE     1 
ATOM   417   N N      . THR A  1 68  ? -50.965  5.327   34.154  1.00 39.65  ? 61  THR A N      1 
ATOM   418   C CA     . THR A  1 68  ? -51.046  3.965   33.645  1.00 42.89  ? 61  THR A CA     1 
ATOM   419   C C      . THR A  1 68  ? -52.454  3.733   33.116  1.00 45.02  ? 61  THR A C      1 
ATOM   420   O O      . THR A  1 68  ? -53.436  3.980   33.825  1.00 43.96  ? 61  THR A O      1 
ATOM   421   C CB     . THR A  1 68  ? -50.716  2.937   34.728  1.00 41.64  ? 61  THR A CB     1 
ATOM   422   O OG1    . THR A  1 68  ? -49.356  3.101   35.146  1.00 42.10  ? 61  THR A OG1    1 
ATOM   423   C CG2    . THR A  1 68  ? -50.918  1.519   34.198  1.00 43.67  ? 61  THR A CG2    1 
ATOM   424   N N      . VAL A  1 69  ? -52.552  3.255   31.880  1.00 44.61  ? 62  VAL A N      1 
ATOM   425   C CA     . VAL A  1 69  ? -53.826  2.904   31.264  1.00 41.72  ? 62  VAL A CA     1 
ATOM   426   C C      . VAL A  1 69  ? -53.842  1.401   31.028  1.00 41.57  ? 62  VAL A C      1 
ATOM   427   O O      . VAL A  1 69  ? -52.879  0.837   30.494  1.00 44.43  ? 62  VAL A O      1 
ATOM   428   C CB     . VAL A  1 69  ? -54.058  3.678   29.957  1.00 42.21  ? 62  VAL A CB     1 
ATOM   429   C CG1    . VAL A  1 69  ? -55.291  3.150   29.254  1.00 41.28  ? 62  VAL A CG1    1 
ATOM   430   C CG2    . VAL A  1 69  ? -54.211  5.161   30.250  1.00 40.32  ? 62  VAL A CG2    1 
ATOM   431   N N      . LEU A  1 70  ? -54.932  0.756   31.432  1.00 40.48  ? 63  LEU A N      1 
ATOM   432   C CA     . LEU A  1 70  ? -55.115  -0.678  31.264  1.00 39.55  ? 63  LEU A CA     1 
ATOM   433   C C      . LEU A  1 70  ? -56.344  -0.938  30.405  1.00 38.10  ? 63  LEU A C      1 
ATOM   434   O O      . LEU A  1 70  ? -57.437  -0.448  30.713  1.00 36.49  ? 63  LEU A O      1 
ATOM   435   C CB     . LEU A  1 70  ? -55.259  -1.359  32.626  1.00 40.64  ? 63  LEU A CB     1 
ATOM   436   C CG     . LEU A  1 70  ? -55.066  -2.873  32.680  1.00 44.77  ? 63  LEU A CG     1 
ATOM   437   C CD1    . LEU A  1 70  ? -53.696  -3.254  32.142  1.00 47.55  ? 63  LEU A CD1    1 
ATOM   438   C CD2    . LEU A  1 70  ? -55.247  -3.375  34.105  1.00 46.75  ? 63  LEU A CD2    1 
ATOM   439   N N      . VAL A  1 71  ? -56.160  -1.696  29.325  1.00 36.75  ? 64  VAL A N      1 
ATOM   440   C CA     . VAL A  1 71  ? -57.259  -2.153  28.484  1.00 38.34  ? 64  VAL A CA     1 
ATOM   441   C C      . VAL A  1 71  ? -57.255  -3.675  28.456  1.00 37.79  ? 64  VAL A C      1 
ATOM   442   O O      . VAL A  1 71  ? -56.199  -4.314  28.509  1.00 41.35  ? 64  VAL A O      1 
ATOM   443   C CB     . VAL A  1 71  ? -57.166  -1.586  27.050  1.00 38.39  ? 64  VAL A CB     1 
ATOM   444   C CG1    . VAL A  1 71  ? -57.052  -0.070  27.082  1.00 35.82  ? 64  VAL A CG1    1 
ATOM   445   C CG2    . VAL A  1 71  ? -55.992  -2.203  26.314  1.00 32.23  ? 64  VAL A CG2    1 
ATOM   446   N N      . GLY A  1 72  ? -58.446  -4.255  28.374  1.00 35.95  ? 65  GLY A N      1 
ATOM   447   C CA     . GLY A  1 72  ? -58.555  -5.702  28.345  1.00 39.44  ? 65  GLY A CA     1 
ATOM   448   C C      . GLY A  1 72  ? -59.996  -6.143  28.200  1.00 37.72  ? 65  GLY A C      1 
ATOM   449   O O      . GLY A  1 72  ? -60.912  -5.330  28.028  1.00 37.57  ? 65  GLY A O      1 
ATOM   450   N N      . SER A  1 73  ? -60.180  -7.459  28.275  1.00 40.96  ? 66  SER A N      1 
ATOM   451   C CA     . SER A  1 73  ? -61.473  -8.107  28.109  1.00 41.25  ? 66  SER A CA     1 
ATOM   452   C C      . SER A  1 73  ? -61.485  -9.383  28.934  1.00 40.86  ? 66  SER A C      1 
ATOM   453   O O      . SER A  1 73  ? -60.421  -9.957  29.195  1.00 39.82  ? 66  SER A O      1 
ATOM   454   C CB     . SER A  1 73  ? -61.763  -8.429  26.636  1.00 41.80  ? 66  SER A CB     1 
ATOM   455   O OG     . SER A  1 73  ? -61.670  -7.266  25.831  1.00 46.62  ? 66  SER A OG     1 
ATOM   456   N N      . PRO A  1 74  ? -62.654  -9.842  29.368  1.00 42.15  ? 67  PRO A N      1 
ATOM   457   C CA     . PRO A  1 74  ? -62.730  -11.137 30.051  1.00 42.57  ? 67  PRO A CA     1 
ATOM   458   C C      . PRO A  1 74  ? -62.452  -12.284 29.092  1.00 45.49  ? 67  PRO A C      1 
ATOM   459   O O      . PRO A  1 74  ? -62.597  -12.166 27.873  1.00 49.62  ? 67  PRO A O      1 
ATOM   460   C CB     . PRO A  1 74  ? -64.171  -11.186 30.569  1.00 43.24  ? 67  PRO A CB     1 
ATOM   461   C CG     . PRO A  1 74  ? -64.925  -10.282 29.651  1.00 45.24  ? 67  PRO A CG     1 
ATOM   462   C CD     . PRO A  1 74  ? -63.970  -9.191  29.254  1.00 44.78  ? 67  PRO A CD     1 
ATOM   463   N N      . ARG A  1 75  ? -62.026  -13.406 29.665  1.00 47.55  ? 68  ARG A N      1 
ATOM   464   C CA     . ARG A  1 75  ? -61.761  -14.622 28.913  1.00 48.60  ? 68  ARG A CA     1 
ATOM   465   C C      . ARG A  1 75  ? -62.615  -15.765 29.447  1.00 56.28  ? 68  ARG A C      1 
ATOM   466   O O      . ARG A  1 75  ? -63.089  -15.739 30.585  1.00 58.98  ? 68  ARG A O      1 
ATOM   467   C CB     . ARG A  1 75  ? -60.277  -15.014 28.978  1.00 48.71  ? 68  ARG A CB     1 
ATOM   468   C CG     . ARG A  1 75  ? -59.314  -14.005 28.374  1.00 45.31  ? 68  ARG A CG     1 
ATOM   469   C CD     . ARG A  1 75  ? -57.872  -14.373 28.700  1.00 45.31  ? 68  ARG A CD     1 
ATOM   470   N NE     . ARG A  1 75  ? -57.482  -15.645 28.098  1.00 48.49  ? 68  ARG A NE     1 
ATOM   471   C CZ     . ARG A  1 75  ? -56.696  -15.763 27.032  1.00 48.65  ? 68  ARG A CZ     1 
ATOM   472   N NH1    . ARG A  1 75  ? -56.199  -14.682 26.445  1.00 47.16  ? 68  ARG A NH1    1 
ATOM   473   N NH2    . ARG A  1 75  ? -56.400  -16.967 26.558  1.00 50.74  ? 68  ARG A NH2    1 
ATOM   474   N N      . LYS A  1 76  ? -62.807  -16.774 28.601  1.00 60.45  ? 69  LYS A N      1 
ATOM   475   C CA     . LYS A  1 76  ? -63.423  -18.030 28.999  1.00 63.42  ? 69  LYS A CA     1 
ATOM   476   C C      . LYS A  1 76  ? -62.397  -19.043 29.485  1.00 64.72  ? 69  LYS A C      1 
ATOM   477   O O      . LYS A  1 76  ? -62.780  -20.095 30.000  1.00 66.17  ? 69  LYS A O      1 
ATOM   478   C CB     . LYS A  1 76  ? -64.225  -18.617 27.829  1.00 62.60  ? 69  LYS A CB     1 
ATOM   479   C CG     . LYS A  1 76  ? -65.174  -17.625 27.163  1.00 62.40  ? 69  LYS A CG     1 
ATOM   480   C CD     . LYS A  1 76  ? -66.245  -17.135 28.127  1.00 65.69  ? 69  LYS A CD     1 
ATOM   481   C CE     . LYS A  1 76  ? -67.078  -16.017 27.510  1.00 67.02  ? 69  LYS A CE     1 
ATOM   482   N NZ     . LYS A  1 76  ? -67.924  -16.487 26.375  1.00 69.44  ? 69  LYS A NZ     1 
ATOM   483   N N      . ASP A  1 77  ? -61.107  -18.740 29.329  1.00 70.10  ? 70  ASP A N      1 
ATOM   484   C CA     . ASP A  1 77  ? -60.038  -19.694 29.583  1.00 75.17  ? 70  ASP A CA     1 
ATOM   485   C C      . ASP A  1 77  ? -59.797  -19.941 31.063  1.00 71.21  ? 70  ASP A C      1 
ATOM   486   O O      . ASP A  1 77  ? -59.248  -20.989 31.422  1.00 70.34  ? 70  ASP A O      1 
ATOM   487   C CB     . ASP A  1 77  ? -58.731  -19.174 28.976  1.00 82.84  ? 70  ASP A CB     1 
ATOM   488   C CG     . ASP A  1 77  ? -58.536  -19.588 27.537  1.00 90.22  ? 70  ASP A CG     1 
ATOM   489   O OD1    . ASP A  1 77  ? -59.469  -20.174 26.957  1.00 93.78  ? 70  ASP A OD1    1 
ATOM   490   O OD2    . ASP A  1 77  ? -57.440  -19.312 26.992  1.00 91.45  ? 70  ASP A OD2    1 
ATOM   491   N N      . GLY A  1 78  ? -60.200  -19.013 31.925  1.00 69.43  ? 71  GLY A N      1 
ATOM   492   C CA     . GLY A  1 78  ? -59.691  -19.054 33.277  1.00 66.17  ? 71  GLY A CA     1 
ATOM   493   C C      . GLY A  1 78  ? -58.237  -18.654 33.365  1.00 63.90  ? 71  GLY A C      1 
ATOM   494   O O      . GLY A  1 78  ? -57.608  -18.848 34.411  1.00 61.85  ? 71  GLY A O      1 
ATOM   495   N N      . LEU A  1 79  ? -57.684  -18.111 32.285  1.00 61.89  ? 72  LEU A N      1 
ATOM   496   C CA     . LEU A  1 79  ? -56.297  -17.685 32.204  1.00 60.44  ? 72  LEU A CA     1 
ATOM   497   C C      . LEU A  1 79  ? -56.194  -16.166 32.258  1.00 60.49  ? 72  LEU A C      1 
ATOM   498   O O      . LEU A  1 79  ? -57.144  -15.441 31.947  1.00 43.53  ? 72  LEU A O      1 
ATOM   499   C CB     . LEU A  1 79  ? -55.642  -18.194 30.916  1.00 48.97  ? 72  LEU A CB     1 
ATOM   500   C CG     . LEU A  1 79  ? -55.704  -19.697 30.647  1.00 55.85  ? 72  LEU A CG     1 
ATOM   501   C CD1    . LEU A  1 79  ? -55.008  -20.037 29.337  1.00 53.02  ? 72  LEU A CD1    1 
ATOM   502   C CD2    . LEU A  1 79  ? -55.073  -20.449 31.802  1.00 53.99  ? 72  LEU A CD2    1 
ATOM   503   N N      . VAL A  1 80  ? -55.012  -15.694 32.645  1.00 44.45  ? 73  VAL A N      1 
ATOM   504   C CA     . VAL A  1 80  ? -54.666  -14.278 32.613  1.00 58.31  ? 73  VAL A CA     1 
ATOM   505   C C      . VAL A  1 80  ? -53.550  -14.095 31.595  1.00 54.70  ? 73  VAL A C      1 
ATOM   506   O O      . VAL A  1 80  ? -52.493  -14.730 31.699  1.00 55.34  ? 73  VAL A O      1 
ATOM   507   C CB     . VAL A  1 80  ? -54.240  -13.761 33.996  1.00 41.38  ? 73  VAL A CB     1 
ATOM   508   C CG1    . VAL A  1 80  ? -53.859  -12.284 33.922  1.00 40.90  ? 73  VAL A CG1    1 
ATOM   509   C CG2    . VAL A  1 80  ? -55.354  -13.974 34.999  1.00 42.95  ? 73  VAL A CG2    1 
ATOM   510   N N      . SER A  1 81  ? -53.785  -13.227 30.615  1.00 53.90  ? 74  SER A N      1 
ATOM   511   C CA     . SER A  1 81  ? -52.811  -12.927 29.573  1.00 55.77  ? 74  SER A CA     1 
ATOM   512   C C      . SER A  1 81  ? -52.485  -11.442 29.634  1.00 51.65  ? 74  SER A C      1 
ATOM   513   O O      . SER A  1 81  ? -53.379  -10.601 29.493  1.00 47.48  ? 74  SER A O      1 
ATOM   514   C CB     . SER A  1 81  ? -53.350  -13.310 28.193  1.00 61.69  ? 74  SER A CB     1 
ATOM   515   O OG     . SER A  1 81  ? -52.304  -13.738 27.339  1.00 66.75  ? 74  SER A OG     1 
ATOM   516   N N      . LEU A  1 82  ? -51.209  -11.123 29.844  1.00 51.82  ? 75  LEU A N      1 
ATOM   517   C CA     . LEU A  1 82  ? -50.767  -9.758  30.082  1.00 45.39  ? 75  LEU A CA     1 
ATOM   518   C C      . LEU A  1 82  ? -49.718  -9.341  29.063  1.00 43.70  ? 75  LEU A C      1 
ATOM   519   O O      . LEU A  1 82  ? -48.924  -10.159 28.589  1.00 46.09  ? 75  LEU A O      1 
ATOM   520   C CB     . LEU A  1 82  ? -50.166  -9.593  31.485  1.00 43.98  ? 75  LEU A CB     1 
ATOM   521   C CG     . LEU A  1 82  ? -50.947  -10.050 32.713  1.00 43.79  ? 75  LEU A CG     1 
ATOM   522   C CD1    . LEU A  1 82  ? -50.087  -9.873  33.946  1.00 42.66  ? 75  LEU A CD1    1 
ATOM   523   C CD2    . LEU A  1 82  ? -52.240  -9.258  32.842  1.00 45.17  ? 75  LEU A CD2    1 
ATOM   524   N N      . LEU A  1 83  ? -49.735  -8.053  28.725  1.00 43.79  ? 76  LEU A N      1 
ATOM   525   C CA     . LEU A  1 83  ? -48.677  -7.439  27.936  1.00 45.14  ? 76  LEU A CA     1 
ATOM   526   C C      . LEU A  1 83  ? -48.487  -6.006  28.405  1.00 44.84  ? 76  LEU A C      1 
ATOM   527   O O      . LEU A  1 83  ? -49.456  -5.245  28.486  1.00 44.20  ? 76  LEU A O      1 
ATOM   528   C CB     . LEU A  1 83  ? -49.002  -7.465  26.439  1.00 45.90  ? 76  LEU A CB     1 
ATOM   529   C CG     . LEU A  1 83  ? -48.094  -6.603  25.559  1.00 43.82  ? 76  LEU A CG     1 
ATOM   530   C CD1    . LEU A  1 83  ? -47.777  -7.312  24.251  1.00 47.49  ? 76  LEU A CD1    1 
ATOM   531   C CD2    . LEU A  1 83  ? -48.720  -5.241  25.300  1.00 42.88  ? 76  LEU A CD2    1 
ATOM   532   N N      . THR A  1 84  ? -47.248  -5.646  28.720  1.00 46.35  ? 77  THR A N      1 
ATOM   533   C CA     . THR A  1 84  ? -46.881  -4.271  29.018  1.00 45.01  ? 77  THR A CA     1 
ATOM   534   C C      . THR A  1 84  ? -45.921  -3.771  27.948  1.00 48.19  ? 77  THR A C      1 
ATOM   535   O O      . THR A  1 84  ? -45.025  -4.503  27.514  1.00 48.22  ? 77  THR A O      1 
ATOM   536   C CB     . THR A  1 84  ? -46.239  -4.146  30.404  1.00 46.39  ? 77  THR A CB     1 
ATOM   537   O OG1    . THR A  1 84  ? -45.868  -2.782  30.643  1.00 42.05  ? 77  THR A OG1    1 
ATOM   538   C CG2    . THR A  1 84  ? -44.999  -5.021  30.499  1.00 49.43  ? 77  THR A CG2    1 
ATOM   539   N N      . THR A  1 85  ? -46.117  -2.528  27.520  1.00 47.71  ? 78  THR A N      1 
ATOM   540   C CA     . THR A  1 85  ? -45.268  -1.905  26.516  1.00 47.01  ? 78  THR A CA     1 
ATOM   541   C C      . THR A  1 85  ? -44.177  -1.040  27.132  1.00 48.54  ? 78  THR A C      1 
ATOM   542   O O      . THR A  1 85  ? -43.463  -0.345  26.401  1.00 52.42  ? 78  THR A O      1 
ATOM   543   C CB     . THR A  1 85  ? -46.113  -1.076  25.549  1.00 47.92  ? 78  THR A CB     1 
ATOM   544   O OG1    . THR A  1 85  ? -46.664  0.051   26.241  1.00 46.41  ? 78  THR A OG1    1 
ATOM   545   C CG2    . THR A  1 85  ? -47.245  -1.921  24.982  1.00 38.08  ? 78  THR A CG2    1 
ATOM   546   N N      . SER A  1 86  ? -44.030  -1.072  28.452  1.00 51.33  ? 79  SER A N      1 
ATOM   547   C CA     . SER A  1 86  ? -43.053  -0.231  29.129  1.00 57.88  ? 79  SER A CA     1 
ATOM   548   C C      . SER A  1 86  ? -41.654  -0.801  28.944  1.00 68.25  ? 79  SER A C      1 
ATOM   549   O O      . SER A  1 86  ? -41.416  -1.986  29.196  1.00 66.61  ? 79  SER A O      1 
ATOM   550   C CB     . SER A  1 86  ? -43.387  -0.122  30.615  1.00 55.22  ? 79  SER A CB     1 
ATOM   551   O OG     . SER A  1 86  ? -44.709  0.349   30.800  1.00 54.08  ? 79  SER A OG     1 
ATOM   552   N N      . GLU A  1 87  ? -40.724  0.055   28.520  1.00 82.63  ? 80  GLU A N      1 
ATOM   553   C CA     . GLU A  1 87  ? -39.390  -0.421  28.172  1.00 88.66  ? 80  GLU A CA     1 
ATOM   554   C C      . GLU A  1 87  ? -38.573  -0.797  29.402  1.00 86.75  ? 80  GLU A C      1 
ATOM   555   O O      . GLU A  1 87  ? -37.757  -1.722  29.337  1.00 88.95  ? 80  GLU A O      1 
ATOM   556   C CB     . GLU A  1 87  ? -38.654  0.641   27.362  1.00 93.79  ? 80  GLU A CB     1 
ATOM   557   N N      . GLY A  1 88  ? -38.761  -0.087  30.513  1.00 79.73  ? 81  GLY A N      1 
ATOM   558   C CA     . GLY A  1 88  ? -38.023  -0.349  31.735  1.00 74.48  ? 81  GLY A CA     1 
ATOM   559   C C      . GLY A  1 88  ? -38.511  -1.585  32.459  1.00 72.73  ? 81  GLY A C      1 
ATOM   560   O O      . GLY A  1 88  ? -38.034  -1.916  33.550  1.00 71.22  ? 81  GLY A O      1 
ATOM   561   N N      . ALA A  1 89  ? -39.444  -2.293  31.837  1.00 68.27  ? 82  ALA A N      1 
ATOM   562   C CA     . ALA A  1 89  ? -40.075  -3.429  32.473  1.00 64.06  ? 82  ALA A CA     1 
ATOM   563   C C      . ALA A  1 89  ? -39.188  -4.667  32.410  1.00 63.68  ? 82  ALA A C      1 
ATOM   564   O O      . ALA A  1 89  ? -38.328  -4.815  31.536  1.00 65.96  ? 82  ALA A O      1 
ATOM   565   C CB     . ALA A  1 89  ? -41.425  -3.698  31.819  1.00 59.92  ? 82  ALA A CB     1 
ATOM   566   N N      . ASP A  1 90  ? -39.426  -5.565  33.362  1.00 63.56  ? 83  ASP A N      1 
ATOM   567   C CA     . ASP A  1 90  ? -38.681  -6.812  33.452  1.00 66.35  ? 83  ASP A CA     1 
ATOM   568   C C      . ASP A  1 90  ? -39.010  -7.707  32.262  1.00 68.19  ? 83  ASP A C      1 
ATOM   569   O O      . ASP A  1 90  ? -40.182  -7.929  31.944  1.00 69.59  ? 83  ASP A O      1 
ATOM   570   C CB     . ASP A  1 90  ? -39.017  -7.527  34.765  1.00 68.53  ? 83  ASP A CB     1 
ATOM   571   C CG     . ASP A  1 90  ? -37.937  -8.510  35.200  1.00 74.87  ? 83  ASP A CG     1 
ATOM   572   O OD1    . ASP A  1 90  ? -36.817  -8.060  35.514  1.00 78.94  ? 83  ASP A OD1    1 
ATOM   573   O OD2    . ASP A  1 90  ? -38.211  -9.729  35.245  1.00 77.64  ? 83  ASP A OD2    1 
ATOM   574   N N      . GLU A  1 91  ? -37.976  -8.218  31.599  1.00 68.43  ? 84  GLU A N      1 
ATOM   575   C CA     . GLU A  1 91  ? -38.260  -9.123  30.493  1.00 69.73  ? 84  GLU A CA     1 
ATOM   576   C C      . GLU A  1 91  ? -38.559  -10.523 31.029  1.00 66.87  ? 84  GLU A C      1 
ATOM   577   O O      . GLU A  1 91  ? -37.920  -10.972 31.984  1.00 65.40  ? 84  GLU A O      1 
ATOM   578   C CB     . GLU A  1 91  ? -37.084  -9.177  29.519  1.00 76.83  ? 84  GLU A CB     1 
ATOM   579   C CG     . GLU A  1 91  ? -37.421  -9.813  28.175  1.00 83.99  ? 84  GLU A CG     1 
ATOM   580   C CD     . GLU A  1 91  ? -37.057  -8.924  26.998  1.00 88.84  ? 84  GLU A CD     1 
ATOM   581   O OE1    . GLU A  1 91  ? -36.105  -8.124  27.125  1.00 90.39  ? 84  GLU A OE1    1 
ATOM   582   O OE2    . GLU A  1 91  ? -37.727  -9.021  25.947  1.00 89.90  ? 84  GLU A OE2    1 
ATOM   583   N N      . PRO A  1 92  ? -39.519  -11.243 30.428  1.00 65.03  ? 85  PRO A N      1 
ATOM   584   C CA     . PRO A  1 92  ? -40.266  -10.838 29.235  1.00 64.51  ? 85  PRO A CA     1 
ATOM   585   C C      . PRO A  1 92  ? -41.481  -9.971  29.542  1.00 59.19  ? 85  PRO A C      1 
ATOM   586   O O      . PRO A  1 92  ? -42.119  -10.146 30.578  1.00 55.77  ? 85  PRO A O      1 
ATOM   587   C CB     . PRO A  1 92  ? -40.706  -12.175 28.648  1.00 64.63  ? 85  PRO A CB     1 
ATOM   588   C CG     . PRO A  1 92  ? -40.948  -13.017 29.864  1.00 65.79  ? 85  PRO A CG     1 
ATOM   589   C CD     . PRO A  1 92  ? -39.944  -12.570 30.910  1.00 66.36  ? 85  PRO A CD     1 
ATOM   590   N N      . GLN A  1 93  ? -41.790  -9.046  28.636  1.00 62.75  ? 86  GLN A N      1 
ATOM   591   C CA     . GLN A  1 93  ? -42.930  -8.149  28.784  1.00 63.28  ? 86  GLN A CA     1 
ATOM   592   C C      . GLN A  1 93  ? -44.258  -8.805  28.418  1.00 65.47  ? 86  GLN A C      1 
ATOM   593   O O      . GLN A  1 93  ? -45.297  -8.140  28.482  1.00 64.01  ? 86  GLN A O      1 
ATOM   594   C CB     . GLN A  1 93  ? -42.692  -6.879  27.965  1.00 65.01  ? 86  GLN A CB     1 
ATOM   595   C CG     . GLN A  1 93  ? -41.660  -5.973  28.624  1.00 68.99  ? 86  GLN A CG     1 
ATOM   596   C CD     . GLN A  1 93  ? -40.889  -5.124  27.637  1.00 74.34  ? 86  GLN A CD     1 
ATOM   597   O OE1    . GLN A  1 93  ? -41.205  -3.951  27.429  1.00 75.37  ? 86  GLN A OE1    1 
ATOM   598   N NE2    . GLN A  1 93  ? -39.860  -5.709  27.032  1.00 76.55  ? 86  GLN A NE2    1 
ATOM   599   N N      . ARG A  1 94  ? -44.249  -10.085 28.053  1.00 69.88  ? 87  ARG A N      1 
ATOM   600   C CA     . ARG A  1 94  ? -45.461  -10.858 27.825  1.00 72.89  ? 87  ARG A CA     1 
ATOM   601   C C      . ARG A  1 94  ? -45.520  -11.968 28.863  1.00 76.28  ? 87  ARG A C      1 
ATOM   602   O O      . ARG A  1 94  ? -44.485  -12.531 29.234  1.00 78.91  ? 87  ARG A O      1 
ATOM   603   C CB     . ARG A  1 94  ? -45.486  -11.472 26.422  1.00 79.64  ? 87  ARG A CB     1 
ATOM   604   C CG     . ARG A  1 94  ? -45.873  -10.527 25.309  1.00 83.19  ? 87  ARG A CG     1 
ATOM   605   C CD     . ARG A  1 94  ? -45.646  -11.192 23.964  1.00 88.20  ? 87  ARG A CD     1 
ATOM   606   N NE     . ARG A  1 94  ? -46.013  -10.325 22.851  1.00 91.98  ? 87  ARG A NE     1 
ATOM   607   C CZ     . ARG A  1 94  ? -45.340  -9.232  22.507  1.00 94.77  ? 87  ARG A CZ     1 
ATOM   608   N NH1    . ARG A  1 94  ? -44.272  -8.867  23.203  1.00 95.60  ? 87  ARG A NH1    1 
ATOM   609   N NH2    . ARG A  1 94  ? -45.738  -8.500  21.476  1.00 95.05  ? 87  ARG A NH2    1 
ATOM   610   N N      . LEU A  1 95  ? -46.724  -12.291 29.329  1.00 72.81  ? 88  LEU A N      1 
ATOM   611   C CA     . LEU A  1 95  ? -46.846  -13.362 30.307  1.00 70.50  ? 88  LEU A CA     1 
ATOM   612   C C      . LEU A  1 95  ? -48.257  -13.934 30.281  1.00 67.66  ? 88  LEU A C      1 
ATOM   613   O O      . LEU A  1 95  ? -49.234  -13.212 30.059  1.00 68.07  ? 88  LEU A O      1 
ATOM   614   C CB     . LEU A  1 95  ? -46.489  -12.872 31.717  1.00 67.79  ? 88  LEU A CB     1 
ATOM   615   C CG     . LEU A  1 95  ? -46.410  -13.928 32.823  1.00 67.28  ? 88  LEU A CG     1 
ATOM   616   C CD1    . LEU A  1 95  ? -45.241  -14.871 32.571  1.00 70.64  ? 88  LEU A CD1    1 
ATOM   617   C CD2    . LEU A  1 95  ? -46.271  -13.270 34.184  1.00 63.51  ? 88  LEU A CD2    1 
ATOM   618   N N      . GLN A  1 96  ? -48.346  -15.240 30.521  1.00 66.83  ? 89  GLN A N      1 
ATOM   619   C CA     . GLN A  1 96  ? -49.614  -15.944 30.645  1.00 61.96  ? 89  GLN A CA     1 
ATOM   620   C C      . GLN A  1 96  ? -49.518  -16.898 31.823  1.00 60.04  ? 89  GLN A C      1 
ATOM   621   O O      . GLN A  1 96  ? -48.496  -17.567 32.003  1.00 61.09  ? 89  GLN A O      1 
ATOM   622   C CB     . GLN A  1 96  ? -49.949  -16.738 29.373  1.00 66.05  ? 89  GLN A CB     1 
ATOM   623   C CG     . GLN A  1 96  ? -51.278  -17.486 29.425  1.00 69.82  ? 89  GLN A CG     1 
ATOM   624   C CD     . GLN A  1 96  ? -51.713  -18.011 28.069  1.00 73.50  ? 89  GLN A CD     1 
ATOM   625   O OE1    . GLN A  1 96  ? -52.904  -18.172 27.804  1.00 74.54  ? 89  GLN A OE1    1 
ATOM   626   N NE2    . GLN A  1 96  ? -50.742  -18.309 27.212  1.00 75.75  ? 89  GLN A NE2    1 
ATOM   627   N N      . PHE A  1 97  ? -50.579  -16.961 32.621  1.00 57.37  ? 90  PHE A N      1 
ATOM   628   C CA     . PHE A  1 97  ? -50.601  -17.838 33.783  1.00 58.80  ? 90  PHE A CA     1 
ATOM   629   C C      . PHE A  1 97  ? -52.049  -18.071 34.186  1.00 59.87  ? 90  PHE A C      1 
ATOM   630   O O      . PHE A  1 97  ? -52.921  -17.245 33.888  1.00 59.50  ? 90  PHE A O      1 
ATOM   631   C CB     . PHE A  1 97  ? -49.794  -17.245 34.950  1.00 57.32  ? 90  PHE A CB     1 
ATOM   632   C CG     . PHE A  1 97  ? -50.227  -15.869 35.354  1.00 54.49  ? 90  PHE A CG     1 
ATOM   633   C CD1    . PHE A  1 97  ? -51.272  -15.696 36.243  1.00 53.77  ? 90  PHE A CD1    1 
ATOM   634   C CD2    . PHE A  1 97  ? -49.578  -14.750 34.860  1.00 52.97  ? 90  PHE A CD2    1 
ATOM   635   C CE1    . PHE A  1 97  ? -51.671  -14.432 36.625  1.00 51.59  ? 90  PHE A CE1    1 
ATOM   636   C CE2    . PHE A  1 97  ? -49.974  -13.482 35.237  1.00 49.53  ? 90  PHE A CE2    1 
ATOM   637   C CZ     . PHE A  1 97  ? -51.022  -13.323 36.121  1.00 48.26  ? 90  PHE A CZ     1 
ATOM   638   N N      . PRO A  1 98  ? -52.336  -19.178 34.862  1.00 59.19  ? 91  PRO A N      1 
ATOM   639   C CA     . PRO A  1 98  ? -53.712  -19.452 35.285  1.00 60.27  ? 91  PRO A CA     1 
ATOM   640   C C      . PRO A  1 98  ? -54.094  -18.697 36.553  1.00 59.79  ? 91  PRO A C      1 
ATOM   641   O O      . PRO A  1 98  ? -53.253  -18.298 37.361  1.00 57.41  ? 91  PRO A O      1 
ATOM   642   C CB     . PRO A  1 98  ? -53.715  -20.967 35.526  1.00 56.74  ? 91  PRO A CB     1 
ATOM   643   C CG     . PRO A  1 98  ? -52.296  -21.312 35.828  1.00 58.40  ? 91  PRO A CG     1 
ATOM   644   C CD     . PRO A  1 98  ? -51.410  -20.277 35.191  1.00 56.16  ? 91  PRO A CD     1 
ATOM   645   N N      . LEU A  1 99  ? -55.409  -18.522 36.716  1.00 52.73  ? 92  LEU A N      1 
ATOM   646   C CA     . LEU A  1 99  ? -55.959  -17.872 37.896  1.00 53.26  ? 92  LEU A CA     1 
ATOM   647   C C      . LEU A  1 99  ? -55.645  -18.666 39.157  1.00 58.60  ? 92  LEU A C      1 
ATOM   648   O O      . LEU A  1 99  ? -55.413  -19.877 39.104  1.00 61.87  ? 92  LEU A O      1 
ATOM   649   C CB     . LEU A  1 99  ? -57.475  -17.712 37.783  1.00 45.45  ? 92  LEU A CB     1 
ATOM   650   C CG     . LEU A  1 99  ? -58.111  -16.322 37.685  1.00 48.30  ? 92  LEU A CG     1 
ATOM   651   C CD1    . LEU A  1 99  ? -57.439  -15.448 36.658  1.00 44.53  ? 92  LEU A CD1    1 
ATOM   652   C CD2    . LEU A  1 99  ? -59.600  -16.450 37.397  1.00 51.10  ? 92  LEU A CD2    1 
ATOM   653   N N      . PRO A  1 100 ? -55.632  -18.001 40.309  1.00 63.11  ? 93  PRO A N      1 
ATOM   654   C CA     . PRO A  1 100 ? -55.464  -18.734 41.563  1.00 65.81  ? 93  PRO A CA     1 
ATOM   655   C C      . PRO A  1 100 ? -56.676  -19.611 41.816  1.00 68.77  ? 93  PRO A C      1 
ATOM   656   O O      . PRO A  1 100 ? -57.799  -19.297 41.411  1.00 69.86  ? 93  PRO A O      1 
ATOM   657   C CB     . PRO A  1 100 ? -55.349  -17.624 42.614  1.00 63.86  ? 93  PRO A CB     1 
ATOM   658   C CG     . PRO A  1 100 ? -56.066  -16.459 42.003  1.00 60.38  ? 93  PRO A CG     1 
ATOM   659   C CD     . PRO A  1 100 ? -55.803  -16.554 40.525  1.00 59.42  ? 93  PRO A CD     1 
ATOM   660   N N      . THR A  1 101 ? -56.439  -20.720 42.504  1.00 72.94  ? 94  THR A N      1 
ATOM   661   C CA     . THR A  1 101 ? -57.482  -21.684 42.804  1.00 77.88  ? 94  THR A CA     1 
ATOM   662   C C      . THR A  1 101 ? -57.472  -21.958 44.301  1.00 81.13  ? 94  THR A C      1 
ATOM   663   O O      . THR A  1 101 ? -56.567  -21.537 45.026  1.00 82.33  ? 94  THR A O      1 
ATOM   664   C CB     . THR A  1 101 ? -57.284  -22.978 42.001  1.00 83.26  ? 94  THR A CB     1 
ATOM   665   O OG1    . THR A  1 101 ? -57.010  -22.645 40.635  1.00 84.69  ? 94  THR A OG1    1 
ATOM   666   C CG2    . THR A  1 101 ? -58.546  -23.815 42.030  1.00 85.96  ? 94  THR A CG2    1 
ATOM   667   N N      . ALA A  1 102 ? -58.498  -22.668 44.771  1.00 90.63  ? 95  ALA A N      1 
ATOM   668   C CA     . ALA A  1 102 ? -58.461  -23.162 46.142  1.00 94.07  ? 95  ALA A CA     1 
ATOM   669   C C      . ALA A  1 102 ? -57.293  -24.116 46.362  1.00 98.13  ? 95  ALA A C      1 
ATOM   670   O O      . ALA A  1 102 ? -56.714  -24.148 47.454  1.00 97.22  ? 95  ALA A O      1 
ATOM   671   C CB     . ALA A  1 102 ? -59.784  -23.843 46.491  1.00 89.32  ? 95  ALA A CB     1 
ATOM   672   N N      . GLN A  1 103 ? -56.927  -24.891 45.339  1.00 106.02 ? 96  GLN A N      1 
ATOM   673   C CA     . GLN A  1 103 ? -55.800  -25.815 45.418  1.00 110.73 ? 96  GLN A CA     1 
ATOM   674   C C      . GLN A  1 103 ? -54.473  -25.064 45.388  1.00 107.62 ? 96  GLN A C      1 
ATOM   675   O O      . GLN A  1 103 ? -53.741  -25.038 46.383  1.00 110.59 ? 96  GLN A O      1 
ATOM   676   C CB     . GLN A  1 103 ? -55.845  -26.835 44.273  1.00 112.76 ? 96  GLN A CB     1 
ATOM   677   C CG     . GLN A  1 103 ? -57.181  -27.575 44.087  1.00 117.97 ? 96  GLN A CG     1 
ATOM   678   C CD     . GLN A  1 103 ? -58.287  -26.691 43.523  1.00 117.80 ? 96  GLN A CD     1 
ATOM   679   O OE1    . GLN A  1 103 ? -58.665  -25.692 44.129  1.00 117.62 ? 96  GLN A OE1    1 
ATOM   680   N NE2    . GLN A  1 103 ? -58.806  -27.057 42.358  1.00 116.75 ? 96  GLN A NE2    1 
ATOM   681   N N      . ARG A  1 104 ? -54.155  -24.452 44.250  1.00 91.93  ? 97  ARG A N      1 
ATOM   682   C CA     . ARG A  1 104 ? -52.914  -23.711 44.068  1.00 84.90  ? 97  ARG A CA     1 
ATOM   683   C C      . ARG A  1 104 ? -53.211  -22.221 43.982  1.00 81.68  ? 97  ARG A C      1 
ATOM   684   O O      . ARG A  1 104 ? -54.118  -21.804 43.253  1.00 83.56  ? 97  ARG A O      1 
ATOM   685   C CB     . ARG A  1 104 ? -52.188  -24.185 42.806  1.00 80.46  ? 97  ARG A CB     1 
ATOM   686   C CG     . ARG A  1 104 ? -51.017  -23.319 42.376  1.00 75.85  ? 97  ARG A CG     1 
ATOM   687   C CD     . ARG A  1 104 ? -50.420  -23.817 41.066  1.00 73.59  ? 97  ARG A CD     1 
ATOM   688   N N      . SER A  1 105 ? -52.449  -21.427 44.728  1.00 78.60  ? 98  SER A N      1 
ATOM   689   C CA     . SER A  1 105 ? -52.561  -19.978 44.711  1.00 73.14  ? 98  SER A CA     1 
ATOM   690   C C      . SER A  1 105 ? -51.356  -19.370 44.005  1.00 66.99  ? 98  SER A C      1 
ATOM   691   O O      . SER A  1 105 ? -50.275  -19.965 43.956  1.00 62.15  ? 98  SER A O      1 
ATOM   692   C CB     . SER A  1 105 ? -52.677  -19.420 46.133  1.00 75.86  ? 98  SER A CB     1 
ATOM   693   O OG     . SER A  1 105 ? -53.956  -19.690 46.681  1.00 78.43  ? 98  SER A OG     1 
ATOM   694   N N      . LEU A  1 106 ? -51.556  -18.177 43.452  1.00 64.37  ? 99  LEU A N      1 
ATOM   695   C CA     . LEU A  1 106 ? -50.473  -17.475 42.778  1.00 66.50  ? 99  LEU A CA     1 
ATOM   696   C C      . LEU A  1 106 ? -49.277  -17.289 43.705  1.00 69.75  ? 99  LEU A C      1 
ATOM   697   O O      . LEU A  1 106 ? -49.411  -17.195 44.928  1.00 72.20  ? 99  LEU A O      1 
ATOM   698   C CB     . LEU A  1 106 ? -50.955  -16.121 42.261  1.00 61.12  ? 99  LEU A CB     1 
ATOM   699   C CG     . LEU A  1 106 ? -51.838  -16.199 41.015  1.00 57.64  ? 99  LEU A CG     1 
ATOM   700   C CD1    . LEU A  1 106 ? -52.049  -14.817 40.421  1.00 45.78  ? 99  LEU A CD1    1 
ATOM   701   C CD2    . LEU A  1 106 ? -51.226  -17.142 39.992  1.00 58.66  ? 99  LEU A CD2    1 
ATOM   702   N N      . GLU A  1 107 ? -48.091  -17.238 43.099  1.00 72.05  ? 100 GLU A N      1 
ATOM   703   C CA     . GLU A  1 107 ? -46.830  -17.067 43.799  1.00 74.48  ? 100 GLU A CA     1 
ATOM   704   C C      . GLU A  1 107 ? -45.981  -16.038 43.065  1.00 71.19  ? 100 GLU A C      1 
ATOM   705   O O      . GLU A  1 107 ? -45.961  -16.023 41.825  1.00 70.19  ? 100 GLU A O      1 
ATOM   706   C CB     . GLU A  1 107 ? -46.059  -18.389 43.918  1.00 85.28  ? 100 GLU A CB     1 
ATOM   707   C CG     . GLU A  1 107 ? -46.578  -19.312 45.009  1.00 93.17  ? 100 GLU A CG     1 
ATOM   708   C CD     . GLU A  1 107 ? -46.468  -18.690 46.387  1.00 98.88  ? 100 GLU A CD     1 
ATOM   709   O OE1    . GLU A  1 107 ? -45.621  -17.789 46.565  1.00 101.08 ? 100 GLU A OE1    1 
ATOM   710   O OE2    . GLU A  1 107 ? -47.233  -19.093 47.289  1.00 101.47 ? 100 GLU A OE2    1 
ATOM   711   N N      . PRO A  1 108 ? -45.279  -15.170 43.791  1.00 66.89  ? 101 PRO A N      1 
ATOM   712   C CA     . PRO A  1 108 ? -44.366  -14.222 43.133  1.00 64.76  ? 101 PRO A CA     1 
ATOM   713   C C      . PRO A  1 108 ? -43.267  -14.966 42.391  1.00 67.05  ? 101 PRO A C      1 
ATOM   714   O O      . PRO A  1 108 ? -42.507  -15.737 42.982  1.00 68.77  ? 101 PRO A O      1 
ATOM   715   C CB     . PRO A  1 108 ? -43.812  -13.396 44.300  1.00 64.42  ? 101 PRO A CB     1 
ATOM   716   C CG     . PRO A  1 108 ? -43.971  -14.280 45.495  1.00 66.57  ? 101 PRO A CG     1 
ATOM   717   C CD     . PRO A  1 108 ? -45.224  -15.068 45.259  1.00 67.37  ? 101 PRO A CD     1 
ATOM   718   N N      . GLY A  1 109 ? -43.185  -14.729 41.084  1.00 67.96  ? 102 GLY A N      1 
ATOM   719   C CA     . GLY A  1 109 ? -42.177  -15.353 40.248  1.00 75.44  ? 102 GLY A CA     1 
ATOM   720   C C      . GLY A  1 109 ? -41.545  -14.349 39.303  1.00 74.91  ? 102 GLY A C      1 
ATOM   721   O O      . GLY A  1 109 ? -41.226  -13.221 39.676  1.00 71.78  ? 102 GLY A O      1 
ATOM   722   N N      . THR A  1 110 ? -41.361  -14.779 38.056  1.00 79.94  ? 103 THR A N      1 
ATOM   723   C CA     . THR A  1 110 ? -40.777  -13.946 37.019  1.00 80.48  ? 103 THR A CA     1 
ATOM   724   C C      . THR A  1 110 ? -41.738  -13.792 35.846  1.00 79.75  ? 103 THR A C      1 
ATOM   725   O O      . THR A  1 110 ? -42.485  -14.721 35.525  1.00 81.25  ? 103 THR A O      1 
ATOM   726   C CB     . THR A  1 110 ? -39.459  -14.546 36.514  1.00 85.39  ? 103 THR A CB     1 
ATOM   727   O OG1    . THR A  1 110 ? -39.023  -13.840 35.346  1.00 87.43  ? 103 THR A OG1    1 
ATOM   728   C CG2    . THR A  1 110 ? -39.648  -16.018 36.167  1.00 88.61  ? 103 THR A CG2    1 
ATOM   729   N N      . PRO A  1 111 ? -41.744  -12.625 35.183  1.00 76.94  ? 104 PRO A N      1 
ATOM   730   C CA     . PRO A  1 111 ? -40.903  -11.449 35.448  1.00 75.22  ? 104 PRO A CA     1 
ATOM   731   C C      . PRO A  1 111 ? -41.323  -10.681 36.701  1.00 72.35  ? 104 PRO A C      1 
ATOM   732   O O      . PRO A  1 111 ? -42.447  -10.852 37.171  1.00 72.52  ? 104 PRO A O      1 
ATOM   733   C CB     . PRO A  1 111 ? -41.093  -10.597 34.191  1.00 73.07  ? 104 PRO A CB     1 
ATOM   734   C CG     . PRO A  1 111 ? -42.452  -10.944 33.720  1.00 73.10  ? 104 PRO A CG     1 
ATOM   735   C CD     . PRO A  1 111 ? -42.642  -12.405 34.036  1.00 75.84  ? 104 PRO A CD     1 
ATOM   736   N N      . ARG A  1 112 ? -40.421  -9.851  37.235  1.00 69.64  ? 105 ARG A N      1 
ATOM   737   C CA     . ARG A  1 112 ? -40.719  -9.132  38.471  1.00 67.74  ? 105 ARG A CA     1 
ATOM   738   C C      . ARG A  1 112 ? -41.956  -8.257  38.317  1.00 64.38  ? 105 ARG A C      1 
ATOM   739   O O      . ARG A  1 112 ? -42.781  -8.172  39.235  1.00 65.03  ? 105 ARG A O      1 
ATOM   740   C CB     . ARG A  1 112 ? -39.518  -8.282  38.889  1.00 70.26  ? 105 ARG A CB     1 
ATOM   741   C CG     . ARG A  1 112 ? -38.470  -9.020  39.711  1.00 74.49  ? 105 ARG A CG     1 
ATOM   742   C CD     . ARG A  1 112 ? -37.079  -8.843  39.122  1.00 75.87  ? 105 ARG A CD     1 
ATOM   743   N NE     . ARG A  1 112 ? -36.778  -7.449  38.804  1.00 76.26  ? 105 ARG A NE     1 
ATOM   744   C CZ     . ARG A  1 112 ? -35.692  -7.055  38.146  1.00 76.73  ? 105 ARG A CZ     1 
ATOM   745   N NH1    . ARG A  1 112 ? -34.805  -7.951  37.738  1.00 80.06  ? 105 ARG A NH1    1 
ATOM   746   N NH2    . ARG A  1 112 ? -35.492  -5.768  37.894  1.00 74.17  ? 105 ARG A NH2    1 
ATOM   747   N N      . TRP A  1 113 ? -42.104  -7.595  37.167  1.00 61.12  ? 106 TRP A N      1 
ATOM   748   C CA     . TRP A  1 113 ? -43.221  -6.672  36.991  1.00 58.66  ? 106 TRP A CA     1 
ATOM   749   C C      . TRP A  1 113 ? -44.566  -7.377  37.108  1.00 53.21  ? 106 TRP A C      1 
ATOM   750   O O      . TRP A  1 113 ? -45.543  -6.770  37.562  1.00 48.92  ? 106 TRP A O      1 
ATOM   751   C CB     . TRP A  1 113 ? -43.107  -5.946  35.649  1.00 59.71  ? 106 TRP A CB     1 
ATOM   752   C CG     . TRP A  1 113 ? -43.268  -6.826  34.445  1.00 62.26  ? 106 TRP A CG     1 
ATOM   753   C CD1    . TRP A  1 113 ? -42.269  -7.401  33.721  1.00 64.17  ? 106 TRP A CD1    1 
ATOM   754   C CD2    . TRP A  1 113 ? -44.496  -7.225  33.820  1.00 62.37  ? 106 TRP A CD2    1 
ATOM   755   N NE1    . TRP A  1 113 ? -42.793  -8.133  32.683  1.00 64.60  ? 106 TRP A NE1    1 
ATOM   756   C CE2    . TRP A  1 113 ? -44.159  -8.043  32.723  1.00 63.39  ? 106 TRP A CE2    1 
ATOM   757   C CE3    . TRP A  1 113 ? -45.846  -6.973  34.082  1.00 61.06  ? 106 TRP A CE3    1 
ATOM   758   C CZ2    . TRP A  1 113 ? -45.121  -8.610  31.889  1.00 63.02  ? 106 TRP A CZ2    1 
ATOM   759   C CZ3    . TRP A  1 113 ? -46.800  -7.536  33.252  1.00 60.83  ? 106 TRP A CZ3    1 
ATOM   760   C CH2    . TRP A  1 113 ? -46.432  -8.345  32.169  1.00 61.50  ? 106 TRP A CH2    1 
ATOM   761   N N      . ALA A  1 114 ? -44.643  -8.651  36.715  1.00 54.36  ? 107 ALA A N      1 
ATOM   762   C CA     . ALA A  1 114 ? -45.911  -9.365  36.807  1.00 54.78  ? 107 ALA A CA     1 
ATOM   763   C C      . ALA A  1 114 ? -46.318  -9.630  38.250  1.00 56.04  ? 107 ALA A C      1 
ATOM   764   O O      . ALA A  1 114 ? -47.484  -9.953  38.502  1.00 58.58  ? 107 ALA A O      1 
ATOM   765   C CB     . ALA A  1 114 ? -45.834  -10.686 36.042  1.00 54.67  ? 107 ALA A CB     1 
ATOM   766   N N      . ASN A  1 115 ? -45.386  -9.505  39.197  1.00 56.30  ? 108 ASN A N      1 
ATOM   767   C CA     . ASN A  1 115 ? -45.727  -9.706  40.601  1.00 55.24  ? 108 ASN A CA     1 
ATOM   768   C C      . ASN A  1 115 ? -46.756  -8.690  41.078  1.00 49.88  ? 108 ASN A C      1 
ATOM   769   O O      . ASN A  1 115 ? -47.592  -9.008  41.932  1.00 46.49  ? 108 ASN A O      1 
ATOM   770   C CB     . ASN A  1 115 ? -44.466  -9.622  41.461  1.00 58.99  ? 108 ASN A CB     1 
ATOM   771   C CG     . ASN A  1 115 ? -43.510  -10.771 41.211  1.00 63.66  ? 108 ASN A CG     1 
ATOM   772   O OD1    . ASN A  1 115 ? -43.921  -11.860 40.811  1.00 67.17  ? 108 ASN A OD1    1 
ATOM   773   N ND2    . ASN A  1 115 ? -42.224  -10.530 41.443  1.00 63.97  ? 108 ASN A ND2    1 
ATOM   774   N N      . TYR A  1 116 ? -46.707  -7.466  40.548  1.00 41.82  ? 109 TYR A N      1 
ATOM   775   C CA     . TYR A  1 116 ? -47.630  -6.427  40.994  1.00 45.92  ? 109 TYR A CA     1 
ATOM   776   C C      . TYR A  1 116 ? -49.073  -6.763  40.629  1.00 48.58  ? 109 TYR A C      1 
ATOM   777   O O      . TYR A  1 116 ? -49.978  -6.602  41.456  1.00 48.03  ? 109 TYR A O      1 
ATOM   778   C CB     . TYR A  1 116 ? -47.204  -5.072  40.424  1.00 39.25  ? 109 TYR A CB     1 
ATOM   779   C CG     . TYR A  1 116 ? -45.891  -4.575  40.997  1.00 48.87  ? 109 TYR A CG     1 
ATOM   780   C CD1    . TYR A  1 116 ? -44.675  -4.993  40.472  1.00 48.37  ? 109 TYR A CD1    1 
ATOM   781   C CD2    . TYR A  1 116 ? -45.871  -3.704  42.080  1.00 48.34  ? 109 TYR A CD2    1 
ATOM   782   C CE1    . TYR A  1 116 ? -43.478  -4.550  41.001  1.00 51.63  ? 109 TYR A CE1    1 
ATOM   783   C CE2    . TYR A  1 116 ? -44.681  -3.255  42.615  1.00 49.85  ? 109 TYR A CE2    1 
ATOM   784   C CZ     . TYR A  1 116 ? -43.487  -3.680  42.072  1.00 51.53  ? 109 TYR A CZ     1 
ATOM   785   O OH     . TYR A  1 116 ? -42.298  -3.236  42.602  1.00 50.12  ? 109 TYR A OH     1 
ATOM   786   N N      . VAL A  1 117 ? -49.315  -7.227  39.401  1.00 49.16  ? 110 VAL A N      1 
ATOM   787   C CA     . VAL A  1 117 ? -50.675  -7.595  39.016  1.00 47.02  ? 110 VAL A CA     1 
ATOM   788   C C      . VAL A  1 117 ? -51.085  -8.902  39.683  1.00 40.23  ? 110 VAL A C      1 
ATOM   789   O O      . VAL A  1 117 ? -52.234  -9.062  40.113  1.00 46.71  ? 110 VAL A O      1 
ATOM   790   C CB     . VAL A  1 117 ? -50.799  -7.675  37.483  1.00 47.56  ? 110 VAL A CB     1 
ATOM   791   C CG1    . VAL A  1 117 ? -50.098  -6.490  36.838  1.00 38.13  ? 110 VAL A CG1    1 
ATOM   792   C CG2    . VAL A  1 117 ? -50.239  -8.992  36.965  1.00 52.09  ? 110 VAL A CG2    1 
ATOM   793   N N      . LYS A  1 118 ? -50.154  -9.856  39.783  1.00 41.66  ? 111 LYS A N      1 
ATOM   794   C CA     . LYS A  1 118 ? -50.452  -11.115 40.458  1.00 42.93  ? 111 LYS A CA     1 
ATOM   795   C C      . LYS A  1 118 ? -50.898  -10.879 41.895  1.00 50.63  ? 111 LYS A C      1 
ATOM   796   O O      . LYS A  1 118 ? -51.874  -11.482 42.358  1.00 49.98  ? 111 LYS A O      1 
ATOM   797   C CB     . LYS A  1 118 ? -49.236  -12.041 40.414  1.00 44.63  ? 111 LYS A CB     1 
ATOM   798   C CG     . LYS A  1 118 ? -48.879  -12.541 39.022  1.00 44.94  ? 111 LYS A CG     1 
ATOM   799   C CD     . LYS A  1 118 ? -47.816  -13.628 39.086  1.00 46.92  ? 111 LYS A CD     1 
ATOM   800   C CE     . LYS A  1 118 ? -47.300  -13.983 37.701  1.00 47.35  ? 111 LYS A CE     1 
ATOM   801   N NZ     . LYS A  1 118 ? -46.333  -15.116 37.754  1.00 52.89  ? 111 LYS A NZ     1 
ATOM   802   N N      . GLY A  1 119 ? -50.197  -10.003 42.617  1.00 42.86  ? 112 GLY A N      1 
ATOM   803   C CA     . GLY A  1 119 ? -50.566  -9.741  43.998  1.00 45.46  ? 112 GLY A CA     1 
ATOM   804   C C      . GLY A  1 119 ? -51.961  -9.162  44.136  1.00 45.10  ? 112 GLY A C      1 
ATOM   805   O O      . GLY A  1 119 ? -52.732  -9.578  45.004  1.00 42.45  ? 112 GLY A O      1 
ATOM   806   N N      . VAL A  1 120 ? -52.305  -8.192  43.284  1.00 40.41  ? 113 VAL A N      1 
ATOM   807   C CA     . VAL A  1 120 ? -53.644  -7.607  43.323  1.00 42.45  ? 113 VAL A CA     1 
ATOM   808   C C      . VAL A  1 120 ? -54.694  -8.668  43.014  1.00 44.62  ? 113 VAL A C      1 
ATOM   809   O O      . VAL A  1 120 ? -55.767  -8.700  43.629  1.00 45.58  ? 113 VAL A O      1 
ATOM   810   C CB     . VAL A  1 120 ? -53.739  -6.410  42.356  1.00 40.99  ? 113 VAL A CB     1 
ATOM   811   C CG1    . VAL A  1 120 ? -55.154  -5.844  42.342  1.00 37.07  ? 113 VAL A CG1    1 
ATOM   812   C CG2    . VAL A  1 120 ? -52.738  -5.330  42.746  1.00 42.39  ? 113 VAL A CG2    1 
ATOM   813   N N      . ILE A  1 121 ? -54.401  -9.554  42.060  1.00 44.30  ? 114 ILE A N      1 
ATOM   814   C CA     . ILE A  1 121 ? -55.327  -10.636 41.737  1.00 46.17  ? 114 ILE A CA     1 
ATOM   815   C C      . ILE A  1 121 ? -55.552  -11.526 42.954  1.00 46.85  ? 114 ILE A C      1 
ATOM   816   O O      . ILE A  1 121 ? -56.691  -11.853 43.306  1.00 51.25  ? 114 ILE A O      1 
ATOM   817   C CB     . ILE A  1 121 ? -54.804  -11.450 40.540  1.00 47.22  ? 114 ILE A CB     1 
ATOM   818   C CG1    . ILE A  1 121 ? -54.788  -10.592 39.274  1.00 44.25  ? 114 ILE A CG1    1 
ATOM   819   C CG2    . ILE A  1 121 ? -55.634  -12.713 40.350  1.00 45.38  ? 114 ILE A CG2    1 
ATOM   820   C CD1    . ILE A  1 121 ? -54.233  -11.306 38.069  1.00 40.38  ? 114 ILE A CD1    1 
ATOM   821   N N      . GLN A  1 122 ? -54.464  -11.927 43.617  1.00 49.03  ? 115 GLN A N      1 
ATOM   822   C CA     . GLN A  1 122 ? -54.576  -12.876 44.721  1.00 49.76  ? 115 GLN A CA     1 
ATOM   823   C C      . GLN A  1 122 ? -55.426  -12.321 45.855  1.00 49.73  ? 115 GLN A C      1 
ATOM   824   O O      . GLN A  1 122 ? -56.187  -13.061 46.490  1.00 52.28  ? 115 GLN A O      1 
ATOM   825   C CB     . GLN A  1 122 ? -53.187  -13.251 45.240  1.00 52.50  ? 115 GLN A CB     1 
ATOM   826   C CG     . GLN A  1 122 ? -53.207  -14.254 46.388  1.00 54.87  ? 115 GLN A CG     1 
ATOM   827   C CD     . GLN A  1 122 ? -53.616  -15.644 45.937  1.00 57.47  ? 115 GLN A CD     1 
ATOM   828   O OE1    . GLN A  1 122 ? -53.328  -16.052 44.811  1.00 57.56  ? 115 GLN A OE1    1 
ATOM   829   N NE2    . GLN A  1 122 ? -54.295  -16.378 46.813  1.00 57.00  ? 115 GLN A NE2    1 
ATOM   830   N N      . TYR A  1 123 ? -55.316  -11.022 46.124  1.00 48.41  ? 116 TYR A N      1 
ATOM   831   C CA     . TYR A  1 123 ? -55.996  -10.409 47.255  1.00 48.74  ? 116 TYR A CA     1 
ATOM   832   C C      . TYR A  1 123 ? -57.278  -9.688  46.868  1.00 47.09  ? 116 TYR A C      1 
ATOM   833   O O      . TYR A  1 123 ? -57.884  -9.038  47.725  1.00 48.10  ? 116 TYR A O      1 
ATOM   834   C CB     . TYR A  1 123 ? -55.052  -9.433  47.965  1.00 43.53  ? 116 TYR A CB     1 
ATOM   835   C CG     . TYR A  1 123 ? -53.836  -10.098 48.560  1.00 45.02  ? 116 TYR A CG     1 
ATOM   836   C CD1    . TYR A  1 123 ? -53.965  -11.064 49.547  1.00 50.40  ? 116 TYR A CD1    1 
ATOM   837   C CD2    . TYR A  1 123 ? -52.560  -9.770  48.126  1.00 44.81  ? 116 TYR A CD2    1 
ATOM   838   C CE1    . TYR A  1 123 ? -52.860  -11.680 50.089  1.00 53.32  ? 116 TYR A CE1    1 
ATOM   839   C CE2    . TYR A  1 123 ? -51.446  -10.381 48.663  1.00 50.26  ? 116 TYR A CE2    1 
ATOM   840   C CZ     . TYR A  1 123 ? -51.603  -11.336 49.645  1.00 54.88  ? 116 TYR A CZ     1 
ATOM   841   O OH     . TYR A  1 123 ? -50.504  -11.954 50.193  1.00 56.63  ? 116 TYR A OH     1 
ATOM   842   N N      . TYR A  1 124 ? -57.706  -9.777  45.614  1.00 45.21  ? 117 TYR A N      1 
ATOM   843   C CA     . TYR A  1 124 ? -58.955  -9.136  45.233  1.00 44.97  ? 117 TYR A CA     1 
ATOM   844   C C      . TYR A  1 124 ? -60.097  -9.766  46.024  1.00 47.45  ? 117 TYR A C      1 
ATOM   845   O O      . TYR A  1 124 ? -60.207  -11.000 46.069  1.00 47.39  ? 117 TYR A O      1 
ATOM   846   C CB     . TYR A  1 124 ? -59.214  -9.256  43.733  1.00 44.53  ? 117 TYR A CB     1 
ATOM   847   C CG     . TYR A  1 124 ? -60.313  -8.331  43.257  1.00 44.60  ? 117 TYR A CG     1 
ATOM   848   C CD1    . TYR A  1 124 ? -60.112  -6.956  43.218  1.00 42.66  ? 117 TYR A CD1    1 
ATOM   849   C CD2    . TYR A  1 124 ? -61.551  -8.825  42.864  1.00 44.40  ? 117 TYR A CD2    1 
ATOM   850   C CE1    . TYR A  1 124 ? -61.106  -6.101  42.794  1.00 44.70  ? 117 TYR A CE1    1 
ATOM   851   C CE2    . TYR A  1 124 ? -62.555  -7.975  42.438  1.00 44.43  ? 117 TYR A CE2    1 
ATOM   852   C CZ     . TYR A  1 124 ? -62.327  -6.613  42.404  1.00 46.98  ? 117 TYR A CZ     1 
ATOM   853   O OH     . TYR A  1 124 ? -63.320  -5.759  41.980  1.00 47.16  ? 117 TYR A OH     1 
ATOM   854   N N      . PRO A  1 125 ? -60.964  -8.969  46.651  1.00 49.22  ? 118 PRO A N      1 
ATOM   855   C CA     . PRO A  1 125 ? -61.915  -9.518  47.625  1.00 50.07  ? 118 PRO A CA     1 
ATOM   856   C C      . PRO A  1 125 ? -63.192  -10.087 47.026  1.00 52.78  ? 118 PRO A C      1 
ATOM   857   O O      . PRO A  1 125 ? -64.002  -10.641 47.777  1.00 54.02  ? 118 PRO A O      1 
ATOM   858   C CB     . PRO A  1 125 ? -62.224  -8.302  48.506  1.00 49.07  ? 118 PRO A CB     1 
ATOM   859   C CG     . PRO A  1 125 ? -62.105  -7.147  47.571  1.00 47.53  ? 118 PRO A CG     1 
ATOM   860   C CD     . PRO A  1 125 ? -60.999  -7.496  46.609  1.00 46.05  ? 118 PRO A CD     1 
ATOM   861   N N      . ALA A  1 126 ? -63.404  -9.978  45.718  1.00 55.17  ? 119 ALA A N      1 
ATOM   862   C CA     . ALA A  1 126 ? -64.651  -10.405 45.105  1.00 56.11  ? 119 ALA A CA     1 
ATOM   863   C C      . ALA A  1 126 ? -64.452  -11.648 44.245  1.00 57.43  ? 119 ALA A C      1 
ATOM   864   O O      . ALA A  1 126 ? -63.343  -11.961 43.803  1.00 58.74  ? 119 ALA A O      1 
ATOM   865   C CB     . ALA A  1 126 ? -65.256  -9.279  44.259  1.00 57.23  ? 119 ALA A CB     1 
ATOM   866   N N      . ALA A  1 127 ? -65.555  -12.355 44.021  1.00 57.78  ? 120 ALA A N      1 
ATOM   867   C CA     . ALA A  1 127 ? -65.589  -13.572 43.225  1.00 60.34  ? 120 ALA A CA     1 
ATOM   868   C C      . ALA A  1 127 ? -66.967  -13.689 42.596  1.00 60.86  ? 120 ALA A C      1 
ATOM   869   O O      . ALA A  1 127 ? -67.940  -13.130 43.116  1.00 64.11  ? 120 ALA A O      1 
ATOM   870   C CB     . ALA A  1 127 ? -65.280  -14.812 44.072  1.00 60.91  ? 120 ALA A CB     1 
ATOM   871   N N      . PRO A  1 128 ? -67.088  -14.406 41.466  1.00 59.64  ? 121 PRO A N      1 
ATOM   872   C CA     . PRO A  1 128 ? -66.000  -15.112 40.786  1.00 58.10  ? 121 PRO A CA     1 
ATOM   873   C C      . PRO A  1 128 ? -65.239  -14.212 39.822  1.00 54.75  ? 121 PRO A C      1 
ATOM   874   O O      . PRO A  1 128 ? -65.849  -13.447 39.076  1.00 54.43  ? 121 PRO A O      1 
ATOM   875   C CB     . PRO A  1 128 ? -66.732  -16.219 40.029  1.00 58.75  ? 121 PRO A CB     1 
ATOM   876   C CG     . PRO A  1 128 ? -68.054  -15.612 39.696  1.00 58.41  ? 121 PRO A CG     1 
ATOM   877   C CD     . PRO A  1 128 ? -68.379  -14.609 40.784  1.00 59.35  ? 121 PRO A CD     1 
ATOM   878   N N      . LEU A  1 129 ? -63.914  -14.315 39.847  1.00 54.84  ? 122 LEU A N      1 
ATOM   879   C CA     . LEU A  1 129 ? -63.064  -13.529 38.966  1.00 53.23  ? 122 LEU A CA     1 
ATOM   880   C C      . LEU A  1 129 ? -62.794  -14.303 37.684  1.00 51.81  ? 122 LEU A C      1 
ATOM   881   O O      . LEU A  1 129 ? -62.242  -15.408 37.748  1.00 52.75  ? 122 LEU A O      1 
ATOM   882   C CB     . LEU A  1 129 ? -61.755  -13.190 39.658  1.00 52.46  ? 122 LEU A CB     1 
ATOM   883   C CG     . LEU A  1 129 ? -61.003  -11.956 39.160  1.00 50.56  ? 122 LEU A CG     1 
ATOM   884   C CD1    . LEU A  1 129 ? -61.919  -10.745 39.148  1.00 49.69  ? 122 LEU A CD1    1 
ATOM   885   C CD2    . LEU A  1 129 ? -59.790  -11.692 40.032  1.00 50.44  ? 122 LEU A CD2    1 
ATOM   886   N N      . PRO A  1 130 ? -63.166  -13.785 36.518  1.00 51.96  ? 123 PRO A N      1 
ATOM   887   C CA     . PRO A  1 130 ? -62.869  -14.488 35.269  1.00 50.22  ? 123 PRO A CA     1 
ATOM   888   C C      . PRO A  1 130 ? -61.421  -14.283 34.850  1.00 53.79  ? 123 PRO A C      1 
ATOM   889   O O      . PRO A  1 130 ? -60.722  -13.387 35.327  1.00 55.46  ? 123 PRO A O      1 
ATOM   890   C CB     . PRO A  1 130 ? -63.824  -13.843 34.253  1.00 47.69  ? 123 PRO A CB     1 
ATOM   891   C CG     . PRO A  1 130 ? -64.670  -12.853 35.039  1.00 48.50  ? 123 PRO A CG     1 
ATOM   892   C CD     . PRO A  1 130 ? -63.908  -12.539 36.280  1.00 49.03  ? 123 PRO A CD     1 
ATOM   893   N N      . GLY A  1 131 ? -60.972  -15.147 33.945  1.00 54.17  ? 124 GLY A N      1 
ATOM   894   C CA     . GLY A  1 131 ? -59.739  -14.871 33.240  1.00 52.74  ? 124 GLY A CA     1 
ATOM   895   C C      . GLY A  1 131 ? -59.865  -13.622 32.393  1.00 49.35  ? 124 GLY A C      1 
ATOM   896   O O      . GLY A  1 131 ? -60.963  -13.162 32.077  1.00 52.59  ? 124 GLY A O      1 
ATOM   897   N N      . PHE A  1 132 ? -58.724  -13.058 32.015  1.00 46.70  ? 125 PHE A N      1 
ATOM   898   C CA     . PHE A  1 132 ? -58.774  -11.862 31.188  1.00 44.87  ? 125 PHE A CA     1 
ATOM   899   C C      . PHE A  1 132 ? -57.475  -11.692 30.420  1.00 46.24  ? 125 PHE A C      1 
ATOM   900   O O      . PHE A  1 132 ? -56.426  -12.226 30.791  1.00 50.30  ? 125 PHE A O      1 
ATOM   901   C CB     . PHE A  1 132 ? -59.056  -10.592 32.002  1.00 48.97  ? 125 PHE A CB     1 
ATOM   902   C CG     . PHE A  1 132 ? -58.091  -10.354 33.130  1.00 49.88  ? 125 PHE A CG     1 
ATOM   903   C CD1    . PHE A  1 132 ? -57.995  -11.246 34.184  1.00 51.49  ? 125 PHE A CD1    1 
ATOM   904   C CD2    . PHE A  1 132 ? -57.228  -9.271  33.098  1.00 48.48  ? 125 PHE A CD2    1 
ATOM   905   C CE1    . PHE A  1 132 ? -57.106  -11.028 35.215  1.00 53.07  ? 125 PHE A CE1    1 
ATOM   906   C CE2    . PHE A  1 132 ? -56.327  -9.051  34.121  1.00 48.94  ? 125 PHE A CE2    1 
ATOM   907   C CZ     . PHE A  1 132 ? -56.265  -9.933  35.181  1.00 50.85  ? 125 PHE A CZ     1 
ATOM   908   N N      . SER A  1 133 ? -57.580  -10.943 29.329  1.00 42.79  ? 126 SER A N      1 
ATOM   909   C CA     . SER A  1 133 ? -56.443  -10.416 28.595  1.00 43.31  ? 126 SER A CA     1 
ATOM   910   C C      . SER A  1 133 ? -56.369  -8.919  28.849  1.00 40.53  ? 126 SER A C      1 
ATOM   911   O O      . SER A  1 133 ? -57.401  -8.254  28.974  1.00 43.59  ? 126 SER A O      1 
ATOM   912   C CB     . SER A  1 133 ? -56.576  -10.680 27.092  1.00 43.11  ? 126 SER A CB     1 
ATOM   913   O OG     . SER A  1 133 ? -56.897  -12.033 26.825  1.00 42.43  ? 126 SER A OG     1 
ATOM   914   N N      . ALA A  1 134 ? -55.151  -8.391  28.932  1.00 39.13  ? 127 ALA A N      1 
ATOM   915   C CA     . ALA A  1 134 ? -54.979  -6.976  29.224  1.00 41.85  ? 127 ALA A CA     1 
ATOM   916   C C      . ALA A  1 134 ? -53.595  -6.539  28.778  1.00 43.86  ? 127 ALA A C      1 
ATOM   917   O O      . ALA A  1 134 ? -52.637  -7.312  28.862  1.00 45.19  ? 127 ALA A O      1 
ATOM   918   C CB     . ALA A  1 134 ? -55.172  -6.683  30.717  1.00 40.76  ? 127 ALA A CB     1 
ATOM   919   N N      . VAL A  1 135 ? -53.502  -5.298  28.307  1.00 42.12  ? 128 VAL A N      1 
ATOM   920   C CA     . VAL A  1 135 ? -52.229  -4.650  28.025  1.00 43.65  ? 128 VAL A CA     1 
ATOM   921   C C      . VAL A  1 135 ? -52.110  -3.422  28.913  1.00 43.59  ? 128 VAL A C      1 
ATOM   922   O O      . VAL A  1 135 ? -53.093  -2.707  29.138  1.00 43.28  ? 128 VAL A O      1 
ATOM   923   C CB     . VAL A  1 135 ? -52.090  -4.256  26.540  1.00 43.87  ? 128 VAL A CB     1 
ATOM   924   C CG1    . VAL A  1 135 ? -52.463  -5.422  25.643  1.00 43.78  ? 128 VAL A CG1    1 
ATOM   925   C CG2    . VAL A  1 135 ? -52.931  -3.026  26.228  1.00 42.94  ? 128 VAL A CG2    1 
ATOM   926   N N      . VAL A  1 136 ? -50.904  -3.185  29.418  1.00 41.95  ? 129 VAL A N      1 
ATOM   927   C CA     . VAL A  1 136 ? -50.607  -2.036  30.262  1.00 37.99  ? 129 VAL A CA     1 
ATOM   928   C C      . VAL A  1 136 ? -49.738  -1.080  29.461  1.00 37.19  ? 129 VAL A C      1 
ATOM   929   O O      . VAL A  1 136 ? -48.745  -1.494  28.849  1.00 37.12  ? 129 VAL A O      1 
ATOM   930   C CB     . VAL A  1 136 ? -49.905  -2.447  31.568  1.00 39.65  ? 129 VAL A CB     1 
ATOM   931   C CG1    . VAL A  1 136 ? -49.778  -1.246  32.503  1.00 41.22  ? 129 VAL A CG1    1 
ATOM   932   C CG2    . VAL A  1 136 ? -50.649  -3.590  32.237  1.00 38.54  ? 129 VAL A CG2    1 
ATOM   933   N N      . VAL A  1 137 ? -50.118  0.191   29.455  1.00 34.80  ? 130 VAL A N      1 
ATOM   934   C CA     . VAL A  1 137 ? -49.278  1.260   28.938  1.00 39.24  ? 130 VAL A CA     1 
ATOM   935   C C      . VAL A  1 137 ? -49.201  2.325   30.018  1.00 39.58  ? 130 VAL A C      1 
ATOM   936   O O      . VAL A  1 137 ? -50.138  2.510   30.801  1.00 41.03  ? 130 VAL A O      1 
ATOM   937   C CB     . VAL A  1 137 ? -49.811  1.849   27.614  1.00 35.01  ? 130 VAL A CB     1 
ATOM   938   C CG1    . VAL A  1 137 ? -49.969  0.751   26.570  1.00 41.38  ? 130 VAL A CG1    1 
ATOM   939   C CG2    . VAL A  1 137 ? -51.127  2.574   27.848  1.00 37.09  ? 130 VAL A CG2    1 
ATOM   940   N N      . SER A  1 138 ? -48.079  3.034   30.057  1.00 40.41  ? 131 SER A N      1 
ATOM   941   C CA     . SER A  1 138 ? -47.826  3.940   31.164  1.00 38.76  ? 131 SER A CA     1 
ATOM   942   C C      . SER A  1 138 ? -46.932  5.081   30.713  1.00 40.23  ? 131 SER A C      1 
ATOM   943   O O      . SER A  1 138 ? -45.999  4.881   29.930  1.00 39.10  ? 131 SER A O      1 
ATOM   944   C CB     . SER A  1 138 ? -47.175  3.196   32.336  1.00 39.20  ? 131 SER A CB     1 
ATOM   945   O OG     . SER A  1 138 ? -46.912  4.078   33.410  1.00 38.34  ? 131 SER A OG     1 
ATOM   946   N N      . SER A  1 139 ? -47.235  6.278   31.211  1.00 40.01  ? 132 SER A N      1 
ATOM   947   C CA     . SER A  1 139 ? -46.356  7.429   31.091  1.00 38.60  ? 132 SER A CA     1 
ATOM   948   C C      . SER A  1 139 ? -45.603  7.712   32.383  1.00 41.37  ? 132 SER A C      1 
ATOM   949   O O      . SER A  1 139 ? -44.886  8.714   32.464  1.00 42.83  ? 132 SER A O      1 
ATOM   950   C CB     . SER A  1 139 ? -47.161  8.666   30.674  1.00 34.23  ? 132 SER A CB     1 
ATOM   951   O OG     . SER A  1 139 ? -48.289  8.854   31.514  1.00 34.29  ? 132 SER A OG     1 
ATOM   952   N N      . VAL A  1 140 ? -45.751  6.857   33.388  1.00 42.32  ? 133 VAL A N      1 
ATOM   953   C CA     . VAL A  1 140 ? -45.032  6.991   34.650  1.00 41.92  ? 133 VAL A CA     1 
ATOM   954   C C      . VAL A  1 140 ? -43.687  6.286   34.500  1.00 40.91  ? 133 VAL A C      1 
ATOM   955   O O      . VAL A  1 140 ? -43.665  5.089   34.171  1.00 44.08  ? 133 VAL A O      1 
ATOM   956   C CB     . VAL A  1 140 ? -45.835  6.405   35.817  1.00 37.44  ? 133 VAL A CB     1 
ATOM   957   C CG1    . VAL A  1 140 ? -45.163  6.727   37.142  1.00 35.93  ? 133 VAL A CG1    1 
ATOM   958   C CG2    . VAL A  1 140 ? -47.246  6.955   35.799  1.00 31.17  ? 133 VAL A CG2    1 
ATOM   959   N N      . PRO A  1 141 ? -42.565  6.972   34.711  1.00 39.40  ? 134 PRO A N      1 
ATOM   960   C CA     . PRO A  1 141 ? -41.260  6.313   34.566  1.00 41.21  ? 134 PRO A CA     1 
ATOM   961   C C      . PRO A  1 141 ? -41.077  5.249   35.639  1.00 42.38  ? 134 PRO A C      1 
ATOM   962   O O      . PRO A  1 141 ? -41.248  5.515   36.831  1.00 43.72  ? 134 PRO A O      1 
ATOM   963   C CB     . PRO A  1 141 ? -40.260  7.463   34.731  1.00 41.34  ? 134 PRO A CB     1 
ATOM   964   C CG     . PRO A  1 141 ? -40.995  8.470   35.561  1.00 41.09  ? 134 PRO A CG     1 
ATOM   965   C CD     . PRO A  1 141 ? -42.442  8.366   35.171  1.00 38.89  ? 134 PRO A CD     1 
ATOM   966   N N      . LEU A  1 142 ? -40.738  4.037   35.208  1.00 42.76  ? 135 LEU A N      1 
ATOM   967   C CA     . LEU A  1 142 ? -40.556  2.939   36.147  1.00 45.59  ? 135 LEU A CA     1 
ATOM   968   C C      . LEU A  1 142 ? -39.319  3.188   36.999  1.00 45.31  ? 135 LEU A C      1 
ATOM   969   O O      . LEU A  1 142 ? -38.222  3.400   36.473  1.00 45.53  ? 135 LEU A O      1 
ATOM   970   C CB     . LEU A  1 142 ? -40.417  1.614   35.400  1.00 45.25  ? 135 LEU A CB     1 
ATOM   971   C CG     . LEU A  1 142 ? -41.463  1.305   34.329  1.00 42.52  ? 135 LEU A CG     1 
ATOM   972   C CD1    . LEU A  1 142 ? -41.550  -0.195  34.078  1.00 44.15  ? 135 LEU A CD1    1 
ATOM   973   C CD2    . LEU A  1 142 ? -42.815  1.867   34.722  1.00 36.80  ? 135 LEU A CD2    1 
ATOM   974   N N      . GLY A  1 143 ? -39.495  3.154   38.318  1.00 43.75  ? 136 GLY A N      1 
ATOM   975   C CA     . GLY A  1 143 ? -38.390  3.355   39.231  1.00 46.65  ? 136 GLY A CA     1 
ATOM   976   C C      . GLY A  1 143 ? -37.969  4.793   39.431  1.00 44.96  ? 136 GLY A C      1 
ATOM   977   O O      . GLY A  1 143 ? -36.912  5.032   40.026  1.00 48.54  ? 136 GLY A O      1 
ATOM   978   N N      . GLY A  1 144 ? -38.758  5.757   38.965  1.00 42.85  ? 137 GLY A N      1 
ATOM   979   C CA     . GLY A  1 144 ? -38.423  7.161   39.066  1.00 39.63  ? 137 GLY A CA     1 
ATOM   980   C C      . GLY A  1 144 ? -38.952  7.872   40.292  1.00 42.78  ? 137 GLY A C      1 
ATOM   981   O O      . GLY A  1 144 ? -38.773  9.089   40.411  1.00 46.20  ? 137 GLY A O      1 
ATOM   982   N N      . GLY A  1 145 ? -39.576  7.151   41.221  1.00 43.23  ? 138 GLY A N      1 
ATOM   983   C CA     . GLY A  1 145 ? -40.080  7.748   42.437  1.00 44.06  ? 138 GLY A CA     1 
ATOM   984   C C      . GLY A  1 145 ? -41.459  8.358   42.341  1.00 43.93  ? 138 GLY A C      1 
ATOM   985   O O      . GLY A  1 145 ? -41.933  8.933   43.328  1.00 46.98  ? 138 GLY A O      1 
ATOM   986   N N      . LEU A  1 146 ? -42.117  8.260   41.191  1.00 41.45  ? 139 LEU A N      1 
ATOM   987   C CA     . LEU A  1 146 ? -43.473  8.761   41.038  1.00 39.11  ? 139 LEU A CA     1 
ATOM   988   C C      . LEU A  1 146 ? -44.515  7.678   41.287  1.00 40.86  ? 139 LEU A C      1 
ATOM   989   O O      . LEU A  1 146 ? -45.683  7.856   40.924  1.00 35.78  ? 139 LEU A O      1 
ATOM   990   C CB     . LEU A  1 146 ? -43.639  9.382   39.650  1.00 38.33  ? 139 LEU A CB     1 
ATOM   991   C CG     . LEU A  1 146 ? -42.558  10.443  39.413  1.00 40.88  ? 139 LEU A CG     1 
ATOM   992   C CD1    . LEU A  1 146 ? -42.676  11.088  38.041  1.00 43.22  ? 139 LEU A CD1    1 
ATOM   993   C CD2    . LEU A  1 146 ? -42.591  11.487  40.522  1.00 40.84  ? 139 LEU A CD2    1 
ATOM   994   N N      . SER A  1 147 ? -44.110  6.565   41.902  1.00 40.80  ? 140 SER A N      1 
ATOM   995   C CA     . SER A  1 147 ? -45.002  5.469   42.283  1.00 38.89  ? 140 SER A CA     1 
ATOM   996   C C      . SER A  1 147 ? -45.695  4.865   41.060  1.00 37.95  ? 140 SER A C      1 
ATOM   997   O O      . SER A  1 147 ? -46.922  4.820   40.959  1.00 41.11  ? 140 SER A O      1 
ATOM   998   C CB     . SER A  1 147 ? -46.017  5.929   43.337  1.00 39.45  ? 140 SER A CB     1 
ATOM   999   O OG     . SER A  1 147 ? -46.698  7.107   42.941  1.00 44.30  ? 140 SER A OG     1 
ATOM   1000  N N      . SER A  1 148 ? -44.871  4.389   40.123  1.00 38.85  ? 141 SER A N      1 
ATOM   1001  C CA     . SER A  1 148 ? -45.386  3.550   39.047  1.00 40.07  ? 141 SER A CA     1 
ATOM   1002  C C      . SER A  1 148 ? -45.954  2.239   39.581  1.00 44.73  ? 141 SER A C      1 
ATOM   1003  O O      . SER A  1 148 ? -46.935  1.721   39.035  1.00 48.73  ? 141 SER A O      1 
ATOM   1004  C CB     . SER A  1 148 ? -44.284  3.275   38.023  1.00 41.73  ? 141 SER A CB     1 
ATOM   1005  O OG     . SER A  1 148 ? -43.211  2.552   38.605  1.00 45.53  ? 141 SER A OG     1 
ATOM   1006  N N      . SER A  1 149 ? -45.353  1.687   40.639  1.00 45.33  ? 142 SER A N      1 
ATOM   1007  C CA     . SER A  1 149 ? -45.865  0.453   41.228  1.00 42.91  ? 142 SER A CA     1 
ATOM   1008  C C      . SER A  1 149 ? -47.313  0.619   41.671  1.00 44.84  ? 142 SER A C      1 
ATOM   1009  O O      . SER A  1 149 ? -48.186  -0.176  41.300  1.00 48.15  ? 142 SER A O      1 
ATOM   1010  C CB     . SER A  1 149 ? -44.983  0.030   42.402  1.00 41.80  ? 142 SER A CB     1 
ATOM   1011  O OG     . SER A  1 149 ? -45.076  0.965   43.463  1.00 45.66  ? 142 SER A OG     1 
ATOM   1012  N N      . ALA A  1 150 ? -47.586  1.651   42.472  1.00 42.61  ? 143 ALA A N      1 
ATOM   1013  C CA     . ALA A  1 150 ? -48.950  1.890   42.928  1.00 44.17  ? 143 ALA A CA     1 
ATOM   1014  C C      . ALA A  1 150 ? -49.871  2.195   41.755  1.00 41.91  ? 143 ALA A C      1 
ATOM   1015  O O      . ALA A  1 150 ? -51.023  1.747   41.726  1.00 43.35  ? 143 ALA A O      1 
ATOM   1016  C CB     . ALA A  1 150 ? -48.971  3.034   43.941  1.00 44.23  ? 143 ALA A CB     1 
ATOM   1017  N N      . SER A  1 151 ? -49.377  2.952   40.772  1.00 40.41  ? 144 SER A N      1 
ATOM   1018  C CA     . SER A  1 151 ? -50.156  3.201   39.563  1.00 41.11  ? 144 SER A CA     1 
ATOM   1019  C C      . SER A  1 151 ? -50.582  1.893   38.907  1.00 40.01  ? 144 SER A C      1 
ATOM   1020  O O      . SER A  1 151 ? -51.741  1.731   38.507  1.00 38.95  ? 144 SER A O      1 
ATOM   1021  C CB     . SER A  1 151 ? -49.350  4.057   38.585  1.00 40.00  ? 144 SER A CB     1 
ATOM   1022  O OG     . SER A  1 151 ? -50.139  4.427   37.468  1.00 41.83  ? 144 SER A OG     1 
ATOM   1023  N N      . LEU A  1 152 ? -49.647  0.949   38.777  1.00 33.23  ? 145 LEU A N      1 
ATOM   1024  C CA     . LEU A  1 152 ? -49.972  -0.341  38.177  1.00 33.86  ? 145 LEU A CA     1 
ATOM   1025  C C      . LEU A  1 152 ? -50.985  -1.103  39.020  1.00 43.21  ? 145 LEU A C      1 
ATOM   1026  O O      . LEU A  1 152 ? -51.925  -1.703  38.486  1.00 46.18  ? 145 LEU A O      1 
ATOM   1027  C CB     . LEU A  1 152 ? -48.698  -1.166  37.992  1.00 34.98  ? 145 LEU A CB     1 
ATOM   1028  C CG     . LEU A  1 152 ? -48.839  -2.579  37.417  1.00 43.92  ? 145 LEU A CG     1 
ATOM   1029  C CD1    . LEU A  1 152 ? -49.603  -2.544  36.107  1.00 35.42  ? 145 LEU A CD1    1 
ATOM   1030  C CD2    . LEU A  1 152 ? -47.473  -3.218  37.212  1.00 37.11  ? 145 LEU A CD2    1 
ATOM   1031  N N      . GLU A  1 153 ? -50.799  -1.104  40.341  1.00 42.88  ? 146 GLU A N      1 
ATOM   1032  C CA     . GLU A  1 153 ? -51.686  -1.863  41.214  1.00 40.59  ? 146 GLU A CA     1 
ATOM   1033  C C      . GLU A  1 153 ? -53.099  -1.294  41.197  1.00 39.14  ? 146 GLU A C      1 
ATOM   1034  O O      . GLU A  1 153 ? -54.078  -2.038  41.066  1.00 40.65  ? 146 GLU A O      1 
ATOM   1035  C CB     . GLU A  1 153 ? -51.135  -1.866  42.639  1.00 44.59  ? 146 GLU A CB     1 
ATOM   1036  C CG     . GLU A  1 153 ? -49.687  -2.304  42.762  1.00 47.59  ? 146 GLU A CG     1 
ATOM   1037  C CD     . GLU A  1 153 ? -49.069  -1.818  44.052  1.00 48.64  ? 146 GLU A CD     1 
ATOM   1038  O OE1    . GLU A  1 153 ? -49.728  -1.013  44.741  1.00 46.63  ? 146 GLU A OE1    1 
ATOM   1039  O OE2    . GLU A  1 153 ? -47.944  -2.245  44.391  1.00 52.75  ? 146 GLU A OE2    1 
ATOM   1040  N N      . VAL A  1 154 ? -53.223  0.029   41.313  1.00 40.35  ? 147 VAL A N      1 
ATOM   1041  C CA     . VAL A  1 154 ? -54.544  0.646   41.377  1.00 42.13  ? 147 VAL A CA     1 
ATOM   1042  C C      . VAL A  1 154 ? -55.258  0.523   40.036  1.00 38.68  ? 147 VAL A C      1 
ATOM   1043  O O      . VAL A  1 154 ? -56.472  0.292   39.984  1.00 32.17  ? 147 VAL A O      1 
ATOM   1044  C CB     . VAL A  1 154 ? -54.423  2.112   41.831  1.00 36.06  ? 147 VAL A CB     1 
ATOM   1045  C CG1    . VAL A  1 154 ? -55.773  2.792   41.785  1.00 34.13  ? 147 VAL A CG1    1 
ATOM   1046  C CG2    . VAL A  1 154 ? -53.830  2.179   43.232  1.00 32.29  ? 147 VAL A CG2    1 
ATOM   1047  N N      . ALA A  1 155 ? -54.522  0.668   38.932  1.00 36.85  ? 148 ALA A N      1 
ATOM   1048  C CA     . ALA A  1 155 ? -55.110  0.403   37.623  1.00 34.08  ? 148 ALA A CA     1 
ATOM   1049  C C      . ALA A  1 155 ? -55.644  -1.022  37.556  1.00 40.08  ? 148 ALA A C      1 
ATOM   1050  O O      . ALA A  1 155 ? -56.775  -1.256  37.116  1.00 39.41  ? 148 ALA A O      1 
ATOM   1051  C CB     . ALA A  1 155 ? -54.082  0.651   36.519  1.00 31.93  ? 148 ALA A CB     1 
ATOM   1052  N N      . THR A  1 156 ? -54.830  -1.991  37.981  1.00 35.64  ? 149 THR A N      1 
ATOM   1053  C CA     . THR A  1 156 ? -55.281  -3.377  38.038  1.00 37.98  ? 149 THR A CA     1 
ATOM   1054  C C      . THR A  1 156 ? -56.542  -3.516  38.880  1.00 40.44  ? 149 THR A C      1 
ATOM   1055  O O      . THR A  1 156 ? -57.524  -4.132  38.449  1.00 40.37  ? 149 THR A O      1 
ATOM   1056  C CB     . THR A  1 156 ? -54.171  -4.265  38.599  1.00 38.75  ? 149 THR A CB     1 
ATOM   1057  O OG1    . THR A  1 156 ? -53.036  -4.228  37.725  1.00 42.20  ? 149 THR A OG1    1 
ATOM   1058  C CG2    . THR A  1 156 ? -54.660  -5.702  38.741  1.00 35.92  ? 149 THR A CG2    1 
ATOM   1059  N N      . TYR A  1 157 ? -56.533  -2.956  40.094  1.00 34.03  ? 150 TYR A N      1 
ATOM   1060  C CA     . TYR A  1 157 ? -57.694  -3.098  40.967  1.00 38.18  ? 150 TYR A CA     1 
ATOM   1061  C C      . TYR A  1 157 ? -58.950  -2.554  40.301  1.00 39.85  ? 150 TYR A C      1 
ATOM   1062  O O      . TYR A  1 157 ? -59.999  -3.207  40.301  1.00 39.98  ? 150 TYR A O      1 
ATOM   1063  C CB     . TYR A  1 157 ? -57.459  -2.403  42.309  1.00 40.15  ? 150 TYR A CB     1 
ATOM   1064  C CG     . TYR A  1 157 ? -58.471  -2.821  43.355  1.00 42.71  ? 150 TYR A CG     1 
ATOM   1065  C CD1    . TYR A  1 157 ? -59.777  -2.349  43.311  1.00 34.72  ? 150 TYR A CD1    1 
ATOM   1066  C CD2    . TYR A  1 157 ? -58.127  -3.697  44.375  1.00 45.81  ? 150 TYR A CD2    1 
ATOM   1067  C CE1    . TYR A  1 157 ? -60.711  -2.735  44.251  1.00 36.32  ? 150 TYR A CE1    1 
ATOM   1068  C CE2    . TYR A  1 157 ? -59.055  -4.086  45.326  1.00 45.38  ? 150 TYR A CE2    1 
ATOM   1069  C CZ     . TYR A  1 157 ? -60.345  -3.602  45.259  1.00 43.34  ? 150 TYR A CZ     1 
ATOM   1070  O OH     . TYR A  1 157 ? -61.274  -3.986  46.200  1.00 47.43  ? 150 TYR A OH     1 
ATOM   1071  N N      . THR A  1 158 ? -58.862  -1.352  39.728  1.00 38.00  ? 151 THR A N      1 
ATOM   1072  C CA     . THR A  1 158 ? -60.018  -0.787  39.043  1.00 37.57  ? 151 THR A CA     1 
ATOM   1073  C C      . THR A  1 158 ? -60.441  -1.664  37.874  1.00 39.40  ? 151 THR A C      1 
ATOM   1074  O O      . THR A  1 158 ? -61.635  -1.754  37.566  1.00 36.55  ? 151 THR A O      1 
ATOM   1075  C CB     . THR A  1 158 ? -59.712  0.628   38.550  1.00 34.68  ? 151 THR A CB     1 
ATOM   1076  O OG1    . THR A  1 158 ? -59.037  1.364   39.578  1.00 33.77  ? 151 THR A OG1    1 
ATOM   1077  C CG2    . THR A  1 158 ? -61.003  1.350   38.174  1.00 36.00  ? 151 THR A CG2    1 
ATOM   1078  N N      . PHE A  1 159 ? -59.480  -2.309  37.208  1.00 41.50  ? 152 PHE A N      1 
ATOM   1079  C CA     . PHE A  1 159 ? -59.824  -3.209  36.112  1.00 41.15  ? 152 PHE A CA     1 
ATOM   1080  C C      . PHE A  1 159 ? -60.639  -4.390  36.621  1.00 42.66  ? 152 PHE A C      1 
ATOM   1081  O O      . PHE A  1 159 ? -61.697  -4.714  36.072  1.00 44.94  ? 152 PHE A O      1 
ATOM   1082  C CB     . PHE A  1 159 ? -58.560  -3.711  35.416  1.00 40.25  ? 152 PHE A CB     1 
ATOM   1083  C CG     . PHE A  1 159 ? -58.833  -4.484  34.157  1.00 43.30  ? 152 PHE A CG     1 
ATOM   1084  C CD1    . PHE A  1 159 ? -59.648  -3.951  33.171  1.00 43.36  ? 152 PHE A CD1    1 
ATOM   1085  C CD2    . PHE A  1 159 ? -58.324  -5.760  33.979  1.00 43.72  ? 152 PHE A CD2    1 
ATOM   1086  C CE1    . PHE A  1 159 ? -59.914  -4.654  32.014  1.00 39.04  ? 152 PHE A CE1    1 
ATOM   1087  C CE2    . PHE A  1 159 ? -58.595  -6.471  32.823  1.00 43.06  ? 152 PHE A CE2    1 
ATOM   1088  C CZ     . PHE A  1 159 ? -59.391  -5.916  31.841  1.00 39.77  ? 152 PHE A CZ     1 
ATOM   1089  N N      . LEU A  1 160 ? -60.152  -5.052  37.675  1.00 44.78  ? 153 LEU A N      1 
ATOM   1090  C CA     . LEU A  1 160 ? -60.868  -6.196  38.230  1.00 40.18  ? 153 LEU A CA     1 
ATOM   1091  C C      . LEU A  1 160 ? -62.263  -5.810  38.700  1.00 39.38  ? 153 LEU A C      1 
ATOM   1092  O O      . LEU A  1 160 ? -63.176  -6.644  38.689  1.00 41.52  ? 153 LEU A O      1 
ATOM   1093  C CB     . LEU A  1 160 ? -60.067  -6.804  39.380  1.00 39.23  ? 153 LEU A CB     1 
ATOM   1094  C CG     . LEU A  1 160 ? -58.649  -7.236  39.011  1.00 40.66  ? 153 LEU A CG     1 
ATOM   1095  C CD1    . LEU A  1 160 ? -57.984  -7.928  40.186  1.00 42.94  ? 153 LEU A CD1    1 
ATOM   1096  C CD2    . LEU A  1 160 ? -58.674  -8.142  37.790  1.00 38.48  ? 153 LEU A CD2    1 
ATOM   1097  N N      . GLN A  1 161 ? -62.447  -4.555  39.116  1.00 36.51  ? 154 GLN A N      1 
ATOM   1098  C CA     . GLN A  1 161 ? -63.778  -4.091  39.487  1.00 38.93  ? 154 GLN A CA     1 
ATOM   1099  C C      . GLN A  1 161 ? -64.725  -4.163  38.302  1.00 42.36  ? 154 GLN A C      1 
ATOM   1100  O O      . GLN A  1 161 ? -65.935  -4.348  38.478  1.00 41.17  ? 154 GLN A O      1 
ATOM   1101  C CB     . GLN A  1 161 ? -63.704  -2.661  40.025  1.00 37.75  ? 154 GLN A CB     1 
ATOM   1102  C CG     . GLN A  1 161 ? -63.112  -2.557  41.424  1.00 39.54  ? 154 GLN A CG     1 
ATOM   1103  C CD     . GLN A  1 161 ? -62.990  -1.124  41.904  1.00 41.41  ? 154 GLN A CD     1 
ATOM   1104  O OE1    . GLN A  1 161 ? -61.935  -0.499  41.779  1.00 44.23  ? 154 GLN A OE1    1 
ATOM   1105  N NE2    . GLN A  1 161 ? -64.073  -0.597  42.462  1.00 40.16  ? 154 GLN A NE2    1 
ATOM   1106  N N      . GLN A  1 162 ? -64.193  -4.010  37.089  1.00 43.23  ? 155 GLN A N      1 
ATOM   1107  C CA     . GLN A  1 162 ? -65.016  -4.152  35.895  1.00 40.43  ? 155 GLN A CA     1 
ATOM   1108  C C      . GLN A  1 162 ? -65.374  -5.612  35.645  1.00 43.78  ? 155 GLN A C      1 
ATOM   1109  O O      . GLN A  1 162 ? -66.506  -5.920  35.258  1.00 45.13  ? 155 GLN A O      1 
ATOM   1110  C CB     . GLN A  1 162 ? -64.291  -3.553  34.693  1.00 36.35  ? 155 GLN A CB     1 
ATOM   1111  C CG     . GLN A  1 162 ? -63.673  -2.197  34.987  1.00 35.57  ? 155 GLN A CG     1 
ATOM   1112  C CD     . GLN A  1 162 ? -64.670  -1.225  35.586  1.00 39.63  ? 155 GLN A CD     1 
ATOM   1113  O OE1    . GLN A  1 162 ? -65.665  -0.876  34.956  1.00 42.82  ? 155 GLN A OE1    1 
ATOM   1114  N NE2    . GLN A  1 162 ? -64.412  -0.791  36.814  1.00 37.73  ? 155 GLN A NE2    1 
ATOM   1115  N N      . LEU A  1 163 ? -64.420  -6.525  35.856  1.00 46.52  ? 156 LEU A N      1 
ATOM   1116  C CA     . LEU A  1 163 ? -64.717  -7.947  35.707  1.00 47.37  ? 156 LEU A CA     1 
ATOM   1117  C C      . LEU A  1 163 ? -65.638  -8.434  36.818  1.00 48.72  ? 156 LEU A C      1 
ATOM   1118  O O      . LEU A  1 163 ? -66.501  -9.291  36.589  1.00 51.66  ? 156 LEU A O      1 
ATOM   1119  C CB     . LEU A  1 163 ? -63.422  -8.761  35.702  1.00 48.21  ? 156 LEU A CB     1 
ATOM   1120  C CG     . LEU A  1 163 ? -62.292  -8.352  34.758  1.00 47.69  ? 156 LEU A CG     1 
ATOM   1121  C CD1    . LEU A  1 163 ? -61.063  -9.202  35.028  1.00 49.32  ? 156 LEU A CD1    1 
ATOM   1122  C CD2    . LEU A  1 163 ? -62.726  -8.493  33.310  1.00 48.00  ? 156 LEU A CD2    1 
ATOM   1123  N N      . CYS A  1 164 ? -65.471  -7.896  38.025  1.00 51.99  ? 157 CYS A N      1 
ATOM   1124  C CA     . CYS A  1 164 ? -66.191  -8.353  39.205  1.00 53.20  ? 157 CYS A CA     1 
ATOM   1125  C C      . CYS A  1 164 ? -66.212  -7.236  40.243  1.00 56.70  ? 157 CYS A C      1 
ATOM   1126  O O      . CYS A  1 164 ? -65.292  -7.132  41.064  1.00 58.88  ? 157 CYS A O      1 
ATOM   1127  C CB     . CYS A  1 164 ? -65.549  -9.617  39.778  1.00 52.20  ? 157 CYS A CB     1 
ATOM   1128  S SG     . CYS A  1 164 ? -66.450  -10.356 41.160  1.00 56.98  ? 157 CYS A SG     1 
ATOM   1129  N N      . PRO A  1 165 ? -67.243  -6.392  40.243  1.00 58.25  ? 158 PRO A N      1 
ATOM   1130  C CA     . PRO A  1 165 ? -67.244  -5.227  41.137  1.00 57.79  ? 158 PRO A CA     1 
ATOM   1131  C C      . PRO A  1 165 ? -67.148  -5.644  42.598  1.00 61.64  ? 158 PRO A C      1 
ATOM   1132  O O      . PRO A  1 165 ? -67.714  -6.658  43.013  1.00 58.56  ? 158 PRO A O      1 
ATOM   1133  C CB     . PRO A  1 165 ? -68.583  -4.545  40.832  1.00 56.90  ? 158 PRO A CB     1 
ATOM   1134  C CG     . PRO A  1 165 ? -69.428  -5.610  40.203  1.00 56.66  ? 158 PRO A CG     1 
ATOM   1135  C CD     . PRO A  1 165 ? -68.482  -6.494  39.455  1.00 57.10  ? 158 PRO A CD     1 
ATOM   1136  N N      . ASP A  1 166 ? -66.418  -4.850  43.377  1.00 63.51  ? 159 ASP A N      1 
ATOM   1137  C CA     . ASP A  1 166 ? -66.235  -5.123  44.793  1.00 67.41  ? 159 ASP A CA     1 
ATOM   1138  C C      . ASP A  1 166 ? -67.278  -4.373  45.619  1.00 76.48  ? 159 ASP A C      1 
ATOM   1139  O O      . ASP A  1 166 ? -68.018  -3.525  45.118  1.00 74.60  ? 159 ASP A O      1 
ATOM   1140  C CB     . ASP A  1 166 ? -64.820  -4.746  45.242  1.00 62.52  ? 159 ASP A CB     1 
ATOM   1141  C CG     . ASP A  1 166 ? -64.593  -3.242  45.290  1.00 58.55  ? 159 ASP A CG     1 
ATOM   1142  O OD1    . ASP A  1 166 ? -65.481  -2.471  44.870  1.00 58.05  ? 159 ASP A OD1    1 
ATOM   1143  O OD2    . ASP A  1 166 ? -63.515  -2.827  45.760  1.00 59.18  ? 159 ASP A OD2    1 
ATOM   1144  N N      . SER A  1 167 ? -67.332  -4.702  46.905  1.00 89.95  ? 160 SER A N      1 
ATOM   1145  C CA     . SER A  1 167 ? -68.309  -4.121  47.816  1.00 92.50  ? 160 SER A CA     1 
ATOM   1146  C C      . SER A  1 167 ? -67.721  -3.047  48.719  1.00 92.43  ? 160 SER A C      1 
ATOM   1147  O O      . SER A  1 167 ? -68.376  -2.033  48.978  1.00 96.93  ? 160 SER A O      1 
ATOM   1148  C CB     . SER A  1 167 ? -68.941  -5.221  48.674  1.00 95.72  ? 160 SER A CB     1 
ATOM   1149  O OG     . SER A  1 167 ? -69.602  -4.680  49.804  1.00 98.97  ? 160 SER A OG     1 
ATOM   1150  N N      . GLY A  1 168 ? -66.498  -3.248  49.200  1.00 88.50  ? 161 GLY A N      1 
ATOM   1151  C CA     . GLY A  1 168 ? -65.933  -2.428  50.253  1.00 82.60  ? 161 GLY A CA     1 
ATOM   1152  C C      . GLY A  1 168 ? -65.672  -0.977  49.905  1.00 77.38  ? 161 GLY A C      1 
ATOM   1153  O O      . GLY A  1 168 ? -66.195  -0.449  48.918  1.00 78.37  ? 161 GLY A O      1 
ATOM   1154  N N      . THR A  1 169 ? -64.860  -0.328  50.733  1.00 71.73  ? 162 THR A N      1 
ATOM   1155  C CA     . THR A  1 169 ? -64.597  1.099   50.660  1.00 64.12  ? 162 THR A CA     1 
ATOM   1156  C C      . THR A  1 169 ? -63.369  1.365   49.792  1.00 54.53  ? 162 THR A C      1 
ATOM   1157  O O      . THR A  1 169 ? -62.606  0.459   49.454  1.00 53.50  ? 162 THR A O      1 
ATOM   1158  C CB     . THR A  1 169 ? -64.387  1.670   52.065  1.00 67.26  ? 162 THR A CB     1 
ATOM   1159  O OG1    . THR A  1 169 ? -65.365  1.120   52.958  1.00 68.55  ? 162 THR A OG1    1 
ATOM   1160  C CG2    . THR A  1 169 ? -64.515  3.186   52.055  1.00 70.09  ? 162 THR A CG2    1 
ATOM   1161  N N      . ILE A  1 170 ? -63.188  2.633   49.416  1.00 51.25  ? 163 ILE A N      1 
ATOM   1162  C CA     . ILE A  1 170 ? -61.985  3.007   48.676  1.00 50.75  ? 163 ILE A CA     1 
ATOM   1163  C C      . ILE A  1 170 ? -60.739  2.714   49.501  1.00 47.10  ? 163 ILE A C      1 
ATOM   1164  O O      . ILE A  1 170 ? -59.707  2.295   48.964  1.00 46.98  ? 163 ILE A O      1 
ATOM   1165  C CB     . ILE A  1 170 ? -62.045  4.483   48.238  1.00 52.89  ? 163 ILE A CB     1 
ATOM   1166  C CG1    . ILE A  1 170 ? -63.274  4.735   47.358  1.00 54.69  ? 163 ILE A CG1    1 
ATOM   1167  C CG2    . ILE A  1 170 ? -60.753  4.883   47.540  1.00 51.95  ? 163 ILE A CG2    1 
ATOM   1168  C CD1    . ILE A  1 170 ? -63.352  6.143   46.795  1.00 55.09  ? 163 ILE A CD1    1 
ATOM   1169  N N      . ALA A  1 171 ? -60.807  2.938   50.816  1.00 45.82  ? 164 ALA A N      1 
ATOM   1170  C CA     . ALA A  1 171 ? -59.666  2.624   51.671  1.00 46.92  ? 164 ALA A CA     1 
ATOM   1171  C C      . ALA A  1 171 ? -59.335  1.138   51.620  1.00 46.90  ? 164 ALA A C      1 
ATOM   1172  O O      . ALA A  1 171 ? -58.159  0.755   51.605  1.00 49.88  ? 164 ALA A O      1 
ATOM   1173  C CB     . ALA A  1 171 ? -59.944  3.060   53.109  1.00 46.91  ? 164 ALA A CB     1 
ATOM   1174  N N      . ALA A  1 172 ? -60.361  0.284   51.583  1.00 44.76  ? 165 ALA A N      1 
ATOM   1175  C CA     . ALA A  1 172 ? -60.120  -1.151  51.482  1.00 44.74  ? 165 ALA A CA     1 
ATOM   1176  C C      . ALA A  1 172 ? -59.372  -1.487  50.200  1.00 45.25  ? 165 ALA A C      1 
ATOM   1177  O O      . ALA A  1 172 ? -58.487  -2.351  50.192  1.00 47.61  ? 165 ALA A O      1 
ATOM   1178  C CB     . ALA A  1 172 ? -61.445  -1.911  51.548  1.00 41.98  ? 165 ALA A CB     1 
ATOM   1179  N N      . ARG A  1 173 ? -59.717  -0.811  49.103  1.00 41.22  ? 166 ARG A N      1 
ATOM   1180  C CA     . ARG A  1 173 ? -58.999  -1.016  47.851  1.00 39.06  ? 166 ARG A CA     1 
ATOM   1181  C C      . ARG A  1 173 ? -57.531  -0.638  48.001  1.00 38.43  ? 166 ARG A C      1 
ATOM   1182  O O      . ARG A  1 173 ? -56.643  -1.364  47.540  1.00 40.69  ? 166 ARG A O      1 
ATOM   1183  C CB     . ARG A  1 173 ? -59.664  -0.209  46.735  1.00 37.67  ? 166 ARG A CB     1 
ATOM   1184  C CG     . ARG A  1 173 ? -61.132  -0.550  46.551  1.00 41.68  ? 166 ARG A CG     1 
ATOM   1185  C CD     . ARG A  1 173 ? -61.845  0.384   45.586  1.00 45.55  ? 166 ARG A CD     1 
ATOM   1186  N NE     . ARG A  1 173 ? -63.282  0.118   45.576  1.00 51.79  ? 166 ARG A NE     1 
ATOM   1187  C CZ     . ARG A  1 173 ? -64.204  0.979   45.161  1.00 52.06  ? 166 ARG A CZ     1 
ATOM   1188  N NH1    . ARG A  1 173 ? -63.844  2.176   44.717  1.00 52.71  ? 166 ARG A NH1    1 
ATOM   1189  N NH2    . ARG A  1 173 ? -65.486  0.643   45.190  1.00 52.37  ? 166 ARG A NH2    1 
ATOM   1190  N N      . ALA A  1 174 ? -57.259  0.498   48.647  1.00 39.28  ? 167 ALA A N      1 
ATOM   1191  C CA     . ALA A  1 174 ? -55.878  0.894   48.904  1.00 41.08  ? 167 ALA A CA     1 
ATOM   1192  C C      . ALA A  1 174 ? -55.127  -0.174  49.695  1.00 42.31  ? 167 ALA A C      1 
ATOM   1193  O O      . ALA A  1 174 ? -53.978  -0.498  49.375  1.00 44.96  ? 167 ALA A O      1 
ATOM   1194  C CB     . ALA A  1 174 ? -55.848  2.234   49.639  1.00 35.34  ? 167 ALA A CB     1 
ATOM   1195  N N      . GLN A  1 175 ? -55.763  -0.741  50.725  1.00 40.70  ? 168 GLN A N      1 
ATOM   1196  C CA     . GLN A  1 175 ? -55.086  -1.737  51.550  1.00 45.53  ? 168 GLN A CA     1 
ATOM   1197  C C      . GLN A  1 175 ? -54.841  -3.034  50.788  1.00 49.13  ? 168 GLN A C      1 
ATOM   1198  O O      . GLN A  1 175 ? -53.829  -3.704  51.022  1.00 50.32  ? 168 GLN A O      1 
ATOM   1199  C CB     . GLN A  1 175 ? -55.893  -1.998  52.822  1.00 52.06  ? 168 GLN A CB     1 
ATOM   1200  C CG     . GLN A  1 175 ? -55.871  -0.829  53.798  1.00 56.60  ? 168 GLN A CG     1 
ATOM   1201  C CD     . GLN A  1 175 ? -57.171  -0.674  54.564  1.00 62.10  ? 168 GLN A CD     1 
ATOM   1202  O OE1    . GLN A  1 175 ? -57.980  -1.601  54.635  1.00 65.85  ? 168 GLN A OE1    1 
ATOM   1203  N NE2    . GLN A  1 175 ? -57.384  0.508   55.133  1.00 61.16  ? 168 GLN A NE2    1 
ATOM   1204  N N      . VAL A  1 176 ? -55.740  -3.402  49.875  1.00 48.40  ? 169 VAL A N      1 
ATOM   1205  C CA     . VAL A  1 176 ? -55.491  -4.568  49.032  1.00 44.68  ? 169 VAL A CA     1 
ATOM   1206  C C      . VAL A  1 176 ? -54.260  -4.335  48.167  1.00 43.30  ? 169 VAL A C      1 
ATOM   1207  O O      . VAL A  1 176 ? -53.366  -5.186  48.081  1.00 42.09  ? 169 VAL A O      1 
ATOM   1208  C CB     . VAL A  1 176 ? -56.731  -4.892  48.182  1.00 43.21  ? 169 VAL A CB     1 
ATOM   1209  C CG1    . VAL A  1 176 ? -56.352  -5.789  47.017  1.00 42.78  ? 169 VAL A CG1    1 
ATOM   1210  C CG2    . VAL A  1 176 ? -57.795  -5.548  49.047  1.00 40.49  ? 169 VAL A CG2    1 
ATOM   1211  N N      . CYS A  1 177 ? -54.198  -3.176  47.507  1.00 43.36  ? 170 CYS A N      1 
ATOM   1212  C CA     . CYS A  1 177 ? -53.040  -2.862  46.680  1.00 45.84  ? 170 CYS A CA     1 
ATOM   1213  C C      . CYS A  1 177 ? -51.774  -2.752  47.522  1.00 48.48  ? 170 CYS A C      1 
ATOM   1214  O O      . CYS A  1 177 ? -50.683  -3.084  47.046  1.00 50.28  ? 170 CYS A O      1 
ATOM   1215  C CB     . CYS A  1 177 ? -53.289  -1.575  45.891  1.00 45.85  ? 170 CYS A CB     1 
ATOM   1216  S SG     . CYS A  1 177 ? -54.626  -1.698  44.673  1.00 46.45  ? 170 CYS A SG     1 
ATOM   1217  N N      . GLN A  1 178 ? -51.896  -2.292  48.771  1.00 48.41  ? 171 GLN A N      1 
ATOM   1218  C CA     . GLN A  1 178 ? -50.728  -2.231  49.644  1.00 48.71  ? 171 GLN A CA     1 
ATOM   1219  C C      . GLN A  1 178 ? -50.280  -3.624  50.062  1.00 46.65  ? 171 GLN A C      1 
ATOM   1220  O O      . GLN A  1 178 ? -49.081  -3.924  50.071  1.00 41.84  ? 171 GLN A O      1 
ATOM   1221  C CB     . GLN A  1 178 ? -51.037  -1.394  50.882  1.00 47.79  ? 171 GLN A CB     1 
ATOM   1222  C CG     . GLN A  1 178 ? -49.849  -1.219  51.805  1.00 48.87  ? 171 GLN A CG     1 
ATOM   1223  C CD     . GLN A  1 178 ? -50.251  -0.696  53.169  1.00 50.80  ? 171 GLN A CD     1 
ATOM   1224  O OE1    . GLN A  1 178 ? -51.414  -0.791  53.565  1.00 52.49  ? 171 GLN A OE1    1 
ATOM   1225  N NE2    . GLN A  1 178 ? -49.289  -0.140  53.898  1.00 41.26  ? 171 GLN A NE2    1 
ATOM   1226  N N      . GLN A  1 179 ? -51.231  -4.485  50.419  1.00 46.69  ? 172 GLN A N      1 
ATOM   1227  C CA     . GLN A  1 179 ? -50.899  -5.866  50.746  1.00 49.39  ? 172 GLN A CA     1 
ATOM   1228  C C      . GLN A  1 179 ? -50.204  -6.549  49.577  1.00 49.36  ? 172 GLN A C      1 
ATOM   1229  O O      . GLN A  1 179 ? -49.251  -7.314  49.769  1.00 50.91  ? 172 GLN A O      1 
ATOM   1230  C CB     . GLN A  1 179 ? -52.166  -6.616  51.153  1.00 52.82  ? 172 GLN A CB     1 
ATOM   1231  C CG     . GLN A  1 179 ? -51.933  -8.004  51.717  1.00 59.98  ? 172 GLN A CG     1 
ATOM   1232  C CD     . GLN A  1 179 ? -50.952  -8.002  52.874  1.00 65.07  ? 172 GLN A CD     1 
ATOM   1233  O OE1    . GLN A  1 179 ? -50.987  -7.121  53.734  1.00 67.45  ? 172 GLN A OE1    1 
ATOM   1234  N NE2    . GLN A  1 179 ? -50.075  -9.001  52.904  1.00 64.30  ? 172 GLN A NE2    1 
ATOM   1235  N N      . ALA A  1 180 ? -50.665  -6.281  48.354  1.00 50.17  ? 173 ALA A N      1 
ATOM   1236  C CA     . ALA A  1 180 ? -50.037  -6.874  47.179  1.00 50.02  ? 173 ALA A CA     1 
ATOM   1237  C C      . ALA A  1 180 ? -48.568  -6.477  47.081  1.00 51.37  ? 173 ALA A C      1 
ATOM   1238  O O      . ALA A  1 180 ? -47.700  -7.326  46.848  1.00 54.57  ? 173 ALA A O      1 
ATOM   1239  C CB     . ALA A  1 180 ? -50.794  -6.466  45.914  1.00 45.47  ? 173 ALA A CB     1 
ATOM   1240  N N      . GLU A  1 181 ? -48.265  -5.188  47.256  1.00 49.47  ? 174 GLU A N      1 
ATOM   1241  C CA     . GLU A  1 181 ? -46.873  -4.752  47.187  1.00 51.17  ? 174 GLU A CA     1 
ATOM   1242  C C      . GLU A  1 181 ? -46.031  -5.401  48.279  1.00 52.40  ? 174 GLU A C      1 
ATOM   1243  O O      . GLU A  1 181 ? -44.858  -5.724  48.058  1.00 53.73  ? 174 GLU A O      1 
ATOM   1244  C CB     . GLU A  1 181 ? -46.781  -3.229  47.271  1.00 53.62  ? 174 GLU A CB     1 
ATOM   1245  C CG     . GLU A  1 181 ? -45.377  -2.701  47.013  1.00 59.09  ? 174 GLU A CG     1 
ATOM   1246  C CD     . GLU A  1 181 ? -45.359  -1.287  46.456  1.00 61.57  ? 174 GLU A CD     1 
ATOM   1247  O OE1    . GLU A  1 181 ? -46.429  -0.787  46.049  1.00 60.97  ? 174 GLU A OE1    1 
ATOM   1248  O OE2    . GLU A  1 181 ? -44.265  -0.681  46.419  1.00 62.08  ? 174 GLU A OE2    1 
ATOM   1249  N N      . HIS A  1 182 ? -46.606  -5.596  49.466  1.00 51.81  ? 175 HIS A N      1 
ATOM   1250  C CA     . HIS A  1 182 ? -45.864  -6.245  50.543  1.00 52.04  ? 175 HIS A CA     1 
ATOM   1251  C C      . HIS A  1 182 ? -45.538  -7.691  50.191  1.00 47.81  ? 175 HIS A C      1 
ATOM   1252  O O      . HIS A  1 182 ? -44.370  -8.098  50.186  1.00 54.72  ? 175 HIS A O      1 
ATOM   1253  C CB     . HIS A  1 182 ? -46.656  -6.190  51.852  1.00 54.08  ? 175 HIS A CB     1 
ATOM   1254  C CG     . HIS A  1 182 ? -46.657  -4.849  52.517  1.00 59.90  ? 175 HIS A CG     1 
ATOM   1255  N ND1    . HIS A  1 182 ? -46.993  -4.684  53.844  1.00 61.61  ? 175 HIS A ND1    1 
ATOM   1256  C CD2    . HIS A  1 182 ? -46.391  -3.610  52.040  1.00 59.55  ? 175 HIS A CD2    1 
ATOM   1257  C CE1    . HIS A  1 182 ? -46.917  -3.405  54.160  1.00 60.87  ? 175 HIS A CE1    1 
ATOM   1258  N NE2    . HIS A  1 182 ? -46.557  -2.730  53.083  1.00 59.74  ? 175 HIS A NE2    1 
ATOM   1259  N N      . SER A  1 183 ? -46.567  -8.480  49.874  1.00 53.16  ? 176 SER A N      1 
ATOM   1260  C CA     . SER A  1 183 ? -46.406  -9.927  49.783  1.00 56.00  ? 176 SER A CA     1 
ATOM   1261  C C      . SER A  1 183 ? -45.815  -10.382 48.455  1.00 56.17  ? 176 SER A C      1 
ATOM   1262  O O      . SER A  1 183 ? -45.072  -11.369 48.424  1.00 56.91  ? 176 SER A O      1 
ATOM   1263  C CB     . SER A  1 183 ? -47.753  -10.612 50.020  1.00 60.93  ? 176 SER A CB     1 
ATOM   1264  O OG     . SER A  1 183 ? -48.261  -10.298 51.306  1.00 63.66  ? 176 SER A OG     1 
ATOM   1265  N N      . PHE A  1 184 ? -46.127  -9.700  47.356  1.00 57.82  ? 177 PHE A N      1 
ATOM   1266  C CA     . PHE A  1 184 ? -45.689  -10.161 46.044  1.00 59.13  ? 177 PHE A CA     1 
ATOM   1267  C C      . PHE A  1 184 ? -44.505  -9.388  45.487  1.00 56.45  ? 177 PHE A C      1 
ATOM   1268  O O      . PHE A  1 184 ? -43.766  -9.931  44.660  1.00 55.66  ? 177 PHE A O      1 
ATOM   1269  C CB     . PHE A  1 184 ? -46.846  -10.112 45.043  1.00 58.90  ? 177 PHE A CB     1 
ATOM   1270  C CG     . PHE A  1 184 ? -47.727  -11.326 45.087  1.00 61.43  ? 177 PHE A CG     1 
ATOM   1271  C CD1    . PHE A  1 184 ? -48.671  -11.486 46.087  1.00 62.11  ? 177 PHE A CD1    1 
ATOM   1272  C CD2    . PHE A  1 184 ? -47.594  -12.320 44.133  1.00 63.12  ? 177 PHE A CD2    1 
ATOM   1273  C CE1    . PHE A  1 184 ? -49.474  -12.609 46.125  1.00 63.28  ? 177 PHE A CE1    1 
ATOM   1274  C CE2    . PHE A  1 184 ? -48.391  -13.443 44.166  1.00 63.42  ? 177 PHE A CE2    1 
ATOM   1275  C CZ     . PHE A  1 184 ? -49.334  -13.588 45.162  1.00 63.02  ? 177 PHE A CZ     1 
ATOM   1276  N N      . ALA A  1 185 ? -44.301  -8.141  45.907  1.00 55.19  ? 178 ALA A N      1 
ATOM   1277  C CA     . ALA A  1 185 ? -43.143  -7.375  45.468  1.00 54.86  ? 178 ALA A CA     1 
ATOM   1278  C C      . ALA A  1 185 ? -42.039  -7.308  46.516  1.00 56.97  ? 178 ALA A C      1 
ATOM   1279  O O      . ALA A  1 185 ? -40.942  -6.832  46.204  1.00 57.84  ? 178 ALA A O      1 
ATOM   1280  C CB     . ALA A  1 185 ? -43.560  -5.952  45.075  1.00 52.77  ? 178 ALA A CB     1 
ATOM   1281  N N      . GLY A  1 186 ? -42.295  -7.775  47.736  1.00 56.08  ? 179 GLY A N      1 
ATOM   1282  C CA     . GLY A  1 186 ? -41.285  -7.732  48.775  1.00 57.81  ? 179 GLY A CA     1 
ATOM   1283  C C      . GLY A  1 186 ? -40.905  -6.329  49.183  1.00 54.25  ? 179 GLY A C      1 
ATOM   1284  O O      . GLY A  1 186 ? -39.769  -6.097  49.609  1.00 59.18  ? 179 GLY A O      1 
ATOM   1285  N N      . MET A  1 187 ? -41.831  -5.383  49.060  1.00 53.24  ? 180 MET A N      1 
ATOM   1286  C CA     . MET A  1 187 ? -41.575  -3.973  49.349  1.00 54.81  ? 180 MET A CA     1 
ATOM   1287  C C      . MET A  1 187 ? -42.553  -3.500  50.416  1.00 55.19  ? 180 MET A C      1 
ATOM   1288  O O      . MET A  1 187 ? -43.735  -3.253  50.115  1.00 56.32  ? 180 MET A O      1 
ATOM   1289  C CB     . MET A  1 187 ? -41.713  -3.148  48.069  1.00 58.27  ? 180 MET A CB     1 
ATOM   1290  C CG     . MET A  1 187 ? -41.852  -1.646  48.250  1.00 63.51  ? 180 MET A CG     1 
ATOM   1291  S SD     . MET A  1 187 ? -40.357  -0.844  48.854  1.00 68.15  ? 180 MET A SD     1 
ATOM   1292  C CE     . MET A  1 187 ? -41.066  0.289   50.039  1.00 66.50  ? 180 MET A CE     1 
ATOM   1293  N N      . PRO A  1 188 ? -42.120  -3.359  51.668  1.00 55.21  ? 181 PRO A N      1 
ATOM   1294  C CA     . PRO A  1 188 ? -43.034  -2.981  52.767  1.00 53.64  ? 181 PRO A CA     1 
ATOM   1295  C C      . PRO A  1 188 ? -43.311  -1.483  52.777  1.00 49.87  ? 181 PRO A C      1 
ATOM   1296  O O      . PRO A  1 188 ? -42.845  -0.718  53.630  1.00 50.90  ? 181 PRO A O      1 
ATOM   1297  C CB     . PRO A  1 188 ? -42.266  -3.454  54.004  1.00 54.68  ? 181 PRO A CB     1 
ATOM   1298  C CG     . PRO A  1 188 ? -40.834  -3.272  53.621  1.00 55.65  ? 181 PRO A CG     1 
ATOM   1299  C CD     . PRO A  1 188 ? -40.744  -3.581  52.145  1.00 54.23  ? 181 PRO A CD     1 
ATOM   1300  N N      . CYS A  1 189 ? -44.096  -1.042  51.800  1.00 45.87  ? 182 CYS A N      1 
ATOM   1301  C CA     . CYS A  1 189 ? -44.414  0.367   51.652  1.00 44.62  ? 182 CYS A CA     1 
ATOM   1302  C C      . CYS A  1 189 ? -45.511  0.790   52.626  1.00 43.10  ? 182 CYS A C      1 
ATOM   1303  O O      . CYS A  1 189 ? -46.139  -0.029  53.302  1.00 44.00  ? 182 CYS A O      1 
ATOM   1304  C CB     . CYS A  1 189 ? -44.856  0.663   50.223  1.00 45.84  ? 182 CYS A CB     1 
ATOM   1305  S SG     . CYS A  1 189 ? -46.382  -0.191  49.756  1.00 48.71  ? 182 CYS A SG     1 
ATOM   1306  N N      . GLY A  1 190 ? -45.738  2.102   52.687  1.00 45.37  ? 183 GLY A N      1 
ATOM   1307  C CA     . GLY A  1 190 ? -46.880  2.644   53.386  1.00 47.03  ? 183 GLY A CA     1 
ATOM   1308  C C      . GLY A  1 190 ? -48.089  2.739   52.473  1.00 48.26  ? 183 GLY A C      1 
ATOM   1309  O O      . GLY A  1 190 ? -48.073  2.311   51.320  1.00 51.58  ? 183 GLY A O      1 
ATOM   1310  N N      . ILE A  1 191 ? -49.161  3.326   53.012  1.00 50.93  ? 184 ILE A N      1 
ATOM   1311  C CA     . ILE A  1 191 ? -50.418  3.418   52.270  1.00 50.59  ? 184 ILE A CA     1 
ATOM   1312  C C      . ILE A  1 191 ? -50.475  4.604   51.323  1.00 51.04  ? 184 ILE A C      1 
ATOM   1313  O O      . ILE A  1 191 ? -51.394  4.678   50.499  1.00 52.12  ? 184 ILE A O      1 
ATOM   1314  C CB     . ILE A  1 191 ? -51.615  3.526   53.231  1.00 53.34  ? 184 ILE A CB     1 
ATOM   1315  C CG1    . ILE A  1 191 ? -51.353  4.602   54.291  1.00 53.95  ? 184 ILE A CG1    1 
ATOM   1316  C CG2    . ILE A  1 191 ? -51.880  2.184   53.897  1.00 56.83  ? 184 ILE A CG2    1 
ATOM   1317  C CD1    . ILE A  1 191 ? -51.481  6.041   53.783  1.00 52.29  ? 184 ILE A CD1    1 
ATOM   1318  N N      . MET A  1 192 ? -49.513  5.524   51.409  1.00 51.14  ? 185 MET A N      1 
ATOM   1319  C CA     . MET A  1 192 ? -49.648  6.810   50.731  1.00 49.38  ? 185 MET A CA     1 
ATOM   1320  C C      . MET A  1 192 ? -49.885  6.650   49.234  1.00 47.59  ? 185 MET A C      1 
ATOM   1321  O O      . MET A  1 192 ? -50.855  7.189   48.688  1.00 47.10  ? 185 MET A O      1 
ATOM   1322  C CB     . MET A  1 192 ? -48.418  7.673   50.995  1.00 47.40  ? 185 MET A CB     1 
ATOM   1323  C CG     . MET A  1 192 ? -48.381  8.913   50.144  1.00 47.13  ? 185 MET A CG     1 
ATOM   1324  S SD     . MET A  1 192 ? -46.807  9.765   50.205  1.00 51.49  ? 185 MET A SD     1 
ATOM   1325  C CE     . MET A  1 192 ? -47.367  11.330  49.569  1.00 51.99  ? 185 MET A CE     1 
ATOM   1326  N N      . ASP A  1 193 ? -49.005  5.921   48.548  1.00 46.14  ? 186 ASP A N      1 
ATOM   1327  C CA     . ASP A  1 193 ? -49.063  5.899   47.090  1.00 41.97  ? 186 ASP A CA     1 
ATOM   1328  C C      . ASP A  1 193 ? -50.387  5.332   46.599  1.00 42.71  ? 186 ASP A C      1 
ATOM   1329  O O      . ASP A  1 193 ? -51.019  5.893   45.697  1.00 42.35  ? 186 ASP A O      1 
ATOM   1330  C CB     . ASP A  1 193 ? -47.890  5.101   46.526  1.00 46.73  ? 186 ASP A CB     1 
ATOM   1331  C CG     . ASP A  1 193 ? -46.553  5.743   46.828  1.00 51.62  ? 186 ASP A CG     1 
ATOM   1332  O OD1    . ASP A  1 193 ? -46.526  6.959   47.121  1.00 54.47  ? 186 ASP A OD1    1 
ATOM   1333  O OD2    . ASP A  1 193 ? -45.529  5.032   46.770  1.00 51.97  ? 186 ASP A OD2    1 
ATOM   1334  N N      . GLN A  1 194 ? -50.824  4.213   47.180  1.00 40.82  ? 187 GLN A N      1 
ATOM   1335  C CA     . GLN A  1 194 ? -52.106  3.636   46.789  1.00 38.00  ? 187 GLN A CA     1 
ATOM   1336  C C      . GLN A  1 194 ? -53.247  4.601   47.074  1.00 38.51  ? 187 GLN A C      1 
ATOM   1337  O O      . GLN A  1 194 ? -54.195  4.711   46.286  1.00 39.56  ? 187 GLN A O      1 
ATOM   1338  C CB     . GLN A  1 194 ? -52.336  2.315   47.521  1.00 37.48  ? 187 GLN A CB     1 
ATOM   1339  C CG     . GLN A  1 194 ? -51.331  1.229   47.193  1.00 39.96  ? 187 GLN A CG     1 
ATOM   1340  C CD     . GLN A  1 194 ? -50.009  1.440   47.906  1.00 41.32  ? 187 GLN A CD     1 
ATOM   1341  O OE1    . GLN A  1 194 ? -49.929  2.187   48.882  1.00 42.02  ? 187 GLN A OE1    1 
ATOM   1342  N NE2    . GLN A  1 194 ? -48.966  0.778   47.425  1.00 39.79  ? 187 GLN A NE2    1 
ATOM   1343  N N      . PHE A  1 195 ? -53.168  5.312   48.199  1.00 37.21  ? 188 PHE A N      1 
ATOM   1344  C CA     . PHE A  1 195 ? -54.262  6.179   48.617  1.00 42.20  ? 188 PHE A CA     1 
ATOM   1345  C C      . PHE A  1 195 ? -54.457  7.327   47.638  1.00 39.85  ? 188 PHE A C      1 
ATOM   1346  O O      . PHE A  1 195 ? -55.586  7.632   47.237  1.00 40.33  ? 188 PHE A O      1 
ATOM   1347  C CB     . PHE A  1 195 ? -53.971  6.733   50.012  1.00 51.19  ? 188 PHE A CB     1 
ATOM   1348  C CG     . PHE A  1 195 ? -55.193  6.952   50.847  1.00 58.68  ? 188 PHE A CG     1 
ATOM   1349  C CD1    . PHE A  1 195 ? -56.004  8.056   50.646  1.00 61.72  ? 188 PHE A CD1    1 
ATOM   1350  C CD2    . PHE A  1 195 ? -55.505  6.073   51.869  1.00 63.52  ? 188 PHE A CD2    1 
ATOM   1351  C CE1    . PHE A  1 195 ? -57.128  8.254   51.422  1.00 65.33  ? 188 PHE A CE1    1 
ATOM   1352  C CE2    . PHE A  1 195 ? -56.621  6.270   52.654  1.00 67.08  ? 188 PHE A CE2    1 
ATOM   1353  C CZ     . PHE A  1 195 ? -57.434  7.362   52.431  1.00 67.25  ? 188 PHE A CZ     1 
ATOM   1354  N N      . ILE A  1 196 ? -53.359  7.973   47.234  1.00 38.32  ? 189 ILE A N      1 
ATOM   1355  C CA     . ILE A  1 196 ? -53.462  9.134   46.355  1.00 40.75  ? 189 ILE A CA     1 
ATOM   1356  C C      . ILE A  1 196 ? -53.851  8.728   44.938  1.00 43.05  ? 189 ILE A C      1 
ATOM   1357  O O      . ILE A  1 196 ? -54.590  9.454   44.262  1.00 40.32  ? 189 ILE A O      1 
ATOM   1358  C CB     . ILE A  1 196 ? -52.153  9.946   46.368  1.00 29.63  ? 189 ILE A CB     1 
ATOM   1359  C CG1    . ILE A  1 196 ? -52.290  11.172  45.461  1.00 28.86  ? 189 ILE A CG1    1 
ATOM   1360  C CG2    . ILE A  1 196 ? -50.972  9.090   45.920  1.00 29.92  ? 189 ILE A CG2    1 
ATOM   1361  C CD1    . ILE A  1 196 ? -53.469  12.066  45.803  1.00 28.70  ? 189 ILE A CD1    1 
ATOM   1362  N N      . SER A  1 197 ? -53.371  7.578   44.459  1.00 44.37  ? 190 SER A N      1 
ATOM   1363  C CA     . SER A  1 197 ? -53.748  7.132   43.120  1.00 40.51  ? 190 SER A CA     1 
ATOM   1364  C C      . SER A  1 197 ? -55.251  6.906   43.014  1.00 38.59  ? 190 SER A C      1 
ATOM   1365  O O      . SER A  1 197 ? -55.853  7.157   41.964  1.00 29.58  ? 190 SER A O      1 
ATOM   1366  C CB     . SER A  1 197 ? -52.989  5.854   42.762  1.00 38.85  ? 190 SER A CB     1 
ATOM   1367  O OG     . SER A  1 197 ? -53.043  5.595   41.369  1.00 40.44  ? 190 SER A OG     1 
ATOM   1368  N N      . LEU A  1 198 ? -55.875  6.428   44.090  1.00 40.42  ? 191 LEU A N      1 
ATOM   1369  C CA     . LEU A  1 198 ? -57.321  6.233   44.095  1.00 37.65  ? 191 LEU A CA     1 
ATOM   1370  C C      . LEU A  1 198 ? -58.068  7.515   44.437  1.00 41.11  ? 191 LEU A C      1 
ATOM   1371  O O      . LEU A  1 198 ? -59.187  7.726   43.953  1.00 46.18  ? 191 LEU A O      1 
ATOM   1372  C CB     . LEU A  1 198 ? -57.702  5.119   45.070  1.00 35.27  ? 191 LEU A CB     1 
ATOM   1373  C CG     . LEU A  1 198 ? -57.486  3.691   44.567  1.00 35.95  ? 191 LEU A CG     1 
ATOM   1374  C CD1    . LEU A  1 198 ? -56.633  2.899   45.538  1.00 37.49  ? 191 LEU A CD1    1 
ATOM   1375  C CD2    . LEU A  1 198 ? -58.835  3.015   44.356  1.00 36.36  ? 191 LEU A CD2    1 
ATOM   1376  N N      . MET A  1 199 ? -57.469  8.375   45.259  1.00 41.63  ? 192 MET A N      1 
ATOM   1377  C CA     . MET A  1 199 ? -58.179  9.461   45.917  1.00 44.12  ? 192 MET A CA     1 
ATOM   1378  C C      . MET A  1 199 ? -57.873  10.822  45.312  1.00 40.62  ? 192 MET A C      1 
ATOM   1379  O O      . MET A  1 199 ? -58.470  11.819  45.732  1.00 36.84  ? 192 MET A O      1 
ATOM   1380  C CB     . MET A  1 199 ? -57.826  9.485   47.410  1.00 51.74  ? 192 MET A CB     1 
ATOM   1381  C CG     . MET A  1 199 ? -58.412  8.346   48.223  1.00 63.77  ? 192 MET A CG     1 
ATOM   1382  S SD     . MET A  1 199 ? -60.171  8.570   48.533  1.00 77.24  ? 192 MET A SD     1 
ATOM   1383  C CE     . MET A  1 199 ? -60.135  10.042  49.559  1.00 78.51  ? 192 MET A CE     1 
ATOM   1384  N N      . GLY A  1 200 ? -56.973  10.895  44.336  1.00 38.64  ? 193 GLY A N      1 
ATOM   1385  C CA     . GLY A  1 200 ? -56.606  12.186  43.789  1.00 38.37  ? 193 GLY A CA     1 
ATOM   1386  C C      . GLY A  1 200 ? -57.785  12.879  43.135  1.00 39.93  ? 193 GLY A C      1 
ATOM   1387  O O      . GLY A  1 200 ? -58.678  12.245  42.568  1.00 41.49  ? 193 GLY A O      1 
ATOM   1388  N N      . GLN A  1 201 ? -57.782  14.205  43.220  1.00 40.03  ? 194 GLN A N      1 
ATOM   1389  C CA     . GLN A  1 201 ? -58.749  15.042  42.527  1.00 39.46  ? 194 GLN A CA     1 
ATOM   1390  C C      . GLN A  1 201 ? -57.969  16.134  41.815  1.00 38.63  ? 194 GLN A C      1 
ATOM   1391  O O      . GLN A  1 201 ? -57.072  16.739  42.411  1.00 39.67  ? 194 GLN A O      1 
ATOM   1392  C CB     . GLN A  1 201 ? -59.769  15.636  43.504  1.00 41.76  ? 194 GLN A CB     1 
ATOM   1393  C CG     . GLN A  1 201 ? -60.534  14.580  44.298  1.00 48.44  ? 194 GLN A CG     1 
ATOM   1394  C CD     . GLN A  1 201 ? -61.501  13.785  43.441  1.00 55.82  ? 194 GLN A CD     1 
ATOM   1395  O OE1    . GLN A  1 201 ? -61.856  14.201  42.337  1.00 58.06  ? 194 GLN A OE1    1 
ATOM   1396  N NE2    . GLN A  1 201 ? -61.930  12.631  43.945  1.00 57.38  ? 194 GLN A NE2    1 
ATOM   1397  N N      . LYS A  1 202 ? -58.297  16.386  40.550  1.00 40.76  ? 195 LYS A N      1 
ATOM   1398  C CA     . LYS A  1 202 ? -57.505  17.330  39.774  1.00 41.09  ? 195 LYS A CA     1 
ATOM   1399  C C      . LYS A  1 202 ? -57.589  18.723  40.387  1.00 40.07  ? 195 LYS A C      1 
ATOM   1400  O O      . LYS A  1 202 ? -58.636  19.138  40.892  1.00 35.64  ? 195 LYS A O      1 
ATOM   1401  C CB     . LYS A  1 202 ? -57.969  17.350  38.317  1.00 43.13  ? 195 LYS A CB     1 
ATOM   1402  C CG     . LYS A  1 202 ? -59.036  18.379  37.995  1.00 48.76  ? 195 LYS A CG     1 
ATOM   1403  C CD     . LYS A  1 202 ? -58.930  18.800  36.538  1.00 54.94  ? 195 LYS A CD     1 
ATOM   1404  C CE     . LYS A  1 202 ? -57.481  19.133  36.193  1.00 59.82  ? 195 LYS A CE     1 
ATOM   1405  N NZ     . LYS A  1 202 ? -57.320  19.626  34.796  1.00 64.42  ? 195 LYS A NZ     1 
ATOM   1406  N N      . GLY A  1 203 ? -56.474  19.447  40.337  1.00 38.51  ? 196 GLY A N      1 
ATOM   1407  C CA     . GLY A  1 203 ? -56.393  20.749  40.972  1.00 39.60  ? 196 GLY A CA     1 
ATOM   1408  C C      . GLY A  1 203 ? -56.405  20.717  42.485  1.00 40.34  ? 196 GLY A C      1 
ATOM   1409  O O      . GLY A  1 203 ? -56.791  21.707  43.115  1.00 42.30  ? 196 GLY A O      1 
ATOM   1410  N N      . HIS A  1 204 ? -55.978  19.609  43.088  1.00 38.99  ? 197 HIS A N      1 
ATOM   1411  C CA     . HIS A  1 204 ? -55.982  19.461  44.536  1.00 36.13  ? 197 HIS A CA     1 
ATOM   1412  C C      . HIS A  1 204 ? -54.801  18.609  44.971  1.00 37.89  ? 197 HIS A C      1 
ATOM   1413  O O      . HIS A  1 204 ? -54.421  17.661  44.280  1.00 40.19  ? 197 HIS A O      1 
ATOM   1414  C CB     . HIS A  1 204 ? -57.267  18.799  45.045  1.00 35.17  ? 197 HIS A CB     1 
ATOM   1415  C CG     . HIS A  1 204 ? -58.483  19.662  44.940  1.00 35.22  ? 197 HIS A CG     1 
ATOM   1416  N ND1    . HIS A  1 204 ? -59.225  19.766  43.784  1.00 36.19  ? 197 HIS A ND1    1 
ATOM   1417  C CD2    . HIS A  1 204 ? -59.094  20.453  45.853  1.00 34.41  ? 197 HIS A CD2    1 
ATOM   1418  C CE1    . HIS A  1 204 ? -60.241  20.586  43.989  1.00 37.35  ? 197 HIS A CE1    1 
ATOM   1419  N NE2    . HIS A  1 204 ? -60.182  21.018  45.235  1.00 36.87  ? 197 HIS A NE2    1 
ATOM   1420  N N      . ALA A  1 205 ? -54.230  18.958  46.117  1.00 34.72  ? 198 ALA A N      1 
ATOM   1421  C CA     . ALA A  1 205 ? -53.370  18.058  46.867  1.00 35.41  ? 198 ALA A CA     1 
ATOM   1422  C C      . ALA A  1 205 ? -54.191  17.379  47.958  1.00 28.15  ? 198 ALA A C      1 
ATOM   1423  O O      . ALA A  1 205 ? -55.252  17.862  48.360  1.00 31.59  ? 198 ALA A O      1 
ATOM   1424  C CB     . ALA A  1 205 ? -52.186  18.812  47.477  1.00 34.05  ? 198 ALA A CB     1 
ATOM   1425  N N      . LEU A  1 206 ? -53.683  16.252  48.445  1.00 33.66  ? 199 LEU A N      1 
ATOM   1426  C CA     . LEU A  1 206 ? -54.392  15.449  49.436  1.00 37.41  ? 199 LEU A CA     1 
ATOM   1427  C C      . LEU A  1 206 ? -53.581  15.410  50.722  1.00 36.25  ? 199 LEU A C      1 
ATOM   1428  O O      . LEU A  1 206 ? -52.531  14.763  50.782  1.00 35.14  ? 199 LEU A O      1 
ATOM   1429  C CB     . LEU A  1 206 ? -54.668  14.038  48.922  1.00 41.71  ? 199 LEU A CB     1 
ATOM   1430  C CG     . LEU A  1 206 ? -56.124  13.765  48.551  1.00 51.19  ? 199 LEU A CG     1 
ATOM   1431  C CD1    . LEU A  1 206 ? -56.381  12.271  48.508  1.00 53.63  ? 199 LEU A CD1    1 
ATOM   1432  C CD2    . LEU A  1 206 ? -57.047  14.433  49.555  1.00 55.22  ? 199 LEU A CD2    1 
ATOM   1433  N N      . LEU A  1 207 ? -54.065  16.112  51.740  1.00 37.60  ? 200 LEU A N      1 
ATOM   1434  C CA     . LEU A  1 207 ? -53.508  15.997  53.080  1.00 38.91  ? 200 LEU A CA     1 
ATOM   1435  C C      . LEU A  1 207 ? -54.071  14.734  53.718  1.00 40.82  ? 200 LEU A C      1 
ATOM   1436  O O      . LEU A  1 207 ? -55.260  14.675  54.049  1.00 41.68  ? 200 LEU A O      1 
ATOM   1437  C CB     . LEU A  1 207 ? -53.845  17.234  53.905  1.00 43.10  ? 200 LEU A CB     1 
ATOM   1438  C CG     . LEU A  1 207 ? -53.354  17.232  55.353  1.00 43.85  ? 200 LEU A CG     1 
ATOM   1439  C CD1    . LEU A  1 207 ? -51.831  17.200  55.434  1.00 43.25  ? 200 LEU A CD1    1 
ATOM   1440  C CD2    . LEU A  1 207 ? -53.917  18.431  56.101  1.00 42.57  ? 200 LEU A CD2    1 
ATOM   1441  N N      . ILE A  1 208 ? -53.225  13.720  53.880  1.00 40.76  ? 201 ILE A N      1 
ATOM   1442  C CA     . ILE A  1 208 ? -53.638  12.417  54.386  1.00 41.34  ? 201 ILE A CA     1 
ATOM   1443  C C      . ILE A  1 208 ? -53.073  12.236  55.786  1.00 42.42  ? 201 ILE A C      1 
ATOM   1444  O O      . ILE A  1 208 ? -51.857  12.345  55.993  1.00 46.37  ? 201 ILE A O      1 
ATOM   1445  C CB     . ILE A  1 208 ? -53.177  11.270  53.469  1.00 39.11  ? 201 ILE A CB     1 
ATOM   1446  C CG1    . ILE A  1 208 ? -53.642  11.501  52.027  1.00 37.12  ? 201 ILE A CG1    1 
ATOM   1447  C CG2    . ILE A  1 208 ? -53.693  9.937   53.995  1.00 37.83  ? 201 ILE A CG2    1 
ATOM   1448  C CD1    . ILE A  1 208 ? -53.006  10.561  51.014  1.00 36.79  ? 201 ILE A CD1    1 
ATOM   1449  N N      . ASP A  1 209 ? -53.955  11.968  56.744  1.00 42.15  ? 202 ASP A N      1 
ATOM   1450  C CA     . ASP A  1 209 ? -53.548  11.579  58.091  1.00 44.55  ? 202 ASP A CA     1 
ATOM   1451  C C      . ASP A  1 209 ? -53.450  10.059  58.081  1.00 45.17  ? 202 ASP A C      1 
ATOM   1452  O O      . ASP A  1 209 ? -54.464  9.357   58.114  1.00 43.99  ? 202 ASP A O      1 
ATOM   1453  C CB     . ASP A  1 209 ? -54.544  12.091  59.128  1.00 47.65  ? 202 ASP A CB     1 
ATOM   1454  C CG     . ASP A  1 209 ? -54.105  11.807  60.556  1.00 48.58  ? 202 ASP A CG     1 
ATOM   1455  O OD1    . ASP A  1 209 ? -53.557  10.714  60.809  1.00 48.36  ? 202 ASP A OD1    1 
ATOM   1456  O OD2    . ASP A  1 209 ? -54.304  12.682  61.431  1.00 49.24  ? 202 ASP A OD2    1 
ATOM   1457  N N      . CYS A  1 210 ? -52.222  9.545   58.037  1.00 47.92  ? 203 CYS A N      1 
ATOM   1458  C CA     . CYS A  1 210 ? -52.001  8.115   57.868  1.00 47.30  ? 203 CYS A CA     1 
ATOM   1459  C C      . CYS A  1 210 ? -52.239  7.318   59.142  1.00 50.31  ? 203 CYS A C      1 
ATOM   1460  O O      . CYS A  1 210 ? -52.089  6.092   59.121  1.00 51.39  ? 203 CYS A O      1 
ATOM   1461  C CB     . CYS A  1 210 ? -50.581  7.862   57.354  1.00 49.75  ? 203 CYS A CB     1 
ATOM   1462  S SG     . CYS A  1 210 ? -50.216  8.653   55.764  1.00 52.50  ? 203 CYS A SG     1 
ATOM   1463  N N      . ARG A  1 211 ? -52.597  7.976   60.243  1.00 52.87  ? 204 ARG A N      1 
ATOM   1464  C CA     . ARG A  1 211 ? -53.034  7.280   61.447  1.00 57.38  ? 204 ARG A CA     1 
ATOM   1465  C C      . ARG A  1 211 ? -54.530  6.987   61.422  1.00 60.59  ? 204 ARG A C      1 
ATOM   1466  O O      . ARG A  1 211 ? -54.947  5.836   61.581  1.00 61.17  ? 204 ARG A O      1 
ATOM   1467  C CB     . ARG A  1 211 ? -52.691  8.113   62.682  1.00 58.44  ? 204 ARG A CB     1 
ATOM   1468  C CG     . ARG A  1 211 ? -53.250  7.557   63.977  1.00 61.14  ? 204 ARG A CG     1 
ATOM   1469  C CD     . ARG A  1 211 ? -53.561  8.685   64.940  1.00 61.99  ? 204 ARG A CD     1 
ATOM   1470  N NE     . ARG A  1 211 ? -52.392  9.081   65.720  1.00 64.03  ? 204 ARG A NE     1 
ATOM   1471  C CZ     . ARG A  1 211 ? -52.255  10.267  66.302  1.00 68.90  ? 204 ARG A CZ     1 
ATOM   1472  N NH1    . ARG A  1 211 ? -53.212  11.177  66.177  1.00 68.41  ? 204 ARG A NH1    1 
ATOM   1473  N NH2    . ARG A  1 211 ? -51.159  10.547  66.995  1.00 71.09  ? 204 ARG A NH2    1 
ATOM   1474  N N      . SER A  1 212 ? -55.345  8.023   61.227  1.00 62.74  ? 205 SER A N      1 
ATOM   1475  C CA     . SER A  1 212 ? -56.795  7.903   61.214  1.00 63.63  ? 205 SER A CA     1 
ATOM   1476  C C      . SER A  1 212 ? -57.364  7.741   59.812  1.00 62.72  ? 205 SER A C      1 
ATOM   1477  O O      . SER A  1 212 ? -58.545  7.406   59.674  1.00 64.16  ? 205 SER A O      1 
ATOM   1478  C CB     . SER A  1 212 ? -57.434  9.126   61.885  1.00 64.42  ? 205 SER A CB     1 
ATOM   1479  O OG     . SER A  1 212 ? -57.133  10.312  61.169  1.00 63.65  ? 205 SER A OG     1 
ATOM   1480  N N      . LEU A  1 213 ? -56.559  7.973   58.776  1.00 60.17  ? 206 LEU A N      1 
ATOM   1481  C CA     . LEU A  1 213 ? -56.973  7.946   57.378  1.00 57.83  ? 206 LEU A CA     1 
ATOM   1482  C C      . LEU A  1 213 ? -57.926  9.080   57.028  1.00 53.90  ? 206 LEU A C      1 
ATOM   1483  O O      . LEU A  1 213 ? -58.565  9.042   55.969  1.00 53.23  ? 206 LEU A O      1 
ATOM   1484  C CB     . LEU A  1 213 ? -57.605  6.601   57.006  1.00 61.38  ? 206 LEU A CB     1 
ATOM   1485  C CG     . LEU A  1 213 ? -56.643  5.423   57.171  1.00 65.02  ? 206 LEU A CG     1 
ATOM   1486  C CD1    . LEU A  1 213 ? -57.247  4.134   56.638  1.00 63.43  ? 206 LEU A CD1    1 
ATOM   1487  C CD2    . LEU A  1 213 ? -55.315  5.717   56.492  1.00 65.49  ? 206 LEU A CD2    1 
ATOM   1488  N N      . GLU A  1 214 ? -58.053  10.081  57.896  1.00 51.02  ? 207 GLU A N      1 
ATOM   1489  C CA     . GLU A  1 214 ? -58.754  11.301  57.526  1.00 49.95  ? 207 GLU A CA     1 
ATOM   1490  C C      . GLU A  1 214 ? -58.036  11.968  56.361  1.00 46.90  ? 207 GLU A C      1 
ATOM   1491  O O      . GLU A  1 214 ? -56.804  11.976  56.292  1.00 45.95  ? 207 GLU A O      1 
ATOM   1492  C CB     . GLU A  1 214 ? -58.830  12.253  58.721  1.00 54.88  ? 207 GLU A CB     1 
ATOM   1493  C CG     . GLU A  1 214 ? -59.303  13.659  58.377  1.00 61.27  ? 207 GLU A CG     1 
ATOM   1494  C CD     . GLU A  1 214 ? -59.517  14.518  59.610  1.00 66.46  ? 207 GLU A CD     1 
ATOM   1495  O OE1    . GLU A  1 214 ? -59.628  13.950  60.717  1.00 68.44  ? 207 GLU A OE1    1 
ATOM   1496  O OE2    . GLU A  1 214 ? -59.575  15.759  59.473  1.00 68.41  ? 207 GLU A OE2    1 
ATOM   1497  N N      . THR A  1 215 ? -58.812  12.524  55.435  1.00 45.24  ? 208 THR A N      1 
ATOM   1498  C CA     . THR A  1 215 ? -58.257  13.124  54.231  1.00 42.02  ? 208 THR A CA     1 
ATOM   1499  C C      . THR A  1 215 ? -58.897  14.477  53.972  1.00 39.23  ? 208 THR A C      1 
ATOM   1500  O O      . THR A  1 215 ? -60.086  14.677  54.238  1.00 34.39  ? 208 THR A O      1 
ATOM   1501  C CB     . THR A  1 215 ? -58.458  12.223  53.014  1.00 41.72  ? 208 THR A CB     1 
ATOM   1502  O OG1    . THR A  1 215 ? -59.860  12.030  52.790  1.00 50.18  ? 208 THR A OG1    1 
ATOM   1503  C CG2    . THR A  1 215 ? -57.795  10.880  53.247  1.00 41.39  ? 208 THR A CG2    1 
ATOM   1504  N N      . SER A  1 216 ? -58.093  15.402  53.451  1.00 37.16  ? 209 SER A N      1 
ATOM   1505  C CA     . SER A  1 216 ? -58.549  16.733  53.081  1.00 36.83  ? 209 SER A CA     1 
ATOM   1506  C C      . SER A  1 216 ? -58.065  17.061  51.678  1.00 36.75  ? 209 SER A C      1 
ATOM   1507  O O      . SER A  1 216 ? -56.872  16.929  51.384  1.00 37.53  ? 209 SER A O      1 
ATOM   1508  C CB     . SER A  1 216 ? -58.039  17.791  54.062  1.00 42.66  ? 209 SER A CB     1 
ATOM   1509  O OG     . SER A  1 216 ? -58.673  17.673  55.321  1.00 50.50  ? 209 SER A OG     1 
ATOM   1510  N N      . LEU A  1 217 ? -58.986  17.481  50.815  1.00 36.16  ? 210 LEU A N      1 
ATOM   1511  C CA     . LEU A  1 217 ? -58.632  17.937  49.476  1.00 35.82  ? 210 LEU A CA     1 
ATOM   1512  C C      . LEU A  1 217 ? -58.296  19.419  49.579  1.00 35.08  ? 210 LEU A C      1 
ATOM   1513  O O      . LEU A  1 217 ? -59.170  20.241  49.872  1.00 34.33  ? 210 LEU A O      1 
ATOM   1514  C CB     . LEU A  1 217 ? -59.770  17.691  48.489  1.00 42.68  ? 210 LEU A CB     1 
ATOM   1515  C CG     . LEU A  1 217 ? -60.220  16.246  48.268  1.00 46.30  ? 210 LEU A CG     1 
ATOM   1516  C CD1    . LEU A  1 217 ? -61.563  16.219  47.561  1.00 49.81  ? 210 LEU A CD1    1 
ATOM   1517  C CD2    . LEU A  1 217 ? -59.188  15.478  47.467  1.00 45.12  ? 210 LEU A CD2    1 
ATOM   1518  N N      . VAL A  1 218 ? -57.039  19.762  49.334  1.00 36.42  ? 211 VAL A N      1 
ATOM   1519  C CA     . VAL A  1 218 ? -56.552  21.134  49.451  1.00 36.16  ? 211 VAL A CA     1 
ATOM   1520  C C      . VAL A  1 218 ? -56.326  21.676  48.044  1.00 35.94  ? 211 VAL A C      1 
ATOM   1521  O O      . VAL A  1 218 ? -55.502  21.125  47.301  1.00 34.33  ? 211 VAL A O      1 
ATOM   1522  C CB     . VAL A  1 218 ? -55.265  21.221  50.285  1.00 33.83  ? 211 VAL A CB     1 
ATOM   1523  C CG1    . VAL A  1 218 ? -54.813  22.671  50.382  1.00 36.48  ? 211 VAL A CG1    1 
ATOM   1524  C CG2    . VAL A  1 218 ? -55.481  20.630  51.666  1.00 29.58  ? 211 VAL A CG2    1 
ATOM   1525  N N      . PRO A  1 219 ? -57.032  22.727  47.633  1.00 36.50  ? 212 PRO A N      1 
ATOM   1526  C CA     . PRO A  1 219 ? -56.903  23.201  46.250  1.00 35.73  ? 212 PRO A CA     1 
ATOM   1527  C C      . PRO A  1 219 ? -55.477  23.611  45.915  1.00 39.09  ? 212 PRO A C      1 
ATOM   1528  O O      . PRO A  1 219 ? -54.793  24.275  46.698  1.00 43.01  ? 212 PRO A O      1 
ATOM   1529  C CB     . PRO A  1 219 ? -57.858  24.399  46.190  1.00 34.05  ? 212 PRO A CB     1 
ATOM   1530  C CG     . PRO A  1 219 ? -58.825  24.195  47.304  1.00 29.78  ? 212 PRO A CG     1 
ATOM   1531  C CD     . PRO A  1 219 ? -58.144  23.371  48.356  1.00 38.13  ? 212 PRO A CD     1 
ATOM   1532  N N      . LEU A  1 220 ? -55.035  23.196  44.727  1.00 40.63  ? 213 LEU A N      1 
ATOM   1533  C CA     . LEU A  1 220 ? -53.749  23.585  44.145  1.00 43.57  ? 213 LEU A CA     1 
ATOM   1534  C C      . LEU A  1 220 ? -54.044  23.953  42.694  1.00 49.58  ? 213 LEU A C      1 
ATOM   1535  O O      . LEU A  1 220 ? -53.891  23.134  41.787  1.00 56.31  ? 213 LEU A O      1 
ATOM   1536  C CB     . LEU A  1 220 ? -52.709  22.470  44.255  1.00 39.97  ? 213 LEU A CB     1 
ATOM   1537  C CG     . LEU A  1 220 ? -51.474  22.767  45.106  1.00 39.78  ? 213 LEU A CG     1 
ATOM   1538  C CD1    . LEU A  1 220 ? -50.471  21.626  44.978  1.00 36.92  ? 213 LEU A CD1    1 
ATOM   1539  C CD2    . LEU A  1 220 ? -50.846  24.093  44.697  1.00 39.96  ? 213 LEU A CD2    1 
ATOM   1540  N N      . SER A  1 221 ? -54.474  25.199  42.479  1.00 55.50  ? 214 SER A N      1 
ATOM   1541  C CA     . SER A  1 221 ? -54.948  25.662  41.178  1.00 58.05  ? 214 SER A CA     1 
ATOM   1542  C C      . SER A  1 221 ? -54.630  27.153  41.049  1.00 59.22  ? 214 SER A C      1 
ATOM   1543  O O      . SER A  1 221 ? -55.487  28.030  41.153  1.00 62.21  ? 214 SER A O      1 
ATOM   1544  C CB     . SER A  1 221 ? -56.445  25.399  40.998  1.00 62.20  ? 214 SER A CB     1 
ATOM   1545  O OG     . SER A  1 221 ? -57.185  25.922  42.088  1.00 65.78  ? 214 SER A OG     1 
ATOM   1546  N N      . ASP A  1 222 ? -53.360  27.454  40.811  1.00 54.53  ? 215 ASP A N      1 
ATOM   1547  C CA     . ASP A  1 222 ? -52.901  28.833  40.662  1.00 51.98  ? 215 ASP A CA     1 
ATOM   1548  C C      . ASP A  1 222 ? -52.073  28.955  39.392  1.00 49.51  ? 215 ASP A C      1 
ATOM   1549  O O      . ASP A  1 222 ? -50.943  28.426  39.341  1.00 49.19  ? 215 ASP A O      1 
ATOM   1550  C CB     . ASP A  1 222 ? -52.093  29.271  41.880  1.00 48.16  ? 215 ASP A CB     1 
ATOM   1551  C CG     . ASP A  1 222 ? -51.860  30.769  41.915  1.00 46.75  ? 215 ASP A CG     1 
ATOM   1552  O OD1    . ASP A  1 222 ? -52.135  31.443  40.899  1.00 47.47  ? 215 ASP A OD1    1 
ATOM   1553  O OD2    . ASP A  1 222 ? -51.414  31.275  42.965  1.00 45.40  ? 215 ASP A OD2    1 
ATOM   1554  N N      . PRO A  1 223 ? -52.576  29.629  38.356  1.00 50.59  ? 216 PRO A N      1 
ATOM   1555  C CA     . PRO A  1 223 ? -51.765  29.813  37.141  1.00 49.53  ? 216 PRO A CA     1 
ATOM   1556  C C      . PRO A  1 223 ? -50.407  30.446  37.407  1.00 47.37  ? 216 PRO A C      1 
ATOM   1557  O O      . PRO A  1 223 ? -49.496  30.290  36.584  1.00 49.92  ? 216 PRO A O      1 
ATOM   1558  C CB     . PRO A  1 223 ? -52.641  30.719  36.262  1.00 47.58  ? 216 PRO A CB     1 
ATOM   1559  C CG     . PRO A  1 223 ? -53.696  31.268  37.165  1.00 48.68  ? 216 PRO A CG     1 
ATOM   1560  C CD     . PRO A  1 223 ? -53.907  30.242  38.232  1.00 50.24  ? 216 PRO A CD     1 
ATOM   1561  N N      . LYS A  1 224 ? -50.247  31.174  38.515  1.00 47.09  ? 217 LYS A N      1 
ATOM   1562  C CA     . LYS A  1 224 ? -48.957  31.742  38.889  1.00 51.34  ? 217 LYS A CA     1 
ATOM   1563  C C      . LYS A  1 224 ? -48.018  30.720  39.514  1.00 47.81  ? 217 LYS A C      1 
ATOM   1564  O O      . LYS A  1 224 ? -46.820  30.995  39.637  1.00 44.94  ? 217 LYS A O      1 
ATOM   1565  C CB     . LYS A  1 224 ? -49.156  32.913  39.857  1.00 55.35  ? 217 LYS A CB     1 
ATOM   1566  C CG     . LYS A  1 224 ? -50.146  33.955  39.363  1.00 60.51  ? 217 LYS A CG     1 
ATOM   1567  C CD     . LYS A  1 224 ? -49.677  34.559  38.046  1.00 65.34  ? 217 LYS A CD     1 
ATOM   1568  C CE     . LYS A  1 224 ? -50.688  35.546  37.486  1.00 70.25  ? 217 LYS A CE     1 
ATOM   1569  N NZ     . LYS A  1 224 ? -51.914  34.865  36.967  1.00 71.84  ? 217 LYS A NZ     1 
ATOM   1570  N N      . LEU A  1 225 ? -48.525  29.552  39.892  1.00 44.59  ? 218 LEU A N      1 
ATOM   1571  C CA     . LEU A  1 225 ? -47.752  28.540  40.597  1.00 41.85  ? 218 LEU A CA     1 
ATOM   1572  C C      . LEU A  1 225 ? -47.551  27.330  39.698  1.00 43.73  ? 218 LEU A C      1 
ATOM   1573  O O      . LEU A  1 225 ? -48.498  26.861  39.055  1.00 48.52  ? 218 LEU A O      1 
ATOM   1574  C CB     . LEU A  1 225 ? -48.457  28.129  41.892  1.00 40.69  ? 218 LEU A CB     1 
ATOM   1575  C CG     . LEU A  1 225 ? -47.768  27.127  42.819  1.00 40.33  ? 218 LEU A CG     1 
ATOM   1576  C CD1    . LEU A  1 225 ? -46.418  27.649  43.296  1.00 37.84  ? 218 LEU A CD1    1 
ATOM   1577  C CD2    . LEU A  1 225 ? -48.670  26.800  44.000  1.00 39.11  ? 218 LEU A CD2    1 
ATOM   1578  N N      . ALA A  1 226 ? -46.320  26.831  39.657  1.00 41.70  ? 219 ALA A N      1 
ATOM   1579  C CA     . ALA A  1 226 ? -45.975  25.639  38.902  1.00 38.60  ? 219 ALA A CA     1 
ATOM   1580  C C      . ALA A  1 226 ? -45.303  24.628  39.820  1.00 41.21  ? 219 ALA A C      1 
ATOM   1581  O O      . ALA A  1 226 ? -44.623  24.994  40.783  1.00 44.54  ? 219 ALA A O      1 
ATOM   1582  C CB     . ALA A  1 226 ? -45.051  25.977  37.725  1.00 33.40  ? 219 ALA A CB     1 
ATOM   1583  N N      . VAL A  1 227 ? -45.500  23.351  39.511  1.00 37.28  ? 220 VAL A N      1 
ATOM   1584  C CA     . VAL A  1 227 ? -44.846  22.251  40.210  1.00 38.24  ? 220 VAL A CA     1 
ATOM   1585  C C      . VAL A  1 227 ? -43.919  21.576  39.211  1.00 41.41  ? 220 VAL A C      1 
ATOM   1586  O O      . VAL A  1 227 ? -44.378  20.937  38.256  1.00 42.73  ? 220 VAL A O      1 
ATOM   1587  C CB     . VAL A  1 227 ? -45.859  21.257  40.792  1.00 30.77  ? 220 VAL A CB     1 
ATOM   1588  C CG1    . VAL A  1 227 ? -45.142  20.035  41.356  1.00 28.05  ? 220 VAL A CG1    1 
ATOM   1589  C CG2    . VAL A  1 227 ? -46.713  21.932  41.860  1.00 31.21  ? 220 VAL A CG2    1 
ATOM   1590  N N      . LEU A  1 228 ? -42.615  21.709  39.430  1.00 37.09  ? 221 LEU A N      1 
ATOM   1591  C CA     . LEU A  1 228 ? -41.614  21.170  38.522  1.00 37.67  ? 221 LEU A CA     1 
ATOM   1592  C C      . LEU A  1 228 ? -41.055  19.884  39.112  1.00 41.72  ? 221 LEU A C      1 
ATOM   1593  O O      . LEU A  1 228 ? -40.456  19.899  40.193  1.00 41.61  ? 221 LEU A O      1 
ATOM   1594  C CB     . LEU A  1 228 ? -40.490  22.177  38.278  1.00 37.97  ? 221 LEU A CB     1 
ATOM   1595  C CG     . LEU A  1 228 ? -39.426  21.746  37.267  1.00 37.95  ? 221 LEU A CG     1 
ATOM   1596  C CD1    . LEU A  1 228 ? -40.073  21.469  35.917  1.00 39.57  ? 221 LEU A CD1    1 
ATOM   1597  C CD2    . LEU A  1 228 ? -38.344  22.801  37.131  1.00 35.71  ? 221 LEU A CD2    1 
ATOM   1598  N N      . ILE A  1 229 ? -41.246  18.780  38.402  1.00 42.02  ? 222 ILE A N      1 
ATOM   1599  C CA     . ILE A  1 229 ? -40.724  17.483  38.805  1.00 38.69  ? 222 ILE A CA     1 
ATOM   1600  C C      . ILE A  1 229 ? -39.501  17.191  37.951  1.00 40.22  ? 222 ILE A C      1 
ATOM   1601  O O      . ILE A  1 229 ? -39.569  17.261  36.717  1.00 41.06  ? 222 ILE A O      1 
ATOM   1602  C CB     . ILE A  1 229 ? -41.790  16.387  38.647  1.00 37.80  ? 222 ILE A CB     1 
ATOM   1603  C CG1    . ILE A  1 229 ? -43.048  16.761  39.431  1.00 41.62  ? 222 ILE A CG1    1 
ATOM   1604  C CG2    . ILE A  1 229 ? -41.252  15.046  39.120  1.00 35.34  ? 222 ILE A CG2    1 
ATOM   1605  C CD1    . ILE A  1 229 ? -44.164  15.765  39.284  1.00 41.88  ? 222 ILE A CD1    1 
ATOM   1606  N N      . THR A  1 230 ? -38.383  16.868  38.596  1.00 42.79  ? 223 THR A N      1 
ATOM   1607  C CA     . THR A  1 230 ? -37.130  16.601  37.898  1.00 45.46  ? 223 THR A CA     1 
ATOM   1608  C C      . THR A  1 230 ? -36.688  15.175  38.186  1.00 48.14  ? 223 THR A C      1 
ATOM   1609  O O      . THR A  1 230 ? -36.414  14.826  39.339  1.00 49.07  ? 223 THR A O      1 
ATOM   1610  C CB     . THR A  1 230 ? -36.037  17.590  38.311  1.00 46.73  ? 223 THR A CB     1 
ATOM   1611  O OG1    . THR A  1 230 ? -36.447  18.924  37.987  1.00 46.55  ? 223 THR A OG1    1 
ATOM   1612  C CG2    . THR A  1 230 ? -34.734  17.275  37.588  1.00 50.31  ? 223 THR A CG2    1 
ATOM   1613  N N      . ASN A  1 231 ? -36.616  14.358  37.138  1.00 49.95  ? 224 ASN A N      1 
ATOM   1614  C CA     . ASN A  1 231 ? -36.165  12.978  37.253  1.00 51.04  ? 224 ASN A CA     1 
ATOM   1615  C C      . ASN A  1 231 ? -34.653  12.938  37.066  1.00 55.52  ? 224 ASN A C      1 
ATOM   1616  O O      . ASN A  1 231 ? -34.144  13.303  36.000  1.00 58.32  ? 224 ASN A O      1 
ATOM   1617  C CB     . ASN A  1 231 ? -36.868  12.101  36.216  1.00 52.82  ? 224 ASN A CB     1 
ATOM   1618  C CG     . ASN A  1 231 ? -36.563  10.625  36.391  1.00 54.26  ? 224 ASN A CG     1 
ATOM   1619  O OD1    . ASN A  1 231 ? -35.610  10.251  37.076  1.00 55.89  ? 224 ASN A OD1    1 
ATOM   1620  N ND2    . ASN A  1 231 ? -37.372  9.776   35.763  1.00 53.24  ? 224 ASN A ND2    1 
ATOM   1621  N N      . SER A  1 232 ? -33.938  12.500  38.104  1.00 54.92  ? 225 SER A N      1 
ATOM   1622  C CA     . SER A  1 232 ? -32.491  12.342  38.022  1.00 55.30  ? 225 SER A CA     1 
ATOM   1623  C C      . SER A  1 232 ? -32.077  11.189  37.120  1.00 57.68  ? 225 SER A C      1 
ATOM   1624  O O      . SER A  1 232 ? -30.899  11.101  36.757  1.00 60.73  ? 225 SER A O      1 
ATOM   1625  C CB     . SER A  1 232 ? -31.902  12.144  39.420  1.00 55.90  ? 225 SER A CB     1 
ATOM   1626  O OG     . SER A  1 232 ? -32.314  10.910  39.978  1.00 57.14  ? 225 SER A OG     1 
ATOM   1627  N N      . ASN A  1 233 ? -33.012  10.317  36.745  1.00 60.95  ? 226 ASN A N      1 
ATOM   1628  C CA     . ASN A  1 233 ? -32.706  9.115   35.973  1.00 64.23  ? 226 ASN A CA     1 
ATOM   1629  C C      . ASN A  1 233 ? -31.666  8.256   36.692  1.00 66.36  ? 226 ASN A C      1 
ATOM   1630  O O      . ASN A  1 233 ? -30.634  7.882   36.133  1.00 66.76  ? 226 ASN A O      1 
ATOM   1631  C CB     . ASN A  1 233 ? -32.245  9.470   34.557  1.00 64.86  ? 226 ASN A CB     1 
ATOM   1632  C CG     . ASN A  1 233 ? -33.358  10.065  33.714  1.00 67.24  ? 226 ASN A CG     1 
ATOM   1633  O OD1    . ASN A  1 233 ? -34.310  9.373   33.344  1.00 65.96  ? 226 ASN A OD1    1 
ATOM   1634  N ND2    . ASN A  1 233 ? -33.242  11.354  33.401  1.00 68.73  ? 226 ASN A ND2    1 
ATOM   1635  N N      . VAL A  1 234 ? -31.954  7.948   37.954  1.00 69.95  ? 227 VAL A N      1 
ATOM   1636  C CA     . VAL A  1 234 ? -31.149  7.016   38.734  1.00 76.33  ? 227 VAL A CA     1 
ATOM   1637  C C      . VAL A  1 234 ? -32.074  6.064   39.480  1.00 79.33  ? 227 VAL A C      1 
ATOM   1638  O O      . VAL A  1 234 ? -33.216  6.410   39.781  1.00 79.30  ? 227 VAL A O      1 
ATOM   1639  C CB     . VAL A  1 234 ? -30.213  7.747   39.714  1.00 79.93  ? 227 VAL A CB     1 
ATOM   1640  C CG1    . VAL A  1 234 ? -29.539  6.749   40.645  1.00 82.17  ? 227 VAL A CG1    1 
ATOM   1641  C CG2    . VAL A  1 234 ? -29.168  8.542   38.953  1.00 80.97  ? 227 VAL A CG2    1 
ATOM   1642  N N      . SER A  1 241 ? -33.162  -2.717  48.721  1.00 73.49  ? 234 SER A N      1 
ATOM   1643  C CA     . SER A  1 241 ? -32.898  -1.324  49.061  1.00 73.26  ? 234 SER A CA     1 
ATOM   1644  C C      . SER A  1 241 ? -32.696  -1.126  50.560  1.00 75.10  ? 234 SER A C      1 
ATOM   1645  O O      . SER A  1 241 ? -32.615  -2.086  51.327  1.00 77.80  ? 234 SER A O      1 
ATOM   1646  C CB     . SER A  1 241 ? -34.039  -0.428  48.573  1.00 73.17  ? 234 SER A CB     1 
ATOM   1647  O OG     . SER A  1 241 ? -34.025  -0.305  47.162  1.00 73.00  ? 234 SER A OG     1 
ATOM   1648  N N      . GLU A  1 242 ? -32.620  0.139   50.966  1.00 71.81  ? 235 GLU A N      1 
ATOM   1649  C CA     . GLU A  1 242 ? -32.449  0.520   52.360  1.00 71.74  ? 235 GLU A CA     1 
ATOM   1650  C C      . GLU A  1 242 ? -33.765  0.878   53.040  1.00 68.89  ? 235 GLU A C      1 
ATOM   1651  O O      . GLU A  1 242 ? -33.801  0.999   54.270  1.00 69.29  ? 235 GLU A O      1 
ATOM   1652  C CB     . GLU A  1 242 ? -31.473  1.698   52.463  1.00 71.99  ? 235 GLU A CB     1 
ATOM   1653  C CG     . GLU A  1 242 ? -30.723  1.778   53.777  1.00 75.47  ? 235 GLU A CG     1 
ATOM   1654  C CD     . GLU A  1 242 ? -29.438  0.967   53.764  1.00 78.76  ? 235 GLU A CD     1 
ATOM   1655  O OE1    . GLU A  1 242 ? -28.705  1.025   52.753  1.00 79.50  ? 235 GLU A OE1    1 
ATOM   1656  O OE2    . GLU A  1 242 ? -29.158  0.279   54.767  1.00 79.70  ? 235 GLU A OE2    1 
ATOM   1657  N N      . TYR A  1 243 ? -34.834  1.058   52.264  1.00 64.52  ? 236 TYR A N      1 
ATOM   1658  C CA     . TYR A  1 243 ? -36.160  1.382   52.792  1.00 60.84  ? 236 TYR A CA     1 
ATOM   1659  C C      . TYR A  1 243 ? -36.616  0.486   53.936  1.00 61.21  ? 236 TYR A C      1 
ATOM   1660  O O      . TYR A  1 243 ? -36.994  1.019   54.992  1.00 60.11  ? 236 TYR A O      1 
ATOM   1661  C CB     . TYR A  1 243 ? -37.167  1.308   51.635  1.00 58.62  ? 236 TYR A CB     1 
ATOM   1662  C CG     . TYR A  1 243 ? -38.573  1.768   51.963  1.00 58.14  ? 236 TYR A CG     1 
ATOM   1663  C CD1    . TYR A  1 243 ? -39.450  0.954   52.673  1.00 59.29  ? 236 TYR A CD1    1 
ATOM   1664  C CD2    . TYR A  1 243 ? -39.038  3.003   51.525  1.00 56.59  ? 236 TYR A CD2    1 
ATOM   1665  C CE1    . TYR A  1 243 ? -40.736  1.370   52.964  1.00 56.99  ? 236 TYR A CE1    1 
ATOM   1666  C CE2    . TYR A  1 243 ? -40.326  3.424   51.809  1.00 56.88  ? 236 TYR A CE2    1 
ATOM   1667  C CZ     . TYR A  1 243 ? -41.170  2.601   52.527  1.00 57.41  ? 236 TYR A CZ     1 
ATOM   1668  O OH     . TYR A  1 243 ? -42.456  3.002   52.820  1.00 56.24  ? 236 TYR A OH     1 
ATOM   1669  N N      . PRO A  1 244 ? -36.618  -0.842  53.809  1.00 63.19  ? 237 PRO A N      1 
ATOM   1670  C CA     . PRO A  1 244 ? -37.060  -1.684  54.935  1.00 64.42  ? 237 PRO A CA     1 
ATOM   1671  C C      . PRO A  1 244 ? -36.230  -1.508  56.193  1.00 68.77  ? 237 PRO A C      1 
ATOM   1672  O O      . PRO A  1 244 ? -36.726  -1.801  57.288  1.00 71.82  ? 237 PRO A O      1 
ATOM   1673  C CB     . PRO A  1 244 ? -36.941  -3.110  54.376  1.00 64.33  ? 237 PRO A CB     1 
ATOM   1674  C CG     . PRO A  1 244 ? -35.965  -2.997  53.243  1.00 64.01  ? 237 PRO A CG     1 
ATOM   1675  C CD     . PRO A  1 244 ? -36.181  -1.639  52.653  1.00 62.97  ? 237 PRO A CD     1 
ATOM   1676  N N      . VAL A  1 245 ? -34.989  -1.032  56.077  1.00 69.19  ? 238 VAL A N      1 
ATOM   1677  C CA     . VAL A  1 245 ? -34.173  -0.801  57.264  1.00 70.41  ? 238 VAL A CA     1 
ATOM   1678  C C      . VAL A  1 245 ? -34.677  0.418   58.028  1.00 70.60  ? 238 VAL A C      1 
ATOM   1679  O O      . VAL A  1 245 ? -34.726  0.415   59.265  1.00 72.86  ? 238 VAL A O      1 
ATOM   1680  C CB     . VAL A  1 245 ? -32.691  -0.654  56.872  1.00 67.47  ? 238 VAL A CB     1 
ATOM   1681  C CG1    . VAL A  1 245 ? -31.844  -0.353  58.097  1.00 64.19  ? 238 VAL A CG1    1 
ATOM   1682  C CG2    . VAL A  1 245 ? -32.201  -1.912  56.175  1.00 67.31  ? 238 VAL A CG2    1 
ATOM   1683  N N      . ARG A  1 246 ? -35.049  1.481   57.308  1.00 66.62  ? 239 ARG A N      1 
ATOM   1684  C CA     . ARG A  1 246 ? -35.596  2.669   57.959  1.00 66.01  ? 239 ARG A CA     1 
ATOM   1685  C C      . ARG A  1 246 ? -36.885  2.355   58.710  1.00 68.41  ? 239 ARG A C      1 
ATOM   1686  O O      . ARG A  1 246 ? -37.069  2.803   59.848  1.00 69.87  ? 239 ARG A O      1 
ATOM   1687  C CB     . ARG A  1 246 ? -35.840  3.765   56.923  1.00 61.20  ? 239 ARG A CB     1 
ATOM   1688  C CG     . ARG A  1 246 ? -34.596  4.219   56.183  1.00 56.84  ? 239 ARG A CG     1 
ATOM   1689  C CD     . ARG A  1 246 ? -33.563  4.816   57.128  1.00 54.65  ? 239 ARG A CD     1 
ATOM   1690  N NE     . ARG A  1 246 ? -32.395  5.331   56.414  1.00 52.79  ? 239 ARG A NE     1 
ATOM   1691  C CZ     . ARG A  1 246 ? -31.365  4.583   56.030  1.00 55.38  ? 239 ARG A CZ     1 
ATOM   1692  N NH1    . ARG A  1 246 ? -31.352  3.284   56.298  1.00 51.66  ? 239 ARG A NH1    1 
ATOM   1693  N NH2    . ARG A  1 246 ? -30.345  5.133   55.382  1.00 55.35  ? 239 ARG A NH2    1 
ATOM   1694  N N      . ARG A  1 247 ? -37.792  1.591   58.091  1.00 70.97  ? 240 ARG A N      1 
ATOM   1695  C CA     . ARG A  1 247 ? -39.025  1.212   58.777  1.00 75.50  ? 240 ARG A CA     1 
ATOM   1696  C C      . ARG A  1 247 ? -38.731  0.429   60.048  1.00 81.04  ? 240 ARG A C      1 
ATOM   1697  O O      . ARG A  1 247 ? -39.386  0.632   61.077  1.00 85.77  ? 240 ARG A O      1 
ATOM   1698  C CB     . ARG A  1 247 ? -39.927  0.386   57.856  1.00 77.16  ? 240 ARG A CB     1 
ATOM   1699  C CG     . ARG A  1 247 ? -41.357  0.232   58.389  1.00 76.26  ? 240 ARG A CG     1 
ATOM   1700  C CD     . ARG A  1 247 ? -42.298  -0.393  57.364  1.00 75.01  ? 240 ARG A CD     1 
ATOM   1701  N NE     . ARG A  1 247 ? -43.704  -0.307  57.764  1.00 78.60  ? 240 ARG A NE     1 
ATOM   1702  C CZ     . ARG A  1 247 ? -44.728  -0.621  56.975  1.00 81.38  ? 240 ARG A CZ     1 
ATOM   1703  N NH1    . ARG A  1 247 ? -44.509  -1.038  55.736  1.00 82.14  ? 240 ARG A NH1    1 
ATOM   1704  N NH2    . ARG A  1 247 ? -45.975  -0.502  57.414  1.00 82.74  ? 240 ARG A NH2    1 
ATOM   1705  N N      . ARG A  1 248 ? -37.743  -0.467  60.002  1.00 79.58  ? 241 ARG A N      1 
ATOM   1706  C CA     . ARG A  1 248 ? -37.410  -1.249  61.187  1.00 79.52  ? 241 ARG A CA     1 
ATOM   1707  C C      . ARG A  1 248 ? -36.879  -0.355  62.301  1.00 77.55  ? 241 ARG A C      1 
ATOM   1708  O O      . ARG A  1 248 ? -37.275  -0.500  63.463  1.00 79.36  ? 241 ARG A O      1 
ATOM   1709  C CB     . ARG A  1 248 ? -36.396  -2.339  60.831  1.00 84.26  ? 241 ARG A CB     1 
ATOM   1710  C CG     . ARG A  1 248 ? -36.957  -3.428  59.927  1.00 87.48  ? 241 ARG A CG     1 
ATOM   1711  C CD     . ARG A  1 248 ? -36.086  -4.676  59.926  1.00 91.70  ? 241 ARG A CD     1 
ATOM   1712  N NE     . ARG A  1 248 ? -34.876  -4.515  59.126  1.00 92.65  ? 241 ARG A NE     1 
ATOM   1713  C CZ     . ARG A  1 248 ? -34.789  -4.824  57.835  1.00 91.19  ? 241 ARG A CZ     1 
ATOM   1714  N NH1    . ARG A  1 248 ? -35.845  -5.309  57.195  1.00 87.70  ? 241 ARG A NH1    1 
ATOM   1715  N NH2    . ARG A  1 248 ? -33.646  -4.650  57.185  1.00 91.88  ? 241 ARG A NH2    1 
ATOM   1716  N N      . GLN A  1 249 ? -35.997  0.585   61.961  1.00 74.48  ? 242 GLN A N      1 
ATOM   1717  C CA     . GLN A  1 249 ? -35.450  1.488   62.968  1.00 74.13  ? 242 GLN A CA     1 
ATOM   1718  C C      . GLN A  1 249 ? -36.556  2.291   63.648  1.00 71.31  ? 242 GLN A C      1 
ATOM   1719  O O      . GLN A  1 249 ? -36.580  2.414   64.878  1.00 73.47  ? 242 GLN A O      1 
ATOM   1720  C CB     . GLN A  1 249 ? -34.409  2.407   62.330  1.00 74.78  ? 242 GLN A CB     1 
ATOM   1721  C CG     . GLN A  1 249 ? -33.141  1.678   61.900  1.00 77.67  ? 242 GLN A CG     1 
ATOM   1722  C CD     . GLN A  1 249 ? -32.262  2.504   60.979  1.00 79.03  ? 242 GLN A CD     1 
ATOM   1723  O OE1    . GLN A  1 249 ? -32.250  3.732   61.054  1.00 78.29  ? 242 GLN A OE1    1 
ATOM   1724  N NE2    . GLN A  1 249 ? -31.515  1.832   60.110  1.00 79.93  ? 242 GLN A NE2    1 
ATOM   1725  N N      . CYS A  1 250 ? -37.483  2.848   62.862  1.00 67.12  ? 243 CYS A N      1 
ATOM   1726  C CA     . CYS A  1 250 ? -38.583  3.602   63.454  1.00 65.57  ? 243 CYS A CA     1 
ATOM   1727  C C      . CYS A  1 250 ? -39.348  2.744   64.457  1.00 67.59  ? 243 CYS A C      1 
ATOM   1728  O O      . CYS A  1 250 ? -39.676  3.203   65.558  1.00 67.52  ? 243 CYS A O      1 
ATOM   1729  C CB     . CYS A  1 250 ? -39.510  4.131   62.355  1.00 64.36  ? 243 CYS A CB     1 
ATOM   1730  S SG     . CYS A  1 250 ? -38.787  5.450   61.347  1.00 63.13  ? 243 CYS A SG     1 
ATOM   1731  N N      . GLU A  1 251 ? -39.628  1.486   64.101  1.00 70.62  ? 244 GLU A N      1 
ATOM   1732  C CA     . GLU A  1 251 ? -40.280  0.578   65.041  1.00 76.08  ? 244 GLU A CA     1 
ATOM   1733  C C      . GLU A  1 251 ? -39.397  0.340   66.259  1.00 80.35  ? 244 GLU A C      1 
ATOM   1734  O O      . GLU A  1 251 ? -39.887  0.297   67.397  1.00 81.00  ? 244 GLU A O      1 
ATOM   1735  C CB     . GLU A  1 251 ? -40.623  -0.734  64.340  1.00 77.67  ? 244 GLU A CB     1 
ATOM   1736  C CG     . GLU A  1 251 ? -41.766  -0.605  63.366  1.00 76.68  ? 244 GLU A CG     1 
ATOM   1737  C CD     . GLU A  1 251 ? -41.548  -1.435  62.127  1.00 78.41  ? 244 GLU A CD     1 
ATOM   1738  O OE1    . GLU A  1 251 ? -40.475  -2.066  62.026  1.00 81.17  ? 244 GLU A OE1    1 
ATOM   1739  O OE2    . GLU A  1 251 ? -42.444  -1.452  61.257  1.00 77.08  ? 244 GLU A OE2    1 
ATOM   1740  N N      . GLU A  1 252 ? -38.084  0.205   66.030  1.00 87.22  ? 245 GLU A N      1 
ATOM   1741  C CA     . GLU A  1 252 ? -37.136  0.003   67.118  1.00 90.27  ? 245 GLU A CA     1 
ATOM   1742  C C      . GLU A  1 252 ? -37.149  1.187   68.072  1.00 85.62  ? 245 GLU A C      1 
ATOM   1743  O O      . GLU A  1 252 ? -37.118  1.004   69.294  1.00 87.85  ? 245 GLU A O      1 
ATOM   1744  C CB     . GLU A  1 252 ? -35.727  -0.204  66.548  1.00 98.77  ? 245 GLU A CB     1 
ATOM   1745  C CG     . GLU A  1 252 ? -35.599  -1.384  65.589  1.00 106.04 ? 245 GLU A CG     1 
ATOM   1746  C CD     . GLU A  1 252 ? -34.210  -1.534  64.969  1.00 111.70 ? 245 GLU A CD     1 
ATOM   1747  O OE1    . GLU A  1 252 ? -33.394  -0.591  65.055  1.00 112.28 ? 245 GLU A OE1    1 
ATOM   1748  O OE2    . GLU A  1 252 ? -33.941  -2.610  64.389  1.00 115.32 ? 245 GLU A OE2    1 
ATOM   1749  N N      . VAL A  1 253 ? -37.181  2.412   67.531  1.00 74.33  ? 246 VAL A N      1 
ATOM   1750  C CA     . VAL A  1 253 ? -37.198  3.597   68.383  1.00 68.67  ? 246 VAL A CA     1 
ATOM   1751  C C      . VAL A  1 253 ? -38.545  3.736   69.096  1.00 68.07  ? 246 VAL A C      1 
ATOM   1752  O O      . VAL A  1 253 ? -38.600  4.154   70.257  1.00 74.01  ? 246 VAL A O      1 
ATOM   1753  C CB     . VAL A  1 253 ? -36.860  4.871   67.572  1.00 61.03  ? 246 VAL A CB     1 
ATOM   1754  C CG1    . VAL A  1 253 ? -37.031  6.131   68.445  1.00 56.36  ? 246 VAL A CG1    1 
ATOM   1755  C CG2    . VAL A  1 253 ? -35.455  4.820   66.995  1.00 58.22  ? 246 VAL A CG2    1 
ATOM   1756  N N      . ALA A  1 254 ? -39.653  3.396   68.422  1.00 60.18  ? 247 ALA A N      1 
ATOM   1757  C CA     . ALA A  1 254 ? -40.968  3.591   69.039  1.00 58.15  ? 247 ALA A CA     1 
ATOM   1758  C C      . ALA A  1 254 ? -41.170  2.699   70.261  1.00 61.01  ? 247 ALA A C      1 
ATOM   1759  O O      . ALA A  1 254 ? -41.692  3.156   71.283  1.00 61.82  ? 247 ALA A O      1 
ATOM   1760  C CB     . ALA A  1 254 ? -42.078  3.347   68.018  1.00 62.45  ? 247 ALA A CB     1 
ATOM   1761  N N      . ARG A  1 255 ? -40.789  1.421   70.176  1.00 65.46  ? 248 ARG A N      1 
ATOM   1762  C CA     . ARG A  1 255 ? -40.864  0.561   71.354  1.00 69.75  ? 248 ARG A CA     1 
ATOM   1763  C C      . ARG A  1 255 ? -39.947  1.073   72.456  1.00 68.80  ? 248 ARG A C      1 
ATOM   1764  O O      . ARG A  1 255 ? -40.333  1.107   73.630  1.00 71.97  ? 248 ARG A O      1 
ATOM   1765  C CB     . ARG A  1 255 ? -40.532  -0.886  70.989  1.00 72.96  ? 248 ARG A CB     1 
ATOM   1766  C CG     . ARG A  1 255 ? -39.377  -1.060  70.020  1.00 75.33  ? 248 ARG A CG     1 
ATOM   1767  C CD     . ARG A  1 255 ? -39.166  -2.534  69.707  1.00 77.64  ? 248 ARG A CD     1 
ATOM   1768  N NE     . ARG A  1 255 ? -40.397  -3.182  69.260  1.00 78.19  ? 248 ARG A NE     1 
ATOM   1769  N N      . ALA A  1 256 ? -38.723  1.469   72.095  1.00 67.19  ? 249 ALA A N      1 
ATOM   1770  C CA     . ALA A  1 256 ? -37.787  1.982   73.088  1.00 73.04  ? 249 ALA A CA     1 
ATOM   1771  C C      . ALA A  1 256 ? -38.407  3.119   73.892  1.00 76.49  ? 249 ALA A C      1 
ATOM   1772  O O      . ALA A  1 256 ? -38.149  3.253   75.094  1.00 82.90  ? 249 ALA A O      1 
ATOM   1773  C CB     . ALA A  1 256 ? -36.498  2.442   72.405  1.00 71.54  ? 249 ALA A CB     1 
ATOM   1774  N N      . LEU A  1 257 ? -39.221  3.951   73.246  1.00 59.82  ? 250 LEU A N      1 
ATOM   1775  C CA     . LEU A  1 257 ? -39.920  5.032   73.929  1.00 61.31  ? 250 LEU A CA     1 
ATOM   1776  C C      . LEU A  1 257 ? -41.303  4.617   74.420  1.00 57.75  ? 250 LEU A C      1 
ATOM   1777  O O      . LEU A  1 257 ? -42.029  5.454   74.965  1.00 56.89  ? 250 LEU A O      1 
ATOM   1778  C CB     . LEU A  1 257 ? -40.029  6.252   73.007  1.00 63.85  ? 250 LEU A CB     1 
ATOM   1779  C CG     . LEU A  1 257 ? -40.131  7.621   73.684  1.00 65.93  ? 250 LEU A CG     1 
ATOM   1780  C CD1    . LEU A  1 257 ? -39.465  8.676   72.818  1.00 63.57  ? 250 LEU A CD1    1 
ATOM   1781  C CD2    . LEU A  1 257 ? -41.581  7.995   73.950  1.00 66.22  ? 250 LEU A CD2    1 
ATOM   1782  N N      . GLY A  1 258 ? -41.672  3.350   74.260  1.00 58.16  ? 251 GLY A N      1 
ATOM   1783  C CA     . GLY A  1 258 ? -42.977  2.873   74.700  1.00 59.06  ? 251 GLY A CA     1 
ATOM   1784  C C      . GLY A  1 258 ? -44.164  3.504   74.004  1.00 61.69  ? 251 GLY A C      1 
ATOM   1785  O O      . GLY A  1 258 ? -45.196  3.752   74.642  1.00 64.71  ? 251 GLY A O      1 
ATOM   1786  N N      . ALA A  1 259 ? -44.044  3.771   72.706  1.00 62.59  ? 252 ALA A N      1 
ATOM   1787  C CA     . ALA A  1 259 ? -45.108  4.370   71.915  1.00 63.93  ? 252 ALA A CA     1 
ATOM   1788  C C      . ALA A  1 259 ? -45.525  3.417   70.801  1.00 63.80  ? 252 ALA A C      1 
ATOM   1789  O O      . ALA A  1 259 ? -44.754  2.557   70.367  1.00 66.71  ? 252 ALA A O      1 
ATOM   1790  C CB     . ALA A  1 259 ? -44.674  5.717   71.321  1.00 62.85  ? 252 ALA A CB     1 
ATOM   1791  N N      . ALA A  1 260 ? -46.768  3.575   70.341  1.00 62.28  ? 253 ALA A N      1 
ATOM   1792  C CA     . ALA A  1 260 ? -47.256  2.734   69.252  1.00 61.33  ? 253 ALA A CA     1 
ATOM   1793  C C      . ALA A  1 260 ? -46.571  3.085   67.938  1.00 59.43  ? 253 ALA A C      1 
ATOM   1794  O O      . ALA A  1 260 ? -46.271  2.199   67.128  1.00 58.28  ? 253 ALA A O      1 
ATOM   1795  C CB     . ALA A  1 260 ? -48.772  2.871   69.119  1.00 61.38  ? 253 ALA A CB     1 
ATOM   1796  N N      . SER A  1 261 ? -46.326  4.373   67.706  1.00 56.84  ? 254 SER A N      1 
ATOM   1797  C CA     . SER A  1 261 ? -45.618  4.838   66.524  1.00 52.60  ? 254 SER A CA     1 
ATOM   1798  C C      . SER A  1 261 ? -44.965  6.176   66.846  1.00 49.76  ? 254 SER A C      1 
ATOM   1799  O O      . SER A  1 261 ? -45.261  6.808   67.863  1.00 49.03  ? 254 SER A O      1 
ATOM   1800  C CB     . SER A  1 261 ? -46.554  4.954   65.316  1.00 48.96  ? 254 SER A CB     1 
ATOM   1801  O OG     . SER A  1 261 ? -47.516  5.974   65.513  1.00 47.51  ? 254 SER A OG     1 
ATOM   1802  N N      . LEU A  1 262 ? -44.059  6.602   65.964  1.00 48.43  ? 255 LEU A N      1 
ATOM   1803  C CA     . LEU A  1 262 ? -43.369  7.877   66.137  1.00 50.55  ? 255 LEU A CA     1 
ATOM   1804  C C      . LEU A  1 262 ? -44.294  9.087   66.122  1.00 52.07  ? 255 LEU A C      1 
ATOM   1805  O O      . LEU A  1 262 ? -43.845  10.183  66.470  1.00 55.21  ? 255 LEU A O      1 
ATOM   1806  C CB     . LEU A  1 262 ? -42.303  8.057   65.055  1.00 48.90  ? 255 LEU A CB     1 
ATOM   1807  C CG     . LEU A  1 262 ? -40.979  7.316   65.245  1.00 54.06  ? 255 LEU A CG     1 
ATOM   1808  C CD1    . LEU A  1 262 ? -40.420  7.608   66.632  1.00 55.78  ? 255 LEU A CD1    1 
ATOM   1809  C CD2    . LEU A  1 262 ? -41.144  5.821   65.033  1.00 58.02  ? 255 LEU A CD2    1 
ATOM   1810  N N      . ARG A  1 263 ? -45.560  8.936   65.733  1.00 53.39  ? 256 ARG A N      1 
ATOM   1811  C CA     . ARG A  1 263 ? -46.437  10.102  65.707  1.00 55.36  ? 256 ARG A CA     1 
ATOM   1812  C C      . ARG A  1 263 ? -46.752  10.647  67.097  1.00 56.43  ? 256 ARG A C      1 
ATOM   1813  O O      . ARG A  1 263 ? -47.022  11.845  67.238  1.00 57.78  ? 256 ARG A O      1 
ATOM   1814  C CB     . ARG A  1 263 ? -47.741  9.772   64.992  1.00 57.33  ? 256 ARG A CB     1 
ATOM   1815  C CG     . ARG A  1 263 ? -48.753  10.885  65.128  1.00 58.93  ? 256 ARG A CG     1 
ATOM   1816  C CD     . ARG A  1 263 ? -49.483  11.139  63.837  1.00 58.58  ? 256 ARG A CD     1 
ATOM   1817  N NE     . ARG A  1 263 ? -50.262  12.368  63.908  1.00 59.81  ? 256 ARG A NE     1 
ATOM   1818  C CZ     . ARG A  1 263 ? -51.329  12.624  63.161  1.00 60.30  ? 256 ARG A CZ     1 
ATOM   1819  N NH1    . ARG A  1 263 ? -51.759  11.736  62.278  1.00 59.70  ? 256 ARG A NH1    1 
ATOM   1820  N NH2    . ARG A  1 263 ? -51.969  13.775  63.302  1.00 63.44  ? 256 ARG A NH2    1 
ATOM   1821  N N      . GLU A  1 264 ? -46.733  9.807   68.128  1.00 61.11  ? 257 GLU A N      1 
ATOM   1822  C CA     . GLU A  1 264 ? -47.072  10.243  69.481  1.00 66.54  ? 257 GLU A CA     1 
ATOM   1823  C C      . GLU A  1 264 ? -45.911  10.891  70.234  1.00 67.26  ? 257 GLU A C      1 
ATOM   1824  O O      . GLU A  1 264 ? -46.057  11.169  71.431  1.00 68.86  ? 257 GLU A O      1 
ATOM   1825  C CB     . GLU A  1 264 ? -47.626  9.071   70.295  1.00 74.63  ? 257 GLU A CB     1 
ATOM   1826  C CG     . GLU A  1 264 ? -47.106  7.708   69.880  1.00 80.25  ? 257 GLU A CG     1 
ATOM   1827  C CD     . GLU A  1 264 ? -48.209  6.808   69.364  1.00 83.31  ? 257 GLU A CD     1 
ATOM   1828  O OE1    . GLU A  1 264 ? -48.487  5.774   70.007  1.00 86.34  ? 257 GLU A OE1    1 
ATOM   1829  O OE2    . GLU A  1 264 ? -48.807  7.142   68.319  1.00 82.89  ? 257 GLU A OE2    1 
ATOM   1830  N N      . VAL A  1 265 ? -44.781  11.137  69.574  1.00 64.82  ? 258 VAL A N      1 
ATOM   1831  C CA     . VAL A  1 265 ? -43.574  11.649  70.213  1.00 67.72  ? 258 VAL A CA     1 
ATOM   1832  C C      . VAL A  1 265 ? -43.299  13.053  69.693  1.00 66.61  ? 258 VAL A C      1 
ATOM   1833  O O      . VAL A  1 265 ? -43.384  13.307  68.486  1.00 67.93  ? 258 VAL A O      1 
ATOM   1834  C CB     . VAL A  1 265 ? -42.370  10.724  69.952  1.00 66.91  ? 258 VAL A CB     1 
ATOM   1835  C CG1    . VAL A  1 265 ? -41.147  11.187  70.731  1.00 49.38  ? 258 VAL A CG1    1 
ATOM   1836  C CG2    . VAL A  1 265 ? -42.723  9.277   70.295  1.00 47.35  ? 258 VAL A CG2    1 
ATOM   1837  N N      . GLN A  1 266 ? -42.976  13.960  70.604  1.00 72.30  ? 259 GLN A N      1 
ATOM   1838  C CA     . GLN A  1 266 ? -42.561  15.307  70.253  1.00 76.21  ? 259 GLN A CA     1 
ATOM   1839  C C      . GLN A  1 266 ? -41.052  15.442  70.435  1.00 79.18  ? 259 GLN A C      1 
ATOM   1840  O O      . GLN A  1 266 ? -40.415  14.652  71.135  1.00 77.56  ? 259 GLN A O      1 
ATOM   1841  C CB     . GLN A  1 266 ? -43.282  16.340  71.124  1.00 80.93  ? 259 GLN A CB     1 
ATOM   1842  C CG     . GLN A  1 266 ? -44.824  16.363  71.019  1.00 84.06  ? 259 GLN A CG     1 
ATOM   1843  C CD     . GLN A  1 266 ? -45.531  15.320  71.894  1.00 89.60  ? 259 GLN A CD     1 
ATOM   1844  O OE1    . GLN A  1 266 ? -45.088  14.179  72.004  1.00 91.31  ? 259 GLN A OE1    1 
ATOM   1845  N NE2    . GLN A  1 266 ? -46.641  15.719  72.513  1.00 92.66  ? 259 GLN A NE2    1 
ATOM   1846  N N      . LEU A  1 267 ? -40.493  16.487  69.818  1.00 84.29  ? 260 LEU A N      1 
ATOM   1847  C CA     . LEU A  1 267 ? -39.045  16.674  69.799  1.00 87.54  ? 260 LEU A CA     1 
ATOM   1848  C C      . LEU A  1 267 ? -38.429  16.589  71.192  1.00 86.66  ? 260 LEU A C      1 
ATOM   1849  O O      . LEU A  1 267 ? -37.460  15.855  71.414  1.00 83.06  ? 260 LEU A O      1 
ATOM   1850  C CB     . LEU A  1 267 ? -38.716  18.026  69.174  1.00 92.34  ? 260 LEU A CB     1 
ATOM   1851  C CG     . LEU A  1 267 ? -37.217  18.286  69.128  1.00 98.63  ? 260 LEU A CG     1 
ATOM   1852  C CD1    . LEU A  1 267 ? -36.501  17.175  68.407  1.00 97.71  ? 260 LEU A CD1    1 
ATOM   1853  C CD2    . LEU A  1 267 ? -37.035  19.521  68.390  1.00 101.26 ? 260 LEU A CD2    1 
ATOM   1854  N N      . GLU A  1 268 ? -38.988  17.328  72.150  1.00 89.56  ? 261 GLU A N      1 
ATOM   1855  C CA     . GLU A  1 268 ? -38.371  17.405  73.471  1.00 92.58  ? 261 GLU A CA     1 
ATOM   1856  C C      . GLU A  1 268 ? -38.343  16.044  74.167  1.00 93.64  ? 261 GLU A C      1 
ATOM   1857  O O      . GLU A  1 268 ? -37.327  15.674  74.770  1.00 95.67  ? 261 GLU A O      1 
ATOM   1858  C CB     . GLU A  1 268 ? -39.074  18.480  74.301  1.00 94.42  ? 261 GLU A CB     1 
ATOM   1859  C CG     . GLU A  1 268 ? -40.567  18.285  74.447  1.00 93.99  ? 261 GLU A CG     1 
ATOM   1860  C CD     . GLU A  1 268 ? -40.957  17.582  75.708  1.00 95.90  ? 261 GLU A CD     1 
ATOM   1861  O OE1    . GLU A  1 268 ? -40.090  17.358  76.576  1.00 97.70  ? 261 GLU A OE1    1 
ATOM   1862  O OE2    . GLU A  1 268 ? -42.155  17.278  75.823  1.00 95.68  ? 261 GLU A OE2    1 
ATOM   1863  N N      . GLU A  1 269 ? -39.429  15.264  74.051  1.00 93.65  ? 262 GLU A N      1 
ATOM   1864  C CA     . GLU A  1 269 ? -39.476  13.936  74.659  1.00 89.70  ? 262 GLU A CA     1 
ATOM   1865  C C      . GLU A  1 269 ? -38.435  13.011  74.038  1.00 78.37  ? 262 GLU A C      1 
ATOM   1866  O O      . GLU A  1 269 ? -37.863  12.171  74.738  1.00 76.83  ? 262 GLU A O      1 
ATOM   1867  C CB     . GLU A  1 269 ? -40.870  13.329  74.493  1.00 89.33  ? 262 GLU A CB     1 
ATOM   1868  C CG     . GLU A  1 269 ? -41.959  14.202  75.077  1.00 93.45  ? 262 GLU A CG     1 
ATOM   1869  C CD     . GLU A  1 269 ? -43.376  13.762  74.708  1.00 99.15  ? 262 GLU A CD     1 
ATOM   1870  O OE1    . GLU A  1 269 ? -43.547  12.854  73.848  1.00 100.03 ? 262 GLU A OE1    1 
ATOM   1871  O OE2    . GLU A  1 269 ? -44.321  14.350  75.290  1.00 103.44 ? 262 GLU A OE2    1 
ATOM   1872  N N      . LEU A  1 270 ? -38.172  13.151  72.731  1.00 71.14  ? 263 LEU A N      1 
ATOM   1873  C CA     . LEU A  1 270 ? -37.153  12.325  72.086  1.00 67.19  ? 263 LEU A CA     1 
ATOM   1874  C C      . LEU A  1 270 ? -35.769  12.612  72.649  1.00 72.18  ? 263 LEU A C      1 
ATOM   1875  O O      . LEU A  1 270 ? -34.950  11.697  72.765  1.00 77.02  ? 263 LEU A O      1 
ATOM   1876  C CB     . LEU A  1 270 ? -37.151  12.543  70.565  1.00 64.26  ? 263 LEU A CB     1 
ATOM   1877  C CG     . LEU A  1 270 ? -36.210  11.675  69.721  1.00 51.90  ? 263 LEU A CG     1 
ATOM   1878  C CD1    . LEU A  1 270 ? -36.545  10.201  69.874  1.00 51.18  ? 263 LEU A CD1    1 
ATOM   1879  C CD2    . LEU A  1 270 ? -36.289  12.059  68.242  1.00 50.05  ? 263 LEU A CD2    1 
ATOM   1880  N N      . GLU A  1 271 ? -35.487  13.870  72.999  1.00 75.56  ? 264 GLU A N      1 
ATOM   1881  C CA     . GLU A  1 271 ? -34.177  14.199  73.553  1.00 75.43  ? 264 GLU A CA     1 
ATOM   1882  C C      . GLU A  1 271 ? -33.953  13.483  74.877  1.00 74.72  ? 264 GLU A C      1 
ATOM   1883  O O      . GLU A  1 271 ? -32.830  13.070  75.185  1.00 76.71  ? 264 GLU A O      1 
ATOM   1884  C CB     . GLU A  1 271 ? -34.046  15.710  73.745  1.00 82.04  ? 264 GLU A CB     1 
ATOM   1885  C CG     . GLU A  1 271 ? -34.268  16.543  72.485  1.00 84.37  ? 264 GLU A CG     1 
ATOM   1886  C CD     . GLU A  1 271 ? -33.054  16.599  71.579  1.00 88.38  ? 264 GLU A CD     1 
ATOM   1887  O OE1    . GLU A  1 271 ? -33.177  17.136  70.456  1.00 87.82  ? 264 GLU A OE1    1 
ATOM   1888  O OE2    . GLU A  1 271 ? -31.987  16.098  71.986  1.00 90.81  ? 264 GLU A OE2    1 
ATOM   1889  N N      . ALA A  1 272 ? -35.006  13.361  75.688  1.00 75.63  ? 265 ALA A N      1 
ATOM   1890  C CA     . ALA A  1 272 ? -34.893  12.666  76.966  1.00 79.61  ? 265 ALA A CA     1 
ATOM   1891  C C      . ALA A  1 272 ? -34.450  11.218  76.780  1.00 78.96  ? 265 ALA A C      1 
ATOM   1892  O O      . ALA A  1 272 ? -33.678  10.689  77.588  1.00 81.61  ? 265 ALA A O      1 
ATOM   1893  C CB     . ALA A  1 272 ? -36.227  12.731  77.708  1.00 79.18  ? 265 ALA A CB     1 
ATOM   1894  N N      . ALA A  1 273 ? -34.926  10.558  75.723  1.00 77.29  ? 266 ALA A N      1 
ATOM   1895  C CA     . ALA A  1 273 ? -34.630  9.152   75.484  1.00 74.70  ? 266 ALA A CA     1 
ATOM   1896  C C      . ALA A  1 273 ? -33.375  8.947   74.643  1.00 70.07  ? 266 ALA A C      1 
ATOM   1897  O O      . ALA A  1 273 ? -33.199  7.870   74.059  1.00 67.80  ? 266 ALA A O      1 
ATOM   1898  C CB     . ALA A  1 273 ? -35.822  8.467   74.812  1.00 74.48  ? 266 ALA A CB     1 
ATOM   1899  N N      . ARG A  1 274 ? -32.505  9.957   74.567  1.00 70.62  ? 267 ARG A N      1 
ATOM   1900  C CA     . ARG A  1 274 ? -31.311  9.852   73.735  1.00 69.34  ? 267 ARG A CA     1 
ATOM   1901  C C      . ARG A  1 274 ? -30.513  8.605   74.087  1.00 70.53  ? 267 ARG A C      1 
ATOM   1902  O O      . ARG A  1 274 ? -29.933  7.956   73.208  1.00 72.46  ? 267 ARG A O      1 
ATOM   1903  C CB     . ARG A  1 274 ? -30.460  11.110  73.896  1.00 70.62  ? 267 ARG A CB     1 
ATOM   1904  C CG     . ARG A  1 274 ? -29.496  11.369  72.754  1.00 68.84  ? 267 ARG A CG     1 
ATOM   1905  C CD     . ARG A  1 274 ? -29.386  12.867  72.499  1.00 69.13  ? 267 ARG A CD     1 
ATOM   1906  N NE     . ARG A  1 274 ? -28.635  13.179  71.288  1.00 71.63  ? 267 ARG A NE     1 
ATOM   1907  C CZ     . ARG A  1 274 ? -28.670  14.360  70.680  1.00 76.69  ? 267 ARG A CZ     1 
ATOM   1908  N NH1    . ARG A  1 274 ? -29.391  15.347  71.196  1.00 76.90  ? 267 ARG A NH1    1 
ATOM   1909  N NH2    . ARG A  1 274 ? -27.963  14.567  69.578  1.00 78.93  ? 267 ARG A NH2    1 
ATOM   1910  N N      . ASP A  1 275 ? -30.466  8.261   75.373  1.00 70.57  ? 268 ASP A N      1 
ATOM   1911  C CA     . ASP A  1 275 ? -29.748  7.091   75.853  1.00 71.35  ? 268 ASP A CA     1 
ATOM   1912  C C      . ASP A  1 275 ? -30.560  5.810   75.721  1.00 72.19  ? 268 ASP A C      1 
ATOM   1913  O O      . ASP A  1 275 ? -30.038  4.729   76.015  1.00 73.40  ? 268 ASP A O      1 
ATOM   1914  C CB     . ASP A  1 275 ? -29.342  7.296   77.316  1.00 68.82  ? 268 ASP A CB     1 
ATOM   1915  C CG     . ASP A  1 275 ? -28.276  8.358   77.475  1.00 70.90  ? 268 ASP A CG     1 
ATOM   1916  O OD1    . ASP A  1 275 ? -27.375  8.418   76.613  1.00 70.89  ? 268 ASP A OD1    1 
ATOM   1917  O OD2    . ASP A  1 275 ? -28.335  9.131   78.455  1.00 74.37  ? 268 ASP A OD2    1 
ATOM   1918  N N      . LEU A  1 276 ? -31.817  5.908   75.289  1.00 69.27  ? 269 LEU A N      1 
ATOM   1919  C CA     . LEU A  1 276 ? -32.657  4.739   75.086  1.00 66.48  ? 269 LEU A CA     1 
ATOM   1920  C C      . LEU A  1 276 ? -32.552  4.167   73.681  1.00 66.42  ? 269 LEU A C      1 
ATOM   1921  O O      . LEU A  1 276 ? -32.894  2.995   73.477  1.00 65.70  ? 269 LEU A O      1 
ATOM   1922  C CB     . LEU A  1 276 ? -34.120  5.097   75.371  1.00 66.09  ? 269 LEU A CB     1 
ATOM   1923  C CG     . LEU A  1 276 ? -34.467  5.508   76.802  1.00 69.73  ? 269 LEU A CG     1 
ATOM   1924  C CD1    . LEU A  1 276 ? -35.948  5.816   76.918  1.00 61.14  ? 269 LEU A CD1    1 
ATOM   1925  C CD2    . LEU A  1 276 ? -34.061  4.424   77.785  1.00 63.82  ? 269 LEU A CD2    1 
ATOM   1926  N N      . VAL A  1 277 ? -32.086  4.959   72.716  1.00 65.47  ? 270 VAL A N      1 
ATOM   1927  C CA     . VAL A  1 277 ? -31.989  4.535   71.328  1.00 62.64  ? 270 VAL A CA     1 
ATOM   1928  C C      . VAL A  1 277 ? -30.546  4.681   70.851  1.00 62.82  ? 270 VAL A C      1 
ATOM   1929  O O      . VAL A  1 277 ? -29.716  5.335   71.484  1.00 59.67  ? 270 VAL A O      1 
ATOM   1930  C CB     . VAL A  1 277 ? -32.947  5.318   70.409  1.00 54.30  ? 270 VAL A CB     1 
ATOM   1931  C CG1    . VAL A  1 277 ? -34.363  5.290   70.970  1.00 56.53  ? 270 VAL A CG1    1 
ATOM   1932  C CG2    . VAL A  1 277 ? -32.464  6.744   70.229  1.00 54.93  ? 270 VAL A CG2    1 
ATOM   1933  N N      . SER A  1 278 ? -30.265  4.047   69.714  1.00 61.11  ? 271 SER A N      1 
ATOM   1934  C CA     . SER A  1 278 ? -28.967  4.158   69.065  1.00 57.80  ? 271 SER A CA     1 
ATOM   1935  C C      . SER A  1 278 ? -28.827  5.532   68.410  1.00 57.57  ? 271 SER A C      1 
ATOM   1936  O O      . SER A  1 278 ? -29.814  6.230   68.165  1.00 56.00  ? 271 SER A O      1 
ATOM   1937  C CB     . SER A  1 278 ? -28.789  3.050   68.022  1.00 72.29  ? 271 SER A CB     1 
ATOM   1938  O OG     . SER A  1 278 ? -29.683  3.202   66.932  1.00 66.55  ? 271 SER A OG     1 
ATOM   1939  N N      . LYS A  1 279 ? -27.578  5.927   68.133  1.00 91.06  ? 272 LYS A N      1 
ATOM   1940  C CA     . LYS A  1 279 ? -27.335  7.228   67.506  1.00 97.64  ? 272 LYS A CA     1 
ATOM   1941  C C      . LYS A  1 279 ? -28.072  7.352   66.180  1.00 89.89  ? 272 LYS A C      1 
ATOM   1942  O O      . LYS A  1 279 ? -28.732  8.362   65.912  1.00 90.44  ? 272 LYS A O      1 
ATOM   1943  C CB     . LYS A  1 279 ? -25.839  7.458   67.290  1.00 62.01  ? 272 LYS A CB     1 
ATOM   1944  C CG     . LYS A  1 279 ? -25.045  7.698   68.563  1.00 66.45  ? 272 LYS A CG     1 
ATOM   1945  C CD     . LYS A  1 279 ? -23.592  8.069   68.284  1.00 71.85  ? 272 LYS A CD     1 
ATOM   1946  C CE     . LYS A  1 279 ? -22.823  8.231   69.589  1.00 76.73  ? 272 LYS A CE     1 
ATOM   1947  N NZ     . LYS A  1 279 ? -21.405  8.614   69.362  1.00 80.50  ? 272 LYS A NZ     1 
ATOM   1948  N N      . GLU A  1 280 ? -27.955  6.342   65.322  1.00 96.23  ? 273 GLU A N      1 
ATOM   1949  C CA     . GLU A  1 280 ? -28.700  6.370   64.067  1.00 89.14  ? 273 GLU A CA     1 
ATOM   1950  C C      . GLU A  1 280 ? -30.205  6.406   64.303  1.00 80.28  ? 273 GLU A C      1 
ATOM   1951  O O      . GLU A  1 280 ? -30.924  7.184   63.668  1.00 72.71  ? 273 GLU A O      1 
ATOM   1952  C CB     . GLU A  1 280 ? -28.347  5.161   63.205  1.00 88.91  ? 273 GLU A CB     1 
ATOM   1953  C CG     . GLU A  1 280 ? -29.185  5.088   61.927  1.00 90.90  ? 273 GLU A CG     1 
ATOM   1954  C CD     . GLU A  1 280 ? -28.664  4.060   60.934  1.00 94.59  ? 273 GLU A CD     1 
ATOM   1955  O OE1    . GLU A  1 280 ? -27.625  3.438   61.243  1.00 91.48  ? 273 GLU A OE1    1 
ATOM   1956  O OE2    . GLU A  1 280 ? -29.256  3.906   59.837  1.00 102.44 ? 273 GLU A OE2    1 
ATOM   1957  N N      . GLY A  1 281 ? -30.698  5.563   65.210  1.00 77.53  ? 274 GLY A N      1 
ATOM   1958  C CA     . GLY A  1 281 ? -32.122  5.549   65.520  1.00 73.95  ? 274 GLY A CA     1 
ATOM   1959  C C      . GLY A  1 281 ? -32.649  6.884   66.008  1.00 68.59  ? 274 GLY A C      1 
ATOM   1960  O O      . GLY A  1 281 ? -33.793  7.254   65.724  1.00 48.39  ? 274 GLY A O      1 
ATOM   1961  N N      . PHE A  1 282 ? -31.833  7.618   66.764  1.00 68.84  ? 275 PHE A N      1 
ATOM   1962  C CA     . PHE A  1 282 ? -32.273  8.920   67.247  1.00 52.36  ? 275 PHE A CA     1 
ATOM   1963  C C      . PHE A  1 282 ? -32.449  9.894   66.092  1.00 51.25  ? 275 PHE A C      1 
ATOM   1964  O O      . PHE A  1 282 ? -33.431  10.644  66.047  1.00 61.24  ? 275 PHE A O      1 
ATOM   1965  C CB     . PHE A  1 282 ? -31.282  9.468   68.272  1.00 60.08  ? 275 PHE A CB     1 
ATOM   1966  C CG     . PHE A  1 282 ? -31.598  10.859  68.730  1.00 60.72  ? 275 PHE A CG     1 
ATOM   1967  C CD1    . PHE A  1 282 ? -31.110  11.964  68.048  1.00 62.04  ? 275 PHE A CD1    1 
ATOM   1968  C CD2    . PHE A  1 282 ? -32.389  11.062  69.845  1.00 60.74  ? 275 PHE A CD2    1 
ATOM   1969  C CE1    . PHE A  1 282 ? -31.413  13.243  68.474  1.00 63.44  ? 275 PHE A CE1    1 
ATOM   1970  C CE2    . PHE A  1 282 ? -32.691  12.331  70.276  1.00 63.22  ? 275 PHE A CE2    1 
ATOM   1971  C CZ     . PHE A  1 282 ? -32.201  13.425  69.593  1.00 63.62  ? 275 PHE A CZ     1 
ATOM   1972  N N      . ARG A  1 283 ? -31.511  9.897   65.145  1.00 51.63  ? 276 ARG A N      1 
ATOM   1973  C CA     . ARG A  1 283 ? -31.634  10.796  64.004  1.00 52.51  ? 276 ARG A CA     1 
ATOM   1974  C C      . ARG A  1 283 ? -32.858  10.447  63.171  1.00 53.11  ? 276 ARG A C      1 
ATOM   1975  O O      . ARG A  1 283 ? -33.561  11.336  62.674  1.00 52.98  ? 276 ARG A O      1 
ATOM   1976  C CB     . ARG A  1 283 ? -30.387  10.721  63.129  1.00 53.61  ? 276 ARG A CB     1 
ATOM   1977  C CG     . ARG A  1 283 ? -29.100  11.222  63.752  1.00 54.75  ? 276 ARG A CG     1 
ATOM   1978  C CD     . ARG A  1 283 ? -28.041  11.236  62.674  1.00 55.79  ? 276 ARG A CD     1 
ATOM   1979  N NE     . ARG A  1 283 ? -27.478  9.903   62.499  1.00 69.21  ? 276 ARG A NE     1 
ATOM   1980  C CZ     . ARG A  1 283 ? -26.916  9.469   61.375  1.00 66.04  ? 276 ARG A CZ     1 
ATOM   1981  N NH1    . ARG A  1 283 ? -26.844  10.260  60.310  1.00 62.08  ? 276 ARG A NH1    1 
ATOM   1982  N NH2    . ARG A  1 283 ? -26.439  8.234   61.313  1.00 64.56  ? 276 ARG A NH2    1 
ATOM   1983  N N      . ARG A  1 284 ? -33.115  9.151   62.998  1.00 53.16  ? 277 ARG A N      1 
ATOM   1984  C CA     . ARG A  1 284 ? -34.296  8.713   62.266  1.00 50.65  ? 277 ARG A CA     1 
ATOM   1985  C C      . ARG A  1 284 ? -35.560  9.295   62.882  1.00 50.64  ? 277 ARG A C      1 
ATOM   1986  O O      . ARG A  1 284 ? -36.397  9.875   62.181  1.00 53.77  ? 277 ARG A O      1 
ATOM   1987  C CB     . ARG A  1 284 ? -34.345  7.185   62.245  1.00 50.94  ? 277 ARG A CB     1 
ATOM   1988  C CG     . ARG A  1 284 ? -33.144  6.558   61.550  1.00 45.45  ? 277 ARG A CG     1 
ATOM   1989  C CD     . ARG A  1 284 ? -32.907  7.164   60.173  1.00 55.40  ? 277 ARG A CD     1 
ATOM   1990  N NE     . ARG A  1 284 ? -31.483  7.318   59.878  1.00 57.40  ? 277 ARG A NE     1 
ATOM   1991  C CZ     . ARG A  1 284 ? -30.713  6.367   59.355  1.00 58.52  ? 277 ARG A CZ     1 
ATOM   1992  N NH1    . ARG A  1 284 ? -31.221  5.176   59.072  1.00 58.00  ? 277 ARG A NH1    1 
ATOM   1993  N NH2    . ARG A  1 284 ? -29.428  6.605   59.124  1.00 60.07  ? 277 ARG A NH2    1 
ATOM   1994  N N      . ALA A  1 285 ? -35.716  9.146   64.199  1.00 52.86  ? 278 ALA A N      1 
ATOM   1995  C CA     . ALA A  1 285 ? -36.904  9.656   64.873  1.00 52.22  ? 278 ALA A CA     1 
ATOM   1996  C C      . ALA A  1 285 ? -36.982  11.176  64.815  1.00 53.79  ? 278 ALA A C      1 
ATOM   1997  O O      . ALA A  1 285 ? -38.082  11.735  64.731  1.00 54.63  ? 278 ALA A O      1 
ATOM   1998  C CB     . ALA A  1 285 ? -36.923  9.185   66.327  1.00 51.73  ? 278 ALA A CB     1 
ATOM   1999  N N      . ARG A  1 286 ? -35.838  11.862  64.859  1.00 54.29  ? 279 ARG A N      1 
ATOM   2000  C CA     . ARG A  1 286 ? -35.856  13.320  64.807  1.00 55.39  ? 279 ARG A CA     1 
ATOM   2001  C C      . ARG A  1 286 ? -36.434  13.813  63.488  1.00 54.52  ? 279 ARG A C      1 
ATOM   2002  O O      . ARG A  1 286 ? -37.157  14.816  63.452  1.00 53.62  ? 279 ARG A O      1 
ATOM   2003  C CB     . ARG A  1 286 ? -34.449  13.877  65.016  1.00 53.43  ? 279 ARG A CB     1 
ATOM   2004  C CG     . ARG A  1 286 ? -34.389  15.396  64.998  1.00 52.16  ? 279 ARG A CG     1 
ATOM   2005  C CD     . ARG A  1 286 ? -33.076  15.909  65.561  1.00 57.01  ? 279 ARG A CD     1 
ATOM   2006  N NE     . ARG A  1 286 ? -31.934  15.440  64.783  1.00 59.58  ? 279 ARG A NE     1 
ATOM   2007  C CZ     . ARG A  1 286 ? -30.668  15.591  65.154  1.00 60.65  ? 279 ARG A CZ     1 
ATOM   2008  N NH1    . ARG A  1 286 ? -30.379  16.199  66.296  1.00 64.01  ? 279 ARG A NH1    1 
ATOM   2009  N NH2    . ARG A  1 286 ? -29.690  15.130  64.385  1.00 61.98  ? 279 ARG A NH2    1 
ATOM   2010  N N      . HIS A  1 287 ? -36.119  13.125  62.390  1.00 53.15  ? 280 HIS A N      1 
ATOM   2011  C CA     . HIS A  1 287 ? -36.698  13.479  61.099  1.00 52.69  ? 280 HIS A CA     1 
ATOM   2012  C C      . HIS A  1 287 ? -38.213  13.310  61.112  1.00 53.22  ? 280 HIS A C      1 
ATOM   2013  O O      . HIS A  1 287 ? -38.955  14.233  60.754  1.00 52.80  ? 280 HIS A O      1 
ATOM   2014  C CB     . HIS A  1 287 ? -36.066  12.630  59.996  1.00 54.87  ? 280 HIS A CB     1 
ATOM   2015  C CG     . HIS A  1 287 ? -36.861  12.597  58.730  1.00 55.56  ? 280 HIS A CG     1 
ATOM   2016  N ND1    . HIS A  1 287 ? -36.873  13.643  57.832  1.00 56.03  ? 280 HIS A ND1    1 
ATOM   2017  C CD2    . HIS A  1 287 ? -37.670  11.644  58.209  1.00 53.67  ? 280 HIS A CD2    1 
ATOM   2018  C CE1    . HIS A  1 287 ? -37.657  13.336  56.814  1.00 54.09  ? 280 HIS A CE1    1 
ATOM   2019  N NE2    . HIS A  1 287 ? -38.150  12.128  57.017  1.00 52.81  ? 280 HIS A NE2    1 
ATOM   2020  N N      . VAL A  1 288 ? -38.692  12.133  61.522  1.00 52.07  ? 281 VAL A N      1 
ATOM   2021  C CA     . VAL A  1 288 ? -40.127  11.846  61.482  1.00 46.26  ? 281 VAL A CA     1 
ATOM   2022  C C      . VAL A  1 288 ? -40.906  12.893  62.269  1.00 45.82  ? 281 VAL A C      1 
ATOM   2023  O O      . VAL A  1 288 ? -41.824  13.534  61.746  1.00 50.49  ? 281 VAL A O      1 
ATOM   2024  C CB     . VAL A  1 288 ? -40.411  10.428  62.004  1.00 44.68  ? 281 VAL A CB     1 
ATOM   2025  C CG1    . VAL A  1 288 ? -41.909  10.196  62.093  1.00 37.41  ? 281 VAL A CG1    1 
ATOM   2026  C CG2    . VAL A  1 288 ? -39.764  9.399   61.097  1.00 37.99  ? 281 VAL A CG2    1 
ATOM   2027  N N      . VAL A  1 289 ? -40.552  13.075  63.543  1.00 51.41  ? 282 VAL A N      1 
ATOM   2028  C CA     . VAL A  1 289 ? -41.270  14.028  64.385  1.00 52.80  ? 282 VAL A CA     1 
ATOM   2029  C C      . VAL A  1 289 ? -41.246  15.412  63.750  1.00 59.60  ? 282 VAL A C      1 
ATOM   2030  O O      . VAL A  1 289 ? -42.233  16.156  63.807  1.00 63.26  ? 282 VAL A O      1 
ATOM   2031  C CB     . VAL A  1 289 ? -40.676  14.042  65.807  1.00 49.91  ? 282 VAL A CB     1 
ATOM   2032  C CG1    . VAL A  1 289 ? -41.287  15.167  66.635  1.00 49.45  ? 282 VAL A CG1    1 
ATOM   2033  C CG2    . VAL A  1 289 ? -40.888  12.699  66.492  1.00 48.73  ? 282 VAL A CG2    1 
ATOM   2034  N N      . GLY A  1 290 ? -40.114  15.786  63.147  1.00 59.12  ? 283 GLY A N      1 
ATOM   2035  C CA     . GLY A  1 290 ? -40.025  17.078  62.491  1.00 58.84  ? 283 GLY A CA     1 
ATOM   2036  C C      . GLY A  1 290 ? -40.710  17.133  61.142  1.00 56.26  ? 283 GLY A C      1 
ATOM   2037  O O      . GLY A  1 290 ? -41.254  18.177  60.768  1.00 55.70  ? 283 GLY A O      1 
ATOM   2038  N N      . GLU A  1 291 ? -40.699  16.025  60.396  1.00 55.03  ? 284 GLU A N      1 
ATOM   2039  C CA     . GLU A  1 291 ? -41.397  15.991  59.114  1.00 51.65  ? 284 GLU A CA     1 
ATOM   2040  C C      . GLU A  1 291 ? -42.907  16.041  59.307  1.00 50.88  ? 284 GLU A C      1 
ATOM   2041  O O      . GLU A  1 291 ? -43.611  16.745  58.572  1.00 51.57  ? 284 GLU A O      1 
ATOM   2042  C CB     . GLU A  1 291 ? -40.992  14.742  58.329  1.00 49.00  ? 284 GLU A CB     1 
ATOM   2043  C CG     . GLU A  1 291 ? -41.574  14.670  56.928  1.00 49.23  ? 284 GLU A CG     1 
ATOM   2044  C CD     . GLU A  1 291 ? -40.880  15.600  55.958  1.00 49.14  ? 284 GLU A CD     1 
ATOM   2045  O OE1    . GLU A  1 291 ? -40.073  16.436  56.414  1.00 52.31  ? 284 GLU A OE1    1 
ATOM   2046  O OE2    . GLU A  1 291 ? -41.141  15.497  54.741  1.00 47.35  ? 284 GLU A OE2    1 
ATOM   2047  N N      . ILE A  1 292 ? -43.425  15.305  60.293  1.00 51.63  ? 285 ILE A N      1 
ATOM   2048  C CA     . ILE A  1 292 ? -44.857  15.356  60.574  1.00 46.67  ? 285 ILE A CA     1 
ATOM   2049  C C      . ILE A  1 292 ? -45.273  16.785  60.882  1.00 48.58  ? 285 ILE A C      1 
ATOM   2050  O O      . ILE A  1 292 ? -46.314  17.264  60.415  1.00 51.98  ? 285 ILE A O      1 
ATOM   2051  C CB     . ILE A  1 292 ? -45.214  14.405  61.733  1.00 42.97  ? 285 ILE A CB     1 
ATOM   2052  C CG1    . ILE A  1 292 ? -44.942  12.950  61.346  1.00 41.58  ? 285 ILE A CG1    1 
ATOM   2053  C CG2    . ILE A  1 292 ? -46.671  14.584  62.138  1.00 39.58  ? 285 ILE A CG2    1 
ATOM   2054  C CD1    . ILE A  1 292 ? -45.248  11.951  62.450  1.00 43.89  ? 285 ILE A CD1    1 
ATOM   2055  N N      . ARG A  1 293 ? -44.454  17.491  61.662  1.00 51.73  ? 286 ARG A N      1 
ATOM   2056  C CA     . ARG A  1 293 ? -44.770  18.864  62.034  1.00 53.25  ? 286 ARG A CA     1 
ATOM   2057  C C      . ARG A  1 293 ? -44.627  19.802  60.842  1.00 52.79  ? 286 ARG A C      1 
ATOM   2058  O O      . ARG A  1 293 ? -45.391  20.764  60.708  1.00 52.68  ? 286 ARG A O      1 
ATOM   2059  C CB     . ARG A  1 293 ? -43.874  19.286  63.199  1.00 56.49  ? 286 ARG A CB     1 
ATOM   2060  C CG     . ARG A  1 293 ? -43.842  20.762  63.521  1.00 61.29  ? 286 ARG A CG     1 
ATOM   2061  C CD     . ARG A  1 293 ? -42.545  21.393  63.013  1.00 67.26  ? 286 ARG A CD     1 
ATOM   2062  N NE     . ARG A  1 293 ? -42.140  22.537  63.819  1.00 73.17  ? 286 ARG A NE     1 
ATOM   2063  C CZ     . ARG A  1 293 ? -41.109  23.328  63.549  1.00 78.76  ? 286 ARG A CZ     1 
ATOM   2064  N NH1    . ARG A  1 293 ? -40.821  24.345  64.355  1.00 82.41  ? 286 ARG A NH1    1 
ATOM   2065  N NH2    . ARG A  1 293 ? -40.378  23.108  62.472  1.00 79.41  ? 286 ARG A NH2    1 
ATOM   2066  N N      . ARG A  1 294 ? -43.670  19.527  59.954  1.00 48.76  ? 287 ARG A N      1 
ATOM   2067  C CA     . ARG A  1 294 ? -43.526  20.343  58.753  1.00 47.77  ? 287 ARG A CA     1 
ATOM   2068  C C      . ARG A  1 294 ? -44.699  20.146  57.800  1.00 48.84  ? 287 ARG A C      1 
ATOM   2069  O O      . ARG A  1 294 ? -45.196  21.113  57.210  1.00 46.87  ? 287 ARG A O      1 
ATOM   2070  C CB     . ARG A  1 294 ? -42.215  20.008  58.047  1.00 45.43  ? 287 ARG A CB     1 
ATOM   2071  C CG     . ARG A  1 294 ? -40.995  20.691  58.627  1.00 48.98  ? 287 ARG A CG     1 
ATOM   2072  C CD     . ARG A  1 294 ? -39.795  20.452  57.732  1.00 47.33  ? 287 ARG A CD     1 
ATOM   2073  N NE     . ARG A  1 294 ? -39.456  19.034  57.672  1.00 47.86  ? 287 ARG A NE     1 
ATOM   2074  C CZ     . ARG A  1 294 ? -38.653  18.423  58.536  1.00 52.46  ? 287 ARG A CZ     1 
ATOM   2075  N NH1    . ARG A  1 294 ? -38.107  19.108  59.533  1.00 53.75  ? 287 ARG A NH1    1 
ATOM   2076  N NH2    . ARG A  1 294 ? -38.402  17.126  58.408  1.00 51.48  ? 287 ARG A NH2    1 
ATOM   2077  N N      . THR A  1 295 ? -45.157  18.902  57.638  1.00 48.39  ? 288 THR A N      1 
ATOM   2078  C CA     . THR A  1 295 ? -46.263  18.635  56.724  1.00 46.47  ? 288 THR A CA     1 
ATOM   2079  C C      . THR A  1 295 ? -47.516  19.382  57.162  1.00 48.74  ? 288 THR A C      1 
ATOM   2080  O O      . THR A  1 295 ? -48.179  20.038  56.351  1.00 48.85  ? 288 THR A O      1 
ATOM   2081  C CB     . THR A  1 295 ? -46.525  17.129  56.634  1.00 44.67  ? 288 THR A CB     1 
ATOM   2082  O OG1    . THR A  1 295 ? -45.332  16.458  56.207  1.00 43.83  ? 288 THR A OG1    1 
ATOM   2083  C CG2    . THR A  1 295 ? -47.641  16.838  55.637  1.00 39.88  ? 288 THR A CG2    1 
ATOM   2084  N N      . ALA A  1 296 ? -47.854  19.293  58.450  1.00 48.72  ? 289 ALA A N      1 
ATOM   2085  C CA     . ALA A  1 296 ? -48.990  20.050  58.965  1.00 48.12  ? 289 ALA A CA     1 
ATOM   2086  C C      . ALA A  1 296 ? -48.788  21.547  58.755  1.00 50.37  ? 289 ALA A C      1 
ATOM   2087  O O      . ALA A  1 296 ? -49.744  22.276  58.463  1.00 54.86  ? 289 ALA A O      1 
ATOM   2088  C CB     . ALA A  1 296 ? -49.205  19.732  60.444  1.00 50.34  ? 289 ALA A CB     1 
ATOM   2089  N N      . GLN A  1 297 ? -47.548  22.026  58.902  1.00 49.95  ? 290 GLN A N      1 
ATOM   2090  C CA     . GLN A  1 297 ? -47.276  23.442  58.672  1.00 48.58  ? 290 GLN A CA     1 
ATOM   2091  C C      . GLN A  1 297 ? -47.404  23.798  57.196  1.00 46.91  ? 290 GLN A C      1 
ATOM   2092  O O      . GLN A  1 297 ? -47.917  24.870  56.852  1.00 48.72  ? 290 GLN A O      1 
ATOM   2093  C CB     . GLN A  1 297 ? -45.878  23.811  59.167  1.00 47.35  ? 290 GLN A CB     1 
ATOM   2094  C CG     . GLN A  1 297 ? -45.757  24.145  60.642  1.00 51.53  ? 290 GLN A CG     1 
ATOM   2095  C CD     . GLN A  1 297 ? -44.300  24.215  61.083  1.00 55.23  ? 290 GLN A CD     1 
ATOM   2096  O OE1    . GLN A  1 297 ? -43.391  23.949  60.296  1.00 54.39  ? 290 GLN A OE1    1 
ATOM   2097  N NE2    . GLN A  1 297 ? -44.071  24.602  62.330  1.00 57.78  ? 290 GLN A NE2    1 
ATOM   2098  N N      . ALA A  1 298 ? -46.957  22.908  56.308  1.00 41.51  ? 291 ALA A N      1 
ATOM   2099  C CA     . ALA A  1 298 ? -46.997  23.208  54.881  1.00 40.63  ? 291 ALA A CA     1 
ATOM   2100  C C      . ALA A  1 298 ? -48.428  23.253  54.362  1.00 43.84  ? 291 ALA A C      1 
ATOM   2101  O O      . ALA A  1 298 ? -48.753  24.072  53.494  1.00 48.14  ? 291 ALA A O      1 
ATOM   2102  C CB     . ALA A  1 298 ? -46.176  22.179  54.106  1.00 32.45  ? 291 ALA A CB     1 
ATOM   2103  N N      . ALA A  1 299 ? -49.294  22.371  54.863  1.00 41.65  ? 292 ALA A N      1 
ATOM   2104  C CA     . ALA A  1 299 ? -50.700  22.435  54.483  1.00 39.10  ? 292 ALA A CA     1 
ATOM   2105  C C      . ALA A  1 299 ? -51.315  23.766  54.896  1.00 42.29  ? 292 ALA A C      1 
ATOM   2106  O O      . ALA A  1 299 ? -52.043  24.391  54.118  1.00 42.47  ? 292 ALA A O      1 
ATOM   2107  C CB     . ALA A  1 299 ? -51.469  21.266  55.097  1.00 37.24  ? 292 ALA A CB     1 
ATOM   2108  N N      . ALA A  1 300 ? -51.021  24.221  56.116  1.00 44.10  ? 293 ALA A N      1 
ATOM   2109  C CA     . ALA A  1 300 ? -51.533  25.512  56.563  1.00 39.57  ? 293 ALA A CA     1 
ATOM   2110  C C      . ALA A  1 300 ? -50.972  26.645  55.713  1.00 40.17  ? 293 ALA A C      1 
ATOM   2111  O O      . ALA A  1 300 ? -51.699  27.577  55.349  1.00 40.65  ? 293 ALA A O      1 
ATOM   2112  C CB     . ALA A  1 300 ? -51.207  25.727  58.040  1.00 36.78  ? 293 ALA A CB     1 
ATOM   2113  N N      . ALA A  1 301 ? -49.677  26.588  55.392  1.00 36.81  ? 294 ALA A N      1 
ATOM   2114  C CA     . ALA A  1 301 ? -49.096  27.602  54.518  1.00 40.21  ? 294 ALA A CA     1 
ATOM   2115  C C      . ALA A  1 301 ? -49.794  27.614  53.165  1.00 45.56  ? 294 ALA A C      1 
ATOM   2116  O O      . ALA A  1 301 ? -49.992  28.677  52.566  1.00 50.64  ? 294 ALA A O      1 
ATOM   2117  C CB     . ALA A  1 301 ? -47.596  27.365  54.349  1.00 36.04  ? 294 ALA A CB     1 
ATOM   2118  N N      . LEU A  1 302 ? -50.167  26.435  52.664  1.00 41.91  ? 295 LEU A N      1 
ATOM   2119  C CA     . LEU A  1 302 ? -50.806  26.353  51.356  1.00 40.45  ? 295 LEU A CA     1 
ATOM   2120  C C      . LEU A  1 302 ? -52.195  26.979  51.380  1.00 40.19  ? 295 LEU A C      1 
ATOM   2121  O O      . LEU A  1 302 ? -52.604  27.636  50.415  1.00 37.81  ? 295 LEU A O      1 
ATOM   2122  C CB     . LEU A  1 302 ? -50.881  24.892  50.912  1.00 39.64  ? 295 LEU A CB     1 
ATOM   2123  C CG     . LEU A  1 302 ? -51.173  24.597  49.443  1.00 34.42  ? 295 LEU A CG     1 
ATOM   2124  C CD1    . LEU A  1 302 ? -50.002  25.049  48.582  1.00 35.72  ? 295 LEU A CD1    1 
ATOM   2125  C CD2    . LEU A  1 302 ? -51.447  23.117  49.251  1.00 31.81  ? 295 LEU A CD2    1 
ATOM   2126  N N      . ARG A  1 303 ? -52.932  26.794  52.479  1.00 41.80  ? 296 ARG A N      1 
ATOM   2127  C CA     . ARG A  1 303 ? -54.295  27.312  52.549  1.00 40.27  ? 296 ARG A CA     1 
ATOM   2128  C C      . ARG A  1 303 ? -54.315  28.831  52.434  1.00 47.93  ? 296 ARG A C      1 
ATOM   2129  O O      . ARG A  1 303 ? -55.234  29.404  51.837  1.00 52.94  ? 296 ARG A O      1 
ATOM   2130  C CB     . ARG A  1 303 ? -54.967  26.865  53.848  1.00 34.63  ? 296 ARG A CB     1 
ATOM   2131  C CG     . ARG A  1 303 ? -55.152  25.361  53.984  1.00 36.40  ? 296 ARG A CG     1 
ATOM   2132  C CD     . ARG A  1 303 ? -55.868  25.020  55.284  1.00 40.74  ? 296 ARG A CD     1 
ATOM   2133  N NE     . ARG A  1 303 ? -56.081  23.582  55.424  1.00 45.76  ? 296 ARG A NE     1 
ATOM   2134  C CZ     . ARG A  1 303 ? -55.236  22.757  56.032  1.00 51.60  ? 296 ARG A CZ     1 
ATOM   2135  N NH1    . ARG A  1 303 ? -54.117  23.227  56.567  1.00 57.22  ? 296 ARG A NH1    1 
ATOM   2136  N NH2    . ARG A  1 303 ? -55.509  21.461  56.109  1.00 49.73  ? 296 ARG A NH2    1 
ATOM   2137  N N      . ARG A  1 304 ? -53.312  29.499  52.993  1.00 45.06  ? 297 ARG A N      1 
ATOM   2138  C CA     . ARG A  1 304 ? -53.224  30.949  52.922  1.00 46.67  ? 297 ARG A CA     1 
ATOM   2139  C C      . ARG A  1 304 ? -52.416  31.439  51.726  1.00 47.76  ? 297 ARG A C      1 
ATOM   2140  O O      . ARG A  1 304 ? -52.222  32.651  51.585  1.00 51.67  ? 297 ARG A O      1 
ATOM   2141  C CB     . ARG A  1 304 ? -52.630  31.507  54.223  1.00 50.11  ? 297 ARG A CB     1 
ATOM   2142  C CG     . ARG A  1 304 ? -51.178  31.126  54.476  1.00 51.42  ? 297 ARG A CG     1 
ATOM   2143  C CD     . ARG A  1 304 ? -50.650  31.790  55.745  1.00 52.94  ? 297 ARG A CD     1 
ATOM   2144  N NE     . ARG A  1 304 ? -49.330  31.299  56.133  1.00 52.89  ? 297 ARG A NE     1 
ATOM   2145  C CZ     . ARG A  1 304 ? -49.125  30.376  57.067  1.00 53.05  ? 297 ARG A CZ     1 
ATOM   2146  N NH1    . ARG A  1 304 ? -50.154  29.852  57.719  1.00 54.25  ? 297 ARG A NH1    1 
ATOM   2147  N NH2    . ARG A  1 304 ? -47.894  29.984  57.361  1.00 54.47  ? 297 ARG A NH2    1 
ATOM   2148  N N      . GLY A  1 305 ? -51.940  30.536  50.868  1.00 42.92  ? 298 GLY A N      1 
ATOM   2149  C CA     . GLY A  1 305 ? -51.213  30.940  49.679  1.00 41.62  ? 298 GLY A CA     1 
ATOM   2150  C C      . GLY A  1 305 ? -49.796  31.393  49.933  1.00 46.47  ? 298 GLY A C      1 
ATOM   2151  O O      . GLY A  1 305 ? -49.212  32.076  49.086  1.00 49.33  ? 298 GLY A O      1 
ATOM   2152  N N      . ASP A  1 306 ? -49.226  31.034  51.082  1.00 49.10  ? 299 ASP A N      1 
ATOM   2153  C CA     . ASP A  1 306 ? -47.873  31.435  51.468  1.00 51.00  ? 299 ASP A CA     1 
ATOM   2154  C C      . ASP A  1 306 ? -46.863  30.481  50.834  1.00 51.97  ? 299 ASP A C      1 
ATOM   2155  O O      . ASP A  1 306 ? -46.321  29.575  51.471  1.00 53.82  ? 299 ASP A O      1 
ATOM   2156  C CB     . ASP A  1 306 ? -47.753  31.468  52.986  1.00 52.92  ? 299 ASP A CB     1 
ATOM   2157  C CG     . ASP A  1 306 ? -46.504  32.177  53.459  1.00 56.78  ? 299 ASP A CG     1 
ATOM   2158  O OD1    . ASP A  1 306 ? -45.583  32.373  52.639  1.00 57.09  ? 299 ASP A OD1    1 
ATOM   2159  O OD2    . ASP A  1 306 ? -46.447  32.540  54.654  1.00 59.20  ? 299 ASP A OD2    1 
ATOM   2160  N N      . TYR A  1 307 ? -46.606  30.698  49.542  1.00 49.19  ? 300 TYR A N      1 
ATOM   2161  C CA     . TYR A  1 307 ? -45.709  29.808  48.811  1.00 45.90  ? 300 TYR A CA     1 
ATOM   2162  C C      . TYR A  1 307 ? -44.274  29.918  49.315  1.00 45.34  ? 300 TYR A C      1 
ATOM   2163  O O      . TYR A  1 307 ? -43.551  28.916  49.364  1.00 43.12  ? 300 TYR A O      1 
ATOM   2164  C CB     . TYR A  1 307 ? -45.781  30.103  47.314  1.00 45.34  ? 300 TYR A CB     1 
ATOM   2165  C CG     . TYR A  1 307 ? -47.170  29.959  46.742  1.00 40.07  ? 300 TYR A CG     1 
ATOM   2166  C CD1    . TYR A  1 307 ? -48.070  29.046  47.281  1.00 40.02  ? 300 TYR A CD1    1 
ATOM   2167  C CD2    . TYR A  1 307 ? -47.577  30.721  45.657  1.00 38.46  ? 300 TYR A CD2    1 
ATOM   2168  C CE1    . TYR A  1 307 ? -49.339  28.905  46.762  1.00 38.04  ? 300 TYR A CE1    1 
ATOM   2169  C CE2    . TYR A  1 307 ? -48.844  30.585  45.129  1.00 38.44  ? 300 TYR A CE2    1 
ATOM   2170  C CZ     . TYR A  1 307 ? -49.720  29.678  45.685  1.00 38.52  ? 300 TYR A CZ     1 
ATOM   2171  O OH     . TYR A  1 307 ? -50.981  29.551  45.153  1.00 39.32  ? 300 TYR A OH     1 
ATOM   2172  N N      . ARG A  1 308 ? -43.838  31.124  49.686  1.00 51.16  ? 301 ARG A N      1 
ATOM   2173  C CA     . ARG A  1 308 ? -42.496  31.276  50.242  1.00 53.99  ? 301 ARG A CA     1 
ATOM   2174  C C      . ARG A  1 308 ? -42.315  30.411  51.481  1.00 51.75  ? 301 ARG A C      1 
ATOM   2175  O O      . ARG A  1 308 ? -41.289  29.738  51.637  1.00 53.56  ? 301 ARG A O      1 
ATOM   2176  C CB     . ARG A  1 308 ? -42.218  32.740  50.582  1.00 64.49  ? 301 ARG A CB     1 
ATOM   2177  C CG     . ARG A  1 308 ? -42.180  33.680  49.391  1.00 72.68  ? 301 ARG A CG     1 
ATOM   2178  C CD     . ARG A  1 308 ? -41.621  35.037  49.798  1.00 81.03  ? 301 ARG A CD     1 
ATOM   2179  N NE     . ARG A  1 308 ? -42.114  35.470  51.104  1.00 88.33  ? 301 ARG A NE     1 
ATOM   2180  C CZ     . ARG A  1 308 ? -41.442  35.317  52.241  1.00 93.07  ? 301 ARG A CZ     1 
ATOM   2181  N NH1    . ARG A  1 308 ? -40.246  34.745  52.229  1.00 95.37  ? 301 ARG A NH1    1 
ATOM   2182  N NH2    . ARG A  1 308 ? -41.961  35.738  53.388  1.00 93.32  ? 301 ARG A NH2    1 
ATOM   2183  N N      . ALA A  1 309 ? -43.303  30.423  52.378  1.00 52.37  ? 302 ALA A N      1 
ATOM   2184  C CA     . ALA A  1 309 ? -43.238  29.581  53.568  1.00 53.81  ? 302 ALA A CA     1 
ATOM   2185  C C      . ALA A  1 309 ? -43.273  28.104  53.201  1.00 50.95  ? 302 ALA A C      1 
ATOM   2186  O O      . ALA A  1 309 ? -42.542  27.295  53.784  1.00 53.78  ? 302 ALA A O      1 
ATOM   2187  C CB     . ALA A  1 309 ? -44.386  29.923  54.517  1.00 41.53  ? 302 ALA A CB     1 
ATOM   2188  N N      . PHE A  1 310 ? -44.128  27.732  52.249  1.00 45.57  ? 303 PHE A N      1 
ATOM   2189  C CA     . PHE A  1 310 ? -44.184  26.344  51.807  1.00 35.89  ? 303 PHE A CA     1 
ATOM   2190  C C      . PHE A  1 310 ? -42.836  25.893  51.256  1.00 41.32  ? 303 PHE A C      1 
ATOM   2191  O O      . PHE A  1 310 ? -42.365  24.793  51.570  1.00 41.26  ? 303 PHE A O      1 
ATOM   2192  C CB     . PHE A  1 310 ? -45.289  26.193  50.761  1.00 33.97  ? 303 PHE A CB     1 
ATOM   2193  C CG     . PHE A  1 310 ? -45.691  24.770  50.487  1.00 32.20  ? 303 PHE A CG     1 
ATOM   2194  C CD1    . PHE A  1 310 ? -44.933  23.961  49.660  1.00 34.42  ? 303 PHE A CD1    1 
ATOM   2195  C CD2    . PHE A  1 310 ? -46.847  24.250  51.046  1.00 34.81  ? 303 PHE A CD2    1 
ATOM   2196  C CE1    . PHE A  1 310 ? -45.316  22.656  49.406  1.00 32.50  ? 303 PHE A CE1    1 
ATOM   2197  C CE2    . PHE A  1 310 ? -47.234  22.949  50.794  1.00 33.08  ? 303 PHE A CE2    1 
ATOM   2198  C CZ     . PHE A  1 310 ? -46.469  22.152  49.972  1.00 30.93  ? 303 PHE A CZ     1 
ATOM   2199  N N      . GLY A  1 311 ? -42.193  26.737  50.445  1.00 41.01  ? 304 GLY A N      1 
ATOM   2200  C CA     . GLY A  1 311 ? -40.876  26.399  49.926  1.00 41.58  ? 304 GLY A CA     1 
ATOM   2201  C C      . GLY A  1 311 ? -39.840  26.179  51.013  1.00 47.57  ? 304 GLY A C      1 
ATOM   2202  O O      . GLY A  1 311 ? -39.009  25.273  50.916  1.00 47.26  ? 304 GLY A O      1 
ATOM   2203  N N      . ARG A  1 312 ? -39.871  27.003  52.062  1.00 49.81  ? 305 ARG A N      1 
ATOM   2204  C CA     . ARG A  1 312 ? -38.900  26.843  53.142  1.00 47.15  ? 305 ARG A CA     1 
ATOM   2205  C C      . ARG A  1 312 ? -39.092  25.517  53.866  1.00 44.94  ? 305 ARG A C      1 
ATOM   2206  O O      . ARG A  1 312 ? -38.116  24.826  54.181  1.00 43.36  ? 305 ARG A O      1 
ATOM   2207  C CB     . ARG A  1 312 ? -38.999  28.013  54.122  1.00 50.36  ? 305 ARG A CB     1 
ATOM   2208  C CG     . ARG A  1 312 ? -38.289  29.276  53.670  1.00 53.56  ? 305 ARG A CG     1 
ATOM   2209  C CD     . ARG A  1 312 ? -38.415  30.394  54.701  1.00 59.66  ? 305 ARG A CD     1 
ATOM   2210  N NE     . ARG A  1 312 ? -39.671  31.133  54.575  1.00 66.08  ? 305 ARG A NE     1 
ATOM   2211  C CZ     . ARG A  1 312 ? -40.723  31.014  55.381  1.00 70.94  ? 305 ARG A CZ     1 
ATOM   2212  N NH1    . ARG A  1 312 ? -40.709  30.169  56.404  1.00 72.75  ? 305 ARG A NH1    1 
ATOM   2213  N NH2    . ARG A  1 312 ? -41.801  31.754  55.155  1.00 71.03  ? 305 ARG A NH2    1 
ATOM   2214  N N      . LEU A  1 313 ? -40.343  25.138  54.129  1.00 40.68  ? 306 LEU A N      1 
ATOM   2215  C CA     . LEU A  1 313 ? -40.596  23.843  54.747  1.00 44.93  ? 306 LEU A CA     1 
ATOM   2216  C C      . LEU A  1 313 ? -40.139  22.705  53.845  1.00 45.56  ? 306 LEU A C      1 
ATOM   2217  O O      . LEU A  1 313 ? -39.676  21.668  54.334  1.00 46.73  ? 306 LEU A O      1 
ATOM   2218  C CB     . LEU A  1 313 ? -42.082  23.710  55.082  1.00 38.11  ? 306 LEU A CB     1 
ATOM   2219  C CG     . LEU A  1 313 ? -42.620  24.744  56.077  1.00 39.30  ? 306 LEU A CG     1 
ATOM   2220  C CD1    . LEU A  1 313 ? -44.140  24.778  56.063  1.00 40.48  ? 306 LEU A CD1    1 
ATOM   2221  C CD2    . LEU A  1 313 ? -42.092  24.487  57.487  1.00 49.49  ? 306 LEU A CD2    1 
ATOM   2222  N N      . MET A  1 314 ? -40.259  22.882  52.527  1.00 45.67  ? 307 MET A N      1 
ATOM   2223  C CA     . MET A  1 314 ? -39.762  21.877  51.594  1.00 44.44  ? 307 MET A CA     1 
ATOM   2224  C C      . MET A  1 314 ? -38.251  21.717  51.701  1.00 44.74  ? 307 MET A C      1 
ATOM   2225  O O      . MET A  1 314 ? -37.732  20.596  51.640  1.00 48.66  ? 307 MET A O      1 
ATOM   2226  C CB     . MET A  1 314 ? -40.155  22.252  50.167  1.00 46.00  ? 307 MET A CB     1 
ATOM   2227  C CG     . MET A  1 314 ? -41.643  22.171  49.884  1.00 40.45  ? 307 MET A CG     1 
ATOM   2228  S SD     . MET A  1 314 ? -42.019  22.792  48.239  1.00 41.19  ? 307 MET A SD     1 
ATOM   2229  C CE     . MET A  1 314 ? -41.073  21.653  47.230  1.00 40.38  ? 307 MET A CE     1 
ATOM   2230  N N      . VAL A  1 315 ? -37.524  22.827  51.850  1.00 44.10  ? 308 VAL A N      1 
ATOM   2231  C CA     . VAL A  1 315 ? -36.068  22.743  51.900  1.00 46.32  ? 308 VAL A CA     1 
ATOM   2232  C C      . VAL A  1 315 ? -35.612  22.143  53.221  1.00 47.64  ? 308 VAL A C      1 
ATOM   2233  O O      . VAL A  1 315 ? -34.632  21.388  53.271  1.00 48.02  ? 308 VAL A O      1 
ATOM   2234  C CB     . VAL A  1 315 ? -35.434  24.125  51.663  1.00 49.13  ? 308 VAL A CB     1 
ATOM   2235  C CG1    . VAL A  1 315 ? -33.919  24.007  51.666  1.00 48.04  ? 308 VAL A CG1    1 
ATOM   2236  C CG2    . VAL A  1 315 ? -35.919  24.717  50.350  1.00 47.71  ? 308 VAL A CG2    1 
ATOM   2237  N N      . GLU A  1 316 ? -36.310  22.468  54.312  1.00 48.68  ? 309 GLU A N      1 
ATOM   2238  C CA     . GLU A  1 316 ? -36.021  21.825  55.588  1.00 48.90  ? 309 GLU A CA     1 
ATOM   2239  C C      . GLU A  1 316 ? -36.236  20.322  55.495  1.00 49.80  ? 309 GLU A C      1 
ATOM   2240  O O      . GLU A  1 316 ? -35.423  19.536  55.996  1.00 50.53  ? 309 GLU A O      1 
ATOM   2241  C CB     . GLU A  1 316 ? -36.899  22.420  56.688  1.00 48.82  ? 309 GLU A CB     1 
ATOM   2242  C CG     . GLU A  1 316 ? -36.663  23.895  56.961  1.00 56.17  ? 309 GLU A CG     1 
ATOM   2243  C CD     . GLU A  1 316 ? -37.651  24.460  57.967  1.00 63.81  ? 309 GLU A CD     1 
ATOM   2244  O OE1    . GLU A  1 316 ? -38.132  23.683  58.822  1.00 65.60  ? 309 GLU A OE1    1 
ATOM   2245  O OE2    . GLU A  1 316 ? -37.955  25.671  57.899  1.00 65.87  ? 309 GLU A OE2    1 
ATOM   2246  N N      . SER A  1 317 ? -37.330  19.903  54.855  1.00 49.38  ? 310 SER A N      1 
ATOM   2247  C CA     . SER A  1 317 ? -37.587  18.479  54.675  1.00 46.14  ? 310 SER A CA     1 
ATOM   2248  C C      . SER A  1 317 ? -36.416  17.792  53.983  1.00 46.66  ? 310 SER A C      1 
ATOM   2249  O O      . SER A  1 317 ? -36.006  16.696  54.384  1.00 47.03  ? 310 SER A O      1 
ATOM   2250  C CB     . SER A  1 317 ? -38.875  18.278  53.878  1.00 44.27  ? 310 SER A CB     1 
ATOM   2251  O OG     . SER A  1 317 ? -39.090  16.906  53.606  1.00 44.86  ? 310 SER A OG     1 
ATOM   2252  N N      . HIS A  1 318 ? -35.869  18.417  52.938  1.00 46.47  ? 311 HIS A N      1 
ATOM   2253  C CA     . HIS A  1 318 ? -34.739  17.819  52.233  1.00 45.75  ? 311 HIS A CA     1 
ATOM   2254  C C      . HIS A  1 318 ? -33.524  17.712  53.149  1.00 51.48  ? 311 HIS A C      1 
ATOM   2255  O O      . HIS A  1 318 ? -32.869  16.664  53.208  1.00 53.39  ? 311 HIS A O      1 
ATOM   2256  C CB     . HIS A  1 318 ? -34.406  18.622  50.975  1.00 45.38  ? 311 HIS A CB     1 
ATOM   2257  C CG     . HIS A  1 318 ? -33.309  18.019  50.153  1.00 44.53  ? 311 HIS A CG     1 
ATOM   2258  N ND1    . HIS A  1 318 ? -33.482  16.869  49.413  1.00 43.88  ? 311 HIS A ND1    1 
ATOM   2259  C CD2    . HIS A  1 318 ? -32.025  18.401  49.959  1.00 48.54  ? 311 HIS A CD2    1 
ATOM   2260  C CE1    . HIS A  1 318 ? -32.353  16.570  48.797  1.00 45.93  ? 311 HIS A CE1    1 
ATOM   2261  N NE2    . HIS A  1 318 ? -31.452  17.483  49.112  1.00 50.14  ? 311 HIS A NE2    1 
ATOM   2262  N N      . ARG A  1 319 ? -33.198  18.795  53.862  1.00 53.32  ? 312 ARG A N      1 
ATOM   2263  C CA     . ARG A  1 319 ? -32.100  18.740  54.824  1.00 56.03  ? 312 ARG A CA     1 
ATOM   2264  C C      . ARG A  1 319 ? -32.301  17.592  55.806  1.00 55.94  ? 312 ARG A C      1 
ATOM   2265  O O      . ARG A  1 319 ? -31.374  16.824  56.085  1.00 57.46  ? 312 ARG A O      1 
ATOM   2266  C CB     . ARG A  1 319 ? -31.980  20.066  55.584  1.00 58.34  ? 312 ARG A CB     1 
ATOM   2267  C CG     . ARG A  1 319 ? -31.653  21.286  54.736  1.00 61.33  ? 312 ARG A CG     1 
ATOM   2268  C CD     . ARG A  1 319 ? -31.420  22.511  55.617  1.00 64.26  ? 312 ARG A CD     1 
ATOM   2269  N NE     . ARG A  1 319 ? -31.534  23.755  54.861  1.00 65.39  ? 312 ARG A NE     1 
ATOM   2270  C CZ     . ARG A  1 319 ? -30.543  24.307  54.168  1.00 67.53  ? 312 ARG A CZ     1 
ATOM   2271  N NH1    . ARG A  1 319 ? -29.350  23.727  54.134  1.00 72.16  ? 312 ARG A NH1    1 
ATOM   2272  N NH2    . ARG A  1 319 ? -30.747  25.441  53.507  1.00 62.46  ? 312 ARG A NH2    1 
ATOM   2273  N N      . SER A  1 320 ? -33.515  17.471  56.350  1.00 53.79  ? 313 SER A N      1 
ATOM   2274  C CA     . SER A  1 320 ? -33.819  16.379  57.269  1.00 54.63  ? 313 SER A CA     1 
ATOM   2275  C C      . SER A  1 320 ? -33.641  15.025  56.592  1.00 56.55  ? 313 SER A C      1 
ATOM   2276  O O      . SER A  1 320 ? -33.014  14.117  57.149  1.00 57.70  ? 313 SER A O      1 
ATOM   2277  C CB     . SER A  1 320 ? -35.242  16.532  57.809  1.00 54.79  ? 313 SER A CB     1 
ATOM   2278  O OG     . SER A  1 320 ? -35.558  15.495  58.722  1.00 57.89  ? 313 SER A OG     1 
ATOM   2279  N N      . LEU A  1 321 ? -34.184  14.873  55.381  1.00 53.11  ? 314 LEU A N      1 
ATOM   2280  C CA     . LEU A  1 321 ? -34.068  13.599  54.677  1.00 50.44  ? 314 LEU A CA     1 
ATOM   2281  C C      . LEU A  1 321 ? -32.625  13.282  54.313  1.00 51.12  ? 314 LEU A C      1 
ATOM   2282  O O      . LEU A  1 321 ? -32.260  12.107  54.204  1.00 51.46  ? 314 LEU A O      1 
ATOM   2283  C CB     . LEU A  1 321 ? -34.940  13.599  53.420  1.00 42.89  ? 314 LEU A CB     1 
ATOM   2284  C CG     . LEU A  1 321 ? -36.457  13.495  53.596  1.00 40.04  ? 314 LEU A CG     1 
ATOM   2285  C CD1    . LEU A  1 321 ? -37.167  13.923  52.320  1.00 36.69  ? 314 LEU A CD1    1 
ATOM   2286  C CD2    . LEU A  1 321 ? -36.859  12.078  53.975  1.00 37.27  ? 314 LEU A CD2    1 
ATOM   2287  N N      . ARG A  1 322 ? -31.795  14.305  54.117  1.00 52.86  ? 315 ARG A N      1 
ATOM   2288  C CA     . ARG A  1 322 ? -30.417  14.069  53.705  1.00 57.80  ? 315 ARG A CA     1 
ATOM   2289  C C      . ARG A  1 322 ? -29.515  13.763  54.893  1.00 60.95  ? 315 ARG A C      1 
ATOM   2290  O O      . ARG A  1 322 ? -28.591  12.951  54.780  1.00 63.27  ? 315 ARG A O      1 
ATOM   2291  C CB     . ARG A  1 322 ? -29.888  15.285  52.954  1.00 55.21  ? 315 ARG A CB     1 
ATOM   2292  C CG     . ARG A  1 322 ? -28.489  15.137  52.418  1.00 56.62  ? 315 ARG A CG     1 
ATOM   2293  C CD     . ARG A  1 322 ? -28.000  16.487  51.966  1.00 55.71  ? 315 ARG A CD     1 
ATOM   2294  N NE     . ARG A  1 322 ? -27.834  17.383  53.108  1.00 55.17  ? 315 ARG A NE     1 
ATOM   2295  C CZ     . ARG A  1 322 ? -27.924  18.707  53.049  1.00 65.63  ? 315 ARG A CZ     1 
ATOM   2296  N NH1    . ARG A  1 322 ? -28.070  19.313  51.878  1.00 67.71  ? 315 ARG A NH1    1 
ATOM   2297  N NH2    . ARG A  1 322 ? -27.764  19.429  54.151  1.00 68.40  ? 315 ARG A NH2    1 
ATOM   2298  N N      . ASP A  1 323 ? -29.756  14.407  56.034  1.00 59.84  ? 316 ASP A N      1 
ATOM   2299  C CA     . ASP A  1 323 ? -28.851  14.307  57.172  1.00 58.62  ? 316 ASP A CA     1 
ATOM   2300  C C      . ASP A  1 323 ? -29.301  13.288  58.209  1.00 57.56  ? 316 ASP A C      1 
ATOM   2301  O O      . ASP A  1 323 ? -28.513  12.430  58.615  1.00 63.11  ? 316 ASP A O      1 
ATOM   2302  C CB     . ASP A  1 323 ? -28.706  15.675  57.849  1.00 58.77  ? 316 ASP A CB     1 
ATOM   2303  C CG     . ASP A  1 323 ? -28.151  16.732  56.919  1.00 58.93  ? 316 ASP A CG     1 
ATOM   2304  O OD1    . ASP A  1 323 ? -27.500  16.361  55.921  1.00 59.06  ? 316 ASP A OD1    1 
ATOM   2305  O OD2    . ASP A  1 323 ? -28.361  17.933  57.191  1.00 57.03  ? 316 ASP A OD2    1 
ATOM   2306  N N      . ASP A  1 324 ? -30.556  13.363  58.646  1.00 59.20  ? 317 ASP A N      1 
ATOM   2307  C CA     . ASP A  1 324 ? -31.034  12.489  59.709  1.00 61.95  ? 317 ASP A CA     1 
ATOM   2308  C C      . ASP A  1 324 ? -31.521  11.141  59.187  1.00 61.13  ? 317 ASP A C      1 
ATOM   2309  O O      . ASP A  1 324 ? -31.175  10.096  59.748  1.00 61.45  ? 317 ASP A O      1 
ATOM   2310  C CB     . ASP A  1 324 ? -32.146  13.189  60.496  1.00 62.56  ? 317 ASP A CB     1 
ATOM   2311  C CG     . ASP A  1 324 ? -31.608  14.206  61.485  1.00 65.05  ? 317 ASP A CG     1 
ATOM   2312  O OD1    . ASP A  1 324 ? -30.377  14.247  61.695  1.00 68.26  ? 317 ASP A OD1    1 
ATOM   2313  O OD2    . ASP A  1 324 ? -32.419  14.963  62.057  1.00 64.52  ? 317 ASP A OD2    1 
ATOM   2314  N N      . TYR A  1 325 ? -32.322  11.142  58.123  1.00 59.04  ? 318 TYR A N      1 
ATOM   2315  C CA     . TYR A  1 325 ? -32.861  9.898   57.589  1.00 58.08  ? 318 TYR A CA     1 
ATOM   2316  C C      . TYR A  1 325 ? -31.949  9.248   56.560  1.00 59.46  ? 318 TYR A C      1 
ATOM   2317  O O      . TYR A  1 325 ? -32.066  8.038   56.330  1.00 60.22  ? 318 TYR A O      1 
ATOM   2318  C CB     . TYR A  1 325 ? -34.235  10.140  56.960  1.00 58.03  ? 318 TYR A CB     1 
ATOM   2319  C CG     . TYR A  1 325 ? -35.246  9.061   57.274  1.00 56.72  ? 318 TYR A CG     1 
ATOM   2320  C CD1    . TYR A  1 325 ? -35.753  8.913   58.557  1.00 57.41  ? 318 TYR A CD1    1 
ATOM   2321  C CD2    . TYR A  1 325 ? -35.688  8.187   56.289  1.00 53.47  ? 318 TYR A CD2    1 
ATOM   2322  C CE1    . TYR A  1 325 ? -36.680  7.931   58.850  1.00 57.83  ? 318 TYR A CE1    1 
ATOM   2323  C CE2    . TYR A  1 325 ? -36.611  7.199   56.574  1.00 54.13  ? 318 TYR A CE2    1 
ATOM   2324  C CZ     . TYR A  1 325 ? -37.105  7.078   57.854  1.00 55.15  ? 318 TYR A CZ     1 
ATOM   2325  O OH     . TYR A  1 325 ? -38.023  6.096   58.141  1.00 53.84  ? 318 TYR A OH     1 
ATOM   2326  N N      . GLU A  1 326 ? -31.042  10.013  55.951  1.00 61.74  ? 319 GLU A N      1 
ATOM   2327  C CA     . GLU A  1 326 ? -30.126  9.489   54.944  1.00 66.97  ? 319 GLU A CA     1 
ATOM   2328  C C      . GLU A  1 326 ? -30.840  8.595   53.937  1.00 66.68  ? 319 GLU A C      1 
ATOM   2329  O O      . GLU A  1 326 ? -30.604  7.382   53.904  1.00 68.40  ? 319 GLU A O      1 
ATOM   2330  C CB     . GLU A  1 326 ? -28.992  8.714   55.619  1.00 71.84  ? 319 GLU A CB     1 
ATOM   2331  C CG     . GLU A  1 326 ? -28.215  9.521   56.650  1.00 74.07  ? 319 GLU A CG     1 
ATOM   2332  C CD     . GLU A  1 326 ? -27.114  8.717   57.317  1.00 78.99  ? 319 GLU A CD     1 
ATOM   2333  O OE1    . GLU A  1 326 ? -27.213  7.473   57.353  1.00 80.40  ? 319 GLU A OE1    1 
ATOM   2334  O OE2    . GLU A  1 326 ? -26.146  9.334   57.806  1.00 83.32  ? 319 GLU A OE2    1 
ATOM   2335  N N      . VAL A  1 327 ? -31.711  9.178   53.114  1.00 68.23  ? 320 VAL A N      1 
ATOM   2336  C CA     . VAL A  1 327 ? -32.375  8.428   52.054  1.00 71.50  ? 320 VAL A CA     1 
ATOM   2337  C C      . VAL A  1 327 ? -32.212  9.143   50.718  1.00 74.91  ? 320 VAL A C      1 
ATOM   2338  O O      . VAL A  1 327 ? -32.806  8.741   49.712  1.00 73.36  ? 320 VAL A O      1 
ATOM   2339  C CB     . VAL A  1 327 ? -33.863  8.210   52.383  1.00 68.95  ? 320 VAL A CB     1 
ATOM   2340  C CG1    . VAL A  1 327 ? -34.002  7.301   53.594  1.00 71.38  ? 320 VAL A CG1    1 
ATOM   2341  C CG2    . VAL A  1 327 ? -34.553  9.543   52.632  1.00 68.88  ? 320 VAL A CG2    1 
ATOM   2342  N N      . SER A  1 328 ? -31.409  10.202  50.697  1.00 76.72  ? 321 SER A N      1 
ATOM   2343  C CA     . SER A  1 328 ? -31.099  10.908  49.464  1.00 77.74  ? 321 SER A CA     1 
ATOM   2344  C C      . SER A  1 328 ? -29.825  10.322  48.856  1.00 81.08  ? 321 SER A C      1 
ATOM   2345  O O      . SER A  1 328 ? -29.331  9.275   49.284  1.00 85.26  ? 321 SER A O      1 
ATOM   2346  C CB     . SER A  1 328 ? -30.982  12.409  49.719  1.00 75.23  ? 321 SER A CB     1 
ATOM   2347  O OG     . SER A  1 328 ? -29.804  12.715  50.444  1.00 79.32  ? 321 SER A OG     1 
ATOM   2348  N N      . CYS A  1 329 ? -29.279  10.996  47.849  1.00 83.94  ? 322 CYS A N      1 
ATOM   2349  C CA     . CYS A  1 329 ? -28.043  10.566  47.209  1.00 88.17  ? 322 CYS A CA     1 
ATOM   2350  C C      . CYS A  1 329 ? -27.405  11.780  46.551  1.00 90.32  ? 322 CYS A C      1 
ATOM   2351  O O      . CYS A  1 329 ? -28.038  12.839  46.438  1.00 89.76  ? 322 CYS A O      1 
ATOM   2352  C CB     . CYS A  1 329 ? -28.296  9.451   46.180  1.00 91.69  ? 322 CYS A CB     1 
ATOM   2353  S SG     . CYS A  1 329 ? -29.233  9.961   44.722  1.00 92.65  ? 322 CYS A SG     1 
ATOM   2354  N N      . PRO A  1 330 ? -26.148  11.664  46.113  1.00 92.52  ? 323 PRO A N      1 
ATOM   2355  C CA     . PRO A  1 330 ? -25.471  12.832  45.521  1.00 92.63  ? 323 PRO A CA     1 
ATOM   2356  C C      . PRO A  1 330 ? -26.230  13.465  44.366  1.00 89.33  ? 323 PRO A C      1 
ATOM   2357  O O      . PRO A  1 330 ? -26.295  14.697  44.281  1.00 91.90  ? 323 PRO A O      1 
ATOM   2358  C CB     . PRO A  1 330 ? -24.127  12.249  45.062  1.00 94.69  ? 323 PRO A CB     1 
ATOM   2359  C CG     . PRO A  1 330 ? -23.896  11.088  45.972  1.00 95.83  ? 323 PRO A CG     1 
ATOM   2360  C CD     . PRO A  1 330 ? -25.255  10.497  46.214  1.00 94.06  ? 323 PRO A CD     1 
ATOM   2361  N N      . GLU A  1 331 ? -26.810  12.658  43.475  1.00 84.94  ? 324 GLU A N      1 
ATOM   2362  C CA     . GLU A  1 331 ? -27.545  13.213  42.342  1.00 81.47  ? 324 GLU A CA     1 
ATOM   2363  C C      . GLU A  1 331 ? -28.708  14.085  42.805  1.00 75.85  ? 324 GLU A C      1 
ATOM   2364  O O      . GLU A  1 331 ? -28.870  15.220  42.342  1.00 72.68  ? 324 GLU A O      1 
ATOM   2365  C CB     . GLU A  1 331 ? -28.053  12.087  41.439  1.00 85.31  ? 324 GLU A CB     1 
ATOM   2366  C CG     . GLU A  1 331 ? -26.969  11.317  40.696  1.00 91.08  ? 324 GLU A CG     1 
ATOM   2367  C CD     . GLU A  1 331 ? -26.257  10.300  41.570  1.00 95.15  ? 324 GLU A CD     1 
ATOM   2368  O OE1    . GLU A  1 331 ? -26.452  10.326  42.804  1.00 95.33  ? 324 GLU A OE1    1 
ATOM   2369  O OE2    . GLU A  1 331 ? -25.503  9.471   41.017  1.00 97.89  ? 324 GLU A OE2    1 
ATOM   2370  N N      . LEU A  1 332 ? -29.533  13.570  43.719  1.00 72.40  ? 325 LEU A N      1 
ATOM   2371  C CA     . LEU A  1 332 ? -30.665  14.349  44.214  1.00 65.37  ? 325 LEU A CA     1 
ATOM   2372  C C      . LEU A  1 332 ? -30.206  15.635  44.890  1.00 61.59  ? 325 LEU A C      1 
ATOM   2373  O O      . LEU A  1 332 ? -30.777  16.707  44.657  1.00 56.88  ? 325 LEU A O      1 
ATOM   2374  C CB     . LEU A  1 332 ? -31.503  13.504  45.171  1.00 63.63  ? 325 LEU A CB     1 
ATOM   2375  C CG     . LEU A  1 332 ? -32.336  12.409  44.503  1.00 62.28  ? 325 LEU A CG     1 
ATOM   2376  C CD1    . LEU A  1 332 ? -33.091  11.603  45.542  1.00 61.75  ? 325 LEU A CD1    1 
ATOM   2377  C CD2    . LEU A  1 332 ? -33.296  13.015  43.490  1.00 60.63  ? 325 LEU A CD2    1 
ATOM   2378  N N      . ASP A  1 333 ? -29.171  15.549  45.727  1.00 63.04  ? 326 ASP A N      1 
ATOM   2379  C CA     . ASP A  1 333 ? -28.684  16.740  46.413  1.00 59.36  ? 326 ASP A CA     1 
ATOM   2380  C C      . ASP A  1 333 ? -28.192  17.774  45.410  1.00 56.31  ? 326 ASP A C      1 
ATOM   2381  O O      . ASP A  1 333 ? -28.362  18.981  45.614  1.00 51.77  ? 326 ASP A O      1 
ATOM   2382  C CB     . ASP A  1 333 ? -27.582  16.363  47.403  1.00 59.25  ? 326 ASP A CB     1 
ATOM   2383  C CG     . ASP A  1 333 ? -28.079  15.433  48.497  1.00 61.36  ? 326 ASP A CG     1 
ATOM   2384  O OD1    . ASP A  1 333 ? -29.294  15.460  48.792  1.00 59.96  ? 326 ASP A OD1    1 
ATOM   2385  O OD2    . ASP A  1 333 ? -27.258  14.673  49.056  1.00 61.52  ? 326 ASP A OD2    1 
ATOM   2386  N N      . GLN A  1 334 ? -27.559  17.315  44.329  1.00 58.23  ? 327 GLN A N      1 
ATOM   2387  C CA     . GLN A  1 334 ? -27.104  18.229  43.287  1.00 61.72  ? 327 GLN A CA     1 
ATOM   2388  C C      . GLN A  1 334 ? -28.280  18.898  42.582  1.00 60.34  ? 327 GLN A C      1 
ATOM   2389  O O      . GLN A  1 334 ? -28.234  20.099  42.292  1.00 60.09  ? 327 GLN A O      1 
ATOM   2390  C CB     . GLN A  1 334 ? -26.230  17.469  42.290  1.00 65.73  ? 327 GLN A CB     1 
ATOM   2391  C CG     . GLN A  1 334 ? -25.821  18.248  41.055  1.00 65.49  ? 327 GLN A CG     1 
ATOM   2392  C CD     . GLN A  1 334 ? -25.091  17.378  40.046  1.00 67.04  ? 327 GLN A CD     1 
ATOM   2393  O OE1    . GLN A  1 334 ? -24.430  17.882  39.139  1.00 67.62  ? 327 GLN A OE1    1 
ATOM   2394  N NE2    . GLN A  1 334 ? -25.212  16.064  40.199  1.00 67.73  ? 327 GLN A NE2    1 
ATOM   2395  N N      . LEU A  1 335 ? -29.347  18.142  42.307  1.00 58.51  ? 328 LEU A N      1 
ATOM   2396  C CA     . LEU A  1 335 ? -30.525  18.731  41.676  1.00 56.16  ? 328 LEU A CA     1 
ATOM   2397  C C      . LEU A  1 335 ? -31.193  19.755  42.586  1.00 54.57  ? 328 LEU A C      1 
ATOM   2398  O O      . LEU A  1 335 ? -31.621  20.819  42.123  1.00 51.83  ? 328 LEU A O      1 
ATOM   2399  C CB     . LEU A  1 335 ? -31.519  17.638  41.284  1.00 56.97  ? 328 LEU A CB     1 
ATOM   2400  C CG     . LEU A  1 335 ? -31.118  16.727  40.125  1.00 59.41  ? 328 LEU A CG     1 
ATOM   2401  C CD1    . LEU A  1 335 ? -32.230  15.735  39.833  1.00 59.42  ? 328 LEU A CD1    1 
ATOM   2402  C CD2    . LEU A  1 335 ? -30.794  17.547  38.889  1.00 58.77  ? 328 LEU A CD2    1 
ATOM   2403  N N      . VAL A  1 336 ? -31.293  19.453  43.883  1.00 54.62  ? 329 VAL A N      1 
ATOM   2404  C CA     . VAL A  1 336 ? -31.960  20.365  44.809  1.00 54.14  ? 329 VAL A CA     1 
ATOM   2405  C C      . VAL A  1 336 ? -31.202  21.683  44.899  1.00 56.61  ? 329 VAL A C      1 
ATOM   2406  O O      . VAL A  1 336 ? -31.802  22.764  44.867  1.00 58.15  ? 329 VAL A O      1 
ATOM   2407  C CB     . VAL A  1 336 ? -32.121  19.705  46.191  1.00 51.81  ? 329 VAL A CB     1 
ATOM   2408  C CG1    . VAL A  1 336 ? -32.695  20.700  47.187  1.00 49.25  ? 329 VAL A CG1    1 
ATOM   2409  C CG2    . VAL A  1 336 ? -33.012  18.479  46.089  1.00 50.11  ? 329 VAL A CG2    1 
ATOM   2410  N N      . GLU A  1 337 ? -29.874  21.619  45.014  1.00 57.92  ? 330 GLU A N      1 
ATOM   2411  C CA     . GLU A  1 337 ? -29.085  22.838  45.156  1.00 63.03  ? 330 GLU A CA     1 
ATOM   2412  C C      . GLU A  1 337 ? -29.212  23.725  43.923  1.00 61.85  ? 330 GLU A C      1 
ATOM   2413  O O      . GLU A  1 337 ? -29.433  24.936  44.035  1.00 60.19  ? 330 GLU A O      1 
ATOM   2414  C CB     . GLU A  1 337 ? -27.620  22.482  45.410  1.00 72.12  ? 330 GLU A CB     1 
ATOM   2415  C CG     . GLU A  1 337 ? -27.380  21.729  46.703  1.00 78.39  ? 330 GLU A CG     1 
ATOM   2416  C CD     . GLU A  1 337 ? -27.547  22.611  47.924  1.00 83.56  ? 330 GLU A CD     1 
ATOM   2417  O OE1    . GLU A  1 337 ? -27.381  23.843  47.795  1.00 85.59  ? 330 GLU A OE1    1 
ATOM   2418  O OE2    . GLU A  1 337 ? -27.847  22.071  49.009  1.00 85.32  ? 330 GLU A OE2    1 
ATOM   2419  N N      . ALA A  1 338 ? -29.076  23.136  42.733  1.00 60.16  ? 331 ALA A N      1 
ATOM   2420  C CA     . ALA A  1 338 ? -29.206  23.915  41.507  1.00 57.66  ? 331 ALA A CA     1 
ATOM   2421  C C      . ALA A  1 338 ? -30.562  24.605  41.423  1.00 54.82  ? 331 ALA A C      1 
ATOM   2422  O O      . ALA A  1 338 ? -30.649  25.769  41.014  1.00 55.00  ? 331 ALA A O      1 
ATOM   2423  C CB     . ALA A  1 338 ? -28.984  23.019  40.289  1.00 57.56  ? 331 ALA A CB     1 
ATOM   2424  N N      . ALA A  1 339 ? -31.631  23.905  41.812  1.00 54.94  ? 332 ALA A N      1 
ATOM   2425  C CA     . ALA A  1 339 ? -32.965  24.494  41.749  1.00 56.33  ? 332 ALA A CA     1 
ATOM   2426  C C      . ALA A  1 339 ? -33.090  25.697  42.676  1.00 61.66  ? 332 ALA A C      1 
ATOM   2427  O O      . ALA A  1 339 ? -33.756  26.683  42.338  1.00 64.72  ? 332 ALA A O      1 
ATOM   2428  C CB     . ALA A  1 339 ? -34.021  23.441  42.089  1.00 53.08  ? 332 ALA A CB     1 
ATOM   2429  N N      . LEU A  1 340 ? -32.457  25.637  43.849  1.00 64.29  ? 333 LEU A N      1 
ATOM   2430  C CA     . LEU A  1 340 ? -32.591  26.719  44.817  1.00 61.90  ? 333 LEU A CA     1 
ATOM   2431  C C      . LEU A  1 340 ? -31.876  27.986  44.366  1.00 62.42  ? 333 LEU A C      1 
ATOM   2432  O O      . LEU A  1 340 ? -32.173  29.068  44.883  1.00 62.51  ? 333 LEU A O      1 
ATOM   2433  C CB     . LEU A  1 340 ? -32.066  26.269  46.182  1.00 62.35  ? 333 LEU A CB     1 
ATOM   2434  C CG     . LEU A  1 340 ? -32.856  25.130  46.835  1.00 61.22  ? 333 LEU A CG     1 
ATOM   2435  C CD1    . LEU A  1 340 ? -32.188  24.635  48.114  1.00 62.93  ? 333 LEU A CD1    1 
ATOM   2436  C CD2    . LEU A  1 340 ? -34.281  25.567  47.104  1.00 55.99  ? 333 LEU A CD2    1 
ATOM   2437  N N      . ALA A  1 341 ? -30.940  27.877  43.423  1.00 60.43  ? 334 ALA A N      1 
ATOM   2438  C CA     . ALA A  1 341 ? -30.270  29.053  42.885  1.00 58.04  ? 334 ALA A CA     1 
ATOM   2439  C C      . ALA A  1 341 ? -31.139  29.813  41.891  1.00 56.60  ? 334 ALA A C      1 
ATOM   2440  O O      . ALA A  1 341 ? -30.877  30.994  41.636  1.00 61.31  ? 334 ALA A O      1 
ATOM   2441  C CB     . ALA A  1 341 ? -28.950  28.654  42.222  1.00 54.17  ? 334 ALA A CB     1 
ATOM   2442  N N      . VAL A  1 342 ? -32.161  29.173  41.339  1.00 53.77  ? 335 VAL A N      1 
ATOM   2443  C CA     . VAL A  1 342 ? -32.994  29.803  40.312  1.00 51.81  ? 335 VAL A CA     1 
ATOM   2444  C C      . VAL A  1 342 ? -33.948  30.789  40.983  1.00 51.17  ? 335 VAL A C      1 
ATOM   2445  O O      . VAL A  1 342 ? -34.642  30.412  41.941  1.00 53.60  ? 335 VAL A O      1 
ATOM   2446  C CB     . VAL A  1 342 ? -33.764  28.745  39.527  1.00 50.23  ? 335 VAL A CB     1 
ATOM   2447  C CG1    . VAL A  1 342 ? -34.658  29.400  38.489  1.00 50.61  ? 335 VAL A CG1    1 
ATOM   2448  C CG2    . VAL A  1 342 ? -32.806  27.759  38.868  1.00 50.09  ? 335 VAL A CG2    1 
ATOM   2449  N N      . PRO A  1 343 ? -34.015  32.034  40.519  1.00 48.62  ? 336 PRO A N      1 
ATOM   2450  C CA     . PRO A  1 343 ? -35.020  32.964  41.045  1.00 47.61  ? 336 PRO A CA     1 
ATOM   2451  C C      . PRO A  1 343 ? -36.424  32.539  40.648  1.00 46.39  ? 336 PRO A C      1 
ATOM   2452  O O      . PRO A  1 343 ? -36.654  31.991  39.568  1.00 46.49  ? 336 PRO A O      1 
ATOM   2453  C CB     . PRO A  1 343 ? -34.639  34.305  40.404  1.00 43.00  ? 336 PRO A CB     1 
ATOM   2454  C CG     . PRO A  1 343 ? -33.210  34.138  39.971  1.00 51.74  ? 336 PRO A CG     1 
ATOM   2455  C CD     . PRO A  1 343 ? -33.069  32.693  39.605  1.00 52.56  ? 336 PRO A CD     1 
ATOM   2456  N N      . GLY A  1 344 ? -37.373  32.799  41.546  1.00 44.70  ? 337 GLY A N      1 
ATOM   2457  C CA     . GLY A  1 344 ? -38.731  32.337  41.373  1.00 37.45  ? 337 GLY A CA     1 
ATOM   2458  C C      . GLY A  1 344 ? -39.005  30.974  41.966  1.00 44.13  ? 337 GLY A C      1 
ATOM   2459  O O      . GLY A  1 344 ? -40.175  30.582  42.065  1.00 45.15  ? 337 GLY A O      1 
ATOM   2460  N N      . VAL A  1 345 ? -37.968  30.239  42.359  1.00 43.99  ? 338 VAL A N      1 
ATOM   2461  C CA     . VAL A  1 345 ? -38.138  28.939  42.997  1.00 43.84  ? 338 VAL A CA     1 
ATOM   2462  C C      . VAL A  1 345 ? -38.390  29.144  44.485  1.00 44.21  ? 338 VAL A C      1 
ATOM   2463  O O      . VAL A  1 345 ? -37.619  29.825  45.170  1.00 49.73  ? 338 VAL A O      1 
ATOM   2464  C CB     . VAL A  1 345 ? -36.906  28.052  42.761  1.00 37.29  ? 338 VAL A CB     1 
ATOM   2465  C CG1    . VAL A  1 345 ? -36.981  26.800  43.622  1.00 36.93  ? 338 VAL A CG1    1 
ATOM   2466  C CG2    . VAL A  1 345 ? -36.780  27.692  41.287  1.00 41.27  ? 338 VAL A CG2    1 
ATOM   2467  N N      . TYR A  1 346 ? -39.476  28.550  44.988  1.00 45.57  ? 339 TYR A N      1 
ATOM   2468  C CA     . TYR A  1 346 ? -39.783  28.643  46.412  1.00 45.23  ? 339 TYR A CA     1 
ATOM   2469  C C      . TYR A  1 346 ? -39.037  27.593  47.226  1.00 47.11  ? 339 TYR A C      1 
ATOM   2470  O O      . TYR A  1 346 ? -38.586  27.876  48.341  1.00 49.24  ? 339 TYR A O      1 
ATOM   2471  C CB     . TYR A  1 346 ? -41.289  28.505  46.639  1.00 43.60  ? 339 TYR A CB     1 
ATOM   2472  C CG     . TYR A  1 346 ? -42.117  29.579  45.974  1.00 45.61  ? 339 TYR A CG     1 
ATOM   2473  C CD1    . TYR A  1 346 ? -42.171  30.862  46.504  1.00 46.44  ? 339 TYR A CD1    1 
ATOM   2474  C CD2    . TYR A  1 346 ? -42.853  29.311  44.827  1.00 42.24  ? 339 TYR A CD2    1 
ATOM   2475  C CE1    . TYR A  1 346 ? -42.930  31.853  45.906  1.00 44.89  ? 339 TYR A CE1    1 
ATOM   2476  C CE2    . TYR A  1 346 ? -43.614  30.295  44.221  1.00 41.06  ? 339 TYR A CE2    1 
ATOM   2477  C CZ     . TYR A  1 346 ? -43.648  31.561  44.765  1.00 43.03  ? 339 TYR A CZ     1 
ATOM   2478  O OH     . TYR A  1 346 ? -44.407  32.533  44.158  1.00 45.39  ? 339 TYR A OH     1 
ATOM   2479  N N      . GLY A  1 347 ? -38.894  26.388  46.690  1.00 44.94  ? 340 GLY A N      1 
ATOM   2480  C CA     . GLY A  1 347 ? -38.203  25.329  47.404  1.00 45.83  ? 340 GLY A CA     1 
ATOM   2481  C C      . GLY A  1 347 ? -38.112  24.099  46.530  1.00 45.01  ? 340 GLY A C      1 
ATOM   2482  O O      . GLY A  1 347 ? -38.734  24.013  45.466  1.00 46.84  ? 340 GLY A O      1 
ATOM   2483  N N      . SER A  1 348 ? -37.313  23.141  46.996  1.00 35.75  ? 341 SER A N      1 
ATOM   2484  C CA     . SER A  1 348 ? -37.107  21.904  46.257  1.00 35.95  ? 341 SER A CA     1 
ATOM   2485  C C      . SER A  1 348 ? -36.589  20.843  47.215  1.00 48.20  ? 341 SER A C      1 
ATOM   2486  O O      . SER A  1 348 ? -35.952  21.153  48.225  1.00 52.88  ? 341 SER A O      1 
ATOM   2487  C CB     . SER A  1 348 ? -36.131  22.096  45.089  1.00 42.42  ? 341 SER A CB     1 
ATOM   2488  O OG     . SER A  1 348 ? -36.052  20.927  44.289  1.00 43.52  ? 341 SER A OG     1 
ATOM   2489  N N      . ARG A  1 349 ? -36.876  19.588  46.884  1.00 51.48  ? 342 ARG A N      1 
ATOM   2490  C CA     . ARG A  1 349 ? -36.484  18.460  47.718  1.00 48.24  ? 342 ARG A CA     1 
ATOM   2491  C C      . ARG A  1 349 ? -36.750  17.180  46.944  1.00 52.07  ? 342 ARG A C      1 
ATOM   2492  O O      . ARG A  1 349 ? -37.484  17.176  45.951  1.00 54.18  ? 342 ARG A O      1 
ATOM   2493  C CB     . ARG A  1 349 ? -37.246  18.443  49.045  1.00 44.20  ? 342 ARG A CB     1 
ATOM   2494  C CG     . ARG A  1 349 ? -38.751  18.313  48.878  1.00 45.13  ? 342 ARG A CG     1 
ATOM   2495  C CD     . ARG A  1 349 ? -39.443  18.083  50.212  1.00 46.47  ? 342 ARG A CD     1 
ATOM   2496  N NE     . ARG A  1 349 ? -40.601  17.207  50.071  1.00 47.53  ? 342 ARG A NE     1 
ATOM   2497  C CZ     . ARG A  1 349 ? -40.585  15.902  50.324  1.00 52.79  ? 342 ARG A CZ     1 
ATOM   2498  N NH1    . ARG A  1 349 ? -39.473  15.318  50.751  1.00 58.00  ? 342 ARG A NH1    1 
ATOM   2499  N NH2    . ARG A  1 349 ? -41.683  15.181  50.163  1.00 53.59  ? 342 ARG A NH2    1 
ATOM   2500  N N      . MET A  1 350 ? -36.145  16.095  47.413  1.00 54.55  ? 343 MET A N      1 
ATOM   2501  C CA     . MET A  1 350 ? -36.439  14.782  46.863  1.00 55.52  ? 343 MET A CA     1 
ATOM   2502  C C      . MET A  1 350 ? -37.844  14.341  47.252  1.00 52.39  ? 343 MET A C      1 
ATOM   2503  O O      . MET A  1 350 ? -38.390  14.754  48.279  1.00 52.12  ? 343 MET A O      1 
ATOM   2504  C CB     . MET A  1 350 ? -35.428  13.751  47.358  1.00 60.17  ? 343 MET A CB     1 
ATOM   2505  C CG     . MET A  1 350 ? -35.346  13.656  48.871  1.00 64.87  ? 343 MET A CG     1 
ATOM   2506  S SD     . MET A  1 350 ? -34.787  12.036  49.441  1.00 68.50  ? 343 MET A SD     1 
ATOM   2507  C CE     . MET A  1 350 ? -36.303  11.083  49.330  1.00 65.22  ? 343 MET A CE     1 
ATOM   2508  N N      . THR A  1 351 ? -38.431  13.497  46.411  1.00 52.64  ? 344 THR A N      1 
ATOM   2509  C CA     . THR A  1 351 ? -39.714  12.878  46.696  1.00 50.28  ? 344 THR A CA     1 
ATOM   2510  C C      . THR A  1 351 ? -39.590  11.376  46.494  1.00 50.90  ? 344 THR A C      1 
ATOM   2511  O O      . THR A  1 351 ? -38.655  10.888  45.854  1.00 56.34  ? 344 THR A O      1 
ATOM   2512  C CB     . THR A  1 351 ? -40.837  13.442  45.814  1.00 48.74  ? 344 THR A CB     1 
ATOM   2513  O OG1    . THR A  1 351 ? -40.409  13.467  44.447  1.00 50.61  ? 344 THR A OG1    1 
ATOM   2514  C CG2    . THR A  1 351 ? -41.196  14.847  46.254  1.00 49.50  ? 344 THR A CG2    1 
ATOM   2515  N N      . GLY A  1 352 ? -40.554  10.648  47.039  1.00 49.01  ? 345 GLY A N      1 
ATOM   2516  C CA     . GLY A  1 352 ? -40.518  9.205   46.961  1.00 54.25  ? 345 GLY A CA     1 
ATOM   2517  C C      . GLY A  1 352 ? -39.600  8.607   48.012  1.00 58.56  ? 345 GLY A C      1 
ATOM   2518  O O      . GLY A  1 352 ? -39.236  9.244   49.007  1.00 61.49  ? 345 GLY A O      1 
ATOM   2519  N N      . GLY A  1 353 ? -39.213  7.354   47.772  1.00 59.38  ? 346 GLY A N      1 
ATOM   2520  C CA     . GLY A  1 353 ? -38.403  6.643   48.749  1.00 58.89  ? 346 GLY A CA     1 
ATOM   2521  C C      . GLY A  1 353 ? -37.003  7.208   48.903  1.00 59.81  ? 346 GLY A C      1 
ATOM   2522  O O      . GLY A  1 353 ? -36.462  7.249   50.012  1.00 59.70  ? 346 GLY A O      1 
ATOM   2523  N N      . GLY A  1 354 ? -36.400  7.651   47.810  1.00 61.80  ? 347 GLY A N      1 
ATOM   2524  C CA     . GLY A  1 354 ? -35.049  8.176   47.839  1.00 65.87  ? 347 GLY A CA     1 
ATOM   2525  C C      . GLY A  1 354 ? -34.071  7.237   47.155  1.00 68.98  ? 347 GLY A C      1 
ATOM   2526  O O      . GLY A  1 354 ? -34.446  6.279   46.474  1.00 70.49  ? 347 GLY A O      1 
ATOM   2527  N N      . PHE A  1 355 ? -32.784  7.534   47.348  1.00 70.81  ? 348 PHE A N      1 
ATOM   2528  C CA     . PHE A  1 355 ? -31.708  6.750   46.745  1.00 73.28  ? 348 PHE A CA     1 
ATOM   2529  C C      . PHE A  1 355 ? -31.742  6.852   45.225  1.00 74.92  ? 348 PHE A C      1 
ATOM   2530  O O      . PHE A  1 355 ? -31.340  5.925   44.516  1.00 78.73  ? 348 PHE A O      1 
ATOM   2531  C CB     . PHE A  1 355 ? -31.771  5.285   47.187  1.00 74.17  ? 348 PHE A CB     1 
ATOM   2532  N N      . GLY A  1 356 ? -32.223  7.987   44.723  1.00 69.89  ? 349 GLY A N      1 
ATOM   2533  C CA     . GLY A  1 356 ? -32.507  8.212   43.327  1.00 67.30  ? 349 GLY A CA     1 
ATOM   2534  C C      . GLY A  1 356 ? -33.911  8.749   43.172  1.00 64.56  ? 349 GLY A C      1 
ATOM   2535  O O      . GLY A  1 356 ? -34.529  9.217   44.136  1.00 63.61  ? 349 GLY A O      1 
ATOM   2536  N N      . GLY A  1 357 ? -34.425  8.675   41.949  1.00 63.16  ? 350 GLY A N      1 
ATOM   2537  C CA     . GLY A  1 357 ? -35.773  9.133   41.675  1.00 61.35  ? 350 GLY A CA     1 
ATOM   2538  C C      . GLY A  1 357 ? -35.879  10.573  41.214  1.00 58.16  ? 350 GLY A C      1 
ATOM   2539  O O      . GLY A  1 357 ? -35.049  11.042  40.430  1.00 58.87  ? 350 GLY A O      1 
ATOM   2540  N N      . CYS A  1 358 ? -36.896  11.285  41.694  1.00 56.22  ? 351 CYS A N      1 
ATOM   2541  C CA     . CYS A  1 358 ? -37.249  12.600  41.178  1.00 54.90  ? 351 CYS A CA     1 
ATOM   2542  C C      . CYS A  1 358 ? -37.098  13.670  42.256  1.00 50.53  ? 351 CYS A C      1 
ATOM   2543  O O      . CYS A  1 358 ? -36.966  13.379  43.448  1.00 48.03  ? 351 CYS A O      1 
ATOM   2544  C CB     . CYS A  1 358 ? -38.683  12.605  40.630  1.00 53.72  ? 351 CYS A CB     1 
ATOM   2545  S SG     . CYS A  1 358 ? -38.920  11.686  39.089  1.00 58.73  ? 351 CYS A SG     1 
ATOM   2546  N N      . THR A  1 359 ? -37.108  14.924  41.806  1.00 48.35  ? 352 THR A N      1 
ATOM   2547  C CA     . THR A  1 359 ? -37.124  16.096  42.671  1.00 47.83  ? 352 THR A CA     1 
ATOM   2548  C C      . THR A  1 359 ? -38.360  16.928  42.350  1.00 47.65  ? 352 THR A C      1 
ATOM   2549  O O      . THR A  1 359 ? -38.663  17.167  41.176  1.00 51.47  ? 352 THR A O      1 
ATOM   2550  C CB     . THR A  1 359 ? -35.851  16.935  42.497  1.00 49.07  ? 352 THR A CB     1 
ATOM   2551  O OG1    . THR A  1 359 ? -35.560  17.627  43.717  1.00 52.27  ? 352 THR A OG1    1 
ATOM   2552  C CG2    . THR A  1 359 ? -36.027  17.954  41.386  1.00 47.90  ? 352 THR A CG2    1 
ATOM   2553  N N      . VAL A  1 360 ? -39.087  17.338  43.387  1.00 43.04  ? 353 VAL A N      1 
ATOM   2554  C CA     . VAL A  1 360 ? -40.242  18.217  43.243  1.00 43.26  ? 353 VAL A CA     1 
ATOM   2555  C C      . VAL A  1 360 ? -39.822  19.635  43.604  1.00 46.69  ? 353 VAL A C      1 
ATOM   2556  O O      . VAL A  1 360 ? -39.150  19.852  44.621  1.00 45.51  ? 353 VAL A O      1 
ATOM   2557  C CB     . VAL A  1 360 ? -41.413  17.755  44.126  1.00 40.24  ? 353 VAL A CB     1 
ATOM   2558  C CG1    . VAL A  1 360 ? -41.031  17.838  45.591  1.00 38.07  ? 353 VAL A CG1    1 
ATOM   2559  C CG2    . VAL A  1 360 ? -42.645  18.596  43.849  1.00 40.28  ? 353 VAL A CG2    1 
ATOM   2560  N N      . THR A  1 361 ? -40.223  20.601  42.780  1.00 47.47  ? 354 THR A N      1 
ATOM   2561  C CA     . THR A  1 361 ? -39.844  21.997  42.960  1.00 43.13  ? 354 THR A CA     1 
ATOM   2562  C C      . THR A  1 361 ? -41.079  22.867  42.786  1.00 42.59  ? 354 THR A C      1 
ATOM   2563  O O      . THR A  1 361 ? -41.741  22.808  41.745  1.00 42.74  ? 354 THR A O      1 
ATOM   2564  C CB     . THR A  1 361 ? -38.755  22.412  41.966  1.00 47.71  ? 354 THR A CB     1 
ATOM   2565  O OG1    . THR A  1 361 ? -37.573  21.634  42.193  1.00 53.03  ? 354 THR A OG1    1 
ATOM   2566  C CG2    . THR A  1 361 ? -38.428  23.887  42.125  1.00 48.32  ? 354 THR A CG2    1 
ATOM   2567  N N      . LEU A  1 362 ? -41.387  23.670  43.800  1.00 41.97  ? 355 LEU A N      1 
ATOM   2568  C CA     . LEU A  1 362 ? -42.464  24.649  43.738  1.00 37.86  ? 355 LEU A CA     1 
ATOM   2569  C C      . LEU A  1 362 ? -41.876  25.999  43.342  1.00 41.19  ? 355 LEU A C      1 
ATOM   2570  O O      . LEU A  1 362 ? -40.950  26.489  43.997  1.00 46.98  ? 355 LEU A O      1 
ATOM   2571  C CB     . LEU A  1 362 ? -43.175  24.753  45.090  1.00 36.50  ? 355 LEU A CB     1 
ATOM   2572  C CG     . LEU A  1 362 ? -44.628  25.235  45.110  1.00 37.75  ? 355 LEU A CG     1 
ATOM   2573  C CD1    . LEU A  1 362 ? -45.537  24.168  44.511  1.00 37.61  ? 355 LEU A CD1    1 
ATOM   2574  C CD2    . LEU A  1 362 ? -45.080  25.600  46.519  1.00 38.69  ? 355 LEU A CD2    1 
ATOM   2575  N N      . LEU A  1 363 ? -42.408  26.597  42.276  1.00 41.79  ? 356 LEU A N      1 
ATOM   2576  C CA     . LEU A  1 363 ? -41.808  27.801  41.713  1.00 41.71  ? 356 LEU A CA     1 
ATOM   2577  C C      . LEU A  1 363 ? -42.868  28.644  41.022  1.00 42.96  ? 356 LEU A C      1 
ATOM   2578  O O      . LEU A  1 363 ? -43.973  28.178  40.733  1.00 43.40  ? 356 LEU A O      1 
ATOM   2579  C CB     . LEU A  1 363 ? -40.675  27.473  40.729  1.00 43.16  ? 356 LEU A CB     1 
ATOM   2580  C CG     . LEU A  1 363 ? -40.919  26.549  39.526  1.00 46.05  ? 356 LEU A CG     1 
ATOM   2581  C CD1    . LEU A  1 363 ? -42.024  27.048  38.601  1.00 50.21  ? 356 LEU A CD1    1 
ATOM   2582  C CD2    . LEU A  1 363 ? -39.620  26.361  38.745  1.00 50.16  ? 356 LEU A CD2    1 
ATOM   2583  N N      . GLU A  1 364 ? -42.512  29.903  40.768  1.00 45.34  ? 357 GLU A N      1 
ATOM   2584  C CA     . GLU A  1 364 ? -43.350  30.781  39.964  1.00 45.31  ? 357 GLU A CA     1 
ATOM   2585  C C      . GLU A  1 364 ? -43.452  30.242  38.543  1.00 43.65  ? 357 GLU A C      1 
ATOM   2586  O O      . GLU A  1 364 ? -42.445  29.852  37.945  1.00 40.02  ? 357 GLU A O      1 
ATOM   2587  C CB     . GLU A  1 364 ? -42.769  32.194  39.939  1.00 51.22  ? 357 GLU A CB     1 
ATOM   2588  C CG     . GLU A  1 364 ? -42.476  32.792  41.298  1.00 54.63  ? 357 GLU A CG     1 
ATOM   2589  C CD     . GLU A  1 364 ? -41.768  34.128  41.186  1.00 59.18  ? 357 GLU A CD     1 
ATOM   2590  O OE1    . GLU A  1 364 ? -41.346  34.480  40.062  1.00 61.61  ? 357 GLU A OE1    1 
ATOM   2591  O OE2    . GLU A  1 364 ? -41.636  34.825  42.214  1.00 60.28  ? 357 GLU A OE2    1 
ATOM   2592  N N      . ALA A  1 365 ? -44.674  30.205  38.005  1.00 43.77  ? 358 ALA A N      1 
ATOM   2593  C CA     . ALA A  1 365 ? -44.873  29.653  36.668  1.00 41.68  ? 358 ALA A CA     1 
ATOM   2594  C C      . ALA A  1 365 ? -43.920  30.292  35.666  1.00 43.22  ? 358 ALA A C      1 
ATOM   2595  O O      . ALA A  1 365 ? -43.361  29.609  34.801  1.00 44.29  ? 358 ALA A O      1 
ATOM   2596  C CB     . ALA A  1 365 ? -46.325  29.838  36.226  1.00 44.70  ? 358 ALA A CB     1 
ATOM   2597  N N      . SER A  1 366 ? -43.731  31.610  35.765  1.00 45.66  ? 359 SER A N      1 
ATOM   2598  C CA     . SER A  1 366 ? -42.848  32.318  34.846  1.00 46.14  ? 359 SER A CA     1 
ATOM   2599  C C      . SER A  1 366 ? -41.408  31.824  34.928  1.00 50.72  ? 359 SER A C      1 
ATOM   2600  O O      . SER A  1 366 ? -40.661  31.967  33.954  1.00 54.99  ? 359 SER A O      1 
ATOM   2601  C CB     . SER A  1 366 ? -42.897  33.822  35.130  1.00 46.30  ? 359 SER A CB     1 
ATOM   2602  O OG     . SER A  1 366 ? -42.633  34.099  36.496  1.00 47.75  ? 359 SER A OG     1 
ATOM   2603  N N      . ALA A  1 367 ? -40.998  31.260  36.065  1.00 50.23  ? 360 ALA A N      1 
ATOM   2604  C CA     . ALA A  1 367 ? -39.621  30.819  36.249  1.00 49.68  ? 360 ALA A CA     1 
ATOM   2605  C C      . ALA A  1 367 ? -39.348  29.420  35.705  1.00 50.92  ? 360 ALA A C      1 
ATOM   2606  O O      . ALA A  1 367 ? -38.181  29.016  35.653  1.00 52.53  ? 360 ALA A O      1 
ATOM   2607  C CB     . ALA A  1 367 ? -39.249  30.869  37.734  1.00 47.31  ? 360 ALA A CB     1 
ATOM   2608  N N      . ALA A  1 368 ? -40.379  28.678  35.297  1.00 49.60  ? 361 ALA A N      1 
ATOM   2609  C CA     . ALA A  1 368 ? -40.174  27.290  34.883  1.00 48.33  ? 361 ALA A CA     1 
ATOM   2610  C C      . ALA A  1 368 ? -39.174  27.148  33.745  1.00 48.93  ? 361 ALA A C      1 
ATOM   2611  O O      . ALA A  1 368 ? -38.234  26.344  33.873  1.00 48.49  ? 361 ALA A O      1 
ATOM   2612  C CB     . ALA A  1 368 ? -41.520  26.663  34.510  1.00 47.71  ? 361 ALA A CB     1 
ATOM   2613  N N      . PRO A  1 369 ? -39.304  27.866  32.628  1.00 47.58  ? 362 PRO A N      1 
ATOM   2614  C CA     . PRO A  1 369 ? -38.328  27.697  31.538  1.00 49.11  ? 362 PRO A CA     1 
ATOM   2615  C C      . PRO A  1 369 ? -36.888  27.896  31.982  1.00 49.97  ? 362 PRO A C      1 
ATOM   2616  O O      . PRO A  1 369 ? -36.015  27.100  31.616  1.00 51.99  ? 362 PRO A O      1 
ATOM   2617  C CB     . PRO A  1 369 ? -38.769  28.753  30.515  1.00 49.15  ? 362 PRO A CB     1 
ATOM   2618  C CG     . PRO A  1 369 ? -40.231  28.935  30.777  1.00 48.22  ? 362 PRO A CG     1 
ATOM   2619  C CD     . PRO A  1 369 ? -40.396  28.784  32.264  1.00 49.13  ? 362 PRO A CD     1 
ATOM   2620  N N      . HIS A  1 370 ? -36.614  28.945  32.761  1.00 49.81  ? 363 HIS A N      1 
ATOM   2621  C CA     . HIS A  1 370 ? -35.254  29.170  33.240  1.00 52.50  ? 363 HIS A CA     1 
ATOM   2622  C C      . HIS A  1 370 ? -34.815  28.075  34.205  1.00 53.09  ? 363 HIS A C      1 
ATOM   2623  O O      . HIS A  1 370 ? -33.671  27.608  34.144  1.00 53.00  ? 363 HIS A O      1 
ATOM   2624  C CB     . HIS A  1 370 ? -35.150  30.537  33.914  1.00 54.84  ? 363 HIS A CB     1 
ATOM   2625  C CG     . HIS A  1 370 ? -33.800  30.819  34.497  1.00 61.70  ? 363 HIS A CG     1 
ATOM   2626  N ND1    . HIS A  1 370 ? -33.627  31.484  35.692  1.00 62.81  ? 363 HIS A ND1    1 
ATOM   2627  C CD2    . HIS A  1 370 ? -32.557  30.523  34.048  1.00 64.86  ? 363 HIS A CD2    1 
ATOM   2628  C CE1    . HIS A  1 370 ? -32.337  31.588  35.953  1.00 64.58  ? 363 HIS A CE1    1 
ATOM   2629  N NE2    . HIS A  1 370 ? -31.665  31.012  34.972  1.00 65.59  ? 363 HIS A NE2    1 
ATOM   2630  N N      . ALA A  1 371 ? -35.711  27.647  35.098  1.00 50.39  ? 364 ALA A N      1 
ATOM   2631  C CA     . ALA A  1 371 ? -35.347  26.624  36.073  1.00 50.02  ? 364 ALA A CA     1 
ATOM   2632  C C      . ALA A  1 371 ? -34.895  25.341  35.386  1.00 53.74  ? 364 ALA A C      1 
ATOM   2633  O O      . ALA A  1 371 ? -33.892  24.737  35.784  1.00 58.37  ? 364 ALA A O      1 
ATOM   2634  C CB     . ALA A  1 371 ? -36.522  26.351  37.012  1.00 45.47  ? 364 ALA A CB     1 
ATOM   2635  N N      . MET A  1 372 ? -35.621  24.910  34.352  1.00 54.02  ? 365 MET A N      1 
ATOM   2636  C CA     . MET A  1 372 ? -35.230  23.700  33.634  1.00 53.14  ? 365 MET A CA     1 
ATOM   2637  C C      . MET A  1 372 ? -33.870  23.871  32.971  1.00 52.91  ? 365 MET A C      1 
ATOM   2638  O O      . MET A  1 372 ? -33.048  22.947  32.975  1.00 53.25  ? 365 MET A O      1 
ATOM   2639  C CB     . MET A  1 372 ? -36.291  23.337  32.597  1.00 54.25  ? 365 MET A CB     1 
ATOM   2640  C CG     . MET A  1 372 ? -37.540  22.713  33.186  1.00 54.44  ? 365 MET A CG     1 
ATOM   2641  S SD     . MET A  1 372 ? -38.843  22.505  31.959  1.00 53.97  ? 365 MET A SD     1 
ATOM   2642  C CE     . MET A  1 372 ? -37.925  21.770  30.604  1.00 60.67  ? 365 MET A CE     1 
ATOM   2643  N N      . ARG A  1 373 ? -33.616  25.047  32.391  1.00 51.43  ? 366 ARG A N      1 
ATOM   2644  C CA     . ARG A  1 373 ? -32.325  25.289  31.757  1.00 56.55  ? 366 ARG A CA     1 
ATOM   2645  C C      . ARG A  1 373 ? -31.201  25.302  32.785  1.00 58.42  ? 366 ARG A C      1 
ATOM   2646  O O      . ARG A  1 373 ? -30.144  24.700  32.565  1.00 59.79  ? 366 ARG A O      1 
ATOM   2647  C CB     . ARG A  1 373 ? -32.351  26.609  30.984  1.00 61.45  ? 366 ARG A CB     1 
ATOM   2648  C CG     . ARG A  1 373 ? -32.888  26.515  29.563  1.00 64.55  ? 366 ARG A CG     1 
ATOM   2649  C CD     . ARG A  1 373 ? -32.611  27.799  28.792  1.00 69.14  ? 366 ARG A CD     1 
ATOM   2650  N NE     . ARG A  1 373 ? -33.270  28.949  29.404  1.00 71.41  ? 366 ARG A NE     1 
ATOM   2651  C CZ     . ARG A  1 373 ? -34.494  29.358  29.090  1.00 71.56  ? 366 ARG A CZ     1 
ATOM   2652  N NH1    . ARG A  1 373 ? -35.190  28.708  28.166  1.00 71.18  ? 366 ARG A NH1    1 
ATOM   2653  N NH2    . ARG A  1 373 ? -35.023  30.413  29.698  1.00 69.40  ? 366 ARG A NH2    1 
ATOM   2654  N N      . HIS A  1 374 ? -31.414  25.977  33.917  1.00 59.08  ? 367 HIS A N      1 
ATOM   2655  C CA     . HIS A  1 374 ? -30.375  26.074  34.938  1.00 61.28  ? 367 HIS A CA     1 
ATOM   2656  C C      . HIS A  1 374 ? -30.076  24.712  35.549  1.00 58.81  ? 367 HIS A C      1 
ATOM   2657  O O      . HIS A  1 374 ? -28.913  24.303  35.643  1.00 60.25  ? 367 HIS A O      1 
ATOM   2658  C CB     . HIS A  1 374 ? -30.809  27.059  36.023  1.00 64.76  ? 367 HIS A CB     1 
ATOM   2659  C CG     . HIS A  1 374 ? -29.732  27.391  37.009  1.00 67.95  ? 367 HIS A CG     1 
ATOM   2660  N ND1    . HIS A  1 374 ? -28.926  28.501  36.880  1.00 69.73  ? 367 HIS A ND1    1 
ATOM   2661  C CD2    . HIS A  1 374 ? -29.334  26.767  38.144  1.00 67.69  ? 367 HIS A CD2    1 
ATOM   2662  C CE1    . HIS A  1 374 ? -28.078  28.547  37.892  1.00 70.55  ? 367 HIS A CE1    1 
ATOM   2663  N NE2    . HIS A  1 374 ? -28.302  27.505  38.671  1.00 69.51  ? 367 HIS A NE2    1 
ATOM   2664  N N      . ILE A  1 375 ? -31.118  23.998  35.974  1.00 51.98  ? 368 ILE A N      1 
ATOM   2665  C CA     . ILE A  1 375 ? -30.923  22.698  36.607  1.00 54.23  ? 368 ILE A CA     1 
ATOM   2666  C C      . ILE A  1 375 ? -30.182  21.757  35.666  1.00 61.39  ? 368 ILE A C      1 
ATOM   2667  O O      . ILE A  1 375 ? -29.213  21.093  36.054  1.00 68.25  ? 368 ILE A O      1 
ATOM   2668  C CB     . ILE A  1 375 ? -32.273  22.108  37.048  1.00 49.64  ? 368 ILE A CB     1 
ATOM   2669  C CG1    . ILE A  1 375 ? -32.839  22.904  38.228  1.00 46.12  ? 368 ILE A CG1    1 
ATOM   2670  C CG2    . ILE A  1 375 ? -32.116  20.633  37.386  1.00 49.54  ? 368 ILE A CG2    1 
ATOM   2671  C CD1    . ILE A  1 375 ? -34.298  22.616  38.518  1.00 44.65  ? 368 ILE A CD1    1 
ATOM   2672  N N      . GLN A  1 376 ? -30.631  21.686  34.411  1.00 63.98  ? 369 GLN A N      1 
ATOM   2673  C CA     . GLN A  1 376 ? -30.017  20.765  33.460  1.00 67.89  ? 369 GLN A CA     1 
ATOM   2674  C C      . GLN A  1 376 ? -28.540  21.079  33.251  1.00 73.34  ? 369 GLN A C      1 
ATOM   2675  O O      . GLN A  1 376 ? -27.704  20.168  33.209  1.00 75.08  ? 369 GLN A O      1 
ATOM   2676  C CB     . GLN A  1 376 ? -30.768  20.798  32.129  1.00 66.44  ? 369 GLN A CB     1 
ATOM   2677  C CG     . GLN A  1 376 ? -30.252  19.796  31.098  1.00 67.91  ? 369 GLN A CG     1 
ATOM   2678  C CD     . GLN A  1 376 ? -30.237  18.366  31.616  1.00 66.63  ? 369 GLN A CD     1 
ATOM   2679  O OE1    . GLN A  1 376 ? -31.035  17.533  31.191  1.00 63.67  ? 369 GLN A OE1    1 
ATOM   2680  N NE2    . GLN A  1 376 ? -29.322  18.074  32.530  1.00 67.69  ? 369 GLN A NE2    1 
ATOM   2681  N N      . GLU A  1 377 ? -28.200  22.362  33.112  1.00 82.35  ? 370 GLU A N      1 
ATOM   2682  C CA     . GLU A  1 377 ? -26.820  22.728  32.809  1.00 87.25  ? 370 GLU A CA     1 
ATOM   2683  C C      . GLU A  1 377 ? -25.877  22.438  33.970  1.00 88.21  ? 370 GLU A C      1 
ATOM   2684  O O      . GLU A  1 377 ? -24.707  22.108  33.746  1.00 92.02  ? 370 GLU A O      1 
ATOM   2685  C CB     . GLU A  1 377 ? -26.745  24.207  32.431  1.00 89.25  ? 370 GLU A CB     1 
ATOM   2686  N N      . HIS A  1 378 ? -26.357  22.552  35.206  1.00 85.70  ? 371 HIS A N      1 
ATOM   2687  C CA     . HIS A  1 378 ? -25.531  22.357  36.390  1.00 83.92  ? 371 HIS A CA     1 
ATOM   2688  C C      . HIS A  1 378 ? -25.700  20.977  37.016  1.00 80.15  ? 371 HIS A C      1 
ATOM   2689  O O      . HIS A  1 378 ? -25.368  20.793  38.192  1.00 79.39  ? 371 HIS A O      1 
ATOM   2690  C CB     . HIS A  1 378 ? -25.825  23.452  37.412  1.00 84.59  ? 371 HIS A CB     1 
ATOM   2691  C CG     . HIS A  1 378 ? -25.457  24.821  36.937  1.00 88.63  ? 371 HIS A CG     1 
ATOM   2692  N ND1    . HIS A  1 378 ? -26.282  25.913  37.096  1.00 87.57  ? 371 HIS A ND1    1 
ATOM   2693  C CD2    . HIS A  1 378 ? -24.355  25.272  36.293  1.00 92.09  ? 371 HIS A CD2    1 
ATOM   2694  C CE1    . HIS A  1 378 ? -25.700  26.979  36.577  1.00 89.35  ? 371 HIS A CE1    1 
ATOM   2695  N NE2    . HIS A  1 378 ? -24.529  26.618  36.084  1.00 91.84  ? 371 HIS A NE2    1 
ATOM   2696  N N      . TYR A  1 379 ? -26.205  20.007  36.261  1.00 77.00  ? 372 TYR A N      1 
ATOM   2697  C CA     . TYR A  1 379 ? -26.418  18.652  36.749  1.00 74.56  ? 372 TYR A CA     1 
ATOM   2698  C C      . TYR A  1 379 ? -25.521  17.696  35.976  1.00 76.92  ? 372 TYR A C      1 
ATOM   2699  O O      . TYR A  1 379 ? -25.542  17.681  34.741  1.00 77.19  ? 372 TYR A O      1 
ATOM   2700  C CB     . TYR A  1 379 ? -27.892  18.256  36.612  1.00 68.65  ? 372 TYR A CB     1 
ATOM   2701  C CG     . TYR A  1 379 ? -28.190  16.795  36.860  1.00 67.96  ? 372 TYR A CG     1 
ATOM   2702  C CD1    . TYR A  1 379 ? -27.927  16.209  38.091  1.00 67.15  ? 372 TYR A CD1    1 
ATOM   2703  C CD2    . TYR A  1 379 ? -28.762  16.008  35.868  1.00 67.26  ? 372 TYR A CD2    1 
ATOM   2704  C CE1    . TYR A  1 379 ? -28.207  14.874  38.320  1.00 66.35  ? 372 TYR A CE1    1 
ATOM   2705  C CE2    . TYR A  1 379 ? -29.046  14.674  36.087  1.00 65.63  ? 372 TYR A CE2    1 
ATOM   2706  C CZ     . TYR A  1 379 ? -28.767  14.112  37.314  1.00 64.64  ? 372 TYR A CZ     1 
ATOM   2707  O OH     . TYR A  1 379 ? -29.050  12.784  37.539  1.00 62.25  ? 372 TYR A OH     1 
ATOM   2708  N N      . GLY A  1 380 ? -24.742  16.896  36.706  1.00 81.11  ? 373 GLY A N      1 
ATOM   2709  C CA     . GLY A  1 380 ? -23.837  15.946  36.088  1.00 88.14  ? 373 GLY A CA     1 
ATOM   2710  C C      . GLY A  1 380 ? -24.535  14.711  35.561  1.00 92.76  ? 373 GLY A C      1 
ATOM   2711  O O      . GLY A  1 380 ? -24.256  13.581  35.978  1.00 95.25  ? 373 GLY A O      1 
ATOM   2712  N N      . GLY A  1 381 ? -25.449  14.935  34.631  1.00 93.78  ? 374 GLY A N      1 
ATOM   2713  C CA     . GLY A  1 381 ? -26.233  13.868  34.046  1.00 92.32  ? 374 GLY A CA     1 
ATOM   2714  C C      . GLY A  1 381 ? -27.351  14.472  33.234  1.00 92.38  ? 374 GLY A C      1 
ATOM   2715  O O      . GLY A  1 381 ? -27.558  15.687  33.218  1.00 93.27  ? 374 GLY A O      1 
ATOM   2716  N N      . THR A  1 382 ? -28.080  13.600  32.553  1.00 91.13  ? 375 THR A N      1 
ATOM   2717  C CA     . THR A  1 382 ? -29.235  14.024  31.778  1.00 89.39  ? 375 THR A CA     1 
ATOM   2718  C C      . THR A  1 382 ? -30.476  13.957  32.656  1.00 84.81  ? 375 THR A C      1 
ATOM   2719  O O      . THR A  1 382 ? -30.743  12.927  33.285  1.00 84.94  ? 375 THR A O      1 
ATOM   2720  C CB     . THR A  1 382 ? -29.413  13.160  30.532  1.00 90.45  ? 375 THR A CB     1 
ATOM   2721  O OG1    . THR A  1 382 ? -28.319  13.384  29.634  1.00 94.68  ? 375 THR A OG1    1 
ATOM   2722  C CG2    . THR A  1 382 ? -30.716  13.514  29.839  1.00 87.80  ? 375 THR A CG2    1 
ATOM   2723  N N      . ALA A  1 383 ? -31.241  15.047  32.675  1.00 80.34  ? 376 ALA A N      1 
ATOM   2724  C CA     . ALA A  1 383 ? -32.400  15.187  33.544  1.00 75.42  ? 376 ALA A CA     1 
ATOM   2725  C C      . ALA A  1 383 ? -33.666  15.324  32.713  1.00 72.58  ? 376 ALA A C      1 
ATOM   2726  O O      . ALA A  1 383 ? -33.656  15.946  31.648  1.00 71.94  ? 376 ALA A O      1 
ATOM   2727  C CB     . ALA A  1 383 ? -32.249  16.399  34.474  1.00 75.59  ? 376 ALA A CB     1 
ATOM   2728  N N      . THR A  1 384 ? -34.752  14.732  33.204  1.00 69.03  ? 377 THR A N      1 
ATOM   2729  C CA     . THR A  1 384 ? -36.063  14.827  32.581  1.00 63.80  ? 377 THR A CA     1 
ATOM   2730  C C      . THR A  1 384 ? -36.975  15.701  33.435  1.00 60.76  ? 377 THR A C      1 
ATOM   2731  O O      . THR A  1 384 ? -36.877  15.713  34.665  1.00 62.56  ? 377 THR A O      1 
ATOM   2732  C CB     . THR A  1 384 ? -36.693  13.439  32.396  1.00 59.92  ? 377 THR A CB     1 
ATOM   2733  O OG1    . THR A  1 384 ? -35.738  12.549  31.805  1.00 60.69  ? 377 THR A OG1    1 
ATOM   2734  C CG2    . THR A  1 384 ? -37.921  13.520  31.497  1.00 57.78  ? 377 THR A CG2    1 
ATOM   2735  N N      . PHE A  1 385 ? -37.867  16.436  32.774  1.00 57.70  ? 378 PHE A N      1 
ATOM   2736  C CA     . PHE A  1 385 ? -38.736  17.392  33.448  1.00 57.14  ? 378 PHE A CA     1 
ATOM   2737  C C      . PHE A  1 385 ? -40.197  17.105  33.140  1.00 59.26  ? 378 PHE A C      1 
ATOM   2738  O O      . PHE A  1 385 ? -40.549  16.749  32.012  1.00 61.92  ? 378 PHE A O      1 
ATOM   2739  C CB     . PHE A  1 385 ? -38.397  18.837  33.051  1.00 55.94  ? 378 PHE A CB     1 
ATOM   2740  C CG     . PHE A  1 385 ? -36.989  19.237  33.380  1.00 55.49  ? 378 PHE A CG     1 
ATOM   2741  C CD1    . PHE A  1 385 ? -36.633  19.543  34.683  1.00 53.56  ? 378 PHE A CD1    1 
ATOM   2742  C CD2    . PHE A  1 385 ? -36.021  19.299  32.393  1.00 55.69  ? 378 PHE A CD2    1 
ATOM   2743  C CE1    . PHE A  1 385 ? -35.339  19.905  34.996  1.00 53.43  ? 378 PHE A CE1    1 
ATOM   2744  C CE2    . PHE A  1 385 ? -34.724  19.662  32.700  1.00 55.90  ? 378 PHE A CE2    1 
ATOM   2745  C CZ     . PHE A  1 385 ? -34.383  19.966  34.004  1.00 56.15  ? 378 PHE A CZ     1 
ATOM   2746  N N      . TYR A  1 386 ? -41.041  17.267  34.158  1.00 55.99  ? 379 TYR A N      1 
ATOM   2747  C CA     . TYR A  1 386 ? -42.489  17.208  34.008  1.00 50.79  ? 379 TYR A CA     1 
ATOM   2748  C C      . TYR A  1 386 ? -43.078  18.438  34.679  1.00 47.03  ? 379 TYR A C      1 
ATOM   2749  O O      . TYR A  1 386 ? -42.908  18.628  35.888  1.00 48.94  ? 379 TYR A O      1 
ATOM   2750  C CB     . TYR A  1 386 ? -43.077  15.940  34.639  1.00 47.62  ? 379 TYR A CB     1 
ATOM   2751  C CG     . TYR A  1 386 ? -42.415  14.636  34.250  1.00 48.94  ? 379 TYR A CG     1 
ATOM   2752  C CD1    . TYR A  1 386 ? -42.760  13.974  33.077  1.00 50.47  ? 379 TYR A CD1    1 
ATOM   2753  C CD2    . TYR A  1 386 ? -41.466  14.051  35.077  1.00 49.02  ? 379 TYR A CD2    1 
ATOM   2754  C CE1    . TYR A  1 386 ? -42.162  12.776  32.733  1.00 50.87  ? 379 TYR A CE1    1 
ATOM   2755  C CE2    . TYR A  1 386 ? -40.866  12.859  34.744  1.00 50.72  ? 379 TYR A CE2    1 
ATOM   2756  C CZ     . TYR A  1 386 ? -41.215  12.224  33.573  1.00 52.37  ? 379 TYR A CZ     1 
ATOM   2757  O OH     . TYR A  1 386 ? -40.607  11.033  33.249  1.00 53.25  ? 379 TYR A OH     1 
ATOM   2758  N N      . LEU A  1 387 ? -43.764  19.269  33.900  1.00 45.92  ? 380 LEU A N      1 
ATOM   2759  C CA     . LEU A  1 387 ? -44.558  20.367  34.447  1.00 44.92  ? 380 LEU A CA     1 
ATOM   2760  C C      . LEU A  1 387 ? -45.967  19.824  34.617  1.00 47.43  ? 380 LEU A C      1 
ATOM   2761  O O      . LEU A  1 387 ? -46.713  19.677  33.645  1.00 50.85  ? 380 LEU A O      1 
ATOM   2762  C CB     . LEU A  1 387 ? -44.536  21.586  33.532  1.00 46.28  ? 380 LEU A CB     1 
ATOM   2763  C CG     . LEU A  1 387 ? -43.331  22.528  33.557  1.00 50.02  ? 380 LEU A CG     1 
ATOM   2764  C CD1    . LEU A  1 387 ? -43.479  23.571  32.463  1.00 49.29  ? 380 LEU A CD1    1 
ATOM   2765  C CD2    . LEU A  1 387 ? -43.179  23.196  34.918  1.00 49.85  ? 380 LEU A CD2    1 
ATOM   2766  N N      . SER A  1 388 ? -46.337  19.525  35.854  1.00 43.80  ? 381 SER A N      1 
ATOM   2767  C CA     . SER A  1 388 ? -47.576  18.820  36.122  1.00 44.59  ? 381 SER A CA     1 
ATOM   2768  C C      . SER A  1 388 ? -48.496  19.649  37.004  1.00 41.44  ? 381 SER A C      1 
ATOM   2769  O O      . SER A  1 388 ? -48.051  20.421  37.858  1.00 42.41  ? 381 SER A O      1 
ATOM   2770  C CB     . SER A  1 388 ? -47.306  17.469  36.796  1.00 47.09  ? 381 SER A CB     1 
ATOM   2771  O OG     . SER A  1 388 ? -48.500  16.719  36.939  1.00 49.07  ? 381 SER A OG     1 
ATOM   2772  N N      . GLN A  1 389 ? -49.789  19.468  36.774  1.00 40.43  ? 382 GLN A N      1 
ATOM   2773  C CA     . GLN A  1 389 ? -50.849  19.963  37.631  1.00 40.38  ? 382 GLN A CA     1 
ATOM   2774  C C      . GLN A  1 389 ? -51.380  18.809  38.467  1.00 40.66  ? 382 GLN A C      1 
ATOM   2775  O O      . GLN A  1 389 ? -51.125  17.637  38.178  1.00 41.80  ? 382 GLN A O      1 
ATOM   2776  C CB     . GLN A  1 389 ? -51.985  20.570  36.803  1.00 45.56  ? 382 GLN A CB     1 
ATOM   2777  C CG     . GLN A  1 389 ? -51.564  21.685  35.856  1.00 53.20  ? 382 GLN A CG     1 
ATOM   2778  C CD     . GLN A  1 389 ? -52.703  22.146  34.959  1.00 59.52  ? 382 GLN A CD     1 
ATOM   2779  O OE1    . GLN A  1 389 ? -53.618  21.380  34.652  1.00 60.99  ? 382 GLN A OE1    1 
ATOM   2780  N NE2    . GLN A  1 389 ? -52.651  23.406  34.537  1.00 62.60  ? 382 GLN A NE2    1 
ATOM   2781  N N      . ALA A  1 390 ? -52.126  19.147  39.512  1.00 37.06  ? 383 ALA A N      1 
ATOM   2782  C CA     . ALA A  1 390 ? -52.767  18.108  40.300  1.00 37.71  ? 383 ALA A CA     1 
ATOM   2783  C C      . ALA A  1 390 ? -53.816  17.420  39.437  1.00 36.30  ? 383 ALA A C      1 
ATOM   2784  O O      . ALA A  1 390 ? -54.662  18.082  38.830  1.00 40.10  ? 383 ALA A O      1 
ATOM   2785  C CB     . ALA A  1 390 ? -53.400  18.704  41.555  1.00 40.18  ? 383 ALA A CB     1 
ATOM   2786  N N      . ALA A  1 391 ? -53.764  16.095  39.377  1.00 33.60  ? 384 ALA A N      1 
ATOM   2787  C CA     . ALA A  1 391 ? -54.598  15.334  38.460  1.00 32.54  ? 384 ALA A CA     1 
ATOM   2788  C C      . ALA A  1 391 ? -55.612  14.495  39.225  1.00 33.21  ? 384 ALA A C      1 
ATOM   2789  O O      . ALA A  1 391 ? -55.589  14.405  40.454  1.00 37.29  ? 384 ALA A O      1 
ATOM   2790  C CB     . ALA A  1 391 ? -53.739  14.437  37.563  1.00 33.61  ? 384 ALA A CB     1 
ATOM   2791  N N      . ASP A  1 392 ? -56.515  13.877  38.468  1.00 35.06  ? 385 ASP A N      1 
ATOM   2792  C CA     . ASP A  1 392 ? -57.525  13.009  39.047  1.00 35.04  ? 385 ASP A CA     1 
ATOM   2793  C C      . ASP A  1 392 ? -56.940  11.643  39.393  1.00 33.92  ? 385 ASP A C      1 
ATOM   2794  O O      . ASP A  1 392 ? -55.908  11.222  38.862  1.00 35.23  ? 385 ASP A O      1 
ATOM   2795  C CB     . ASP A  1 392 ? -58.707  12.840  38.092  1.00 41.16  ? 385 ASP A CB     1 
ATOM   2796  C CG     . ASP A  1 392 ? -59.599  14.062  38.047  1.00 47.96  ? 385 ASP A CG     1 
ATOM   2797  O OD1    . ASP A  1 392 ? -59.957  14.566  39.132  1.00 49.79  ? 385 ASP A OD1    1 
ATOM   2798  O OD2    . ASP A  1 392 ? -59.962  14.506  36.936  1.00 52.09  ? 385 ASP A OD2    1 
ATOM   2799  N N      . GLY A  1 393 ? -57.625  10.950  40.297  1.00 31.58  ? 386 GLY A N      1 
ATOM   2800  C CA     . GLY A  1 393 ? -57.275  9.596   40.656  1.00 36.11  ? 386 GLY A CA     1 
ATOM   2801  C C      . GLY A  1 393 ? -57.844  8.582   39.681  1.00 34.77  ? 386 GLY A C      1 
ATOM   2802  O O      . GLY A  1 393 ? -58.303  8.902   38.583  1.00 39.96  ? 386 GLY A O      1 
ATOM   2803  N N      . ALA A  1 394 ? -57.810  7.323   40.113  1.00 34.66  ? 387 ALA A N      1 
ATOM   2804  C CA     . ALA A  1 394 ? -58.266  6.223   39.275  1.00 38.29  ? 387 ALA A CA     1 
ATOM   2805  C C      . ALA A  1 394 ? -59.694  6.456   38.798  1.00 38.09  ? 387 ALA A C      1 
ATOM   2806  O O      . ALA A  1 394 ? -60.541  6.966   39.537  1.00 42.09  ? 387 ALA A O      1 
ATOM   2807  C CB     . ALA A  1 394 ? -58.181  4.904   40.045  1.00 38.85  ? 387 ALA A CB     1 
ATOM   2808  N N      . LYS A  1 395 ? -59.953  6.082   37.548  1.00 39.95  ? 388 LYS A N      1 
ATOM   2809  C CA     . LYS A  1 395 ? -61.285  6.189   36.974  1.00 41.02  ? 388 LYS A CA     1 
ATOM   2810  C C      . LYS A  1 395 ? -61.434  5.130   35.893  1.00 44.19  ? 388 LYS A C      1 
ATOM   2811  O O      . LYS A  1 395 ? -60.449  4.660   35.317  1.00 46.24  ? 388 LYS A O      1 
ATOM   2812  C CB     . LYS A  1 395 ? -61.539  7.587   36.395  1.00 39.93  ? 388 LYS A CB     1 
ATOM   2813  C CG     . LYS A  1 395 ? -60.634  7.944   35.224  1.00 41.22  ? 388 LYS A CG     1 
ATOM   2814  C CD     . LYS A  1 395 ? -60.951  9.322   34.678  1.00 44.47  ? 388 LYS A CD     1 
ATOM   2815  C CE     . LYS A  1 395 ? -60.590  10.389  35.692  1.00 47.63  ? 388 LYS A CE     1 
ATOM   2816  N NZ     . LYS A  1 395 ? -60.494  11.741  35.083  1.00 50.57  ? 388 LYS A NZ     1 
ATOM   2817  N N      . VAL A  1 396 ? -62.683  4.770   35.617  1.00 45.79  ? 389 VAL A N      1 
ATOM   2818  C CA     . VAL A  1 396 ? -63.003  3.859   34.525  1.00 43.29  ? 389 VAL A CA     1 
ATOM   2819  C C      . VAL A  1 396 ? -63.072  4.641   33.220  1.00 45.72  ? 389 VAL A C      1 
ATOM   2820  O O      . VAL A  1 396 ? -63.497  5.801   33.187  1.00 46.40  ? 389 VAL A O      1 
ATOM   2821  C CB     . VAL A  1 396 ? -64.320  3.109   34.808  1.00 43.56  ? 389 VAL A CB     1 
ATOM   2822  C CG1    . VAL A  1 396 ? -64.597  2.090   33.713  1.00 40.68  ? 389 VAL A CG1    1 
ATOM   2823  C CG2    . VAL A  1 396 ? -64.264  2.435   36.176  1.00 47.63  ? 389 VAL A CG2    1 
ATOM   2824  N N      . LEU A  1 397 ? -62.660  4.005   32.129  1.00 45.52  ? 390 LEU A N      1 
ATOM   2825  C CA     . LEU A  1 397 ? -62.722  4.607   30.802  1.00 46.62  ? 390 LEU A CA     1 
ATOM   2826  C C      . LEU A  1 397 ? -63.724  3.828   29.963  1.00 50.64  ? 390 LEU A C      1 
ATOM   2827  O O      . LEU A  1 397 ? -63.577  2.613   29.788  1.00 53.23  ? 390 LEU A O      1 
ATOM   2828  C CB     . LEU A  1 397 ? -61.349  4.600   30.130  1.00 43.65  ? 390 LEU A CB     1 
ATOM   2829  C CG     . LEU A  1 397 ? -60.174  5.259   30.851  1.00 39.35  ? 390 LEU A CG     1 
ATOM   2830  C CD1    . LEU A  1 397 ? -58.909  5.080   30.031  1.00 38.98  ? 390 LEU A CD1    1 
ATOM   2831  C CD2    . LEU A  1 397 ? -60.449  6.736   31.108  1.00 40.48  ? 390 LEU A CD2    1 
ATOM   2832  N N      . CYS A  1 398 ? -64.741  4.521   29.451  1.00 50.63  ? 391 CYS A N      1 
ATOM   2833  C CA     . CYS A  1 398 ? -65.788  3.856   28.685  1.00 49.69  ? 391 CYS A CA     1 
ATOM   2834  C C      . CYS A  1 398 ? -65.339  3.724   27.236  1.00 50.68  ? 391 CYS A C      1 
ATOM   2835  O O      . CYS A  1 398 ? -65.018  4.726   26.589  1.00 50.50  ? 391 CYS A O      1 
ATOM   2836  C CB     . CYS A  1 398 ? -67.099  4.636   28.763  1.00 52.03  ? 391 CYS A CB     1 
ATOM   2837  S SG     . CYS A  1 398 ? -67.837  4.833   30.417  1.00 58.61  ? 391 CYS A SG     1 
ATOM   2838  N N      . LEU A  1 399 ? -65.325  2.497   26.726  1.00 52.51  ? 392 LEU A N      1 
ATOM   2839  C CA     . LEU A  1 399 ? -64.950  2.259   25.336  1.00 57.78  ? 392 LEU A CA     1 
ATOM   2840  C C      . LEU A  1 399 ? -66.178  2.175   24.428  1.00 65.06  ? 392 LEU A C      1 
ATOM   2841  O O      . LEU A  1 399 ? -67.209  1.596   24.783  1.00 66.50  ? 392 LEU A O      1 
ATOM   2842  C CB     . LEU A  1 399 ? -64.113  0.986   25.217  1.00 53.04  ? 392 LEU A CB     1 
ATOM   2843  C CG     . LEU A  1 399 ? -62.726  1.052   25.854  1.00 49.54  ? 392 LEU A CG     1 
ATOM   2844  C CD1    . LEU A  1 399 ? -62.049  -0.303  25.801  1.00 49.60  ? 392 LEU A CD1    1 
ATOM   2845  C CD2    . LEU A  1 399 ? -61.877  2.106   25.164  1.00 49.24  ? 392 LEU A CD2    1 
ATOM   2846  O OXT    . LEU A  1 399 ? -66.161  2.686   23.307  1.00 67.73  ? 392 LEU A OXT    1 
ATOM   2847  N N      . GLN B  1 13  ? -72.454  -43.921 27.013  1.00 85.01  ? 6   GLN B N      1 
ATOM   2848  C CA     . GLN B  1 13  ? -73.269  -42.765 26.655  1.00 88.50  ? 6   GLN B CA     1 
ATOM   2849  C C      . GLN B  1 13  ? -74.622  -43.041 25.946  1.00 91.12  ? 6   GLN B C      1 
ATOM   2850  O O      . GLN B  1 13  ? -75.377  -42.102 25.716  1.00 93.09  ? 6   GLN B O      1 
ATOM   2851  C CB     . GLN B  1 13  ? -72.452  -41.830 25.763  1.00 88.50  ? 6   GLN B CB     1 
ATOM   2852  N N      . PRO B  1 14  ? -74.943  -44.296 25.605  1.00 92.17  ? 7   PRO B N      1 
ATOM   2853  C CA     . PRO B  1 14  ? -76.168  -44.547 24.827  1.00 92.23  ? 7   PRO B CA     1 
ATOM   2854  C C      . PRO B  1 14  ? -77.432  -44.137 25.574  1.00 90.03  ? 7   PRO B C      1 
ATOM   2855  O O      . PRO B  1 14  ? -77.472  -44.056 26.805  1.00 88.81  ? 7   PRO B O      1 
ATOM   2856  C CB     . PRO B  1 14  ? -76.142  -46.062 24.563  1.00 92.64  ? 7   PRO B CB     1 
ATOM   2857  C CG     . PRO B  1 14  ? -75.191  -46.629 25.508  1.00 92.07  ? 7   PRO B CG     1 
ATOM   2858  C CD     . PRO B  1 14  ? -74.344  -45.549 26.099  1.00 91.20  ? 7   PRO B CD     1 
ATOM   2859  N N      . GLN B  1 15  ? -78.485  -43.888 24.799  1.00 83.43  ? 8   GLN B N      1 
ATOM   2860  C CA     . GLN B  1 15  ? -79.780  -43.520 25.348  1.00 75.00  ? 8   GLN B CA     1 
ATOM   2861  C C      . GLN B  1 15  ? -80.629  -44.762 25.597  1.00 63.30  ? 8   GLN B C      1 
ATOM   2862  O O      . GLN B  1 15  ? -80.292  -45.877 25.190  1.00 60.65  ? 8   GLN B O      1 
ATOM   2863  C CB     . GLN B  1 15  ? -80.543  -42.597 24.399  1.00 79.22  ? 8   GLN B CB     1 
ATOM   2864  C CG     . GLN B  1 15  ? -80.024  -41.187 24.287  1.00 82.76  ? 8   GLN B CG     1 
ATOM   2865  C CD     . GLN B  1 15  ? -81.143  -40.206 23.996  1.00 84.79  ? 8   GLN B CD     1 
ATOM   2866  O OE1    . GLN B  1 15  ? -81.267  -39.694 22.882  1.00 87.27  ? 8   GLN B OE1    1 
ATOM   2867  N NE2    . GLN B  1 15  ? -81.972  -39.945 25.002  1.00 82.57  ? 8   GLN B NE2    1 
ATOM   2868  N N      . VAL B  1 16  ? -81.744  -44.552 26.299  1.00 55.14  ? 9   VAL B N      1 
ATOM   2869  C CA     . VAL B  1 16  ? -82.591  -45.670 26.700  1.00 49.32  ? 9   VAL B CA     1 
ATOM   2870  C C      . VAL B  1 16  ? -83.058  -46.443 25.476  1.00 50.54  ? 9   VAL B C      1 
ATOM   2871  O O      . VAL B  1 16  ? -83.086  -47.680 25.475  1.00 46.29  ? 9   VAL B O      1 
ATOM   2872  C CB     . VAL B  1 16  ? -83.782  -45.168 27.535  1.00 45.23  ? 9   VAL B CB     1 
ATOM   2873  C CG1    . VAL B  1 16  ? -84.534  -46.343 28.144  1.00 42.60  ? 9   VAL B CG1    1 
ATOM   2874  C CG2    . VAL B  1 16  ? -83.311  -44.200 28.609  1.00 48.92  ? 9   VAL B CG2    1 
ATOM   2875  N N      . ALA B  1 17  ? -83.441  -45.727 24.416  1.00 53.38  ? 10  ALA B N      1 
ATOM   2876  C CA     . ALA B  1 17  ? -83.964  -46.387 23.225  1.00 53.32  ? 10  ALA B CA     1 
ATOM   2877  C C      . ALA B  1 17  ? -82.930  -47.313 22.593  1.00 53.45  ? 10  ALA B C      1 
ATOM   2878  O O      . ALA B  1 17  ? -83.262  -48.433 22.188  1.00 53.48  ? 10  ALA B O      1 
ATOM   2879  C CB     . ALA B  1 17  ? -84.440  -45.345 22.215  1.00 53.36  ? 10  ALA B CB     1 
ATOM   2880  N N      . GLU B  1 18  ? -81.674  -46.869 22.491  1.00 58.07  ? 11  GLU B N      1 
ATOM   2881  C CA     . GLU B  1 18  ? -80.650  -47.727 21.900  1.00 60.03  ? 11  GLU B CA     1 
ATOM   2882  C C      . GLU B  1 18  ? -80.448  -48.989 22.729  1.00 57.05  ? 11  GLU B C      1 
ATOM   2883  O O      . GLU B  1 18  ? -80.387  -50.099 22.187  1.00 57.69  ? 11  GLU B O      1 
ATOM   2884  C CB     . GLU B  1 18  ? -79.329  -46.973 21.758  1.00 64.83  ? 11  GLU B CB     1 
ATOM   2885  C CG     . GLU B  1 18  ? -78.289  -47.755 20.966  1.00 74.60  ? 11  GLU B CG     1 
ATOM   2886  C CD     . GLU B  1 18  ? -76.975  -47.014 20.817  1.00 83.19  ? 11  GLU B CD     1 
ATOM   2887  O OE1    . GLU B  1 18  ? -76.978  -45.768 20.906  1.00 85.82  ? 11  GLU B OE1    1 
ATOM   2888  O OE2    . GLU B  1 18  ? -75.940  -47.684 20.608  1.00 86.55  ? 11  GLU B OE2    1 
ATOM   2889  N N      . LEU B  1 19  ? -80.344  -48.840 24.051  1.00 51.61  ? 12  LEU B N      1 
ATOM   2890  C CA     . LEU B  1 19  ? -80.188  -50.012 24.904  1.00 47.65  ? 12  LEU B CA     1 
ATOM   2891  C C      . LEU B  1 19  ? -81.428  -50.889 24.841  1.00 44.97  ? 12  LEU B C      1 
ATOM   2892  O O      . LEU B  1 19  ? -81.328  -52.118 24.748  1.00 44.42  ? 12  LEU B O      1 
ATOM   2893  C CB     . LEU B  1 19  ? -79.902  -49.588 26.344  1.00 45.16  ? 12  LEU B CB     1 
ATOM   2894  C CG     . LEU B  1 19  ? -78.507  -49.041 26.632  1.00 45.44  ? 12  LEU B CG     1 
ATOM   2895  C CD1    . LEU B  1 19  ? -78.411  -48.607 28.078  1.00 42.10  ? 12  LEU B CD1    1 
ATOM   2896  C CD2    . LEU B  1 19  ? -77.458  -50.095 26.314  1.00 45.67  ? 12  LEU B CD2    1 
ATOM   2897  N N      . LEU B  1 20  ? -82.610  -50.272 24.893  1.00 44.58  ? 13  LEU B N      1 
ATOM   2898  C CA     . LEU B  1 20  ? -83.846  -51.035 24.782  1.00 42.62  ? 13  LEU B CA     1 
ATOM   2899  C C      . LEU B  1 20  ? -83.898  -51.780 23.453  1.00 48.28  ? 13  LEU B C      1 
ATOM   2900  O O      . LEU B  1 20  ? -84.348  -52.930 23.391  1.00 46.51  ? 13  LEU B O      1 
ATOM   2901  C CB     . LEU B  1 20  ? -85.048  -50.102 24.937  1.00 42.04  ? 13  LEU B CB     1 
ATOM   2902  C CG     . LEU B  1 20  ? -86.427  -50.759 24.960  1.00 46.26  ? 13  LEU B CG     1 
ATOM   2903  C CD1    . LEU B  1 20  ? -86.488  -51.783 26.080  1.00 44.21  ? 13  LEU B CD1    1 
ATOM   2904  C CD2    . LEU B  1 20  ? -87.523  -49.716 25.120  1.00 50.06  ? 13  LEU B CD2    1 
ATOM   2905  N N      . ALA B  1 21  ? -83.439  -51.134 22.378  1.00 51.29  ? 14  ALA B N      1 
ATOM   2906  C CA     . ALA B  1 21  ? -83.400  -51.791 21.075  1.00 53.06  ? 14  ALA B CA     1 
ATOM   2907  C C      . ALA B  1 21  ? -82.369  -52.913 21.057  1.00 52.48  ? 14  ALA B C      1 
ATOM   2908  O O      . ALA B  1 21  ? -82.617  -53.982 20.488  1.00 53.01  ? 14  ALA B O      1 
ATOM   2909  C CB     . ALA B  1 21  ? -83.103  -50.770 19.977  1.00 41.23  ? 14  ALA B CB     1 
ATOM   2910  N N      . GLU B  1 22  ? -81.206  -52.687 21.675  1.00 53.58  ? 15  GLU B N      1 
ATOM   2911  C CA     . GLU B  1 22  ? -80.198  -53.739 21.760  1.00 54.81  ? 15  GLU B CA     1 
ATOM   2912  C C      . GLU B  1 22  ? -80.730  -54.946 22.519  1.00 53.89  ? 15  GLU B C      1 
ATOM   2913  O O      . GLU B  1 22  ? -80.466  -56.094 22.141  1.00 56.35  ? 15  GLU B O      1 
ATOM   2914  C CB     . GLU B  1 22  ? -78.932  -53.207 22.434  1.00 59.27  ? 15  GLU B CB     1 
ATOM   2915  C CG     . GLU B  1 22  ? -77.904  -54.289 22.732  1.00 68.02  ? 15  GLU B CG     1 
ATOM   2916  C CD     . GLU B  1 22  ? -76.723  -53.777 23.543  1.00 72.90  ? 15  GLU B CD     1 
ATOM   2917  O OE1    . GLU B  1 22  ? -76.410  -52.569 23.448  1.00 75.13  ? 15  GLU B OE1    1 
ATOM   2918  O OE2    . GLU B  1 22  ? -76.113  -54.585 24.279  1.00 71.96  ? 15  GLU B OE2    1 
ATOM   2919  N N      . ALA B  1 23  ? -81.483  -54.705 23.593  1.00 46.59  ? 16  ALA B N      1 
ATOM   2920  C CA     . ALA B  1 23  ? -82.009  -55.804 24.392  1.00 43.60  ? 16  ALA B CA     1 
ATOM   2921  C C      . ALA B  1 23  ? -83.088  -56.586 23.655  1.00 45.82  ? 16  ALA B C      1 
ATOM   2922  O O      . ALA B  1 23  ? -83.195  -57.803 23.840  1.00 47.17  ? 16  ALA B O      1 
ATOM   2923  C CB     . ALA B  1 23  ? -82.558  -55.274 25.715  1.00 39.13  ? 16  ALA B CB     1 
ATOM   2924  N N      . ARG B  1 24  ? -83.893  -55.923 22.816  1.00 44.08  ? 17  ARG B N      1 
ATOM   2925  C CA     . ARG B  1 24  ? -84.960  -56.657 22.141  1.00 43.62  ? 17  ARG B CA     1 
ATOM   2926  C C      . ARG B  1 24  ? -84.394  -57.549 21.044  1.00 44.88  ? 17  ARG B C      1 
ATOM   2927  O O      . ARG B  1 24  ? -84.807  -58.707 20.904  1.00 45.80  ? 17  ARG B O      1 
ATOM   2928  C CB     . ARG B  1 24  ? -86.010  -55.708 21.555  1.00 46.77  ? 17  ARG B CB     1 
ATOM   2929  C CG     . ARG B  1 24  ? -86.901  -55.036 22.600  1.00 51.42  ? 17  ARG B CG     1 
ATOM   2930  C CD     . ARG B  1 24  ? -88.065  -54.256 21.991  1.00 56.53  ? 17  ARG B CD     1 
ATOM   2931  N NE     . ARG B  1 24  ? -87.779  -53.712 20.667  1.00 63.02  ? 17  ARG B NE     1 
ATOM   2932  C CZ     . ARG B  1 24  ? -88.321  -54.204 19.556  1.00 67.58  ? 17  ARG B CZ     1 
ATOM   2933  N NH1    . ARG B  1 24  ? -89.195  -55.198 19.644  1.00 66.05  ? 17  ARG B NH1    1 
ATOM   2934  N NH2    . ARG B  1 24  ? -88.026  -53.692 18.368  1.00 70.00  ? 17  ARG B NH2    1 
ATOM   2935  N N      . ARG B  1 25  ? -83.444  -57.030 20.260  1.00 47.20  ? 18  ARG B N      1 
ATOM   2936  C CA     . ARG B  1 25  ? -82.802  -57.840 19.229  1.00 51.03  ? 18  ARG B CA     1 
ATOM   2937  C C      . ARG B  1 25  ? -82.172  -59.085 19.835  1.00 48.29  ? 18  ARG B C      1 
ATOM   2938  O O      . ARG B  1 25  ? -82.329  -60.195 19.314  1.00 52.16  ? 18  ARG B O      1 
ATOM   2939  C CB     . ARG B  1 25  ? -81.752  -57.012 18.486  1.00 60.05  ? 18  ARG B CB     1 
ATOM   2940  C CG     . ARG B  1 25  ? -81.102  -57.740 17.316  1.00 70.27  ? 18  ARG B CG     1 
ATOM   2941  C CD     . ARG B  1 25  ? -80.109  -56.859 16.574  1.00 77.23  ? 18  ARG B CD     1 
ATOM   2942  N NE     . ARG B  1 25  ? -80.741  -55.646 16.065  1.00 83.89  ? 18  ARG B NE     1 
ATOM   2943  C CZ     . ARG B  1 25  ? -81.495  -55.602 14.972  1.00 90.68  ? 18  ARG B CZ     1 
ATOM   2944  N NH1    . ARG B  1 25  ? -81.714  -56.709 14.274  1.00 93.05  ? 18  ARG B NH1    1 
ATOM   2945  N NH2    . ARG B  1 25  ? -82.036  -54.457 14.578  1.00 91.67  ? 18  ARG B NH2    1 
ATOM   2946  N N      . ALA B  1 26  ? -81.452  -58.915 20.944  1.00 46.13  ? 19  ALA B N      1 
ATOM   2947  C CA     . ALA B  1 26  ? -80.847  -60.060 21.613  1.00 46.36  ? 19  ALA B CA     1 
ATOM   2948  C C      . ALA B  1 26  ? -81.911  -60.996 22.171  1.00 47.12  ? 19  ALA B C      1 
ATOM   2949  O O      . ALA B  1 26  ? -81.781  -62.222 22.071  1.00 47.78  ? 19  ALA B O      1 
ATOM   2950  C CB     . ALA B  1 26  ? -79.911  -59.583 22.724  1.00 43.22  ? 19  ALA B CB     1 
ATOM   2951  N N      . PHE B  1 27  ? -82.978  -60.438 22.753  1.00 44.27  ? 20  PHE B N      1 
ATOM   2952  C CA     . PHE B  1 27  ? -84.039  -61.275 23.305  1.00 43.64  ? 20  PHE B CA     1 
ATOM   2953  C C      . PHE B  1 27  ? -84.736  -62.071 22.212  1.00 53.06  ? 20  PHE B C      1 
ATOM   2954  O O      . PHE B  1 27  ? -85.043  -63.255 22.395  1.00 42.52  ? 20  PHE B O      1 
ATOM   2955  C CB     . PHE B  1 27  ? -85.051  -60.409 24.055  1.00 39.96  ? 20  PHE B CB     1 
ATOM   2956  C CG     . PHE B  1 27  ? -86.095  -61.196 24.797  1.00 38.66  ? 20  PHE B CG     1 
ATOM   2957  C CD1    . PHE B  1 27  ? -87.206  -61.709 24.142  1.00 40.19  ? 20  PHE B CD1    1 
ATOM   2958  C CD2    . PHE B  1 27  ? -85.971  -61.408 26.158  1.00 38.25  ? 20  PHE B CD2    1 
ATOM   2959  C CE1    . PHE B  1 27  ? -88.165  -62.428 24.832  1.00 38.62  ? 20  PHE B CE1    1 
ATOM   2960  C CE2    . PHE B  1 27  ? -86.927  -62.121 26.853  1.00 40.93  ? 20  PHE B CE2    1 
ATOM   2961  C CZ     . PHE B  1 27  ? -88.025  -62.633 26.190  1.00 42.28  ? 20  PHE B CZ     1 
ATOM   2962  N N      . ARG B  1 28  ? -84.989  -61.441 21.064  1.00 52.38  ? 21  ARG B N      1 
ATOM   2963  C CA     . ARG B  1 28  ? -85.613  -62.155 19.956  1.00 54.12  ? 21  ARG B CA     1 
ATOM   2964  C C      . ARG B  1 28  ? -84.696  -63.255 19.445  1.00 53.59  ? 21  ARG B C      1 
ATOM   2965  O O      . ARG B  1 28  ? -85.107  -64.413 19.306  1.00 48.60  ? 21  ARG B O      1 
ATOM   2966  C CB     . ARG B  1 28  ? -85.969  -61.181 18.833  1.00 54.84  ? 21  ARG B CB     1 
ATOM   2967  N N      . GLU B  1 29  ? -83.441  -62.906 19.154  1.00 56.95  ? 22  GLU B N      1 
ATOM   2968  C CA     . GLU B  1 29  ? -82.489  -63.903 18.682  1.00 57.86  ? 22  GLU B CA     1 
ATOM   2969  C C      . GLU B  1 29  ? -82.338  -65.048 19.674  1.00 62.38  ? 22  GLU B C      1 
ATOM   2970  O O      . GLU B  1 29  ? -82.078  -66.186 19.269  1.00 66.99  ? 22  GLU B O      1 
ATOM   2971  C CB     . GLU B  1 29  ? -81.135  -63.247 18.409  1.00 50.77  ? 22  GLU B CB     1 
ATOM   2972  N N      . GLU B  1 30  ? -82.486  -64.771 20.972  1.00 62.57  ? 23  GLU B N      1 
ATOM   2973  C CA     . GLU B  1 30  ? -82.224  -65.780 21.991  1.00 63.22  ? 23  GLU B CA     1 
ATOM   2974  C C      . GLU B  1 30  ? -83.457  -66.584 22.379  1.00 63.74  ? 23  GLU B C      1 
ATOM   2975  O O      . GLU B  1 30  ? -83.327  -67.767 22.717  1.00 66.67  ? 23  GLU B O      1 
ATOM   2976  C CB     . GLU B  1 30  ? -81.632  -65.132 23.245  1.00 65.02  ? 23  GLU B CB     1 
ATOM   2977  C CG     . GLU B  1 30  ? -81.444  -66.111 24.388  1.00 67.67  ? 23  GLU B CG     1 
ATOM   2978  C CD     . GLU B  1 30  ? -80.211  -66.977 24.209  1.00 72.65  ? 23  GLU B CD     1 
ATOM   2979  O OE1    . GLU B  1 30  ? -79.452  -66.737 23.245  1.00 74.60  ? 23  GLU B OE1    1 
ATOM   2980  O OE2    . GLU B  1 30  ? -80.007  -67.901 25.027  1.00 73.52  ? 23  GLU B OE2    1 
ATOM   2981  N N      . PHE B  1 31  ? -84.649  -65.985 22.344  1.00 60.95  ? 24  PHE B N      1 
ATOM   2982  C CA     . PHE B  1 31  ? -85.854  -66.664 22.800  1.00 57.67  ? 24  PHE B CA     1 
ATOM   2983  C C      . PHE B  1 31  ? -86.925  -66.811 21.729  1.00 59.86  ? 24  PHE B C      1 
ATOM   2984  O O      . PHE B  1 31  ? -87.917  -67.510 21.968  1.00 59.73  ? 24  PHE B O      1 
ATOM   2985  C CB     . PHE B  1 31  ? -86.463  -65.945 24.016  1.00 52.73  ? 24  PHE B CB     1 
ATOM   2986  C CG     . PHE B  1 31  ? -85.599  -65.987 25.247  1.00 50.66  ? 24  PHE B CG     1 
ATOM   2987  C CD1    . PHE B  1 31  ? -85.422  -67.173 25.944  1.00 48.04  ? 24  PHE B CD1    1 
ATOM   2988  C CD2    . PHE B  1 31  ? -84.997  -64.836 25.728  1.00 46.61  ? 24  PHE B CD2    1 
ATOM   2989  C CE1    . PHE B  1 31  ? -84.637  -67.215 27.081  1.00 47.00  ? 24  PHE B CE1    1 
ATOM   2990  C CE2    . PHE B  1 31  ? -84.212  -64.872 26.866  1.00 45.48  ? 24  PHE B CE2    1 
ATOM   2991  C CZ     . PHE B  1 31  ? -84.032  -66.062 27.543  1.00 45.95  ? 24  PHE B CZ     1 
ATOM   2992  N N      . GLY B  1 32  ? -86.761  -66.184 20.564  1.00 59.37  ? 25  GLY B N      1 
ATOM   2993  C CA     . GLY B  1 32  ? -87.647  -66.398 19.441  1.00 59.96  ? 25  GLY B CA     1 
ATOM   2994  C C      . GLY B  1 32  ? -88.880  -65.520 19.396  1.00 60.88  ? 25  GLY B C      1 
ATOM   2995  O O      . GLY B  1 32  ? -89.581  -65.518 18.379  1.00 66.08  ? 25  GLY B O      1 
ATOM   2996  N N      . ALA B  1 33  ? -89.172  -64.767 20.449  1.00 55.24  ? 26  ALA B N      1 
ATOM   2997  C CA     . ALA B  1 33  ? -90.346  -63.910 20.456  1.00 53.00  ? 26  ALA B CA     1 
ATOM   2998  C C      . ALA B  1 33  ? -89.950  -62.503 20.877  1.00 51.13  ? 26  ALA B C      1 
ATOM   2999  O O      . ALA B  1 33  ? -88.807  -62.239 21.260  1.00 51.11  ? 26  ALA B O      1 
ATOM   3000  C CB     . ALA B  1 33  ? -91.437  -64.463 21.382  1.00 48.25  ? 26  ALA B CB     1 
ATOM   3001  N N      . GLU B  1 34  ? -90.911  -61.596 20.792  1.00 51.82  ? 27  GLU B N      1 
ATOM   3002  C CA     . GLU B  1 34  ? -90.688  -60.250 21.293  1.00 50.61  ? 27  GLU B CA     1 
ATOM   3003  C C      . GLU B  1 34  ? -90.834  -60.236 22.813  1.00 46.81  ? 27  GLU B C      1 
ATOM   3004  O O      . GLU B  1 34  ? -91.723  -60.896 23.359  1.00 46.37  ? 27  GLU B O      1 
ATOM   3005  C CB     . GLU B  1 34  ? -91.678  -59.268 20.663  1.00 54.24  ? 27  GLU B CB     1 
ATOM   3006  C CG     . GLU B  1 34  ? -91.383  -58.907 19.208  1.00 64.22  ? 27  GLU B CG     1 
ATOM   3007  C CD     . GLU B  1 34  ? -90.183  -57.990 19.064  1.00 70.41  ? 27  GLU B CD     1 
ATOM   3008  O OE1    . GLU B  1 34  ? -89.555  -57.987 17.984  1.00 75.47  ? 27  GLU B OE1    1 
ATOM   3009  O OE2    . GLU B  1 34  ? -89.864  -57.271 20.033  1.00 70.93  ? 27  GLU B OE2    1 
ATOM   3010  N N      . PRO B  1 35  ? -89.971  -59.511 23.519  1.00 43.98  ? 28  PRO B N      1 
ATOM   3011  C CA     . PRO B  1 35  ? -90.170  -59.348 24.961  1.00 42.06  ? 28  PRO B CA     1 
ATOM   3012  C C      . PRO B  1 35  ? -91.424  -58.537 25.240  1.00 44.66  ? 28  PRO B C      1 
ATOM   3013  O O      . PRO B  1 35  ? -91.830  -57.679 24.453  1.00 46.38  ? 28  PRO B O      1 
ATOM   3014  C CB     . PRO B  1 35  ? -88.903  -58.614 25.415  1.00 39.93  ? 28  PRO B CB     1 
ATOM   3015  C CG     . PRO B  1 35  ? -88.442  -57.887 24.200  1.00 40.21  ? 28  PRO B CG     1 
ATOM   3016  C CD     . PRO B  1 35  ? -88.792  -58.776 23.032  1.00 43.95  ? 28  PRO B CD     1 
ATOM   3017  N N      . GLU B  1 36  ? -92.052  -58.833 26.375  1.00 45.65  ? 29  GLU B N      1 
ATOM   3018  C CA     . GLU B  1 36  ? -93.282  -58.158 26.767  1.00 43.66  ? 29  GLU B CA     1 
ATOM   3019  C C      . GLU B  1 36  ? -93.068  -57.063 27.800  1.00 41.03  ? 29  GLU B C      1 
ATOM   3020  O O      . GLU B  1 36  ? -93.870  -56.126 27.868  1.00 42.27  ? 29  GLU B O      1 
ATOM   3021  C CB     . GLU B  1 36  ? -94.291  -59.165 27.328  1.00 48.83  ? 29  GLU B CB     1 
ATOM   3022  C CG     . GLU B  1 36  ? -94.697  -60.284 26.378  1.00 53.88  ? 29  GLU B CG     1 
ATOM   3023  C CD     . GLU B  1 36  ? -95.695  -61.236 27.015  1.00 60.95  ? 29  GLU B CD     1 
ATOM   3024  O OE1    . GLU B  1 36  ? -96.027  -61.037 28.202  1.00 63.34  ? 29  GLU B OE1    1 
ATOM   3025  O OE2    . GLU B  1 36  ? -96.155  -62.176 26.332  1.00 65.99  ? 29  GLU B OE2    1 
ATOM   3026  N N      . LEU B  1 37  ? -92.004  -57.152 28.593  1.00 39.28  ? 30  LEU B N      1 
ATOM   3027  C CA     . LEU B  1 37  ? -91.791  -56.261 29.720  1.00 33.87  ? 30  LEU B CA     1 
ATOM   3028  C C      . LEU B  1 37  ? -90.398  -55.655 29.640  1.00 36.74  ? 30  LEU B C      1 
ATOM   3029  O O      . LEU B  1 37  ? -89.448  -56.300 29.187  1.00 35.66  ? 30  LEU B O      1 
ATOM   3030  C CB     . LEU B  1 37  ? -91.957  -57.016 31.039  1.00 35.38  ? 30  LEU B CB     1 
ATOM   3031  C CG     . LEU B  1 37  ? -93.265  -57.801 31.178  1.00 36.91  ? 30  LEU B CG     1 
ATOM   3032  C CD1    . LEU B  1 37  ? -93.160  -58.826 32.294  1.00 33.27  ? 30  LEU B CD1    1 
ATOM   3033  C CD2    . LEU B  1 37  ? -94.456  -56.875 31.406  1.00 33.80  ? 30  LEU B CD2    1 
ATOM   3034  N N      . ALA B  1 38  ? -90.289  -54.403 30.084  1.00 30.21  ? 31  ALA B N      1 
ATOM   3035  C CA     . ALA B  1 38  ? -89.034  -53.668 30.036  1.00 32.76  ? 31  ALA B CA     1 
ATOM   3036  C C      . ALA B  1 38  ? -88.872  -52.840 31.304  1.00 33.62  ? 31  ALA B C      1 
ATOM   3037  O O      . ALA B  1 38  ? -89.852  -52.379 31.896  1.00 35.87  ? 31  ALA B O      1 
ATOM   3038  C CB     . ALA B  1 38  ? -88.966  -52.768 28.792  1.00 37.83  ? 31  ALA B CB     1 
ATOM   3039  N N      . VAL B  1 39  ? -87.616  -52.655 31.710  1.00 31.46  ? 32  VAL B N      1 
ATOM   3040  C CA     . VAL B  1 39  ? -87.290  -52.036 32.989  1.00 29.15  ? 32  VAL B CA     1 
ATOM   3041  C C      . VAL B  1 39  ? -85.885  -51.467 32.883  1.00 33.57  ? 32  VAL B C      1 
ATOM   3042  O O      . VAL B  1 39  ? -85.046  -51.983 32.140  1.00 38.54  ? 32  VAL B O      1 
ATOM   3043  C CB     . VAL B  1 39  ? -87.409  -53.056 34.152  1.00 27.48  ? 32  VAL B CB     1 
ATOM   3044  C CG1    . VAL B  1 39  ? -86.241  -52.905 35.121  1.00 28.81  ? 32  VAL B CG1    1 
ATOM   3045  C CG2    . VAL B  1 39  ? -88.749  -52.895 34.876  1.00 30.95  ? 32  VAL B CG2    1 
ATOM   3046  N N      . SER B  1 40  ? -85.629  -50.396 33.630  1.00 26.48  ? 33  SER B N      1 
ATOM   3047  C CA     . SER B  1 40  ? -84.308  -49.791 33.673  1.00 28.34  ? 33  SER B CA     1 
ATOM   3048  C C      . SER B  1 40  ? -84.008  -49.339 35.095  1.00 31.97  ? 33  SER B C      1 
ATOM   3049  O O      . SER B  1 40  ? -84.916  -49.048 35.880  1.00 34.03  ? 33  SER B O      1 
ATOM   3050  C CB     . SER B  1 40  ? -84.193  -48.607 32.704  1.00 26.54  ? 33  SER B CB     1 
ATOM   3051  O OG     . SER B  1 40  ? -85.117  -47.589 33.043  1.00 29.85  ? 33  SER B OG     1 
ATOM   3052  N N      . ALA B  1 41  ? -82.713  -49.281 35.411  1.00 30.50  ? 34  ALA B N      1 
ATOM   3053  C CA     . ALA B  1 41  ? -82.208  -48.874 36.701  1.00 28.87  ? 34  ALA B CA     1 
ATOM   3054  C C      . ALA B  1 41  ? -80.828  -48.278 36.460  1.00 33.96  ? 34  ALA B C      1 
ATOM   3055  O O      . ALA B  1 41  ? -80.014  -48.901 35.759  1.00 35.42  ? 34  ALA B O      1 
ATOM   3056  C CB     . ALA B  1 41  ? -82.116  -50.034 37.691  1.00 27.71  ? 34  ALA B CB     1 
ATOM   3057  N N      . PRO B  1 42  ? -80.537  -47.102 37.006  1.00 31.05  ? 35  PRO B N      1 
ATOM   3058  C CA     . PRO B  1 42  ? -79.276  -46.421 36.703  1.00 29.99  ? 35  PRO B CA     1 
ATOM   3059  C C      . PRO B  1 42  ? -78.127  -46.847 37.609  1.00 32.96  ? 35  PRO B C      1 
ATOM   3060  O O      . PRO B  1 42  ? -78.312  -47.441 38.672  1.00 32.27  ? 35  PRO B O      1 
ATOM   3061  C CB     . PRO B  1 42  ? -79.625  -44.949 36.950  1.00 22.31  ? 35  PRO B CB     1 
ATOM   3062  C CG     . PRO B  1 42  ? -80.616  -45.017 38.072  1.00 23.64  ? 35  PRO B CG     1 
ATOM   3063  C CD     . PRO B  1 42  ? -81.432  -46.263 37.824  1.00 27.73  ? 35  PRO B CD     1 
ATOM   3064  N N      . GLY B  1 43  ? -76.919  -46.519 37.155  1.00 33.83  ? 36  GLY B N      1 
ATOM   3065  C CA     . GLY B  1 43  ? -75.744  -46.529 37.999  1.00 33.45  ? 36  GLY B CA     1 
ATOM   3066  C C      . GLY B  1 43  ? -75.700  -45.309 38.898  1.00 35.81  ? 36  GLY B C      1 
ATOM   3067  O O      . GLY B  1 43  ? -76.626  -44.496 38.949  1.00 36.35  ? 36  GLY B O      1 
ATOM   3068  N N      . ARG B  1 44  ? -74.584  -45.173 39.612  1.00 42.20  ? 37  ARG B N      1 
ATOM   3069  C CA     . ARG B  1 44  ? -74.456  -44.120 40.604  1.00 42.43  ? 37  ARG B CA     1 
ATOM   3070  C C      . ARG B  1 44  ? -73.037  -43.578 40.637  1.00 41.50  ? 37  ARG B C      1 
ATOM   3071  O O      . ARG B  1 44  ? -72.069  -44.288 40.351  1.00 39.06  ? 37  ARG B O      1 
ATOM   3072  C CB     . ARG B  1 44  ? -74.793  -44.620 42.013  1.00 44.32  ? 37  ARG B CB     1 
ATOM   3073  C CG     . ARG B  1 44  ? -73.895  -44.000 43.069  1.00 52.55  ? 37  ARG B CG     1 
ATOM   3074  C CD     . ARG B  1 44  ? -73.809  -44.839 44.333  1.00 53.77  ? 37  ARG B CD     1 
ATOM   3075  N NE     . ARG B  1 44  ? -72.699  -45.797 44.438  1.00 47.40  ? 37  ARG B NE     1 
ATOM   3076  C CZ     . ARG B  1 44  ? -71.536  -45.763 43.784  1.00 39.13  ? 37  ARG B CZ     1 
ATOM   3077  N NH1    . ARG B  1 44  ? -70.639  -46.708 44.025  1.00 40.86  ? 37  ARG B NH1    1 
ATOM   3078  N NH2    . ARG B  1 44  ? -71.259  -44.834 42.882  1.00 39.85  ? 37  ARG B NH2    1 
ATOM   3079  N N      . VAL B  1 45  ? -72.936  -42.301 40.991  1.00 39.50  ? 38  VAL B N      1 
ATOM   3080  C CA     . VAL B  1 45  ? -71.682  -41.673 41.379  1.00 34.74  ? 38  VAL B CA     1 
ATOM   3081  C C      . VAL B  1 45  ? -71.935  -40.936 42.685  1.00 32.54  ? 38  VAL B C      1 
ATOM   3082  O O      . VAL B  1 45  ? -72.930  -40.212 42.810  1.00 25.62  ? 38  VAL B O      1 
ATOM   3083  C CB     . VAL B  1 45  ? -71.148  -40.711 40.302  1.00 33.60  ? 38  VAL B CB     1 
ATOM   3084  C CG1    . VAL B  1 45  ? -72.036  -39.485 40.188  1.00 28.33  ? 38  VAL B CG1    1 
ATOM   3085  C CG2    . VAL B  1 45  ? -69.714  -40.311 40.621  1.00 32.47  ? 38  VAL B CG2    1 
ATOM   3086  N N      . ASN B  1 46  ? -71.048  -41.119 43.655  1.00 32.57  ? 39  ASN B N      1 
ATOM   3087  C CA     . ASN B  1 46  ? -71.174  -40.443 44.938  1.00 29.64  ? 39  ASN B CA     1 
ATOM   3088  C C      . ASN B  1 46  ? -70.422  -39.121 44.883  1.00 25.07  ? 39  ASN B C      1 
ATOM   3089  O O      . ASN B  1 46  ? -69.195  -39.106 44.732  1.00 27.35  ? 39  ASN B O      1 
ATOM   3090  C CB     . ASN B  1 46  ? -70.647  -41.309 46.079  1.00 34.07  ? 39  ASN B CB     1 
ATOM   3091  C CG     . ASN B  1 46  ? -71.008  -40.749 47.439  1.00 40.21  ? 39  ASN B CG     1 
ATOM   3092  O OD1    . ASN B  1 46  ? -71.846  -39.847 47.548  1.00 40.70  ? 39  ASN B OD1    1 
ATOM   3093  N ND2    . ASN B  1 46  ? -70.389  -41.285 48.485  1.00 41.37  ? 39  ASN B ND2    1 
ATOM   3094  N N      . LEU B  1 47  ? -71.156  -38.013 45.001  1.00 25.70  ? 40  LEU B N      1 
ATOM   3095  C CA     . LEU B  1 47  ? -70.514  -36.704 44.978  1.00 31.21  ? 40  LEU B CA     1 
ATOM   3096  C C      . LEU B  1 47  ? -69.620  -36.511 46.197  1.00 34.49  ? 40  LEU B C      1 
ATOM   3097  O O      . LEU B  1 47  ? -68.518  -35.962 46.085  1.00 35.43  ? 40  LEU B O      1 
ATOM   3098  C CB     . LEU B  1 47  ? -71.569  -35.600 44.904  1.00 35.26  ? 40  LEU B CB     1 
ATOM   3099  C CG     . LEU B  1 47  ? -72.509  -35.676 43.701  1.00 35.64  ? 40  LEU B CG     1 
ATOM   3100  C CD1    . LEU B  1 47  ? -73.471  -34.500 43.677  1.00 35.42  ? 40  LEU B CD1    1 
ATOM   3101  C CD2    . LEU B  1 47  ? -71.706  -35.745 42.408  1.00 37.03  ? 40  LEU B CD2    1 
ATOM   3102  N N      . ILE B  1 48  ? -70.074  -36.959 47.369  1.00 32.78  ? 41  ILE B N      1 
ATOM   3103  C CA     . ILE B  1 48  ? -69.281  -36.868 48.591  1.00 33.62  ? 41  ILE B CA     1 
ATOM   3104  C C      . ILE B  1 48  ? -69.898  -37.747 49.673  1.00 32.67  ? 41  ILE B C      1 
ATOM   3105  O O      . ILE B  1 48  ? -71.102  -38.026 49.648  1.00 34.38  ? 41  ILE B O      1 
ATOM   3106  C CB     . ILE B  1 48  ? -69.170  -35.406 49.065  1.00 31.43  ? 41  ILE B CB     1 
ATOM   3107  C CG1    . ILE B  1 48  ? -68.096  -35.258 50.144  1.00 30.18  ? 41  ILE B CG1    1 
ATOM   3108  C CG2    . ILE B  1 48  ? -70.512  -34.907 49.580  1.00 27.65  ? 41  ILE B CG2    1 
ATOM   3109  C CD1    . ILE B  1 48  ? -67.832  -33.815 50.545  1.00 32.62  ? 41  ILE B CD1    1 
ATOM   3110  N N      . GLY B  1 49  ? -69.083  -38.185 50.634  1.00 26.72  ? 42  GLY B N      1 
ATOM   3111  C CA     . GLY B  1 49  ? -69.582  -39.024 51.708  1.00 28.01  ? 42  GLY B CA     1 
ATOM   3112  C C      . GLY B  1 49  ? -69.176  -40.478 51.578  1.00 31.86  ? 42  GLY B C      1 
ATOM   3113  O O      . GLY B  1 49  ? -70.026  -41.370 51.659  1.00 38.54  ? 42  GLY B O      1 
ATOM   3114  N N      . GLU B  1 50  ? -67.886  -40.738 51.383  1.00 31.64  ? 43  GLU B N      1 
ATOM   3115  C CA     . GLU B  1 50  ? -67.430  -42.090 51.093  1.00 26.78  ? 43  GLU B CA     1 
ATOM   3116  C C      . GLU B  1 50  ? -67.208  -42.885 52.372  1.00 31.99  ? 43  GLU B C      1 
ATOM   3117  O O      . GLU B  1 50  ? -66.717  -42.359 53.375  1.00 34.87  ? 43  GLU B O      1 
ATOM   3118  C CB     . GLU B  1 50  ? -66.134  -42.057 50.286  1.00 28.30  ? 43  GLU B CB     1 
ATOM   3119  C CG     . GLU B  1 50  ? -66.120  -43.014 49.110  1.00 31.80  ? 43  GLU B CG     1 
ATOM   3120  C CD     . GLU B  1 50  ? -67.235  -42.724 48.119  1.00 35.63  ? 43  GLU B CD     1 
ATOM   3121  O OE1    . GLU B  1 50  ? -68.291  -43.396 48.182  1.00 33.93  ? 43  GLU B OE1    1 
ATOM   3122  O OE2    . GLU B  1 50  ? -67.069  -41.796 47.297  1.00 37.99  ? 43  GLU B OE2    1 
ATOM   3123  N N      . HIS B  1 51  ? -67.579  -44.165 52.328  1.00 32.13  ? 44  HIS B N      1 
ATOM   3124  C CA     . HIS B  1 51  ? -67.390  -45.077 53.453  1.00 37.27  ? 44  HIS B CA     1 
ATOM   3125  C C      . HIS B  1 51  ? -68.054  -44.555 54.722  1.00 38.00  ? 44  HIS B C      1 
ATOM   3126  O O      . HIS B  1 51  ? -67.588  -44.816 55.834  1.00 38.44  ? 44  HIS B O      1 
ATOM   3127  C CB     . HIS B  1 51  ? -65.904  -45.342 53.694  1.00 38.98  ? 44  HIS B CB     1 
ATOM   3128  C CG     . HIS B  1 51  ? -65.267  -46.169 52.624  1.00 37.75  ? 44  HIS B CG     1 
ATOM   3129  N ND1    . HIS B  1 51  ? -65.330  -47.546 52.609  1.00 37.86  ? 44  HIS B ND1    1 
ATOM   3130  C CD2    . HIS B  1 51  ? -64.573  -45.812 51.518  1.00 36.99  ? 44  HIS B CD2    1 
ATOM   3131  C CE1    . HIS B  1 51  ? -64.691  -48.002 51.547  1.00 37.87  ? 44  HIS B CE1    1 
ATOM   3132  N NE2    . HIS B  1 51  ? -64.222  -46.970 50.868  1.00 38.17  ? 44  HIS B NE2    1 
ATOM   3133  N N      . THR B  1 52  ? -69.142  -43.799 54.570  1.00 29.53  ? 45  THR B N      1 
ATOM   3134  C CA     . THR B  1 52  ? -69.955  -43.384 55.703  1.00 30.65  ? 45  THR B CA     1 
ATOM   3135  C C      . THR B  1 52  ? -71.296  -44.091 55.804  1.00 30.92  ? 45  THR B C      1 
ATOM   3136  O O      . THR B  1 52  ? -71.918  -44.042 56.870  1.00 37.44  ? 45  THR B O      1 
ATOM   3137  C CB     . THR B  1 52  ? -70.220  -41.874 55.645  1.00 36.89  ? 45  THR B CB     1 
ATOM   3138  O OG1    . THR B  1 52  ? -70.879  -41.556 54.412  1.00 34.69  ? 45  THR B OG1    1 
ATOM   3139  C CG2    . THR B  1 52  ? -68.918  -41.100 55.748  1.00 38.29  ? 45  THR B CG2    1 
ATOM   3140  N N      . ASP B  1 53  ? -71.758  -44.737 54.733  1.00 31.16  ? 46  ASP B N      1 
ATOM   3141  C CA     . ASP B  1 53  ? -73.116  -45.270 54.737  1.00 32.38  ? 46  ASP B CA     1 
ATOM   3142  C C      . ASP B  1 53  ? -73.259  -46.410 55.741  1.00 31.29  ? 46  ASP B C      1 
ATOM   3143  O O      . ASP B  1 53  ? -74.221  -46.443 56.517  1.00 32.55  ? 46  ASP B O      1 
ATOM   3144  C CB     . ASP B  1 53  ? -73.532  -45.686 53.320  1.00 28.84  ? 46  ASP B CB     1 
ATOM   3145  C CG     . ASP B  1 53  ? -72.749  -46.864 52.789  1.00 29.40  ? 46  ASP B CG     1 
ATOM   3146  O OD1    . ASP B  1 53  ? -71.602  -47.078 53.222  1.00 34.37  ? 46  ASP B OD1    1 
ATOM   3147  O OD2    . ASP B  1 53  ? -73.284  -47.578 51.919  1.00 32.67  ? 46  ASP B OD2    1 
ATOM   3148  N N      . TYR B  1 54  ? -72.316  -47.357 55.750  1.00 35.54  ? 47  TYR B N      1 
ATOM   3149  C CA     . TYR B  1 54  ? -72.401  -48.417 56.753  1.00 34.81  ? 47  TYR B CA     1 
ATOM   3150  C C      . TYR B  1 54  ? -71.995  -47.944 58.147  1.00 36.75  ? 47  TYR B C      1 
ATOM   3151  O O      . TYR B  1 54  ? -72.045  -48.740 59.093  1.00 37.77  ? 47  TYR B O      1 
ATOM   3152  C CB     . TYR B  1 54  ? -71.563  -49.626 56.316  1.00 38.16  ? 47  TYR B CB     1 
ATOM   3153  C CG     . TYR B  1 54  ? -70.103  -49.345 56.043  1.00 41.78  ? 47  TYR B CG     1 
ATOM   3154  C CD1    . TYR B  1 54  ? -69.272  -48.826 57.029  1.00 41.79  ? 47  TYR B CD1    1 
ATOM   3155  C CD2    . TYR B  1 54  ? -69.579  -49.517 54.770  1.00 42.38  ? 47  TYR B CD2    1 
ATOM   3156  C CE1    . TYR B  1 54  ? -67.944  -48.559 56.773  1.00 42.94  ? 47  TYR B CE1    1 
ATOM   3157  C CE2    . TYR B  1 54  ? -68.257  -49.240 54.499  1.00 39.89  ? 47  TYR B CE2    1 
ATOM   3158  C CZ     . TYR B  1 54  ? -67.444  -48.760 55.505  1.00 40.78  ? 47  TYR B CZ     1 
ATOM   3159  O OH     . TYR B  1 54  ? -66.124  -48.479 55.248  1.00 39.53  ? 47  TYR B OH     1 
ATOM   3160  N N      . ASN B  1 55  ? -71.601  -46.677 58.293  1.00 39.18  ? 48  ASN B N      1 
ATOM   3161  C CA     . ASN B  1 55  ? -71.384  -46.053 59.591  1.00 40.14  ? 48  ASN B CA     1 
ATOM   3162  C C      . ASN B  1 55  ? -72.561  -45.172 60.003  1.00 43.35  ? 48  ASN B C      1 
ATOM   3163  O O      . ASN B  1 55  ? -72.423  -44.344 60.910  1.00 39.08  ? 48  ASN B O      1 
ATOM   3164  C CB     . ASN B  1 55  ? -70.087  -45.238 59.581  1.00 37.49  ? 48  ASN B CB     1 
ATOM   3165  C CG     . ASN B  1 55  ? -68.840  -46.109 59.647  1.00 41.96  ? 48  ASN B CG     1 
ATOM   3166  O OD1    . ASN B  1 55  ? -68.670  -46.905 60.571  1.00 45.32  ? 48  ASN B OD1    1 
ATOM   3167  N ND2    . ASN B  1 55  ? -67.957  -45.956 58.663  1.00 40.24  ? 48  ASN B ND2    1 
ATOM   3168  N N      . GLN B  1 56  ? -73.713  -45.331 59.348  1.00 43.44  ? 49  GLN B N      1 
ATOM   3169  C CA     . GLN B  1 56  ? -74.918  -44.563 59.669  1.00 37.46  ? 49  GLN B CA     1 
ATOM   3170  C C      . GLN B  1 56  ? -74.690  -43.065 59.478  1.00 37.52  ? 49  GLN B C      1 
ATOM   3171  O O      . GLN B  1 56  ? -75.186  -42.238 60.245  1.00 39.64  ? 49  GLN B O      1 
ATOM   3172  C CB     . GLN B  1 56  ? -75.405  -44.873 61.086  1.00 43.93  ? 49  GLN B CB     1 
ATOM   3173  C CG     . GLN B  1 56  ? -75.779  -46.339 61.272  1.00 47.37  ? 49  GLN B CG     1 
ATOM   3174  C CD     . GLN B  1 56  ? -76.859  -46.554 62.313  1.00 52.97  ? 49  GLN B CD     1 
ATOM   3175  O OE1    . GLN B  1 56  ? -76.660  -46.298 63.497  1.00 57.23  ? 49  GLN B OE1    1 
ATOM   3176  N NE2    . GLN B  1 56  ? -78.013  -47.033 61.872  1.00 56.90  ? 49  GLN B NE2    1 
ATOM   3177  N N      . GLY B  1 57  ? -73.915  -42.721 58.459  1.00 36.95  ? 50  GLY B N      1 
ATOM   3178  C CA     . GLY B  1 57  ? -73.552  -41.355 58.138  1.00 43.55  ? 50  GLY B CA     1 
ATOM   3179  C C      . GLY B  1 57  ? -74.411  -40.758 57.042  1.00 41.63  ? 50  GLY B C      1 
ATOM   3180  O O      . GLY B  1 57  ? -75.574  -41.136 56.851  1.00 40.95  ? 50  GLY B O      1 
ATOM   3181  N N      . LEU B  1 58  ? -73.834  -39.801 56.316  1.00 41.89  ? 51  LEU B N      1 
ATOM   3182  C CA     . LEU B  1 58  ? -74.513  -39.097 55.238  1.00 36.59  ? 51  LEU B CA     1 
ATOM   3183  C C      . LEU B  1 58  ? -73.841  -39.395 53.904  1.00 34.89  ? 51  LEU B C      1 
ATOM   3184  O O      . LEU B  1 58  ? -72.621  -39.577 53.829  1.00 34.84  ? 51  LEU B O      1 
ATOM   3185  C CB     . LEU B  1 58  ? -74.516  -37.580 55.490  1.00 37.31  ? 51  LEU B CB     1 
ATOM   3186  C CG     . LEU B  1 58  ? -75.171  -37.099 56.790  1.00 40.38  ? 51  LEU B CG     1 
ATOM   3187  C CD1    . LEU B  1 58  ? -75.020  -35.598 56.945  1.00 40.43  ? 51  LEU B CD1    1 
ATOM   3188  C CD2    . LEU B  1 58  ? -76.643  -37.487 56.836  1.00 41.98  ? 51  LEU B CD2    1 
ATOM   3189  N N      . VAL B  1 59  ? -74.649  -39.439 52.846  1.00 32.03  ? 52  VAL B N      1 
ATOM   3190  C CA     . VAL B  1 59  ? -74.148  -39.620 51.491  1.00 30.21  ? 52  VAL B CA     1 
ATOM   3191  C C      . VAL B  1 59  ? -74.899  -38.679 50.560  1.00 32.08  ? 52  VAL B C      1 
ATOM   3192  O O      . VAL B  1 59  ? -76.036  -38.278 50.830  1.00 31.24  ? 52  VAL B O      1 
ATOM   3193  C CB     . VAL B  1 59  ? -74.269  -41.083 51.018  1.00 27.85  ? 52  VAL B CB     1 
ATOM   3194  C CG1    . VAL B  1 59  ? -73.419  -41.985 51.898  1.00 28.90  ? 52  VAL B CG1    1 
ATOM   3195  C CG2    . VAL B  1 59  ? -75.722  -41.524 51.035  1.00 29.18  ? 52  VAL B CG2    1 
ATOM   3196  N N      . LEU B  1 60  ? -74.239  -38.316 49.462  1.00 31.81  ? 53  LEU B N      1 
ATOM   3197  C CA     . LEU B  1 60  ? -74.781  -37.400 48.460  1.00 32.10  ? 53  LEU B CA     1 
ATOM   3198  C C      . LEU B  1 60  ? -74.515  -37.948 47.061  1.00 34.87  ? 53  LEU B C      1 
ATOM   3199  O O      . LEU B  1 60  ? -73.715  -37.390 46.301  1.00 34.21  ? 53  LEU B O      1 
ATOM   3200  C CB     . LEU B  1 60  ? -74.168  -36.011 48.634  1.00 26.55  ? 53  LEU B CB     1 
ATOM   3201  C CG     . LEU B  1 60  ? -74.787  -34.827 47.889  1.00 28.22  ? 53  LEU B CG     1 
ATOM   3202  C CD1    . LEU B  1 60  ? -76.265  -34.701 48.194  1.00 28.47  ? 53  LEU B CD1    1 
ATOM   3203  C CD2    . LEU B  1 60  ? -74.059  -33.534 48.234  1.00 28.45  ? 53  LEU B CD2    1 
ATOM   3204  N N      . PRO B  1 61  ? -75.174  -39.039 46.686  1.00 31.74  ? 54  PRO B N      1 
ATOM   3205  C CA     . PRO B  1 61  ? -75.019  -39.576 45.332  1.00 30.35  ? 54  PRO B CA     1 
ATOM   3206  C C      . PRO B  1 61  ? -76.025  -38.971 44.363  1.00 28.00  ? 54  PRO B C      1 
ATOM   3207  O O      . PRO B  1 61  ? -77.039  -38.389 44.753  1.00 28.95  ? 54  PRO B O      1 
ATOM   3208  C CB     . PRO B  1 61  ? -75.303  -41.071 45.528  1.00 25.31  ? 54  PRO B CB     1 
ATOM   3209  C CG     . PRO B  1 61  ? -76.336  -41.080 46.614  1.00 23.21  ? 54  PRO B CG     1 
ATOM   3210  C CD     . PRO B  1 61  ? -75.984  -39.924 47.541  1.00 28.69  ? 54  PRO B CD     1 
ATOM   3211  N N      . MET B  1 62  ? -75.722  -39.121 43.074  1.00 26.28  ? 55  MET B N      1 
ATOM   3212  C CA     . MET B  1 62  ? -76.668  -38.806 42.013  1.00 29.75  ? 55  MET B CA     1 
ATOM   3213  C C      . MET B  1 62  ? -76.688  -39.959 41.023  1.00 30.13  ? 55  MET B C      1 
ATOM   3214  O O      . MET B  1 62  ? -75.666  -40.608 40.783  1.00 25.26  ? 55  MET B O      1 
ATOM   3215  C CB     . MET B  1 62  ? -76.329  -37.505 41.266  1.00 32.89  ? 55  MET B CB     1 
ATOM   3216  C CG     . MET B  1 62  ? -75.232  -37.637 40.221  1.00 36.04  ? 55  MET B CG     1 
ATOM   3217  S SD     . MET B  1 62  ? -74.950  -36.086 39.338  1.00 39.98  ? 55  MET B SD     1 
ATOM   3218  C CE     . MET B  1 62  ? -74.028  -36.647 37.905  1.00 38.80  ? 55  MET B CE     1 
ATOM   3219  N N      . ALA B  1 63  ? -77.858  -40.204 40.444  1.00 29.79  ? 56  ALA B N      1 
ATOM   3220  C CA     . ALA B  1 63  ? -77.976  -41.234 39.424  1.00 29.42  ? 56  ALA B CA     1 
ATOM   3221  C C      . ALA B  1 63  ? -77.299  -40.782 38.136  1.00 32.81  ? 56  ALA B C      1 
ATOM   3222  O O      . ALA B  1 63  ? -77.347  -39.605 37.765  1.00 35.28  ? 56  ALA B O      1 
ATOM   3223  C CB     . ALA B  1 63  ? -79.448  -41.560 39.165  1.00 30.45  ? 56  ALA B CB     1 
ATOM   3224  N N      . LEU B  1 64  ? -76.651  -41.722 37.462  1.00 34.91  ? 57  LEU B N      1 
ATOM   3225  C CA     . LEU B  1 64  ? -75.954  -41.444 36.217  1.00 32.61  ? 57  LEU B CA     1 
ATOM   3226  C C      . LEU B  1 64  ? -76.858  -41.769 35.033  1.00 33.61  ? 57  LEU B C      1 
ATOM   3227  O O      . LEU B  1 64  ? -77.887  -42.437 35.163  1.00 27.65  ? 57  LEU B O      1 
ATOM   3228  C CB     . LEU B  1 64  ? -74.654  -42.248 36.135  1.00 30.49  ? 57  LEU B CB     1 
ATOM   3229  C CG     . LEU B  1 64  ? -73.568  -41.892 37.150  1.00 28.94  ? 57  LEU B CG     1 
ATOM   3230  C CD1    . LEU B  1 64  ? -72.359  -42.803 36.974  1.00 27.49  ? 57  LEU B CD1    1 
ATOM   3231  C CD2    . LEU B  1 64  ? -73.178  -40.429 37.038  1.00 28.08  ? 57  LEU B CD2    1 
ATOM   3232  N N      . GLU B  1 65  ? -76.464  -41.280 33.859  1.00 38.54  ? 58  GLU B N      1 
ATOM   3233  C CA     . GLU B  1 65  ? -77.165  -41.659 32.640  1.00 38.41  ? 58  GLU B CA     1 
ATOM   3234  C C      . GLU B  1 65  ? -76.800  -43.065 32.178  1.00 38.79  ? 58  GLU B C      1 
ATOM   3235  O O      . GLU B  1 65  ? -77.498  -43.623 31.326  1.00 48.68  ? 58  GLU B O      1 
ATOM   3236  C CB     . GLU B  1 65  ? -76.900  -40.626 31.541  1.00 41.85  ? 58  GLU B CB     1 
ATOM   3237  C CG     . GLU B  1 65  ? -77.742  -39.363 31.707  1.00 48.22  ? 58  GLU B CG     1 
ATOM   3238  C CD     . GLU B  1 65  ? -77.176  -38.160 30.968  1.00 60.96  ? 58  GLU B CD     1 
ATOM   3239  O OE1    . GLU B  1 65  ? -75.969  -37.876 31.128  1.00 64.17  ? 58  GLU B OE1    1 
ATOM   3240  O OE2    . GLU B  1 65  ? -77.942  -37.493 30.238  1.00 65.73  ? 58  GLU B OE2    1 
ATOM   3241  N N      . LEU B  1 66  ? -75.727  -43.640 32.715  1.00 34.31  ? 59  LEU B N      1 
ATOM   3242  C CA     . LEU B  1 66  ? -75.425  -45.051 32.501  1.00 30.40  ? 59  LEU B CA     1 
ATOM   3243  C C      . LEU B  1 66  ? -76.457  -45.932 33.204  1.00 28.47  ? 59  LEU B C      1 
ATOM   3244  O O      . LEU B  1 66  ? -76.906  -45.624 34.312  1.00 31.77  ? 59  LEU B O      1 
ATOM   3245  C CB     . LEU B  1 66  ? -74.014  -45.365 32.997  1.00 32.77  ? 59  LEU B CB     1 
ATOM   3246  C CG     . LEU B  1 66  ? -72.919  -44.461 32.416  1.00 34.78  ? 59  LEU B CG     1 
ATOM   3247  C CD1    . LEU B  1 66  ? -71.542  -44.877 32.916  1.00 33.92  ? 59  LEU B CD1    1 
ATOM   3248  C CD2    . LEU B  1 66  ? -72.957  -44.455 30.897  1.00 35.12  ? 59  LEU B CD2    1 
ATOM   3249  N N      . MET B  1 67  ? -76.832  -47.038 32.554  1.00 32.20  ? 60  MET B N      1 
ATOM   3250  C CA     . MET B  1 67  ? -78.064  -47.744 32.890  1.00 29.59  ? 60  MET B CA     1 
ATOM   3251  C C      . MET B  1 67  ? -77.922  -49.248 32.684  1.00 27.60  ? 60  MET B C      1 
ATOM   3252  O O      . MET B  1 67  ? -77.096  -49.720 31.896  1.00 29.07  ? 60  MET B O      1 
ATOM   3253  C CB     . MET B  1 67  ? -79.239  -47.276 32.028  1.00 37.61  ? 60  MET B CB     1 
ATOM   3254  C CG     . MET B  1 67  ? -79.664  -45.839 32.154  1.00 45.00  ? 60  MET B CG     1 
ATOM   3255  S SD     . MET B  1 67  ? -81.023  -45.659 30.988  1.00 42.51  ? 60  MET B SD     1 
ATOM   3256  C CE     . MET B  1 67  ? -81.130  -47.339 30.373  1.00 43.28  ? 60  MET B CE     1 
ATOM   3257  N N      . THR B  1 68  ? -78.742  -49.992 33.423  1.00 24.89  ? 61  THR B N      1 
ATOM   3258  C CA     . THR B  1 68  ? -79.011  -51.400 33.161  1.00 27.57  ? 61  THR B CA     1 
ATOM   3259  C C      . THR B  1 68  ? -80.448  -51.523 32.670  1.00 32.98  ? 61  THR B C      1 
ATOM   3260  O O      . THR B  1 68  ? -81.372  -51.008 33.310  1.00 31.90  ? 61  THR B O      1 
ATOM   3261  C CB     . THR B  1 68  ? -78.790  -52.264 34.407  1.00 24.82  ? 61  THR B CB     1 
ATOM   3262  O OG1    . THR B  1 68  ? -77.407  -52.224 34.783  1.00 24.02  ? 61  THR B OG1    1 
ATOM   3263  C CG2    . THR B  1 68  ? -79.187  -53.709 34.129  1.00 24.68  ? 61  THR B CG2    1 
ATOM   3264  N N      . VAL B  1 69  ? -80.635  -52.190 31.534  1.00 32.56  ? 62  VAL B N      1 
ATOM   3265  C CA     . VAL B  1 69  ? -81.956  -52.415 30.959  1.00 30.34  ? 62  VAL B CA     1 
ATOM   3266  C C      . VAL B  1 69  ? -82.258  -53.906 30.959  1.00 29.74  ? 62  VAL B C      1 
ATOM   3267  O O      . VAL B  1 69  ? -81.417  -54.718 30.554  1.00 28.32  ? 62  VAL B O      1 
ATOM   3268  C CB     . VAL B  1 69  ? -82.067  -51.837 29.537  1.00 31.46  ? 62  VAL B CB     1 
ATOM   3269  C CG1    . VAL B  1 69  ? -83.391  -52.237 28.914  1.00 28.07  ? 62  VAL B CG1    1 
ATOM   3270  C CG2    . VAL B  1 69  ? -81.932  -50.326 29.577  1.00 33.26  ? 62  VAL B CG2    1 
ATOM   3271  N N      . LEU B  1 70  ? -83.454  -54.260 31.421  1.00 30.61  ? 63  LEU B N      1 
ATOM   3272  C CA     . LEU B  1 70  ? -83.934  -55.634 31.417  1.00 31.10  ? 63  LEU B CA     1 
ATOM   3273  C C      . LEU B  1 70  ? -85.203  -55.739 30.583  1.00 33.77  ? 63  LEU B C      1 
ATOM   3274  O O      . LEU B  1 70  ? -86.172  -55.008 30.819  1.00 32.51  ? 63  LEU B O      1 
ATOM   3275  C CB     . LEU B  1 70  ? -84.208  -56.138 32.836  1.00 33.10  ? 63  LEU B CB     1 
ATOM   3276  C CG     . LEU B  1 70  ? -83.144  -56.995 33.521  1.00 38.37  ? 63  LEU B CG     1 
ATOM   3277  C CD1    . LEU B  1 70  ? -83.707  -57.584 34.806  1.00 37.67  ? 63  LEU B CD1    1 
ATOM   3278  C CD2    . LEU B  1 70  ? -82.677  -58.095 32.582  1.00 44.78  ? 63  LEU B CD2    1 
ATOM   3279  N N      . VAL B  1 71  ? -85.191  -56.645 29.609  1.00 35.06  ? 64  VAL B N      1 
ATOM   3280  C CA     . VAL B  1 71  ? -86.377  -56.991 28.839  1.00 34.91  ? 64  VAL B CA     1 
ATOM   3281  C C      . VAL B  1 71  ? -86.647  -58.472 29.047  1.00 35.31  ? 64  VAL B C      1 
ATOM   3282  O O      . VAL B  1 71  ? -85.713  -59.273 29.154  1.00 35.46  ? 64  VAL B O      1 
ATOM   3283  C CB     . VAL B  1 71  ? -86.209  -56.674 27.337  1.00 36.96  ? 64  VAL B CB     1 
ATOM   3284  C CG1    . VAL B  1 71  ? -85.790  -55.225 27.135  1.00 36.17  ? 64  VAL B CG1    1 
ATOM   3285  C CG2    . VAL B  1 71  ? -85.206  -57.625 26.692  1.00 32.59  ? 64  VAL B CG2    1 
ATOM   3286  N N      . GLY B  1 72  ? -87.920  -58.838 29.093  1.00 38.11  ? 65  GLY B N      1 
ATOM   3287  C CA     . GLY B  1 72  ? -88.261  -60.230 29.303  1.00 36.49  ? 65  GLY B CA     1 
ATOM   3288  C C      . GLY B  1 72  ? -89.758  -60.426 29.270  1.00 37.35  ? 65  GLY B C      1 
ATOM   3289  O O      . GLY B  1 72  ? -90.531  -59.499 29.002  1.00 37.66  ? 65  GLY B O      1 
ATOM   3290  N N      . SER B  1 73  ? -90.157  -61.662 29.553  1.00 41.19  ? 66  SER B N      1 
ATOM   3291  C CA     . SER B  1 73  ? -91.551  -62.072 29.520  1.00 40.72  ? 66  SER B CA     1 
ATOM   3292  C C      . SER B  1 73  ? -91.739  -63.191 30.528  1.00 41.90  ? 66  SER B C      1 
ATOM   3293  O O      . SER B  1 73  ? -90.779  -63.909 30.835  1.00 44.00  ? 66  SER B O      1 
ATOM   3294  C CB     . SER B  1 73  ? -91.967  -62.541 28.119  1.00 42.88  ? 66  SER B CB     1 
ATOM   3295  O OG     . SER B  1 73  ? -91.700  -61.538 27.153  1.00 46.14  ? 66  SER B OG     1 
ATOM   3296  N N      . PRO B  1 74  ? -92.940  -63.359 31.068  1.00 42.16  ? 67  PRO B N      1 
ATOM   3297  C CA     . PRO B  1 74  ? -93.192  -64.514 31.932  1.00 45.98  ? 67  PRO B CA     1 
ATOM   3298  C C      . PRO B  1 74  ? -93.159  -65.805 31.129  1.00 48.02  ? 67  PRO B C      1 
ATOM   3299  O O      . PRO B  1 74  ? -93.372  -65.827 29.915  1.00 49.08  ? 67  PRO B O      1 
ATOM   3300  C CB     . PRO B  1 74  ? -94.588  -64.243 32.502  1.00 47.07  ? 67  PRO B CB     1 
ATOM   3301  C CG     . PRO B  1 74  ? -95.231  -63.337 31.508  1.00 46.60  ? 67  PRO B CG     1 
ATOM   3302  C CD     . PRO B  1 74  ? -94.123  -62.492 30.935  1.00 42.69  ? 67  PRO B CD     1 
ATOM   3303  N N      . ARG B  1 75  ? -92.880  -66.895 31.835  1.00 50.22  ? 68  ARG B N      1 
ATOM   3304  C CA     . ARG B  1 75  ? -92.835  -68.226 31.253  1.00 46.80  ? 68  ARG B CA     1 
ATOM   3305  C C      . ARG B  1 75  ? -93.868  -69.096 31.948  1.00 53.60  ? 68  ARG B C      1 
ATOM   3306  O O      . ARG B  1 75  ? -94.314  -68.798 33.059  1.00 55.67  ? 68  ARG B O      1 
ATOM   3307  C CB     . ARG B  1 75  ? -91.444  -68.859 31.382  1.00 45.04  ? 68  ARG B CB     1 
ATOM   3308  C CG     . ARG B  1 75  ? -90.343  -68.107 30.657  1.00 47.42  ? 68  ARG B CG     1 
ATOM   3309  C CD     . ARG B  1 75  ? -88.972  -68.656 31.028  1.00 49.58  ? 68  ARG B CD     1 
ATOM   3310  N NE     . ARG B  1 75  ? -88.790  -70.033 30.574  1.00 54.97  ? 68  ARG B NE     1 
ATOM   3311  C CZ     . ARG B  1 75  ? -88.038  -70.389 29.537  1.00 55.98  ? 68  ARG B CZ     1 
ATOM   3312  N NH1    . ARG B  1 75  ? -87.381  -69.468 28.843  1.00 54.07  ? 68  ARG B NH1    1 
ATOM   3313  N NH2    . ARG B  1 75  ? -87.935  -71.669 29.200  1.00 55.54  ? 68  ARG B NH2    1 
ATOM   3314  N N      . LYS B  1 76  ? -94.260  -70.176 31.282  1.00 53.98  ? 69  LYS B N      1 
ATOM   3315  C CA     . LYS B  1 76  ? -95.160  -71.124 31.917  1.00 57.38  ? 69  LYS B CA     1 
ATOM   3316  C C      . LYS B  1 76  ? -94.468  -72.276 32.642  1.00 59.28  ? 69  LYS B C      1 
ATOM   3317  O O      . LYS B  1 76  ? -95.132  -72.965 33.422  1.00 62.43  ? 69  LYS B O      1 
ATOM   3318  C CB     . LYS B  1 76  ? -96.127  -71.698 30.877  1.00 61.92  ? 69  LYS B CB     1 
ATOM   3319  N N      . ASP B  1 77  ? -93.171  -72.521 32.434  1.00 61.73  ? 70  ASP B N      1 
ATOM   3320  C CA     . ASP B  1 77  ? -92.559  -73.725 33.002  1.00 67.28  ? 70  ASP B CA     1 
ATOM   3321  C C      . ASP B  1 77  ? -91.870  -73.507 34.348  1.00 71.61  ? 70  ASP B C      1 
ATOM   3322  O O      . ASP B  1 77  ? -91.153  -74.402 34.808  1.00 76.79  ? 70  ASP B O      1 
ATOM   3323  C CB     . ASP B  1 77  ? -91.592  -74.382 32.010  1.00 72.75  ? 70  ASP B CB     1 
ATOM   3324  C CG     . ASP B  1 77  ? -90.459  -73.469 31.589  1.00 77.02  ? 70  ASP B CG     1 
ATOM   3325  O OD1    . ASP B  1 77  ? -90.355  -72.342 32.123  1.00 77.22  ? 70  ASP B OD1    1 
ATOM   3326  O OD2    . ASP B  1 77  ? -89.672  -73.890 30.716  1.00 78.79  ? 70  ASP B OD2    1 
ATOM   3327  N N      . GLY B  1 78  ? -91.995  -72.328 34.953  1.00 67.09  ? 71  GLY B N      1 
ATOM   3328  C CA     . GLY B  1 78  ? -91.296  -72.118 36.210  1.00 65.03  ? 71  GLY B CA     1 
ATOM   3329  C C      . GLY B  1 78  ? -89.791  -71.977 36.147  1.00 58.85  ? 71  GLY B C      1 
ATOM   3330  O O      . GLY B  1 78  ? -89.137  -72.090 37.188  1.00 56.47  ? 71  GLY B O      1 
ATOM   3331  N N      . LEU B  1 79  ? -89.209  -71.761 34.973  1.00 57.82  ? 72  LEU B N      1 
ATOM   3332  C CA     . LEU B  1 79  ? -87.765  -71.624 34.850  1.00 54.31  ? 72  LEU B CA     1 
ATOM   3333  C C      . LEU B  1 79  ? -87.382  -70.158 34.702  1.00 48.88  ? 72  LEU B C      1 
ATOM   3334  O O      . LEU B  1 79  ? -88.193  -69.314 34.314  1.00 49.01  ? 72  LEU B O      1 
ATOM   3335  C CB     . LEU B  1 79  ? -87.232  -72.410 33.644  1.00 60.11  ? 72  LEU B CB     1 
ATOM   3336  C CG     . LEU B  1 79  ? -86.998  -73.920 33.714  1.00 68.22  ? 72  LEU B CG     1 
ATOM   3337  C CD1    . LEU B  1 79  ? -86.402  -74.415 32.401  1.00 70.84  ? 72  LEU B CD1    1 
ATOM   3338  C CD2    . LEU B  1 79  ? -86.094  -74.277 34.879  1.00 68.82  ? 72  LEU B CD2    1 
ATOM   3339  N N      . VAL B  1 80  ? -86.129  -69.863 35.035  1.00 48.04  ? 73  VAL B N      1 
ATOM   3340  C CA     . VAL B  1 80  ? -85.537  -68.555 34.790  1.00 47.25  ? 73  VAL B CA     1 
ATOM   3341  C C      . VAL B  1 80  ? -84.432  -68.756 33.769  1.00 48.94  ? 73  VAL B C      1 
ATOM   3342  O O      . VAL B  1 80  ? -83.491  -69.525 34.004  1.00 47.84  ? 73  VAL B O      1 
ATOM   3343  C CB     . VAL B  1 80  ? -84.990  -67.916 36.075  1.00 49.28  ? 73  VAL B CB     1 
ATOM   3344  C CG1    . VAL B  1 80  ? -84.369  -66.559 35.767  1.00 46.51  ? 73  VAL B CG1    1 
ATOM   3345  C CG2    . VAL B  1 80  ? -86.091  -67.776 37.100  1.00 48.68  ? 73  VAL B CG2    1 
ATOM   3346  N N      . SER B  1 81  ? -84.546  -68.067 32.640  1.00 49.24  ? 74  SER B N      1 
ATOM   3347  C CA     . SER B  1 81  ? -83.561  -68.140 31.571  1.00 40.77  ? 74  SER B CA     1 
ATOM   3348  C C      . SER B  1 81  ? -83.021  -66.739 31.347  1.00 42.51  ? 74  SER B C      1 
ATOM   3349  O O      . SER B  1 81  ? -83.784  -65.819 31.032  1.00 43.13  ? 74  SER B O      1 
ATOM   3350  C CB     . SER B  1 81  ? -84.176  -68.705 30.290  1.00 49.46  ? 74  SER B CB     1 
ATOM   3351  O OG     . SER B  1 81  ? -83.178  -69.230 29.432  1.00 51.05  ? 74  SER B OG     1 
ATOM   3352  N N      . LEU B  1 82  ? -81.716  -66.575 31.519  1.00 44.45  ? 75  LEU B N      1 
ATOM   3353  C CA     . LEU B  1 82  ? -81.094  -65.263 31.499  1.00 43.65  ? 75  LEU B CA     1 
ATOM   3354  C C      . LEU B  1 82  ? -80.000  -65.212 30.445  1.00 45.16  ? 75  LEU B C      1 
ATOM   3355  O O      . LEU B  1 82  ? -79.338  -66.213 30.156  1.00 48.43  ? 75  LEU B O      1 
ATOM   3356  C CB     . LEU B  1 82  ? -80.497  -64.905 32.866  1.00 38.86  ? 75  LEU B CB     1 
ATOM   3357  C CG     . LEU B  1 82  ? -81.399  -65.033 34.093  1.00 38.18  ? 75  LEU B CG     1 
ATOM   3358  C CD1    . LEU B  1 82  ? -80.603  -64.725 35.352  1.00 38.04  ? 75  LEU B CD1    1 
ATOM   3359  C CD2    . LEU B  1 82  ? -82.607  -64.116 33.976  1.00 39.03  ? 75  LEU B CD2    1 
ATOM   3360  N N      . LEU B  1 83  ? -79.835  -64.028 29.865  1.00 42.88  ? 76  LEU B N      1 
ATOM   3361  C CA     . LEU B  1 83  ? -78.710  -63.724 28.995  1.00 44.96  ? 76  LEU B CA     1 
ATOM   3362  C C      . LEU B  1 83  ? -78.325  -62.274 29.227  1.00 44.86  ? 76  LEU B C      1 
ATOM   3363  O O      . LEU B  1 83  ? -79.179  -61.385 29.168  1.00 43.59  ? 76  LEU B O      1 
ATOM   3364  C CB     . LEU B  1 83  ? -79.051  -63.956 27.519  1.00 47.19  ? 76  LEU B CB     1 
ATOM   3365  C CG     . LEU B  1 83  ? -78.043  -63.416 26.501  1.00 50.41  ? 76  LEU B CG     1 
ATOM   3366  C CD1    . LEU B  1 83  ? -76.706  -64.134 26.620  1.00 51.32  ? 76  LEU B CD1    1 
ATOM   3367  C CD2    . LEU B  1 83  ? -78.598  -63.544 25.088  1.00 53.55  ? 76  LEU B CD2    1 
ATOM   3368  N N      . THR B  1 84  ? -77.047  -62.040 29.499  1.00 45.02  ? 77  THR B N      1 
ATOM   3369  C CA     . THR B  1 84  ? -76.506  -60.695 29.595  1.00 44.79  ? 77  THR B CA     1 
ATOM   3370  C C      . THR B  1 84  ? -75.523  -60.480 28.454  1.00 46.74  ? 77  THR B C      1 
ATOM   3371  O O      . THR B  1 84  ? -74.734  -61.372 28.126  1.00 47.51  ? 77  THR B O      1 
ATOM   3372  C CB     . THR B  1 84  ? -75.818  -60.464 30.945  1.00 43.14  ? 77  THR B CB     1 
ATOM   3373  O OG1    . THR B  1 84  ? -75.272  -59.139 30.988  1.00 44.79  ? 77  THR B OG1    1 
ATOM   3374  C CG2    . THR B  1 84  ? -74.703  -61.473 31.154  1.00 39.53  ? 77  THR B CG2    1 
ATOM   3375  N N      . THR B  1 85  ? -75.579  -59.296 27.850  1.00 46.31  ? 78  THR B N      1 
ATOM   3376  C CA     . THR B  1 85  ? -74.712  -58.934 26.737  1.00 47.60  ? 78  THR B CA     1 
ATOM   3377  C C      . THR B  1 85  ? -73.482  -58.157 27.182  1.00 51.13  ? 78  THR B C      1 
ATOM   3378  O O      . THR B  1 85  ? -72.740  -57.651 26.333  1.00 54.88  ? 78  THR B O      1 
ATOM   3379  C CB     . THR B  1 85  ? -75.490  -58.126 25.698  1.00 43.18  ? 78  THR B CB     1 
ATOM   3380  O OG1    . THR B  1 85  ? -75.832  -56.848 26.247  1.00 43.54  ? 78  THR B OG1    1 
ATOM   3381  C CG2    . THR B  1 85  ? -76.762  -58.861 25.301  1.00 41.68  ? 78  THR B CG2    1 
ATOM   3382  N N      . SER B  1 86  ? -73.247  -58.059 28.486  1.00 56.91  ? 79  SER B N      1 
ATOM   3383  C CA     . SER B  1 86  ? -72.136  -57.277 29.009  1.00 62.69  ? 79  SER B CA     1 
ATOM   3384  C C      . SER B  1 86  ? -70.820  -58.012 28.787  1.00 69.15  ? 79  SER B C      1 
ATOM   3385  O O      . SER B  1 86  ? -70.702  -59.203 29.093  1.00 69.95  ? 79  SER B O      1 
ATOM   3386  C CB     . SER B  1 86  ? -72.336  -57.001 30.499  1.00 58.91  ? 79  SER B CB     1 
ATOM   3387  O OG     . SER B  1 86  ? -73.503  -56.234 30.733  1.00 58.92  ? 79  SER B OG     1 
ATOM   3388  N N      . GLU B  1 87  ? -69.828  -57.292 28.253  1.00 78.47  ? 80  GLU B N      1 
ATOM   3389  C CA     . GLU B  1 87  ? -68.567  -57.923 27.876  1.00 84.33  ? 80  GLU B CA     1 
ATOM   3390  C C      . GLU B  1 87  ? -67.754  -58.317 29.101  1.00 83.90  ? 80  GLU B C      1 
ATOM   3391  O O      . GLU B  1 87  ? -67.075  -59.350 29.095  1.00 86.19  ? 80  GLU B O      1 
ATOM   3392  C CB     . GLU B  1 87  ? -67.759  -56.975 26.988  1.00 90.87  ? 80  GLU B CB     1 
ATOM   3393  C CG     . GLU B  1 87  ? -67.980  -57.156 25.500  1.00 96.71  ? 80  GLU B CG     1 
ATOM   3394  C CD     . GLU B  1 87  ? -67.140  -58.278 24.930  1.00 102.29 ? 80  GLU B CD     1 
ATOM   3395  O OE1    . GLU B  1 87  ? -66.372  -58.896 25.698  1.00 103.94 ? 80  GLU B OE1    1 
ATOM   3396  O OE2    . GLU B  1 87  ? -67.242  -58.539 23.715  1.00 105.46 ? 80  GLU B OE2    1 
ATOM   3397  N N      . GLY B  1 88  ? -67.806  -57.511 30.158  1.00 83.10  ? 81  GLY B N      1 
ATOM   3398  C CA     . GLY B  1 88  ? -67.079  -57.803 31.375  1.00 85.28  ? 81  GLY B CA     1 
ATOM   3399  C C      . GLY B  1 88  ? -67.679  -58.875 32.256  1.00 79.98  ? 81  GLY B C      1 
ATOM   3400  O O      . GLY B  1 88  ? -67.163  -59.125 33.349  1.00 82.00  ? 81  GLY B O      1 
ATOM   3401  N N      . ALA B  1 89  ? -68.754  -59.522 31.813  1.00 78.85  ? 82  ALA B N      1 
ATOM   3402  C CA     . ALA B  1 89  ? -69.454  -60.503 32.630  1.00 78.07  ? 82  ALA B CA     1 
ATOM   3403  C C      . ALA B  1 89  ? -68.735  -61.848 32.630  1.00 78.01  ? 82  ALA B C      1 
ATOM   3404  O O      . ALA B  1 89  ? -68.221  -62.300 31.604  1.00 79.14  ? 82  ALA B O      1 
ATOM   3405  C CB     . ALA B  1 89  ? -70.888  -60.683 32.129  1.00 76.21  ? 82  ALA B CB     1 
ATOM   3406  N N      A ASP B  1 90  ? -68.769  -62.492 33.798  0.36 72.97  ? 83  ASP B N      1 
ATOM   3407  N N      B ASP B  1 90  ? -68.646  -62.482 33.796  0.64 72.92  ? 83  ASP B N      1 
ATOM   3408  C CA     A ASP B  1 90  ? -68.263  -63.846 33.994  0.36 70.32  ? 83  ASP B CA     1 
ATOM   3409  C CA     B ASP B  1 90  ? -67.952  -63.762 33.841  0.64 71.62  ? 83  ASP B CA     1 
ATOM   3410  C C      A ASP B  1 90  ? -68.916  -64.828 33.025  0.36 73.30  ? 83  ASP B C      1 
ATOM   3411  C C      B ASP B  1 90  ? -68.774  -64.831 33.131  0.64 73.40  ? 83  ASP B C      1 
ATOM   3412  O O      A ASP B  1 90  ? -70.142  -64.863 32.894  0.36 71.71  ? 83  ASP B O      1 
ATOM   3413  O O      B ASP B  1 90  ? -69.996  -64.900 33.275  0.64 71.19  ? 83  ASP B O      1 
ATOM   3414  C CB     A ASP B  1 90  ? -68.549  -64.267 35.439  0.36 65.24  ? 83  ASP B CB     1 
ATOM   3415  C CB     B ASP B  1 90  ? -67.646  -64.188 35.278  0.64 66.85  ? 83  ASP B CB     1 
ATOM   3416  C CG     A ASP B  1 90  ? -67.575  -65.297 35.960  0.36 67.68  ? 83  ASP B CG     1 
ATOM   3417  C CG     B ASP B  1 90  ? -68.836  -64.056 36.199  0.64 63.99  ? 83  ASP B CG     1 
ATOM   3418  O OD1    A ASP B  1 90  ? -66.385  -64.957 36.116  0.36 68.42  ? 83  ASP B OD1    1 
ATOM   3419  O OD1    B ASP B  1 90  ? -69.233  -62.909 36.490  0.64 61.00  ? 83  ASP B OD1    1 
ATOM   3420  O OD2    A ASP B  1 90  ? -68.002  -66.437 36.238  0.36 67.44  ? 83  ASP B OD2    1 
ATOM   3421  O OD2    B ASP B  1 90  ? -69.374  -65.097 36.636  0.64 64.32  ? 83  ASP B OD2    1 
ATOM   3422  N N      . GLU B  1 91  ? -68.093  -65.654 32.357  1.00 74.49  ? 84  GLU B N      1 
ATOM   3423  C CA     . GLU B  1 91  ? -68.706  -66.676 31.513  1.00 74.03  ? 84  GLU B CA     1 
ATOM   3424  C C      . GLU B  1 91  ? -69.189  -67.852 32.362  1.00 70.95  ? 84  GLU B C      1 
ATOM   3425  O O      . GLU B  1 91  ? -68.538  -68.219 33.344  1.00 73.50  ? 84  GLU B O      1 
ATOM   3426  C CB     . GLU B  1 91  ? -67.720  -67.169 30.458  1.00 77.78  ? 84  GLU B CB     1 
ATOM   3427  N N      . PRO B  1 92  ? -70.317  -68.478 31.993  1.00 65.39  ? 85  PRO B N      1 
ATOM   3428  C CA     . PRO B  1 92  ? -71.075  -68.180 30.774  1.00 66.82  ? 85  PRO B CA     1 
ATOM   3429  C C      . PRO B  1 92  ? -72.088  -67.048 30.917  1.00 63.97  ? 85  PRO B C      1 
ATOM   3430  O O      . PRO B  1 92  ? -72.682  -66.881 31.981  1.00 61.84  ? 85  PRO B O      1 
ATOM   3431  C CB     . PRO B  1 92  ? -71.792  -69.501 30.499  1.00 65.77  ? 85  PRO B CB     1 
ATOM   3432  C CG     . PRO B  1 92  ? -72.074  -70.033 31.872  1.00 64.46  ? 85  PRO B CG     1 
ATOM   3433  C CD     . PRO B  1 92  ? -70.922  -69.586 32.754  1.00 65.90  ? 85  PRO B CD     1 
ATOM   3434  N N      . GLN B  1 93  ? -72.275  -66.284 29.840  1.00 66.64  ? 86  GLN B N      1 
ATOM   3435  C CA     . GLN B  1 93  ? -73.229  -65.184 29.810  1.00 66.79  ? 86  GLN B CA     1 
ATOM   3436  C C      . GLN B  1 93  ? -74.661  -65.654 29.599  1.00 65.20  ? 86  GLN B C      1 
ATOM   3437  O O      . GLN B  1 93  ? -75.575  -64.822 29.576  1.00 60.89  ? 86  GLN B O      1 
ATOM   3438  C CB     . GLN B  1 93  ? -72.838  -64.186 28.718  1.00 70.88  ? 86  GLN B CB     1 
ATOM   3439  C CG     . GLN B  1 93  ? -71.453  -63.601 28.909  1.00 75.86  ? 86  GLN B CG     1 
ATOM   3440  C CD     . GLN B  1 93  ? -70.933  -62.925 27.659  1.00 81.61  ? 86  GLN B CD     1 
ATOM   3441  O OE1    . GLN B  1 93  ? -71.457  -63.134 26.563  1.00 83.37  ? 86  GLN B OE1    1 
ATOM   3442  N NE2    . GLN B  1 93  ? -69.897  -62.108 27.816  1.00 84.39  ? 86  GLN B NE2    1 
ATOM   3443  N N      . ARG B  1 94  ? -74.875  -66.960 29.465  1.00 73.79  ? 87  ARG B N      1 
ATOM   3444  C CA     . ARG B  1 94  ? -76.201  -67.548 29.387  1.00 74.20  ? 87  ARG B CA     1 
ATOM   3445  C C      . ARG B  1 94  ? -76.385  -68.442 30.601  1.00 74.41  ? 87  ARG B C      1 
ATOM   3446  O O      . ARG B  1 94  ? -75.440  -69.099 31.045  1.00 77.46  ? 87  ARG B O      1 
ATOM   3447  C CB     . ARG B  1 94  ? -76.382  -68.388 28.117  1.00 80.00  ? 87  ARG B CB     1 
ATOM   3448  C CG     . ARG B  1 94  ? -76.338  -67.642 26.800  1.00 86.93  ? 87  ARG B CG     1 
ATOM   3449  C CD     . ARG B  1 94  ? -76.238  -68.651 25.661  1.00 93.39  ? 87  ARG B CD     1 
ATOM   3450  N NE     . ARG B  1 94  ? -76.533  -68.068 24.357  1.00 98.60  ? 87  ARG B NE     1 
ATOM   3451  C CZ     . ARG B  1 94  ? -75.700  -67.279 23.689  1.00 104.60 ? 87  ARG B CZ     1 
ATOM   3452  N NH1    . ARG B  1 94  ? -74.523  -66.967 24.213  1.00 106.26 ? 87  ARG B NH1    1 
ATOM   3453  N NH2    . ARG B  1 94  ? -76.047  -66.796 22.503  1.00 106.93 ? 87  ARG B NH2    1 
ATOM   3454  N N      . LEU B  1 95  ? -77.602  -68.478 31.130  1.00 64.30  ? 88  LEU B N      1 
ATOM   3455  C CA     . LEU B  1 95  ? -77.861  -69.347 32.266  1.00 61.69  ? 88  LEU B CA     1 
ATOM   3456  C C      . LEU B  1 95  ? -79.343  -69.665 32.318  1.00 55.45  ? 88  LEU B C      1 
ATOM   3457  O O      . LEU B  1 95  ? -80.188  -68.828 31.989  1.00 52.51  ? 88  LEU B O      1 
ATOM   3458  C CB     . LEU B  1 95  ? -77.405  -68.715 33.587  1.00 62.70  ? 88  LEU B CB     1 
ATOM   3459  C CG     . LEU B  1 95  ? -77.531  -69.649 34.792  1.00 64.30  ? 88  LEU B CG     1 
ATOM   3460  C CD1    . LEU B  1 95  ? -76.563  -70.817 34.674  1.00 67.75  ? 88  LEU B CD1    1 
ATOM   3461  C CD2    . LEU B  1 95  ? -77.299  -68.886 36.083  1.00 61.50  ? 88  LEU B CD2    1 
ATOM   3462  N N      . GLN B  1 96  ? -79.645  -70.889 32.735  1.00 56.72  ? 89  GLN B N      1 
ATOM   3463  C CA     . GLN B  1 96  ? -81.022  -71.298 32.940  1.00 57.20  ? 89  GLN B CA     1 
ATOM   3464  C C      . GLN B  1 96  ? -81.061  -72.117 34.221  1.00 57.41  ? 89  GLN B C      1 
ATOM   3465  O O      . GLN B  1 96  ? -80.204  -72.983 34.427  1.00 59.20  ? 89  GLN B O      1 
ATOM   3466  C CB     . GLN B  1 96  ? -81.515  -72.102 31.728  1.00 61.58  ? 89  GLN B CB     1 
ATOM   3467  C CG     . GLN B  1 96  ? -82.972  -72.493 31.741  1.00 64.50  ? 89  GLN B CG     1 
ATOM   3468  C CD     . GLN B  1 96  ? -83.443  -72.945 30.367  1.00 67.92  ? 89  GLN B CD     1 
ATOM   3469  O OE1    . GLN B  1 96  ? -82.847  -73.834 29.762  1.00 71.99  ? 89  GLN B OE1    1 
ATOM   3470  N NE2    . GLN B  1 96  ? -84.506  -72.323 29.864  1.00 65.27  ? 89  GLN B NE2    1 
ATOM   3471  N N      . PHE B  1 97  ? -82.048  -71.851 35.072  1.00 55.35  ? 90  PHE B N      1 
ATOM   3472  C CA     . PHE B  1 97  ? -82.179  -72.552 36.343  1.00 54.76  ? 90  PHE B CA     1 
ATOM   3473  C C      . PHE B  1 97  ? -83.617  -72.413 36.820  1.00 52.56  ? 90  PHE B C      1 
ATOM   3474  O O      . PHE B  1 97  ? -84.307  -71.455 36.451  1.00 48.12  ? 90  PHE B O      1 
ATOM   3475  C CB     . PHE B  1 97  ? -81.211  -71.998 37.403  1.00 55.69  ? 90  PHE B CB     1 
ATOM   3476  C CG     . PHE B  1 97  ? -81.387  -70.529 37.692  1.00 53.84  ? 90  PHE B CG     1 
ATOM   3477  C CD1    . PHE B  1 97  ? -80.742  -69.568 36.932  1.00 52.28  ? 90  PHE B CD1    1 
ATOM   3478  C CD2    . PHE B  1 97  ? -82.188  -70.115 38.746  1.00 52.54  ? 90  PHE B CD2    1 
ATOM   3479  C CE1    . PHE B  1 97  ? -80.904  -68.221 37.207  1.00 47.92  ? 90  PHE B CE1    1 
ATOM   3480  C CE2    . PHE B  1 97  ? -82.352  -68.771 39.028  1.00 51.45  ? 90  PHE B CE2    1 
ATOM   3481  C CZ     . PHE B  1 97  ? -81.710  -67.823 38.257  1.00 47.97  ? 90  PHE B CZ     1 
ATOM   3482  N N      . PRO B  1 98  ? -84.087  -73.331 37.657  1.00 55.43  ? 91  PRO B N      1 
ATOM   3483  C CA     . PRO B  1 98  ? -85.464  -73.247 38.151  1.00 50.35  ? 91  PRO B CA     1 
ATOM   3484  C C      . PRO B  1 98  ? -85.622  -72.251 39.293  1.00 48.71  ? 91  PRO B C      1 
ATOM   3485  O O      . PRO B  1 98  ? -84.671  -71.892 39.990  1.00 48.23  ? 91  PRO B O      1 
ATOM   3486  C CB     . PRO B  1 98  ? -85.756  -74.675 38.630  1.00 53.80  ? 91  PRO B CB     1 
ATOM   3487  C CG     . PRO B  1 98  ? -84.423  -75.257 38.950  1.00 58.91  ? 91  PRO B CG     1 
ATOM   3488  C CD     . PRO B  1 98  ? -83.383  -74.535 38.136  1.00 58.00  ? 91  PRO B CD     1 
ATOM   3489  N N      . LEU B  1 99  ? -86.871  -71.812 39.474  1.00 49.59  ? 92  LEU B N      1 
ATOM   3490  C CA     . LEU B  1 99  ? -87.222  -70.934 40.579  1.00 49.88  ? 92  LEU B CA     1 
ATOM   3491  C C      . LEU B  1 99  ? -86.952  -71.634 41.907  1.00 57.52  ? 92  LEU B C      1 
ATOM   3492  O O      . LEU B  1 99  ? -86.910  -72.865 41.980  1.00 60.66  ? 92  LEU B O      1 
ATOM   3493  C CB     . LEU B  1 99  ? -88.694  -70.526 40.508  1.00 46.76  ? 92  LEU B CB     1 
ATOM   3494  C CG     . LEU B  1 99  ? -89.099  -69.084 40.195  1.00 49.21  ? 92  LEU B CG     1 
ATOM   3495  C CD1    . LEU B  1 99  ? -88.121  -68.431 39.260  1.00 43.70  ? 92  LEU B CD1    1 
ATOM   3496  C CD2    . LEU B  1 99  ? -90.496  -69.062 39.600  1.00 49.47  ? 92  LEU B CD2    1 
ATOM   3497  N N      . PRO B  1 100 ? -86.755  -70.866 42.973  1.00 57.75  ? 93  PRO B N      1 
ATOM   3498  C CA     . PRO B  1 100 ? -86.593  -71.481 44.292  1.00 62.67  ? 93  PRO B CA     1 
ATOM   3499  C C      . PRO B  1 100 ? -87.879  -72.159 44.730  1.00 63.83  ? 93  PRO B C      1 
ATOM   3500  O O      . PRO B  1 100 ? -88.979  -71.793 44.309  1.00 57.29  ? 93  PRO B O      1 
ATOM   3501  C CB     . PRO B  1 100 ? -86.251  -70.293 45.199  1.00 61.58  ? 93  PRO B CB     1 
ATOM   3502  C CG     . PRO B  1 100 ? -86.841  -69.110 44.502  1.00 57.10  ? 93  PRO B CG     1 
ATOM   3503  C CD     . PRO B  1 100 ? -86.703  -69.396 43.031  1.00 54.30  ? 93  PRO B CD     1 
ATOM   3504  N N      . THR B  1 101 ? -87.726  -73.165 45.584  1.00 70.61  ? 94  THR B N      1 
ATOM   3505  C CA     . THR B  1 101 ? -88.839  -73.949 46.092  1.00 75.12  ? 94  THR B CA     1 
ATOM   3506  C C      . THR B  1 101 ? -88.808  -73.936 47.615  1.00 79.85  ? 94  THR B C      1 
ATOM   3507  O O      . THR B  1 101 ? -87.840  -73.489 48.237  1.00 79.39  ? 94  THR B O      1 
ATOM   3508  C CB     . THR B  1 101 ? -88.777  -75.392 45.566  1.00 81.53  ? 94  THR B CB     1 
ATOM   3509  O OG1    . THR B  1 101 ? -88.553  -75.378 44.150  1.00 80.26  ? 94  THR B OG1    1 
ATOM   3510  C CG2    . THR B  1 101 ? -90.075  -76.136 45.856  1.00 86.97  ? 94  THR B CG2    1 
ATOM   3511  N N      . ALA B  1 102 ? -89.892  -74.422 48.223  1.00 82.17  ? 95  ALA B N      1 
ATOM   3512  C CA     . ALA B  1 102 ? -89.866  -74.671 49.659  1.00 83.26  ? 95  ALA B CA     1 
ATOM   3513  C C      . ALA B  1 102 ? -88.821  -75.718 50.017  1.00 84.16  ? 95  ALA B C      1 
ATOM   3514  O O      . ALA B  1 102 ? -88.206  -75.645 51.087  1.00 87.22  ? 95  ALA B O      1 
ATOM   3515  C CB     . ALA B  1 102 ? -91.246  -75.110 50.144  1.00 84.08  ? 95  ALA B CB     1 
ATOM   3516  N N      . GLN B  1 103 ? -88.605  -76.691 49.134  1.00 84.44  ? 96  GLN B N      1 
ATOM   3517  C CA     . GLN B  1 103 ? -87.606  -77.731 49.338  1.00 86.79  ? 96  GLN B CA     1 
ATOM   3518  C C      . GLN B  1 103 ? -86.200  -77.173 49.167  1.00 86.71  ? 96  GLN B C      1 
ATOM   3519  O O      . GLN B  1 103 ? -85.427  -77.105 50.128  1.00 88.74  ? 96  GLN B O      1 
ATOM   3520  C CB     . GLN B  1 103 ? -87.841  -78.893 48.370  1.00 89.62  ? 96  GLN B CB     1 
ATOM   3521  N N      . ARG B  1 104 ? -85.861  -76.776 47.945  1.00 84.72  ? 97  ARG B N      1 
ATOM   3522  C CA     . ARG B  1 104 ? -84.549  -76.236 47.627  1.00 82.19  ? 97  ARG B CA     1 
ATOM   3523  C C      . ARG B  1 104 ? -84.646  -74.745 47.337  1.00 78.40  ? 97  ARG B C      1 
ATOM   3524  O O      . ARG B  1 104 ? -85.545  -74.296 46.619  1.00 79.27  ? 97  ARG B O      1 
ATOM   3525  C CB     . ARG B  1 104 ? -83.936  -76.956 46.423  1.00 80.33  ? 97  ARG B CB     1 
ATOM   3526  N N      . SER B  1 105 ? -83.718  -73.984 47.907  1.00 76.57  ? 98  SER B N      1 
ATOM   3527  C CA     . SER B  1 105 ? -83.619  -72.554 47.676  1.00 70.48  ? 98  SER B CA     1 
ATOM   3528  C C      . SER B  1 105 ? -82.428  -72.273 46.771  1.00 68.15  ? 98  SER B C      1 
ATOM   3529  O O      . SER B  1 105 ? -81.471  -73.051 46.718  1.00 69.85  ? 98  SER B O      1 
ATOM   3530  C CB     . SER B  1 105 ? -83.460  -71.790 48.995  1.00 69.24  ? 98  SER B CB     1 
ATOM   3531  O OG     . SER B  1 105 ? -84.676  -71.763 49.722  1.00 71.78  ? 98  SER B OG     1 
ATOM   3532  N N      . LEU B  1 106 ? -82.499  -71.156 46.052  1.00 63.26  ? 99  LEU B N      1 
ATOM   3533  C CA     . LEU B  1 106 ? -81.398  -70.761 45.186  1.00 62.49  ? 99  LEU B CA     1 
ATOM   3534  C C      . LEU B  1 106 ? -80.102  -70.696 45.983  1.00 64.70  ? 99  LEU B C      1 
ATOM   3535  O O      . LEU B  1 106 ? -80.102  -70.445 47.192  1.00 66.77  ? 99  LEU B O      1 
ATOM   3536  C CB     . LEU B  1 106 ? -81.691  -69.411 44.530  1.00 54.78  ? 99  LEU B CB     1 
ATOM   3537  C CG     . LEU B  1 106 ? -82.918  -69.380 43.613  1.00 51.27  ? 99  LEU B CG     1 
ATOM   3538  C CD1    . LEU B  1 106 ? -83.043  -68.043 42.898  1.00 46.34  ? 99  LEU B CD1    1 
ATOM   3539  C CD2    . LEU B  1 106 ? -82.873  -70.528 42.610  1.00 51.80  ? 99  LEU B CD2    1 
ATOM   3540  N N      . GLU B  1 107 ? -78.986  -70.918 45.293  1.00 67.91  ? 100 GLU B N      1 
ATOM   3541  C CA     . GLU B  1 107 ? -77.686  -70.911 45.938  1.00 69.51  ? 100 GLU B CA     1 
ATOM   3542  C C      . GLU B  1 107 ? -76.712  -70.060 45.139  1.00 66.96  ? 100 GLU B C      1 
ATOM   3543  O O      . GLU B  1 107 ? -76.672  -70.150 43.905  1.00 67.67  ? 100 GLU B O      1 
ATOM   3544  C CB     . GLU B  1 107 ? -77.129  -72.336 46.063  1.00 77.66  ? 100 GLU B CB     1 
ATOM   3545  C CG     . GLU B  1 107 ? -77.807  -73.189 47.115  1.00 86.93  ? 100 GLU B CG     1 
ATOM   3546  C CD     . GLU B  1 107 ? -77.393  -72.809 48.523  1.00 91.82  ? 100 GLU B CD     1 
ATOM   3547  O OE1    . GLU B  1 107 ? -76.592  -71.862 48.673  1.00 92.72  ? 100 GLU B OE1    1 
ATOM   3548  O OE2    . GLU B  1 107 ? -77.866  -73.460 49.478  1.00 95.73  ? 100 GLU B OE2    1 
ATOM   3549  N N      . PRO B  1 108 ? -75.918  -69.224 45.808  1.00 64.05  ? 101 PRO B N      1 
ATOM   3550  C CA     . PRO B  1 108 ? -74.872  -68.472 45.100  1.00 58.86  ? 101 PRO B CA     1 
ATOM   3551  C C      . PRO B  1 108 ? -73.826  -69.432 44.551  1.00 61.70  ? 101 PRO B C      1 
ATOM   3552  O O      . PRO B  1 108 ? -73.160  -70.144 45.307  1.00 63.48  ? 101 PRO B O      1 
ATOM   3553  C CB     . PRO B  1 108 ? -74.299  -67.550 46.183  1.00 54.12  ? 101 PRO B CB     1 
ATOM   3554  C CG     . PRO B  1 108 ? -74.628  -68.230 47.470  1.00 48.45  ? 101 PRO B CG     1 
ATOM   3555  C CD     . PRO B  1 108 ? -75.943  -68.916 47.248  1.00 65.46  ? 101 PRO B CD     1 
ATOM   3556  N N      . GLY B  1 109 ? -73.689  -69.450 43.230  1.00 64.81  ? 102 GLY B N      1 
ATOM   3557  C CA     . GLY B  1 109 ? -72.710  -70.294 42.576  1.00 69.47  ? 102 GLY B CA     1 
ATOM   3558  C C      . GLY B  1 109 ? -72.002  -69.593 41.437  1.00 70.41  ? 102 GLY B C      1 
ATOM   3559  O O      . GLY B  1 109 ? -71.602  -68.430 41.553  1.00 69.69  ? 102 GLY B O      1 
ATOM   3560  N N      . THR B  1 110 ? -71.846  -70.303 40.323  1.00 78.68  ? 103 THR B N      1 
ATOM   3561  C CA     . THR B  1 110 ? -71.248  -69.766 39.119  1.00 79.96  ? 103 THR B CA     1 
ATOM   3562  C C      . THR B  1 110 ? -72.242  -69.853 37.966  1.00 78.57  ? 103 THR B C      1 
ATOM   3563  O O      . THR B  1 110 ? -73.018  -70.812 37.892  1.00 80.34  ? 103 THR B O      1 
ATOM   3564  C CB     . THR B  1 110 ? -69.967  -70.532 38.754  1.00 84.51  ? 103 THR B CB     1 
ATOM   3565  O OG1    . THR B  1 110 ? -69.527  -70.143 37.448  1.00 87.42  ? 103 THR B OG1    1 
ATOM   3566  C CG2    . THR B  1 110 ? -70.219  -72.035 38.778  1.00 88.12  ? 103 THR B CG2    1 
ATOM   3567  N N      . PRO B  1 111 ? -72.247  -68.872 37.052  1.00 75.08  ? 104 PRO B N      1 
ATOM   3568  C CA     . PRO B  1 111 ? -71.329  -67.727 37.038  1.00 73.18  ? 104 PRO B CA     1 
ATOM   3569  C C      . PRO B  1 111 ? -71.612  -66.709 38.143  1.00 72.85  ? 104 PRO B C      1 
ATOM   3570  O O      . PRO B  1 111 ? -72.717  -66.662 38.687  1.00 75.10  ? 104 PRO B O      1 
ATOM   3571  C CB     . PRO B  1 111 ? -71.572  -67.110 35.660  1.00 70.85  ? 104 PRO B CB     1 
ATOM   3572  C CG     . PRO B  1 111 ? -72.988  -67.448 35.357  1.00 69.10  ? 104 PRO B CG     1 
ATOM   3573  C CD     . PRO B  1 111 ? -73.225  -68.807 35.952  1.00 73.03  ? 104 PRO B CD     1 
ATOM   3574  N N      . ARG B  1 112 ? -70.597  -65.907 38.474  1.00 70.05  ? 105 ARG B N      1 
ATOM   3575  C CA     . ARG B  1 112 ? -70.723  -64.960 39.577  1.00 65.02  ? 105 ARG B CA     1 
ATOM   3576  C C      . ARG B  1 112 ? -71.819  -63.931 39.321  1.00 59.03  ? 105 ARG B C      1 
ATOM   3577  O O      . ARG B  1 112 ? -72.579  -63.585 40.233  1.00 55.79  ? 105 ARG B O      1 
ATOM   3578  C CB     . ARG B  1 112 ? -69.382  -64.265 39.822  1.00 69.14  ? 105 ARG B CB     1 
ATOM   3579  C CG     . ARG B  1 112 ? -68.178  -65.201 39.779  1.00 76.03  ? 105 ARG B CG     1 
ATOM   3580  C CD     . ARG B  1 112 ? -66.926  -64.541 40.348  1.00 80.21  ? 105 ARG B CD     1 
ATOM   3581  N NE     . ARG B  1 112 ? -66.435  -63.443 39.518  1.00 83.10  ? 105 ARG B NE     1 
ATOM   3582  C CZ     . ARG B  1 112 ? -65.490  -63.569 38.591  1.00 86.57  ? 105 ARG B CZ     1 
ATOM   3583  N NH1    . ARG B  1 112 ? -64.928  -64.750 38.370  1.00 89.26  ? 105 ARG B NH1    1 
ATOM   3584  N NH2    . ARG B  1 112 ? -65.104  -62.514 37.885  1.00 86.31  ? 105 ARG B NH2    1 
ATOM   3585  N N      . TRP B  1 113 ? -71.916  -63.426 38.087  1.00 57.44  ? 106 TRP B N      1 
ATOM   3586  C CA     . TRP B  1 113 ? -72.846  -62.335 37.807  1.00 54.91  ? 106 TRP B CA     1 
ATOM   3587  C C      . TRP B  1 113 ? -74.294  -62.726 38.067  1.00 51.34  ? 106 TRP B C      1 
ATOM   3588  O O      . TRP B  1 113 ? -75.099  -61.878 38.469  1.00 49.78  ? 106 TRP B O      1 
ATOM   3589  C CB     . TRP B  1 113 ? -72.678  -61.850 36.366  1.00 53.54  ? 106 TRP B CB     1 
ATOM   3590  C CG     . TRP B  1 113 ? -73.105  -62.838 35.320  1.00 53.10  ? 106 TRP B CG     1 
ATOM   3591  C CD1    . TRP B  1 113 ? -72.306  -63.717 34.649  1.00 54.12  ? 106 TRP B CD1    1 
ATOM   3592  C CD2    . TRP B  1 113 ? -74.432  -63.039 34.817  1.00 52.16  ? 106 TRP B CD2    1 
ATOM   3593  N NE1    . TRP B  1 113 ? -73.052  -64.454 33.760  1.00 55.44  ? 106 TRP B NE1    1 
ATOM   3594  C CE2    . TRP B  1 113 ? -74.361  -64.059 33.847  1.00 53.29  ? 106 TRP B CE2    1 
ATOM   3595  C CE3    . TRP B  1 113 ? -75.673  -62.459 35.095  1.00 45.84  ? 106 TRP B CE3    1 
ATOM   3596  C CZ2    . TRP B  1 113 ? -75.482  -64.509 33.152  1.00 48.39  ? 106 TRP B CZ2    1 
ATOM   3597  C CZ3    . TRP B  1 113 ? -76.786  -62.909 34.406  1.00 43.46  ? 106 TRP B CZ3    1 
ATOM   3598  C CH2    . TRP B  1 113 ? -76.682  -63.923 33.446  1.00 43.04  ? 106 TRP B CH2    1 
ATOM   3599  N N      . ALA B  1 114 ? -74.649  -63.993 37.853  1.00 49.80  ? 107 ALA B N      1 
ATOM   3600  C CA     . ALA B  1 114 ? -76.027  -64.413 38.074  1.00 48.61  ? 107 ALA B CA     1 
ATOM   3601  C C      . ALA B  1 114 ? -76.411  -64.422 39.545  1.00 48.38  ? 107 ALA B C      1 
ATOM   3602  O O      . ALA B  1 114 ? -77.606  -64.490 39.853  1.00 49.68  ? 107 ALA B O      1 
ATOM   3603  C CB     . ALA B  1 114 ? -76.263  -65.800 37.475  1.00 48.15  ? 107 ALA B CB     1 
ATOM   3604  N N      . ASN B  1 115 ? -75.437  -64.361 40.456  1.00 48.99  ? 108 ASN B N      1 
ATOM   3605  C CA     . ASN B  1 115 ? -75.761  -64.352 41.878  1.00 49.57  ? 108 ASN B CA     1 
ATOM   3606  C C      . ASN B  1 115 ? -76.606  -63.147 42.253  1.00 43.33  ? 108 ASN B C      1 
ATOM   3607  O O      . ASN B  1 115 ? -77.467  -63.241 43.135  1.00 40.33  ? 108 ASN B O      1 
ATOM   3608  C CB     . ASN B  1 115 ? -74.478  -64.354 42.708  1.00 55.38  ? 108 ASN B CB     1 
ATOM   3609  C CG     . ASN B  1 115 ? -73.702  -65.640 42.570  1.00 61.86  ? 108 ASN B CG     1 
ATOM   3610  O OD1    . ASN B  1 115 ? -74.274  -66.692 42.286  1.00 64.47  ? 108 ASN B OD1    1 
ATOM   3611  N ND2    . ASN B  1 115 ? -72.390  -65.566 42.770  1.00 64.31  ? 108 ASN B ND2    1 
ATOM   3612  N N      . TYR B  1 116 ? -76.378  -62.011 41.598  1.00 37.65  ? 109 TYR B N      1 
ATOM   3613  C CA     . TYR B  1 116 ? -77.112  -60.801 41.944  1.00 38.25  ? 109 TYR B CA     1 
ATOM   3614  C C      . TYR B  1 116 ? -78.594  -60.942 41.619  1.00 40.22  ? 109 TYR B C      1 
ATOM   3615  O O      . TYR B  1 116 ? -79.454  -60.580 42.429  1.00 39.38  ? 109 TYR B O      1 
ATOM   3616  C CB     . TYR B  1 116 ? -76.502  -59.606 41.218  1.00 36.94  ? 109 TYR B CB     1 
ATOM   3617  C CG     . TYR B  1 116 ? -75.092  -59.293 41.663  1.00 35.79  ? 109 TYR B CG     1 
ATOM   3618  C CD1    . TYR B  1 116 ? -74.852  -58.486 42.767  1.00 36.47  ? 109 TYR B CD1    1 
ATOM   3619  C CD2    . TYR B  1 116 ? -74.001  -59.811 40.980  1.00 35.54  ? 109 TYR B CD2    1 
ATOM   3620  C CE1    . TYR B  1 116 ? -73.562  -58.201 43.176  1.00 34.72  ? 109 TYR B CE1    1 
ATOM   3621  C CE2    . TYR B  1 116 ? -72.711  -59.533 41.380  1.00 34.78  ? 109 TYR B CE2    1 
ATOM   3622  C CZ     . TYR B  1 116 ? -72.496  -58.726 42.477  1.00 35.42  ? 109 TYR B CZ     1 
ATOM   3623  O OH     . TYR B  1 116 ? -71.213  -58.444 42.884  1.00 31.04  ? 109 TYR B OH     1 
ATOM   3624  N N      . VAL B  1 117 ? -78.917  -61.453 40.429  1.00 38.06  ? 110 VAL B N      1 
ATOM   3625  C CA     . VAL B  1 117 ? -80.321  -61.658 40.091  1.00 33.53  ? 110 VAL B CA     1 
ATOM   3626  C C      . VAL B  1 117 ? -80.875  -62.849 40.861  1.00 34.26  ? 110 VAL B C      1 
ATOM   3627  O O      . VAL B  1 117 ? -82.033  -62.841 41.297  1.00 32.79  ? 110 VAL B O      1 
ATOM   3628  C CB     . VAL B  1 117 ? -80.498  -61.820 38.571  1.00 37.60  ? 110 VAL B CB     1 
ATOM   3629  C CG1    . VAL B  1 117 ? -79.149  -61.806 37.880  1.00 37.38  ? 110 VAL B CG1    1 
ATOM   3630  C CG2    . VAL B  1 117 ? -81.250  -63.099 38.259  1.00 32.32  ? 110 VAL B CG2    1 
ATOM   3631  N N      . LYS B  1 118 ? -80.064  -63.897 41.030  1.00 34.29  ? 111 LYS B N      1 
ATOM   3632  C CA     . LYS B  1 118 ? -80.482  -65.033 41.843  1.00 36.39  ? 111 LYS B CA     1 
ATOM   3633  C C      . LYS B  1 118 ? -80.836  -64.586 43.256  1.00 44.70  ? 111 LYS B C      1 
ATOM   3634  O O      . LYS B  1 118 ? -81.881  -64.964 43.798  1.00 37.44  ? 111 LYS B O      1 
ATOM   3635  C CB     . LYS B  1 118 ? -79.375  -66.087 41.889  1.00 38.37  ? 111 LYS B CB     1 
ATOM   3636  C CG     . LYS B  1 118 ? -79.360  -67.087 40.748  1.00 39.66  ? 111 LYS B CG     1 
ATOM   3637  C CD     . LYS B  1 118 ? -78.208  -68.067 40.944  1.00 49.93  ? 111 LYS B CD     1 
ATOM   3638  C CE     . LYS B  1 118 ? -78.106  -69.074 39.810  1.00 52.82  ? 111 LYS B CE     1 
ATOM   3639  N NZ     . LYS B  1 118 ? -76.819  -69.819 39.878  1.00 55.42  ? 111 LYS B NZ     1 
ATOM   3640  N N      . GLY B  1 119 ? -79.979  -63.761 43.863  1.00 41.33  ? 112 GLY B N      1 
ATOM   3641  C CA     . GLY B  1 119 ? -80.238  -63.303 45.219  1.00 38.95  ? 112 GLY B CA     1 
ATOM   3642  C C      . GLY B  1 119 ? -81.512  -62.491 45.331  1.00 39.42  ? 112 GLY B C      1 
ATOM   3643  O O      . GLY B  1 119 ? -82.293  -62.668 46.269  1.00 39.26  ? 112 GLY B O      1 
ATOM   3644  N N      . VAL B  1 120 ? -81.739  -61.585 44.377  1.00 38.71  ? 113 VAL B N      1 
ATOM   3645  C CA     . VAL B  1 120 ? -82.952  -60.773 44.398  1.00 39.84  ? 113 VAL B CA     1 
ATOM   3646  C C      . VAL B  1 120 ? -84.186  -61.658 44.282  1.00 42.61  ? 113 VAL B C      1 
ATOM   3647  O O      . VAL B  1 120 ? -85.200  -61.426 44.951  1.00 44.86  ? 113 VAL B O      1 
ATOM   3648  C CB     . VAL B  1 120 ? -82.905  -59.713 43.283  1.00 35.74  ? 113 VAL B CB     1 
ATOM   3649  C CG1    . VAL B  1 120 ? -84.188  -58.906 43.271  1.00 32.93  ? 113 VAL B CG1    1 
ATOM   3650  C CG2    . VAL B  1 120 ? -81.706  -58.801 43.471  1.00 28.89  ? 113 VAL B CG2    1 
ATOM   3651  N N      . ILE B  1 121 ? -84.123  -62.682 43.428  1.00 41.14  ? 114 ILE B N      1 
ATOM   3652  C CA     . ILE B  1 121 ? -85.236  -63.621 43.312  1.00 39.64  ? 114 ILE B CA     1 
ATOM   3653  C C      . ILE B  1 121 ? -85.474  -64.316 44.644  1.00 38.86  ? 114 ILE B C      1 
ATOM   3654  O O      . ILE B  1 121 ? -86.610  -64.410 45.124  1.00 40.81  ? 114 ILE B O      1 
ATOM   3655  C CB     . ILE B  1 121 ? -84.969  -64.645 42.196  1.00 38.28  ? 114 ILE B CB     1 
ATOM   3656  C CG1    . ILE B  1 121 ? -84.743  -63.944 40.856  1.00 37.81  ? 114 ILE B CG1    1 
ATOM   3657  C CG2    . ILE B  1 121 ? -86.120  -65.637 42.113  1.00 38.27  ? 114 ILE B CG2    1 
ATOM   3658  C CD1    . ILE B  1 121 ? -84.353  -64.889 39.730  1.00 35.39  ? 114 ILE B CD1    1 
ATOM   3659  N N      . GLN B  1 122 ? -84.398  -64.810 45.262  1.00 38.92  ? 115 GLN B N      1 
ATOM   3660  C CA     . GLN B  1 122 ? -84.535  -65.585 46.489  1.00 45.52  ? 115 GLN B CA     1 
ATOM   3661  C C      . GLN B  1 122 ? -85.193  -64.766 47.590  1.00 45.56  ? 115 GLN B C      1 
ATOM   3662  O O      . GLN B  1 122 ? -85.974  -65.296 48.387  1.00 52.15  ? 115 GLN B O      1 
ATOM   3663  C CB     . GLN B  1 122 ? -83.163  -66.086 46.945  1.00 43.94  ? 115 GLN B CB     1 
ATOM   3664  C CG     . GLN B  1 122 ? -83.200  -66.949 48.197  1.00 45.49  ? 115 GLN B CG     1 
ATOM   3665  C CD     . GLN B  1 122 ? -83.926  -68.260 47.974  1.00 47.90  ? 115 GLN B CD     1 
ATOM   3666  O OE1    . GLN B  1 122 ? -83.669  -68.966 46.999  1.00 49.07  ? 115 GLN B OE1    1 
ATOM   3667  N NE2    . GLN B  1 122 ? -84.844  -68.589 48.874  1.00 50.04  ? 115 GLN B NE2    1 
ATOM   3668  N N      . TYR B  1 123 ? -84.879  -63.475 47.659  1.00 44.08  ? 116 TYR B N      1 
ATOM   3669  C CA     . TYR B  1 123 ? -85.384  -62.608 48.712  1.00 45.05  ? 116 TYR B CA     1 
ATOM   3670  C C      . TYR B  1 123 ? -86.541  -61.726 48.266  1.00 44.04  ? 116 TYR B C      1 
ATOM   3671  O O      . TYR B  1 123 ? -86.984  -60.876 49.045  1.00 43.20  ? 116 TYR B O      1 
ATOM   3672  C CB     . TYR B  1 123 ? -84.249  -61.745 49.262  1.00 46.07  ? 116 TYR B CB     1 
ATOM   3673  C CG     . TYR B  1 123 ? -83.173  -62.560 49.937  1.00 52.80  ? 116 TYR B CG     1 
ATOM   3674  C CD1    . TYR B  1 123 ? -83.459  -63.323 51.061  1.00 57.60  ? 116 TYR B CD1    1 
ATOM   3675  C CD2    . TYR B  1 123 ? -81.880  -62.592 49.435  1.00 52.34  ? 116 TYR B CD2    1 
ATOM   3676  C CE1    . TYR B  1 123 ? -82.483  -64.078 51.680  1.00 60.21  ? 116 TYR B CE1    1 
ATOM   3677  C CE2    . TYR B  1 123 ? -80.897  -63.345 50.045  1.00 55.11  ? 116 TYR B CE2    1 
ATOM   3678  C CZ     . TYR B  1 123 ? -81.203  -64.087 51.167  1.00 59.83  ? 116 TYR B CZ     1 
ATOM   3679  O OH     . TYR B  1 123 ? -80.225  -64.839 51.775  1.00 64.15  ? 116 TYR B OH     1 
ATOM   3680  N N      . TYR B  1 124 ? -87.043  -61.900 47.051  1.00 41.62  ? 117 TYR B N      1 
ATOM   3681  C CA     . TYR B  1 124 ? -88.188  -61.113 46.624  1.00 44.30  ? 117 TYR B CA     1 
ATOM   3682  C C      . TYR B  1 124 ? -89.376  -61.406 47.535  1.00 49.73  ? 117 TYR B C      1 
ATOM   3683  O O      . TYR B  1 124 ? -89.702  -62.579 47.766  1.00 47.98  ? 117 TYR B O      1 
ATOM   3684  C CB     . TYR B  1 124 ? -88.558  -61.411 45.174  1.00 42.80  ? 117 TYR B CB     1 
ATOM   3685  C CG     . TYR B  1 124 ? -89.557  -60.428 44.608  1.00 39.80  ? 117 TYR B CG     1 
ATOM   3686  C CD1    . TYR B  1 124 ? -89.193  -59.115 44.338  1.00 33.66  ? 117 TYR B CD1    1 
ATOM   3687  C CD2    . TYR B  1 124 ? -90.870  -60.808 44.364  1.00 41.02  ? 117 TYR B CD2    1 
ATOM   3688  C CE1    . TYR B  1 124 ? -90.100  -58.214 43.829  1.00 36.21  ? 117 TYR B CE1    1 
ATOM   3689  C CE2    . TYR B  1 124 ? -91.786  -59.914 43.851  1.00 39.66  ? 117 TYR B CE2    1 
ATOM   3690  C CZ     . TYR B  1 124 ? -91.396  -58.616 43.588  1.00 39.34  ? 117 TYR B CZ     1 
ATOM   3691  O OH     . TYR B  1 124 ? -92.298  -57.713 43.074  1.00 41.90  ? 117 TYR B OH     1 
ATOM   3692  N N      . PRO B  1 125 ? -90.051  -60.381 48.058  1.00 52.93  ? 118 PRO B N      1 
ATOM   3693  C CA     . PRO B  1 125 ? -91.047  -60.595 49.114  1.00 57.18  ? 118 PRO B CA     1 
ATOM   3694  C C      . PRO B  1 125 ? -92.440  -60.979 48.643  1.00 60.46  ? 118 PRO B C      1 
ATOM   3695  O O      . PRO B  1 125 ? -93.288  -61.273 49.497  1.00 64.56  ? 118 PRO B O      1 
ATOM   3696  C CB     . PRO B  1 125 ? -91.088  -59.224 49.807  1.00 55.52  ? 118 PRO B CB     1 
ATOM   3697  C CG     . PRO B  1 125 ? -90.784  -58.260 48.706  1.00 52.46  ? 118 PRO B CG     1 
ATOM   3698  C CD     . PRO B  1 125 ? -89.796  -58.954 47.804  1.00 49.37  ? 118 PRO B CD     1 
ATOM   3699  N N      . ALA B  1 126 ? -92.706  -60.998 47.339  1.00 61.85  ? 119 ALA B N      1 
ATOM   3700  C CA     . ALA B  1 126 ? -94.045  -61.244 46.827  1.00 61.82  ? 119 ALA B CA     1 
ATOM   3701  C C      . ALA B  1 126 ? -94.135  -62.593 46.123  1.00 64.60  ? 119 ALA B C      1 
ATOM   3702  O O      . ALA B  1 126 ? -93.134  -63.165 45.683  1.00 62.20  ? 119 ALA B O      1 
ATOM   3703  C CB     . ALA B  1 126 ? -94.477  -60.133 45.864  1.00 61.29  ? 119 ALA B CB     1 
ATOM   3704  N N      . ALA B  1 127 ? -95.363  -63.090 46.025  1.00 66.75  ? 120 ALA B N      1 
ATOM   3705  C CA     . ALA B  1 127 ? -95.664  -64.361 45.384  1.00 67.32  ? 120 ALA B CA     1 
ATOM   3706  C C      . ALA B  1 127 ? -97.074  -64.283 44.821  1.00 67.02  ? 120 ALA B C      1 
ATOM   3707  O O      . ALA B  1 127 ? -97.893  -63.490 45.298  1.00 67.41  ? 120 ALA B O      1 
ATOM   3708  C CB     . ALA B  1 127 ? -95.537  -65.535 46.363  1.00 66.94  ? 120 ALA B CB     1 
ATOM   3709  N N      . PRO B  1 128 ? -97.391  -65.092 43.800  1.00 68.31  ? 121 PRO B N      1 
ATOM   3710  C CA     . PRO B  1 128 ? -96.483  -66.074 43.205  1.00 66.76  ? 121 PRO B CA     1 
ATOM   3711  C C      . PRO B  1 128 ? -95.600  -65.478 42.115  1.00 62.10  ? 121 PRO B C      1 
ATOM   3712  O O      . PRO B  1 128 ? -96.081  -64.719 41.273  1.00 58.44  ? 121 PRO B O      1 
ATOM   3713  C CB     . PRO B  1 128 ? -97.441  -67.114 42.624  1.00 68.58  ? 121 PRO B CB     1 
ATOM   3714  C CG     . PRO B  1 128 ? -98.644  -66.321 42.239  1.00 69.49  ? 121 PRO B CG     1 
ATOM   3715  C CD     . PRO B  1 128 ? -98.728  -65.137 43.182  1.00 68.86  ? 121 PRO B CD     1 
ATOM   3716  N N      . LEU B  1 129 ? -94.319  -65.833 42.136  1.00 58.99  ? 122 LEU B N      1 
ATOM   3717  C CA     . LEU B  1 129 ? -93.381  -65.363 41.128  1.00 54.46  ? 122 LEU B CA     1 
ATOM   3718  C C      . LEU B  1 129 ? -93.332  -66.352 39.971  1.00 51.83  ? 122 LEU B C      1 
ATOM   3719  O O      . LEU B  1 129 ? -92.984  -67.521 40.186  1.00 53.00  ? 122 LEU B O      1 
ATOM   3720  C CB     . LEU B  1 129 ? -91.998  -65.192 41.732  1.00 53.85  ? 122 LEU B CB     1 
ATOM   3721  C CG     . LEU B  1 129 ? -91.057  -64.219 41.023  1.00 52.40  ? 122 LEU B CG     1 
ATOM   3722  C CD1    . LEU B  1 129 ? -91.721  -62.868 40.833  1.00 55.44  ? 122 LEU B CD1    1 
ATOM   3723  C CD2    . LEU B  1 129 ? -89.758  -64.068 41.803  1.00 46.87  ? 122 LEU B CD2    1 
ATOM   3724  N N      . PRO B  1 130 ? -93.673  -65.948 38.752  1.00 48.52  ? 123 PRO B N      1 
ATOM   3725  C CA     . PRO B  1 130 ? -93.582  -66.871 37.621  1.00 48.90  ? 123 PRO B CA     1 
ATOM   3726  C C      . PRO B  1 130 ? -92.146  -67.000 37.138  1.00 47.15  ? 123 PRO B C      1 
ATOM   3727  O O      . PRO B  1 130 ? -91.274  -66.190 37.456  1.00 45.60  ? 123 PRO B O      1 
ATOM   3728  C CB     . PRO B  1 130 ? -94.459  -66.214 36.546  1.00 49.44  ? 123 PRO B CB     1 
ATOM   3729  C CG     . PRO B  1 130 ? -95.059  -64.974 37.190  1.00 47.35  ? 123 PRO B CG     1 
ATOM   3730  C CD     . PRO B  1 130 ? -94.181  -64.632 38.337  1.00 45.95  ? 123 PRO B CD     1 
ATOM   3731  N N      . GLY B  1 131 ? -91.905  -68.052 36.362  1.00 48.87  ? 124 GLY B N      1 
ATOM   3732  C CA     . GLY B  1 131 ? -90.682  -68.106 35.591  1.00 48.92  ? 124 GLY B CA     1 
ATOM   3733  C C      . GLY B  1 131 ? -90.636  -66.994 34.562  1.00 49.74  ? 124 GLY B C      1 
ATOM   3734  O O      . GLY B  1 131 ? -91.656  -66.409 34.194  1.00 47.72  ? 124 GLY B O      1 
ATOM   3735  N N      . PHE B  1 132 ? -89.434  -66.694 34.082  1.00 47.35  ? 125 PHE B N      1 
ATOM   3736  C CA     . PHE B  1 132 ? -89.325  -65.646 33.079  1.00 43.34  ? 125 PHE B CA     1 
ATOM   3737  C C      . PHE B  1 132 ? -88.037  -65.826 32.295  1.00 43.45  ? 125 PHE B C      1 
ATOM   3738  O O      . PHE B  1 132 ? -87.072  -66.429 32.772  1.00 46.22  ? 125 PHE B O      1 
ATOM   3739  C CB     . PHE B  1 132 ? -89.364  -64.250 33.714  1.00 41.05  ? 125 PHE B CB     1 
ATOM   3740  C CG     . PHE B  1 132 ? -88.278  -64.008 34.732  1.00 43.98  ? 125 PHE B CG     1 
ATOM   3741  C CD1    . PHE B  1 132 ? -88.441  -64.394 36.053  1.00 45.20  ? 125 PHE B CD1    1 
ATOM   3742  C CD2    . PHE B  1 132 ? -87.091  -63.391 34.363  1.00 42.42  ? 125 PHE B CD2    1 
ATOM   3743  C CE1    . PHE B  1 132 ? -87.443  -64.167 36.985  1.00 43.77  ? 125 PHE B CE1    1 
ATOM   3744  C CE2    . PHE B  1 132 ? -86.093  -63.160 35.289  1.00 40.56  ? 125 PHE B CE2    1 
ATOM   3745  C CZ     . PHE B  1 132 ? -86.268  -63.551 36.601  1.00 41.65  ? 125 PHE B CZ     1 
ATOM   3746  N N      . SER B  1 133 ? -88.044  -65.292 31.079  1.00 41.52  ? 126 SER B N      1 
ATOM   3747  C CA     . SER B  1 133 ? -86.839  -65.108 30.289  1.00 36.86  ? 126 SER B CA     1 
ATOM   3748  C C      . SER B  1 133 ? -86.537  -63.619 30.220  1.00 36.82  ? 126 SER B C      1 
ATOM   3749  O O      . SER B  1 133 ? -87.454  -62.793 30.173  1.00 34.70  ? 126 SER B O      1 
ATOM   3750  C CB     . SER B  1 133 ? -86.997  -65.698 28.884  1.00 40.72  ? 126 SER B CB     1 
ATOM   3751  O OG     . SER B  1 133 ? -87.489  -67.027 28.944  1.00 44.99  ? 126 SER B OG     1 
ATOM   3752  N N      . ALA B  1 134 ? -85.253  -63.279 30.227  1.00 36.86  ? 127 ALA B N      1 
ATOM   3753  C CA     . ALA B  1 134 ? -84.855  -61.881 30.230  1.00 32.95  ? 127 ALA B CA     1 
ATOM   3754  C C      . ALA B  1 134 ? -83.426  -61.775 29.727  1.00 38.42  ? 127 ALA B C      1 
ATOM   3755  O O      . ALA B  1 134 ? -82.608  -62.671 29.949  1.00 40.78  ? 127 ALA B O      1 
ATOM   3756  C CB     . ALA B  1 134 ? -84.979  -61.259 31.625  1.00 31.51  ? 127 ALA B CB     1 
ATOM   3757  N N      . VAL B  1 135 ? -83.135  -60.671 29.048  1.00 37.99  ? 128 VAL B N      1 
ATOM   3758  C CA     . VAL B  1 135 ? -81.775  -60.329 28.656  1.00 39.85  ? 128 VAL B CA     1 
ATOM   3759  C C      . VAL B  1 135 ? -81.391  -59.039 29.364  1.00 42.16  ? 128 VAL B C      1 
ATOM   3760  O O      . VAL B  1 135 ? -82.214  -58.127 29.505  1.00 39.15  ? 128 VAL B O      1 
ATOM   3761  C CB     . VAL B  1 135 ? -81.629  -60.184 27.128  1.00 46.73  ? 128 VAL B CB     1 
ATOM   3762  C CG1    . VAL B  1 135 ? -82.240  -61.384 26.423  1.00 50.34  ? 128 VAL B CG1    1 
ATOM   3763  C CG2    . VAL B  1 135 ? -82.266  -58.888 26.654  1.00 52.67  ? 128 VAL B CG2    1 
ATOM   3764  N N      . VAL B  1 136 ? -80.141  -58.968 29.811  1.00 40.45  ? 129 VAL B N      1 
ATOM   3765  C CA     . VAL B  1 136 ? -79.622  -57.813 30.531  1.00 29.68  ? 129 VAL B CA     1 
ATOM   3766  C C      . VAL B  1 136 ? -78.662  -57.072 29.614  1.00 30.43  ? 129 VAL B C      1 
ATOM   3767  O O      . VAL B  1 136 ? -77.747  -57.676 29.042  1.00 33.56  ? 129 VAL B O      1 
ATOM   3768  C CB     . VAL B  1 136 ? -78.919  -58.235 31.834  1.00 32.25  ? 129 VAL B CB     1 
ATOM   3769  C CG1    . VAL B  1 136 ? -78.554  -57.017 32.663  1.00 31.42  ? 129 VAL B CG1    1 
ATOM   3770  C CG2    . VAL B  1 136 ? -79.787  -59.211 32.625  1.00 29.38  ? 129 VAL B CG2    1 
ATOM   3771  N N      . VAL B  1 137 ? -78.866  -55.767 29.481  1.00 30.93  ? 130 VAL B N      1 
ATOM   3772  C CA     . VAL B  1 137 ? -77.913  -54.894 28.815  1.00 35.82  ? 130 VAL B CA     1 
ATOM   3773  C C      . VAL B  1 137 ? -77.639  -53.704 29.721  1.00 35.31  ? 130 VAL B C      1 
ATOM   3774  O O      . VAL B  1 137 ? -78.493  -53.293 30.514  1.00 35.50  ? 130 VAL B O      1 
ATOM   3775  C CB     . VAL B  1 137 ? -78.413  -54.431 27.431  1.00 38.34  ? 130 VAL B CB     1 
ATOM   3776  C CG1    . VAL B  1 137 ? -78.737  -55.632 26.553  1.00 38.50  ? 130 VAL B CG1    1 
ATOM   3777  C CG2    . VAL B  1 137 ? -79.625  -53.532 27.588  1.00 38.49  ? 130 VAL B CG2    1 
ATOM   3778  N N      . SER B  1 138 ? -76.431  -53.159 29.612  1.00 37.05  ? 131 SER B N      1 
ATOM   3779  C CA     . SER B  1 138 ? -75.993  -52.122 30.532  1.00 37.55  ? 131 SER B CA     1 
ATOM   3780  C C      . SER B  1 138 ? -74.957  -51.232 29.865  1.00 38.54  ? 131 SER B C      1 
ATOM   3781  O O      . SER B  1 138 ? -74.111  -51.710 29.105  1.00 37.67  ? 131 SER B O      1 
ATOM   3782  C CB     . SER B  1 138 ? -75.407  -52.727 31.812  1.00 36.27  ? 131 SER B CB     1 
ATOM   3783  O OG     . SER B  1 138 ? -74.968  -51.710 32.695  1.00 39.07  ? 131 SER B OG     1 
ATOM   3784  N N      . SER B  1 139 ? -75.041  -49.936 30.154  1.00 38.16  ? 132 SER B N      1 
ATOM   3785  C CA     . SER B  1 139 ? -73.987  -48.987 29.830  1.00 39.83  ? 132 SER B CA     1 
ATOM   3786  C C      . SER B  1 139 ? -73.157  -48.634 31.057  1.00 39.45  ? 132 SER B C      1 
ATOM   3787  O O      . SER B  1 139 ? -72.305  -47.742 30.989  1.00 39.33  ? 132 SER B O      1 
ATOM   3788  C CB     . SER B  1 139 ? -74.579  -47.719 29.208  1.00 29.36  ? 132 SER B CB     1 
ATOM   3789  O OG     . SER B  1 139 ? -75.617  -47.190 30.015  1.00 37.57  ? 132 SER B OG     1 
ATOM   3790  N N      . VAL B  1 140 ? -73.407  -49.301 32.178  1.00 38.52  ? 133 VAL B N      1 
ATOM   3791  C CA     . VAL B  1 140 ? -72.636  -49.109 33.402  1.00 41.39  ? 133 VAL B CA     1 
ATOM   3792  C C      . VAL B  1 140 ? -71.414  -50.022 33.329  1.00 41.51  ? 133 VAL B C      1 
ATOM   3793  O O      . VAL B  1 140 ? -71.581  -51.244 33.198  1.00 38.41  ? 133 VAL B O      1 
ATOM   3794  C CB     . VAL B  1 140 ? -73.474  -49.421 34.648  1.00 40.62  ? 133 VAL B CB     1 
ATOM   3795  C CG1    . VAL B  1 140 ? -72.718  -49.030 35.913  1.00 40.67  ? 133 VAL B CG1    1 
ATOM   3796  C CG2    . VAL B  1 140 ? -74.820  -48.718 34.581  1.00 39.12  ? 133 VAL B CG2    1 
ATOM   3797  N N      . PRO B  1 141 ? -70.197  -49.488 33.416  1.00 41.09  ? 134 PRO B N      1 
ATOM   3798  C CA     . PRO B  1 141 ? -69.003  -50.343 33.322  1.00 41.63  ? 134 PRO B CA     1 
ATOM   3799  C C      . PRO B  1 141 ? -68.893  -51.285 34.513  1.00 42.10  ? 134 PRO B C      1 
ATOM   3800  O O      . PRO B  1 141 ? -68.989  -50.864 35.668  1.00 41.72  ? 134 PRO B O      1 
ATOM   3801  C CB     . PRO B  1 141 ? -67.847  -49.337 33.288  1.00 41.15  ? 134 PRO B CB     1 
ATOM   3802  C CG     . PRO B  1 141 ? -68.384  -48.129 33.980  1.00 37.58  ? 134 PRO B CG     1 
ATOM   3803  C CD     . PRO B  1 141 ? -69.853  -48.075 33.654  1.00 38.79  ? 134 PRO B CD     1 
ATOM   3804  N N      . LEU B  1 142 ? -68.695  -52.569 34.222  1.00 48.04  ? 135 LEU B N      1 
ATOM   3805  C CA     . LEU B  1 142 ? -68.607  -53.569 35.278  1.00 51.56  ? 135 LEU B CA     1 
ATOM   3806  C C      . LEU B  1 142 ? -67.343  -53.364 36.103  1.00 52.95  ? 135 LEU B C      1 
ATOM   3807  O O      . LEU B  1 142 ? -66.234  -53.316 35.562  1.00 56.85  ? 135 LEU B O      1 
ATOM   3808  C CB     . LEU B  1 142 ? -68.617  -54.976 34.679  1.00 55.98  ? 135 LEU B CB     1 
ATOM   3809  C CG     . LEU B  1 142 ? -69.713  -55.333 33.672  1.00 56.17  ? 135 LEU B CG     1 
ATOM   3810  C CD1    . LEU B  1 142 ? -69.899  -56.841 33.607  1.00 57.02  ? 135 LEU B CD1    1 
ATOM   3811  C CD2    . LEU B  1 142 ? -71.029  -54.649 34.021  1.00 56.25  ? 135 LEU B CD2    1 
ATOM   3812  N N      . GLY B  1 143 ? -67.515  -53.237 37.418  1.00 56.02  ? 136 GLY B N      1 
ATOM   3813  C CA     . GLY B  1 143 ? -66.391  -53.088 38.319  1.00 56.38  ? 136 GLY B CA     1 
ATOM   3814  C C      . GLY B  1 143 ? -65.770  -51.712 38.369  1.00 55.77  ? 136 GLY B C      1 
ATOM   3815  O O      . GLY B  1 143 ? -64.674  -51.568 38.925  1.00 57.99  ? 136 GLY B O      1 
ATOM   3816  N N      . GLY B  1 144 ? -66.422  -50.698 37.809  1.00 50.28  ? 137 GLY B N      1 
ATOM   3817  C CA     . GLY B  1 144 ? -65.867  -49.363 37.760  1.00 49.90  ? 137 GLY B CA     1 
ATOM   3818  C C      . GLY B  1 144 ? -66.234  -48.446 38.905  1.00 47.79  ? 137 GLY B C      1 
ATOM   3819  O O      . GLY B  1 144 ? -65.877  -47.263 38.867  1.00 51.49  ? 137 GLY B O      1 
ATOM   3820  N N      . GLY B  1 145 ? -66.930  -48.947 39.924  1.00 44.71  ? 138 GLY B N      1 
ATOM   3821  C CA     . GLY B  1 145 ? -67.292  -48.140 41.069  1.00 40.04  ? 138 GLY B CA     1 
ATOM   3822  C C      . GLY B  1 145 ? -68.550  -47.320 40.908  1.00 39.73  ? 138 GLY B C      1 
ATOM   3823  O O      . GLY B  1 145 ? -68.888  -46.552 41.818  1.00 36.18  ? 138 GLY B O      1 
ATOM   3824  N N      . LEU B  1 146 ? -69.242  -47.438 39.775  1.00 39.06  ? 139 LEU B N      1 
ATOM   3825  C CA     . LEU B  1 146 ? -70.490  -46.730 39.524  1.00 35.88  ? 139 LEU B CA     1 
ATOM   3826  C C      . LEU B  1 146 ? -71.717  -47.571 39.860  1.00 32.70  ? 139 LEU B C      1 
ATOM   3827  O O      . LEU B  1 146 ? -72.828  -47.235 39.436  1.00 28.05  ? 139 LEU B O      1 
ATOM   3828  C CB     . LEU B  1 146 ? -70.531  -46.253 38.073  1.00 39.09  ? 139 LEU B CB     1 
ATOM   3829  C CG     . LEU B  1 146 ? -69.308  -45.410 37.707  1.00 38.89  ? 139 LEU B CG     1 
ATOM   3830  C CD1    . LEU B  1 146 ? -69.373  -44.971 36.260  1.00 37.51  ? 139 LEU B CD1    1 
ATOM   3831  C CD2    . LEU B  1 146 ? -69.205  -44.206 38.636  1.00 36.65  ? 139 LEU B CD2    1 
ATOM   3832  N N      . SER B  1 147 ? -71.538  -48.648 40.622  1.00 35.88  ? 140 SER B N      1 
ATOM   3833  C CA     . SER B  1 147 ? -72.637  -49.499 41.075  1.00 32.57  ? 140 SER B CA     1 
ATOM   3834  C C      . SER B  1 147 ? -73.363  -50.157 39.901  1.00 29.01  ? 140 SER B C      1 
ATOM   3835  O O      . SER B  1 147 ? -74.573  -50.005 39.714  1.00 24.68  ? 140 SER B O      1 
ATOM   3836  C CB     . SER B  1 147 ? -73.621  -48.697 41.935  1.00 31.78  ? 140 SER B CB     1 
ATOM   3837  O OG     . SER B  1 147 ? -72.960  -48.018 42.984  1.00 38.68  ? 140 SER B OG     1 
ATOM   3838  N N      . SER B  1 148 ? -72.598  -50.901 39.100  1.00 31.67  ? 141 SER B N      1 
ATOM   3839  C CA     . SER B  1 148 ? -73.231  -51.815 38.157  1.00 36.94  ? 141 SER B CA     1 
ATOM   3840  C C      . SER B  1 148 ? -73.980  -52.911 38.903  1.00 42.01  ? 141 SER B C      1 
ATOM   3841  O O      . SER B  1 148 ? -75.051  -53.353 38.471  1.00 45.54  ? 141 SER B O      1 
ATOM   3842  C CB     . SER B  1 148 ? -72.190  -52.420 37.214  1.00 37.26  ? 141 SER B CB     1 
ATOM   3843  O OG     . SER B  1 148 ? -71.235  -53.195 37.923  1.00 40.77  ? 141 SER B OG     1 
ATOM   3844  N N      . SER B  1 149 ? -73.429  -53.350 40.036  1.00 38.80  ? 142 SER B N      1 
ATOM   3845  C CA     . SER B  1 149 ? -74.069  -54.377 40.851  1.00 36.99  ? 142 SER B CA     1 
ATOM   3846  C C      . SER B  1 149 ? -75.451  -53.937 41.320  1.00 31.66  ? 142 SER B C      1 
ATOM   3847  O O      . SER B  1 149 ? -76.450  -54.632 41.102  1.00 28.86  ? 142 SER B O      1 
ATOM   3848  C CB     . SER B  1 149 ? -73.174  -54.711 42.044  1.00 40.15  ? 142 SER B CB     1 
ATOM   3849  O OG     . SER B  1 149 ? -73.081  -53.604 42.924  1.00 41.17  ? 142 SER B OG     1 
ATOM   3850  N N      . ALA B  1 150 ? -75.526  -52.778 41.981  1.00 27.31  ? 143 ALA B N      1 
ATOM   3851  C CA     . ALA B  1 150 ? -76.814  -52.286 42.457  1.00 28.92  ? 143 ALA B CA     1 
ATOM   3852  C C      . ALA B  1 150 ? -77.745  -51.980 41.292  1.00 31.39  ? 143 ALA B C      1 
ATOM   3853  O O      . ALA B  1 150 ? -78.952  -52.238 41.365  1.00 34.54  ? 143 ALA B O      1 
ATOM   3854  C CB     . ALA B  1 150 ? -76.617  -51.046 43.331  1.00 29.16  ? 143 ALA B CB     1 
ATOM   3855  N N      . SER B  1 151 ? -77.199  -51.430 40.205  1.00 34.16  ? 144 SER B N      1 
ATOM   3856  C CA     . SER B  1 151 ? -77.998  -51.197 39.007  1.00 33.09  ? 144 SER B CA     1 
ATOM   3857  C C      . SER B  1 151 ? -78.662  -52.488 38.543  1.00 34.22  ? 144 SER B C      1 
ATOM   3858  O O      . SER B  1 151 ? -79.856  -52.512 38.224  1.00 35.40  ? 144 SER B O      1 
ATOM   3859  C CB     . SER B  1 151 ? -77.120  -50.605 37.903  1.00 34.31  ? 144 SER B CB     1 
ATOM   3860  O OG     . SER B  1 151 ? -77.898  -50.213 36.785  1.00 37.76  ? 144 SER B OG     1 
ATOM   3861  N N      . LEU B  1 152 ? -77.892  -53.576 38.498  1.00 30.41  ? 145 LEU B N      1 
ATOM   3862  C CA     . LEU B  1 152 ? -78.446  -54.868 38.107  1.00 30.51  ? 145 LEU B CA     1 
ATOM   3863  C C      . LEU B  1 152 ? -79.477  -55.358 39.116  1.00 31.22  ? 145 LEU B C      1 
ATOM   3864  O O      . LEU B  1 152 ? -80.541  -55.859 38.732  1.00 35.29  ? 145 LEU B O      1 
ATOM   3865  C CB     . LEU B  1 152 ? -77.318  -55.885 37.944  1.00 33.35  ? 145 LEU B CB     1 
ATOM   3866  C CG     . LEU B  1 152 ? -77.675  -57.322 37.567  1.00 36.94  ? 145 LEU B CG     1 
ATOM   3867  C CD1    . LEU B  1 152 ? -78.515  -57.363 36.299  1.00 34.20  ? 145 LEU B CD1    1 
ATOM   3868  C CD2    . LEU B  1 152 ? -76.400  -58.126 37.398  1.00 38.83  ? 145 LEU B CD2    1 
ATOM   3869  N N      . GLU B  1 153 ? -79.183  -55.222 40.413  1.00 29.69  ? 146 GLU B N      1 
ATOM   3870  C CA     . GLU B  1 153 ? -80.092  -55.738 41.431  1.00 33.09  ? 146 GLU B CA     1 
ATOM   3871  C C      . GLU B  1 153 ? -81.431  -55.013 41.392  1.00 31.08  ? 146 GLU B C      1 
ATOM   3872  O O      . GLU B  1 153 ? -82.491  -55.648 41.434  1.00 34.72  ? 146 GLU B O      1 
ATOM   3873  C CB     . GLU B  1 153 ? -79.459  -55.609 42.814  1.00 34.29  ? 146 GLU B CB     1 
ATOM   3874  C CG     . GLU B  1 153 ? -78.083  -56.218 42.933  1.00 38.54  ? 146 GLU B CG     1 
ATOM   3875  C CD     . GLU B  1 153 ? -77.318  -55.635 44.099  1.00 46.57  ? 146 GLU B CD     1 
ATOM   3876  O OE1    . GLU B  1 153 ? -77.814  -54.652 44.689  1.00 46.74  ? 146 GLU B OE1    1 
ATOM   3877  O OE2    . GLU B  1 153 ? -76.232  -56.157 44.429  1.00 50.48  ? 146 GLU B OE2    1 
ATOM   3878  N N      . VAL B  1 154 ? -81.401  -53.683 41.298  1.00 33.19  ? 147 VAL B N      1 
ATOM   3879  C CA     . VAL B  1 154 ? -82.637  -52.908 41.288  1.00 32.05  ? 147 VAL B CA     1 
ATOM   3880  C C      . VAL B  1 154 ? -83.395  -53.131 39.984  1.00 31.56  ? 147 VAL B C      1 
ATOM   3881  O O      . VAL B  1 154 ? -84.630  -53.202 39.974  1.00 30.35  ? 147 VAL B O      1 
ATOM   3882  C CB     . VAL B  1 154 ? -82.329  -51.418 41.532  1.00 29.31  ? 147 VAL B CB     1 
ATOM   3883  C CG1    . VAL B  1 154 ? -83.594  -50.578 41.403  1.00 27.90  ? 147 VAL B CG1    1 
ATOM   3884  C CG2    . VAL B  1 154 ? -81.697  -51.226 42.908  1.00 27.86  ? 147 VAL B CG2    1 
ATOM   3885  N N      . ALA B  1 155 ? -82.674  -53.241 38.864  1.00 31.20  ? 148 ALA B N      1 
ATOM   3886  C CA     . ALA B  1 155 ? -83.321  -53.589 37.602  1.00 29.76  ? 148 ALA B CA     1 
ATOM   3887  C C      . ALA B  1 155 ? -84.052  -54.919 37.718  1.00 34.10  ? 148 ALA B C      1 
ATOM   3888  O O      . ALA B  1 155 ? -85.219  -55.037 37.328  1.00 32.28  ? 148 ALA B O      1 
ATOM   3889  C CB     . ALA B  1 155 ? -82.291  -53.639 36.472  1.00 25.57  ? 148 ALA B CB     1 
ATOM   3890  N N      . THR B  1 156 ? -83.371  -55.938 38.246  1.00 33.99  ? 149 THR B N      1 
ATOM   3891  C CA     . THR B  1 156 ? -84.020  -57.222 38.477  1.00 32.35  ? 149 THR B CA     1 
ATOM   3892  C C      . THR B  1 156 ? -85.257  -57.054 39.346  1.00 36.03  ? 149 THR B C      1 
ATOM   3893  O O      . THR B  1 156 ? -86.330  -57.582 39.032  1.00 40.91  ? 149 THR B O      1 
ATOM   3894  C CB     . THR B  1 156 ? -83.040  -58.198 39.126  1.00 34.13  ? 149 THR B CB     1 
ATOM   3895  O OG1    . THR B  1 156 ? -81.939  -58.433 38.241  1.00 34.11  ? 149 THR B OG1    1 
ATOM   3896  C CG2    . THR B  1 156 ? -83.731  -59.514 39.433  1.00 28.42  ? 149 THR B CG2    1 
ATOM   3897  N N      . TYR B  1 157 ? -85.121  -56.337 40.463  1.00 33.48  ? 150 TYR B N      1 
ATOM   3898  C CA     . TYR B  1 157 ? -86.266  -56.136 41.346  1.00 34.37  ? 150 TYR B CA     1 
ATOM   3899  C C      . TYR B  1 157 ? -87.421  -55.463 40.617  1.00 34.31  ? 150 TYR B C      1 
ATOM   3900  O O      . TYR B  1 157 ? -88.573  -55.897 40.724  1.00 33.94  ? 150 TYR B O      1 
ATOM   3901  C CB     . TYR B  1 157 ? -85.862  -55.320 42.573  1.00 31.85  ? 150 TYR B CB     1 
ATOM   3902  C CG     . TYR B  1 157 ? -86.926  -55.313 43.645  1.00 31.83  ? 150 TYR B CG     1 
ATOM   3903  C CD1    . TYR B  1 157 ? -88.065  -54.528 43.507  1.00 28.68  ? 150 TYR B CD1    1 
ATOM   3904  C CD2    . TYR B  1 157 ? -86.809  -56.105 44.774  1.00 30.32  ? 150 TYR B CD2    1 
ATOM   3905  C CE1    . TYR B  1 157 ? -89.047  -54.518 44.470  1.00 30.24  ? 150 TYR B CE1    1 
ATOM   3906  C CE2    . TYR B  1 157 ? -87.784  -56.101 45.745  1.00 32.54  ? 150 TYR B CE2    1 
ATOM   3907  C CZ     . TYR B  1 157 ? -88.904  -55.311 45.589  1.00 32.26  ? 150 TYR B CZ     1 
ATOM   3908  O OH     . TYR B  1 157 ? -89.876  -55.313 46.565  1.00 38.35  ? 150 TYR B OH     1 
ATOM   3909  N N      . THR B  1 158 ? -87.138  -54.386 39.884  1.00 33.00  ? 151 THR B N      1 
ATOM   3910  C CA     . THR B  1 158 ? -88.209  -53.701 39.171  1.00 32.41  ? 151 THR B CA     1 
ATOM   3911  C C      . THR B  1 158 ? -88.865  -54.617 38.146  1.00 34.21  ? 151 THR B C      1 
ATOM   3912  O O      . THR B  1 158 ? -90.073  -54.512 37.904  1.00 34.04  ? 151 THR B O      1 
ATOM   3913  C CB     . THR B  1 158 ? -87.676  -52.440 38.499  1.00 31.84  ? 151 THR B CB     1 
ATOM   3914  O OG1    . THR B  1 158 ? -86.818  -51.737 39.409  1.00 31.53  ? 151 THR B OG1    1 
ATOM   3915  C CG2    . THR B  1 158 ? -88.831  -51.536 38.102  1.00 26.23  ? 151 THR B CG2    1 
ATOM   3916  N N      . PHE B  1 159 ? -88.091  -55.518 37.536  1.00 33.97  ? 152 PHE B N      1 
ATOM   3917  C CA     . PHE B  1 159 ? -88.671  -56.477 36.601  1.00 36.09  ? 152 PHE B CA     1 
ATOM   3918  C C      . PHE B  1 159 ? -89.659  -57.393 37.308  1.00 34.95  ? 152 PHE B C      1 
ATOM   3919  O O      . PHE B  1 159 ? -90.790  -57.585 36.846  1.00 35.97  ? 152 PHE B O      1 
ATOM   3920  C CB     . PHE B  1 159 ? -87.573  -57.316 35.952  1.00 40.28  ? 152 PHE B CB     1 
ATOM   3921  C CG     . PHE B  1 159 ? -88.074  -58.238 34.880  1.00 42.79  ? 152 PHE B CG     1 
ATOM   3922  C CD1    . PHE B  1 159 ? -88.841  -57.757 33.833  1.00 44.77  ? 152 PHE B CD1    1 
ATOM   3923  C CD2    . PHE B  1 159 ? -87.849  -59.602 34.969  1.00 45.19  ? 152 PHE B CD2    1 
ATOM   3924  C CE1    . PHE B  1 159 ? -89.315  -58.609 32.854  1.00 42.83  ? 152 PHE B CE1    1 
ATOM   3925  C CE2    . PHE B  1 159 ? -88.333  -60.461 34.002  1.00 48.36  ? 152 PHE B CE2    1 
ATOM   3926  C CZ     . PHE B  1 159 ? -89.066  -59.964 32.941  1.00 45.42  ? 152 PHE B CZ     1 
ATOM   3927  N N      . LEU B  1 160 ? -89.239  -57.977 38.435  1.00 34.14  ? 153 LEU B N      1 
ATOM   3928  C CA     . LEU B  1 160 ? -90.103  -58.884 39.182  1.00 38.78  ? 153 LEU B CA     1 
ATOM   3929  C C      . LEU B  1 160 ? -91.390  -58.203 39.623  1.00 40.01  ? 153 LEU B C      1 
ATOM   3930  O O      . LEU B  1 160 ? -92.425  -58.864 39.769  1.00 41.33  ? 153 LEU B O      1 
ATOM   3931  C CB     . LEU B  1 160 ? -89.345  -59.440 40.389  1.00 36.23  ? 153 LEU B CB     1 
ATOM   3932  C CG     . LEU B  1 160 ? -88.037  -60.178 40.082  1.00 36.32  ? 153 LEU B CG     1 
ATOM   3933  C CD1    . LEU B  1 160 ? -87.433  -60.769 41.349  1.00 35.92  ? 153 LEU B CD1    1 
ATOM   3934  C CD2    . LEU B  1 160 ? -88.274  -61.268 39.049  1.00 31.98  ? 153 LEU B CD2    1 
ATOM   3935  N N      . GLN B  1 161 ? -91.349  -56.886 39.837  1.00 40.10  ? 154 GLN B N      1 
ATOM   3936  C CA     . GLN B  1 161 ? -92.567  -56.159 40.170  1.00 41.33  ? 154 GLN B CA     1 
ATOM   3937  C C      . GLN B  1 161 ? -93.581  -56.236 39.038  1.00 41.25  ? 154 GLN B C      1 
ATOM   3938  O O      . GLN B  1 161 ? -94.793  -56.227 39.285  1.00 42.48  ? 154 GLN B O      1 
ATOM   3939  C CB     . GLN B  1 161 ? -92.237  -54.698 40.469  1.00 41.80  ? 154 GLN B CB     1 
ATOM   3940  C CG     . GLN B  1 161 ? -91.542  -54.466 41.800  1.00 39.53  ? 154 GLN B CG     1 
ATOM   3941  C CD     . GLN B  1 161 ? -91.195  -53.011 42.019  1.00 38.84  ? 154 GLN B CD     1 
ATOM   3942  O OE1    . GLN B  1 161 ? -90.078  -52.575 41.745  1.00 44.21  ? 154 GLN B OE1    1 
ATOM   3943  N NE2    . GLN B  1 161 ? -92.161  -52.246 42.505  1.00 37.83  ? 154 GLN B NE2    1 
ATOM   3944  N N      . GLN B  1 162 ? -93.107  -56.318 37.794  1.00 42.61  ? 155 GLN B N      1 
ATOM   3945  C CA     . GLN B  1 162 ? -94.022  -56.447 36.666  1.00 43.17  ? 155 GLN B CA     1 
ATOM   3946  C C      . GLN B  1 162 ? -94.648  -57.835 36.632  1.00 45.67  ? 155 GLN B C      1 
ATOM   3947  O O      . GLN B  1 162 ? -95.841  -57.978 36.343  1.00 47.68  ? 155 GLN B O      1 
ATOM   3948  C CB     . GLN B  1 162 ? -93.288  -56.155 35.359  1.00 42.20  ? 155 GLN B CB     1 
ATOM   3949  C CG     . GLN B  1 162 ? -92.384  -54.932 35.418  1.00 37.46  ? 155 GLN B CG     1 
ATOM   3950  C CD     . GLN B  1 162 ? -93.096  -53.696 35.931  1.00 38.82  ? 155 GLN B CD     1 
ATOM   3951  O OE1    . GLN B  1 162 ? -92.608  -53.019 36.837  1.00 41.68  ? 155 GLN B OE1    1 
ATOM   3952  N NE2    . GLN B  1 162 ? -94.253  -53.394 35.354  1.00 36.62  ? 155 GLN B NE2    1 
ATOM   3953  N N      . LEU B  1 163 ? -93.853  -58.869 36.923  1.00 44.81  ? 156 LEU B N      1 
ATOM   3954  C CA     . LEU B  1 163 ? -94.376  -60.229 36.989  1.00 47.06  ? 156 LEU B CA     1 
ATOM   3955  C C      . LEU B  1 163 ? -95.283  -60.422 38.196  1.00 50.21  ? 156 LEU B C      1 
ATOM   3956  O O      . LEU B  1 163 ? -96.259  -61.178 38.124  1.00 53.04  ? 156 LEU B O      1 
ATOM   3957  C CB     . LEU B  1 163 ? -93.224  -61.231 37.038  1.00 44.01  ? 156 LEU B CB     1 
ATOM   3958  C CG     . LEU B  1 163 ? -92.146  -61.081 35.967  1.00 42.94  ? 156 LEU B CG     1 
ATOM   3959  C CD1    . LEU B  1 163 ? -91.003  -62.042 36.234  1.00 41.92  ? 156 LEU B CD1    1 
ATOM   3960  C CD2    . LEU B  1 163 ? -92.751  -61.342 34.602  1.00 43.65  ? 156 LEU B CD2    1 
ATOM   3961  N N      . CYS B  1 164 ? -94.977  -59.756 39.305  1.00 51.95  ? 157 CYS B N      1 
ATOM   3962  C CA     . CYS B  1 164 ? -95.670  -59.952 40.570  1.00 54.78  ? 157 CYS B CA     1 
ATOM   3963  C C      . CYS B  1 164 ? -95.508  -58.696 41.414  1.00 58.13  ? 157 CYS B C      1 
ATOM   3964  O O      . CYS B  1 164 ? -94.536  -58.574 42.171  1.00 59.05  ? 157 CYS B O      1 
ATOM   3965  C CB     . CYS B  1 164 ? -95.122  -61.178 41.305  1.00 53.22  ? 157 CYS B CB     1 
ATOM   3966  S SG     . CYS B  1 164 ? -95.994  -61.622 42.828  1.00 58.77  ? 157 CYS B SG     1 
ATOM   3967  N N      . PRO B  1 165 ? -96.436  -57.746 41.316  1.00 61.81  ? 158 PRO B N      1 
ATOM   3968  C CA     . PRO B  1 165 ? -96.251  -56.473 42.018  1.00 62.60  ? 158 PRO B CA     1 
ATOM   3969  C C      . PRO B  1 165 ? -96.144  -56.694 43.517  1.00 64.62  ? 158 PRO B C      1 
ATOM   3970  O O      . PRO B  1 165 ? -96.863  -57.510 44.096  1.00 64.17  ? 158 PRO B O      1 
ATOM   3971  C CB     . PRO B  1 165 ? -97.515  -55.680 41.662  1.00 63.21  ? 158 PRO B CB     1 
ATOM   3972  C CG     . PRO B  1 165 ? -98.516  -56.718 41.245  1.00 64.46  ? 158 PRO B CG     1 
ATOM   3973  C CD     . PRO B  1 165 ? -97.727  -57.818 40.612  1.00 63.13  ? 158 PRO B CD     1 
ATOM   3974  N N      . ASP B  1 166 ? -95.232  -55.959 44.140  1.00 66.28  ? 159 ASP B N      1 
ATOM   3975  C CA     . ASP B  1 166 ? -95.061  -56.004 45.582  1.00 72.28  ? 159 ASP B CA     1 
ATOM   3976  C C      . ASP B  1 166 ? -95.866  -54.872 46.205  1.00 82.89  ? 159 ASP B C      1 
ATOM   3977  O O      . ASP B  1 166 ? -96.367  -53.979 45.518  1.00 81.29  ? 159 ASP B O      1 
ATOM   3978  C CB     . ASP B  1 166 ? -93.579  -55.913 45.976  1.00 66.30  ? 159 ASP B CB     1 
ATOM   3979  C CG     . ASP B  1 166 ? -92.983  -54.530 45.743  1.00 63.68  ? 159 ASP B CG     1 
ATOM   3980  O OD1    . ASP B  1 166 ? -93.670  -53.653 45.178  1.00 64.16  ? 159 ASP B OD1    1 
ATOM   3981  O OD2    . ASP B  1 166 ? -91.814  -54.319 46.128  1.00 64.26  ? 159 ASP B OD2    1 
ATOM   3982  N N      . SER B  1 167 ? -95.984  -54.910 47.527  1.00 98.53  ? 160 SER B N      1 
ATOM   3983  C CA     . SER B  1 167 ? -96.792  -53.924 48.230  1.00 103.05 ? 160 SER B CA     1 
ATOM   3984  C C      . SER B  1 167 ? -95.969  -52.848 48.923  1.00 102.84 ? 160 SER B C      1 
ATOM   3985  O O      . SER B  1 167 ? -96.348  -51.673 48.887  1.00 105.74 ? 160 SER B O      1 
ATOM   3986  C CB     . SER B  1 167 ? -97.691  -54.621 49.256  1.00 107.66 ? 160 SER B CB     1 
ATOM   3987  O OG     . SER B  1 167 ? -96.931  -55.412 50.157  1.00 110.01 ? 160 SER B OG     1 
ATOM   3988  N N      . GLY B  1 168 ? -94.846  -53.210 49.533  1.00 98.04  ? 161 GLY B N      1 
ATOM   3989  C CA     . GLY B  1 168 ? -94.161  -52.305 50.428  1.00 92.73  ? 161 GLY B CA     1 
ATOM   3990  C C      . GLY B  1 168 ? -93.581  -51.076 49.749  1.00 85.92  ? 161 GLY B C      1 
ATOM   3991  O O      . GLY B  1 168 ? -93.875  -50.740 48.601  1.00 84.11  ? 161 GLY B O      1 
ATOM   3992  N N      . THR B  1 169 ? -92.718  -50.398 50.504  1.00 80.77  ? 162 THR B N      1 
ATOM   3993  C CA     . THR B  1 169 ? -92.141  -49.109 50.154  1.00 71.90  ? 162 THR B CA     1 
ATOM   3994  C C      . THR B  1 169 ? -90.789  -49.275 49.458  1.00 60.62  ? 162 THR B C      1 
ATOM   3995  O O      . THR B  1 169 ? -90.212  -50.363 49.406  1.00 57.69  ? 162 THR B O      1 
ATOM   3996  C CB     . THR B  1 169 ? -91.989  -48.234 51.399  1.00 71.29  ? 162 THR B CB     1 
ATOM   3997  N N      . ILE B  1 170 ? -90.280  -48.161 48.922  1.00 56.28  ? 163 ILE B N      1 
ATOM   3998  C CA     . ILE B  1 170 ? -88.959  -48.163 48.295  1.00 51.96  ? 163 ILE B CA     1 
ATOM   3999  C C      . ILE B  1 170 ? -87.885  -48.633 49.265  1.00 52.99  ? 163 ILE B C      1 
ATOM   4000  O O      . ILE B  1 170 ? -86.932  -49.313 48.867  1.00 52.09  ? 163 ILE B O      1 
ATOM   4001  C CB     . ILE B  1 170 ? -88.616  -46.770 47.732  1.00 52.19  ? 163 ILE B CB     1 
ATOM   4002  C CG1    . ILE B  1 170 ? -89.583  -46.358 46.615  1.00 54.23  ? 163 ILE B CG1    1 
ATOM   4003  C CG2    . ILE B  1 170 ? -87.145  -46.707 47.320  1.00 53.41  ? 163 ILE B CG2    1 
ATOM   4004  C CD1    . ILE B  1 170 ? -88.891  -46.202 45.262  1.00 55.44  ? 163 ILE B CD1    1 
ATOM   4005  N N      . ALA B  1 171 ? -88.004  -48.274 50.545  1.00 52.44  ? 164 ALA B N      1 
ATOM   4006  C CA     . ALA B  1 171 ? -86.991  -48.701 51.506  1.00 52.47  ? 164 ALA B CA     1 
ATOM   4007  C C      . ALA B  1 171 ? -86.896  -50.222 51.579  1.00 50.38  ? 164 ALA B C      1 
ATOM   4008  O O      . ALA B  1 171 ? -85.794  -50.779 51.637  1.00 50.03  ? 164 ALA B O      1 
ATOM   4009  C CB     . ALA B  1 171 ? -87.296  -48.115 52.884  1.00 55.76  ? 164 ALA B CB     1 
ATOM   4010  N N      . ALA B  1 172 ? -88.038  -50.912 51.551  1.00 50.68  ? 165 ALA B N      1 
ATOM   4011  C CA     . ALA B  1 172 ? -88.019  -52.372 51.580  1.00 50.00  ? 165 ALA B CA     1 
ATOM   4012  C C      . ALA B  1 172 ? -87.319  -52.944 50.352  1.00 45.06  ? 165 ALA B C      1 
ATOM   4013  O O      . ALA B  1 172 ? -86.564  -53.919 50.453  1.00 42.02  ? 165 ALA B O      1 
ATOM   4014  C CB     . ALA B  1 172 ? -89.445  -52.912 51.683  1.00 53.43  ? 165 ALA B CB     1 
ATOM   4015  N N      . ARG B  1 173 ? -87.559  -52.348 49.183  1.00 44.12  ? 166 ARG B N      1 
ATOM   4016  C CA     . ARG B  1 173 ? -86.896  -52.798 47.964  1.00 45.70  ? 166 ARG B CA     1 
ATOM   4017  C C      . ARG B  1 173 ? -85.387  -52.633 48.079  1.00 44.89  ? 166 ARG B C      1 
ATOM   4018  O O      . ARG B  1 173 ? -84.620  -53.532 47.717  1.00 47.17  ? 166 ARG B O      1 
ATOM   4019  C CB     . ARG B  1 173 ? -87.432  -52.019 46.764  1.00 45.29  ? 166 ARG B CB     1 
ATOM   4020  C CG     . ARG B  1 173 ? -88.937  -52.101 46.596  1.00 50.78  ? 166 ARG B CG     1 
ATOM   4021  C CD     . ARG B  1 173 ? -89.426  -51.141 45.525  1.00 53.78  ? 166 ARG B CD     1 
ATOM   4022  N NE     . ARG B  1 173 ? -90.883  -51.078 45.483  1.00 57.48  ? 166 ARG B NE     1 
ATOM   4023  C CZ     . ARG B  1 173 ? -91.569  -50.074 44.949  1.00 61.31  ? 166 ARG B CZ     1 
ATOM   4024  N NH1    . ARG B  1 173 ? -90.927  -49.045 44.411  1.00 60.95  ? 166 ARG B NH1    1 
ATOM   4025  N NH2    . ARG B  1 173 ? -92.895  -50.100 44.954  1.00 63.55  ? 166 ARG B NH2    1 
ATOM   4026  N N      . ALA B  1 174 ? -84.943  -51.477 48.576  1.00 43.05  ? 167 ALA B N      1 
ATOM   4027  C CA     . ALA B  1 174 ? -83.514  -51.262 48.783  1.00 37.78  ? 167 ALA B CA     1 
ATOM   4028  C C      . ALA B  1 174 ? -82.918  -52.328 49.695  1.00 32.64  ? 167 ALA B C      1 
ATOM   4029  O O      . ALA B  1 174 ? -81.831  -52.852 49.423  1.00 32.42  ? 167 ALA B O      1 
ATOM   4030  C CB     . ALA B  1 174 ? -83.274  -49.868 49.360  1.00 34.74  ? 167 ALA B CB     1 
ATOM   4031  N N      . GLN B  1 175 ? -83.614  -52.662 50.785  1.00 34.85  ? 168 GLN B N      1 
ATOM   4032  C CA     . GLN B  1 175 ? -83.085  -53.658 51.711  1.00 41.86  ? 168 GLN B CA     1 
ATOM   4033  C C      . GLN B  1 175 ? -83.075  -55.054 51.101  1.00 44.05  ? 168 GLN B C      1 
ATOM   4034  O O      . GLN B  1 175 ? -82.187  -55.856 51.412  1.00 43.68  ? 168 GLN B O      1 
ATOM   4035  C CB     . GLN B  1 175 ? -83.883  -53.653 53.014  1.00 51.41  ? 168 GLN B CB     1 
ATOM   4036  C CG     . GLN B  1 175 ? -83.167  -52.960 54.172  1.00 60.76  ? 168 GLN B CG     1 
ATOM   4037  C CD     . GLN B  1 175 ? -83.759  -51.604 54.509  1.00 65.45  ? 168 GLN B CD     1 
ATOM   4038  O OE1    . GLN B  1 175 ? -84.784  -51.513 55.190  1.00 68.56  ? 168 GLN B OE1    1 
ATOM   4039  N NE2    . GLN B  1 175 ? -83.115  -50.539 54.036  1.00 62.42  ? 168 GLN B NE2    1 
ATOM   4040  N N      . VAL B  1 176 ? -84.043  -55.367 50.238  1.00 44.60  ? 169 VAL B N      1 
ATOM   4041  C CA     . VAL B  1 176 ? -84.009  -56.648 49.539  1.00 41.48  ? 169 VAL B CA     1 
ATOM   4042  C C      . VAL B  1 176 ? -82.763  -56.733 48.670  1.00 39.88  ? 169 VAL B C      1 
ATOM   4043  O O      . VAL B  1 176 ? -82.027  -57.727 48.699  1.00 40.74  ? 169 VAL B O      1 
ATOM   4044  C CB     . VAL B  1 176 ? -85.291  -56.846 48.710  1.00 38.48  ? 169 VAL B CB     1 
ATOM   4045  C CG1    . VAL B  1 176 ? -85.069  -57.919 47.655  1.00 36.20  ? 169 VAL B CG1    1 
ATOM   4046  C CG2    . VAL B  1 176 ? -86.455  -57.214 49.618  1.00 38.61  ? 169 VAL B CG2    1 
ATOM   4047  N N      . CYS B  1 177 ? -82.506  -55.684 47.883  1.00 37.37  ? 170 CYS B N      1 
ATOM   4048  C CA     . CYS B  1 177 ? -81.324  -55.672 47.030  1.00 40.11  ? 170 CYS B CA     1 
ATOM   4049  C C      . CYS B  1 177 ? -80.038  -55.673 47.850  1.00 44.56  ? 170 CYS B C      1 
ATOM   4050  O O      . CYS B  1 177 ? -79.039  -56.265 47.425  1.00 49.57  ? 170 CYS B O      1 
ATOM   4051  C CB     . CYS B  1 177 ? -81.373  -54.468 46.088  1.00 38.03  ? 170 CYS B CB     1 
ATOM   4052  S SG     . CYS B  1 177 ? -82.737  -54.523 44.893  1.00 38.96  ? 170 CYS B SG     1 
ATOM   4053  N N      . GLN B  1 178 ? -80.034  -55.023 49.019  1.00 45.12  ? 171 GLN B N      1 
ATOM   4054  C CA     . GLN B  1 178 ? -78.844  -55.076 49.864  1.00 46.89  ? 171 GLN B CA     1 
ATOM   4055  C C      . GLN B  1 178 ? -78.691  -56.455 50.487  1.00 47.33  ? 171 GLN B C      1 
ATOM   4056  O O      . GLN B  1 178 ? -77.580  -56.994 50.556  1.00 43.05  ? 171 GLN B O      1 
ATOM   4057  C CB     . GLN B  1 178 ? -78.898  -54.007 50.955  1.00 44.26  ? 171 GLN B CB     1 
ATOM   4058  C CG     . GLN B  1 178 ? -77.623  -53.944 51.789  1.00 44.71  ? 171 GLN B CG     1 
ATOM   4059  C CD     . GLN B  1 178 ? -77.790  -53.141 53.066  1.00 45.54  ? 171 GLN B CD     1 
ATOM   4060  O OE1    . GLN B  1 178 ? -78.907  -52.928 53.535  1.00 48.07  ? 171 GLN B OE1    1 
ATOM   4061  N NE2    . GLN B  1 178 ? -76.677  -52.690 53.635  1.00 43.16  ? 171 GLN B NE2    1 
ATOM   4062  N N      . GLN B  1 179 ? -79.799  -57.039 50.949  1.00 51.82  ? 172 GLN B N      1 
ATOM   4063  C CA     . GLN B  1 179 ? -79.761  -58.399 51.470  1.00 55.72  ? 172 GLN B CA     1 
ATOM   4064  C C      . GLN B  1 179 ? -79.219  -59.357 50.418  1.00 55.82  ? 172 GLN B C      1 
ATOM   4065  O O      . GLN B  1 179 ? -78.445  -60.270 50.731  1.00 55.72  ? 172 GLN B O      1 
ATOM   4066  C CB     . GLN B  1 179 ? -81.161  -58.815 51.922  1.00 62.26  ? 172 GLN B CB     1 
ATOM   4067  C CG     . GLN B  1 179 ? -81.223  -60.123 52.686  1.00 70.52  ? 172 GLN B CG     1 
ATOM   4068  C CD     . GLN B  1 179 ? -80.301  -60.125 53.891  1.00 77.24  ? 172 GLN B CD     1 
ATOM   4069  O OE1    . GLN B  1 179 ? -79.417  -60.972 54.011  1.00 80.23  ? 172 GLN B OE1    1 
ATOM   4070  N NE2    . GLN B  1 179 ? -80.507  -59.170 54.794  1.00 77.59  ? 172 GLN B NE2    1 
ATOM   4071  N N      . ALA B  1 180 ? -79.628  -59.169 49.161  1.00 51.43  ? 173 ALA B N      1 
ATOM   4072  C CA     . ALA B  1 180 ? -79.120  -60.003 48.079  1.00 46.75  ? 173 ALA B CA     1 
ATOM   4073  C C      . ALA B  1 180 ? -77.610  -59.853 47.930  1.00 45.95  ? 173 ALA B C      1 
ATOM   4074  O O      . ALA B  1 180 ? -76.884  -60.849 47.835  1.00 48.23  ? 173 ALA B O      1 
ATOM   4075  C CB     . ALA B  1 180 ? -79.828  -59.650 46.770  1.00 43.22  ? 173 ALA B CB     1 
ATOM   4076  N N      . GLU B  1 181 ? -77.116  -58.611 47.907  1.00 44.00  ? 174 GLU B N      1 
ATOM   4077  C CA     . GLU B  1 181 ? -75.676  -58.399 47.765  1.00 42.59  ? 174 GLU B CA     1 
ATOM   4078  C C      . GLU B  1 181 ? -74.908  -58.994 48.939  1.00 43.70  ? 174 GLU B C      1 
ATOM   4079  O O      . GLU B  1 181 ? -73.793  -59.503 48.767  1.00 45.81  ? 174 GLU B O      1 
ATOM   4080  C CB     . GLU B  1 181 ? -75.360  -56.909 47.614  1.00 41.65  ? 174 GLU B CB     1 
ATOM   4081  C CG     . GLU B  1 181 ? -73.901  -56.641 47.247  1.00 45.33  ? 174 GLU B CG     1 
ATOM   4082  C CD     . GLU B  1 181 ? -73.699  -55.338 46.496  1.00 47.21  ? 174 GLU B CD     1 
ATOM   4083  O OE1    . GLU B  1 181 ? -74.700  -54.739 46.058  1.00 47.87  ? 174 GLU B OE1    1 
ATOM   4084  O OE2    . GLU B  1 181 ? -72.534  -54.914 46.339  1.00 50.07  ? 174 GLU B OE2    1 
ATOM   4085  N N      . HIS B  1 182 ? -75.479  -58.931 50.141  1.00 46.56  ? 175 HIS B N      1 
ATOM   4086  C CA     . HIS B  1 182 ? -74.824  -59.525 51.303  1.00 53.80  ? 175 HIS B CA     1 
ATOM   4087  C C      . HIS B  1 182 ? -74.725  -61.042 51.162  1.00 58.08  ? 175 HIS B C      1 
ATOM   4088  O O      . HIS B  1 182 ? -73.636  -61.618 51.262  1.00 60.65  ? 175 HIS B O      1 
ATOM   4089  C CB     . HIS B  1 182 ? -75.570  -59.145 52.587  1.00 58.19  ? 175 HIS B CB     1 
ATOM   4090  C CG     . HIS B  1 182 ? -75.324  -57.738 53.041  1.00 62.20  ? 175 HIS B CG     1 
ATOM   4091  N ND1    . HIS B  1 182 ? -75.617  -57.306 54.317  1.00 66.06  ? 175 HIS B ND1    1 
ATOM   4092  C CD2    . HIS B  1 182 ? -74.806  -56.668 52.392  1.00 61.95  ? 175 HIS B CD2    1 
ATOM   4093  C CE1    . HIS B  1 182 ? -75.292  -56.031 54.434  1.00 64.18  ? 175 HIS B CE1    1 
ATOM   4094  N NE2    . HIS B  1 182 ? -74.799  -55.619 53.280  1.00 61.32  ? 175 HIS B NE2    1 
ATOM   4095  N N      . SER B  1 183 ? -75.859  -61.710 50.930  1.00 60.85  ? 176 SER B N      1 
ATOM   4096  C CA     . SER B  1 183 ? -75.897  -63.166 51.028  1.00 62.42  ? 176 SER B CA     1 
ATOM   4097  C C      . SER B  1 183 ? -75.394  -63.872 49.771  1.00 62.84  ? 176 SER B C      1 
ATOM   4098  O O      . SER B  1 183 ? -74.786  -64.943 49.878  1.00 64.07  ? 176 SER B O      1 
ATOM   4099  C CB     . SER B  1 183 ? -77.320  -63.631 51.346  1.00 63.40  ? 176 SER B CB     1 
ATOM   4100  O OG     . SER B  1 183 ? -77.772  -63.085 52.573  1.00 64.73  ? 176 SER B OG     1 
ATOM   4101  N N      . PHE B  1 184 ? -75.629  -63.308 48.585  1.00 58.28  ? 177 PHE B N      1 
ATOM   4102  C CA     . PHE B  1 184 ? -75.320  -63.994 47.333  1.00 56.98  ? 177 PHE B CA     1 
ATOM   4103  C C      . PHE B  1 184 ? -74.047  -63.512 46.650  1.00 56.61  ? 177 PHE B C      1 
ATOM   4104  O O      . PHE B  1 184 ? -73.431  -64.287 45.910  1.00 59.03  ? 177 PHE B O      1 
ATOM   4105  C CB     . PHE B  1 184 ? -76.495  -63.872 46.356  1.00 49.95  ? 177 PHE B CB     1 
ATOM   4106  C CG     . PHE B  1 184 ? -77.556  -64.913 46.562  1.00 48.82  ? 177 PHE B CG     1 
ATOM   4107  C CD1    . PHE B  1 184 ? -78.457  -64.810 47.607  1.00 49.65  ? 177 PHE B CD1    1 
ATOM   4108  C CD2    . PHE B  1 184 ? -77.645  -66.002 45.711  1.00 48.32  ? 177 PHE B CD2    1 
ATOM   4109  C CE1    . PHE B  1 184 ? -79.428  -65.774 47.798  1.00 47.20  ? 177 PHE B CE1    1 
ATOM   4110  C CE2    . PHE B  1 184 ? -78.612  -66.968 45.896  1.00 46.82  ? 177 PHE B CE2    1 
ATOM   4111  C CZ     . PHE B  1 184 ? -79.504  -66.854 46.942  1.00 46.39  ? 177 PHE B CZ     1 
ATOM   4112  N N      . ALA B  1 185 ? -73.624  -62.270 46.879  1.00 56.31  ? 178 ALA B N      1 
ATOM   4113  C CA     . ALA B  1 185 ? -72.383  -61.775 46.297  1.00 57.95  ? 178 ALA B CA     1 
ATOM   4114  C C      . ALA B  1 185 ? -71.224  -61.745 47.285  1.00 62.59  ? 178 ALA B C      1 
ATOM   4115  O O      . ALA B  1 185 ? -70.088  -61.494 46.872  1.00 63.58  ? 178 ALA B O      1 
ATOM   4116  C CB     . ALA B  1 185 ? -72.588  -60.369 45.715  1.00 54.98  ? 178 ALA B CB     1 
ATOM   4117  N N      . GLY B  1 186 ? -71.476  -61.995 48.568  1.00 66.57  ? 179 GLY B N      1 
ATOM   4118  C CA     . GLY B  1 186 ? -70.409  -61.959 49.550  1.00 69.26  ? 179 GLY B CA     1 
ATOM   4119  C C      . GLY B  1 186 ? -69.812  -60.585 49.742  1.00 67.78  ? 179 GLY B C      1 
ATOM   4120  O O      . GLY B  1 186 ? -68.634  -60.469 50.096  1.00 68.85  ? 179 GLY B O      1 
ATOM   4121  N N      . MET B  1 187 ? -70.599  -59.536 49.519  1.00 66.25  ? 180 MET B N      1 
ATOM   4122  C CA     . MET B  1 187 ? -70.129  -58.152 49.591  1.00 64.84  ? 180 MET B CA     1 
ATOM   4123  C C      . MET B  1 187 ? -70.955  -57.360 50.596  1.00 65.43  ? 180 MET B C      1 
ATOM   4124  O O      . MET B  1 187 ? -72.108  -56.993 50.309  1.00 66.33  ? 180 MET B O      1 
ATOM   4125  C CB     . MET B  1 187 ? -70.190  -57.515 48.202  1.00 67.09  ? 180 MET B CB     1 
ATOM   4126  C CG     . MET B  1 187 ? -70.147  -56.000 48.174  1.00 67.15  ? 180 MET B CG     1 
ATOM   4127  S SD     . MET B  1 187 ? -68.594  -55.259 48.693  1.00 68.28  ? 180 MET B SD     1 
ATOM   4128  C CE     . MET B  1 187 ? -69.258  -53.937 49.696  1.00 65.41  ? 180 MET B CE     1 
ATOM   4129  N N      . PRO B  1 188 ? -70.421  -57.080 51.783  1.00 62.29  ? 181 PRO B N      1 
ATOM   4130  C CA     . PRO B  1 188 ? -71.200  -56.388 52.832  1.00 57.82  ? 181 PRO B CA     1 
ATOM   4131  C C      . PRO B  1 188 ? -71.260  -54.879 52.618  1.00 53.07  ? 181 PRO B C      1 
ATOM   4132  O O      . PRO B  1 188 ? -70.633  -54.076 53.318  1.00 53.62  ? 181 PRO B O      1 
ATOM   4133  C CB     . PRO B  1 188 ? -70.446  -56.780 54.104  1.00 58.08  ? 181 PRO B CB     1 
ATOM   4134  C CG     . PRO B  1 188 ? -69.027  -56.901 53.651  1.00 57.27  ? 181 PRO B CG     1 
ATOM   4135  C CD     . PRO B  1 188 ? -69.071  -57.444 52.247  1.00 60.18  ? 181 PRO B CD     1 
ATOM   4136  N N      . CYS B  1 189 ? -72.032  -54.470 51.616  1.00 49.21  ? 182 CYS B N      1 
ATOM   4137  C CA     . CYS B  1 189 ? -72.176  -53.060 51.291  1.00 45.41  ? 182 CYS B CA     1 
ATOM   4138  C C      . CYS B  1 189 ? -73.177  -52.389 52.230  1.00 44.84  ? 182 CYS B C      1 
ATOM   4139  O O      . CYS B  1 189 ? -73.864  -53.036 53.024  1.00 45.90  ? 182 CYS B O      1 
ATOM   4140  C CB     . CYS B  1 189 ? -72.624  -52.889 49.843  1.00 45.48  ? 182 CYS B CB     1 
ATOM   4141  S SG     . CYS B  1 189 ? -74.259  -53.588 49.511  1.00 48.39  ? 182 CYS B SG     1 
ATOM   4142  N N      . GLY B  1 190 ? -73.250  -51.063 52.132  1.00 45.51  ? 183 GLY B N      1 
ATOM   4143  C CA     . GLY B  1 190 ? -74.288  -50.297 52.785  1.00 50.88  ? 183 GLY B CA     1 
ATOM   4144  C C      . GLY B  1 190 ? -75.513  -50.164 51.901  1.00 53.59  ? 183 GLY B C      1 
ATOM   4145  O O      . GLY B  1 190 ? -75.603  -50.738 50.814  1.00 55.06  ? 183 GLY B O      1 
ATOM   4146  N N      . ILE B  1 191 ? -76.476  -49.377 52.386  1.00 56.49  ? 184 ILE B N      1 
ATOM   4147  C CA     . ILE B  1 191 ? -77.737  -49.199 51.667  1.00 59.84  ? 184 ILE B CA     1 
ATOM   4148  C C      . ILE B  1 191 ? -77.651  -48.154 50.568  1.00 60.49  ? 184 ILE B C      1 
ATOM   4149  O O      . ILE B  1 191 ? -78.604  -48.006 49.792  1.00 64.21  ? 184 ILE B O      1 
ATOM   4150  C CB     . ILE B  1 191 ? -78.867  -48.819 52.642  1.00 64.61  ? 184 ILE B CB     1 
ATOM   4151  C CG1    . ILE B  1 191 ? -78.409  -47.712 53.602  1.00 63.45  ? 184 ILE B CG1    1 
ATOM   4152  C CG2    . ILE B  1 191 ? -79.344  -50.046 53.409  1.00 69.26  ? 184 ILE B CG2    1 
ATOM   4153  C CD1    . ILE B  1 191 ? -78.327  -46.324 52.981  1.00 62.20  ? 184 ILE B CD1    1 
ATOM   4154  N N      . MET B  1 192 ? -76.542  -47.416 50.493  1.00 56.29  ? 185 MET B N      1 
ATOM   4155  C CA     . MET B  1 192 ? -76.480  -46.241 49.629  1.00 53.96  ? 185 MET B CA     1 
ATOM   4156  C C      . MET B  1 192 ? -76.799  -46.575 48.174  1.00 51.19  ? 185 MET B C      1 
ATOM   4157  O O      . MET B  1 192 ? -77.691  -45.968 47.569  1.00 47.00  ? 185 MET B O      1 
ATOM   4158  C CB     . MET B  1 192 ? -75.107  -45.580 49.734  1.00 51.20  ? 185 MET B CB     1 
ATOM   4159  C CG     . MET B  1 192 ? -74.895  -44.542 48.655  1.00 53.96  ? 185 MET B CG     1 
ATOM   4160  S SD     . MET B  1 192 ? -73.186  -44.019 48.480  1.00 57.39  ? 185 MET B SD     1 
ATOM   4161  C CE     . MET B  1 192 ? -73.416  -42.560 47.479  1.00 57.64  ? 185 MET B CE     1 
ATOM   4162  N N      . ASP B  1 193 ? -76.079  -47.539 47.595  1.00 50.89  ? 186 ASP B N      1 
ATOM   4163  C CA     . ASP B  1 193 ? -76.157  -47.760 46.152  1.00 48.87  ? 186 ASP B CA     1 
ATOM   4164  C C      . ASP B  1 193 ? -77.559  -48.162 45.716  1.00 47.35  ? 186 ASP B C      1 
ATOM   4165  O O      . ASP B  1 193 ? -78.110  -47.598 44.763  1.00 46.70  ? 186 ASP B O      1 
ATOM   4166  C CB     . ASP B  1 193 ? -75.148  -48.829 45.730  1.00 51.12  ? 186 ASP B CB     1 
ATOM   4167  C CG     . ASP B  1 193 ? -73.718  -48.397 45.953  1.00 51.80  ? 186 ASP B CG     1 
ATOM   4168  O OD1    . ASP B  1 193 ? -73.481  -47.178 46.078  1.00 51.24  ? 186 ASP B OD1    1 
ATOM   4169  O OD2    . ASP B  1 193 ? -72.829  -49.274 45.980  1.00 52.20  ? 186 ASP B OD2    1 
ATOM   4170  N N      . GLN B  1 194 ? -78.160  -49.127 46.411  1.00 45.45  ? 187 GLN B N      1 
ATOM   4171  C CA     . GLN B  1 194 ? -79.513  -49.539 46.056  1.00 45.22  ? 187 GLN B CA     1 
ATOM   4172  C C      . GLN B  1 194 ? -80.484  -48.380 46.193  1.00 46.16  ? 187 GLN B C      1 
ATOM   4173  O O      . GLN B  1 194 ? -81.416  -48.237 45.393  1.00 53.13  ? 187 GLN B O      1 
ATOM   4174  C CB     . GLN B  1 194 ? -79.965  -50.708 46.931  1.00 41.45  ? 187 GLN B CB     1 
ATOM   4175  C CG     . GLN B  1 194 ? -79.147  -51.969 46.762  1.00 39.87  ? 187 GLN B CG     1 
ATOM   4176  C CD     . GLN B  1 194 ? -77.821  -51.891 47.493  1.00 39.12  ? 187 GLN B CD     1 
ATOM   4177  O OE1    . GLN B  1 194 ? -77.642  -51.067 48.389  1.00 39.11  ? 187 GLN B OE1    1 
ATOM   4178  N NE2    . GLN B  1 194 ? -76.879  -52.740 47.105  1.00 37.39  ? 187 GLN B NE2    1 
ATOM   4179  N N      . PHE B  1 195 ? -80.287  -47.549 47.217  1.00 45.42  ? 188 PHE B N      1 
ATOM   4180  C CA     . PHE B  1 195 ? -81.241  -46.489 47.514  1.00 45.95  ? 188 PHE B CA     1 
ATOM   4181  C C      . PHE B  1 195 ? -81.258  -45.441 46.405  1.00 41.78  ? 188 PHE B C      1 
ATOM   4182  O O      . PHE B  1 195 ? -82.329  -45.011 45.959  1.00 40.49  ? 188 PHE B O      1 
ATOM   4183  C CB     . PHE B  1 195 ? -80.885  -45.856 48.860  1.00 51.63  ? 188 PHE B CB     1 
ATOM   4184  C CG     . PHE B  1 195 ? -82.076  -45.465 49.684  1.00 59.95  ? 188 PHE B CG     1 
ATOM   4185  C CD1    . PHE B  1 195 ? -82.782  -44.301 49.429  1.00 62.99  ? 188 PHE B CD1    1 
ATOM   4186  C CD2    . PHE B  1 195 ? -82.480  -46.271 50.737  1.00 64.07  ? 188 PHE B CD2    1 
ATOM   4187  C CE1    . PHE B  1 195 ? -83.879  -43.960 50.202  1.00 67.67  ? 188 PHE B CE1    1 
ATOM   4188  C CE2    . PHE B  1 195 ? -83.567  -45.934 51.513  1.00 69.36  ? 188 PHE B CE2    1 
ATOM   4189  C CZ     . PHE B  1 195 ? -84.269  -44.778 51.247  1.00 71.12  ? 188 PHE B CZ     1 
ATOM   4190  N N      . ILE B  1 196 ? -80.076  -45.023 45.940  1.00 38.12  ? 189 ILE B N      1 
ATOM   4191  C CA     . ILE B  1 196 ? -80.002  -43.997 44.901  1.00 39.20  ? 189 ILE B CA     1 
ATOM   4192  C C      . ILE B  1 196 ? -80.470  -44.546 43.560  1.00 42.98  ? 189 ILE B C      1 
ATOM   4193  O O      . ILE B  1 196 ? -81.105  -43.835 42.771  1.00 43.40  ? 189 ILE B O      1 
ATOM   4194  C CB     . ILE B  1 196 ? -78.576  -43.428 44.805  1.00 21.94  ? 189 ILE B CB     1 
ATOM   4195  C CG1    . ILE B  1 196 ? -78.510  -42.382 43.691  1.00 36.56  ? 189 ILE B CG1    1 
ATOM   4196  C CG2    . ILE B  1 196 ? -77.565  -44.549 44.581  1.00 21.62  ? 189 ILE B CG2    1 
ATOM   4197  C CD1    . ILE B  1 196 ? -79.530  -41.265 43.835  1.00 22.36  ? 189 ILE B CD1    1 
ATOM   4198  N N      . SER B  1 197 ? -80.163  -45.812 43.272  1.00 38.26  ? 190 SER B N      1 
ATOM   4199  C CA     . SER B  1 197 ? -80.639  -46.403 42.027  1.00 36.16  ? 190 SER B CA     1 
ATOM   4200  C C      . SER B  1 197 ? -82.160  -46.424 41.979  1.00 39.16  ? 190 SER B C      1 
ATOM   4201  O O      . SER B  1 197 ? -82.752  -46.277 40.903  1.00 38.42  ? 190 SER B O      1 
ATOM   4202  C CB     . SER B  1 197 ? -80.074  -47.815 41.862  1.00 32.51  ? 190 SER B CB     1 
ATOM   4203  O OG     . SER B  1 197 ? -80.210  -48.271 40.526  1.00 36.59  ? 190 SER B OG     1 
ATOM   4204  N N      . LEU B  1 198 ? -82.805  -46.601 43.135  1.00 40.24  ? 191 LEU B N      1 
ATOM   4205  C CA     . LEU B  1 198 ? -84.261  -46.603 43.223  1.00 41.75  ? 191 LEU B CA     1 
ATOM   4206  C C      . LEU B  1 198 ? -84.849  -45.202 43.342  1.00 42.44  ? 191 LEU B C      1 
ATOM   4207  O O      . LEU B  1 198 ? -85.936  -44.945 42.810  1.00 47.65  ? 191 LEU B O      1 
ATOM   4208  C CB     . LEU B  1 198 ? -84.711  -47.425 44.431  1.00 40.89  ? 191 LEU B CB     1 
ATOM   4209  C CG     . LEU B  1 198 ? -84.698  -48.950 44.386  1.00 41.45  ? 191 LEU B CG     1 
ATOM   4210  C CD1    . LEU B  1 198 ? -84.710  -49.501 45.797  1.00 41.80  ? 191 LEU B CD1    1 
ATOM   4211  C CD2    . LEU B  1 198 ? -85.901  -49.450 43.616  1.00 38.76  ? 191 LEU B CD2    1 
ATOM   4212  N N      . MET B  1 199 ? -84.148  -44.285 44.013  1.00 43.45  ? 192 MET B N      1 
ATOM   4213  C CA     . MET B  1 199 ? -84.752  -43.058 44.514  1.00 48.21  ? 192 MET B CA     1 
ATOM   4214  C C      . MET B  1 199 ? -84.379  -41.818 43.716  1.00 43.23  ? 192 MET B C      1 
ATOM   4215  O O      . MET B  1 199 ? -84.927  -40.742 43.984  1.00 43.85  ? 192 MET B O      1 
ATOM   4216  C CB     . MET B  1 199 ? -84.326  -42.839 45.976  1.00 58.69  ? 192 MET B CB     1 
ATOM   4217  C CG     . MET B  1 199 ? -84.939  -43.804 46.985  1.00 70.43  ? 192 MET B CG     1 
ATOM   4218  S SD     . MET B  1 199 ? -86.650  -43.430 47.399  1.00 85.34  ? 192 MET B SD     1 
ATOM   4219  C CE     . MET B  1 199 ? -86.421  -41.860 48.228  1.00 84.78  ? 192 MET B CE     1 
ATOM   4220  N N      . GLY B  1 200 ? -83.479  -41.935 42.746  1.00 39.02  ? 193 GLY B N      1 
ATOM   4221  C CA     . GLY B  1 200 ? -83.046  -40.763 42.013  1.00 38.04  ? 193 GLY B CA     1 
ATOM   4222  C C      . GLY B  1 200 ? -84.166  -40.135 41.205  1.00 38.43  ? 193 GLY B C      1 
ATOM   4223  O O      . GLY B  1 200 ? -85.072  -40.810 40.714  1.00 42.65  ? 193 GLY B O      1 
ATOM   4224  N N      . GLN B  1 201 ? -84.090  -38.816 41.075  1.00 37.43  ? 194 GLN B N      1 
ATOM   4225  C CA     . GLN B  1 201 ? -84.920  -38.023 40.179  1.00 35.49  ? 194 GLN B CA     1 
ATOM   4226  C C      . GLN B  1 201 ? -83.983  -37.126 39.389  1.00 36.97  ? 194 GLN B C      1 
ATOM   4227  O O      . GLN B  1 201 ? -83.067  -36.524 39.958  1.00 41.89  ? 194 GLN B O      1 
ATOM   4228  C CB     . GLN B  1 201 ? -85.974  -37.187 40.927  1.00 37.99  ? 194 GLN B CB     1 
ATOM   4229  C CG     . GLN B  1 201 ? -87.017  -37.989 41.699  1.00 45.66  ? 194 GLN B CG     1 
ATOM   4230  C CD     . GLN B  1 201 ? -88.019  -38.670 40.778  1.00 53.39  ? 194 GLN B CD     1 
ATOM   4231  O OE1    . GLN B  1 201 ? -88.144  -38.307 39.608  1.00 55.12  ? 194 GLN B OE1    1 
ATOM   4232  N NE2    . GLN B  1 201 ? -88.751  -39.645 41.307  1.00 54.78  ? 194 GLN B NE2    1 
ATOM   4233  N N      . LYS B  1 202 ? -84.209  -37.036 38.082  1.00 39.30  ? 195 LYS B N      1 
ATOM   4234  C CA     . LYS B  1 202 ? -83.273  -36.324 37.224  1.00 40.91  ? 195 LYS B CA     1 
ATOM   4235  C C      . LYS B  1 202 ? -83.171  -34.862 37.639  1.00 36.25  ? 195 LYS B C      1 
ATOM   4236  O O      . LYS B  1 202 ? -84.142  -34.249 38.088  1.00 33.89  ? 195 LYS B O      1 
ATOM   4237  C CB     . LYS B  1 202 ? -83.694  -36.436 35.759  1.00 46.13  ? 195 LYS B CB     1 
ATOM   4238  C CG     . LYS B  1 202 ? -84.878  -35.574 35.366  1.00 53.81  ? 195 LYS B CG     1 
ATOM   4239  C CD     . LYS B  1 202 ? -85.216  -35.775 33.895  1.00 59.12  ? 195 LYS B CD     1 
ATOM   4240  C CE     . LYS B  1 202 ? -83.960  -35.746 33.035  1.00 61.38  ? 195 LYS B CE     1 
ATOM   4241  N NZ     . LYS B  1 202 ? -84.274  -35.874 31.587  1.00 64.36  ? 195 LYS B NZ     1 
ATOM   4242  N N      . GLY B  1 203 ? -81.971  -34.306 37.487  1.00 35.22  ? 196 GLY B N      1 
ATOM   4243  C CA     . GLY B  1 203 ? -81.699  -32.959 37.952  1.00 38.72  ? 196 GLY B CA     1 
ATOM   4244  C C      . GLY B  1 203 ? -81.638  -32.824 39.456  1.00 42.66  ? 196 GLY B C      1 
ATOM   4245  O O      . GLY B  1 203 ? -81.878  -31.735 39.986  1.00 44.86  ? 196 GLY B O      1 
ATOM   4246  N N      . HIS B  1 204 ? -81.312  -33.906 40.160  1.00 37.98  ? 197 HIS B N      1 
ATOM   4247  C CA     . HIS B  1 204 ? -81.251  -33.904 41.613  1.00 34.74  ? 197 HIS B CA     1 
ATOM   4248  C C      . HIS B  1 204 ? -80.161  -34.853 42.082  1.00 34.32  ? 197 HIS B C      1 
ATOM   4249  O O      . HIS B  1 204 ? -79.947  -35.910 41.481  1.00 36.47  ? 197 HIS B O      1 
ATOM   4250  C CB     . HIS B  1 204 ? -82.580  -34.337 42.242  1.00 34.64  ? 197 HIS B CB     1 
ATOM   4251  C CG     . HIS B  1 204 ? -83.681  -33.338 42.091  1.00 39.34  ? 197 HIS B CG     1 
ATOM   4252  N ND1    . HIS B  1 204 ? -84.454  -33.251 40.954  1.00 40.67  ? 197 HIS B ND1    1 
ATOM   4253  C CD2    . HIS B  1 204 ? -84.147  -32.390 42.937  1.00 40.88  ? 197 HIS B CD2    1 
ATOM   4254  C CE1    . HIS B  1 204 ? -85.347  -32.290 41.104  1.00 41.29  ? 197 HIS B CE1    1 
ATOM   4255  N NE2    . HIS B  1 204 ? -85.183  -31.752 42.299  1.00 42.33  ? 197 HIS B NE2    1 
ATOM   4256  N N      . ALA B  1 205 ? -79.477  -34.464 43.152  1.00 32.71  ? 198 ALA B N      1 
ATOM   4257  C CA     . ALA B  1 205 ? -78.695  -35.379 43.966  1.00 31.85  ? 198 ALA B CA     1 
ATOM   4258  C C      . ALA B  1 205 ? -79.541  -35.807 45.158  1.00 30.81  ? 198 ALA B C      1 
ATOM   4259  O O      . ALA B  1 205 ? -80.513  -35.143 45.525  1.00 28.28  ? 198 ALA B O      1 
ATOM   4260  C CB     . ALA B  1 205 ? -77.394  -34.727 44.440  1.00 22.31  ? 198 ALA B CB     1 
ATOM   4261  N N      . LEU B  1 206 ? -79.154  -36.919 45.775  1.00 31.87  ? 199 LEU B N      1 
ATOM   4262  C CA     . LEU B  1 206 ? -79.928  -37.502 46.867  1.00 34.56  ? 199 LEU B CA     1 
ATOM   4263  C C      . LEU B  1 206 ? -79.094  -37.456 48.139  1.00 35.91  ? 199 LEU B C      1 
ATOM   4264  O O      . LEU B  1 206 ? -78.138  -38.225 48.293  1.00 36.09  ? 199 LEU B O      1 
ATOM   4265  C CB     . LEU B  1 206 ? -80.351  -38.933 46.544  1.00 41.28  ? 199 LEU B CB     1 
ATOM   4266  C CG     . LEU B  1 206 ? -81.547  -39.443 47.350  1.00 51.54  ? 199 LEU B CG     1 
ATOM   4267  C CD1    . LEU B  1 206 ? -82.830  -38.728 46.950  1.00 56.14  ? 199 LEU B CD1    1 
ATOM   4268  C CD2    . LEU B  1 206 ? -81.695  -40.948 47.199  1.00 54.18  ? 199 LEU B CD2    1 
ATOM   4269  N N      . LEU B  1 207 ? -79.458  -36.553 49.045  1.00 34.19  ? 200 LEU B N      1 
ATOM   4270  C CA     . LEU B  1 207 ? -78.877  -36.517 50.382  1.00 33.08  ? 200 LEU B CA     1 
ATOM   4271  C C      . LEU B  1 207 ? -79.570  -37.565 51.244  1.00 36.71  ? 200 LEU B C      1 
ATOM   4272  O O      . LEU B  1 207 ? -80.745  -37.413 51.593  1.00 38.31  ? 200 LEU B O      1 
ATOM   4273  C CB     . LEU B  1 207 ? -79.017  -35.126 50.990  1.00 32.20  ? 200 LEU B CB     1 
ATOM   4274  C CG     . LEU B  1 207 ? -78.461  -34.987 52.408  1.00 30.77  ? 200 LEU B CG     1 
ATOM   4275  C CD1    . LEU B  1 207 ? -76.960  -35.227 52.423  1.00 28.23  ? 200 LEU B CD1    1 
ATOM   4276  C CD2    . LEU B  1 207 ? -78.801  -33.621 52.983  1.00 29.94  ? 200 LEU B CD2    1 
ATOM   4277  N N      . ILE B  1 208 ? -78.850  -38.633 51.581  1.00 38.86  ? 201 ILE B N      1 
ATOM   4278  C CA     . ILE B  1 208 ? -79.400  -39.758 52.329  1.00 36.67  ? 201 ILE B CA     1 
ATOM   4279  C C      . ILE B  1 208 ? -78.797  -39.760 53.726  1.00 35.06  ? 201 ILE B C      1 
ATOM   4280  O O      . ILE B  1 208 ? -77.570  -39.769 53.882  1.00 34.23  ? 201 ILE B O      1 
ATOM   4281  C CB     . ILE B  1 208 ? -79.131  -41.098 51.623  1.00 31.21  ? 201 ILE B CB     1 
ATOM   4282  C CG1    . ILE B  1 208 ? -79.625  -41.060 50.178  1.00 28.91  ? 201 ILE B CG1    1 
ATOM   4283  C CG2    . ILE B  1 208 ? -79.799  -42.244 52.369  1.00 33.26  ? 201 ILE B CG2    1 
ATOM   4284  C CD1    . ILE B  1 208 ? -79.155  -42.240 49.349  1.00 22.86  ? 201 ILE B CD1    1 
ATOM   4285  N N      . ASP B  1 209 ? -79.661  -39.746 54.737  1.00 37.47  ? 202 ASP B N      1 
ATOM   4286  C CA     . ASP B  1 209 ? -79.245  -39.941 56.123  1.00 35.92  ? 202 ASP B CA     1 
ATOM   4287  C C      . ASP B  1 209 ? -79.331  -41.439 56.389  1.00 34.00  ? 202 ASP B C      1 
ATOM   4288  O O      . ASP B  1 209 ? -80.421  -41.988 56.570  1.00 34.70  ? 202 ASP B O      1 
ATOM   4289  C CB     . ASP B  1 209 ? -80.132  -39.136 57.066  1.00 38.61  ? 202 ASP B CB     1 
ATOM   4290  C CG     . ASP B  1 209 ? -79.670  -39.204 58.508  1.00 42.87  ? 202 ASP B CG     1 
ATOM   4291  O OD1    . ASP B  1 209 ? -79.234  -40.287 58.951  1.00 43.92  ? 202 ASP B OD1    1 
ATOM   4292  O OD2    . ASP B  1 209 ? -79.745  -38.167 59.201  1.00 45.16  ? 202 ASP B OD2    1 
ATOM   4293  N N      . CYS B  1 210 ? -78.178  -42.108 56.422  1.00 34.53  ? 203 CYS B N      1 
ATOM   4294  C CA     . CYS B  1 210 ? -78.152  -43.564 56.510  1.00 37.62  ? 203 CYS B CA     1 
ATOM   4295  C C      . CYS B  1 210 ? -78.456  -44.086 57.909  1.00 45.25  ? 203 CYS B C      1 
ATOM   4296  O O      . CYS B  1 210 ? -78.476  -45.307 58.104  1.00 49.23  ? 203 CYS B O      1 
ATOM   4297  C CB     . CYS B  1 210 ? -76.792  -44.095 56.044  1.00 32.57  ? 203 CYS B CB     1 
ATOM   4298  S SG     . CYS B  1 210 ? -76.350  -43.666 54.337  1.00 34.46  ? 203 CYS B SG     1 
ATOM   4299  N N      . ARG B  1 211 ? -78.697  -43.207 58.880  1.00 48.55  ? 204 ARG B N      1 
ATOM   4300  C CA     . ARG B  1 211 ? -79.179  -43.624 60.192  1.00 52.49  ? 204 ARG B CA     1 
ATOM   4301  C C      . ARG B  1 211 ? -80.700  -43.739 60.218  1.00 55.82  ? 204 ARG B C      1 
ATOM   4302  O O      . ARG B  1 211 ? -81.244  -44.784 60.588  1.00 57.80  ? 204 ARG B O      1 
ATOM   4303  C CB     . ARG B  1 211 ? -78.708  -42.634 61.260  1.00 53.43  ? 204 ARG B CB     1 
ATOM   4304  C CG     . ARG B  1 211 ? -79.278  -42.878 62.647  1.00 55.74  ? 204 ARG B CG     1 
ATOM   4305  C CD     . ARG B  1 211 ? -79.416  -41.566 63.391  1.00 57.27  ? 204 ARG B CD     1 
ATOM   4306  N NE     . ARG B  1 211 ? -78.178  -41.177 64.061  1.00 57.21  ? 204 ARG B NE     1 
ATOM   4307  C CZ     . ARG B  1 211 ? -77.884  -39.927 64.402  1.00 58.78  ? 204 ARG B CZ     1 
ATOM   4308  N NH1    . ARG B  1 211 ? -78.736  -38.953 64.115  1.00 57.05  ? 204 ARG B NH1    1 
ATOM   4309  N NH2    . ARG B  1 211 ? -76.739  -39.648 65.011  1.00 59.35  ? 204 ARG B NH2    1 
ATOM   4310  N N      . SER B  1 212 ? -81.389  -42.671 59.822  1.00 57.18  ? 205 SER B N      1 
ATOM   4311  C CA     . SER B  1 212 ? -82.843  -42.610 59.808  1.00 60.08  ? 205 SER B CA     1 
ATOM   4312  C C      . SER B  1 212 ? -83.439  -42.966 58.453  1.00 61.34  ? 205 SER B C      1 
ATOM   4313  O O      . SER B  1 212 ? -84.652  -43.179 58.362  1.00 64.21  ? 205 SER B O      1 
ATOM   4314  C CB     . SER B  1 212 ? -83.310  -41.214 60.229  1.00 61.40  ? 205 SER B CB     1 
ATOM   4315  O OG     . SER B  1 212 ? -82.846  -40.236 59.317  1.00 60.69  ? 205 SER B OG     1 
ATOM   4316  N N      . LEU B  1 213 ? -82.621  -43.043 57.407  1.00 57.87  ? 206 LEU B N      1 
ATOM   4317  C CA     . LEU B  1 213 ? -83.039  -43.317 56.037  1.00 54.43  ? 206 LEU B CA     1 
ATOM   4318  C C      . LEU B  1 213 ? -83.840  -42.188 55.399  1.00 51.02  ? 206 LEU B C      1 
ATOM   4319  O O      . LEU B  1 213 ? -84.333  -42.356 54.277  1.00 52.85  ? 206 LEU B O      1 
ATOM   4320  C CB     . LEU B  1 213 ? -83.842  -44.620 55.948  1.00 57.69  ? 206 LEU B CB     1 
ATOM   4321  C CG     . LEU B  1 213 ? -83.084  -45.883 56.365  1.00 59.70  ? 206 LEU B CG     1 
ATOM   4322  C CD1    . LEU B  1 213 ? -83.907  -47.124 56.064  1.00 59.96  ? 206 LEU B CD1    1 
ATOM   4323  C CD2    . LEU B  1 213 ? -81.724  -45.940 55.684  1.00 58.38  ? 206 LEU B CD2    1 
ATOM   4324  N N      A GLU B  1 214 ? -83.964  -41.045 56.074  0.56 48.88  ? 207 GLU B N      1 
ATOM   4325  N N      B GLU B  1 214 ? -84.006  -41.049 56.064  0.44 48.94  ? 207 GLU B N      1 
ATOM   4326  C CA     A GLU B  1 214 ? -84.558  -39.864 55.463  0.56 48.76  ? 207 GLU B CA     1 
ATOM   4327  C CA     B GLU B  1 214 ? -84.685  -39.933 55.418  0.44 48.90  ? 207 GLU B CA     1 
ATOM   4328  C C      A GLU B  1 214 ? -83.741  -39.434 54.251  0.56 47.37  ? 207 GLU B C      1 
ATOM   4329  C C      B GLU B  1 214 ? -83.805  -39.331 54.327  0.44 47.49  ? 207 GLU B C      1 
ATOM   4330  O O      A GLU B  1 214 ? -82.507  -39.475 54.267  0.56 47.01  ? 207 GLU B O      1 
ATOM   4331  O O      B GLU B  1 214 ? -82.598  -39.146 54.506  0.44 47.36  ? 207 GLU B O      1 
ATOM   4332  C CB     A GLU B  1 214 ? -84.628  -38.724 56.483  0.56 48.81  ? 207 GLU B CB     1 
ATOM   4333  C CB     B GLU B  1 214 ? -85.077  -38.868 56.439  0.44 49.15  ? 207 GLU B CB     1 
ATOM   4334  C CG     A GLU B  1 214 ? -85.355  -39.082 57.772  0.56 50.18  ? 207 GLU B CG     1 
ATOM   4335  C CG     B GLU B  1 214 ? -84.035  -38.592 57.495  0.44 48.74  ? 207 GLU B CG     1 
ATOM   4336  C CD     A GLU B  1 214 ? -86.863  -38.957 57.656  0.56 51.95  ? 207 GLU B CD     1 
ATOM   4337  C CD     B GLU B  1 214 ? -83.867  -37.114 57.750  0.44 48.94  ? 207 GLU B CD     1 
ATOM   4338  O OE1    A GLU B  1 214 ? -87.333  -38.021 56.975  0.56 52.85  ? 207 GLU B OE1    1 
ATOM   4339  O OE1    B GLU B  1 214 ? -84.126  -36.326 56.817  0.44 48.37  ? 207 GLU B OE1    1 
ATOM   4340  O OE2    A GLU B  1 214 ? -87.576  -39.795 58.248  0.56 52.62  ? 207 GLU B OE2    1 
ATOM   4341  O OE2    B GLU B  1 214 ? -83.479  -36.739 58.875  0.44 50.02  ? 207 GLU B OE2    1 
ATOM   4342  N N      . THR B  1 215 ? -84.433  -39.009 53.197  1.00 44.93  ? 208 THR B N      1 
ATOM   4343  C CA     . THR B  1 215 ? -83.771  -38.574 51.975  1.00 38.28  ? 208 THR B CA     1 
ATOM   4344  C C      . THR B  1 215 ? -84.289  -37.212 51.535  1.00 37.51  ? 208 THR B C      1 
ATOM   4345  O O      . THR B  1 215 ? -85.459  -36.875 51.743  1.00 40.27  ? 208 THR B O      1 
ATOM   4346  C CB     . THR B  1 215 ? -83.980  -39.586 50.853  1.00 37.54  ? 208 THR B CB     1 
ATOM   4347  O OG1    . THR B  1 215 ? -85.380  -39.683 50.558  1.00 43.85  ? 208 THR B OG1    1 
ATOM   4348  C CG2    . THR B  1 215 ? -83.473  -40.945 51.287  1.00 33.51  ? 208 THR B CG2    1 
ATOM   4349  N N      . SER B  1 216 ? -83.397  -36.428 50.933  1.00 35.38  ? 209 SER B N      1 
ATOM   4350  C CA     . SER B  1 216 ? -83.735  -35.117 50.397  1.00 39.15  ? 209 SER B CA     1 
ATOM   4351  C C      . SER B  1 216 ? -83.209  -34.994 48.974  1.00 38.73  ? 209 SER B C      1 
ATOM   4352  O O      . SER B  1 216 ? -82.033  -35.271 48.715  1.00 39.65  ? 209 SER B O      1 
ATOM   4353  C CB     . SER B  1 216 ? -83.156  -33.999 51.270  1.00 42.80  ? 209 SER B CB     1 
ATOM   4354  O OG     . SER B  1 216 ? -83.826  -33.929 52.517  1.00 50.04  ? 209 SER B OG     1 
ATOM   4355  N N      . LEU B  1 217 ? -84.085  -34.592 48.055  1.00 40.38  ? 210 LEU B N      1 
ATOM   4356  C CA     . LEU B  1 217 ? -83.702  -34.330 46.673  1.00 40.69  ? 210 LEU B CA     1 
ATOM   4357  C C      . LEU B  1 217 ? -83.209  -32.891 46.575  1.00 42.78  ? 210 LEU B C      1 
ATOM   4358  O O      . LEU B  1 217 ? -83.976  -31.949 46.806  1.00 46.07  ? 210 LEU B O      1 
ATOM   4359  C CB     . LEU B  1 217 ? -84.873  -34.568 45.719  1.00 42.75  ? 210 LEU B CB     1 
ATOM   4360  C CG     . LEU B  1 217 ? -85.430  -35.990 45.682  1.00 44.81  ? 210 LEU B CG     1 
ATOM   4361  C CD1    . LEU B  1 217 ? -86.788  -36.029 45.001  1.00 47.66  ? 210 LEU B CD1    1 
ATOM   4362  C CD2    . LEU B  1 217 ? -84.455  -36.903 44.966  1.00 44.19  ? 210 LEU B CD2    1 
ATOM   4363  N N      . VAL B  1 218 ? -81.938  -32.725 46.240  1.00 35.01  ? 211 VAL B N      1 
ATOM   4364  C CA     . VAL B  1 218 ? -81.291  -31.420 46.152  1.00 37.72  ? 211 VAL B CA     1 
ATOM   4365  C C      . VAL B  1 218 ? -81.110  -31.091 44.674  1.00 38.32  ? 211 VAL B C      1 
ATOM   4366  O O      . VAL B  1 218 ? -80.405  -31.824 43.967  1.00 36.55  ? 211 VAL B O      1 
ATOM   4367  C CB     . VAL B  1 218 ? -79.943  -31.405 46.889  1.00 34.43  ? 211 VAL B CB     1 
ATOM   4368  C CG1    . VAL B  1 218 ? -79.300  -30.032 46.789  1.00 35.91  ? 211 VAL B CG1    1 
ATOM   4369  C CG2    . VAL B  1 218 ? -80.129  -31.813 48.342  1.00 26.72  ? 211 VAL B CG2    1 
ATOM   4370  N N      . PRO B  1 219 ? -81.726  -30.026 44.164  1.00 40.08  ? 212 PRO B N      1 
ATOM   4371  C CA     . PRO B  1 219 ? -81.650  -29.761 42.722  1.00 40.71  ? 212 PRO B CA     1 
ATOM   4372  C C      . PRO B  1 219 ? -80.212  -29.588 42.252  1.00 42.91  ? 212 PRO B C      1 
ATOM   4373  O O      . PRO B  1 219 ? -79.406  -28.895 42.880  1.00 44.35  ? 212 PRO B O      1 
ATOM   4374  C CB     . PRO B  1 219 ? -82.461  -28.471 42.551  1.00 42.56  ? 212 PRO B CB     1 
ATOM   4375  C CG     . PRO B  1 219 ? -83.365  -28.411 43.735  1.00 32.98  ? 212 PRO B CG     1 
ATOM   4376  C CD     . PRO B  1 219 ? -82.707  -29.169 44.852  1.00 41.35  ? 212 PRO B CD     1 
ATOM   4377  N N      . LEU B  1 220 ? -79.904  -30.227 41.121  1.00 45.98  ? 213 LEU B N      1 
ATOM   4378  C CA     . LEU B  1 220 ? -78.622  -30.113 40.423  1.00 47.48  ? 213 LEU B CA     1 
ATOM   4379  C C      . LEU B  1 220 ? -78.973  -29.912 38.952  1.00 53.13  ? 213 LEU B C      1 
ATOM   4380  O O      . LEU B  1 220 ? -79.013  -30.862 38.169  1.00 51.80  ? 213 LEU B O      1 
ATOM   4381  C CB     . LEU B  1 220 ? -77.732  -31.344 40.637  1.00 42.67  ? 213 LEU B CB     1 
ATOM   4382  C CG     . LEU B  1 220 ? -76.393  -31.180 41.362  1.00 43.08  ? 213 LEU B CG     1 
ATOM   4383  C CD1    . LEU B  1 220 ? -75.616  -32.491 41.313  1.00 42.23  ? 213 LEU B CD1    1 
ATOM   4384  C CD2    . LEU B  1 220 ? -75.575  -30.034 40.769  1.00 41.24  ? 213 LEU B CD2    1 
ATOM   4385  N N      . SER B  1 221 ? -79.225  -28.660 38.578  1.00 62.94  ? 214 SER B N      1 
ATOM   4386  C CA     . SER B  1 221 ? -79.723  -28.329 37.253  1.00 69.14  ? 214 SER B CA     1 
ATOM   4387  C C      . SER B  1 221 ? -79.146  -26.964 36.880  1.00 69.31  ? 214 SER B C      1 
ATOM   4388  O O      . SER B  1 221 ? -79.819  -25.933 36.880  1.00 72.99  ? 214 SER B O      1 
ATOM   4389  C CB     . SER B  1 221 ? -81.252  -28.327 37.208  1.00 81.85  ? 214 SER B CB     1 
ATOM   4390  O OG     . SER B  1 221 ? -81.785  -27.393 38.131  1.00 88.98  ? 214 SER B OG     1 
ATOM   4391  N N      . ASP B  1 222 ? -77.860  -26.965 36.554  1.00 58.12  ? 215 ASP B N      1 
ATOM   4392  C CA     . ASP B  1 222 ? -77.142  -25.751 36.180  1.00 57.00  ? 215 ASP B CA     1 
ATOM   4393  C C      . ASP B  1 222 ? -76.394  -26.002 34.878  1.00 53.13  ? 215 ASP B C      1 
ATOM   4394  O O      . ASP B  1 222 ? -75.386  -26.739 34.880  1.00 50.04  ? 215 ASP B O      1 
ATOM   4395  C CB     . ASP B  1 222 ? -76.186  -25.341 37.297  1.00 58.47  ? 215 ASP B CB     1 
ATOM   4396  C CG     . ASP B  1 222 ? -75.642  -23.945 37.116  1.00 62.12  ? 215 ASP B CG     1 
ATOM   4397  O OD1    . ASP B  1 222 ? -75.831  -23.368 36.026  1.00 65.50  ? 215 ASP B OD1    1 
ATOM   4398  O OD2    . ASP B  1 222 ? -75.024  -23.424 38.067  1.00 63.59  ? 215 ASP B OD2    1 
ATOM   4399  N N      . PRO B  1 223 ? -76.841  -25.429 33.758  1.00 53.14  ? 216 PRO B N      1 
ATOM   4400  C CA     . PRO B  1 223 ? -76.096  -25.596 32.498  1.00 52.46  ? 216 PRO B CA     1 
ATOM   4401  C C      . PRO B  1 223 ? -74.650  -25.143 32.584  1.00 52.23  ? 216 PRO B C      1 
ATOM   4402  O O      . PRO B  1 223 ? -73.823  -25.606 31.789  1.00 56.22  ? 216 PRO B O      1 
ATOM   4403  C CB     . PRO B  1 223 ? -76.893  -24.747 31.496  1.00 54.92  ? 216 PRO B CB     1 
ATOM   4404  C CG     . PRO B  1 223 ? -77.804  -23.885 32.326  1.00 54.86  ? 216 PRO B CG     1 
ATOM   4405  C CD     . PRO B  1 223 ? -78.079  -24.653 33.577  1.00 52.01  ? 216 PRO B CD     1 
ATOM   4406  N N      . LYS B  1 224 ? -74.321  -24.249 33.517  1.00 52.04  ? 217 LYS B N      1 
ATOM   4407  C CA     . LYS B  1 224 ? -72.946  -23.819 33.730  1.00 52.16  ? 217 LYS B CA     1 
ATOM   4408  C C      . LYS B  1 224 ? -72.119  -24.847 34.491  1.00 49.88  ? 217 LYS B C      1 
ATOM   4409  O O      . LYS B  1 224 ? -70.890  -24.721 34.533  1.00 49.90  ? 217 LYS B O      1 
ATOM   4410  C CB     . LYS B  1 224 ? -72.920  -22.496 34.502  1.00 54.92  ? 217 LYS B CB     1 
ATOM   4411  C CG     . LYS B  1 224 ? -73.957  -21.468 34.070  1.00 61.47  ? 217 LYS B CG     1 
ATOM   4412  C CD     . LYS B  1 224 ? -73.518  -20.709 32.828  1.00 67.79  ? 217 LYS B CD     1 
ATOM   4413  C CE     . LYS B  1 224 ? -74.533  -19.641 32.454  1.00 75.37  ? 217 LYS B CE     1 
ATOM   4414  N NZ     . LYS B  1 224 ? -75.840  -20.245 32.059  1.00 75.92  ? 217 LYS B NZ     1 
ATOM   4415  N N      . LEU B  1 225 ? -72.759  -25.850 35.086  1.00 48.75  ? 218 LEU B N      1 
ATOM   4416  C CA     . LEU B  1 225 ? -72.097  -26.820 35.944  1.00 48.81  ? 218 LEU B CA     1 
ATOM   4417  C C      . LEU B  1 225 ? -72.091  -28.192 35.282  1.00 49.05  ? 218 LEU B C      1 
ATOM   4418  O O      . LEU B  1 225 ? -73.095  -28.617 34.699  1.00 53.57  ? 218 LEU B O      1 
ATOM   4419  C CB     . LEU B  1 225 ? -72.791  -26.905 37.306  1.00 50.30  ? 218 LEU B CB     1 
ATOM   4420  C CG     . LEU B  1 225 ? -72.107  -27.808 38.329  1.00 49.75  ? 218 LEU B CG     1 
ATOM   4421  C CD1    . LEU B  1 225 ? -70.697  -27.303 38.606  1.00 50.90  ? 218 LEU B CD1    1 
ATOM   4422  C CD2    . LEU B  1 225 ? -72.924  -27.877 39.605  1.00 47.35  ? 218 LEU B CD2    1 
ATOM   4423  N N      . ALA B  1 226 ? -70.940  -28.862 35.343  1.00 47.14  ? 219 ALA B N      1 
ATOM   4424  C CA     . ALA B  1 226 ? -70.777  -30.206 34.810  1.00 46.01  ? 219 ALA B CA     1 
ATOM   4425  C C      . ALA B  1 226 ? -70.207  -31.140 35.871  1.00 45.58  ? 219 ALA B C      1 
ATOM   4426  O O      . ALA B  1 226 ? -69.445  -30.722 36.748  1.00 45.21  ? 219 ALA B O      1 
ATOM   4427  C CB     . ALA B  1 226 ? -69.856  -30.204 33.583  1.00 46.50  ? 219 ALA B CB     1 
ATOM   4428  N N      . VAL B  1 227 ? -70.582  -32.413 35.777  1.00 42.59  ? 220 VAL B N      1 
ATOM   4429  C CA     . VAL B  1 227 ? -70.032  -33.477 36.612  1.00 40.64  ? 220 VAL B CA     1 
ATOM   4430  C C      . VAL B  1 227 ? -69.290  -34.438 35.693  1.00 40.86  ? 220 VAL B C      1 
ATOM   4431  O O      . VAL B  1 227 ? -69.914  -35.147 34.892  1.00 39.63  ? 220 VAL B O      1 
ATOM   4432  C CB     . VAL B  1 227 ? -71.119  -34.203 37.413  1.00 30.20  ? 220 VAL B CB     1 
ATOM   4433  C CG1    . VAL B  1 227 ? -70.539  -35.416 38.125  1.00 22.98  ? 220 VAL B CG1    1 
ATOM   4434  C CG2    . VAL B  1 227 ? -71.757  -33.250 38.403  1.00 25.63  ? 220 VAL B CG2    1 
ATOM   4435  N N      . LEU B  1 228 ? -67.965  -34.474 35.810  1.00 38.65  ? 221 LEU B N      1 
ATOM   4436  C CA     . LEU B  1 228 ? -67.118  -35.295 34.953  1.00 36.03  ? 221 LEU B CA     1 
ATOM   4437  C C      . LEU B  1 228 ? -66.664  -36.536 35.710  1.00 38.56  ? 221 LEU B C      1 
ATOM   4438  O O      . LEU B  1 228 ? -66.016  -36.426 36.756  1.00 43.99  ? 221 LEU B O      1 
ATOM   4439  C CB     . LEU B  1 228 ? -65.899  -34.516 34.463  1.00 32.14  ? 221 LEU B CB     1 
ATOM   4440  C CG     . LEU B  1 228 ? -64.936  -35.375 33.640  1.00 32.79  ? 221 LEU B CG     1 
ATOM   4441  C CD1    . LEU B  1 228 ? -65.492  -35.635 32.244  1.00 31.08  ? 221 LEU B CD1    1 
ATOM   4442  C CD2    . LEU B  1 228 ? -63.554  -34.733 33.583  1.00 38.10  ? 221 LEU B CD2    1 
ATOM   4443  N N      . ILE B  1 229 ? -66.997  -37.708 35.179  1.00 38.96  ? 222 ILE B N      1 
ATOM   4444  C CA     . ILE B  1 229 ? -66.578  -38.983 35.751  1.00 36.45  ? 222 ILE B CA     1 
ATOM   4445  C C      . ILE B  1 229 ? -65.426  -39.530 34.922  1.00 40.13  ? 222 ILE B C      1 
ATOM   4446  O O      . ILE B  1 229 ? -65.530  -39.634 33.694  1.00 42.70  ? 222 ILE B O      1 
ATOM   4447  C CB     . ILE B  1 229 ? -67.742  -39.984 35.795  1.00 33.35  ? 222 ILE B CB     1 
ATOM   4448  C CG1    . ILE B  1 229 ? -68.910  -39.388 36.570  1.00 39.72  ? 222 ILE B CG1    1 
ATOM   4449  C CG2    . ILE B  1 229 ? -67.301  -41.291 36.437  1.00 24.73  ? 222 ILE B CG2    1 
ATOM   4450  C CD1    . ILE B  1 229 ? -70.109  -40.285 36.619  1.00 42.41  ? 222 ILE B CD1    1 
ATOM   4451  N N      . THR B  1 230 ? -64.328  -39.883 35.589  1.00 38.33  ? 223 THR B N      1 
ATOM   4452  C CA     . THR B  1 230 ? -63.137  -40.409 34.931  1.00 34.84  ? 223 THR B CA     1 
ATOM   4453  C C      . THR B  1 230 ? -62.874  -41.813 35.454  1.00 34.63  ? 223 THR B C      1 
ATOM   4454  O O      . THR B  1 230 ? -62.592  -41.991 36.644  1.00 36.20  ? 223 THR B O      1 
ATOM   4455  C CB     . THR B  1 230 ? -61.917  -39.518 35.184  1.00 37.60  ? 223 THR B CB     1 
ATOM   4456  O OG1    . THR B  1 230 ? -62.165  -38.200 34.679  1.00 40.89  ? 223 THR B OG1    1 
ATOM   4457  C CG2    . THR B  1 230 ? -60.687  -40.097 34.499  1.00 38.69  ? 223 THR B CG2    1 
ATOM   4458  N N      . ASN B  1 231 ? -62.957  -42.803 34.569  1.00 39.21  ? 224 ASN B N      1 
ATOM   4459  C CA     . ASN B  1 231 ? -62.688  -44.187 34.934  1.00 39.21  ? 224 ASN B CA     1 
ATOM   4460  C C      . ASN B  1 231 ? -61.208  -44.482 34.725  1.00 38.69  ? 224 ASN B C      1 
ATOM   4461  O O      . ASN B  1 231 ? -60.700  -44.377 33.603  1.00 35.26  ? 224 ASN B O      1 
ATOM   4462  C CB     . ASN B  1 231 ? -63.549  -45.150 34.117  1.00 42.34  ? 224 ASN B CB     1 
ATOM   4463  C CG     . ASN B  1 231 ? -63.429  -46.590 34.596  1.00 47.28  ? 224 ASN B CG     1 
ATOM   4464  O OD1    . ASN B  1 231 ? -62.495  -46.943 35.318  1.00 47.39  ? 224 ASN B OD1    1 
ATOM   4465  N ND2    . ASN B  1 231 ? -64.392  -47.424 34.211  1.00 48.98  ? 224 ASN B ND2    1 
ATOM   4466  N N      . SER B  1 232 ? -60.520  -44.849 35.806  1.00 39.55  ? 225 SER B N      1 
ATOM   4467  C CA     . SER B  1 232 ? -59.121  -45.242 35.708  1.00 41.63  ? 225 SER B CA     1 
ATOM   4468  C C      . SER B  1 232 ? -58.937  -46.560 34.970  1.00 47.25  ? 225 SER B C      1 
ATOM   4469  O O      . SER B  1 232 ? -57.804  -46.892 34.606  1.00 49.60  ? 225 SER B O      1 
ATOM   4470  C CB     . SER B  1 232 ? -58.508  -45.341 37.105  1.00 41.07  ? 225 SER B CB     1 
ATOM   4471  O OG     . SER B  1 232 ? -59.091  -46.403 37.839  1.00 37.42  ? 225 SER B OG     1 
ATOM   4472  N N      . ASN B  1 233 ? -60.015  -47.312 34.752  1.00 49.64  ? 226 ASN B N      1 
ATOM   4473  C CA     . ASN B  1 233 ? -59.947  -48.637 34.139  1.00 52.55  ? 226 ASN B CA     1 
ATOM   4474  C C      . ASN B  1 233 ? -58.991  -49.547 34.904  1.00 57.63  ? 226 ASN B C      1 
ATOM   4475  O O      . ASN B  1 233 ? -58.267  -50.362 34.327  1.00 57.81  ? 226 ASN B O      1 
ATOM   4476  C CB     . ASN B  1 233 ? -59.583  -48.547 32.656  1.00 50.63  ? 226 ASN B CB     1 
ATOM   4477  C CG     . ASN B  1 233 ? -60.702  -47.939 31.822  1.00 50.43  ? 226 ASN B CG     1 
ATOM   4478  O OD1    . ASN B  1 233 ? -60.533  -46.889 31.199  1.00 50.73  ? 226 ASN B OD1    1 
ATOM   4479  N ND2    . ASN B  1 233 ? -61.859  -48.599 31.816  1.00 49.15  ? 226 ASN B ND2    1 
ATOM   4480  N N      . VAL B  1 234 ? -58.983  -49.387 36.223  1.00 63.09  ? 227 VAL B N      1 
ATOM   4481  C CA     . VAL B  1 234 ? -58.517  -50.406 37.152  1.00 70.44  ? 227 VAL B CA     1 
ATOM   4482  C C      . VAL B  1 234 ? -59.726  -50.834 37.968  1.00 77.69  ? 227 VAL B C      1 
ATOM   4483  O O      . VAL B  1 234 ? -60.570  -50.002 38.321  1.00 77.15  ? 227 VAL B O      1 
ATOM   4484  C CB     . VAL B  1 234 ? -57.383  -49.895 38.062  1.00 69.80  ? 227 VAL B CB     1 
ATOM   4485  C CG1    . VAL B  1 234 ? -56.744  -51.054 38.814  1.00 70.11  ? 227 VAL B CG1    1 
ATOM   4486  C CG2    . VAL B  1 234 ? -56.342  -49.148 37.244  1.00 69.66  ? 227 VAL B CG2    1 
ATOM   4487  N N      . ARG B  1 235 ? -59.831  -52.130 38.239  1.00 82.97  ? 228 ARG B N      1 
ATOM   4488  C CA     . ARG B  1 235 ? -61.033  -52.662 38.874  1.00 81.57  ? 228 ARG B CA     1 
ATOM   4489  C C      . ARG B  1 235 ? -60.857  -52.846 40.377  1.00 79.54  ? 228 ARG B C      1 
ATOM   4490  O O      . ARG B  1 235 ? -61.822  -52.744 41.136  1.00 76.76  ? 228 ARG B O      1 
ATOM   4491  C CB     . ARG B  1 235 ? -61.432  -53.990 38.227  1.00 83.40  ? 228 ARG B CB     1 
ATOM   4492  N N      . SER B  1 241 ? -61.658  -57.602 48.649  1.00 70.40  ? 234 SER B N      1 
ATOM   4493  C CA     . SER B  1 241 ? -60.470  -56.809 48.941  1.00 73.39  ? 234 SER B CA     1 
ATOM   4494  C C      . SER B  1 241 ? -60.392  -56.476 50.427  1.00 73.50  ? 234 SER B C      1 
ATOM   4495  O O      . SER B  1 241 ? -60.579  -57.341 51.281  1.00 75.84  ? 234 SER B O      1 
ATOM   4496  C CB     . SER B  1 241 ? -60.469  -55.520 48.114  1.00 71.19  ? 234 SER B CB     1 
ATOM   4497  O OG     . SER B  1 241 ? -61.570  -54.694 48.459  1.00 68.29  ? 234 SER B OG     1 
ATOM   4498  N N      . GLU B  1 242 ? -60.118  -55.206 50.719  1.00 72.19  ? 235 GLU B N      1 
ATOM   4499  C CA     . GLU B  1 242 ? -60.056  -54.693 52.082  1.00 70.61  ? 235 GLU B CA     1 
ATOM   4500  C C      . GLU B  1 242 ? -61.347  -54.030 52.537  1.00 66.72  ? 235 GLU B C      1 
ATOM   4501  O O      . GLU B  1 242 ? -61.456  -53.680 53.717  1.00 67.24  ? 235 GLU B O      1 
ATOM   4502  C CB     . GLU B  1 242 ? -58.896  -53.705 52.253  1.00 72.83  ? 235 GLU B CB     1 
ATOM   4503  C CG     . GLU B  1 242 ? -57.538  -54.368 52.362  1.00 78.22  ? 235 GLU B CG     1 
ATOM   4504  C CD     . GLU B  1 242 ? -56.525  -53.498 53.074  1.00 83.15  ? 235 GLU B CD     1 
ATOM   4505  O OE1    . GLU B  1 242 ? -55.759  -52.796 52.385  1.00 84.73  ? 235 GLU B OE1    1 
ATOM   4506  O OE2    . GLU B  1 242 ? -56.501  -53.505 54.323  1.00 85.14  ? 235 GLU B OE2    1 
ATOM   4507  N N      . TYR B  1 243 ? -62.307  -53.823 51.638  1.00 59.77  ? 236 TYR B N      1 
ATOM   4508  C CA     . TYR B  1 243 ? -63.580  -53.221 52.032  1.00 52.89  ? 236 TYR B CA     1 
ATOM   4509  C C      . TYR B  1 243 ? -64.153  -53.822 53.307  1.00 52.58  ? 236 TYR B C      1 
ATOM   4510  O O      . TYR B  1 243 ? -64.468  -53.057 54.231  1.00 52.99  ? 236 TYR B O      1 
ATOM   4511  C CB     . TYR B  1 243 ? -64.587  -53.364 50.881  1.00 49.94  ? 236 TYR B CB     1 
ATOM   4512  C CG     . TYR B  1 243 ? -65.912  -52.669 51.125  1.00 47.07  ? 236 TYR B CG     1 
ATOM   4513  C CD1    . TYR B  1 243 ? -66.872  -53.236 51.957  1.00 46.13  ? 236 TYR B CD1    1 
ATOM   4514  C CD2    . TYR B  1 243 ? -66.216  -51.464 50.504  1.00 43.98  ? 236 TYR B CD2    1 
ATOM   4515  C CE1    . TYR B  1 243 ? -68.082  -52.610 52.189  1.00 43.47  ? 236 TYR B CE1    1 
ATOM   4516  C CE2    . TYR B  1 243 ? -67.428  -50.834 50.722  1.00 41.57  ? 236 TYR B CE2    1 
ATOM   4517  C CZ     . TYR B  1 243 ? -68.357  -51.413 51.562  1.00 42.37  ? 236 TYR B CZ     1 
ATOM   4518  O OH     . TYR B  1 243 ? -69.563  -50.788 51.781  1.00 41.47  ? 236 TYR B OH     1 
ATOM   4519  N N      . PRO B  1 244 ? -64.320  -55.140 53.430  1.00 54.29  ? 237 PRO B N      1 
ATOM   4520  C CA     . PRO B  1 244 ? -64.808  -55.697 54.704  1.00 56.22  ? 237 PRO B CA     1 
ATOM   4521  C C      . PRO B  1 244 ? -63.887  -55.440 55.887  1.00 57.02  ? 237 PRO B C      1 
ATOM   4522  O O      . PRO B  1 244 ? -64.354  -55.478 57.032  1.00 56.97  ? 237 PRO B O      1 
ATOM   4523  C CB     . PRO B  1 244 ? -64.934  -57.198 54.406  1.00 55.73  ? 237 PRO B CB     1 
ATOM   4524  C CG     . PRO B  1 244 ? -64.042  -57.438 53.233  1.00 55.18  ? 237 PRO B CG     1 
ATOM   4525  C CD     . PRO B  1 244 ? -64.105  -56.183 52.414  1.00 54.67  ? 237 PRO B CD     1 
ATOM   4526  N N      . VAL B  1 245 ? -62.597  -55.184 55.658  1.00 58.62  ? 238 VAL B N      1 
ATOM   4527  C CA     . VAL B  1 245 ? -61.693  -54.923 56.775  1.00 63.89  ? 238 VAL B CA     1 
ATOM   4528  C C      . VAL B  1 245 ? -61.966  -53.553 57.382  1.00 64.43  ? 238 VAL B C      1 
ATOM   4529  O O      . VAL B  1 245 ? -61.958  -53.391 58.608  1.00 65.70  ? 238 VAL B O      1 
ATOM   4530  C CB     . VAL B  1 245 ? -60.228  -55.060 56.325  1.00 66.38  ? 238 VAL B CB     1 
ATOM   4531  C CG1    . VAL B  1 245 ? -59.295  -54.714 57.472  1.00 65.71  ? 238 VAL B CG1    1 
ATOM   4532  C CG2    . VAL B  1 245 ? -59.958  -56.468 55.829  1.00 69.09  ? 238 VAL B CG2    1 
ATOM   4533  N N      . ARG B  1 246 ? -62.200  -52.544 56.539  1.00 60.61  ? 239 ARG B N      1 
ATOM   4534  C CA     . ARG B  1 246 ? -62.532  -51.218 57.051  1.00 56.21  ? 239 ARG B CA     1 
ATOM   4535  C C      . ARG B  1 246 ? -63.815  -51.241 57.871  1.00 54.11  ? 239 ARG B C      1 
ATOM   4536  O O      . ARG B  1 246 ? -63.880  -50.640 58.950  1.00 52.53  ? 239 ARG B O      1 
ATOM   4537  C CB     . ARG B  1 246 ? -62.668  -50.227 55.896  1.00 50.86  ? 239 ARG B CB     1 
ATOM   4538  C CG     . ARG B  1 246 ? -61.418  -50.045 55.070  1.00 48.60  ? 239 ARG B CG     1 
ATOM   4539  C CD     . ARG B  1 246 ? -60.270  -49.511 55.910  1.00 45.30  ? 239 ARG B CD     1 
ATOM   4540  N NE     . ARG B  1 246 ? -59.095  -49.238 55.090  1.00 40.59  ? 239 ARG B NE     1 
ATOM   4541  C CZ     . ARG B  1 246 ? -58.214  -50.162 54.723  1.00 44.07  ? 239 ARG B CZ     1 
ATOM   4542  N NH1    . ARG B  1 246 ? -58.373  -51.421 55.107  1.00 46.22  ? 239 ARG B NH1    1 
ATOM   4543  N NH2    . ARG B  1 246 ? -57.175  -49.829 53.972  1.00 45.95  ? 239 ARG B NH2    1 
ATOM   4544  N N      . ARG B  1 247 ? -64.845  -51.939 57.383  1.00 54.26  ? 240 ARG B N      1 
ATOM   4545  C CA     . ARG B  1 247 ? -66.106  -52.010 58.117  1.00 55.46  ? 240 ARG B CA     1 
ATOM   4546  C C      . ARG B  1 247 ? -65.925  -52.601 59.511  1.00 56.79  ? 240 ARG B C      1 
ATOM   4547  O O      . ARG B  1 247 ? -66.554  -52.139 60.470  1.00 56.79  ? 240 ARG B O      1 
ATOM   4548  C CB     . ARG B  1 247 ? -67.143  -52.812 57.327  1.00 55.31  ? 240 ARG B CB     1 
ATOM   4549  C CG     . ARG B  1 247 ? -68.545  -52.687 57.912  1.00 54.87  ? 240 ARG B CG     1 
ATOM   4550  C CD     . ARG B  1 247 ? -69.641  -53.231 57.003  1.00 51.42  ? 240 ARG B CD     1 
ATOM   4551  N NE     . ARG B  1 247 ? -70.959  -52.856 57.515  1.00 52.13  ? 240 ARG B NE     1 
ATOM   4552  C CZ     . ARG B  1 247 ? -72.105  -53.003 56.856  1.00 52.55  ? 240 ARG B CZ     1 
ATOM   4553  N NH1    . ARG B  1 247 ? -73.245  -52.614 57.416  1.00 52.73  ? 240 ARG B NH1    1 
ATOM   4554  N NH2    . ARG B  1 247 ? -72.115  -53.520 55.636  1.00 53.18  ? 240 ARG B NH2    1 
ATOM   4555  N N      . ARG B  1 248 ? -65.079  -53.625 59.648  1.00 60.74  ? 241 ARG B N      1 
ATOM   4556  C CA     . ARG B  1 248 ? -64.869  -54.225 60.964  1.00 64.23  ? 241 ARG B CA     1 
ATOM   4557  C C      . ARG B  1 248 ? -64.193  -53.249 61.919  1.00 63.52  ? 241 ARG B C      1 
ATOM   4558  O O      . ARG B  1 248 ? -64.594  -53.133 63.084  1.00 65.16  ? 241 ARG B O      1 
ATOM   4559  C CB     . ARG B  1 248 ? -64.043  -55.505 60.835  1.00 69.01  ? 241 ARG B CB     1 
ATOM   4560  N N      . GLN B  1 249 ? -63.169  -52.537 61.445  1.00 61.44  ? 242 GLN B N      1 
ATOM   4561  C CA     . GLN B  1 249 ? -62.466  -51.584 62.298  1.00 61.97  ? 242 GLN B CA     1 
ATOM   4562  C C      . GLN B  1 249 ? -63.416  -50.519 62.830  1.00 58.02  ? 242 GLN B C      1 
ATOM   4563  O O      . GLN B  1 249 ? -63.414  -50.210 64.027  1.00 59.53  ? 242 GLN B O      1 
ATOM   4564  C CB     . GLN B  1 249 ? -61.322  -50.932 61.522  1.00 64.42  ? 242 GLN B CB     1 
ATOM   4565  C CG     . GLN B  1 249 ? -60.170  -51.859 61.179  1.00 67.33  ? 242 GLN B CG     1 
ATOM   4566  C CD     . GLN B  1 249 ? -59.248  -51.265 60.130  1.00 67.53  ? 242 GLN B CD     1 
ATOM   4567  O OE1    . GLN B  1 249 ? -58.361  -50.474 60.448  1.00 68.01  ? 242 GLN B OE1    1 
ATOM   4568  N NE2    . GLN B  1 249 ? -59.458  -51.638 58.872  1.00 66.96  ? 242 GLN B NE2    1 
ATOM   4569  N N      . CYS B  1 250 ? -64.237  -49.941 61.950  1.00 50.84  ? 243 CYS B N      1 
ATOM   4570  C CA     . CYS B  1 250 ? -65.179  -48.913 62.382  1.00 50.37  ? 243 CYS B CA     1 
ATOM   4571  C C      . CYS B  1 250 ? -66.096  -49.432 63.483  1.00 51.65  ? 243 CYS B C      1 
ATOM   4572  O O      . CYS B  1 250 ? -66.346  -48.735 64.474  1.00 52.13  ? 243 CYS B O      1 
ATOM   4573  C CB     . CYS B  1 250 ? -65.995  -48.417 61.188  1.00 50.04  ? 243 CYS B CB     1 
ATOM   4574  S SG     . CYS B  1 250 ? -65.060  -47.434 59.992  1.00 51.12  ? 243 CYS B SG     1 
ATOM   4575  N N      . GLU B  1 251 ? -66.610  -50.655 63.327  1.00 52.95  ? 244 GLU B N      1 
ATOM   4576  C CA     . GLU B  1 251 ? -67.438  -51.247 64.373  1.00 56.63  ? 244 GLU B CA     1 
ATOM   4577  C C      . GLU B  1 251 ? -66.643  -51.441 65.659  1.00 61.61  ? 244 GLU B C      1 
ATOM   4578  O O      . GLU B  1 251 ? -67.150  -51.181 66.757  1.00 63.29  ? 244 GLU B O      1 
ATOM   4579  C CB     . GLU B  1 251 ? -68.029  -52.568 63.883  1.00 59.86  ? 244 GLU B CB     1 
ATOM   4580  C CG     . GLU B  1 251 ? -69.217  -52.375 62.952  1.00 61.53  ? 244 GLU B CG     1 
ATOM   4581  C CD     . GLU B  1 251 ? -69.253  -53.373 61.807  1.00 64.48  ? 244 GLU B CD     1 
ATOM   4582  O OE1    . GLU B  1 251 ? -68.673  -54.473 61.946  1.00 67.32  ? 244 GLU B OE1    1 
ATOM   4583  O OE2    . GLU B  1 251 ? -69.862  -53.048 60.763  1.00 61.34  ? 244 GLU B OE2    1 
ATOM   4584  N N      . GLU B  1 252 ? -65.393  -51.897 65.543  1.00 62.13  ? 245 GLU B N      1 
ATOM   4585  C CA     . GLU B  1 252 ? -64.559  -52.078 66.727  1.00 59.31  ? 245 GLU B CA     1 
ATOM   4586  C C      . GLU B  1 252 ? -64.304  -50.747 67.424  1.00 58.27  ? 245 GLU B C      1 
ATOM   4587  O O      . GLU B  1 252 ? -64.348  -50.664 68.657  1.00 60.46  ? 245 GLU B O      1 
ATOM   4588  C CB     . GLU B  1 252 ? -63.239  -52.747 66.343  1.00 58.32  ? 245 GLU B CB     1 
ATOM   4589  N N      . VAL B  1 253 ? -64.046  -49.690 66.648  1.00 55.85  ? 246 VAL B N      1 
ATOM   4590  C CA     . VAL B  1 253 ? -63.784  -48.383 67.242  1.00 56.47  ? 246 VAL B CA     1 
ATOM   4591  C C      . VAL B  1 253 ? -65.036  -47.842 67.918  1.00 60.11  ? 246 VAL B C      1 
ATOM   4592  O O      . VAL B  1 253 ? -64.949  -47.163 68.948  1.00 62.01  ? 246 VAL B O      1 
ATOM   4593  C CB     . VAL B  1 253 ? -63.251  -47.402 66.179  1.00 49.90  ? 246 VAL B CB     1 
ATOM   4594  C CG1    . VAL B  1 253 ? -63.143  -45.997 66.755  1.00 46.26  ? 246 VAL B CG1    1 
ATOM   4595  C CG2    . VAL B  1 253 ? -61.906  -47.870 65.644  1.00 49.57  ? 246 VAL B CG2    1 
ATOM   4596  N N      . ALA B  1 254 ? -66.216  -48.121 67.356  1.00 63.25  ? 247 ALA B N      1 
ATOM   4597  C CA     . ALA B  1 254 ? -67.451  -47.638 67.966  1.00 62.94  ? 247 ALA B CA     1 
ATOM   4598  C C      . ALA B  1 254 ? -67.685  -48.287 69.325  1.00 66.85  ? 247 ALA B C      1 
ATOM   4599  O O      . ALA B  1 254 ? -68.100  -47.615 70.276  1.00 69.88  ? 247 ALA B O      1 
ATOM   4600  C CB     . ALA B  1 254 ? -68.634  -47.898 67.034  1.00 59.22  ? 247 ALA B CB     1 
ATOM   4601  N N      . ARG B  1 255 ? -67.431  -49.593 69.434  1.00 69.49  ? 248 ARG B N      1 
ATOM   4602  C CA     . ARG B  1 255 ? -67.546  -50.264 70.725  1.00 72.98  ? 248 ARG B CA     1 
ATOM   4603  C C      . ARG B  1 255 ? -66.563  -49.688 71.735  1.00 72.67  ? 248 ARG B C      1 
ATOM   4604  O O      . ARG B  1 255 ? -66.930  -49.400 72.880  1.00 75.20  ? 248 ARG B O      1 
ATOM   4605  C CB     . ARG B  1 255 ? -67.324  -51.767 70.561  1.00 82.07  ? 248 ARG B CB     1 
ATOM   4606  C CG     . ARG B  1 255 ? -68.601  -52.573 70.383  1.00 89.15  ? 248 ARG B CG     1 
ATOM   4607  C CD     . ARG B  1 255 ? -68.311  -54.065 70.374  1.00 95.87  ? 248 ARG B CD     1 
ATOM   4608  N NE     . ARG B  1 255 ? -69.508  -54.852 70.086  1.00 101.25 ? 248 ARG B NE     1 
ATOM   4609  C CZ     . ARG B  1 255 ? -70.321  -55.349 71.013  1.00 106.86 ? 248 ARG B CZ     1 
ATOM   4610  N NH1    . ARG B  1 255 ? -70.070  -55.146 72.300  1.00 108.48 ? 248 ARG B NH1    1 
ATOM   4611  N NH2    . ARG B  1 255 ? -71.386  -56.051 70.651  1.00 109.08 ? 248 ARG B NH2    1 
ATOM   4612  N N      . ALA B  1 256 ? -65.303  -49.512 71.326  1.00 67.43  ? 249 ALA B N      1 
ATOM   4613  C CA     . ALA B  1 256 ? -64.293  -48.969 72.231  1.00 64.76  ? 249 ALA B CA     1 
ATOM   4614  C C      . ALA B  1 256 ? -64.738  -47.639 72.823  1.00 60.19  ? 249 ALA B C      1 
ATOM   4615  O O      . ALA B  1 256 ? -64.450  -47.338 73.988  1.00 63.08  ? 249 ALA B O      1 
ATOM   4616  C CB     . ALA B  1 256 ? -62.961  -48.810 71.499  1.00 62.65  ? 249 ALA B CB     1 
ATOM   4617  N N      . LEU B  1 257 ? -65.446  -46.834 72.037  1.00 57.29  ? 250 LEU B N      1 
ATOM   4618  C CA     . LEU B  1 257 ? -65.973  -45.557 72.490  1.00 55.81  ? 250 LEU B CA     1 
ATOM   4619  C C      . LEU B  1 257 ? -67.360  -45.691 73.100  1.00 54.99  ? 250 LEU B C      1 
ATOM   4620  O O      . LEU B  1 257 ? -67.974  -44.677 73.449  1.00 51.31  ? 250 LEU B O      1 
ATOM   4621  C CB     . LEU B  1 257 ? -66.008  -44.559 71.328  1.00 56.72  ? 250 LEU B CB     1 
ATOM   4622  C CG     . LEU B  1 257 ? -64.693  -43.865 70.965  1.00 60.22  ? 250 LEU B CG     1 
ATOM   4623  C CD1    . LEU B  1 257 ? -63.585  -44.879 70.730  1.00 60.25  ? 250 LEU B CD1    1 
ATOM   4624  C CD2    . LEU B  1 257 ? -64.877  -42.982 69.739  1.00 58.40  ? 250 LEU B CD2    1 
ATOM   4625  N N      . GLY B  1 258 ? -67.862  -46.914 73.234  1.00 58.06  ? 251 GLY B N      1 
ATOM   4626  C CA     . GLY B  1 258 ? -69.183  -47.121 73.802  1.00 58.60  ? 251 GLY B CA     1 
ATOM   4627  C C      . GLY B  1 258 ? -70.277  -46.453 73.000  1.00 58.63  ? 251 GLY B C      1 
ATOM   4628  O O      . GLY B  1 258 ? -71.250  -45.950 73.576  1.00 61.04  ? 251 GLY B O      1 
ATOM   4629  N N      . ALA B  1 259 ? -70.141  -46.442 71.677  1.00 57.87  ? 252 ALA B N      1 
ATOM   4630  C CA     . ALA B  1 259 ? -71.095  -45.799 70.790  1.00 57.94  ? 252 ALA B CA     1 
ATOM   4631  C C      . ALA B  1 259 ? -71.740  -46.827 69.872  1.00 60.12  ? 252 ALA B C      1 
ATOM   4632  O O      . ALA B  1 259 ? -71.156  -47.872 69.572  1.00 60.90  ? 252 ALA B O      1 
ATOM   4633  C CB     . ALA B  1 259 ? -70.421  -44.708 69.948  1.00 56.23  ? 252 ALA B CB     1 
ATOM   4634  N N      . ALA B  1 260 ? -72.957  -46.512 69.423  1.00 59.58  ? 253 ALA B N      1 
ATOM   4635  C CA     . ALA B  1 260 ? -73.663  -47.407 68.513  1.00 58.81  ? 253 ALA B CA     1 
ATOM   4636  C C      . ALA B  1 260 ? -73.019  -47.404 67.136  1.00 55.43  ? 253 ALA B C      1 
ATOM   4637  O O      . ALA B  1 260 ? -72.940  -48.446 66.474  1.00 54.20  ? 253 ALA B O      1 
ATOM   4638  C CB     . ALA B  1 260 ? -75.132  -47.003 68.416  1.00 57.37  ? 253 ALA B CB     1 
ATOM   4639  N N      . SER B  1 261 ? -72.573  -46.237 66.683  1.00 52.63  ? 254 SER B N      1 
ATOM   4640  C CA     . SER B  1 261 ? -71.883  -46.109 65.412  1.00 48.98  ? 254 SER B CA     1 
ATOM   4641  C C      . SER B  1 261 ? -70.990  -44.881 65.474  1.00 44.91  ? 254 SER B C      1 
ATOM   4642  O O      . SER B  1 261 ? -71.120  -44.035 66.363  1.00 41.69  ? 254 SER B O      1 
ATOM   4643  C CB     . SER B  1 261 ? -72.869  -46.004 64.244  1.00 49.58  ? 254 SER B CB     1 
ATOM   4644  O OG     . SER B  1 261 ? -73.609  -44.795 64.309  1.00 51.24  ? 254 SER B OG     1 
ATOM   4645  N N      . LEU B  1 262 ? -70.080  -44.784 64.505  1.00 42.14  ? 255 LEU B N      1 
ATOM   4646  C CA     . LEU B  1 262 ? -69.212  -43.617 64.435  1.00 38.94  ? 255 LEU B CA     1 
ATOM   4647  C C      . LEU B  1 262 ? -70.003  -42.333 64.223  1.00 42.65  ? 255 LEU B C      1 
ATOM   4648  O O      . LEU B  1 262 ? -69.438  -41.243 64.364  1.00 46.59  ? 255 LEU B O      1 
ATOM   4649  C CB     . LEU B  1 262 ? -68.180  -43.798 63.323  1.00 34.85  ? 255 LEU B CB     1 
ATOM   4650  C CG     . LEU B  1 262 ? -67.048  -44.768 63.678  1.00 34.66  ? 255 LEU B CG     1 
ATOM   4651  C CD1    . LEU B  1 262 ? -65.982  -44.814 62.591  1.00 28.57  ? 255 LEU B CD1    1 
ATOM   4652  C CD2    . LEU B  1 262 ? -66.443  -44.449 65.035  1.00 38.47  ? 255 LEU B CD2    1 
ATOM   4653  N N      . ARG B  1 263 ? -71.292  -42.439 63.889  1.00 44.49  ? 256 ARG B N      1 
ATOM   4654  C CA     . ARG B  1 263 ? -72.135  -41.259 63.744  1.00 46.33  ? 256 ARG B CA     1 
ATOM   4655  C C      . ARG B  1 263 ? -72.340  -40.562 65.082  1.00 51.10  ? 256 ARG B C      1 
ATOM   4656  O O      . ARG B  1 263 ? -72.610  -39.356 65.119  1.00 53.17  ? 256 ARG B O      1 
ATOM   4657  C CB     . ARG B  1 263 ? -73.484  -41.665 63.151  1.00 46.34  ? 256 ARG B CB     1 
ATOM   4658  C CG     . ARG B  1 263 ? -74.543  -40.576 63.103  1.00 42.47  ? 256 ARG B CG     1 
ATOM   4659  C CD     . ARG B  1 263 ? -74.380  -39.669 61.903  1.00 40.31  ? 256 ARG B CD     1 
ATOM   4660  N NE     . ARG B  1 263 ? -75.415  -38.640 61.865  1.00 42.81  ? 256 ARG B NE     1 
ATOM   4661  C CZ     . ARG B  1 263 ? -76.287  -38.496 60.873  1.00 43.66  ? 256 ARG B CZ     1 
ATOM   4662  N NH1    . ARG B  1 263 ? -76.245  -39.310 59.828  1.00 44.42  ? 256 ARG B NH1    1 
ATOM   4663  N NH2    . ARG B  1 263 ? -77.196  -37.536 60.920  1.00 45.62  ? 256 ARG B NH2    1 
ATOM   4664  N N      . GLU B  1 264 ? -72.250  -41.308 66.182  1.00 53.50  ? 257 GLU B N      1 
ATOM   4665  C CA     . GLU B  1 264 ? -72.416  -40.756 67.520  1.00 53.88  ? 257 GLU B CA     1 
ATOM   4666  C C      . GLU B  1 264 ? -71.141  -40.134 68.064  1.00 47.39  ? 257 GLU B C      1 
ATOM   4667  O O      . GLU B  1 264 ? -71.135  -39.684 69.214  1.00 48.40  ? 257 GLU B O      1 
ATOM   4668  C CB     . GLU B  1 264 ? -72.876  -41.847 68.487  1.00 61.71  ? 257 GLU B CB     1 
ATOM   4669  C CG     . GLU B  1 264 ? -73.925  -42.771 67.919  1.00 67.68  ? 257 GLU B CG     1 
ATOM   4670  C CD     . GLU B  1 264 ? -75.310  -42.174 67.974  1.00 73.14  ? 257 GLU B CD     1 
ATOM   4671  O OE1    . GLU B  1 264 ? -76.123  -42.652 68.792  1.00 77.24  ? 257 GLU B OE1    1 
ATOM   4672  O OE2    . GLU B  1 264 ? -75.581  -41.225 67.208  1.00 73.51  ? 257 GLU B OE2    1 
ATOM   4673  N N      . VAL B  1 265 ? -70.072  -40.094 67.278  1.00 43.19  ? 258 VAL B N      1 
ATOM   4674  C CA     . VAL B  1 265 ? -68.778  -39.602 67.732  1.00 44.04  ? 258 VAL B CA     1 
ATOM   4675  C C      . VAL B  1 265 ? -68.439  -38.344 66.952  1.00 45.33  ? 258 VAL B C      1 
ATOM   4676  O O      . VAL B  1 265 ? -68.578  -38.308 65.723  1.00 48.93  ? 258 VAL B O      1 
ATOM   4677  C CB     . VAL B  1 265 ? -67.675  -40.661 67.563  1.00 41.18  ? 258 VAL B CB     1 
ATOM   4678  C CG1    . VAL B  1 265 ? -66.367  -40.159 68.161  1.00 37.61  ? 258 VAL B CG1    1 
ATOM   4679  C CG2    . VAL B  1 265 ? -68.091  -41.969 68.212  1.00 41.41  ? 258 VAL B CG2    1 
ATOM   4680  N N      . GLN B  1 266 ? -67.994  -37.316 67.665  1.00 50.30  ? 259 GLN B N      1 
ATOM   4681  C CA     . GLN B  1 266 ? -67.529  -36.091 67.039  1.00 47.92  ? 259 GLN B CA     1 
ATOM   4682  C C      . GLN B  1 266 ? -66.011  -36.046 67.104  1.00 41.04  ? 259 GLN B C      1 
ATOM   4683  O O      . GLN B  1 266 ? -65.379  -36.761 67.883  1.00 37.60  ? 259 GLN B O      1 
ATOM   4684  C CB     . GLN B  1 266 ? -68.129  -34.855 67.717  1.00 53.70  ? 259 GLN B CB     1 
ATOM   4685  C CG     . GLN B  1 266 ? -69.646  -34.790 67.649  1.00 58.00  ? 259 GLN B CG     1 
ATOM   4686  C CD     . GLN B  1 266 ? -70.212  -33.489 68.192  1.00 64.95  ? 259 GLN B CD     1 
ATOM   4687  O OE1    . GLN B  1 266 ? -69.587  -32.432 68.089  1.00 66.94  ? 259 GLN B OE1    1 
ATOM   4688  N NE2    . GLN B  1 266 ? -71.404  -33.562 68.774  1.00 69.02  ? 259 GLN B NE2    1 
ATOM   4689  N N      . LEU B  1 267 ? -65.427  -35.198 66.259  1.00 42.62  ? 260 LEU B N      1 
ATOM   4690  C CA     . LEU B  1 267 ? -63.973  -35.165 66.133  1.00 44.88  ? 260 LEU B CA     1 
ATOM   4691  C C      . LEU B  1 267 ? -63.296  -34.990 67.485  1.00 46.86  ? 260 LEU B C      1 
ATOM   4692  O O      . LEU B  1 267 ? -62.334  -35.696 67.810  1.00 48.24  ? 260 LEU B O      1 
ATOM   4693  C CB     . LEU B  1 267 ? -63.561  -34.052 65.176  1.00 45.33  ? 260 LEU B CB     1 
ATOM   4694  C CG     . LEU B  1 267 ? -62.064  -33.931 64.893  1.00 48.23  ? 260 LEU B CG     1 
ATOM   4695  C CD1    . LEU B  1 267 ? -61.520  -35.260 64.394  1.00 45.93  ? 260 LEU B CD1    1 
ATOM   4696  C CD2    . LEU B  1 267 ? -61.799  -32.835 63.864  1.00 47.81  ? 260 LEU B CD2    1 
ATOM   4697  N N      . GLU B  1 268 ? -63.779  -34.037 68.280  1.00 51.56  ? 261 GLU B N      1 
ATOM   4698  C CA     . GLU B  1 268 ? -63.146  -33.742 69.560  1.00 59.39  ? 261 GLU B CA     1 
ATOM   4699  C C      . GLU B  1 268 ? -63.185  -34.948 70.490  1.00 66.40  ? 261 GLU B C      1 
ATOM   4700  O O      . GLU B  1 268 ? -62.210  -35.227 71.202  1.00 65.86  ? 261 GLU B O      1 
ATOM   4701  C CB     . GLU B  1 268 ? -63.820  -32.521 70.194  1.00 59.77  ? 261 GLU B CB     1 
ATOM   4702  C CG     . GLU B  1 268 ? -63.547  -31.219 69.432  1.00 61.12  ? 261 GLU B CG     1 
ATOM   4703  C CD     . GLU B  1 268 ? -64.222  -31.181 68.063  1.00 61.65  ? 261 GLU B CD     1 
ATOM   4704  O OE1    . GLU B  1 268 ? -65.252  -31.868 67.858  1.00 62.05  ? 261 GLU B OE1    1 
ATOM   4705  O OE2    . GLU B  1 268 ? -63.703  -30.469 67.179  1.00 61.45  ? 261 GLU B OE2    1 
ATOM   4706  N N      . GLU B  1 269 ? -64.309  -35.669 70.514  1.00 72.78  ? 262 GLU B N      1 
ATOM   4707  C CA     . GLU B  1 269 ? -64.395  -36.830 71.394  1.00 74.25  ? 262 GLU B CA     1 
ATOM   4708  C C      . GLU B  1 269 ? -63.428  -37.917 70.956  1.00 70.97  ? 262 GLU B C      1 
ATOM   4709  O O      . GLU B  1 269 ? -62.861  -38.624 71.797  1.00 70.85  ? 262 GLU B O      1 
ATOM   4710  C CB     . GLU B  1 269 ? -65.816  -37.404 71.433  1.00 79.30  ? 262 GLU B CB     1 
ATOM   4711  C CG     . GLU B  1 269 ? -65.979  -38.495 72.504  1.00 90.91  ? 262 GLU B CG     1 
ATOM   4712  C CD     . GLU B  1 269 ? -67.324  -39.175 72.463  1.00 102.11 ? 262 GLU B CD     1 
ATOM   4713  O OE1    . GLU B  1 269 ? -68.158  -38.673 71.696  1.00 102.88 ? 262 GLU B OE1    1 
ATOM   4714  O OE2    . GLU B  1 269 ? -67.493  -40.288 73.038  1.00 107.76 ? 262 GLU B OE2    1 
ATOM   4715  N N      . LEU B  1 270 ? -63.220  -38.041 69.646  1.00 68.85  ? 263 LEU B N      1 
ATOM   4716  C CA     . LEU B  1 270 ? -62.338  -39.059 69.091  1.00 59.90  ? 263 LEU B CA     1 
ATOM   4717  C C      . LEU B  1 270 ? -60.896  -38.838 69.526  1.00 58.00  ? 263 LEU B C      1 
ATOM   4718  O O      . LEU B  1 270 ? -60.153  -39.801 69.780  1.00 57.22  ? 263 LEU B O      1 
ATOM   4719  C CB     . LEU B  1 270 ? -62.473  -39.047 67.573  1.00 48.20  ? 263 LEU B CB     1 
ATOM   4720  C CG     . LEU B  1 270 ? -61.638  -40.113 66.880  1.00 39.84  ? 263 LEU B CG     1 
ATOM   4721  C CD1    . LEU B  1 270 ? -62.092  -41.479 67.327  1.00 36.85  ? 263 LEU B CD1    1 
ATOM   4722  C CD2    . LEU B  1 270 ? -61.687  -39.931 65.380  1.00 31.67  ? 263 LEU B CD2    1 
ATOM   4723  N N      . GLU B  1 271 ? -60.502  -37.566 69.630  1.00 63.48  ? 264 GLU B N      1 
ATOM   4724  C CA     . GLU B  1 271 ? -59.163  -37.210 70.076  1.00 68.93  ? 264 GLU B CA     1 
ATOM   4725  C C      . GLU B  1 271 ? -58.947  -37.598 71.528  1.00 65.84  ? 264 GLU B C      1 
ATOM   4726  O O      . GLU B  1 271 ? -57.894  -38.140 71.875  1.00 67.68  ? 264 GLU B O      1 
ATOM   4727  C CB     . GLU B  1 271 ? -58.917  -35.716 69.858  1.00 76.95  ? 264 GLU B CB     1 
ATOM   4728  C CG     . GLU B  1 271 ? -59.000  -35.310 68.399  1.00 80.93  ? 264 GLU B CG     1 
ATOM   4729  C CD     . GLU B  1 271 ? -58.468  -33.906 68.146  1.00 86.75  ? 264 GLU B CD     1 
ATOM   4730  O OE1    . GLU B  1 271 ? -57.800  -33.351 69.055  1.00 89.33  ? 264 GLU B OE1    1 
ATOM   4731  O OE2    . GLU B  1 271 ? -58.735  -33.367 67.042  1.00 86.97  ? 264 GLU B OE2    1 
ATOM   4732  N N      . ALA B  1 272 ? -59.952  -37.385 72.375  1.00 55.47  ? 265 ALA B N      1 
ATOM   4733  C CA     . ALA B  1 272 ? -59.842  -37.766 73.780  1.00 56.78  ? 265 ALA B CA     1 
ATOM   4734  C C      . ALA B  1 272 ? -59.636  -39.269 73.950  1.00 59.35  ? 265 ALA B C      1 
ATOM   4735  O O      . ALA B  1 272 ? -58.893  -39.706 74.837  1.00 62.66  ? 265 ALA B O      1 
ATOM   4736  C CB     . ALA B  1 272 ? -61.083  -37.302 74.538  1.00 54.94  ? 265 ALA B CB     1 
ATOM   4737  N N      . ALA B  1 273 ? -60.278  -40.078 73.109  1.00 44.31  ? 266 ALA B N      1 
ATOM   4738  C CA     . ALA B  1 273 ? -60.248  -41.526 73.252  1.00 50.31  ? 266 ALA B CA     1 
ATOM   4739  C C      . ALA B  1 273 ? -59.070  -42.164 72.529  1.00 45.88  ? 266 ALA B C      1 
ATOM   4740  O O      . ALA B  1 273 ? -59.127  -43.355 72.203  1.00 44.02  ? 266 ALA B O      1 
ATOM   4741  C CB     . ALA B  1 273 ? -61.562  -42.131 72.748  1.00 53.36  ? 266 ALA B CB     1 
ATOM   4742  N N      . ARG B  1 274 ? -58.017  -41.391 72.252  1.00 52.85  ? 267 ARG B N      1 
ATOM   4743  C CA     . ARG B  1 274 ? -56.882  -41.912 71.496  1.00 54.39  ? 267 ARG B CA     1 
ATOM   4744  C C      . ARG B  1 274 ? -56.307  -43.168 72.143  1.00 62.07  ? 267 ARG B C      1 
ATOM   4745  O O      . ARG B  1 274 ? -55.851  -44.084 71.447  1.00 69.80  ? 267 ARG B O      1 
ATOM   4746  C CB     . ARG B  1 274 ? -55.812  -40.830 71.358  1.00 57.30  ? 267 ARG B CB     1 
ATOM   4747  C CG     . ARG B  1 274 ? -54.895  -41.008 70.163  1.00 60.41  ? 267 ARG B CG     1 
ATOM   4748  C CD     . ARG B  1 274 ? -54.559  -39.632 69.606  1.00 63.28  ? 267 ARG B CD     1 
ATOM   4749  N NE     . ARG B  1 274 ? -53.866  -39.674 68.325  1.00 63.23  ? 267 ARG B NE     1 
ATOM   4750  C CZ     . ARG B  1 274 ? -53.765  -38.632 67.506  1.00 65.57  ? 267 ARG B CZ     1 
ATOM   4751  N NH1    . ARG B  1 274 ? -54.277  -37.459 67.857  1.00 64.86  ? 267 ARG B NH1    1 
ATOM   4752  N NH2    . ARG B  1 274 ? -53.126  -38.755 66.350  1.00 65.71  ? 267 ARG B NH2    1 
ATOM   4753  N N      . ASP B  1 275 ? -56.307  -43.223 73.478  1.00 58.69  ? 268 ASP B N      1 
ATOM   4754  C CA     . ASP B  1 275 ? -55.751  -44.360 74.202  1.00 59.01  ? 268 ASP B CA     1 
ATOM   4755  C C      . ASP B  1 275 ? -56.704  -45.545 74.287  1.00 55.46  ? 268 ASP B C      1 
ATOM   4756  O O      . ASP B  1 275 ? -56.306  -46.597 74.798  1.00 57.10  ? 268 ASP B O      1 
ATOM   4757  C CB     . ASP B  1 275 ? -55.351  -43.947 75.626  1.00 62.51  ? 268 ASP B CB     1 
ATOM   4758  C CG     . ASP B  1 275 ? -54.136  -43.041 75.660  1.00 64.04  ? 268 ASP B CG     1 
ATOM   4759  O OD1    . ASP B  1 275 ? -53.209  -43.269 74.858  1.00 64.47  ? 268 ASP B OD1    1 
ATOM   4760  O OD2    . ASP B  1 275 ? -54.096  -42.117 76.502  1.00 65.12  ? 268 ASP B OD2    1 
ATOM   4761  N N      . LEU B  1 276 ? -57.941  -45.412 73.806  1.00 50.53  ? 269 LEU B N      1 
ATOM   4762  C CA     . LEU B  1 276 ? -58.866  -46.539 73.795  1.00 51.41  ? 269 LEU B CA     1 
ATOM   4763  C C      . LEU B  1 276 ? -58.793  -47.365 72.520  1.00 51.05  ? 269 LEU B C      1 
ATOM   4764  O O      . LEU B  1 276 ? -59.197  -48.535 72.533  1.00 54.32  ? 269 LEU B O      1 
ATOM   4765  C CB     . LEU B  1 276 ? -60.311  -46.052 73.967  1.00 51.00  ? 269 LEU B CB     1 
ATOM   4766  C CG     . LEU B  1 276 ? -60.762  -45.400 75.273  1.00 50.68  ? 269 LEU B CG     1 
ATOM   4767  C CD1    . LEU B  1 276 ? -62.233  -45.010 75.187  1.00 49.83  ? 269 LEU B CD1    1 
ATOM   4768  C CD2    . LEU B  1 276 ? -60.521  -46.336 76.451  1.00 58.36  ? 269 LEU B CD2    1 
ATOM   4769  N N      . VAL B  1 277 ? -58.280  -46.793 71.433  1.00 48.02  ? 270 VAL B N      1 
ATOM   4770  C CA     . VAL B  1 277 ? -58.237  -47.464 70.143  1.00 44.83  ? 270 VAL B CA     1 
ATOM   4771  C C      . VAL B  1 277 ? -56.801  -47.517 69.634  1.00 46.77  ? 270 VAL B C      1 
ATOM   4772  O O      . VAL B  1 277 ? -55.910  -46.821 70.122  1.00 49.24  ? 270 VAL B O      1 
ATOM   4773  C CB     . VAL B  1 277 ? -59.152  -46.784 69.109  1.00 40.77  ? 270 VAL B CB     1 
ATOM   4774  C CG1    . VAL B  1 277 ? -60.554  -46.621 69.682  1.00 40.84  ? 270 VAL B CG1    1 
ATOM   4775  C CG2    . VAL B  1 277 ? -58.569  -45.444 68.685  1.00 39.61  ? 270 VAL B CG2    1 
ATOM   4776  N N      . SER B  1 278 ? -56.595  -48.369 68.635  1.00 44.85  ? 271 SER B N      1 
ATOM   4777  C CA     . SER B  1 278 ? -55.312  -48.475 67.963  1.00 45.70  ? 271 SER B CA     1 
ATOM   4778  C C      . SER B  1 278 ? -55.100  -47.285 67.028  1.00 45.38  ? 271 SER B C      1 
ATOM   4779  O O      . SER B  1 278 ? -56.046  -46.607 66.617  1.00 42.32  ? 271 SER B O      1 
ATOM   4780  C CB     . SER B  1 278 ? -55.231  -49.783 67.177  1.00 46.70  ? 271 SER B CB     1 
ATOM   4781  O OG     . SER B  1 278 ? -56.150  -49.783 66.101  1.00 45.48  ? 271 SER B OG     1 
ATOM   4782  N N      . LYS B  1 279 ? -53.833  -47.032 66.690  1.00 47.02  ? 272 LYS B N      1 
ATOM   4783  C CA     . LYS B  1 279 ? -53.520  -45.928 65.786  1.00 48.52  ? 272 LYS B CA     1 
ATOM   4784  C C      . LYS B  1 279 ? -54.241  -46.090 64.452  1.00 48.87  ? 272 LYS B C      1 
ATOM   4785  O O      . LYS B  1 279 ? -54.857  -45.144 63.947  1.00 46.34  ? 272 LYS B O      1 
ATOM   4786  C CB     . LYS B  1 279 ? -52.010  -45.821 65.573  1.00 53.73  ? 272 LYS B CB     1 
ATOM   4787  C CG     . LYS B  1 279 ? -51.244  -45.303 66.777  1.00 58.20  ? 272 LYS B CG     1 
ATOM   4788  C CD     . LYS B  1 279 ? -49.797  -45.019 66.423  1.00 61.94  ? 272 LYS B CD     1 
ATOM   4789  C CE     . LYS B  1 279 ? -49.029  -44.537 67.640  1.00 68.04  ? 272 LYS B CE     1 
ATOM   4790  N NZ     . LYS B  1 279 ? -47.583  -44.359 67.347  1.00 70.28  ? 272 LYS B NZ     1 
ATOM   4791  N N      . GLU B  1 280 ? -54.175  -47.287 63.865  1.00 50.85  ? 273 GLU B N      1 
ATOM   4792  C CA     . GLU B  1 280 ? -54.880  -47.535 62.611  1.00 47.96  ? 273 GLU B CA     1 
ATOM   4793  C C      . GLU B  1 280 ? -56.383  -47.367 62.794  1.00 41.80  ? 273 GLU B C      1 
ATOM   4794  O O      . GLU B  1 280 ? -57.054  -46.738 61.968  1.00 37.33  ? 273 GLU B O      1 
ATOM   4795  C CB     . GLU B  1 280 ? -54.549  -48.937 62.094  1.00 54.00  ? 273 GLU B CB     1 
ATOM   4796  C CG     . GLU B  1 280 ? -55.229  -49.309 60.783  1.00 58.32  ? 273 GLU B CG     1 
ATOM   4797  C CD     . GLU B  1 280 ? -54.712  -50.620 60.212  1.00 64.57  ? 273 GLU B CD     1 
ATOM   4798  O OE1    . GLU B  1 280 ? -53.493  -50.873 60.317  1.00 67.46  ? 273 GLU B OE1    1 
ATOM   4799  O OE2    . GLU B  1 280 ? -55.523  -51.399 59.663  1.00 65.00  ? 273 GLU B OE2    1 
ATOM   4800  N N      . GLY B  1 281 ? -56.933  -47.933 63.869  1.00 44.23  ? 274 GLY B N      1 
ATOM   4801  C CA     . GLY B  1 281 ? -58.344  -47.729 64.155  1.00 42.96  ? 274 GLY B CA     1 
ATOM   4802  C C      . GLY B  1 281 ? -58.699  -46.263 64.316  1.00 44.17  ? 274 GLY B C      1 
ATOM   4803  O O      . GLY B  1 281 ? -59.784  -45.829 63.920  1.00 46.28  ? 274 GLY B O      1 
ATOM   4804  N N      . PHE B  1 282 ? -57.792  -45.481 64.906  1.00 43.42  ? 275 PHE B N      1 
ATOM   4805  C CA     . PHE B  1 282 ? -58.057  -44.060 65.101  1.00 39.10  ? 275 PHE B CA     1 
ATOM   4806  C C      . PHE B  1 282 ? -58.128  -43.309 63.777  1.00 34.27  ? 275 PHE B C      1 
ATOM   4807  O O      . PHE B  1 282 ? -59.020  -42.475 63.581  1.00 31.35  ? 275 PHE B O      1 
ATOM   4808  C CB     . PHE B  1 282 ? -56.984  -43.443 65.998  1.00 40.63  ? 275 PHE B CB     1 
ATOM   4809  C CG     . PHE B  1 282 ? -57.100  -41.950 66.143  1.00 39.42  ? 275 PHE B CG     1 
ATOM   4810  C CD1    . PHE B  1 282 ? -57.897  -41.398 67.131  1.00 42.29  ? 275 PHE B CD1    1 
ATOM   4811  C CD2    . PHE B  1 282 ? -56.409  -41.097 65.294  1.00 38.56  ? 275 PHE B CD2    1 
ATOM   4812  C CE1    . PHE B  1 282 ? -58.005  -40.026 67.270  1.00 42.84  ? 275 PHE B CE1    1 
ATOM   4813  C CE2    . PHE B  1 282 ? -56.518  -39.725 65.425  1.00 34.85  ? 275 PHE B CE2    1 
ATOM   4814  C CZ     . PHE B  1 282 ? -57.316  -39.189 66.415  1.00 40.34  ? 275 PHE B CZ     1 
ATOM   4815  N N      . ARG B  1 283 ? -57.199  -43.581 62.857  1.00 38.20  ? 276 ARG B N      1 
ATOM   4816  C CA     . ARG B  1 283 ? -57.211  -42.869 61.582  1.00 41.75  ? 276 ARG B CA     1 
ATOM   4817  C C      . ARG B  1 283 ? -58.462  -43.198 60.781  1.00 35.74  ? 276 ARG B C      1 
ATOM   4818  O O      . ARG B  1 283 ? -59.047  -42.316 60.139  1.00 27.89  ? 276 ARG B O      1 
ATOM   4819  C CB     . ARG B  1 283 ? -55.961  -43.200 60.771  1.00 50.85  ? 276 ARG B CB     1 
ATOM   4820  C CG     . ARG B  1 283 ? -54.669  -42.710 61.401  1.00 61.19  ? 276 ARG B CG     1 
ATOM   4821  C CD     . ARG B  1 283 ? -53.499  -42.863 60.445  1.00 69.08  ? 276 ARG B CD     1 
ATOM   4822  N NE     . ARG B  1 283 ? -52.956  -44.215 60.450  1.00 76.99  ? 276 ARG B NE     1 
ATOM   4823  C CZ     . ARG B  1 283 ? -53.093  -45.070 59.440  1.00 79.13  ? 276 ARG B CZ     1 
ATOM   4824  N NH1    . ARG B  1 283 ? -53.757  -44.710 58.344  1.00 76.18  ? 276 ARG B NH1    1 
ATOM   4825  N NH2    . ARG B  1 283 ? -52.567  -46.285 59.526  1.00 81.11  ? 276 ARG B NH2    1 
ATOM   4826  N N      . ARG B  1 284 ? -58.881  -44.465 60.801  1.00 37.76  ? 277 ARG B N      1 
ATOM   4827  C CA     . ARG B  1 284 ? -60.116  -44.849 60.128  1.00 36.03  ? 277 ARG B CA     1 
ATOM   4828  C C      . ARG B  1 284 ? -61.284  -44.018 60.639  1.00 35.71  ? 277 ARG B C      1 
ATOM   4829  O O      . ARG B  1 284 ? -62.041  -43.434 59.855  1.00 33.64  ? 277 ARG B O      1 
ATOM   4830  C CB     . ARG B  1 284 ? -60.399  -46.339 60.339  1.00 32.75  ? 277 ARG B CB     1 
ATOM   4831  C CG     . ARG B  1 284 ? -59.370  -47.327 59.783  1.00 31.46  ? 277 ARG B CG     1 
ATOM   4832  C CD     . ARG B  1 284 ? -59.003  -47.101 58.321  1.00 33.88  ? 277 ARG B CD     1 
ATOM   4833  N NE     . ARG B  1 284 ? -57.982  -48.055 57.884  1.00 39.78  ? 277 ARG B NE     1 
ATOM   4834  C CZ     . ARG B  1 284 ? -56.685  -47.785 57.773  1.00 43.41  ? 277 ARG B CZ     1 
ATOM   4835  N NH1    . ARG B  1 284 ? -56.222  -46.576 58.059  1.00 44.76  ? 277 ARG B NH1    1 
ATOM   4836  N NH2    . ARG B  1 284 ? -55.845  -48.729 57.372  1.00 45.71  ? 277 ARG B NH2    1 
ATOM   4837  N N      . ALA B  1 285 ? -61.442  -43.955 61.965  1.00 36.12  ? 278 ALA B N      1 
ATOM   4838  C CA     . ALA B  1 285 ? -62.558  -43.222 62.551  1.00 34.61  ? 278 ALA B CA     1 
ATOM   4839  C C      . ALA B  1 285 ? -62.469  -41.730 62.265  1.00 34.53  ? 278 ALA B C      1 
ATOM   4840  O O      . ALA B  1 285 ? -63.502  -41.063 62.131  1.00 36.15  ? 278 ALA B O      1 
ATOM   4841  C CB     . ALA B  1 285 ? -62.618  -43.475 64.057  1.00 34.07  ? 278 ALA B CB     1 
ATOM   4842  N N      . ARG B  1 286 ? -61.255  -41.182 62.181  1.00 36.08  ? 279 ARG B N      1 
ATOM   4843  C CA     . ARG B  1 286 ? -61.124  -39.756 61.903  1.00 37.35  ? 279 ARG B CA     1 
ATOM   4844  C C      . ARG B  1 286 ? -61.695  -39.407 60.534  1.00 35.24  ? 279 ARG B C      1 
ATOM   4845  O O      . ARG B  1 286 ? -62.311  -38.349 60.363  1.00 31.44  ? 279 ARG B O      1 
ATOM   4846  C CB     . ARG B  1 286 ? -59.663  -39.318 62.008  1.00 35.12  ? 279 ARG B CB     1 
ATOM   4847  C CG     . ARG B  1 286 ? -59.469  -37.826 61.763  1.00 33.75  ? 279 ARG B CG     1 
ATOM   4848  C CD     . ARG B  1 286 ? -58.115  -37.341 62.242  1.00 33.73  ? 279 ARG B CD     1 
ATOM   4849  N NE     . ARG B  1 286 ? -57.008  -38.000 61.557  1.00 36.86  ? 279 ARG B NE     1 
ATOM   4850  C CZ     . ARG B  1 286 ? -55.734  -37.890 61.923  1.00 40.52  ? 279 ARG B CZ     1 
ATOM   4851  N NH1    . ARG B  1 286 ? -55.402  -37.147 62.971  1.00 41.35  ? 279 ARG B NH1    1 
ATOM   4852  N NH2    . ARG B  1 286 ? -54.791  -38.525 61.241  1.00 40.04  ? 279 ARG B NH2    1 
ATOM   4853  N N      . HIS B  1 287 ? -61.496  -40.277 59.540  1.00 40.79  ? 280 HIS B N      1 
ATOM   4854  C CA     . HIS B  1 287 ? -62.095  -40.031 58.232  1.00 35.52  ? 280 HIS B CA     1 
ATOM   4855  C C      . HIS B  1 287 ? -63.615  -40.034 58.312  1.00 32.90  ? 280 HIS B C      1 
ATOM   4856  O O      . HIS B  1 287 ? -64.276  -39.097 57.850  1.00 34.32  ? 280 HIS B O      1 
ATOM   4857  C CB     . HIS B  1 287 ? -61.641  -41.073 57.216  1.00 39.35  ? 280 HIS B CB     1 
ATOM   4858  C CG     . HIS B  1 287 ? -62.537  -41.154 56.018  1.00 44.28  ? 280 HIS B CG     1 
ATOM   4859  N ND1    . HIS B  1 287 ? -62.501  -40.230 54.996  1.00 45.23  ? 280 HIS B ND1    1 
ATOM   4860  C CD2    . HIS B  1 287 ? -63.523  -42.026 55.701  1.00 43.89  ? 280 HIS B CD2    1 
ATOM   4861  C CE1    . HIS B  1 287 ? -63.413  -40.539 54.092  1.00 43.84  ? 280 HIS B CE1    1 
ATOM   4862  N NE2    . HIS B  1 287 ? -64.046  -41.626 54.495  1.00 45.33  ? 280 HIS B NE2    1 
ATOM   4863  N N      . VAL B  1 288 ? -64.187  -41.100 58.875  1.00 30.39  ? 281 VAL B N      1 
ATOM   4864  C CA     . VAL B  1 288 ? -65.641  -41.243 58.907  1.00 31.18  ? 281 VAL B CA     1 
ATOM   4865  C C      . VAL B  1 288 ? -66.274  -40.018 59.551  1.00 35.45  ? 281 VAL B C      1 
ATOM   4866  O O      . VAL B  1 288 ? -67.146  -39.364 58.969  1.00 39.31  ? 281 VAL B O      1 
ATOM   4867  C CB     . VAL B  1 288 ? -66.043  -42.534 59.641  1.00 30.38  ? 281 VAL B CB     1 
ATOM   4868  C CG1    . VAL B  1 288 ? -67.555  -42.620 59.786  1.00 24.74  ? 281 VAL B CG1    1 
ATOM   4869  C CG2    . VAL B  1 288 ? -65.505  -43.753 58.909  1.00 24.48  ? 281 VAL B CG2    1 
ATOM   4870  N N      . VAL B  1 289 ? -65.843  -39.695 60.770  1.00 37.48  ? 282 VAL B N      1 
ATOM   4871  C CA     . VAL B  1 289 ? -66.421  -38.557 61.477  1.00 36.50  ? 282 VAL B CA     1 
ATOM   4872  C C      . VAL B  1 289 ? -66.259  -37.284 60.658  1.00 34.05  ? 282 VAL B C      1 
ATOM   4873  O O      . VAL B  1 289 ? -67.162  -36.441 60.609  1.00 39.62  ? 282 VAL B O      1 
ATOM   4874  C CB     . VAL B  1 289 ? -65.794  -38.418 62.876  1.00 38.22  ? 282 VAL B CB     1 
ATOM   4875  C CG1    . VAL B  1 289 ? -66.264  -37.131 63.535  1.00 38.04  ? 282 VAL B CG1    1 
ATOM   4876  C CG2    . VAL B  1 289 ? -66.141  -39.630 63.730  1.00 36.09  ? 282 VAL B CG2    1 
ATOM   4877  N N      . GLY B  1 290 ? -65.110  -37.125 59.996  1.00 31.88  ? 283 GLY B N      1 
ATOM   4878  C CA     . GLY B  1 290 ? -64.894  -35.938 59.188  1.00 33.84  ? 283 GLY B CA     1 
ATOM   4879  C C      . GLY B  1 290 ? -65.636  -35.950 57.869  1.00 36.11  ? 283 GLY B C      1 
ATOM   4880  O O      . GLY B  1 290 ? -66.048  -34.893 57.380  1.00 35.30  ? 283 GLY B O      1 
ATOM   4881  N N      . GLU B  1 291 ? -65.818  -37.131 57.275  1.00 35.36  ? 284 GLU B N      1 
ATOM   4882  C CA     . GLU B  1 291 ? -66.584  -37.219 56.036  1.00 32.50  ? 284 GLU B CA     1 
ATOM   4883  C C      . GLU B  1 291 ? -68.054  -36.900 56.287  1.00 36.51  ? 284 GLU B C      1 
ATOM   4884  O O      . GLU B  1 291 ? -68.694  -36.213 55.481  1.00 39.63  ? 284 GLU B O      1 
ATOM   4885  C CB     . GLU B  1 291 ? -66.414  -38.609 55.418  1.00 30.60  ? 284 GLU B CB     1 
ATOM   4886  C CG     . GLU B  1 291 ? -67.025  -38.773 54.033  1.00 33.74  ? 284 GLU B CG     1 
ATOM   4887  C CD     . GLU B  1 291 ? -66.186  -38.116 52.943  1.00 34.06  ? 284 GLU B CD     1 
ATOM   4888  O OE1    . GLU B  1 291 ? -65.234  -37.380 53.287  1.00 34.68  ? 284 GLU B OE1    1 
ATOM   4889  O OE2    . GLU B  1 291 ? -66.483  -38.332 51.746  1.00 27.43  ? 284 GLU B OE2    1 
ATOM   4890  N N      . ILE B  1 292 ? -68.603  -37.389 57.404  1.00 37.90  ? 285 ILE B N      1 
ATOM   4891  C CA     . ILE B  1 292 ? -69.982  -37.075 57.772  1.00 36.18  ? 285 ILE B CA     1 
ATOM   4892  C C      . ILE B  1 292 ? -70.171  -35.568 57.892  1.00 38.60  ? 285 ILE B C      1 
ATOM   4893  O O      . ILE B  1 292 ? -71.156  -35.009 57.395  1.00 39.36  ? 285 ILE B O      1 
ATOM   4894  C CB     . ILE B  1 292 ? -70.359  -37.797 59.080  1.00 32.78  ? 285 ILE B CB     1 
ATOM   4895  C CG1    . ILE B  1 292 ? -70.361  -39.313 58.874  1.00 27.59  ? 285 ILE B CG1    1 
ATOM   4896  C CG2    . ILE B  1 292 ? -71.704  -37.311 59.596  1.00 25.27  ? 285 ILE B CG2    1 
ATOM   4897  C CD1    . ILE B  1 292 ? -70.700  -40.095 60.127  1.00 25.18  ? 285 ILE B CD1    1 
ATOM   4898  N N      . ARG B  1 293 ? -69.234  -34.885 58.558  1.00 40.97  ? 286 ARG B N      1 
ATOM   4899  C CA     . ARG B  1 293 ? -69.318  -33.430 58.666  1.00 38.38  ? 286 ARG B CA     1 
ATOM   4900  C C      . ARG B  1 293 ? -69.157  -32.761 57.305  1.00 37.14  ? 286 ARG B C      1 
ATOM   4901  O O      . ARG B  1 293 ? -69.888  -31.818 56.980  1.00 40.93  ? 286 ARG B O      1 
ATOM   4902  C CB     . ARG B  1 293 ? -68.265  -32.912 59.648  1.00 47.21  ? 286 ARG B CB     1 
ATOM   4903  C CG     . ARG B  1 293 ? -68.724  -32.869 61.101  1.00 55.47  ? 286 ARG B CG     1 
ATOM   4904  C CD     . ARG B  1 293 ? -68.774  -31.439 61.617  1.00 62.41  ? 286 ARG B CD     1 
ATOM   4905  N NE     . ARG B  1 293 ? -67.489  -30.767 61.445  1.00 67.73  ? 286 ARG B NE     1 
ATOM   4906  C CZ     . ARG B  1 293 ? -66.551  -30.683 62.384  1.00 72.17  ? 286 ARG B CZ     1 
ATOM   4907  N NH1    . ARG B  1 293 ? -66.751  -31.223 63.580  1.00 73.75  ? 286 ARG B NH1    1 
ATOM   4908  N NH2    . ARG B  1 293 ? -65.410  -30.054 62.126  1.00 71.63  ? 286 ARG B NH2    1 
ATOM   4909  N N      . ARG B  1 294 ? -68.205  -33.233 56.496  1.00 33.64  ? 287 ARG B N      1 
ATOM   4910  C CA     . ARG B  1 294 ? -68.008  -32.656 55.170  1.00 34.06  ? 287 ARG B CA     1 
ATOM   4911  C C      . ARG B  1 294 ? -69.255  -32.809 54.306  1.00 33.21  ? 287 ARG B C      1 
ATOM   4912  O O      . ARG B  1 294 ? -69.637  -31.881 53.585  1.00 32.47  ? 287 ARG B O      1 
ATOM   4913  C CB     . ARG B  1 294 ? -66.806  -33.309 54.487  1.00 33.17  ? 287 ARG B CB     1 
ATOM   4914  C CG     . ARG B  1 294 ? -65.455  -32.744 54.899  1.00 35.88  ? 287 ARG B CG     1 
ATOM   4915  C CD     . ARG B  1 294 ? -64.338  -33.310 54.040  1.00 39.29  ? 287 ARG B CD     1 
ATOM   4916  N NE     . ARG B  1 294 ? -64.195  -34.749 54.243  1.00 43.07  ? 287 ARG B NE     1 
ATOM   4917  C CZ     . ARG B  1 294 ? -63.430  -35.298 55.183  1.00 45.73  ? 287 ARG B CZ     1 
ATOM   4918  N NH1    . ARG B  1 294 ? -62.734  -34.525 56.007  1.00 47.37  ? 287 ARG B NH1    1 
ATOM   4919  N NH2    . ARG B  1 294 ? -63.362  -36.618 55.301  1.00 44.14  ? 287 ARG B NH2    1 
ATOM   4920  N N      . THR B  1 295 ? -69.904  -33.974 54.372  1.00 31.34  ? 288 THR B N      1 
ATOM   4921  C CA     . THR B  1 295 ? -71.092  -34.213 53.557  1.00 31.89  ? 288 THR B CA     1 
ATOM   4922  C C      . THR B  1 295 ? -72.209  -33.241 53.913  1.00 36.04  ? 288 THR B C      1 
ATOM   4923  O O      . THR B  1 295 ? -72.807  -32.613 53.031  1.00 33.37  ? 288 THR B O      1 
ATOM   4924  C CB     . THR B  1 295 ? -71.561  -35.657 53.725  1.00 31.02  ? 288 THR B CB     1 
ATOM   4925  O OG1    . THR B  1 295 ? -70.500  -36.549 53.364  1.00 30.21  ? 288 THR B OG1    1 
ATOM   4926  C CG2    . THR B  1 295 ? -72.768  -35.922 52.837  1.00 28.78  ? 288 THR B CG2    1 
ATOM   4927  N N      . ALA B  1 296 ? -72.504  -33.097 55.207  1.00 37.66  ? 289 ALA B N      1 
ATOM   4928  C CA     . ALA B  1 296 ? -73.515  -32.131 55.618  1.00 39.62  ? 289 ALA B CA     1 
ATOM   4929  C C      . ALA B  1 296 ? -73.135  -30.731 55.158  1.00 46.23  ? 289 ALA B C      1 
ATOM   4930  O O      . ALA B  1 296 ? -74.000  -29.930 54.780  1.00 48.40  ? 289 ALA B O      1 
ATOM   4931  C CB     . ALA B  1 296 ? -73.699  -32.172 57.135  1.00 36.42  ? 289 ALA B CB     1 
ATOM   4932  N N      . GLN B  1 297 ? -71.839  -30.418 55.189  1.00 47.92  ? 290 GLN B N      1 
ATOM   4933  C CA     . GLN B  1 297 ? -71.368  -29.115 54.736  1.00 45.06  ? 290 GLN B CA     1 
ATOM   4934  C C      . GLN B  1 297 ? -71.491  -28.979 53.222  1.00 43.88  ? 290 GLN B C      1 
ATOM   4935  O O      . GLN B  1 297 ? -71.835  -27.905 52.715  1.00 48.11  ? 290 GLN B O      1 
ATOM   4936  C CB     . GLN B  1 297 ? -69.920  -28.913 55.178  1.00 44.02  ? 290 GLN B CB     1 
ATOM   4937  C CG     . GLN B  1 297 ? -69.756  -28.437 56.611  1.00 47.75  ? 290 GLN B CG     1 
ATOM   4938  C CD     . GLN B  1 297 ? -68.323  -28.568 57.103  1.00 48.64  ? 290 GLN B CD     1 
ATOM   4939  O OE1    . GLN B  1 297 ? -67.451  -29.058 56.383  1.00 47.36  ? 290 GLN B OE1    1 
ATOM   4940  N NE2    . GLN B  1 297 ? -68.077  -28.145 58.339  1.00 49.06  ? 290 GLN B NE2    1 
ATOM   4941  N N      . ALA B  1 298 ? -71.223  -30.061 52.484  1.00 35.26  ? 291 ALA B N      1 
ATOM   4942  C CA     . ALA B  1 298 ? -71.268  -29.994 51.026  1.00 41.28  ? 291 ALA B CA     1 
ATOM   4943  C C      . ALA B  1 298 ? -72.694  -29.815 50.518  1.00 42.11  ? 291 ALA B C      1 
ATOM   4944  O O      . ALA B  1 298 ? -72.924  -29.095 49.540  1.00 40.07  ? 291 ALA B O      1 
ATOM   4945  C CB     . ALA B  1 298 ? -70.635  -31.250 50.425  1.00 40.78  ? 291 ALA B CB     1 
ATOM   4946  N N      . ALA B  1 299 ? -73.665  -30.461 51.166  1.00 38.24  ? 292 ALA B N      1 
ATOM   4947  C CA     . ALA B  1 299 ? -75.059  -30.256 50.790  1.00 36.05  ? 292 ALA B CA     1 
ATOM   4948  C C      . ALA B  1 299 ? -75.461  -28.795 50.951  1.00 37.46  ? 292 ALA B C      1 
ATOM   4949  O O      . ALA B  1 299 ? -76.163  -28.240 50.098  1.00 41.83  ? 292 ALA B O      1 
ATOM   4950  C CB     . ALA B  1 299 ? -75.969  -31.165 51.617  1.00 34.84  ? 292 ALA B CB     1 
ATOM   4951  N N      . ALA B  1 300 ? -75.025  -28.156 52.040  1.00 41.09  ? 293 ALA B N      1 
ATOM   4952  C CA     . ALA B  1 300 ? -75.350  -26.748 52.256  1.00 43.05  ? 293 ALA B CA     1 
ATOM   4953  C C      . ALA B  1 300 ? -74.751  -25.865 51.167  1.00 42.44  ? 293 ALA B C      1 
ATOM   4954  O O      . ALA B  1 300 ? -75.416  -24.950 50.665  1.00 40.70  ? 293 ALA B O      1 
ATOM   4955  C CB     . ALA B  1 300 ? -74.864  -26.307 53.637  1.00 41.07  ? 293 ALA B CB     1 
ATOM   4956  N N      . ALA B  1 301 ? -73.498  -26.124 50.784  1.00 41.81  ? 294 ALA B N      1 
ATOM   4957  C CA     . ALA B  1 301 ? -72.887  -25.359 49.701  1.00 43.49  ? 294 ALA B CA     1 
ATOM   4958  C C      . ALA B  1 301 ? -73.682  -25.510 48.413  1.00 41.98  ? 294 ALA B C      1 
ATOM   4959  O O      . ALA B  1 301 ? -73.821  -24.554 47.641  1.00 46.19  ? 294 ALA B O      1 
ATOM   4960  C CB     . ALA B  1 301 ? -71.438  -25.799 49.490  1.00 40.68  ? 294 ALA B CB     1 
ATOM   4961  N N      . LEU B  1 302 ? -74.207  -26.709 48.164  1.00 40.92  ? 295 LEU B N      1 
ATOM   4962  C CA     . LEU B  1 302 ? -74.941  -26.959 46.930  1.00 41.02  ? 295 LEU B CA     1 
ATOM   4963  C C      . LEU B  1 302 ? -76.249  -26.181 46.895  1.00 43.94  ? 295 LEU B C      1 
ATOM   4964  O O      . LEU B  1 302 ? -76.633  -25.647 45.848  1.00 45.40  ? 295 LEU B O      1 
ATOM   4965  C CB     . LEU B  1 302 ? -75.209  -28.456 46.783  1.00 39.19  ? 295 LEU B CB     1 
ATOM   4966  C CG     . LEU B  1 302 ? -75.658  -28.966 45.415  1.00 40.18  ? 295 LEU B CG     1 
ATOM   4967  C CD1    . LEU B  1 302 ? -74.544  -28.831 44.391  1.00 41.47  ? 295 LEU B CD1    1 
ATOM   4968  C CD2    . LEU B  1 302 ? -76.113  -30.409 45.526  1.00 39.49  ? 295 LEU B CD2    1 
ATOM   4969  N N      . ARG B  1 303 ? -76.942  -26.100 48.032  1.00 44.42  ? 296 ARG B N      1 
ATOM   4970  C CA     . ARG B  1 303 ? -78.227  -25.409 48.063  1.00 45.31  ? 296 ARG B CA     1 
ATOM   4971  C C      . ARG B  1 303 ? -78.076  -23.942 47.680  1.00 53.11  ? 296 ARG B C      1 
ATOM   4972  O O      . ARG B  1 303 ? -78.958  -23.370 47.029  1.00 60.81  ? 296 ARG B O      1 
ATOM   4973  C CB     . ARG B  1 303 ? -78.861  -25.552 49.446  1.00 43.55  ? 296 ARG B CB     1 
ATOM   4974  C CG     . ARG B  1 303 ? -79.132  -26.996 49.840  1.00 41.29  ? 296 ARG B CG     1 
ATOM   4975  C CD     . ARG B  1 303 ? -79.879  -27.087 51.159  1.00 42.86  ? 296 ARG B CD     1 
ATOM   4976  N NE     . ARG B  1 303 ? -80.438  -28.419 51.380  1.00 46.41  ? 296 ARG B NE     1 
ATOM   4977  C CZ     . ARG B  1 303 ? -80.000  -29.278 52.296  1.00 47.74  ? 296 ARG B CZ     1 
ATOM   4978  N NH1    . ARG B  1 303 ? -78.994  -28.943 53.093  1.00 48.41  ? 296 ARG B NH1    1 
ATOM   4979  N NH2    . ARG B  1 303 ? -80.576  -30.468 52.421  1.00 47.37  ? 296 ARG B NH2    1 
ATOM   4980  N N      . ARG B  1 304 ? -76.966  -23.319 48.067  1.00 50.40  ? 297 ARG B N      1 
ATOM   4981  C CA     . ARG B  1 304 ? -76.707  -21.928 47.724  1.00 54.90  ? 297 ARG B CA     1 
ATOM   4982  C C      . ARG B  1 304 ? -75.846  -21.778 46.474  1.00 56.37  ? 297 ARG B C      1 
ATOM   4983  O O      . ARG B  1 304 ? -75.511  -20.648 46.103  1.00 60.21  ? 297 ARG B O      1 
ATOM   4984  C CB     . ARG B  1 304 ? -76.043  -21.207 48.904  1.00 56.25  ? 297 ARG B CB     1 
ATOM   4985  C CG     . ARG B  1 304 ? -74.639  -21.690 49.224  1.00 53.89  ? 297 ARG B CG     1 
ATOM   4986  C CD     . ARG B  1 304 ? -74.028  -20.889 50.363  1.00 56.52  ? 297 ARG B CD     1 
ATOM   4987  N NE     . ARG B  1 304 ? -72.762  -21.456 50.816  1.00 55.10  ? 297 ARG B NE     1 
ATOM   4988  C CZ     . ARG B  1 304 ? -72.634  -22.251 51.874  1.00 54.79  ? 297 ARG B CZ     1 
ATOM   4989  N NH1    . ARG B  1 304 ? -73.697  -22.568 52.602  1.00 54.64  ? 297 ARG B NH1    1 
ATOM   4990  N NH2    . ARG B  1 304 ? -71.440  -22.723 52.207  1.00 54.96  ? 297 ARG B NH2    1 
ATOM   4991  N N      . GLY B  1 305 ? -75.484  -22.881 45.820  1.00 52.38  ? 298 GLY B N      1 
ATOM   4992  C CA     . GLY B  1 305 ? -74.713  -22.809 44.595  1.00 52.45  ? 298 GLY B CA     1 
ATOM   4993  C C      . GLY B  1 305 ? -73.243  -22.514 44.775  1.00 53.73  ? 298 GLY B C      1 
ATOM   4994  O O      . GLY B  1 305 ? -72.593  -22.068 43.825  1.00 54.93  ? 298 GLY B O      1 
ATOM   4995  N N      . ASP B  1 306 ? -72.693  -22.747 45.969  1.00 49.26  ? 299 ASP B N      1 
ATOM   4996  C CA     . ASP B  1 306 ? -71.282  -22.472 46.251  1.00 45.06  ? 299 ASP B CA     1 
ATOM   4997  C C      . ASP B  1 306 ? -70.436  -23.638 45.739  1.00 42.21  ? 299 ASP B C      1 
ATOM   4998  O O      . ASP B  1 306 ? -69.972  -24.500 46.490  1.00 42.01  ? 299 ASP B O      1 
ATOM   4999  C CB     . ASP B  1 306 ? -71.073  -22.231 47.742  1.00 45.16  ? 299 ASP B CB     1 
ATOM   5000  C CG     . ASP B  1 306 ? -69.713  -21.630 48.053  1.00 45.93  ? 299 ASP B CG     1 
ATOM   5001  O OD1    . ASP B  1 306 ? -68.824  -21.677 47.178  1.00 45.84  ? 299 ASP B OD1    1 
ATOM   5002  O OD2    . ASP B  1 306 ? -69.533  -21.112 49.176  1.00 49.26  ? 299 ASP B OD2    1 
ATOM   5003  N N      . TYR B  1 307 ? -70.230  -23.653 44.419  1.00 41.27  ? 300 TYR B N      1 
ATOM   5004  C CA     . TYR B  1 307 ? -69.490  -24.747 43.795  1.00 35.88  ? 300 TYR B CA     1 
ATOM   5005  C C      . TYR B  1 307 ? -68.025  -24.740 44.214  1.00 37.71  ? 300 TYR B C      1 
ATOM   5006  O O      . TYR B  1 307 ? -67.425  -25.805 44.407  1.00 35.15  ? 300 TYR B O      1 
ATOM   5007  C CB     . TYR B  1 307 ? -69.624  -24.663 42.275  1.00 35.78  ? 300 TYR B CB     1 
ATOM   5008  C CG     . TYR B  1 307 ? -71.055  -24.723 41.798  1.00 41.56  ? 300 TYR B CG     1 
ATOM   5009  C CD1    . TYR B  1 307 ? -72.003  -25.462 42.492  1.00 42.91  ? 300 TYR B CD1    1 
ATOM   5010  C CD2    . TYR B  1 307 ? -71.462  -24.029 40.664  1.00 46.91  ? 300 TYR B CD2    1 
ATOM   5011  C CE1    . TYR B  1 307 ? -73.310  -25.520 42.069  1.00 47.12  ? 300 TYR B CE1    1 
ATOM   5012  C CE2    . TYR B  1 307 ? -72.771  -24.079 40.231  1.00 49.62  ? 300 TYR B CE2    1 
ATOM   5013  C CZ     . TYR B  1 307 ? -73.692  -24.827 40.938  1.00 51.03  ? 300 TYR B CZ     1 
ATOM   5014  O OH     . TYR B  1 307 ? -74.999  -24.887 40.515  1.00 49.73  ? 300 TYR B OH     1 
ATOM   5015  N N      . ARG B  1 308 ? -67.431  -23.553 44.355  1.00 41.62  ? 301 ARG B N      1 
ATOM   5016  C CA     . ARG B  1 308 ? -66.048  -23.471 44.817  1.00 44.68  ? 301 ARG B CA     1 
ATOM   5017  C C      . ARG B  1 308 ? -65.888  -24.129 46.180  1.00 45.36  ? 301 ARG B C      1 
ATOM   5018  O O      . ARG B  1 308 ? -64.930  -24.876 46.411  1.00 43.25  ? 301 ARG B O      1 
ATOM   5019  C CB     . ARG B  1 308 ? -65.598  -22.011 44.871  1.00 50.19  ? 301 ARG B CB     1 
ATOM   5020  N N      . ALA B  1 309 ? -66.820  -23.862 47.095  1.00 47.10  ? 302 ALA B N      1 
ATOM   5021  C CA     . ALA B  1 309 ? -66.769  -24.489 48.410  1.00 50.37  ? 302 ALA B CA     1 
ATOM   5022  C C      . ALA B  1 309 ? -67.051  -25.982 48.318  1.00 44.77  ? 302 ALA B C      1 
ATOM   5023  O O      . ALA B  1 309 ? -66.388  -26.787 48.983  1.00 45.47  ? 302 ALA B O      1 
ATOM   5024  C CB     . ALA B  1 309 ? -67.760  -23.808 49.352  1.00 30.45  ? 302 ALA B CB     1 
ATOM   5025  N N      . PHE B  1 310 ? -68.032  -26.373 47.503  1.00 39.74  ? 303 PHE B N      1 
ATOM   5026  C CA     . PHE B  1 310 ? -68.320  -27.793 47.324  1.00 35.08  ? 303 PHE B CA     1 
ATOM   5027  C C      . PHE B  1 310 ? -67.102  -28.533 46.781  1.00 34.91  ? 303 PHE B C      1 
ATOM   5028  O O      . PHE B  1 310 ? -66.754  -29.618 47.261  1.00 32.37  ? 303 PHE B O      1 
ATOM   5029  C CB     . PHE B  1 310 ? -69.521  -27.965 46.393  1.00 34.45  ? 303 PHE B CB     1 
ATOM   5030  C CG     . PHE B  1 310 ? -70.094  -29.357 46.388  1.00 29.87  ? 303 PHE B CG     1 
ATOM   5031  C CD1    . PHE B  1 310 ? -69.489  -30.369 45.662  1.00 26.41  ? 303 PHE B CD1    1 
ATOM   5032  C CD2    . PHE B  1 310 ? -71.241  -29.649 47.106  1.00 31.89  ? 303 PHE B CD2    1 
ATOM   5033  C CE1    . PHE B  1 310 ? -70.016  -31.648 45.657  1.00 28.16  ? 303 PHE B CE1    1 
ATOM   5034  C CE2    . PHE B  1 310 ? -71.774  -30.924 47.105  1.00 29.01  ? 303 PHE B CE2    1 
ATOM   5035  C CZ     . PHE B  1 310 ? -71.162  -31.925 46.379  1.00 28.32  ? 303 PHE B CZ     1 
ATOM   5036  N N      . GLY B  1 311 ? -66.441  -27.957 45.775  1.00 36.71  ? 304 GLY B N      1 
ATOM   5037  C CA     . GLY B  1 311 ? -65.222  -28.559 45.261  1.00 37.70  ? 304 GLY B CA     1 
ATOM   5038  C C      . GLY B  1 311 ? -64.145  -28.683 46.321  1.00 42.80  ? 304 GLY B C      1 
ATOM   5039  O O      . GLY B  1 311 ? -63.394  -29.662 46.351  1.00 46.50  ? 304 GLY B O      1 
ATOM   5040  N N      . ARG B  1 312 ? -64.057  -27.688 47.206  1.00 44.02  ? 305 ARG B N      1 
ATOM   5041  C CA     . ARG B  1 312 ? -63.035  -27.703 48.245  1.00 45.86  ? 305 ARG B CA     1 
ATOM   5042  C C      . ARG B  1 312 ? -63.240  -28.878 49.192  1.00 41.21  ? 305 ARG B C      1 
ATOM   5043  O O      . ARG B  1 312 ? -62.281  -29.562 49.566  1.00 36.85  ? 305 ARG B O      1 
ATOM   5044  C CB     . ARG B  1 312 ? -63.075  -26.382 49.016  1.00 51.02  ? 305 ARG B CB     1 
ATOM   5045  C CG     . ARG B  1 312 ? -61.862  -26.108 49.866  1.00 60.53  ? 305 ARG B CG     1 
ATOM   5046  C CD     . ARG B  1 312 ? -61.992  -24.787 50.626  1.00 67.22  ? 305 ARG B CD     1 
ATOM   5047  N NE     . ARG B  1 312 ? -62.326  -23.653 49.769  1.00 71.09  ? 305 ARG B NE     1 
ATOM   5048  C CZ     . ARG B  1 312 ? -63.476  -22.987 49.824  1.00 73.07  ? 305 ARG B CZ     1 
ATOM   5049  N NH1    . ARG B  1 312 ? -64.406  -23.338 50.698  1.00 74.98  ? 305 ARG B NH1    1 
ATOM   5050  N NH2    . ARG B  1 312 ? -63.695  -21.967 49.005  1.00 73.60  ? 305 ARG B NH2    1 
ATOM   5051  N N      . LEU B  1 313 ? -64.491  -29.134 49.579  1.00 40.75  ? 306 LEU B N      1 
ATOM   5052  C CA     . LEU B  1 313 ? -64.796  -30.289 50.417  1.00 39.39  ? 306 LEU B CA     1 
ATOM   5053  C C      . LEU B  1 313 ? -64.498  -31.601 49.702  1.00 36.47  ? 306 LEU B C      1 
ATOM   5054  O O      . LEU B  1 313 ? -64.123  -32.588 50.345  1.00 37.63  ? 306 LEU B O      1 
ATOM   5055  C CB     . LEU B  1 313 ? -66.256  -30.231 50.860  1.00 34.28  ? 306 LEU B CB     1 
ATOM   5056  C CG     . LEU B  1 313 ? -66.574  -29.000 51.710  1.00 35.29  ? 306 LEU B CG     1 
ATOM   5057  C CD1    . LEU B  1 313 ? -68.073  -28.775 51.808  1.00 37.21  ? 306 LEU B CD1    1 
ATOM   5058  C CD2    . LEU B  1 313 ? -65.956  -29.140 53.092  1.00 35.24  ? 306 LEU B CD2    1 
ATOM   5059  N N      . MET B  1 314 ? -64.667  -31.635 48.380  1.00 36.67  ? 307 MET B N      1 
ATOM   5060  C CA     . MET B  1 314 ? -64.356  -32.845 47.626  1.00 37.24  ? 307 MET B CA     1 
ATOM   5061  C C      . MET B  1 314 ? -62.885  -33.217 47.747  1.00 37.61  ? 307 MET B C      1 
ATOM   5062  O O      . MET B  1 314 ? -62.545  -34.401 47.856  1.00 40.06  ? 307 MET B O      1 
ATOM   5063  C CB     . MET B  1 314 ? -64.745  -32.660 46.160  1.00 35.61  ? 307 MET B CB     1 
ATOM   5064  C CG     . MET B  1 314 ? -66.246  -32.567 45.958  1.00 35.52  ? 307 MET B CG     1 
ATOM   5065  S SD     . MET B  1 314 ? -66.745  -32.189 44.266  1.00 38.91  ? 307 MET B SD     1 
ATOM   5066  C CE     . MET B  1 314 ? -66.094  -33.609 43.385  1.00 35.41  ? 307 MET B CE     1 
ATOM   5067  N N      . VAL B  1 315 ? -61.997  -32.223 47.725  1.00 37.14  ? 308 VAL B N      1 
ATOM   5068  C CA     . VAL B  1 315 ? -60.568  -32.516 47.775  1.00 40.44  ? 308 VAL B CA     1 
ATOM   5069  C C      . VAL B  1 315 ? -60.162  -32.988 49.166  1.00 38.42  ? 308 VAL B C      1 
ATOM   5070  O O      . VAL B  1 315 ? -59.299  -33.863 49.309  1.00 34.91  ? 308 VAL B O      1 
ATOM   5071  C CB     . VAL B  1 315 ? -59.757  -31.287 47.333  1.00 40.24  ? 308 VAL B CB     1 
ATOM   5072  C CG1    . VAL B  1 315 ? -58.274  -31.615 47.325  1.00 37.00  ? 308 VAL B CG1    1 
ATOM   5073  C CG2    . VAL B  1 315 ? -60.217  -30.820 45.962  1.00 38.99  ? 308 VAL B CG2    1 
ATOM   5074  N N      . GLU B  1 316 ? -60.764  -32.416 50.212  1.00 40.37  ? 309 GLU B N      1 
ATOM   5075  C CA     . GLU B  1 316 ? -60.525  -32.929 51.557  1.00 41.33  ? 309 GLU B CA     1 
ATOM   5076  C C      . GLU B  1 316 ? -60.974  -34.377 51.671  1.00 39.34  ? 309 GLU B C      1 
ATOM   5077  O O      . GLU B  1 316 ? -60.272  -35.209 52.258  1.00 41.90  ? 309 GLU B O      1 
ATOM   5078  C CB     . GLU B  1 316 ? -61.241  -32.068 52.596  1.00 46.04  ? 309 GLU B CB     1 
ATOM   5079  C CG     . GLU B  1 316 ? -60.744  -30.640 52.690  1.00 55.10  ? 309 GLU B CG     1 
ATOM   5080  C CD     . GLU B  1 316 ? -61.580  -29.802 53.641  1.00 62.14  ? 309 GLU B CD     1 
ATOM   5081  O OE1    . GLU B  1 316 ? -62.162  -30.383 54.584  1.00 64.20  ? 309 GLU B OE1    1 
ATOM   5082  O OE2    . GLU B  1 316 ? -61.656  -28.570 53.446  1.00 64.43  ? 309 GLU B OE2    1 
ATOM   5083  N N      . SER B  1 317 ? -62.145  -34.697 51.115  1.00 35.88  ? 310 SER B N      1 
ATOM   5084  C CA     . SER B  1 317 ? -62.626  -36.073 51.139  1.00 34.57  ? 310 SER B CA     1 
ATOM   5085  C C      . SER B  1 317 ? -61.596  -37.016 50.535  1.00 32.98  ? 310 SER B C      1 
ATOM   5086  O O      . SER B  1 317 ? -61.343  -38.101 51.072  1.00 33.00  ? 310 SER B O      1 
ATOM   5087  C CB     . SER B  1 317 ? -63.958  -36.174 50.392  1.00 37.15  ? 310 SER B CB     1 
ATOM   5088  O OG     . SER B  1 317 ? -64.409  -37.515 50.326  1.00 39.73  ? 310 SER B OG     1 
ATOM   5089  N N      . HIS B  1 318 ? -60.993  -36.618 49.412  1.00 32.83  ? 311 HIS B N      1 
ATOM   5090  C CA     . HIS B  1 318 ? -59.980  -37.456 48.782  1.00 33.76  ? 311 HIS B CA     1 
ATOM   5091  C C      . HIS B  1 318 ? -58.758  -37.603 49.681  1.00 34.98  ? 311 HIS B C      1 
ATOM   5092  O O      . HIS B  1 318 ? -58.275  -38.717 49.914  1.00 35.09  ? 311 HIS B O      1 
ATOM   5093  C CB     . HIS B  1 318 ? -59.579  -36.874 47.428  1.00 31.64  ? 311 HIS B CB     1 
ATOM   5094  C CG     . HIS B  1 318 ? -58.606  -37.725 46.675  1.00 33.08  ? 311 HIS B CG     1 
ATOM   5095  N ND1    . HIS B  1 318 ? -58.967  -38.914 46.079  1.00 33.19  ? 311 HIS B ND1    1 
ATOM   5096  C CD2    . HIS B  1 318 ? -57.283  -37.569 46.437  1.00 33.95  ? 311 HIS B CD2    1 
ATOM   5097  C CE1    . HIS B  1 318 ? -57.909  -39.449 45.496  1.00 33.77  ? 311 HIS B CE1    1 
ATOM   5098  N NE2    . HIS B  1 318 ? -56.874  -38.654 45.700  1.00 34.78  ? 311 HIS B NE2    1 
ATOM   5099  N N      . ARG B  1 319 ? -58.243  -36.485 50.199  1.00 36.76  ? 312 ARG B N      1 
ATOM   5100  C CA     . ARG B  1 319 ? -57.109  -36.552 51.116  1.00 34.22  ? 312 ARG B CA     1 
ATOM   5101  C C      . ARG B  1 319 ? -57.407  -37.482 52.284  1.00 29.81  ? 312 ARG B C      1 
ATOM   5102  O O      . ARG B  1 319 ? -56.584  -38.330 52.646  1.00 31.85  ? 312 ARG B O      1 
ATOM   5103  C CB     . ARG B  1 319 ? -56.755  -35.156 51.632  1.00 42.28  ? 312 ARG B CB     1 
ATOM   5104  C CG     . ARG B  1 319 ? -56.416  -34.133 50.561  1.00 49.15  ? 312 ARG B CG     1 
ATOM   5105  C CD     . ARG B  1 319 ? -56.000  -32.815 51.205  1.00 55.37  ? 312 ARG B CD     1 
ATOM   5106  N NE     . ARG B  1 319 ? -56.103  -31.680 50.292  1.00 60.40  ? 312 ARG B NE     1 
ATOM   5107  C CZ     . ARG B  1 319 ? -55.096  -31.209 49.563  1.00 64.98  ? 312 ARG B CZ     1 
ATOM   5108  N NH1    . ARG B  1 319 ? -55.285  -30.169 48.762  1.00 66.74  ? 312 ARG B NH1    1 
ATOM   5109  N NH2    . ARG B  1 319 ? -53.899  -31.775 49.636  1.00 70.52  ? 312 ARG B NH2    1 
ATOM   5110  N N      . SER B  1 320 ? -58.590  -37.333 52.887  1.00 28.64  ? 313 SER B N      1 
ATOM   5111  C CA     . SER B  1 320 ? -58.979  -38.195 53.999  1.00 27.04  ? 313 SER B CA     1 
ATOM   5112  C C      . SER B  1 320 ? -59.002  -39.656 53.571  1.00 30.54  ? 313 SER B C      1 
ATOM   5113  O O      . SER B  1 320 ? -58.476  -40.531 54.269  1.00 33.08  ? 313 SER B O      1 
ATOM   5114  C CB     . SER B  1 320 ? -60.348  -37.768 54.533  1.00 26.61  ? 313 SER B CB     1 
ATOM   5115  O OG     . SER B  1 320 ? -60.739  -38.569 55.635  1.00 30.75  ? 313 SER B OG     1 
ATOM   5116  N N      . LEU B  1 321 ? -59.615  -39.937 52.421  1.00 28.61  ? 314 LEU B N      1 
ATOM   5117  C CA     . LEU B  1 321 ? -59.680  -41.306 51.929  1.00 30.79  ? 314 LEU B CA     1 
ATOM   5118  C C      . LEU B  1 321 ? -58.298  -41.841 51.574  1.00 35.83  ? 314 LEU B C      1 
ATOM   5119  O O      . LEU B  1 321 ? -58.066  -43.053 51.653  1.00 24.36  ? 314 LEU B O      1 
ATOM   5120  C CB     . LEU B  1 321 ? -60.603  -41.377 50.711  1.00 33.83  ? 314 LEU B CB     1 
ATOM   5121  C CG     . LEU B  1 321 ? -62.103  -41.222 50.968  1.00 28.68  ? 314 LEU B CG     1 
ATOM   5122  C CD1    . LEU B  1 321 ? -62.860  -40.897 49.687  1.00 30.97  ? 314 LEU B CD1    1 
ATOM   5123  C CD2    . LEU B  1 321 ? -62.655  -42.476 51.620  1.00 20.95  ? 314 LEU B CD2    1 
ATOM   5124  N N      . ARG B  1 322 ? -57.375  -40.962 51.183  1.00 38.98  ? 315 ARG B N      1 
ATOM   5125  C CA     . ARG B  1 322 ? -56.049  -41.407 50.767  1.00 35.96  ? 315 ARG B CA     1 
ATOM   5126  C C      . ARG B  1 322 ? -55.124  -41.602 51.959  1.00 40.24  ? 315 ARG B C      1 
ATOM   5127  O O      . ARG B  1 322 ? -54.292  -42.515 51.962  1.00 41.64  ? 315 ARG B O      1 
ATOM   5128  C CB     . ARG B  1 322 ? -55.439  -40.391 49.806  1.00 34.24  ? 315 ARG B CB     1 
ATOM   5129  C CG     . ARG B  1 322 ? -54.086  -40.761 49.242  1.00 37.96  ? 315 ARG B CG     1 
ATOM   5130  C CD     . ARG B  1 322 ? -53.509  -39.546 48.566  1.00 45.01  ? 315 ARG B CD     1 
ATOM   5131  N NE     . ARG B  1 322 ? -53.219  -38.522 49.565  1.00 49.87  ? 315 ARG B NE     1 
ATOM   5132  C CZ     . ARG B  1 322 ? -53.221  -37.215 49.331  1.00 51.64  ? 315 ARG B CZ     1 
ATOM   5133  N NH1    . ARG B  1 322 ? -53.404  -36.759 48.097  1.00 51.72  ? 315 ARG B NH1    1 
ATOM   5134  N NH2    . ARG B  1 322 ? -52.960  -36.367 50.320  1.00 50.89  ? 315 ARG B NH2    1 
ATOM   5135  N N      . ASP B  1 323 ? -55.244  -40.744 52.969  1.00 39.45  ? 316 ASP B N      1 
ATOM   5136  C CA     . ASP B  1 323 ? -54.318  -40.723 54.092  1.00 43.94  ? 316 ASP B CA     1 
ATOM   5137  C C      . ASP B  1 323 ? -54.847  -41.467 55.313  1.00 41.67  ? 316 ASP B C      1 
ATOM   5138  O O      . ASP B  1 323 ? -54.140  -42.309 55.872  1.00 39.72  ? 316 ASP B O      1 
ATOM   5139  C CB     . ASP B  1 323 ? -53.997  -39.270 54.468  1.00 46.54  ? 316 ASP B CB     1 
ATOM   5140  C CG     . ASP B  1 323 ? -53.361  -38.493 53.323  1.00 50.41  ? 316 ASP B CG     1 
ATOM   5141  O OD1    . ASP B  1 323 ? -52.791  -39.127 52.409  1.00 51.92  ? 316 ASP B OD1    1 
ATOM   5142  O OD2    . ASP B  1 323 ? -53.425  -37.245 53.343  1.00 52.34  ? 316 ASP B OD2    1 
ATOM   5143  N N      . ASP B  1 324 ? -56.076  -41.178 55.743  1.00 40.77  ? 317 ASP B N      1 
ATOM   5144  C CA     . ASP B  1 324 ? -56.610  -41.799 56.951  1.00 41.35  ? 317 ASP B CA     1 
ATOM   5145  C C      . ASP B  1 324 ? -57.282  -43.144 56.682  1.00 43.24  ? 317 ASP B C      1 
ATOM   5146  O O      . ASP B  1 324 ? -57.041  -44.113 57.409  1.00 45.96  ? 317 ASP B O      1 
ATOM   5147  C CB     . ASP B  1 324 ? -57.575  -40.838 57.653  1.00 42.29  ? 317 ASP B CB     1 
ATOM   5148  C CG     . ASP B  1 324 ? -56.849  -39.777 58.467  1.00 48.23  ? 317 ASP B CG     1 
ATOM   5149  O OD1    . ASP B  1 324 ? -55.617  -39.893 58.644  1.00 49.38  ? 317 ASP B OD1    1 
ATOM   5150  O OD2    . ASP B  1 324 ? -57.507  -38.826 58.935  1.00 51.34  ? 317 ASP B OD2    1 
ATOM   5151  N N      . TYR B  1 325 ? -58.123  -43.224 55.651  1.00 41.08  ? 318 TYR B N      1 
ATOM   5152  C CA     . TYR B  1 325 ? -58.825  -44.465 55.353  1.00 40.03  ? 318 TYR B CA     1 
ATOM   5153  C C      . TYR B  1 325 ? -58.025  -45.386 54.442  1.00 41.68  ? 318 TYR B C      1 
ATOM   5154  O O      . TYR B  1 325 ? -58.286  -46.594 54.424  1.00 44.45  ? 318 TYR B O      1 
ATOM   5155  C CB     . TYR B  1 325 ? -60.187  -44.163 54.719  1.00 38.74  ? 318 TYR B CB     1 
ATOM   5156  C CG     . TYR B  1 325 ? -61.309  -45.043 55.229  1.00 35.89  ? 318 TYR B CG     1 
ATOM   5157  C CD1    . TYR B  1 325 ? -61.776  -44.924 56.535  1.00 34.20  ? 318 TYR B CD1    1 
ATOM   5158  C CD2    . TYR B  1 325 ? -61.905  -45.987 54.403  1.00 34.95  ? 318 TYR B CD2    1 
ATOM   5159  C CE1    . TYR B  1 325 ? -62.804  -45.726 57.003  1.00 33.52  ? 318 TYR B CE1    1 
ATOM   5160  C CE2    . TYR B  1 325 ? -62.928  -46.792 54.860  1.00 34.47  ? 318 TYR B CE2    1 
ATOM   5161  C CZ     . TYR B  1 325 ? -63.376  -46.658 56.158  1.00 34.21  ? 318 TYR B CZ     1 
ATOM   5162  O OH     . TYR B  1 325 ? -64.397  -47.464 56.608  1.00 31.69  ? 318 TYR B OH     1 
ATOM   5163  N N      . GLU B  1 326 ? -57.052  -44.845 53.707  1.00 43.33  ? 319 GLU B N      1 
ATOM   5164  C CA     . GLU B  1 326 ? -56.218  -45.627 52.802  1.00 44.86  ? 319 GLU B CA     1 
ATOM   5165  C C      . GLU B  1 326 ? -57.044  -46.605 51.977  1.00 44.20  ? 319 GLU B C      1 
ATOM   5166  O O      . GLU B  1 326 ? -56.922  -47.823 52.138  1.00 42.45  ? 319 GLU B O      1 
ATOM   5167  C CB     . GLU B  1 326 ? -55.141  -46.369 53.596  1.00 51.18  ? 319 GLU B CB     1 
ATOM   5168  C CG     . GLU B  1 326 ? -54.180  -45.439 54.321  1.00 57.20  ? 319 GLU B CG     1 
ATOM   5169  C CD     . GLU B  1 326 ? -52.978  -46.162 54.893  1.00 66.26  ? 319 GLU B CD     1 
ATOM   5170  O OE1    . GLU B  1 326 ? -53.080  -47.379 55.153  1.00 68.87  ? 319 GLU B OE1    1 
ATOM   5171  O OE2    . GLU B  1 326 ? -51.928  -45.511 55.079  1.00 69.45  ? 319 GLU B OE2    1 
ATOM   5172  N N      . VAL B  1 327 ? -57.889  -46.079 51.094  1.00 43.61  ? 320 VAL B N      1 
ATOM   5173  C CA     . VAL B  1 327 ? -58.653  -46.907 50.166  1.00 41.55  ? 320 VAL B CA     1 
ATOM   5174  C C      . VAL B  1 327 ? -58.478  -46.370 48.753  1.00 42.44  ? 320 VAL B C      1 
ATOM   5175  O O      . VAL B  1 327 ? -59.157  -46.812 47.820  1.00 39.20  ? 320 VAL B O      1 
ATOM   5176  C CB     . VAL B  1 327 ? -60.141  -46.960 50.554  1.00 34.18  ? 320 VAL B CB     1 
ATOM   5177  C CG1    . VAL B  1 327 ? -60.321  -47.684 51.875  1.00 29.04  ? 320 VAL B CG1    1 
ATOM   5178  C CG2    . VAL B  1 327 ? -60.713  -45.553 50.638  1.00 33.54  ? 320 VAL B CG2    1 
ATOM   5179  N N      . SER B  1 328 ? -57.574  -45.410 48.589  1.00 44.02  ? 321 SER B N      1 
ATOM   5180  C CA     . SER B  1 328 ? -57.256  -44.861 47.282  1.00 45.76  ? 321 SER B CA     1 
ATOM   5181  C C      . SER B  1 328 ? -56.116  -45.669 46.661  1.00 51.42  ? 321 SER B C      1 
ATOM   5182  O O      . SER B  1 328 ? -55.717  -46.718 47.173  1.00 55.12  ? 321 SER B O      1 
ATOM   5183  C CB     . SER B  1 328 ? -56.917  -43.377 47.410  1.00 42.95  ? 321 SER B CB     1 
ATOM   5184  O OG     . SER B  1 328 ? -56.704  -42.778 46.143  1.00 42.08  ? 321 SER B OG     1 
ATOM   5185  N N      . CYS B  1 329 ? -55.579  -45.190 45.546  1.00 52.54  ? 322 CYS B N      1 
ATOM   5186  C CA     . CYS B  1 329 ? -54.469  -45.864 44.887  1.00 53.27  ? 322 CYS B CA     1 
ATOM   5187  C C      . CYS B  1 329 ? -53.744  -44.851 44.015  1.00 47.98  ? 322 CYS B C      1 
ATOM   5188  O O      . CYS B  1 329 ? -54.252  -43.746 43.775  1.00 45.37  ? 322 CYS B O      1 
ATOM   5189  C CB     . CYS B  1 329 ? -54.953  -47.062 44.053  1.00 57.09  ? 322 CYS B CB     1 
ATOM   5190  S SG     . CYS B  1 329 ? -55.957  -46.621 42.617  1.00 62.83  ? 322 CYS B SG     1 
ATOM   5191  N N      . PRO B  1 330 ? -52.547  -45.191 43.533  1.00 49.01  ? 323 PRO B N      1 
ATOM   5192  C CA     . PRO B  1 330 ? -51.783  -44.224 42.724  1.00 51.29  ? 323 PRO B CA     1 
ATOM   5193  C C      . PRO B  1 330 ? -52.523  -43.713 41.498  1.00 51.93  ? 323 PRO B C      1 
ATOM   5194  O O      . PRO B  1 330 ? -52.478  -42.509 41.219  1.00 51.57  ? 323 PRO B O      1 
ATOM   5195  C CB     . PRO B  1 330 ? -50.529  -45.020 42.339  1.00 52.45  ? 323 PRO B CB     1 
ATOM   5196  C CG     . PRO B  1 330 ? -50.376  -46.026 43.433  1.00 51.95  ? 323 PRO B CG     1 
ATOM   5197  C CD     . PRO B  1 330 ? -51.778  -46.416 43.812  1.00 50.73  ? 323 PRO B CD     1 
ATOM   5198  N N      . GLU B  1 331 ? -53.200  -44.588 40.749  1.00 48.33  ? 324 GLU B N      1 
ATOM   5199  C CA     . GLU B  1 331 ? -53.915  -44.127 39.561  1.00 46.20  ? 324 GLU B CA     1 
ATOM   5200  C C      . GLU B  1 331 ? -54.975  -43.095 39.927  1.00 43.78  ? 324 GLU B C      1 
ATOM   5201  O O      . GLU B  1 331 ? -55.057  -42.026 39.312  1.00 42.90  ? 324 GLU B O      1 
ATOM   5202  C CB     . GLU B  1 331 ? -54.545  -45.307 38.820  1.00 44.10  ? 324 GLU B CB     1 
ATOM   5203  C CG     . GLU B  1 331 ? -53.548  -46.286 38.222  1.00 43.34  ? 324 GLU B CG     1 
ATOM   5204  C CD     . GLU B  1 331 ? -53.035  -47.282 39.240  1.00 46.32  ? 324 GLU B CD     1 
ATOM   5205  O OE1    . GLU B  1 331 ? -53.527  -47.258 40.387  1.00 46.43  ? 324 GLU B OE1    1 
ATOM   5206  O OE2    . GLU B  1 331 ? -52.145  -48.088 38.895  1.00 49.26  ? 324 GLU B OE2    1 
ATOM   5207  N N      . LEU B  1 332 ? -55.800  -43.401 40.933  1.00 42.09  ? 325 LEU B N      1 
ATOM   5208  C CA     . LEU B  1 332 ? -56.806  -42.442 41.378  1.00 40.27  ? 325 LEU B CA     1 
ATOM   5209  C C      . LEU B  1 332 ? -56.151  -41.148 41.838  1.00 42.80  ? 325 LEU B C      1 
ATOM   5210  O O      . LEU B  1 332 ? -56.629  -40.050 41.524  1.00 39.64  ? 325 LEU B O      1 
ATOM   5211  C CB     . LEU B  1 332 ? -57.655  -43.048 42.495  1.00 40.21  ? 325 LEU B CB     1 
ATOM   5212  C CG     . LEU B  1 332 ? -58.669  -44.116 42.084  1.00 41.03  ? 325 LEU B CG     1 
ATOM   5213  C CD1    . LEU B  1 332 ? -59.388  -44.657 43.308  1.00 39.31  ? 325 LEU B CD1    1 
ATOM   5214  C CD2    . LEU B  1 332 ? -59.671  -43.543 41.094  1.00 40.20  ? 325 LEU B CD2    1 
ATOM   5215  N N      . ASP B  1 333 ? -55.054  -41.258 42.589  1.00 41.43  ? 326 ASP B N      1 
ATOM   5216  C CA     . ASP B  1 333 ? -54.359  -40.067 43.057  1.00 40.49  ? 326 ASP B CA     1 
ATOM   5217  C C      . ASP B  1 333 ? -53.837  -39.245 41.885  1.00 39.66  ? 326 ASP B C      1 
ATOM   5218  O O      . ASP B  1 333 ? -53.887  -38.010 41.913  1.00 38.29  ? 326 ASP B O      1 
ATOM   5219  C CB     . ASP B  1 333 ? -53.215  -40.461 43.993  1.00 41.72  ? 326 ASP B CB     1 
ATOM   5220  C CG     . ASP B  1 333 ? -53.707  -41.117 45.271  1.00 42.36  ? 326 ASP B CG     1 
ATOM   5221  O OD1    . ASP B  1 333 ? -54.880  -40.895 45.638  1.00 38.57  ? 326 ASP B OD1    1 
ATOM   5222  O OD2    . ASP B  1 333 ? -52.923  -41.852 45.909  1.00 42.86  ? 326 ASP B OD2    1 
ATOM   5223  N N      . GLN B  1 334 ? -53.324  -39.912 40.844  1.00 38.81  ? 327 GLN B N      1 
ATOM   5224  C CA     . GLN B  1 334 ? -52.837  -39.188 39.672  1.00 39.61  ? 327 GLN B CA     1 
ATOM   5225  C C      . GLN B  1 334 ? -53.975  -38.514 38.917  1.00 41.85  ? 327 GLN B C      1 
ATOM   5226  O O      . GLN B  1 334 ? -53.835  -37.373 38.461  1.00 42.09  ? 327 GLN B O      1 
ATOM   5227  C CB     . GLN B  1 334 ? -52.073  -40.132 38.745  1.00 41.45  ? 327 GLN B CB     1 
ATOM   5228  C CG     . GLN B  1 334 ? -51.360  -39.425 37.598  1.00 47.03  ? 327 GLN B CG     1 
ATOM   5229  C CD     . GLN B  1 334 ? -50.725  -40.394 36.617  1.00 52.81  ? 327 GLN B CD     1 
ATOM   5230  O OE1    . GLN B  1 334 ? -51.287  -41.450 36.322  1.00 54.13  ? 327 GLN B OE1    1 
ATOM   5231  N NE2    . GLN B  1 334 ? -49.546  -40.042 36.111  1.00 53.96  ? 327 GLN B NE2    1 
ATOM   5232  N N      . LEU B  1 335 ? -55.110  -39.202 38.772  1.00 40.97  ? 328 LEU B N      1 
ATOM   5233  C CA     . LEU B  1 335 ? -56.256  -38.595 38.104  1.00 36.86  ? 328 LEU B CA     1 
ATOM   5234  C C      . LEU B  1 335 ? -56.771  -37.395 38.884  1.00 37.40  ? 328 LEU B C      1 
ATOM   5235  O O      . LEU B  1 335 ? -57.126  -36.368 38.294  1.00 35.74  ? 328 LEU B O      1 
ATOM   5236  C CB     . LEU B  1 335 ? -57.373  -39.622 37.917  1.00 34.23  ? 328 LEU B CB     1 
ATOM   5237  C CG     . LEU B  1 335 ? -57.175  -40.746 36.902  1.00 35.95  ? 328 LEU B CG     1 
ATOM   5238  C CD1    . LEU B  1 335 ? -58.313  -41.753 36.993  1.00 32.43  ? 328 LEU B CD1    1 
ATOM   5239  C CD2    . LEU B  1 335 ? -57.094  -40.170 35.502  1.00 36.74  ? 328 LEU B CD2    1 
ATOM   5240  N N      . VAL B  1 336 ? -56.819  -37.501 40.213  1.00 38.11  ? 329 VAL B N      1 
ATOM   5241  C CA     . VAL B  1 336 ? -57.357  -36.408 41.018  1.00 36.07  ? 329 VAL B CA     1 
ATOM   5242  C C      . VAL B  1 336 ? -56.488  -35.164 40.875  1.00 41.44  ? 329 VAL B C      1 
ATOM   5243  O O      . VAL B  1 336 ? -56.990  -34.054 40.661  1.00 42.61  ? 329 VAL B O      1 
ATOM   5244  C CB     . VAL B  1 336 ? -57.486  -36.835 42.491  1.00 30.63  ? 329 VAL B CB     1 
ATOM   5245  C CG1    . VAL B  1 336 ? -57.683  -35.612 43.369  1.00 27.43  ? 329 VAL B CG1    1 
ATOM   5246  C CG2    . VAL B  1 336 ? -58.640  -37.818 42.667  1.00 32.73  ? 329 VAL B CG2    1 
ATOM   5247  N N      . GLU B  1 337 ? -55.171  -35.332 40.997  1.00 45.40  ? 330 GLU B N      1 
ATOM   5248  C CA     . GLU B  1 337 ? -54.265  -34.191 40.915  1.00 52.47  ? 330 GLU B CA     1 
ATOM   5249  C C      . GLU B  1 337 ? -54.294  -33.560 39.528  1.00 51.90  ? 330 GLU B C      1 
ATOM   5250  O O      . GLU B  1 337 ? -54.352  -32.332 39.393  1.00 51.24  ? 330 GLU B O      1 
ATOM   5251  C CB     . GLU B  1 337 ? -52.847  -34.622 41.288  1.00 60.19  ? 330 GLU B CB     1 
ATOM   5252  C CG     . GLU B  1 337 ? -52.131  -33.640 42.196  1.00 70.27  ? 330 GLU B CG     1 
ATOM   5253  C CD     . GLU B  1 337 ? -52.922  -33.340 43.459  1.00 76.30  ? 330 GLU B CD     1 
ATOM   5254  O OE1    . GLU B  1 337 ? -53.559  -34.270 44.002  1.00 77.63  ? 330 GLU B OE1    1 
ATOM   5255  O OE2    . GLU B  1 337 ? -52.914  -32.171 43.900  1.00 79.05  ? 330 GLU B OE2    1 
ATOM   5256  N N      . ALA B  1 338 ? -54.243  -34.387 38.481  1.00 48.94  ? 331 ALA B N      1 
ATOM   5257  C CA     . ALA B  1 338 ? -54.300  -33.860 37.122  1.00 46.16  ? 331 ALA B CA     1 
ATOM   5258  C C      . ALA B  1 338 ? -55.555  -33.023 36.900  1.00 43.11  ? 331 ALA B C      1 
ATOM   5259  O O      . ALA B  1 338 ? -55.501  -31.968 36.257  1.00 46.73  ? 331 ALA B O      1 
ATOM   5260  C CB     . ALA B  1 338 ? -54.236  -35.005 36.113  1.00 45.79  ? 331 ALA B CB     1 
ATOM   5261  N N      . ALA B  1 339 ? -56.696  -33.478 37.422  1.00 39.41  ? 332 ALA B N      1 
ATOM   5262  C CA     . ALA B  1 339 ? -57.934  -32.721 37.257  1.00 39.16  ? 332 ALA B CA     1 
ATOM   5263  C C      . ALA B  1 339 ? -57.850  -31.365 37.944  1.00 39.04  ? 332 ALA B C      1 
ATOM   5264  O O      . ALA B  1 339 ? -58.376  -30.366 37.438  1.00 38.21  ? 332 ALA B O      1 
ATOM   5265  C CB     . ALA B  1 339 ? -59.116  -33.520 37.803  1.00 36.11  ? 332 ALA B CB     1 
ATOM   5266  N N      . LEU B  1 340 ? -57.191  -31.311 39.103  1.00 40.97  ? 333 LEU B N      1 
ATOM   5267  C CA     . LEU B  1 340 ? -57.119  -30.075 39.870  1.00 41.59  ? 333 LEU B CA     1 
ATOM   5268  C C      . LEU B  1 340 ? -56.248  -29.022 39.196  1.00 47.68  ? 333 LEU B C      1 
ATOM   5269  O O      . LEU B  1 340 ? -56.342  -27.841 39.548  1.00 46.03  ? 333 LEU B O      1 
ATOM   5270  C CB     . LEU B  1 340 ? -56.606  -30.368 41.281  1.00 38.00  ? 333 LEU B CB     1 
ATOM   5271  C CG     . LEU B  1 340 ? -57.538  -31.228 42.139  1.00 37.70  ? 333 LEU B CG     1 
ATOM   5272  C CD1    . LEU B  1 340 ? -56.893  -31.611 43.463  1.00 40.27  ? 333 LEU B CD1    1 
ATOM   5273  C CD2    . LEU B  1 340 ? -58.853  -30.498 42.364  1.00 37.06  ? 333 LEU B CD2    1 
ATOM   5274  N N      . ALA B  1 341 ? -55.398  -29.422 38.250  1.00 53.50  ? 334 ALA B N      1 
ATOM   5275  C CA     . ALA B  1 341 ? -54.580  -28.464 37.516  1.00 38.52  ? 334 ALA B CA     1 
ATOM   5276  C C      . ALA B  1 341 ? -55.373  -27.708 36.458  1.00 56.62  ? 334 ALA B C      1 
ATOM   5277  O O      . ALA B  1 341 ? -54.936  -26.637 36.021  1.00 61.82  ? 334 ALA B O      1 
ATOM   5278  C CB     . ALA B  1 341 ? -53.398  -29.177 36.860  1.00 40.09  ? 334 ALA B CB     1 
ATOM   5279  N N      . VAL B  1 342 ? -56.515  -28.237 36.041  1.00 51.27  ? 335 VAL B N      1 
ATOM   5280  C CA     . VAL B  1 342 ? -57.312  -27.612 34.985  1.00 49.11  ? 335 VAL B CA     1 
ATOM   5281  C C      . VAL B  1 342 ? -58.077  -26.429 35.574  1.00 48.29  ? 335 VAL B C      1 
ATOM   5282  O O      . VAL B  1 342 ? -58.743  -26.587 36.609  1.00 47.57  ? 335 VAL B O      1 
ATOM   5283  C CB     . VAL B  1 342 ? -58.272  -28.623 34.367  1.00 47.99  ? 335 VAL B CB     1 
ATOM   5284  C CG1    . VAL B  1 342 ? -59.137  -27.952 33.307  1.00 50.04  ? 335 VAL B CG1    1 
ATOM   5285  C CG2    . VAL B  1 342 ? -57.505  -29.796 33.776  1.00 48.70  ? 335 VAL B CG2    1 
ATOM   5286  N N      . PRO B  1 343 ? -58.013  -25.252 34.958  1.00 48.74  ? 336 PRO B N      1 
ATOM   5287  C CA     . PRO B  1 343 ? -58.867  -24.149 35.404  1.00 48.58  ? 336 PRO B CA     1 
ATOM   5288  C C      . PRO B  1 343 ? -60.326  -24.457 35.121  1.00 48.37  ? 336 PRO B C      1 
ATOM   5289  O O      . PRO B  1 343 ? -60.672  -25.086 34.118  1.00 51.09  ? 336 PRO B O      1 
ATOM   5290  C CB     . PRO B  1 343 ? -58.383  -22.956 34.571  1.00 44.14  ? 336 PRO B CB     1 
ATOM   5291  C CG     . PRO B  1 343 ? -57.027  -23.343 34.090  1.00 45.58  ? 336 PRO B CG     1 
ATOM   5292  C CD     . PRO B  1 343 ? -57.066  -24.830 33.915  1.00 51.73  ? 336 PRO B CD     1 
ATOM   5293  N N      . GLY B  1 344 ? -61.189  -23.984 36.015  1.00 43.63  ? 337 GLY B N      1 
ATOM   5294  C CA     . GLY B  1 344 ? -62.597  -24.293 35.955  1.00 39.63  ? 337 GLY B CA     1 
ATOM   5295  C C      . GLY B  1 344 ? -63.015  -25.511 36.747  1.00 42.89  ? 337 GLY B C      1 
ATOM   5296  O O      . GLY B  1 344 ? -64.220  -25.722 36.935  1.00 44.20  ? 337 GLY B O      1 
ATOM   5297  N N      . VAL B  1 345 ? -62.070  -26.318 37.219  1.00 41.85  ? 338 VAL B N      1 
ATOM   5298  C CA     . VAL B  1 345 ? -62.400  -27.456 38.068  1.00 38.73  ? 338 VAL B CA     1 
ATOM   5299  C C      . VAL B  1 345 ? -62.550  -26.965 39.499  1.00 39.86  ? 338 VAL B C      1 
ATOM   5300  O O      . VAL B  1 345 ? -61.654  -26.310 40.045  1.00 39.23  ? 338 VAL B O      1 
ATOM   5301  C CB     . VAL B  1 345 ? -61.326  -28.550 37.969  1.00 36.99  ? 338 VAL B CB     1 
ATOM   5302  C CG1    . VAL B  1 345 ? -61.544  -29.599 39.048  1.00 28.94  ? 338 VAL B CG1    1 
ATOM   5303  C CG2    . VAL B  1 345 ? -61.357  -29.194 36.599  1.00 37.49  ? 338 VAL B CG2    1 
ATOM   5304  N N      . TYR B  1 346 ? -63.687  -27.286 40.114  1.00 43.15  ? 339 TYR B N      1 
ATOM   5305  C CA     . TYR B  1 346 ? -63.908  -26.891 41.497  1.00 42.57  ? 339 TYR B CA     1 
ATOM   5306  C C      . TYR B  1 346 ? -63.270  -27.887 42.454  1.00 43.06  ? 339 TYR B C      1 
ATOM   5307  O O      . TYR B  1 346 ? -62.751  -27.500 43.507  1.00 47.24  ? 339 TYR B O      1 
ATOM   5308  C CB     . TYR B  1 346 ? -65.406  -26.765 41.770  1.00 41.52  ? 339 TYR B CB     1 
ATOM   5309  C CG     . TYR B  1 346 ? -66.101  -25.771 40.869  1.00 42.55  ? 339 TYR B CG     1 
ATOM   5310  C CD1    . TYR B  1 346 ? -65.948  -24.403 41.058  1.00 46.10  ? 339 TYR B CD1    1 
ATOM   5311  C CD2    . TYR B  1 346 ? -66.919  -26.201 39.835  1.00 42.18  ? 339 TYR B CD2    1 
ATOM   5312  C CE1    . TYR B  1 346 ? -66.586  -23.492 40.235  1.00 45.01  ? 339 TYR B CE1    1 
ATOM   5313  C CE2    . TYR B  1 346 ? -67.557  -25.301 39.010  1.00 44.92  ? 339 TYR B CE2    1 
ATOM   5314  C CZ     . TYR B  1 346 ? -67.390  -23.950 39.212  1.00 46.40  ? 339 TYR B CZ     1 
ATOM   5315  O OH     . TYR B  1 346 ? -68.033  -23.061 38.381  1.00 48.72  ? 339 TYR B OH     1 
ATOM   5316  N N      . GLY B  1 347 ? -63.302  -29.165 42.101  1.00 42.71  ? 340 GLY B N      1 
ATOM   5317  C CA     . GLY B  1 347 ? -62.721  -30.194 42.940  1.00 39.48  ? 340 GLY B CA     1 
ATOM   5318  C C      . GLY B  1 347 ? -62.823  -31.536 42.252  1.00 40.73  ? 340 GLY B C      1 
ATOM   5319  O O      . GLY B  1 347 ? -63.506  -31.693 41.233  1.00 42.92  ? 340 GLY B O      1 
ATOM   5320  N N      . SER B  1 348 ? -62.127  -32.509 42.832  1.00 36.99  ? 341 SER B N      1 
ATOM   5321  C CA     . SER B  1 348 ? -62.085  -33.857 42.289  1.00 34.56  ? 341 SER B CA     1 
ATOM   5322  C C      . SER B  1 348 ? -61.653  -34.805 43.397  1.00 37.28  ? 341 SER B C      1 
ATOM   5323  O O      . SER B  1 348 ? -60.962  -34.406 44.338  1.00 40.86  ? 341 SER B O      1 
ATOM   5324  C CB     . SER B  1 348 ? -61.132  -33.950 41.091  1.00 32.68  ? 341 SER B CB     1 
ATOM   5325  O OG     . SER B  1 348 ? -61.205  -35.224 40.476  1.00 31.08  ? 341 SER B OG     1 
ATOM   5326  N N      . ARG B  1 349 ? -62.067  -36.062 43.276  1.00 36.76  ? 342 ARG B N      1 
ATOM   5327  C CA     . ARG B  1 349 ? -61.774  -37.068 44.288  1.00 36.19  ? 342 ARG B CA     1 
ATOM   5328  C C      . ARG B  1 349 ? -62.154  -38.428 43.735  1.00 37.19  ? 342 ARG B C      1 
ATOM   5329  O O      . ARG B  1 349 ? -62.889  -38.531 42.749  1.00 39.30  ? 342 ARG B O      1 
ATOM   5330  C CB     . ARG B  1 349 ? -62.528  -36.800 45.600  1.00 30.50  ? 342 ARG B CB     1 
ATOM   5331  C CG     . ARG B  1 349 ? -64.052  -36.765 45.452  1.00 28.10  ? 342 ARG B CG     1 
ATOM   5332  C CD     . ARG B  1 349 ? -64.776  -36.727 46.798  1.00 30.59  ? 342 ARG B CD     1 
ATOM   5333  N NE     . ARG B  1 349 ? -66.065  -37.418 46.752  1.00 37.27  ? 342 ARG B NE     1 
ATOM   5334  C CZ     . ARG B  1 349 ? -66.258  -38.676 47.140  1.00 38.96  ? 342 ARG B CZ     1 
ATOM   5335  N NH1    . ARG B  1 349 ? -65.250  -39.391 47.616  1.00 41.43  ? 342 ARG B NH1    1 
ATOM   5336  N NH2    . ARG B  1 349 ? -67.463  -39.222 47.063  1.00 40.79  ? 342 ARG B NH2    1 
ATOM   5337  N N      . MET B  1 350 ? -61.651  -39.473 44.383  1.00 39.99  ? 343 MET B N      1 
ATOM   5338  C CA     . MET B  1 350 ? -62.102  -40.808 44.039  1.00 39.75  ? 343 MET B CA     1 
ATOM   5339  C C      . MET B  1 350 ? -63.553  -40.964 44.472  1.00 37.48  ? 343 MET B C      1 
ATOM   5340  O O      . MET B  1 350 ? -64.009  -40.327 45.426  1.00 37.09  ? 343 MET B O      1 
ATOM   5341  C CB     . MET B  1 350 ? -61.238  -41.869 44.719  1.00 43.37  ? 343 MET B CB     1 
ATOM   5342  C CG     . MET B  1 350 ? -61.203  -41.741 46.233  1.00 44.97  ? 343 MET B CG     1 
ATOM   5343  S SD     . MET B  1 350 ? -60.860  -43.306 47.060  1.00 48.69  ? 343 MET B SD     1 
ATOM   5344  C CE     . MET B  1 350 ? -62.476  -44.077 46.986  1.00 46.08  ? 343 MET B CE     1 
ATOM   5345  N N      . THR B  1 351 ? -64.281  -41.821 43.764  1.00 38.79  ? 344 THR B N      1 
ATOM   5346  C CA     . THR B  1 351 ? -65.654  -42.143 44.115  1.00 34.93  ? 344 THR B CA     1 
ATOM   5347  C C      . THR B  1 351 ? -65.796  -43.657 44.186  1.00 32.23  ? 344 THR B C      1 
ATOM   5348  O O      . THR B  1 351 ? -64.971  -44.402 43.652  1.00 37.92  ? 344 THR B O      1 
ATOM   5349  C CB     . THR B  1 351 ? -66.645  -41.543 43.102  1.00 35.60  ? 344 THR B CB     1 
ATOM   5350  O OG1    . THR B  1 351 ? -67.920  -41.348 43.726  1.00 38.06  ? 344 THR B OG1    1 
ATOM   5351  C CG2    . THR B  1 351 ? -66.803  -42.458 41.897  1.00 37.26  ? 344 THR B CG2    1 
ATOM   5352  N N      . GLY B  1 352 ? -66.856  -44.108 44.845  1.00 35.30  ? 345 GLY B N      1 
ATOM   5353  C CA     . GLY B  1 352 ? -67.052  -45.533 45.020  1.00 40.32  ? 345 GLY B CA     1 
ATOM   5354  C C      . GLY B  1 352 ? -66.219  -46.094 46.162  1.00 45.43  ? 345 GLY B C      1 
ATOM   5355  O O      . GLY B  1 352 ? -65.741  -45.375 47.048  1.00 47.02  ? 345 GLY B O      1 
ATOM   5356  N N      . GLY B  1 353 ? -66.043  -47.416 46.125  1.00 46.40  ? 346 GLY B N      1 
ATOM   5357  C CA     . GLY B  1 353 ? -65.333  -48.092 47.201  1.00 43.15  ? 346 GLY B CA     1 
ATOM   5358  C C      . GLY B  1 353 ? -63.854  -47.757 47.264  1.00 43.62  ? 346 GLY B C      1 
ATOM   5359  O O      . GLY B  1 353 ? -63.283  -47.644 48.352  1.00 46.02  ? 346 GLY B O      1 
ATOM   5360  N N      . GLY B  1 354 ? -63.213  -47.595 46.114  1.00 41.79  ? 347 GLY B N      1 
ATOM   5361  C CA     . GLY B  1 354 ? -61.796  -47.295 46.065  1.00 41.03  ? 347 GLY B CA     1 
ATOM   5362  C C      . GLY B  1 354 ? -60.978  -48.456 45.524  1.00 39.87  ? 347 GLY B C      1 
ATOM   5363  O O      . GLY B  1 354 ? -61.499  -49.431 44.975  1.00 43.30  ? 347 GLY B O      1 
ATOM   5364  N N      . PHE B  1 355 ? -59.659  -48.325 45.680  1.00 41.01  ? 348 PHE B N      1 
ATOM   5365  C CA     . PHE B  1 355 ? -58.701  -49.322 45.198  1.00 45.70  ? 348 PHE B CA     1 
ATOM   5366  C C      . PHE B  1 355 ? -58.730  -49.423 43.678  1.00 46.99  ? 348 PHE B C      1 
ATOM   5367  O O      . PHE B  1 355 ? -58.428  -50.473 43.103  1.00 48.39  ? 348 PHE B O      1 
ATOM   5368  C CB     . PHE B  1 355 ? -58.954  -50.696 45.823  1.00 53.67  ? 348 PHE B CB     1 
ATOM   5369  C CG     . PHE B  1 355 ? -58.818  -50.717 47.318  1.00 61.19  ? 348 PHE B CG     1 
ATOM   5370  C CD1    . PHE B  1 355 ? -57.595  -50.467 47.919  1.00 64.00  ? 348 PHE B CD1    1 
ATOM   5371  C CD2    . PHE B  1 355 ? -59.909  -51.002 48.121  1.00 63.67  ? 348 PHE B CD2    1 
ATOM   5372  C CE1    . PHE B  1 355 ? -57.467  -50.486 49.293  1.00 65.47  ? 348 PHE B CE1    1 
ATOM   5373  C CE2    . PHE B  1 355 ? -59.786  -51.025 49.496  1.00 64.61  ? 348 PHE B CE2    1 
ATOM   5374  C CZ     . PHE B  1 355 ? -58.564  -50.768 50.083  1.00 65.75  ? 348 PHE B CZ     1 
ATOM   5375  N N      . GLY B  1 356 ? -59.077  -48.325 43.024  1.00 43.45  ? 349 GLY B N      1 
ATOM   5376  C CA     . GLY B  1 356 ? -59.342  -48.276 41.609  1.00 42.45  ? 349 GLY B CA     1 
ATOM   5377  C C      . GLY B  1 356 ? -60.690  -47.635 41.385  1.00 37.48  ? 349 GLY B C      1 
ATOM   5378  O O      . GLY B  1 356 ? -61.263  -47.014 42.287  1.00 37.95  ? 349 GLY B O      1 
ATOM   5379  N N      . GLY B  1 357 ? -61.219  -47.811 40.181  1.00 39.47  ? 350 GLY B N      1 
ATOM   5380  C CA     . GLY B  1 357 ? -62.517  -47.250 39.873  1.00 36.03  ? 350 GLY B CA     1 
ATOM   5381  C C      . GLY B  1 357 ? -62.446  -45.867 39.266  1.00 35.94  ? 350 GLY B C      1 
ATOM   5382  O O      . GLY B  1 357 ? -61.555  -45.581 38.461  1.00 33.61  ? 350 GLY B O      1 
ATOM   5383  N N      . CYS B  1 358 ? -63.355  -44.986 39.667  1.00 35.95  ? 351 CYS B N      1 
ATOM   5384  C CA     . CYS B  1 358 ? -63.536  -43.716 38.985  1.00 39.39  ? 351 CYS B CA     1 
ATOM   5385  C C      . CYS B  1 358 ? -63.213  -42.532 39.889  1.00 40.68  ? 351 CYS B C      1 
ATOM   5386  O O      . CYS B  1 358 ? -63.073  -42.650 41.110  1.00 40.32  ? 351 CYS B O      1 
ATOM   5387  C CB     . CYS B  1 358 ? -64.966  -43.584 38.445  1.00 40.17  ? 351 CYS B CB     1 
ATOM   5388  S SG     . CYS B  1 358 ? -65.318  -44.652 37.034  1.00 43.19  ? 351 CYS B SG     1 
ATOM   5389  N N      . THR B  1 359 ? -63.089  -41.380 39.236  1.00 39.61  ? 352 THR B N      1 
ATOM   5390  C CA     . THR B  1 359 ? -62.928  -40.081 39.870  1.00 37.12  ? 352 THR B CA     1 
ATOM   5391  C C      . THR B  1 359 ? -64.104  -39.209 39.466  1.00 39.62  ? 352 THR B C      1 
ATOM   5392  O O      . THR B  1 359 ? -64.451  -39.143 38.282  1.00 47.10  ? 352 THR B O      1 
ATOM   5393  C CB     . THR B  1 359 ? -61.620  -39.409 39.441  1.00 36.95  ? 352 THR B CB     1 
ATOM   5394  O OG1    . THR B  1 359 ? -60.530  -39.926 40.213  1.00 40.21  ? 352 THR B OG1    1 
ATOM   5395  C CG2    . THR B  1 359 ? -61.711  -37.894 39.612  1.00 39.63  ? 352 THR B CG2    1 
ATOM   5396  N N      . VAL B  1 360 ? -64.722  -38.557 40.442  1.00 34.78  ? 353 VAL B N      1 
ATOM   5397  C CA     . VAL B  1 360 ? -65.793  -37.605 40.183  1.00 35.14  ? 353 VAL B CA     1 
ATOM   5398  C C      . VAL B  1 360 ? -65.195  -36.209 40.247  1.00 36.21  ? 353 VAL B C      1 
ATOM   5399  O O      . VAL B  1 360 ? -64.444  -35.890 41.178  1.00 40.64  ? 353 VAL B O      1 
ATOM   5400  C CB     . VAL B  1 360 ? -66.946  -37.766 41.189  1.00 37.48  ? 353 VAL B CB     1 
ATOM   5401  C CG1    . VAL B  1 360 ? -66.469  -37.463 42.598  1.00 36.65  ? 353 VAL B CG1    1 
ATOM   5402  C CG2    . VAL B  1 360 ? -68.101  -36.862 40.810  1.00 39.68  ? 353 VAL B CG2    1 
ATOM   5403  N N      . THR B  1 361 ? -65.526  -35.375 39.263  1.00 33.78  ? 354 THR B N      1 
ATOM   5404  C CA     . THR B  1 361 ? -64.955  -34.040 39.145  1.00 31.97  ? 354 THR B CA     1 
ATOM   5405  C C      . THR B  1 361 ? -66.080  -33.056 38.878  1.00 35.39  ? 354 THR B C      1 
ATOM   5406  O O      . THR B  1 361 ? -66.813  -33.201 37.895  1.00 42.66  ? 354 THR B O      1 
ATOM   5407  C CB     . THR B  1 361 ? -63.917  -33.980 38.019  1.00 29.96  ? 354 THR B CB     1 
ATOM   5408  O OG1    . THR B  1 361 ? -62.840  -34.881 38.303  1.00 31.74  ? 354 THR B OG1    1 
ATOM   5409  C CG2    . THR B  1 361 ? -63.369  -32.576 37.882  1.00 28.73  ? 354 THR B CG2    1 
ATOM   5410  N N      . LEU B  1 362 ? -66.215  -32.059 39.746  1.00 31.68  ? 355 LEU B N      1 
ATOM   5411  C CA     . LEU B  1 362 ? -67.179  -30.983 39.563  1.00 38.00  ? 355 LEU B CA     1 
ATOM   5412  C C      . LEU B  1 362 ? -66.466  -29.797 38.922  1.00 40.61  ? 355 LEU B C      1 
ATOM   5413  O O      . LEU B  1 362 ? -65.467  -29.309 39.461  1.00 41.97  ? 355 LEU B O      1 
ATOM   5414  C CB     . LEU B  1 362 ? -67.798  -30.598 40.908  1.00 43.70  ? 355 LEU B CB     1 
ATOM   5415  C CG     . LEU B  1 362 ? -69.198  -29.984 40.915  1.00 49.23  ? 355 LEU B CG     1 
ATOM   5416  C CD1    . LEU B  1 362 ? -70.005  -30.551 42.071  1.00 47.68  ? 355 LEU B CD1    1 
ATOM   5417  C CD2    . LEU B  1 362 ? -69.135  -28.474 41.002  1.00 50.63  ? 355 LEU B CD2    1 
ATOM   5418  N N      . LEU B  1 363 ? -66.979  -29.327 37.784  1.00 42.39  ? 356 LEU B N      1 
ATOM   5419  C CA     . LEU B  1 363 ? -66.241  -28.338 37.008  1.00 44.72  ? 356 LEU B CA     1 
ATOM   5420  C C      . LEU B  1 363 ? -67.188  -27.462 36.200  1.00 49.04  ? 356 LEU B C      1 
ATOM   5421  O O      . LEU B  1 363 ? -68.365  -27.781 36.018  1.00 51.20  ? 356 LEU B O      1 
ATOM   5422  C CB     . LEU B  1 363 ? -65.227  -29.003 36.067  1.00 42.71  ? 356 LEU B CB     1 
ATOM   5423  C CG     . LEU B  1 363 ? -65.793  -29.657 34.805  1.00 39.76  ? 356 LEU B CG     1 
ATOM   5424  C CD1    . LEU B  1 363 ? -64.675  -30.025 33.841  1.00 38.99  ? 356 LEU B CD1    1 
ATOM   5425  C CD2    . LEU B  1 363 ? -66.630  -30.876 35.151  1.00 33.04  ? 356 LEU B CD2    1 
ATOM   5426  N N      . GLU B  1 364 ? -66.648  -26.337 35.728  1.00 52.56  ? 357 GLU B N      1 
ATOM   5427  C CA     . GLU B  1 364 ? -67.374  -25.481 34.797  1.00 53.46  ? 357 GLU B CA     1 
ATOM   5428  C C      . GLU B  1 364 ? -67.626  -26.226 33.493  1.00 50.84  ? 357 GLU B C      1 
ATOM   5429  O O      . GLU B  1 364 ? -66.718  -26.852 32.936  1.00 50.71  ? 357 GLU B O      1 
ATOM   5430  C CB     . GLU B  1 364 ? -66.580  -24.201 34.532  1.00 62.76  ? 357 GLU B CB     1 
ATOM   5431  C CG     . GLU B  1 364 ? -67.077  -22.984 35.291  1.00 70.68  ? 357 GLU B CG     1 
ATOM   5432  C CD     . GLU B  1 364 ? -66.008  -21.909 35.430  1.00 79.18  ? 357 GLU B CD     1 
ATOM   5433  O OE1    . GLU B  1 364 ? -65.326  -21.605 34.426  1.00 83.52  ? 357 GLU B OE1    1 
ATOM   5434  O OE2    . GLU B  1 364 ? -65.841  -21.383 36.553  1.00 79.56  ? 357 GLU B OE2    1 
ATOM   5435  N N      . ALA B  1 365 ? -68.871  -26.164 33.011  1.00 49.17  ? 358 ALA B N      1 
ATOM   5436  C CA     . ALA B  1 365 ? -69.251  -26.926 31.825  1.00 45.60  ? 358 ALA B CA     1 
ATOM   5437  C C      . ALA B  1 365 ? -68.315  -26.654 30.652  1.00 46.01  ? 358 ALA B C      1 
ATOM   5438  O O      . ALA B  1 365 ? -67.879  -27.581 29.961  1.00 46.97  ? 358 ALA B O      1 
ATOM   5439  C CB     . ALA B  1 365 ? -70.695  -26.604 31.441  1.00 41.16  ? 358 ALA B CB     1 
ATOM   5440  N N      . SER B  1 366 ? -67.995  -25.381 30.412  1.00 45.99  ? 359 SER B N      1 
ATOM   5441  C CA     . SER B  1 366 ? -67.146  -25.033 29.278  1.00 48.85  ? 359 SER B CA     1 
ATOM   5442  C C      . SER B  1 366 ? -65.751  -25.634 29.385  1.00 49.29  ? 359 SER B C      1 
ATOM   5443  O O      . SER B  1 366 ? -65.091  -25.825 28.357  1.00 54.13  ? 359 SER B O      1 
ATOM   5444  C CB     . SER B  1 366 ? -67.053  -23.512 29.133  1.00 52.21  ? 359 SER B CB     1 
ATOM   5445  O OG     . SER B  1 366 ? -66.643  -22.901 30.343  1.00 51.83  ? 359 SER B OG     1 
ATOM   5446  N N      . ALA B  1 367 ? -65.284  -25.931 30.597  1.00 44.12  ? 360 ALA B N      1 
ATOM   5447  C CA     . ALA B  1 367 ? -63.935  -26.449 30.784  1.00 46.22  ? 360 ALA B CA     1 
ATOM   5448  C C      . ALA B  1 367 ? -63.830  -27.950 30.549  1.00 44.49  ? 360 ALA B C      1 
ATOM   5449  O O      . ALA B  1 367 ? -62.713  -28.476 30.516  1.00 45.72  ? 360 ALA B O      1 
ATOM   5450  C CB     . ALA B  1 367 ? -63.436  -26.117 32.193  1.00 41.24  ? 360 ALA B CB     1 
ATOM   5451  N N      . ALA B  1 368 ? -64.956  -28.645 30.383  1.00 42.62  ? 361 ALA B N      1 
ATOM   5452  C CA     . ALA B  1 368 ? -64.919  -30.099 30.245  1.00 43.75  ? 361 ALA B CA     1 
ATOM   5453  C C      . ALA B  1 368 ? -64.036  -30.553 29.092  1.00 47.84  ? 361 ALA B C      1 
ATOM   5454  O O      . ALA B  1 368 ? -63.186  -31.436 29.303  1.00 49.88  ? 361 ALA B O      1 
ATOM   5455  C CB     . ALA B  1 368 ? -66.346  -30.635 30.101  1.00 42.73  ? 361 ALA B CB     1 
ATOM   5456  N N      . PRO B  1 369 ? -64.171  -30.018 27.875  1.00 48.41  ? 362 PRO B N      1 
ATOM   5457  C CA     . PRO B  1 369 ? -63.310  -30.493 26.775  1.00 49.02  ? 362 PRO B CA     1 
ATOM   5458  C C      . PRO B  1 369 ? -61.828  -30.419 27.098  1.00 48.14  ? 362 PRO B C      1 
ATOM   5459  O O      . PRO B  1 369 ? -61.094  -31.383 26.845  1.00 47.33  ? 362 PRO B O      1 
ATOM   5460  C CB     . PRO B  1 369 ? -63.702  -29.570 25.613  1.00 46.98  ? 362 PRO B CB     1 
ATOM   5461  C CG     . PRO B  1 369 ? -65.101  -29.150 25.922  1.00 46.95  ? 362 PRO B CG     1 
ATOM   5462  C CD     . PRO B  1 369 ? -65.161  -29.027 27.420  1.00 47.32  ? 362 PRO B CD     1 
ATOM   5463  N N      . HIS B  1 370 ? -61.359  -29.298 27.650  1.00 49.26  ? 363 HIS B N      1 
ATOM   5464  C CA     . HIS B  1 370 ? -59.947  -29.203 28.005  1.00 52.13  ? 363 HIS B CA     1 
ATOM   5465  C C      . HIS B  1 370 ? -59.600  -30.155 29.144  1.00 51.53  ? 363 HIS B C      1 
ATOM   5466  O O      . HIS B  1 370 ? -58.546  -30.801 29.120  1.00 50.19  ? 363 HIS B O      1 
ATOM   5467  C CB     . HIS B  1 370 ? -59.585  -27.768 28.382  1.00 57.63  ? 363 HIS B CB     1 
ATOM   5468  C CG     . HIS B  1 370 ? -58.144  -27.592 28.747  1.00 64.92  ? 363 HIS B CG     1 
ATOM   5469  N ND1    . HIS B  1 370 ? -57.737  -26.840 29.828  1.00 66.49  ? 363 HIS B ND1    1 
ATOM   5470  C CD2    . HIS B  1 370 ? -57.015  -28.076 28.179  1.00 68.08  ? 363 HIS B CD2    1 
ATOM   5471  C CE1    . HIS B  1 370 ? -56.418  -26.868 29.909  1.00 67.95  ? 363 HIS B CE1    1 
ATOM   5472  N NE2    . HIS B  1 370 ? -55.956  -27.610 28.919  1.00 68.97  ? 363 HIS B NE2    1 
ATOM   5473  N N      . ALA B  1 371 ? -60.475  -30.256 30.149  1.00 50.13  ? 364 ALA B N      1 
ATOM   5474  C CA     . ALA B  1 371 ? -60.201  -31.138 31.279  1.00 47.26  ? 364 ALA B CA     1 
ATOM   5475  C C      . ALA B  1 371 ? -60.033  -32.581 30.824  1.00 48.48  ? 364 ALA B C      1 
ATOM   5476  O O      . ALA B  1 371 ? -59.115  -33.279 31.271  1.00 49.62  ? 364 ALA B O      1 
ATOM   5477  C CB     . ALA B  1 371 ? -61.321  -31.031 32.314  1.00 34.39  ? 364 ALA B CB     1 
ATOM   5478  N N      . MET B  1 372 ? -60.916  -33.048 29.939  1.00 48.54  ? 365 MET B N      1 
ATOM   5479  C CA     . MET B  1 372 ? -60.808  -34.418 29.450  1.00 48.64  ? 365 MET B CA     1 
ATOM   5480  C C      . MET B  1 372 ? -59.507  -34.624 28.684  1.00 50.74  ? 365 MET B C      1 
ATOM   5481  O O      . MET B  1 372 ? -58.841  -35.654 28.841  1.00 52.52  ? 365 MET B O      1 
ATOM   5482  C CB     . MET B  1 372 ? -62.017  -34.761 28.576  1.00 48.93  ? 365 MET B CB     1 
ATOM   5483  C CG     . MET B  1 372 ? -63.283  -35.084 29.358  1.00 48.73  ? 365 MET B CG     1 
ATOM   5484  S SD     . MET B  1 372 ? -64.737  -35.192 28.302  1.00 52.13  ? 365 MET B SD     1 
ATOM   5485  C CE     . MET B  1 372 ? -64.164  -36.360 27.074  1.00 56.51  ? 365 MET B CE     1 
ATOM   5486  N N      . ARG B  1 373 ? -59.122  -33.652 27.852  1.00 51.50  ? 366 ARG B N      1 
ATOM   5487  C CA     . ARG B  1 373 ? -57.867  -33.777 27.119  1.00 55.27  ? 366 ARG B CA     1 
ATOM   5488  C C      . ARG B  1 373 ? -56.672  -33.712 28.066  1.00 53.93  ? 366 ARG B C      1 
ATOM   5489  O O      . ARG B  1 373 ? -55.719  -34.485 27.923  1.00 53.10  ? 366 ARG B O      1 
ATOM   5490  C CB     . ARG B  1 373 ? -57.778  -32.711 26.022  1.00 61.50  ? 366 ARG B CB     1 
ATOM   5491  C CG     . ARG B  1 373 ? -57.126  -31.400 26.422  1.00 66.45  ? 366 ARG B CG     1 
ATOM   5492  C CD     . ARG B  1 373 ? -56.969  -30.474 25.216  1.00 70.73  ? 366 ARG B CD     1 
ATOM   5493  N NE     . ARG B  1 373 ? -58.208  -29.777 24.878  1.00 69.70  ? 366 ARG B NE     1 
ATOM   5494  C CZ     . ARG B  1 373 ? -59.141  -30.254 24.059  1.00 67.45  ? 366 ARG B CZ     1 
ATOM   5495  N NH1    . ARG B  1 373 ? -58.982  -31.439 23.486  1.00 67.41  ? 366 ARG B NH1    1 
ATOM   5496  N NH2    . ARG B  1 373 ? -60.235  -29.544 23.817  1.00 65.55  ? 366 ARG B NH2    1 
ATOM   5497  N N      . HIS B  1 374 ? -56.704  -32.798 29.040  1.00 52.45  ? 367 HIS B N      1 
ATOM   5498  C CA     . HIS B  1 374 ? -55.580  -32.654 29.962  1.00 48.96  ? 367 HIS B CA     1 
ATOM   5499  C C      . HIS B  1 374 ? -55.414  -33.892 30.839  1.00 46.28  ? 367 HIS B C      1 
ATOM   5500  O O      . HIS B  1 374 ? -54.307  -34.428 30.967  1.00 42.06  ? 367 HIS B O      1 
ATOM   5501  C CB     . HIS B  1 374 ? -55.763  -31.405 30.825  1.00 49.90  ? 367 HIS B CB     1 
ATOM   5502  C CG     . HIS B  1 374 ? -54.574  -31.079 31.676  1.00 55.09  ? 367 HIS B CG     1 
ATOM   5503  N ND1    . HIS B  1 374 ? -54.408  -31.578 32.951  1.00 53.21  ? 367 HIS B ND1    1 
ATOM   5504  C CD2    . HIS B  1 374 ? -53.489  -30.305 31.432  1.00 57.62  ? 367 HIS B CD2    1 
ATOM   5505  C CE1    . HIS B  1 374 ? -53.275  -31.123 33.456  1.00 55.12  ? 367 HIS B CE1    1 
ATOM   5506  N NE2    . HIS B  1 374 ? -52.696  -30.352 32.553  1.00 57.45  ? 367 HIS B NE2    1 
ATOM   5507  N N      . ILE B  1 375 ? -56.503  -34.358 31.458  1.00 41.61  ? 368 ILE B N      1 
ATOM   5508  C CA     . ILE B  1 375 ? -56.411  -35.508 32.357  1.00 41.71  ? 368 ILE B CA     1 
ATOM   5509  C C      . ILE B  1 375 ? -55.843  -36.716 31.621  1.00 46.70  ? 368 ILE B C      1 
ATOM   5510  O O      . ILE B  1 375 ? -54.932  -37.394 32.110  1.00 49.55  ? 368 ILE B O      1 
ATOM   5511  C CB     . ILE B  1 375 ? -57.782  -35.825 32.980  1.00 39.85  ? 368 ILE B CB     1 
ATOM   5512  C CG1    . ILE B  1 375 ? -58.255  -34.669 33.864  1.00 36.68  ? 368 ILE B CG1    1 
ATOM   5513  C CG2    . ILE B  1 375 ? -57.712  -37.114 33.786  1.00 38.53  ? 368 ILE B CG2    1 
ATOM   5514  C CD1    . ILE B  1 375 ? -59.526  -34.969 34.633  1.00 30.84  ? 368 ILE B CD1    1 
ATOM   5515  N N      . GLN B  1 376 ? -56.376  -37.001 30.432  1.00 47.85  ? 369 GLN B N      1 
ATOM   5516  C CA     . GLN B  1 376 ? -55.928  -38.169 29.681  1.00 51.33  ? 369 GLN B CA     1 
ATOM   5517  C C      . GLN B  1 376 ? -54.438  -38.099 29.381  1.00 52.03  ? 369 GLN B C      1 
ATOM   5518  O O      . GLN B  1 376 ? -53.717  -39.092 29.534  1.00 51.96  ? 369 GLN B O      1 
ATOM   5519  C CB     . GLN B  1 376 ? -56.726  -38.285 28.383  1.00 57.65  ? 369 GLN B CB     1 
ATOM   5520  C CG     . GLN B  1 376 ? -57.719  -39.426 28.359  1.00 62.23  ? 369 GLN B CG     1 
ATOM   5521  C CD     . GLN B  1 376 ? -57.043  -40.774 28.224  1.00 66.71  ? 369 GLN B CD     1 
ATOM   5522  O OE1    . GLN B  1 376 ? -55.829  -40.894 28.396  1.00 68.38  ? 369 GLN B OE1    1 
ATOM   5523  N NE2    . GLN B  1 376 ? -57.827  -41.799 27.909  1.00 67.46  ? 369 GLN B NE2    1 
ATOM   5524  N N      . GLU B  1 377 ? -53.957  -36.929 28.964  1.00 53.46  ? 370 GLU B N      1 
ATOM   5525  C CA     . GLU B  1 377 ? -52.565  -36.794 28.552  1.00 61.30  ? 370 GLU B CA     1 
ATOM   5526  C C      . GLU B  1 377 ? -51.603  -36.941 29.725  1.00 58.89  ? 370 GLU B C      1 
ATOM   5527  O O      . GLU B  1 377 ? -50.469  -37.395 29.540  1.00 58.93  ? 370 GLU B O      1 
ATOM   5528  C CB     . GLU B  1 377 ? -52.381  -35.456 27.837  1.00 65.78  ? 370 GLU B CB     1 
ATOM   5529  C CG     . GLU B  1 377 ? -53.269  -35.335 26.598  1.00 70.01  ? 370 GLU B CG     1 
ATOM   5530  C CD     . GLU B  1 377 ? -53.256  -33.952 25.973  1.00 74.88  ? 370 GLU B CD     1 
ATOM   5531  O OE1    . GLU B  1 377 ? -52.519  -33.076 26.471  1.00 76.04  ? 370 GLU B OE1    1 
ATOM   5532  O OE2    . GLU B  1 377 ? -53.990  -33.746 24.981  1.00 75.20  ? 370 GLU B OE2    1 
ATOM   5533  N N      . HIS B  1 378 ? -52.026  -36.556 30.927  1.00 60.36  ? 371 HIS B N      1 
ATOM   5534  C CA     . HIS B  1 378 ? -51.188  -36.618 32.116  1.00 62.84  ? 371 HIS B CA     1 
ATOM   5535  C C      . HIS B  1 378 ? -51.471  -37.842 32.982  1.00 60.76  ? 371 HIS B C      1 
ATOM   5536  O O      . HIS B  1 378 ? -51.156  -37.835 34.177  1.00 57.13  ? 371 HIS B O      1 
ATOM   5537  C CB     . HIS B  1 378 ? -51.337  -35.330 32.921  1.00 64.83  ? 371 HIS B CB     1 
ATOM   5538  C CG     . HIS B  1 378 ? -50.802  -34.127 32.210  1.00 70.44  ? 371 HIS B CG     1 
ATOM   5539  N ND1    . HIS B  1 378 ? -51.576  -33.351 31.374  1.00 71.47  ? 371 HIS B ND1    1 
ATOM   5540  C CD2    . HIS B  1 378 ? -49.558  -33.594 32.174  1.00 73.52  ? 371 HIS B CD2    1 
ATOM   5541  C CE1    . HIS B  1 378 ? -50.838  -32.377 30.874  1.00 74.45  ? 371 HIS B CE1    1 
ATOM   5542  N NE2    . HIS B  1 378 ? -49.609  -32.503 31.342  1.00 76.04  ? 371 HIS B NE2    1 
ATOM   5543  N N      . TYR B  1 379 ? -52.074  -38.882 32.410  1.00 61.05  ? 372 TYR B N      1 
ATOM   5544  C CA     . TYR B  1 379 ? -52.387  -40.111 33.128  1.00 57.54  ? 372 TYR B CA     1 
ATOM   5545  C C      . TYR B  1 379 ? -51.591  -41.262 32.529  1.00 62.95  ? 372 TYR B C      1 
ATOM   5546  O O      . TYR B  1 379 ? -51.635  -41.488 31.314  1.00 64.31  ? 372 TYR B O      1 
ATOM   5547  C CB     . TYR B  1 379 ? -53.889  -40.414 33.071  1.00 52.83  ? 372 TYR B CB     1 
ATOM   5548  C CG     . TYR B  1 379 ? -54.310  -41.717 33.726  1.00 53.40  ? 372 TYR B CG     1 
ATOM   5549  C CD1    . TYR B  1 379 ? -54.032  -41.971 35.066  1.00 52.12  ? 372 TYR B CD1    1 
ATOM   5550  C CD2    . TYR B  1 379 ? -55.015  -42.681 33.011  1.00 53.48  ? 372 TYR B CD2    1 
ATOM   5551  C CE1    . TYR B  1 379 ? -54.427  -43.159 35.669  1.00 52.28  ? 372 TYR B CE1    1 
ATOM   5552  C CE2    . TYR B  1 379 ? -55.417  -43.868 33.606  1.00 53.97  ? 372 TYR B CE2    1 
ATOM   5553  C CZ     . TYR B  1 379 ? -55.120  -44.102 34.933  1.00 55.89  ? 372 TYR B CZ     1 
ATOM   5554  O OH     . TYR B  1 379 ? -55.518  -45.284 35.518  1.00 57.23  ? 372 TYR B OH     1 
ATOM   5555  N N      . GLY B  1 380 ? -50.861  -41.980 33.380  1.00 65.00  ? 373 GLY B N      1 
ATOM   5556  C CA     . GLY B  1 380 ? -50.081  -43.118 32.934  1.00 69.86  ? 373 GLY B CA     1 
ATOM   5557  C C      . GLY B  1 380 ? -50.939  -44.345 32.708  1.00 67.55  ? 373 GLY B C      1 
ATOM   5558  O O      . GLY B  1 380 ? -50.742  -45.385 33.344  1.00 70.57  ? 373 GLY B O      1 
ATOM   5559  N N      . GLY B  1 381 ? -51.894  -44.224 31.795  1.00 69.07  ? 374 GLY B N      1 
ATOM   5560  C CA     . GLY B  1 381 ? -52.832  -45.292 31.521  1.00 65.34  ? 374 GLY B CA     1 
ATOM   5561  C C      . GLY B  1 381 ? -53.959  -44.779 30.652  1.00 63.14  ? 374 GLY B C      1 
ATOM   5562  O O      . GLY B  1 381 ? -54.034  -43.590 30.327  1.00 61.29  ? 374 GLY B O      1 
ATOM   5563  N N      . THR B  1 382 ? -54.840  -45.702 30.279  1.00 61.41  ? 375 THR B N      1 
ATOM   5564  C CA     . THR B  1 382 ? -56.015  -45.354 29.490  1.00 59.04  ? 375 THR B CA     1 
ATOM   5565  C C      . THR B  1 382 ? -57.174  -45.006 30.415  1.00 48.04  ? 375 THR B C      1 
ATOM   5566  O O      . THR B  1 382 ? -57.505  -45.773 31.325  1.00 42.96  ? 375 THR B O      1 
ATOM   5567  C CB     . THR B  1 382 ? -56.405  -46.504 28.561  1.00 60.92  ? 375 THR B CB     1 
ATOM   5568  O OG1    . THR B  1 382 ? -56.718  -47.668 29.337  1.00 63.99  ? 375 THR B OG1    1 
ATOM   5569  C CG2    . THR B  1 382 ? -55.257  -46.827 27.617  1.00 60.66  ? 375 THR B CG2    1 
ATOM   5570  N N      . ALA B  1 383 ? -57.785  -43.847 30.179  1.00 46.91  ? 376 ALA B N      1 
ATOM   5571  C CA     . ALA B  1 383 ? -58.863  -43.329 31.007  1.00 44.18  ? 376 ALA B CA     1 
ATOM   5572  C C      . ALA B  1 383 ? -60.130  -43.188 30.176  1.00 48.40  ? 376 ALA B C      1 
ATOM   5573  O O      . ALA B  1 383 ? -60.075  -42.807 29.002  1.00 53.29  ? 376 ALA B O      1 
ATOM   5574  C CB     . ALA B  1 383 ? -58.484  -41.976 31.623  1.00 36.52  ? 376 ALA B CB     1 
ATOM   5575  N N      . THR B  1 384 ? -61.268  -43.502 30.788  1.00 49.22  ? 377 THR B N      1 
ATOM   5576  C CA     . THR B  1 384 ? -62.575  -43.325 30.176  1.00 50.20  ? 377 THR B CA     1 
ATOM   5577  C C      . THR B  1 384 ? -63.321  -42.204 30.891  1.00 49.36  ? 377 THR B C      1 
ATOM   5578  O O      . THR B  1 384 ? -63.179  -42.018 32.103  1.00 49.01  ? 377 THR B O      1 
ATOM   5579  C CB     . THR B  1 384 ? -63.387  -44.625 30.226  1.00 53.24  ? 377 THR B CB     1 
ATOM   5580  O OG1    . THR B  1 384 ? -62.571  -45.718 29.783  1.00 54.34  ? 377 THR B OG1    1 
ATOM   5581  C CG2    . THR B  1 384 ? -64.605  -44.527 29.322  1.00 54.89  ? 377 THR B CG2    1 
ATOM   5582  N N      . PHE B  1 385 ? -64.123  -41.458 30.136  1.00 49.98  ? 378 PHE B N      1 
ATOM   5583  C CA     . PHE B  1 385 ? -64.823  -40.293 30.660  1.00 46.41  ? 378 PHE B CA     1 
ATOM   5584  C C      . PHE B  1 385 ? -66.323  -40.417 30.433  1.00 46.95  ? 378 PHE B C      1 
ATOM   5585  O O      . PHE B  1 385 ? -66.768  -40.902 29.387  1.00 47.90  ? 378 PHE B O      1 
ATOM   5586  C CB     . PHE B  1 385 ? -64.333  -38.991 30.016  1.00 42.15  ? 378 PHE B CB     1 
ATOM   5587  C CG     . PHE B  1 385 ? -62.866  -38.731 30.192  1.00 43.38  ? 378 PHE B CG     1 
ATOM   5588  C CD1    . PHE B  1 385 ? -62.365  -38.295 31.409  1.00 39.62  ? 378 PHE B CD1    1 
ATOM   5589  C CD2    . PHE B  1 385 ? -61.993  -38.885 29.129  1.00 44.17  ? 378 PHE B CD2    1 
ATOM   5590  C CE1    . PHE B  1 385 ? -61.018  -38.045 31.568  1.00 36.60  ? 378 PHE B CE1    1 
ATOM   5591  C CE2    . PHE B  1 385 ? -60.646  -38.635 29.283  1.00 43.35  ? 378 PHE B CE2    1 
ATOM   5592  C CZ     . PHE B  1 385 ? -60.158  -38.212 30.503  1.00 41.51  ? 378 PHE B CZ     1 
ATOM   5593  N N      . TYR B  1 386 ? -67.094  -39.972 31.421  1.00 42.68  ? 379 TYR B N      1 
ATOM   5594  C CA     . TYR B  1 386 ? -68.541  -39.847 31.302  1.00 37.68  ? 379 TYR B CA     1 
ATOM   5595  C C      . TYR B  1 386 ? -68.955  -38.464 31.778  1.00 35.57  ? 379 TYR B C      1 
ATOM   5596  O O      . TYR B  1 386 ? -68.738  -38.114 32.943  1.00 38.86  ? 379 TYR B O      1 
ATOM   5597  C CB     . TYR B  1 386 ? -69.265  -40.932 32.107  1.00 40.63  ? 379 TYR B CB     1 
ATOM   5598  C CG     . TYR B  1 386 ? -68.800  -42.342 31.813  1.00 47.04  ? 379 TYR B CG     1 
ATOM   5599  C CD1    . TYR B  1 386 ? -69.381  -43.086 30.791  1.00 50.13  ? 379 TYR B CD1    1 
ATOM   5600  C CD2    . TYR B  1 386 ? -67.791  -42.934 32.561  1.00 46.40  ? 379 TYR B CD2    1 
ATOM   5601  C CE1    . TYR B  1 386 ? -68.964  -44.376 30.518  1.00 51.10  ? 379 TYR B CE1    1 
ATOM   5602  C CE2    . TYR B  1 386 ? -67.369  -44.221 32.297  1.00 48.69  ? 379 TYR B CE2    1 
ATOM   5603  C CZ     . TYR B  1 386 ? -67.956  -44.938 31.276  1.00 52.10  ? 379 TYR B CZ     1 
ATOM   5604  O OH     . TYR B  1 386 ? -67.526  -46.220 31.022  1.00 55.20  ? 379 TYR B OH     1 
ATOM   5605  N N      . LEU B  1 387 ? -69.550  -37.683 30.880  1.00 33.70  ? 380 LEU B N      1 
ATOM   5606  C CA     . LEU B  1 387 ? -70.167  -36.406 31.233  1.00 38.34  ? 380 LEU B CA     1 
ATOM   5607  C C      . LEU B  1 387 ? -71.644  -36.668 31.488  1.00 43.42  ? 380 LEU B C      1 
ATOM   5608  O O      . LEU B  1 387 ? -72.427  -36.841 30.551  1.00 49.88  ? 380 LEU B O      1 
ATOM   5609  C CB     . LEU B  1 387 ? -69.965  -35.381 30.124  1.00 37.50  ? 380 LEU B CB     1 
ATOM   5610  C CG     . LEU B  1 387 ? -68.552  -34.828 29.943  1.00 39.66  ? 380 LEU B CG     1 
ATOM   5611  C CD1    . LEU B  1 387 ? -68.472  -34.013 28.663  1.00 38.62  ? 380 LEU B CD1    1 
ATOM   5612  C CD2    . LEU B  1 387 ? -68.147  -33.983 31.139  1.00 37.59  ? 380 LEU B CD2    1 
ATOM   5613  N N      . SER B  1 388 ? -72.031  -36.697 32.759  1.00 41.57  ? 381 SER B N      1 
ATOM   5614  C CA     . SER B  1 388 ? -73.372  -37.107 33.138  1.00 41.53  ? 381 SER B CA     1 
ATOM   5615  C C      . SER B  1 388 ? -74.089  -36.010 33.910  1.00 40.60  ? 381 SER B C      1 
ATOM   5616  O O      . SER B  1 388 ? -73.471  -35.220 34.630  1.00 39.64  ? 381 SER B O      1 
ATOM   5617  C CB     . SER B  1 388 ? -73.342  -38.382 33.988  1.00 41.19  ? 381 SER B CB     1 
ATOM   5618  O OG     . SER B  1 388 ? -74.658  -38.841 34.237  1.00 39.37  ? 381 SER B OG     1 
ATOM   5619  N N      . GLN B  1 389 ? -75.404  -35.978 33.744  1.00 43.11  ? 382 GLN B N      1 
ATOM   5620  C CA     . GLN B  1 389 ? -76.309  -35.192 34.565  1.00 40.96  ? 382 GLN B CA     1 
ATOM   5621  C C      . GLN B  1 389 ? -76.987  -36.119 35.566  1.00 38.47  ? 382 GLN B C      1 
ATOM   5622  O O      . GLN B  1 389 ? -76.947  -37.344 35.430  1.00 37.13  ? 382 GLN B O      1 
ATOM   5623  C CB     . GLN B  1 389 ? -77.361  -34.486 33.703  1.00 48.91  ? 382 GLN B CB     1 
ATOM   5624  C CG     . GLN B  1 389 ? -76.806  -33.539 32.645  1.00 58.54  ? 382 GLN B CG     1 
ATOM   5625  C CD     . GLN B  1 389 ? -77.893  -32.985 31.734  1.00 65.77  ? 382 GLN B CD     1 
ATOM   5626  O OE1    . GLN B  1 389 ? -78.734  -33.729 31.230  1.00 66.23  ? 382 GLN B OE1    1 
ATOM   5627  N NE2    . GLN B  1 389 ? -77.880  -31.673 31.523  1.00 70.94  ? 382 GLN B NE2    1 
ATOM   5628  N N      . ALA B  1 390 ? -77.611  -35.529 36.580  1.00 37.32  ? 383 ALA B N      1 
ATOM   5629  C CA     . ALA B  1 390 ? -78.365  -36.341 37.522  1.00 31.28  ? 383 ALA B CA     1 
ATOM   5630  C C      . ALA B  1 390 ? -79.547  -36.963 36.794  1.00 35.05  ? 383 ALA B C      1 
ATOM   5631  O O      . ALA B  1 390 ? -80.317  -36.264 36.128  1.00 37.86  ? 383 ALA B O      1 
ATOM   5632  C CB     . ALA B  1 390 ? -78.837  -35.500 38.705  1.00 24.51  ? 383 ALA B CB     1 
ATOM   5633  N N      . ALA B  1 391 ? -79.696  -38.275 36.923  1.00 36.59  ? 384 ALA B N      1 
ATOM   5634  C CA     . ALA B  1 391 ? -80.660  -39.025 36.135  1.00 35.42  ? 384 ALA B CA     1 
ATOM   5635  C C      . ALA B  1 391 ? -81.764  -39.587 37.018  1.00 33.51  ? 384 ALA B C      1 
ATOM   5636  O O      . ALA B  1 391 ? -81.736  -39.481 38.247  1.00 28.84  ? 384 ALA B O      1 
ATOM   5637  C CB     . ALA B  1 391 ? -79.962  -40.153 35.368  1.00 26.03  ? 384 ALA B CB     1 
ATOM   5638  N N      . ASP B  1 392 ? -82.752  -40.191 36.364  1.00 37.72  ? 385 ASP B N      1 
ATOM   5639  C CA     . ASP B  1 392 ? -83.866  -40.804 37.064  1.00 38.57  ? 385 ASP B CA     1 
ATOM   5640  C C      . ASP B  1 392 ? -83.459  -42.142 37.670  1.00 32.79  ? 385 ASP B C      1 
ATOM   5641  O O      . ASP B  1 392 ? -82.502  -42.792 37.239  1.00 31.47  ? 385 ASP B O      1 
ATOM   5642  C CB     . ASP B  1 392 ? -85.050  -41.024 36.118  1.00 50.29  ? 385 ASP B CB     1 
ATOM   5643  C CG     . ASP B  1 392 ? -85.793  -39.743 35.790  1.00 60.69  ? 385 ASP B CG     1 
ATOM   5644  O OD1    . ASP B  1 392 ? -86.119  -38.984 36.728  1.00 63.96  ? 385 ASP B OD1    1 
ATOM   5645  O OD2    . ASP B  1 392 ? -86.059  -39.507 34.592  1.00 63.42  ? 385 ASP B OD2    1 
ATOM   5646  N N      . GLY B  1 393 ? -84.221  -42.559 38.674  1.00 30.48  ? 386 GLY B N      1 
ATOM   5647  C CA     . GLY B  1 393 ? -84.052  -43.864 39.268  1.00 30.53  ? 386 GLY B CA     1 
ATOM   5648  C C      . GLY B  1 393 ? -84.763  -44.929 38.457  1.00 33.31  ? 386 GLY B C      1 
ATOM   5649  O O      . GLY B  1 393 ? -85.163  -44.725 37.310  1.00 33.72  ? 386 GLY B O      1 
ATOM   5650  N N      . ALA B  1 394 ? -84.912  -46.097 39.077  1.00 32.49  ? 387 ALA B N      1 
ATOM   5651  C CA     . ALA B  1 394 ? -85.546  -47.217 38.399  1.00 36.02  ? 387 ALA B CA     1 
ATOM   5652  C C      . ALA B  1 394 ? -86.919  -46.810 37.883  1.00 41.11  ? 387 ALA B C      1 
ATOM   5653  O O      . ALA B  1 394 ? -87.657  -46.077 38.547  1.00 44.19  ? 387 ALA B O      1 
ATOM   5654  C CB     . ALA B  1 394 ? -85.671  -48.410 39.348  1.00 32.01  ? 387 ALA B CB     1 
ATOM   5655  N N      . LYS B  1 395 ? -87.259  -47.291 36.689  1.00 39.43  ? 388 LYS B N      1 
ATOM   5656  C CA     . LYS B  1 395 ? -88.557  -47.012 36.098  1.00 42.11  ? 388 LYS B CA     1 
ATOM   5657  C C      . LYS B  1 395 ? -88.945  -48.159 35.179  1.00 43.57  ? 388 LYS B C      1 
ATOM   5658  O O      . LYS B  1 395 ? -88.094  -48.903 34.682  1.00 44.99  ? 388 LYS B O      1 
ATOM   5659  C CB     . LYS B  1 395 ? -88.566  -45.690 35.312  1.00 36.14  ? 388 LYS B CB     1 
ATOM   5660  C CG     . LYS B  1 395 ? -87.633  -45.669 34.109  1.00 35.62  ? 388 LYS B CG     1 
ATOM   5661  C CD     . LYS B  1 395 ? -87.757  -44.371 33.325  1.00 43.32  ? 388 LYS B CD     1 
ATOM   5662  C CE     . LYS B  1 395 ? -87.262  -43.171 34.110  1.00 46.28  ? 388 LYS B CE     1 
ATOM   5663  N NZ     . LYS B  1 395 ? -87.015  -42.005 33.215  1.00 47.82  ? 388 LYS B NZ     1 
ATOM   5664  N N      . VAL B  1 396 ? -90.249  -48.284 34.959  1.00 40.17  ? 389 VAL B N      1 
ATOM   5665  C CA     . VAL B  1 396 ? -90.784  -49.238 33.998  1.00 44.18  ? 389 VAL B CA     1 
ATOM   5666  C C      . VAL B  1 396 ? -90.738  -48.620 32.609  1.00 48.88  ? 389 VAL B C      1 
ATOM   5667  O O      . VAL B  1 396 ? -90.957  -47.413 32.437  1.00 52.01  ? 389 VAL B O      1 
ATOM   5668  C CB     . VAL B  1 396 ? -92.217  -49.647 34.384  1.00 44.61  ? 389 VAL B CB     1 
ATOM   5669  C CG1    . VAL B  1 396 ? -92.739  -50.727 33.443  1.00 46.94  ? 389 VAL B CG1    1 
ATOM   5670  C CG2    . VAL B  1 396 ? -92.257  -50.120 35.827  1.00 44.28  ? 389 VAL B CG2    1 
ATOM   5671  N N      . LEU B  1 397 ? -90.452  -49.447 31.609  1.00 50.29  ? 390 LEU B N      1 
ATOM   5672  C CA     . LEU B  1 397 ? -90.448  -49.023 30.216  1.00 44.52  ? 390 LEU B CA     1 
ATOM   5673  C C      . LEU B  1 397 ? -91.535  -49.806 29.496  1.00 48.17  ? 390 LEU B C      1 
ATOM   5674  O O      . LEU B  1 397 ? -91.494  -51.041 29.468  1.00 48.39  ? 390 LEU B O      1 
ATOM   5675  C CB     . LEU B  1 397 ? -89.085  -49.274 29.574  1.00 43.38  ? 390 LEU B CB     1 
ATOM   5676  C CG     . LEU B  1 397 ? -87.884  -48.683 30.313  1.00 42.14  ? 390 LEU B CG     1 
ATOM   5677  C CD1    . LEU B  1 397 ? -86.597  -49.030 29.578  1.00 41.52  ? 390 LEU B CD1    1 
ATOM   5678  C CD2    . LEU B  1 397 ? -88.030  -47.180 30.503  1.00 43.14  ? 390 LEU B CD2    1 
ATOM   5679  N N      . CYS B  1 398 ? -92.496  -49.097 28.910  1.00 50.35  ? 391 CYS B N      1 
ATOM   5680  C CA     . CYS B  1 398 ? -93.623  -49.756 28.263  1.00 55.33  ? 391 CYS B CA     1 
ATOM   5681  C C      . CYS B  1 398 ? -93.287  -50.142 26.829  1.00 56.50  ? 391 CYS B C      1 
ATOM   5682  O O      . CYS B  1 398 ? -92.883  -49.299 26.024  1.00 54.49  ? 391 CYS B O      1 
ATOM   5683  C CB     . CYS B  1 398 ? -94.860  -48.862 28.292  1.00 58.15  ? 391 CYS B CB     1 
ATOM   5684  S SG     . CYS B  1 398 ? -95.498  -48.522 29.949  1.00 66.31  ? 391 CYS B SG     1 
ATOM   5685  N N      . LEU B  1 399 ? -93.463  -51.422 26.519  1.00 60.26  ? 392 LEU B N      1 
ATOM   5686  C CA     . LEU B  1 399 ? -93.225  -51.947 25.183  1.00 62.90  ? 392 LEU B CA     1 
ATOM   5687  C C      . LEU B  1 399 ? -94.523  -51.975 24.381  1.00 73.00  ? 392 LEU B C      1 
ATOM   5688  O O      . LEU B  1 399 ? -95.589  -52.292 24.911  1.00 76.23  ? 392 LEU B O      1 
ATOM   5689  C CB     . LEU B  1 399 ? -92.616  -53.345 25.269  1.00 59.96  ? 392 LEU B CB     1 
ATOM   5690  C CG     . LEU B  1 399 ? -91.199  -53.410 25.839  1.00 56.11  ? 392 LEU B CG     1 
ATOM   5691  C CD1    . LEU B  1 399 ? -90.760  -54.850 26.024  1.00 55.01  ? 392 LEU B CD1    1 
ATOM   5692  C CD2    . LEU B  1 399 ? -90.234  -52.670 24.927  1.00 55.54  ? 392 LEU B CD2    1 
ATOM   5693  O OXT    . LEU B  1 399 ? -94.540  -51.673 23.188  1.00 79.28  ? 392 LEU B OXT    1 
ATOM   5694  N N      . LEU C  1 11  ? -37.535  -43.643 52.627  1.00 66.36  ? 4   LEU C N      1 
ATOM   5695  C CA     . LEU C  1 11  ? -37.899  -43.712 51.216  1.00 67.03  ? 4   LEU C CA     1 
ATOM   5696  C C      . LEU C  1 11  ? -37.157  -44.840 50.510  1.00 70.60  ? 4   LEU C C      1 
ATOM   5697  O O      . LEU C  1 11  ? -36.639  -45.755 51.153  1.00 73.85  ? 4   LEU C O      1 
ATOM   5698  C CB     . LEU C  1 11  ? -37.614  -42.382 50.517  1.00 63.09  ? 4   LEU C CB     1 
ATOM   5699  N N      . ARG C  1 12  ? -37.106  -44.766 49.181  1.00 69.58  ? 5   ARG C N      1 
ATOM   5700  C CA     . ARG C  1 12  ? -36.516  -45.814 48.356  1.00 69.53  ? 5   ARG C CA     1 
ATOM   5701  C C      . ARG C  1 12  ? -35.562  -45.191 47.349  1.00 68.89  ? 5   ARG C C      1 
ATOM   5702  O O      . ARG C  1 12  ? -35.902  -44.198 46.698  1.00 67.82  ? 5   ARG C O      1 
ATOM   5703  C CB     . ARG C  1 12  ? -37.599  -46.623 47.633  1.00 70.57  ? 5   ARG C CB     1 
ATOM   5704  N N      . GLN C  1 13  ? -34.379  -45.784 47.212  1.00 68.21  ? 6   GLN C N      1 
ATOM   5705  C CA     . GLN C  1 13  ? -33.317  -45.250 46.361  1.00 63.01  ? 6   GLN C CA     1 
ATOM   5706  C C      . GLN C  1 13  ? -32.795  -46.341 45.434  1.00 59.69  ? 6   GLN C C      1 
ATOM   5707  O O      . GLN C  1 13  ? -32.019  -47.210 45.867  1.00 59.53  ? 6   GLN C O      1 
ATOM   5708  C CB     . GLN C  1 13  ? -32.189  -44.669 47.206  1.00 62.51  ? 6   GLN C CB     1 
ATOM   5709  C CG     . GLN C  1 13  ? -32.674  -43.751 48.318  1.00 63.68  ? 6   GLN C CG     1 
ATOM   5710  C CD     . GLN C  1 13  ? -31.541  -43.043 49.032  1.00 62.83  ? 6   GLN C CD     1 
ATOM   5711  O OE1    . GLN C  1 13  ? -30.389  -43.102 48.602  1.00 61.16  ? 6   GLN C OE1    1 
ATOM   5712  N NE2    . GLN C  1 13  ? -31.862  -42.367 50.131  1.00 63.28  ? 6   GLN C NE2    1 
ATOM   5713  N N      . PRO C  1 14  ? -33.185  -46.327 44.160  1.00 58.01  ? 7   PRO C N      1 
ATOM   5714  C CA     . PRO C  1 14  ? -32.767  -47.400 43.250  1.00 55.41  ? 7   PRO C CA     1 
ATOM   5715  C C      . PRO C  1 14  ? -31.257  -47.428 43.082  1.00 53.05  ? 7   PRO C C      1 
ATOM   5716  O O      . PRO C  1 14  ? -30.576  -46.410 43.215  1.00 52.15  ? 7   PRO C O      1 
ATOM   5717  C CB     . PRO C  1 14  ? -33.466  -47.056 41.930  1.00 56.65  ? 7   PRO C CB     1 
ATOM   5718  C CG     . PRO C  1 14  ? -33.880  -45.638 42.033  1.00 55.07  ? 7   PRO C CG     1 
ATOM   5719  C CD     . PRO C  1 14  ? -33.809  -45.192 43.460  1.00 58.15  ? 7   PRO C CD     1 
ATOM   5720  N N      . GLN C  1 15  ? -30.743  -48.612 42.768  1.00 54.06  ? 8   GLN C N      1 
ATOM   5721  C CA     . GLN C  1 15  ? -29.320  -48.810 42.551  1.00 52.85  ? 8   GLN C CA     1 
ATOM   5722  C C      . GLN C  1 15  ? -28.989  -48.653 41.070  1.00 54.11  ? 8   GLN C C      1 
ATOM   5723  O O      . GLN C  1 15  ? -29.872  -48.581 40.212  1.00 53.96  ? 8   GLN C O      1 
ATOM   5724  C CB     . GLN C  1 15  ? -28.885  -50.186 43.053  1.00 52.71  ? 8   GLN C CB     1 
ATOM   5725  N N      . VAL C  1 16  ? -27.687  -48.606 40.778  1.00 53.31  ? 9   VAL C N      1 
ATOM   5726  C CA     . VAL C  1 16  ? -27.230  -48.276 39.429  1.00 52.24  ? 9   VAL C CA     1 
ATOM   5727  C C      . VAL C  1 16  ? -27.827  -49.234 38.405  1.00 53.95  ? 9   VAL C C      1 
ATOM   5728  O O      . VAL C  1 16  ? -28.253  -48.818 37.321  1.00 51.06  ? 9   VAL C O      1 
ATOM   5729  C CB     . VAL C  1 16  ? -25.690  -48.277 39.373  1.00 51.09  ? 9   VAL C CB     1 
ATOM   5730  C CG1    . VAL C  1 16  ? -25.203  -47.490 38.169  1.00 46.89  ? 9   VAL C CG1    1 
ATOM   5731  C CG2    . VAL C  1 16  ? -25.106  -47.712 40.658  1.00 55.52  ? 9   VAL C CG2    1 
ATOM   5732  N N      . ALA C  1 17  ? -27.870  -50.529 38.727  1.00 54.07  ? 10  ALA C N      1 
ATOM   5733  C CA     . ALA C  1 17  ? -28.378  -51.507 37.769  1.00 51.12  ? 10  ALA C CA     1 
ATOM   5734  C C      . ALA C  1 17  ? -29.832  -51.228 37.405  1.00 47.72  ? 10  ALA C C      1 
ATOM   5735  O O      . ALA C  1 17  ? -30.210  -51.306 36.230  1.00 49.70  ? 10  ALA C O      1 
ATOM   5736  C CB     . ALA C  1 17  ? -28.228  -52.921 38.329  1.00 49.82  ? 10  ALA C CB     1 
ATOM   5737  N N      . GLU C  1 18  ? -30.664  -50.899 38.397  1.00 47.11  ? 11  GLU C N      1 
ATOM   5738  C CA     . GLU C  1 18  ? -32.067  -50.602 38.118  1.00 50.51  ? 11  GLU C CA     1 
ATOM   5739  C C      . GLU C  1 18  ? -32.212  -49.393 37.203  1.00 48.69  ? 11  GLU C C      1 
ATOM   5740  O O      . GLU C  1 18  ? -32.973  -49.424 36.230  1.00 48.30  ? 11  GLU C O      1 
ATOM   5741  C CB     . GLU C  1 18  ? -32.821  -50.358 39.425  1.00 54.97  ? 11  GLU C CB     1 
ATOM   5742  C CG     . GLU C  1 18  ? -34.321  -50.170 39.244  1.00 60.79  ? 11  GLU C CG     1 
ATOM   5743  C CD     . GLU C  1 18  ? -35.039  -49.941 40.562  1.00 67.17  ? 11  GLU C CD     1 
ATOM   5744  O OE1    . GLU C  1 18  ? -34.516  -50.389 41.606  1.00 70.30  ? 11  GLU C OE1    1 
ATOM   5745  O OE2    . GLU C  1 18  ? -36.107  -49.290 40.557  1.00 68.64  ? 11  GLU C OE2    1 
ATOM   5746  N N      . LEU C  1 19  ? -31.488  -48.313 37.503  1.00 47.12  ? 12  LEU C N      1 
ATOM   5747  C CA     . LEU C  1 19  ? -31.576  -47.115 36.674  1.00 43.43  ? 12  LEU C CA     1 
ATOM   5748  C C      . LEU C  1 19  ? -31.014  -47.369 35.281  1.00 43.49  ? 12  LEU C C      1 
ATOM   5749  O O      . LEU C  1 19  ? -31.602  -46.945 34.280  1.00 47.39  ? 12  LEU C O      1 
ATOM   5750  C CB     . LEU C  1 19  ? -30.862  -45.954 37.364  1.00 43.75  ? 12  LEU C CB     1 
ATOM   5751  C CG     . LEU C  1 19  ? -31.639  -45.433 38.579  1.00 44.75  ? 12  LEU C CG     1 
ATOM   5752  C CD1    . LEU C  1 19  ? -30.887  -44.308 39.286  1.00 41.69  ? 12  LEU C CD1    1 
ATOM   5753  C CD2    . LEU C  1 19  ? -33.046  -44.999 38.202  1.00 44.70  ? 12  LEU C CD2    1 
ATOM   5754  N N      . LEU C  1 20  ? -29.875  -48.059 35.198  1.00 39.90  ? 13  LEU C N      1 
ATOM   5755  C CA     . LEU C  1 20  ? -29.303  -48.385 33.897  1.00 43.39  ? 13  LEU C CA     1 
ATOM   5756  C C      . LEU C  1 20  ? -30.266  -49.224 33.062  1.00 48.66  ? 13  LEU C C      1 
ATOM   5757  O O      . LEU C  1 20  ? -30.386  -49.016 31.850  1.00 48.25  ? 13  LEU C O      1 
ATOM   5758  C CB     . LEU C  1 20  ? -27.970  -49.108 34.077  1.00 46.32  ? 13  LEU C CB     1 
ATOM   5759  C CG     . LEU C  1 20  ? -27.222  -49.457 32.788  1.00 48.64  ? 13  LEU C CG     1 
ATOM   5760  C CD1    . LEU C  1 20  ? -26.960  -48.219 31.945  1.00 30.47  ? 13  LEU C CD1    1 
ATOM   5761  C CD2    . LEU C  1 20  ? -25.920  -50.188 33.096  1.00 32.22  ? 13  LEU C CD2    1 
ATOM   5762  N N      . ALA C  1 21  ? -30.966  -50.175 33.693  1.00 51.10  ? 14  ALA C N      1 
ATOM   5763  C CA     . ALA C  1 21  ? -31.914  -51.011 32.959  1.00 49.58  ? 14  ALA C CA     1 
ATOM   5764  C C      . ALA C  1 21  ? -33.105  -50.204 32.474  1.00 47.76  ? 14  ALA C C      1 
ATOM   5765  O O      . ALA C  1 21  ? -33.538  -50.343 31.323  1.00 51.94  ? 14  ALA C O      1 
ATOM   5766  C CB     . ALA C  1 21  ? -32.408  -52.149 33.848  1.00 49.24  ? 14  ALA C CB     1 
ATOM   5767  N N      . GLU C  1 22  ? -33.637  -49.349 33.341  1.00 47.13  ? 15  GLU C N      1 
ATOM   5768  C CA     . GLU C  1 22  ? -34.733  -48.486 32.941  1.00 48.44  ? 15  GLU C CA     1 
ATOM   5769  C C      . GLU C  1 22  ? -34.306  -47.553 31.812  1.00 48.21  ? 15  GLU C C      1 
ATOM   5770  O O      . GLU C  1 22  ? -35.065  -47.329 30.861  1.00 48.63  ? 15  GLU C O      1 
ATOM   5771  C CB     . GLU C  1 22  ? -35.231  -47.710 34.155  1.00 50.29  ? 15  GLU C CB     1 
ATOM   5772  C CG     . GLU C  1 22  ? -35.993  -46.483 33.792  1.00 54.83  ? 15  GLU C CG     1 
ATOM   5773  C CD     . GLU C  1 22  ? -36.435  -45.717 35.003  1.00 58.47  ? 15  GLU C CD     1 
ATOM   5774  O OE1    . GLU C  1 22  ? -36.332  -46.272 36.117  1.00 61.24  ? 15  GLU C OE1    1 
ATOM   5775  O OE2    . GLU C  1 22  ? -36.879  -44.563 34.838  1.00 57.59  ? 15  GLU C OE2    1 
ATOM   5776  N N      . ALA C  1 23  ? -33.084  -47.016 31.887  1.00 49.56  ? 16  ALA C N      1 
ATOM   5777  C CA     . ALA C  1 23  ? -32.617  -46.107 30.848  1.00 51.67  ? 16  ALA C CA     1 
ATOM   5778  C C      . ALA C  1 23  ? -32.393  -46.848 29.539  1.00 53.85  ? 16  ALA C C      1 
ATOM   5779  O O      . ALA C  1 23  ? -32.562  -46.265 28.458  1.00 55.99  ? 16  ALA C O      1 
ATOM   5780  C CB     . ALA C  1 23  ? -31.343  -45.397 31.309  1.00 46.10  ? 16  ALA C CB     1 
ATOM   5781  N N      . ARG C  1 24  ? -32.019  -48.129 29.627  1.00 59.18  ? 17  ARG C N      1 
ATOM   5782  C CA     . ARG C  1 24  ? -31.778  -48.916 28.429  1.00 59.45  ? 17  ARG C CA     1 
ATOM   5783  C C      . ARG C  1 24  ? -33.093  -49.263 27.735  1.00 55.94  ? 17  ARG C C      1 
ATOM   5784  O O      . ARG C  1 24  ? -33.191  -49.160 26.511  1.00 55.96  ? 17  ARG C O      1 
ATOM   5785  C CB     . ARG C  1 24  ? -30.996  -50.176 28.791  1.00 64.92  ? 17  ARG C CB     1 
ATOM   5786  C CG     . ARG C  1 24  ? -29.545  -49.929 29.092  1.00 73.18  ? 17  ARG C CG     1 
ATOM   5787  C CD     . ARG C  1 24  ? -28.830  -51.237 29.407  1.00 85.75  ? 17  ARG C CD     1 
ATOM   5788  N NE     . ARG C  1 24  ? -28.951  -51.710 30.790  1.00 93.63  ? 17  ARG C NE     1 
ATOM   5789  C CZ     . ARG C  1 24  ? -29.707  -52.737 31.180  1.00 98.36  ? 17  ARG C CZ     1 
ATOM   5790  N NH1    . ARG C  1 24  ? -30.444  -53.403 30.300  1.00 98.42  ? 17  ARG C NH1    1 
ATOM   5791  N NH2    . ARG C  1 24  ? -29.739  -53.096 32.454  1.00 103.67 ? 17  ARG C NH2    1 
ATOM   5792  N N      . ARG C  1 25  ? -34.115  -49.685 28.490  1.00 52.76  ? 18  ARG C N      1 
ATOM   5793  C CA     . ARG C  1 25  ? -35.432  -49.912 27.891  1.00 53.39  ? 18  ARG C CA     1 
ATOM   5794  C C      . ARG C  1 25  ? -35.976  -48.646 27.230  1.00 47.69  ? 18  ARG C C      1 
ATOM   5795  O O      . ARG C  1 25  ? -36.494  -48.694 26.108  1.00 46.07  ? 18  ARG C O      1 
ATOM   5796  C CB     . ARG C  1 25  ? -36.414  -50.411 28.955  1.00 53.96  ? 18  ARG C CB     1 
ATOM   5797  N N      . ALA C  1 26  ? -35.875  -47.500 27.913  1.00 43.51  ? 19  ALA C N      1 
ATOM   5798  C CA     . ALA C  1 26  ? -36.409  -46.262 27.346  1.00 35.07  ? 19  ALA C CA     1 
ATOM   5799  C C      . ALA C  1 26  ? -35.680  -45.867 26.067  1.00 34.39  ? 19  ALA C C      1 
ATOM   5800  O O      . ALA C  1 26  ? -36.314  -45.420 25.104  1.00 34.79  ? 19  ALA C O      1 
ATOM   5801  C CB     . ALA C  1 26  ? -36.336  -45.127 28.370  1.00 38.16  ? 19  ALA C CB     1 
ATOM   5802  N N      . PHE C  1 27  ? -34.352  -46.012 26.037  1.00 40.10  ? 20  PHE C N      1 
ATOM   5803  C CA     . PHE C  1 27  ? -33.611  -45.698 24.820  1.00 39.26  ? 20  PHE C CA     1 
ATOM   5804  C C      . PHE C  1 27  ? -34.011  -46.637 23.688  1.00 44.07  ? 20  PHE C C      1 
ATOM   5805  O O      . PHE C  1 27  ? -34.127  -46.217 22.530  1.00 46.28  ? 20  PHE C O      1 
ATOM   5806  C CB     . PHE C  1 27  ? -32.107  -45.774 25.084  1.00 36.68  ? 20  PHE C CB     1 
ATOM   5807  C CG     . PHE C  1 27  ? -31.265  -45.343 23.920  1.00 38.02  ? 20  PHE C CG     1 
ATOM   5808  C CD1    . PHE C  1 27  ? -31.000  -46.219 22.880  1.00 40.65  ? 20  PHE C CD1    1 
ATOM   5809  C CD2    . PHE C  1 27  ? -30.734  -44.067 23.865  1.00 38.89  ? 20  PHE C CD2    1 
ATOM   5810  C CE1    . PHE C  1 27  ? -30.224  -45.829 21.803  1.00 38.80  ? 20  PHE C CE1    1 
ATOM   5811  C CE2    . PHE C  1 27  ? -29.955  -43.670 22.792  1.00 37.63  ? 20  PHE C CE2    1 
ATOM   5812  C CZ     . PHE C  1 27  ? -29.699  -44.552 21.760  1.00 38.33  ? 20  PHE C CZ     1 
ATOM   5813  N N      . ARG C  1 28  ? -34.240  -47.912 24.009  1.00 48.44  ? 21  ARG C N      1 
ATOM   5814  C CA     . ARG C  1 28  ? -34.667  -48.870 22.994  1.00 50.36  ? 21  ARG C CA     1 
ATOM   5815  C C      . ARG C  1 28  ? -36.034  -48.498 22.432  1.00 44.67  ? 21  ARG C C      1 
ATOM   5816  O O      . ARG C  1 28  ? -36.220  -48.428 21.211  1.00 39.20  ? 21  ARG C O      1 
ATOM   5817  C CB     . ARG C  1 28  ? -34.697  -50.281 23.585  1.00 55.31  ? 21  ARG C CB     1 
ATOM   5818  C CG     . ARG C  1 28  ? -33.554  -51.189 23.161  1.00 60.09  ? 21  ARG C CG     1 
ATOM   5819  C CD     . ARG C  1 28  ? -33.152  -52.076 24.318  1.00 65.82  ? 21  ARG C CD     1 
ATOM   5820  N NE     . ARG C  1 28  ? -34.293  -52.574 25.079  1.00 71.82  ? 21  ARG C NE     1 
ATOM   5821  C CZ     . ARG C  1 28  ? -34.193  -53.103 26.293  1.00 74.54  ? 21  ARG C CZ     1 
ATOM   5822  N NH1    . ARG C  1 28  ? -35.273  -53.528 26.938  1.00 76.36  ? 21  ARG C NH1    1 
ATOM   5823  N NH2    . ARG C  1 28  ? -33.004  -53.196 26.866  1.00 73.32  ? 21  ARG C NH2    1 
ATOM   5824  N N      . GLU C  1 29  ? -37.012  -48.277 23.312  1.00 45.75  ? 22  GLU C N      1 
ATOM   5825  C CA     . GLU C  1 29  ? -38.349  -47.912 22.855  1.00 47.60  ? 22  GLU C CA     1 
ATOM   5826  C C      . GLU C  1 29  ? -38.339  -46.640 22.016  1.00 48.11  ? 22  GLU C C      1 
ATOM   5827  O O      . GLU C  1 29  ? -39.166  -46.492 21.109  1.00 49.39  ? 22  GLU C O      1 
ATOM   5828  C CB     . GLU C  1 29  ? -39.289  -47.748 24.049  1.00 46.91  ? 22  GLU C CB     1 
ATOM   5829  N N      . GLU C  1 30  ? -37.417  -45.717 22.298  1.00 47.35  ? 23  GLU C N      1 
ATOM   5830  C CA     . GLU C  1 30  ? -37.433  -44.395 21.679  1.00 43.35  ? 23  GLU C CA     1 
ATOM   5831  C C      . GLU C  1 30  ? -36.635  -44.318 20.383  1.00 41.22  ? 23  GLU C C      1 
ATOM   5832  O O      . GLU C  1 30  ? -37.007  -43.553 19.485  1.00 43.13  ? 23  GLU C O      1 
ATOM   5833  C CB     . GLU C  1 30  ? -36.893  -43.352 22.665  1.00 42.23  ? 23  GLU C CB     1 
ATOM   5834  C CG     . GLU C  1 30  ? -36.769  -41.942 22.100  1.00 41.93  ? 23  GLU C CG     1 
ATOM   5835  C CD     . GLU C  1 30  ? -38.098  -41.207 22.077  1.00 43.13  ? 23  GLU C CD     1 
ATOM   5836  O OE1    . GLU C  1 30  ? -39.093  -41.763 22.589  1.00 44.88  ? 23  GLU C OE1    1 
ATOM   5837  O OE2    . GLU C  1 30  ? -38.147  -40.069 21.564  1.00 41.99  ? 23  GLU C OE2    1 
ATOM   5838  N N      . PHE C  1 31  ? -35.554  -45.089 20.255  1.00 40.61  ? 24  PHE C N      1 
ATOM   5839  C CA     . PHE C  1 31  ? -34.656  -44.971 19.115  1.00 40.30  ? 24  PHE C CA     1 
ATOM   5840  C C      . PHE C  1 31  ? -34.518  -46.242 18.291  1.00 40.35  ? 24  PHE C C      1 
ATOM   5841  O O      . PHE C  1 31  ? -33.883  -46.199 17.231  1.00 37.10  ? 24  PHE C O      1 
ATOM   5842  C CB     . PHE C  1 31  ? -33.259  -44.525 19.579  1.00 40.88  ? 24  PHE C CB     1 
ATOM   5843  C CG     . PHE C  1 31  ? -33.228  -43.139 20.159  1.00 38.00  ? 24  PHE C CG     1 
ATOM   5844  C CD1    . PHE C  1 31  ? -33.361  -42.028 19.342  1.00 32.86  ? 24  PHE C CD1    1 
ATOM   5845  C CD2    . PHE C  1 31  ? -33.079  -42.947 21.521  1.00 40.09  ? 24  PHE C CD2    1 
ATOM   5846  C CE1    . PHE C  1 31  ? -33.336  -40.752 19.872  1.00 37.20  ? 24  PHE C CE1    1 
ATOM   5847  C CE2    . PHE C  1 31  ? -33.055  -41.675 22.058  1.00 40.11  ? 24  PHE C CE2    1 
ATOM   5848  C CZ     . PHE C  1 31  ? -33.186  -40.576 21.234  1.00 35.51  ? 24  PHE C CZ     1 
ATOM   5849  N N      . GLY C  1 32  ? -35.070  -47.368 18.741  1.00 42.62  ? 25  GLY C N      1 
ATOM   5850  C CA     . GLY C  1 32  ? -35.101  -48.572 17.938  1.00 44.75  ? 25  GLY C CA     1 
ATOM   5851  C C      . GLY C  1 32  ? -33.875  -49.454 18.045  1.00 48.07  ? 25  GLY C C      1 
ATOM   5852  O O      . GLY C  1 32  ? -33.896  -50.578 17.527  1.00 48.27  ? 25  GLY C O      1 
ATOM   5853  N N      . ALA C  1 33  ? -32.808  -48.984 18.690  1.00 47.22  ? 26  ALA C N      1 
ATOM   5854  C CA     . ALA C  1 33  ? -31.580  -49.746 18.862  1.00 44.76  ? 26  ALA C CA     1 
ATOM   5855  C C      . ALA C  1 33  ? -31.156  -49.722 20.325  1.00 47.40  ? 26  ALA C C      1 
ATOM   5856  O O      . ALA C  1 33  ? -31.754  -49.044 21.165  1.00 49.45  ? 26  ALA C O      1 
ATOM   5857  C CB     . ALA C  1 33  ? -30.444  -49.205 17.984  1.00 40.98  ? 26  ALA C CB     1 
ATOM   5858  N N      . GLU C  1 34  ? -30.106  -50.477 20.615  1.00 48.77  ? 27  GLU C N      1 
ATOM   5859  C CA     . GLU C  1 34  ? -29.477  -50.478 21.926  1.00 48.51  ? 27  GLU C CA     1 
ATOM   5860  C C      . GLU C  1 34  ? -28.585  -49.244 22.074  1.00 45.24  ? 27  GLU C C      1 
ATOM   5861  O O      . GLU C  1 34  ? -27.898  -48.856 21.124  1.00 47.02  ? 27  GLU C O      1 
ATOM   5862  C CB     . GLU C  1 34  ? -28.635  -51.743 22.112  1.00 51.18  ? 27  GLU C CB     1 
ATOM   5863  C CG     . GLU C  1 34  ? -29.426  -53.037 22.320  1.00 58.64  ? 27  GLU C CG     1 
ATOM   5864  C CD     . GLU C  1 34  ? -30.086  -53.128 23.683  1.00 62.41  ? 27  GLU C CD     1 
ATOM   5865  O OE1    . GLU C  1 34  ? -31.022  -53.942 23.834  1.00 66.48  ? 27  GLU C OE1    1 
ATOM   5866  O OE2    . GLU C  1 34  ? -29.669  -52.390 24.600  1.00 60.58  ? 27  GLU C OE2    1 
ATOM   5867  N N      . PRO C  1 35  ? -28.577  -48.605 23.241  1.00 41.42  ? 28  PRO C N      1 
ATOM   5868  C CA     . PRO C  1 35  ? -27.603  -47.537 23.475  1.00 40.27  ? 28  PRO C CA     1 
ATOM   5869  C C      . PRO C  1 35  ? -26.196  -48.113 23.502  1.00 43.09  ? 28  PRO C C      1 
ATOM   5870  O O      . PRO C  1 35  ? -25.980  -49.271 23.866  1.00 32.80  ? 28  PRO C O      1 
ATOM   5871  C CB     . PRO C  1 35  ? -28.014  -46.969 24.839  1.00 40.01  ? 28  PRO C CB     1 
ATOM   5872  C CG     . PRO C  1 35  ? -28.698  -48.105 25.520  1.00 39.84  ? 28  PRO C CG     1 
ATOM   5873  C CD     . PRO C  1 35  ? -29.412  -48.861 24.428  1.00 43.44  ? 28  PRO C CD     1 
ATOM   5874  N N      . GLU C  1 36  ? -25.230  -47.294 23.097  1.00 39.51  ? 29  GLU C N      1 
ATOM   5875  C CA     . GLU C  1 36  ? -23.844  -47.738 23.045  1.00 41.76  ? 29  GLU C CA     1 
ATOM   5876  C C      . GLU C  1 36  ? -23.034  -47.301 24.255  1.00 37.02  ? 29  GLU C C      1 
ATOM   5877  O O      . GLU C  1 36  ? -22.043  -47.955 24.597  1.00 35.27  ? 29  GLU C O      1 
ATOM   5878  C CB     . GLU C  1 36  ? -23.164  -47.209 21.776  1.00 46.83  ? 29  GLU C CB     1 
ATOM   5879  C CG     . GLU C  1 36  ? -23.825  -47.642 20.475  1.00 53.19  ? 29  GLU C CG     1 
ATOM   5880  C CD     . GLU C  1 36  ? -23.126  -47.080 19.244  1.00 59.33  ? 29  GLU C CD     1 
ATOM   5881  O OE1    . GLU C  1 36  ? -22.151  -46.317 19.407  1.00 60.47  ? 29  GLU C OE1    1 
ATOM   5882  O OE2    . GLU C  1 36  ? -23.549  -47.404 18.113  1.00 63.35  ? 29  GLU C OE2    1 
ATOM   5883  N N      . LEU C  1 37  ? -23.432  -46.213 24.903  1.00 32.79  ? 30  LEU C N      1 
ATOM   5884  C CA     . LEU C  1 37  ? -22.667  -45.621 25.986  1.00 33.62  ? 30  LEU C CA     1 
ATOM   5885  C C      . LEU C  1 37  ? -23.577  -45.352 27.176  1.00 39.41  ? 30  LEU C C      1 
ATOM   5886  O O      . LEU C  1 37  ? -24.764  -45.052 27.015  1.00 43.90  ? 30  LEU C O      1 
ATOM   5887  C CB     . LEU C  1 37  ? -21.990  -44.334 25.519  1.00 36.20  ? 30  LEU C CB     1 
ATOM   5888  C CG     . LEU C  1 37  ? -21.155  -44.525 24.251  1.00 39.55  ? 30  LEU C CG     1 
ATOM   5889  C CD1    . LEU C  1 37  ? -20.841  -43.191 23.615  1.00 34.97  ? 30  LEU C CD1    1 
ATOM   5890  C CD2    . LEU C  1 37  ? -19.873  -45.275 24.577  1.00 37.99  ? 30  LEU C CD2    1 
ATOM   5891  N N      . ALA C  1 38  ? -23.010  -45.470 28.375  1.00 39.78  ? 31  ALA C N      1 
ATOM   5892  C CA     . ALA C  1 38  ? -23.756  -45.258 29.607  1.00 40.62  ? 31  ALA C CA     1 
ATOM   5893  C C      . ALA C  1 38  ? -22.897  -44.483 30.596  1.00 41.54  ? 31  ALA C C      1 
ATOM   5894  O O      . ALA C  1 38  ? -21.671  -44.620 30.622  1.00 37.68  ? 31  ALA C O      1 
ATOM   5895  C CB     . ALA C  1 38  ? -24.212  -46.582 30.236  1.00 40.39  ? 31  ALA C CB     1 
ATOM   5896  N N      . VAL C  1 39  ? -23.561  -43.677 31.424  1.00 47.17  ? 32  VAL C N      1 
ATOM   5897  C CA     . VAL C  1 39  ? -22.877  -42.737 32.304  1.00 43.05  ? 32  VAL C CA     1 
ATOM   5898  C C      . VAL C  1 39  ? -23.803  -42.420 33.467  1.00 41.38  ? 32  VAL C C      1 
ATOM   5899  O O      . VAL C  1 39  ? -25.029  -42.457 33.330  1.00 44.11  ? 32  VAL C O      1 
ATOM   5900  C CB     . VAL C  1 39  ? -22.465  -41.458 31.532  1.00 43.59  ? 32  VAL C CB     1 
ATOM   5901  C CG1    . VAL C  1 39  ? -23.144  -40.245 32.130  1.00 42.92  ? 32  VAL C CG1    1 
ATOM   5902  C CG2    . VAL C  1 39  ? -20.956  -41.292 31.533  1.00 45.46  ? 32  VAL C CG2    1 
ATOM   5903  N N      . SER C  1 40  ? -23.212  -42.111 34.623  1.00 37.13  ? 33  SER C N      1 
ATOM   5904  C CA     . SER C  1 40  ? -23.980  -41.747 35.806  1.00 36.49  ? 33  SER C CA     1 
ATOM   5905  C C      . SER C  1 40  ? -23.272  -40.644 36.582  1.00 35.87  ? 33  SER C C      1 
ATOM   5906  O O      . SER C  1 40  ? -22.047  -40.504 36.521  1.00 38.07  ? 33  SER C O      1 
ATOM   5907  C CB     . SER C  1 40  ? -24.212  -42.960 36.722  1.00 37.97  ? 33  SER C CB     1 
ATOM   5908  O OG     . SER C  1 40  ? -22.988  -43.505 37.183  1.00 41.26  ? 33  SER C OG     1 
ATOM   5909  N N      . ALA C  1 41  ? -24.066  -39.866 37.325  1.00 29.78  ? 34  ALA C N      1 
ATOM   5910  C CA     . ALA C  1 41  ? -23.575  -38.776 38.157  1.00 30.00  ? 34  ALA C CA     1 
ATOM   5911  C C      . ALA C  1 41  ? -24.547  -38.577 39.315  1.00 32.00  ? 34  ALA C C      1 
ATOM   5912  O O      . ALA C  1 41  ? -25.763  -38.499 39.078  1.00 31.52  ? 34  ALA C O      1 
ATOM   5913  C CB     . ALA C  1 41  ? -23.420  -37.474 37.372  1.00 28.77  ? 34  ALA C CB     1 
ATOM   5914  N N      . PRO C  1 42  ? -24.058  -38.502 40.550  1.00 31.06  ? 35  PRO C N      1 
ATOM   5915  C CA     . PRO C  1 42  ? -24.945  -38.439 41.714  1.00 30.94  ? 35  PRO C CA     1 
ATOM   5916  C C      . PRO C  1 42  ? -25.340  -37.016 42.090  1.00 31.09  ? 35  PRO C C      1 
ATOM   5917  O O      . PRO C  1 42  ? -24.739  -36.031 41.655  1.00 31.86  ? 35  PRO C O      1 
ATOM   5918  C CB     . PRO C  1 42  ? -24.089  -39.068 42.822  1.00 27.98  ? 35  PRO C CB     1 
ATOM   5919  C CG     . PRO C  1 42  ? -22.702  -38.646 42.457  1.00 29.99  ? 35  PRO C CG     1 
ATOM   5920  C CD     . PRO C  1 42  ? -22.646  -38.653 40.942  1.00 28.41  ? 35  PRO C CD     1 
ATOM   5921  N N      . GLY C  1 43  ? -26.389  -36.928 42.907  1.00 34.39  ? 36  GLY C N      1 
ATOM   5922  C CA     . GLY C  1 43  ? -26.674  -35.717 43.644  1.00 36.41  ? 36  GLY C CA     1 
ATOM   5923  C C      . GLY C  1 43  ? -25.764  -35.581 44.853  1.00 37.13  ? 36  GLY C C      1 
ATOM   5924  O O      . GLY C  1 43  ? -24.847  -36.371 45.076  1.00 30.57  ? 36  GLY C O      1 
ATOM   5925  N N      . ARG C  1 44  ? -26.020  -34.542 45.646  1.00 38.56  ? 37  ARG C N      1 
ATOM   5926  C CA     . ARG C  1 44  ? -25.162  -34.251 46.785  1.00 37.46  ? 37  ARG C CA     1 
ATOM   5927  C C      . ARG C  1 44  ? -25.987  -33.645 47.911  1.00 37.81  ? 37  ARG C C      1 
ATOM   5928  O O      . ARG C  1 44  ? -27.034  -33.034 47.680  1.00 40.19  ? 37  ARG C O      1 
ATOM   5929  C CB     . ARG C  1 44  ? -24.012  -33.306 46.403  1.00 37.40  ? 37  ARG C CB     1 
ATOM   5930  C CG     . ARG C  1 44  ? -24.436  -31.880 46.079  1.00 37.51  ? 37  ARG C CG     1 
ATOM   5931  C CD     . ARG C  1 44  ? -24.526  -31.021 47.338  1.00 38.60  ? 37  ARG C CD     1 
ATOM   5932  N NE     . ARG C  1 44  ? -25.030  -29.680 47.054  1.00 37.00  ? 37  ARG C NE     1 
ATOM   5933  C CZ     . ARG C  1 44  ? -26.305  -29.323 47.173  1.00 36.73  ? 37  ARG C CZ     1 
ATOM   5934  N NH1    . ARG C  1 44  ? -27.205  -30.209 47.576  1.00 36.43  ? 37  ARG C NH1    1 
ATOM   5935  N NH2    . ARG C  1 44  ? -26.679  -28.082 46.892  1.00 35.80  ? 37  ARG C NH2    1 
ATOM   5936  N N      . VAL C  1 45  ? -25.501  -33.830 49.135  1.00 37.55  ? 38  VAL C N      1 
ATOM   5937  C CA     . VAL C  1 45  ? -25.999  -33.120 50.304  1.00 39.69  ? 38  VAL C CA     1 
ATOM   5938  C C      . VAL C  1 45  ? -24.803  -32.505 51.013  1.00 40.03  ? 38  VAL C C      1 
ATOM   5939  O O      . VAL C  1 45  ? -23.779  -33.172 51.206  1.00 39.52  ? 38  VAL C O      1 
ATOM   5940  C CB     . VAL C  1 45  ? -26.783  -34.041 51.256  1.00 39.66  ? 38  VAL C CB     1 
ATOM   5941  C CG1    . VAL C  1 45  ? -25.843  -35.031 51.922  1.00 39.83  ? 38  VAL C CG1    1 
ATOM   5942  C CG2    . VAL C  1 45  ? -27.527  -33.217 52.295  1.00 40.40  ? 38  VAL C CG2    1 
ATOM   5943  N N      . ASN C  1 46  ? -24.928  -31.238 51.390  1.00 41.79  ? 39  ASN C N      1 
ATOM   5944  C CA     . ASN C  1 46  ? -23.860  -30.519 52.072  1.00 42.07  ? 39  ASN C CA     1 
ATOM   5945  C C      . ASN C  1 46  ? -24.007  -30.694 53.578  1.00 41.93  ? 39  ASN C C      1 
ATOM   5946  O O      . ASN C  1 46  ? -24.989  -30.234 54.170  1.00 42.85  ? 39  ASN C O      1 
ATOM   5947  C CB     . ASN C  1 46  ? -23.886  -29.039 51.699  1.00 44.58  ? 39  ASN C CB     1 
ATOM   5948  C CG     . ASN C  1 46  ? -22.650  -28.293 52.173  1.00 48.98  ? 39  ASN C CG     1 
ATOM   5949  O OD1    . ASN C  1 46  ? -21.654  -28.897 52.572  1.00 49.30  ? 39  ASN C OD1    1 
ATOM   5950  N ND2    . ASN C  1 46  ? -22.705  -26.968 52.108  1.00 51.12  ? 39  ASN C ND2    1 
ATOM   5951  N N      . LEU C  1 47  ? -23.029  -31.358 54.194  1.00 42.03  ? 40  LEU C N      1 
ATOM   5952  C CA     . LEU C  1 47  ? -23.081  -31.555 55.637  1.00 44.31  ? 40  LEU C CA     1 
ATOM   5953  C C      . LEU C  1 47  ? -22.935  -30.231 56.378  1.00 43.10  ? 40  LEU C C      1 
ATOM   5954  O O      . LEU C  1 47  ? -23.629  -29.994 57.375  1.00 44.22  ? 40  LEU C O      1 
ATOM   5955  C CB     . LEU C  1 47  ? -22.003  -32.551 56.065  1.00 48.92  ? 40  LEU C CB     1 
ATOM   5956  C CG     . LEU C  1 47  ? -22.110  -33.919 55.383  1.00 48.83  ? 40  LEU C CG     1 
ATOM   5957  C CD1    . LEU C  1 47  ? -21.060  -34.892 55.905  1.00 50.07  ? 40  LEU C CD1    1 
ATOM   5958  C CD2    . LEU C  1 47  ? -23.512  -34.484 55.559  1.00 49.57  ? 40  LEU C CD2    1 
ATOM   5959  N N      . ILE C  1 48  ? -22.041  -29.359 55.917  1.00 39.99  ? 41  ILE C N      1 
ATOM   5960  C CA     . ILE C  1 48  ? -21.884  -28.034 56.508  1.00 37.48  ? 41  ILE C CA     1 
ATOM   5961  C C      . ILE C  1 48  ? -21.016  -27.194 55.584  1.00 36.20  ? 41  ILE C C      1 
ATOM   5962  O O      . ILE C  1 48  ? -20.236  -27.732 54.789  1.00 36.16  ? 41  ILE C O      1 
ATOM   5963  C CB     . ILE C  1 48  ? -21.281  -28.138 57.935  1.00 38.40  ? 41  ILE C CB     1 
ATOM   5964  C CG1    . ILE C  1 48  ? -21.437  -26.803 58.661  1.00 42.56  ? 41  ILE C CG1    1 
ATOM   5965  C CG2    . ILE C  1 48  ? -19.820  -28.534 57.874  1.00 35.46  ? 41  ILE C CG2    1 
ATOM   5966  C CD1    . ILE C  1 48  ? -21.023  -26.840 60.109  1.00 43.91  ? 41  ILE C CD1    1 
ATOM   5967  N N      . GLY C  1 49  ? -21.149  -25.873 55.688  1.00 37.96  ? 42  GLY C N      1 
ATOM   5968  C CA     . GLY C  1 49  ? -20.381  -24.966 54.857  1.00 38.51  ? 42  GLY C CA     1 
ATOM   5969  C C      . GLY C  1 49  ? -21.221  -24.310 53.782  1.00 44.78  ? 42  GLY C C      1 
ATOM   5970  O O      . GLY C  1 49  ? -20.850  -24.317 52.605  1.00 47.94  ? 42  GLY C O      1 
ATOM   5971  N N      . GLU C  1 50  ? -22.359  -23.743 54.175  1.00 45.30  ? 43  GLU C N      1 
ATOM   5972  C CA     . GLU C  1 50  ? -23.321  -23.203 53.225  1.00 42.49  ? 43  GLU C CA     1 
ATOM   5973  C C      . GLU C  1 50  ? -22.992  -21.760 52.869  1.00 43.38  ? 43  GLU C C      1 
ATOM   5974  O O      . GLU C  1 50  ? -22.590  -20.969 53.727  1.00 43.99  ? 43  GLU C O      1 
ATOM   5975  C CB     . GLU C  1 50  ? -24.738  -23.284 53.791  1.00 45.20  ? 43  GLU C CB     1 
ATOM   5976  C CG     . GLU C  1 50  ? -25.747  -23.802 52.793  1.00 47.50  ? 43  GLU C CG     1 
ATOM   5977  C CD     . GLU C  1 50  ? -25.368  -25.174 52.285  1.00 48.52  ? 43  GLU C CD     1 
ATOM   5978  O OE1    . GLU C  1 50  ? -24.787  -25.263 51.183  1.00 49.30  ? 43  GLU C OE1    1 
ATOM   5979  O OE2    . GLU C  1 50  ? -25.621  -26.165 53.000  1.00 50.05  ? 43  GLU C OE2    1 
ATOM   5980  N N      . HIS C  1 51  ? -23.178  -21.424 51.591  1.00 40.26  ? 44  HIS C N      1 
ATOM   5981  C CA     . HIS C  1 51  ? -22.951  -20.075 51.072  1.00 37.79  ? 44  HIS C CA     1 
ATOM   5982  C C      . HIS C  1 51  ? -21.532  -19.587 51.345  1.00 40.87  ? 44  HIS C C      1 
ATOM   5983  O O      . HIS C  1 51  ? -21.291  -18.385 51.490  1.00 44.86  ? 44  HIS C O      1 
ATOM   5984  C CB     . HIS C  1 51  ? -23.979  -19.090 51.634  1.00 41.06  ? 44  HIS C CB     1 
ATOM   5985  C CG     . HIS C  1 51  ? -25.358  -19.284 51.084  1.00 46.04  ? 44  HIS C CG     1 
ATOM   5986  N ND1    . HIS C  1 51  ? -25.758  -18.749 49.878  1.00 45.56  ? 44  HIS C ND1    1 
ATOM   5987  C CD2    . HIS C  1 51  ? -26.428  -19.959 51.569  1.00 46.29  ? 44  HIS C CD2    1 
ATOM   5988  C CE1    . HIS C  1 51  ? -27.014  -19.085 49.645  1.00 45.62  ? 44  HIS C CE1    1 
ATOM   5989  N NE2    . HIS C  1 51  ? -27.443  -19.821 50.654  1.00 46.71  ? 44  HIS C NE2    1 
ATOM   5990  N N      . THR C  1 52  ? -20.578  -20.518 51.420  1.00 37.05  ? 45  THR C N      1 
ATOM   5991  C CA     . THR C  1 52  ? -19.168  -20.167 51.476  1.00 37.05  ? 45  THR C CA     1 
ATOM   5992  C C      . THR C  1 52  ? -18.414  -20.459 50.187  1.00 35.64  ? 45  THR C C      1 
ATOM   5993  O O      . THR C  1 52  ? -17.324  -19.913 49.998  1.00 31.82  ? 45  THR C O      1 
ATOM   5994  C CB     . THR C  1 52  ? -18.468  -20.908 52.626  1.00 37.95  ? 45  THR C CB     1 
ATOM   5995  O OG1    . THR C  1 52  ? -18.593  -22.324 52.436  1.00 37.86  ? 45  THR C OG1    1 
ATOM   5996  C CG2    . THR C  1 52  ? -19.087  -20.524 53.961  1.00 37.56  ? 45  THR C CG2    1 
ATOM   5997  N N      . ASP C  1 53  ? -18.958  -21.292 49.294  1.00 34.79  ? 46  ASP C N      1 
ATOM   5998  C CA     . ASP C  1 53  ? -18.177  -21.712 48.133  1.00 32.16  ? 46  ASP C CA     1 
ATOM   5999  C C      . ASP C  1 53  ? -17.914  -20.543 47.190  1.00 33.47  ? 46  ASP C C      1 
ATOM   6000  O O      . ASP C  1 53  ? -16.785  -20.366 46.718  1.00 34.50  ? 46  ASP C O      1 
ATOM   6001  C CB     . ASP C  1 53  ? -18.858  -22.879 47.413  1.00 34.16  ? 46  ASP C CB     1 
ATOM   6002  C CG     . ASP C  1 53  ? -20.154  -22.489 46.758  1.00 39.10  ? 46  ASP C CG     1 
ATOM   6003  O OD1    . ASP C  1 53  ? -20.780  -21.515 47.217  1.00 43.49  ? 46  ASP C OD1    1 
ATOM   6004  O OD2    . ASP C  1 53  ? -20.559  -23.169 45.796  1.00 42.72  ? 46  ASP C OD2    1 
ATOM   6005  N N      . TYR C  1 54  ? -18.936  -19.734 46.898  1.00 32.72  ? 47  TYR C N      1 
ATOM   6006  C CA     . TYR C  1 54  ? -18.689  -18.561 46.065  1.00 33.99  ? 47  TYR C CA     1 
ATOM   6007  C C      . TYR C  1 54  ? -17.935  -17.465 46.811  1.00 40.07  ? 47  TYR C C      1 
ATOM   6008  O O      . TYR C  1 54  ? -17.654  -16.413 46.223  1.00 40.81  ? 47  TYR C O      1 
ATOM   6009  C CB     . TYR C  1 54  ? -20.011  -18.038 45.484  1.00 32.06  ? 47  TYR C CB     1 
ATOM   6010  C CG     . TYR C  1 54  ? -21.110  -17.701 46.472  1.00 32.73  ? 47  TYR C CG     1 
ATOM   6011  C CD1    . TYR C  1 54  ? -20.908  -16.790 47.500  1.00 34.09  ? 47  TYR C CD1    1 
ATOM   6012  C CD2    . TYR C  1 54  ? -22.343  -18.337 46.397  1.00 46.01  ? 47  TYR C CD2    1 
ATOM   6013  C CE1    . TYR C  1 54  ? -21.919  -16.494 48.397  1.00 41.71  ? 47  TYR C CE1    1 
ATOM   6014  C CE2    . TYR C  1 54  ? -23.352  -18.056 47.293  1.00 41.29  ? 47  TYR C CE2    1 
ATOM   6015  C CZ     . TYR C  1 54  ? -23.137  -17.136 48.290  1.00 41.69  ? 47  TYR C CZ     1 
ATOM   6016  O OH     . TYR C  1 54  ? -24.146  -16.861 49.184  1.00 35.07  ? 47  TYR C OH     1 
ATOM   6017  N N      . ASN C  1 55  ? -17.618  -17.689 48.088  1.00 41.60  ? 48  ASN C N      1 
ATOM   6018  C CA     . ASN C  1 55  ? -16.715  -16.849 48.862  1.00 40.72  ? 48  ASN C CA     1 
ATOM   6019  C C      . ASN C  1 55  ? -15.330  -17.479 49.021  1.00 40.72  ? 48  ASN C C      1 
ATOM   6020  O O      . ASN C  1 55  ? -14.563  -17.063 49.897  1.00 41.63  ? 48  ASN C O      1 
ATOM   6021  C CB     . ASN C  1 55  ? -17.320  -16.541 50.234  1.00 39.90  ? 48  ASN C CB     1 
ATOM   6022  C CG     . ASN C  1 55  ? -18.411  -15.494 50.166  1.00 40.35  ? 48  ASN C CG     1 
ATOM   6023  O OD1    . ASN C  1 55  ? -18.188  -14.385 49.684  1.00 42.92  ? 48  ASN C OD1    1 
ATOM   6024  N ND2    . ASN C  1 55  ? -19.598  -15.840 50.646  1.00 39.92  ? 48  ASN C ND2    1 
ATOM   6025  N N      . GLN C  1 56  ? -15.002  -18.481 48.203  1.00 36.57  ? 49  GLN C N      1 
ATOM   6026  C CA     . GLN C  1 56  ? -13.700  -19.150 48.260  1.00 40.46  ? 49  GLN C CA     1 
ATOM   6027  C C      . GLN C  1 56  ? -13.460  -19.809 49.616  1.00 41.16  ? 49  GLN C C      1 
ATOM   6028  O O      . GLN C  1 56  ? -12.334  -19.842 50.115  1.00 41.57  ? 49  GLN C O      1 
ATOM   6029  C CB     . GLN C  1 56  ? -12.561  -18.180 47.940  1.00 47.14  ? 49  GLN C CB     1 
ATOM   6030  C CG     . GLN C  1 56  ? -12.601  -17.582 46.552  1.00 53.68  ? 49  GLN C CG     1 
ATOM   6031  C CD     . GLN C  1 56  ? -11.219  -17.221 46.043  1.00 61.58  ? 49  GLN C CD     1 
ATOM   6032  O OE1    . GLN C  1 56  ? -10.494  -18.069 45.522  1.00 63.62  ? 49  GLN C OE1    1 
ATOM   6033  N NE2    . GLN C  1 56  ? -10.842  -15.958 46.200  1.00 65.09  ? 49  GLN C NE2    1 
ATOM   6034  N N      . GLY C  1 57  ? -14.513  -20.341 50.219  1.00 42.25  ? 50  GLY C N      1 
ATOM   6035  C CA     . GLY C  1 57  ? -14.430  -20.934 51.540  1.00 43.22  ? 50  GLY C CA     1 
ATOM   6036  C C      . GLY C  1 57  ? -14.273  -22.440 51.508  1.00 44.34  ? 50  GLY C C      1 
ATOM   6037  O O      . GLY C  1 57  ? -13.765  -23.018 50.539  1.00 43.70  ? 50  GLY C O      1 
ATOM   6038  N N      . LEU C  1 58  ? -14.719  -23.086 52.581  1.00 45.12  ? 51  LEU C N      1 
ATOM   6039  C CA     . LEU C  1 58  ? -14.633  -24.530 52.733  1.00 38.81  ? 51  LEU C CA     1 
ATOM   6040  C C      . LEU C  1 58  ? -16.034  -25.124 52.745  1.00 31.42  ? 51  LEU C C      1 
ATOM   6041  O O      . LEU C  1 58  ? -16.983  -24.506 53.234  1.00 33.60  ? 51  LEU C O      1 
ATOM   6042  C CB     . LEU C  1 58  ? -13.890  -24.903 54.021  1.00 42.24  ? 51  LEU C CB     1 
ATOM   6043  C CG     . LEU C  1 58  ? -12.457  -24.380 54.162  1.00 45.76  ? 51  LEU C CG     1 
ATOM   6044  C CD1    . LEU C  1 58  ? -11.892  -24.747 55.520  1.00 48.54  ? 51  LEU C CD1    1 
ATOM   6045  C CD2    . LEU C  1 58  ? -11.557  -24.925 53.048  1.00 46.18  ? 51  LEU C CD2    1 
ATOM   6046  N N      . VAL C  1 59  ? -16.156  -26.333 52.199  1.00 29.83  ? 52  VAL C N      1 
ATOM   6047  C CA     . VAL C  1 59  ? -17.422  -27.053 52.170  1.00 31.25  ? 52  VAL C CA     1 
ATOM   6048  C C      . VAL C  1 59  ? -17.176  -28.515 52.509  1.00 33.92  ? 52  VAL C C      1 
ATOM   6049  O O      . VAL C  1 59  ? -16.082  -29.047 52.300  1.00 36.27  ? 52  VAL C O      1 
ATOM   6050  C CB     . VAL C  1 59  ? -18.118  -26.916 50.801  1.00 31.79  ? 52  VAL C CB     1 
ATOM   6051  C CG1    . VAL C  1 59  ? -18.449  -25.458 50.529  1.00 34.14  ? 52  VAL C CG1    1 
ATOM   6052  C CG2    . VAL C  1 59  ? -17.228  -27.477 49.701  1.00 30.55  ? 52  VAL C CG2    1 
ATOM   6053  N N      . LEU C  1 60  ? -18.211  -29.169 53.029  1.00 35.77  ? 53  LEU C N      1 
ATOM   6054  C CA     . LEU C  1 60  ? -18.143  -30.577 53.412  1.00 40.03  ? 53  LEU C CA     1 
ATOM   6055  C C      . LEU C  1 60  ? -19.364  -31.310 52.874  1.00 43.83  ? 53  LEU C C      1 
ATOM   6056  O O      . LEU C  1 60  ? -20.241  -31.737 53.635  1.00 46.80  ? 53  LEU C O      1 
ATOM   6057  C CB     . LEU C  1 60  ? -18.036  -30.726 54.929  1.00 44.11  ? 53  LEU C CB     1 
ATOM   6058  C CG     . LEU C  1 60  ? -17.673  -32.135 55.396  1.00 41.65  ? 53  LEU C CG     1 
ATOM   6059  C CD1    . LEU C  1 60  ? -16.398  -32.630 54.725  1.00 40.33  ? 53  LEU C CD1    1 
ATOM   6060  C CD2    . LEU C  1 60  ? -17.548  -32.188 56.913  1.00 42.28  ? 53  LEU C CD2    1 
ATOM   6061  N N      . PRO C  1 61  ? -19.455  -31.466 51.557  1.00 40.22  ? 54  PRO C N      1 
ATOM   6062  C CA     . PRO C  1 61  ? -20.544  -32.248 50.973  1.00 35.89  ? 54  PRO C CA     1 
ATOM   6063  C C      . PRO C  1 61  ? -20.161  -33.713 50.826  1.00 37.97  ? 54  PRO C C      1 
ATOM   6064  O O      . PRO C  1 61  ? -18.994  -34.097 50.914  1.00 26.19  ? 54  PRO C O      1 
ATOM   6065  C CB     . PRO C  1 61  ? -20.732  -31.596 49.599  1.00 33.30  ? 54  PRO C CB     1 
ATOM   6066  C CG     . PRO C  1 61  ? -19.357  -31.175 49.229  1.00 32.69  ? 54  PRO C CG     1 
ATOM   6067  C CD     . PRO C  1 61  ? -18.674  -30.766 50.521  1.00 36.87  ? 54  PRO C CD     1 
ATOM   6068  N N      . MET C  1 62  ? -21.185  -34.533 50.614  1.00 33.90  ? 55  MET C N      1 
ATOM   6069  C CA     . MET C  1 62  ? -21.003  -35.928 50.251  1.00 31.62  ? 55  MET C CA     1 
ATOM   6070  C C      . MET C  1 62  ? -21.886  -36.258 49.058  1.00 36.06  ? 55  MET C C      1 
ATOM   6071  O O      . MET C  1 62  ? -22.998  -35.738 48.927  1.00 36.42  ? 55  MET C O      1 
ATOM   6072  C CB     . MET C  1 62  ? -21.332  -36.869 51.419  1.00 34.13  ? 55  MET C CB     1 
ATOM   6073  C CG     . MET C  1 62  ? -22.816  -37.075 51.682  1.00 39.91  ? 55  MET C CG     1 
ATOM   6074  S SD     . MET C  1 62  ? -23.106  -38.273 53.003  1.00 46.55  ? 55  MET C SD     1 
ATOM   6075  C CE     . MET C  1 62  ? -24.836  -38.665 52.742  1.00 45.81  ? 55  MET C CE     1 
ATOM   6076  N N      . ALA C  1 63  ? -21.385  -37.135 48.193  1.00 36.45  ? 56  ALA C N      1 
ATOM   6077  C CA     . ALA C  1 63  ? -22.179  -37.591 47.062  1.00 32.69  ? 56  ALA C CA     1 
ATOM   6078  C C      . ALA C  1 63  ? -23.286  -38.516 47.549  1.00 35.96  ? 56  ALA C C      1 
ATOM   6079  O O      . ALA C  1 63  ? -23.086  -39.329 48.456  1.00 40.49  ? 56  ALA C O      1 
ATOM   6080  C CB     . ALA C  1 63  ? -21.296  -38.304 46.038  1.00 24.16  ? 56  ALA C CB     1 
ATOM   6081  N N      . LEU C  1 64  ? -24.457  -38.392 46.936  1.00 38.00  ? 57  LEU C N      1 
ATOM   6082  C CA     . LEU C  1 64  ? -25.617  -39.165 47.346  1.00 43.29  ? 57  LEU C CA     1 
ATOM   6083  C C      . LEU C  1 64  ? -25.766  -40.427 46.506  1.00 48.20  ? 57  LEU C C      1 
ATOM   6084  O O      . LEU C  1 64  ? -25.149  -40.583 45.450  1.00 49.11  ? 57  LEU C O      1 
ATOM   6085  C CB     . LEU C  1 64  ? -26.889  -38.322 47.236  1.00 40.77  ? 57  LEU C CB     1 
ATOM   6086  C CG     . LEU C  1 64  ? -27.052  -37.131 48.180  1.00 41.61  ? 57  LEU C CG     1 
ATOM   6087  C CD1    . LEU C  1 64  ? -28.335  -36.386 47.863  1.00 43.76  ? 57  LEU C CD1    1 
ATOM   6088  C CD2    . LEU C  1 64  ? -27.059  -37.607 49.621  1.00 42.28  ? 57  LEU C CD2    1 
ATOM   6089  N N      . GLU C  1 65  ? -26.595  -41.343 47.007  1.00 56.51  ? 58  GLU C N      1 
ATOM   6090  C CA     . GLU C  1 65  ? -26.978  -42.513 46.232  1.00 58.78  ? 58  GLU C CA     1 
ATOM   6091  C C      . GLU C  1 65  ? -28.032  -42.176 45.184  1.00 55.79  ? 58  GLU C C      1 
ATOM   6092  O O      . GLU C  1 65  ? -28.220  -42.949 44.238  1.00 56.94  ? 58  GLU C O      1 
ATOM   6093  C CB     . GLU C  1 65  ? -27.491  -43.608 47.170  1.00 66.55  ? 58  GLU C CB     1 
ATOM   6094  C CG     . GLU C  1 65  ? -26.388  -44.341 47.924  1.00 75.24  ? 58  GLU C CG     1 
ATOM   6095  C CD     . GLU C  1 65  ? -26.900  -45.043 49.170  1.00 83.34  ? 58  GLU C CD     1 
ATOM   6096  O OE1    . GLU C  1 65  ? -27.605  -44.394 49.973  1.00 86.07  ? 58  GLU C OE1    1 
ATOM   6097  O OE2    . GLU C  1 65  ? -26.595  -46.241 49.350  1.00 86.61  ? 58  GLU C OE2    1 
ATOM   6098  N N      . LEU C  1 66  ? -28.711  -41.040 45.330  1.00 46.42  ? 59  LEU C N      1 
ATOM   6099  C CA     . LEU C  1 66  ? -29.576  -40.537 44.273  1.00 42.63  ? 59  LEU C CA     1 
ATOM   6100  C C      . LEU C  1 66  ? -28.725  -40.097 43.090  1.00 39.96  ? 59  LEU C C      1 
ATOM   6101  O O      . LEU C  1 66  ? -27.667  -39.485 43.258  1.00 40.01  ? 59  LEU C O      1 
ATOM   6102  C CB     . LEU C  1 66  ? -30.442  -39.391 44.794  1.00 39.33  ? 59  LEU C CB     1 
ATOM   6103  C CG     . LEU C  1 66  ? -31.246  -39.771 46.043  1.00 38.99  ? 59  LEU C CG     1 
ATOM   6104  C CD1    . LEU C  1 66  ? -32.141  -38.630 46.503  1.00 41.19  ? 59  LEU C CD1    1 
ATOM   6105  C CD2    . LEU C  1 66  ? -32.065  -41.035 45.792  1.00 35.56  ? 59  LEU C CD2    1 
ATOM   6106  N N      . MET C  1 67  ? -29.194  -40.409 41.885  1.00 34.94  ? 60  MET C N      1 
ATOM   6107  C CA     . MET C  1 67  ? -28.289  -40.468 40.750  1.00 33.85  ? 60  MET C CA     1 
ATOM   6108  C C      . MET C  1 67  ? -28.999  -40.069 39.467  1.00 37.65  ? 60  MET C C      1 
ATOM   6109  O O      . MET C  1 67  ? -30.218  -40.212 39.337  1.00 36.89  ? 60  MET C O      1 
ATOM   6110  C CB     . MET C  1 67  ? -27.728  -41.886 40.622  1.00 38.08  ? 60  MET C CB     1 
ATOM   6111  C CG     . MET C  1 67  ? -26.449  -42.043 39.840  1.00 40.95  ? 60  MET C CG     1 
ATOM   6112  S SD     . MET C  1 67  ? -26.034  -43.792 39.885  1.00 47.25  ? 60  MET C SD     1 
ATOM   6113  C CE     . MET C  1 67  ? -27.445  -44.414 40.797  1.00 45.04  ? 60  MET C CE     1 
ATOM   6114  N N      . THR C  1 68  ? -28.213  -39.566 38.521  1.00 36.50  ? 61  THR C N      1 
ATOM   6115  C CA     . THR C  1 68  ? -28.631  -39.400 37.136  1.00 33.20  ? 61  THR C CA     1 
ATOM   6116  C C      . THR C  1 68  ? -27.878  -40.395 36.265  1.00 34.49  ? 61  THR C C      1 
ATOM   6117  O O      . THR C  1 68  ? -26.645  -40.457 36.315  1.00 40.50  ? 61  THR C O      1 
ATOM   6118  C CB     . THR C  1 68  ? -28.371  -37.976 36.638  1.00 30.90  ? 61  THR C CB     1 
ATOM   6119  O OG1    . THR C  1 68  ? -29.195  -37.050 37.358  1.00 33.76  ? 61  THR C OG1    1 
ATOM   6120  C CG2    . THR C  1 68  ? -28.670  -37.871 35.147  1.00 26.99  ? 61  THR C CG2    1 
ATOM   6121  N N      . VAL C  1 69  ? -28.613  -41.165 35.466  1.00 33.97  ? 62  VAL C N      1 
ATOM   6122  C CA     . VAL C  1 69  ? -28.027  -42.095 34.507  1.00 32.41  ? 62  VAL C CA     1 
ATOM   6123  C C      . VAL C  1 69  ? -28.384  -41.627 33.105  1.00 33.13  ? 62  VAL C C      1 
ATOM   6124  O O      . VAL C  1 69  ? -29.556  -41.366 32.808  1.00 36.97  ? 62  VAL C O      1 
ATOM   6125  C CB     . VAL C  1 69  ? -28.499  -43.539 34.745  1.00 32.79  ? 62  VAL C CB     1 
ATOM   6126  C CG1    . VAL C  1 69  ? -28.035  -44.432 33.604  1.00 32.03  ? 62  VAL C CG1    1 
ATOM   6127  C CG2    . VAL C  1 69  ? -27.952  -44.053 36.068  1.00 32.03  ? 62  VAL C CG2    1 
ATOM   6128  N N      . LEU C  1 70  ? -27.373  -41.513 32.251  1.00 31.18  ? 63  LEU C N      1 
ATOM   6129  C CA     . LEU C  1 70  ? -27.544  -41.119 30.861  1.00 30.44  ? 63  LEU C CA     1 
ATOM   6130  C C      . LEU C  1 70  ? -26.964  -42.198 29.961  1.00 33.91  ? 63  LEU C C      1 
ATOM   6131  O O      . LEU C  1 70  ? -25.798  -42.576 30.115  1.00 37.87  ? 63  LEU C O      1 
ATOM   6132  C CB     . LEU C  1 70  ? -26.873  -39.767 30.613  1.00 29.00  ? 63  LEU C CB     1 
ATOM   6133  C CG     . LEU C  1 70  ? -27.163  -38.921 29.379  1.00 32.40  ? 63  LEU C CG     1 
ATOM   6134  C CD1    . LEU C  1 70  ? -26.684  -37.509 29.599  1.00 31.40  ? 63  LEU C CD1    1 
ATOM   6135  C CD2    . LEU C  1 70  ? -26.423  -39.518 28.223  1.00 37.04  ? 63  LEU C CD2    1 
ATOM   6136  N N      . VAL C  1 71  ? -27.781  -42.693 29.031  1.00 36.39  ? 64  VAL C N      1 
ATOM   6137  C CA     . VAL C  1 71  ? -27.351  -43.638 28.009  1.00 33.96  ? 64  VAL C CA     1 
ATOM   6138  C C      . VAL C  1 71  ? -27.596  -43.020 26.640  1.00 36.43  ? 64  VAL C C      1 
ATOM   6139  O O      . VAL C  1 71  ? -28.544  -42.252 26.443  1.00 36.79  ? 64  VAL C O      1 
ATOM   6140  C CB     . VAL C  1 71  ? -28.076  -44.998 28.127  1.00 37.08  ? 64  VAL C CB     1 
ATOM   6141  C CG1    . VAL C  1 71  ? -27.923  -45.572 29.530  1.00 38.61  ? 64  VAL C CG1    1 
ATOM   6142  C CG2    . VAL C  1 71  ? -29.551  -44.861 27.751  1.00 39.47  ? 64  VAL C CG2    1 
ATOM   6143  N N      . GLY C  1 72  ? -26.738  -43.366 25.687  1.00 38.57  ? 65  GLY C N      1 
ATOM   6144  C CA     . GLY C  1 72  ? -26.873  -42.811 24.356  1.00 39.08  ? 65  GLY C CA     1 
ATOM   6145  C C      . GLY C  1 72  ? -25.865  -43.407 23.400  1.00 37.46  ? 65  GLY C C      1 
ATOM   6146  O O      . GLY C  1 72  ? -25.119  -44.329 23.740  1.00 37.43  ? 65  GLY C O      1 
ATOM   6147  N N      . SER C  1 73  ? -25.854  -42.852 22.189  1.00 35.39  ? 66  SER C N      1 
ATOM   6148  C CA     . SER C  1 73  ? -25.017  -43.330 21.099  1.00 40.69  ? 66  SER C CA     1 
ATOM   6149  C C      . SER C  1 73  ? -24.643  -42.161 20.203  1.00 39.82  ? 66  SER C C      1 
ATOM   6150  O O      . SER C  1 73  ? -25.391  -41.178 20.123  1.00 38.60  ? 66  SER C O      1 
ATOM   6151  C CB     . SER C  1 73  ? -25.737  -44.410 20.278  1.00 45.24  ? 66  SER C CB     1 
ATOM   6152  O OG     . SER C  1 73  ? -26.161  -45.474 21.111  1.00 50.40  ? 66  SER C OG     1 
ATOM   6153  N N      . PRO C  1 74  ? -23.497  -42.229 19.530  1.00 40.08  ? 67  PRO C N      1 
ATOM   6154  C CA     . PRO C  1 74  ? -23.154  -41.196 18.547  1.00 37.68  ? 67  PRO C CA     1 
ATOM   6155  C C      . PRO C  1 74  ? -24.039  -41.283 17.310  1.00 38.75  ? 67  PRO C C      1 
ATOM   6156  O O      . PRO C  1 74  ? -24.601  -42.330 16.977  1.00 36.50  ? 67  PRO C O      1 
ATOM   6157  C CB     . PRO C  1 74  ? -21.689  -41.498 18.206  1.00 35.43  ? 67  PRO C CB     1 
ATOM   6158  C CG     . PRO C  1 74  ? -21.527  -42.947 18.507  1.00 35.98  ? 67  PRO C CG     1 
ATOM   6159  C CD     . PRO C  1 74  ? -22.439  -43.244 19.669  1.00 38.01  ? 67  PRO C CD     1 
ATOM   6160  N N      . ARG C  1 75  ? -24.165  -40.145 16.632  1.00 38.52  ? 68  ARG C N      1 
ATOM   6161  C CA     . ARG C  1 75  ? -24.924  -40.036 15.395  1.00 38.75  ? 68  ARG C CA     1 
ATOM   6162  C C      . ARG C  1 75  ? -24.038  -39.506 14.274  1.00 39.54  ? 68  ARG C C      1 
ATOM   6163  O O      . ARG C  1 75  ? -22.997  -38.889 14.512  1.00 37.47  ? 68  ARG C O      1 
ATOM   6164  C CB     . ARG C  1 75  ? -26.144  -39.114 15.559  1.00 36.65  ? 68  ARG C CB     1 
ATOM   6165  C CG     . ARG C  1 75  ? -27.182  -39.572 16.563  1.00 36.75  ? 68  ARG C CG     1 
ATOM   6166  C CD     . ARG C  1 75  ? -28.200  -38.466 16.799  1.00 37.78  ? 68  ARG C CD     1 
ATOM   6167  N NE     . ARG C  1 75  ? -29.069  -38.245 15.642  1.00 38.11  ? 68  ARG C NE     1 
ATOM   6168  C CZ     . ARG C  1 75  ? -30.324  -38.678 15.557  1.00 35.96  ? 68  ARG C CZ     1 
ATOM   6169  N NH1    . ARG C  1 75  ? -30.857  -39.353 16.568  1.00 34.38  ? 68  ARG C NH1    1 
ATOM   6170  N NH2    . ARG C  1 75  ? -31.046  -38.432 14.466  1.00 31.71  ? 68  ARG C NH2    1 
ATOM   6171  N N      . LYS C  1 76  ? -24.456  -39.775 13.040  1.00 43.29  ? 69  LYS C N      1 
ATOM   6172  C CA     . LYS C  1 76  ? -23.863  -39.157 11.863  1.00 45.72  ? 69  LYS C CA     1 
ATOM   6173  C C      . LYS C  1 76  ? -24.581  -37.875 11.464  1.00 51.63  ? 69  LYS C C      1 
ATOM   6174  O O      . LYS C  1 76  ? -24.102  -37.163 10.578  1.00 53.05  ? 69  LYS C O      1 
ATOM   6175  C CB     . LYS C  1 76  ? -23.859  -40.140 10.684  1.00 44.90  ? 69  LYS C CB     1 
ATOM   6176  N N      . ASP C  1 77  ? -25.718  -37.574 12.100  1.00 58.13  ? 70  ASP C N      1 
ATOM   6177  C CA     . ASP C  1 77  ? -26.586  -36.478 11.690  1.00 59.33  ? 70  ASP C CA     1 
ATOM   6178  C C      . ASP C  1 77  ? -26.008  -35.114 12.024  1.00 56.48  ? 70  ASP C C      1 
ATOM   6179  O O      . ASP C  1 77  ? -26.381  -34.124 11.386  1.00 56.02  ? 70  ASP C O      1 
ATOM   6180  C CB     . ASP C  1 77  ? -27.945  -36.591 12.399  1.00 69.36  ? 70  ASP C CB     1 
ATOM   6181  C CG     . ASP C  1 77  ? -28.964  -37.417 11.634  1.00 82.76  ? 70  ASP C CG     1 
ATOM   6182  O OD1    . ASP C  1 77  ? -28.595  -38.016 10.606  1.00 89.64  ? 70  ASP C OD1    1 
ATOM   6183  O OD2    . ASP C  1 77  ? -30.138  -37.460 12.078  1.00 84.98  ? 70  ASP C OD2    1 
ATOM   6184  N N      . GLY C  1 78  ? -25.095  -35.040 12.988  1.00 50.20  ? 71  GLY C N      1 
ATOM   6185  C CA     . GLY C  1 78  ? -24.786  -33.743 13.540  1.00 45.24  ? 71  GLY C CA     1 
ATOM   6186  C C      . GLY C  1 78  ? -25.899  -33.187 14.398  1.00 42.26  ? 71  GLY C C      1 
ATOM   6187  O O      . GLY C  1 78  ? -25.860  -32.009 14.770  1.00 40.54  ? 71  GLY C O      1 
ATOM   6188  N N      . LEU C  1 79  ? -26.893  -34.007 14.725  1.00 38.03  ? 72  LEU C N      1 
ATOM   6189  C CA     . LEU C  1 79  ? -28.030  -33.604 15.534  1.00 32.27  ? 72  LEU C CA     1 
ATOM   6190  C C      . LEU C  1 79  ? -27.914  -34.166 16.942  1.00 31.82  ? 72  LEU C C      1 
ATOM   6191  O O      . LEU C  1 79  ? -27.239  -35.170 17.185  1.00 33.39  ? 72  LEU C O      1 
ATOM   6192  C CB     . LEU C  1 79  ? -29.345  -34.078 14.909  1.00 38.43  ? 72  LEU C CB     1 
ATOM   6193  C CG     . LEU C  1 79  ? -29.613  -33.580 13.496  1.00 46.39  ? 72  LEU C CG     1 
ATOM   6194  C CD1    . LEU C  1 79  ? -31.039  -33.900 13.079  1.00 48.71  ? 72  LEU C CD1    1 
ATOM   6195  C CD2    . LEU C  1 79  ? -29.350  -32.090 13.446  1.00 47.36  ? 72  LEU C CD2    1 
ATOM   6196  N N      . VAL C  1 80  ? -28.603  -33.506 17.868  1.00 31.15  ? 73  VAL C N      1 
ATOM   6197  C CA     . VAL C  1 80  ? -28.736  -33.968 19.243  1.00 29.94  ? 73  VAL C CA     1 
ATOM   6198  C C      . VAL C  1 80  ? -30.207  -34.269 19.490  1.00 30.35  ? 73  VAL C C      1 
ATOM   6199  O O      . VAL C  1 80  ? -31.060  -33.385 19.334  1.00 34.90  ? 73  VAL C O      1 
ATOM   6200  C CB     . VAL C  1 80  ? -28.210  -32.929 20.248  1.00 30.42  ? 73  VAL C CB     1 
ATOM   6201  C CG1    . VAL C  1 80  ? -28.365  -33.442 21.676  1.00 29.23  ? 73  VAL C CG1    1 
ATOM   6202  C CG2    . VAL C  1 80  ? -26.757  -32.573 19.948  1.00 26.83  ? 73  VAL C CG2    1 
ATOM   6203  N N      . SER C  1 81  ? -30.502  -35.508 19.881  1.00 32.39  ? 74  SER C N      1 
ATOM   6204  C CA     . SER C  1 81  ? -31.860  -35.949 20.184  1.00 31.46  ? 74  SER C CA     1 
ATOM   6205  C C      . SER C  1 81  ? -31.892  -36.430 21.627  1.00 30.35  ? 74  SER C C      1 
ATOM   6206  O O      . SER C  1 81  ? -31.182  -37.376 21.982  1.00 32.15  ? 74  SER C O      1 
ATOM   6207  C CB     . SER C  1 81  ? -32.310  -37.061 19.231  1.00 33.30  ? 74  SER C CB     1 
ATOM   6208  O OG     . SER C  1 81  ? -33.677  -37.386 19.425  1.00 36.67  ? 74  SER C OG     1 
ATOM   6209  N N      . LEU C  1 82  ? -32.728  -35.797 22.448  1.00 27.78  ? 75  LEU C N      1 
ATOM   6210  C CA     . LEU C  1 82  ? -32.738  -36.028 23.884  1.00 30.02  ? 75  LEU C CA     1 
ATOM   6211  C C      . LEU C  1 82  ? -34.112  -36.478 24.357  1.00 30.84  ? 75  LEU C C      1 
ATOM   6212  O O      . LEU C  1 82  ? -35.144  -36.081 23.805  1.00 35.94  ? 75  LEU C O      1 
ATOM   6213  C CB     . LEU C  1 82  ? -32.331  -34.766 24.667  1.00 33.32  ? 75  LEU C CB     1 
ATOM   6214  C CG     . LEU C  1 82  ? -31.028  -34.045 24.325  1.00 33.42  ? 75  LEU C CG     1 
ATOM   6215  C CD1    . LEU C  1 82  ? -30.911  -32.784 25.165  1.00 34.08  ? 75  LEU C CD1    1 
ATOM   6216  C CD2    . LEU C  1 82  ? -29.839  -34.958 24.570  1.00 32.17  ? 75  LEU C CD2    1 
ATOM   6217  N N      . LEU C  1 83  ? -34.106  -37.311 25.396  1.00 32.62  ? 76  LEU C N      1 
ATOM   6218  C CA     . LEU C  1 83  ? -35.313  -37.712 26.103  1.00 41.06  ? 76  LEU C CA     1 
ATOM   6219  C C      . LEU C  1 83  ? -34.996  -37.845 27.584  1.00 40.07  ? 76  LEU C C      1 
ATOM   6220  O O      . LEU C  1 83  ? -34.025  -38.512 27.955  1.00 35.36  ? 76  LEU C O      1 
ATOM   6221  C CB     . LEU C  1 83  ? -35.857  -39.041 25.570  1.00 28.04  ? 76  LEU C CB     1 
ATOM   6222  C CG     . LEU C  1 83  ? -36.944  -39.699 26.423  1.00 29.57  ? 76  LEU C CG     1 
ATOM   6223  C CD1    . LEU C  1 83  ? -38.208  -38.853 26.460  1.00 36.89  ? 76  LEU C CD1    1 
ATOM   6224  C CD2    . LEU C  1 83  ? -37.243  -41.100 25.912  1.00 30.87  ? 76  LEU C CD2    1 
ATOM   6225  N N      . THR C  1 84  ? -35.800  -37.200 28.421  1.00 35.90  ? 77  THR C N      1 
ATOM   6226  C CA     . THR C  1 84  ? -35.735  -37.379 29.863  1.00 33.94  ? 77  THR C CA     1 
ATOM   6227  C C      . THR C  1 84  ? -37.020  -38.050 30.329  1.00 38.24  ? 77  THR C C      1 
ATOM   6228  O O      . THR C  1 84  ? -38.111  -37.711 29.861  1.00 40.54  ? 77  THR C O      1 
ATOM   6229  C CB     . THR C  1 84  ? -35.543  -36.044 30.589  1.00 34.27  ? 77  THR C CB     1 
ATOM   6230  O OG1    . THR C  1 84  ? -35.529  -36.268 32.005  1.00 35.86  ? 77  THR C OG1    1 
ATOM   6231  C CG2    . THR C  1 84  ? -36.668  -35.078 30.246  1.00 36.17  ? 77  THR C CG2    1 
ATOM   6232  N N      . THR C  1 85  ? -36.889  -39.011 31.240  1.00 38.94  ? 78  THR C N      1 
ATOM   6233  C CA     . THR C  1 85  ? -38.040  -39.719 31.781  1.00 44.11  ? 78  THR C CA     1 
ATOM   6234  C C      . THR C  1 85  ? -38.500  -39.147 33.115  1.00 53.34  ? 78  THR C C      1 
ATOM   6235  O O      . THR C  1 85  ? -39.395  -39.716 33.749  1.00 56.14  ? 78  THR C O      1 
ATOM   6236  C CB     . THR C  1 85  ? -37.727  -41.210 31.925  1.00 41.22  ? 78  THR C CB     1 
ATOM   6237  O OG1    . THR C  1 85  ? -36.745  -41.400 32.951  1.00 43.05  ? 78  THR C OG1    1 
ATOM   6238  C CG2    . THR C  1 85  ? -37.203  -41.769 30.607  1.00 32.05  ? 78  THR C CG2    1 
ATOM   6239  N N      . SER C  1 86  ? -37.910  -38.039 33.551  1.00 58.61  ? 79  SER C N      1 
ATOM   6240  C CA     . SER C  1 86  ? -38.253  -37.445 34.834  1.00 69.03  ? 79  SER C CA     1 
ATOM   6241  C C      . SER C  1 86  ? -39.566  -36.680 34.721  1.00 85.63  ? 79  SER C C      1 
ATOM   6242  O O      . SER C  1 86  ? -39.741  -35.855 33.817  1.00 84.16  ? 79  SER C O      1 
ATOM   6243  C CB     . SER C  1 86  ? -37.130  -36.523 35.304  1.00 62.77  ? 79  SER C CB     1 
ATOM   6244  O OG     . SER C  1 86  ? -35.873  -37.169 35.194  1.00 57.88  ? 79  SER C OG     1 
ATOM   6245  N N      . GLU C  1 87  ? -40.485  -36.952 35.650  1.00 102.65 ? 80  GLU C N      1 
ATOM   6246  C CA     . GLU C  1 87  ? -41.827  -36.384 35.562  1.00 105.44 ? 80  GLU C CA     1 
ATOM   6247  C C      . GLU C  1 87  ? -41.848  -34.898 35.901  1.00 103.96 ? 80  GLU C C      1 
ATOM   6248  O O      . GLU C  1 87  ? -42.625  -34.144 35.308  1.00 105.36 ? 80  GLU C O      1 
ATOM   6249  C CB     . GLU C  1 87  ? -42.776  -37.148 36.486  1.00 107.39 ? 80  GLU C CB     1 
ATOM   6250  N N      . GLY C  1 88  ? -41.009  -34.457 36.835  1.00 89.11  ? 81  GLY C N      1 
ATOM   6251  C CA     . GLY C  1 88  ? -40.998  -33.062 37.235  1.00 79.77  ? 81  GLY C CA     1 
ATOM   6252  C C      . GLY C  1 88  ? -40.351  -32.133 36.228  1.00 69.85  ? 81  GLY C C      1 
ATOM   6253  O O      . GLY C  1 88  ? -40.193  -30.936 36.488  1.00 70.93  ? 81  GLY C O      1 
ATOM   6254  N N      . ALA C  1 89  ? -39.982  -32.674 35.072  1.00 61.92  ? 82  ALA C N      1 
ATOM   6255  C CA     . ALA C  1 89  ? -39.265  -31.913 34.064  1.00 54.68  ? 82  ALA C CA     1 
ATOM   6256  C C      . ALA C  1 89  ? -40.204  -31.010 33.269  1.00 56.08  ? 82  ALA C C      1 
ATOM   6257  O O      . ALA C  1 89  ? -41.415  -31.239 33.174  1.00 57.56  ? 82  ALA C O      1 
ATOM   6258  C CB     . ALA C  1 89  ? -38.518  -32.849 33.115  1.00 50.33  ? 82  ALA C CB     1 
ATOM   6259  N N      . ASP C  1 90  ? -39.609  -29.970 32.689  1.00 55.95  ? 83  ASP C N      1 
ATOM   6260  C CA     . ASP C  1 90  ? -40.330  -29.022 31.852  1.00 54.86  ? 83  ASP C CA     1 
ATOM   6261  C C      . ASP C  1 90  ? -40.821  -29.707 30.582  1.00 51.37  ? 83  ASP C C      1 
ATOM   6262  O O      . ASP C  1 90  ? -40.053  -30.379 29.888  1.00 46.06  ? 83  ASP C O      1 
ATOM   6263  C CB     . ASP C  1 90  ? -39.407  -27.849 31.511  1.00 57.75  ? 83  ASP C CB     1 
ATOM   6264  C CG     . ASP C  1 90  ? -40.153  -26.643 30.972  1.00 67.21  ? 83  ASP C CG     1 
ATOM   6265  O OD1    . ASP C  1 90  ? -41.386  -26.722 30.791  1.00 73.87  ? 83  ASP C OD1    1 
ATOM   6266  O OD2    . ASP C  1 90  ? -39.493  -25.609 30.730  1.00 69.77  ? 83  ASP C OD2    1 
ATOM   6267  N N      . GLU C  1 91  ? -42.104  -29.539 30.281  1.00 50.92  ? 84  GLU C N      1 
ATOM   6268  C CA     . GLU C  1 91  ? -42.647  -30.152 29.077  1.00 51.77  ? 84  GLU C CA     1 
ATOM   6269  C C      . GLU C  1 91  ? -42.231  -29.348 27.845  1.00 50.65  ? 84  GLU C C      1 
ATOM   6270  O O      . GLU C  1 91  ? -42.184  -28.115 27.894  1.00 52.00  ? 84  GLU C O      1 
ATOM   6271  C CB     . GLU C  1 91  ? -44.170  -30.235 29.158  1.00 55.20  ? 84  GLU C CB     1 
ATOM   6272  C CG     . GLU C  1 91  ? -44.711  -31.654 29.206  1.00 60.15  ? 84  GLU C CG     1 
ATOM   6273  C CD     . GLU C  1 91  ? -46.238  -31.716 29.176  1.00 70.11  ? 84  GLU C CD     1 
ATOM   6274  O OE1    . GLU C  1 91  ? -46.877  -31.355 30.191  1.00 73.30  ? 84  GLU C OE1    1 
ATOM   6275  O OE2    . GLU C  1 91  ? -46.794  -32.130 28.133  1.00 70.21  ? 84  GLU C OE2    1 
ATOM   6276  N N      . PRO C  1 92  ? -41.912  -30.015 26.724  1.00 42.78  ? 85  PRO C N      1 
ATOM   6277  C CA     . PRO C  1 92  ? -41.971  -31.457 26.457  1.00 40.36  ? 85  PRO C CA     1 
ATOM   6278  C C      . PRO C  1 92  ? -40.729  -32.203 26.931  1.00 40.13  ? 85  PRO C C      1 
ATOM   6279  O O      . PRO C  1 92  ? -39.649  -31.619 26.940  1.00 38.96  ? 85  PRO C O      1 
ATOM   6280  C CB     . PRO C  1 92  ? -42.079  -31.513 24.933  1.00 40.20  ? 85  PRO C CB     1 
ATOM   6281  C CG     . PRO C  1 92  ? -41.262  -30.350 24.482  1.00 41.49  ? 85  PRO C CG     1 
ATOM   6282  C CD     . PRO C  1 92  ? -41.422  -29.272 25.548  1.00 44.65  ? 85  PRO C CD     1 
ATOM   6283  N N      . GLN C  1 93  ? -40.879  -33.472 27.314  1.00 34.31  ? 86  GLN C N      1 
ATOM   6284  C CA     . GLN C  1 93  ? -39.744  -34.254 27.788  1.00 37.93  ? 86  GLN C CA     1 
ATOM   6285  C C      . GLN C  1 93  ? -38.831  -34.720 26.660  1.00 35.93  ? 86  GLN C C      1 
ATOM   6286  O O      . GLN C  1 93  ? -37.847  -35.417 26.932  1.00 40.91  ? 86  GLN C O      1 
ATOM   6287  C CB     . GLN C  1 93  ? -40.228  -35.460 28.604  1.00 42.32  ? 86  GLN C CB     1 
ATOM   6288  C CG     . GLN C  1 93  ? -40.842  -36.586 27.788  1.00 54.95  ? 86  GLN C CG     1 
ATOM   6289  C CD     . GLN C  1 93  ? -41.374  -37.715 28.662  1.00 67.85  ? 86  GLN C CD     1 
ATOM   6290  O OE1    . GLN C  1 93  ? -41.165  -38.893 28.371  1.00 70.87  ? 86  GLN C OE1    1 
ATOM   6291  N NE2    . GLN C  1 93  ? -42.069  -37.357 29.736  1.00 74.22  ? 86  GLN C NE2    1 
ATOM   6292  N N      . ARG C  1 94  ? -39.131  -34.364 25.414  1.00 36.53  ? 87  ARG C N      1 
ATOM   6293  C CA     . ARG C  1 94  ? -38.259  -34.634 24.282  1.00 38.18  ? 87  ARG C CA     1 
ATOM   6294  C C      . ARG C  1 94  ? -37.820  -33.330 23.635  1.00 39.42  ? 87  ARG C C      1 
ATOM   6295  O O      . ARG C  1 94  ? -38.572  -32.351 23.598  1.00 43.77  ? 87  ARG C O      1 
ATOM   6296  C CB     . ARG C  1 94  ? -38.952  -35.493 23.226  1.00 40.67  ? 87  ARG C CB     1 
ATOM   6297  C CG     . ARG C  1 94  ? -39.190  -36.923 23.637  1.00 40.59  ? 87  ARG C CG     1 
ATOM   6298  C CD     . ARG C  1 94  ? -40.010  -37.636 22.583  1.00 38.14  ? 87  ARG C CD     1 
ATOM   6299  N NE     . ARG C  1 94  ? -40.376  -38.984 22.994  1.00 37.53  ? 87  ARG C NE     1 
ATOM   6300  C CZ     . ARG C  1 94  ? -41.344  -39.264 23.859  1.00 36.69  ? 87  ARG C CZ     1 
ATOM   6301  N NH1    . ARG C  1 94  ? -42.043  -38.285 24.420  1.00 36.48  ? 87  ARG C NH1    1 
ATOM   6302  N NH2    . ARG C  1 94  ? -41.607  -40.525 24.167  1.00 39.35  ? 87  ARG C NH2    1 
ATOM   6303  N N      . LEU C  1 95  ? -36.591  -33.324 23.127  1.00 33.24  ? 88  LEU C N      1 
ATOM   6304  C CA     . LEU C  1 95  ? -36.097  -32.174 22.385  1.00 33.64  ? 88  LEU C CA     1 
ATOM   6305  C C      . LEU C  1 95  ? -34.976  -32.634 21.467  1.00 34.57  ? 88  LEU C C      1 
ATOM   6306  O O      . LEU C  1 95  ? -34.190  -33.517 21.818  1.00 27.52  ? 88  LEU C O      1 
ATOM   6307  C CB     . LEU C  1 95  ? -35.612  -31.048 23.305  1.00 36.82  ? 88  LEU C CB     1 
ATOM   6308  C CG     . LEU C  1 95  ? -35.237  -29.768 22.549  1.00 37.82  ? 88  LEU C CG     1 
ATOM   6309  C CD1    . LEU C  1 95  ? -36.474  -29.144 21.920  1.00 32.26  ? 88  LEU C CD1    1 
ATOM   6310  C CD2    . LEU C  1 95  ? -34.544  -28.761 23.458  1.00 37.53  ? 88  LEU C CD2    1 
ATOM   6311  N N      . GLN C  1 96  ? -34.912  -32.015 20.289  1.00 29.72  ? 89  GLN C N      1 
ATOM   6312  C CA     . GLN C  1 96  ? -33.861  -32.274 19.317  1.00 36.05  ? 89  GLN C CA     1 
ATOM   6313  C C      . GLN C  1 96  ? -33.408  -30.951 18.727  1.00 36.38  ? 89  GLN C C      1 
ATOM   6314  O O      . GLN C  1 96  ? -34.225  -30.055 18.493  1.00 32.02  ? 89  GLN C O      1 
ATOM   6315  C CB     . GLN C  1 96  ? -34.325  -33.200 18.185  1.00 33.91  ? 89  GLN C CB     1 
ATOM   6316  C CG     . GLN C  1 96  ? -34.981  -34.470 18.653  1.00 34.11  ? 89  GLN C CG     1 
ATOM   6317  C CD     . GLN C  1 96  ? -36.489  -34.352 18.674  1.00 34.66  ? 89  GLN C CD     1 
ATOM   6318  O OE1    . GLN C  1 96  ? -37.073  -33.603 17.893  1.00 38.99  ? 89  GLN C OE1    1 
ATOM   6319  N NE2    . GLN C  1 96  ? -37.128  -35.100 19.559  1.00 36.54  ? 89  GLN C NE2    1 
ATOM   6320  N N      . PHE C  1 97  ? -32.107  -30.834 18.493  1.00 34.14  ? 90  PHE C N      1 
ATOM   6321  C CA     . PHE C  1 97  ? -31.529  -29.613 17.956  1.00 31.61  ? 90  PHE C CA     1 
ATOM   6322  C C      . PHE C  1 97  ? -30.198  -29.954 17.304  1.00 31.63  ? 90  PHE C C      1 
ATOM   6323  O O      . PHE C  1 97  ? -29.553  -30.941 17.680  1.00 35.19  ? 90  PHE C O      1 
ATOM   6324  C CB     . PHE C  1 97  ? -31.334  -28.564 19.060  1.00 32.53  ? 90  PHE C CB     1 
ATOM   6325  C CG     . PHE C  1 97  ? -30.553  -29.071 20.239  1.00 33.38  ? 90  PHE C CG     1 
ATOM   6326  C CD1    . PHE C  1 97  ? -29.169  -29.011 20.257  1.00 35.41  ? 90  PHE C CD1    1 
ATOM   6327  C CD2    . PHE C  1 97  ? -31.209  -29.631 21.323  1.00 33.18  ? 90  PHE C CD2    1 
ATOM   6328  C CE1    . PHE C  1 97  ? -28.455  -29.485 21.346  1.00 32.27  ? 90  PHE C CE1    1 
ATOM   6329  C CE2    . PHE C  1 97  ? -30.504  -30.108 22.409  1.00 31.73  ? 90  PHE C CE2    1 
ATOM   6330  C CZ     . PHE C  1 97  ? -29.126  -30.036 22.421  1.00 32.45  ? 90  PHE C CZ     1 
ATOM   6331  N N      . PRO C  1 98  ? -29.750  -29.146 16.348  1.00 33.45  ? 91  PRO C N      1 
ATOM   6332  C CA     . PRO C  1 98  ? -28.451  -29.385 15.721  1.00 33.96  ? 91  PRO C CA     1 
ATOM   6333  C C      . PRO C  1 98  ? -27.318  -28.897 16.609  1.00 43.67  ? 91  PRO C C      1 
ATOM   6334  O O      . PRO C  1 98  ? -27.491  -28.070 17.508  1.00 45.04  ? 91  PRO C O      1 
ATOM   6335  C CB     . PRO C  1 98  ? -28.513  -28.570 14.426  1.00 38.24  ? 91  PRO C CB     1 
ATOM   6336  C CG     . PRO C  1 98  ? -29.494  -27.495 14.704  1.00 37.45  ? 91  PRO C CG     1 
ATOM   6337  C CD     . PRO C  1 98  ? -30.437  -27.974 15.779  1.00 35.54  ? 91  PRO C CD     1 
ATOM   6338  N N      . LEU C  1 99  ? -26.140  -29.438 16.335  1.00 46.16  ? 92  LEU C N      1 
ATOM   6339  C CA     . LEU C  1 99  ? -24.955  -29.075 17.083  1.00 41.44  ? 92  LEU C CA     1 
ATOM   6340  C C      . LEU C  1 99  ? -24.643  -27.592 16.861  1.00 46.39  ? 92  LEU C C      1 
ATOM   6341  O O      . LEU C  1 99  ? -24.996  -27.025 15.822  1.00 52.91  ? 92  LEU C O      1 
ATOM   6342  C CB     . LEU C  1 99  ? -23.794  -29.955 16.628  1.00 33.97  ? 92  LEU C CB     1 
ATOM   6343  C CG     . LEU C  1 99  ? -23.528  -31.195 17.491  1.00 32.69  ? 92  LEU C CG     1 
ATOM   6344  C CD1    . LEU C  1 99  ? -22.379  -32.008 16.919  1.00 32.31  ? 92  LEU C CD1    1 
ATOM   6345  C CD2    . LEU C  1 99  ? -23.292  -30.854 18.949  1.00 30.56  ? 92  LEU C CD2    1 
ATOM   6346  N N      . PRO C  1 100 ? -23.997  -26.934 17.822  1.00 49.58  ? 93  PRO C N      1 
ATOM   6347  C CA     . PRO C  1 100 ? -23.592  -25.539 17.613  1.00 50.24  ? 93  PRO C CA     1 
ATOM   6348  C C      . PRO C  1 100 ? -22.494  -25.435 16.566  1.00 52.62  ? 93  PRO C C      1 
ATOM   6349  O O      . PRO C  1 100 ? -21.729  -26.372 16.327  1.00 50.14  ? 93  PRO C O      1 
ATOM   6350  C CB     . PRO C  1 100 ? -23.095  -25.098 18.995  1.00 48.62  ? 93  PRO C CB     1 
ATOM   6351  C CG     . PRO C  1 100 ? -22.680  -26.359 19.659  1.00 45.39  ? 93  PRO C CG     1 
ATOM   6352  C CD     . PRO C  1 100 ? -23.629  -27.419 19.162  1.00 47.77  ? 93  PRO C CD     1 
ATOM   6353  N N      . THR C  1 101 ? -22.431  -24.271 15.926  1.00 57.63  ? 94  THR C N      1 
ATOM   6354  C CA     . THR C  1 101 ? -21.463  -24.015 14.871  1.00 65.96  ? 94  THR C CA     1 
ATOM   6355  C C      . THR C  1 101 ? -20.677  -22.751 15.190  1.00 71.48  ? 94  THR C C      1 
ATOM   6356  O O      . THR C  1 101 ? -21.009  -21.996 16.109  1.00 70.08  ? 94  THR C O      1 
ATOM   6357  C CB     . THR C  1 101 ? -22.156  -23.869 13.504  1.00 68.37  ? 94  THR C CB     1 
ATOM   6358  O OG1    . THR C  1 101 ? -23.081  -24.947 13.314  1.00 67.33  ? 94  THR C OG1    1 
ATOM   6359  C CG2    . THR C  1 101 ? -21.138  -23.878 12.368  1.00 72.56  ? 94  THR C CG2    1 
ATOM   6360  N N      . ALA C  1 102 ? -19.612  -22.528 14.418  1.00 79.92  ? 95  ALA C N      1 
ATOM   6361  C CA     . ALA C  1 102 ? -18.959  -21.227 14.442  1.00 88.50  ? 95  ALA C CA     1 
ATOM   6362  C C      . ALA C  1 102 ? -19.926  -20.138 14.001  1.00 96.69  ? 95  ALA C C      1 
ATOM   6363  O O      . ALA C  1 102 ? -19.825  -18.991 14.452  1.00 100.87 ? 95  ALA C O      1 
ATOM   6364  C CB     . ALA C  1 102 ? -17.718  -21.239 13.550  1.00 91.15  ? 95  ALA C CB     1 
ATOM   6365  N N      . GLN C  1 103 ? -20.860  -20.479 13.114  1.00 105.19 ? 96  GLN C N      1 
ATOM   6366  C CA     . GLN C  1 103 ? -21.882  -19.545 12.662  1.00 108.79 ? 96  GLN C CA     1 
ATOM   6367  C C      . GLN C  1 103 ? -22.898  -19.293 13.769  1.00 106.88 ? 96  GLN C C      1 
ATOM   6368  O O      . GLN C  1 103 ? -22.965  -18.189 14.319  1.00 110.34 ? 96  GLN C O      1 
ATOM   6369  C CB     . GLN C  1 103 ? -22.577  -20.080 11.409  1.00 107.76 ? 96  GLN C CB     1 
ATOM   6370  N N      . ARG C  1 104 ? -23.695  -20.307 14.098  1.00 94.64  ? 97  ARG C N      1 
ATOM   6371  C CA     . ARG C  1 104 ? -24.711  -20.212 15.138  1.00 87.44  ? 97  ARG C CA     1 
ATOM   6372  C C      . ARG C  1 104 ? -24.327  -21.085 16.326  1.00 80.89  ? 97  ARG C C      1 
ATOM   6373  O O      . ARG C  1 104 ? -23.918  -22.238 16.150  1.00 80.98  ? 97  ARG C O      1 
ATOM   6374  C CB     . ARG C  1 104 ? -26.082  -20.627 14.599  1.00 80.77  ? 97  ARG C CB     1 
ATOM   6375  N N      . SER C  1 105 ? -24.453  -20.531 17.529  1.00 76.28  ? 98  SER C N      1 
ATOM   6376  C CA     . SER C  1 105 ? -24.212  -21.247 18.773  1.00 72.77  ? 98  SER C CA     1 
ATOM   6377  C C      . SER C  1 105 ? -25.536  -21.522 19.477  1.00 68.90  ? 98  SER C C      1 
ATOM   6378  O O      . SER C  1 105 ? -26.533  -20.825 19.269  1.00 72.70  ? 98  SER C O      1 
ATOM   6379  C CB     . SER C  1 105 ? -23.281  -20.457 19.701  1.00 76.51  ? 98  SER C CB     1 
ATOM   6380  O OG     . SER C  1 105 ? -21.943  -20.484 19.235  1.00 79.11  ? 98  SER C OG     1 
ATOM   6381  N N      . LEU C  1 106 ? -25.533  -22.554 20.320  1.00 59.89  ? 99  LEU C N      1 
ATOM   6382  C CA     . LEU C  1 106 ? -26.724  -22.909 21.081  1.00 53.13  ? 99  LEU C CA     1 
ATOM   6383  C C      . LEU C  1 106 ? -27.250  -21.709 21.859  1.00 54.20  ? 99  LEU C C      1 
ATOM   6384  O O      . LEU C  1 106 ? -26.501  -20.799 22.225  1.00 57.29  ? 99  LEU C O      1 
ATOM   6385  C CB     . LEU C  1 106 ? -26.423  -24.057 22.048  1.00 47.08  ? 99  LEU C CB     1 
ATOM   6386  C CG     . LEU C  1 106 ? -26.206  -25.444 21.445  1.00 41.88  ? 99  LEU C CG     1 
ATOM   6387  C CD1    . LEU C  1 106 ? -26.157  -26.508 22.530  1.00 41.08  ? 99  LEU C CD1    1 
ATOM   6388  C CD2    . LEU C  1 106 ? -27.302  -25.750 20.433  1.00 41.46  ? 99  LEU C CD2    1 
ATOM   6389  N N      . GLU C  1 107 ? -28.560  -21.715 22.109  1.00 53.69  ? 100 GLU C N      1 
ATOM   6390  C CA     . GLU C  1 107 ? -29.228  -20.646 22.832  1.00 56.86  ? 100 GLU C CA     1 
ATOM   6391  C C      . GLU C  1 107 ? -30.150  -21.229 23.895  1.00 51.38  ? 100 GLU C C      1 
ATOM   6392  O O      . GLU C  1 107 ? -30.856  -22.213 23.641  1.00 43.60  ? 100 GLU C O      1 
ATOM   6393  C CB     . GLU C  1 107 ? -30.040  -19.756 21.877  1.00 63.36  ? 100 GLU C CB     1 
ATOM   6394  C CG     . GLU C  1 107 ? -29.196  -18.808 21.046  1.00 70.82  ? 100 GLU C CG     1 
ATOM   6395  C CD     . GLU C  1 107 ? -28.586  -17.697 21.879  1.00 77.77  ? 100 GLU C CD     1 
ATOM   6396  O OE1    . GLU C  1 107 ? -29.191  -17.330 22.909  1.00 79.67  ? 100 GLU C OE1    1 
ATOM   6397  O OE2    . GLU C  1 107 ? -27.503  -17.198 21.509  1.00 80.98  ? 100 GLU C OE2    1 
ATOM   6398  N N      . PRO C  1 108 ? -30.164  -20.646 25.093  1.00 53.89  ? 101 PRO C N      1 
ATOM   6399  C CA     . PRO C  1 108 ? -31.108  -21.094 26.127  1.00 53.50  ? 101 PRO C CA     1 
ATOM   6400  C C      . PRO C  1 108 ? -32.543  -20.833 25.695  1.00 55.42  ? 101 PRO C C      1 
ATOM   6401  O O      . PRO C  1 108 ? -32.937  -19.692 25.445  1.00 58.30  ? 101 PRO C O      1 
ATOM   6402  C CB     . PRO C  1 108 ? -30.714  -20.257 27.351  1.00 53.12  ? 101 PRO C CB     1 
ATOM   6403  C CG     . PRO C  1 108 ? -30.032  -19.052 26.781  1.00 54.86  ? 101 PRO C CG     1 
ATOM   6404  C CD     . PRO C  1 108 ? -29.320  -19.529 25.550  1.00 53.38  ? 101 PRO C CD     1 
ATOM   6405  N N      . GLY C  1 109 ? -33.326  -21.903 25.600  1.00 55.00  ? 102 GLY C N      1 
ATOM   6406  C CA     . GLY C  1 109 ? -34.719  -21.757 25.232  1.00 57.13  ? 102 GLY C CA     1 
ATOM   6407  C C      . GLY C  1 109 ? -35.655  -22.622 26.049  1.00 56.00  ? 102 GLY C C      1 
ATOM   6408  O O      . GLY C  1 109 ? -35.504  -22.744 27.268  1.00 53.20  ? 102 GLY C O      1 
ATOM   6409  N N      . THR C  1 110 ? -36.631  -23.228 25.377  1.00 59.49  ? 103 THR C N      1 
ATOM   6410  C CA     . THR C  1 110 ? -37.583  -24.137 25.987  1.00 59.02  ? 103 THR C CA     1 
ATOM   6411  C C      . THR C  1 110 ? -37.519  -25.495 25.301  1.00 50.45  ? 103 THR C C      1 
ATOM   6412  O O      . THR C  1 110 ? -37.319  -25.561 24.084  1.00 48.51  ? 103 THR C O      1 
ATOM   6413  C CB     . THR C  1 110 ? -39.013  -23.583 25.893  1.00 69.23  ? 103 THR C CB     1 
ATOM   6414  O OG1    . THR C  1 110 ? -39.951  -24.597 26.277  1.00 72.87  ? 103 THR C OG1    1 
ATOM   6415  C CG2    . THR C  1 110 ? -39.315  -23.122 24.472  1.00 73.27  ? 103 THR C CG2    1 
ATOM   6416  N N      . PRO C  1 111 ? -37.695  -26.598 26.045  1.00 49.32  ? 104 PRO C N      1 
ATOM   6417  C CA     . PRO C  1 111 ? -37.989  -26.630 27.483  1.00 48.25  ? 104 PRO C CA     1 
ATOM   6418  C C      . PRO C  1 111 ? -36.797  -26.236 28.354  1.00 50.46  ? 104 PRO C C      1 
ATOM   6419  O O      . PRO C  1 111 ? -35.650  -26.327 27.913  1.00 48.52  ? 104 PRO C O      1 
ATOM   6420  C CB     . PRO C  1 111 ? -38.374  -28.092 27.721  1.00 44.50  ? 104 PRO C CB     1 
ATOM   6421  C CG     . PRO C  1 111 ? -37.617  -28.844 26.686  1.00 42.59  ? 104 PRO C CG     1 
ATOM   6422  C CD     . PRO C  1 111 ? -37.585  -27.953 25.475  1.00 45.15  ? 104 PRO C CD     1 
ATOM   6423  N N      . ARG C  1 112 ? -37.082  -25.807 29.587  1.00 52.11  ? 105 ARG C N      1 
ATOM   6424  C CA     . ARG C  1 112 ? -36.028  -25.312 30.467  1.00 52.82  ? 105 ARG C CA     1 
ATOM   6425  C C      . ARG C  1 112 ? -34.991  -26.385 30.774  1.00 47.90  ? 105 ARG C C      1 
ATOM   6426  O O      . ARG C  1 112 ? -33.787  -26.103 30.797  1.00 45.89  ? 105 ARG C O      1 
ATOM   6427  C CB     . ARG C  1 112 ? -36.632  -24.772 31.763  1.00 59.54  ? 105 ARG C CB     1 
ATOM   6428  C CG     . ARG C  1 112 ? -37.520  -23.554 31.570  1.00 69.03  ? 105 ARG C CG     1 
ATOM   6429  C CD     . ARG C  1 112 ? -37.839  -22.891 32.903  1.00 74.74  ? 105 ARG C CD     1 
ATOM   6430  N NE     . ARG C  1 112 ? -38.356  -23.840 33.886  1.00 78.34  ? 105 ARG C NE     1 
ATOM   6431  C CZ     . ARG C  1 112 ? -39.626  -24.228 33.954  1.00 81.98  ? 105 ARG C CZ     1 
ATOM   6432  N NH1    . ARG C  1 112 ? -40.511  -23.754 33.089  1.00 84.18  ? 105 ARG C NH1    1 
ATOM   6433  N NH2    . ARG C  1 112 ? -40.009  -25.094 34.883  1.00 82.08  ? 105 ARG C NH2    1 
ATOM   6434  N N      . TRP C  1 113 ? -35.433  -27.622 31.015  1.00 45.09  ? 106 TRP C N      1 
ATOM   6435  C CA     . TRP C  1 113 ? -34.501  -28.658 31.451  1.00 40.10  ? 106 TRP C CA     1 
ATOM   6436  C C      . TRP C  1 113 ? -33.412  -28.910 30.418  1.00 39.78  ? 106 TRP C C      1 
ATOM   6437  O O      . TRP C  1 113 ? -32.283  -29.261 30.781  1.00 41.16  ? 106 TRP C O      1 
ATOM   6438  C CB     . TRP C  1 113 ? -35.257  -29.947 31.774  1.00 42.10  ? 106 TRP C CB     1 
ATOM   6439  C CG     . TRP C  1 113 ? -35.881  -30.617 30.592  1.00 44.45  ? 106 TRP C CG     1 
ATOM   6440  C CD1    . TRP C  1 113 ? -37.165  -30.473 30.157  1.00 45.01  ? 106 TRP C CD1    1 
ATOM   6441  C CD2    . TRP C  1 113 ? -35.263  -31.561 29.711  1.00 41.47  ? 106 TRP C CD2    1 
ATOM   6442  N NE1    . TRP C  1 113 ? -37.382  -31.258 29.051  1.00 45.60  ? 106 TRP C NE1    1 
ATOM   6443  C CE2    . TRP C  1 113 ? -36.230  -31.937 28.757  1.00 43.57  ? 106 TRP C CE2    1 
ATOM   6444  C CE3    . TRP C  1 113 ? -33.985  -32.120 29.632  1.00 40.85  ? 106 TRP C CE3    1 
ATOM   6445  C CZ2    . TRP C  1 113 ? -35.958  -32.846 27.736  1.00 43.94  ? 106 TRP C CZ2    1 
ATOM   6446  C CZ3    . TRP C  1 113 ? -33.717  -33.022 28.619  1.00 40.03  ? 106 TRP C CZ3    1 
ATOM   6447  C CH2    . TRP C  1 113 ? -34.699  -33.377 27.685  1.00 43.50  ? 106 TRP C CH2    1 
ATOM   6448  N N      . ALA C  1 114 ? -33.721  -28.732 29.135  1.00 38.30  ? 107 ALA C N      1 
ATOM   6449  C CA     . ALA C  1 114 ? -32.722  -28.966 28.102  1.00 37.96  ? 107 ALA C CA     1 
ATOM   6450  C C      . ALA C  1 114 ? -31.617  -27.916 28.103  1.00 32.21  ? 107 ALA C C      1 
ATOM   6451  O O      . ALA C  1 114 ? -30.572  -28.141 27.485  1.00 34.53  ? 107 ALA C O      1 
ATOM   6452  C CB     . ALA C  1 114 ? -33.393  -29.024 26.729  1.00 27.46  ? 107 ALA C CB     1 
ATOM   6453  N N      . ASN C  1 115 ? -31.813  -26.778 28.779  1.00 31.00  ? 108 ASN C N      1 
ATOM   6454  C CA     . ASN C  1 115 ? -30.766  -25.758 28.816  1.00 38.55  ? 108 ASN C CA     1 
ATOM   6455  C C      . ASN C  1 115 ? -29.490  -26.267 29.473  1.00 41.97  ? 108 ASN C C      1 
ATOM   6456  O O      . ASN C  1 115 ? -28.388  -25.862 29.086  1.00 46.23  ? 108 ASN C O      1 
ATOM   6457  C CB     . ASN C  1 115 ? -31.263  -24.508 29.547  1.00 41.14  ? 108 ASN C CB     1 
ATOM   6458  C CG     . ASN C  1 115 ? -32.324  -23.768 28.770  1.00 42.66  ? 108 ASN C CG     1 
ATOM   6459  O OD1    . ASN C  1 115 ? -32.372  -23.840 27.543  1.00 45.06  ? 108 ASN C OD1    1 
ATOM   6460  N ND2    . ASN C  1 115 ? -33.178  -23.041 29.479  1.00 46.65  ? 108 ASN C ND2    1 
ATOM   6461  N N      . TYR C  1 116 ? -29.616  -27.154 30.460  1.00 36.03  ? 109 TYR C N      1 
ATOM   6462  C CA     . TYR C  1 116 ? -28.442  -27.626 31.184  1.00 33.46  ? 109 TYR C CA     1 
ATOM   6463  C C      . TYR C  1 116 ? -27.516  -28.432 30.281  1.00 31.52  ? 109 TYR C C      1 
ATOM   6464  O O      . TYR C  1 116 ? -26.297  -28.223 30.284  1.00 29.64  ? 109 TYR C O      1 
ATOM   6465  C CB     . TYR C  1 116 ? -28.886  -28.447 32.392  1.00 29.67  ? 109 TYR C CB     1 
ATOM   6466  C CG     . TYR C  1 116 ? -29.633  -27.622 33.413  1.00 30.59  ? 109 TYR C CG     1 
ATOM   6467  C CD1    . TYR C  1 116 ? -31.012  -27.461 33.331  1.00 29.60  ? 109 TYR C CD1    1 
ATOM   6468  C CD2    . TYR C  1 116 ? -28.961  -26.990 34.446  1.00 29.52  ? 109 TYR C CD2    1 
ATOM   6469  C CE1    . TYR C  1 116 ? -31.698  -26.704 34.260  1.00 31.01  ? 109 TYR C CE1    1 
ATOM   6470  C CE2    . TYR C  1 116 ? -29.636  -26.233 35.378  1.00 31.28  ? 109 TYR C CE2    1 
ATOM   6471  C CZ     . TYR C  1 116 ? -31.003  -26.093 35.283  1.00 33.88  ? 109 TYR C CZ     1 
ATOM   6472  O OH     . TYR C  1 116 ? -31.670  -25.333 36.216  1.00 37.85  ? 109 TYR C OH     1 
ATOM   6473  N N      . VAL C  1 117 ? -28.076  -29.352 29.491  1.00 30.75  ? 110 VAL C N      1 
ATOM   6474  C CA     . VAL C  1 117 ? -27.248  -30.138 28.580  1.00 31.06  ? 110 VAL C CA     1 
ATOM   6475  C C      . VAL C  1 117 ? -26.791  -29.280 27.407  1.00 33.07  ? 110 VAL C C      1 
ATOM   6476  O O      . VAL C  1 117 ? -25.657  -29.410 26.932  1.00 35.52  ? 110 VAL C O      1 
ATOM   6477  C CB     . VAL C  1 117 ? -27.989  -31.406 28.117  1.00 31.83  ? 110 VAL C CB     1 
ATOM   6478  C CG1    . VAL C  1 117 ? -29.380  -31.471 28.721  1.00 33.74  ? 110 VAL C CG1    1 
ATOM   6479  C CG2    . VAL C  1 117 ? -28.042  -31.466 26.602  1.00 32.84  ? 110 VAL C CG2    1 
ATOM   6480  N N      . LYS C  1 118 ? -27.660  -28.388 26.923  1.00 36.65  ? 111 LYS C N      1 
ATOM   6481  C CA     . LYS C  1 118 ? -27.249  -27.466 25.869  1.00 38.42  ? 111 LYS C CA     1 
ATOM   6482  C C      . LYS C  1 118 ? -26.031  -26.668 26.309  1.00 34.30  ? 111 LYS C C      1 
ATOM   6483  O O      . LYS C  1 118 ? -25.059  -26.522 25.558  1.00 27.57  ? 111 LYS C O      1 
ATOM   6484  C CB     . LYS C  1 118 ? -28.391  -26.512 25.516  1.00 42.48  ? 111 LYS C CB     1 
ATOM   6485  C CG     . LYS C  1 118 ? -29.495  -27.072 24.641  1.00 43.31  ? 111 LYS C CG     1 
ATOM   6486  C CD     . LYS C  1 118 ? -30.499  -25.971 24.332  1.00 46.49  ? 111 LYS C CD     1 
ATOM   6487  C CE     . LYS C  1 118 ? -31.698  -26.477 23.555  1.00 51.76  ? 111 LYS C CE     1 
ATOM   6488  N NZ     . LYS C  1 118 ? -32.701  -25.385 23.397  1.00 55.83  ? 111 LYS C NZ     1 
ATOM   6489  N N      . GLY C  1 119 ? -26.068  -26.150 27.538  1.00 36.10  ? 112 GLY C N      1 
ATOM   6490  C CA     . GLY C  1 119 ? -24.948  -25.374 28.040  1.00 37.66  ? 112 GLY C CA     1 
ATOM   6491  C C      . GLY C  1 119 ? -23.671  -26.186 28.129  1.00 36.24  ? 112 GLY C C      1 
ATOM   6492  O O      . GLY C  1 119 ? -22.592  -25.703 27.778  1.00 27.48  ? 112 GLY C O      1 
ATOM   6493  N N      . VAL C  1 120 ? -23.773  -27.424 28.616  1.00 30.78  ? 113 VAL C N      1 
ATOM   6494  C CA     . VAL C  1 120 ? -22.596  -28.283 28.703  1.00 30.75  ? 113 VAL C CA     1 
ATOM   6495  C C      . VAL C  1 120 ? -22.026  -28.539 27.315  1.00 35.49  ? 113 VAL C C      1 
ATOM   6496  O O      . VAL C  1 120 ? -20.805  -28.538 27.116  1.00 38.00  ? 113 VAL C O      1 
ATOM   6497  C CB     . VAL C  1 120 ? -22.948  -29.598 29.422  1.00 26.78  ? 113 VAL C CB     1 
ATOM   6498  C CG1    . VAL C  1 120 ? -21.741  -30.521 29.466  1.00 23.97  ? 113 VAL C CG1    1 
ATOM   6499  C CG2    . VAL C  1 120 ? -23.460  -29.312 30.823  1.00 24.95  ? 113 VAL C CG2    1 
ATOM   6500  N N      . ILE C  1 121 ? -22.901  -28.755 26.332  1.00 36.38  ? 114 ILE C N      1 
ATOM   6501  C CA     . ILE C  1 121 ? -22.450  -28.946 24.957  1.00 36.92  ? 114 ILE C CA     1 
ATOM   6502  C C      . ILE C  1 121 ? -21.715  -27.708 24.464  1.00 37.63  ? 114 ILE C C      1 
ATOM   6503  O O      . ILE C  1 121 ? -20.627  -27.796 23.883  1.00 39.18  ? 114 ILE C O      1 
ATOM   6504  C CB     . ILE C  1 121 ? -23.645  -29.288 24.048  1.00 32.20  ? 114 ILE C CB     1 
ATOM   6505  C CG1    . ILE C  1 121 ? -24.164  -30.692 24.351  1.00 24.50  ? 114 ILE C CG1    1 
ATOM   6506  C CG2    . ILE C  1 121 ? -23.269  -29.153 22.580  1.00 27.61  ? 114 ILE C CG2    1 
ATOM   6507  C CD1    . ILE C  1 121 ? -25.523  -30.957 23.772  1.00 24.57  ? 114 ILE C CD1    1 
ATOM   6508  N N      . GLN C  1 122 ? -22.304  -26.532 24.687  1.00 35.42  ? 115 GLN C N      1 
ATOM   6509  C CA     . GLN C  1 122 ? -21.736  -25.304 24.144  1.00 38.04  ? 115 GLN C CA     1 
ATOM   6510  C C      . GLN C  1 122 ? -20.340  -25.030 24.692  1.00 40.35  ? 115 GLN C C      1 
ATOM   6511  O O      . GLN C  1 122 ? -19.465  -24.550 23.962  1.00 47.54  ? 115 GLN C O      1 
ATOM   6512  C CB     . GLN C  1 122 ? -22.662  -24.127 24.444  1.00 42.44  ? 115 GLN C CB     1 
ATOM   6513  C CG     . GLN C  1 122 ? -22.191  -22.813 23.854  1.00 44.28  ? 115 GLN C CG     1 
ATOM   6514  C CD     . GLN C  1 122 ? -22.419  -22.733 22.360  1.00 45.64  ? 115 GLN C CD     1 
ATOM   6515  O OE1    . GLN C  1 122 ? -23.441  -23.196 21.852  1.00 43.90  ? 115 GLN C OE1    1 
ATOM   6516  N NE2    . GLN C  1 122 ? -21.467  -22.142 21.647  1.00 47.51  ? 115 GLN C NE2    1 
ATOM   6517  N N      . TYR C  1 123 ? -20.108  -25.328 25.970  1.00 40.38  ? 116 TYR C N      1 
ATOM   6518  C CA     . TYR C  1 123 ? -18.847  -24.989 26.618  1.00 44.18  ? 116 TYR C CA     1 
ATOM   6519  C C      . TYR C  1 123 ? -17.887  -26.168 26.721  1.00 47.45  ? 116 TYR C C      1 
ATOM   6520  O O      . TYR C  1 123 ? -16.827  -26.036 27.342  1.00 48.58  ? 116 TYR C O      1 
ATOM   6521  C CB     . TYR C  1 123 ? -19.110  -24.409 28.010  1.00 39.80  ? 116 TYR C CB     1 
ATOM   6522  C CG     . TYR C  1 123 ? -19.919  -23.133 27.982  1.00 42.74  ? 116 TYR C CG     1 
ATOM   6523  C CD1    . TYR C  1 123 ? -19.459  -22.011 27.307  1.00 46.48  ? 116 TYR C CD1    1 
ATOM   6524  C CD2    . TYR C  1 123 ? -21.138  -23.048 28.640  1.00 41.28  ? 116 TYR C CD2    1 
ATOM   6525  C CE1    . TYR C  1 123 ? -20.199  -20.844 27.275  1.00 47.76  ? 116 TYR C CE1    1 
ATOM   6526  C CE2    . TYR C  1 123 ? -21.884  -21.885 28.616  1.00 42.99  ? 116 TYR C CE2    1 
ATOM   6527  C CZ     . TYR C  1 123 ? -21.409  -20.785 27.931  1.00 46.22  ? 116 TYR C CZ     1 
ATOM   6528  O OH     . TYR C  1 123 ? -22.144  -19.622 27.908  1.00 49.34  ? 116 TYR C OH     1 
ATOM   6529  N N      . TYR C  1 124 ? -18.223  -27.308 26.135  1.00 43.02  ? 117 TYR C N      1 
ATOM   6530  C CA     . TYR C  1 124 ? -17.303  -28.435 26.149  1.00 40.88  ? 117 TYR C CA     1 
ATOM   6531  C C      . TYR C  1 124 ? -16.026  -28.051 25.408  1.00 41.13  ? 117 TYR C C      1 
ATOM   6532  O O      . TYR C  1 124 ? -16.099  -27.534 24.285  1.00 45.04  ? 117 TYR C O      1 
ATOM   6533  C CB     . TYR C  1 124 ? -17.939  -29.662 25.502  1.00 39.04  ? 117 TYR C CB     1 
ATOM   6534  C CG     . TYR C  1 124 ? -17.170  -30.938 25.746  1.00 37.44  ? 117 TYR C CG     1 
ATOM   6535  C CD1    . TYR C  1 124 ? -17.136  -31.517 27.009  1.00 33.41  ? 117 TYR C CD1    1 
ATOM   6536  C CD2    . TYR C  1 124 ? -16.471  -31.561 24.718  1.00 38.63  ? 117 TYR C CD2    1 
ATOM   6537  C CE1    . TYR C  1 124 ? -16.436  -32.682 27.241  1.00 32.47  ? 117 TYR C CE1    1 
ATOM   6538  C CE2    . TYR C  1 124 ? -15.765  -32.729 24.943  1.00 38.70  ? 117 TYR C CE2    1 
ATOM   6539  C CZ     . TYR C  1 124 ? -15.752  -33.281 26.209  1.00 33.76  ? 117 TYR C CZ     1 
ATOM   6540  O OH     . TYR C  1 124 ? -15.062  -34.442 26.455  1.00 32.95  ? 117 TYR C OH     1 
ATOM   6541  N N      . PRO C  1 125 ? -14.847  -28.284 25.991  1.00 43.68  ? 118 PRO C N      1 
ATOM   6542  C CA     . PRO C  1 125 ? -13.609  -27.726 25.429  1.00 45.79  ? 118 PRO C CA     1 
ATOM   6543  C C      . PRO C  1 125 ? -12.940  -28.531 24.324  1.00 49.84  ? 118 PRO C C      1 
ATOM   6544  O O      . PRO C  1 125 ? -11.956  -28.040 23.753  1.00 53.56  ? 118 PRO C O      1 
ATOM   6545  C CB     . PRO C  1 125 ? -12.693  -27.660 26.661  1.00 41.48  ? 118 PRO C CB     1 
ATOM   6546  C CG     . PRO C  1 125 ? -13.142  -28.810 27.501  1.00 41.34  ? 118 PRO C CG     1 
ATOM   6547  C CD     . PRO C  1 125 ? -14.632  -28.916 27.304  1.00 43.78  ? 118 PRO C CD     1 
ATOM   6548  N N      . ALA C  1 126 ? -13.416  -29.729 23.999  1.00 47.90  ? 119 ALA C N      1 
ATOM   6549  C CA     . ALA C  1 126 ? -12.763  -30.576 23.012  1.00 47.77  ? 119 ALA C CA     1 
ATOM   6550  C C      . ALA C  1 126 ? -13.623  -30.704 21.759  1.00 51.37  ? 119 ALA C C      1 
ATOM   6551  O O      . ALA C  1 126 ? -14.840  -30.499 21.789  1.00 48.16  ? 119 ALA C O      1 
ATOM   6552  C CB     . ALA C  1 126 ? -12.466  -31.965 23.593  1.00 45.77  ? 119 ALA C CB     1 
ATOM   6553  N N      . ALA C  1 127 ? -12.974  -31.063 20.653  1.00 50.61  ? 120 ALA C N      1 
ATOM   6554  C CA     . ALA C  1 127 ? -13.627  -31.232 19.361  1.00 49.51  ? 120 ALA C CA     1 
ATOM   6555  C C      . ALA C  1 127 ? -12.883  -32.305 18.586  1.00 50.67  ? 120 ALA C C      1 
ATOM   6556  O O      . ALA C  1 127 ? -11.693  -32.531 18.837  1.00 51.65  ? 120 ALA C O      1 
ATOM   6557  C CB     . ALA C  1 127 ? -13.661  -29.927 18.553  1.00 48.79  ? 120 ALA C CB     1 
ATOM   6558  N N      . PRO C  1 128 ? -13.541  -32.967 17.620  1.00 52.76  ? 121 PRO C N      1 
ATOM   6559  C CA     . PRO C  1 128 ? -14.918  -32.717 17.184  1.00 49.76  ? 121 PRO C CA     1 
ATOM   6560  C C      . PRO C  1 128 ? -15.974  -33.455 17.998  1.00 47.96  ? 121 PRO C C      1 
ATOM   6561  O O      . PRO C  1 128 ? -15.806  -34.633 18.312  1.00 48.74  ? 121 PRO C O      1 
ATOM   6562  C CB     . PRO C  1 128 ? -14.912  -33.224 15.742  1.00 52.72  ? 121 PRO C CB     1 
ATOM   6563  C CG     . PRO C  1 128 ? -13.930  -34.354 15.766  1.00 52.42  ? 121 PRO C CG     1 
ATOM   6564  C CD     . PRO C  1 128 ? -12.908  -34.044 16.837  1.00 54.07  ? 121 PRO C CD     1 
ATOM   6565  N N      . LEU C  1 129 ? -17.050  -32.750 18.343  1.00 45.71  ? 122 LEU C N      1 
ATOM   6566  C CA     . LEU C  1 129 ? -18.159  -33.352 19.069  1.00 42.35  ? 122 LEU C CA     1 
ATOM   6567  C C      . LEU C  1 129 ? -19.199  -33.864 18.082  1.00 39.57  ? 122 LEU C C      1 
ATOM   6568  O O      . LEU C  1 129 ? -19.739  -33.067 17.305  1.00 39.20  ? 122 LEU C O      1 
ATOM   6569  C CB     . LEU C  1 129 ? -18.797  -32.346 20.010  1.00 41.17  ? 122 LEU C CB     1 
ATOM   6570  C CG     . LEU C  1 129 ? -19.564  -32.939 21.192  1.00 41.47  ? 122 LEU C CG     1 
ATOM   6571  C CD1    . LEU C  1 129 ? -18.685  -33.913 21.960  1.00 39.38  ? 122 LEU C CD1    1 
ATOM   6572  C CD2    . LEU C  1 129 ? -20.072  -31.838 22.103  1.00 43.65  ? 122 LEU C CD2    1 
ATOM   6573  N N      . PRO C  1 130 ? -19.494  -35.158 18.059  1.00 39.42  ? 123 PRO C N      1 
ATOM   6574  C CA     . PRO C  1 130 ? -20.544  -35.659 17.171  1.00 37.30  ? 123 PRO C CA     1 
ATOM   6575  C C      . PRO C  1 130 ? -21.928  -35.424 17.757  1.00 38.63  ? 123 PRO C C      1 
ATOM   6576  O O      . PRO C  1 130 ? -22.098  -35.166 18.950  1.00 39.24  ? 123 PRO C O      1 
ATOM   6577  C CB     . PRO C  1 130 ? -20.227  -37.154 17.078  1.00 36.69  ? 123 PRO C CB     1 
ATOM   6578  C CG     . PRO C  1 130 ? -19.660  -37.465 18.423  1.00 33.02  ? 123 PRO C CG     1 
ATOM   6579  C CD     . PRO C  1 130 ? -18.850  -36.249 18.813  1.00 33.72  ? 123 PRO C CD     1 
ATOM   6580  N N      . GLY C  1 131 ? -22.929  -35.514 16.886  1.00 41.46  ? 124 GLY C N      1 
ATOM   6581  C CA     . GLY C  1 131 ? -24.296  -35.606 17.356  1.00 37.01  ? 124 GLY C CA     1 
ATOM   6582  C C      . GLY C  1 131 ? -24.526  -36.875 18.152  1.00 36.47  ? 124 GLY C C      1 
ATOM   6583  O O      . GLY C  1 131 ? -23.752  -37.831 18.083  1.00 37.82  ? 124 GLY C O      1 
ATOM   6584  N N      . PHE C  1 132 ? -25.611  -36.892 18.923  1.00 33.52  ? 125 PHE C N      1 
ATOM   6585  C CA     . PHE C  1 132 ? -25.908  -38.082 19.709  1.00 32.85  ? 125 PHE C CA     1 
ATOM   6586  C C      . PHE C  1 132 ? -27.388  -38.159 20.048  1.00 33.77  ? 125 PHE C C      1 
ATOM   6587  O O      . PHE C  1 132 ? -28.114  -37.160 20.029  1.00 33.61  ? 125 PHE C O      1 
ATOM   6588  C CB     . PHE C  1 132 ? -25.094  -38.154 21.012  1.00 35.44  ? 125 PHE C CB     1 
ATOM   6589  C CG     . PHE C  1 132 ? -25.244  -36.952 21.913  1.00 32.84  ? 125 PHE C CG     1 
ATOM   6590  C CD1    . PHE C  1 132 ? -24.790  -35.701 21.526  1.00 33.97  ? 125 PHE C CD1    1 
ATOM   6591  C CD2    . PHE C  1 132 ? -25.911  -37.069 23.121  1.00 29.24  ? 125 PHE C CD2    1 
ATOM   6592  C CE1    . PHE C  1 132 ? -24.936  -34.609 22.361  1.00 31.50  ? 125 PHE C CE1    1 
ATOM   6593  C CE2    . PHE C  1 132 ? -26.065  -35.984 23.956  1.00 25.54  ? 125 PHE C CE2    1 
ATOM   6594  C CZ     . PHE C  1 132 ? -25.582  -34.750 23.575  1.00 27.54  ? 125 PHE C CZ     1 
ATOM   6595  N N      . SER C  1 133 ? -27.818  -39.381 20.354  1.00 35.17  ? 126 SER C N      1 
ATOM   6596  C CA     . SER C  1 133 ? -29.103  -39.655 20.978  1.00 37.70  ? 126 SER C CA     1 
ATOM   6597  C C      . SER C  1 133 ? -28.855  -40.074 22.421  1.00 35.34  ? 126 SER C C      1 
ATOM   6598  O O      . SER C  1 133 ? -27.840  -40.710 22.721  1.00 36.30  ? 126 SER C O      1 
ATOM   6599  C CB     . SER C  1 133 ? -29.856  -40.757 20.226  1.00 40.06  ? 126 SER C CB     1 
ATOM   6600  O OG     . SER C  1 133 ? -29.879  -40.501 18.832  1.00 40.88  ? 126 SER C OG     1 
ATOM   6601  N N      . ALA C  1 134 ? -29.758  -39.689 23.320  1.00 32.89  ? 127 ALA C N      1 
ATOM   6602  C CA     . ALA C  1 134 ? -29.564  -39.995 24.731  1.00 31.95  ? 127 ALA C CA     1 
ATOM   6603  C C      . ALA C  1 134 ? -30.889  -39.891 25.471  1.00 33.56  ? 127 ALA C C      1 
ATOM   6604  O O      . ALA C  1 134 ? -31.743  -39.068 25.128  1.00 34.50  ? 127 ALA C O      1 
ATOM   6605  C CB     . ALA C  1 134 ? -28.527  -39.065 25.368  1.00 32.15  ? 127 ALA C CB     1 
ATOM   6606  N N      . VAL C  1 135 ? -31.051  -40.736 26.487  1.00 32.81  ? 128 VAL C N      1 
ATOM   6607  C CA     . VAL C  1 135 ? -32.157  -40.630 27.429  1.00 36.76  ? 128 VAL C CA     1 
ATOM   6608  C C      . VAL C  1 135 ? -31.577  -40.383 28.813  1.00 36.85  ? 128 VAL C C      1 
ATOM   6609  O O      . VAL C  1 135 ? -30.545  -40.959 29.178  1.00 32.84  ? 128 VAL C O      1 
ATOM   6610  C CB     . VAL C  1 135 ? -33.051  -41.888 27.434  1.00 40.32  ? 128 VAL C CB     1 
ATOM   6611  C CG1    . VAL C  1 135 ? -33.418  -42.283 26.011  1.00 43.44  ? 128 VAL C CG1    1 
ATOM   6612  C CG2    . VAL C  1 135 ? -32.371  -43.031 28.174  1.00 44.55  ? 128 VAL C CG2    1 
ATOM   6613  N N      . VAL C  1 136 ? -32.239  -39.523 29.579  1.00 36.77  ? 129 VAL C N      1 
ATOM   6614  C CA     . VAL C  1 136 ? -31.823  -39.191 30.935  1.00 30.77  ? 129 VAL C CA     1 
ATOM   6615  C C      . VAL C  1 136 ? -32.816  -39.806 31.907  1.00 34.77  ? 129 VAL C C      1 
ATOM   6616  O O      . VAL C  1 136 ? -34.033  -39.650 31.746  1.00 39.44  ? 129 VAL C O      1 
ATOM   6617  C CB     . VAL C  1 136 ? -31.726  -37.671 31.144  1.00 24.33  ? 129 VAL C CB     1 
ATOM   6618  C CG1    . VAL C  1 136 ? -31.128  -37.368 32.514  1.00 27.51  ? 129 VAL C CG1    1 
ATOM   6619  C CG2    . VAL C  1 136 ? -30.906  -37.039 30.032  1.00 23.93  ? 129 VAL C CG2    1 
ATOM   6620  N N      . VAL C  1 137 ? -32.300  -40.509 32.909  1.00 32.96  ? 130 VAL C N      1 
ATOM   6621  C CA     . VAL C  1 137 ? -33.101  -40.969 34.033  1.00 32.33  ? 130 VAL C CA     1 
ATOM   6622  C C      . VAL C  1 137 ? -32.397  -40.568 35.319  1.00 36.51  ? 130 VAL C C      1 
ATOM   6623  O O      . VAL C  1 137 ? -31.165  -40.494 35.381  1.00 40.62  ? 130 VAL C O      1 
ATOM   6624  C CB     . VAL C  1 137 ? -33.351  -42.490 33.994  1.00 32.04  ? 130 VAL C CB     1 
ATOM   6625  C CG1    . VAL C  1 137 ? -34.014  -42.884 32.674  1.00 36.18  ? 130 VAL C CG1    1 
ATOM   6626  C CG2    . VAL C  1 137 ? -32.049  -43.246 34.199  1.00 36.27  ? 130 VAL C CG2    1 
ATOM   6627  N N      . SER C  1 138 ? -33.189  -40.318 36.356  1.00 35.67  ? 131 SER C N      1 
ATOM   6628  C CA     . SER C  1 138 ? -32.655  -39.765 37.589  1.00 35.79  ? 131 SER C CA     1 
ATOM   6629  C C      . SER C  1 138 ? -33.527  -40.171 38.765  1.00 36.82  ? 131 SER C C      1 
ATOM   6630  O O      . SER C  1 138 ? -34.755  -40.215 38.652  1.00 42.35  ? 131 SER C O      1 
ATOM   6631  C CB     . SER C  1 138 ? -32.559  -38.238 37.503  1.00 39.27  ? 131 SER C CB     1 
ATOM   6632  O OG     . SER C  1 138 ? -32.047  -37.697 38.705  1.00 41.72  ? 131 SER C OG     1 
ATOM   6633  N N      . SER C  1 139 ? -32.881  -40.464 39.892  1.00 36.98  ? 132 SER C N      1 
ATOM   6634  C CA     . SER C  1 139 ? -33.561  -40.631 41.168  1.00 39.25  ? 132 SER C CA     1 
ATOM   6635  C C      . SER C  1 139 ? -33.401  -39.413 42.069  1.00 38.78  ? 132 SER C C      1 
ATOM   6636  O O      . SER C  1 139 ? -33.836  -39.444 43.225  1.00 37.13  ? 132 SER C O      1 
ATOM   6637  C CB     . SER C  1 139 ? -33.047  -41.884 41.882  1.00 41.65  ? 132 SER C CB     1 
ATOM   6638  O OG     . SER C  1 139 ? -31.632  -41.894 41.961  1.00 47.31  ? 132 SER C OG     1 
ATOM   6639  N N      . VAL C  1 140 ? -32.788  -38.348 41.564  1.00 38.65  ? 133 VAL C N      1 
ATOM   6640  C CA     . VAL C  1 140 ? -32.617  -37.108 42.313  1.00 40.61  ? 133 VAL C CA     1 
ATOM   6641  C C      . VAL C  1 140 ? -33.874  -36.266 42.119  1.00 45.37  ? 133 VAL C C      1 
ATOM   6642  O O      . VAL C  1 140 ? -34.241  -35.983 40.967  1.00 48.05  ? 133 VAL C O      1 
ATOM   6643  C CB     . VAL C  1 140 ? -31.373  -36.342 41.849  1.00 36.86  ? 133 VAL C CB     1 
ATOM   6644  C CG1    . VAL C  1 140 ? -31.103  -35.164 42.773  1.00 37.18  ? 133 VAL C CG1    1 
ATOM   6645  C CG2    . VAL C  1 140 ? -30.170  -37.273 41.778  1.00 34.90  ? 133 VAL C CG2    1 
ATOM   6646  N N      . PRO C  1 141 ? -34.561  -35.862 43.187  1.00 47.63  ? 134 PRO C N      1 
ATOM   6647  C CA     . PRO C  1 141 ? -35.778  -35.060 43.008  1.00 46.04  ? 134 PRO C CA     1 
ATOM   6648  C C      . PRO C  1 141 ? -35.441  -33.700 42.413  1.00 44.90  ? 134 PRO C C      1 
ATOM   6649  O O      . PRO C  1 141 ? -34.598  -32.969 42.937  1.00 49.21  ? 134 PRO C O      1 
ATOM   6650  C CB     . PRO C  1 141 ? -36.334  -34.932 44.430  1.00 49.50  ? 134 PRO C CB     1 
ATOM   6651  C CG     . PRO C  1 141 ? -35.142  -35.082 45.313  1.00 49.87  ? 134 PRO C CG     1 
ATOM   6652  C CD     . PRO C  1 141 ? -34.221  -36.050 44.608  1.00 49.31  ? 134 PRO C CD     1 
ATOM   6653  N N      . LEU C  1 142 ? -36.107  -33.368 41.311  1.00 46.58  ? 135 LEU C N      1 
ATOM   6654  C CA     . LEU C  1 142 ? -35.854  -32.097 40.647  1.00 45.83  ? 135 LEU C CA     1 
ATOM   6655  C C      . LEU C  1 142 ? -36.361  -30.950 41.510  1.00 44.58  ? 135 LEU C C      1 
ATOM   6656  O O      . LEU C  1 142 ? -37.524  -30.937 41.924  1.00 42.20  ? 135 LEU C O      1 
ATOM   6657  C CB     . LEU C  1 142 ? -36.522  -32.062 39.272  1.00 44.33  ? 135 LEU C CB     1 
ATOM   6658  C CG     . LEU C  1 142 ? -36.282  -33.225 38.307  1.00 47.61  ? 135 LEU C CG     1 
ATOM   6659  C CD1    . LEU C  1 142 ? -36.536  -32.768 36.874  1.00 49.54  ? 135 LEU C CD1    1 
ATOM   6660  C CD2    . LEU C  1 142 ? -34.874  -33.782 38.453  1.00 46.59  ? 135 LEU C CD2    1 
ATOM   6661  N N      . GLY C  1 143 ? -35.481  -29.991 41.787  1.00 48.71  ? 136 GLY C N      1 
ATOM   6662  C CA     . GLY C  1 143 ? -35.845  -28.835 42.578  1.00 59.18  ? 136 GLY C CA     1 
ATOM   6663  C C      . GLY C  1 143 ? -35.896  -29.061 44.071  1.00 62.77  ? 136 GLY C C      1 
ATOM   6664  O O      . GLY C  1 143 ? -36.414  -28.201 44.792  1.00 64.75  ? 136 GLY C O      1 
ATOM   6665  N N      . GLY C  1 144 ? -35.386  -30.189 44.560  1.00 66.88  ? 137 GLY C N      1 
ATOM   6666  C CA     . GLY C  1 144 ? -35.409  -30.522 45.967  1.00 66.24  ? 137 GLY C CA     1 
ATOM   6667  C C      . GLY C  1 144 ? -34.181  -30.122 46.755  1.00 64.81  ? 137 GLY C C      1 
ATOM   6668  O O      . GLY C  1 144 ? -34.088  -30.454 47.941  1.00 67.37  ? 137 GLY C O      1 
ATOM   6669  N N      . GLY C  1 145 ? -33.240  -29.410 46.140  1.00 55.73  ? 138 GLY C N      1 
ATOM   6670  C CA     . GLY C  1 145 ? -32.051  -28.959 46.827  1.00 50.13  ? 138 GLY C CA     1 
ATOM   6671  C C      . GLY C  1 145 ? -30.915  -29.953 46.888  1.00 45.30  ? 138 GLY C C      1 
ATOM   6672  O O      . GLY C  1 145 ? -29.874  -29.637 47.479  1.00 48.37  ? 138 GLY C O      1 
ATOM   6673  N N      . LEU C  1 146 ? -31.070  -31.137 46.296  1.00 41.28  ? 139 LEU C N      1 
ATOM   6674  C CA     . LEU C  1 146 ? -30.001  -32.123 46.231  1.00 32.43  ? 139 LEU C CA     1 
ATOM   6675  C C      . LEU C  1 146 ? -29.202  -32.012 44.938  1.00 28.68  ? 139 LEU C C      1 
ATOM   6676  O O      . LEU C  1 146 ? -28.446  -32.930 44.597  1.00 30.34  ? 139 LEU C O      1 
ATOM   6677  C CB     . LEU C  1 146 ? -30.566  -33.535 46.417  1.00 31.86  ? 139 LEU C CB     1 
ATOM   6678  C CG     . LEU C  1 146 ? -31.380  -33.740 47.702  1.00 34.41  ? 139 LEU C CG     1 
ATOM   6679  C CD1    . LEU C  1 146 ? -31.910  -35.163 47.808  1.00 34.08  ? 139 LEU C CD1    1 
ATOM   6680  C CD2    . LEU C  1 146 ? -30.548  -33.377 48.927  1.00 35.47  ? 139 LEU C CD2    1 
ATOM   6681  N N      . SER C  1 147 ? -29.352  -30.899 44.219  1.00 35.55  ? 140 SER C N      1 
ATOM   6682  C CA     . SER C  1 147 ? -28.579  -30.602 43.014  1.00 39.17  ? 140 SER C CA     1 
ATOM   6683  C C      . SER C  1 147 ? -28.794  -31.661 41.930  1.00 36.79  ? 140 SER C C      1 
ATOM   6684  O O      . SER C  1 147 ? -27.863  -32.326 41.469  1.00 33.08  ? 140 SER C O      1 
ATOM   6685  C CB     . SER C  1 147 ? -27.091  -30.427 43.346  1.00 41.81  ? 140 SER C CB     1 
ATOM   6686  O OG     . SER C  1 147 ? -26.626  -31.419 44.241  1.00 51.61  ? 140 SER C OG     1 
ATOM   6687  N N      . SER C  1 148 ? -30.057  -31.807 41.526  1.00 37.00  ? 141 SER C N      1 
ATOM   6688  C CA     . SER C  1 148 ? -30.338  -32.545 40.301  1.00 38.69  ? 141 SER C CA     1 
ATOM   6689  C C      . SER C  1 148 ? -29.714  -31.846 39.102  1.00 40.52  ? 141 SER C C      1 
ATOM   6690  O O      . SER C  1 148 ? -29.289  -32.506 38.146  1.00 38.92  ? 141 SER C O      1 
ATOM   6691  C CB     . SER C  1 148 ? -31.846  -32.703 40.108  1.00 36.65  ? 141 SER C CB     1 
ATOM   6692  O OG     . SER C  1 148 ? -32.480  -31.443 39.961  1.00 36.84  ? 141 SER C OG     1 
ATOM   6693  N N      . SER C  1 149 ? -29.660  -30.512 39.134  1.00 40.87  ? 142 SER C N      1 
ATOM   6694  C CA     . SER C  1 149 ? -29.033  -29.755 38.055  1.00 42.05  ? 142 SER C CA     1 
ATOM   6695  C C      . SER C  1 149 ? -27.577  -30.164 37.872  1.00 37.67  ? 142 SER C C      1 
ATOM   6696  O O      . SER C  1 149 ? -27.149  -30.508 36.763  1.00 34.69  ? 142 SER C O      1 
ATOM   6697  C CB     . SER C  1 149 ? -29.140  -28.257 38.340  1.00 47.32  ? 142 SER C CB     1 
ATOM   6698  O OG     . SER C  1 149 ? -28.361  -27.897 39.469  1.00 50.48  ? 142 SER C OG     1 
ATOM   6699  N N      . ALA C  1 150 ? -26.796  -30.132 38.954  1.00 34.65  ? 143 ALA C N      1 
ATOM   6700  C CA     . ALA C  1 150 ? -25.395  -30.526 38.855  1.00 32.57  ? 143 ALA C CA     1 
ATOM   6701  C C      . ALA C  1 150 ? -25.272  -31.986 38.441  1.00 33.79  ? 143 ALA C C      1 
ATOM   6702  O O      . ALA C  1 150 ? -24.358  -32.353 37.694  1.00 36.65  ? 143 ALA C O      1 
ATOM   6703  C CB     . ALA C  1 150 ? -24.682  -30.286 40.186  1.00 34.16  ? 143 ALA C CB     1 
ATOM   6704  N N      . SER C  1 151 ? -26.168  -32.839 38.942  1.00 33.22  ? 144 SER C N      1 
ATOM   6705  C CA     . SER C  1 151 ? -26.182  -34.237 38.523  1.00 32.16  ? 144 SER C CA     1 
ATOM   6706  C C      . SER C  1 151 ? -26.347  -34.365 37.012  1.00 33.11  ? 144 SER C C      1 
ATOM   6707  O O      . SER C  1 151 ? -25.610  -35.107 36.353  1.00 35.75  ? 144 SER C O      1 
ATOM   6708  C CB     . SER C  1 151 ? -27.302  -34.986 39.244  1.00 30.37  ? 144 SER C CB     1 
ATOM   6709  O OG     . SER C  1 151 ? -27.227  -36.375 38.975  1.00 30.36  ? 144 SER C OG     1 
ATOM   6710  N N      . LEU C  1 152 ? -27.323  -33.650 36.448  1.00 31.67  ? 145 LEU C N      1 
ATOM   6711  C CA     . LEU C  1 152 ? -27.548  -33.693 35.008  1.00 32.34  ? 145 LEU C CA     1 
ATOM   6712  C C      . LEU C  1 152 ? -26.360  -33.114 34.244  1.00 34.89  ? 145 LEU C C      1 
ATOM   6713  O O      . LEU C  1 152 ? -25.910  -33.696 33.250  1.00 30.88  ? 145 LEU C O      1 
ATOM   6714  C CB     . LEU C  1 152 ? -28.843  -32.948 34.675  1.00 32.52  ? 145 LEU C CB     1 
ATOM   6715  C CG     . LEU C  1 152 ? -29.286  -32.836 33.214  1.00 34.94  ? 145 LEU C CG     1 
ATOM   6716  C CD1    . LEU C  1 152 ? -29.371  -34.220 32.572  1.00 34.73  ? 145 LEU C CD1    1 
ATOM   6717  C CD2    . LEU C  1 152 ? -30.616  -32.103 33.101  1.00 35.92  ? 145 LEU C CD2    1 
ATOM   6718  N N      . GLU C  1 153 ? -25.822  -31.981 34.708  1.00 35.79  ? 146 GLU C N      1 
ATOM   6719  C CA     . GLU C  1 153 ? -24.731  -31.332 33.987  1.00 33.27  ? 146 GLU C CA     1 
ATOM   6720  C C      . GLU C  1 153 ? -23.478  -32.198 33.965  1.00 32.03  ? 146 GLU C C      1 
ATOM   6721  O O      . GLU C  1 153 ? -22.851  -32.362 32.912  1.00 35.74  ? 146 GLU C O      1 
ATOM   6722  C CB     . GLU C  1 153 ? -24.427  -29.969 34.607  1.00 34.02  ? 146 GLU C CB     1 
ATOM   6723  C CG     . GLU C  1 153 ? -25.628  -29.065 34.716  1.00 34.39  ? 146 GLU C CG     1 
ATOM   6724  C CD     . GLU C  1 153 ? -25.438  -27.987 35.757  1.00 39.27  ? 146 GLU C CD     1 
ATOM   6725  O OE1    . GLU C  1 153 ? -24.438  -28.051 36.505  1.00 39.21  ? 146 GLU C OE1    1 
ATOM   6726  O OE2    . GLU C  1 153 ? -26.284  -27.071 35.824  1.00 42.22  ? 146 GLU C OE2    1 
ATOM   6727  N N      . VAL C  1 154 ? -23.102  -32.770 35.111  1.00 30.90  ? 147 VAL C N      1 
ATOM   6728  C CA     . VAL C  1 154 ? -21.888  -33.578 35.167  1.00 30.10  ? 147 VAL C CA     1 
ATOM   6729  C C      . VAL C  1 154 ? -22.079  -34.880 34.402  1.00 29.61  ? 147 VAL C C      1 
ATOM   6730  O O      . VAL C  1 154 ? -21.156  -35.368 33.739  1.00 31.80  ? 147 VAL C O      1 
ATOM   6731  C CB     . VAL C  1 154 ? -21.474  -33.837 36.628  1.00 27.01  ? 147 VAL C CB     1 
ATOM   6732  C CG1    . VAL C  1 154 ? -20.284  -34.790 36.677  1.00 26.08  ? 147 VAL C CG1    1 
ATOM   6733  C CG2    . VAL C  1 154 ? -21.148  -32.525 37.338  1.00 25.46  ? 147 VAL C CG2    1 
ATOM   6734  N N      . ALA C  1 155 ? -23.271  -35.474 34.494  1.00 29.75  ? 148 ALA C N      1 
ATOM   6735  C CA     . ALA C  1 155 ? -23.579  -36.637 33.670  1.00 30.55  ? 148 ALA C CA     1 
ATOM   6736  C C      . ALA C  1 155 ? -23.413  -36.305 32.195  1.00 30.81  ? 148 ALA C C      1 
ATOM   6737  O O      . ALA C  1 155 ? -22.792  -37.061 31.440  1.00 31.03  ? 148 ALA C O      1 
ATOM   6738  C CB     . ALA C  1 155 ? -24.997  -37.126 33.956  1.00 33.05  ? 148 ALA C CB     1 
ATOM   6739  N N      . THR C  1 156 ? -23.983  -35.177 31.764  1.00 30.20  ? 149 THR C N      1 
ATOM   6740  C CA     . THR C  1 156 ? -23.801  -34.737 30.386  1.00 30.77  ? 149 THR C CA     1 
ATOM   6741  C C      . THR C  1 156 ? -22.324  -34.635 30.045  1.00 30.72  ? 149 THR C C      1 
ATOM   6742  O O      . THR C  1 156 ? -21.874  -35.140 29.011  1.00 31.67  ? 149 THR C O      1 
ATOM   6743  C CB     . THR C  1 156 ? -24.487  -33.390 30.161  1.00 31.76  ? 149 THR C CB     1 
ATOM   6744  O OG1    . THR C  1 156 ? -25.900  -33.529 30.351  1.00 34.93  ? 149 THR C OG1    1 
ATOM   6745  C CG2    . THR C  1 156 ? -24.210  -32.881 28.752  1.00 27.53  ? 149 THR C CG2    1 
ATOM   6746  N N      . TYR C  1 157 ? -21.552  -33.967 30.900  1.00 32.75  ? 150 TYR C N      1 
ATOM   6747  C CA     . TYR C  1 157 ? -20.128  -33.822 30.629  1.00 28.63  ? 150 TYR C CA     1 
ATOM   6748  C C      . TYR C  1 157 ? -19.453  -35.183 30.504  1.00 27.43  ? 150 TYR C C      1 
ATOM   6749  O O      . TYR C  1 157 ? -18.658  -35.411 29.586  1.00 25.72  ? 150 TYR C O      1 
ATOM   6750  C CB     . TYR C  1 157 ? -19.459  -32.988 31.718  1.00 29.09  ? 150 TYR C CB     1 
ATOM   6751  C CG     . TYR C  1 157 ? -18.102  -32.489 31.303  1.00 29.43  ? 150 TYR C CG     1 
ATOM   6752  C CD1    . TYR C  1 157 ? -17.005  -33.336 31.278  1.00 26.05  ? 150 TYR C CD1    1 
ATOM   6753  C CD2    . TYR C  1 157 ? -17.928  -31.176 30.901  1.00 25.64  ? 150 TYR C CD2    1 
ATOM   6754  C CE1    . TYR C  1 157 ? -15.768  -32.882 30.887  1.00 26.99  ? 150 TYR C CE1    1 
ATOM   6755  C CE2    . TYR C  1 157 ? -16.699  -30.713 30.504  1.00 26.56  ? 150 TYR C CE2    1 
ATOM   6756  C CZ     . TYR C  1 157 ? -15.619  -31.566 30.499  1.00 31.39  ? 150 TYR C CZ     1 
ATOM   6757  O OH     . TYR C  1 157 ? -14.385  -31.096 30.104  1.00 32.14  ? 150 TYR C OH     1 
ATOM   6758  N N      . THR C  1 158 ? -19.745  -36.099 31.432  1.00 27.54  ? 151 THR C N      1 
ATOM   6759  C CA     . THR C  1 158 ? -19.124  -37.419 31.374  1.00 29.22  ? 151 THR C CA     1 
ATOM   6760  C C      . THR C  1 158 ? -19.494  -38.146 30.087  1.00 34.38  ? 151 THR C C      1 
ATOM   6761  O O      . THR C  1 158 ? -18.676  -38.882 29.523  1.00 37.78  ? 151 THR C O      1 
ATOM   6762  C CB     . THR C  1 158 ? -19.530  -38.247 32.592  1.00 27.75  ? 151 THR C CB     1 
ATOM   6763  O OG1    . THR C  1 158 ? -19.432  -37.437 33.771  1.00 34.17  ? 151 THR C OG1    1 
ATOM   6764  C CG2    . THR C  1 158 ? -18.625  -39.462 32.733  1.00 26.98  ? 151 THR C CG2    1 
ATOM   6765  N N      . PHE C  1 159 ? -20.717  -37.946 29.600  1.00 31.19  ? 152 PHE C N      1 
ATOM   6766  C CA     . PHE C  1 159 ? -21.110  -38.550 28.332  1.00 33.96  ? 152 PHE C CA     1 
ATOM   6767  C C      . PHE C  1 159 ? -20.282  -37.997 27.180  1.00 34.55  ? 152 PHE C C      1 
ATOM   6768  O O      . PHE C  1 159 ? -19.742  -38.753 26.363  1.00 27.01  ? 152 PHE C O      1 
ATOM   6769  C CB     . PHE C  1 159 ? -22.597  -38.313 28.079  1.00 35.23  ? 152 PHE C CB     1 
ATOM   6770  C CG     . PHE C  1 159 ? -23.116  -39.004 26.857  1.00 38.02  ? 152 PHE C CG     1 
ATOM   6771  C CD1    . PHE C  1 159 ? -23.333  -40.371 26.856  1.00 38.36  ? 152 PHE C CD1    1 
ATOM   6772  C CD2    . PHE C  1 159 ? -23.363  -38.290 25.700  1.00 38.99  ? 152 PHE C CD2    1 
ATOM   6773  C CE1    . PHE C  1 159 ? -23.808  -41.008 25.730  1.00 41.00  ? 152 PHE C CE1    1 
ATOM   6774  C CE2    . PHE C  1 159 ? -23.831  -38.921 24.571  1.00 42.82  ? 152 PHE C CE2    1 
ATOM   6775  C CZ     . PHE C  1 159 ? -24.057  -40.282 24.584  1.00 43.34  ? 152 PHE C CZ     1 
ATOM   6776  N N      . LEU C  1 160 ? -20.175  -36.670 27.096  1.00 31.91  ? 153 LEU C N      1 
ATOM   6777  C CA     . LEU C  1 160 ? -19.414  -36.067 26.010  1.00 31.12  ? 153 LEU C CA     1 
ATOM   6778  C C      . LEU C  1 160 ? -17.969  -36.551 26.008  1.00 34.23  ? 153 LEU C C      1 
ATOM   6779  O O      . LEU C  1 160 ? -17.341  -36.618 24.946  1.00 38.29  ? 153 LEU C O      1 
ATOM   6780  C CB     . LEU C  1 160 ? -19.486  -34.542 26.111  1.00 26.31  ? 153 LEU C CB     1 
ATOM   6781  C CG     . LEU C  1 160 ? -20.893  -33.928 26.128  1.00 26.28  ? 153 LEU C CG     1 
ATOM   6782  C CD1    . LEU C  1 160 ? -20.824  -32.416 26.106  1.00 25.78  ? 153 LEU C CD1    1 
ATOM   6783  C CD2    . LEU C  1 160 ? -21.744  -34.443 24.964  1.00 30.45  ? 153 LEU C CD2    1 
ATOM   6784  N N      . GLN C  1 161 ? -17.426  -36.905 27.179  1.00 31.54  ? 154 GLN C N      1 
ATOM   6785  C CA     . GLN C  1 161 ? -16.081  -37.476 27.219  1.00 34.88  ? 154 GLN C CA     1 
ATOM   6786  C C      . GLN C  1 161 ? -16.010  -38.809 26.485  1.00 34.58  ? 154 GLN C C      1 
ATOM   6787  O O      . GLN C  1 161 ? -14.963  -39.151 25.924  1.00 36.64  ? 154 GLN C O      1 
ATOM   6788  C CB     . GLN C  1 161 ? -15.614  -37.649 28.664  1.00 37.80  ? 154 GLN C CB     1 
ATOM   6789  C CG     . GLN C  1 161 ? -15.208  -36.360 29.354  1.00 37.67  ? 154 GLN C CG     1 
ATOM   6790  C CD     . GLN C  1 161 ? -14.808  -36.585 30.794  1.00 37.33  ? 154 GLN C CD     1 
ATOM   6791  O OE1    . GLN C  1 161 ? -15.612  -36.415 31.710  1.00 37.18  ? 154 GLN C OE1    1 
ATOM   6792  N NE2    . GLN C  1 161 ? -13.562  -36.996 31.001  1.00 40.81  ? 154 GLN C NE2    1 
ATOM   6793  N N      . GLN C  1 162 ? -17.104  -39.574 26.469  1.00 39.16  ? 155 GLN C N      1 
ATOM   6794  C CA     . GLN C  1 162 ? -17.110  -40.821 25.710  1.00 45.45  ? 155 GLN C CA     1 
ATOM   6795  C C      . GLN C  1 162 ? -17.095  -40.550 24.212  1.00 47.65  ? 155 GLN C C      1 
ATOM   6796  O O      . GLN C  1 162 ? -16.413  -41.249 23.455  1.00 50.27  ? 155 GLN C O      1 
ATOM   6797  C CB     . GLN C  1 162 ? -18.326  -41.665 26.095  1.00 49.26  ? 155 GLN C CB     1 
ATOM   6798  C CG     . GLN C  1 162 ? -18.503  -41.864 27.594  1.00 53.20  ? 155 GLN C CG     1 
ATOM   6799  C CD     . GLN C  1 162 ? -17.275  -42.491 28.231  1.00 59.77  ? 155 GLN C CD     1 
ATOM   6800  O OE1    . GLN C  1 162 ? -16.744  -41.990 29.221  1.00 62.78  ? 155 GLN C OE1    1 
ATOM   6801  N NE2    . GLN C  1 162 ? -16.830  -43.613 27.670  1.00 62.45  ? 155 GLN C NE2    1 
ATOM   6802  N N      . LEU C  1 163 ? -17.850  -39.547 23.765  1.00 43.00  ? 156 LEU C N      1 
ATOM   6803  C CA     . LEU C  1 163 ? -17.822  -39.173 22.357  1.00 42.93  ? 156 LEU C CA     1 
ATOM   6804  C C      . LEU C  1 163 ? -16.506  -38.499 21.978  1.00 44.54  ? 156 LEU C C      1 
ATOM   6805  O O      . LEU C  1 163 ? -16.032  -38.663 20.848  1.00 45.26  ? 156 LEU C O      1 
ATOM   6806  C CB     . LEU C  1 163 ? -19.007  -38.262 22.032  1.00 37.23  ? 156 LEU C CB     1 
ATOM   6807  C CG     . LEU C  1 163 ? -20.391  -38.757 22.464  1.00 37.54  ? 156 LEU C CG     1 
ATOM   6808  C CD1    . LEU C  1 163 ? -21.446  -37.695 22.187  1.00 35.31  ? 156 LEU C CD1    1 
ATOM   6809  C CD2    . LEU C  1 163 ? -20.747  -40.075 21.779  1.00 37.84  ? 156 LEU C CD2    1 
ATOM   6810  N N      . CYS C  1 164 ? -15.906  -37.746 22.897  1.00 40.44  ? 157 CYS C N      1 
ATOM   6811  C CA     . CYS C  1 164 ? -14.750  -36.921 22.571  1.00 43.77  ? 157 CYS C CA     1 
ATOM   6812  C C      . CYS C  1 164 ? -13.917  -36.620 23.814  1.00 41.56  ? 157 CYS C C      1 
ATOM   6813  O O      . CYS C  1 164 ? -14.213  -35.665 24.541  1.00 42.18  ? 157 CYS C O      1 
ATOM   6814  C CB     . CYS C  1 164 ? -15.212  -35.623 21.907  1.00 44.71  ? 157 CYS C CB     1 
ATOM   6815  S SG     . CYS C  1 164 ? -13.883  -34.547 21.336  1.00 47.32  ? 157 CYS C SG     1 
ATOM   6816  N N      . PRO C  1 165 ? -12.886  -37.415 24.100  1.00 43.45  ? 158 PRO C N      1 
ATOM   6817  C CA     . PRO C  1 165 ? -12.133  -37.227 25.349  1.00 46.39  ? 158 PRO C CA     1 
ATOM   6818  C C      . PRO C  1 165 ? -11.505  -35.842 25.428  1.00 47.22  ? 158 PRO C C      1 
ATOM   6819  O O      . PRO C  1 165 ? -11.011  -35.306 24.435  1.00 47.89  ? 158 PRO C O      1 
ATOM   6820  C CB     . PRO C  1 165 ? -11.058  -38.318 25.283  1.00 47.59  ? 158 PRO C CB     1 
ATOM   6821  C CG     . PRO C  1 165 ? -10.956  -38.678 23.828  1.00 49.90  ? 158 PRO C CG     1 
ATOM   6822  C CD     . PRO C  1 165 ? -12.331  -38.494 23.267  1.00 45.11  ? 158 PRO C CD     1 
ATOM   6823  N N      . ASP C  1 166 ? -11.521  -35.267 26.627  1.00 41.57  ? 159 ASP C N      1 
ATOM   6824  C CA     . ASP C  1 166 ? -10.934  -33.957 26.869  1.00 49.04  ? 159 ASP C CA     1 
ATOM   6825  C C      . ASP C  1 166 ? -9.515   -34.107 27.408  1.00 54.58  ? 159 ASP C C      1 
ATOM   6826  O O      . ASP C  1 166 ? -9.061   -35.203 27.744  1.00 57.29  ? 159 ASP C O      1 
ATOM   6827  C CB     . ASP C  1 166 ? -11.790  -33.143 27.845  1.00 51.27  ? 159 ASP C CB     1 
ATOM   6828  C CG     . ASP C  1 166 ? -11.713  -33.663 29.276  1.00 56.15  ? 159 ASP C CG     1 
ATOM   6829  O OD1    . ASP C  1 166 ? -11.093  -34.725 29.508  1.00 58.87  ? 159 ASP C OD1    1 
ATOM   6830  O OD2    . ASP C  1 166 ? -12.269  -32.998 30.175  1.00 56.41  ? 159 ASP C OD2    1 
ATOM   6831  N N      . SER C  1 167 ? -8.807   -32.980 27.478  1.00 55.97  ? 160 SER C N      1 
ATOM   6832  C CA     . SER C  1 167 ? -7.428   -32.953 27.952  1.00 58.73  ? 160 SER C CA     1 
ATOM   6833  C C      . SER C  1 167 ? -7.294   -32.402 29.365  1.00 62.55  ? 160 SER C C      1 
ATOM   6834  O O      . SER C  1 167 ? -6.505   -32.930 30.155  1.00 67.87  ? 160 SER C O      1 
ATOM   6835  C CB     . SER C  1 167 ? -6.550   -32.127 27.003  1.00 56.79  ? 160 SER C CB     1 
ATOM   6836  O OG     . SER C  1 167 ? -6.920   -30.757 27.027  1.00 57.96  ? 160 SER C OG     1 
ATOM   6837  N N      . GLY C  1 168 ? -8.050   -31.361 29.700  1.00 67.40  ? 161 GLY C N      1 
ATOM   6838  C CA     . GLY C  1 168 ? -7.827   -30.611 30.918  1.00 67.57  ? 161 GLY C CA     1 
ATOM   6839  C C      . GLY C  1 168 ? -8.108   -31.396 32.190  1.00 66.33  ? 161 GLY C C      1 
ATOM   6840  O O      . GLY C  1 168 ? -8.259   -32.618 32.205  1.00 67.31  ? 161 GLY C O      1 
ATOM   6841  N N      . THR C  1 169 ? -8.187   -30.643 33.287  1.00 58.21  ? 162 THR C N      1 
ATOM   6842  C CA     . THR C  1 169 ? -8.293   -31.172 34.640  1.00 56.35  ? 162 THR C CA     1 
ATOM   6843  C C      . THR C  1 169 ? -9.751   -31.259 35.099  1.00 50.96  ? 162 THR C C      1 
ATOM   6844  O O      . THR C  1 169 ? -10.664  -30.720 34.471  1.00 50.61  ? 162 THR C O      1 
ATOM   6845  C CB     . THR C  1 169 ? -7.481   -30.315 35.615  1.00 57.72  ? 162 THR C CB     1 
ATOM   6846  O OG1    . THR C  1 169 ? -7.280   -31.035 36.839  1.00 55.73  ? 162 THR C OG1    1 
ATOM   6847  C CG2    . THR C  1 169 ? -8.215   -29.023 35.923  1.00 53.64  ? 162 THR C CG2    1 
ATOM   6848  N N      . ILE C  1 170 ? -9.960   -31.959 36.221  1.00 47.90  ? 163 ILE C N      1 
ATOM   6849  C CA     . ILE C  1 170 ? -11.295  -32.070 36.812  1.00 45.89  ? 163 ILE C CA     1 
ATOM   6850  C C      . ILE C  1 170 ? -11.858  -30.701 37.175  1.00 43.61  ? 163 ILE C C      1 
ATOM   6851  O O      . ILE C  1 170 ? -13.060  -30.452 37.020  1.00 40.85  ? 163 ILE C O      1 
ATOM   6852  C CB     . ILE C  1 170 ? -11.268  -33.003 38.039  1.00 45.24  ? 163 ILE C CB     1 
ATOM   6853  C CG1    . ILE C  1 170 ? -10.789  -34.407 37.645  1.00 48.82  ? 163 ILE C CG1    1 
ATOM   6854  C CG2    . ILE C  1 170 ? -12.629  -33.004 38.747  1.00 44.33  ? 163 ILE C CG2    1 
ATOM   6855  C CD1    . ILE C  1 170 ? -10.809  -35.411 38.788  1.00 52.68  ? 163 ILE C CD1    1 
ATOM   6856  N N      . ALA C  1 171 ? -11.013  -29.791 37.666  1.00 44.85  ? 164 ALA C N      1 
ATOM   6857  C CA     . ALA C  1 171 ? -11.518  -28.465 38.007  1.00 39.04  ? 164 ALA C CA     1 
ATOM   6858  C C      . ALA C  1 171 ? -12.122  -27.785 36.784  1.00 41.31  ? 164 ALA C C      1 
ATOM   6859  O O      . ALA C  1 171 ? -13.147  -27.100 36.886  1.00 39.69  ? 164 ALA C O      1 
ATOM   6860  C CB     . ALA C  1 171 ? -10.405  -27.608 38.609  1.00 33.66  ? 164 ALA C CB     1 
ATOM   6861  N N      . ALA C  1 172 ? -11.501  -27.970 35.616  1.00 42.57  ? 165 ALA C N      1 
ATOM   6862  C CA     . ALA C  1 172 ? -12.041  -27.401 34.386  1.00 39.17  ? 165 ALA C CA     1 
ATOM   6863  C C      . ALA C  1 172 ? -13.414  -27.977 34.060  1.00 38.53  ? 165 ALA C C      1 
ATOM   6864  O O      . ALA C  1 172 ? -14.311  -27.250 33.613  1.00 39.52  ? 165 ALA C O      1 
ATOM   6865  C CB     . ALA C  1 172 ? -11.072  -27.641 33.229  1.00 38.20  ? 165 ALA C CB     1 
ATOM   6866  N N      . ARG C  1 173 ? -13.600  -29.282 34.273  1.00 40.15  ? 166 ARG C N      1 
ATOM   6867  C CA     . ARG C  1 173 ? -14.899  -29.893 34.014  1.00 37.39  ? 166 ARG C CA     1 
ATOM   6868  C C      . ARG C  1 173 ? -15.974  -29.292 34.907  1.00 36.79  ? 166 ARG C C      1 
ATOM   6869  O O      . ARG C  1 173 ? -17.059  -28.933 34.436  1.00 39.05  ? 166 ARG C O      1 
ATOM   6870  C CB     . ARG C  1 173 ? -14.814  -31.407 34.206  1.00 37.37  ? 166 ARG C CB     1 
ATOM   6871  C CG     . ARG C  1 173 ? -13.774  -32.068 33.317  1.00 37.91  ? 166 ARG C CG     1 
ATOM   6872  C CD     . ARG C  1 173 ? -13.564  -33.538 33.660  1.00 35.20  ? 166 ARG C CD     1 
ATOM   6873  N NE     . ARG C  1 173 ? -12.467  -34.111 32.887  1.00 34.29  ? 166 ARG C NE     1 
ATOM   6874  C CZ     . ARG C  1 173 ? -11.811  -35.218 33.216  1.00 32.39  ? 166 ARG C CZ     1 
ATOM   6875  N NH1    . ARG C  1 173 ? -12.135  -35.886 34.314  1.00 34.09  ? 166 ARG C NH1    1 
ATOM   6876  N NH2    . ARG C  1 173 ? -10.829  -35.657 32.442  1.00 33.40  ? 166 ARG C NH2    1 
ATOM   6877  N N      . ALA C  1 174 ? -15.689  -29.170 36.205  1.00 35.95  ? 167 ALA C N      1 
ATOM   6878  C CA     . ALA C  1 174 ? -16.637  -28.514 37.099  1.00 34.01  ? 167 ALA C CA     1 
ATOM   6879  C C      . ALA C  1 174 ? -16.923  -27.091 36.640  1.00 33.46  ? 167 ALA C C      1 
ATOM   6880  O O      . ALA C  1 174 ? -18.081  -26.656 36.621  1.00 31.38  ? 167 ALA C O      1 
ATOM   6881  C CB     . ALA C  1 174 ? -16.105  -28.523 38.532  1.00 33.24  ? 167 ALA C CB     1 
ATOM   6882  N N      . GLN C  1 175 ? -15.880  -26.356 36.248  1.00 34.99  ? 168 GLN C N      1 
ATOM   6883  C CA     . GLN C  1 175 ? -16.070  -24.975 35.821  1.00 38.71  ? 168 GLN C CA     1 
ATOM   6884  C C      . GLN C  1 175 ? -16.842  -24.895 34.510  1.00 38.52  ? 168 GLN C C      1 
ATOM   6885  O O      . GLN C  1 175 ? -17.594  -23.937 34.298  1.00 37.41  ? 168 GLN C O      1 
ATOM   6886  C CB     . GLN C  1 175 ? -14.714  -24.273 35.723  1.00 41.55  ? 168 GLN C CB     1 
ATOM   6887  C CG     . GLN C  1 175 ? -14.185  -23.831 37.084  1.00 47.68  ? 168 GLN C CG     1 
ATOM   6888  C CD     . GLN C  1 175 ? -12.669  -23.847 37.176  1.00 49.83  ? 168 GLN C CD     1 
ATOM   6889  O OE1    . GLN C  1 175 ? -11.969  -23.670 36.179  1.00 51.15  ? 168 GLN C OE1    1 
ATOM   6890  N NE2    . GLN C  1 175 ? -12.156  -24.073 38.380  1.00 48.21  ? 168 GLN C NE2    1 
ATOM   6891  N N      . VAL C  1 176 ? -16.675  -25.879 33.623  1.00 37.98  ? 169 VAL C N      1 
ATOM   6892  C CA     . VAL C  1 176 ? -17.506  -25.939 32.421  1.00 35.47  ? 169 VAL C CA     1 
ATOM   6893  C C      . VAL C  1 176 ? -18.966  -26.144 32.799  1.00 33.64  ? 169 VAL C C      1 
ATOM   6894  O O      . VAL C  1 176 ? -19.859  -25.441 32.312  1.00 29.56  ? 169 VAL C O      1 
ATOM   6895  C CB     . VAL C  1 176 ? -17.014  -27.044 31.472  1.00 30.54  ? 169 VAL C CB     1 
ATOM   6896  C CG1    . VAL C  1 176 ? -18.122  -27.416 30.501  1.00 32.35  ? 169 VAL C CG1    1 
ATOM   6897  C CG2    . VAL C  1 176 ? -15.787  -26.574 30.712  1.00 28.41  ? 169 VAL C CG2    1 
ATOM   6898  N N      . CYS C  1 177 ? -19.233  -27.122 33.668  1.00 31.12  ? 170 CYS C N      1 
ATOM   6899  C CA     . CYS C  1 177 ? -20.606  -27.360 34.096  1.00 30.43  ? 170 CYS C CA     1 
ATOM   6900  C C      . CYS C  1 177 ? -21.155  -26.157 34.847  1.00 33.10  ? 170 CYS C C      1 
ATOM   6901  O O      . CYS C  1 177 ? -22.358  -25.881 34.786  1.00 35.57  ? 170 CYS C O      1 
ATOM   6902  C CB     . CYS C  1 177 ? -20.681  -28.621 34.960  1.00 30.89  ? 170 CYS C CB     1 
ATOM   6903  S SG     . CYS C  1 177 ? -20.259  -30.161 34.094  1.00 34.66  ? 170 CYS C SG     1 
ATOM   6904  N N      . GLN C  1 178 ? -20.292  -25.432 35.561  1.00 35.97  ? 171 GLN C N      1 
ATOM   6905  C CA     . GLN C  1 178 ? -20.736  -24.225 36.245  1.00 33.58  ? 171 GLN C CA     1 
ATOM   6906  C C      . GLN C  1 178 ? -21.052  -23.117 35.250  1.00 33.66  ? 171 GLN C C      1 
ATOM   6907  O O      . GLN C  1 178 ? -22.032  -22.384 35.418  1.00 33.88  ? 171 GLN C O      1 
ATOM   6908  C CB     . GLN C  1 178 ? -19.674  -23.767 37.242  1.00 34.78  ? 171 GLN C CB     1 
ATOM   6909  C CG     . GLN C  1 178 ? -20.075  -22.572 38.084  1.00 35.43  ? 171 GLN C CG     1 
ATOM   6910  C CD     . GLN C  1 178 ? -18.890  -21.978 38.823  1.00 37.52  ? 171 GLN C CD     1 
ATOM   6911  O OE1    . GLN C  1 178 ? -17.738  -22.214 38.454  1.00 38.19  ? 171 GLN C OE1    1 
ATOM   6912  N NE2    . GLN C  1 178 ? -19.165  -21.209 39.876  1.00 28.83  ? 171 GLN C NE2    1 
ATOM   6913  N N      . GLN C  1 179 ? -20.228  -22.975 34.210  1.00 34.71  ? 172 GLN C N      1 
ATOM   6914  C CA     . GLN C  1 179 ? -20.492  -21.979 33.176  1.00 39.97  ? 172 GLN C CA     1 
ATOM   6915  C C      . GLN C  1 179 ? -21.857  -22.187 32.525  1.00 40.41  ? 172 GLN C C      1 
ATOM   6916  O O      . GLN C  1 179 ? -22.596  -21.223 32.295  1.00 38.60  ? 172 GLN C O      1 
ATOM   6917  C CB     . GLN C  1 179 ? -19.382  -22.031 32.126  1.00 45.72  ? 172 GLN C CB     1 
ATOM   6918  C CG     . GLN C  1 179 ? -19.415  -20.918 31.097  1.00 50.88  ? 172 GLN C CG     1 
ATOM   6919  C CD     . GLN C  1 179 ? -19.425  -19.544 31.737  1.00 59.51  ? 172 GLN C CD     1 
ATOM   6920  O OE1    . GLN C  1 179 ? -18.716  -19.292 32.715  1.00 64.64  ? 172 GLN C OE1    1 
ATOM   6921  N NE2    . GLN C  1 179 ? -20.222  -18.640 31.179  1.00 61.08  ? 172 GLN C NE2    1 
ATOM   6922  N N      . ALA C  1 180 ? -22.213  -23.439 32.225  1.00 41.38  ? 173 ALA C N      1 
ATOM   6923  C CA     . ALA C  1 180 ? -23.514  -23.713 31.621  1.00 39.78  ? 173 ALA C CA     1 
ATOM   6924  C C      . ALA C  1 180 ? -24.649  -23.272 32.538  1.00 43.28  ? 173 ALA C C      1 
ATOM   6925  O O      . ALA C  1 180 ? -25.603  -22.619 32.098  1.00 46.93  ? 173 ALA C O      1 
ATOM   6926  C CB     . ALA C  1 180 ? -23.637  -25.200 31.287  1.00 35.02  ? 173 ALA C CB     1 
ATOM   6927  N N      . GLU C  1 181 ? -24.561  -23.620 33.823  1.00 42.00  ? 174 GLU C N      1 
ATOM   6928  C CA     . GLU C  1 181 ? -25.601  -23.223 34.765  1.00 44.26  ? 174 GLU C CA     1 
ATOM   6929  C C      . GLU C  1 181 ? -25.702  -21.704 34.842  1.00 45.75  ? 174 GLU C C      1 
ATOM   6930  O O      . GLU C  1 181 ? -26.797  -21.149 34.997  1.00 47.09  ? 174 GLU C O      1 
ATOM   6931  C CB     . GLU C  1 181 ? -25.315  -23.833 36.139  1.00 46.24  ? 174 GLU C CB     1 
ATOM   6932  C CG     . GLU C  1 181 ? -26.448  -23.700 37.144  1.00 48.04  ? 174 GLU C CG     1 
ATOM   6933  C CD     . GLU C  1 181 ? -26.428  -24.800 38.189  1.00 49.73  ? 174 GLU C CD     1 
ATOM   6934  O OE1    . GLU C  1 181 ? -25.673  -25.778 38.008  1.00 48.75  ? 174 GLU C OE1    1 
ATOM   6935  O OE2    . GLU C  1 181 ? -27.173  -24.694 39.186  1.00 51.31  ? 174 GLU C OE2    1 
ATOM   6936  N N      . HIS C  1 182 ? -24.562  -21.018 34.734  1.00 43.96  ? 175 HIS C N      1 
ATOM   6937  C CA     . HIS C  1 182 ? -24.552  -19.560 34.714  1.00 43.74  ? 175 HIS C CA     1 
ATOM   6938  C C      . HIS C  1 182 ? -25.236  -19.019 33.462  1.00 42.32  ? 175 HIS C C      1 
ATOM   6939  O O      . HIS C  1 182 ? -26.186  -18.233 33.548  1.00 47.32  ? 175 HIS C O      1 
ATOM   6940  C CB     . HIS C  1 182 ? -23.110  -19.045 34.805  1.00 45.38  ? 175 HIS C CB     1 
ATOM   6941  C CG     . HIS C  1 182 ? -22.512  -19.137 36.176  1.00 45.42  ? 175 HIS C CG     1 
ATOM   6942  N ND1    . HIS C  1 182 ? -21.377  -18.443 36.539  1.00 47.55  ? 175 HIS C ND1    1 
ATOM   6943  C CD2    . HIS C  1 182 ? -22.894  -19.832 37.273  1.00 45.27  ? 175 HIS C CD2    1 
ATOM   6944  C CE1    . HIS C  1 182 ? -21.086  -18.708 37.800  1.00 46.09  ? 175 HIS C CE1    1 
ATOM   6945  N NE2    . HIS C  1 182 ? -21.989  -19.550 38.268  1.00 45.38  ? 175 HIS C NE2    1 
ATOM   6946  N N      . SER C  1 183 ? -24.767  -19.437 32.282  1.00 43.03  ? 176 SER C N      1 
ATOM   6947  C CA     . SER C  1 183 ? -25.189  -18.785 31.045  1.00 46.95  ? 176 SER C CA     1 
ATOM   6948  C C      . SER C  1 183 ? -26.526  -19.307 30.528  1.00 46.60  ? 176 SER C C      1 
ATOM   6949  O O      . SER C  1 183 ? -27.317  -18.539 29.968  1.00 47.62  ? 176 SER C O      1 
ATOM   6950  C CB     . SER C  1 183 ? -24.110  -18.956 29.973  1.00 52.41  ? 176 SER C CB     1 
ATOM   6951  O OG     . SER C  1 183 ? -22.881  -18.389 30.394  1.00 56.32  ? 176 SER C OG     1 
ATOM   6952  N N      . PHE C  1 184 ? -26.811  -20.594 30.709  1.00 44.40  ? 177 PHE C N      1 
ATOM   6953  C CA     . PHE C  1 184 ? -27.991  -21.185 30.089  1.00 41.65  ? 177 PHE C CA     1 
ATOM   6954  C C      . PHE C  1 184 ? -29.158  -21.385 31.046  1.00 42.75  ? 177 PHE C C      1 
ATOM   6955  O O      . PHE C  1 184 ? -30.309  -21.404 30.599  1.00 44.57  ? 177 PHE C O      1 
ATOM   6956  C CB     . PHE C  1 184 ? -27.630  -22.526 29.443  1.00 35.75  ? 177 PHE C CB     1 
ATOM   6957  C CG     . PHE C  1 184 ? -27.028  -22.392 28.072  1.00 38.91  ? 177 PHE C CG     1 
ATOM   6958  C CD1    . PHE C  1 184 ? -25.703  -22.020 27.909  1.00 36.13  ? 177 PHE C CD1    1 
ATOM   6959  C CD2    . PHE C  1 184 ? -27.795  -22.629 26.943  1.00 40.61  ? 177 PHE C CD2    1 
ATOM   6960  C CE1    . PHE C  1 184 ? -25.154  -21.895 26.646  1.00 34.28  ? 177 PHE C CE1    1 
ATOM   6961  C CE2    . PHE C  1 184 ? -27.253  -22.506 25.680  1.00 38.62  ? 177 PHE C CE2    1 
ATOM   6962  C CZ     . PHE C  1 184 ? -25.929  -22.140 25.531  1.00 35.77  ? 177 PHE C CZ     1 
ATOM   6963  N N      . ALA C  1 185 ? -28.900  -21.538 32.344  1.00 42.49  ? 178 ALA C N      1 
ATOM   6964  C CA     . ALA C  1 185 ? -29.970  -21.656 33.325  1.00 40.10  ? 178 ALA C CA     1 
ATOM   6965  C C      . ALA C  1 185 ? -30.191  -20.379 34.124  1.00 44.69  ? 178 ALA C C      1 
ATOM   6966  O O      . ALA C  1 185 ? -31.184  -20.289 34.855  1.00 46.30  ? 178 ALA C O      1 
ATOM   6967  C CB     . ALA C  1 185 ? -29.684  -22.818 34.285  1.00 36.53  ? 178 ALA C CB     1 
ATOM   6968  N N      . GLY C  1 186 ? -29.303  -19.395 33.999  1.00 44.25  ? 179 GLY C N      1 
ATOM   6969  C CA     . GLY C  1 186 ? -29.448  -18.145 34.721  1.00 47.84  ? 179 GLY C CA     1 
ATOM   6970  C C      . GLY C  1 186 ? -29.319  -18.242 36.226  1.00 49.89  ? 179 GLY C C      1 
ATOM   6971  O O      . GLY C  1 186 ? -29.931  -17.444 36.942  1.00 55.03  ? 179 GLY C O      1 
ATOM   6972  N N      . MET C  1 187 ? -28.543  -19.200 36.729  1.00 51.19  ? 180 MET C N      1 
ATOM   6973  C CA     . MET C  1 187 ? -28.377  -19.403 38.170  1.00 56.32  ? 180 MET C CA     1 
ATOM   6974  C C      . MET C  1 187 ? -26.899  -19.296 38.526  1.00 53.75  ? 180 MET C C      1 
ATOM   6975  O O      . MET C  1 187 ? -26.124  -20.235 38.272  1.00 50.05  ? 180 MET C O      1 
ATOM   6976  C CB     . MET C  1 187 ? -28.946  -20.758 38.592  1.00 66.15  ? 180 MET C CB     1 
ATOM   6977  C CG     . MET C  1 187 ? -28.487  -21.253 39.961  1.00 72.85  ? 180 MET C CG     1 
ATOM   6978  S SD     . MET C  1 187 ? -29.120  -20.275 41.336  1.00 81.48  ? 180 MET C SD     1 
ATOM   6979  C CE     . MET C  1 187 ? -27.658  -20.175 42.360  1.00 82.55  ? 180 MET C CE     1 
ATOM   6980  N N      . PRO C  1 188 ? -26.459  -18.180 39.114  1.00 56.32  ? 181 PRO C N      1 
ATOM   6981  C CA     . PRO C  1 188 ? -25.022  -17.958 39.396  1.00 55.24  ? 181 PRO C CA     1 
ATOM   6982  C C      . PRO C  1 188 ? -24.546  -18.683 40.650  1.00 53.20  ? 181 PRO C C      1 
ATOM   6983  O O      . PRO C  1 188 ? -24.278  -18.094 41.702  1.00 57.85  ? 181 PRO C O      1 
ATOM   6984  C CB     . PRO C  1 188 ? -24.950  -16.433 39.522  1.00 55.42  ? 181 PRO C CB     1 
ATOM   6985  C CG     . PRO C  1 188 ? -26.282  -16.058 40.085  1.00 56.35  ? 181 PRO C CG     1 
ATOM   6986  C CD     . PRO C  1 188 ? -27.284  -17.020 39.494  1.00 56.24  ? 181 PRO C CD     1 
ATOM   6987  N N      . CYS C  1 189 ? -24.441  -20.004 40.533  1.00 50.02  ? 182 CYS C N      1 
ATOM   6988  C CA     . CYS C  1 189 ? -24.013  -20.879 41.614  1.00 49.78  ? 182 CYS C CA     1 
ATOM   6989  C C      . CYS C  1 189 ? -22.490  -20.887 41.743  1.00 47.65  ? 182 CYS C C      1 
ATOM   6990  O O      . CYS C  1 189 ? -21.762  -20.335 40.914  1.00 48.83  ? 182 CYS C O      1 
ATOM   6991  C CB     . CYS C  1 189 ? -24.521  -22.300 41.376  1.00 49.61  ? 182 CYS C CB     1 
ATOM   6992  S SG     . CYS C  1 189 ? -23.847  -23.091 39.893  1.00 48.34  ? 182 CYS C SG     1 
ATOM   6993  N N      . GLY C  1 190 ? -22.011  -21.518 42.816  1.00 42.49  ? 183 GLY C N      1 
ATOM   6994  C CA     . GLY C  1 190 ? -20.605  -21.820 42.975  1.00 38.07  ? 183 GLY C CA     1 
ATOM   6995  C C      . GLY C  1 190 ? -20.259  -23.179 42.392  1.00 38.22  ? 183 GLY C C      1 
ATOM   6996  O O      . GLY C  1 190 ? -21.086  -23.858 41.780  1.00 44.57  ? 183 GLY C O      1 
ATOM   6997  N N      . ILE C  1 191 ? -19.000  -23.581 42.594  1.00 33.91  ? 184 ILE C N      1 
ATOM   6998  C CA     . ILE C  1 191 ? -18.528  -24.853 42.046  1.00 37.79  ? 184 ILE C CA     1 
ATOM   6999  C C      . ILE C  1 191 ? -18.872  -26.046 42.918  1.00 39.79  ? 184 ILE C C      1 
ATOM   7000  O O      . ILE C  1 191 ? -18.667  -27.188 42.488  1.00 42.04  ? 184 ILE C O      1 
ATOM   7001  C CB     . ILE C  1 191 ? -17.001  -24.884 41.833  1.00 44.46  ? 184 ILE C CB     1 
ATOM   7002  C CG1    . ILE C  1 191 ? -16.261  -24.356 43.068  1.00 48.34  ? 184 ILE C CG1    1 
ATOM   7003  C CG2    . ILE C  1 191 ? -16.618  -24.123 40.572  1.00 46.76  ? 184 ILE C CG2    1 
ATOM   7004  C CD1    . ILE C  1 191 ? -16.225  -25.322 44.250  1.00 49.89  ? 184 ILE C CD1    1 
ATOM   7005  N N      . MET C  1 192 ? -19.381  -25.818 44.131  1.00 39.58  ? 185 MET C N      1 
ATOM   7006  C CA     . MET C  1 192 ? -19.503  -26.903 45.098  1.00 37.45  ? 185 MET C CA     1 
ATOM   7007  C C      . MET C  1 192 ? -20.295  -28.076 44.531  1.00 35.07  ? 185 MET C C      1 
ATOM   7008  O O      . MET C  1 192 ? -19.824  -29.219 44.533  1.00 32.32  ? 185 MET C O      1 
ATOM   7009  C CB     . MET C  1 192 ? -20.154  -26.402 46.383  1.00 36.46  ? 185 MET C CB     1 
ATOM   7010  C CG     . MET C  1 192 ? -20.521  -27.553 47.274  1.00 36.45  ? 185 MET C CG     1 
ATOM   7011  S SD     . MET C  1 192 ? -21.648  -27.153 48.600  1.00 40.02  ? 185 MET C SD     1 
ATOM   7012  C CE     . MET C  1 192 ? -21.409  -28.627 49.570  1.00 40.53  ? 185 MET C CE     1 
ATOM   7013  N N      . ASP C  1 193 ? -21.508  -27.812 44.043  1.00 32.82  ? 186 ASP C N      1 
ATOM   7014  C CA     . ASP C  1 193 ? -22.378  -28.907 43.625  1.00 34.60  ? 186 ASP C CA     1 
ATOM   7015  C C      . ASP C  1 193 ? -21.738  -29.703 42.497  1.00 28.20  ? 186 ASP C C      1 
ATOM   7016  O O      . ASP C  1 193 ? -21.731  -30.939 42.519  1.00 27.48  ? 186 ASP C O      1 
ATOM   7017  C CB     . ASP C  1 193 ? -23.742  -28.367 43.192  1.00 38.44  ? 186 ASP C CB     1 
ATOM   7018  C CG     . ASP C  1 193 ? -24.509  -27.734 44.333  1.00 43.13  ? 186 ASP C CG     1 
ATOM   7019  O OD1    . ASP C  1 193 ? -24.196  -28.032 45.505  1.00 46.18  ? 186 ASP C OD1    1 
ATOM   7020  O OD2    . ASP C  1 193 ? -25.435  -26.946 44.054  1.00 45.16  ? 186 ASP C OD2    1 
ATOM   7021  N N      . GLN C  1 194 ? -21.196  -29.008 41.494  1.00 28.21  ? 187 GLN C N      1 
ATOM   7022  C CA     . GLN C  1 194 ? -20.514  -29.700 40.405  1.00 28.04  ? 187 GLN C CA     1 
ATOM   7023  C C      . GLN C  1 194 ? -19.294  -30.466 40.909  1.00 30.84  ? 187 GLN C C      1 
ATOM   7024  O O      . GLN C  1 194 ? -19.044  -31.600 40.483  1.00 31.59  ? 187 GLN C O      1 
ATOM   7025  C CB     . GLN C  1 194 ? -20.099  -28.706 39.320  1.00 24.52  ? 187 GLN C CB     1 
ATOM   7026  C CG     . GLN C  1 194 ? -21.242  -28.018 38.597  1.00 31.14  ? 187 GLN C CG     1 
ATOM   7027  C CD     . GLN C  1 194 ? -21.860  -26.906 39.414  1.00 32.65  ? 187 GLN C CD     1 
ATOM   7028  O OE1    . GLN C  1 194 ? -21.260  -26.417 40.375  1.00 33.00  ? 187 GLN C OE1    1 
ATOM   7029  N NE2    . GLN C  1 194 ? -23.065  -26.491 39.032  1.00 30.24  ? 187 GLN C NE2    1 
ATOM   7030  N N      . PHE C  1 195 ? -18.531  -29.869 41.831  1.00 35.51  ? 188 PHE C N      1 
ATOM   7031  C CA     . PHE C  1 195 ? -17.285  -30.487 42.275  1.00 35.47  ? 188 PHE C CA     1 
ATOM   7032  C C      . PHE C  1 195 ? -17.539  -31.790 43.021  1.00 38.51  ? 188 PHE C C      1 
ATOM   7033  O O      . PHE C  1 195 ? -16.831  -32.780 42.802  1.00 39.52  ? 188 PHE C O      1 
ATOM   7034  C CB     . PHE C  1 195 ? -16.480  -29.518 43.142  1.00 37.75  ? 188 PHE C CB     1 
ATOM   7035  C CG     . PHE C  1 195 ? -14.993  -29.732 43.057  1.00 41.83  ? 188 PHE C CG     1 
ATOM   7036  C CD1    . PHE C  1 195 ? -14.375  -30.724 43.804  1.00 46.86  ? 188 PHE C CD1    1 
ATOM   7037  C CD2    . PHE C  1 195 ? -14.219  -28.969 42.202  1.00 45.68  ? 188 PHE C CD2    1 
ATOM   7038  C CE1    . PHE C  1 195 ? -13.006  -30.928 43.718  1.00 50.04  ? 188 PHE C CE1    1 
ATOM   7039  C CE2    . PHE C  1 195 ? -12.852  -29.174 42.107  1.00 49.11  ? 188 PHE C CE2    1 
ATOM   7040  C CZ     . PHE C  1 195 ? -12.246  -30.154 42.865  1.00 48.93  ? 188 PHE C CZ     1 
ATOM   7041  N N      . ILE C  1 196 ? -18.537  -31.815 43.908  1.00 33.37  ? 189 ILE C N      1 
ATOM   7042  C CA     . ILE C  1 196 ? -18.794  -33.042 44.657  1.00 33.16  ? 189 ILE C CA     1 
ATOM   7043  C C      . ILE C  1 196 ? -19.349  -34.121 43.741  1.00 35.16  ? 189 ILE C C      1 
ATOM   7044  O O      . ILE C  1 196 ? -19.061  -35.311 43.922  1.00 33.61  ? 189 ILE C O      1 
ATOM   7045  C CB     . ILE C  1 196 ? -19.737  -32.782 45.846  1.00 29.69  ? 189 ILE C CB     1 
ATOM   7046  C CG1    . ILE C  1 196 ? -20.008  -34.094 46.592  1.00 29.89  ? 189 ILE C CG1    1 
ATOM   7047  C CG2    . ILE C  1 196 ? -21.033  -32.123 45.383  1.00 26.09  ? 189 ILE C CG2    1 
ATOM   7048  C CD1    . ILE C  1 196 ? -18.749  -34.822 47.052  1.00 28.29  ? 189 ILE C CD1    1 
ATOM   7049  N N      . SER C  1 197 ? -20.157  -33.736 42.754  1.00 34.62  ? 190 SER C N      1 
ATOM   7050  C CA     . SER C  1 197 ? -20.669  -34.713 41.803  1.00 33.96  ? 190 SER C CA     1 
ATOM   7051  C C      . SER C  1 197 ? -19.546  -35.374 41.017  1.00 32.28  ? 190 SER C C      1 
ATOM   7052  O O      . SER C  1 197 ? -19.648  -36.553 40.664  1.00 32.25  ? 190 SER C O      1 
ATOM   7053  C CB     . SER C  1 197 ? -21.655  -34.042 40.849  1.00 35.29  ? 190 SER C CB     1 
ATOM   7054  O OG     . SER C  1 197 ? -22.429  -35.004 40.158  1.00 34.44  ? 190 SER C OG     1 
ATOM   7055  N N      . LEU C  1 198 ? -18.472  -34.634 40.732  1.00 32.94  ? 191 LEU C N      1 
ATOM   7056  C CA     . LEU C  1 198 ? -17.349  -35.198 39.993  1.00 33.50  ? 191 LEU C CA     1 
ATOM   7057  C C      . LEU C  1 198 ? -16.382  -35.964 40.890  1.00 36.92  ? 191 LEU C C      1 
ATOM   7058  O O      . LEU C  1 198 ? -15.806  -36.967 40.455  1.00 39.38  ? 191 LEU C O      1 
ATOM   7059  C CB     . LEU C  1 198 ? -16.592  -34.086 39.261  1.00 32.45  ? 191 LEU C CB     1 
ATOM   7060  C CG     . LEU C  1 198 ? -17.174  -33.502 37.974  1.00 34.19  ? 191 LEU C CG     1 
ATOM   7061  C CD1    . LEU C  1 198 ? -16.554  -32.144 37.693  1.00 31.42  ? 191 LEU C CD1    1 
ATOM   7062  C CD2    . LEU C  1 198 ? -16.915  -34.452 36.823  1.00 32.15  ? 191 LEU C CD2    1 
ATOM   7063  N N      . MET C  1 199 ? -16.187  -35.517 42.131  1.00 36.99  ? 192 MET C N      1 
ATOM   7064  C CA     . MET C  1 199 ? -15.064  -35.965 42.945  1.00 42.11  ? 192 MET C CA     1 
ATOM   7065  C C      . MET C  1 199 ? -15.452  -36.865 44.111  1.00 41.44  ? 192 MET C C      1 
ATOM   7066  O O      . MET C  1 199 ? -14.566  -37.313 44.845  1.00 38.52  ? 192 MET C O      1 
ATOM   7067  C CB     . MET C  1 199 ? -14.286  -34.756 43.473  1.00 46.45  ? 192 MET C CB     1 
ATOM   7068  C CG     . MET C  1 199 ? -13.494  -34.046 42.400  1.00 52.08  ? 192 MET C CG     1 
ATOM   7069  S SD     . MET C  1 199 ? -12.047  -35.005 41.926  1.00 62.82  ? 192 MET C SD     1 
ATOM   7070  C CE     . MET C  1 199 ? -11.120  -34.976 43.454  1.00 63.12  ? 192 MET C CE     1 
ATOM   7071  N N      . GLY C  1 200 ? -16.738  -37.141 44.310  1.00 37.79  ? 193 GLY C N      1 
ATOM   7072  C CA     . GLY C  1 200 ? -17.142  -37.908 45.475  1.00 38.16  ? 193 GLY C CA     1 
ATOM   7073  C C      . GLY C  1 200 ? -16.526  -39.294 45.499  1.00 40.75  ? 193 GLY C C      1 
ATOM   7074  O O      . GLY C  1 200 ? -16.249  -39.901 44.463  1.00 41.20  ? 193 GLY C O      1 
ATOM   7075  N N      . GLN C  1 201 ? -16.302  -39.794 46.713  1.00 40.76  ? 194 GLN C N      1 
ATOM   7076  C CA     . GLN C  1 201 ? -15.849  -41.160 46.935  1.00 41.00  ? 194 GLN C CA     1 
ATOM   7077  C C      . GLN C  1 201 ? -16.760  -41.794 47.973  1.00 38.15  ? 194 GLN C C      1 
ATOM   7078  O O      . GLN C  1 201 ? -17.053  -41.173 49.000  1.00 37.50  ? 194 GLN C O      1 
ATOM   7079  C CB     . GLN C  1 201 ? -14.392  -41.188 47.407  1.00 46.02  ? 194 GLN C CB     1 
ATOM   7080  C CG     . GLN C  1 201 ? -13.416  -40.547 46.439  1.00 51.59  ? 194 GLN C CG     1 
ATOM   7081  C CD     . GLN C  1 201 ? -13.200  -41.376 45.193  1.00 58.55  ? 194 GLN C CD     1 
ATOM   7082  O OE1    . GLN C  1 201 ? -13.503  -42.570 45.167  1.00 62.08  ? 194 GLN C OE1    1 
ATOM   7083  N NE2    . GLN C  1 201 ? -12.672  -40.747 44.148  1.00 59.47  ? 194 GLN C NE2    1 
ATOM   7084  N N      . LYS C  1 202 ? -17.200  -43.023 47.714  1.00 42.96  ? 195 LYS C N      1 
ATOM   7085  C CA     . LYS C  1 202 ? -18.176  -43.652 48.594  1.00 43.37  ? 195 LYS C CA     1 
ATOM   7086  C C      . LYS C  1 202 ? -17.603  -43.847 49.993  1.00 44.36  ? 195 LYS C C      1 
ATOM   7087  O O      . LYS C  1 202 ? -16.414  -44.123 50.173  1.00 44.31  ? 195 LYS C O      1 
ATOM   7088  C CB     . LYS C  1 202 ? -18.638  -44.995 48.026  1.00 44.05  ? 195 LYS C CB     1 
ATOM   7089  C CG     . LYS C  1 202 ? -17.583  -46.089 48.010  1.00 46.07  ? 195 LYS C CG     1 
ATOM   7090  C CD     . LYS C  1 202 ? -18.228  -47.443 47.779  1.00 48.71  ? 195 LYS C CD     1 
ATOM   7091  C CE     . LYS C  1 202 ? -19.344  -47.681 48.786  1.00 52.20  ? 195 LYS C CE     1 
ATOM   7092  N NZ     . LYS C  1 202 ? -19.983  -49.016 48.620  1.00 55.22  ? 195 LYS C NZ     1 
ATOM   7093  N N      . GLY C  1 203 ? -18.471  -43.702 50.991  1.00 46.27  ? 196 GLY C N      1 
ATOM   7094  C CA     . GLY C  1 203 ? -18.043  -43.761 52.375  1.00 46.79  ? 196 GLY C CA     1 
ATOM   7095  C C      . GLY C  1 203 ? -17.192  -42.588 52.796  1.00 44.75  ? 196 GLY C C      1 
ATOM   7096  O O      . GLY C  1 203 ? -16.396  -42.710 53.731  1.00 49.88  ? 196 GLY C O      1 
ATOM   7097  N N      . HIS C  1 204 ? -17.330  -41.450 52.122  1.00 43.12  ? 197 HIS C N      1 
ATOM   7098  C CA     . HIS C  1 204 ? -16.516  -40.289 52.435  1.00 41.66  ? 197 HIS C CA     1 
ATOM   7099  C C      . HIS C  1 204 ? -17.307  -39.020 52.167  1.00 42.63  ? 197 HIS C C      1 
ATOM   7100  O O      . HIS C  1 204 ? -18.111  -38.960 51.233  1.00 41.85  ? 197 HIS C O      1 
ATOM   7101  C CB     . HIS C  1 204 ? -15.224  -40.264 51.612  1.00 43.97  ? 197 HIS C CB     1 
ATOM   7102  C CG     . HIS C  1 204 ? -14.241  -41.325 51.994  1.00 53.26  ? 197 HIS C CG     1 
ATOM   7103  N ND1    . HIS C  1 204 ? -14.313  -42.612 51.505  1.00 55.48  ? 197 HIS C ND1    1 
ATOM   7104  C CD2    . HIS C  1 204 ? -13.160  -41.291 52.808  1.00 55.71  ? 197 HIS C CD2    1 
ATOM   7105  C CE1    . HIS C  1 204 ? -13.321  -43.326 52.005  1.00 57.94  ? 197 HIS C CE1    1 
ATOM   7106  N NE2    . HIS C  1 204 ? -12.605  -42.548 52.797  1.00 58.04  ? 197 HIS C NE2    1 
ATOM   7107  N N      . ALA C  1 205 ? -17.075  -38.018 53.003  1.00 41.86  ? 198 ALA C N      1 
ATOM   7108  C CA     . ALA C  1 205 ? -17.419  -36.642 52.695  1.00 39.89  ? 198 ALA C CA     1 
ATOM   7109  C C      . ALA C  1 205 ? -16.189  -35.947 52.131  1.00 39.80  ? 198 ALA C C      1 
ATOM   7110  O O      . ALA C  1 205 ? -15.055  -36.398 52.314  1.00 42.96  ? 198 ALA C O      1 
ATOM   7111  C CB     . ALA C  1 205 ? -17.921  -35.907 53.938  1.00 42.71  ? 198 ALA C CB     1 
ATOM   7112  N N      . LEU C  1 206 ? -16.421  -34.840 51.434  1.00 35.85  ? 199 LEU C N      1 
ATOM   7113  C CA     . LEU C  1 206 ? -15.349  -34.132 50.748  1.00 36.97  ? 199 LEU C CA     1 
ATOM   7114  C C      . LEU C  1 206 ? -15.220  -32.729 51.323  1.00 38.52  ? 199 LEU C C      1 
ATOM   7115  O O      . LEU C  1 206 ? -16.076  -31.872 51.076  1.00 38.04  ? 199 LEU C O      1 
ATOM   7116  C CB     . LEU C  1 206 ? -15.602  -34.079 49.243  1.00 42.16  ? 199 LEU C CB     1 
ATOM   7117  C CG     . LEU C  1 206 ? -14.758  -35.103 48.486  1.00 44.16  ? 199 LEU C CG     1 
ATOM   7118  C CD1    . LEU C  1 206 ? -14.588  -34.731 47.018  1.00 43.08  ? 199 LEU C CD1    1 
ATOM   7119  C CD2    . LEU C  1 206 ? -13.425  -35.323 49.190  1.00 47.42  ? 199 LEU C CD2    1 
ATOM   7120  N N      . LEU C  1 207 ? -14.153  -32.490 52.080  1.00 40.12  ? 200 LEU C N      1 
ATOM   7121  C CA     . LEU C  1 207 ? -13.816  -31.131 52.486  1.00 39.74  ? 200 LEU C CA     1 
ATOM   7122  C C      . LEU C  1 207 ? -13.130  -30.460 51.305  1.00 39.38  ? 200 LEU C C      1 
ATOM   7123  O O      . LEU C  1 207 ? -11.993  -30.799 50.964  1.00 41.81  ? 200 LEU C O      1 
ATOM   7124  C CB     . LEU C  1 207 ? -12.916  -31.126 53.718  1.00 36.03  ? 200 LEU C CB     1 
ATOM   7125  C CG     . LEU C  1 207 ? -12.475  -29.742 54.207  1.00 35.62  ? 200 LEU C CG     1 
ATOM   7126  C CD1    . LEU C  1 207 ? -13.671  -28.913 54.650  1.00 32.89  ? 200 LEU C CD1    1 
ATOM   7127  C CD2    . LEU C  1 207 ? -11.463  -29.863 55.341  1.00 34.77  ? 200 LEU C CD2    1 
ATOM   7128  N N      . ILE C  1 208 ? -13.817  -29.508 50.681  1.00 32.68  ? 201 ILE C N      1 
ATOM   7129  C CA     . ILE C  1 208 ? -13.344  -28.858 49.465  1.00 32.89  ? 201 ILE C CA     1 
ATOM   7130  C C      . ILE C  1 208 ? -12.940  -27.438 49.816  1.00 34.90  ? 201 ILE C C      1 
ATOM   7131  O O      . ILE C  1 208 ? -13.738  -26.676 50.375  1.00 31.85  ? 201 ILE C O      1 
ATOM   7132  C CB     . ILE C  1 208 ? -14.415  -28.860 48.364  1.00 33.10  ? 201 ILE C CB     1 
ATOM   7133  C CG1    . ILE C  1 208 ? -14.916  -30.279 48.115  1.00 34.87  ? 201 ILE C CG1    1 
ATOM   7134  C CG2    . ILE C  1 208 ? -13.870  -28.254 47.077  1.00 30.37  ? 201 ILE C CG2    1 
ATOM   7135  C CD1    . ILE C  1 208 ? -16.151  -30.331 47.256  1.00 38.24  ? 201 ILE C CD1    1 
ATOM   7136  N N      . ASP C  1 209 ? -11.701  -27.085 49.491  1.00 39.62  ? 202 ASP C N      1 
ATOM   7137  C CA     . ASP C  1 209 ? -11.230  -25.710 49.611  1.00 38.68  ? 202 ASP C CA     1 
ATOM   7138  C C      . ASP C  1 209 ? -11.528  -25.030 48.283  1.00 36.88  ? 202 ASP C C      1 
ATOM   7139  O O      . ASP C  1 209 ? -10.843  -25.261 47.283  1.00 32.39  ? 202 ASP C O      1 
ATOM   7140  C CB     . ASP C  1 209 ? -9.746   -25.674 49.959  1.00 38.68  ? 202 ASP C CB     1 
ATOM   7141  C CG     . ASP C  1 209 ? -9.231   -24.263 50.205  1.00 42.54  ? 202 ASP C CG     1 
ATOM   7142  O OD1    . ASP C  1 209 ? -9.644   -23.334 49.477  1.00 44.13  ? 202 ASP C OD1    1 
ATOM   7143  O OD2    . ASP C  1 209 ? -8.411   -24.084 51.133  1.00 44.05  ? 202 ASP C OD2    1 
ATOM   7144  N N      . CYS C  1 210 ? -12.561  -24.192 48.270  1.00 40.71  ? 203 CYS C N      1 
ATOM   7145  C CA     . CYS C  1 210 ? -13.032  -23.570 47.041  1.00 40.78  ? 203 CYS C CA     1 
ATOM   7146  C C      . CYS C  1 210 ? -12.142  -22.424 46.585  1.00 43.73  ? 203 CYS C C      1 
ATOM   7147  O O      . CYS C  1 210 ? -12.432  -21.807 45.555  1.00 47.53  ? 203 CYS C O      1 
ATOM   7148  C CB     . CYS C  1 210 ? -14.474  -23.081 47.215  1.00 42.14  ? 203 CYS C CB     1 
ATOM   7149  S SG     . CYS C  1 210 ? -15.650  -24.400 47.618  1.00 46.39  ? 203 CYS C SG     1 
ATOM   7150  N N      . ARG C  1 211 ? -11.072  -22.130 47.322  1.00 45.78  ? 204 ARG C N      1 
ATOM   7151  C CA     . ARG C  1 211 ? -10.066  -21.192 46.842  1.00 45.83  ? 204 ARG C CA     1 
ATOM   7152  C C      . ARG C  1 211 ? -9.047   -21.902 45.960  1.00 45.17  ? 204 ARG C C      1 
ATOM   7153  O O      . ARG C  1 211 ? -8.809   -21.495 44.817  1.00 44.69  ? 204 ARG C O      1 
ATOM   7154  C CB     . ARG C  1 211 ? -9.366   -20.526 48.028  1.00 48.21  ? 204 ARG C CB     1 
ATOM   7155  C CG     . ARG C  1 211 ? -8.176   -19.660 47.650  1.00 53.13  ? 204 ARG C CG     1 
ATOM   7156  C CD     . ARG C  1 211 ? -7.125   -19.674 48.752  1.00 53.59  ? 204 ARG C CD     1 
ATOM   7157  N NE     . ARG C  1 211 ? -7.386   -18.678 49.789  1.00 56.36  ? 204 ARG C NE     1 
ATOM   7158  C CZ     . ARG C  1 211 ? -6.905   -18.746 51.027  1.00 60.61  ? 204 ARG C CZ     1 
ATOM   7159  N NH1    . ARG C  1 211 ? -6.149   -19.771 51.392  1.00 60.47  ? 204 ARG C NH1    1 
ATOM   7160  N NH2    . ARG C  1 211 ? -7.190   -17.795 51.907  1.00 63.60  ? 204 ARG C NH2    1 
ATOM   7161  N N      . SER C  1 212 ? -8.440   -22.970 46.483  1.00 44.79  ? 205 SER C N      1 
ATOM   7162  C CA     . SER C  1 212 ? -7.423   -23.737 45.778  1.00 45.88  ? 205 SER C CA     1 
ATOM   7163  C C      . SER C  1 212 ? -7.973   -24.974 45.078  1.00 46.57  ? 205 SER C C      1 
ATOM   7164  O O      . SER C  1 212 ? -7.275   -25.547 44.235  1.00 43.45  ? 205 SER C O      1 
ATOM   7165  C CB     . SER C  1 212 ? -6.318   -24.174 46.751  1.00 43.76  ? 205 SER C CB     1 
ATOM   7166  O OG     . SER C  1 212 ? -6.828   -25.054 47.740  1.00 45.71  ? 205 SER C OG     1 
ATOM   7167  N N      . LEU C  1 213 ? -9.196   -25.398 45.396  1.00 45.03  ? 206 LEU C N      1 
ATOM   7168  C CA     . LEU C  1 213 ? -9.776   -26.631 44.871  1.00 42.11  ? 206 LEU C CA     1 
ATOM   7169  C C      . LEU C  1 213 ? -9.055   -27.876 45.373  1.00 42.73  ? 206 LEU C C      1 
ATOM   7170  O O      . LEU C  1 213 ? -9.196   -28.957 44.788  1.00 45.69  ? 206 LEU C O      1 
ATOM   7171  C CB     . LEU C  1 213 ? -9.815   -26.627 43.339  1.00 42.07  ? 206 LEU C CB     1 
ATOM   7172  C CG     . LEU C  1 213 ? -10.697  -25.538 42.732  1.00 40.59  ? 206 LEU C CG     1 
ATOM   7173  C CD1    . LEU C  1 213 ? -10.810  -25.695 41.224  1.00 41.69  ? 206 LEU C CD1    1 
ATOM   7174  C CD2    . LEU C  1 213 ? -12.072  -25.580 43.373  1.00 36.66  ? 206 LEU C CD2    1 
ATOM   7175  N N      . GLU C  1 214 ? -8.266   -27.733 46.434  1.00 43.41  ? 207 GLU C N      1 
ATOM   7176  C CA     . GLU C  1 214 ? -7.705   -28.881 47.128  1.00 40.88  ? 207 GLU C CA     1 
ATOM   7177  C C      . GLU C  1 214 ? -8.806   -29.629 47.867  1.00 33.36  ? 207 GLU C C      1 
ATOM   7178  O O      . GLU C  1 214 ? -9.793   -29.042 48.318  1.00 33.79  ? 207 GLU C O      1 
ATOM   7179  C CB     . GLU C  1 214 ? -6.624   -28.433 48.110  1.00 42.63  ? 207 GLU C CB     1 
ATOM   7180  C CG     . GLU C  1 214 ? -6.107   -29.541 49.010  1.00 46.89  ? 207 GLU C CG     1 
ATOM   7181  C CD     . GLU C  1 214 ? -4.855   -29.137 49.760  1.00 55.12  ? 207 GLU C CD     1 
ATOM   7182  O OE1    . GLU C  1 214 ? -4.289   -28.073 49.431  1.00 56.03  ? 207 GLU C OE1    1 
ATOM   7183  O OE2    . GLU C  1 214 ? -4.440   -29.879 50.676  1.00 57.75  ? 207 GLU C OE2    1 
ATOM   7184  N N      . THR C  1 215 ? -8.628   -30.938 47.997  1.00 34.07  ? 208 THR C N      1 
ATOM   7185  C CA     . THR C  1 215 ? -9.674   -31.799 48.521  1.00 38.08  ? 208 THR C CA     1 
ATOM   7186  C C      . THR C  1 215 ? -9.123   -32.697 49.619  1.00 40.41  ? 208 THR C C      1 
ATOM   7187  O O      . THR C  1 215 ? -7.968   -33.130 49.573  1.00 42.13  ? 208 THR C O      1 
ATOM   7188  C CB     . THR C  1 215 ? -10.297  -32.657 47.408  1.00 44.07  ? 208 THR C CB     1 
ATOM   7189  O OG1    . THR C  1 215 ? -10.747  -31.809 46.343  1.00 51.11  ? 208 THR C OG1    1 
ATOM   7190  C CG2    . THR C  1 215 ? -11.475  -33.436 47.940  1.00 44.15  ? 208 THR C CG2    1 
ATOM   7191  N N      . SER C  1 216 ? -9.966   -32.968 50.611  1.00 42.49  ? 209 SER C N      1 
ATOM   7192  C CA     . SER C  1 216 ? -9.634   -33.868 51.704  1.00 44.67  ? 209 SER C CA     1 
ATOM   7193  C C      . SER C  1 216 ? -10.770  -34.868 51.846  1.00 44.25  ? 209 SER C C      1 
ATOM   7194  O O      . SER C  1 216 ? -11.933  -34.476 51.988  1.00 45.60  ? 209 SER C O      1 
ATOM   7195  C CB     . SER C  1 216 ? -9.422   -33.099 53.013  1.00 51.46  ? 209 SER C CB     1 
ATOM   7196  O OG     . SER C  1 216 ? -8.230   -32.333 52.970  1.00 59.38  ? 209 SER C OG     1 
ATOM   7197  N N      . LEU C  1 217 ? -10.430  -36.152 51.813  1.00 43.19  ? 210 LEU C N      1 
ATOM   7198  C CA     . LEU C  1 217 ? -11.408  -37.220 51.965  1.00 46.81  ? 210 LEU C CA     1 
ATOM   7199  C C      . LEU C  1 217 ? -11.598  -37.520 53.447  1.00 45.29  ? 210 LEU C C      1 
ATOM   7200  O O      . LEU C  1 217 ? -10.667  -37.980 54.117  1.00 48.61  ? 210 LEU C O      1 
ATOM   7201  C CB     . LEU C  1 217 ? -10.961  -38.465 51.200  1.00 52.14  ? 210 LEU C CB     1 
ATOM   7202  C CG     . LEU C  1 217 ? -10.802  -38.258 49.691  1.00 53.07  ? 210 LEU C CG     1 
ATOM   7203  C CD1    . LEU C  1 217 ? -10.015  -39.389 49.064  1.00 55.65  ? 210 LEU C CD1    1 
ATOM   7204  C CD2    . LEU C  1 217 ? -12.165  -38.140 49.030  1.00 52.01  ? 210 LEU C CD2    1 
ATOM   7205  N N      . VAL C  1 218 ? -12.800  -37.266 53.947  1.00 43.08  ? 211 VAL C N      1 
ATOM   7206  C CA     . VAL C  1 218 ? -13.150  -37.442 55.354  1.00 48.73  ? 211 VAL C CA     1 
ATOM   7207  C C      . VAL C  1 218 ? -14.040  -38.675 55.468  1.00 50.92  ? 211 VAL C C      1 
ATOM   7208  O O      . VAL C  1 218 ? -15.147  -38.686 54.912  1.00 50.20  ? 211 VAL C O      1 
ATOM   7209  C CB     . VAL C  1 218 ? -13.853  -36.197 55.918  1.00 50.91  ? 211 VAL C CB     1 
ATOM   7210  C CG1    . VAL C  1 218 ? -14.180  -36.394 57.387  1.00 52.77  ? 211 VAL C CG1    1 
ATOM   7211  C CG2    . VAL C  1 218 ? -12.986  -34.966 55.718  1.00 49.71  ? 211 VAL C CG2    1 
ATOM   7212  N N      . PRO C  1 219 ? -13.608  -39.727 56.162  1.00 53.75  ? 212 PRO C N      1 
ATOM   7213  C CA     . PRO C  1 219 ? -14.408  -40.959 56.211  1.00 56.31  ? 212 PRO C CA     1 
ATOM   7214  C C      . PRO C  1 219 ? -15.778  -40.720 56.830  1.00 57.08  ? 212 PRO C C      1 
ATOM   7215  O O      . PRO C  1 219 ? -15.907  -40.064 57.866  1.00 56.40  ? 212 PRO C O      1 
ATOM   7216  C CB     . PRO C  1 219 ? -13.561  -41.901 57.074  1.00 46.06  ? 212 PRO C CB     1 
ATOM   7217  C CG     . PRO C  1 219 ? -12.171  -41.371 56.993  1.00 46.19  ? 212 PRO C CG     1 
ATOM   7218  C CD     . PRO C  1 219 ? -12.253  -39.900 56.712  1.00 50.36  ? 212 PRO C CD     1 
ATOM   7219  N N      . LEU C  1 220 ? -16.817  -41.266 56.172  1.00 52.72  ? 213 LEU C N      1 
ATOM   7220  C CA     . LEU C  1 220 ? -18.192  -41.267 56.685  1.00 52.85  ? 213 LEU C CA     1 
ATOM   7221  C C      . LEU C  1 220 ? -18.786  -42.655 56.417  1.00 58.57  ? 213 LEU C C      1 
ATOM   7222  O O      . LEU C  1 220 ? -19.518  -42.866 55.447  1.00 62.50  ? 213 LEU C O      1 
ATOM   7223  C CB     . LEU C  1 220 ? -19.028  -40.159 56.043  1.00 52.19  ? 213 LEU C CB     1 
ATOM   7224  C CG     . LEU C  1 220 ? -19.577  -39.043 56.934  1.00 50.54  ? 213 LEU C CG     1 
ATOM   7225  C CD1    . LEU C  1 220 ? -20.481  -38.122 56.129  1.00 47.77  ? 213 LEU C CD1    1 
ATOM   7226  C CD2    . LEU C  1 220 ? -20.332  -39.619 58.128  1.00 49.79  ? 213 LEU C CD2    1 
ATOM   7227  N N      . SER C  1 221 ? -18.468  -43.618 57.293  1.00 60.64  ? 214 SER C N      1 
ATOM   7228  C CA     . SER C  1 221 ? -18.875  -45.014 57.086  1.00 60.63  ? 214 SER C CA     1 
ATOM   7229  C C      . SER C  1 221 ? -18.993  -45.683 58.460  1.00 64.76  ? 214 SER C C      1 
ATOM   7230  O O      . SER C  1 221 ? -18.140  -46.471 58.877  1.00 68.03  ? 214 SER C O      1 
ATOM   7231  C CB     . SER C  1 221 ? -17.902  -45.766 56.179  1.00 58.45  ? 214 SER C CB     1 
ATOM   7232  N N      . ASP C  1 222 ? -20.071  -45.371 59.170  1.00 66.08  ? 215 ASP C N      1 
ATOM   7233  C CA     . ASP C  1 222 ? -20.305  -45.909 60.511  1.00 70.16  ? 215 ASP C CA     1 
ATOM   7234  C C      . ASP C  1 222 ? -21.704  -46.498 60.625  1.00 71.35  ? 215 ASP C C      1 
ATOM   7235  O O      . ASP C  1 222 ? -22.696  -45.741 60.581  1.00 70.88  ? 215 ASP C O      1 
ATOM   7236  C CB     . ASP C  1 222 ? -20.094  -44.832 61.571  1.00 73.71  ? 215 ASP C CB     1 
ATOM   7237  C CG     . ASP C  1 222 ? -20.029  -45.403 62.975  1.00 79.79  ? 215 ASP C CG     1 
ATOM   7238  O OD1    . ASP C  1 222 ? -20.354  -46.596 63.150  1.00 82.25  ? 215 ASP C OD1    1 
ATOM   7239  O OD2    . ASP C  1 222 ? -19.653  -44.656 63.903  1.00 82.22  ? 215 ASP C OD2    1 
ATOM   7240  N N      . PRO C  1 223 ? -21.839  -47.820 60.766  1.00 71.51  ? 216 PRO C N      1 
ATOM   7241  C CA     . PRO C  1 223 ? -23.180  -48.405 60.940  1.00 70.82  ? 216 PRO C CA     1 
ATOM   7242  C C      . PRO C  1 223 ? -23.959  -47.810 62.102  1.00 71.24  ? 216 PRO C C      1 
ATOM   7243  O O      . PRO C  1 223 ? -25.195  -47.866 62.089  1.00 75.15  ? 216 PRO C O      1 
ATOM   7244  C CB     . PRO C  1 223 ? -22.892  -49.898 61.170  1.00 71.65  ? 216 PRO C CB     1 
ATOM   7245  C CG     . PRO C  1 223 ? -21.424  -49.986 61.479  1.00 71.52  ? 216 PRO C CG     1 
ATOM   7246  C CD     . PRO C  1 223 ? -20.778  -48.840 60.772  1.00 71.13  ? 216 PRO C CD     1 
ATOM   7247  N N      . LYS C  1 224 ? -23.284  -47.248 63.107  1.00 70.02  ? 217 LYS C N      1 
ATOM   7248  C CA     . LYS C  1 224 ? -23.963  -46.577 64.210  1.00 69.21  ? 217 LYS C CA     1 
ATOM   7249  C C      . LYS C  1 224 ? -24.437  -45.174 63.852  1.00 68.33  ? 217 LYS C C      1 
ATOM   7250  O O      . LYS C  1 224 ? -25.238  -44.599 64.596  1.00 68.66  ? 217 LYS C O      1 
ATOM   7251  C CB     . LYS C  1 224 ? -23.042  -46.508 65.430  1.00 69.91  ? 217 LYS C CB     1 
ATOM   7252  N N      . LEU C  1 225 ? -23.969  -44.620 62.739  1.00 64.99  ? 218 LEU C N      1 
ATOM   7253  C CA     . LEU C  1 225 ? -24.261  -43.254 62.333  1.00 61.06  ? 218 LEU C CA     1 
ATOM   7254  C C      . LEU C  1 225 ? -25.134  -43.252 61.088  1.00 62.90  ? 218 LEU C C      1 
ATOM   7255  O O      . LEU C  1 225 ? -24.902  -44.026 60.155  1.00 64.77  ? 218 LEU C O      1 
ATOM   7256  C CB     . LEU C  1 225 ? -22.970  -42.478 62.059  1.00 54.58  ? 218 LEU C CB     1 
ATOM   7257  C CG     . LEU C  1 225 ? -23.111  -41.007 61.667  1.00 51.53  ? 218 LEU C CG     1 
ATOM   7258  C CD1    . LEU C  1 225 ? -23.826  -40.220 62.748  1.00 52.77  ? 218 LEU C CD1    1 
ATOM   7259  C CD2    . LEU C  1 225 ? -21.742  -40.412 61.387  1.00 48.49  ? 218 LEU C CD2    1 
ATOM   7260  N N      . ALA C  1 226 ? -26.155  -42.400 61.088  1.00 60.19  ? 219 ALA C N      1 
ATOM   7261  C CA     . ALA C  1 226 ? -27.018  -42.229 59.932  1.00 56.12  ? 219 ALA C CA     1 
ATOM   7262  C C      . ALA C  1 226 ? -27.060  -40.760 59.543  1.00 55.20  ? 219 ALA C C      1 
ATOM   7263  O O      . ALA C  1 226 ? -26.958  -39.871 60.393  1.00 58.41  ? 219 ALA C O      1 
ATOM   7264  C CB     . ALA C  1 226 ? -28.440  -42.733 60.204  1.00 54.37  ? 219 ALA C CB     1 
ATOM   7265  N N      . VAL C  1 227 ? -27.221  -40.515 58.249  1.00 52.38  ? 220 VAL C N      1 
ATOM   7266  C CA     . VAL C  1 227 ? -27.408  -39.173 57.716  1.00 51.82  ? 220 VAL C CA     1 
ATOM   7267  C C      . VAL C  1 227 ? -28.816  -39.121 57.148  1.00 52.38  ? 220 VAL C C      1 
ATOM   7268  O O      . VAL C  1 227 ? -29.109  -39.757 56.128  1.00 50.79  ? 220 VAL C O      1 
ATOM   7269  C CB     . VAL C  1 227 ? -26.358  -38.823 56.654  1.00 47.77  ? 220 VAL C CB     1 
ATOM   7270  C CG1    . VAL C  1 227 ? -26.696  -37.497 55.996  1.00 43.52  ? 220 VAL C CG1    1 
ATOM   7271  C CG2    . VAL C  1 227 ? -24.975  -38.772 57.281  1.00 46.20  ? 220 VAL C CG2    1 
ATOM   7272  N N      . LEU C  1 228 ? -29.689  -38.364 57.800  1.00 55.89  ? 221 LEU C N      1 
ATOM   7273  C CA     . LEU C  1 228 ? -31.088  -38.279 57.408  1.00 58.13  ? 221 LEU C CA     1 
ATOM   7274  C C      . LEU C  1 228 ? -31.315  -36.977 56.654  1.00 54.69  ? 221 LEU C C      1 
ATOM   7275  O O      . LEU C  1 228 ? -31.105  -35.890 57.203  1.00 50.31  ? 221 LEU C O      1 
ATOM   7276  C CB     . LEU C  1 228 ? -32.011  -38.362 58.622  1.00 61.40  ? 221 LEU C CB     1 
ATOM   7277  C CG     . LEU C  1 228 ? -33.471  -38.029 58.305  1.00 63.89  ? 221 LEU C CG     1 
ATOM   7278  C CD1    . LEU C  1 228 ? -34.018  -38.966 57.238  1.00 63.69  ? 221 LEU C CD1    1 
ATOM   7279  C CD2    . LEU C  1 228 ? -34.327  -38.083 59.560  1.00 66.46  ? 221 LEU C CD2    1 
ATOM   7280  N N      . ILE C  1 229 ? -31.745  -37.092 55.403  1.00 51.49  ? 222 ILE C N      1 
ATOM   7281  C CA     . ILE C  1 229 ? -32.069  -35.943 54.572  1.00 48.81  ? 222 ILE C CA     1 
ATOM   7282  C C      . ILE C  1 229 ? -33.584  -35.806 54.552  1.00 52.20  ? 222 ILE C C      1 
ATOM   7283  O O      . ILE C  1 229 ? -34.298  -36.771 54.249  1.00 55.88  ? 222 ILE C O      1 
ATOM   7284  C CB     . ILE C  1 229 ? -31.509  -36.108 53.148  1.00 47.13  ? 222 ILE C CB     1 
ATOM   7285  C CG1    . ILE C  1 229 ? -30.002  -36.365 53.190  1.00 46.68  ? 222 ILE C CG1    1 
ATOM   7286  C CG2    . ILE C  1 229 ? -31.796  -34.868 52.318  1.00 45.46  ? 222 ILE C CG2    1 
ATOM   7287  C CD1    . ILE C  1 229 ? -29.383  -36.588 51.825  1.00 44.10  ? 222 ILE C CD1    1 
ATOM   7288  N N      . THR C  1 230 ? -34.078  -34.617 54.881  1.00 51.34  ? 223 THR C N      1 
ATOM   7289  C CA     . THR C  1 230 ? -35.509  -34.353 54.938  1.00 53.58  ? 223 THR C CA     1 
ATOM   7290  C C      . THR C  1 230 ? -35.835  -33.268 53.925  1.00 53.36  ? 223 THR C C      1 
ATOM   7291  O O      . THR C  1 230 ? -35.367  -32.132 54.053  1.00 54.57  ? 223 THR C O      1 
ATOM   7292  C CB     . THR C  1 230 ? -35.937  -33.928 56.346  1.00 55.56  ? 223 THR C CB     1 
ATOM   7293  O OG1    . THR C  1 230 ? -35.621  -34.969 57.278  1.00 58.34  ? 223 THR C OG1    1 
ATOM   7294  C CG2    . THR C  1 230 ? -37.434  -33.665 56.395  1.00 54.46  ? 223 THR C CG2    1 
ATOM   7295  N N      . ASN C  1 231 ? -36.631  -33.620 52.920  1.00 54.77  ? 224 ASN C N      1 
ATOM   7296  C CA     . ASN C  1 231 ? -37.056  -32.672 51.901  1.00 53.44  ? 224 ASN C CA     1 
ATOM   7297  C C      . ASN C  1 231 ? -38.349  -32.011 52.359  1.00 55.48  ? 224 ASN C C      1 
ATOM   7298  O O      . ASN C  1 231 ? -39.358  -32.691 52.576  1.00 56.70  ? 224 ASN C O      1 
ATOM   7299  C CB     . ASN C  1 231 ? -37.242  -33.365 50.553  1.00 56.12  ? 224 ASN C CB     1 
ATOM   7300  C CG     . ASN C  1 231 ? -37.515  -32.385 49.428  1.00 63.13  ? 224 ASN C CG     1 
ATOM   7301  O OD1    . ASN C  1 231 ? -37.863  -31.227 49.665  1.00 63.85  ? 224 ASN C OD1    1 
ATOM   7302  N ND2    . ASN C  1 231 ? -37.356  -32.846 48.192  1.00 64.44  ? 224 ASN C ND2    1 
ATOM   7303  N N      . SER C  1 232 ? -38.314  -30.688 52.512  1.00 55.02  ? 225 SER C N      1 
ATOM   7304  C CA     . SER C  1 232 ? -39.515  -29.952 52.882  1.00 57.21  ? 225 SER C CA     1 
ATOM   7305  C C      . SER C  1 232 ? -40.555  -29.945 51.771  1.00 58.76  ? 225 SER C C      1 
ATOM   7306  O O      . SER C  1 232 ? -41.717  -29.613 52.030  1.00 59.09  ? 225 SER C O      1 
ATOM   7307  C CB     . SER C  1 232 ? -39.148  -28.517 53.257  1.00 54.62  ? 225 SER C CB     1 
ATOM   7308  O OG     . SER C  1 232 ? -38.663  -27.812 52.127  1.00 51.14  ? 225 SER C OG     1 
ATOM   7309  N N      . ASN C  1 233 ? -40.170  -30.305 50.546  1.00 61.04  ? 226 ASN C N      1 
ATOM   7310  C CA     . ASN C  1 233 ? -41.074  -30.241 49.397  1.00 62.06  ? 226 ASN C CA     1 
ATOM   7311  C C      . ASN C  1 233 ? -41.674  -28.847 49.248  1.00 67.44  ? 226 ASN C C      1 
ATOM   7312  O O      . ASN C  1 233 ? -42.813  -28.683 48.806  1.00 71.36  ? 226 ASN C O      1 
ATOM   7313  C CB     . ASN C  1 233 ? -42.171  -31.303 49.492  1.00 61.63  ? 226 ASN C CB     1 
ATOM   7314  C CG     . ASN C  1 233 ? -41.633  -32.709 49.318  1.00 61.00  ? 226 ASN C CG     1 
ATOM   7315  O OD1    . ASN C  1 233 ? -41.218  -33.091 48.223  1.00 61.87  ? 226 ASN C OD1    1 
ATOM   7316  N ND2    . ASN C  1 233 ? -41.626  -33.484 50.398  1.00 59.74  ? 226 ASN C ND2    1 
ATOM   7317  N N      . VAL C  1 234 ? -40.904  -27.833 49.630  1.00 67.28  ? 227 VAL C N      1 
ATOM   7318  C CA     . VAL C  1 234 ? -41.292  -26.439 49.478  1.00 69.41  ? 227 VAL C CA     1 
ATOM   7319  C C      . VAL C  1 234 ? -40.246  -25.747 48.622  1.00 69.94  ? 227 VAL C C      1 
ATOM   7320  O O      . VAL C  1 234 ? -39.055  -26.071 48.676  1.00 71.15  ? 227 VAL C O      1 
ATOM   7321  C CB     . VAL C  1 234 ? -41.442  -25.718 50.836  1.00 68.53  ? 227 VAL C CB     1 
ATOM   7322  C CG1    . VAL C  1 234 ? -41.853  -24.267 50.623  1.00 69.66  ? 227 VAL C CG1    1 
ATOM   7323  C CG2    . VAL C  1 234 ? -42.443  -26.439 51.718  1.00 69.53  ? 227 VAL C CG2    1 
ATOM   7324  N N      . ARG C  1 235 ? -40.700  -24.787 47.822  1.00 74.75  ? 228 ARG C N      1 
ATOM   7325  C CA     . ARG C  1 235 ? -39.810  -23.974 46.992  1.00 75.03  ? 228 ARG C CA     1 
ATOM   7326  C C      . ARG C  1 235 ? -40.418  -22.575 46.949  1.00 81.05  ? 228 ARG C C      1 
ATOM   7327  O O      . ARG C  1 235 ? -41.160  -22.236 46.024  1.00 81.67  ? 228 ARG C O      1 
ATOM   7328  C CB     . ARG C  1 235 ? -39.639  -24.569 45.601  1.00 73.21  ? 228 ARG C CB     1 
ATOM   7329  N N      . HIS C  1 236 ? -40.102  -21.772 47.959  1.00 82.25  ? 229 HIS C N      1 
ATOM   7330  C CA     . HIS C  1 236 ? -40.662  -20.432 48.074  1.00 86.33  ? 229 HIS C CA     1 
ATOM   7331  C C      . HIS C  1 236 ? -39.715  -19.380 47.506  1.00 87.11  ? 229 HIS C C      1 
ATOM   7332  O O      . HIS C  1 236 ? -38.958  -19.649 46.574  1.00 87.06  ? 229 HIS C O      1 
ATOM   7333  C CB     . HIS C  1 236 ? -40.986  -20.115 49.535  1.00 87.23  ? 229 HIS C CB     1 
ATOM   7334  N N      . SER C  1 240 ? -34.868  -18.649 45.350  1.00 84.01  ? 233 SER C N      1 
ATOM   7335  C CA     . SER C  1 240 ? -33.607  -18.412 44.654  1.00 83.64  ? 233 SER C CA     1 
ATOM   7336  C C      . SER C  1 240 ? -33.652  -17.124 43.834  1.00 86.27  ? 233 SER C C      1 
ATOM   7337  O O      . SER C  1 240 ? -33.092  -17.051 42.738  1.00 86.98  ? 233 SER C O      1 
ATOM   7338  C CB     . SER C  1 240 ? -33.256  -19.594 43.750  1.00 83.42  ? 233 SER C CB     1 
ATOM   7339  O OG     . SER C  1 240 ? -34.172  -19.700 42.675  1.00 85.54  ? 233 SER C OG     1 
ATOM   7340  N N      . SER C  1 241 ? -34.354  -16.122 44.361  1.00 85.77  ? 234 SER C N      1 
ATOM   7341  C CA     . SER C  1 241 ? -34.216  -14.749 43.897  1.00 84.48  ? 234 SER C CA     1 
ATOM   7342  C C      . SER C  1 241 ? -33.319  -13.928 44.812  1.00 80.57  ? 234 SER C C      1 
ATOM   7343  O O      . SER C  1 241 ? -32.886  -12.839 44.423  1.00 83.11  ? 234 SER C O      1 
ATOM   7344  C CB     . SER C  1 241 ? -35.589  -14.078 43.782  1.00 89.10  ? 234 SER C CB     1 
ATOM   7345  O OG     . SER C  1 241 ? -36.128  -13.810 45.062  1.00 90.19  ? 234 SER C OG     1 
ATOM   7346  N N      . GLU C  1 242 ? -33.020  -14.443 46.006  1.00 72.28  ? 235 GLU C N      1 
ATOM   7347  C CA     . GLU C  1 242 ? -32.126  -13.809 46.964  1.00 67.90  ? 235 GLU C CA     1 
ATOM   7348  C C      . GLU C  1 242 ? -30.702  -14.337 46.878  1.00 63.40  ? 235 GLU C C      1 
ATOM   7349  O O      . GLU C  1 242 ? -29.778  -13.659 47.341  1.00 60.90  ? 235 GLU C O      1 
ATOM   7350  C CB     . GLU C  1 242 ? -32.628  -14.049 48.398  1.00 66.14  ? 235 GLU C CB     1 
ATOM   7351  C CG     . GLU C  1 242 ? -33.838  -13.239 48.859  1.00 70.79  ? 235 GLU C CG     1 
ATOM   7352  C CD     . GLU C  1 242 ? -33.469  -11.840 49.307  1.00 72.65  ? 235 GLU C CD     1 
ATOM   7353  O OE1    . GLU C  1 242 ? -32.267  -11.510 49.273  1.00 71.27  ? 235 GLU C OE1    1 
ATOM   7354  O OE2    . GLU C  1 242 ? -34.373  -11.084 49.719  1.00 77.30  ? 235 GLU C OE2    1 
ATOM   7355  N N      . TYR C  1 243 ? -30.503  -15.515 46.289  1.00 59.90  ? 236 TYR C N      1 
ATOM   7356  C CA     . TYR C  1 243 ? -29.155  -16.054 46.119  1.00 56.43  ? 236 TYR C CA     1 
ATOM   7357  C C      . TYR C  1 243 ? -28.213  -15.075 45.437  1.00 56.86  ? 236 TYR C C      1 
ATOM   7358  O O      . TYR C  1 243 ? -27.141  -14.792 45.997  1.00 56.78  ? 236 TYR C O      1 
ATOM   7359  C CB     . TYR C  1 243 ? -29.235  -17.378 45.346  1.00 51.26  ? 236 TYR C CB     1 
ATOM   7360  C CG     . TYR C  1 243 ? -27.919  -18.116 45.252  1.00 47.18  ? 236 TYR C CG     1 
ATOM   7361  C CD1    . TYR C  1 243 ? -26.945  -17.731 44.340  1.00 46.02  ? 236 TYR C CD1    1 
ATOM   7362  C CD2    . TYR C  1 243 ? -27.656  -19.206 46.071  1.00 42.83  ? 236 TYR C CD2    1 
ATOM   7363  C CE1    . TYR C  1 243 ? -25.745  -18.403 44.253  1.00 42.47  ? 236 TYR C CE1    1 
ATOM   7364  C CE2    . TYR C  1 243 ? -26.461  -19.885 45.989  1.00 40.66  ? 236 TYR C CE2    1 
ATOM   7365  C CZ     . TYR C  1 243 ? -25.508  -19.481 45.078  1.00 40.50  ? 236 TYR C CZ     1 
ATOM   7366  O OH     . TYR C  1 243 ? -24.314  -20.157 44.997  1.00 37.91  ? 236 TYR C OH     1 
ATOM   7367  N N      . PRO C  1 244 ? -28.525  -14.537 44.257  1.00 59.75  ? 237 PRO C N      1 
ATOM   7368  C CA     . PRO C  1 244 ? -27.640  -13.525 43.661  1.00 60.44  ? 237 PRO C CA     1 
ATOM   7369  C C      . PRO C  1 244 ? -27.523  -12.266 44.502  1.00 60.78  ? 237 PRO C C      1 
ATOM   7370  O O      . PRO C  1 244 ? -26.534  -11.536 44.364  1.00 60.24  ? 237 PRO C O      1 
ATOM   7371  C CB     . PRO C  1 244 ? -28.295  -13.238 42.302  1.00 63.07  ? 237 PRO C CB     1 
ATOM   7372  C CG     . PRO C  1 244 ? -29.719  -13.663 42.465  1.00 63.82  ? 237 PRO C CG     1 
ATOM   7373  C CD     . PRO C  1 244 ? -29.691  -14.830 43.406  1.00 62.67  ? 237 PRO C CD     1 
ATOM   7374  N N      . VAL C  1 245 ? -28.501  -11.987 45.367  1.00 62.27  ? 238 VAL C N      1 
ATOM   7375  C CA     . VAL C  1 245 ? -28.421  -10.805 46.219  1.00 63.67  ? 238 VAL C CA     1 
ATOM   7376  C C      . VAL C  1 245 ? -27.378  -11.004 47.313  1.00 60.75  ? 238 VAL C C      1 
ATOM   7377  O O      . VAL C  1 245 ? -26.587  -10.100 47.606  1.00 58.81  ? 238 VAL C O      1 
ATOM   7378  C CB     . VAL C  1 245 ? -29.805  -10.478 46.806  1.00 67.53  ? 238 VAL C CB     1 
ATOM   7379  C CG1    . VAL C  1 245 ? -29.714  -9.279  47.737  1.00 71.02  ? 238 VAL C CG1    1 
ATOM   7380  C CG2    . VAL C  1 245 ? -30.801  -10.223 45.691  1.00 68.96  ? 238 VAL C CG2    1 
ATOM   7381  N N      . ARG C  1 246 ? -27.355  -12.188 47.932  1.00 56.29  ? 239 ARG C N      1 
ATOM   7382  C CA     . ARG C  1 246 ? -26.313  -12.487 48.910  1.00 54.03  ? 239 ARG C CA     1 
ATOM   7383  C C      . ARG C  1 246 ? -24.936  -12.422 48.268  1.00 50.62  ? 239 ARG C C      1 
ATOM   7384  O O      . ARG C  1 246 ? -23.987  -11.890 48.857  1.00 48.93  ? 239 ARG C O      1 
ATOM   7385  C CB     . ARG C  1 246 ? -26.541  -13.866 49.529  1.00 51.32  ? 239 ARG C CB     1 
ATOM   7386  C CG     . ARG C  1 246 ? -27.835  -14.019 50.299  1.00 53.35  ? 239 ARG C CG     1 
ATOM   7387  C CD     . ARG C  1 246 ? -27.894  -13.070 51.483  1.00 57.45  ? 239 ARG C CD     1 
ATOM   7388  N NE     . ARG C  1 246 ? -29.095  -13.297 52.278  1.00 58.79  ? 239 ARG C NE     1 
ATOM   7389  C CZ     . ARG C  1 246 ? -30.284  -12.788 51.982  1.00 62.51  ? 239 ARG C CZ     1 
ATOM   7390  N NH1    . ARG C  1 246 ? -30.427  -12.019 50.912  1.00 64.97  ? 239 ARG C NH1    1 
ATOM   7391  N NH2    . ARG C  1 246 ? -31.330  -13.047 52.754  1.00 67.03  ? 239 ARG C NH2    1 
ATOM   7392  N N      . ARG C  1 247 ? -24.813  -12.960 47.053  1.00 50.76  ? 240 ARG C N      1 
ATOM   7393  C CA     . ARG C  1 247 ? -23.546  -12.928 46.334  1.00 51.26  ? 240 ARG C CA     1 
ATOM   7394  C C      . ARG C  1 247 ? -23.060  -11.495 46.149  1.00 55.17  ? 240 ARG C C      1 
ATOM   7395  O O      . ARG C  1 247 ? -21.865  -11.211 46.298  1.00 57.16  ? 240 ARG C O      1 
ATOM   7396  C CB     . ARG C  1 247 ? -23.733  -13.620 44.981  1.00 54.59  ? 240 ARG C CB     1 
ATOM   7397  C CG     . ARG C  1 247 ? -22.479  -14.026 44.219  1.00 58.39  ? 240 ARG C CG     1 
ATOM   7398  C CD     . ARG C  1 247 ? -22.889  -14.897 43.028  1.00 63.06  ? 240 ARG C CD     1 
ATOM   7399  N NE     . ARG C  1 247 ? -22.204  -16.184 42.961  1.00 65.80  ? 240 ARG C NE     1 
ATOM   7400  C CZ     . ARG C  1 247 ? -20.959  -16.336 42.525  1.00 70.10  ? 240 ARG C CZ     1 
ATOM   7401  N NH1    . ARG C  1 247 ? -20.400  -17.541 42.476  1.00 72.48  ? 240 ARG C NH1    1 
ATOM   7402  N NH2    . ARG C  1 247 ? -20.267  -15.274 42.144  1.00 71.52  ? 240 ARG C NH2    1 
ATOM   7403  N N      . ARG C  1 248 ? -23.974  -10.574 45.830  1.00 55.49  ? 241 ARG C N      1 
ATOM   7404  C CA     . ARG C  1 248 ? -23.589  -9.174  45.673  1.00 61.26  ? 241 ARG C CA     1 
ATOM   7405  C C      . ARG C  1 248 ? -23.179  -8.558  47.005  1.00 60.22  ? 241 ARG C C      1 
ATOM   7406  O O      . ARG C  1 248 ? -22.167  -7.851  47.081  1.00 61.22  ? 241 ARG C O      1 
ATOM   7407  C CB     . ARG C  1 248 ? -24.734  -8.380  45.045  1.00 63.45  ? 241 ARG C CB     1 
ATOM   7408  N N      . GLN C  1 249 ? -23.952  -8.813  48.063  1.00 61.87  ? 242 GLN C N      1 
ATOM   7409  C CA     . GLN C  1 249 ? -23.624  -8.258  49.372  1.00 63.08  ? 242 GLN C CA     1 
ATOM   7410  C C      . GLN C  1 249 ? -22.245  -8.719  49.827  1.00 61.48  ? 242 GLN C C      1 
ATOM   7411  O O      . GLN C  1 249 ? -21.434  -7.916  50.301  1.00 59.11  ? 242 GLN C O      1 
ATOM   7412  C CB     . GLN C  1 249 ? -24.702  -8.639  50.388  1.00 64.19  ? 242 GLN C CB     1 
ATOM   7413  C CG     . GLN C  1 249 ? -26.038  -7.944  50.145  1.00 68.42  ? 242 GLN C CG     1 
ATOM   7414  C CD     . GLN C  1 249 ? -27.186  -8.569  50.918  1.00 69.96  ? 242 GLN C CD     1 
ATOM   7415  O OE1    . GLN C  1 249 ? -27.096  -9.708  51.378  1.00 67.36  ? 242 GLN C OE1    1 
ATOM   7416  N NE2    . GLN C  1 249 ? -28.271  -7.817  51.073  1.00 72.65  ? 242 GLN C NE2    1 
ATOM   7417  N N      . CYS C  1 250 ? -21.965  -10.019 49.699  1.00 57.32  ? 243 CYS C N      1 
ATOM   7418  C CA     . CYS C  1 250 ? -20.640  -10.518 50.052  1.00 55.72  ? 243 CYS C CA     1 
ATOM   7419  C C      . CYS C  1 250 ? -19.558  -9.805  49.251  1.00 55.95  ? 243 CYS C C      1 
ATOM   7420  O O      . CYS C  1 250 ? -18.516  -9.426  49.799  1.00 57.95  ? 243 CYS C O      1 
ATOM   7421  C CB     . CYS C  1 250 ? -20.565  -12.030 49.830  1.00 49.92  ? 243 CYS C CB     1 
ATOM   7422  S SG     . CYS C  1 250 ? -21.515  -13.013 51.014  1.00 47.68  ? 243 CYS C SG     1 
ATOM   7423  N N      . GLU C  1 251 ? -19.787  -9.614  47.948  1.00 58.41  ? 244 GLU C N      1 
ATOM   7424  C CA     . GLU C  1 251 ? -18.830  -8.876  47.129  1.00 61.68  ? 244 GLU C CA     1 
ATOM   7425  C C      . GLU C  1 251 ? -18.693  -7.438  47.612  1.00 62.27  ? 244 GLU C C      1 
ATOM   7426  O O      . GLU C  1 251 ? -17.582  -6.896  47.665  1.00 62.45  ? 244 GLU C O      1 
ATOM   7427  C CB     . GLU C  1 251 ? -19.252  -8.919  45.659  1.00 67.91  ? 244 GLU C CB     1 
ATOM   7428  C CG     . GLU C  1 251 ? -19.058  -10.279 45.001  1.00 69.34  ? 244 GLU C CG     1 
ATOM   7429  C CD     . GLU C  1 251 ? -19.739  -10.382 43.647  1.00 75.36  ? 244 GLU C CD     1 
ATOM   7430  O OE1    . GLU C  1 251 ? -20.390  -9.400  43.226  1.00 78.55  ? 244 GLU C OE1    1 
ATOM   7431  O OE2    . GLU C  1 251 ? -19.626  -11.449 43.006  1.00 75.40  ? 244 GLU C OE2    1 
ATOM   7432  N N      . GLU C  1 252 ? -19.811  -6.804  47.969  1.00 63.33  ? 245 GLU C N      1 
ATOM   7433  C CA     . GLU C  1 252 ? -19.755  -5.434  48.466  1.00 65.95  ? 245 GLU C CA     1 
ATOM   7434  C C      . GLU C  1 252 ? -18.956  -5.349  49.762  1.00 63.34  ? 245 GLU C C      1 
ATOM   7435  O O      . GLU C  1 252 ? -18.167  -4.416  49.954  1.00 61.81  ? 245 GLU C O      1 
ATOM   7436  C CB     . GLU C  1 252 ? -21.170  -4.891  48.672  1.00 67.86  ? 245 GLU C CB     1 
ATOM   7437  C CG     . GLU C  1 252 ? -21.861  -4.431  47.401  1.00 71.35  ? 245 GLU C CG     1 
ATOM   7438  C CD     . GLU C  1 252 ? -23.296  -3.999  47.646  1.00 78.01  ? 245 GLU C CD     1 
ATOM   7439  O OE1    . GLU C  1 252 ? -24.209  -4.835  47.473  1.00 78.64  ? 245 GLU C OE1    1 
ATOM   7440  O OE2    . GLU C  1 252 ? -23.509  -2.826  48.024  1.00 81.41  ? 245 GLU C OE2    1 
ATOM   7441  N N      . VAL C  1 253 ? -19.147  -6.317  50.663  1.00 60.29  ? 246 VAL C N      1 
ATOM   7442  C CA     . VAL C  1 253 ? -18.450  -6.297  51.947  1.00 61.07  ? 246 VAL C CA     1 
ATOM   7443  C C      . VAL C  1 253 ? -16.956  -6.542  51.764  1.00 61.10  ? 246 VAL C C      1 
ATOM   7444  O O      . VAL C  1 253 ? -16.128  -5.966  52.480  1.00 59.07  ? 246 VAL C O      1 
ATOM   7445  C CB     . VAL C  1 253 ? -19.075  -7.324  52.908  1.00 61.67  ? 246 VAL C CB     1 
ATOM   7446  C CG1    . VAL C  1 253 ? -18.249  -7.430  54.185  1.00 62.63  ? 246 VAL C CG1    1 
ATOM   7447  C CG2    . VAL C  1 253 ? -20.514  -6.949  53.223  1.00 62.67  ? 246 VAL C CG2    1 
ATOM   7448  N N      . ALA C  1 254 ? -16.586  -7.397  50.809  1.00 60.32  ? 247 ALA C N      1 
ATOM   7449  C CA     . ALA C  1 254 ? -15.172  -7.685  50.586  1.00 61.67  ? 247 ALA C CA     1 
ATOM   7450  C C      . ALA C  1 254 ? -14.429  -6.436  50.133  1.00 67.05  ? 247 ALA C C      1 
ATOM   7451  O O      . ALA C  1 254 ? -13.285  -6.199  50.541  1.00 67.76  ? 247 ALA C O      1 
ATOM   7452  C CB     . ALA C  1 254 ? -15.017  -8.803  49.556  1.00 57.31  ? 247 ALA C CB     1 
ATOM   7453  N N      . ARG C  1 255 ? -15.064  -5.637  49.272  1.00 73.54  ? 248 ARG C N      1 
ATOM   7454  C CA     . ARG C  1 255 ? -14.484  -4.367  48.840  1.00 75.67  ? 248 ARG C CA     1 
ATOM   7455  C C      . ARG C  1 255 ? -14.274  -3.429  50.022  1.00 77.11  ? 248 ARG C C      1 
ATOM   7456  O O      . ARG C  1 255 ? -13.202  -2.829  50.173  1.00 77.57  ? 248 ARG C O      1 
ATOM   7457  C CB     . ARG C  1 255 ? -15.393  -3.709  47.795  1.00 81.89  ? 248 ARG C CB     1 
ATOM   7458  C CG     . ARG C  1 255 ? -14.855  -3.718  46.366  1.00 86.60  ? 248 ARG C CG     1 
ATOM   7459  C CD     . ARG C  1 255 ? -15.770  -2.966  45.357  1.00 92.36  ? 248 ARG C CD     1 
ATOM   7460  N NE     . ARG C  1 255 ? -17.078  -3.593  45.238  1.00 94.82  ? 248 ARG C NE     1 
ATOM   7461  C CZ     . ARG C  1 255 ? -17.259  -4.848  44.849  1.00 93.65  ? 248 ARG C CZ     1 
ATOM   7462  N NH1    . ARG C  1 255 ? -18.477  -5.353  44.756  1.00 93.99  ? 248 ARG C NH1    1 
ATOM   7463  N NH2    . ARG C  1 255 ? -16.216  -5.595  44.521  1.00 91.68  ? 248 ARG C NH2    1 
ATOM   7464  N N      . ALA C  1 256 ? -15.290  -3.302  50.881  1.00 70.52  ? 249 ALA C N      1 
ATOM   7465  C CA     . ALA C  1 256 ? -15.207  -2.397  52.024  1.00 75.32  ? 249 ALA C CA     1 
ATOM   7466  C C      . ALA C  1 256 ? -14.000  -2.694  52.906  1.00 72.57  ? 249 ALA C C      1 
ATOM   7467  O O      . ALA C  1 256 ? -13.370  -1.773  53.438  1.00 74.60  ? 249 ALA C O      1 
ATOM   7468  C CB     . ALA C  1 256 ? -16.497  -2.473  52.840  1.00 77.48  ? 249 ALA C CB     1 
ATOM   7469  N N      . LEU C  1 257 ? -13.655  -3.966  53.066  1.00 62.51  ? 250 LEU C N      1 
ATOM   7470  C CA     . LEU C  1 257 ? -12.523  -4.351  53.895  1.00 61.52  ? 250 LEU C CA     1 
ATOM   7471  C C      . LEU C  1 257 ? -11.213  -4.423  53.119  1.00 63.95  ? 250 LEU C C      1 
ATOM   7472  O O      . LEU C  1 257 ? -10.191  -4.815  53.692  1.00 63.68  ? 250 LEU C O      1 
ATOM   7473  C CB     . LEU C  1 257 ? -12.803  -5.695  54.570  1.00 59.12  ? 250 LEU C CB     1 
ATOM   7474  N N      . GLY C  1 258 ? -11.213  -4.041  51.846  1.00 66.62  ? 251 GLY C N      1 
ATOM   7475  C CA     . GLY C  1 258 ? -9.997   -4.109  51.050  1.00 68.99  ? 251 GLY C CA     1 
ATOM   7476  C C      . GLY C  1 258 ? -9.467   -5.516  50.887  1.00 69.85  ? 251 GLY C C      1 
ATOM   7477  O O      . GLY C  1 258 ? -8.247   -5.725  50.884  1.00 72.44  ? 251 GLY C O      1 
ATOM   7478  N N      . ALA C  1 259 ? -10.361  -6.490  50.756  1.00 67.90  ? 252 ALA C N      1 
ATOM   7479  C CA     . ALA C  1 259 ? -9.980   -7.884  50.609  1.00 66.20  ? 252 ALA C CA     1 
ATOM   7480  C C      . ALA C  1 259 ? -10.462  -8.422  49.269  1.00 67.62  ? 252 ALA C C      1 
ATOM   7481  O O      . ALA C  1 259 ? -11.450  -7.943  48.703  1.00 66.00  ? 252 ALA C O      1 
ATOM   7482  C CB     . ALA C  1 259 ? -10.548  -8.740  51.751  1.00 64.95  ? 252 ALA C CB     1 
ATOM   7483  N N      . ALA C  1 260 ? -9.751   -9.435  48.771  1.00 66.11  ? 253 ALA C N      1 
ATOM   7484  C CA     . ALA C  1 260 ? -10.132  -10.060 47.509  1.00 65.74  ? 253 ALA C CA     1 
ATOM   7485  C C      . ALA C  1 260 ? -11.400  -10.890 47.666  1.00 62.90  ? 253 ALA C C      1 
ATOM   7486  O O      . ALA C  1 260 ? -12.240  -10.930 46.759  1.00 62.32  ? 253 ALA C O      1 
ATOM   7487  C CB     . ALA C  1 260 ? -8.984   -10.918 46.980  1.00 64.39  ? 253 ALA C CB     1 
ATOM   7488  N N      . SER C  1 261 ? -11.551  -11.564 48.805  1.00 60.19  ? 254 SER C N      1 
ATOM   7489  C CA     . SER C  1 261 ? -12.745  -12.342 49.095  1.00 56.34  ? 254 SER C CA     1 
ATOM   7490  C C      . SER C  1 261 ? -12.933  -12.414 50.602  1.00 54.13  ? 254 SER C C      1 
ATOM   7491  O O      . SER C  1 261 ? -12.015  -12.132 51.376  1.00 56.82  ? 254 SER C O      1 
ATOM   7492  C CB     . SER C  1 261 ? -12.651  -13.755 48.502  1.00 57.01  ? 254 SER C CB     1 
ATOM   7493  O OG     . SER C  1 261 ? -11.630  -14.513 49.133  1.00 55.68  ? 254 SER C OG     1 
ATOM   7494  N N      . LEU C  1 262 ? -14.140  -12.802 51.017  1.00 49.48  ? 255 LEU C N      1 
ATOM   7495  C CA     . LEU C  1 262 ? -14.403  -12.954 52.441  1.00 45.50  ? 255 LEU C CA     1 
ATOM   7496  C C      . LEU C  1 262 ? -13.544  -14.037 53.075  1.00 47.93  ? 255 LEU C C      1 
ATOM   7497  O O      . LEU C  1 262 ? -13.475  -14.109 54.307  1.00 48.10  ? 255 LEU C O      1 
ATOM   7498  C CB     . LEU C  1 262 ? -15.883  -13.262 52.674  1.00 41.10  ? 255 LEU C CB     1 
ATOM   7499  C CG     . LEU C  1 262 ? -16.831  -12.067 52.574  1.00 41.55  ? 255 LEU C CG     1 
ATOM   7500  C CD1    . LEU C  1 262 ? -18.247  -12.486 52.910  1.00 38.69  ? 255 LEU C CD1    1 
ATOM   7501  C CD2    . LEU C  1 262 ? -16.373  -10.954 53.503  1.00 43.95  ? 255 LEU C CD2    1 
ATOM   7502  N N      . ARG C  1 263 ? -12.891  -14.874 52.266  1.00 50.08  ? 256 ARG C N      1 
ATOM   7503  C CA     . ARG C  1 263 ? -12.019  -15.904 52.813  1.00 50.32  ? 256 ARG C CA     1 
ATOM   7504  C C      . ARG C  1 263 ? -10.781  -15.304 53.454  1.00 54.37  ? 256 ARG C C      1 
ATOM   7505  O O      . ARG C  1 263 ? -10.188  -15.917 54.349  1.00 53.88  ? 256 ARG C O      1 
ATOM   7506  C CB     . ARG C  1 263 ? -11.586  -16.871 51.718  1.00 47.85  ? 256 ARG C CB     1 
ATOM   7507  C CG     . ARG C  1 263 ? -10.560  -17.883 52.177  1.00 37.45  ? 256 ARG C CG     1 
ATOM   7508  C CD     . ARG C  1 263 ? -11.263  -19.056 52.872  1.00 36.44  ? 256 ARG C CD     1 
ATOM   7509  N NE     . ARG C  1 263 ? -10.274  -20.031 53.309  1.00 36.98  ? 256 ARG C NE     1 
ATOM   7510  C CZ     . ARG C  1 263 ? -9.829   -21.032 52.553  1.00 37.08  ? 256 ARG C CZ     1 
ATOM   7511  N NH1    . ARG C  1 263 ? -8.926   -21.877 53.028  1.00 37.76  ? 256 ARG C NH1    1 
ATOM   7512  N NH2    . ARG C  1 263 ? -10.308  -21.214 51.325  1.00 50.54  ? 256 ARG C NH2    1 
ATOM   7513  N N      . GLU C  1 264 ? -10.359  -14.131 52.992  1.00 62.07  ? 257 GLU C N      1 
ATOM   7514  C CA     . GLU C  1 264 ? -9.172   -13.493 53.537  1.00 64.20  ? 257 GLU C CA     1 
ATOM   7515  C C      . GLU C  1 264 ? -9.458   -12.735 54.823  1.00 63.62  ? 257 GLU C C      1 
ATOM   7516  O O      . GLU C  1 264 ? -8.538   -12.131 55.383  1.00 67.51  ? 257 GLU C O      1 
ATOM   7517  C CB     . GLU C  1 264 ? -8.569   -12.537 52.504  1.00 68.50  ? 257 GLU C CB     1 
ATOM   7518  C CG     . GLU C  1 264 ? -8.060   -13.199 51.229  1.00 77.12  ? 257 GLU C CG     1 
ATOM   7519  C CD     . GLU C  1 264 ? -7.509   -12.189 50.237  1.00 85.22  ? 257 GLU C CD     1 
ATOM   7520  O OE1    . GLU C  1 264 ? -8.223   -11.212 49.922  1.00 87.04  ? 257 GLU C OE1    1 
ATOM   7521  O OE2    . GLU C  1 264 ? -6.358   -12.363 49.783  1.00 88.84  ? 257 GLU C OE2    1 
ATOM   7522  N N      . VAL C  1 265 ? -10.697  -12.761 55.305  1.00 59.49  ? 258 VAL C N      1 
ATOM   7523  C CA     . VAL C  1 265 ? -11.098  -12.057 56.516  1.00 59.29  ? 258 VAL C CA     1 
ATOM   7524  C C      . VAL C  1 265 ? -11.560  -13.090 57.536  1.00 58.78  ? 258 VAL C C      1 
ATOM   7525  O O      . VAL C  1 265 ? -12.325  -14.001 57.199  1.00 60.18  ? 258 VAL C O      1 
ATOM   7526  C CB     . VAL C  1 265 ? -12.207  -11.026 56.234  1.00 54.56  ? 258 VAL C CB     1 
ATOM   7527  C CG1    . VAL C  1 265 ? -12.521  -10.240 57.490  1.00 49.72  ? 258 VAL C CG1    1 
ATOM   7528  C CG2    . VAL C  1 265 ? -11.786  -10.089 55.111  1.00 55.53  ? 258 VAL C CG2    1 
ATOM   7529  N N      . GLN C  1 266 ? -11.084  -12.963 58.772  1.00 59.29  ? 259 GLN C N      1 
ATOM   7530  C CA     . GLN C  1 266 ? -11.533  -13.802 59.873  1.00 55.98  ? 259 GLN C CA     1 
ATOM   7531  C C      . GLN C  1 266 ? -12.394  -12.989 60.837  1.00 52.53  ? 259 GLN C C      1 
ATOM   7532  O O      . GLN C  1 266 ? -12.413  -11.756 60.796  1.00 49.73  ? 259 GLN C O      1 
ATOM   7533  C CB     . GLN C  1 266 ? -10.343  -14.437 60.596  1.00 57.97  ? 259 GLN C CB     1 
ATOM   7534  C CG     . GLN C  1 266 ? -9.526   -15.321 59.677  1.00 62.46  ? 259 GLN C CG     1 
ATOM   7535  C CD     . GLN C  1 266 ? -8.436   -16.082 60.392  1.00 63.36  ? 259 GLN C CD     1 
ATOM   7536  O OE1    . GLN C  1 266 ? -8.654   -16.649 61.463  1.00 63.90  ? 259 GLN C OE1    1 
ATOM   7537  N NE2    . GLN C  1 266 ? -7.251   -16.113 59.793  1.00 64.39  ? 259 GLN C NE2    1 
ATOM   7538  N N      . LEU C  1 267 ? -13.120  -13.702 61.704  1.00 53.70  ? 260 LEU C N      1 
ATOM   7539  C CA     . LEU C  1 267 ? -14.073  -13.057 62.606  1.00 55.14  ? 260 LEU C CA     1 
ATOM   7540  C C      . LEU C  1 267 ? -13.432  -11.893 63.350  1.00 57.14  ? 260 LEU C C      1 
ATOM   7541  O O      . LEU C  1 267 ? -14.012  -10.804 63.451  1.00 57.04  ? 260 LEU C O      1 
ATOM   7542  C CB     . LEU C  1 267 ? -14.623  -14.088 63.597  1.00 55.00  ? 260 LEU C CB     1 
ATOM   7543  C CG     . LEU C  1 267 ? -15.661  -13.693 64.648  1.00 58.57  ? 260 LEU C CG     1 
ATOM   7544  C CD1    . LEU C  1 267 ? -16.852  -13.048 63.999  1.00 59.95  ? 260 LEU C CD1    1 
ATOM   7545  C CD2    . LEU C  1 267 ? -16.110  -14.954 65.374  1.00 57.92  ? 260 LEU C CD2    1 
ATOM   7546  N N      . GLU C  1 268 ? -12.237  -12.116 63.897  1.00 61.35  ? 261 GLU C N      1 
ATOM   7547  C CA     . GLU C  1 268 ? -11.578  -11.079 64.681  1.00 66.20  ? 261 GLU C CA     1 
ATOM   7548  C C      . GLU C  1 268 ? -11.311  -9.855  63.819  1.00 63.39  ? 261 GLU C C      1 
ATOM   7549  O O      . GLU C  1 268 ? -11.491  -8.715  64.264  1.00 62.83  ? 261 GLU C O      1 
ATOM   7550  C CB     . GLU C  1 268 ? -10.279  -11.618 65.287  1.00 73.17  ? 261 GLU C CB     1 
ATOM   7551  C CG     . GLU C  1 268 ? -10.048  -13.110 65.048  1.00 78.74  ? 261 GLU C CG     1 
ATOM   7552  C CD     . GLU C  1 268 ? -11.063  -13.997 65.754  1.00 81.04  ? 261 GLU C CD     1 
ATOM   7553  O OE1    . GLU C  1 268 ? -11.308  -13.794 66.965  1.00 84.25  ? 261 GLU C OE1    1 
ATOM   7554  O OE2    . GLU C  1 268 ? -11.624  -14.891 65.083  1.00 77.77  ? 261 GLU C OE2    1 
ATOM   7555  N N      . GLU C  1 269 ? -10.878  -10.078 62.578  1.00 65.11  ? 262 GLU C N      1 
ATOM   7556  C CA     . GLU C  1 269 ? -10.625  -8.968  61.671  1.00 66.11  ? 262 GLU C CA     1 
ATOM   7557  C C      . GLU C  1 269 ? -11.920  -8.239  61.317  1.00 61.76  ? 262 GLU C C      1 
ATOM   7558  O O      . GLU C  1 269 ? -11.930  -7.008  61.208  1.00 62.46  ? 262 GLU C O      1 
ATOM   7559  C CB     . GLU C  1 269 ? -9.927   -9.483  60.409  1.00 73.36  ? 262 GLU C CB     1 
ATOM   7560  C CG     . GLU C  1 269 ? -9.584   -8.408  59.389  1.00 79.82  ? 262 GLU C CG     1 
ATOM   7561  C CD     . GLU C  1 269 ? -9.072   -8.997  58.088  1.00 84.72  ? 262 GLU C CD     1 
ATOM   7562  O OE1    . GLU C  1 269 ? -8.786   -10.213 58.061  1.00 86.80  ? 262 GLU C OE1    1 
ATOM   7563  O OE2    . GLU C  1 269 ? -9.027   -8.264  57.076  1.00 86.47  ? 262 GLU C OE2    1 
ATOM   7564  N N      . LEU C  1 270 ? -13.029  -8.975  61.157  1.00 55.55  ? 263 LEU C N      1 
ATOM   7565  C CA     . LEU C  1 270 ? -14.302  -8.343  60.814  1.00 51.87  ? 263 LEU C CA     1 
ATOM   7566  C C      . LEU C  1 270 ? -14.814  -7.468  61.947  1.00 52.72  ? 263 LEU C C      1 
ATOM   7567  O O      . LEU C  1 270 ? -15.338  -6.370  61.712  1.00 57.02  ? 263 LEU C O      1 
ATOM   7568  C CB     . LEU C  1 270 ? -15.329  -9.417  60.471  1.00 45.82  ? 263 LEU C CB     1 
ATOM   7569  C CG     . LEU C  1 270 ? -16.681  -8.869  60.033  1.00 44.55  ? 263 LEU C CG     1 
ATOM   7570  C CD1    . LEU C  1 270 ? -16.532  -8.028  58.775  1.00 38.20  ? 263 LEU C CD1    1 
ATOM   7571  C CD2    . LEU C  1 270 ? -17.654  -10.012 59.829  1.00 48.20  ? 263 LEU C CD2    1 
ATOM   7572  N N      . GLU C  1 271 ? -14.650  -7.946  63.181  1.00 53.32  ? 264 GLU C N      1 
ATOM   7573  C CA     . GLU C  1 271 ? -15.089  -7.213  64.360  1.00 52.09  ? 264 GLU C CA     1 
ATOM   7574  C C      . GLU C  1 271 ? -14.275  -5.945  64.560  1.00 53.76  ? 264 GLU C C      1 
ATOM   7575  O O      . GLU C  1 271 ? -14.834  -4.885  64.862  1.00 56.36  ? 264 GLU C O      1 
ATOM   7576  C CB     . GLU C  1 271 ? -15.023  -8.147  65.570  1.00 52.70  ? 264 GLU C CB     1 
ATOM   7577  C CG     . GLU C  1 271 ? -15.951  -9.342  65.383  1.00 49.09  ? 264 GLU C CG     1 
ATOM   7578  C CD     . GLU C  1 271 ? -16.133  -10.175 66.633  1.00 49.85  ? 264 GLU C CD     1 
ATOM   7579  O OE1    . GLU C  1 271 ? -15.728  -9.716  67.725  1.00 56.41  ? 264 GLU C OE1    1 
ATOM   7580  O OE2    . GLU C  1 271 ? -16.654  -11.306 66.506  1.00 48.35  ? 264 GLU C OE2    1 
ATOM   7581  N N      . ALA C  1 272 ? -12.959  -6.024  64.359  1.00 52.15  ? 265 ALA C N      1 
ATOM   7582  C CA     . ALA C  1 272 ? -12.125  -4.833  64.465  1.00 52.40  ? 265 ALA C CA     1 
ATOM   7583  C C      . ALA C  1 272 ? -12.530  -3.789  63.431  1.00 51.70  ? 265 ALA C C      1 
ATOM   7584  O O      . ALA C  1 272 ? -12.528  -2.584  63.712  1.00 52.34  ? 265 ALA C O      1 
ATOM   7585  C CB     . ALA C  1 272 ? -10.657  -5.220  64.300  1.00 45.64  ? 265 ALA C CB     1 
ATOM   7586  N N      . ALA C  1 273 ? -12.857  -4.233  62.218  1.00 45.05  ? 266 ALA C N      1 
ATOM   7587  C CA     . ALA C  1 273 ? -13.224  -3.351  61.120  1.00 42.81  ? 266 ALA C CA     1 
ATOM   7588  C C      . ALA C  1 273 ? -14.735  -3.156  60.996  1.00 41.94  ? 266 ALA C C      1 
ATOM   7589  O O      . ALA C  1 273 ? -15.211  -2.746  59.930  1.00 43.98  ? 266 ALA C O      1 
ATOM   7590  C CB     . ALA C  1 273 ? -12.644  -3.885  59.808  1.00 42.61  ? 266 ALA C CB     1 
ATOM   7591  N N      . ARG C  1 274 ? -15.494  -3.441  62.060  1.00 41.77  ? 267 ARG C N      1 
ATOM   7592  C CA     . ARG C  1 274 ? -16.954  -3.370  61.996  1.00 45.43  ? 267 ARG C CA     1 
ATOM   7593  C C      . ARG C  1 274 ? -17.456  -2.021  61.496  1.00 50.05  ? 267 ARG C C      1 
ATOM   7594  O O      . ARG C  1 274 ? -18.497  -1.956  60.830  1.00 59.32  ? 267 ARG C O      1 
ATOM   7595  C CB     . ARG C  1 274 ? -17.570  -3.696  63.359  1.00 46.17  ? 267 ARG C CB     1 
ATOM   7596  C CG     . ARG C  1 274 ? -17.172  -2.772  64.488  1.00 42.64  ? 267 ARG C CG     1 
ATOM   7597  C CD     . ARG C  1 274 ? -17.644  -3.337  65.816  1.00 43.20  ? 267 ARG C CD     1 
ATOM   7598  N NE     . ARG C  1 274 ? -17.308  -2.451  66.921  1.00 44.52  ? 267 ARG C NE     1 
ATOM   7599  C CZ     . ARG C  1 274 ? -16.075  -2.268  67.376  1.00 45.45  ? 267 ARG C CZ     1 
ATOM   7600  N NH1    . ARG C  1 274 ? -15.058  -2.871  66.780  1.00 45.20  ? 267 ARG C NH1    1 
ATOM   7601  N NH2    . ARG C  1 274 ? -15.853  -1.433  68.383  1.00 58.84  ? 267 ARG C NH2    1 
ATOM   7602  N N      . ASP C  1 275 ? -16.744  -0.935  61.799  1.00 52.31  ? 268 ASP C N      1 
ATOM   7603  C CA     . ASP C  1 275 ? -17.215  0.385   61.400  1.00 51.71  ? 268 ASP C CA     1 
ATOM   7604  C C      . ASP C  1 275 ? -17.002  0.654   59.918  1.00 53.04  ? 268 ASP C C      1 
ATOM   7605  O O      . ASP C  1 275 ? -17.437  1.700   59.426  1.00 54.81  ? 268 ASP C O      1 
ATOM   7606  C CB     . ASP C  1 275 ? -16.510  1.476   62.213  1.00 55.36  ? 268 ASP C CB     1 
ATOM   7607  C CG     . ASP C  1 275 ? -16.921  1.481   63.672  1.00 56.89  ? 268 ASP C CG     1 
ATOM   7608  O OD1    . ASP C  1 275 ? -18.112  1.241   63.960  1.00 54.87  ? 268 ASP C OD1    1 
ATOM   7609  O OD2    . ASP C  1 275 ? -16.056  1.752   64.530  1.00 59.35  ? 268 ASP C OD2    1 
ATOM   7610  N N      . LEU C  1 276 ? -16.366  -0.268  59.199  1.00 55.69  ? 269 LEU C N      1 
ATOM   7611  C CA     . LEU C  1 276 ? -16.211  -0.147  57.757  1.00 57.76  ? 269 LEU C CA     1 
ATOM   7612  C C      . LEU C  1 276 ? -17.364  -0.764  56.970  1.00 58.78  ? 269 LEU C C      1 
ATOM   7613  O O      . LEU C  1 276 ? -17.503  -0.462  55.780  1.00 59.01  ? 269 LEU C O      1 
ATOM   7614  C CB     . LEU C  1 276 ? -14.897  -0.786  57.299  1.00 56.99  ? 269 LEU C CB     1 
ATOM   7615  C CG     . LEU C  1 276 ? -13.603  -0.131  57.783  1.00 54.87  ? 269 LEU C CG     1 
ATOM   7616  C CD1    . LEU C  1 276 ? -12.399  -0.879  57.237  1.00 56.46  ? 269 LEU C CD1    1 
ATOM   7617  C CD2    . LEU C  1 276 ? -13.554  1.335   57.377  1.00 52.12  ? 269 LEU C CD2    1 
ATOM   7618  N N      . VAL C  1 277 ? -18.197  -1.607  57.587  1.00 57.90  ? 270 VAL C N      1 
ATOM   7619  C CA     . VAL C  1 277 ? -19.280  -2.269  56.867  1.00 54.41  ? 270 VAL C CA     1 
ATOM   7620  C C      . VAL C  1 277 ? -20.618  -1.840  57.459  1.00 50.68  ? 270 VAL C C      1 
ATOM   7621  O O      . VAL C  1 277 ? -20.694  -1.330  58.578  1.00 48.10  ? 270 VAL C O      1 
ATOM   7622  C CB     . VAL C  1 277 ? -19.144  -3.808  56.913  1.00 52.28  ? 270 VAL C CB     1 
ATOM   7623  N N      . SER C  1 278 ? -21.687  -2.051  56.693  1.00 52.37  ? 271 SER C N      1 
ATOM   7624  C CA     . SER C  1 278 ? -23.011  -1.781  57.233  1.00 50.09  ? 271 SER C CA     1 
ATOM   7625  C C      . SER C  1 278 ? -23.398  -2.838  58.240  1.00 52.13  ? 271 SER C C      1 
ATOM   7626  O O      . SER C  1 278 ? -22.831  -3.932  58.285  1.00 52.92  ? 271 SER C O      1 
ATOM   7627  C CB     . SER C  1 278 ? -24.083  -1.752  56.150  1.00 48.16  ? 271 SER C CB     1 
ATOM   7628  O OG     . SER C  1 278 ? -24.168  -3.031  55.521  1.00 47.28  ? 271 SER C OG     1 
ATOM   7629  N N      . LYS C  1 279 ? -24.406  -2.503  59.038  1.00 52.42  ? 272 LYS C N      1 
ATOM   7630  C CA     . LYS C  1 279 ? -24.905  -3.460  60.009  1.00 51.84  ? 272 LYS C CA     1 
ATOM   7631  C C      . LYS C  1 279 ? -25.311  -4.760  59.323  1.00 54.18  ? 272 LYS C C      1 
ATOM   7632  O O      . LYS C  1 279 ? -24.883  -5.846  59.731  1.00 53.36  ? 272 LYS C O      1 
ATOM   7633  C CB     . LYS C  1 279 ? -26.086  -2.855  60.763  1.00 53.58  ? 272 LYS C CB     1 
ATOM   7634  N N      . GLU C  1 280 ? -26.126  -4.672  58.266  1.00 55.53  ? 273 GLU C N      1 
ATOM   7635  C CA     . GLU C  1 280 ? -26.491  -5.877  57.523  1.00 53.05  ? 273 GLU C CA     1 
ATOM   7636  C C      . GLU C  1 280 ? -25.281  -6.483  56.820  1.00 49.25  ? 273 GLU C C      1 
ATOM   7637  O O      . GLU C  1 280 ? -25.075  -7.702  56.857  1.00 46.87  ? 273 GLU C O      1 
ATOM   7638  C CB     . GLU C  1 280 ? -27.606  -5.578  56.520  1.00 52.81  ? 273 GLU C CB     1 
ATOM   7639  C CG     . GLU C  1 280 ? -28.025  -6.793  55.703  1.00 51.88  ? 273 GLU C CG     1 
ATOM   7640  C CD     . GLU C  1 280 ? -29.275  -6.551  54.880  1.00 53.79  ? 273 GLU C CD     1 
ATOM   7641  O OE1    . GLU C  1 280 ? -30.378  -6.507  55.468  1.00 53.79  ? 273 GLU C OE1    1 
ATOM   7642  O OE2    . GLU C  1 280 ? -29.156  -6.397  53.646  1.00 52.55  ? 273 GLU C OE2    1 
ATOM   7643  N N      . GLY C  1 281 ? -24.472  -5.648  56.165  1.00 47.94  ? 274 GLY C N      1 
ATOM   7644  C CA     . GLY C  1 281 ? -23.272  -6.158  55.523  1.00 48.60  ? 274 GLY C CA     1 
ATOM   7645  C C      . GLY C  1 281 ? -22.370  -6.895  56.492  1.00 55.58  ? 274 GLY C C      1 
ATOM   7646  O O      . GLY C  1 281 ? -21.735  -7.890  56.134  1.00 61.16  ? 274 GLY C O      1 
ATOM   7647  N N      . PHE C  1 282 ? -22.301  -6.412  57.734  1.00 53.93  ? 275 PHE C N      1 
ATOM   7648  C CA     . PHE C  1 282 ? -21.501  -7.078  58.756  1.00 48.60  ? 275 PHE C CA     1 
ATOM   7649  C C      . PHE C  1 282 ? -22.079  -8.445  59.104  1.00 46.23  ? 275 PHE C C      1 
ATOM   7650  O O      . PHE C  1 282 ? -21.336  -9.423  59.249  1.00 49.65  ? 275 PHE C O      1 
ATOM   7651  C CB     . PHE C  1 282 ? -21.413  -6.195  60.001  1.00 46.21  ? 275 PHE C CB     1 
ATOM   7652  C CG     . PHE C  1 282 ? -20.719  -6.847  61.162  1.00 45.76  ? 275 PHE C CG     1 
ATOM   7653  C CD1    . PHE C  1 282 ? -19.343  -6.767  61.295  1.00 45.17  ? 275 PHE C CD1    1 
ATOM   7654  C CD2    . PHE C  1 282 ? -21.441  -7.538  62.122  1.00 39.12  ? 275 PHE C CD2    1 
ATOM   7655  C CE1    . PHE C  1 282 ? -18.697  -7.364  62.360  1.00 43.48  ? 275 PHE C CE1    1 
ATOM   7656  C CE2    . PHE C  1 282 ? -20.802  -8.140  63.189  1.00 43.01  ? 275 PHE C CE2    1 
ATOM   7657  C CZ     . PHE C  1 282 ? -19.427  -8.051  63.309  1.00 42.08  ? 275 PHE C CZ     1 
ATOM   7658  N N      . ARG C  1 283 ? -23.406  -8.533  59.240  1.00 47.94  ? 276 ARG C N      1 
ATOM   7659  C CA     . ARG C  1 283 ? -24.032  -9.806  59.587  1.00 47.84  ? 276 ARG C CA     1 
ATOM   7660  C C      . ARG C  1 283 ? -23.833  -10.848 58.493  1.00 52.68  ? 276 ARG C C      1 
ATOM   7661  O O      . ARG C  1 283 ? -23.556  -12.017 58.787  1.00 55.25  ? 276 ARG C O      1 
ATOM   7662  C CB     . ARG C  1 283 ? -25.521  -9.597  59.867  1.00 47.93  ? 276 ARG C CB     1 
ATOM   7663  C CG     . ARG C  1 283 ? -25.809  -8.810  61.138  1.00 52.01  ? 276 ARG C CG     1 
ATOM   7664  C CD     . ARG C  1 283 ? -27.294  -8.782  61.457  1.00 55.31  ? 276 ARG C CD     1 
ATOM   7665  N NE     . ARG C  1 283 ? -27.864  -7.455  61.253  1.00 59.72  ? 276 ARG C NE     1 
ATOM   7666  C CZ     . ARG C  1 283 ? -28.685  -7.132  60.261  1.00 62.13  ? 276 ARG C CZ     1 
ATOM   7667  N NH1    . ARG C  1 283 ? -29.038  -8.040  59.362  1.00 63.59  ? 276 ARG C NH1    1 
ATOM   7668  N NH2    . ARG C  1 283 ? -29.148  -5.894  60.166  1.00 63.13  ? 276 ARG C NH2    1 
ATOM   7669  N N      . ARG C  1 284 ? -23.964  -10.448 57.225  1.00 50.66  ? 277 ARG C N      1 
ATOM   7670  C CA     . ARG C  1 284 ? -23.686  -11.375 56.132  1.00 47.68  ? 277 ARG C CA     1 
ATOM   7671  C C      . ARG C  1 284 ? -22.270  -11.924 56.239  1.00 43.86  ? 277 ARG C C      1 
ATOM   7672  O O      . ARG C  1 284 ? -22.054  -13.141 56.200  1.00 43.25  ? 277 ARG C O      1 
ATOM   7673  C CB     . ARG C  1 284 ? -23.878  -10.688 54.778  1.00 47.17  ? 277 ARG C CB     1 
ATOM   7674  C CG     . ARG C  1 284 ? -25.289  -10.221 54.421  1.00 47.22  ? 277 ARG C CG     1 
ATOM   7675  C CD     . ARG C  1 284 ? -26.342  -11.316 54.559  1.00 49.05  ? 277 ARG C CD     1 
ATOM   7676  N NE     . ARG C  1 284 ? -27.677  -10.822 54.220  1.00 50.59  ? 277 ARG C NE     1 
ATOM   7677  C CZ     . ARG C  1 284 ? -28.611  -10.481 55.101  1.00 52.63  ? 277 ARG C CZ     1 
ATOM   7678  N NH1    . ARG C  1 284 ? -28.380  -10.582 56.400  1.00 56.50  ? 277 ARG C NH1    1 
ATOM   7679  N NH2    . ARG C  1 284 ? -29.786  -10.042 54.676  1.00 52.51  ? 277 ARG C NH2    1 
ATOM   7680  N N      . ALA C  1 285 ? -21.288  -11.030 56.382  1.00 41.88  ? 278 ALA C N      1 
ATOM   7681  C CA     . ALA C  1 285 ? -19.895  -11.456 56.451  1.00 40.36  ? 278 ALA C CA     1 
ATOM   7682  C C      . ALA C  1 285 ? -19.623  -12.300 57.687  1.00 42.37  ? 278 ALA C C      1 
ATOM   7683  O O      . ALA C  1 285 ? -18.790  -13.212 57.641  1.00 44.88  ? 278 ALA C O      1 
ATOM   7684  C CB     . ALA C  1 285 ? -18.971  -10.238 56.429  1.00 43.08  ? 278 ALA C CB     1 
ATOM   7685  N N      . ARG C  1 286 ? -20.308  -12.018 58.798  1.00 40.54  ? 279 ARG C N      1 
ATOM   7686  C CA     . ARG C  1 286 ? -20.079  -12.808 60.003  1.00 42.05  ? 279 ARG C CA     1 
ATOM   7687  C C      . ARG C  1 286 ? -20.448  -14.266 59.777  1.00 41.77  ? 279 ARG C C      1 
ATOM   7688  O O      . ARG C  1 286 ? -19.780  -15.170 60.290  1.00 42.54  ? 279 ARG C O      1 
ATOM   7689  C CB     . ARG C  1 286 ? -20.866  -12.246 61.186  1.00 42.15  ? 279 ARG C CB     1 
ATOM   7690  C CG     . ARG C  1 286 ? -20.626  -13.040 62.466  1.00 41.92  ? 279 ARG C CG     1 
ATOM   7691  C CD     . ARG C  1 286 ? -21.108  -12.309 63.700  1.00 43.02  ? 279 ARG C CD     1 
ATOM   7692  N NE     . ARG C  1 286 ? -22.543  -12.053 63.658  1.00 45.21  ? 279 ARG C NE     1 
ATOM   7693  C CZ     . ARG C  1 286 ? -23.188  -11.280 64.526  1.00 44.66  ? 279 ARG C CZ     1 
ATOM   7694  N NH1    . ARG C  1 286 ? -22.524  -10.686 65.509  1.00 42.69  ? 279 ARG C NH1    1 
ATOM   7695  N NH2    . ARG C  1 286 ? -24.497  -11.100 64.410  1.00 44.49  ? 279 ARG C NH2    1 
ATOM   7696  N N      . HIS C  1 287 ? -21.520  -14.517 59.022  1.00 41.11  ? 280 HIS C N      1 
ATOM   7697  C CA     . HIS C  1 287 ? -21.870  -15.895 58.698  1.00 39.02  ? 280 HIS C CA     1 
ATOM   7698  C C      . HIS C  1 287 ? -20.773  -16.562 57.883  1.00 38.09  ? 280 HIS C C      1 
ATOM   7699  O O      . HIS C  1 287 ? -20.289  -17.644 58.236  1.00 38.72  ? 280 HIS C O      1 
ATOM   7700  C CB     . HIS C  1 287 ? -23.179  -15.950 57.919  1.00 39.84  ? 280 HIS C CB     1 
ATOM   7701  C CG     . HIS C  1 287 ? -23.362  -17.235 57.174  1.00 39.94  ? 280 HIS C CG     1 
ATOM   7702  N ND1    . HIS C  1 287 ? -23.744  -18.404 57.796  1.00 40.20  ? 280 HIS C ND1    1 
ATOM   7703  C CD2    . HIS C  1 287 ? -23.177  -17.546 55.869  1.00 39.28  ? 280 HIS C CD2    1 
ATOM   7704  C CE1    . HIS C  1 287 ? -23.804  -19.376 56.903  1.00 39.96  ? 280 HIS C CE1    1 
ATOM   7705  N NE2    . HIS C  1 287 ? -23.469  -18.880 55.725  1.00 42.09  ? 280 HIS C NE2    1 
ATOM   7706  N N      . VAL C  1 288 ? -20.382  -15.933 56.774  1.00 34.61  ? 281 VAL C N      1 
ATOM   7707  C CA     . VAL C  1 288 ? -19.410  -16.544 55.870  1.00 42.78  ? 281 VAL C CA     1 
ATOM   7708  C C      . VAL C  1 288 ? -18.130  -16.882 56.620  1.00 43.30  ? 281 VAL C C      1 
ATOM   7709  O O      . VAL C  1 288 ? -17.697  -18.039 56.660  1.00 47.69  ? 281 VAL C O      1 
ATOM   7710  C CB     . VAL C  1 288 ? -19.131  -15.615 54.676  1.00 41.57  ? 281 VAL C CB     1 
ATOM   7711  C CG1    . VAL C  1 288 ? -18.025  -16.187 53.804  1.00 34.27  ? 281 VAL C CG1    1 
ATOM   7712  C CG2    . VAL C  1 288 ? -20.397  -15.402 53.867  1.00 38.61  ? 281 VAL C CG2    1 
ATOM   7713  N N      . VAL C  1 289 ? -17.512  -15.873 57.236  1.00 43.29  ? 282 VAL C N      1 
ATOM   7714  C CA     . VAL C  1 289 ? -16.246  -16.092 57.931  1.00 43.90  ? 282 VAL C CA     1 
ATOM   7715  C C      . VAL C  1 289 ? -16.405  -17.134 59.031  1.00 44.50  ? 282 VAL C C      1 
ATOM   7716  O O      . VAL C  1 289 ? -15.513  -17.963 59.252  1.00 42.71  ? 282 VAL C O      1 
ATOM   7717  C CB     . VAL C  1 289 ? -15.696  -14.765 58.482  1.00 51.99  ? 282 VAL C CB     1 
ATOM   7718  C CG1    . VAL C  1 289 ? -14.490  -15.035 59.358  1.00 58.95  ? 282 VAL C CG1    1 
ATOM   7719  C CG2    . VAL C  1 289 ? -15.328  -13.832 57.338  1.00 54.13  ? 282 VAL C CG2    1 
ATOM   7720  N N      . GLY C  1 290 ? -17.538  -17.111 59.739  1.00 45.70  ? 283 GLY C N      1 
ATOM   7721  C CA     . GLY C  1 290 ? -17.756  -18.079 60.800  1.00 36.41  ? 283 GLY C CA     1 
ATOM   7722  C C      . GLY C  1 290 ? -18.094  -19.462 60.284  1.00 41.96  ? 283 GLY C C      1 
ATOM   7723  O O      . GLY C  1 290 ? -17.749  -20.466 60.915  1.00 42.65  ? 283 GLY C O      1 
ATOM   7724  N N      . GLU C  1 291 ? -18.768  -19.539 59.137  1.00 42.69  ? 284 GLU C N      1 
ATOM   7725  C CA     . GLU C  1 291 ? -19.056  -20.838 58.542  1.00 38.81  ? 284 GLU C CA     1 
ATOM   7726  C C      . GLU C  1 291 ? -17.778  -21.520 58.077  1.00 39.38  ? 284 GLU C C      1 
ATOM   7727  O O      . GLU C  1 291 ? -17.623  -22.736 58.238  1.00 41.54  ? 284 GLU C O      1 
ATOM   7728  C CB     . GLU C  1 291 ? -20.027  -20.677 57.373  1.00 42.74  ? 284 GLU C CB     1 
ATOM   7729  C CG     . GLU C  1 291 ? -20.479  -21.982 56.738  1.00 43.45  ? 284 GLU C CG     1 
ATOM   7730  C CD     . GLU C  1 291 ? -21.523  -22.711 57.555  1.00 44.89  ? 284 GLU C CD     1 
ATOM   7731  O OE1    . GLU C  1 291 ? -21.772  -22.312 58.712  1.00 45.85  ? 284 GLU C OE1    1 
ATOM   7732  O OE2    . GLU C  1 291 ? -22.111  -23.678 57.030  1.00 44.03  ? 284 GLU C OE2    1 
ATOM   7733  N N      . ILE C  1 292 ? -16.857  -20.754 57.486  1.00 39.98  ? 285 ILE C N      1 
ATOM   7734  C CA     . ILE C  1 292 ? -15.589  -21.317 57.029  1.00 41.21  ? 285 ILE C CA     1 
ATOM   7735  C C      . ILE C  1 292 ? -14.840  -21.966 58.186  1.00 40.65  ? 285 ILE C C      1 
ATOM   7736  O O      . ILE C  1 292 ? -14.278  -23.060 58.047  1.00 44.01  ? 285 ILE C O      1 
ATOM   7737  C CB     . ILE C  1 292 ? -14.744  -20.232 56.337  1.00 41.58  ? 285 ILE C CB     1 
ATOM   7738  C CG1    . ILE C  1 292 ? -15.435  -19.753 55.057  1.00 39.65  ? 285 ILE C CG1    1 
ATOM   7739  C CG2    . ILE C  1 292 ? -13.345  -20.750 56.041  1.00 35.19  ? 285 ILE C CG2    1 
ATOM   7740  C CD1    . ILE C  1 292 ? -14.677  -18.670 54.319  1.00 38.00  ? 285 ILE C CD1    1 
ATOM   7741  N N      . ARG C  1 293 ? -14.809  -21.300 59.343  1.00 45.43  ? 286 ARG C N      1 
ATOM   7742  C CA     . ARG C  1 293 ? -14.160  -21.885 60.512  1.00 47.81  ? 286 ARG C CA     1 
ATOM   7743  C C      . ARG C  1 293 ? -14.937  -23.085 61.037  1.00 47.22  ? 286 ARG C C      1 
ATOM   7744  O O      . ARG C  1 293 ? -14.339  -24.064 61.498  1.00 38.47  ? 286 ARG C O      1 
ATOM   7745  C CB     . ARG C  1 293 ? -14.002  -20.835 61.609  1.00 50.12  ? 286 ARG C CB     1 
ATOM   7746  C CG     . ARG C  1 293 ? -13.346  -21.359 62.873  1.00 55.15  ? 286 ARG C CG     1 
ATOM   7747  C CD     . ARG C  1 293 ? -12.939  -20.212 63.775  1.00 56.67  ? 286 ARG C CD     1 
ATOM   7748  N NE     . ARG C  1 293 ? -11.967  -19.344 63.119  1.00 58.97  ? 286 ARG C NE     1 
ATOM   7749  C CZ     . ARG C  1 293 ? -11.547  -18.183 63.608  1.00 60.21  ? 286 ARG C CZ     1 
ATOM   7750  N NH1    . ARG C  1 293 ? -12.016  -17.737 64.766  1.00 60.48  ? 286 ARG C NH1    1 
ATOM   7751  N NH2    . ARG C  1 293 ? -10.660  -17.462 62.936  1.00 59.46  ? 286 ARG C NH2    1 
ATOM   7752  N N      . ARG C  1 294 ? -16.270  -23.023 60.995  1.00 42.50  ? 287 ARG C N      1 
ATOM   7753  C CA     . ARG C  1 294 ? -17.069  -24.152 61.459  1.00 46.28  ? 287 ARG C CA     1 
ATOM   7754  C C      . ARG C  1 294 ? -16.847  -25.372 60.576  1.00 48.40  ? 287 ARG C C      1 
ATOM   7755  O O      . ARG C  1 294 ? -16.748  -26.502 61.071  1.00 52.77  ? 287 ARG C O      1 
ATOM   7756  C CB     . ARG C  1 294 ? -18.551  -23.774 61.489  1.00 46.45  ? 287 ARG C CB     1 
ATOM   7757  C CG     . ARG C  1 294 ? -18.983  -22.984 62.716  1.00 49.20  ? 287 ARG C CG     1 
ATOM   7758  C CD     . ARG C  1 294 ? -20.498  -22.819 62.770  1.00 50.32  ? 287 ARG C CD     1 
ATOM   7759  N NE     . ARG C  1 294 ? -21.000  -22.022 61.652  1.00 52.56  ? 287 ARG C NE     1 
ATOM   7760  C CZ     . ARG C  1 294 ? -21.098  -20.695 61.664  1.00 54.14  ? 287 ARG C CZ     1 
ATOM   7761  N NH1    . ARG C  1 294 ? -20.726  -20.014 62.740  1.00 53.17  ? 287 ARG C NH1    1 
ATOM   7762  N NH2    . ARG C  1 294 ? -21.564  -20.050 60.600  1.00 53.07  ? 287 ARG C NH2    1 
ATOM   7763  N N      . THR C  1 295 ? -16.767  -25.161 59.262  1.00 43.05  ? 288 THR C N      1 
ATOM   7764  C CA     . THR C  1 295 ? -16.553  -26.273 58.344  1.00 40.61  ? 288 THR C CA     1 
ATOM   7765  C C      . THR C  1 295 ? -15.212  -26.948 58.604  1.00 46.11  ? 288 THR C C      1 
ATOM   7766  O O      . THR C  1 295 ? -15.136  -28.177 58.722  1.00 46.57  ? 288 THR C O      1 
ATOM   7767  C CB     . THR C  1 295 ? -16.642  -25.782 56.900  1.00 36.64  ? 288 THR C CB     1 
ATOM   7768  O OG1    . THR C  1 295 ? -17.922  -25.176 56.679  1.00 36.51  ? 288 THR C OG1    1 
ATOM   7769  C CG2    . THR C  1 295 ? -16.460  -26.943 55.929  1.00 37.95  ? 288 THR C CG2    1 
ATOM   7770  N N      . ALA C  1 296 ? -14.139  -26.160 58.702  1.00 47.82  ? 289 ALA C N      1 
ATOM   7771  C CA     . ALA C  1 296 ? -12.836  -26.744 59.005  1.00 43.33  ? 289 ALA C CA     1 
ATOM   7772  C C      . ALA C  1 296 ? -12.863  -27.471 60.344  1.00 38.73  ? 289 ALA C C      1 
ATOM   7773  O O      . ALA C  1 296 ? -12.251  -28.536 60.495  1.00 39.53  ? 289 ALA C O      1 
ATOM   7774  C CB     . ALA C  1 296 ? -11.754  -25.664 58.988  1.00 43.04  ? 289 ALA C CB     1 
ATOM   7775  N N      . GLN C  1 297 ? -13.581  -26.917 61.325  1.00 39.24  ? 290 GLN C N      1 
ATOM   7776  C CA     . GLN C  1 297 ? -13.693  -27.565 62.628  1.00 51.05  ? 290 GLN C CA     1 
ATOM   7777  C C      . GLN C  1 297 ? -14.535  -28.833 62.544  1.00 50.82  ? 290 GLN C C      1 
ATOM   7778  O O      . GLN C  1 297 ? -14.232  -29.833 63.205  1.00 51.10  ? 290 GLN C O      1 
ATOM   7779  C CB     . GLN C  1 297 ? -14.288  -26.591 63.644  1.00 51.31  ? 290 GLN C CB     1 
ATOM   7780  C CG     . GLN C  1 297 ? -13.273  -25.647 64.257  1.00 48.65  ? 290 GLN C CG     1 
ATOM   7781  C CD     . GLN C  1 297 ? -13.922  -24.486 64.995  1.00 50.19  ? 290 GLN C CD     1 
ATOM   7782  O OE1    . GLN C  1 297 ? -15.146  -24.351 65.014  1.00 51.98  ? 290 GLN C OE1    1 
ATOM   7783  N NE2    . GLN C  1 297 ? -13.100  -23.635 65.596  1.00 49.80  ? 290 GLN C NE2    1 
ATOM   7784  N N      . ALA C  1 298 ? -15.596  -28.812 61.735  1.00 47.46  ? 291 ALA C N      1 
ATOM   7785  C CA     . ALA C  1 298 ? -16.458  -29.984 61.633  1.00 48.40  ? 291 ALA C CA     1 
ATOM   7786  C C      . ALA C  1 298 ? -15.747  -31.136 60.932  1.00 46.78  ? 291 ALA C C      1 
ATOM   7787  O O      . ALA C  1 298 ? -15.931  -32.300 61.304  1.00 43.38  ? 291 ALA C O      1 
ATOM   7788  C CB     . ALA C  1 298 ? -17.752  -29.626 60.905  1.00 48.09  ? 291 ALA C CB     1 
ATOM   7789  N N      . ALA C  1 299 ? -14.934  -30.837 59.915  1.00 47.79  ? 292 ALA C N      1 
ATOM   7790  C CA     . ALA C  1 299 ? -14.155  -31.887 59.265  1.00 45.99  ? 292 ALA C CA     1 
ATOM   7791  C C      . ALA C  1 299 ? -13.220  -32.565 60.257  1.00 48.50  ? 292 ALA C C      1 
ATOM   7792  O O      . ALA C  1 299 ? -13.094  -33.796 60.268  1.00 47.94  ? 292 ALA C O      1 
ATOM   7793  C CB     . ALA C  1 299 ? -13.366  -31.310 58.091  1.00 37.25  ? 292 ALA C CB     1 
ATOM   7794  N N      . ALA C  1 300 ? -12.551  -31.774 61.098  1.00 44.95  ? 293 ALA C N      1 
ATOM   7795  C CA     . ALA C  1 300 ? -11.684  -32.351 62.118  1.00 52.09  ? 293 ALA C CA     1 
ATOM   7796  C C      . ALA C  1 300 ? -12.491  -33.180 63.107  1.00 50.96  ? 293 ALA C C      1 
ATOM   7797  O O      . ALA C  1 300 ? -12.072  -34.275 63.502  1.00 50.55  ? 293 ALA C O      1 
ATOM   7798  C CB     . ALA C  1 300 ? -10.913  -31.243 62.838  1.00 50.51  ? 293 ALA C CB     1 
ATOM   7799  N N      . ALA C  1 301 ? -13.659  -32.677 63.514  1.00 44.21  ? 294 ALA C N      1 
ATOM   7800  C CA     . ALA C  1 301 ? -14.513  -33.434 64.423  1.00 45.65  ? 294 ALA C CA     1 
ATOM   7801  C C      . ALA C  1 301 ? -14.944  -34.761 63.808  1.00 50.63  ? 294 ALA C C      1 
ATOM   7802  O O      . ALA C  1 301 ? -14.992  -35.787 64.497  1.00 52.97  ? 294 ALA C O      1 
ATOM   7803  C CB     . ALA C  1 301 ? -15.734  -32.599 64.808  1.00 45.38  ? 294 ALA C CB     1 
ATOM   7804  N N      . LEU C  1 302 ? -15.264  -34.759 62.511  1.00 49.72  ? 295 LEU C N      1 
ATOM   7805  C CA     . LEU C  1 302 ? -15.735  -35.980 61.863  1.00 48.75  ? 295 LEU C CA     1 
ATOM   7806  C C      . LEU C  1 302 ? -14.622  -37.010 61.721  1.00 47.97  ? 295 LEU C C      1 
ATOM   7807  O O      . LEU C  1 302 ? -14.865  -38.214 61.861  1.00 49.57  ? 295 LEU C O      1 
ATOM   7808  C CB     . LEU C  1 302 ? -16.343  -35.651 60.500  1.00 51.89  ? 295 LEU C CB     1 
ATOM   7809  C CG     . LEU C  1 302 ? -17.170  -36.777 59.877  1.00 52.93  ? 295 LEU C CG     1 
ATOM   7810  C CD1    . LEU C  1 302 ? -18.426  -37.034 60.701  1.00 52.40  ? 295 LEU C CD1    1 
ATOM   7811  C CD2    . LEU C  1 302 ? -17.525  -36.448 58.434  1.00 51.06  ? 295 LEU C CD2    1 
ATOM   7812  N N      . ARG C  1 303 ? -13.395  -36.564 61.441  1.00 49.96  ? 296 ARG C N      1 
ATOM   7813  C CA     . ARG C  1 303 ? -12.296  -37.510 61.270  1.00 53.84  ? 296 ARG C CA     1 
ATOM   7814  C C      . ARG C  1 303 ? -12.082  -38.361 62.517  1.00 54.49  ? 296 ARG C C      1 
ATOM   7815  O O      . ARG C  1 303 ? -11.736  -39.544 62.408  1.00 52.98  ? 296 ARG C O      1 
ATOM   7816  C CB     . ARG C  1 303 ? -11.008  -36.769 60.908  1.00 58.28  ? 296 ARG C CB     1 
ATOM   7817  C CG     . ARG C  1 303 ? -11.015  -36.123 59.536  1.00 61.23  ? 296 ARG C CG     1 
ATOM   7818  C CD     . ARG C  1 303 ? -9.636   -35.586 59.180  1.00 66.57  ? 296 ARG C CD     1 
ATOM   7819  N NE     . ARG C  1 303 ? -9.671   -34.707 58.015  1.00 70.47  ? 296 ARG C NE     1 
ATOM   7820  C CZ     . ARG C  1 303 ? -9.764   -33.383 58.084  1.00 73.75  ? 296 ARG C CZ     1 
ATOM   7821  N NH1    . ARG C  1 303 ? -9.831   -32.784 59.266  1.00 73.99  ? 296 ARG C NH1    1 
ATOM   7822  N NH2    . ARG C  1 303 ? -9.791   -32.655 56.976  1.00 73.37  ? 296 ARG C NH2    1 
ATOM   7823  N N      . ARG C  1 304 ? -12.279  -37.786 63.702  1.00 57.94  ? 297 ARG C N      1 
ATOM   7824  C CA     . ARG C  1 304 ? -12.110  -38.508 64.958  1.00 61.99  ? 297 ARG C CA     1 
ATOM   7825  C C      . ARG C  1 304 ? -13.412  -39.096 65.492  1.00 60.76  ? 297 ARG C C      1 
ATOM   7826  O O      . ARG C  1 304 ? -13.415  -39.664 66.591  1.00 63.06  ? 297 ARG C O      1 
ATOM   7827  C CB     . ARG C  1 304 ? -11.475  -37.596 66.014  1.00 63.75  ? 297 ARG C CB     1 
ATOM   7828  C CG     . ARG C  1 304 ? -12.345  -36.432 66.447  1.00 65.58  ? 297 ARG C CG     1 
ATOM   7829  C CD     . ARG C  1 304 ? -11.663  -35.617 67.536  1.00 71.98  ? 297 ARG C CD     1 
ATOM   7830  N NE     . ARG C  1 304 ? -12.369  -34.371 67.825  1.00 76.79  ? 297 ARG C NE     1 
ATOM   7831  C CZ     . ARG C  1 304 ? -12.025  -33.186 67.328  1.00 77.92  ? 297 ARG C CZ     1 
ATOM   7832  N NH1    . ARG C  1 304 ? -10.975  -33.083 66.522  1.00 77.62  ? 297 ARG C NH1    1 
ATOM   7833  N NH2    . ARG C  1 304 ? -12.725  -32.102 67.645  1.00 76.60  ? 297 ARG C NH2    1 
ATOM   7834  N N      . GLY C  1 305 ? -14.511  -38.971 64.752  1.00 62.54  ? 298 GLY C N      1 
ATOM   7835  C CA     . GLY C  1 305 ? -15.768  -39.556 65.172  1.00 61.79  ? 298 GLY C CA     1 
ATOM   7836  C C      . GLY C  1 305 ? -16.509  -38.797 66.246  1.00 62.97  ? 298 GLY C C      1 
ATOM   7837  O O      . GLY C  1 305 ? -17.362  -39.381 66.921  1.00 64.60  ? 298 GLY C O      1 
ATOM   7838  N N      . ASP C  1 306 ? -16.210  -37.511 66.434  1.00 62.77  ? 299 ASP C N      1 
ATOM   7839  C CA     . ASP C  1 306 ? -16.872  -36.694 67.451  1.00 64.39  ? 299 ASP C CA     1 
ATOM   7840  C C      . ASP C  1 306 ? -18.203  -36.206 66.885  1.00 60.49  ? 299 ASP C C      1 
ATOM   7841  O O      . ASP C  1 306 ? -18.365  -35.055 66.472  1.00 57.05  ? 299 ASP C O      1 
ATOM   7842  C CB     . ASP C  1 306 ? -15.978  -35.535 67.870  1.00 66.11  ? 299 ASP C CB     1 
ATOM   7843  C CG     . ASP C  1 306 ? -16.461  -34.847 69.132  1.00 70.47  ? 299 ASP C CG     1 
ATOM   7844  O OD1    . ASP C  1 306 ? -17.627  -35.060 69.527  1.00 72.28  ? 299 ASP C OD1    1 
ATOM   7845  O OD2    . ASP C  1 306 ? -15.672  -34.080 69.722  1.00 73.29  ? 299 ASP C OD2    1 
ATOM   7846  N N      . TYR C  1 307 ? -19.179  -37.114 66.873  1.00 63.35  ? 300 TYR C N      1 
ATOM   7847  C CA     . TYR C  1 307 ? -20.477  -36.799 66.286  1.00 64.10  ? 300 TYR C CA     1 
ATOM   7848  C C      . TYR C  1 307 ? -21.222  -35.733 67.080  1.00 67.38  ? 300 TYR C C      1 
ATOM   7849  O O      . TYR C  1 307 ? -21.949  -34.923 66.493  1.00 68.23  ? 300 TYR C O      1 
ATOM   7850  C CB     . TYR C  1 307 ? -21.313  -38.071 66.176  1.00 62.60  ? 300 TYR C CB     1 
ATOM   7851  C CG     . TYR C  1 307 ? -20.649  -39.150 65.351  1.00 59.24  ? 300 TYR C CG     1 
ATOM   7852  C CD1    . TYR C  1 307 ? -19.821  -38.824 64.283  1.00 54.62  ? 300 TYR C CD1    1 
ATOM   7853  C CD2    . TYR C  1 307 ? -20.837  -40.494 65.647  1.00 58.54  ? 300 TYR C CD2    1 
ATOM   7854  C CE1    . TYR C  1 307 ? -19.208  -39.806 63.527  1.00 51.16  ? 300 TYR C CE1    1 
ATOM   7855  C CE2    . TYR C  1 307 ? -20.227  -41.485 64.896  1.00 55.20  ? 300 TYR C CE2    1 
ATOM   7856  C CZ     . TYR C  1 307 ? -19.412  -41.132 63.838  1.00 51.60  ? 300 TYR C CZ     1 
ATOM   7857  O OH     . TYR C  1 307 ? -18.797  -42.104 63.085  1.00 50.17  ? 300 TYR C OH     1 
ATOM   7858  N N      . ARG C  1 308 ? -21.062  -35.711 68.405  1.00 71.25  ? 301 ARG C N      1 
ATOM   7859  C CA     . ARG C  1 308 ? -21.762  -34.709 69.202  1.00 71.17  ? 301 ARG C CA     1 
ATOM   7860  C C      . ARG C  1 308 ? -21.248  -33.307 68.898  1.00 67.27  ? 301 ARG C C      1 
ATOM   7861  O O      . ARG C  1 308 ? -22.035  -32.357 68.815  1.00 67.34  ? 301 ARG C O      1 
ATOM   7862  C CB     . ARG C  1 308 ? -21.627  -35.025 70.692  1.00 79.38  ? 301 ARG C CB     1 
ATOM   7863  C CG     . ARG C  1 308 ? -22.092  -36.424 71.067  1.00 86.70  ? 301 ARG C CG     1 
ATOM   7864  C CD     . ARG C  1 308 ? -22.495  -36.512 72.530  1.00 92.86  ? 301 ARG C CD     1 
ATOM   7865  N NE     . ARG C  1 308 ? -21.420  -36.100 73.428  1.00 98.03  ? 301 ARG C NE     1 
ATOM   7866  C CZ     . ARG C  1 308 ? -21.310  -34.883 73.954  1.00 101.59 ? 301 ARG C CZ     1 
ATOM   7867  N NH1    . ARG C  1 308 ? -22.213  -33.954 73.672  1.00 101.85 ? 301 ARG C NH1    1 
ATOM   7868  N NH2    . ARG C  1 308 ? -20.299  -34.597 74.763  1.00 103.40 ? 301 ARG C NH2    1 
ATOM   7869  N N      . ALA C  1 309 ? -19.933  -33.157 68.725  1.00 63.78  ? 302 ALA C N      1 
ATOM   7870  C CA     . ALA C  1 309 ? -19.386  -31.858 68.349  1.00 60.76  ? 302 ALA C CA     1 
ATOM   7871  C C      . ALA C  1 309 ? -19.824  -31.466 66.945  1.00 58.02  ? 302 ALA C C      1 
ATOM   7872  O O      . ALA C  1 309 ? -20.185  -30.310 66.698  1.00 57.24  ? 302 ALA C O      1 
ATOM   7873  C CB     . ALA C  1 309 ? -17.861  -31.879 68.449  1.00 56.35  ? 302 ALA C CB     1 
ATOM   7874  N N      . PHE C  1 310 ? -19.793  -32.418 66.012  1.00 56.31  ? 303 PHE C N      1 
ATOM   7875  C CA     . PHE C  1 310 ? -20.254  -32.144 64.656  1.00 53.31  ? 303 PHE C CA     1 
ATOM   7876  C C      . PHE C  1 310 ? -21.725  -31.733 64.652  1.00 57.03  ? 303 PHE C C      1 
ATOM   7877  O O      . PHE C  1 310 ? -22.103  -30.772 63.972  1.00 60.87  ? 303 PHE C O      1 
ATOM   7878  C CB     . PHE C  1 310 ? -19.987  -33.372 63.776  1.00 49.61  ? 303 PHE C CB     1 
ATOM   7879  C CG     . PHE C  1 310 ? -20.112  -33.119 62.291  1.00 45.49  ? 303 PHE C CG     1 
ATOM   7880  C CD1    . PHE C  1 310 ? -21.191  -32.430 61.770  1.00 47.92  ? 303 PHE C CD1    1 
ATOM   7881  C CD2    . PHE C  1 310 ? -19.120  -33.550 61.420  1.00 44.45  ? 303 PHE C CD2    1 
ATOM   7882  C CE1    . PHE C  1 310 ? -21.302  -32.202 60.414  1.00 45.87  ? 303 PHE C CE1    1 
ATOM   7883  C CE2    . PHE C  1 310 ? -19.220  -33.314 60.062  1.00 42.03  ? 303 PHE C CE2    1 
ATOM   7884  C CZ     . PHE C  1 310 ? -20.313  -32.639 59.559  1.00 43.36  ? 303 PHE C CZ     1 
ATOM   7885  N N      . GLY C  1 311 ? -22.566  -32.433 65.418  1.00 61.68  ? 304 GLY C N      1 
ATOM   7886  C CA     . GLY C  1 311 ? -23.962  -32.033 65.507  1.00 61.25  ? 304 GLY C CA     1 
ATOM   7887  C C      . GLY C  1 311 ? -24.131  -30.619 66.029  1.00 64.55  ? 304 GLY C C      1 
ATOM   7888  O O      . GLY C  1 311 ? -24.973  -29.862 65.542  1.00 70.15  ? 304 GLY C O      1 
ATOM   7889  N N      . ARG C  1 312 ? -23.331  -30.244 67.028  1.00 60.27  ? 305 ARG C N      1 
ATOM   7890  C CA     . ARG C  1 312 ? -23.407  -28.891 67.569  1.00 58.75  ? 305 ARG C CA     1 
ATOM   7891  C C      . ARG C  1 312 ? -22.944  -27.853 66.551  1.00 52.49  ? 305 ARG C C      1 
ATOM   7892  O O      . ARG C  1 312 ? -23.551  -26.783 66.430  1.00 47.56  ? 305 ARG C O      1 
ATOM   7893  C CB     . ARG C  1 312 ? -22.623  -28.815 68.882  1.00 57.12  ? 305 ARG C CB     1 
ATOM   7894  C CG     . ARG C  1 312 ? -23.440  -29.341 70.060  1.00 59.29  ? 305 ARG C CG     1 
ATOM   7895  C CD     . ARG C  1 312 ? -22.718  -29.311 71.402  1.00 65.39  ? 305 ARG C CD     1 
ATOM   7896  N NE     . ARG C  1 312 ? -21.893  -30.498 71.619  1.00 70.10  ? 305 ARG C NE     1 
ATOM   7897  C CZ     . ARG C  1 312 ? -20.567  -30.549 71.545  1.00 73.03  ? 305 ARG C CZ     1 
ATOM   7898  N NH1    . ARG C  1 312 ? -19.854  -29.469 71.250  1.00 73.46  ? 305 ARG C NH1    1 
ATOM   7899  N NH2    . ARG C  1 312 ? -19.951  -31.702 71.772  1.00 74.44  ? 305 ARG C NH2    1 
ATOM   7900  N N      . LEU C  1 313 ? -21.873  -28.143 65.809  1.00 50.71  ? 306 LEU C N      1 
ATOM   7901  C CA     . LEU C  1 313 ? -21.461  -27.226 64.751  1.00 49.28  ? 306 LEU C CA     1 
ATOM   7902  C C      . LEU C  1 313 ? -22.522  -27.118 63.662  1.00 47.30  ? 306 LEU C C      1 
ATOM   7903  O O      . LEU C  1 313 ? -22.688  -26.050 63.063  1.00 47.62  ? 306 LEU C O      1 
ATOM   7904  C CB     . LEU C  1 313 ? -20.124  -27.666 64.156  1.00 48.80  ? 306 LEU C CB     1 
ATOM   7905  C CG     . LEU C  1 313 ? -18.952  -27.656 65.135  1.00 48.37  ? 306 LEU C CG     1 
ATOM   7906  C CD1    . LEU C  1 313 ? -17.780  -28.440 64.567  1.00 52.73  ? 306 LEU C CD1    1 
ATOM   7907  C CD2    . LEU C  1 313 ? -18.545  -26.229 65.457  1.00 42.91  ? 306 LEU C CD2    1 
ATOM   7908  N N      . MET C  1 314 ? -23.241  -28.209 63.384  1.00 46.16  ? 307 MET C N      1 
ATOM   7909  C CA     . MET C  1 314 ? -24.327  -28.150 62.410  1.00 45.32  ? 307 MET C CA     1 
ATOM   7910  C C      . MET C  1 314 ? -25.420  -27.191 62.862  1.00 46.43  ? 307 MET C C      1 
ATOM   7911  O O      . MET C  1 314 ? -25.986  -26.451 62.048  1.00 40.89  ? 307 MET C O      1 
ATOM   7912  C CB     . MET C  1 314 ? -24.906  -29.548 62.184  1.00 48.81  ? 307 MET C CB     1 
ATOM   7913  C CG     . MET C  1 314 ? -23.968  -30.512 61.475  1.00 48.59  ? 307 MET C CG     1 
ATOM   7914  S SD     . MET C  1 314 ? -24.617  -32.195 61.385  1.00 49.83  ? 307 MET C SD     1 
ATOM   7915  C CE     . MET C  1 314 ? -26.115  -31.950 60.436  1.00 52.86  ? 307 MET C CE     1 
ATOM   7916  N N      . VAL C  1 315 ? -25.736  -27.198 64.159  1.00 48.47  ? 308 VAL C N      1 
ATOM   7917  C CA     . VAL C  1 315 ? -26.800  -26.346 64.680  1.00 49.18  ? 308 VAL C CA     1 
ATOM   7918  C C      . VAL C  1 315 ? -26.355  -24.888 64.701  1.00 51.83  ? 308 VAL C C      1 
ATOM   7919  O O      . VAL C  1 315 ? -27.156  -23.977 64.455  1.00 51.83  ? 308 VAL C O      1 
ATOM   7920  C CB     . VAL C  1 315 ? -27.232  -26.832 66.076  1.00 47.34  ? 308 VAL C CB     1 
ATOM   7921  C CG1    . VAL C  1 315 ? -28.383  -25.988 66.606  1.00 56.83  ? 308 VAL C CG1    1 
ATOM   7922  C CG2    . VAL C  1 315 ? -27.616  -28.307 66.032  1.00 48.32  ? 308 VAL C CG2    1 
ATOM   7923  N N      . GLU C  1 316 ? -25.075  -24.640 64.994  1.00 55.47  ? 309 GLU C N      1 
ATOM   7924  C CA     . GLU C  1 316 ? -24.554  -23.281 64.893  1.00 56.62  ? 309 GLU C CA     1 
ATOM   7925  C C      . GLU C  1 316 ? -24.686  -22.753 63.471  1.00 52.61  ? 309 GLU C C      1 
ATOM   7926  O O      . GLU C  1 316 ? -25.097  -21.606 63.263  1.00 52.41  ? 309 GLU C O      1 
ATOM   7927  C CB     . GLU C  1 316 ? -23.092  -23.237 65.340  1.00 64.10  ? 309 GLU C CB     1 
ATOM   7928  C CG     . GLU C  1 316 ? -22.862  -23.585 66.798  1.00 72.04  ? 309 GLU C CG     1 
ATOM   7929  C CD     . GLU C  1 316 ? -21.386  -23.672 67.151  1.00 77.64  ? 309 GLU C CD     1 
ATOM   7930  O OE1    . GLU C  1 316 ? -20.571  -22.991 66.491  1.00 78.59  ? 309 GLU C OE1    1 
ATOM   7931  O OE2    . GLU C  1 316 ? -21.042  -24.425 68.088  1.00 81.01  ? 309 GLU C OE2    1 
ATOM   7932  N N      . SER C  1 317 ? -24.339  -23.578 62.480  1.00 49.17  ? 310 SER C N      1 
ATOM   7933  C CA     . SER C  1 317 ? -24.477  -23.171 61.084  1.00 46.84  ? 310 SER C CA     1 
ATOM   7934  C C      . SER C  1 317 ? -25.914  -22.781 60.752  1.00 47.04  ? 310 SER C C      1 
ATOM   7935  O O      . SER C  1 317 ? -26.149  -21.773 60.075  1.00 44.11  ? 310 SER C O      1 
ATOM   7936  C CB     . SER C  1 317 ? -23.997  -24.292 60.163  1.00 44.22  ? 310 SER C CB     1 
ATOM   7937  O OG     . SER C  1 317 ? -24.207  -23.956 58.803  1.00 43.10  ? 310 SER C OG     1 
ATOM   7938  N N      . HIS C  1 318 ? -26.891  -23.568 61.216  1.00 47.53  ? 311 HIS C N      1 
ATOM   7939  C CA     . HIS C  1 318 ? -28.286  -23.264 60.906  1.00 49.14  ? 311 HIS C CA     1 
ATOM   7940  C C      . HIS C  1 318 ? -28.706  -21.923 61.493  1.00 53.39  ? 311 HIS C C      1 
ATOM   7941  O O      . HIS C  1 318 ? -29.295  -21.088 60.796  1.00 54.57  ? 311 HIS C O      1 
ATOM   7942  C CB     . HIS C  1 318 ? -29.207  -24.375 61.411  1.00 49.70  ? 311 HIS C CB     1 
ATOM   7943  C CG     . HIS C  1 318 ? -30.652  -24.143 61.095  1.00 55.41  ? 311 HIS C CG     1 
ATOM   7944  N ND1    . HIS C  1 318 ? -31.168  -24.262 59.822  1.00 56.37  ? 311 HIS C ND1    1 
ATOM   7945  C CD2    . HIS C  1 318 ? -31.688  -23.775 61.887  1.00 57.54  ? 311 HIS C CD2    1 
ATOM   7946  C CE1    . HIS C  1 318 ? -32.461  -23.991 59.846  1.00 56.04  ? 311 HIS C CE1    1 
ATOM   7947  N NE2    . HIS C  1 318 ? -32.801  -23.691 61.086  1.00 58.00  ? 311 HIS C NE2    1 
ATOM   7948  N N      . ARG C  1 319 ? -28.427  -21.700 62.780  1.00 53.10  ? 312 ARG C N      1 
ATOM   7949  C CA     . ARG C  1 319 ? -28.729  -20.400 63.369  1.00 52.45  ? 312 ARG C CA     1 
ATOM   7950  C C      . ARG C  1 319 ? -28.080  -19.285 62.564  1.00 48.54  ? 312 ARG C C      1 
ATOM   7951  O O      . ARG C  1 319 ? -28.713  -18.264 62.276  1.00 49.45  ? 312 ARG C O      1 
ATOM   7952  C CB     . ARG C  1 319 ? -28.278  -20.349 64.829  1.00 60.37  ? 312 ARG C CB     1 
ATOM   7953  C CG     . ARG C  1 319 ? -29.243  -21.004 65.794  1.00 68.55  ? 312 ARG C CG     1 
ATOM   7954  C CD     . ARG C  1 319 ? -28.865  -20.709 67.233  1.00 73.92  ? 312 ARG C CD     1 
ATOM   7955  N NE     . ARG C  1 319 ? -28.603  -21.937 67.975  1.00 78.13  ? 312 ARG C NE     1 
ATOM   7956  C CZ     . ARG C  1 319 ? -29.551  -22.763 68.405  1.00 83.59  ? 312 ARG C CZ     1 
ATOM   7957  N NH1    . ARG C  1 319 ? -29.223  -23.861 69.073  1.00 84.65  ? 312 ARG C NH1    1 
ATOM   7958  N NH2    . ARG C  1 319 ? -30.827  -22.496 68.159  1.00 87.10  ? 312 ARG C NH2    1 
ATOM   7959  N N      . SER C  1 320 ? -26.811  -19.467 62.192  1.00 43.75  ? 313 SER C N      1 
ATOM   7960  C CA     . SER C  1 320 ? -26.129  -18.471 61.373  1.00 43.42  ? 313 SER C CA     1 
ATOM   7961  C C      . SER C  1 320 ? -26.872  -18.254 60.064  1.00 47.99  ? 313 SER C C      1 
ATOM   7962  O O      . SER C  1 320 ? -27.079  -17.116 59.631  1.00 48.05  ? 313 SER C O      1 
ATOM   7963  C CB     . SER C  1 320 ? -24.687  -18.907 61.108  1.00 37.88  ? 313 SER C CB     1 
ATOM   7964  O OG     . SER C  1 320 ? -23.990  -17.955 60.318  1.00 50.66  ? 313 SER C OG     1 
ATOM   7965  N N      . LEU C  1 321 ? -27.266  -19.346 59.409  1.00 49.82  ? 314 LEU C N      1 
ATOM   7966  C CA     . LEU C  1 321 ? -28.000  -19.234 58.157  1.00 46.66  ? 314 LEU C CA     1 
ATOM   7967  C C      . LEU C  1 321 ? -29.377  -18.614 58.364  1.00 50.89  ? 314 LEU C C      1 
ATOM   7968  O O      . LEU C  1 321 ? -29.904  -17.965 57.454  1.00 50.57  ? 314 LEU C O      1 
ATOM   7969  C CB     . LEU C  1 321 ? -28.130  -20.614 57.512  1.00 38.08  ? 314 LEU C CB     1 
ATOM   7970  C CG     . LEU C  1 321 ? -26.859  -21.225 56.919  1.00 51.02  ? 314 LEU C CG     1 
ATOM   7971  C CD1    . LEU C  1 321 ? -27.047  -22.716 56.701  1.00 48.97  ? 314 LEU C CD1    1 
ATOM   7972  C CD2    . LEU C  1 321 ? -26.499  -20.535 55.622  1.00 36.09  ? 314 LEU C CD2    1 
ATOM   7973  N N      . ARG C  1 322 ? -29.971  -18.797 59.547  1.00 50.62  ? 315 ARG C N      1 
ATOM   7974  C CA     . ARG C  1 322 ? -31.323  -18.305 59.799  1.00 50.21  ? 315 ARG C CA     1 
ATOM   7975  C C      . ARG C  1 322 ? -31.338  -16.845 60.228  1.00 52.80  ? 315 ARG C C      1 
ATOM   7976  O O      . ARG C  1 322 ? -32.226  -16.085 59.824  1.00 53.76  ? 315 ARG C O      1 
ATOM   7977  C CB     . ARG C  1 322 ? -31.989  -19.162 60.877  1.00 44.14  ? 315 ARG C CB     1 
ATOM   7978  C CG     . ARG C  1 322 ? -33.410  -18.773 61.220  1.00 53.26  ? 315 ARG C CG     1 
ATOM   7979  C CD     . ARG C  1 322 ? -33.859  -19.514 62.463  1.00 53.49  ? 315 ARG C CD     1 
ATOM   7980  N NE     . ARG C  1 322 ? -33.100  -19.091 63.638  1.00 52.04  ? 315 ARG C NE     1 
ATOM   7981  C CZ     . ARG C  1 322 ? -32.887  -19.846 64.712  1.00 54.57  ? 315 ARG C CZ     1 
ATOM   7982  N NH1    . ARG C  1 322 ? -33.460  -21.039 64.816  1.00 56.09  ? 315 ARG C NH1    1 
ATOM   7983  N NH2    . ARG C  1 322 ? -32.170  -19.369 65.723  1.00 54.21  ? 315 ARG C NH2    1 
ATOM   7984  N N      . ASP C  1 323 ? -30.379  -16.441 61.058  1.00 54.88  ? 316 ASP C N      1 
ATOM   7985  C CA     . ASP C  1 323 ? -30.368  -15.114 61.661  1.00 56.33  ? 316 ASP C CA     1 
ATOM   7986  C C      . ASP C  1 323 ? -29.421  -14.147 60.960  1.00 54.31  ? 316 ASP C C      1 
ATOM   7987  O O      . ASP C  1 323 ? -29.811  -13.017 60.654  1.00 56.44  ? 316 ASP C O      1 
ATOM   7988  C CB     . ASP C  1 323 ? -30.022  -15.219 63.151  1.00 58.92  ? 316 ASP C CB     1 
ATOM   7989  C CG     . ASP C  1 323 ? -31.034  -16.045 63.926  1.00 62.50  ? 316 ASP C CG     1 
ATOM   7990  O OD1    . ASP C  1 323 ? -32.179  -16.185 63.445  1.00 64.89  ? 316 ASP C OD1    1 
ATOM   7991  O OD2    . ASP C  1 323 ? -30.694  -16.546 65.019  1.00 62.56  ? 316 ASP C OD2    1 
ATOM   7992  N N      . ASP C  1 324 ? -28.182  -14.564 60.698  1.00 55.26  ? 317 ASP C N      1 
ATOM   7993  C CA     . ASP C  1 324 ? -27.215  -13.652 60.097  1.00 53.16  ? 317 ASP C CA     1 
ATOM   7994  C C      . ASP C  1 324 ? -27.364  -13.600 58.581  1.00 51.07  ? 317 ASP C C      1 
ATOM   7995  O O      . ASP C  1 324 ? -27.385  -12.515 57.990  1.00 53.14  ? 317 ASP C O      1 
ATOM   7996  C CB     . ASP C  1 324 ? -25.792  -14.064 60.483  1.00 50.03  ? 317 ASP C CB     1 
ATOM   7997  C CG     . ASP C  1 324 ? -25.418  -13.624 61.886  1.00 52.30  ? 317 ASP C CG     1 
ATOM   7998  O OD1    . ASP C  1 324 ? -26.187  -12.843 62.484  1.00 54.52  ? 317 ASP C OD1    1 
ATOM   7999  O OD2    . ASP C  1 324 ? -24.359  -14.054 62.392  1.00 50.50  ? 317 ASP C OD2    1 
ATOM   8000  N N      . TYR C  1 325 ? -27.467  -14.759 57.932  1.00 47.10  ? 318 TYR C N      1 
ATOM   8001  C CA     . TYR C  1 325 ? -27.596  -14.796 56.482  1.00 45.17  ? 318 TYR C CA     1 
ATOM   8002  C C      . TYR C  1 325 ? -29.045  -14.773 56.006  1.00 47.24  ? 318 TYR C C      1 
ATOM   8003  O O      . TYR C  1 325 ? -29.298  -14.376 54.863  1.00 43.25  ? 318 TYR C O      1 
ATOM   8004  C CB     . TYR C  1 325 ? -26.892  -16.038 55.925  1.00 42.27  ? 318 TYR C CB     1 
ATOM   8005  C CG     . TYR C  1 325 ? -26.086  -15.770 54.674  1.00 40.91  ? 318 TYR C CG     1 
ATOM   8006  C CD1    . TYR C  1 325 ? -24.933  -14.999 54.724  1.00 40.14  ? 318 TYR C CD1    1 
ATOM   8007  C CD2    . TYR C  1 325 ? -26.470  -16.294 53.447  1.00 39.85  ? 318 TYR C CD2    1 
ATOM   8008  C CE1    . TYR C  1 325 ? -24.188  -14.751 53.587  1.00 39.10  ? 318 TYR C CE1    1 
ATOM   8009  C CE2    . TYR C  1 325 ? -25.730  -16.051 52.303  1.00 40.60  ? 318 TYR C CE2    1 
ATOM   8010  C CZ     . TYR C  1 325 ? -24.592  -15.278 52.379  1.00 40.12  ? 318 TYR C CZ     1 
ATOM   8011  O OH     . TYR C  1 325 ? -23.859  -15.038 51.240  1.00 37.92  ? 318 TYR C OH     1 
ATOM   8012  N N      . GLU C  1 326 ? -29.996  -15.167 56.859  1.00 51.77  ? 319 GLU C N      1 
ATOM   8013  C CA     . GLU C  1 326 ? -31.415  -15.221 56.509  1.00 55.55  ? 319 GLU C CA     1 
ATOM   8014  C C      . GLU C  1 326 ? -31.636  -15.821 55.124  1.00 51.52  ? 319 GLU C C      1 
ATOM   8015  O O      . GLU C  1 326 ? -32.042  -15.112 54.196  1.00 52.63  ? 319 GLU C O      1 
ATOM   8016  C CB     . GLU C  1 326 ? -32.069  -13.832 56.600  1.00 67.21  ? 319 GLU C CB     1 
ATOM   8017  C CG     . GLU C  1 326 ? -31.169  -12.614 56.333  1.00 73.15  ? 319 GLU C CG     1 
ATOM   8018  C CD     . GLU C  1 326 ? -31.824  -11.305 56.774  1.00 79.44  ? 319 GLU C CD     1 
ATOM   8019  O OE1    . GLU C  1 326 ? -31.767  -10.313 56.014  1.00 81.93  ? 319 GLU C OE1    1 
ATOM   8020  O OE2    . GLU C  1 326 ? -32.407  -11.273 57.880  1.00 81.39  ? 319 GLU C OE2    1 
ATOM   8021  N N      . VAL C  1 327 ? -31.366  -17.118 54.969  1.00 47.06  ? 320 VAL C N      1 
ATOM   8022  C CA     . VAL C  1 327 ? -31.641  -17.794 53.705  1.00 47.15  ? 320 VAL C CA     1 
ATOM   8023  C C      . VAL C  1 327 ? -32.469  -19.046 53.967  1.00 48.24  ? 320 VAL C C      1 
ATOM   8024  O O      . VAL C  1 327 ? -32.707  -19.853 53.060  1.00 52.78  ? 320 VAL C O      1 
ATOM   8025  C CB     . VAL C  1 327 ? -30.331  -18.124 52.967  1.00 43.32  ? 320 VAL C CB     1 
ATOM   8026  C CG1    . VAL C  1 327 ? -29.636  -16.838 52.545  1.00 42.98  ? 320 VAL C CG1    1 
ATOM   8027  C CG2    . VAL C  1 327 ? -29.428  -18.924 53.876  1.00 41.74  ? 320 VAL C CG2    1 
ATOM   8028  N N      . SER C  1 328 ? -32.895  -19.228 55.212  1.00 46.17  ? 321 SER C N      1 
ATOM   8029  C CA     . SER C  1 328 ? -33.788  -20.321 55.556  1.00 51.99  ? 321 SER C CA     1 
ATOM   8030  C C      . SER C  1 328 ? -35.224  -19.806 55.475  1.00 57.07  ? 321 SER C C      1 
ATOM   8031  O O      . SER C  1 328 ? -35.486  -18.710 54.970  1.00 58.77  ? 321 SER C O      1 
ATOM   8032  C CB     . SER C  1 328 ? -33.433  -20.905 56.925  1.00 52.01  ? 321 SER C CB     1 
ATOM   8033  O OG     . SER C  1 328 ? -33.797  -20.044 57.991  1.00 55.87  ? 321 SER C OG     1 
ATOM   8034  N N      . CYS C  1 329 ? -36.169  -20.587 55.982  1.00 59.01  ? 322 CYS C N      1 
ATOM   8035  C CA     . CYS C  1 329 ? -37.564  -20.171 55.991  1.00 64.41  ? 322 CYS C CA     1 
ATOM   8036  C C      . CYS C  1 329 ? -38.281  -20.933 57.095  1.00 65.63  ? 322 CYS C C      1 
ATOM   8037  O O      . CYS C  1 329 ? -37.748  -21.917 57.632  1.00 61.99  ? 322 CYS C O      1 
ATOM   8038  C CB     . CYS C  1 329 ? -38.230  -20.418 54.627  1.00 66.16  ? 322 CYS C CB     1 
ATOM   8039  S SG     . CYS C  1 329 ? -38.435  -22.161 54.184  1.00 66.33  ? 322 CYS C SG     1 
ATOM   8040  N N      . PRO C  1 330 ? -39.500  -20.512 57.449  1.00 69.56  ? 323 PRO C N      1 
ATOM   8041  C CA     . PRO C  1 330 ? -40.216  -21.180 58.550  1.00 70.39  ? 323 PRO C CA     1 
ATOM   8042  C C      . PRO C  1 330 ? -40.358  -22.677 58.360  1.00 69.47  ? 323 PRO C C      1 
ATOM   8043  O O      . PRO C  1 330 ? -40.217  -23.433 59.330  1.00 70.28  ? 323 PRO C O      1 
ATOM   8044  C CB     . PRO C  1 330 ? -41.577  -20.470 58.558  1.00 74.82  ? 323 PRO C CB     1 
ATOM   8045  C CG     . PRO C  1 330 ? -41.288  -19.120 57.994  1.00 76.14  ? 323 PRO C CG     1 
ATOM   8046  C CD     . PRO C  1 330 ? -40.238  -19.344 56.938  1.00 71.88  ? 323 PRO C CD     1 
ATOM   8047  N N      . GLU C  1 331 ? -40.645  -23.133 57.140  1.00 66.83  ? 324 GLU C N      1 
ATOM   8048  C CA     . GLU C  1 331 ? -40.770  -24.568 56.910  1.00 67.40  ? 324 GLU C CA     1 
ATOM   8049  C C      . GLU C  1 331 ? -39.484  -25.287 57.299  1.00 63.28  ? 324 GLU C C      1 
ATOM   8050  O O      . GLU C  1 331 ? -39.513  -26.296 58.014  1.00 61.68  ? 324 GLU C O      1 
ATOM   8051  C CB     . GLU C  1 331 ? -41.121  -24.843 55.446  1.00 69.07  ? 324 GLU C CB     1 
ATOM   8052  C CG     . GLU C  1 331 ? -42.562  -24.528 55.058  1.00 75.11  ? 324 GLU C CG     1 
ATOM   8053  C CD     . GLU C  1 331 ? -42.770  -23.078 54.656  1.00 79.83  ? 324 GLU C CD     1 
ATOM   8054  O OE1    . GLU C  1 331 ? -41.791  -22.301 54.675  1.00 80.13  ? 324 GLU C OE1    1 
ATOM   8055  O OE2    . GLU C  1 331 ? -43.917  -22.718 54.314  1.00 82.47  ? 324 GLU C OE2    1 
ATOM   8056  N N      . LEU C  1 332 ? -38.341  -24.784 56.829  1.00 61.92  ? 325 LEU C N      1 
ATOM   8057  C CA     . LEU C  1 332 ? -37.060  -25.376 57.203  1.00 59.12  ? 325 LEU C CA     1 
ATOM   8058  C C      . LEU C  1 332 ? -36.829  -25.298 58.709  1.00 63.24  ? 325 LEU C C      1 
ATOM   8059  O O      . LEU C  1 332 ? -36.378  -26.269 59.328  1.00 62.95  ? 325 LEU C O      1 
ATOM   8060  C CB     . LEU C  1 332 ? -35.924  -24.685 56.451  1.00 52.49  ? 325 LEU C CB     1 
ATOM   8061  C CG     . LEU C  1 332 ? -35.792  -24.991 54.958  1.00 50.75  ? 325 LEU C CG     1 
ATOM   8062  C CD1    . LEU C  1 332 ? -34.652  -24.190 54.352  1.00 48.35  ? 325 LEU C CD1    1 
ATOM   8063  C CD2    . LEU C  1 332 ? -35.580  -26.479 54.731  1.00 49.57  ? 325 LEU C CD2    1 
ATOM   8064  N N      . ASP C  1 333 ? -37.136  -24.150 59.316  1.00 68.00  ? 326 ASP C N      1 
ATOM   8065  C CA     . ASP C  1 333 ? -36.883  -23.976 60.743  1.00 71.21  ? 326 ASP C CA     1 
ATOM   8066  C C      . ASP C  1 333 ? -37.682  -24.967 61.583  1.00 74.13  ? 326 ASP C C      1 
ATOM   8067  O O      . ASP C  1 333 ? -37.173  -25.499 62.576  1.00 73.04  ? 326 ASP C O      1 
ATOM   8068  C CB     . ASP C  1 333 ? -37.195  -22.538 61.156  1.00 76.14  ? 326 ASP C CB     1 
ATOM   8069  C CG     . ASP C  1 333 ? -36.284  -21.527 60.480  1.00 77.43  ? 326 ASP C CG     1 
ATOM   8070  O OD1    . ASP C  1 333 ? -35.112  -21.870 60.213  1.00 75.75  ? 326 ASP C OD1    1 
ATOM   8071  O OD2    . ASP C  1 333 ? -36.739  -20.395 60.214  1.00 78.86  ? 326 ASP C OD2    1 
ATOM   8072  N N      . GLN C  1 334 ? -38.935  -25.230 61.208  1.00 74.83  ? 327 GLN C N      1 
ATOM   8073  C CA     . GLN C  1 334 ? -39.725  -26.190 61.973  1.00 76.58  ? 327 GLN C CA     1 
ATOM   8074  C C      . GLN C  1 334 ? -39.162  -27.603 61.854  1.00 73.83  ? 327 GLN C C      1 
ATOM   8075  O O      . GLN C  1 334 ? -39.120  -28.344 62.844  1.00 74.43  ? 327 GLN C O      1 
ATOM   8076  C CB     . GLN C  1 334 ? -41.181  -26.154 61.524  1.00 80.88  ? 327 GLN C CB     1 
ATOM   8077  C CG     . GLN C  1 334 ? -41.903  -27.452 61.791  1.00 85.49  ? 327 GLN C CG     1 
ATOM   8078  C CD     . GLN C  1 334 ? -43.401  -27.293 61.808  1.00 92.20  ? 327 GLN C CD     1 
ATOM   8079  O OE1    . GLN C  1 334 ? -43.923  -26.177 61.769  1.00 92.16  ? 327 GLN C OE1    1 
ATOM   8080  N NE2    . GLN C  1 334 ? -44.108  -28.412 61.880  1.00 95.98  ? 327 GLN C NE2    1 
ATOM   8081  N N      . LEU C  1 335 ? -38.714  -27.991 60.657  1.00 69.31  ? 328 LEU C N      1 
ATOM   8082  C CA     . LEU C  1 335 ? -38.132  -29.318 60.489  1.00 65.81  ? 328 LEU C CA     1 
ATOM   8083  C C      . LEU C  1 335 ? -36.867  -29.466 61.323  1.00 65.96  ? 328 LEU C C      1 
ATOM   8084  O O      . LEU C  1 335 ? -36.641  -30.513 61.943  1.00 66.12  ? 328 LEU C O      1 
ATOM   8085  C CB     . LEU C  1 335 ? -37.846  -29.582 59.010  1.00 61.63  ? 328 LEU C CB     1 
ATOM   8086  C CG     . LEU C  1 335 ? -39.094  -29.772 58.145  1.00 62.05  ? 328 LEU C CG     1 
ATOM   8087  C CD1    . LEU C  1 335 ? -38.748  -29.786 56.663  1.00 60.21  ? 328 LEU C CD1    1 
ATOM   8088  C CD2    . LEU C  1 335 ? -39.809  -31.050 58.539  1.00 62.75  ? 328 LEU C CD2    1 
ATOM   8089  N N      . VAL C  1 336 ? -36.028  -28.430 61.352  1.00 65.73  ? 329 VAL C N      1 
ATOM   8090  C CA     . VAL C  1 336 ? -34.800  -28.504 62.135  1.00 63.07  ? 329 VAL C CA     1 
ATOM   8091  C C      . VAL C  1 336 ? -35.132  -28.626 63.616  1.00 65.62  ? 329 VAL C C      1 
ATOM   8092  O O      . VAL C  1 336 ? -34.552  -29.451 64.332  1.00 69.27  ? 329 VAL C O      1 
ATOM   8093  C CB     . VAL C  1 336 ? -33.901  -27.287 61.848  1.00 58.11  ? 329 VAL C CB     1 
ATOM   8094  C CG1    . VAL C  1 336 ? -32.664  -27.323 62.732  1.00 56.97  ? 329 VAL C CG1    1 
ATOM   8095  C CG2    . VAL C  1 336 ? -33.512  -27.252 60.376  1.00 54.20  ? 329 VAL C CG2    1 
ATOM   8096  N N      . GLU C  1 337 ? -36.075  -27.813 64.097  1.00 68.45  ? 330 GLU C N      1 
ATOM   8097  C CA     . GLU C  1 337 ? -36.423  -27.836 65.515  1.00 70.44  ? 330 GLU C CA     1 
ATOM   8098  C C      . GLU C  1 337 ? -37.007  -29.185 65.917  1.00 72.63  ? 330 GLU C C      1 
ATOM   8099  O O      . GLU C  1 337 ? -36.626  -29.758 66.944  1.00 74.88  ? 330 GLU C O      1 
ATOM   8100  C CB     . GLU C  1 337 ? -37.408  -26.710 65.832  1.00 72.44  ? 330 GLU C CB     1 
ATOM   8101  N N      . ALA C  1 338 ? -37.948  -29.701 65.123  1.00 69.95  ? 331 ALA C N      1 
ATOM   8102  C CA     . ALA C  1 338 ? -38.530  -31.006 65.420  1.00 68.33  ? 331 ALA C CA     1 
ATOM   8103  C C      . ALA C  1 338 ? -37.461  -32.089 65.481  1.00 63.16  ? 331 ALA C C      1 
ATOM   8104  O O      . ALA C  1 338 ? -37.497  -32.960 66.358  1.00 62.47  ? 331 ALA C O      1 
ATOM   8105  C CB     . ALA C  1 338 ? -39.588  -31.357 64.375  1.00 65.55  ? 331 ALA C CB     1 
ATOM   8106  N N      . ALA C  1 339 ? -36.498  -32.049 64.557  1.00 61.48  ? 332 ALA C N      1 
ATOM   8107  C CA     . ALA C  1 339 ? -35.439  -33.053 64.549  1.00 60.98  ? 332 ALA C CA     1 
ATOM   8108  C C      . ALA C  1 339 ? -34.599  -32.982 65.818  1.00 64.21  ? 332 ALA C C      1 
ATOM   8109  O O      . ALA C  1 339 ? -34.167  -34.014 66.346  1.00 64.90  ? 332 ALA C O      1 
ATOM   8110  C CB     . ALA C  1 339 ? -34.563  -32.881 63.308  1.00 50.10  ? 332 ALA C CB     1 
ATOM   8111  N N      . LEU C  1 340 ? -34.359  -31.771 66.327  1.00 63.08  ? 333 LEU C N      1 
ATOM   8112  C CA     . LEU C  1 340 ? -33.511  -31.610 67.501  1.00 61.73  ? 333 LEU C CA     1 
ATOM   8113  C C      . LEU C  1 340 ? -34.174  -32.137 68.766  1.00 68.51  ? 333 LEU C C      1 
ATOM   8114  O O      . LEU C  1 340 ? -33.481  -32.383 69.758  1.00 72.25  ? 333 LEU C O      1 
ATOM   8115  C CB     . LEU C  1 340 ? -33.144  -30.136 67.680  1.00 59.65  ? 333 LEU C CB     1 
ATOM   8116  C CG     . LEU C  1 340 ? -32.294  -29.523 66.565  1.00 56.61  ? 333 LEU C CG     1 
ATOM   8117  C CD1    . LEU C  1 340 ? -32.129  -28.023 66.764  1.00 56.10  ? 333 LEU C CD1    1 
ATOM   8118  C CD2    . LEU C  1 340 ? -30.940  -30.209 66.476  1.00 54.16  ? 333 LEU C CD2    1 
ATOM   8119  N N      . ALA C  1 341 ? -35.497  -32.311 68.755  1.00 70.37  ? 334 ALA C N      1 
ATOM   8120  C CA     . ALA C  1 341 ? -36.193  -32.862 69.909  1.00 72.28  ? 334 ALA C CA     1 
ATOM   8121  C C      . ALA C  1 341 ? -36.014  -34.368 70.040  1.00 75.68  ? 334 ALA C C      1 
ATOM   8122  O O      . ALA C  1 341 ? -36.224  -34.910 71.131  1.00 81.43  ? 334 ALA C O      1 
ATOM   8123  C CB     . ALA C  1 341 ? -37.683  -32.525 69.837  1.00 71.48  ? 334 ALA C CB     1 
ATOM   8124  N N      . VAL C  1 342 ? -35.640  -35.050 68.967  1.00 74.92  ? 335 VAL C N      1 
ATOM   8125  C CA     . VAL C  1 342 ? -35.513  -36.508 69.003  1.00 76.05  ? 335 VAL C CA     1 
ATOM   8126  C C      . VAL C  1 342 ? -34.204  -36.873 69.698  1.00 76.13  ? 335 VAL C C      1 
ATOM   8127  O O      . VAL C  1 342 ? -33.144  -36.348 69.320  1.00 72.94  ? 335 VAL C O      1 
ATOM   8128  C CB     . VAL C  1 342 ? -35.562  -37.086 67.593  1.00 76.26  ? 335 VAL C CB     1 
ATOM   8129  C CG1    . VAL C  1 342 ? -35.379  -38.599 67.631  1.00 79.14  ? 335 VAL C CG1    1 
ATOM   8130  C CG2    . VAL C  1 342 ? -36.873  -36.717 66.914  1.00 78.39  ? 335 VAL C CG2    1 
ATOM   8131  N N      . PRO C  1 343 ? -34.229  -37.751 70.697  1.00 79.23  ? 336 PRO C N      1 
ATOM   8132  C CA     . PRO C  1 343 ? -32.974  -38.235 71.278  1.00 80.25  ? 336 PRO C CA     1 
ATOM   8133  C C      . PRO C  1 343 ? -32.208  -39.092 70.283  1.00 77.67  ? 336 PRO C C      1 
ATOM   8134  O O      . PRO C  1 343 ? -32.789  -39.816 69.471  1.00 79.49  ? 336 PRO C O      1 
ATOM   8135  C CB     . PRO C  1 343 ? -33.431  -39.059 72.488  1.00 81.38  ? 336 PRO C CB     1 
ATOM   8136  C CG     . PRO C  1 343 ? -34.824  -38.590 72.774  1.00 82.38  ? 336 PRO C CG     1 
ATOM   8137  C CD     . PRO C  1 343 ? -35.406  -38.220 71.446  1.00 81.98  ? 336 PRO C CD     1 
ATOM   8138  N N      . GLY C  1 344 ? -30.882  -39.008 70.364  1.00 76.06  ? 337 GLY C N      1 
ATOM   8139  C CA     . GLY C  1 344 ? -30.013  -39.664 69.414  1.00 74.68  ? 337 GLY C CA     1 
ATOM   8140  C C      . GLY C  1 344 ? -29.621  -38.821 68.221  1.00 74.03  ? 337 GLY C C      1 
ATOM   8141  O O      . GLY C  1 344 ? -28.722  -39.219 67.468  1.00 73.75  ? 337 GLY C O      1 
ATOM   8142  N N      . VAL C  1 345 ? -30.265  -37.678 68.019  1.00 71.09  ? 338 VAL C N      1 
ATOM   8143  C CA     . VAL C  1 345 ? -29.895  -36.772 66.940  1.00 66.84  ? 338 VAL C CA     1 
ATOM   8144  C C      . VAL C  1 345 ? -28.739  -35.901 67.413  1.00 63.73  ? 338 VAL C C      1 
ATOM   8145  O O      . VAL C  1 345 ? -28.819  -35.263 68.470  1.00 66.77  ? 338 VAL C O      1 
ATOM   8146  C CB     . VAL C  1 345 ? -31.100  -35.919 66.510  1.00 62.55  ? 338 VAL C CB     1 
ATOM   8147  C CG1    . VAL C  1 345 ? -30.661  -34.819 65.559  1.00 58.98  ? 338 VAL C CG1    1 
ATOM   8148  C CG2    . VAL C  1 345 ? -32.167  -36.794 65.864  1.00 60.94  ? 338 VAL C CG2    1 
ATOM   8149  N N      . TYR C  1 346 ? -27.659  -35.865 66.629  1.00 61.06  ? 339 TYR C N      1 
ATOM   8150  C CA     . TYR C  1 346 ? -26.521  -35.027 66.994  1.00 61.25  ? 339 TYR C CA     1 
ATOM   8151  C C      . TYR C  1 346 ? -26.733  -33.579 66.573  1.00 61.21  ? 339 TYR C C      1 
ATOM   8152  O O      . TYR C  1 346 ? -26.310  -32.656 67.278  1.00 63.10  ? 339 TYR C O      1 
ATOM   8153  C CB     . TYR C  1 346 ? -25.231  -35.570 66.375  1.00 61.87  ? 339 TYR C CB     1 
ATOM   8154  C CG     . TYR C  1 346 ? -24.842  -36.962 66.825  1.00 66.95  ? 339 TYR C CG     1 
ATOM   8155  C CD1    . TYR C  1 346 ? -24.300  -37.177 68.085  1.00 69.41  ? 339 TYR C CD1    1 
ATOM   8156  C CD2    . TYR C  1 346 ? -24.991  -38.054 65.982  1.00 67.00  ? 339 TYR C CD2    1 
ATOM   8157  C CE1    . TYR C  1 346 ? -23.933  -38.441 68.499  1.00 70.98  ? 339 TYR C CE1    1 
ATOM   8158  C CE2    . TYR C  1 346 ? -24.626  -39.324 66.387  1.00 69.15  ? 339 TYR C CE2    1 
ATOM   8159  C CZ     . TYR C  1 346 ? -24.098  -39.511 67.647  1.00 70.19  ? 339 TYR C CZ     1 
ATOM   8160  O OH     . TYR C  1 346 ? -23.732  -40.771 68.061  1.00 69.77  ? 339 TYR C OH     1 
ATOM   8161  N N      . GLY C  1 347 ? -27.368  -33.365 65.430  1.00 58.11  ? 340 GLY C N      1 
ATOM   8162  C CA     . GLY C  1 347 ? -27.620  -32.019 64.950  1.00 56.44  ? 340 GLY C CA     1 
ATOM   8163  C C      . GLY C  1 347 ? -28.426  -32.079 63.673  1.00 58.16  ? 340 GLY C C      1 
ATOM   8164  O O      . GLY C  1 347 ? -28.607  -33.143 63.071  1.00 60.33  ? 340 GLY C O      1 
ATOM   8165  N N      . SER C  1 348 ? -28.909  -30.909 63.266  1.00 54.92  ? 341 SER C N      1 
ATOM   8166  C CA     . SER C  1 348 ? -29.731  -30.798 62.070  1.00 54.28  ? 341 SER C CA     1 
ATOM   8167  C C      . SER C  1 348 ? -29.709  -29.350 61.607  1.00 50.05  ? 341 SER C C      1 
ATOM   8168  O O      . SER C  1 348 ? -29.535  -28.432 62.411  1.00 47.89  ? 341 SER C O      1 
ATOM   8169  C CB     . SER C  1 348 ? -31.166  -31.267 62.335  1.00 56.76  ? 341 SER C CB     1 
ATOM   8170  O OG     . SER C  1 348 ? -31.923  -31.299 61.140  1.00 56.96  ? 341 SER C OG     1 
ATOM   8171  N N      . ARG C  1 349 ? -29.890  -29.152 60.305  1.00 49.98  ? 342 ARG C N      1 
ATOM   8172  C CA     . ARG C  1 349 ? -29.814  -27.807 59.755  1.00 49.28  ? 342 ARG C CA     1 
ATOM   8173  C C      . ARG C  1 349 ? -30.270  -27.847 58.306  1.00 48.01  ? 342 ARG C C      1 
ATOM   8174  O O      . ARG C  1 349 ? -30.344  -28.916 57.694  1.00 45.63  ? 342 ARG C O      1 
ATOM   8175  C CB     . ARG C  1 349 ? -28.390  -27.259 59.853  1.00 47.83  ? 342 ARG C CB     1 
ATOM   8176  C CG     . ARG C  1 349 ? -27.389  -28.102 59.081  1.00 46.53  ? 342 ARG C CG     1 
ATOM   8177  C CD     . ARG C  1 349 ? -26.033  -27.440 59.034  1.00 45.59  ? 342 ARG C CD     1 
ATOM   8178  N NE     . ARG C  1 349 ? -25.359  -27.692 57.766  1.00 48.71  ? 342 ARG C NE     1 
ATOM   8179  C CZ     . ARG C  1 349 ? -25.366  -26.838 56.748  1.00 52.17  ? 342 ARG C CZ     1 
ATOM   8180  N NH1    . ARG C  1 349 ? -26.003  -25.680 56.863  1.00 54.37  ? 342 ARG C NH1    1 
ATOM   8181  N NH2    . ARG C  1 349 ? -24.735  -27.135 55.621  1.00 50.96  ? 342 ARG C NH2    1 
ATOM   8182  N N      . MET C  1 350 ? -30.575  -26.673 57.764  1.00 49.22  ? 343 MET C N      1 
ATOM   8183  C CA     . MET C  1 350 ? -30.864  -26.581 56.341  1.00 50.87  ? 343 MET C CA     1 
ATOM   8184  C C      . MET C  1 350 ? -29.592  -26.801 55.528  1.00 49.77  ? 343 MET C C      1 
ATOM   8185  O O      . MET C  1 350 ? -28.478  -26.535 55.987  1.00 50.48  ? 343 MET C O      1 
ATOM   8186  C CB     . MET C  1 350 ? -31.467  -25.222 55.995  1.00 51.37  ? 343 MET C CB     1 
ATOM   8187  C CG     . MET C  1 350 ? -30.593  -24.049 56.393  1.00 49.48  ? 343 MET C CG     1 
ATOM   8188  S SD     . MET C  1 350 ? -30.883  -22.591 55.370  1.00 50.07  ? 343 MET C SD     1 
ATOM   8189  C CE     . MET C  1 350 ? -29.926  -23.002 53.909  1.00 43.08  ? 343 MET C CE     1 
ATOM   8190  N N      . THR C  1 351 ? -29.770  -27.297 54.307  1.00 48.50  ? 344 THR C N      1 
ATOM   8191  C CA     . THR C  1 351 ? -28.677  -27.470 53.362  1.00 44.71  ? 344 THR C CA     1 
ATOM   8192  C C      . THR C  1 351 ? -29.059  -26.840 52.030  1.00 43.95  ? 344 THR C C      1 
ATOM   8193  O O      . THR C  1 351 ? -30.230  -26.558 51.767  1.00 48.43  ? 344 THR C O      1 
ATOM   8194  C CB     . THR C  1 351 ? -28.329  -28.954 53.164  1.00 48.65  ? 344 THR C CB     1 
ATOM   8195  O OG1    . THR C  1 351 ? -27.346  -29.086 52.129  1.00 52.37  ? 344 THR C OG1    1 
ATOM   8196  C CG2    . THR C  1 351 ? -29.572  -29.751 52.786  1.00 51.15  ? 344 THR C CG2    1 
ATOM   8197  N N      . GLY C  1 352 ? -28.052  -26.612 51.190  1.00 39.72  ? 345 GLY C N      1 
ATOM   8198  C CA     . GLY C  1 352 ? -28.294  -26.003 49.896  1.00 33.63  ? 345 GLY C CA     1 
ATOM   8199  C C      . GLY C  1 352 ? -28.442  -24.493 49.970  1.00 40.11  ? 345 GLY C C      1 
ATOM   8200  O O      . GLY C  1 352 ? -28.023  -23.836 50.930  1.00 41.80  ? 345 GLY C O      1 
ATOM   8201  N N      . GLY C  1 353 ? -29.055  -23.937 48.921  1.00 40.03  ? 346 GLY C N      1 
ATOM   8202  C CA     . GLY C  1 353 ? -29.199  -22.492 48.841  1.00 36.16  ? 346 GLY C CA     1 
ATOM   8203  C C      . GLY C  1 353 ? -30.135  -21.928 49.892  1.00 45.91  ? 346 GLY C C      1 
ATOM   8204  O O      . GLY C  1 353 ? -29.911  -20.830 50.409  1.00 49.82  ? 346 GLY C O      1 
ATOM   8205  N N      . GLY C  1 354 ? -31.197  -22.653 50.212  1.00 47.59  ? 347 GLY C N      1 
ATOM   8206  C CA     . GLY C  1 354 ? -32.171  -22.216 51.192  1.00 48.92  ? 347 GLY C CA     1 
ATOM   8207  C C      . GLY C  1 354 ? -33.498  -21.840 50.555  1.00 52.06  ? 347 GLY C C      1 
ATOM   8208  O O      . GLY C  1 354 ? -33.753  -22.078 49.371  1.00 51.08  ? 347 GLY C O      1 
ATOM   8209  N N      . PHE C  1 355 ? -34.355  -21.231 51.378  1.00 56.26  ? 348 PHE C N      1 
ATOM   8210  C CA     . PHE C  1 355 ? -35.689  -20.803 50.956  1.00 60.41  ? 348 PHE C CA     1 
ATOM   8211  C C      . PHE C  1 355 ? -36.562  -21.993 50.574  1.00 60.24  ? 348 PHE C C      1 
ATOM   8212  O O      . PHE C  1 355 ? -37.448  -21.885 49.722  1.00 60.22  ? 348 PHE C O      1 
ATOM   8213  C CB     . PHE C  1 355 ? -35.614  -19.800 49.803  1.00 58.80  ? 348 PHE C CB     1 
ATOM   8214  C CG     . PHE C  1 355 ? -34.819  -18.569 50.125  1.00 58.75  ? 348 PHE C CG     1 
ATOM   8215  C CD1    . PHE C  1 355 ? -35.271  -17.663 51.072  1.00 59.35  ? 348 PHE C CD1    1 
ATOM   8216  C CD2    . PHE C  1 355 ? -33.621  -18.314 49.480  1.00 55.22  ? 348 PHE C CD2    1 
ATOM   8217  C CE1    . PHE C  1 355 ? -34.541  -16.530 51.370  1.00 58.35  ? 348 PHE C CE1    1 
ATOM   8218  C CE2    . PHE C  1 355 ? -32.888  -17.182 49.773  1.00 52.75  ? 348 PHE C CE2    1 
ATOM   8219  C CZ     . PHE C  1 355 ? -33.348  -16.289 50.719  1.00 55.06  ? 348 PHE C CZ     1 
ATOM   8220  N N      . GLY C  1 356 ? -36.315  -23.131 51.213  1.00 59.55  ? 349 GLY C N      1 
ATOM   8221  C CA     . GLY C  1 356 ? -36.896  -24.408 50.880  1.00 59.06  ? 349 GLY C CA     1 
ATOM   8222  C C      . GLY C  1 356 ? -35.803  -25.440 50.749  1.00 59.05  ? 349 GLY C C      1 
ATOM   8223  O O      . GLY C  1 356 ? -34.669  -25.230 51.193  1.00 58.45  ? 349 GLY C O      1 
ATOM   8224  N N      . GLY C  1 357 ? -36.140  -26.563 50.126  1.00 58.16  ? 350 GLY C N      1 
ATOM   8225  C CA     . GLY C  1 357 ? -35.163  -27.614