data_6HBU
# 
_entry.id   6HBU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6HBU         
WWPDB D_1200011438 
EMDB  EMD-0190     
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'Cryo-EM structure of the ABCG2 E211Q mutant bound to ATP and Magnesium' 
_pdbx_database_related.db_id          EMD-0190 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6HBU 
_pdbx_database_status.recvd_initial_deposition_date   2018-08-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Manolaridis, I.' 1 ? 
'Jackson, S.M.'   2 ? 
'Taylor, N.M.I.'  3 ? 
'Kowal, J.'       4 ? 
'Stahlberg, H.'   5 ? 
'Locher, K.P.'    6 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            563 
_citation.language                  ? 
_citation.page_first                426 
_citation.page_last                 430 
_citation.title                     'Cryo-EM structures of a human ABCG2 mutant trapped in ATP-bound and substrate-bound states.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41586-018-0680-3 
_citation.pdbx_database_id_PubMed   30405239 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Manolaridis, I.' 1 ? 
primary 'Jackson, S.M.'   2 ? 
primary 'Taylor, N.M.I.'  3 ? 
primary 'Kowal, J.'       4 ? 
primary 'Stahlberg, H.'   5 ? 
primary 'Locher, K.P.'    6 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6HBU 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.00 
_cell.length_a_esd                 ? 
_cell.length_b                     1.00 
_cell.length_b_esd                 ? 
_cell.length_c                     1.00 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6HBU 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ATP-binding cassette sub-family G member 2' 72384.867 2 ? E211Q ? ? 
2 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE"                  507.181   2 ? ?     ? ? 
3 non-polymer syn 'MAGNESIUM ION'                              24.305    2 ? ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Breast cancer resistance protein,CDw338,Mitoxantrone resistance-associated protein,Placenta-specific ATP-binding cassette transporter,Urate exporter
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSSSNVEVFIPVSQGNTNGFPATASNDLKAFTEGAVLSFHNICYRVKLKSGFLPCRKPVEKEILSNINGIMKPGLNAILG
PTGGGKSSLLDVLAARKDPSGLSGDVLINGAPRPANFKCNSGYVVQDDVVMGTLTVRENLQFSAALRLATTMTNHEKNER
INRVIQELGLDKVADSKVGTQFIRGVSGGERKRTSIGMELITDPSILFLDQPTTGLDSSTANAVLLLLKRMSKQGRTIIF
SIHQPRYSIFKLFDSLTLLASGRLMFHGPAQEALGYFESAGYHCEAYNNPADFFLDIINGDSTAVALNREEDFKATEIIE
PSKQDKPLIEKLAEIYVNSSFYKETKAELHQLSGGEKKKKITVFKEISYTTSFCHQLRWVSKRSFKNLLGNPQASIAQII
VTVVLGLVIGAIYFGLKNDSTGIQNRAGVLFFLTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFLGKLLSDLLP
MRMLPSIIFTCIVYFMLGLKPKADAFFVMMFTLMMVAYSASSMALAIAAGQSVVSVATLLMTICFVFMMIFSGLLVNLTT
IASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGNNPCNYATCTGEEYLVKQGIDLSPWGLWKNHVALACMIVIF
LTIAYLKLLFLKKYS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSSSNVEVFIPVSQGNTNGFPATASNDLKAFTEGAVLSFHNICYRVKLKSGFLPCRKPVEKEILSNINGIMKPGLNAILG
PTGGGKSSLLDVLAARKDPSGLSGDVLINGAPRPANFKCNSGYVVQDDVVMGTLTVRENLQFSAALRLATTMTNHEKNER
INRVIQELGLDKVADSKVGTQFIRGVSGGERKRTSIGMELITDPSILFLDQPTTGLDSSTANAVLLLLKRMSKQGRTIIF
SIHQPRYSIFKLFDSLTLLASGRLMFHGPAQEALGYFESAGYHCEAYNNPADFFLDIINGDSTAVALNREEDFKATEIIE
PSKQDKPLIEKLAEIYVNSSFYKETKAELHQLSGGEKKKKITVFKEISYTTSFCHQLRWVSKRSFKNLLGNPQASIAQII
VTVVLGLVIGAIYFGLKNDSTGIQNRAGVLFFLTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFLGKLLSDLLP
MRMLPSIIFTCIVYFMLGLKPKADAFFVMMFTLMMVAYSASSMALAIAAGQSVVSVATLLMTICFVFMMIFSGLLVNLTT
IASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGNNPCNYATCTGEEYLVKQGIDLSPWGLWKNHVALACMIVIF
LTIAYLKLLFLKKYS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   SER n 
1 4   SER n 
1 5   ASN n 
1 6   VAL n 
1 7   GLU n 
1 8   VAL n 
1 9   PHE n 
1 10  ILE n 
1 11  PRO n 
1 12  VAL n 
1 13  SER n 
1 14  GLN n 
1 15  GLY n 
1 16  ASN n 
1 17  THR n 
1 18  ASN n 
1 19  GLY n 
1 20  PHE n 
1 21  PRO n 
1 22  ALA n 
1 23  THR n 
1 24  ALA n 
1 25  SER n 
1 26  ASN n 
1 27  ASP n 
1 28  LEU n 
1 29  LYS n 
1 30  ALA n 
1 31  PHE n 
1 32  THR n 
1 33  GLU n 
1 34  GLY n 
1 35  ALA n 
1 36  VAL n 
1 37  LEU n 
1 38  SER n 
1 39  PHE n 
1 40  HIS n 
1 41  ASN n 
1 42  ILE n 
1 43  CYS n 
1 44  TYR n 
1 45  ARG n 
1 46  VAL n 
1 47  LYS n 
1 48  LEU n 
1 49  LYS n 
1 50  SER n 
1 51  GLY n 
1 52  PHE n 
1 53  LEU n 
1 54  PRO n 
1 55  CYS n 
1 56  ARG n 
1 57  LYS n 
1 58  PRO n 
1 59  VAL n 
1 60  GLU n 
1 61  LYS n 
1 62  GLU n 
1 63  ILE n 
1 64  LEU n 
1 65  SER n 
1 66  ASN n 
1 67  ILE n 
1 68  ASN n 
1 69  GLY n 
1 70  ILE n 
1 71  MET n 
1 72  LYS n 
1 73  PRO n 
1 74  GLY n 
1 75  LEU n 
1 76  ASN n 
1 77  ALA n 
1 78  ILE n 
1 79  LEU n 
1 80  GLY n 
1 81  PRO n 
1 82  THR n 
1 83  GLY n 
1 84  GLY n 
1 85  GLY n 
1 86  LYS n 
1 87  SER n 
1 88  SER n 
1 89  LEU n 
1 90  LEU n 
1 91  ASP n 
1 92  VAL n 
1 93  LEU n 
1 94  ALA n 
1 95  ALA n 
1 96  ARG n 
1 97  LYS n 
1 98  ASP n 
1 99  PRO n 
1 100 SER n 
1 101 GLY n 
1 102 LEU n 
1 103 SER n 
1 104 GLY n 
1 105 ASP n 
1 106 VAL n 
1 107 LEU n 
1 108 ILE n 
1 109 ASN n 
1 110 GLY n 
1 111 ALA n 
1 112 PRO n 
1 113 ARG n 
1 114 PRO n 
1 115 ALA n 
1 116 ASN n 
1 117 PHE n 
1 118 LYS n 
1 119 CYS n 
1 120 ASN n 
1 121 SER n 
1 122 GLY n 
1 123 TYR n 
1 124 VAL n 
1 125 VAL n 
1 126 GLN n 
1 127 ASP n 
1 128 ASP n 
1 129 VAL n 
1 130 VAL n 
1 131 MET n 
1 132 GLY n 
1 133 THR n 
1 134 LEU n 
1 135 THR n 
1 136 VAL n 
1 137 ARG n 
1 138 GLU n 
1 139 ASN n 
1 140 LEU n 
1 141 GLN n 
1 142 PHE n 
1 143 SER n 
1 144 ALA n 
1 145 ALA n 
1 146 LEU n 
1 147 ARG n 
1 148 LEU n 
1 149 ALA n 
1 150 THR n 
1 151 THR n 
1 152 MET n 
1 153 THR n 
1 154 ASN n 
1 155 HIS n 
1 156 GLU n 
1 157 LYS n 
1 158 ASN n 
1 159 GLU n 
1 160 ARG n 
1 161 ILE n 
1 162 ASN n 
1 163 ARG n 
1 164 VAL n 
1 165 ILE n 
1 166 GLN n 
1 167 GLU n 
1 168 LEU n 
1 169 GLY n 
1 170 LEU n 
1 171 ASP n 
1 172 LYS n 
1 173 VAL n 
1 174 ALA n 
1 175 ASP n 
1 176 SER n 
1 177 LYS n 
1 178 VAL n 
1 179 GLY n 
1 180 THR n 
1 181 GLN n 
1 182 PHE n 
1 183 ILE n 
1 184 ARG n 
1 185 GLY n 
1 186 VAL n 
1 187 SER n 
1 188 GLY n 
1 189 GLY n 
1 190 GLU n 
1 191 ARG n 
1 192 LYS n 
1 193 ARG n 
1 194 THR n 
1 195 SER n 
1 196 ILE n 
1 197 GLY n 
1 198 MET n 
1 199 GLU n 
1 200 LEU n 
1 201 ILE n 
1 202 THR n 
1 203 ASP n 
1 204 PRO n 
1 205 SER n 
1 206 ILE n 
1 207 LEU n 
1 208 PHE n 
1 209 LEU n 
1 210 ASP n 
1 211 GLN n 
1 212 PRO n 
1 213 THR n 
1 214 THR n 
1 215 GLY n 
1 216 LEU n 
1 217 ASP n 
1 218 SER n 
1 219 SER n 
1 220 THR n 
1 221 ALA n 
1 222 ASN n 
1 223 ALA n 
1 224 VAL n 
1 225 LEU n 
1 226 LEU n 
1 227 LEU n 
1 228 LEU n 
1 229 LYS n 
1 230 ARG n 
1 231 MET n 
1 232 SER n 
1 233 LYS n 
1 234 GLN n 
1 235 GLY n 
1 236 ARG n 
1 237 THR n 
1 238 ILE n 
1 239 ILE n 
1 240 PHE n 
1 241 SER n 
1 242 ILE n 
1 243 HIS n 
1 244 GLN n 
1 245 PRO n 
1 246 ARG n 
1 247 TYR n 
1 248 SER n 
1 249 ILE n 
1 250 PHE n 
1 251 LYS n 
1 252 LEU n 
1 253 PHE n 
1 254 ASP n 
1 255 SER n 
1 256 LEU n 
1 257 THR n 
1 258 LEU n 
1 259 LEU n 
1 260 ALA n 
1 261 SER n 
1 262 GLY n 
1 263 ARG n 
1 264 LEU n 
1 265 MET n 
1 266 PHE n 
1 267 HIS n 
1 268 GLY n 
1 269 PRO n 
1 270 ALA n 
1 271 GLN n 
1 272 GLU n 
1 273 ALA n 
1 274 LEU n 
1 275 GLY n 
1 276 TYR n 
1 277 PHE n 
1 278 GLU n 
1 279 SER n 
1 280 ALA n 
1 281 GLY n 
1 282 TYR n 
1 283 HIS n 
1 284 CYS n 
1 285 GLU n 
1 286 ALA n 
1 287 TYR n 
1 288 ASN n 
1 289 ASN n 
1 290 PRO n 
1 291 ALA n 
1 292 ASP n 
1 293 PHE n 
1 294 PHE n 
1 295 LEU n 
1 296 ASP n 
1 297 ILE n 
1 298 ILE n 
1 299 ASN n 
1 300 GLY n 
1 301 ASP n 
1 302 SER n 
1 303 THR n 
1 304 ALA n 
1 305 VAL n 
1 306 ALA n 
1 307 LEU n 
1 308 ASN n 
1 309 ARG n 
1 310 GLU n 
1 311 GLU n 
1 312 ASP n 
1 313 PHE n 
1 314 LYS n 
1 315 ALA n 
1 316 THR n 
1 317 GLU n 
1 318 ILE n 
1 319 ILE n 
1 320 GLU n 
1 321 PRO n 
1 322 SER n 
1 323 LYS n 
1 324 GLN n 
1 325 ASP n 
1 326 LYS n 
1 327 PRO n 
1 328 LEU n 
1 329 ILE n 
1 330 GLU n 
1 331 LYS n 
1 332 LEU n 
1 333 ALA n 
1 334 GLU n 
1 335 ILE n 
1 336 TYR n 
1 337 VAL n 
1 338 ASN n 
1 339 SER n 
1 340 SER n 
1 341 PHE n 
1 342 TYR n 
1 343 LYS n 
1 344 GLU n 
1 345 THR n 
1 346 LYS n 
1 347 ALA n 
1 348 GLU n 
1 349 LEU n 
1 350 HIS n 
1 351 GLN n 
1 352 LEU n 
1 353 SER n 
1 354 GLY n 
1 355 GLY n 
1 356 GLU n 
1 357 LYS n 
1 358 LYS n 
1 359 LYS n 
1 360 LYS n 
1 361 ILE n 
1 362 THR n 
1 363 VAL n 
1 364 PHE n 
1 365 LYS n 
1 366 GLU n 
1 367 ILE n 
1 368 SER n 
1 369 TYR n 
1 370 THR n 
1 371 THR n 
1 372 SER n 
1 373 PHE n 
1 374 CYS n 
1 375 HIS n 
1 376 GLN n 
1 377 LEU n 
1 378 ARG n 
1 379 TRP n 
1 380 VAL n 
1 381 SER n 
1 382 LYS n 
1 383 ARG n 
1 384 SER n 
1 385 PHE n 
1 386 LYS n 
1 387 ASN n 
1 388 LEU n 
1 389 LEU n 
1 390 GLY n 
1 391 ASN n 
1 392 PRO n 
1 393 GLN n 
1 394 ALA n 
1 395 SER n 
1 396 ILE n 
1 397 ALA n 
1 398 GLN n 
1 399 ILE n 
1 400 ILE n 
1 401 VAL n 
1 402 THR n 
1 403 VAL n 
1 404 VAL n 
1 405 LEU n 
1 406 GLY n 
1 407 LEU n 
1 408 VAL n 
1 409 ILE n 
1 410 GLY n 
1 411 ALA n 
1 412 ILE n 
1 413 TYR n 
1 414 PHE n 
1 415 GLY n 
1 416 LEU n 
1 417 LYS n 
1 418 ASN n 
1 419 ASP n 
1 420 SER n 
1 421 THR n 
1 422 GLY n 
1 423 ILE n 
1 424 GLN n 
1 425 ASN n 
1 426 ARG n 
1 427 ALA n 
1 428 GLY n 
1 429 VAL n 
1 430 LEU n 
1 431 PHE n 
1 432 PHE n 
1 433 LEU n 
1 434 THR n 
1 435 THR n 
1 436 ASN n 
1 437 GLN n 
1 438 CYS n 
1 439 PHE n 
1 440 SER n 
1 441 SER n 
1 442 VAL n 
1 443 SER n 
1 444 ALA n 
1 445 VAL n 
1 446 GLU n 
1 447 LEU n 
1 448 PHE n 
1 449 VAL n 
1 450 VAL n 
1 451 GLU n 
1 452 LYS n 
1 453 LYS n 
1 454 LEU n 
1 455 PHE n 
1 456 ILE n 
1 457 HIS n 
1 458 GLU n 
1 459 TYR n 
1 460 ILE n 
1 461 SER n 
1 462 GLY n 
1 463 TYR n 
1 464 TYR n 
1 465 ARG n 
1 466 VAL n 
1 467 SER n 
1 468 SER n 
1 469 TYR n 
1 470 PHE n 
1 471 LEU n 
1 472 GLY n 
1 473 LYS n 
1 474 LEU n 
1 475 LEU n 
1 476 SER n 
1 477 ASP n 
1 478 LEU n 
1 479 LEU n 
1 480 PRO n 
1 481 MET n 
1 482 ARG n 
1 483 MET n 
1 484 LEU n 
1 485 PRO n 
1 486 SER n 
1 487 ILE n 
1 488 ILE n 
1 489 PHE n 
1 490 THR n 
1 491 CYS n 
1 492 ILE n 
1 493 VAL n 
1 494 TYR n 
1 495 PHE n 
1 496 MET n 
1 497 LEU n 
1 498 GLY n 
1 499 LEU n 
1 500 LYS n 
1 501 PRO n 
1 502 LYS n 
1 503 ALA n 
1 504 ASP n 
1 505 ALA n 
1 506 PHE n 
1 507 PHE n 
1 508 VAL n 
1 509 MET n 
1 510 MET n 
1 511 PHE n 
1 512 THR n 
1 513 LEU n 
1 514 MET n 
1 515 MET n 
1 516 VAL n 
1 517 ALA n 
1 518 TYR n 
1 519 SER n 
1 520 ALA n 
1 521 SER n 
1 522 SER n 
1 523 MET n 
1 524 ALA n 
1 525 LEU n 
1 526 ALA n 
1 527 ILE n 
1 528 ALA n 
1 529 ALA n 
1 530 GLY n 
1 531 GLN n 
1 532 SER n 
1 533 VAL n 
1 534 VAL n 
1 535 SER n 
1 536 VAL n 
1 537 ALA n 
1 538 THR n 
1 539 LEU n 
1 540 LEU n 
1 541 MET n 
1 542 THR n 
1 543 ILE n 
1 544 CYS n 
1 545 PHE n 
1 546 VAL n 
1 547 PHE n 
1 548 MET n 
1 549 MET n 
1 550 ILE n 
1 551 PHE n 
1 552 SER n 
1 553 GLY n 
1 554 LEU n 
1 555 LEU n 
1 556 VAL n 
1 557 ASN n 
1 558 LEU n 
1 559 THR n 
1 560 THR n 
1 561 ILE n 
1 562 ALA n 
1 563 SER n 
1 564 TRP n 
1 565 LEU n 
1 566 SER n 
1 567 TRP n 
1 568 LEU n 
1 569 GLN n 
1 570 TYR n 
1 571 PHE n 
1 572 SER n 
1 573 ILE n 
1 574 PRO n 
1 575 ARG n 
1 576 TYR n 
1 577 GLY n 
1 578 PHE n 
1 579 THR n 
1 580 ALA n 
1 581 LEU n 
1 582 GLN n 
1 583 HIS n 
1 584 ASN n 
1 585 GLU n 
1 586 PHE n 
1 587 LEU n 
1 588 GLY n 
1 589 GLN n 
1 590 ASN n 
1 591 PHE n 
1 592 CYS n 
1 593 PRO n 
1 594 GLY n 
1 595 LEU n 
1 596 ASN n 
1 597 ALA n 
1 598 THR n 
1 599 GLY n 
1 600 ASN n 
1 601 ASN n 
1 602 PRO n 
1 603 CYS n 
1 604 ASN n 
1 605 TYR n 
1 606 ALA n 
1 607 THR n 
1 608 CYS n 
1 609 THR n 
1 610 GLY n 
1 611 GLU n 
1 612 GLU n 
1 613 TYR n 
1 614 LEU n 
1 615 VAL n 
1 616 LYS n 
1 617 GLN n 
1 618 GLY n 
1 619 ILE n 
1 620 ASP n 
1 621 LEU n 
1 622 SER n 
1 623 PRO n 
1 624 TRP n 
1 625 GLY n 
1 626 LEU n 
1 627 TRP n 
1 628 LYS n 
1 629 ASN n 
1 630 HIS n 
1 631 VAL n 
1 632 ALA n 
1 633 LEU n 
1 634 ALA n 
1 635 CYS n 
1 636 MET n 
1 637 ILE n 
1 638 VAL n 
1 639 ILE n 
1 640 PHE n 
1 641 LEU n 
1 642 THR n 
1 643 ILE n 
1 644 ALA n 
1 645 TYR n 
1 646 LEU n 
1 647 LYS n 
1 648 LEU n 
1 649 LEU n 
1 650 PHE n 
1 651 LEU n 
1 652 LYS n 
1 653 LYS n 
1 654 TYR n 
1 655 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   655 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ABCG2, ABCP, BCRP, BCRP1, MXR' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'HEK293 EBNA' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ABCG2_HUMAN 
_struct_ref.pdbx_db_accession          Q9UNQ0 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSSSNVEVFIPVSQGNTNGFPATASNDLKAFTEGAVLSFHNICYRVKLKSGFLPCRKPVEKEILSNINGIMKPGLNAILG
PTGGGKSSLLDVLAARKDPSGLSGDVLINGAPRPANFKCNSGYVVQDDVVMGTLTVRENLQFSAALRLATTMTNHEKNER
INRVIQELGLDKVADSKVGTQFIRGVSGGERKRTSIGMELITDPSILFLDEPTTGLDSSTANAVLLLLKRMSKQGRTIIF
SIHQPRYSIFKLFDSLTLLASGRLMFHGPAQEALGYFESAGYHCEAYNNPADFFLDIINGDSTAVALNREEDFKATEIIE
PSKQDKPLIEKLAEIYVNSSFYKETKAELHQLSGGEKKKKITVFKEISYTTSFCHQLRWVSKRSFKNLLGNPQASIAQII
VTVVLGLVIGAIYFGLKNDSTGIQNRAGVLFFLTTNQCFSSVSAVELFVVEKKLFIHEYISGYYRVSSYFLGKLLSDLLP
MRMLPSIIFTCIVYFMLGLKPKADAFFVMMFTLMMVAYSASSMALAIAAGQSVVSVATLLMTICFVFMMIFSGLLVNLTT
IASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGNNPCNYATCTGEEYLVKQGIDLSPWGLWKNHVALACMIVIF
LTIAYLKLLFLKKYS
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6HBU A 1 ? 655 ? Q9UNQ0 1 ? 655 ? 1 655 
2 1 6HBU B 1 ? 655 ? Q9UNQ0 1 ? 655 ? 1 655 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6HBU GLN A 211 ? UNP Q9UNQ0 GLU 211 'engineered mutation' 211 1 
2 6HBU GLN B 211 ? UNP Q9UNQ0 GLU 211 'engineered mutation' 211 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                     ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                    ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ? 'C4 H7 N O4'        133.103 
ATP non-polymer         . "ADENOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O13 P3' 507.181 
CYS 'L-peptide linking' y CYSTEINE                    ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                   ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                     ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                   ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                  ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                     ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                      ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                  ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'             ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE               ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                     ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                      ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                   ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                  ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                    ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                      ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6HBU 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6HBU 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            . 
_refine.ls_d_res_low                             ? 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.009 ? 9339  ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 1.136 ? 12652 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 7.834 ? 5526  ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.060 ? 1466  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.007 ? 1566  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     6HBU 
_struct.title                        'Cryo-EM structure of the ABCG2 E211Q mutant bound to ATP and Magnesium' 
_struct.pdbx_descriptor              'ATP-binding cassette sub-family G member 2' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6HBU 
_struct_keywords.text            'Multidrug transporter, membrane protein, cancer' 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 85  ? ALA A 94  ? GLY A 85  ALA A 94  1 ? 10 
HELX_P HELX_P2  AA2 THR A 135 ? LEU A 148 ? THR A 135 LEU A 148 1 ? 14 
HELX_P HELX_P3  AA3 THR A 153 ? GLY A 169 ? THR A 153 GLY A 169 1 ? 17 
HELX_P HELX_P4  AA4 SER A 187 ? GLU A 199 ? SER A 187 GLU A 199 1 ? 13 
HELX_P HELX_P5  AA5 ASP A 217 ? LYS A 233 ? ASP A 217 LYS A 233 1 ? 17 
HELX_P HELX_P6  AA6 ARG A 246 ? LYS A 251 ? ARG A 246 LYS A 251 1 ? 6  
HELX_P HELX_P7  AA7 ALA A 273 ? GLU A 278 ? ALA A 273 GLU A 278 1 ? 6  
HELX_P HELX_P8  AA8 ASN A 289 ? ILE A 298 ? ASN A 289 ILE A 298 1 ? 10 
HELX_P HELX_P9  AA9 SER A 302 ? ASN A 308 ? SER A 302 ASN A 308 1 ? 7  
HELX_P HELX_P10 AB1 PRO A 327 ? ASN A 338 ? PRO A 327 ASN A 338 1 ? 12 
HELX_P HELX_P11 AB2 SER A 339 ? SER A 353 ? SER A 339 SER A 353 1 ? 15 
HELX_P HELX_P12 AB3 SER A 372 ? ASN A 391 ? SER A 372 ASN A 391 1 ? 20 
HELX_P HELX_P13 AB4 PRO A 392 ? TYR A 413 ? PRO A 392 TYR A 413 1 ? 22 
HELX_P HELX_P14 AB5 GLY A 422 ? SER A 440 ? GLY A 422 SER A 440 1 ? 19 
HELX_P HELX_P15 AB6 SER A 441 ? PHE A 448 ? SER A 441 PHE A 448 5 ? 8  
HELX_P HELX_P16 AB7 GLU A 451 ? SER A 461 ? GLU A 451 SER A 461 1 ? 11 
HELX_P HELX_P17 AB8 ARG A 465 ? LEU A 479 ? ARG A 465 LEU A 479 1 ? 15 
HELX_P HELX_P18 AB9 MET A 483 ? VAL A 493 ? MET A 483 VAL A 493 1 ? 11 
HELX_P HELX_P19 AC1 ALA A 503 ? ALA A 529 ? ALA A 503 ALA A 529 1 ? 27 
HELX_P HELX_P20 AC2 VAL A 534 ? PHE A 551 ? VAL A 534 PHE A 551 1 ? 18 
HELX_P HELX_P21 AC3 TRP A 567 ? PHE A 571 ? TRP A 567 PHE A 571 5 ? 5  
HELX_P HELX_P22 AC4 SER A 572 ? PHE A 586 ? SER A 572 PHE A 586 1 ? 15 
HELX_P HELX_P23 AC5 THR A 609 ? GLY A 618 ? THR A 609 GLY A 618 1 ? 10 
HELX_P HELX_P24 AC6 PRO A 623 ? PHE A 650 ? PRO A 623 PHE A 650 1 ? 28 
HELX_P HELX_P25 AC7 GLY B 85  ? ALA B 94  ? GLY B 85  ALA B 94  1 ? 10 
HELX_P HELX_P26 AC8 THR B 135 ? LEU B 148 ? THR B 135 LEU B 148 1 ? 14 
HELX_P HELX_P27 AC9 THR B 153 ? GLY B 169 ? THR B 153 GLY B 169 1 ? 17 
HELX_P HELX_P28 AD1 SER B 187 ? GLU B 199 ? SER B 187 GLU B 199 1 ? 13 
HELX_P HELX_P29 AD2 ASP B 217 ? LYS B 233 ? ASP B 217 LYS B 233 1 ? 17 
HELX_P HELX_P30 AD3 ARG B 246 ? LYS B 251 ? ARG B 246 LYS B 251 1 ? 6  
HELX_P HELX_P31 AD4 ALA B 273 ? GLU B 278 ? ALA B 273 GLU B 278 1 ? 6  
HELX_P HELX_P32 AD5 ASN B 289 ? ILE B 298 ? ASN B 289 ILE B 298 1 ? 10 
HELX_P HELX_P33 AD6 SER B 302 ? ASN B 308 ? SER B 302 ASN B 308 1 ? 7  
HELX_P HELX_P34 AD7 PRO B 327 ? ASN B 338 ? PRO B 327 ASN B 338 1 ? 12 
HELX_P HELX_P35 AD8 SER B 339 ? SER B 353 ? SER B 339 SER B 353 1 ? 15 
HELX_P HELX_P36 AD9 SER B 372 ? ASN B 391 ? SER B 372 ASN B 391 1 ? 20 
HELX_P HELX_P37 AE1 PRO B 392 ? TYR B 413 ? PRO B 392 TYR B 413 1 ? 22 
HELX_P HELX_P38 AE2 GLY B 422 ? SER B 440 ? GLY B 422 SER B 440 1 ? 19 
HELX_P HELX_P39 AE3 SER B 441 ? PHE B 448 ? SER B 441 PHE B 448 5 ? 8  
HELX_P HELX_P40 AE4 GLU B 451 ? SER B 461 ? GLU B 451 SER B 461 1 ? 11 
HELX_P HELX_P41 AE5 ARG B 465 ? LEU B 479 ? ARG B 465 LEU B 479 1 ? 15 
HELX_P HELX_P42 AE6 MET B 483 ? VAL B 493 ? MET B 483 VAL B 493 1 ? 11 
HELX_P HELX_P43 AE7 ALA B 503 ? ALA B 529 ? ALA B 503 ALA B 529 1 ? 27 
HELX_P HELX_P44 AE8 VAL B 534 ? PHE B 551 ? VAL B 534 PHE B 551 1 ? 18 
HELX_P HELX_P45 AE9 TRP B 567 ? PHE B 571 ? TRP B 567 PHE B 571 5 ? 5  
HELX_P HELX_P46 AF1 SER B 572 ? PHE B 586 ? SER B 572 PHE B 586 1 ? 15 
HELX_P HELX_P47 AF2 THR B 609 ? GLY B 618 ? THR B 609 GLY B 618 1 ? 10 
HELX_P HELX_P48 AF3 PRO B 623 ? PHE B 650 ? PRO B 623 PHE B 650 1 ? 28 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 592 SG  ? ? ? 1_555 A CYS 608 SG ? ? A CYS 592 A CYS 608  1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf2 disulf ? ? A CYS 603 SG  ? ? ? 1_555 B CYS 603 SG ? ? A CYS 603 B CYS 603  1_555 ? ? ? ? ? ? ? 2.012 ? 
disulf3 disulf ? ? B CYS 592 SG  ? ? ? 1_555 B CYS 608 SG ? ? B CYS 592 B CYS 608  1_555 ? ? ? ? ? ? ? 2.034 ? 
metalc1 metalc ? ? A GLN 211 OE1 ? ? ? 1_555 D MG  .   MG ? ? A GLN 211 A MG  1502 1_555 ? ? ? ? ? ? ? 2.498 ? 
metalc2 metalc ? ? A SER 241 OG  ? ? ? 1_555 D MG  .   MG ? ? A SER 241 A MG  1502 1_555 ? ? ? ? ? ? ? 2.944 ? 
metalc3 metalc ? ? B GLN 211 OE1 ? ? ? 1_555 F MG  .   MG ? ? B GLN 211 B MG  1502 1_555 ? ? ? ? ? ? ? 2.498 ? 
metalc4 metalc ? ? B SER 241 OG  ? ? ? 1_555 F MG  .   MG ? ? B SER 241 B MG  1502 1_555 ? ? ? ? ? ? ? 2.944 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
AA3 ? 6 ? 
AA4 ? 3 ? 
AA5 ? 2 ? 
AA6 ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? parallel      
AA3 3 4 ? parallel      
AA3 4 5 ? parallel      
AA3 5 6 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? parallel      
AA6 2 3 ? parallel      
AA6 3 4 ? parallel      
AA6 4 5 ? parallel      
AA6 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 67  ? MET A 71  ? ILE A 67  MET A 71  
AA1 2 LEU A 37  ? ILE A 42  ? LEU A 37  ILE A 42  
AA1 3 ASP A 105 ? ILE A 108 ? ASP A 105 ILE A 108 
AA2 1 VAL A 46  ? LYS A 47  ? VAL A 46  LYS A 47  
AA2 2 GLU A 60  ? LYS A 61  ? GLU A 60  LYS A 61  
AA3 1 SER A 121 ? VAL A 124 ? SER A 121 VAL A 124 
AA3 2 ILE A 206 ? ASP A 210 ? ILE A 206 ASP A 210 
AA3 3 THR A 237 ? SER A 241 ? THR A 237 SER A 241 
AA3 4 LEU A 75  ? LEU A 79  ? LEU A 75  LEU A 79  
AA3 5 SER A 255 ? ALA A 260 ? SER A 255 ALA A 260 
AA3 6 ARG A 263 ? GLY A 268 ? ARG A 263 GLY A 268 
AA4 1 ILE B 67  ? MET B 71  ? ILE B 67  MET B 71  
AA4 2 LEU B 37  ? ILE B 42  ? LEU B 37  ILE B 42  
AA4 3 ASP B 105 ? ILE B 108 ? ASP B 105 ILE B 108 
AA5 1 VAL B 46  ? LYS B 47  ? VAL B 46  LYS B 47  
AA5 2 GLU B 60  ? LYS B 61  ? GLU B 60  LYS B 61  
AA6 1 SER B 121 ? VAL B 124 ? SER B 121 VAL B 124 
AA6 2 ILE B 206 ? ASP B 210 ? ILE B 206 ASP B 210 
AA6 3 THR B 237 ? SER B 241 ? THR B 237 SER B 241 
AA6 4 LEU B 75  ? LEU B 79  ? LEU B 75  LEU B 79  
AA6 5 SER B 255 ? ALA B 260 ? SER B 255 ALA B 260 
AA6 6 ARG B 263 ? GLY B 268 ? ARG B 263 GLY B 268 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O MET A 71  ? O MET A 71  N LEU A 37  ? N LEU A 37  
AA1 2 3 N SER A 38  ? N SER A 38  O LEU A 107 ? O LEU A 107 
AA2 1 2 N VAL A 46  ? N VAL A 46  O LYS A 61  ? O LYS A 61  
AA3 1 2 N GLY A 122 ? N GLY A 122 O PHE A 208 ? O PHE A 208 
AA3 2 3 N LEU A 207 ? N LEU A 207 O THR A 237 ? O THR A 237 
AA3 3 4 O ILE A 238 ? O ILE A 238 N ASN A 76  ? N ASN A 76  
AA3 4 5 N LEU A 79  ? N LEU A 79  O THR A 257 ? O THR A 257 
AA3 5 6 N LEU A 258 ? N LEU A 258 O MET A 265 ? O MET A 265 
AA4 1 2 O MET B 71  ? O MET B 71  N LEU B 37  ? N LEU B 37  
AA4 2 3 N SER B 38  ? N SER B 38  O LEU B 107 ? O LEU B 107 
AA5 1 2 N VAL B 46  ? N VAL B 46  O LYS B 61  ? O LYS B 61  
AA6 1 2 N GLY B 122 ? N GLY B 122 O PHE B 208 ? O PHE B 208 
AA6 2 3 N LEU B 207 ? N LEU B 207 O THR B 237 ? O THR B 237 
AA6 3 4 O ILE B 238 ? O ILE B 238 N ASN B 76  ? N ASN B 76  
AA6 4 5 N LEU B 79  ? N LEU B 79  O THR B 257 ? O THR B 257 
AA6 5 6 N LEU B 258 ? N LEU B 258 O MET B 265 ? O MET B 265 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ATP 1501 ? 22 'binding site for residue ATP A 1501' 
AC2 Software A MG  1502 ? 6  'binding site for residue MG A 1502'  
AC3 Software B ATP 1501 ? 22 'binding site for residue ATP B 1501' 
AC4 Software B MG  1502 ? 6  'binding site for residue MG B 1502'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 22 VAL A 46  ? VAL A 46   . ? 1_555 ? 
2  AC1 22 LEU A 48  ? LEU A 48   . ? 1_555 ? 
3  AC1 22 LYS A 61  ? LYS A 61   . ? 1_555 ? 
4  AC1 22 ILE A 63  ? ILE A 63   . ? 1_555 ? 
5  AC1 22 PRO A 81  ? PRO A 81   . ? 1_555 ? 
6  AC1 22 THR A 82  ? THR A 82   . ? 1_555 ? 
7  AC1 22 GLY A 83  ? GLY A 83   . ? 1_555 ? 
8  AC1 22 GLY A 84  ? GLY A 84   . ? 1_555 ? 
9  AC1 22 GLY A 85  ? GLY A 85   . ? 1_555 ? 
10 AC1 22 LYS A 86  ? LYS A 86   . ? 1_555 ? 
11 AC1 22 SER A 87  ? SER A 87   . ? 1_555 ? 
12 AC1 22 SER A 88  ? SER A 88   . ? 1_555 ? 
13 AC1 22 GLN A 126 ? GLN A 126  . ? 1_555 ? 
14 AC1 22 GLN A 211 ? GLN A 211  . ? 1_555 ? 
15 AC1 22 HIS A 243 ? HIS A 243  . ? 1_555 ? 
16 AC1 22 MG  D .   ? MG  A 1502 . ? 1_555 ? 
17 AC1 22 ARG B 184 ? ARG B 184  . ? 1_555 ? 
18 AC1 22 GLY B 185 ? GLY B 185  . ? 1_555 ? 
19 AC1 22 SER B 187 ? SER B 187  . ? 1_555 ? 
20 AC1 22 GLY B 188 ? GLY B 188  . ? 1_555 ? 
21 AC1 22 GLY B 189 ? GLY B 189  . ? 1_555 ? 
22 AC1 22 GLU B 190 ? GLU B 190  . ? 1_555 ? 
23 AC2 6  LYS A 86  ? LYS A 86   . ? 1_555 ? 
24 AC2 6  SER A 87  ? SER A 87   . ? 1_555 ? 
25 AC2 6  ASP A 210 ? ASP A 210  . ? 1_555 ? 
26 AC2 6  GLN A 211 ? GLN A 211  . ? 1_555 ? 
27 AC2 6  SER A 241 ? SER A 241  . ? 1_555 ? 
28 AC2 6  ATP C .   ? ATP A 1501 . ? 1_555 ? 
29 AC3 22 VAL A 173 ? VAL A 173  . ? 1_555 ? 
30 AC3 22 ARG A 184 ? ARG A 184  . ? 1_555 ? 
31 AC3 22 GLY A 185 ? GLY A 185  . ? 1_555 ? 
32 AC3 22 SER A 187 ? SER A 187  . ? 1_555 ? 
33 AC3 22 GLY A 189 ? GLY A 189  . ? 1_555 ? 
34 AC3 22 GLU A 190 ? GLU A 190  . ? 1_555 ? 
35 AC3 22 VAL B 46  ? VAL B 46   . ? 1_555 ? 
36 AC3 22 LEU B 48  ? LEU B 48   . ? 1_555 ? 
37 AC3 22 LYS B 61  ? LYS B 61   . ? 1_555 ? 
38 AC3 22 ILE B 63  ? ILE B 63   . ? 1_555 ? 
39 AC3 22 PRO B 81  ? PRO B 81   . ? 1_555 ? 
40 AC3 22 THR B 82  ? THR B 82   . ? 1_555 ? 
41 AC3 22 GLY B 83  ? GLY B 83   . ? 1_555 ? 
42 AC3 22 GLY B 84  ? GLY B 84   . ? 1_555 ? 
43 AC3 22 GLY B 85  ? GLY B 85   . ? 1_555 ? 
44 AC3 22 LYS B 86  ? LYS B 86   . ? 1_555 ? 
45 AC3 22 SER B 87  ? SER B 87   . ? 1_555 ? 
46 AC3 22 SER B 88  ? SER B 88   . ? 1_555 ? 
47 AC3 22 GLN B 126 ? GLN B 126  . ? 1_555 ? 
48 AC3 22 GLN B 211 ? GLN B 211  . ? 1_555 ? 
49 AC3 22 HIS B 243 ? HIS B 243  . ? 1_555 ? 
50 AC3 22 MG  F .   ? MG  B 1502 . ? 1_555 ? 
51 AC4 6  LYS B 86  ? LYS B 86   . ? 1_555 ? 
52 AC4 6  SER B 87  ? SER B 87   . ? 1_555 ? 
53 AC4 6  ASP B 210 ? ASP B 210  . ? 1_555 ? 
54 AC4 6  GLN B 211 ? GLN B 211  . ? 1_555 ? 
55 AC4 6  SER B 241 ? SER B 241  . ? 1_555 ? 
56 AC4 6  ATP E .   ? ATP B 1501 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6HBU 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 34  ? 87.077  77.335  141.213 1.00 21.18  ? 34   GLY A N     1 
ATOM   2    C  CA    . GLY A 1 34  ? 88.068  78.267  140.711 1.00 21.18  ? 34   GLY A CA    1 
ATOM   3    C  C     . GLY A 1 34  ? 89.156  77.581  139.916 1.00 21.18  ? 34   GLY A C     1 
ATOM   4    O  O     . GLY A 1 34  ? 89.266  76.360  139.934 1.00 21.18  ? 34   GLY A O     1 
ATOM   5    N  N     . ALA A 1 35  ? 89.964  78.368  139.217 1.00 19.56  ? 35   ALA A N     1 
ATOM   6    C  CA    . ALA A 1 35  ? 91.042  77.847  138.390 1.00 19.56  ? 35   ALA A CA    1 
ATOM   7    C  C     . ALA A 1 35  ? 92.355  77.921  139.152 1.00 19.56  ? 35   ALA A C     1 
ATOM   8    O  O     . ALA A 1 35  ? 92.714  78.978  139.677 1.00 19.56  ? 35   ALA A O     1 
ATOM   9    C  CB    . ALA A 1 35  ? 91.149  78.623  137.079 1.00 19.56  ? 35   ALA A CB    1 
ATOM   10   N  N     . VAL A 1 36  ? 93.061  76.803  139.214 1.00 18.16  ? 36   VAL A N     1 
ATOM   11   C  CA    . VAL A 1 36  ? 94.340  76.712  139.900 1.00 18.16  ? 36   VAL A CA    1 
ATOM   12   C  C     . VAL A 1 36  ? 95.402  76.637  138.815 1.00 18.16  ? 36   VAL A C     1 
ATOM   13   O  O     . VAL A 1 36  ? 95.666  75.567  138.261 1.00 18.16  ? 36   VAL A O     1 
ATOM   14   C  CB    . VAL A 1 36  ? 94.406  75.500  140.835 1.00 18.16  ? 36   VAL A CB    1 
ATOM   15   C  CG1   . VAL A 1 36  ? 95.743  75.447  141.538 1.00 18.16  ? 36   VAL A CG1   1 
ATOM   16   C  CG2   . VAL A 1 36  ? 93.275  75.536  141.838 1.00 18.16  ? 36   VAL A CG2   1 
ATOM   17   N  N     . LEU A 1 37  ? 96.002  77.773  138.490 1.00 17.49  ? 37   LEU A N     1 
ATOM   18   C  CA    . LEU A 1 37  ? 97.085  77.804  137.518 1.00 17.49  ? 37   LEU A CA    1 
ATOM   19   C  C     . LEU A 1 37  ? 98.387  77.471  138.231 1.00 17.49  ? 37   LEU A C     1 
ATOM   20   O  O     . LEU A 1 37  ? 98.746  78.125  139.212 1.00 17.49  ? 37   LEU A O     1 
ATOM   21   C  CB    . LEU A 1 37  ? 97.148  79.171  136.839 1.00 17.49  ? 37   LEU A CB    1 
ATOM   22   C  CG    . LEU A 1 37  ? 98.077  79.392  135.644 1.00 17.49  ? 37   LEU A CG    1 
ATOM   23   C  CD1   . LEU A 1 37  ? 97.449  80.357  134.682 1.00 17.49  ? 37   LEU A CD1   1 
ATOM   24   C  CD2   . LEU A 1 37  ? 99.391  79.953  136.085 1.00 17.49  ? 37   LEU A CD2   1 
ATOM   25   N  N     . SER A 1 38  ? 99.094  76.463  137.735 1.00 19.38  ? 38   SER A N     1 
ATOM   26   C  CA    . SER A 1 38  ? 100.334 76.000  138.338 1.00 19.38  ? 38   SER A CA    1 
ATOM   27   C  C     . SER A 1 38  ? 101.403 75.908  137.266 1.00 19.38  ? 38   SER A C     1 
ATOM   28   O  O     . SER A 1 38  ? 101.149 75.395  136.176 1.00 19.38  ? 38   SER A O     1 
ATOM   29   C  CB    . SER A 1 38  ? 100.140 74.647  139.016 1.00 19.38  ? 38   SER A CB    1 
ATOM   30   O  OG    . SER A 1 38  ? 99.800  73.657  138.071 1.00 19.38  ? 38   SER A OG    1 
ATOM   31   N  N     . PHE A 1 39  ? 102.590 76.404  137.575 1.00 19.88  ? 39   PHE A N     1 
ATOM   32   C  CA    . PHE A 1 39  ? 103.695 76.442  136.632 1.00 19.88  ? 39   PHE A CA    1 
ATOM   33   C  C     . PHE A 1 39  ? 104.916 75.802  137.271 1.00 19.88  ? 39   PHE A C     1 
ATOM   34   O  O     . PHE A 1 39  ? 105.214 76.043  138.441 1.00 19.88  ? 39   PHE A O     1 
ATOM   35   C  CB    . PHE A 1 39  ? 103.974 77.880  136.163 1.00 19.88  ? 39   PHE A CB    1 
ATOM   36   C  CG    . PHE A 1 39  ? 104.223 78.864  137.274 1.00 19.88  ? 39   PHE A CG    1 
ATOM   37   C  CD1   . PHE A 1 39  ? 103.173 79.531  137.888 1.00 19.88  ? 39   PHE A CD1   1 
ATOM   38   C  CD2   . PHE A 1 39  ? 105.504 79.173  137.664 1.00 19.88  ? 39   PHE A CD2   1 
ATOM   39   C  CE1   . PHE A 1 39  ? 103.405 80.438  138.896 1.00 19.88  ? 39   PHE A CE1   1 
ATOM   40   C  CE2   . PHE A 1 39  ? 105.725 80.085  138.667 1.00 19.88  ? 39   PHE A CE2   1 
ATOM   41   C  CZ    . PHE A 1 39  ? 104.682 80.716  139.275 1.00 19.88  ? 39   PHE A CZ    1 
ATOM   42   N  N     . HIS A 1 40  ? 105.614 74.978  136.493 1.00 24.70  ? 40   HIS A N     1 
ATOM   43   C  CA    . HIS A 1 40  ? 106.548 73.996  137.029 1.00 24.70  ? 40   HIS A CA    1 
ATOM   44   C  C     . HIS A 1 40  ? 107.796 73.966  136.163 1.00 24.70  ? 40   HIS A C     1 
ATOM   45   O  O     . HIS A 1 40  ? 107.700 73.672  134.968 1.00 24.70  ? 40   HIS A O     1 
ATOM   46   C  CB    . HIS A 1 40  ? 105.885 72.618  137.065 1.00 24.70  ? 40   HIS A CB    1 
ATOM   47   C  CG    . HIS A 1 40  ? 106.674 71.577  137.792 1.00 24.70  ? 40   HIS A CG    1 
ATOM   48   N  ND1   . HIS A 1 40  ? 106.422 70.230  137.657 1.00 24.70  ? 40   HIS A ND1   1 
ATOM   49   C  CD2   . HIS A 1 40  ? 107.691 71.683  138.677 1.00 24.70  ? 40   HIS A CD2   1 
ATOM   50   C  CE1   . HIS A 1 40  ? 107.261 69.550  138.416 1.00 24.70  ? 40   HIS A CE1   1 
ATOM   51   N  NE2   . HIS A 1 40  ? 108.041 70.407  139.046 1.00 24.70  ? 40   HIS A NE2   1 
ATOM   52   N  N     . ASN A 1 41  ? 108.953 74.252  136.776 1.00 22.33  ? 41   ASN A N     1 
ATOM   53   C  CA    . ASN A 1 41  ? 110.273 74.252  136.126 1.00 22.33  ? 41   ASN A CA    1 
ATOM   54   C  C     . ASN A 1 41  ? 110.325 75.192  134.928 1.00 22.33  ? 41   ASN A C     1 
ATOM   55   O  O     . ASN A 1 41  ? 110.896 74.864  133.890 1.00 22.33  ? 41   ASN A O     1 
ATOM   56   C  CB    . ASN A 1 41  ? 110.710 72.843  135.720 1.00 22.33  ? 41   ASN A CB    1 
ATOM   57   C  CG    . ASN A 1 41  ? 111.008 71.963  136.907 1.00 22.33  ? 41   ASN A CG    1 
ATOM   58   O  OD1   . ASN A 1 41  ? 110.328 70.967  137.142 1.00 22.33  ? 41   ASN A OD1   1 
ATOM   59   N  ND2   . ASN A 1 41  ? 112.034 72.323  137.662 1.00 22.33  ? 41   ASN A ND2   1 
ATOM   60   N  N     . ILE A 1 42  ? 109.733 76.371  135.078 1.00 20.36  ? 42   ILE A N     1 
ATOM   61   C  CA    . ILE A 1 42  ? 109.685 77.337  133.989 1.00 20.36  ? 42   ILE A CA    1 
ATOM   62   C  C     . ILE A 1 42  ? 111.068 77.936  133.790 1.00 20.36  ? 42   ILE A C     1 
ATOM   63   O  O     . ILE A 1 42  ? 111.662 78.480  134.723 1.00 20.36  ? 42   ILE A O     1 
ATOM   64   C  CB    . ILE A 1 42  ? 108.653 78.432  134.275 1.00 20.36  ? 42   ILE A CB    1 
ATOM   65   C  CG1   . ILE A 1 42  ? 107.262 77.829  134.421 1.00 20.36  ? 42   ILE A CG1   1 
ATOM   66   C  CG2   . ILE A 1 42  ? 108.676 79.478  133.187 1.00 20.36  ? 42   ILE A CG2   1 
ATOM   67   C  CD1   . ILE A 1 42  ? 106.778 77.126  133.188 1.00 20.36  ? 42   ILE A CD1   1 
ATOM   68   N  N     . CYS A 1 43  ? 111.592 77.822  132.578 1.00 20.51  ? 43   CYS A N     1 
ATOM   69   C  CA    . CYS A 1 43  ? 112.777 78.552  132.169 1.00 20.51  ? 43   CYS A CA    1 
ATOM   70   C  C     . CYS A 1 43  ? 112.455 79.295  130.884 1.00 20.51  ? 43   CYS A C     1 
ATOM   71   O  O     . CYS A 1 43  ? 111.467 79.000  130.212 1.00 20.51  ? 43   CYS A O     1 
ATOM   72   C  CB    . CYS A 1 43  ? 113.983 77.635  131.957 1.00 20.51  ? 43   CYS A CB    1 
ATOM   73   S  SG    . CYS A 1 43  ? 114.549 76.766  133.421 1.00 20.51  ? 43   CYS A SG    1 
ATOM   74   N  N     . TYR A 1 44  ? 113.290 80.268  130.542 1.00 19.37  ? 44   TYR A N     1 
ATOM   75   C  CA    . TYR A 1 44  ? 113.093 80.985  129.296 1.00 19.37  ? 44   TYR A CA    1 
ATOM   76   C  C     . TYR A 1 44  ? 114.456 81.410  128.767 1.00 19.37  ? 44   TYR A C     1 
ATOM   77   O  O     . TYR A 1 44  ? 115.439 81.441  129.503 1.00 19.37  ? 44   TYR A O     1 
ATOM   78   C  CB    . TYR A 1 44  ? 112.122 82.157  129.490 1.00 19.37  ? 44   TYR A CB    1 
ATOM   79   C  CG    . TYR A 1 44  ? 111.734 82.836  128.208 1.00 19.37  ? 44   TYR A CG    1 
ATOM   80   C  CD1   . TYR A 1 44  ? 111.036 82.149  127.231 1.00 19.37  ? 44   TYR A CD1   1 
ATOM   81   C  CD2   . TYR A 1 44  ? 112.039 84.164  127.986 1.00 19.37  ? 44   TYR A CD2   1 
ATOM   82   C  CE1   . TYR A 1 44  ? 110.687 82.750  126.051 1.00 19.37  ? 44   TYR A CE1   1 
ATOM   83   C  CE2   . TYR A 1 44  ? 111.689 84.777  126.816 1.00 19.37  ? 44   TYR A CE2   1 
ATOM   84   C  CZ    . TYR A 1 44  ? 111.020 84.067  125.846 1.00 19.37  ? 44   TYR A CZ    1 
ATOM   85   O  OH    . TYR A 1 44  ? 110.665 84.689  124.674 1.00 19.37  ? 44   TYR A OH    1 
ATOM   86   N  N     . ARG A 1 45  ? 114.531 81.639  127.459 1.00 24.65  ? 45   ARG A N     1 
ATOM   87   C  CA    . ARG A 1 45  ? 115.753 82.097  126.813 1.00 24.65  ? 45   ARG A CA    1 
ATOM   88   C  C     . ARG A 1 45  ? 115.394 83.059  125.694 1.00 24.65  ? 45   ARG A C     1 
ATOM   89   O  O     . ARG A 1 45  ? 114.332 82.955  125.079 1.00 24.65  ? 45   ARG A O     1 
ATOM   90   C  CB    . ARG A 1 45  ? 116.587 80.946  126.230 1.00 24.65  ? 45   ARG A CB    1 
ATOM   91   C  CG    . ARG A 1 45  ? 117.296 80.057  127.237 1.00 24.65  ? 45   ARG A CG    1 
ATOM   92   C  CD    . ARG A 1 45  ? 118.049 78.955  126.538 1.00 24.65  ? 45   ARG A CD    1 
ATOM   93   N  NE    . ARG A 1 45  ? 117.134 78.057  125.845 1.00 24.65  ? 45   ARG A NE    1 
ATOM   94   C  CZ    . ARG A 1 45  ? 117.517 77.081  125.030 1.00 24.65  ? 45   ARG A CZ    1 
ATOM   95   N  NH1   . ARG A 1 45  ? 118.807 76.872  124.805 1.00 24.65  ? 45   ARG A NH1   1 
ATOM   96   N  NH2   . ARG A 1 45  ? 116.609 76.315  124.441 1.00 24.65  ? 45   ARG A NH2   1 
ATOM   97   N  N     . VAL A 1 46  ? 116.298 83.995  125.433 1.00 27.30  ? 46   VAL A N     1 
ATOM   98   C  CA    . VAL A 1 46  ? 116.131 85.000  124.392 1.00 27.30  ? 46   VAL A CA    1 
ATOM   99   C  C     . VAL A 1 46  ? 117.386 85.004  123.538 1.00 27.30  ? 46   VAL A C     1 
ATOM   100  O  O     . VAL A 1 46  ? 118.488 85.213  124.056 1.00 27.30  ? 46   VAL A O     1 
ATOM   101  C  CB    . VAL A 1 46  ? 115.872 86.398  124.976 1.00 27.30  ? 46   VAL A CB    1 
ATOM   102  C  CG1   . VAL A 1 46  ? 116.052 87.458  123.923 1.00 27.30  ? 46   VAL A CG1   1 
ATOM   103  C  CG2   . VAL A 1 46  ? 114.478 86.477  125.496 1.00 27.30  ? 46   VAL A CG2   1 
ATOM   104  N  N     . LYS A 1 47  ? 117.221 84.773  122.239 1.00 37.01  ? 47   LYS A N     1 
ATOM   105  C  CA    . LYS A 1 47  ? 118.325 84.863  121.294 1.00 37.01  ? 47   LYS A CA    1 
ATOM   106  C  C     . LYS A 1 47  ? 118.489 86.316  120.869 1.00 37.01  ? 47   LYS A C     1 
ATOM   107  O  O     . LYS A 1 47  ? 117.607 86.884  120.216 1.00 37.01  ? 47   LYS A O     1 
ATOM   108  C  CB    . LYS A 1 47  ? 118.069 83.963  120.091 1.00 37.01  ? 47   LYS A CB    1 
ATOM   109  C  CG    . LYS A 1 47  ? 118.036 82.495  120.434 1.00 37.01  ? 47   LYS A CG    1 
ATOM   110  C  CD    . LYS A 1 47  ? 117.804 81.648  119.203 1.00 37.01  ? 47   LYS A CD    1 
ATOM   111  C  CE    . LYS A 1 47  ? 117.840 80.173  119.545 1.00 37.01  ? 47   LYS A CE    1 
ATOM   112  N  NZ    . LYS A 1 47  ? 116.700 79.786  120.419 1.00 37.01  ? 47   LYS A NZ    1 
ATOM   113  N  N     . LEU A 1 48  ? 119.611 86.920  121.240 1.00 38.80  ? 48   LEU A N     1 
ATOM   114  C  CA    . LEU A 1 48  ? 119.908 88.290  120.847 1.00 38.80  ? 48   LEU A CA    1 
ATOM   115  C  C     . LEU A 1 48  ? 120.762 88.332  119.583 1.00 38.80  ? 48   LEU A C     1 
ATOM   116  O  O     . LEU A 1 48  ? 120.352 88.876  118.558 1.00 38.80  ? 48   LEU A O     1 
ATOM   117  C  CB    . LEU A 1 48  ? 120.614 89.029  121.982 1.00 38.80  ? 48   LEU A CB    1 
ATOM   118  C  CG    . LEU A 1 48  ? 119.757 89.283  123.219 1.00 38.80  ? 48   LEU A CG    1 
ATOM   119  C  CD1   . LEU A 1 48  ? 120.571 89.935  124.324 1.00 38.80  ? 48   LEU A CD1   1 
ATOM   120  C  CD2   . LEU A 1 48  ? 118.572 90.145  122.849 1.00 38.80  ? 48   LEU A CD2   1 
ATOM   121  N  N     . PRO A 1 58  ? 121.874 82.776  117.702 1.00 42.95  ? 58   PRO A N     1 
ATOM   122  C  CA    . PRO A 1 58  ? 122.956 83.659  118.148 1.00 42.95  ? 58   PRO A CA    1 
ATOM   123  C  C     . PRO A 1 58  ? 123.266 83.523  119.633 1.00 42.95  ? 58   PRO A C     1 
ATOM   124  O  O     . PRO A 1 58  ? 123.366 82.409  120.145 1.00 42.95  ? 58   PRO A O     1 
ATOM   125  C  CB    . PRO A 1 58  ? 122.418 85.058  117.833 1.00 42.95  ? 58   PRO A CB    1 
ATOM   126  C  CG    . PRO A 1 58  ? 120.949 84.907  117.844 1.00 42.95  ? 58   PRO A CG    1 
ATOM   127  C  CD    . PRO A 1 58  ? 120.675 83.533  117.306 1.00 42.95  ? 58   PRO A CD    1 
ATOM   128  N  N     . VAL A 1 59  ? 123.416 84.657  120.311 1.00 41.18  ? 59   VAL A N     1 
ATOM   129  C  CA    . VAL A 1 59  ? 123.768 84.686  121.725 1.00 41.18  ? 59   VAL A CA    1 
ATOM   130  C  C     . VAL A 1 59  ? 122.488 84.597  122.544 1.00 41.18  ? 59   VAL A C     1 
ATOM   131  O  O     . VAL A 1 59  ? 121.620 85.471  122.451 1.00 41.18  ? 59   VAL A O     1 
ATOM   132  C  CB    . VAL A 1 59  ? 124.554 85.957  122.071 1.00 41.18  ? 59   VAL A CB    1 
ATOM   133  C  CG1   . VAL A 1 59  ? 124.865 86.000  123.556 1.00 41.18  ? 59   VAL A CG1   1 
ATOM   134  C  CG2   . VAL A 1 59  ? 125.825 86.034  121.243 1.00 41.18  ? 59   VAL A CG2   1 
ATOM   135  N  N     . GLU A 1 60  ? 122.370 83.545  123.346 1.00 38.03  ? 60   GLU A N     1 
ATOM   136  C  CA    . GLU A 1 60  ? 121.200 83.347  124.187 1.00 38.03  ? 60   GLU A CA    1 
ATOM   137  C  C     . GLU A 1 60  ? 121.431 83.955  125.562 1.00 38.03  ? 60   GLU A C     1 
ATOM   138  O  O     . GLU A 1 60  ? 122.542 83.915  126.094 1.00 38.03  ? 60   GLU A O     1 
ATOM   139  C  CB    . GLU A 1 60  ? 120.867 81.862  124.329 1.00 38.03  ? 60   GLU A CB    1 
ATOM   140  C  CG    . GLU A 1 60  ? 120.373 81.204  123.053 1.00 38.03  ? 60   GLU A CG    1 
ATOM   141  C  CD    . GLU A 1 60  ? 121.499 80.688  122.174 1.00 38.03  ? 60   GLU A CD    1 
ATOM   142  O  OE1   . GLU A 1 60  ? 122.672 80.754  122.600 1.00 38.03  ? 60   GLU A OE1   1 
ATOM   143  O  OE2   . GLU A 1 60  ? 121.213 80.222  121.051 1.00 38.03  ? 60   GLU A OE2   1 
ATOM   144  N  N     . LYS A 1 61  ? 120.374 84.528  126.126 1.00 26.98  ? 61   LYS A N     1 
ATOM   145  C  CA    . LYS A 1 61  ? 120.409 85.091  127.466 1.00 26.98  ? 61   LYS A CA    1 
ATOM   146  C  C     . LYS A 1 61  ? 119.262 84.503  128.267 1.00 26.98  ? 61   LYS A C     1 
ATOM   147  O  O     . LYS A 1 61  ? 118.140 84.397  127.769 1.00 26.98  ? 61   LYS A O     1 
ATOM   148  C  CB    . LYS A 1 61  ? 120.325 86.612  127.430 1.00 26.98  ? 61   LYS A CB    1 
ATOM   149  C  CG    . LYS A 1 61  ? 120.440 87.271  128.788 1.00 26.98  ? 61   LYS A CG    1 
ATOM   150  C  CD    . LYS A 1 61  ? 120.598 88.774  128.662 1.00 26.98  ? 61   LYS A CD    1 
ATOM   151  C  CE    . LYS A 1 61  ? 119.271 89.500  128.592 1.00 26.98  ? 61   LYS A CE    1 
ATOM   152  N  NZ    . LYS A 1 61  ? 118.729 89.548  127.211 1.00 26.98  ? 61   LYS A NZ    1 
ATOM   153  N  N     . GLU A 1 62  ? 119.553 84.101  129.502 1.00 23.14  ? 62   GLU A N     1 
ATOM   154  C  CA    . GLU A 1 62  ? 118.603 83.339  130.307 1.00 23.14  ? 62   GLU A CA    1 
ATOM   155  C  C     . GLU A 1 62  ? 117.838 84.296  131.214 1.00 23.14  ? 62   GLU A C     1 
ATOM   156  O  O     . GLU A 1 62  ? 118.167 84.510  132.378 1.00 23.14  ? 62   GLU A O     1 
ATOM   157  C  CB    . GLU A 1 62  ? 119.317 82.253  131.096 1.00 23.14  ? 62   GLU A CB    1 
ATOM   158  C  CG    . GLU A 1 62  ? 118.385 81.284  131.795 1.00 23.14  ? 62   GLU A CG    1 
ATOM   159  C  CD    . GLU A 1 62  ? 119.133 80.165  132.483 1.00 23.14  ? 62   GLU A CD    1 
ATOM   160  O  OE1   . GLU A 1 62  ? 120.381 80.167  132.427 1.00 23.14  ? 62   GLU A OE1   1 
ATOM   161  O  OE2   . GLU A 1 62  ? 118.477 79.281  133.075 1.00 23.14  ? 62   GLU A OE2   1 
ATOM   162  N  N     . ILE A 1 63  ? 116.813 84.908  130.636 1.00 17.77  ? 63   ILE A N     1 
ATOM   163  C  CA    . ILE A 1 63  ? 115.748 85.510  131.416 1.00 17.77  ? 63   ILE A CA    1 
ATOM   164  C  C     . ILE A 1 63  ? 114.932 84.372  132.002 1.00 17.77  ? 63   ILE A C     1 
ATOM   165  O  O     . ILE A 1 63  ? 114.716 83.368  131.322 1.00 17.77  ? 63   ILE A O     1 
ATOM   166  C  CB    . ILE A 1 63  ? 114.902 86.425  130.510 1.00 17.77  ? 63   ILE A CB    1 
ATOM   167  C  CG1   . ILE A 1 63  ? 115.743 87.575  129.964 1.00 17.77  ? 63   ILE A CG1   1 
ATOM   168  C  CG2   . ILE A 1 63  ? 113.743 87.021  131.233 1.00 17.77  ? 63   ILE A CG2   1 
ATOM   169  C  CD1   . ILE A 1 63  ? 116.235 87.395  128.563 1.00 17.77  ? 63   ILE A CD1   1 
ATOM   170  N  N     . LEU A 1 64  ? 114.507 84.497  133.268 1.00 15.97  ? 64   LEU A N     1 
ATOM   171  C  CA    . LEU A 1 64  ? 113.691 83.479  133.947 1.00 15.97  ? 64   LEU A CA    1 
ATOM   172  C  C     . LEU A 1 64  ? 114.357 82.111  134.085 1.00 15.97  ? 64   LEU A C     1 
ATOM   173  O  O     . LEU A 1 64  ? 114.088 81.195  133.319 1.00 15.97  ? 64   LEU A O     1 
ATOM   174  C  CB    . LEU A 1 64  ? 112.315 83.286  133.300 1.00 15.97  ? 64   LEU A CB    1 
ATOM   175  C  CG    . LEU A 1 64  ? 111.116 84.056  133.813 1.00 15.97  ? 64   LEU A CG    1 
ATOM   176  C  CD1   . LEU A 1 64  ? 111.301 85.507  133.616 1.00 15.97  ? 64   LEU A CD1   1 
ATOM   177  C  CD2   . LEU A 1 64  ? 109.932 83.562  133.039 1.00 15.97  ? 64   LEU A CD2   1 
ATOM   178  N  N     . SER A 1 65  ? 115.270 81.997  135.044 1.00 18.96  ? 65   SER A N     1 
ATOM   179  C  CA    . SER A 1 65  ? 115.762 80.703  135.513 1.00 18.96  ? 65   SER A CA    1 
ATOM   180  C  C     . SER A 1 65  ? 114.648 79.902  136.204 1.00 18.96  ? 65   SER A C     1 
ATOM   181  O  O     . SER A 1 65  ? 113.465 80.211  136.077 1.00 18.96  ? 65   SER A O     1 
ATOM   182  C  CB    . SER A 1 65  ? 116.962 80.898  136.427 1.00 18.96  ? 65   SER A CB    1 
ATOM   183  O  OG    . SER A 1 65  ? 118.021 81.536  135.737 1.00 18.96  ? 65   SER A OG    1 
ATOM   184  N  N     . ASN A 1 66  ? 115.008 78.815  136.894 1.00 20.66  ? 66   ASN A N     1 
ATOM   185  C  CA    . ASN A 1 66  ? 114.056 77.853  137.464 1.00 20.66  ? 66   ASN A CA    1 
ATOM   186  C  C     . ASN A 1 66  ? 113.035 78.472  138.416 1.00 20.66  ? 66   ASN A C     1 
ATOM   187  O  O     . ASN A 1 66  ? 113.395 78.944  139.497 1.00 20.66  ? 66   ASN A O     1 
ATOM   188  C  CB    . ASN A 1 66  ? 114.814 76.762  138.222 1.00 20.66  ? 66   ASN A CB    1 
ATOM   189  C  CG    . ASN A 1 66  ? 115.625 75.873  137.313 1.00 20.66  ? 66   ASN A CG    1 
ATOM   190  O  OD1   . ASN A 1 66  ? 115.141 75.402  136.288 1.00 20.66  ? 66   ASN A OD1   1 
ATOM   191  N  ND2   . ASN A 1 66  ? 116.881 75.653  137.676 1.00 20.66  ? 66   ASN A ND2   1 
ATOM   192  N  N     . ILE A 1 67  ? 111.765 78.492  138.013 1.00 20.20  ? 67   ILE A N     1 
ATOM   193  C  CA    . ILE A 1 67  ? 110.698 79.151  138.759 1.00 20.20  ? 67   ILE A CA    1 
ATOM   194  C  C     . ILE A 1 67  ? 109.532 78.186  138.885 1.00 20.20  ? 67   ILE A C     1 
ATOM   195  O  O     . ILE A 1 67  ? 109.051 77.654  137.882 1.00 20.20  ? 67   ILE A O     1 
ATOM   196  C  CB    . ILE A 1 67  ? 110.238 80.459  138.085 1.00 20.20  ? 67   ILE A CB    1 
ATOM   197  C  CG1   . ILE A 1 67  ? 111.344 81.497  138.099 1.00 20.20  ? 67   ILE A CG1   1 
ATOM   198  C  CG2   . ILE A 1 67  ? 109.106 81.076  138.836 1.00 20.20  ? 67   ILE A CG2   1 
ATOM   199  C  CD1   . ILE A 1 67  ? 111.055 82.645  137.234 1.00 20.20  ? 67   ILE A CD1   1 
ATOM   200  N  N     . ASN A 1 68  ? 109.074 77.972  140.112 1.00 22.04  ? 68   ASN A N     1 
ATOM   201  C  CA    . ASN A 1 68  ? 108.011 77.033  140.425 1.00 22.04  ? 68   ASN A CA    1 
ATOM   202  C  C     . ASN A 1 68  ? 106.976 77.736  141.283 1.00 22.04  ? 68   ASN A C     1 
ATOM   203  O  O     . ASN A 1 68  ? 107.331 78.498  142.183 1.00 22.04  ? 68   ASN A O     1 
ATOM   204  C  CB    . ASN A 1 68  ? 108.567 75.830  141.171 1.00 22.04  ? 68   ASN A CB    1 
ATOM   205  C  CG    . ASN A 1 68  ? 109.470 74.991  140.314 1.00 22.04  ? 68   ASN A CG    1 
ATOM   206  O  OD1   . ASN A 1 68  ? 109.145 74.694  139.177 1.00 22.04  ? 68   ASN A OD1   1 
ATOM   207  N  ND2   . ASN A 1 68  ? 110.622 74.625  140.845 1.00 22.04  ? 68   ASN A ND2   1 
ATOM   208  N  N     . GLY A 1 69  ? 105.704 77.478  141.020 1.00 20.48  ? 69   GLY A N     1 
ATOM   209  C  CA    . GLY A 1 69  ? 104.673 78.151  141.785 1.00 20.48  ? 69   GLY A CA    1 
ATOM   210  C  C     . GLY A 1 69  ? 103.296 77.633  141.450 1.00 20.48  ? 69   GLY A C     1 
ATOM   211  O  O     . GLY A 1 69  ? 103.087 76.945  140.449 1.00 20.48  ? 69   GLY A O     1 
ATOM   212  N  N     . ILE A 1 70  ? 102.358 77.967  142.334 1.00 20.04  ? 70   ILE A N     1 
ATOM   213  C  CA    . ILE A 1 70  ? 100.945 77.628  142.226 1.00 20.04  ? 70   ILE A CA    1 
ATOM   214  C  C     . ILE A 1 70  ? 100.166 78.900  142.508 1.00 20.04  ? 70   ILE A C     1 
ATOM   215  O  O     . ILE A 1 70  ? 100.490 79.624  143.454 1.00 20.04  ? 70   ILE A O     1 
ATOM   216  C  CB    . ILE A 1 70  ? 100.544 76.527  143.226 1.00 20.04  ? 70   ILE A CB    1 
ATOM   217  C  CG1   . ILE A 1 70  ? 101.314 75.247  142.958 1.00 20.04  ? 70   ILE A CG1   1 
ATOM   218  C  CG2   . ILE A 1 70  ? 99.066  76.215  143.157 1.00 20.04  ? 70   ILE A CG2   1 
ATOM   219  C  CD1   . ILE A 1 70  ? 101.198 74.265  144.039 1.00 20.04  ? 70   ILE A CD1   1 
ATOM   220  N  N     . MET A 1 71  ? 99.155  79.187  141.691 1.00 17.18  ? 71   MET A N     1 
ATOM   221  C  CA    . MET A 1 71  ? 98.354  80.401  141.843 1.00 17.18  ? 71   MET A CA    1 
ATOM   222  C  C     . MET A 1 71  ? 96.880  80.028  141.944 1.00 17.18  ? 71   MET A C     1 
ATOM   223  O  O     . MET A 1 71  ? 96.183  79.904  140.939 1.00 17.18  ? 71   MET A O     1 
ATOM   224  C  CB    . MET A 1 71  ? 98.651  81.355  140.707 1.00 17.18  ? 71   MET A CB    1 
ATOM   225  C  CG    . MET A 1 71  ? 99.987  82.017  140.925 1.00 17.18  ? 71   MET A CG    1 
ATOM   226  S  SD    . MET A 1 71  ? 100.654 82.981  139.595 1.00 17.18  ? 71   MET A SD    1 
ATOM   227  C  CE    . MET A 1 71  ? 102.121 83.615  140.384 1.00 17.18  ? 71   MET A CE    1 
ATOM   228  N  N     . LYS A 1 72  ? 96.422  79.865  143.181 1.00 17.68  ? 72   LYS A N     1 
ATOM   229  C  CA    . LYS A 1 72  ? 95.065  79.463  143.499 1.00 17.68  ? 72   LYS A CA    1 
ATOM   230  C  C     . LYS A 1 72  ? 94.098  80.630  143.270 1.00 17.68  ? 72   LYS A C     1 
ATOM   231  O  O     . LYS A 1 72  ? 94.538  81.771  143.121 1.00 17.68  ? 72   LYS A O     1 
ATOM   232  C  CB    . LYS A 1 72  ? 95.035  78.981  144.951 1.00 17.68  ? 72   LYS A CB    1 
ATOM   233  C  CG    . LYS A 1 72  ? 95.796  77.696  145.175 1.00 17.68  ? 72   LYS A CG    1 
ATOM   234  C  CD    . LYS A 1 72  ? 95.674  77.231  146.610 1.00 17.68  ? 72   LYS A CD    1 
ATOM   235  C  CE    . LYS A 1 72  ? 96.473  75.964  146.833 1.00 17.68  ? 72   LYS A CE    1 
ATOM   236  N  NZ    . LYS A 1 72  ? 95.892  74.828  146.063 1.00 17.68  ? 72   LYS A NZ    1 
ATOM   237  N  N     . PRO A 1 73  ? 92.783  80.373  143.199 1.00 18.27  ? 73   PRO A N     1 
ATOM   238  C  CA    . PRO A 1 73  ? 91.826  81.484  143.045 1.00 18.27  ? 73   PRO A CA    1 
ATOM   239  C  C     . PRO A 1 73  ? 91.829  82.456  144.214 1.00 18.27  ? 73   PRO A C     1 
ATOM   240  O  O     . PRO A 1 73  ? 91.484  82.109  145.344 1.00 18.27  ? 73   PRO A O     1 
ATOM   241  C  CB    . PRO A 1 73  ? 90.476  80.772  142.902 1.00 18.27  ? 73   PRO A CB    1 
ATOM   242  C  CG    . PRO A 1 73  ? 90.695  79.406  143.389 1.00 18.27  ? 73   PRO A CG    1 
ATOM   243  C  CD    . PRO A 1 73  ? 92.095  79.083  143.014 1.00 18.27  ? 73   PRO A CD    1 
ATOM   244  N  N     . GLY A 1 74  ? 92.217  83.690  143.914 1.00 16.27  ? 74   GLY A N     1 
ATOM   245  C  CA    . GLY A 1 74  ? 92.373  84.753  144.878 1.00 16.27  ? 74   GLY A CA    1 
ATOM   246  C  C     . GLY A 1 74  ? 92.997  85.953  144.202 1.00 16.27  ? 74   GLY A C     1 
ATOM   247  O  O     . GLY A 1 74  ? 92.657  86.260  143.060 1.00 16.27  ? 74   GLY A O     1 
ATOM   248  N  N     . LEU A 1 75  ? 93.930  86.620  144.874 1.00 13.96  ? 75   LEU A N     1 
ATOM   249  C  CA    . LEU A 1 75  ? 94.569  87.827  144.354 1.00 13.96  ? 75   LEU A CA    1 
ATOM   250  C  C     . LEU A 1 75  ? 96.077  87.625  144.474 1.00 13.96  ? 75   LEU A C     1 
ATOM   251  O  O     . LEU A 1 75  ? 96.636  87.743  145.566 1.00 13.96  ? 75   LEU A O     1 
ATOM   252  C  CB    . LEU A 1 75  ? 94.089  89.050  145.121 1.00 13.96  ? 75   LEU A CB    1 
ATOM   253  C  CG    . LEU A 1 75  ? 94.324  90.435  144.550 1.00 13.96  ? 75   LEU A CG    1 
ATOM   254  C  CD1   . LEU A 1 75  ? 93.558  90.556  143.258 1.00 13.96  ? 75   LEU A CD1   1 
ATOM   255  C  CD2   . LEU A 1 75  ? 93.854  91.467  145.530 1.00 13.96  ? 75   LEU A CD2   1 
ATOM   256  N  N     . ASN A 1 76  ? 96.731  87.334  143.348 1.00 12.63  ? 76   ASN A N     1 
ATOM   257  C  CA    . ASN A 1 76  ? 98.095  86.811  143.302 1.00 12.63  ? 76   ASN A CA    1 
ATOM   258  C  C     . ASN A 1 76  ? 99.032  87.893  142.779 1.00 12.63  ? 76   ASN A C     1 
ATOM   259  O  O     . ASN A 1 76  ? 99.047  88.172  141.578 1.00 12.63  ? 76   ASN A O     1 
ATOM   260  C  CB    . ASN A 1 76  ? 98.153  85.586  142.395 1.00 12.63  ? 76   ASN A CB    1 
ATOM   261  C  CG    . ASN A 1 76  ? 97.236  84.484  142.846 1.00 12.63  ? 76   ASN A CG    1 
ATOM   262  O  OD1   . ASN A 1 76  ? 97.167  84.161  144.019 1.00 12.63  ? 76   ASN A OD1   1 
ATOM   263  N  ND2   . ASN A 1 76  ? 96.500  83.916  141.911 1.00 12.63  ? 76   ASN A ND2   1 
ATOM   264  N  N     . ALA A 1 77  ? 99.839  88.474  143.659 1.00 11.72  ? 77   ALA A N     1 
ATOM   265  C  CA    . ALA A 1 77  ? 100.712 89.575  143.282 1.00 11.72  ? 77   ALA A CA    1 
ATOM   266  C  C     . ALA A 1 77  ? 102.110 89.083  142.950 1.00 11.72  ? 77   ALA A C     1 
ATOM   267  O  O     . ALA A 1 77  ? 102.569 88.069  143.475 1.00 11.72  ? 77   ALA A O     1 
ATOM   268  C  CB    . ALA A 1 77  ? 100.803 90.606  144.396 1.00 11.72  ? 77   ALA A CB    1 
ATOM   269  N  N     . ILE A 1 78  ? 102.787 89.816  142.067 1.00 9.72   ? 78   ILE A N     1 
ATOM   270  C  CA    . ILE A 1 78  ? 104.174 89.549  141.703 1.00 9.72   ? 78   ILE A CA    1 
ATOM   271  C  C     . ILE A 1 78  ? 104.952 90.843  141.904 1.00 9.72   ? 78   ILE A C     1 
ATOM   272  O  O     . ILE A 1 78  ? 104.761 91.805  141.155 1.00 9.72   ? 78   ILE A O     1 
ATOM   273  C  CB    . ILE A 1 78  ? 104.322 89.055  140.258 1.00 9.72   ? 78   ILE A CB    1 
ATOM   274  C  CG1   . ILE A 1 78  ? 103.490 87.805  140.002 1.00 9.72   ? 78   ILE A CG1   1 
ATOM   275  C  CG2   . ILE A 1 78  ? 105.765 88.740  139.958 1.00 9.72   ? 78   ILE A CG2   1 
ATOM   276  C  CD1   . ILE A 1 78  ? 103.372 87.476  138.537 1.00 9.72   ? 78   ILE A CD1   1 
ATOM   277  N  N     . LEU A 1 79  ? 105.822 90.874  142.903 1.00 11.72  ? 79   LEU A N     1 
ATOM   278  C  CA    . LEU A 1 79  ? 106.675 92.024  143.160 1.00 11.72  ? 79   LEU A CA    1 
ATOM   279  C  C     . LEU A 1 79  ? 108.101 91.725  142.722 1.00 11.72  ? 79   LEU A C     1 
ATOM   280  O  O     . LEU A 1 79  ? 108.480 90.574  142.515 1.00 11.72  ? 79   LEU A O     1 
ATOM   281  C  CB    . LEU A 1 79  ? 106.665 92.400  144.642 1.00 11.72  ? 79   LEU A CB    1 
ATOM   282  C  CG    . LEU A 1 79  ? 105.633 93.321  145.290 1.00 11.72  ? 79   LEU A CG    1 
ATOM   283  C  CD1   . LEU A 1 79  ? 105.671 94.689  144.662 1.00 11.72  ? 79   LEU A CD1   1 
ATOM   284  C  CD2   . LEU A 1 79  ? 104.254 92.748  145.239 1.00 11.72  ? 79   LEU A CD2   1 
ATOM   285  N  N     . GLY A 1 80  ? 108.893 92.778  142.581 1.00 11.28  ? 80   GLY A N     1 
ATOM   286  C  CA    . GLY A 1 80  ? 110.275 92.627  142.198 1.00 11.28  ? 80   GLY A CA    1 
ATOM   287  C  C     . GLY A 1 80  ? 110.833 93.852  141.509 1.00 11.28  ? 80   GLY A C     1 
ATOM   288  O  O     . GLY A 1 80  ? 110.091 94.759  141.129 1.00 11.28  ? 80   GLY A O     1 
ATOM   289  N  N     . PRO A 1 81  ? 112.158 93.912  141.346 1.00 11.09  ? 81   PRO A N     1 
ATOM   290  C  CA    . PRO A 1 81  ? 112.771 95.084  140.710 1.00 11.09  ? 81   PRO A CA    1 
ATOM   291  C  C     . PRO A 1 81  ? 112.511 95.207  139.223 1.00 11.09  ? 81   PRO A C     1 
ATOM   292  O  O     . PRO A 1 81  ? 111.901 94.331  138.608 1.00 11.09  ? 81   PRO A O     1 
ATOM   293  C  CB    . PRO A 1 81  ? 114.263 94.885  140.988 1.00 11.09  ? 81   PRO A CB    1 
ATOM   294  C  CG    . PRO A 1 81  ? 114.305 94.044  142.184 1.00 11.09  ? 81   PRO A CG    1 
ATOM   295  C  CD    . PRO A 1 81  ? 113.158 93.110  142.060 1.00 11.09  ? 81   PRO A CD    1 
ATOM   296  N  N     . THR A 1 82  ? 112.962 96.312  138.642 1.00 10.56  ? 82   THR A N     1 
ATOM   297  C  CA    . THR A 1 82  ? 112.849 96.518  137.209 1.00 10.56  ? 82   THR A CA    1 
ATOM   298  C  C     . THR A 1 82  ? 113.900 95.683  136.497 1.00 10.56  ? 82   THR A C     1 
ATOM   299  O  O     . THR A 1 82  ? 115.086 95.751  136.825 1.00 10.56  ? 82   THR A O     1 
ATOM   300  C  CB    . THR A 1 82  ? 113.008 97.995  136.864 1.00 10.56  ? 82   THR A CB    1 
ATOM   301  O  OG1   . THR A 1 82  ? 114.290 98.454  137.295 1.00 10.56  ? 82   THR A OG1   1 
ATOM   302  C  CG2   . THR A 1 82  ? 111.952 98.799  137.552 1.00 10.56  ? 82   THR A CG2   1 
ATOM   303  N  N     . GLY A 1 83  ? 113.463 94.897  135.524 1.00 9.71   ? 83   GLY A N     1 
ATOM   304  C  CA    . GLY A 1 83  ? 114.324 93.927  134.897 1.00 9.71   ? 83   GLY A CA    1 
ATOM   305  C  C     . GLY A 1 83  ? 114.384 92.600  135.608 1.00 9.71   ? 83   GLY A C     1 
ATOM   306  O  O     . GLY A 1 83  ? 115.261 91.789  135.295 1.00 9.71   ? 83   GLY A O     1 
ATOM   307  N  N     . GLY A 1 84  ? 113.481 92.350  136.557 1.00 10.54  ? 84   GLY A N     1 
ATOM   308  C  CA    . GLY A 1 84  ? 113.511 91.115  137.310 1.00 10.54  ? 84   GLY A CA    1 
ATOM   309  C  C     . GLY A 1 84  ? 112.881 89.937  136.612 1.00 10.54  ? 84   GLY A C     1 
ATOM   310  O  O     . GLY A 1 84  ? 113.159 88.795  136.984 1.00 10.54  ? 84   GLY A O     1 
ATOM   311  N  N     . GLY A 1 85  ? 112.038 90.180  135.618 1.00 9.07   ? 85   GLY A N     1 
ATOM   312  C  CA    . GLY A 1 85  ? 111.414 89.100  134.888 1.00 9.07   ? 85   GLY A CA    1 
ATOM   313  C  C     . GLY A 1 85  ? 109.928 88.981  135.136 1.00 9.07   ? 85   GLY A C     1 
ATOM   314  O  O     . GLY A 1 85  ? 109.365 87.896  134.998 1.00 9.07   ? 85   GLY A O     1 
ATOM   315  N  N     . LYS A 1 86  ? 109.274 90.089  135.489 1.00 8.84   ? 86   LYS A N     1 
ATOM   316  C  CA    . LYS A 1 86  ? 107.871 90.025  135.884 1.00 8.84   ? 86   LYS A CA    1 
ATOM   317  C  C     . LYS A 1 86  ? 106.936 90.013  134.686 1.00 8.84   ? 86   LYS A C     1 
ATOM   318  O  O     . LYS A 1 86  ? 105.946 89.281  134.690 1.00 8.84   ? 86   LYS A O     1 
ATOM   319  C  CB    . LYS A 1 86  ? 107.521 91.190  136.798 1.00 8.84   ? 86   LYS A CB    1 
ATOM   320  C  CG    . LYS A 1 86  ? 108.246 91.194  138.110 1.00 8.84   ? 86   LYS A CG    1 
ATOM   321  C  CD    . LYS A 1 86  ? 107.723 92.299  138.977 1.00 8.84   ? 86   LYS A CD    1 
ATOM   322  C  CE    . LYS A 1 86  ? 108.073 93.626  138.385 1.00 8.84   ? 86   LYS A CE    1 
ATOM   323  N  NZ    . LYS A 1 86  ? 109.535 93.844  138.362 1.00 8.84   ? 86   LYS A NZ    1 
ATOM   324  N  N     . SER A 1 87  ? 107.206 90.827  133.667 1.00 8.86   ? 87   SER A N     1 
ATOM   325  C  CA    . SER A 1 87  ? 106.409 90.773  132.451 1.00 8.86   ? 87   SER A CA    1 
ATOM   326  C  C     . SER A 1 87  ? 106.774 89.590  131.579 1.00 8.86   ? 87   SER A C     1 
ATOM   327  O  O     . SER A 1 87  ? 106.016 89.251  130.669 1.00 8.86   ? 87   SER A O     1 
ATOM   328  C  CB    . SER A 1 87  ? 106.561 92.055  131.639 1.00 8.86   ? 87   SER A CB    1 
ATOM   329  O  OG    . SER A 1 87  ? 106.014 93.166  132.324 1.00 8.86   ? 87   SER A OG    1 
ATOM   330  N  N     . SER A 1 88  ? 107.922 88.963  131.824 1.00 9.12   ? 88   SER A N     1 
ATOM   331  C  CA    . SER A 1 88  ? 108.282 87.764  131.085 1.00 9.12   ? 88   SER A CA    1 
ATOM   332  C  C     . SER A 1 88  ? 107.650 86.530  131.704 1.00 9.12   ? 88   SER A C     1 
ATOM   333  O  O     . SER A 1 88  ? 107.268 85.606  130.985 1.00 9.12   ? 88   SER A O     1 
ATOM   334  C  CB    . SER A 1 88  ? 109.796 87.620  131.028 1.00 9.12   ? 88   SER A CB    1 
ATOM   335  O  OG    . SER A 1 88  ? 110.390 88.684  130.306 1.00 9.12   ? 88   SER A OG    1 
ATOM   336  N  N     . LEU A 1 89  ? 107.525 86.501  133.030 1.00 9.12   ? 89   LEU A N     1 
ATOM   337  C  CA    . LEU A 1 89  ? 106.805 85.419  133.688 1.00 9.12   ? 89   LEU A CA    1 
ATOM   338  C  C     . LEU A 1 89  ? 105.320 85.492  133.402 1.00 9.12   ? 89   LEU A C     1 
ATOM   339  O  O     . LEU A 1 89  ? 104.664 84.461  133.229 1.00 9.12   ? 89   LEU A O     1 
ATOM   340  C  CB    . LEU A 1 89  ? 107.041 85.467  135.195 1.00 9.12   ? 89   LEU A CB    1 
ATOM   341  C  CG    . LEU A 1 89  ? 106.400 84.356  136.027 1.00 9.12   ? 89   LEU A CG    1 
ATOM   342  C  CD1   . LEU A 1 89  ? 107.032 83.025  135.700 1.00 9.12   ? 89   LEU A CD1   1 
ATOM   343  C  CD2   . LEU A 1 89  ? 106.478 84.650  137.504 1.00 9.12   ? 89   LEU A CD2   1 
ATOM   344  N  N     . LEU A 1 90  ? 104.784 86.701  133.318 1.00 8.76   ? 90   LEU A N     1 
ATOM   345  C  CA    . LEU A 1 90  ? 103.354 86.901  133.185 1.00 8.76   ? 90   LEU A CA    1 
ATOM   346  C  C     . LEU A 1 90  ? 102.873 86.643  131.766 1.00 8.76   ? 90   LEU A C     1 
ATOM   347  O  O     . LEU A 1 90  ? 101.678 86.430  131.556 1.00 8.76   ? 90   LEU A O     1 
ATOM   348  C  CB    . LEU A 1 90  ? 103.043 88.320  133.647 1.00 8.76   ? 90   LEU A CB    1 
ATOM   349  C  CG    . LEU A 1 90  ? 101.676 88.782  134.067 1.00 8.76   ? 90   LEU A CG    1 
ATOM   350  C  CD1   . LEU A 1 90  ? 101.247 87.931  135.197 1.00 8.76   ? 90   LEU A CD1   1 
ATOM   351  C  CD2   . LEU A 1 90  ? 101.872 90.169  134.552 1.00 8.76   ? 90   LEU A CD2   1 
ATOM   352  N  N     . ASP A 1 91  ? 103.787 86.635  130.800 1.00 10.69  ? 91   ASP A N     1 
ATOM   353  C  CA    . ASP A 1 91  ? 103.521 86.205  129.435 1.00 10.69  ? 91   ASP A CA    1 
ATOM   354  C  C     . ASP A 1 91  ? 103.690 84.708  129.231 1.00 10.69  ? 91   ASP A C     1 
ATOM   355  O  O     . ASP A 1 91  ? 103.022 84.136  128.369 1.00 10.69  ? 91   ASP A O     1 
ATOM   356  C  CB    . ASP A 1 91  ? 104.454 86.927  128.474 1.00 10.69  ? 91   ASP A CB    1 
ATOM   357  C  CG    . ASP A 1 91  ? 104.024 88.328  128.171 1.00 10.69  ? 91   ASP A CG    1 
ATOM   358  O  OD1   . ASP A 1 91  ? 102.809 88.563  128.122 1.00 10.69  ? 91   ASP A OD1   1 
ATOM   359  O  OD2   . ASP A 1 91  ? 104.898 89.198  127.965 1.00 10.69  ? 91   ASP A OD2   1 
ATOM   360  N  N     . VAL A 1 92  ? 104.600 84.069  129.969 1.00 11.31  ? 92   VAL A N     1 
ATOM   361  C  CA    . VAL A 1 92  ? 104.679 82.610  129.966 1.00 11.31  ? 92   VAL A CA    1 
ATOM   362  C  C     . VAL A 1 92  ? 103.403 82.010  130.539 1.00 11.31  ? 92   VAL A C     1 
ATOM   363  O  O     . VAL A 1 92  ? 102.836 81.064  129.983 1.00 11.31  ? 92   VAL A O     1 
ATOM   364  C  CB    . VAL A 1 92  ? 105.928 82.146  130.741 1.00 11.31  ? 92   VAL A CB    1 
ATOM   365  C  CG1   . VAL A 1 92  ? 105.890 80.657  130.988 1.00 11.31  ? 92   VAL A CG1   1 
ATOM   366  C  CG2   . VAL A 1 92  ? 107.178 82.490  129.974 1.00 11.31  ? 92   VAL A CG2   1 
ATOM   367  N  N     . LEU A 1 93  ? 102.913 82.580  131.635 1.00 11.47  ? 93   LEU A N     1 
ATOM   368  C  CA    . LEU A 1 93  ? 101.701 82.093  132.277 1.00 11.47  ? 93   LEU A CA    1 
ATOM   369  C  C     . LEU A 1 93  ? 100.457 82.376  131.448 1.00 11.47  ? 93   LEU A C     1 
ATOM   370  O  O     . LEU A 1 93  ? 99.482  81.622  131.521 1.00 11.47  ? 93   LEU A O     1 
ATOM   371  C  CB    . LEU A 1 93  ? 101.592 82.720  133.661 1.00 11.47  ? 93   LEU A CB    1 
ATOM   372  C  CG    . LEU A 1 93  ? 102.188 81.988  134.862 1.00 11.47  ? 93   LEU A CG    1 
ATOM   373  C  CD1   . LEU A 1 93  ? 103.658 81.737  134.776 1.00 11.47  ? 93   LEU A CD1   1 
ATOM   374  C  CD2   . LEU A 1 93  ? 101.892 82.807  136.094 1.00 11.47  ? 93   LEU A CD2   1 
ATOM   375  N  N     . ALA A 1 94  ? 100.474 83.434  130.645 1.00 10.38  ? 94   ALA A N     1 
ATOM   376  C  CA    . ALA A 1 94  ? 99.364  83.759  129.765 1.00 10.38  ? 94   ALA A CA    1 
ATOM   377  C  C     . ALA A 1 94  ? 99.540  83.193  128.365 1.00 10.38  ? 94   ALA A C     1 
ATOM   378  O  O     . ALA A 1 94  ? 98.754  83.542  127.481 1.00 10.38  ? 94   ALA A O     1 
ATOM   379  C  CB    . ALA A 1 94  ? 99.174  85.272  129.693 1.00 10.38  ? 94   ALA A CB    1 
ATOM   380  N  N     . ALA A 1 95  ? 100.560 82.347  128.157 1.00 11.78  ? 95   ALA A N     1 
ATOM   381  C  CA    . ALA A 1 95  ? 100.841 81.641  126.897 1.00 11.78  ? 95   ALA A CA    1 
ATOM   382  C  C     . ALA A 1 95  ? 101.071 82.604  125.740 1.00 11.78  ? 95   ALA A C     1 
ATOM   383  O  O     . ALA A 1 95  ? 100.450 82.495  124.684 1.00 11.78  ? 95   ALA A O     1 
ATOM   384  C  CB    . ALA A 1 95  ? 99.740  80.639  126.547 1.00 11.78  ? 95   ALA A CB    1 
ATOM   385  N  N     . ARG A 1 96  ? 101.976 83.564  125.942 1.00 10.03  ? 96   ARG A N     1 
ATOM   386  C  CA    . ARG A 1 96  ? 102.241 84.570  124.922 1.00 10.03  ? 96   ARG A CA    1 
ATOM   387  C  C     . ARG A 1 96  ? 103.725 84.705  124.607 1.00 10.03  ? 96   ARG A C     1 
ATOM   388  O  O     . ARG A 1 96  ? 104.141 85.722  124.049 1.00 10.03  ? 96   ARG A O     1 
ATOM   389  C  CB    . ARG A 1 96  ? 101.663 85.927  125.327 1.00 10.03  ? 96   ARG A CB    1 
ATOM   390  C  CG    . ARG A 1 96  ? 100.166 85.921  125.443 1.00 10.03  ? 96   ARG A CG    1 
ATOM   391  C  CD    . ARG A 1 96  ? 99.586  87.287  125.520 1.00 10.03  ? 96   ARG A CD    1 
ATOM   392  N  NE    . ARG A 1 96  ? 98.141  87.199  125.652 1.00 10.03  ? 96   ARG A NE    1 
ATOM   393  C  CZ    . ARG A 1 96  ? 97.321  88.236  125.565 1.00 10.03  ? 96   ARG A CZ    1 
ATOM   394  N  NH1   . ARG A 1 96  ? 96.021  88.064  125.713 1.00 10.03  ? 96   ARG A NH1   1 
ATOM   395  N  NH2   . ARG A 1 96  ? 97.798  89.433  125.293 1.00 10.03  ? 96   ARG A NH2   1 
ATOM   396  N  N     . LYS A 1 97  ? 104.531 83.705  124.936 1.00 14.46  ? 97   LYS A N     1 
ATOM   397  C  CA    . LYS A 1 97  ? 105.922 83.674  124.523 1.00 14.46  ? 97   LYS A CA    1 
ATOM   398  C  C     . LYS A 1 97  ? 106.130 82.528  123.549 1.00 14.46  ? 97   LYS A C     1 
ATOM   399  O  O     . LYS A 1 97  ? 105.355 81.570  123.508 1.00 14.46  ? 97   LYS A O     1 
ATOM   400  C  CB    . LYS A 1 97  ? 106.866 83.516  125.719 1.00 14.46  ? 97   LYS A CB    1 
ATOM   401  C  CG    . LYS A 1 97  ? 106.697 84.596  126.750 1.00 14.46  ? 97   LYS A CG    1 
ATOM   402  C  CD    . LYS A 1 97  ? 107.069 85.981  126.254 1.00 14.46  ? 97   LYS A CD    1 
ATOM   403  C  CE    . LYS A 1 97  ? 108.487 86.339  126.528 1.00 14.46  ? 97   LYS A CE    1 
ATOM   404  N  NZ    . LYS A 1 97  ? 108.762 87.752  126.172 1.00 14.46  ? 97   LYS A NZ    1 
ATOM   405  N  N     . ASP A 1 98  ? 107.183 82.648  122.763 1.00 21.73  ? 98   ASP A N     1 
ATOM   406  C  CA    . ASP A 1 98  ? 107.561 81.622  121.806 1.00 21.73  ? 98   ASP A CA    1 
ATOM   407  C  C     . ASP A 1 98  ? 108.026 80.385  122.564 1.00 21.73  ? 98   ASP A C     1 
ATOM   408  O  O     . ASP A 1 98  ? 108.982 80.477  123.343 1.00 21.73  ? 98   ASP A O     1 
ATOM   409  C  CB    . ASP A 1 98  ? 108.671 82.172  120.914 1.00 21.73  ? 98   ASP A CB    1 
ATOM   410  C  CG    . ASP A 1 98  ? 108.926 81.327  119.681 1.00 21.73  ? 98   ASP A CG    1 
ATOM   411  O  OD1   . ASP A 1 98  ? 108.249 80.302  119.476 1.00 21.73  ? 98   ASP A OD1   1 
ATOM   412  O  OD2   . ASP A 1 98  ? 109.826 81.702  118.902 1.00 21.73  ? 98   ASP A OD2   1 
ATOM   413  N  N     . PRO A 1 99  ? 107.393 79.224  122.387 1.00 23.57  ? 99   PRO A N     1 
ATOM   414  C  CA    . PRO A 1 99  ? 107.794 78.032  123.144 1.00 23.57  ? 99   PRO A CA    1 
ATOM   415  C  C     . PRO A 1 99  ? 109.092 77.384  122.690 1.00 23.57  ? 99   PRO A C     1 
ATOM   416  O  O     . PRO A 1 99  ? 109.442 76.328  123.222 1.00 23.57  ? 99   PRO A O     1 
ATOM   417  C  CB    . PRO A 1 99  ? 106.610 77.078  122.925 1.00 23.57  ? 99   PRO A CB    1 
ATOM   418  C  CG    . PRO A 1 99  ? 106.022 77.495  121.653 1.00 23.57  ? 99   PRO A CG    1 
ATOM   419  C  CD    . PRO A 1 99  ? 106.178 78.979  121.594 1.00 23.57  ? 99   PRO A CD    1 
ATOM   420  N  N     . SER A 1 100 ? 109.814 77.966  121.731 1.00 25.43  ? 100  SER A N     1 
ATOM   421  C  CA    . SER A 1 100 ? 111.126 77.440  121.378 1.00 25.43  ? 100  SER A CA    1 
ATOM   422  C  C     . SER A 1 100 ? 112.147 77.720  122.469 1.00 25.43  ? 100  SER A C     1 
ATOM   423  O  O     . SER A 1 100 ? 113.090 76.942  122.646 1.00 25.43  ? 100  SER A O     1 
ATOM   424  C  CB    . SER A 1 100 ? 111.595 78.034  120.052 1.00 25.43  ? 100  SER A CB    1 
ATOM   425  O  OG    . SER A 1 100 ? 111.848 79.421  120.178 1.00 25.43  ? 100  SER A OG    1 
ATOM   426  N  N     . GLY A 1 101 ? 111.980 78.819  123.202 1.00 22.61  ? 101  GLY A N     1 
ATOM   427  C  CA    . GLY A 1 101 ? 112.832 79.158  124.317 1.00 22.61  ? 101  GLY A CA    1 
ATOM   428  C  C     . GLY A 1 101 ? 112.285 78.790  125.672 1.00 22.61  ? 101  GLY A C     1 
ATOM   429  O  O     . GLY A 1 101 ? 112.987 78.951  126.671 1.00 22.61  ? 101  GLY A O     1 
ATOM   430  N  N     . LEU A 1 102 ? 111.059 78.287  125.740 1.00 21.71  ? 102  LEU A N     1 
ATOM   431  C  CA    . LEU A 1 102 ? 110.403 77.985  127.002 1.00 21.71  ? 102  LEU A CA    1 
ATOM   432  C  C     . LEU A 1 102 ? 110.679 76.538  127.383 1.00 21.71  ? 102  LEU A C     1 
ATOM   433  O  O     . LEU A 1 102 ? 110.665 75.650  126.529 1.00 21.71  ? 102  LEU A O     1 
ATOM   434  C  CB    . LEU A 1 102 ? 108.903 78.237  126.874 1.00 21.71  ? 102  LEU A CB    1 
ATOM   435  C  CG    . LEU A 1 102 ? 107.993 78.414  128.082 1.00 21.71  ? 102  LEU A CG    1 
ATOM   436  C  CD1   . LEU A 1 102 ? 106.873 79.306  127.624 1.00 21.71  ? 102  LEU A CD1   1 
ATOM   437  C  CD2   . LEU A 1 102 ? 107.433 77.110  128.610 1.00 21.71  ? 102  LEU A CD2   1 
ATOM   438  N  N     . SER A 1 103 ? 110.924 76.302  128.672 1.00 22.30  ? 103  SER A N     1 
ATOM   439  C  CA    . SER A 1 103 ? 111.461 75.021  129.111 1.00 22.30  ? 103  SER A CA    1 
ATOM   440  C  C     . SER A 1 103 ? 110.709 74.463  130.313 1.00 22.30  ? 103  SER A C     1 
ATOM   441  O  O     . SER A 1 103 ? 111.300 73.785  131.155 1.00 22.30  ? 103  SER A O     1 
ATOM   442  C  CB    . SER A 1 103 ? 112.948 75.148  129.433 1.00 22.30  ? 103  SER A CB    1 
ATOM   443  O  OG    . SER A 1 103 ? 113.681 75.573  128.298 1.00 22.30  ? 103  SER A OG    1 
ATOM   444  N  N     . GLY A 1 104 ? 109.412 74.722  130.406 1.00 23.12  ? 104  GLY A N     1 
ATOM   445  C  CA    . GLY A 1 104 ? 108.618 74.175  131.488 1.00 23.12  ? 104  GLY A CA    1 
ATOM   446  C  C     . GLY A 1 104 ? 107.201 73.877  131.054 1.00 23.12  ? 104  GLY A C     1 
ATOM   447  O  O     . GLY A 1 104 ? 106.944 73.732  129.857 1.00 23.12  ? 104  GLY A O     1 
ATOM   448  N  N     . ASP A 1 105 ? 106.269 73.779  132.000 1.00 24.50  ? 105  ASP A N     1 
ATOM   449  C  CA    . ASP A 1 105 ? 104.867 73.572  131.663 1.00 24.50  ? 105  ASP A CA    1 
ATOM   450  C  C     . ASP A 1 105 ? 103.961 74.332  132.618 1.00 24.50  ? 105  ASP A C     1 
ATOM   451  O  O     . ASP A 1 105 ? 104.207 74.377  133.824 1.00 24.50  ? 105  ASP A O     1 
ATOM   452  C  CB    . ASP A 1 105 ? 104.503 72.083  131.659 1.00 24.50  ? 105  ASP A CB    1 
ATOM   453  C  CG    . ASP A 1 105 ? 104.935 71.372  132.916 1.00 24.50  ? 105  ASP A CG    1 
ATOM   454  O  OD1   . ASP A 1 105 ? 105.693 71.963  133.707 1.00 24.50  ? 105  ASP A OD1   1 
ATOM   455  O  OD2   . ASP A 1 105 ? 104.509 70.218  133.123 1.00 24.50  ? 105  ASP A OD2   1 
ATOM   456  N  N     . VAL A 1 106 ? 102.911 74.933  132.065 1.00 20.61  ? 106  VAL A N     1 
ATOM   457  C  CA    . VAL A 1 106 ? 101.902 75.643  132.838 1.00 20.61  ? 106  VAL A CA    1 
ATOM   458  C  C     . VAL A 1 106 ? 100.607 74.853  132.740 1.00 20.61  ? 106  VAL A C     1 
ATOM   459  O  O     . VAL A 1 106 ? 100.193 74.465  131.643 1.00 20.61  ? 106  VAL A O     1 
ATOM   460  C  CB    . VAL A 1 106 ? 101.719 77.082  132.333 1.00 20.61  ? 106  VAL A CB    1 
ATOM   461  C  CG1   . VAL A 1 106 ? 100.687 77.811  133.162 1.00 20.61  ? 106  VAL A CG1   1 
ATOM   462  C  CG2   . VAL A 1 106 ? 103.036 77.819  132.351 1.00 20.61  ? 106  VAL A CG2   1 
ATOM   463  N  N     . LEU A 1 107 ? 99.978  74.602  133.882 1.00 19.94  ? 107  LEU A N     1 
ATOM   464  C  CA    . LEU A 1 107 ? 98.822  73.724  133.958 1.00 19.94  ? 107  LEU A CA    1 
ATOM   465  C  C     . LEU A 1 107 ? 97.695  74.436  134.683 1.00 19.94  ? 107  LEU A C     1 
ATOM   466  O  O     . LEU A 1 107 ? 97.913  75.008  135.753 1.00 19.94  ? 107  LEU A O     1 
ATOM   467  C  CB    . LEU A 1 107 ? 99.166  72.427  134.694 1.00 19.94  ? 107  LEU A CB    1 
ATOM   468  C  CG    . LEU A 1 107 ? 99.962  71.302  134.027 1.00 19.94  ? 107  LEU A CG    1 
ATOM   469  C  CD1   . LEU A 1 107 ? 101.443 71.604  133.935 1.00 19.94  ? 107  LEU A CD1   1 
ATOM   470  C  CD2   . LEU A 1 107 ? 99.746  70.021  134.789 1.00 19.94  ? 107  LEU A CD2   1 
ATOM   471  N  N     . ILE A 1 108 ? 96.495  74.396  134.114 1.00 19.40  ? 108  ILE A N     1 
ATOM   472  C  CA    . ILE A 1 108 ? 95.293  74.887  134.777 1.00 19.40  ? 108  ILE A CA    1 
ATOM   473  C  C     . ILE A 1 108 ? 94.518  73.686  135.292 1.00 19.40  ? 108  ILE A C     1 
ATOM   474  O  O     . ILE A 1 108 ? 94.105  72.828  134.505 1.00 19.40  ? 108  ILE A O     1 
ATOM   475  C  CB    . ILE A 1 108 ? 94.424  75.746  133.845 1.00 19.40  ? 108  ILE A CB    1 
ATOM   476  C  CG1   . ILE A 1 108 ? 95.075  77.098  133.570 1.00 19.40  ? 108  ILE A CG1   1 
ATOM   477  C  CG2   . ILE A 1 108 ? 93.063  75.980  134.454 1.00 19.40  ? 108  ILE A CG2   1 
ATOM   478  C  CD1   . ILE A 1 108 ? 95.883  77.165  132.329 1.00 19.40  ? 108  ILE A CD1   1 
ATOM   479  N  N     . ASN A 1 109 ? 94.339  73.634  136.617 1.00 20.98  ? 109  ASN A N     1 
ATOM   480  C  CA    . ASN A 1 109 ? 93.663  72.550  137.342 1.00 20.98  ? 109  ASN A CA    1 
ATOM   481  C  C     . ASN A 1 109 ? 94.305  71.188  137.093 1.00 20.98  ? 109  ASN A C     1 
ATOM   482  O  O     . ASN A 1 109 ? 93.619  70.166  137.073 1.00 20.98  ? 109  ASN A O     1 
ATOM   483  C  CB    . ASN A 1 109 ? 92.166  72.495  137.022 1.00 20.98  ? 109  ASN A CB    1 
ATOM   484  C  CG    . ASN A 1 109 ? 91.423  73.720  137.497 1.00 20.98  ? 109  ASN A CG    1 
ATOM   485  O  OD1   . ASN A 1 109 ? 90.907  74.494  136.696 1.00 20.98  ? 109  ASN A OD1   1 
ATOM   486  N  ND2   . ASN A 1 109 ? 91.350  73.896  138.808 1.00 20.98  ? 109  ASN A ND2   1 
ATOM   487  N  N     . GLY A 1 110 ? 95.623  71.154  136.911 1.00 23.26  ? 110  GLY A N     1 
ATOM   488  C  CA    . GLY A 1 110 ? 96.325  69.907  136.697 1.00 23.26  ? 110  GLY A CA    1 
ATOM   489  C  C     . GLY A 1 110 ? 96.278  69.365  135.286 1.00 23.26  ? 110  GLY A C     1 
ATOM   490  O  O     . GLY A 1 110 ? 96.904  68.333  135.016 1.00 23.26  ? 110  GLY A O     1 
ATOM   491  N  N     . ALA A 1 111 ? 95.555  70.005  134.394 1.00 21.81  ? 111  ALA A N     1 
ATOM   492  C  CA    . ALA A 1 111 ? 95.469  69.700  132.983 1.00 21.81  ? 111  ALA A CA    1 
ATOM   493  C  C     . ALA A 1 111 ? 96.137  70.810  132.184 1.00 21.81  ? 111  ALA A C     1 
ATOM   494  O  O     . ALA A 1 111 ? 96.197  71.949  132.651 1.00 21.81  ? 111  ALA A O     1 
ATOM   495  C  CB    . ALA A 1 111 ? 94.003  69.564  132.553 1.00 21.81  ? 111  ALA A CB    1 
ATOM   496  N  N     . PRO A 1 112 ? 96.662  70.532  130.982 1.00 21.13  ? 112  PRO A N     1 
ATOM   497  C  CA    . PRO A 1 112 ? 97.254  71.618  130.188 1.00 21.13  ? 112  PRO A CA    1 
ATOM   498  C  C     . PRO A 1 112 ? 96.220  72.589  129.639 1.00 21.13  ? 112  PRO A C     1 
ATOM   499  O  O     . PRO A 1 112 ? 95.016  72.400  129.835 1.00 21.13  ? 112  PRO A O     1 
ATOM   500  C  CB    . PRO A 1 112 ? 97.986  70.873  129.066 1.00 21.13  ? 112  PRO A CB    1 
ATOM   501  C  CG    . PRO A 1 112 ? 97.303  69.579  128.963 1.00 21.13  ? 112  PRO A CG    1 
ATOM   502  C  CD    . PRO A 1 112 ? 96.883  69.219  130.351 1.00 21.13  ? 112  PRO A CD    1 
ATOM   503  N  N     . ARG A 1 113 ? 96.682  73.637  128.964 1.00 19.78  ? 113  ARG A N     1 
ATOM   504  C  CA    . ARG A 1 113 ? 95.774  74.665  128.478 1.00 19.78  ? 113  ARG A CA    1 
ATOM   505  C  C     . ARG A 1 113 ? 94.929  74.126  127.328 1.00 19.78  ? 113  ARG A C     1 
ATOM   506  O  O     . ARG A 1 113 ? 95.437  73.391  126.476 1.00 19.78  ? 113  ARG A O     1 
ATOM   507  C  CB    . ARG A 1 113 ? 96.540  75.888  127.984 1.00 19.78  ? 113  ARG A CB    1 
ATOM   508  C  CG    . ARG A 1 113 ? 97.324  76.658  129.015 1.00 19.78  ? 113  ARG A CG    1 
ATOM   509  C  CD    . ARG A 1 113 ? 97.908  77.882  128.354 1.00 19.78  ? 113  ARG A CD    1 
ATOM   510  N  NE    . ARG A 1 113 ? 98.697  78.724  129.241 1.00 19.78  ? 113  ARG A NE    1 
ATOM   511  C  CZ    . ARG A 1 113 ? 100.011 78.623  129.381 1.00 19.78  ? 113  ARG A CZ    1 
ATOM   512  N  NH1   . ARG A 1 113 ? 100.686 77.718  128.695 1.00 19.78  ? 113  ARG A NH1   1 
ATOM   513  N  NH2   . ARG A 1 113 ? 100.651 79.444  130.187 1.00 19.78  ? 113  ARG A NH2   1 
ATOM   514  N  N     . PRO A 1 114 ? 93.647  74.487  127.262 1.00 21.83  ? 114  PRO A N     1 
ATOM   515  C  CA    . PRO A 1 114 ? 92.845  74.149  126.079 1.00 21.83  ? 114  PRO A CA    1 
ATOM   516  C  C     . PRO A 1 114 ? 93.190  75.043  124.899 1.00 21.83  ? 114  PRO A C     1 
ATOM   517  O  O     . PRO A 1 114 ? 94.116  75.857  124.994 1.00 21.83  ? 114  PRO A O     1 
ATOM   518  C  CB    . PRO A 1 114 ? 91.407  74.381  126.554 1.00 21.83  ? 114  PRO A CB    1 
ATOM   519  C  CG    . PRO A 1 114 ? 91.481  74.355  128.041 1.00 21.83  ? 114  PRO A CG    1 
ATOM   520  C  CD    . PRO A 1 114 ? 92.806  74.947  128.376 1.00 21.83  ? 114  PRO A CD    1 
ATOM   521  N  N     . ALA A 1 115 ? 92.472  74.921  123.780 1.00 22.20  ? 115  ALA A N     1 
ATOM   522  C  CA    . ALA A 1 115 ? 92.727  75.911  122.744 1.00 22.20  ? 115  ALA A CA    1 
ATOM   523  C  C     . ALA A 1 115 ? 92.118  77.251  123.139 1.00 22.20  ? 115  ALA A C     1 
ATOM   524  O  O     . ALA A 1 115 ? 92.859  78.193  123.436 1.00 22.20  ? 115  ALA A O     1 
ATOM   525  C  CB    . ALA A 1 115 ? 92.173  75.428  121.405 1.00 22.20  ? 115  ALA A CB    1 
ATOM   526  N  N     . ASN A 1 116 ? 90.796  77.391  123.084 1.00 21.24  ? 116  ASN A N     1 
ATOM   527  C  CA    . ASN A 1 116 ? 89.907  77.783  124.196 1.00 21.24  ? 116  ASN A CA    1 
ATOM   528  C  C     . ASN A 1 116 ? 90.556  78.466  125.436 1.00 21.24  ? 116  ASN A C     1 
ATOM   529  O  O     . ASN A 1 116 ? 90.215  78.134  126.573 1.00 21.24  ? 116  ASN A O     1 
ATOM   530  C  CB    . ASN A 1 116 ? 89.119  76.531  124.623 1.00 21.24  ? 116  ASN A CB    1 
ATOM   531  C  CG    . ASN A 1 116 ? 87.805  76.857  125.321 1.00 21.24  ? 116  ASN A CG    1 
ATOM   532  O  OD1   . ASN A 1 116 ? 87.462  78.021  125.496 1.00 21.24  ? 116  ASN A OD1   1 
ATOM   533  N  ND2   . ASN A 1 116 ? 87.079  75.825  125.737 1.00 21.24  ? 116  ASN A ND2   1 
ATOM   534  N  N     . PHE A 1 117 ? 91.486  79.379  125.258 1.00 16.72  ? 117  PHE A N     1 
ATOM   535  C  CA    . PHE A 1 117 ? 92.064  79.966  126.463 1.00 16.72  ? 117  PHE A CA    1 
ATOM   536  C  C     . PHE A 1 117 ? 92.134  81.473  126.387 1.00 16.72  ? 117  PHE A C     1 
ATOM   537  O  O     . PHE A 1 117 ? 91.882  82.144  127.383 1.00 16.72  ? 117  PHE A O     1 
ATOM   538  C  CB    . PHE A 1 117 ? 93.457  79.392  126.750 1.00 16.72  ? 117  PHE A CB    1 
ATOM   539  C  CG    . PHE A 1 117 ? 94.099  79.957  127.986 1.00 16.72  ? 117  PHE A CG    1 
ATOM   540  C  CD1   . PHE A 1 117 ? 93.629  79.624  129.243 1.00 16.72  ? 117  PHE A CD1   1 
ATOM   541  C  CD2   . PHE A 1 117 ? 95.180  80.816  127.889 1.00 16.72  ? 117  PHE A CD2   1 
ATOM   542  C  CE1   . PHE A 1 117 ? 94.217  80.149  130.375 1.00 16.72  ? 117  PHE A CE1   1 
ATOM   543  C  CE2   . PHE A 1 117 ? 95.768  81.338  129.018 1.00 16.72  ? 117  PHE A CE2   1 
ATOM   544  C  CZ    . PHE A 1 117 ? 95.286  81.002  130.260 1.00 16.72  ? 117  PHE A CZ    1 
ATOM   545  N  N     . LYS A 1 118 ? 92.443  82.020  125.216 1.00 13.71  ? 118  LYS A N     1 
ATOM   546  C  CA    . LYS A 1 118 ? 92.344  83.453  125.010 1.00 13.71  ? 118  LYS A CA    1 
ATOM   547  C  C     . LYS A 1 118 ? 90.900  83.919  124.987 1.00 13.71  ? 118  LYS A C     1 
ATOM   548  O  O     . LYS A 1 118 ? 90.639  85.104  125.199 1.00 13.71  ? 118  LYS A O     1 
ATOM   549  C  CB    . LYS A 1 118 ? 93.061  83.821  123.720 1.00 13.71  ? 118  LYS A CB    1 
ATOM   550  C  CG    . LYS A 1 118 ? 92.504  83.157  122.494 1.00 13.71  ? 118  LYS A CG    1 
ATOM   551  C  CD    . LYS A 1 118 ? 93.368  83.466  121.303 1.00 13.71  ? 118  LYS A CD    1 
ATOM   552  C  CE    . LYS A 1 118 ? 92.816  82.842  120.048 1.00 13.71  ? 118  LYS A CE    1 
ATOM   553  N  NZ    . LYS A 1 118 ? 93.678  83.140  118.883 1.00 13.71  ? 118  LYS A NZ    1 
ATOM   554  N  N     . CYS A 1 119 ? 89.962  83.013  124.755 1.00 17.63  ? 119  CYS A N     1 
ATOM   555  C  CA    . CYS A 1 119 ? 88.543  83.294  124.837 1.00 17.63  ? 119  CYS A CA    1 
ATOM   556  C  C     . CYS A 1 119 ? 87.974  83.007  126.219 1.00 17.63  ? 119  CYS A C     1 
ATOM   557  O  O     . CYS A 1 119 ? 86.755  83.051  126.395 1.00 17.63  ? 119  CYS A O     1 
ATOM   558  C  CB    . CYS A 1 119 ? 87.800  82.479  123.782 1.00 17.63  ? 119  CYS A CB    1 
ATOM   559  S  SG    . CYS A 1 119 ? 88.299  82.872  122.100 1.00 17.63  ? 119  CYS A SG    1 
ATOM   560  N  N     . ASN A 1 120 ? 88.830  82.691  127.191 1.00 17.87  ? 120  ASN A N     1 
ATOM   561  C  CA    . ASN A 1 120 ? 88.413  82.469  128.566 1.00 17.87  ? 120  ASN A CA    1 
ATOM   562  C  C     . ASN A 1 120 ? 89.317  83.145  129.581 1.00 17.87  ? 120  ASN A C     1 
ATOM   563  O  O     . ASN A 1 120 ? 89.045  83.052  130.781 1.00 17.87  ? 120  ASN A O     1 
ATOM   564  C  CB    . ASN A 1 120 ? 88.357  80.971  128.886 1.00 17.87  ? 120  ASN A CB    1 
ATOM   565  C  CG    . ASN A 1 120 ? 87.224  80.268  128.189 1.00 17.87  ? 120  ASN A CG    1 
ATOM   566  O  OD1   . ASN A 1 120 ? 86.119  80.793  128.086 1.00 17.87  ? 120  ASN A OD1   1 
ATOM   567  N  ND2   . ASN A 1 120 ? 87.487  79.060  127.714 1.00 17.87  ? 120  ASN A ND2   1 
ATOM   568  N  N     . SER A 1 121 ? 90.387  83.799  129.146 1.00 14.04  ? 121  SER A N     1 
ATOM   569  C  CA    . SER A 1 121 ? 91.283  84.519  130.030 1.00 14.04  ? 121  SER A CA    1 
ATOM   570  C  C     . SER A 1 121 ? 91.389  85.961  129.566 1.00 14.04  ? 121  SER A C     1 
ATOM   571  O  O     . SER A 1 121 ? 90.897  86.330  128.499 1.00 14.04  ? 121  SER A O     1 
ATOM   572  C  CB    . SER A 1 121 ? 92.669  83.876  130.077 1.00 14.04  ? 121  SER A CB    1 
ATOM   573  O  OG    . SER A 1 121 ? 93.321  84.009  128.831 1.00 14.04  ? 121  SER A OG    1 
ATOM   574  N  N     . GLY A 1 122 ? 92.040  86.782  130.386 1.00 10.00  ? 122  GLY A N     1 
ATOM   575  C  CA    . GLY A 1 122 ? 92.292  88.161  130.031 1.00 10.00  ? 122  GLY A CA    1 
ATOM   576  C  C     . GLY A 1 122 ? 93.679  88.594  130.441 1.00 10.00  ? 122  GLY A C     1 
ATOM   577  O  O     . GLY A 1 122 ? 94.086  88.363  131.579 1.00 10.00  ? 122  GLY A O     1 
ATOM   578  N  N     . TYR A 1 123 ? 94.422  89.197  129.525 1.00 8.86   ? 123  TYR A N     1 
ATOM   579  C  CA    . TYR A 1 123 ? 95.750  89.728  129.797 1.00 8.86   ? 123  TYR A CA    1 
ATOM   580  C  C     . TYR A 1 123 ? 95.731  91.216  129.498 1.00 8.86   ? 123  TYR A C     1 
ATOM   581  O  O     . TYR A 1 123 ? 95.561  91.620  128.345 1.00 8.86   ? 123  TYR A O     1 
ATOM   582  C  CB    . TYR A 1 123 ? 96.816  89.009  128.967 1.00 8.86   ? 123  TYR A CB    1 
ATOM   583  C  CG    . TYR A 1 123 ? 98.236  89.482  129.194 1.00 8.86   ? 123  TYR A CG    1 
ATOM   584  C  CD1   . TYR A 1 123 ? 98.901  89.180  130.348 1.00 8.86   ? 123  TYR A CD1   1 
ATOM   585  C  CD2   . TYR A 1 123 ? 98.923  90.209  128.232 1.00 8.86   ? 123  TYR A CD2   1 
ATOM   586  C  CE1   . TYR A 1 123 ? 100.177 89.596  130.586 1.00 8.86   ? 123  TYR A CE1   1 
ATOM   587  C  CE2   . TYR A 1 123 ? 100.220 90.621  128.454 1.00 8.86   ? 123  TYR A CE2   1 
ATOM   588  C  CZ    . TYR A 1 123 ? 100.834 90.316  129.639 1.00 8.86   ? 123  TYR A CZ    1 
ATOM   589  O  OH    . TYR A 1 123 ? 102.127 90.721  129.866 1.00 8.86   ? 123  TYR A OH    1 
ATOM   590  N  N     . VAL A 1 124 ? 95.879  92.026  130.537 1.00 7.83   ? 124  VAL A N     1 
ATOM   591  C  CA    . VAL A 1 124 ? 96.022  93.467  130.387 1.00 7.83   ? 124  VAL A CA    1 
ATOM   592  C  C     . VAL A 1 124 ? 97.505  93.748  130.198 1.00 7.83   ? 124  VAL A C     1 
ATOM   593  O  O     . VAL A 1 124 ? 98.309  93.474  131.089 1.00 7.83   ? 124  VAL A O     1 
ATOM   594  C  CB    . VAL A 1 124 ? 95.464  94.218  131.603 1.00 7.83   ? 124  VAL A CB    1 
ATOM   595  C  CG1   . VAL A 1 124 ? 95.697  95.700  131.456 1.00 7.83   ? 124  VAL A CG1   1 
ATOM   596  C  CG2   . VAL A 1 124 ? 93.998  93.931  131.783 1.00 7.83   ? 124  VAL A CG2   1 
ATOM   597  N  N     . VAL A 1 125 ? 97.872  94.280  129.036 1.00 8.89   ? 125  VAL A N     1 
ATOM   598  C  CA    . VAL A 1 125 ? 99.267  94.507  128.695 1.00 8.89   ? 125  VAL A CA    1 
ATOM   599  C  C     . VAL A 1 125 ? 99.774  95.752  129.404 1.00 8.89   ? 125  VAL A C     1 
ATOM   600  O  O     . VAL A 1 125 ? 99.000  96.543  129.943 1.00 8.89   ? 125  VAL A O     1 
ATOM   601  C  CB    . VAL A 1 125 ? 99.476  94.630  127.174 1.00 8.89   ? 125  VAL A CB    1 
ATOM   602  C  CG1   . VAL A 1 125 ? 99.080  93.366  126.492 1.00 8.89   ? 125  VAL A CG1   1 
ATOM   603  C  CG2   . VAL A 1 125 ? 98.679  95.791  126.621 1.00 8.89   ? 125  VAL A CG2   1 
ATOM   604  N  N     . GLN A 1 126 ? 101.091 95.942  129.382 1.00 10.90  ? 126  GLN A N     1 
ATOM   605  C  CA    . GLN A 1 126 ? 101.678 97.040  130.136 1.00 10.90  ? 126  GLN A CA    1 
ATOM   606  C  C     . GLN A 1 126 ? 101.600 98.357  129.372 1.00 10.90  ? 126  GLN A C     1 
ATOM   607  O  O     . GLN A 1 126 ? 101.333 99.405  129.969 1.00 10.90  ? 126  GLN A O     1 
ATOM   608  C  CB    . GLN A 1 126 ? 103.125 96.716  130.491 1.00 10.90  ? 126  GLN A CB    1 
ATOM   609  C  CG    . GLN A 1 126 ? 103.754 97.717  131.428 1.00 10.90  ? 126  GLN A CG    1 
ATOM   610  C  CD    . GLN A 1 126 ? 105.185 97.388  131.745 1.00 10.90  ? 126  GLN A CD    1 
ATOM   611  O  OE1   . GLN A 1 126 ? 105.728 96.410  131.247 1.00 10.90  ? 126  GLN A OE1   1 
ATOM   612  N  NE2   . GLN A 1 126 ? 105.813 98.213  132.570 1.00 10.90  ? 126  GLN A NE2   1 
ATOM   613  N  N     . ASP A 1 127 ? 101.821 98.334  128.055 1.00 13.77  ? 127  ASP A N     1 
ATOM   614  C  CA    . ASP A 1 127 ? 102.018 99.560  127.290 1.00 13.77  ? 127  ASP A CA    1 
ATOM   615  C  C     . ASP A 1 127 ? 100.783 100.007 126.510 1.00 13.77  ? 127  ASP A C     1 
ATOM   616  O  O     . ASP A 1 127 ? 100.918 100.753 125.536 1.00 13.77  ? 127  ASP A O     1 
ATOM   617  C  CB    . ASP A 1 127 ? 103.202 99.426  126.337 1.00 13.77  ? 127  ASP A CB    1 
ATOM   618  C  CG    . ASP A 1 127 ? 104.532 99.493  127.046 1.00 13.77  ? 127  ASP A CG    1 
ATOM   619  O  OD1   . ASP A 1 127 ? 104.602 100.123 128.119 1.00 13.77  ? 127  ASP A OD1   1 
ATOM   620  O  OD2   . ASP A 1 127 ? 105.515 98.929  126.519 1.00 13.77  ? 127  ASP A OD2   1 
ATOM   621  N  N     . ASP A 1 128 ? 99.591  99.556  126.918 1.00 12.54  ? 128  ASP A N     1 
ATOM   622  C  CA    . ASP A 1 128 ? 98.303  100.187 126.597 1.00 12.54  ? 128  ASP A CA    1 
ATOM   623  C  C     . ASP A 1 128 ? 98.027  100.229 125.089 1.00 12.54  ? 128  ASP A C     1 
ATOM   624  O  O     . ASP A 1 128 ? 98.035  101.285 124.456 1.00 12.54  ? 128  ASP A O     1 
ATOM   625  C  CB    . ASP A 1 128 ? 98.238  101.597 127.192 1.00 12.54  ? 128  ASP A CB    1 
ATOM   626  C  CG    . ASP A 1 128 ? 98.178  101.587 128.698 1.00 12.54  ? 128  ASP A CG    1 
ATOM   627  O  OD1   . ASP A 1 128 ? 97.626  100.615 129.252 1.00 12.54  ? 128  ASP A OD1   1 
ATOM   628  O  OD2   . ASP A 1 128 ? 98.688  102.540 129.325 1.00 12.54  ? 128  ASP A OD2   1 
ATOM   629  N  N     . VAL A 1 129 ? 97.815  99.047  124.519 1.00 11.26  ? 129  VAL A N     1 
ATOM   630  C  CA    . VAL A 1 129 ? 97.485  98.928  123.103 1.00 11.26  ? 129  VAL A CA    1 
ATOM   631  C  C     . VAL A 1 129 ? 95.979  99.144  122.966 1.00 11.26  ? 129  VAL A C     1 
ATOM   632  O  O     . VAL A 1 129 ? 95.181  98.245  123.222 1.00 11.26  ? 129  VAL A O     1 
ATOM   633  C  CB    . VAL A 1 129 ? 97.927  97.582  122.531 1.00 11.26  ? 129  VAL A CB    1 
ATOM   634  C  CG1   . VAL A 1 129 ? 97.615  97.512  121.052 1.00 11.26  ? 129  VAL A CG1   1 
ATOM   635  C  CG2   . VAL A 1 129 ? 99.407  97.366  122.780 1.00 11.26  ? 129  VAL A CG2   1 
ATOM   636  N  N     . VAL A 1 130 ? 95.591  100.348 122.560 1.00 10.83  ? 130  VAL A N     1 
ATOM   637  C  CA    . VAL A 1 130 ? 94.192  100.740 122.437 1.00 10.83  ? 130  VAL A CA    1 
ATOM   638  C  C     . VAL A 1 130 ? 94.067  101.654 121.222 1.00 10.83  ? 130  VAL A C     1 
ATOM   639  O  O     . VAL A 1 130 ? 94.966  102.450 120.940 1.00 10.83  ? 130  VAL A O     1 
ATOM   640  C  CB    . VAL A 1 130 ? 93.690  101.395 123.752 1.00 10.83  ? 130  VAL A CB    1 
ATOM   641  C  CG1   . VAL A 1 130 ? 94.504  102.592 124.118 1.00 10.83  ? 130  VAL A CG1   1 
ATOM   642  C  CG2   . VAL A 1 130 ? 92.236  101.779 123.679 1.00 10.83  ? 130  VAL A CG2   1 
ATOM   643  N  N     . MET A 1 131 ? 92.986  101.489 120.459 1.00 9.35   ? 131  MET A N     1 
ATOM   644  C  CA    . MET A 1 131 ? 92.772  102.299 119.264 1.00 9.35   ? 131  MET A CA    1 
ATOM   645  C  C     . MET A 1 131 ? 92.420  103.732 119.644 1.00 9.35   ? 131  MET A C     1 
ATOM   646  O  O     . MET A 1 131 ? 91.434  103.975 120.344 1.00 9.35   ? 131  MET A O     1 
ATOM   647  C  CB    . MET A 1 131 ? 91.681  101.681 118.392 1.00 9.35   ? 131  MET A CB    1 
ATOM   648  C  CG    . MET A 1 131 ? 91.370  102.496 117.156 1.00 9.35   ? 131  MET A CG    1 
ATOM   649  S  SD    . MET A 1 131 ? 90.278  101.733 115.957 1.00 9.35   ? 131  MET A SD    1 
ATOM   650  C  CE    . MET A 1 131 ? 91.397  100.711 115.040 1.00 9.35   ? 131  MET A CE    1 
ATOM   651  N  N     . GLY A 1 132 ? 93.233  104.677 119.183 1.00 8.94   ? 132  GLY A N     1 
ATOM   652  C  CA    . GLY A 1 132 ? 93.089  106.081 119.493 1.00 8.94   ? 132  GLY A CA    1 
ATOM   653  C  C     . GLY A 1 132 ? 92.308  106.899 118.491 1.00 8.94   ? 132  GLY A C     1 
ATOM   654  O  O     . GLY A 1 132 ? 92.376  108.132 118.521 1.00 8.94   ? 132  GLY A O     1 
ATOM   655  N  N     . THR A 1 133 ? 91.597  106.268 117.578 1.00 9.33   ? 133  THR A N     1 
ATOM   656  C  CA    . THR A 1 133 ? 90.628  106.989 116.781 1.00 9.33   ? 133  THR A CA    1 
ATOM   657  C  C     . THR A 1 133 ? 89.219  106.678 117.226 1.00 9.33   ? 133  THR A C     1 
ATOM   658  O  O     . THR A 1 133 ? 88.265  107.228 116.674 1.00 9.33   ? 133  THR A O     1 
ATOM   659  C  CB    . THR A 1 133 ? 90.809  106.660 115.301 1.00 9.33   ? 133  THR A CB    1 
ATOM   660  O  OG1   . THR A 1 133 ? 90.656  105.255 115.107 1.00 9.33   ? 133  THR A OG1   1 
ATOM   661  C  CG2   . THR A 1 133 ? 92.183  107.076 114.841 1.00 9.33   ? 133  THR A CG2   1 
ATOM   662  N  N     . LEU A 1 134 ? 89.071  105.797 118.194 1.00 8.63   ? 134  LEU A N     1 
ATOM   663  C  CA    . LEU A 1 134 ? 87.810  105.541 118.854 1.00 8.63   ? 134  LEU A CA    1 
ATOM   664  C  C     . LEU A 1 134 ? 87.779  106.232 120.206 1.00 8.63   ? 134  LEU A C     1 
ATOM   665  O  O     . LEU A 1 134 ? 88.675  106.987 120.575 1.00 8.63   ? 134  LEU A O     1 
ATOM   666  C  CB    . LEU A 1 134 ? 87.570  104.041 118.980 1.00 8.63   ? 134  LEU A CB    1 
ATOM   667  C  CG    . LEU A 1 134 ? 86.635  103.411 117.959 1.00 8.63   ? 134  LEU A CG    1 
ATOM   668  C  CD1   . LEU A 1 134 ? 87.162  103.506 116.553 1.00 8.63   ? 134  LEU A CD1   1 
ATOM   669  C  CD2   . LEU A 1 134 ? 86.417  101.972 118.364 1.00 8.63   ? 134  LEU A CD2   1 
ATOM   670  N  N     . THR A 1 135 ? 86.730  105.955 120.951 1.00 8.87   ? 135  THR A N     1 
ATOM   671  C  CA    . THR A 1 135 ? 86.379  106.617 122.187 1.00 8.87   ? 135  THR A CA    1 
ATOM   672  C  C     . THR A 1 135 ? 86.596  105.614 123.319 1.00 8.87   ? 135  THR A C     1 
ATOM   673  O  O     . THR A 1 135 ? 86.785  104.423 123.072 1.00 8.87   ? 135  THR A O     1 
ATOM   674  C  CB    . THR A 1 135 ? 84.927  107.099 122.072 1.00 8.87   ? 135  THR A CB    1 
ATOM   675  O  OG1   . THR A 1 135 ? 84.768  107.760 120.816 1.00 8.87   ? 135  THR A OG1   1 
ATOM   676  C  CG2   . THR A 1 135 ? 84.588  108.104 123.063 1.00 8.87   ? 135  THR A CG2   1 
ATOM   677  N  N     . VAL A 1 136 ? 86.640  106.104 124.562 1.00 8.51   ? 136  VAL A N     1 
ATOM   678  C  CA    . VAL A 1 136 ? 86.706  105.217 125.722 1.00 8.51   ? 136  VAL A CA    1 
ATOM   679  C  C     . VAL A 1 136 ? 85.473  104.323 125.784 1.00 8.51   ? 136  VAL A C     1 
ATOM   680  O  O     . VAL A 1 136 ? 85.573  103.128 126.069 1.00 8.51   ? 136  VAL A O     1 
ATOM   681  C  CB    . VAL A 1 136 ? 86.892  106.047 127.006 1.00 8.51   ? 136  VAL A CB    1 
ATOM   682  C  CG1   . VAL A 1 136 ? 86.784  105.193 128.244 1.00 8.51   ? 136  VAL A CG1   1 
ATOM   683  C  CG2   . VAL A 1 136 ? 88.232  106.742 126.978 1.00 8.51   ? 136  VAL A CG2   1 
ATOM   684  N  N     . ARG A 1 137 ? 84.304  104.864 125.457 1.00 9.70   ? 137  ARG A N     1 
ATOM   685  C  CA    . ARG A 1 137 ? 83.124  104.012 125.395 1.00 9.70   ? 137  ARG A CA    1 
ATOM   686  C  C     . ARG A 1 137 ? 83.132  103.132 124.155 1.00 9.70   ? 137  ARG A C     1 
ATOM   687  O  O     . ARG A 1 137 ? 82.699  101.983 124.222 1.00 9.70   ? 137  ARG A O     1 
ATOM   688  C  CB    . ARG A 1 137 ? 81.856  104.852 125.443 1.00 9.70   ? 137  ARG A CB    1 
ATOM   689  C  CG    . ARG A 1 137 ? 80.579  104.060 125.599 1.00 9.70   ? 137  ARG A CG    1 
ATOM   690  C  CD    . ARG A 1 137 ? 79.391  104.980 125.636 1.00 9.70   ? 137  ARG A CD    1 
ATOM   691  N  NE    . ARG A 1 137 ? 79.429  105.845 126.803 1.00 9.70   ? 137  ARG A NE    1 
ATOM   692  C  CZ    . ARG A 1 137 ? 78.945  105.504 127.988 1.00 9.70   ? 137  ARG A CZ    1 
ATOM   693  N  NH1   . ARG A 1 137 ? 78.377  104.318 128.154 1.00 9.70   ? 137  ARG A NH1   1 
ATOM   694  N  NH2   . ARG A 1 137 ? 79.023  106.351 129.002 1.00 9.70   ? 137  ARG A NH2   1 
ATOM   695  N  N     . GLU A 1 138 ? 83.642  103.632 123.029 1.00 8.34   ? 138  GLU A N     1 
ATOM   696  C  CA    . GLU A 1 138 ? 83.624  102.848 121.797 1.00 8.34   ? 138  GLU A CA    1 
ATOM   697  C  C     . GLU A 1 138 ? 84.637  101.715 121.817 1.00 8.34   ? 138  GLU A C     1 
ATOM   698  O  O     . GLU A 1 138 ? 84.429  100.695 121.157 1.00 8.34   ? 138  GLU A O     1 
ATOM   699  C  CB    . GLU A 1 138 ? 83.875  103.744 120.592 1.00 8.34   ? 138  GLU A CB    1 
ATOM   700  C  CG    . GLU A 1 138 ? 82.726  104.648 120.246 1.00 8.34   ? 138  GLU A CG    1 
ATOM   701  C  CD    . GLU A 1 138 ? 83.047  105.572 119.097 1.00 8.34   ? 138  GLU A CD    1 
ATOM   702  O  OE1   . GLU A 1 138 ? 84.221  105.622 118.687 1.00 8.34   ? 138  GLU A OE1   1 
ATOM   703  O  OE2   . GLU A 1 138 ? 82.127  106.246 118.596 1.00 8.34   ? 138  GLU A OE2   1 
ATOM   704  N  N     . ASN A 1 139 ? 85.739  101.875 122.544 1.00 7.55   ? 139  ASN A N     1 
ATOM   705  C  CA    . ASN A 1 139 ? 86.679  100.778 122.715 1.00 7.55   ? 139  ASN A CA    1 
ATOM   706  C  C     . ASN A 1 139 ? 86.150  99.737  123.681 1.00 7.55   ? 139  ASN A C     1 
ATOM   707  O  O     . ASN A 1 139 ? 86.500  98.561  123.570 1.00 7.55   ? 139  ASN A O     1 
ATOM   708  C  CB    . ASN A 1 139 ? 88.019  101.311 123.203 1.00 7.55   ? 139  ASN A CB    1 
ATOM   709  C  CG    . ASN A 1 139 ? 88.781  102.029 122.128 1.00 7.55   ? 139  ASN A CG    1 
ATOM   710  O  OD1   . ASN A 1 139 ? 88.864  101.564 121.000 1.00 7.55   ? 139  ASN A OD1   1 
ATOM   711  N  ND2   . ASN A 1 139 ? 89.340  103.172 122.467 1.00 7.55   ? 139  ASN A ND2   1 
ATOM   712  N  N     . LEU A 1 140 ? 85.322  100.150 124.631 1.00 8.38   ? 140  LEU A N     1 
ATOM   713  C  CA    . LEU A 1 140 ? 84.642  99.221  125.518 1.00 8.38   ? 140  LEU A CA    1 
ATOM   714  C  C     . LEU A 1 140 ? 83.453  98.563  124.839 1.00 8.38   ? 140  LEU A C     1 
ATOM   715  O  O     . LEU A 1 140 ? 83.113  97.424  125.162 1.00 8.38   ? 140  LEU A O     1 
ATOM   716  C  CB    . LEU A 1 140 ? 84.190  99.959  126.777 1.00 8.38   ? 140  LEU A CB    1 
ATOM   717  C  CG    . LEU A 1 140 ? 85.052  100.058 128.042 1.00 8.38   ? 140  LEU A CG    1 
ATOM   718  C  CD1   . LEU A 1 140 ? 85.101  98.739  128.720 1.00 8.38   ? 140  LEU A CD1   1 
ATOM   719  C  CD2   . LEU A 1 140 ? 86.465  100.513 127.781 1.00 8.38   ? 140  LEU A CD2   1 
ATOM   720  N  N     . GLN A 1 141 ? 82.803  99.259  123.907 1.00 9.77   ? 141  GLN A N     1 
ATOM   721  C  CA    . GLN A 1 141 ? 81.711  98.650  123.159 1.00 9.77   ? 141  GLN A CA    1 
ATOM   722  C  C     . GLN A 1 141 ? 82.219  97.638  122.150 1.00 9.77   ? 141  GLN A C     1 
ATOM   723  O  O     . GLN A 1 141 ? 81.529  96.657  121.865 1.00 9.77   ? 141  GLN A O     1 
ATOM   724  C  CB    . GLN A 1 141 ? 80.887  99.723  122.461 1.00 9.77   ? 141  GLN A CB    1 
ATOM   725  C  CG    . GLN A 1 141 ? 79.974  100.500 123.374 1.00 9.77   ? 141  GLN A CG    1 
ATOM   726  C  CD    . GLN A 1 141 ? 79.360  101.676 122.676 1.00 9.77   ? 141  GLN A CD    1 
ATOM   727  O  OE1   . GLN A 1 141 ? 79.703  101.974 121.539 1.00 9.77   ? 141  GLN A OE1   1 
ATOM   728  N  NE2   . GLN A 1 141 ? 78.448  102.358 123.350 1.00 9.77   ? 141  GLN A NE2   1 
ATOM   729  N  N     . PHE A 1 142 ? 83.415  97.853  121.608 1.00 8.30   ? 142  PHE A N     1 
ATOM   730  C  CA    . PHE A 1 142 ? 83.981  96.909  120.654 1.00 8.30   ? 142  PHE A CA    1 
ATOM   731  C  C     . PHE A 1 142 ? 84.458  95.642  121.350 1.00 8.30   ? 142  PHE A C     1 
ATOM   732  O  O     . PHE A 1 142 ? 84.330  94.544  120.804 1.00 8.30   ? 142  PHE A O     1 
ATOM   733  C  CB    . PHE A 1 142 ? 85.131  97.568  119.898 1.00 8.30   ? 142  PHE A CB    1 
ATOM   734  C  CG    . PHE A 1 142 ? 85.725  96.709  118.829 1.00 8.30   ? 142  PHE A CG    1 
ATOM   735  C  CD1   . PHE A 1 142 ? 85.082  96.548  117.624 1.00 8.30   ? 142  PHE A CD1   1 
ATOM   736  C  CD2   . PHE A 1 142 ? 86.929  96.065  119.024 1.00 8.30   ? 142  PHE A CD2   1 
ATOM   737  C  CE1   . PHE A 1 142 ? 85.626  95.763  116.641 1.00 8.30   ? 142  PHE A CE1   1 
ATOM   738  C  CE2   . PHE A 1 142 ? 87.466  95.278  118.040 1.00 8.30   ? 142  PHE A CE2   1 
ATOM   739  C  CZ    . PHE A 1 142 ? 86.817  95.136  116.849 1.00 8.30   ? 142  PHE A CZ    1 
ATOM   740  N  N     . SER A 1 143 ? 85.015  95.778  122.551 1.00 8.92   ? 143  SER A N     1 
ATOM   741  C  CA    . SER A 1 143 ? 85.528  94.625  123.279 1.00 8.92   ? 143  SER A CA    1 
ATOM   742  C  C     . SER A 1 143 ? 84.401  93.756  123.812 1.00 8.92   ? 143  SER A C     1 
ATOM   743  O  O     . SER A 1 143 ? 84.530  92.533  123.867 1.00 8.92   ? 143  SER A O     1 
ATOM   744  C  CB    . SER A 1 143 ? 86.423  95.097  124.415 1.00 8.92   ? 143  SER A CB    1 
ATOM   745  O  OG    . SER A 1 143 ? 86.856  94.010  125.197 1.00 8.92   ? 143  SER A OG    1 
ATOM   746  N  N     . ALA A 1 144 ? 83.290  94.366  124.212 1.00 10.27  ? 144  ALA A N     1 
ATOM   747  C  CA    . ALA A 1 144 ? 82.152  93.599  124.692 1.00 10.27  ? 144  ALA A CA    1 
ATOM   748  C  C     . ALA A 1 144 ? 81.363  92.964  123.566 1.00 10.27  ? 144  ALA A C     1 
ATOM   749  O  O     . ALA A 1 144 ? 80.665  91.975  123.797 1.00 10.27  ? 144  ALA A O     1 
ATOM   750  C  CB    . ALA A 1 144 ? 81.218  94.481  125.509 1.00 10.27  ? 144  ALA A CB    1 
ATOM   751  N  N     . ALA A 1 145 ? 81.446  93.510  122.362 1.00 9.84   ? 145  ALA A N     1 
ATOM   752  C  CA    . ALA A 1 145 ? 80.688  92.973  121.249 1.00 9.84   ? 145  ALA A CA    1 
ATOM   753  C  C     . ALA A 1 145 ? 81.287  91.702  120.688 1.00 9.84   ? 145  ALA A C     1 
ATOM   754  O  O     . ALA A 1 145 ? 80.573  90.933  120.043 1.00 9.84   ? 145  ALA A O     1 
ATOM   755  C  CB    . ALA A 1 145 ? 80.598  94.005  120.139 1.00 9.84   ? 145  ALA A CB    1 
ATOM   756  N  N     . LEU A 1 146 ? 82.574  91.469  120.901 1.00 9.40   ? 146  LEU A N     1 
ATOM   757  C  CA    . LEU A 1 146 ? 83.247  90.325  120.319 1.00 9.40   ? 146  LEU A CA    1 
ATOM   758  C  C     . LEU A 1 146 ? 83.711  89.314  121.347 1.00 9.40   ? 146  LEU A C     1 
ATOM   759  O  O     . LEU A 1 146 ? 84.075  88.199  120.971 1.00 9.40   ? 146  LEU A O     1 
ATOM   760  C  CB    . LEU A 1 146 ? 84.448  90.781  119.485 1.00 9.40   ? 146  LEU A CB    1 
ATOM   761  C  CG    . LEU A 1 146 ? 84.081  91.617  118.269 1.00 9.40   ? 146  LEU A CG    1 
ATOM   762  C  CD1   . LEU A 1 146 ? 85.303  91.982  117.486 1.00 9.40   ? 146  LEU A CD1   1 
ATOM   763  C  CD2   . LEU A 1 146 ? 83.113  90.859  117.416 1.00 9.40   ? 146  LEU A CD2   1 
ATOM   764  N  N     . ARG A 1 147 ? 83.706  89.663  122.623 1.00 10.45  ? 147  ARG A N     1 
ATOM   765  C  CA    . ARG A 1 147 ? 84.179  88.765  123.653 1.00 10.45  ? 147  ARG A CA    1 
ATOM   766  C  C     . ARG A 1 147 ? 83.094  88.385  124.646 1.00 10.45  ? 147  ARG A C     1 
ATOM   767  O  O     . ARG A 1 147 ? 83.371  87.636  125.586 1.00 10.45  ? 147  ARG A O     1 
ATOM   768  C  CB    . ARG A 1 147 ? 85.371  89.390  124.373 1.00 10.45  ? 147  ARG A CB    1 
ATOM   769  C  CG    . ARG A 1 147 ? 86.528  89.710  123.449 1.00 10.45  ? 147  ARG A CG    1 
ATOM   770  C  CD    . ARG A 1 147 ? 87.681  90.354  124.178 1.00 10.45  ? 147  ARG A CD    1 
ATOM   771  N  NE    . ARG A 1 147 ? 88.416  89.433  125.032 1.00 10.45  ? 147  ARG A NE    1 
ATOM   772  C  CZ    . ARG A 1 147 ? 89.401  89.800  125.844 1.00 10.45  ? 147  ARG A CZ    1 
ATOM   773  N  NH1   . ARG A 1 147 ? 89.774  91.069  125.906 1.00 10.45  ? 147  ARG A NH1   1 
ATOM   774  N  NH2   . ARG A 1 147 ? 90.013  88.894  126.594 1.00 10.45  ? 147  ARG A NH2   1 
ATOM   775  N  N     . LEU A 1 148 ? 81.875  88.879  124.473 1.00 13.35  ? 148  LEU A N     1 
ATOM   776  C  CA    . LEU A 1 148 ? 80.710  88.362  125.168 1.00 13.35  ? 148  LEU A CA    1 
ATOM   777  C  C     . LEU A 1 148 ? 79.793  87.687  124.156 1.00 13.35  ? 148  LEU A C     1 
ATOM   778  O  O     . LEU A 1 148 ? 79.785  88.037  122.975 1.00 13.35  ? 148  LEU A O     1 
ATOM   779  C  CB    . LEU A 1 148 ? 79.957  89.472  125.904 1.00 13.35  ? 148  LEU A CB    1 
ATOM   780  C  CG    . LEU A 1 148 ? 80.646  90.173  127.074 1.00 13.35  ? 148  LEU A CG    1 
ATOM   781  C  CD1   . LEU A 1 148 ? 79.775  91.291  127.596 1.00 13.35  ? 148  LEU A CD1   1 
ATOM   782  C  CD2   . LEU A 1 148 ? 80.967  89.204  128.182 1.00 13.35  ? 148  LEU A CD2   1 
ATOM   783  N  N     . ALA A 1 149 ? 79.029  86.707  124.619 1.00 18.28  ? 149  ALA A N     1 
ATOM   784  C  CA    . ALA A 1 149 ? 78.184  85.950  123.714 1.00 18.28  ? 149  ALA A CA    1 
ATOM   785  C  C     . ALA A 1 149 ? 76.959  86.763  123.314 1.00 18.28  ? 149  ALA A C     1 
ATOM   786  O  O     . ALA A 1 149 ? 76.553  87.698  124.002 1.00 18.28  ? 149  ALA A O     1 
ATOM   787  C  CB    . ALA A 1 149 ? 77.754  84.635  124.356 1.00 18.28  ? 149  ALA A CB    1 
ATOM   788  N  N     . THR A 1 150 ? 76.366  86.390  122.181 1.00 21.39  ? 150  THR A N     1 
ATOM   789  C  CA    . THR A 1 150 ? 75.188  87.075  121.665 1.00 21.39  ? 150  THR A CA    1 
ATOM   790  C  C     . THR A 1 150 ? 73.891  86.596  122.293 1.00 21.39  ? 150  THR A C     1 
ATOM   791  O  O     . THR A 1 150 ? 72.820  87.011  121.842 1.00 21.39  ? 150  THR A O     1 
ATOM   792  C  CB    . THR A 1 150 ? 75.094  86.923  120.149 1.00 21.39  ? 150  THR A CB    1 
ATOM   793  O  OG1   . THR A 1 150 ? 75.074  85.532  119.805 1.00 21.39  ? 150  THR A OG1   1 
ATOM   794  C  CG2   . THR A 1 150 ? 76.255  87.606  119.478 1.00 21.39  ? 150  THR A CG2   1 
ATOM   795  N  N     . THR A 1 151 ? 73.954  85.731  123.305 1.00 22.35  ? 151  THR A N     1 
ATOM   796  C  CA    . THR A 1 151 ? 72.786  85.512  124.147 1.00 22.35  ? 151  THR A CA    1 
ATOM   797  C  C     . THR A 1 151 ? 72.446  86.766  124.939 1.00 22.35  ? 151  THR A C     1 
ATOM   798  O  O     . THR A 1 151 ? 71.279  86.995  125.274 1.00 22.35  ? 151  THR A O     1 
ATOM   799  C  CB    . THR A 1 151 ? 73.034  84.340  125.089 1.00 22.35  ? 151  THR A CB    1 
ATOM   800  O  OG1   . THR A 1 151 ? 74.150  84.639  125.934 1.00 22.35  ? 151  THR A OG1   1 
ATOM   801  C  CG2   . THR A 1 151 ? 73.336  83.085  124.295 1.00 22.35  ? 151  THR A CG2   1 
ATOM   802  N  N     . MET A 1 152 ? 73.453  87.574  125.254 1.00 23.81  ? 152  MET A N     1 
ATOM   803  C  CA    . MET A 1 152 ? 73.242  88.913  125.776 1.00 23.81  ? 152  MET A CA    1 
ATOM   804  C  C     . MET A 1 152 ? 72.857  89.850  124.644 1.00 23.81  ? 152  MET A C     1 
ATOM   805  O  O     . MET A 1 152 ? 73.477  89.833  123.577 1.00 23.81  ? 152  MET A O     1 
ATOM   806  C  CB    . MET A 1 152 ? 74.511  89.417  126.449 1.00 23.81  ? 152  MET A CB    1 
ATOM   807  C  CG    . MET A 1 152 ? 74.884  88.676  127.700 1.00 23.81  ? 152  MET A CG    1 
ATOM   808  S  SD    . MET A 1 152 ? 76.464  89.282  128.269 1.00 23.81  ? 152  MET A SD    1 
ATOM   809  C  CE    . MET A 1 152 ? 75.997  90.971  128.582 1.00 23.81  ? 152  MET A CE    1 
ATOM   810  N  N     . THR A 1 153 ? 71.841  90.674  124.875 1.00 26.16  ? 153  THR A N     1 
ATOM   811  C  CA    . THR A 1 153 ? 71.454  91.642  123.867 1.00 26.16  ? 153  THR A CA    1 
ATOM   812  C  C     . THR A 1 153 ? 72.399  92.839  123.896 1.00 26.16  ? 153  THR A C     1 
ATOM   813  O  O     . THR A 1 153 ? 73.276  92.953  124.752 1.00 26.16  ? 153  THR A O     1 
ATOM   814  C  CB    . THR A 1 153 ? 70.008  92.085  124.073 1.00 26.16  ? 153  THR A CB    1 
ATOM   815  O  OG1   . THR A 1 153 ? 69.614  92.952  123.001 1.00 26.16  ? 153  THR A OG1   1 
ATOM   816  C  CG2   . THR A 1 153 ? 69.854  92.811  125.384 1.00 26.16  ? 153  THR A CG2   1 
ATOM   817  N  N     . ASN A 1 154 ? 72.214  93.742  122.933 1.00 26.82  ? 154  ASN A N     1 
ATOM   818  C  CA    . ASN A 1 154 ? 73.061  94.925  122.856 1.00 26.82  ? 154  ASN A CA    1 
ATOM   819  C  C     . ASN A 1 154 ? 72.728  95.935  123.947 1.00 26.82  ? 154  ASN A C     1 
ATOM   820  O  O     . ASN A 1 154 ? 73.553  96.805  124.240 1.00 26.82  ? 154  ASN A O     1 
ATOM   821  C  CB    . ASN A 1 154 ? 72.923  95.576  121.480 1.00 26.82  ? 154  ASN A CB    1 
ATOM   822  C  CG    . ASN A 1 154 ? 74.163  96.352  121.061 1.00 26.82  ? 154  ASN A CG    1 
ATOM   823  O  OD1   . ASN A 1 154 ? 74.284  96.756  119.908 1.00 26.82  ? 154  ASN A OD1   1 
ATOM   824  N  ND2   . ASN A 1 154 ? 75.101  96.532  121.980 1.00 26.82  ? 154  ASN A ND2   1 
ATOM   825  N  N     . HIS A 1 155 ? 71.542  95.846  124.544 1.00 26.70  ? 155  HIS A N     1 
ATOM   826  C  CA    . HIS A 1 155 ? 71.205  96.705  125.671 1.00 26.70  ? 155  HIS A CA    1 
ATOM   827  C  C     . HIS A 1 155 ? 71.860  96.221  126.956 1.00 26.70  ? 155  HIS A C     1 
ATOM   828  O  O     . HIS A 1 155 ? 72.336  97.034  127.753 1.00 26.70  ? 155  HIS A O     1 
ATOM   829  C  CB    . HIS A 1 155 ? 69.690  96.770  125.842 1.00 26.70  ? 155  HIS A CB    1 
ATOM   830  C  CG    . HIS A 1 155 ? 69.248  97.637  126.976 1.00 26.70  ? 155  HIS A CG    1 
ATOM   831  N  ND1   . HIS A 1 155 ? 69.278  99.013  126.917 1.00 26.70  ? 155  HIS A ND1   1 
ATOM   832  C  CD2   . HIS A 1 155 ? 68.766  97.323  128.201 1.00 26.70  ? 155  HIS A CD2   1 
ATOM   833  C  CE1   . HIS A 1 155 ? 68.833  99.510  128.057 1.00 26.70  ? 155  HIS A CE1   1 
ATOM   834  N  NE2   . HIS A 1 155 ? 68.516  98.505  128.853 1.00 26.70  ? 155  HIS A NE2   1 
ATOM   835  N  N     . GLU A 1 156 ? 71.890  94.903  127.176 1.00 26.10  ? 156  GLU A N     1 
ATOM   836  C  CA    . GLU A 1 156 ? 72.505  94.362  128.384 1.00 26.10  ? 156  GLU A CA    1 
ATOM   837  C  C     . GLU A 1 156 ? 74.019  94.456  128.340 1.00 26.10  ? 156  GLU A C     1 
ATOM   838  O  O     . GLU A 1 156 ? 74.660  94.482  129.394 1.00 26.10  ? 156  GLU A O     1 
ATOM   839  C  CB    . GLU A 1 156 ? 72.084  92.911  128.596 1.00 26.10  ? 156  GLU A CB    1 
ATOM   840  C  CG    . GLU A 1 156 ? 70.639  92.730  129.015 1.00 26.10  ? 156  GLU A CG    1 
ATOM   841  C  CD    . GLU A 1 156 ? 70.253  91.270  129.147 1.00 26.10  ? 156  GLU A CD    1 
ATOM   842  O  OE1   . GLU A 1 156 ? 71.076  90.403  128.788 1.00 26.10  ? 156  GLU A OE1   1 
ATOM   843  O  OE2   . GLU A 1 156 ? 69.126  90.988  129.605 1.00 26.10  ? 156  GLU A OE2   1 
ATOM   844  N  N     . LYS A 1 157 ? 74.611  94.492  127.145 1.00 19.89  ? 157  LYS A N     1 
ATOM   845  C  CA    . LYS A 1 157 ? 76.048  94.716  127.056 1.00 19.89  ? 157  LYS A CA    1 
ATOM   846  C  C     . LYS A 1 157 ? 76.404  96.145  127.426 1.00 19.89  ? 157  LYS A C     1 
ATOM   847  O  O     . LYS A 1 157 ? 77.382  96.376  128.140 1.00 19.89  ? 157  LYS A O     1 
ATOM   848  C  CB    . LYS A 1 157 ? 76.562  94.385  125.658 1.00 19.89  ? 157  LYS A CB    1 
ATOM   849  C  CG    . LYS A 1 157 ? 76.624  92.905  125.355 1.00 19.89  ? 157  LYS A CG    1 
ATOM   850  C  CD    . LYS A 1 157 ? 77.235  92.658  123.998 1.00 19.89  ? 157  LYS A CD    1 
ATOM   851  C  CE    . LYS A 1 157 ? 77.303  91.186  123.683 1.00 19.89  ? 157  LYS A CE    1 
ATOM   852  N  NZ    . LYS A 1 157 ? 77.885  90.945  122.341 1.00 19.89  ? 157  LYS A NZ    1 
ATOM   853  N  N     . ASN A 1 158 ? 75.608  97.116  126.976 1.00 20.73  ? 158  ASN A N     1 
ATOM   854  C  CA    . ASN A 1 158 ? 75.872  98.511  127.303 1.00 20.73  ? 158  ASN A CA    1 
ATOM   855  C  C     . ASN A 1 158 ? 75.545  98.850  128.750 1.00 20.73  ? 158  ASN A C     1 
ATOM   856  O  O     . ASN A 1 158 ? 76.023  99.870  129.249 1.00 20.73  ? 158  ASN A O     1 
ATOM   857  C  CB    . ASN A 1 158 ? 75.090  99.431  126.370 1.00 20.73  ? 158  ASN A CB    1 
ATOM   858  C  CG    . ASN A 1 158 ? 75.632  99.425  124.961 1.00 20.73  ? 158  ASN A CG    1 
ATOM   859  O  OD1   . ASN A 1 158 ? 76.841  99.438  124.750 1.00 20.73  ? 158  ASN A OD1   1 
ATOM   860  N  ND2   . ASN A 1 158 ? 74.737  99.408  123.985 1.00 20.73  ? 158  ASN A ND2   1 
ATOM   861  N  N     . GLU A 1 159 ? 74.735  98.038  129.430 1.00 23.21  ? 159  GLU A N     1 
ATOM   862  C  CA    . GLU A 1 159 ? 74.551  98.231  130.864 1.00 23.21  ? 159  GLU A CA    1 
ATOM   863  C  C     . GLU A 1 159 ? 75.788  97.805  131.635 1.00 23.21  ? 159  GLU A C     1 
ATOM   864  O  O     . GLU A 1 159 ? 76.133  98.415  132.651 1.00 23.21  ? 159  GLU A O     1 
ATOM   865  C  CB    . GLU A 1 159 ? 73.337  97.454  131.360 1.00 23.21  ? 159  GLU A CB    1 
ATOM   866  C  CG    . GLU A 1 159 ? 72.006  97.999  130.909 1.00 23.21  ? 159  GLU A CG    1 
ATOM   867  C  CD    . GLU A 1 159 ? 70.853  97.156  131.410 1.00 23.21  ? 159  GLU A CD    1 
ATOM   868  O  OE1   . GLU A 1 159 ? 71.116  96.088  132.003 1.00 23.21  ? 159  GLU A OE1   1 
ATOM   869  O  OE2   . GLU A 1 159 ? 69.687  97.555  131.210 1.00 23.21  ? 159  GLU A OE2   1 
ATOM   870  N  N     . ARG A 1 160 ? 76.460  96.752  131.177 1.00 19.86  ? 160  ARG A N     1 
ATOM   871  C  CA    . ARG A 1 160 ? 77.703  96.326  131.797 1.00 19.86  ? 160  ARG A CA    1 
ATOM   872  C  C     . ARG A 1 160 ? 78.879  97.205  131.410 1.00 19.86  ? 160  ARG A C     1 
ATOM   873  O  O     . ARG A 1 160 ? 79.864  97.247  132.146 1.00 19.86  ? 160  ARG A O     1 
ATOM   874  C  CB    . ARG A 1 160 ? 77.994  94.872  131.435 1.00 19.86  ? 160  ARG A CB    1 
ATOM   875  C  CG    . ARG A 1 160 ? 77.030  93.897  132.064 1.00 19.86  ? 160  ARG A CG    1 
ATOM   876  C  CD    . ARG A 1 160 ? 77.307  92.471  131.641 1.00 19.86  ? 160  ARG A CD    1 
ATOM   877  N  NE    . ARG A 1 160 ? 78.622  92.002  132.061 1.00 19.86  ? 160  ARG A NE    1 
ATOM   878  C  CZ    . ARG A 1 160 ? 78.884  91.470  133.250 1.00 19.86  ? 160  ARG A CZ    1 
ATOM   879  N  NH1   . ARG A 1 160 ? 77.920  91.346  134.152 1.00 19.86  ? 160  ARG A NH1   1 
ATOM   880  N  NH2   . ARG A 1 160 ? 80.114  91.070  133.542 1.00 19.86  ? 160  ARG A NH2   1 
ATOM   881  N  N     . ILE A 1 161 ? 78.804  97.900  130.277 1.00 16.65  ? 161  ILE A N     1 
ATOM   882  C  CA    . ILE A 1 161 ? 79.837  98.867  129.921 1.00 16.65  ? 161  ILE A CA    1 
ATOM   883  C  C     . ILE A 1 161 ? 79.699  100.129 130.759 1.00 16.65  ? 161  ILE A C     1 
ATOM   884  O  O     . ILE A 1 161 ? 80.698  100.697 131.212 1.00 16.65  ? 161  ILE A O     1 
ATOM   885  C  CB    . ILE A 1 161 ? 79.778  99.151  128.410 1.00 16.65  ? 161  ILE A CB    1 
ATOM   886  C  CG1   . ILE A 1 161 ? 80.196  97.905  127.645 1.00 16.65  ? 161  ILE A CG1   1 
ATOM   887  C  CG2   . ILE A 1 161 ? 80.675  100.293 128.016 1.00 16.65  ? 161  ILE A CG2   1 
ATOM   888  C  CD1   . ILE A 1 161 ? 79.805  97.923  126.217 1.00 16.65  ? 161  ILE A CD1   1 
ATOM   889  N  N     . ASN A 1 162 ? 78.462  100.566 131.012 1.00 16.96  ? 162  ASN A N     1 
ATOM   890  C  CA    . ASN A 1 162 ? 78.231  101.708 131.890 1.00 16.96  ? 162  ASN A CA    1 
ATOM   891  C  C     . ASN A 1 162 ? 78.651  101.418 133.321 1.00 16.96  ? 162  ASN A C     1 
ATOM   892  O  O     . ASN A 1 162 ? 79.087  102.327 134.027 1.00 16.96  ? 162  ASN A O     1 
ATOM   893  C  CB    . ASN A 1 162 ? 76.761  102.109 131.864 1.00 16.96  ? 162  ASN A CB    1 
ATOM   894  C  CG    . ASN A 1 162 ? 76.358  102.762 130.570 1.00 16.96  ? 162  ASN A CG    1 
ATOM   895  O  OD1   . ASN A 1 162 ? 77.096  103.572 130.018 1.00 16.96  ? 162  ASN A OD1   1 
ATOM   896  N  ND2   . ASN A 1 162 ? 75.174  102.423 130.080 1.00 16.96  ? 162  ASN A ND2   1 
ATOM   897  N  N     . ARG A 1 163 ? 78.539  100.165 133.757 1.00 19.28  ? 163  ARG A N     1 
ATOM   898  C  CA    . ARG A 1 163 ? 78.937  99.804  135.112 1.00 19.28  ? 163  ARG A CA    1 
ATOM   899  C  C     . ARG A 1 163 ? 80.452  99.817  135.266 1.00 19.28  ? 163  ARG A C     1 
ATOM   900  O  O     . ARG A 1 163 ? 80.970  100.224 136.310 1.00 19.28  ? 163  ARG A O     1 
ATOM   901  C  CB    . ARG A 1 163 ? 78.370  98.432  135.462 1.00 19.28  ? 163  ARG A CB    1 
ATOM   902  C  CG    . ARG A 1 163 ? 78.594  97.995  136.887 1.00 19.28  ? 163  ARG A CG    1 
ATOM   903  C  CD    . ARG A 1 163 ? 77.964  96.635  137.154 1.00 19.28  ? 163  ARG A CD    1 
ATOM   904  N  NE    . ARG A 1 163 ? 76.513  96.668  136.996 1.00 19.28  ? 163  ARG A NE    1 
ATOM   905  C  CZ    . ARG A 1 163 ? 75.839  95.975  136.084 1.00 19.28  ? 163  ARG A CZ    1 
ATOM   906  N  NH1   . ARG A 1 163 ? 76.481  95.173  135.249 1.00 19.28  ? 163  ARG A NH1   1 
ATOM   907  N  NH2   . ARG A 1 163 ? 74.520  96.076  136.013 1.00 19.28  ? 163  ARG A NH2   1 
ATOM   908  N  N     . VAL A 1 164 ? 81.177  99.390  134.232 1.00 15.91  ? 164  VAL A N     1 
ATOM   909  C  CA    . VAL A 1 164 ? 82.635  99.367  134.289 1.00 15.91  ? 164  VAL A CA    1 
ATOM   910  C  C     . VAL A 1 164 ? 83.206  100.777 134.195 1.00 15.91  ? 164  VAL A C     1 
ATOM   911  O  O     . VAL A 1 164 ? 84.221  101.087 134.830 1.00 15.91  ? 164  VAL A O     1 
ATOM   912  C  CB    . VAL A 1 164 ? 83.154  98.415  133.192 1.00 15.91  ? 164  VAL A CB    1 
ATOM   913  C  CG1   . VAL A 1 164 ? 84.646  98.486  133.012 1.00 15.91  ? 164  VAL A CG1   1 
ATOM   914  C  CG2   . VAL A 1 164 ? 82.802  97.013  133.578 1.00 15.91  ? 164  VAL A CG2   1 
ATOM   915  N  N     . ILE A 1 165 ? 82.538  101.668 133.462 1.00 14.70  ? 165  ILE A N     1 
ATOM   916  C  CA    . ILE A 1 165 ? 82.955  103.067 133.408 1.00 14.70  ? 165  ILE A CA    1 
ATOM   917  C  C     . ILE A 1 165 ? 82.756  103.748 134.761 1.00 14.70  ? 165  ILE A C     1 
ATOM   918  O  O     . ILE A 1 165 ? 83.597  104.542 135.197 1.00 14.70  ? 165  ILE A O     1 
ATOM   919  C  CB    . ILE A 1 165 ? 82.211  103.780 132.261 1.00 14.70  ? 165  ILE A CB    1 
ATOM   920  C  CG1   . ILE A 1 165 ? 82.729  103.280 130.916 1.00 14.70  ? 165  ILE A CG1   1 
ATOM   921  C  CG2   . ILE A 1 165 ? 82.352  105.276 132.321 1.00 14.70  ? 165  ILE A CG2   1 
ATOM   922  C  CD1   . ILE A 1 165 ? 81.938  103.754 129.753 1.00 14.70  ? 165  ILE A CD1   1 
ATOM   923  N  N     . GLN A 1 166 ? 81.683  103.402 135.479 1.00 17.73  ? 166  GLN A N     1 
ATOM   924  C  CA    . GLN A 1 166 ? 81.479  103.957 136.816 1.00 17.73  ? 166  GLN A CA    1 
ATOM   925  C  C     . GLN A 1 166 ? 82.483  103.399 137.818 1.00 17.73  ? 166  GLN A C     1 
ATOM   926  O  O     . GLN A 1 166 ? 83.032  104.147 138.632 1.00 17.73  ? 166  GLN A O     1 
ATOM   927  C  CB    . GLN A 1 166 ? 80.060  103.678 137.303 1.00 17.73  ? 166  GLN A CB    1 
ATOM   928  C  CG    . GLN A 1 166 ? 78.969  104.380 136.530 1.00 17.73  ? 166  GLN A CG    1 
ATOM   929  C  CD    . GLN A 1 166 ? 79.016  105.875 136.680 1.00 17.73  ? 166  GLN A CD    1 
ATOM   930  O  OE1   . GLN A 1 166 ? 79.318  106.389 137.752 1.00 17.73  ? 166  GLN A OE1   1 
ATOM   931  N  NE2   . GLN A 1 166 ? 78.698  106.586 135.608 1.00 17.73  ? 166  GLN A NE2   1 
ATOM   932  N  N     . GLU A 1 167 ? 82.737  102.092 137.773 1.00 18.83  ? 167  GLU A N     1 
ATOM   933  C  CA    . GLU A 1 167 ? 83.614  101.457 138.749 1.00 18.83  ? 167  GLU A CA    1 
ATOM   934  C  C     . GLU A 1 167 ? 85.082  101.786 138.537 1.00 18.83  ? 167  GLU A C     1 
ATOM   935  O  O     . GLU A 1 167 ? 85.858  101.709 139.492 1.00 18.83  ? 167  GLU A O     1 
ATOM   936  C  CB    . GLU A 1 167 ? 83.399  99.948  138.721 1.00 18.83  ? 167  GLU A CB    1 
ATOM   937  C  CG    . GLU A 1 167 ? 82.091  99.539  139.355 1.00 18.83  ? 167  GLU A CG    1 
ATOM   938  C  CD    . GLU A 1 167 ? 81.767  98.077  139.169 1.00 18.83  ? 167  GLU A CD    1 
ATOM   939  O  OE1   . GLU A 1 167 ? 82.436  97.415  138.347 1.00 18.83  ? 167  GLU A OE1   1 
ATOM   940  O  OE2   . GLU A 1 167 ? 80.850  97.586  139.861 1.00 18.83  ? 167  GLU A OE2   1 
ATOM   941  N  N     . LEU A 1 168 ? 85.485  102.158 137.327 1.00 12.95  ? 168  LEU A N     1 
ATOM   942  C  CA    . LEU A 1 168 ? 86.859  102.560 137.074 1.00 12.95  ? 168  LEU A CA    1 
ATOM   943  C  C     . LEU A 1 168 ? 87.066  104.065 137.115 1.00 12.95  ? 168  LEU A C     1 
ATOM   944  O  O     . LEU A 1 168 ? 88.212  104.512 137.063 1.00 12.95  ? 168  LEU A O     1 
ATOM   945  C  CB    . LEU A 1 168 ? 87.327  102.030 135.723 1.00 12.95  ? 168  LEU A CB    1 
ATOM   946  C  CG    . LEU A 1 168 ? 87.569  100.533 135.621 1.00 12.95  ? 168  LEU A CG    1 
ATOM   947  C  CD1   . LEU A 1 168 ? 87.755  100.204 134.201 1.00 12.95  ? 168  LEU A CD1   1 
ATOM   948  C  CD2   . LEU A 1 168 ? 88.805  100.156 136.388 1.00 12.95  ? 168  LEU A CD2   1 
ATOM   949  N  N     . GLY A 1 169 ? 86.003  104.851 137.207 1.00 14.44  ? 169  GLY A N     1 
ATOM   950  C  CA    . GLY A 1 169 ? 86.154  106.289 137.261 1.00 14.44  ? 169  GLY A CA    1 
ATOM   951  C  C     . GLY A 1 169 ? 86.400  106.929 135.918 1.00 14.44  ? 169  GLY A C     1 
ATOM   952  O  O     . GLY A 1 169 ? 87.228  107.838 135.809 1.00 14.44  ? 169  GLY A O     1 
ATOM   953  N  N     . LEU A 1 170 ? 85.695  106.485 134.887 1.00 12.85  ? 170  LEU A N     1 
ATOM   954  C  CA    . LEU A 1 170 ? 85.909  106.950 133.526 1.00 12.85  ? 170  LEU A CA    1 
ATOM   955  C  C     . LEU A 1 170 ? 84.749  107.800 133.019 1.00 12.85  ? 170  LEU A C     1 
ATOM   956  O  O     . LEU A 1 170 ? 84.509  107.857 131.816 1.00 12.85  ? 170  LEU A O     1 
ATOM   957  C  CB    . LEU A 1 170 ? 86.127  105.756 132.602 1.00 12.85  ? 170  LEU A CB    1 
ATOM   958  C  CG    . LEU A 1 170 ? 87.401  104.941 132.782 1.00 12.85  ? 170  LEU A CG    1 
ATOM   959  C  CD1   . LEU A 1 170 ? 87.300  103.652 132.015 1.00 12.85  ? 170  LEU A CD1   1 
ATOM   960  C  CD2   . LEU A 1 170 ? 88.570  105.753 132.295 1.00 12.85  ? 170  LEU A CD2   1 
ATOM   961  N  N     . ASP A 1 171 ? 84.023  108.464 133.922 1.00 16.26  ? 171  ASP A N     1 
ATOM   962  C  CA    . ASP A 1 171 ? 82.796  109.152 133.530 1.00 16.26  ? 171  ASP A CA    1 
ATOM   963  C  C     . ASP A 1 171 ? 83.078  110.414 132.733 1.00 16.26  ? 171  ASP A C     1 
ATOM   964  O  O     . ASP A 1 171 ? 82.396  110.693 131.741 1.00 16.26  ? 171  ASP A O     1 
ATOM   965  C  CB    . ASP A 1 171 ? 81.973  109.509 134.758 1.00 16.26  ? 171  ASP A CB    1 
ATOM   966  C  CG    . ASP A 1 171 ? 81.350  108.315 135.397 1.00 16.26  ? 171  ASP A CG    1 
ATOM   967  O  OD1   . ASP A 1 171 ? 81.127  107.310 134.696 1.00 16.26  ? 171  ASP A OD1   1 
ATOM   968  O  OD2   . ASP A 1 171 ? 81.040  108.393 136.598 1.00 16.26  ? 171  ASP A OD2   1 
ATOM   969  N  N     . LYS A 1 172 ? 84.065  111.196 133.160 1.00 16.90  ? 172  LYS A N     1 
ATOM   970  C  CA    . LYS A 1 172 ? 84.356  112.461 132.504 1.00 16.90  ? 172  LYS A CA    1 
ATOM   971  C  C     . LYS A 1 172 ? 85.009  112.276 131.144 1.00 16.90  ? 172  LYS A C     1 
ATOM   972  O  O     . LYS A 1 172 ? 85.029  113.221 130.351 1.00 16.90  ? 172  LYS A O     1 
ATOM   973  C  CB    . LYS A 1 172 ? 85.248  113.313 133.404 1.00 16.90  ? 172  LYS A CB    1 
ATOM   974  C  CG    . LYS A 1 172 ? 84.558  113.768 134.673 1.00 16.90  ? 172  LYS A CG    1 
ATOM   975  C  CD    . LYS A 1 172 ? 85.482  114.596 135.544 1.00 16.90  ? 172  LYS A CD    1 
ATOM   976  C  CE    . LYS A 1 172 ? 84.733  115.163 136.735 1.00 16.90  ? 172  LYS A CE    1 
ATOM   977  N  NZ    . LYS A 1 172 ? 84.253  114.093 137.650 1.00 16.90  ? 172  LYS A NZ    1 
ATOM   978  N  N     . VAL A 1 173 ? 85.545  111.093 130.855 1.00 12.43  ? 173  VAL A N     1 
ATOM   979  C  CA    . VAL A 1 173 ? 86.222  110.841 129.594 1.00 12.43  ? 173  VAL A CA    1 
ATOM   980  C  C     . VAL A 1 173 ? 85.615  109.659 128.843 1.00 12.43  ? 173  VAL A C     1 
ATOM   981  O  O     . VAL A 1 173 ? 86.228  109.151 127.930 1.00 12.43  ? 173  VAL A O     1 
ATOM   982  C  CB    . VAL A 1 173 ? 87.733  110.636 129.804 1.00 12.43  ? 173  VAL A CB    1 
ATOM   983  C  CG1   . VAL A 1 173 ? 88.365  111.904 130.323 1.00 12.43  ? 173  VAL A CG1   1 
ATOM   984  C  CG2   . VAL A 1 173 ? 87.981  109.491 130.746 1.00 12.43  ? 173  VAL A CG2   1 
ATOM   985  N  N     . ALA A 1 174 ? 84.404  109.232 129.210 1.00 11.62  ? 174  ALA A N     1 
ATOM   986  C  CA    . ALA A 1 174 ? 83.759  108.121 128.514 1.00 11.62  ? 174  ALA A CA    1 
ATOM   987  C  C     . ALA A 1 174 ? 83.423  108.468 127.075 1.00 11.62  ? 174  ALA A C     1 
ATOM   988  O  O     . ALA A 1 174 ? 83.493  107.604 126.199 1.00 11.62  ? 174  ALA A O     1 
ATOM   989  C  CB    . ALA A 1 174 ? 82.486  107.698 129.240 1.00 11.62  ? 174  ALA A CB    1 
ATOM   990  N  N     . ASP A 1 175 ? 83.069  109.721 126.809 1.00 14.27  ? 175  ASP A N     1 
ATOM   991  C  CA    . ASP A 1 175 ? 82.752  110.173 125.467 1.00 14.27  ? 175  ASP A CA    1 
ATOM   992  C  C     . ASP A 1 175 ? 83.885  110.982 124.850 1.00 14.27  ? 175  ASP A C     1 
ATOM   993  O  O     . ASP A 1 175 ? 83.655  111.733 123.899 1.00 14.27  ? 175  ASP A O     1 
ATOM   994  C  CB    . ASP A 1 175 ? 81.455  110.976 125.485 1.00 14.27  ? 175  ASP A CB    1 
ATOM   995  C  CG    . ASP A 1 175 ? 80.243  110.116 125.803 1.00 14.27  ? 175  ASP A CG    1 
ATOM   996  O  OD1   . ASP A 1 175 ? 80.234  108.924 125.435 1.00 14.27  ? 175  ASP A OD1   1 
ATOM   997  O  OD2   . ASP A 1 175 ? 79.299  110.632 126.432 1.00 14.27  ? 175  ASP A OD2   1 
ATOM   998  N  N     . SER A 1 176 ? 85.106  110.818 125.353 1.00 12.00  ? 176  SER A N     1 
ATOM   999  C  CA    . SER A 1 176 ? 86.285  111.496 124.837 1.00 12.00  ? 176  SER A CA    1 
ATOM   1000 C  C     . SER A 1 176 ? 87.170  110.510 124.091 1.00 12.00  ? 176  SER A C     1 
ATOM   1001 O  O     . SER A 1 176 ? 87.270  109.341 124.463 1.00 12.00  ? 176  SER A O     1 
ATOM   1002 C  CB    . SER A 1 176 ? 87.096  112.146 125.961 1.00 12.00  ? 176  SER A CB    1 
ATOM   1003 O  OG    . SER A 1 176 ? 86.365  113.170 126.609 1.00 12.00  ? 176  SER A OG    1 
ATOM   1004 N  N     . LYS A 1 177 ? 87.829  111.005 123.047 1.00 9.28   ? 177  LYS A N     1 
ATOM   1005 C  CA    . LYS A 1 177 ? 88.666  110.162 122.204 1.00 9.28   ? 177  LYS A CA    1 
ATOM   1006 C  C     . LYS A 1 177 ? 89.917  109.761 122.967 1.00 9.28   ? 177  LYS A C     1 
ATOM   1007 O  O     . LYS A 1 177 ? 90.553  110.602 123.608 1.00 9.28   ? 177  LYS A O     1 
ATOM   1008 C  CB    . LYS A 1 177 ? 89.062  110.911 120.934 1.00 9.28   ? 177  LYS A CB    1 
ATOM   1009 C  CG    . LYS A 1 177 ? 87.913  111.539 120.177 1.00 9.28   ? 177  LYS A CG    1 
ATOM   1010 C  CD    . LYS A 1 177 ? 86.999  110.528 119.546 1.00 9.28   ? 177  LYS A CD    1 
ATOM   1011 C  CE    . LYS A 1 177 ? 87.650  109.929 118.339 1.00 9.28   ? 177  LYS A CE    1 
ATOM   1012 N  NZ    . LYS A 1 177 ? 86.722  109.016 117.621 1.00 9.28   ? 177  LYS A NZ    1 
ATOM   1013 N  N     . VAL A 1 178 ? 90.250  108.469 122.932 1.00 9.04   ? 178  VAL A N     1 
ATOM   1014 C  CA    . VAL A 1 178 ? 91.575  108.042 123.353 1.00 9.04   ? 178  VAL A CA    1 
ATOM   1015 C  C     . VAL A 1 178 ? 92.563  108.656 122.380 1.00 9.04   ? 178  VAL A C     1 
ATOM   1016 O  O     . VAL A 1 178 ? 92.285  108.756 121.186 1.00 9.04   ? 178  VAL A O     1 
ATOM   1017 C  CB    . VAL A 1 178 ? 91.666  106.507 123.369 1.00 9.04   ? 178  VAL A CB    1 
ATOM   1018 C  CG1   . VAL A 1 178 ? 93.016  106.039 123.870 1.00 9.04   ? 178  VAL A CG1   1 
ATOM   1019 C  CG2   . VAL A 1 178 ? 90.560  105.920 124.199 1.00 9.04   ? 178  VAL A CG2   1 
ATOM   1020 N  N     . GLY A 1 179 ? 93.677  109.141 122.874 1.00 9.17   ? 179  GLY A N     1 
ATOM   1021 C  CA    . GLY A 1 179 ? 94.590  109.836 121.998 1.00 9.17   ? 179  GLY A CA    1 
ATOM   1022 C  C     . GLY A 1 179 ? 95.411  108.912 121.124 1.00 9.17   ? 179  GLY A C     1 
ATOM   1023 O  O     . GLY A 1 179 ? 95.575  107.725 121.386 1.00 9.17   ? 179  GLY A O     1 
ATOM   1024 N  N     . THR A 1 180 ? 95.924  109.475 120.043 1.00 10.63  ? 180  THR A N     1 
ATOM   1025 C  CA    . THR A 1 180 ? 97.019  108.868 119.314 1.00 10.63  ? 180  THR A CA    1 
ATOM   1026 C  C     . THR A 1 180 ? 98.311  109.502 119.818 1.00 10.63  ? 180  THR A C     1 
ATOM   1027 O  O     . THR A 1 180 ? 98.312  110.267 120.784 1.00 10.63  ? 180  THR A O     1 
ATOM   1028 C  CB    . THR A 1 180 ? 96.836  109.033 117.804 1.00 10.63  ? 180  THR A CB    1 
ATOM   1029 O  OG1   . THR A 1 180 ? 96.886  110.419 117.459 1.00 10.63  ? 180  THR A OG1   1 
ATOM   1030 C  CG2   . THR A 1 180 ? 95.502  108.479 117.376 1.00 10.63  ? 180  THR A CG2   1 
ATOM   1031 N  N     . GLN A 1 181 ? 99.425  109.188 119.173 1.00 12.51  ? 181  GLN A N     1 
ATOM   1032 C  CA    . GLN A 1 181 ? 100.696 109.777 119.566 1.00 12.51  ? 181  GLN A CA    1 
ATOM   1033 C  C     . GLN A 1 181 ? 100.937 111.130 118.923 1.00 12.51  ? 181  GLN A C     1 
ATOM   1034 O  O     . GLN A 1 181 ? 101.968 111.749 119.191 1.00 12.51  ? 181  GLN A O     1 
ATOM   1035 C  CB    . GLN A 1 181 ? 101.854 108.835 119.231 1.00 12.51  ? 181  GLN A CB    1 
ATOM   1036 C  CG    . GLN A 1 181 ? 102.055 108.599 117.763 1.00 12.51  ? 181  GLN A CG    1 
ATOM   1037 C  CD    . GLN A 1 181 ? 103.180 107.636 117.484 1.00 12.51  ? 181  GLN A CD    1 
ATOM   1038 O  OE1   . GLN A 1 181 ? 103.839 107.158 118.401 1.00 12.51  ? 181  GLN A OE1   1 
ATOM   1039 N  NE2   . GLN A 1 181 ? 103.415 107.349 116.210 1.00 12.51  ? 181  GLN A NE2   1 
ATOM   1040 N  N     . PHE A 1 182 ? 100.023 111.607 118.092 1.00 11.27  ? 182  PHE A N     1 
ATOM   1041 C  CA    . PHE A 1 182 ? 100.149 112.933 117.511 1.00 11.27  ? 182  PHE A CA    1 
ATOM   1042 C  C     . PHE A 1 182 ? 99.031  113.864 117.926 1.00 11.27  ? 182  PHE A C     1 
ATOM   1043 O  O     . PHE A 1 182 ? 99.276  115.047 118.155 1.00 11.27  ? 182  PHE A O     1 
ATOM   1044 C  CB    . PHE A 1 182 ? 100.205 112.843 115.986 1.00 11.27  ? 182  PHE A CB    1 
ATOM   1045 C  CG    . PHE A 1 182 ? 101.372 112.065 115.488 1.00 11.27  ? 182  PHE A CG    1 
ATOM   1046 C  CD1   . PHE A 1 182 ? 102.643 112.596 115.555 1.00 11.27  ? 182  PHE A CD1   1 
ATOM   1047 C  CD2   . PHE A 1 182 ? 101.204 110.804 114.955 1.00 11.27  ? 182  PHE A CD2   1 
ATOM   1048 C  CE1   . PHE A 1 182 ? 103.720 111.881 115.115 1.00 11.27  ? 182  PHE A CE1   1 
ATOM   1049 C  CE2   . PHE A 1 182 ? 102.280 110.091 114.502 1.00 11.27  ? 182  PHE A CE2   1 
ATOM   1050 C  CZ    . PHE A 1 182 ? 103.539 110.631 114.583 1.00 11.27  ? 182  PHE A CZ    1 
ATOM   1051 N  N     . ILE A 1 183 ? 97.811  113.361 118.037 1.00 10.22  ? 183  ILE A N     1 
ATOM   1052 C  CA    . ILE A 1 183 ? 96.702  114.119 118.594 1.00 10.22  ? 183  ILE A CA    1 
ATOM   1053 C  C     . ILE A 1 183 ? 96.526  113.664 120.031 1.00 10.22  ? 183  ILE A C     1 
ATOM   1054 O  O     . ILE A 1 183 ? 96.169  112.509 120.288 1.00 10.22  ? 183  ILE A O     1 
ATOM   1055 C  CB    . ILE A 1 183 ? 95.401  113.942 117.796 1.00 10.22  ? 183  ILE A CB    1 
ATOM   1056 C  CG1   . ILE A 1 183 ? 95.539  114.470 116.369 1.00 10.22  ? 183  ILE A CG1   1 
ATOM   1057 C  CG2   . ILE A 1 183 ? 94.272  114.665 118.485 1.00 10.22  ? 183  ILE A CG2   1 
ATOM   1058 C  CD1   . ILE A 1 183 ? 95.833  113.405 115.343 1.00 10.22  ? 183  ILE A CD1   1 
ATOM   1059 N  N     . ARG A 1 184 ? 96.802  114.571 120.958 1.00 9.31   ? 184  ARG A N     1 
ATOM   1060 C  CA    . ARG A 1 184 ? 96.592  114.336 122.375 1.00 9.31   ? 184  ARG A CA    1 
ATOM   1061 C  C     . ARG A 1 184 ? 95.113  114.140 122.680 1.00 9.31   ? 184  ARG A C     1 
ATOM   1062 O  O     . ARG A 1 184 ? 94.248  114.846 122.161 1.00 9.31   ? 184  ARG A O     1 
ATOM   1063 C  CB    . ARG A 1 184 ? 97.154  115.521 123.156 1.00 9.31   ? 184  ARG A CB    1 
ATOM   1064 C  CG    . ARG A 1 184 ? 96.801  115.592 124.610 1.00 9.31   ? 184  ARG A CG    1 
ATOM   1065 C  CD    . ARG A 1 184 ? 97.427  114.509 125.410 1.00 9.31   ? 184  ARG A CD    1 
ATOM   1066 N  NE    . ARG A 1 184 ? 97.064  114.663 126.808 1.00 9.31   ? 184  ARG A NE    1 
ATOM   1067 C  CZ    . ARG A 1 184 ? 97.748  115.409 127.661 1.00 9.31   ? 184  ARG A CZ    1 
ATOM   1068 N  NH1   . ARG A 1 184 ? 97.353  115.493 128.907 1.00 9.31   ? 184  ARG A NH1   1 
ATOM   1069 N  NH2   . ARG A 1 184 ? 98.827  116.072 127.271 1.00 9.31   ? 184  ARG A NH2   1 
ATOM   1070 N  N     . GLY A 1 185 ? 94.823  113.149 123.512 1.00 8.54   ? 185  GLY A N     1 
ATOM   1071 C  CA    . GLY A 1 185 ? 93.472  112.944 123.979 1.00 8.54   ? 185  GLY A CA    1 
ATOM   1072 C  C     . GLY A 1 185 ? 93.420  112.632 125.455 1.00 8.54   ? 185  GLY A C     1 
ATOM   1073 O  O     . GLY A 1 185 ? 93.939  113.382 126.280 1.00 8.54   ? 185  GLY A O     1 
ATOM   1074 N  N     . VAL A 1 186 ? 92.759  111.530 125.780 1.00 9.55   ? 186  VAL A N     1 
ATOM   1075 C  CA    . VAL A 1 186 ? 92.703  110.911 127.101 1.00 9.55   ? 186  VAL A CA    1 
ATOM   1076 C  C     . VAL A 1 186 ? 94.094  110.717 127.704 1.00 9.55   ? 186  VAL A C     1 
ATOM   1077 O  O     . VAL A 1 186 ? 95.034  110.316 127.010 1.00 9.55   ? 186  VAL A O     1 
ATOM   1078 C  CB    . VAL A 1 186 ? 91.915  109.594 126.957 1.00 9.55   ? 186  VAL A CB    1 
ATOM   1079 C  CG1   . VAL A 1 186 ? 92.237  108.605 128.004 1.00 9.55   ? 186  VAL A CG1   1 
ATOM   1080 C  CG2   . VAL A 1 186 ? 90.445  109.897 127.012 1.00 9.55   ? 186  VAL A CG2   1 
ATOM   1081 N  N     . SER A 1 187 ? 94.240  111.034 128.992 1.00 9.00   ? 187  SER A N     1 
ATOM   1082 C  CA    . SER A 1 187 ? 95.520  111.039 129.682 1.00 9.00   ? 187  SER A CA    1 
ATOM   1083 C  C     . SER A 1 187 ? 96.059  109.624 129.876 1.00 9.00   ? 187  SER A C     1 
ATOM   1084 O  O     . SER A 1 187 ? 95.410  108.631 129.555 1.00 9.00   ? 187  SER A O     1 
ATOM   1085 C  CB    . SER A 1 187 ? 95.392  111.750 131.023 1.00 9.00   ? 187  SER A CB    1 
ATOM   1086 O  OG    . SER A 1 187 ? 94.564  111.039 131.912 1.00 9.00   ? 187  SER A OG    1 
ATOM   1087 N  N     . GLY A 1 188 ? 97.268  109.538 130.433 1.00 8.96   ? 188  GLY A N     1 
ATOM   1088 C  CA    . GLY A 1 188 ? 97.970  108.269 130.493 1.00 8.96   ? 188  GLY A CA    1 
ATOM   1089 C  C     . GLY A 1 188 ? 97.404  107.295 131.501 1.00 8.96   ? 188  GLY A C     1 
ATOM   1090 O  O     . GLY A 1 188 ? 97.490  106.083 131.306 1.00 8.96   ? 188  GLY A O     1 
ATOM   1091 N  N     . GLY A 1 189 ? 96.831  107.798 132.584 1.00 8.78   ? 189  GLY A N     1 
ATOM   1092 C  CA    . GLY A 1 189 ? 96.201  106.943 133.564 1.00 8.78   ? 189  GLY A CA    1 
ATOM   1093 C  C     . GLY A 1 189 ? 94.771  106.630 133.201 1.00 8.78   ? 189  GLY A C     1 
ATOM   1094 O  O     . GLY A 1 189 ? 94.239  105.585 133.568 1.00 8.78   ? 189  GLY A O     1 
ATOM   1095 N  N     . GLU A 1 190 ? 94.136  107.543 132.476 1.00 9.55   ? 190  GLU A N     1 
ATOM   1096 C  CA    . GLU A 1 190 ? 92.789  107.307 131.980 1.00 9.55   ? 190  GLU A CA    1 
ATOM   1097 C  C     . GLU A 1 190 ? 92.780  106.357 130.794 1.00 9.55   ? 190  GLU A C     1 
ATOM   1098 O  O     . GLU A 1 190 ? 91.777  105.679 130.560 1.00 9.55   ? 190  GLU A O     1 
ATOM   1099 C  CB    . GLU A 1 190 ? 92.141  108.633 131.601 1.00 9.55   ? 190  GLU A CB    1 
ATOM   1100 C  CG    . GLU A 1 190 ? 91.781  109.508 132.760 1.00 9.55   ? 190  GLU A CG    1 
ATOM   1101 C  CD    . GLU A 1 190 ? 91.276  110.848 132.321 1.00 9.55   ? 190  GLU A CD    1 
ATOM   1102 O  OE1   . GLU A 1 190 ? 91.440  111.170 131.131 1.00 9.55   ? 190  GLU A OE1   1 
ATOM   1103 O  OE2   . GLU A 1 190 ? 90.704  111.579 133.154 1.00 9.55   ? 190  GLU A OE2   1 
ATOM   1104 N  N     . ARG A 1 191 ? 93.872  106.312 130.033 1.00 9.72   ? 191  ARG A N     1 
ATOM   1105 C  CA    . ARG A 1 191 ? 94.059  105.306 128.996 1.00 9.72   ? 191  ARG A CA    1 
ATOM   1106 C  C     . ARG A 1 191 ? 94.422  103.954 129.587 1.00 9.72   ? 191  ARG A C     1 
ATOM   1107 O  O     . ARG A 1 191 ? 94.077  102.919 129.013 1.00 9.72   ? 191  ARG A O     1 
ATOM   1108 C  CB    . ARG A 1 191 ? 95.148  105.767 128.031 1.00 9.72   ? 191  ARG A CB    1 
ATOM   1109 C  CG    . ARG A 1 191 ? 95.378  104.889 126.835 1.00 9.72   ? 191  ARG A CG    1 
ATOM   1110 C  CD    . ARG A 1 191 ? 96.473  105.440 125.958 1.00 9.72   ? 191  ARG A CD    1 
ATOM   1111 N  NE    . ARG A 1 191 ? 97.762  105.423 126.635 1.00 9.72   ? 191  ARG A NE    1 
ATOM   1112 C  CZ    . ARG A 1 191 ? 98.434  106.512 126.985 1.00 9.72   ? 191  ARG A CZ    1 
ATOM   1113 N  NH1   . ARG A 1 191 ? 97.935  107.713 126.729 1.00 9.72   ? 191  ARG A NH1   1 
ATOM   1114 N  NH2   . ARG A 1 191 ? 99.601  106.399 127.600 1.00 9.72   ? 191  ARG A NH2   1 
ATOM   1115 N  N     . LYS A 1 192 ? 95.118  103.949 130.725 1.00 9.21   ? 192  LYS A N     1 
ATOM   1116 C  CA    . LYS A 1 192 ? 95.434  102.705 131.416 1.00 9.21   ? 192  LYS A CA    1 
ATOM   1117 C  C     . LYS A 1 192 ? 94.176  102.004 131.901 1.00 9.21   ? 192  LYS A C     1 
ATOM   1118 O  O     . LYS A 1 192 ? 94.036  100.788 131.744 1.00 9.21   ? 192  LYS A O     1 
ATOM   1119 C  CB    . LYS A 1 192 ? 96.360  102.986 132.596 1.00 9.21   ? 192  LYS A CB    1 
ATOM   1120 C  CG    . LYS A 1 192 ? 96.775  101.754 133.358 1.00 9.21   ? 192  LYS A CG    1 
ATOM   1121 C  CD    . LYS A 1 192 ? 97.711  100.945 132.510 1.00 9.21   ? 192  LYS A CD    1 
ATOM   1122 C  CE    . LYS A 1 192 ? 98.265  99.772  133.246 1.00 9.21   ? 192  LYS A CE    1 
ATOM   1123 N  NZ    . LYS A 1 192 ? 99.197  98.994  132.404 1.00 9.21   ? 192  LYS A NZ    1 
ATOM   1124 N  N     . ARG A 1 193 ? 93.247  102.753 132.487 1.00 9.02   ? 193  ARG A N     1 
ATOM   1125 C  CA    . ARG A 1 193 ? 92.013  102.159 132.975 1.00 9.02   ? 193  ARG A CA    1 
ATOM   1126 C  C     . ARG A 1 193 ? 91.064  101.781 131.855 1.00 9.02   ? 193  ARG A C     1 
ATOM   1127 O  O     . ARG A 1 193 ? 90.172  100.960 132.075 1.00 9.02   ? 193  ARG A O     1 
ATOM   1128 C  CB    . ARG A 1 193 ? 91.323  103.110 133.938 1.00 9.02   ? 193  ARG A CB    1 
ATOM   1129 C  CG    . ARG A 1 193 ? 92.028  103.233 135.248 1.00 9.02   ? 193  ARG A CG    1 
ATOM   1130 C  CD    . ARG A 1 193 ? 91.329  104.233 136.099 1.00 9.02   ? 193  ARG A CD    1 
ATOM   1131 N  NE    . ARG A 1 193 ? 91.506  105.577 135.579 1.00 9.02   ? 193  ARG A NE    1 
ATOM   1132 C  CZ    . ARG A 1 193 ? 90.859  106.634 136.038 1.00 9.02   ? 193  ARG A CZ    1 
ATOM   1133 N  NH1   . ARG A 1 193 ? 89.982  106.498 137.015 1.00 9.02   ? 193  ARG A NH1   1 
ATOM   1134 N  NH2   . ARG A 1 193 ? 91.086  107.822 135.524 1.00 9.02   ? 193  ARG A NH2   1 
ATOM   1135 N  N     . THR A 1 194 ? 91.221  102.368 130.671 1.00 8.57   ? 194  THR A N     1 
ATOM   1136 C  CA    . THR A 1 194 ? 90.487  101.880 129.512 1.00 8.57   ? 194  THR A CA    1 
ATOM   1137 C  C     . THR A 1 194 ? 90.992  100.501 129.113 1.00 8.57   ? 194  THR A C     1 
ATOM   1138 O  O     . THR A 1 194 ? 90.201  99.620  128.764 1.00 8.57   ? 194  THR A O     1 
ATOM   1139 C  CB    . THR A 1 194 ? 90.620  102.870 128.355 1.00 8.57   ? 194  THR A CB    1 
ATOM   1140 O  OG1   . THR A 1 194 ? 90.224  104.168 128.802 1.00 8.57   ? 194  THR A OG1   1 
ATOM   1141 C  CG2   . THR A 1 194 ? 89.725  102.478 127.192 1.00 8.57   ? 194  THR A CG2   1 
ATOM   1142 N  N     . SER A 1 195 ? 92.306  100.288 129.198 1.00 8.15   ? 195  SER A N     1 
ATOM   1143 C  CA    . SER A 1 195 ? 92.882  98.982  128.902 1.00 8.15   ? 195  SER A CA    1 
ATOM   1144 C  C     . SER A 1 195 ? 92.505  97.958  129.955 1.00 8.15   ? 195  SER A C     1 
ATOM   1145 O  O     . SER A 1 195 ? 92.299  96.790  129.634 1.00 8.15   ? 195  SER A O     1 
ATOM   1146 C  CB    . SER A 1 195 ? 94.399  99.090  128.799 1.00 8.15   ? 195  SER A CB    1 
ATOM   1147 O  OG    . SER A 1 195 ? 94.777  99.930  127.728 1.00 8.15   ? 195  SER A OG    1 
ATOM   1148 N  N     . ILE A 1 196 ? 92.420  98.377  131.218 1.00 7.99   ? 196  ILE A N     1 
ATOM   1149 C  CA    . ILE A 1 196 ? 91.958  97.492  132.285 1.00 7.99   ? 196  ILE A CA    1 
ATOM   1150 C  C     . ILE A 1 196 ? 90.507  97.097  132.056 1.00 7.99   ? 196  ILE A C     1 
ATOM   1151 O  O     . ILE A 1 196 ? 90.140  95.927  132.188 1.00 7.99   ? 196  ILE A O     1 
ATOM   1152 C  CB    . ILE A 1 196 ? 92.149  98.171  133.655 1.00 7.99   ? 196  ILE A CB    1 
ATOM   1153 C  CG1   . ILE A 1 196 ? 93.629  98.349  133.969 1.00 7.99   ? 196  ILE A CG1   1 
ATOM   1154 C  CG2   . ILE A 1 196 ? 91.475  97.393  134.765 1.00 7.99   ? 196  ILE A CG2   1 
ATOM   1155 C  CD1   . ILE A 1 196 ? 93.870  99.184  135.187 1.00 7.99   ? 196  ILE A CD1   1 
ATOM   1156 N  N     . GLY A 1 197 ? 89.673  98.056  131.654 1.00 9.39   ? 197  GLY A N     1 
ATOM   1157 C  CA    . GLY A 1 197 ? 88.251  97.821  131.491 1.00 9.39   ? 197  GLY A CA    1 
ATOM   1158 C  C     . GLY A 1 197 ? 87.863  96.991  130.295 1.00 9.39   ? 197  GLY A C     1 
ATOM   1159 O  O     . GLY A 1 197 ? 86.801  96.367  130.321 1.00 9.39   ? 197  GLY A O     1 
ATOM   1160 N  N     . MET A 1 198 ? 88.686  96.965  129.246 1.00 9.32   ? 198  MET A N     1 
ATOM   1161 C  CA    . MET A 1 198 ? 88.349  96.148  128.087 1.00 9.32   ? 198  MET A CA    1 
ATOM   1162 C  C     . MET A 1 198 ? 88.531  94.667  128.366 1.00 9.32   ? 198  MET A C     1 
ATOM   1163 O  O     . MET A 1 198 ? 87.775  93.847  127.838 1.00 9.32   ? 198  MET A O     1 
ATOM   1164 C  CB    . MET A 1 198 ? 89.174  96.563  126.877 1.00 9.32   ? 198  MET A CB    1 
ATOM   1165 C  CG    . MET A 1 198 ? 88.775  97.898  126.317 1.00 9.32   ? 198  MET A CG    1 
ATOM   1166 S  SD    . MET A 1 198 ? 89.666  98.325  124.832 1.00 9.32   ? 198  MET A SD    1 
ATOM   1167 C  CE    . MET A 1 198 ? 91.257  98.702  125.515 1.00 9.32   ? 198  MET A CE    1 
ATOM   1168 N  N     . GLU A 1 199 ? 89.515  94.301  129.188 1.00 10.42  ? 199  GLU A N     1 
ATOM   1169 C  CA    . GLU A 1 199 ? 89.660  92.932  129.668 1.00 10.42  ? 199  GLU A CA    1 
ATOM   1170 C  C     . GLU A 1 199 ? 88.936  92.693  130.983 1.00 10.42  ? 199  GLU A C     1 
ATOM   1171 O  O     . GLU A 1 199 ? 89.321  91.799  131.740 1.00 10.42  ? 199  GLU A O     1 
ATOM   1172 C  CB    . GLU A 1 199 ? 91.137  92.561  129.800 1.00 10.42  ? 199  GLU A CB    1 
ATOM   1173 C  CG    . GLU A 1 199 ? 91.805  92.129  128.499 1.00 10.42  ? 199  GLU A CG    1 
ATOM   1174 C  CD    . GLU A 1 199 ? 92.346  93.268  127.660 1.00 10.42  ? 199  GLU A CD    1 
ATOM   1175 O  OE1   . GLU A 1 199 ? 92.321  94.422  128.120 1.00 10.42  ? 199  GLU A OE1   1 
ATOM   1176 O  OE2   . GLU A 1 199 ? 92.790  93.012  126.527 1.00 10.42  ? 199  GLU A OE2   1 
ATOM   1177 N  N     . LEU A 1 200 ? 87.892  93.464  131.268 1.00 10.96  ? 200  LEU A N     1 
ATOM   1178 C  CA    . LEU A 1 200 ? 87.145  93.353  132.510 1.00 10.96  ? 200  LEU A CA    1 
ATOM   1179 C  C     . LEU A 1 200 ? 85.642  93.309  132.299 1.00 10.96  ? 200  LEU A C     1 
ATOM   1180 O  O     . LEU A 1 200 ? 84.933  92.779  133.162 1.00 10.96  ? 200  LEU A O     1 
ATOM   1181 C  CB    . LEU A 1 200 ? 87.509  94.518  133.439 1.00 10.96  ? 200  LEU A CB    1 
ATOM   1182 C  CG    . LEU A 1 200 ? 87.197  94.542  134.925 1.00 10.96  ? 200  LEU A CG    1 
ATOM   1183 C  CD1   . LEU A 1 200 ? 88.344  95.230  135.619 1.00 10.96  ? 200  LEU A CD1   1 
ATOM   1184 C  CD2   . LEU A 1 200 ? 85.927  95.305  135.178 1.00 10.96  ? 200  LEU A CD2   1 
ATOM   1185 N  N     . ILE A 1 201 ? 85.133  93.837  131.186 1.00 12.51  ? 201  ILE A N     1 
ATOM   1186 C  CA    . ILE A 1 201 ? 83.758  93.583  130.771 1.00 12.51  ? 201  ILE A CA    1 
ATOM   1187 C  C     . ILE A 1 201 ? 83.556  92.127  130.393 1.00 12.51  ? 201  ILE A C     1 
ATOM   1188 O  O     . ILE A 1 201 ? 82.451  91.593  130.529 1.00 12.51  ? 201  ILE A O     1 
ATOM   1189 C  CB    . ILE A 1 201 ? 83.394  94.517  129.608 1.00 12.51  ? 201  ILE A CB    1 
ATOM   1190 C  CG1   . ILE A 1 201 ? 84.540  94.538  128.608 1.00 12.51  ? 201  ILE A CG1   1 
ATOM   1191 C  CG2   . ILE A 1 201 ? 83.054  95.893  130.092 1.00 12.51  ? 201  ILE A CG2   1 
ATOM   1192 C  CD1   . ILE A 1 201 ? 84.276  95.351  127.423 1.00 12.51  ? 201  ILE A CD1   1 
ATOM   1193 N  N     . THR A 1 202 ? 84.610  91.456  129.938 1.00 13.30  ? 202  THR A N     1 
ATOM   1194 C  CA    . THR A 1 202 ? 84.519  90.099  129.430 1.00 13.30  ? 202  THR A CA    1 
ATOM   1195 C  C     . THR A 1 202 ? 84.482  89.050  130.533 1.00 13.30  ? 202  THR A C     1 
ATOM   1196 O  O     . THR A 1 202 ? 84.357  87.864  130.215 1.00 13.30  ? 202  THR A O     1 
ATOM   1197 C  CB    . THR A 1 202 ? 85.708  89.831  128.509 1.00 13.30  ? 202  THR A CB    1 
ATOM   1198 O  OG1   . THR A 1 202 ? 86.897  89.724  129.292 1.00 13.30  ? 202  THR A OG1   1 
ATOM   1199 C  CG2   . THR A 1 202 ? 85.898  91.001  127.587 1.00 13.30  ? 202  THR A CG2   1 
ATOM   1200 N  N     . ASP A 1 203 ? 84.635  89.472  131.804 1.00 15.97  ? 203  ASP A N     1 
ATOM   1201 C  CA    . ASP A 1 203 ? 84.752  88.794  133.103 1.00 15.97  ? 203  ASP A CA    1 
ATOM   1202 C  C     . ASP A 1 203 ? 85.364  87.391  133.029 1.00 15.97  ? 203  ASP A C     1 
ATOM   1203 O  O     . ASP A 1 203 ? 84.700  86.391  133.328 1.00 15.97  ? 203  ASP A O     1 
ATOM   1204 C  CB    . ASP A 1 203 ? 83.422  88.830  133.896 1.00 15.97  ? 203  ASP A CB    1 
ATOM   1205 C  CG    . ASP A 1 203 ? 82.242  88.115  133.235 1.00 15.97  ? 203  ASP A CG    1 
ATOM   1206 O  OD1   . ASP A 1 203 ? 82.354  87.546  132.140 1.00 15.97  ? 203  ASP A OD1   1 
ATOM   1207 O  OD2   . ASP A 1 203 ? 81.166  88.115  133.866 1.00 15.97  ? 203  ASP A OD2   1 
ATOM   1208 N  N     . PRO A 1 204 ? 86.642  87.274  132.658 1.00 14.47  ? 204  PRO A N     1 
ATOM   1209 C  CA    . PRO A 1 204 ? 87.243  85.946  132.531 1.00 14.47  ? 204  PRO A CA    1 
ATOM   1210 C  C     . PRO A 1 204 ? 87.566  85.358  133.892 1.00 14.47  ? 204  PRO A C     1 
ATOM   1211 O  O     . PRO A 1 204 ? 87.632  86.075  134.891 1.00 14.47  ? 204  PRO A O     1 
ATOM   1212 C  CB    . PRO A 1 204 ? 88.511  86.222  131.731 1.00 14.47  ? 204  PRO A CB    1 
ATOM   1213 C  CG    . PRO A 1 204 ? 88.892  87.568  132.145 1.00 14.47  ? 204  PRO A CG    1 
ATOM   1214 C  CD    . PRO A 1 204 ? 87.634  88.331  132.392 1.00 14.47  ? 204  PRO A CD    1 
ATOM   1215 N  N     . SER A 1 205 ? 87.776  84.041  133.932 1.00 13.70  ? 205  SER A N     1 
ATOM   1216 C  CA    . SER A 1 205 ? 88.057  83.382  135.202 1.00 13.70  ? 205  SER A CA    1 
ATOM   1217 C  C     . SER A 1 205 ? 89.512  83.540  135.614 1.00 13.70  ? 205  SER A C     1 
ATOM   1218 O  O     . SER A 1 205 ? 89.802  83.734  136.797 1.00 13.70  ? 205  SER A O     1 
ATOM   1219 C  CB    . SER A 1 205 ? 87.685  81.905  135.127 1.00 13.70  ? 205  SER A CB    1 
ATOM   1220 O  OG    . SER A 1 205 ? 86.289  81.749  134.973 1.00 13.70  ? 205  SER A OG    1 
ATOM   1221 N  N     . ILE A 1 206 ? 90.439  83.450  134.670 1.00 11.60  ? 206  ILE A N     1 
ATOM   1222 C  CA    . ILE A 1 206 ? 91.846  83.730  134.921 1.00 11.60  ? 206  ILE A CA    1 
ATOM   1223 C  C     . ILE A 1 206 ? 92.138  85.092  134.320 1.00 11.60  ? 206  ILE A C     1 
ATOM   1224 O  O     . ILE A 1 206 ? 91.824  85.338  133.154 1.00 11.60  ? 206  ILE A O     1 
ATOM   1225 C  CB    . ILE A 1 206 ? 92.765  82.657  134.320 1.00 11.60  ? 206  ILE A CB    1 
ATOM   1226 C  CG1   . ILE A 1 206 ? 92.327  81.273  134.768 1.00 11.60  ? 206  ILE A CG1   1 
ATOM   1227 C  CG2   . ILE A 1 206 ? 94.174  82.855  134.810 1.00 11.60  ? 206  ILE A CG2   1 
ATOM   1228 C  CD1   . ILE A 1 206 ? 93.022  80.164  134.064 1.00 11.60  ? 206  ILE A CD1   1 
ATOM   1229 N  N     . LEU A 1 207 ? 92.730  85.979  135.107 1.00 9.03   ? 207  LEU A N     1 
ATOM   1230 C  CA    . LEU A 1 207 ? 92.834  87.370  134.701 1.00 9.03   ? 207  LEU A CA    1 
ATOM   1231 C  C     . LEU A 1 207 ? 94.223  87.884  135.035 1.00 9.03   ? 207  LEU A C     1 
ATOM   1232 O  O     . LEU A 1 207 ? 94.597  87.958  136.206 1.00 9.03   ? 207  LEU A O     1 
ATOM   1233 C  CB    . LEU A 1 207 ? 91.721  88.178  135.368 1.00 9.03   ? 207  LEU A CB    1 
ATOM   1234 C  CG    . LEU A 1 207 ? 91.396  89.627  135.045 1.00 9.03   ? 207  LEU A CG    1 
ATOM   1235 C  CD1   . LEU A 1 207 ? 89.917  89.772  134.955 1.00 9.03   ? 207  LEU A CD1   1 
ATOM   1236 C  CD2   . LEU A 1 207 ? 91.808  90.408  136.207 1.00 9.03   ? 207  LEU A CD2   1 
ATOM   1237 N  N     . PHE A 1 208 ? 94.995  88.202  134.002 1.00 8.25   ? 208  PHE A N     1 
ATOM   1238 C  CA    . PHE A 1 208 ? 96.373  88.647  134.138 1.00 8.25   ? 208  PHE A CA    1 
ATOM   1239 C  C     . PHE A 1 208 ? 96.434  90.154  133.929 1.00 8.25   ? 208  PHE A C     1 
ATOM   1240 O  O     . PHE A 1 208 ? 95.807  90.671  133.002 1.00 8.25   ? 208  PHE A O     1 
ATOM   1241 C  CB    . PHE A 1 208 ? 97.273  87.965  133.112 1.00 8.25   ? 208  PHE A CB    1 
ATOM   1242 C  CG    . PHE A 1 208 ? 97.343  86.476  133.219 1.00 8.25   ? 208  PHE A CG    1 
ATOM   1243 C  CD1   . PHE A 1 208 ? 98.235  85.868  134.078 1.00 8.25   ? 208  PHE A CD1   1 
ATOM   1244 C  CD2   . PHE A 1 208 ? 96.534  85.682  132.429 1.00 8.25   ? 208  PHE A CD2   1 
ATOM   1245 C  CE1   . PHE A 1 208 ? 98.301  84.504  134.163 1.00 8.25   ? 208  PHE A CE1   1 
ATOM   1246 C  CE2   . PHE A 1 208 ? 96.595  84.321  132.516 1.00 8.25   ? 208  PHE A CE2   1 
ATOM   1247 C  CZ    . PHE A 1 208 ? 97.479  83.733  133.382 1.00 8.25   ? 208  PHE A CZ    1 
ATOM   1248 N  N     . LEU A 1 209 ? 97.192  90.861  134.766 1.00 7.70   ? 209  LEU A N     1 
ATOM   1249 C  CA    . LEU A 1 209 ? 97.370  92.296  134.576 1.00 7.70   ? 209  LEU A CA    1 
ATOM   1250 C  C     . LEU A 1 209 ? 98.845  92.621  134.702 1.00 7.70   ? 209  LEU A C     1 
ATOM   1251 O  O     . LEU A 1 209 ? 99.497  92.177  135.644 1.00 7.70   ? 209  LEU A O     1 
ATOM   1252 C  CB    . LEU A 1 209 ? 96.596  93.143  135.587 1.00 7.70   ? 209  LEU A CB    1 
ATOM   1253 C  CG    . LEU A 1 209 ? 95.094  92.991  135.749 1.00 7.70   ? 209  LEU A CG    1 
ATOM   1254 C  CD1   . LEU A 1 209 ? 94.917  92.067  136.887 1.00 7.70   ? 209  LEU A CD1   1 
ATOM   1255 C  CD2   . LEU A 1 209 ? 94.370  94.285  135.986 1.00 7.70   ? 209  LEU A CD2   1 
ATOM   1256 N  N     . ASP A 1 210 ? 99.367  93.399  133.773 1.00 8.91   ? 210  ASP A N     1 
ATOM   1257 C  CA    . ASP A 1 210 ? 100.783 93.737  133.754 1.00 8.91   ? 210  ASP A CA    1 
ATOM   1258 C  C     . ASP A 1 210 ? 100.906 95.170  134.251 1.00 8.91   ? 210  ASP A C     1 
ATOM   1259 O  O     . ASP A 1 210 ? 100.721 96.116  133.482 1.00 8.91   ? 210  ASP A O     1 
ATOM   1260 C  CB    . ASP A 1 210 ? 101.356 93.564  132.354 1.00 8.91   ? 210  ASP A CB    1 
ATOM   1261 C  CG    . ASP A 1 210 ? 102.859 93.455  132.342 1.00 8.91   ? 210  ASP A CG    1 
ATOM   1262 O  OD1   . ASP A 1 210 ? 103.488 93.552  133.412 1.00 8.91   ? 210  ASP A OD1   1 
ATOM   1263 O  OD2   . ASP A 1 210 ? 103.418 93.240  131.249 1.00 8.91   ? 210  ASP A OD2   1 
ATOM   1264 N  N     . GLN A 1 211 ? 101.208 95.313  135.546 1.00 9.21   ? 211  GLN A N     1 
ATOM   1265 C  CA    . GLN A 1 211 ? 101.336 96.557  136.303 1.00 9.21   ? 211  GLN A CA    1 
ATOM   1266 C  C     . GLN A 1 211 ? 100.117 97.455  136.150 1.00 9.21   ? 211  GLN A C     1 
ATOM   1267 O  O     . GLN A 1 211 ? 100.211 98.507  135.512 1.00 9.21   ? 211  GLN A O     1 
ATOM   1268 C  CB    . GLN A 1 211 ? 102.596 97.295  135.875 1.00 9.21   ? 211  GLN A CB    1 
ATOM   1269 C  CG    . GLN A 1 211 ? 103.829 96.512  136.172 1.00 9.21   ? 211  GLN A CG    1 
ATOM   1270 C  CD    . GLN A 1 211 ? 105.045 97.133  135.575 1.00 9.21   ? 211  GLN A CD    1 
ATOM   1271 O  OE1   . GLN A 1 211 ? 106.137 96.573  135.626 1.00 9.21   ? 211  GLN A OE1   1 
ATOM   1272 N  NE2   . GLN A 1 211 ? 104.888 98.339  135.072 1.00 9.21   ? 211  GLN A NE2   1 
ATOM   1273 N  N     . PRO A 1 212 ? 98.969  97.087  136.730 1.00 8.85   ? 212  PRO A N     1 
ATOM   1274 C  CA    . PRO A 1 212 ? 97.735  97.827  136.447 1.00 8.85   ? 212  PRO A CA    1 
ATOM   1275 C  C     . PRO A 1 212 ? 97.648  99.181  137.107 1.00 8.85   ? 212  PRO A C     1 
ATOM   1276 O  O     . PRO A 1 212 ? 96.798  99.985  136.708 1.00 8.85   ? 212  PRO A O     1 
ATOM   1277 C  CB    . PRO A 1 212 ? 96.653  96.909  137.001 1.00 8.85   ? 212  PRO A CB    1 
ATOM   1278 C  CG    . PRO A 1 212 ? 97.329  96.157  138.074 1.00 8.85   ? 212  PRO A CG    1 
ATOM   1279 C  CD    . PRO A 1 212 ? 98.728  95.955  137.639 1.00 8.85   ? 212  PRO A CD    1 
ATOM   1280 N  N     . THR A 1 213 ? 98.469  99.443  138.116 1.00 9.48   ? 213  THR A N     1 
ATOM   1281 C  CA    . THR A 1 213 ? 98.454  100.690 138.851 1.00 9.48   ? 213  THR A CA    1 
ATOM   1282 C  C     . THR A 1 213 ? 99.597  101.600 138.463 1.00 9.48   ? 213  THR A C     1 
ATOM   1283 O  O     . THR A 1 213 ? 99.746  102.675 139.043 1.00 9.48   ? 213  THR A O     1 
ATOM   1284 C  CB    . THR A 1 213 ? 98.511  100.398 140.340 1.00 9.48   ? 213  THR A CB    1 
ATOM   1285 O  OG1   . THR A 1 213 ? 99.740  99.733  140.643 1.00 9.48   ? 213  THR A OG1   1 
ATOM   1286 C  CG2   . THR A 1 213 ? 97.396  99.497  140.686 1.00 9.48   ? 213  THR A CG2   1 
ATOM   1287 N  N     . THR A 1 214 ? 100.427 101.173 137.530 1.00 10.28  ? 214  THR A N     1 
ATOM   1288 C  CA    . THR A 1 214 ? 101.465 102.011 136.957 1.00 10.28  ? 214  THR A CA    1 
ATOM   1289 C  C     . THR A 1 214 ? 100.806 103.048 136.064 1.00 10.28  ? 214  THR A C     1 
ATOM   1290 O  O     . THR A 1 214 ? 100.233 102.712 135.024 1.00 10.28  ? 214  THR A O     1 
ATOM   1291 C  CB    . THR A 1 214 ? 102.456 101.131 136.207 1.00 10.28  ? 214  THR A CB    1 
ATOM   1292 O  OG1   . THR A 1 214 ? 103.189 100.347 137.157 1.00 10.28  ? 214  THR A OG1   1 
ATOM   1293 C  CG2   . THR A 1 214 ? 103.408 101.929 135.377 1.00 10.28  ? 214  THR A CG2   1 
ATOM   1294 N  N     . GLY A 1 215 ? 100.839 104.303 136.503 1.00 10.11  ? 215  GLY A N     1 
ATOM   1295 C  CA    . GLY A 1 215 ? 100.123 105.382 135.861 1.00 10.11  ? 215  GLY A CA    1 
ATOM   1296 C  C     . GLY A 1 215 ? 98.959  105.913 136.661 1.00 10.11  ? 215  GLY A C     1 
ATOM   1297 O  O     . GLY A 1 215 ? 98.376  106.925 136.266 1.00 10.11  ? 215  GLY A O     1 
ATOM   1298 N  N     . LEU A 1 216 ? 98.603  105.269 137.767 1.00 9.84   ? 216  LEU A N     1 
ATOM   1299 C  CA    . LEU A 1 216 ? 97.508  105.690 138.624 1.00 9.84   ? 216  LEU A CA    1 
ATOM   1300 C  C     . LEU A 1 216 ? 98.072  106.247 139.922 1.00 9.84   ? 216  LEU A C     1 
ATOM   1301 O  O     . LEU A 1 216 ? 99.197  105.938 140.307 1.00 9.84   ? 216  LEU A O     1 
ATOM   1302 C  CB    . LEU A 1 216 ? 96.567  104.522 138.931 1.00 9.84   ? 216  LEU A CB    1 
ATOM   1303 C  CG    . LEU A 1 216 ? 95.939  103.736 137.780 1.00 9.84   ? 216  LEU A CG    1 
ATOM   1304 C  CD1   . LEU A 1 216 ? 95.051  102.644 138.335 1.00 9.84   ? 216  LEU A CD1   1 
ATOM   1305 C  CD2   . LEU A 1 216 ? 95.187  104.615 136.813 1.00 9.84   ? 216  LEU A CD2   1 
ATOM   1306 N  N     . ASP A 1 217 ? 97.276  107.062 140.608 1.00 13.00  ? 217  ASP A N     1 
ATOM   1307 C  CA    . ASP A 1 217 ? 97.717  107.673 141.853 1.00 13.00  ? 217  ASP A CA    1 
ATOM   1308 C  C     . ASP A 1 217 ? 97.437  106.750 143.035 1.00 13.00  ? 217  ASP A C     1 
ATOM   1309 O  O     . ASP A 1 217 ? 97.067  105.592 142.863 1.00 13.00  ? 217  ASP A O     1 
ATOM   1310 C  CB    . ASP A 1 217 ? 97.063  109.031 142.064 1.00 13.00  ? 217  ASP A CB    1 
ATOM   1311 C  CG    . ASP A 1 217 ? 95.579  108.954 142.093 1.00 13.00  ? 217  ASP A CG    1 
ATOM   1312 O  OD1   . ASP A 1 217 ? 95.045  107.986 141.555 1.00 13.00  ? 217  ASP A OD1   1 
ATOM   1313 O  OD2   . ASP A 1 217 ? 94.947  109.805 142.738 1.00 13.00  ? 217  ASP A OD2   1 
ATOM   1314 N  N     . SER A 1 218 ? 97.590  107.269 144.253 1.00 14.86  ? 218  SER A N     1 
ATOM   1315 C  CA    . SER A 1 218 ? 97.457  106.444 145.449 1.00 14.86  ? 218  SER A CA    1 
ATOM   1316 C  C     . SER A 1 218 ? 96.020  106.012 145.703 1.00 14.86  ? 218  SER A C     1 
ATOM   1317 O  O     . SER A 1 218 ? 95.795  104.978 146.339 1.00 14.86  ? 218  SER A O     1 
ATOM   1318 C  CB    . SER A 1 218 ? 97.978  107.199 146.673 1.00 14.86  ? 218  SER A CB    1 
ATOM   1319 O  OG    . SER A 1 218 ? 99.366  107.454 146.594 1.00 14.86  ? 218  SER A OG    1 
ATOM   1320 N  N     . SER A 1 219 ? 95.040  106.776 145.231 1.00 15.69  ? 219  SER A N     1 
ATOM   1321 C  CA    . SER A 1 219 ? 93.654  106.514 145.588 1.00 15.69  ? 219  SER A CA    1 
ATOM   1322 C  C     . SER A 1 219 ? 92.858  105.815 144.497 1.00 15.69  ? 219  SER A C     1 
ATOM   1323 O  O     . SER A 1 219 ? 91.926  105.076 144.816 1.00 15.69  ? 219  SER A O     1 
ATOM   1324 C  CB    . SER A 1 219 ? 92.951  107.814 145.974 1.00 15.69  ? 219  SER A CB    1 
ATOM   1325 O  OG    . SER A 1 219 ? 91.619  107.570 146.381 1.00 15.69  ? 219  SER A OG    1 
ATOM   1326 N  N     . THR A 1 220 ? 93.176  106.035 143.221 1.00 13.87  ? 220  THR A N     1 
ATOM   1327 C  CA    . THR A 1 220 ? 92.543  105.239 142.176 1.00 13.87  ? 220  THR A CA    1 
ATOM   1328 C  C     . THR A 1 220 ? 93.106  103.827 142.157 1.00 13.87  ? 220  THR A C     1 
ATOM   1329 O  O     . THR A 1 220 ? 92.361  102.876 141.909 1.00 13.87  ? 220  THR A O     1 
ATOM   1330 C  CB    . THR A 1 220 ? 92.712  105.904 140.810 1.00 13.87  ? 220  THR A CB    1 
ATOM   1331 O  OG1   . THR A 1 220 ? 92.269  107.260 140.891 1.00 13.87  ? 220  THR A OG1   1 
ATOM   1332 C  CG2   . THR A 1 220 ? 91.887  105.218 139.748 1.00 13.87  ? 220  THR A CG2   1 
ATOM   1333 N  N     . ALA A 1 221 ? 94.398  103.669 142.463 1.00 13.63  ? 221  ALA A N     1 
ATOM   1334 C  CA    . ALA A 1 221 ? 95.002  102.343 142.532 1.00 13.63  ? 221  ALA A CA    1 
ATOM   1335 C  C     . ALA A 1 221 ? 94.419  101.501 143.653 1.00 13.63  ? 221  ALA A C     1 
ATOM   1336 O  O     . ALA A 1 221 ? 94.307  100.282 143.510 1.00 13.63  ? 221  ALA A O     1 
ATOM   1337 C  CB    . ALA A 1 221 ? 96.505  102.453 142.723 1.00 13.63  ? 221  ALA A CB    1 
ATOM   1338 N  N     . ASN A 1 222 ? 94.054  102.122 144.771 1.00 15.03  ? 222  ASN A N     1 
ATOM   1339 C  CA    . ASN A 1 222 ? 93.341  101.393 145.808 1.00 15.03  ? 222  ASN A CA    1 
ATOM   1340 C  C     . ASN A 1 222 ? 91.939  101.037 145.341 1.00 15.03  ? 222  ASN A C     1 
ATOM   1341 O  O     . ASN A 1 222 ? 91.427  99.964  145.666 1.00 15.03  ? 222  ASN A O     1 
ATOM   1342 C  CB    . ASN A 1 222 ? 93.284  102.225 147.084 1.00 15.03  ? 222  ASN A CB    1 
ATOM   1343 C  CG    . ASN A 1 222 ? 93.156  101.379 148.342 1.00 15.03  ? 222  ASN A CG    1 
ATOM   1344 O  OD1   . ASN A 1 222 ? 93.341  101.881 149.445 1.00 15.03  ? 222  ASN A OD1   1 
ATOM   1345 N  ND2   . ASN A 1 222 ? 92.866  100.096 148.185 1.00 15.03  ? 222  ASN A ND2   1 
ATOM   1346 N  N     . ALA A 1 223 ? 91.308  101.919 144.569 1.00 16.04  ? 223  ALA A N     1 
ATOM   1347 C  CA    . ALA A 1 223 ? 89.967  101.640 144.076 1.00 16.04  ? 223  ALA A CA    1 
ATOM   1348 C  C     . ALA A 1 223 ? 89.979  100.593 142.973 1.00 16.04  ? 223  ALA A C     1 
ATOM   1349 O  O     . ALA A 1 223 ? 88.970  99.918  142.757 1.00 16.04  ? 223  ALA A O     1 
ATOM   1350 C  CB    . ALA A 1 223 ? 89.317  102.927 143.584 1.00 16.04  ? 223  ALA A CB    1 
ATOM   1351 N  N     . VAL A 1 224 ? 91.101  100.439 142.272 1.00 14.01  ? 224  VAL A N     1 
ATOM   1352 C  CA    . VAL A 1 224 ? 91.219  99.388  141.270 1.00 14.01  ? 224  VAL A CA    1 
ATOM   1353 C  C     . VAL A 1 224 ? 91.433  98.032  141.932 1.00 14.01  ? 224  VAL A C     1 
ATOM   1354 O  O     . VAL A 1 224 ? 90.783  97.048  141.571 1.00 14.01  ? 224  VAL A O     1 
ATOM   1355 C  CB    . VAL A 1 224 ? 92.335  99.728  140.265 1.00 14.01  ? 224  VAL A CB    1 
ATOM   1356 C  CG1   . VAL A 1 224 ? 92.683  98.538  139.407 1.00 14.01  ? 224  VAL A CG1   1 
ATOM   1357 C  CG2   . VAL A 1 224 ? 91.878  100.848 139.369 1.00 14.01  ? 224  VAL A CG2   1 
ATOM   1358 N  N     . LEU A 1 225 ? 92.319  97.948  142.926 1.00 14.96  ? 225  LEU A N     1 
ATOM   1359 C  CA    . LEU A 1 225 ? 92.513  96.653  143.565 1.00 14.96  ? 225  LEU A CA    1 
ATOM   1360 C  C     . LEU A 1 225 ? 91.398  96.266  144.519 1.00 14.96  ? 225  LEU A C     1 
ATOM   1361 O  O     . LEU A 1 225 ? 91.262  95.079  144.820 1.00 14.96  ? 225  LEU A O     1 
ATOM   1362 C  CB    . LEU A 1 225 ? 93.840  96.562  144.307 1.00 14.96  ? 225  LEU A CB    1 
ATOM   1363 C  CG    . LEU A 1 225 ? 94.890  95.956  143.380 1.00 14.96  ? 225  LEU A CG    1 
ATOM   1364 C  CD1   . LEU A 1 225 ? 95.548  96.994  142.536 1.00 14.96  ? 225  LEU A CD1   1 
ATOM   1365 C  CD2   . LEU A 1 225 ? 95.885  95.098  144.104 1.00 14.96  ? 225  LEU A CD2   1 
ATOM   1366 N  N     . LEU A 1 226 ? 90.604  97.214  145.009 1.00 16.38  ? 226  LEU A N     1 
ATOM   1367 C  CA    . LEU A 1 226 ? 89.400  96.815  145.721 1.00 16.38  ? 226  LEU A CA    1 
ATOM   1368 C  C     . LEU A 1 226 ? 88.330  96.338  144.758 1.00 16.38  ? 226  LEU A C     1 
ATOM   1369 O  O     . LEU A 1 226 ? 87.457  95.558  145.145 1.00 16.38  ? 226  LEU A O     1 
ATOM   1370 C  CB    . LEU A 1 226 ? 88.884  97.963  146.577 1.00 16.38  ? 226  LEU A CB    1 
ATOM   1371 C  CG    . LEU A 1 226 ? 89.725  98.224  147.820 1.00 16.38  ? 226  LEU A CG    1 
ATOM   1372 C  CD1   . LEU A 1 226 ? 89.360  99.555  148.406 1.00 16.38  ? 226  LEU A CD1   1 
ATOM   1373 C  CD2   . LEU A 1 226 ? 89.516  97.116  148.827 1.00 16.38  ? 226  LEU A CD2   1 
ATOM   1374 N  N     . LEU A 1 227 ? 88.378  96.800  143.510 1.00 16.72  ? 227  LEU A N     1 
ATOM   1375 C  CA    . LEU A 1 227 ? 87.535  96.228  142.468 1.00 16.72  ? 227  LEU A CA    1 
ATOM   1376 C  C     . LEU A 1 227 ? 87.967  94.811  142.137 1.00 16.72  ? 227  LEU A C     1 
ATOM   1377 O  O     . LEU A 1 227 ? 87.127  93.940  141.899 1.00 16.72  ? 227  LEU A O     1 
ATOM   1378 C  CB    . LEU A 1 227 ? 87.585  97.110  141.223 1.00 16.72  ? 227  LEU A CB    1 
ATOM   1379 C  CG    . LEU A 1 227 ? 86.865  96.662  139.961 1.00 16.72  ? 227  LEU A CG    1 
ATOM   1380 C  CD1   . LEU A 1 227 ? 85.383  96.559  140.218 1.00 16.72  ? 227  LEU A CD1   1 
ATOM   1381 C  CD2   . LEU A 1 227 ? 87.165  97.638  138.850 1.00 16.72  ? 227  LEU A CD2   1 
ATOM   1382 N  N     . LEU A 1 228 ? 89.275  94.561  142.131 1.00 14.19  ? 228  LEU A N     1 
ATOM   1383 C  CA    . LEU A 1 228 ? 89.771  93.228  141.820 1.00 14.19  ? 228  LEU A CA    1 
ATOM   1384 C  C     . LEU A 1 228 ? 89.578  92.282  142.994 1.00 14.19  ? 228  LEU A C     1 
ATOM   1385 O  O     . LEU A 1 228 ? 89.310  91.096  142.796 1.00 14.19  ? 228  LEU A O     1 
ATOM   1386 C  CB    . LEU A 1 228 ? 91.242  93.299  141.419 1.00 14.19  ? 228  LEU A CB    1 
ATOM   1387 C  CG    . LEU A 1 228 ? 91.572  94.043  140.128 1.00 14.19  ? 228  LEU A CG    1 
ATOM   1388 C  CD1   . LEU A 1 228 ? 93.063  94.149  139.934 1.00 14.19  ? 228  LEU A CD1   1 
ATOM   1389 C  CD2   . LEU A 1 228 ? 90.934  93.352  138.962 1.00 14.19  ? 228  LEU A CD2   1 
ATOM   1390 N  N     . LYS A 1 229 ? 89.712  92.789  144.221 1.00 15.76  ? 229  LYS A N     1 
ATOM   1391 C  CA    . LYS A 1 229 ? 89.487  91.964  145.405 1.00 15.76  ? 229  LYS A CA    1 
ATOM   1392 C  C     . LYS A 1 229 ? 88.022  91.567  145.530 1.00 15.76  ? 229  LYS A C     1 
ATOM   1393 O  O     . LYS A 1 229 ? 87.709  90.455  145.965 1.00 15.76  ? 229  LYS A O     1 
ATOM   1394 C  CB    . LYS A 1 229 ? 89.953  92.712  146.652 1.00 15.76  ? 229  LYS A CB    1 
ATOM   1395 C  CG    . LYS A 1 229 ? 89.809  91.958  147.957 1.00 15.76  ? 229  LYS A CG    1 
ATOM   1396 C  CD    . LYS A 1 229 ? 90.793  90.817  148.047 1.00 15.76  ? 229  LYS A CD    1 
ATOM   1397 C  CE    . LYS A 1 229 ? 90.742  90.157  149.402 1.00 15.76  ? 229  LYS A CE    1 
ATOM   1398 N  NZ    . LYS A 1 229 ? 91.679  89.014  149.466 1.00 15.76  ? 229  LYS A NZ    1 
ATOM   1399 N  N     . ARG A 1 230 ? 87.112  92.459  145.143 1.00 19.06  ? 230  ARG A N     1 
ATOM   1400 C  CA    . ARG A 1 230 ? 85.697  92.114  145.062 1.00 19.06  ? 230  ARG A CA    1 
ATOM   1401 C  C     . ARG A 1 230 ? 85.447  91.084  143.973 1.00 19.06  ? 230  ARG A C     1 
ATOM   1402 O  O     . ARG A 1 230 ? 84.574  90.223  144.117 1.00 19.06  ? 230  ARG A O     1 
ATOM   1403 C  CB    . ARG A 1 230 ? 84.881  93.380  144.800 1.00 19.06  ? 230  ARG A CB    1 
ATOM   1404 C  CG    . ARG A 1 230 ? 83.389  93.198  144.841 1.00 19.06  ? 230  ARG A CG    1 
ATOM   1405 C  CD    . ARG A 1 230 ? 82.666  94.497  144.532 1.00 19.06  ? 230  ARG A CD    1 
ATOM   1406 N  NE    . ARG A 1 230 ? 82.862  94.930  143.151 1.00 19.06  ? 230  ARG A NE    1 
ATOM   1407 C  CZ    . ARG A 1 230 ? 82.144  94.492  142.120 1.00 19.06  ? 230  ARG A CZ    1 
ATOM   1408 N  NH1   . ARG A 1 230 ? 81.177  93.607  142.304 1.00 19.06  ? 230  ARG A NH1   1 
ATOM   1409 N  NH2   . ARG A 1 230 ? 82.388  94.940  140.897 1.00 19.06  ? 230  ARG A NH2   1 
ATOM   1410 N  N     . MET A 1 231 ? 86.223  91.145  142.896 1.00 17.06  ? 231  MET A N     1 
ATOM   1411 C  CA    . MET A 1 231 ? 86.084  90.232  141.771 1.00 17.06  ? 231  MET A CA    1 
ATOM   1412 C  C     . MET A 1 231 ? 86.735  88.884  142.049 1.00 17.06  ? 231  MET A C     1 
ATOM   1413 O  O     . MET A 1 231 ? 86.261  87.856  141.559 1.00 17.06  ? 231  MET A O     1 
ATOM   1414 C  CB    . MET A 1 231 ? 86.697  90.888  140.537 1.00 17.06  ? 231  MET A CB    1 
ATOM   1415 C  CG    . MET A 1 231 ? 86.489  90.184  139.239 1.00 17.06  ? 231  MET A CG    1 
ATOM   1416 S  SD    . MET A 1 231 ? 87.253  91.159  137.941 1.00 17.06  ? 231  MET A SD    1 
ATOM   1417 C  CE    . MET A 1 231 ? 86.170  92.578  137.962 1.00 17.06  ? 231  MET A CE    1 
ATOM   1418 N  N     . SER A 1 232 ? 87.808  88.871  142.838 1.00 16.66  ? 232  SER A N     1 
ATOM   1419 C  CA    . SER A 1 232 ? 88.514  87.643  143.168 1.00 16.66  ? 232  SER A CA    1 
ATOM   1420 C  C     . SER A 1 232 ? 87.761  86.778  144.161 1.00 16.66  ? 232  SER A C     1 
ATOM   1421 O  O     . SER A 1 232 ? 88.011  85.572  144.221 1.00 16.66  ? 232  SER A O     1 
ATOM   1422 C  CB    . SER A 1 232 ? 89.885  87.967  143.742 1.00 16.66  ? 232  SER A CB    1 
ATOM   1423 O  OG    . SER A 1 232 ? 89.752  88.594  145.000 1.00 16.66  ? 232  SER A OG    1 
ATOM   1424 N  N     . LYS A 1 233 ? 86.861  87.360  144.946 1.00 18.00  ? 233  LYS A N     1 
ATOM   1425 C  CA    . LYS A 1 233 ? 86.053  86.601  145.889 1.00 18.00  ? 233  LYS A CA    1 
ATOM   1426 C  C     . LYS A 1 233 ? 84.839  85.957  145.238 1.00 18.00  ? 233  LYS A C     1 
ATOM   1427 O  O     . LYS A 1 233 ? 84.057  85.302  145.932 1.00 18.00  ? 233  LYS A O     1 
ATOM   1428 C  CB    . LYS A 1 233 ? 85.614  87.504  147.039 1.00 18.00  ? 233  LYS A CB    1 
ATOM   1429 C  CG    . LYS A 1 233 ? 86.758  87.949  147.924 1.00 18.00  ? 233  LYS A CG    1 
ATOM   1430 C  CD    . LYS A 1 233 ? 86.258  88.737  149.114 1.00 18.00  ? 233  LYS A CD    1 
ATOM   1431 C  CE    . LYS A 1 233 ? 85.799  90.118  148.689 1.00 18.00  ? 233  LYS A CE    1 
ATOM   1432 N  NZ    . LYS A 1 233 ? 85.408  90.964  149.842 1.00 18.00  ? 233  LYS A NZ    1 
ATOM   1433 N  N     . GLN A 1 234 ? 84.660  86.135  143.933 1.00 19.48  ? 234  GLN A N     1 
ATOM   1434 C  CA    . GLN A 1 234 ? 83.667  85.400  143.169 1.00 19.48  ? 234  GLN A CA    1 
ATOM   1435 C  C     . GLN A 1 234 ? 84.210  84.090  142.619 1.00 19.48  ? 234  GLN A C     1 
ATOM   1436 O  O     . GLN A 1 234 ? 83.447  83.321  142.027 1.00 19.48  ? 234  GLN A O     1 
ATOM   1437 C  CB    . GLN A 1 234 ? 83.158  86.258  142.011 1.00 19.48  ? 234  GLN A CB    1 
ATOM   1438 C  CG    . GLN A 1 234 ? 82.432  87.509  142.443 1.00 19.48  ? 234  GLN A CG    1 
ATOM   1439 C  CD    . GLN A 1 234 ? 82.041  88.380  141.271 1.00 19.48  ? 234  GLN A CD    1 
ATOM   1440 O  OE1   . GLN A 1 234 ? 82.351  88.069  140.123 1.00 19.48  ? 234  GLN A OE1   1 
ATOM   1441 N  NE2   . GLN A 1 234 ? 81.369  89.486  141.555 1.00 19.48  ? 234  GLN A NE2   1 
ATOM   1442 N  N     . GLY A 1 235 ? 85.503  83.825  142.791 1.00 18.93  ? 235  GLY A N     1 
ATOM   1443 C  CA    . GLY A 1 235 ? 86.126  82.622  142.280 1.00 18.93  ? 235  GLY A CA    1 
ATOM   1444 C  C     . GLY A 1 235 ? 87.133  82.846  141.178 1.00 18.93  ? 235  GLY A C     1 
ATOM   1445 O  O     . GLY A 1 235 ? 87.672  81.868  140.651 1.00 18.93  ? 235  GLY A O     1 
ATOM   1446 N  N     . ARG A 1 236 ? 87.403  84.089  140.802 1.00 17.07  ? 236  ARG A N     1 
ATOM   1447 C  CA    . ARG A 1 236 ? 88.382  84.367  139.766 1.00 17.07  ? 236  ARG A CA    1 
ATOM   1448 C  C     . ARG A 1 236 ? 89.785  84.345  140.346 1.00 17.07  ? 236  ARG A C     1 
ATOM   1449 O  O     . ARG A 1 236 ? 90.015  84.816  141.461 1.00 17.07  ? 236  ARG A O     1 
ATOM   1450 C  CB    . ARG A 1 236 ? 88.123  85.727  139.121 1.00 17.07  ? 236  ARG A CB    1 
ATOM   1451 C  CG    . ARG A 1 236 ? 87.026  85.747  138.087 1.00 17.07  ? 236  ARG A CG    1 
ATOM   1452 C  CD    . ARG A 1 236 ? 85.676  86.050  138.681 1.00 17.07  ? 236  ARG A CD    1 
ATOM   1453 N  NE    . ARG A 1 236 ? 84.672  86.248  137.643 1.00 17.07  ? 236  ARG A NE    1 
ATOM   1454 C  CZ    . ARG A 1 236 ? 83.887  85.282  137.181 1.00 17.07  ? 236  ARG A CZ    1 
ATOM   1455 N  NH1   . ARG A 1 236 ? 83.992  84.055  137.669 1.00 17.07  ? 236  ARG A NH1   1 
ATOM   1456 N  NH2   . ARG A 1 236 ? 82.997  85.540  136.235 1.00 17.07  ? 236  ARG A NH2   1 
ATOM   1457 N  N     . THR A 1 237 ? 90.725  83.792  139.589 1.00 13.03  ? 237  THR A N     1 
ATOM   1458 C  CA    . THR A 1 237 ? 92.132  83.918  139.933 1.00 13.03  ? 237  THR A CA    1 
ATOM   1459 C  C     . THR A 1 237 ? 92.731  85.093  139.171 1.00 13.03  ? 237  THR A C     1 
ATOM   1460 O  O     . THR A 1 237 ? 92.554  85.225  137.958 1.00 13.03  ? 237  THR A O     1 
ATOM   1461 C  CB    . THR A 1 237 ? 92.899  82.611  139.686 1.00 13.03  ? 237  THR A CB    1 
ATOM   1462 O  OG1   . THR A 1 237 ? 94.299  82.808  139.912 1.00 13.03  ? 237  THR A OG1   1 
ATOM   1463 C  CG2   . THR A 1 237 ? 92.660  82.038  138.332 1.00 13.03  ? 237  THR A CG2   1 
ATOM   1464 N  N     . ILE A 1 238 ? 93.385  85.982  139.905 1.00 10.77  ? 238  ILE A N     1 
ATOM   1465 C  CA    . ILE A 1 238 ? 93.879  87.238  139.369 1.00 10.77  ? 238  ILE A CA    1 
ATOM   1466 C  C     . ILE A 1 238 ? 95.371  87.280  139.638 1.00 10.77  ? 238  ILE A C     1 
ATOM   1467 O  O     . ILE A 1 238 ? 95.796  87.388  140.792 1.00 10.77  ? 238  ILE A O     1 
ATOM   1468 C  CB    . ILE A 1 238 ? 93.160  88.446  139.985 1.00 10.77  ? 238  ILE A CB    1 
ATOM   1469 C  CG1   . ILE A 1 238 ? 91.681  88.426  139.615 1.00 10.77  ? 238  ILE A CG1   1 
ATOM   1470 C  CG2   . ILE A 1 238 ? 93.771  89.737  139.518 1.00 10.77  ? 238  ILE A CG2   1 
ATOM   1471 C  CD1   . ILE A 1 238 ? 90.867  89.365  140.403 1.00 10.77  ? 238  ILE A CD1   1 
ATOM   1472 N  N     . ILE A 1 239 ? 96.165  87.176  138.581 1.00 8.92   ? 239  ILE A N     1 
ATOM   1473 C  CA    . ILE A 1 239 ? 97.618  87.189  138.671 1.00 8.92   ? 239  ILE A CA    1 
ATOM   1474 C  C     . ILE A 1 239 ? 98.087  88.532  138.142 1.00 8.92   ? 239  ILE A C     1 
ATOM   1475 O  O     . ILE A 1 239 ? 97.791  88.883  137.001 1.00 8.92   ? 239  ILE A O     1 
ATOM   1476 C  CB    . ILE A 1 239 ? 98.260  86.050  137.864 1.00 8.92   ? 239  ILE A CB    1 
ATOM   1477 C  CG1   . ILE A 1 239 ? 97.750  84.675  138.291 1.00 8.92   ? 239  ILE A CG1   1 
ATOM   1478 C  CG2   . ILE A 1 239 ? 99.748  86.107  138.012 1.00 8.92   ? 239  ILE A CG2   1 
ATOM   1479 C  CD1   . ILE A 1 239 ? 96.678  84.092  137.412 1.00 8.92   ? 239  ILE A CD1   1 
ATOM   1480 N  N     . PHE A 1 240 ? 98.821  89.287  138.944 1.00 8.77   ? 240  PHE A N     1 
ATOM   1481 C  CA    . PHE A 1 240 ? 99.303  90.565  138.454 1.00 8.77   ? 240  PHE A CA    1 
ATOM   1482 C  C     . PHE A 1 240 ? 100.694 90.844  138.984 1.00 8.77   ? 240  PHE A C     1 
ATOM   1483 O  O     . PHE A 1 240 ? 101.086 90.350  140.040 1.00 8.77   ? 240  PHE A O     1 
ATOM   1484 C  CB    . PHE A 1 240 ? 98.347  91.729  138.805 1.00 8.77   ? 240  PHE A CB    1 
ATOM   1485 C  CG    . PHE A 1 240 ? 98.112  91.907  140.268 1.00 8.77   ? 240  PHE A CG    1 
ATOM   1486 C  CD1   . PHE A 1 240 ? 97.113  91.202  140.897 1.00 8.77   ? 240  PHE A CD1   1 
ATOM   1487 C  CD2   . PHE A 1 240 ? 98.869  92.790  141.013 1.00 8.77   ? 240  PHE A CD2   1 
ATOM   1488 C  CE1   . PHE A 1 240 ? 96.903  91.345  142.222 1.00 8.77   ? 240  PHE A CE1   1 
ATOM   1489 C  CE2   . PHE A 1 240 ? 98.650  92.931  142.348 1.00 8.77   ? 240  PHE A CE2   1 
ATOM   1490 C  CZ    . PHE A 1 240 ? 97.664  92.207  142.947 1.00 8.77   ? 240  PHE A CZ    1 
ATOM   1491 N  N     . SER A 1 241 ? 101.440 91.620  138.217 1.00 8.31   ? 241  SER A N     1 
ATOM   1492 C  CA    . SER A 1 241 ? 102.656 92.256  138.686 1.00 8.31   ? 241  SER A CA    1 
ATOM   1493 C  C     . SER A 1 241 ? 102.318 93.673  139.123 1.00 8.31   ? 241  SER A C     1 
ATOM   1494 O  O     . SER A 1 241 ? 101.361 94.266  138.634 1.00 8.31   ? 241  SER A O     1 
ATOM   1495 C  CB    . SER A 1 241 ? 103.725 92.258  137.594 1.00 8.31   ? 241  SER A CB    1 
ATOM   1496 O  OG    . SER A 1 241 ? 103.336 93.050  136.496 1.00 8.31   ? 241  SER A OG    1 
ATOM   1497 N  N     . ILE A 1 242 ? 103.078 94.207  140.071 1.00 9.04   ? 242  ILE A N     1 
ATOM   1498 C  CA    . ILE A 1 242 ? 102.760 95.526  140.605 1.00 9.04   ? 242  ILE A CA    1 
ATOM   1499 C  C     . ILE A 1 242 ? 104.050 96.192  141.067 1.00 9.04   ? 242  ILE A C     1 
ATOM   1500 O  O     . ILE A 1 242 ? 104.991 95.529  141.503 1.00 9.04   ? 242  ILE A O     1 
ATOM   1501 C  CB    . ILE A 1 242 ? 101.689 95.426  141.723 1.00 9.04   ? 242  ILE A CB    1 
ATOM   1502 C  CG1   . ILE A 1 242 ? 101.118 96.796  142.100 1.00 9.04   ? 242  ILE A CG1   1 
ATOM   1503 C  CG2   . ILE A 1 242 ? 102.201 94.708  142.940 1.00 9.04   ? 242  ILE A CG2   1 
ATOM   1504 C  CD1   . ILE A 1 242 ? 99.892  96.725  142.962 1.00 9.04   ? 242  ILE A CD1   1 
ATOM   1505 N  N     . HIS A 1 243 ? 104.120 97.505  140.889 1.00 9.68   ? 243  HIS A N     1 
ATOM   1506 C  CA    . HIS A 1 243 ? 105.178 98.332  141.446 1.00 9.68   ? 243  HIS A CA    1 
ATOM   1507 C  C     . HIS A 1 243 ? 104.583 99.291  142.455 1.00 9.68   ? 243  HIS A C     1 
ATOM   1508 O  O     . HIS A 1 243 ? 103.534 99.888  142.202 1.00 9.68   ? 243  HIS A O     1 
ATOM   1509 C  CB    . HIS A 1 243 ? 105.929 99.139  140.399 1.00 9.68   ? 243  HIS A CB    1 
ATOM   1510 C  CG    . HIS A 1 243 ? 106.810 98.330  139.507 1.00 9.68   ? 243  HIS A CG    1 
ATOM   1511 N  ND1   . HIS A 1 243 ? 107.880 97.608  139.984 1.00 9.68   ? 243  HIS A ND1   1 
ATOM   1512 C  CD2   . HIS A 1 243 ? 106.839 98.201  138.162 1.00 9.68   ? 243  HIS A CD2   1 
ATOM   1513 C  CE1   . HIS A 1 243 ? 108.502 97.029  138.976 1.00 9.68   ? 243  HIS A CE1   1 
ATOM   1514 N  NE2   . HIS A 1 243 ? 107.891 97.374  137.859 1.00 9.68   ? 243  HIS A NE2   1 
ATOM   1515 N  N     . GLN A 1 244 ? 105.284 99.433  143.576 1.00 11.49  ? 244  GLN A N     1 
ATOM   1516 C  CA    . GLN A 1 244 ? 104.922 100.330 144.667 1.00 11.49  ? 244  GLN A CA    1 
ATOM   1517 C  C     . GLN A 1 244 ? 103.493 100.196 145.201 1.00 11.49  ? 244  GLN A C     1 
ATOM   1518 O  O     . GLN A 1 244 ? 102.700 101.140 145.102 1.00 11.49  ? 244  GLN A O     1 
ATOM   1519 C  CB    . GLN A 1 244 ? 105.174 101.766 144.221 1.00 11.49  ? 244  GLN A CB    1 
ATOM   1520 C  CG    . GLN A 1 244 ? 106.559 102.007 143.707 1.00 11.49  ? 244  GLN A CG    1 
ATOM   1521 C  CD    . GLN A 1 244 ? 106.669 103.336 143.016 1.00 11.49  ? 244  GLN A CD    1 
ATOM   1522 O  OE1   . GLN A 1 244 ? 105.702 104.085 142.945 1.00 11.49  ? 244  GLN A OE1   1 
ATOM   1523 N  NE2   . GLN A 1 244 ? 107.830 103.618 142.453 1.00 11.49  ? 244  GLN A NE2   1 
ATOM   1524 N  N     . PRO A 1 245 ? 103.119 99.055  145.789 1.00 13.01  ? 245  PRO A N     1 
ATOM   1525 C  CA    . PRO A 1 245 ? 101.815 99.013  146.450 1.00 13.01  ? 245  PRO A CA    1 
ATOM   1526 C  C     . PRO A 1 245 ? 101.900 99.623  147.837 1.00 13.01  ? 245  PRO A C     1 
ATOM   1527 O  O     . PRO A 1 245 ? 102.872 99.428  148.570 1.00 13.01  ? 245  PRO A O     1 
ATOM   1528 C  CB    . PRO A 1 245 ? 101.498 97.519  146.509 1.00 13.01  ? 245  PRO A CB    1 
ATOM   1529 C  CG    . PRO A 1 245 ? 102.780 96.881  146.557 1.00 13.01  ? 245  PRO A CG    1 
ATOM   1530 C  CD    . PRO A 1 245 ? 103.726 97.710  145.772 1.00 13.01  ? 245  PRO A CD    1 
ATOM   1531 N  N     . ARG A 1 246 ? 100.879 100.386 148.197 1.00 16.57  ? 246  ARG A N     1 
ATOM   1532 C  CA    . ARG A 1 246 ? 100.845 100.905 149.549 1.00 16.57  ? 246  ARG A CA    1 
ATOM   1533 C  C     . ARG A 1 246 ? 100.306 99.830  150.486 1.00 16.57  ? 246  ARG A C     1 
ATOM   1534 O  O     . ARG A 1 246 ? 99.955  98.727  150.066 1.00 16.57  ? 246  ARG A O     1 
ATOM   1535 C  CB    . ARG A 1 246 ? 100.029 102.188 149.608 1.00 16.57  ? 246  ARG A CB    1 
ATOM   1536 C  CG    . ARG A 1 246 ? 98.554  102.040 149.376 1.00 16.57  ? 246  ARG A CG    1 
ATOM   1537 C  CD    . ARG A 1 246 ? 97.923  103.406 149.495 1.00 16.57  ? 246  ARG A CD    1 
ATOM   1538 N  NE    . ARG A 1 246 ? 96.473  103.378 149.439 1.00 16.57  ? 246  ARG A NE    1 
ATOM   1539 C  CZ    . ARG A 1 246 ? 95.717  104.458 149.573 1.00 16.57  ? 246  ARG A CZ    1 
ATOM   1540 N  NH1   . ARG A 1 246 ? 96.284  105.637 149.765 1.00 16.57  ? 246  ARG A NH1   1 
ATOM   1541 N  NH2   . ARG A 1 246 ? 94.399  104.362 149.519 1.00 16.57  ? 246  ARG A NH2   1 
ATOM   1542 N  N     . TYR A 1 247 ? 100.248 100.145 151.778 1.00 18.74  ? 247  TYR A N     1 
ATOM   1543 C  CA    . TYR A 1 247 ? 99.876  99.138  152.762 1.00 18.74  ? 247  TYR A CA    1 
ATOM   1544 C  C     . TYR A 1 247 ? 98.406  98.754  152.674 1.00 18.74  ? 247  TYR A C     1 
ATOM   1545 O  O     . TYR A 1 247 ? 98.048  97.633  153.041 1.00 18.74  ? 247  TYR A O     1 
ATOM   1546 C  CB    . TYR A 1 247 ? 100.225 99.631  154.165 1.00 18.74  ? 247  TYR A CB    1 
ATOM   1547 C  CG    . TYR A 1 247 ? 99.917  98.636  155.251 1.00 18.74  ? 247  TYR A CG    1 
ATOM   1548 C  CD1   . TYR A 1 247 ? 100.690 97.501  155.413 1.00 18.74  ? 247  TYR A CD1   1 
ATOM   1549 C  CD2   . TYR A 1 247 ? 98.846  98.829  156.109 1.00 18.74  ? 247  TYR A CD2   1 
ATOM   1550 C  CE1   . TYR A 1 247 ? 100.412 96.582  156.398 1.00 18.74  ? 247  TYR A CE1   1 
ATOM   1551 C  CE2   . TYR A 1 247 ? 98.555  97.916  157.101 1.00 18.74  ? 247  TYR A CE2   1 
ATOM   1552 C  CZ    . TYR A 1 247 ? 99.343  96.794  157.241 1.00 18.74  ? 247  TYR A CZ    1 
ATOM   1553 O  OH    . TYR A 1 247 ? 99.056  95.884  158.231 1.00 18.74  ? 247  TYR A OH    1 
ATOM   1554 N  N     . SER A 1 248 ? 97.554  99.640  152.166 1.00 17.11  ? 248  SER A N     1 
ATOM   1555 C  CA    . SER A 1 248 ? 96.169  99.264  151.925 1.00 17.11  ? 248  SER A CA    1 
ATOM   1556 C  C     . SER A 1 248 ? 96.048  98.305  150.750 1.00 17.11  ? 248  SER A C     1 
ATOM   1557 O  O     . SER A 1 248 ? 95.104  97.514  150.694 1.00 17.11  ? 248  SER A O     1 
ATOM   1558 C  CB    . SER A 1 248 ? 95.329  100.510 151.671 1.00 17.11  ? 248  SER A CB    1 
ATOM   1559 O  OG    . SER A 1 248 ? 95.326  101.364 152.799 1.00 17.11  ? 248  SER A OG    1 
ATOM   1560 N  N     . ILE A 1 249 ? 96.990  98.363  149.810 1.00 15.23  ? 249  ILE A N     1 
ATOM   1561 C  CA    . ILE A 1 249 ? 96.965  97.482  148.648 1.00 15.23  ? 249  ILE A CA    1 
ATOM   1562 C  C     . ILE A 1 249 ? 97.655  96.162  148.959 1.00 15.23  ? 249  ILE A C     1 
ATOM   1563 O  O     . ILE A 1 249 ? 97.175  95.095  148.564 1.00 15.23  ? 249  ILE A O     1 
ATOM   1564 C  CB    . ILE A 1 249 ? 97.599  98.200  147.441 1.00 15.23  ? 249  ILE A CB    1 
ATOM   1565 C  CG1   . ILE A 1 249 ? 96.715  99.347  146.966 1.00 15.23  ? 249  ILE A CG1   1 
ATOM   1566 C  CG2   . ILE A 1 249 ? 97.840  97.270  146.297 1.00 15.23  ? 249  ILE A CG2   1 
ATOM   1567 C  CD1   . ILE A 1 249 ? 97.376  100.198 145.928 1.00 15.23  ? 249  ILE A CD1   1 
ATOM   1568 N  N     . PHE A 1 250 ? 98.766  96.209  149.701 1.00 16.93  ? 250  PHE A N     1 
ATOM   1569 C  CA    . PHE A 1 250 ? 99.492  94.997  150.068 1.00 16.93  ? 250  PHE A CA    1 
ATOM   1570 C  C     . PHE A 1 250 ? 98.680  94.105  150.998 1.00 16.93  ? 250  PHE A C     1 
ATOM   1571 O  O     . PHE A 1 250 ? 98.855  92.883  150.993 1.00 16.93  ? 250  PHE A O     1 
ATOM   1572 C  CB    . PHE A 1 250 ? 100.824 95.363  150.723 1.00 16.93  ? 250  PHE A CB    1 
ATOM   1573 C  CG    . PHE A 1 250 ? 101.652 94.173  151.113 1.00 16.93  ? 250  PHE A CG    1 
ATOM   1574 C  CD1   . PHE A 1 250 ? 102.391 93.491  150.165 1.00 16.93  ? 250  PHE A CD1   1 
ATOM   1575 C  CD2   . PHE A 1 250 ? 101.675 93.722  152.425 1.00 16.93  ? 250  PHE A CD2   1 
ATOM   1576 C  CE1   . PHE A 1 250 ? 103.140 92.393  150.514 1.00 16.93  ? 250  PHE A CE1   1 
ATOM   1577 C  CE2   . PHE A 1 250 ? 102.416 92.621  152.772 1.00 16.93  ? 250  PHE A CE2   1 
ATOM   1578 C  CZ    . PHE A 1 250 ? 103.149 91.959  151.816 1.00 16.93  ? 250  PHE A CZ    1 
ATOM   1579 N  N     . LYS A 1 251 ? 97.789  94.689  151.794 1.00 16.35  ? 251  LYS A N     1 
ATOM   1580 C  CA    . LYS A 1 251 ? 96.962  93.923  152.716 1.00 16.35  ? 251  LYS A CA    1 
ATOM   1581 C  C     . LYS A 1 251 ? 95.927  93.072  151.984 1.00 16.35  ? 251  LYS A C     1 
ATOM   1582 O  O     . LYS A 1 251 ? 95.426  92.094  152.548 1.00 16.35  ? 251  LYS A O     1 
ATOM   1583 C  CB    . LYS A 1 251 ? 96.302  94.900  153.691 1.00 16.35  ? 251  LYS A CB    1 
ATOM   1584 C  CG    . LYS A 1 251 ? 95.556  94.310  154.869 1.00 16.35  ? 251  LYS A CG    1 
ATOM   1585 C  CD    . LYS A 1 251 ? 95.039  95.406  155.789 1.00 16.35  ? 251  LYS A CD    1 
ATOM   1586 C  CE    . LYS A 1 251 ? 93.671  95.917  155.348 1.00 16.35  ? 251  LYS A CE    1 
ATOM   1587 N  NZ    . LYS A 1 251 ? 93.750  97.005  154.332 1.00 16.35  ? 251  LYS A NZ    1 
ATOM   1588 N  N     . LEU A 1 252 ? 95.632  93.398  150.727 1.00 15.44  ? 252  LEU A N     1 
ATOM   1589 C  CA    . LEU A 1 252 ? 94.647  92.683  149.929 1.00 15.44  ? 252  LEU A CA    1 
ATOM   1590 C  C     . LEU A 1 252 ? 95.188  91.411  149.293 1.00 15.44  ? 252  LEU A C     1 
ATOM   1591 O  O     . LEU A 1 252 ? 94.397  90.638  148.747 1.00 15.44  ? 252  LEU A O     1 
ATOM   1592 C  CB    . LEU A 1 252 ? 94.117  93.592  148.821 1.00 15.44  ? 252  LEU A CB    1 
ATOM   1593 C  CG    . LEU A 1 252 ? 93.403  94.875  149.224 1.00 15.44  ? 252  LEU A CG    1 
ATOM   1594 C  CD1   . LEU A 1 252 ? 93.063  95.663  147.988 1.00 15.44  ? 252  LEU A CD1   1 
ATOM   1595 C  CD2   . LEU A 1 252 ? 92.162  94.568  150.026 1.00 15.44  ? 252  LEU A CD2   1 
ATOM   1596 N  N     . PHE A 1 253 ? 96.496  91.176  149.343 1.00 15.05  ? 253  PHE A N     1 
ATOM   1597 C  CA    . PHE A 1 253 ? 97.093  90.089  148.577 1.00 15.05  ? 253  PHE A CA    1 
ATOM   1598 C  C     . PHE A 1 253 ? 96.791  88.746  149.225 1.00 15.05  ? 253  PHE A C     1 
ATOM   1599 O  O     . PHE A 1 253 ? 96.760  88.622  150.451 1.00 15.05  ? 253  PHE A O     1 
ATOM   1600 C  CB    . PHE A 1 253 ? 98.610  90.261  148.470 1.00 15.05  ? 253  PHE A CB    1 
ATOM   1601 C  CG    . PHE A 1 253 ? 99.054  91.453  147.665 1.00 15.05  ? 253  PHE A CG    1 
ATOM   1602 C  CD1   . PHE A 1 253 ? 98.195  92.111  146.805 1.00 15.05  ? 253  PHE A CD1   1 
ATOM   1603 C  CD2   . PHE A 1 253 ? 100.350 91.916  147.780 1.00 15.05  ? 253  PHE A CD2   1 
ATOM   1604 C  CE1   . PHE A 1 253 ? 98.622  93.206  146.094 1.00 15.05  ? 253  PHE A CE1   1 
ATOM   1605 C  CE2   . PHE A 1 253 ? 100.777 93.010  147.061 1.00 15.05  ? 253  PHE A CE2   1 
ATOM   1606 C  CZ    . PHE A 1 253 ? 99.913  93.649  146.218 1.00 15.05  ? 253  PHE A CZ    1 
ATOM   1607 N  N     . ASP A 1 254 ? 96.568  87.735  148.391 1.00 17.19  ? 254  ASP A N     1 
ATOM   1608 C  CA    . ASP A 1 254 ? 96.366  86.369  148.854 1.00 17.19  ? 254  ASP A CA    1 
ATOM   1609 C  C     . ASP A 1 254 ? 97.591  85.497  148.657 1.00 17.19  ? 254  ASP A C     1 
ATOM   1610 O  O     . ASP A 1 254 ? 97.774  84.525  149.394 1.00 17.19  ? 254  ASP A O     1 
ATOM   1611 C  CB    . ASP A 1 254 ? 95.177  85.734  148.127 1.00 17.19  ? 254  ASP A CB    1 
ATOM   1612 C  CG    . ASP A 1 254 ? 93.857  86.340  148.540 1.00 17.19  ? 254  ASP A CG    1 
ATOM   1613 O  OD1   . ASP A 1 254 ? 93.736  86.745  149.711 1.00 17.19  ? 254  ASP A OD1   1 
ATOM   1614 O  OD2   . ASP A 1 254 ? 92.945  86.433  147.695 1.00 17.19  ? 254  ASP A OD2   1 
ATOM   1615 N  N     . SER A 1 255 ? 98.423  85.829  147.680 1.00 16.10  ? 255  SER A N     1 
ATOM   1616 C  CA    . SER A 1 255 ? 99.654  85.117  147.392 1.00 16.10  ? 255  SER A CA    1 
ATOM   1617 C  C     . SER A 1 255 ? 100.685 86.126  146.921 1.00 16.10  ? 255  SER A C     1 
ATOM   1618 O  O     . SER A 1 255 ? 100.347 87.085  146.226 1.00 16.10  ? 255  SER A O     1 
ATOM   1619 C  CB    . SER A 1 255 ? 99.441  84.043  146.328 1.00 16.10  ? 255  SER A CB    1 
ATOM   1620 O  OG    . SER A 1 255 ? 100.661 83.439  145.943 1.00 16.10  ? 255  SER A OG    1 
ATOM   1621 N  N     . LEU A 1 256 ? 101.936 85.909  147.300 1.00 16.49  ? 256  LEU A N     1 
ATOM   1622 C  CA    . LEU A 1 256 ? 103.008 86.835  146.983 1.00 16.49  ? 256  LEU A CA    1 
ATOM   1623 C  C     . LEU A 1 256 ? 104.122 86.096  146.262 1.00 16.49  ? 256  LEU A C     1 
ATOM   1624 O  O     . LEU A 1 256 ? 104.485 84.983  146.642 1.00 16.49  ? 256  LEU A O     1 
ATOM   1625 C  CB    . LEU A 1 256 ? 103.540 87.500  148.247 1.00 16.49  ? 256  LEU A CB    1 
ATOM   1626 C  CG    . LEU A 1 256 ? 104.587 88.578  148.034 1.00 16.49  ? 256  LEU A CG    1 
ATOM   1627 C  CD1   . LEU A 1 256 ? 103.962 89.688  147.266 1.00 16.49  ? 256  LEU A CD1   1 
ATOM   1628 C  CD2   . LEU A 1 256 ? 105.094 89.071  149.342 1.00 16.49  ? 256  LEU A CD2   1 
ATOM   1629 N  N     . THR A 1 257 ? 104.656 86.724  145.219 1.00 14.21  ? 257  THR A N     1 
ATOM   1630 C  CA    . THR A 1 257 ? 105.717 86.168  144.393 1.00 14.21  ? 257  THR A CA    1 
ATOM   1631 C  C     . THR A 1 257 ? 106.777 87.240  144.210 1.00 14.21  ? 257  THR A C     1 
ATOM   1632 O  O     . THR A 1 257 ? 106.456 88.358  143.806 1.00 14.21  ? 257  THR A O     1 
ATOM   1633 C  CB    . THR A 1 257 ? 105.157 85.717  143.039 1.00 14.21  ? 257  THR A CB    1 
ATOM   1634 O  OG1   . THR A 1 257 ? 104.164 84.707  143.237 1.00 14.21  ? 257  THR A OG1   1 
ATOM   1635 C  CG2   . THR A 1 257 ? 106.232 85.173  142.157 1.00 14.21  ? 257  THR A CG2   1 
ATOM   1636 N  N     . LEU A 1 258 ? 108.029 86.920  144.519 1.00 15.31  ? 258  LEU A N     1 
ATOM   1637 C  CA    . LEU A 1 258 ? 109.118 87.893  144.451 1.00 15.31  ? 258  LEU A CA    1 
ATOM   1638 C  C     . LEU A 1 258 ? 110.147 87.443  143.424 1.00 15.31  ? 258  LEU A C     1 
ATOM   1639 O  O     . LEU A 1 258 ? 110.858 86.460  143.643 1.00 15.31  ? 258  LEU A O     1 
ATOM   1640 C  CB    . LEU A 1 258 ? 109.773 88.080  145.816 1.00 15.31  ? 258  LEU A CB    1 
ATOM   1641 C  CG    . LEU A 1 258 ? 108.991 88.790  146.913 1.00 15.31  ? 258  LEU A CG    1 
ATOM   1642 C  CD1   . LEU A 1 258 ? 109.708 88.645  148.209 1.00 15.31  ? 258  LEU A CD1   1 
ATOM   1643 C  CD2   . LEU A 1 258 ? 108.885 90.239  146.585 1.00 15.31  ? 258  LEU A CD2   1 
ATOM   1644 N  N     . LEU A 1 259 ? 110.237 88.174  142.321 1.00 14.48  ? 259  LEU A N     1 
ATOM   1645 C  CA    . LEU A 1 259 ? 111.224 87.948  141.276 1.00 14.48  ? 259  LEU A CA    1 
ATOM   1646 C  C     . LEU A 1 259 ? 112.398 88.891  141.464 1.00 14.48  ? 259  LEU A C     1 
ATOM   1647 O  O     . LEU A 1 259 ? 112.227 90.023  141.905 1.00 14.48  ? 259  LEU A O     1 
ATOM   1648 C  CB    . LEU A 1 259 ? 110.624 88.178  139.887 1.00 14.48  ? 259  LEU A CB    1 
ATOM   1649 C  CG    . LEU A 1 259 ? 109.993 87.059  139.069 1.00 14.48  ? 259  LEU A CG    1 
ATOM   1650 C  CD1   . LEU A 1 259 ? 111.061 86.083  138.706 1.00 14.48  ? 259  LEU A CD1   1 
ATOM   1651 C  CD2   . LEU A 1 259 ? 108.893 86.369  139.820 1.00 14.48  ? 259  LEU A CD2   1 
ATOM   1652 N  N     . ALA A 1 260 ? 113.591 88.421  141.113 1.00 17.11  ? 260  ALA A N     1 
ATOM   1653 C  CA    . ALA A 1 260 ? 114.768 89.284  141.075 1.00 17.11  ? 260  ALA A CA    1 
ATOM   1654 C  C     . ALA A 1 260 ? 115.775 88.656  140.126 1.00 17.11  ? 260  ALA A C     1 
ATOM   1655 O  O     . ALA A 1 260 ? 116.290 87.571  140.413 1.00 17.11  ? 260  ALA A O     1 
ATOM   1656 C  CB    . ALA A 1 260 ? 115.368 89.469  142.457 1.00 17.11  ? 260  ALA A CB    1 
ATOM   1657 N  N     . SER A 1 261 ? 116.048 89.347  139.015 1.00 17.36  ? 261  SER A N     1 
ATOM   1658 C  CA    . SER A 1 261 ? 116.986 88.924  137.964 1.00 17.36  ? 261  SER A CA    1 
ATOM   1659 C  C     . SER A 1 261 ? 116.655 87.537  137.416 1.00 17.36  ? 261  SER A C     1 
ATOM   1660 O  O     . SER A 1 261 ? 117.544 86.732  137.140 1.00 17.36  ? 261  SER A O     1 
ATOM   1661 C  CB    . SER A 1 261 ? 118.436 88.980  138.443 1.00 17.36  ? 261  SER A CB    1 
ATOM   1662 O  OG    . SER A 1 261 ? 118.705 87.955  139.375 1.00 17.36  ? 261  SER A OG    1 
ATOM   1663 N  N     . GLY A 1 262 ? 115.366 87.253  137.256 1.00 17.75  ? 262  GLY A N     1 
ATOM   1664 C  CA    . GLY A 1 262 ? 114.925 86.011  136.671 1.00 17.75  ? 262  GLY A CA    1 
ATOM   1665 C  C     . GLY A 1 262 ? 114.733 84.869  137.640 1.00 17.75  ? 262  GLY A C     1 
ATOM   1666 O  O     . GLY A 1 262 ? 114.130 83.862  137.267 1.00 17.75  ? 262  GLY A O     1 
ATOM   1667 N  N     . ARG A 1 263 ? 115.223 84.983  138.863 1.00 21.24  ? 263  ARG A N     1 
ATOM   1668 C  CA    . ARG A 1 263 ? 115.074 83.922  139.842 1.00 21.24  ? 263  ARG A CA    1 
ATOM   1669 C  C     . ARG A 1 263 ? 114.018 84.300  140.870 1.00 21.24  ? 263  ARG A C     1 
ATOM   1670 O  O     . ARG A 1 263 ? 113.639 85.461  141.010 1.00 21.24  ? 263  ARG A O     1 
ATOM   1671 C  CB    . ARG A 1 263 ? 116.410 83.623  140.523 1.00 21.24  ? 263  ARG A CB    1 
ATOM   1672 C  CG    . ARG A 1 263 ? 117.436 83.013  139.585 1.00 21.24  ? 263  ARG A CG    1 
ATOM   1673 C  CD    . ARG A 1 263 ? 118.785 82.852  140.247 1.00 21.24  ? 263  ARG A CD    1 
ATOM   1674 N  NE    . ARG A 1 263 ? 118.769 81.870  141.326 1.00 21.24  ? 263  ARG A NE    1 
ATOM   1675 C  CZ    . ARG A 1 263 ? 119.018 80.575  141.163 1.00 21.24  ? 263  ARG A CZ    1 
ATOM   1676 N  NH1   . ARG A 1 263 ? 119.305 80.099  139.959 1.00 21.24  ? 263  ARG A NH1   1 
ATOM   1677 N  NH2   . ARG A 1 263 ? 118.984 79.755  142.204 1.00 21.24  ? 263  ARG A NH2   1 
ATOM   1678 N  N     . LEU A 1 264 ? 113.548 83.295  141.589 1.00 20.49  ? 264  LEU A N     1 
ATOM   1679 C  CA    . LEU A 1 264 ? 112.434 83.433  142.514 1.00 20.49  ? 264  LEU A CA    1 
ATOM   1680 C  C     . LEU A 1 264 ? 112.985 83.649  143.918 1.00 20.49  ? 264  LEU A C     1 
ATOM   1681 O  O     . LEU A 1 264 ? 113.674 82.777  144.455 1.00 20.49  ? 264  LEU A O     1 
ATOM   1682 C  CB    . LEU A 1 264 ? 111.562 82.183  142.458 1.00 20.49  ? 264  LEU A CB    1 
ATOM   1683 C  CG    . LEU A 1 264 ? 110.210 82.161  143.147 1.00 20.49  ? 264  LEU A CG    1 
ATOM   1684 C  CD1   . LEU A 1 264 ? 109.300 83.118  142.442 1.00 20.49  ? 264  LEU A CD1   1 
ATOM   1685 C  CD2   . LEU A 1 264 ? 109.646 80.767  143.108 1.00 20.49  ? 264  LEU A CD2   1 
ATOM   1686 N  N     . MET A 1 265 ? 112.690 84.809  144.507 1.00 21.97  ? 265  MET A N     1 
ATOM   1687 C  CA    . MET A 1 265 ? 113.157 85.084  145.862 1.00 21.97  ? 265  MET A CA    1 
ATOM   1688 C  C     . MET A 1 265 ? 112.221 84.514  146.911 1.00 21.97  ? 265  MET A C     1 
ATOM   1689 O  O     . MET A 1 265 ? 112.680 84.103  147.980 1.00 21.97  ? 265  MET A O     1 
ATOM   1690 C  CB    . MET A 1 265 ? 113.306 86.586  146.090 1.00 21.97  ? 265  MET A CB    1 
ATOM   1691 C  CG    . MET A 1 265 ? 114.321 87.282  145.217 1.00 21.97  ? 265  MET A CG    1 
ATOM   1692 S  SD    . MET A 1 265 ? 116.022 86.763  145.429 1.00 21.97  ? 265  MET A SD    1 
ATOM   1693 C  CE    . MET A 1 265 ? 116.277 85.786  143.958 1.00 21.97  ? 265  MET A CE    1 
ATOM   1694 N  N     . PHE A 1 266 ? 110.922 84.493  146.629 1.00 21.26  ? 266  PHE A N     1 
ATOM   1695 C  CA    . PHE A 1 266 ? 109.919 83.984  147.549 1.00 21.26  ? 266  PHE A CA    1 
ATOM   1696 C  C     . PHE A 1 266 ? 108.642 83.715  146.772 1.00 21.26  ? 266  PHE A C     1 
ATOM   1697 O  O     . PHE A 1 266 ? 108.308 84.457  145.850 1.00 21.26  ? 266  PHE A O     1 
ATOM   1698 C  CB    . PHE A 1 266 ? 109.648 84.976  148.687 1.00 21.26  ? 266  PHE A CB    1 
ATOM   1699 C  CG    . PHE A 1 266 ? 108.584 84.532  149.640 1.00 21.26  ? 266  PHE A CG    1 
ATOM   1700 C  CD1   . PHE A 1 266 ? 108.838 83.544  150.569 1.00 21.26  ? 266  PHE A CD1   1 
ATOM   1701 C  CD2   . PHE A 1 266 ? 107.327 85.105  149.606 1.00 21.26  ? 266  PHE A CD2   1 
ATOM   1702 C  CE1   . PHE A 1 266 ? 107.859 83.133  151.442 1.00 21.26  ? 266  PHE A CE1   1 
ATOM   1703 C  CE2   . PHE A 1 266 ? 106.347 84.691  150.473 1.00 21.26  ? 266  PHE A CE2   1 
ATOM   1704 C  CZ    . PHE A 1 266 ? 106.615 83.709  151.395 1.00 21.26  ? 266  PHE A CZ    1 
ATOM   1705 N  N     . HIS A 1 267 ? 107.946 82.648  147.142 1.00 19.62  ? 267  HIS A N     1 
ATOM   1706 C  CA    . HIS A 1 267 ? 106.594 82.395  146.667 1.00 19.62  ? 267  HIS A CA    1 
ATOM   1707 C  C     . HIS A 1 267 ? 105.815 81.727  147.785 1.00 19.62  ? 267  HIS A C     1 
ATOM   1708 O  O     . HIS A 1 267 ? 106.280 80.744  148.366 1.00 19.62  ? 267  HIS A O     1 
ATOM   1709 C  CB    . HIS A 1 267 ? 106.575 81.517  145.416 1.00 19.62  ? 267  HIS A CB    1 
ATOM   1710 C  CG    . HIS A 1 267 ? 105.197 81.185  144.941 1.00 19.62  ? 267  HIS A CG    1 
ATOM   1711 N  ND1   . HIS A 1 267 ? 104.404 82.087  144.268 1.00 19.62  ? 267  HIS A ND1   1 
ATOM   1712 C  CD2   . HIS A 1 267 ? 104.459 80.058  145.067 1.00 19.62  ? 267  HIS A CD2   1 
ATOM   1713 C  CE1   . HIS A 1 267 ? 103.243 81.526  143.988 1.00 19.62  ? 267  HIS A CE1   1 
ATOM   1714 N  NE2   . HIS A 1 267 ? 103.250 80.296  144.463 1.00 19.62  ? 267  HIS A NE2   1 
ATOM   1715 N  N     . GLY A 1 268 ? 104.640 82.259  148.081 1.00 20.84  ? 268  GLY A N     1 
ATOM   1716 C  CA    . GLY A 1 268 ? 103.799 81.717  149.115 1.00 20.84  ? 268  GLY A CA    1 
ATOM   1717 C  C     . GLY A 1 268 ? 102.716 82.703  149.477 1.00 20.84  ? 268  GLY A C     1 
ATOM   1718 O  O     . GLY A 1 268 ? 102.358 83.571  148.679 1.00 20.84  ? 268  GLY A O     1 
ATOM   1719 N  N     . PRO A 1 269 ? 102.159 82.581  150.680 1.00 25.27  ? 269  PRO A N     1 
ATOM   1720 C  CA    . PRO A 1 269 ? 101.200 83.581  151.151 1.00 25.27  ? 269  PRO A CA    1 
ATOM   1721 C  C     . PRO A 1 269 ? 101.876 84.915  151.417 1.00 25.27  ? 269  PRO A C     1 
ATOM   1722 O  O     . PRO A 1 269 ? 103.074 84.997  151.688 1.00 25.27  ? 269  PRO A O     1 
ATOM   1723 C  CB    . PRO A 1 269 ? 100.655 82.968  152.443 1.00 25.27  ? 269  PRO A CB    1 
ATOM   1724 C  CG    . PRO A 1 269 ? 100.886 81.516  152.291 1.00 25.27  ? 269  PRO A CG    1 
ATOM   1725 C  CD    . PRO A 1 269 ? 102.177 81.399  151.552 1.00 25.27  ? 269  PRO A CD    1 
ATOM   1726 N  N     . ALA A 1 270 ? 101.081 85.979  151.320 1.00 23.97  ? 270  ALA A N     1 
ATOM   1727 C  CA    . ALA A 1 270 ? 101.612 87.316  151.536 1.00 23.97  ? 270  ALA A CA    1 
ATOM   1728 C  C     . ALA A 1 270 ? 101.649 87.683  153.009 1.00 23.97  ? 270  ALA A C     1 
ATOM   1729 O  O     . ALA A 1 270 ? 102.496 88.481  153.423 1.00 23.97  ? 270  ALA A O     1 
ATOM   1730 C  CB    . ALA A 1 270 ? 100.784 88.337  150.769 1.00 23.97  ? 270  ALA A CB    1 
ATOM   1731 N  N     . GLN A 1 271 ? 100.745 87.121  153.809 1.00 30.10  ? 271  GLN A N     1 
ATOM   1732 C  CA    . GLN A 1 271 ? 100.754 87.384  155.240 1.00 30.10  ? 271  GLN A CA    1 
ATOM   1733 C  C     . GLN A 1 271 ? 101.885 86.654  155.947 1.00 30.10  ? 271  GLN A C     1 
ATOM   1734 O  O     . GLN A 1 271 ? 102.253 87.039  157.061 1.00 30.10  ? 271  GLN A O     1 
ATOM   1735 C  CB    . GLN A 1 271 ? 99.411  86.991  155.855 1.00 30.10  ? 271  GLN A CB    1 
ATOM   1736 C  CG    . GLN A 1 271 ? 99.132  85.491  155.876 1.00 30.10  ? 271  GLN A CG    1 
ATOM   1737 C  CD    . GLN A 1 271 ? 98.451  84.989  154.614 1.00 30.10  ? 271  GLN A CD    1 
ATOM   1738 O  OE1   . GLN A 1 271 ? 98.396  85.684  153.600 1.00 30.10  ? 271  GLN A OE1   1 
ATOM   1739 N  NE2   . GLN A 1 271 ? 97.936  83.766  154.670 1.00 30.10  ? 271  GLN A NE2   1 
ATOM   1740 N  N     . GLU A 1 272 ? 102.446 85.622  155.322 1.00 31.72  ? 272  GLU A N     1 
ATOM   1741 C  CA    . GLU A 1 272 ? 103.535 84.843  155.887 1.00 31.72  ? 272  GLU A CA    1 
ATOM   1742 C  C     . GLU A 1 272 ? 104.873 85.192  155.264 1.00 31.72  ? 272  GLU A C     1 
ATOM   1743 O  O     . GLU A 1 272 ? 105.847 84.467  155.468 1.00 31.72  ? 272  GLU A O     1 
ATOM   1744 C  CB    . GLU A 1 272 ? 103.249 83.353  155.715 1.00 31.72  ? 272  GLU A CB    1 
ATOM   1745 C  CG    . GLU A 1 272 ? 102.009 82.891  156.452 1.00 31.72  ? 272  GLU A CG    1 
ATOM   1746 C  CD    . GLU A 1 272 ? 101.711 81.426  156.234 1.00 31.72  ? 272  GLU A CD    1 
ATOM   1747 O  OE1   . GLU A 1 272 ? 102.418 80.788  155.426 1.00 31.72  ? 272  GLU A OE1   1 
ATOM   1748 O  OE2   . GLU A 1 272 ? 100.764 80.913  156.865 1.00 31.72  ? 272  GLU A OE2   1 
ATOM   1749 N  N     . ALA A 1 273 ? 104.940 86.284  154.511 1.00 28.44  ? 273  ALA A N     1 
ATOM   1750 C  CA    . ALA A 1 273 ? 106.177 86.716  153.878 1.00 28.44  ? 273  ALA A CA    1 
ATOM   1751 C  C     . ALA A 1 273 ? 107.031 87.574  154.787 1.00 28.44  ? 273  ALA A C     1 
ATOM   1752 O  O     . ALA A 1 273 ? 108.260 87.545  154.676 1.00 28.44  ? 273  ALA A O     1 
ATOM   1753 C  CB    . ALA A 1 273 ? 105.870 87.507  152.611 1.00 28.44  ? 273  ALA A CB    1 
ATOM   1754 N  N     . LEU A 1 274 ? 106.403 88.351  155.667 1.00 30.87  ? 274  LEU A N     1 
ATOM   1755 C  CA    . LEU A 1 274 ? 107.154 89.220  156.563 1.00 30.87  ? 274  LEU A CA    1 
ATOM   1756 C  C     . LEU A 1 274 ? 107.844 88.412  157.650 1.00 30.87  ? 274  LEU A C     1 
ATOM   1757 O  O     . LEU A 1 274 ? 108.968 88.729  158.051 1.00 30.87  ? 274  LEU A O     1 
ATOM   1758 C  CB    . LEU A 1 274 ? 106.222 90.263  157.169 1.00 30.87  ? 274  LEU A CB    1 
ATOM   1759 C  CG    . LEU A 1 274 ? 106.890 91.360  157.986 1.00 30.87  ? 274  LEU A CG    1 
ATOM   1760 C  CD1   . LEU A 1 274 ? 107.788 92.165  157.080 1.00 30.87  ? 274  LEU A CD1   1 
ATOM   1761 C  CD2   . LEU A 1 274 ? 105.845 92.241  158.640 1.00 30.87  ? 274  LEU A CD2   1 
ATOM   1762 N  N     . GLY A 1 275 ? 107.192 87.355  158.130 1.00 31.37  ? 275  GLY A N     1 
ATOM   1763 C  CA    . GLY A 1 275 ? 107.816 86.430  159.054 1.00 31.37  ? 275  GLY A CA    1 
ATOM   1764 C  C     . GLY A 1 275 ? 108.784 85.461  158.421 1.00 31.37  ? 275  GLY A C     1 
ATOM   1765 O  O     . GLY A 1 275 ? 109.405 84.666  159.130 1.00 31.37  ? 275  GLY A O     1 
ATOM   1766 N  N     . TYR A 1 276 ? 108.909 85.500  157.097 1.00 30.00  ? 276  TYR A N     1 
ATOM   1767 C  CA    . TYR A 1 276 ? 109.900 84.697  156.397 1.00 30.00  ? 276  TYR A CA    1 
ATOM   1768 C  C     . TYR A 1 276 ? 111.261 85.380  156.386 1.00 30.00  ? 276  TYR A C     1 
ATOM   1769 O  O     . TYR A 1 276 ? 112.284 84.745  156.660 1.00 30.00  ? 276  TYR A O     1 
ATOM   1770 C  CB    . TYR A 1 276 ? 109.422 84.423  154.973 1.00 30.00  ? 276  TYR A CB    1 
ATOM   1771 C  CG    . TYR A 1 276 ? 110.432 83.702  154.136 1.00 30.00  ? 276  TYR A CG    1 
ATOM   1772 C  CD1   . TYR A 1 276 ? 110.681 82.355  154.326 1.00 30.00  ? 276  TYR A CD1   1 
ATOM   1773 C  CD2   . TYR A 1 276 ? 111.146 84.374  153.156 1.00 30.00  ? 276  TYR A CD2   1 
ATOM   1774 C  CE1   . TYR A 1 276 ? 111.612 81.703  153.563 1.00 30.00  ? 276  TYR A CE1   1 
ATOM   1775 C  CE2   . TYR A 1 276 ? 112.075 83.733  152.397 1.00 30.00  ? 276  TYR A CE2   1 
ATOM   1776 C  CZ    . TYR A 1 276 ? 112.300 82.404  152.601 1.00 30.00  ? 276  TYR A CZ    1 
ATOM   1777 O  OH    . TYR A 1 276 ? 113.232 81.781  151.832 1.00 30.00  ? 276  TYR A OH    1 
ATOM   1778 N  N     . PHE A 1 277 ? 111.294 86.671  156.060 1.00 31.11  ? 277  PHE A N     1 
ATOM   1779 C  CA    . PHE A 1 277 ? 112.549 87.406  156.015 1.00 31.11  ? 277  PHE A CA    1 
ATOM   1780 C  C     . PHE A 1 277 ? 113.088 87.747  157.395 1.00 31.11  ? 277  PHE A C     1 
ATOM   1781 O  O     . PHE A 1 277 ? 114.267 88.093  157.514 1.00 31.11  ? 277  PHE A O     1 
ATOM   1782 C  CB    . PHE A 1 277 ? 112.383 88.689  155.204 1.00 31.11  ? 277  PHE A CB    1 
ATOM   1783 C  CG    . PHE A 1 277 ? 112.193 88.457  153.738 1.00 31.11  ? 277  PHE A CG    1 
ATOM   1784 C  CD1   . PHE A 1 277 ? 113.274 88.163  152.931 1.00 31.11  ? 277  PHE A CD1   1 
ATOM   1785 C  CD2   . PHE A 1 277 ? 110.939 88.545  153.164 1.00 31.11  ? 277  PHE A CD2   1 
ATOM   1786 C  CE1   . PHE A 1 277 ? 113.107 87.950  151.583 1.00 31.11  ? 277  PHE A CE1   1 
ATOM   1787 C  CE2   . PHE A 1 277 ? 110.767 88.335  151.813 1.00 31.11  ? 277  PHE A CE2   1 
ATOM   1788 C  CZ    . PHE A 1 277 ? 111.855 88.037  151.026 1.00 31.11  ? 277  PHE A CZ    1 
ATOM   1789 N  N     . GLU A 1 278 ? 112.258 87.676  158.436 1.00 35.89  ? 278  GLU A N     1 
ATOM   1790 C  CA    . GLU A 1 278 ? 112.781 87.792  159.790 1.00 35.89  ? 278  GLU A CA    1 
ATOM   1791 C  C     . GLU A 1 278 ? 113.534 86.542  160.210 1.00 35.89  ? 278  GLU A C     1 
ATOM   1792 O  O     . GLU A 1 278 ? 114.410 86.620  161.076 1.00 35.89  ? 278  GLU A O     1 
ATOM   1793 C  CB    . GLU A 1 278 ? 111.651 88.087  160.773 1.00 35.89  ? 278  GLU A CB    1 
ATOM   1794 C  CG    . GLU A 1 278 ? 111.062 89.475  160.612 1.00 35.89  ? 278  GLU A CG    1 
ATOM   1795 C  CD    . GLU A 1 278 ? 109.926 89.744  161.573 1.00 35.89  ? 278  GLU A CD    1 
ATOM   1796 O  OE1   . GLU A 1 278 ? 109.509 88.801  162.279 1.00 35.89  ? 278  GLU A OE1   1 
ATOM   1797 O  OE2   . GLU A 1 278 ? 109.452 90.899  161.622 1.00 35.89  ? 278  GLU A OE2   1 
ATOM   1798 N  N     . SER A 1 279 ? 113.216 85.396  159.609 1.00 35.07  ? 279  SER A N     1 
ATOM   1799 C  CA    . SER A 1 279 ? 113.996 84.191  159.850 1.00 35.07  ? 279  SER A CA    1 
ATOM   1800 C  C     . SER A 1 279 ? 115.331 84.235  159.120 1.00 35.07  ? 279  SER A C     1 
ATOM   1801 O  O     . SER A 1 279 ? 116.300 83.616  159.570 1.00 35.07  ? 279  SER A O     1 
ATOM   1802 C  CB    . SER A 1 279 ? 113.198 82.963  159.425 1.00 35.07  ? 279  SER A CB    1 
ATOM   1803 O  OG    . SER A 1 279 ? 113.953 81.781  159.606 1.00 35.07  ? 279  SER A OG    1 
ATOM   1804 N  N     . ALA A 1 280 ? 115.403 84.955  158.005 1.00 35.22  ? 280  ALA A N     1 
ATOM   1805 C  CA    . ALA A 1 280 ? 116.628 85.070  157.228 1.00 35.22  ? 280  ALA A CA    1 
ATOM   1806 C  C     . ALA A 1 280 ? 117.531 86.200  157.701 1.00 35.22  ? 280  ALA A C     1 
ATOM   1807 O  O     . ALA A 1 280 ? 118.567 86.446  157.078 1.00 35.22  ? 280  ALA A O     1 
ATOM   1808 C  CB    . ALA A 1 280 ? 116.295 85.263  155.746 1.00 35.22  ? 280  ALA A CB    1 
ATOM   1809 N  N     . GLY A 1 281 ? 117.167 86.893  158.774 1.00 37.08  ? 281  GLY A N     1 
ATOM   1810 C  CA    . GLY A 1 281 ? 118.016 87.906  159.359 1.00 37.08  ? 281  GLY A CA    1 
ATOM   1811 C  C     . GLY A 1 281 ? 117.657 89.339  159.043 1.00 37.08  ? 281  GLY A C     1 
ATOM   1812 O  O     . GLY A 1 281 ? 118.476 90.229  159.294 1.00 37.08  ? 281  GLY A O     1 
ATOM   1813 N  N     . TYR A 1 282 ? 116.464 89.597  158.513 1.00 35.74  ? 282  TYR A N     1 
ATOM   1814 C  CA    . TYR A 1 282 ? 116.045 90.939  158.122 1.00 35.74  ? 282  TYR A CA    1 
ATOM   1815 C  C     . TYR A 1 282 ? 114.836 91.333  158.955 1.00 35.74  ? 282  TYR A C     1 
ATOM   1816 O  O     . TYR A 1 282 ? 113.743 90.796  158.754 1.00 35.74  ? 282  TYR A O     1 
ATOM   1817 C  CB    . TYR A 1 282 ? 115.711 90.993  156.635 1.00 35.74  ? 282  TYR A CB    1 
ATOM   1818 C  CG    . TYR A 1 282 ? 116.886 90.755  155.728 1.00 35.74  ? 282  TYR A CG    1 
ATOM   1819 C  CD1   . TYR A 1 282 ? 117.802 91.762  155.477 1.00 35.74  ? 282  TYR A CD1   1 
ATOM   1820 C  CD2   . TYR A 1 282 ? 117.068 89.528  155.109 1.00 35.74  ? 282  TYR A CD2   1 
ATOM   1821 C  CE1   . TYR A 1 282 ? 118.876 91.552  154.643 1.00 35.74  ? 282  TYR A CE1   1 
ATOM   1822 C  CE2   . TYR A 1 282 ? 118.138 89.307  154.273 1.00 35.74  ? 282  TYR A CE2   1 
ATOM   1823 C  CZ    . TYR A 1 282 ? 119.038 90.323  154.043 1.00 35.74  ? 282  TYR A CZ    1 
ATOM   1824 O  OH    . TYR A 1 282 ? 120.110 90.113  153.209 1.00 35.74  ? 282  TYR A OH    1 
ATOM   1825 N  N     . HIS A 1 283 ? 115.019 92.274  159.873 1.00 41.17  ? 283  HIS A N     1 
ATOM   1826 C  CA    . HIS A 1 283 ? 113.930 92.706  160.735 1.00 41.17  ? 283  HIS A CA    1 
ATOM   1827 C  C     . HIS A 1 283 ? 113.188 93.877  160.102 1.00 41.17  ? 283  HIS A C     1 
ATOM   1828 O  O     . HIS A 1 283 ? 113.774 94.700  159.395 1.00 41.17  ? 283  HIS A O     1 
ATOM   1829 C  CB    . HIS A 1 283 ? 114.455 93.082  162.120 1.00 41.17  ? 283  HIS A CB    1 
ATOM   1830 C  CG    . HIS A 1 283 ? 115.017 91.921  162.881 1.00 41.17  ? 283  HIS A CG    1 
ATOM   1831 N  ND1   . HIS A 1 283 ? 115.699 92.067  164.069 1.00 41.17  ? 283  HIS A ND1   1 
ATOM   1832 C  CD2   . HIS A 1 283 ? 115.008 90.594  162.614 1.00 41.17  ? 283  HIS A CD2   1 
ATOM   1833 C  CE1   . HIS A 1 283 ? 116.081 90.879  164.504 1.00 41.17  ? 283  HIS A CE1   1 
ATOM   1834 N  NE2   . HIS A 1 283 ? 115.674 89.968  163.639 1.00 41.17  ? 283  HIS A NE2   1 
ATOM   1835 N  N     . CYS A 1 284 ? 111.886 93.950  160.383 1.00 44.74  ? 284  CYS A N     1 
ATOM   1836 C  CA    . CYS A 1 284 ? 110.989 94.786  159.590 1.00 44.74  ? 284  CYS A CA    1 
ATOM   1837 C  C     . CYS A 1 284 ? 111.073 96.258  159.973 1.00 44.74  ? 284  CYS A C     1 
ATOM   1838 O  O     . CYS A 1 284 ? 111.229 97.124  159.104 1.00 44.74  ? 284  CYS A O     1 
ATOM   1839 C  CB    . CYS A 1 284 ? 109.549 94.296  159.731 1.00 44.74  ? 284  CYS A CB    1 
ATOM   1840 S  SG    . CYS A 1 284 ? 108.366 95.326  158.836 1.00 44.74  ? 284  CYS A SG    1 
ATOM   1841 N  N     . GLU A 1 285 ? 110.970 96.565  161.266 1.00 48.53  ? 285  GLU A N     1 
ATOM   1842 C  CA    . GLU A 1 285 ? 110.517 97.887  161.690 1.00 48.53  ? 285  GLU A CA    1 
ATOM   1843 C  C     . GLU A 1 285 ? 111.574 98.969  161.501 1.00 48.53  ? 285  GLU A C     1 
ATOM   1844 O  O     . GLU A 1 285 ? 112.126 99.507  162.463 1.00 48.53  ? 285  GLU A O     1 
ATOM   1845 C  CB    . GLU A 1 285 ? 110.066 97.849  163.148 1.00 48.53  ? 285  GLU A CB    1 
ATOM   1846 C  CG    . GLU A 1 285 ? 108.820 97.008  163.362 1.00 48.53  ? 285  GLU A CG    1 
ATOM   1847 C  CD    . GLU A 1 285 ? 107.594 97.576  162.662 1.00 48.53  ? 285  GLU A CD    1 
ATOM   1848 O  OE1   . GLU A 1 285 ? 107.469 98.817  162.566 1.00 48.53  ? 285  GLU A OE1   1 
ATOM   1849 O  OE2   . GLU A 1 285 ? 106.756 96.774  162.200 1.00 48.53  ? 285  GLU A OE2   1 
ATOM   1850 N  N     . ALA A 1 286 ? 111.841 99.280  160.239 1.00 43.88  ? 286  ALA A N     1 
ATOM   1851 C  CA    . ALA A 1 286 ? 112.460 100.519 159.815 1.00 43.88  ? 286  ALA A CA    1 
ATOM   1852 C  C     . ALA A 1 286 ? 111.640 100.950 158.610 1.00 43.88  ? 286  ALA A C     1 
ATOM   1853 O  O     . ALA A 1 286 ? 111.948 101.931 157.934 1.00 43.88  ? 286  ALA A O     1 
ATOM   1854 C  CB    . ALA A 1 286 ? 113.919 100.325 159.462 1.00 43.88  ? 286  ALA A CB    1 
ATOM   1855 N  N     . TYR A 1 287 ? 110.578 100.181 158.365 1.00 38.69  ? 287  TYR A N     1 
ATOM   1856 C  CA    . TYR A 1 287 ? 109.680 100.375 157.230 1.00 38.69  ? 287  TYR A CA    1 
ATOM   1857 C  C     . TYR A 1 287 ? 108.270 100.038 157.692 1.00 38.69  ? 287  TYR A C     1 
ATOM   1858 O  O     . TYR A 1 287 ? 108.012 98.911  158.121 1.00 38.69  ? 287  TYR A O     1 
ATOM   1859 C  CB    . TYR A 1 287 ? 110.082 99.493  156.046 1.00 38.69  ? 287  TYR A CB    1 
ATOM   1860 C  CG    . TYR A 1 287 ? 111.428 99.829  155.456 1.00 38.69  ? 287  TYR A CG    1 
ATOM   1861 C  CD1   . TYR A 1 287 ? 111.578 100.909 154.597 1.00 38.69  ? 287  TYR A CD1   1 
ATOM   1862 C  CD2   . TYR A 1 287 ? 112.548 99.069  155.759 1.00 38.69  ? 287  TYR A CD2   1 
ATOM   1863 C  CE1   . TYR A 1 287 ? 112.809 101.227 154.060 1.00 38.69  ? 287  TYR A CE1   1 
ATOM   1864 C  CE2   . TYR A 1 287 ? 113.783 99.372  155.224 1.00 38.69  ? 287  TYR A CE2   1 
ATOM   1865 C  CZ    . TYR A 1 287 ? 113.909 100.453 154.378 1.00 38.69  ? 287  TYR A CZ    1 
ATOM   1866 O  OH    . TYR A 1 287 ? 115.140 100.759 153.840 1.00 38.69  ? 287  TYR A OH    1 
ATOM   1867 N  N     . ASN A 1 288 ? 107.356 101.005 157.598 1.00 36.91  ? 288  ASN A N     1 
ATOM   1868 C  CA    . ASN A 1 288 ? 105.971 100.747 157.977 1.00 36.91  ? 288  ASN A CA    1 
ATOM   1869 C  C     . ASN A 1 288 ? 105.212 99.974  156.907 1.00 36.91  ? 288  ASN A C     1 
ATOM   1870 O  O     . ASN A 1 288 ? 104.123 99.463  157.185 1.00 36.91  ? 288  ASN A O     1 
ATOM   1871 C  CB    . ASN A 1 288 ? 105.247 102.061 158.276 1.00 36.91  ? 288  ASN A CB    1 
ATOM   1872 C  CG    . ASN A 1 288 ? 105.696 102.692 159.576 1.00 36.91  ? 288  ASN A CG    1 
ATOM   1873 O  OD1   . ASN A 1 288 ? 105.884 102.006 160.580 1.00 36.91  ? 288  ASN A OD1   1 
ATOM   1874 N  ND2   . ASN A 1 288 ? 105.866 104.007 159.567 1.00 36.91  ? 288  ASN A ND2   1 
ATOM   1875 N  N     . ASN A 1 289 ? 105.755 99.883  155.696 1.00 27.43  ? 289  ASN A N     1 
ATOM   1876 C  CA    . ASN A 1 289 ? 105.141 99.150  154.602 1.00 27.43  ? 289  ASN A CA    1 
ATOM   1877 C  C     . ASN A 1 289 ? 105.947 97.888  154.350 1.00 27.43  ? 289  ASN A C     1 
ATOM   1878 O  O     . ASN A 1 289 ? 107.163 97.983  154.130 1.00 27.43  ? 289  ASN A O     1 
ATOM   1879 C  CB    . ASN A 1 289 ? 105.095 100.023 153.351 1.00 27.43  ? 289  ASN A CB    1 
ATOM   1880 C  CG    . ASN A 1 289 ? 104.244 99.439  152.241 1.00 27.43  ? 289  ASN A CG    1 
ATOM   1881 O  OD1   . ASN A 1 289 ? 103.650 98.375  152.376 1.00 27.43  ? 289  ASN A OD1   1 
ATOM   1882 N  ND2   . ASN A 1 289 ? 104.192 100.143 151.122 1.00 27.43  ? 289  ASN A ND2   1 
ATOM   1883 N  N     . PRO A 1 290 ? 105.340 96.699  154.402 1.00 25.00  ? 290  PRO A N     1 
ATOM   1884 C  CA    . PRO A 1 290 ? 106.105 95.478  154.119 1.00 25.00  ? 290  PRO A CA    1 
ATOM   1885 C  C     . PRO A 1 290 ? 106.558 95.360  152.679 1.00 25.00  ? 290  PRO A C     1 
ATOM   1886 O  O     . PRO A 1 290 ? 107.616 94.775  152.433 1.00 25.00  ? 290  PRO A O     1 
ATOM   1887 C  CB    . PRO A 1 290 ? 105.125 94.360  154.490 1.00 25.00  ? 290  PRO A CB    1 
ATOM   1888 C  CG    . PRO A 1 290 ? 104.204 94.977  155.448 1.00 25.00  ? 290  PRO A CG    1 
ATOM   1889 C  CD    . PRO A 1 290 ? 104.037 96.389  155.004 1.00 25.00  ? 290  PRO A CD    1 
ATOM   1890 N  N     . ALA A 1 291 ? 105.801 95.893  151.721 1.00 21.72  ? 291  ALA A N     1 
ATOM   1891 C  CA    . ALA A 1 291 ? 106.226 95.824  150.330 1.00 21.72  ? 291  ALA A CA    1 
ATOM   1892 C  C     . ALA A 1 291 ? 107.384 96.761  150.037 1.00 21.72  ? 291  ALA A C     1 
ATOM   1893 O  O     . ALA A 1 291 ? 108.119 96.534  149.074 1.00 21.72  ? 291  ALA A O     1 
ATOM   1894 C  CB    . ALA A 1 291 ? 105.059 96.141  149.401 1.00 21.72  ? 291  ALA A CB    1 
ATOM   1895 N  N     . ASP A 1 292 ? 107.552 97.816  150.830 1.00 24.10  ? 292  ASP A N     1 
ATOM   1896 C  CA    . ASP A 1 292 ? 108.733 98.653  150.718 1.00 24.10  ? 292  ASP A CA    1 
ATOM   1897 C  C     . ASP A 1 292 ? 109.930 98.019  151.397 1.00 24.10  ? 292  ASP A C     1 
ATOM   1898 O  O     . ASP A 1 292 ? 111.066 98.384  151.092 1.00 24.10  ? 292  ASP A O     1 
ATOM   1899 C  CB    . ASP A 1 292 ? 108.471 100.034 151.321 1.00 24.10  ? 292  ASP A CB    1 
ATOM   1900 C  CG    . ASP A 1 292 ? 107.442 100.829 150.544 1.00 24.10  ? 292  ASP A CG    1 
ATOM   1901 O  OD1   . ASP A 1 292 ? 107.265 100.576 149.337 1.00 24.10  ? 292  ASP A OD1   1 
ATOM   1902 O  OD2   . ASP A 1 292 ? 106.823 101.732 151.135 1.00 24.10  ? 292  ASP A OD2   1 
ATOM   1903 N  N     . PHE A 1 293 ? 109.692 97.079  152.306 1.00 27.51  ? 293  PHE A N     1 
ATOM   1904 C  CA    . PHE A 1 293 ? 110.763 96.345  152.962 1.00 27.51  ? 293  PHE A CA    1 
ATOM   1905 C  C     . PHE A 1 293 ? 111.224 95.150  152.144 1.00 27.51  ? 293  PHE A C     1 
ATOM   1906 O  O     . PHE A 1 293 ? 112.401 94.786  152.199 1.00 27.51  ? 293  PHE A O     1 
ATOM   1907 C  CB    . PHE A 1 293 ? 110.294 95.895  154.345 1.00 27.51  ? 293  PHE A CB    1 
ATOM   1908 C  CG    . PHE A 1 293 ? 111.277 95.032  155.067 1.00 27.51  ? 293  PHE A CG    1 
ATOM   1909 C  CD1   . PHE A 1 293 ? 112.464 95.563  155.537 1.00 27.51  ? 293  PHE A CD1   1 
ATOM   1910 C  CD2   . PHE A 1 293 ? 111.006 93.694  155.293 1.00 27.51  ? 293  PHE A CD2   1 
ATOM   1911 C  CE1   . PHE A 1 293 ? 113.369 94.776  156.198 1.00 27.51  ? 293  PHE A CE1   1 
ATOM   1912 C  CE2   . PHE A 1 293 ? 111.904 92.904  155.960 1.00 27.51  ? 293  PHE A CE2   1 
ATOM   1913 C  CZ    . PHE A 1 293 ? 113.088 93.446  156.413 1.00 27.51  ? 293  PHE A CZ    1 
ATOM   1914 N  N     . PHE A 1 294 ? 110.317 94.539  151.381 1.00 22.32  ? 294  PHE A N     1 
ATOM   1915 C  CA    . PHE A 1 294 ? 110.649 93.336  150.628 1.00 22.32  ? 294  PHE A CA    1 
ATOM   1916 C  C     . PHE A 1 294 ? 111.541 93.645  149.446 1.00 22.32  ? 294  PHE A C     1 
ATOM   1917 O  O     . PHE A 1 294 ? 112.340 92.799  149.036 1.00 22.32  ? 294  PHE A O     1 
ATOM   1918 C  CB    . PHE A 1 294 ? 109.377 92.648  150.138 1.00 22.32  ? 294  PHE A CB    1 
ATOM   1919 C  CG    . PHE A 1 294 ? 108.572 92.018  151.223 1.00 22.32  ? 294  PHE A CG    1 
ATOM   1920 C  CD1   . PHE A 1 294 ? 109.131 91.748  152.456 1.00 22.32  ? 294  PHE A CD1   1 
ATOM   1921 C  CD2   . PHE A 1 294 ? 107.250 91.707  151.015 1.00 22.32  ? 294  PHE A CD2   1 
ATOM   1922 C  CE1   . PHE A 1 294 ? 108.391 91.178  153.453 1.00 22.32  ? 294  PHE A CE1   1 
ATOM   1923 C  CE2   . PHE A 1 294 ? 106.507 91.133  152.013 1.00 22.32  ? 294  PHE A CE2   1 
ATOM   1924 C  CZ    . PHE A 1 294 ? 107.078 90.873  153.230 1.00 22.32  ? 294  PHE A CZ    1 
ATOM   1925 N  N     . LEU A 1 295 ? 111.422 94.838  148.888 1.00 19.98  ? 295  LEU A N     1 
ATOM   1926 C  CA    . LEU A 1 295 ? 112.174 95.204  147.705 1.00 19.98  ? 295  LEU A CA    1 
ATOM   1927 C  C     . LEU A 1 295 ? 113.381 96.063  148.024 1.00 19.98  ? 295  LEU A C     1 
ATOM   1928 O  O     . LEU A 1 295 ? 114.061 96.506  147.105 1.00 19.98  ? 295  LEU A O     1 
ATOM   1929 C  CB    . LEU A 1 295 ? 111.275 95.917  146.693 1.00 19.98  ? 295  LEU A CB    1 
ATOM   1930 C  CG    . LEU A 1 295 ? 110.431 95.021  145.785 1.00 19.98  ? 295  LEU A CG    1 
ATOM   1931 C  CD1   . LEU A 1 295 ? 109.204 94.438  146.459 1.00 19.98  ? 295  LEU A CD1   1 
ATOM   1932 C  CD2   . LEU A 1 295 ? 110.031 95.794  144.590 1.00 19.98  ? 295  LEU A CD2   1 
ATOM   1933 N  N     . ASP A 1 296 ? 113.653 96.325  149.294 1.00 24.56  ? 296  ASP A N     1 
ATOM   1934 C  CA    . ASP A 1 296 ? 114.958 96.834  149.677 1.00 24.56  ? 296  ASP A CA    1 
ATOM   1935 C  C     . ASP A 1 296 ? 115.922 95.718  150.016 1.00 24.56  ? 296  ASP A C     1 
ATOM   1936 O  O     . ASP A 1 296 ? 117.136 95.939  150.006 1.00 24.56  ? 296  ASP A O     1 
ATOM   1937 C  CB    . ASP A 1 296 ? 114.842 97.776  150.869 1.00 24.56  ? 296  ASP A CB    1 
ATOM   1938 C  CG    . ASP A 1 296 ? 114.176 99.070  150.510 1.00 24.56  ? 296  ASP A CG    1 
ATOM   1939 O  OD1   . ASP A 1 296 ? 114.238 99.464  149.332 1.00 24.56  ? 296  ASP A OD1   1 
ATOM   1940 O  OD2   . ASP A 1 296 ? 113.602 99.709  151.402 1.00 24.56  ? 296  ASP A OD2   1 
ATOM   1941 N  N     . ILE A 1 297 ? 115.407 94.529  150.309 1.00 25.30  ? 297  ILE A N     1 
ATOM   1942 C  CA    . ILE A 1 297 ? 116.266 93.372  150.501 1.00 25.30  ? 297  ILE A CA    1 
ATOM   1943 C  C     . ILE A 1 297 ? 116.770 92.858  149.163 1.00 25.30  ? 297  ILE A C     1 
ATOM   1944 O  O     . ILE A 1 297 ? 117.974 92.671  148.968 1.00 25.30  ? 297  ILE A O     1 
ATOM   1945 C  CB    . ILE A 1 297 ? 115.513 92.272  151.267 1.00 25.30  ? 297  ILE A CB    1 
ATOM   1946 C  CG1   . ILE A 1 297 ? 115.027 92.789  152.609 1.00 25.30  ? 297  ILE A CG1   1 
ATOM   1947 C  CG2   . ILE A 1 297 ? 116.412 91.083  151.498 1.00 25.30  ? 297  ILE A CG2   1 
ATOM   1948 C  CD1   . ILE A 1 297 ? 114.067 91.851  153.265 1.00 25.30  ? 297  ILE A CD1   1 
ATOM   1949 N  N     . ILE A 1 298 ? 115.862 92.653  148.210 1.00 21.91  ? 298  ILE A N     1 
ATOM   1950 C  CA    . ILE A 1 298 ? 116.169 91.919  146.990 1.00 21.91  ? 298  ILE A CA    1 
ATOM   1951 C  C     . ILE A 1 298 ? 116.695 92.856  145.910 1.00 21.91  ? 298  ILE A C     1 
ATOM   1952 O  O     . ILE A 1 298 ? 116.884 92.447  144.760 1.00 21.91  ? 298  ILE A O     1 
ATOM   1953 C  CB    . ILE A 1 298 ? 114.935 91.138  146.499 1.00 21.91  ? 298  ILE A CB    1 
ATOM   1954 C  CG1   . ILE A 1 298 ? 113.831 92.079  146.037 1.00 21.91  ? 298  ILE A CG1   1 
ATOM   1955 C  CG2   . ILE A 1 298 ? 114.387 90.283  147.610 1.00 21.91  ? 298  ILE A CG2   1 
ATOM   1956 C  CD1   . ILE A 1 298 ? 112.683 91.370  145.371 1.00 21.91  ? 298  ILE A CD1   1 
ATOM   1957 N  N     . ASN A 1 299 ? 116.951 94.113  146.269 1.00 23.05  ? 299  ASN A N     1 
ATOM   1958 C  CA    . ASN A 1 299 ? 117.479 95.093  145.330 1.00 23.05  ? 299  ASN A CA    1 
ATOM   1959 C  C     . ASN A 1 299 ? 118.704 95.795  145.904 1.00 23.05  ? 299  ASN A C     1 
ATOM   1960 O  O     . ASN A 1 299 ? 119.140 96.814  145.357 1.00 23.05  ? 299  ASN A O     1 
ATOM   1961 C  CB    . ASN A 1 299 ? 116.396 96.117  144.972 1.00 23.05  ? 299  ASN A CB    1 
ATOM   1962 C  CG    . ASN A 1 299 ? 116.634 96.802  143.649 1.00 23.05  ? 299  ASN A CG    1 
ATOM   1963 O  OD1   . ASN A 1 299 ? 117.535 96.441  142.909 1.00 23.05  ? 299  ASN A OD1   1 
ATOM   1964 N  ND2   . ASN A 1 299 ? 115.841 97.816  143.363 1.00 23.05  ? 299  ASN A ND2   1 
ATOM   1965 N  N     . GLY A 1 300 ? 119.273 95.275  146.992 1.00 27.44  ? 300  GLY A N     1 
ATOM   1966 C  CA    . GLY A 1 300 ? 120.401 95.922  147.632 1.00 27.44  ? 300  GLY A CA    1 
ATOM   1967 C  C     . GLY A 1 300 ? 121.681 95.869  146.830 1.00 27.44  ? 300  GLY A C     1 
ATOM   1968 O  O     . GLY A 1 300 ? 122.550 96.724  147.018 1.00 27.44  ? 300  GLY A O     1 
ATOM   1969 N  N     . ASP A 1 301 ? 121.811 94.898  145.926 1.00 31.63  ? 301  ASP A N     1 
ATOM   1970 C  CA    . ASP A 1 301 ? 122.993 94.780  145.082 1.00 31.63  ? 301  ASP A CA    1 
ATOM   1971 C  C     . ASP A 1 301 ? 122.954 95.683  143.858 1.00 31.63  ? 301  ASP A C     1 
ATOM   1972 O  O     . ASP A 1 301 ? 123.875 95.619  143.041 1.00 31.63  ? 301  ASP A O     1 
ATOM   1973 C  CB    . ASP A 1 301 ? 123.183 93.329  144.633 1.00 31.63  ? 301  ASP A CB    1 
ATOM   1974 C  CG    . ASP A 1 301 ? 121.990 92.782  143.860 1.00 31.63  ? 301  ASP A CG    1 
ATOM   1975 O  OD1   . ASP A 1 301 ? 120.926 93.433  143.811 1.00 31.63  ? 301  ASP A OD1   1 
ATOM   1976 O  OD2   . ASP A 1 301 ? 122.128 91.692  143.275 1.00 31.63  ? 301  ASP A OD2   1 
ATOM   1977 N  N     . SER A 1 302 ? 121.911 96.492  143.699 1.00 27.46  ? 302  SER A N     1 
ATOM   1978 C  CA    . SER A 1 302 ? 121.802 97.351  142.532 1.00 27.46  ? 302  SER A CA    1 
ATOM   1979 C  C     . SER A 1 302 ? 122.772 98.511  142.635 1.00 27.46  ? 302  SER A C     1 
ATOM   1980 O  O     . SER A 1 302 ? 122.977 99.078  143.710 1.00 27.46  ? 302  SER A O     1 
ATOM   1981 C  CB    . SER A 1 302 ? 120.382 97.886  142.392 1.00 27.46  ? 302  SER A CB    1 
ATOM   1982 O  OG    . SER A 1 302 ? 120.274 98.759  141.282 1.00 27.46  ? 302  SER A OG    1 
ATOM   1983 N  N     . THR A 1 303 ? 123.371 98.860  141.500 1.00 23.69  ? 303  THR A N     1 
ATOM   1984 C  CA    . THR A 1 303 ? 124.334 99.948  141.470 1.00 23.69  ? 303  THR A CA    1 
ATOM   1985 C  C     . THR A 1 303 ? 123.665 101.312 141.554 1.00 23.69  ? 303  THR A C     1 
ATOM   1986 O  O     . THR A 1 303 ? 124.333 102.291 141.889 1.00 23.69  ? 303  THR A O     1 
ATOM   1987 C  CB    . THR A 1 303 ? 125.194 99.835  140.211 1.00 23.69  ? 303  THR A CB    1 
ATOM   1988 O  OG1   . THR A 1 303 ? 126.194 100.860 140.203 1.00 23.69  ? 303  THR A OG1   1 
ATOM   1989 C  CG2   . THR A 1 303 ? 124.339 99.939  138.978 1.00 23.69  ? 303  THR A CG2   1 
ATOM   1990 N  N     . ALA A 1 304 ? 122.363 101.404 141.276 1.00 24.02  ? 304  ALA A N     1 
ATOM   1991 C  CA    . ALA A 1 304 ? 121.658 102.656 141.518 1.00 24.02  ? 304  ALA A CA    1 
ATOM   1992 C  C     . ALA A 1 304 ? 121.517 102.912 143.009 1.00 24.02  ? 304  ALA A C     1 
ATOM   1993 O  O     . ALA A 1 304 ? 121.656 104.050 143.468 1.00 24.02  ? 304  ALA A O     1 
ATOM   1994 C  CB    . ALA A 1 304 ? 120.288 102.632 140.847 1.00 24.02  ? 304  ALA A CB    1 
ATOM   1995 N  N     . VAL A 1 305 ? 121.259 101.857 143.778 1.00 24.79  ? 305  VAL A N     1 
ATOM   1996 C  CA    . VAL A 1 305 ? 121.071 101.990 145.214 1.00 24.79  ? 305  VAL A CA    1 
ATOM   1997 C  C     . VAL A 1 305 ? 122.417 102.118 145.915 1.00 24.79  ? 305  VAL A C     1 
ATOM   1998 O  O     . VAL A 1 305 ? 122.536 102.816 146.927 1.00 24.79  ? 305  VAL A O     1 
ATOM   1999 C  CB    . VAL A 1 305 ? 120.253 100.786 145.713 1.00 24.79  ? 305  VAL A CB    1 
ATOM   2000 C  CG1   . VAL A 1 305 ? 119.943 100.883 147.197 1.00 24.79  ? 305  VAL A CG1   1 
ATOM   2001 C  CG2   . VAL A 1 305 ? 118.981 100.657 144.898 1.00 24.79  ? 305  VAL A CG2   1 
ATOM   2002 N  N     . ALA A 1 306 ? 123.455 101.489 145.369 1.00 27.04  ? 306  ALA A N     1 
ATOM   2003 C  CA    . ALA A 1 306 ? 124.779 101.548 145.971 1.00 27.04  ? 306  ALA A CA    1 
ATOM   2004 C  C     . ALA A 1 306 ? 125.469 102.885 145.740 1.00 27.04  ? 306  ALA A C     1 
ATOM   2005 O  O     . ALA A 1 306 ? 126.373 103.245 146.499 1.00 27.04  ? 306  ALA A O     1 
ATOM   2006 C  CB    . ALA A 1 306 ? 125.646 100.415 145.427 1.00 27.04  ? 306  ALA A CB    1 
ATOM   2007 N  N     . LEU A 1 307 ? 125.076 103.627 144.708 1.00 25.80  ? 307  LEU A N     1 
ATOM   2008 C  CA    . LEU A 1 307 ? 125.680 104.919 144.410 1.00 25.80  ? 307  LEU A CA    1 
ATOM   2009 C  C     . LEU A 1 307 ? 124.874 106.104 144.922 1.00 25.80  ? 307  LEU A C     1 
ATOM   2010 O  O     . LEU A 1 307 ? 125.367 107.235 144.863 1.00 25.80  ? 307  LEU A O     1 
ATOM   2011 C  CB    . LEU A 1 307 ? 125.895 105.069 142.897 1.00 25.80  ? 307  LEU A CB    1 
ATOM   2012 C  CG    . LEU A 1 307 ? 127.231 104.632 142.291 1.00 25.80  ? 307  LEU A CG    1 
ATOM   2013 C  CD1   . LEU A 1 307 ? 127.465 103.136 142.344 1.00 25.80  ? 307  LEU A CD1   1 
ATOM   2014 C  CD2   . LEU A 1 307 ? 127.312 105.117 140.864 1.00 25.80  ? 307  LEU A CD2   1 
ATOM   2015 N  N     . ASN A 1 308 ? 123.662 105.881 145.424 1.00 25.91  ? 308  ASN A N     1 
ATOM   2016 C  CA    . ASN A 1 308 ? 122.784 106.956 145.873 1.00 25.91  ? 308  ASN A CA    1 
ATOM   2017 C  C     . ASN A 1 308 ? 122.398 106.684 147.319 1.00 25.91  ? 308  ASN A C     1 
ATOM   2018 O  O     . ASN A 1 308 ? 121.683 105.713 147.593 1.00 25.91  ? 308  ASN A O     1 
ATOM   2019 C  CB    . ASN A 1 308 ? 121.556 107.059 144.972 1.00 25.91  ? 308  ASN A CB    1 
ATOM   2020 C  CG    . ASN A 1 308 ? 121.900 107.555 143.580 1.00 25.91  ? 308  ASN A CG    1 
ATOM   2021 O  OD1   . ASN A 1 308 ? 122.678 108.494 143.420 1.00 25.91  ? 308  ASN A OD1   1 
ATOM   2022 N  ND2   . ASN A 1 308 ? 121.337 106.912 142.567 1.00 25.91  ? 308  ASN A ND2   1 
ATOM   2023 N  N     . ARG A 1 309 ? 122.939 107.518 148.231 1.00 32.44  ? 309  ARG A N     1 
ATOM   2024 C  CA    . ARG A 1 309 ? 122.814 107.530 149.697 1.00 32.44  ? 309  ARG A CA    1 
ATOM   2025 C  C     . ARG A 1 309 ? 123.627 106.395 150.333 1.00 32.44  ? 309  ARG A C     1 
ATOM   2026 O  O     . ARG A 1 309 ? 123.815 106.358 151.554 1.00 32.44  ? 309  ARG A O     1 
ATOM   2027 C  CB    . ARG A 1 309 ? 121.331 107.497 150.127 1.00 32.44  ? 309  ARG A CB    1 
ATOM   2028 C  CG    . ARG A 1 309 ? 120.994 107.750 151.601 1.00 32.44  ? 309  ARG A CG    1 
ATOM   2029 C  CD    . ARG A 1 309 ? 119.506 107.610 151.849 1.00 32.44  ? 309  ARG A CD    1 
ATOM   2030 N  NE    . ARG A 1 309 ? 119.166 107.734 153.261 1.00 32.44  ? 309  ARG A NE    1 
ATOM   2031 C  CZ    . ARG A 1 309 ? 119.130 106.710 154.107 1.00 32.44  ? 309  ARG A CZ    1 
ATOM   2032 N  NH1   . ARG A 1 309 ? 119.416 105.487 153.681 1.00 32.44  ? 309  ARG A NH1   1 
ATOM   2033 N  NH2   . ARG A 1 309 ? 118.808 106.907 155.378 1.00 32.44  ? 309  ARG A NH2   1 
ATOM   2034 N  N     . GLU A 1 310 ? 124.191 105.510 149.520 1.00 33.94  ? 310  GLU A N     1 
ATOM   2035 C  CA    . GLU A 1 310 ? 124.990 104.409 150.037 1.00 33.94  ? 310  GLU A CA    1 
ATOM   2036 C  C     . GLU A 1 310 ? 126.378 104.421 149.416 1.00 33.94  ? 310  GLU A C     1 
ATOM   2037 O  O     . GLU A 1 310 ? 126.840 105.457 148.938 1.00 33.94  ? 310  GLU A O     1 
ATOM   2038 C  CB    . GLU A 1 310 ? 124.298 103.072 149.771 1.00 33.94  ? 310  GLU A CB    1 
ATOM   2039 C  CG    . GLU A 1 310 ? 122.988 102.906 150.519 1.00 33.94  ? 310  GLU A CG    1 
ATOM   2040 C  CD    . GLU A 1 310 ? 122.339 101.566 150.268 1.00 33.94  ? 310  GLU A CD    1 
ATOM   2041 O  OE1   . GLU A 1 310 ? 122.845 100.808 149.417 1.00 33.94  ? 310  GLU A OE1   1 
ATOM   2042 O  OE2   . GLU A 1 310 ? 121.323 101.269 150.927 1.00 33.94  ? 310  GLU A OE2   1 
ATOM   2043 N  N     . LYS A 1 326 ? 127.601 84.026  147.359 1.00 47.51  ? 326  LYS A N     1 
ATOM   2044 C  CA    . LYS A 1 326 ? 128.329 85.282  147.543 1.00 47.51  ? 326  LYS A CA    1 
ATOM   2045 C  C     . LYS A 1 326 ? 127.648 86.549  146.952 1.00 47.51  ? 326  LYS A C     1 
ATOM   2046 O  O     . LYS A 1 326 ? 127.743 87.607  147.574 1.00 47.51  ? 326  LYS A O     1 
ATOM   2047 C  CB    . LYS A 1 326 ? 129.763 85.146  147.000 1.00 47.51  ? 326  LYS A CB    1 
ATOM   2048 C  CG    . LYS A 1 326 ? 130.593 84.070  147.683 1.00 47.51  ? 326  LYS A CG    1 
ATOM   2049 C  CD    . LYS A 1 326 ? 130.919 84.446  149.118 1.00 47.51  ? 326  LYS A CD    1 
ATOM   2050 C  CE    . LYS A 1 326 ? 131.738 83.364  149.798 1.00 47.51  ? 326  LYS A CE    1 
ATOM   2051 N  NZ    . LYS A 1 326 ? 133.101 83.255  149.216 1.00 47.51  ? 326  LYS A NZ    1 
ATOM   2052 N  N     . PRO A 1 327 ? 126.973 86.494  145.794 1.00 42.73  ? 327  PRO A N     1 
ATOM   2053 C  CA    . PRO A 1 327 ? 126.084 87.609  145.451 1.00 42.73  ? 327  PRO A CA    1 
ATOM   2054 C  C     . PRO A 1 327 ? 124.833 87.588  146.312 1.00 42.73  ? 327  PRO A C     1 
ATOM   2055 O  O     . PRO A 1 327 ? 124.494 86.585  146.942 1.00 42.73  ? 327  PRO A O     1 
ATOM   2056 C  CB    . PRO A 1 327 ? 125.744 87.369  143.976 1.00 42.73  ? 327  PRO A CB    1 
ATOM   2057 C  CG    . PRO A 1 327 ? 126.835 86.550  143.470 1.00 42.73  ? 327  PRO A CG    1 
ATOM   2058 C  CD    . PRO A 1 327 ? 127.183 85.646  144.600 1.00 42.73  ? 327  PRO A CD    1 
ATOM   2059 N  N     . LEU A 1 328 ? 124.138 88.726  146.329 1.00 36.71  ? 328  LEU A N     1 
ATOM   2060 C  CA    . LEU A 1 328 ? 122.927 88.840  147.133 1.00 36.71  ? 328  LEU A CA    1 
ATOM   2061 C  C     . LEU A 1 328 ? 121.769 88.062  146.527 1.00 36.71  ? 328  LEU A C     1 
ATOM   2062 O  O     . LEU A 1 328 ? 120.931 87.533  147.263 1.00 36.71  ? 328  LEU A O     1 
ATOM   2063 C  CB    . LEU A 1 328 ? 122.555 90.310  147.305 1.00 36.71  ? 328  LEU A CB    1 
ATOM   2064 C  CG    . LEU A 1 328 ? 121.323 90.674  148.131 1.00 36.71  ? 328  LEU A CG    1 
ATOM   2065 C  CD1   . LEU A 1 328 ? 121.453 90.158  149.547 1.00 36.71  ? 328  LEU A CD1   1 
ATOM   2066 C  CD2   . LEU A 1 328 ? 121.140 92.174  148.128 1.00 36.71  ? 328  LEU A CD2   1 
ATOM   2067 N  N     . ILE A 1 329 ? 121.708 87.971  145.198 1.00 33.08  ? 329  ILE A N     1 
ATOM   2068 C  CA    . ILE A 1 329 ? 120.631 87.224  144.554 1.00 33.08  ? 329  ILE A CA    1 
ATOM   2069 C  C     . ILE A 1 329 ? 120.822 85.730  144.759 1.00 33.08  ? 329  ILE A C     1 
ATOM   2070 O  O     . ILE A 1 329 ? 119.882 85.013  145.118 1.00 33.08  ? 329  ILE A O     1 
ATOM   2071 C  CB    . ILE A 1 329 ? 120.544 87.586  143.062 1.00 33.08  ? 329  ILE A CB    1 
ATOM   2072 C  CG1   . ILE A 1 329 ? 120.212 89.064  142.907 1.00 33.08  ? 329  ILE A CG1   1 
ATOM   2073 C  CG2   . ILE A 1 329 ? 119.509 86.739  142.356 1.00 33.08  ? 329  ILE A CG2   1 
ATOM   2074 C  CD1   . ILE A 1 329 ? 118.921 89.463  143.570 1.00 33.08  ? 329  ILE A CD1   1 
ATOM   2075 N  N     . GLU A 1 330 ? 122.047 85.241  144.571 1.00 36.10  ? 330  GLU A N     1 
ATOM   2076 C  CA    . GLU A 1 330 ? 122.304 83.819  144.751 1.00 36.10  ? 330  GLU A CA    1 
ATOM   2077 C  C     . GLU A 1 330 ? 122.293 83.411  146.216 1.00 36.10  ? 330  GLU A C     1 
ATOM   2078 O  O     . GLU A 1 330 ? 122.176 82.219  146.511 1.00 36.10  ? 330  GLU A O     1 
ATOM   2079 C  CB    . GLU A 1 330 ? 123.634 83.442  144.104 1.00 36.10  ? 330  GLU A CB    1 
ATOM   2080 C  CG    . GLU A 1 330 ? 123.648 83.660  142.602 1.00 36.10  ? 330  GLU A CG    1 
ATOM   2081 C  CD    . GLU A 1 330 ? 122.665 82.767  141.866 1.00 36.10  ? 330  GLU A CD    1 
ATOM   2082 O  OE1   . GLU A 1 330 ? 122.461 81.609  142.292 1.00 36.10  ? 330  GLU A OE1   1 
ATOM   2083 O  OE2   . GLU A 1 330 ? 122.083 83.232  140.865 1.00 36.10  ? 330  GLU A OE2   1 
ATOM   2084 N  N     . LYS A 1 331 ? 122.407 84.370  147.134 1.00 35.57  ? 331  LYS A N     1 
ATOM   2085 C  CA    . LYS A 1 331 ? 122.220 84.084  148.550 1.00 35.57  ? 331  LYS A CA    1 
ATOM   2086 C  C     . LYS A 1 331 ? 120.744 83.936  148.890 1.00 35.57  ? 331  LYS A C     1 
ATOM   2087 O  O     . LYS A 1 331 ? 120.347 82.968  149.542 1.00 35.57  ? 331  LYS A O     1 
ATOM   2088 C  CB    . LYS A 1 331 ? 122.850 85.189  149.390 1.00 35.57  ? 331  LYS A CB    1 
ATOM   2089 C  CG    . LYS A 1 331 ? 122.809 84.961  150.879 1.00 35.57  ? 331  LYS A CG    1 
ATOM   2090 C  CD    . LYS A 1 331 ? 123.432 86.139  151.593 1.00 35.57  ? 331  LYS A CD    1 
ATOM   2091 C  CE    . LYS A 1 331 ? 124.934 86.152  151.385 1.00 35.57  ? 331  LYS A CE    1 
ATOM   2092 N  NZ    . LYS A 1 331 ? 125.601 87.233  152.155 1.00 35.57  ? 331  LYS A NZ    1 
ATOM   2093 N  N     . LEU A 1 332 ? 119.918 84.887  148.446 1.00 32.16  ? 332  LEU A N     1 
ATOM   2094 C  CA    . LEU A 1 332 ? 118.497 84.861  148.777 1.00 32.16  ? 332  LEU A CA    1 
ATOM   2095 C  C     . LEU A 1 332 ? 117.746 83.785  148.009 1.00 32.16  ? 332  LEU A C     1 
ATOM   2096 O  O     . LEU A 1 332 ? 116.711 83.303  148.480 1.00 32.16  ? 332  LEU A O     1 
ATOM   2097 C  CB    . LEU A 1 332 ? 117.868 86.221  148.505 1.00 32.16  ? 332  LEU A CB    1 
ATOM   2098 C  CG    . LEU A 1 332 ? 118.262 87.372  149.418 1.00 32.16  ? 332  LEU A CG    1 
ATOM   2099 C  CD1   . LEU A 1 332 ? 117.679 88.657  148.886 1.00 32.16  ? 332  LEU A CD1   1 
ATOM   2100 C  CD2   . LEU A 1 332 ? 117.763 87.101  150.821 1.00 32.16  ? 332  LEU A CD2   1 
ATOM   2101 N  N     . ALA A 1 333 ? 118.231 83.403  146.830 1.00 31.31  ? 333  ALA A N     1 
ATOM   2102 C  CA    . ALA A 1 333 ? 117.597 82.311  146.109 1.00 31.31  ? 333  ALA A CA    1 
ATOM   2103 C  C     . ALA A 1 333 ? 117.967 80.960  146.697 1.00 31.31  ? 333  ALA A C     1 
ATOM   2104 O  O     . ALA A 1 333 ? 117.191 80.008  146.583 1.00 31.31  ? 333  ALA A O     1 
ATOM   2105 C  CB    . ALA A 1 333 ? 117.972 82.361  144.631 1.00 31.31  ? 333  ALA A CB    1 
ATOM   2106 N  N     . GLU A 1 334 ? 119.139 80.855  147.324 1.00 35.53  ? 334  GLU A N     1 
ATOM   2107 C  CA    . GLU A 1 334 ? 119.533 79.614  147.978 1.00 35.53  ? 334  GLU A CA    1 
ATOM   2108 C  C     . GLU A 1 334 ? 118.765 79.398  149.275 1.00 35.53  ? 334  GLU A C     1 
ATOM   2109 O  O     . GLU A 1 334 ? 118.509 78.250  149.656 1.00 35.53  ? 334  GLU A O     1 
ATOM   2110 C  CB    . GLU A 1 334 ? 121.040 79.625  148.241 1.00 35.53  ? 334  GLU A CB    1 
ATOM   2111 C  CG    . GLU A 1 334 ? 121.625 78.308  148.726 1.00 35.53  ? 334  GLU A CG    1 
ATOM   2112 C  CD    . GLU A 1 334 ? 123.127 78.378  148.922 1.00 35.53  ? 334  GLU A CD    1 
ATOM   2113 O  OE1   . GLU A 1 334 ? 123.703 79.469  148.725 1.00 35.53  ? 334  GLU A OE1   1 
ATOM   2114 O  OE2   . GLU A 1 334 ? 123.732 77.341  149.266 1.00 35.53  ? 334  GLU A OE2   1 
ATOM   2115 N  N     . ILE A 1 335 ? 118.388 80.484  149.954 1.00 30.83  ? 335  ILE A N     1 
ATOM   2116 C  CA    . ILE A 1 335 ? 117.581 80.380  151.165 1.00 30.83  ? 335  ILE A CA    1 
ATOM   2117 C  C     . ILE A 1 335 ? 116.183 79.872  150.834 1.00 30.83  ? 335  ILE A C     1 
ATOM   2118 O  O     . ILE A 1 335 ? 115.610 79.066  151.576 1.00 30.83  ? 335  ILE A O     1 
ATOM   2119 C  CB    . ILE A 1 335 ? 117.545 81.739  151.890 1.00 30.83  ? 335  ILE A CB    1 
ATOM   2120 C  CG1   . ILE A 1 335 ? 118.941 82.124  152.357 1.00 30.83  ? 335  ILE A CG1   1 
ATOM   2121 C  CG2   . ILE A 1 335 ? 116.638 81.710  153.100 1.00 30.83  ? 335  ILE A CG2   1 
ATOM   2122 C  CD1   . ILE A 1 335 ? 119.041 83.541  152.842 1.00 30.83  ? 335  ILE A CD1   1 
ATOM   2123 N  N     . TYR A 1 336 ? 115.629 80.296  149.694 1.00 27.42  ? 336  TYR A N     1 
ATOM   2124 C  CA    . TYR A 1 336 ? 114.250 79.937  149.382 1.00 27.42  ? 336  TYR A CA    1 
ATOM   2125 C  C     . TYR A 1 336 ? 114.121 78.478  148.975 1.00 27.42  ? 336  TYR A C     1 
ATOM   2126 O  O     . TYR A 1 336 ? 113.140 77.824  149.339 1.00 27.42  ? 336  TYR A O     1 
ATOM   2127 C  CB    . TYR A 1 336 ? 113.674 80.855  148.303 1.00 27.42  ? 336  TYR A CB    1 
ATOM   2128 C  CG    . TYR A 1 336 ? 112.267 80.456  147.937 1.00 27.42  ? 336  TYR A CG    1 
ATOM   2129 C  CD1   . TYR A 1 336 ? 111.230 80.606  148.843 1.00 27.42  ? 336  TYR A CD1   1 
ATOM   2130 C  CD2   . TYR A 1 336 ? 111.980 79.910  146.698 1.00 27.42  ? 336  TYR A CD2   1 
ATOM   2131 C  CE1   . TYR A 1 336 ? 109.949 80.221  148.525 1.00 27.42  ? 336  TYR A CE1   1 
ATOM   2132 C  CE2   . TYR A 1 336 ? 110.703 79.526  146.372 1.00 27.42  ? 336  TYR A CE2   1 
ATOM   2133 C  CZ    . TYR A 1 336 ? 109.696 79.684  147.286 1.00 27.42  ? 336  TYR A CZ    1 
ATOM   2134 O  OH    . TYR A 1 336 ? 108.427 79.295  146.954 1.00 27.42  ? 336  TYR A OH    1 
ATOM   2135 N  N     . VAL A 1 337 ? 115.098 77.947  148.237 1.00 31.89  ? 337  VAL A N     1 
ATOM   2136 C  CA    . VAL A 1 337 ? 115.050 76.548  147.819 1.00 31.89  ? 337  VAL A CA    1 
ATOM   2137 C  C     . VAL A 1 337 ? 115.188 75.624  149.026 1.00 31.89  ? 337  VAL A C     1 
ATOM   2138 O  O     . VAL A 1 337 ? 114.505 74.598  149.126 1.00 31.89  ? 337  VAL A O     1 
ATOM   2139 C  CB    . VAL A 1 337 ? 116.135 76.287  146.756 1.00 31.89  ? 337  VAL A CB    1 
ATOM   2140 C  CG1   . VAL A 1 337 ? 116.198 74.826  146.377 1.00 31.89  ? 337  VAL A CG1   1 
ATOM   2141 C  CG2   . VAL A 1 337 ? 115.864 77.118  145.527 1.00 31.89  ? 337  VAL A CG2   1 
ATOM   2142 N  N     . ASN A 1 338 ? 116.015 76.008  149.991 1.00 33.84  ? 338  ASN A N     1 
ATOM   2143 C  CA    . ASN A 1 338 ? 116.179 75.247  151.220 1.00 33.84  ? 338  ASN A CA    1 
ATOM   2144 C  C     . ASN A 1 338 ? 115.054 75.474  152.221 1.00 33.84  ? 338  ASN A C     1 
ATOM   2145 O  O     . ASN A 1 338 ? 115.056 74.838  153.279 1.00 33.84  ? 338  ASN A O     1 
ATOM   2146 C  CB    . ASN A 1 338 ? 117.514 75.604  151.871 1.00 33.84  ? 338  ASN A CB    1 
ATOM   2147 C  CG    . ASN A 1 338 ? 118.696 75.174  151.038 1.00 33.84  ? 338  ASN A CG    1 
ATOM   2148 O  OD1   . ASN A 1 338 ? 118.707 74.081  150.474 1.00 33.84  ? 338  ASN A OD1   1 
ATOM   2149 N  ND2   . ASN A 1 338 ? 119.698 76.035  150.948 1.00 33.84  ? 338  ASN A ND2   1 
ATOM   2150 N  N     . SER A 1 339 ? 114.099 76.351  151.921 1.00 34.35  ? 339  SER A N     1 
ATOM   2151 C  CA    . SER A 1 339 ? 113.070 76.733  152.874 1.00 34.35  ? 339  SER A CA    1 
ATOM   2152 C  C     . SER A 1 339 ? 111.934 75.716  152.893 1.00 34.35  ? 339  SER A C     1 
ATOM   2153 O  O     . SER A 1 339 ? 111.962 74.692  152.209 1.00 34.35  ? 339  SER A O     1 
ATOM   2154 C  CB    . SER A 1 339 ? 112.531 78.119  152.545 1.00 34.35  ? 339  SER A CB    1 
ATOM   2155 O  OG    . SER A 1 339 ? 111.470 78.459  153.415 1.00 34.35  ? 339  SER A OG    1 
ATOM   2156 N  N     . SER A 1 340 ? 110.914 76.011  153.696 1.00 36.00  ? 340  SER A N     1 
ATOM   2157 C  CA    . SER A 1 340 ? 109.725 75.178  153.764 1.00 36.00  ? 340  SER A CA    1 
ATOM   2158 C  C     . SER A 1 340 ? 108.642 75.608  152.791 1.00 36.00  ? 340  SER A C     1 
ATOM   2159 O  O     . SER A 1 340 ? 107.786 74.790  152.443 1.00 36.00  ? 340  SER A O     1 
ATOM   2160 C  CB    . SER A 1 340 ? 109.144 75.186  155.178 1.00 36.00  ? 340  SER A CB    1 
ATOM   2161 O  OG    . SER A 1 340 ? 107.953 74.422  155.230 1.00 36.00  ? 340  SER A OG    1 
ATOM   2162 N  N     . PHE A 1 341 ? 108.653 76.869  152.354 1.00 33.58  ? 341  PHE A N     1 
ATOM   2163 C  CA    . PHE A 1 341 ? 107.690 77.326  151.362 1.00 33.58  ? 341  PHE A CA    1 
ATOM   2164 C  C     . PHE A 1 341 ? 107.944 76.718  149.993 1.00 33.58  ? 341  PHE A C     1 
ATOM   2165 O  O     . PHE A 1 341 ? 107.013 76.623  149.189 1.00 33.58  ? 341  PHE A O     1 
ATOM   2166 C  CB    . PHE A 1 341 ? 107.718 78.849  151.265 1.00 33.58  ? 341  PHE A CB    1 
ATOM   2167 C  CG    . PHE A 1 341 ? 107.177 79.546  152.477 1.00 33.58  ? 341  PHE A CG    1 
ATOM   2168 C  CD1   . PHE A 1 341 ? 105.817 79.724  152.637 1.00 33.58  ? 341  PHE A CD1   1 
ATOM   2169 C  CD2   . PHE A 1 341 ? 108.029 80.027  153.454 1.00 33.58  ? 341  PHE A CD2   1 
ATOM   2170 C  CE1   . PHE A 1 341 ? 105.318 80.368  153.747 1.00 33.58  ? 341  PHE A CE1   1 
ATOM   2171 C  CE2   . PHE A 1 341 ? 107.533 80.670  154.566 1.00 33.58  ? 341  PHE A CE2   1 
ATOM   2172 C  CZ    . PHE A 1 341 ? 106.177 80.839  154.711 1.00 33.58  ? 341  PHE A CZ    1 
ATOM   2173 N  N     . TYR A 1 342 ? 109.180 76.314  149.711 1.00 33.33  ? 342  TYR A N     1 
ATOM   2174 C  CA    . TYR A 1 342 ? 109.489 75.621  148.468 1.00 33.33  ? 342  TYR A CA    1 
ATOM   2175 C  C     . TYR A 1 342 ? 109.122 74.150  148.553 1.00 33.33  ? 342  TYR A C     1 
ATOM   2176 O  O     . TYR A 1 342 ? 108.690 73.559  147.560 1.00 33.33  ? 342  TYR A O     1 
ATOM   2177 C  CB    . TYR A 1 342 ? 110.969 75.780  148.152 1.00 33.33  ? 342  TYR A CB    1 
ATOM   2178 C  CG    . TYR A 1 342 ? 111.444 75.153  146.873 1.00 33.33  ? 342  TYR A CG    1 
ATOM   2179 C  CD1   . TYR A 1 342 ? 111.219 75.766  145.651 1.00 33.33  ? 342  TYR A CD1   1 
ATOM   2180 C  CD2   . TYR A 1 342 ? 112.147 73.957  146.889 1.00 33.33  ? 342  TYR A CD2   1 
ATOM   2181 C  CE1   . TYR A 1 342 ? 111.668 75.198  144.478 1.00 33.33  ? 342  TYR A CE1   1 
ATOM   2182 C  CE2   . TYR A 1 342 ? 112.598 73.380  145.723 1.00 33.33  ? 342  TYR A CE2   1 
ATOM   2183 C  CZ    . TYR A 1 342 ? 112.357 74.005  144.521 1.00 33.33  ? 342  TYR A CZ    1 
ATOM   2184 O  OH    . TYR A 1 342 ? 112.808 73.428  143.359 1.00 33.33  ? 342  TYR A OH    1 
ATOM   2185 N  N     . LYS A 1 343 ? 109.293 73.544  149.730 1.00 36.80  ? 343  LYS A N     1 
ATOM   2186 C  CA    . LYS A 1 343 ? 108.942 72.141  149.903 1.00 36.80  ? 343  LYS A CA    1 
ATOM   2187 C  C     . LYS A 1 343 ? 107.435 71.933  149.885 1.00 36.80  ? 343  LYS A C     1 
ATOM   2188 O  O     . LYS A 1 343 ? 106.966 70.880  149.442 1.00 36.80  ? 343  LYS A O     1 
ATOM   2189 C  CB    . LYS A 1 343 ? 109.526 71.611  151.208 1.00 36.80  ? 343  LYS A CB    1 
ATOM   2190 C  CG    . LYS A 1 343 ? 111.040 71.590  151.266 1.00 36.80  ? 343  LYS A CG    1 
ATOM   2191 C  CD    . LYS A 1 343 ? 111.505 71.030  152.602 1.00 36.80  ? 343  LYS A CD    1 
ATOM   2192 C  CE    . LYS A 1 343 ? 113.016 70.910  152.672 1.00 36.80  ? 343  LYS A CE    1 
ATOM   2193 N  NZ    . LYS A 1 343 ? 113.688 72.236  152.692 1.00 36.80  ? 343  LYS A NZ    1 
ATOM   2194 N  N     . GLU A 1 344 ? 106.665 72.913  150.368 1.00 38.53  ? 344  GLU A N     1 
ATOM   2195 C  CA    . GLU A 1 344 ? 105.212 72.838  150.265 1.00 38.53  ? 344  GLU A CA    1 
ATOM   2196 C  C     . GLU A 1 344 ? 104.745 72.972  148.826 1.00 38.53  ? 344  GLU A C     1 
ATOM   2197 O  O     . GLU A 1 344 ? 103.742 72.362  148.443 1.00 38.53  ? 344  GLU A O     1 
ATOM   2198 C  CB    . GLU A 1 344 ? 104.555 73.926  151.113 1.00 38.53  ? 344  GLU A CB    1 
ATOM   2199 C  CG    . GLU A 1 344 ? 104.662 73.731  152.611 1.00 38.53  ? 344  GLU A CG    1 
ATOM   2200 C  CD    . GLU A 1 344 ? 104.025 74.870  153.390 1.00 38.53  ? 344  GLU A CD    1 
ATOM   2201 O  OE1   . GLU A 1 344 ? 103.634 75.876  152.764 1.00 38.53  ? 344  GLU A OE1   1 
ATOM   2202 O  OE2   . GLU A 1 344 ? 103.909 74.755  154.627 1.00 38.53  ? 344  GLU A OE2   1 
ATOM   2203 N  N     . THR A 1 345 ? 105.448 73.766  148.021 1.00 35.62  ? 345  THR A N     1 
ATOM   2204 C  CA    . THR A 1 345 ? 105.034 73.983  146.641 1.00 35.62  ? 345  THR A CA    1 
ATOM   2205 C  C     . THR A 1 345 ? 105.363 72.776  145.772 1.00 35.62  ? 345  THR A C     1 
ATOM   2206 O  O     . THR A 1 345 ? 104.507 72.299  145.020 1.00 35.62  ? 345  THR A O     1 
ATOM   2207 C  CB    . THR A 1 345 ? 105.691 75.251  146.090 1.00 35.62  ? 345  THR A CB    1 
ATOM   2208 O  OG1   . THR A 1 345 ? 105.303 76.372  146.891 1.00 35.62  ? 345  THR A OG1   1 
ATOM   2209 C  CG2   . THR A 1 345 ? 105.254 75.510  144.668 1.00 35.62  ? 345  THR A CG2   1 
ATOM   2210 N  N     . LYS A 1 346 ? 106.587 72.250  145.885 1.00 35.85  ? 346  LYS A N     1 
ATOM   2211 C  CA    . LYS A 1 346 ? 107.006 71.122  145.056 1.00 35.85  ? 346  LYS A CA    1 
ATOM   2212 C  C     . LYS A 1 346 ? 106.265 69.839  145.407 1.00 35.85  ? 346  LYS A C     1 
ATOM   2213 O  O     . LYS A 1 346 ? 106.109 68.966  144.548 1.00 35.85  ? 346  LYS A O     1 
ATOM   2214 C  CB    . LYS A 1 346 ? 108.509 70.903  145.193 1.00 35.85  ? 346  LYS A CB    1 
ATOM   2215 C  CG    . LYS A 1 346 ? 109.344 72.050  144.680 1.00 35.85  ? 346  LYS A CG    1 
ATOM   2216 C  CD    . LYS A 1 346 ? 109.287 72.173  143.172 1.00 35.85  ? 346  LYS A CD    1 
ATOM   2217 C  CE    . LYS A 1 346 ? 110.106 71.076  142.515 1.00 35.85  ? 346  LYS A CE    1 
ATOM   2218 N  NZ    . LYS A 1 346 ? 110.209 71.241  141.042 1.00 35.85  ? 346  LYS A NZ    1 
ATOM   2219 N  N     . ALA A 1 347 ? 105.803 69.701  146.647 1.00 38.34  ? 347  ALA A N     1 
ATOM   2220 C  CA    . ALA A 1 347 ? 105.015 68.535  147.017 1.00 38.34  ? 347  ALA A CA    1 
ATOM   2221 C  C     . ALA A 1 347 ? 103.583 68.608  146.514 1.00 38.34  ? 347  ALA A C     1 
ATOM   2222 O  O     . ALA A 1 347 ? 102.889 67.587  146.527 1.00 38.34  ? 347  ALA A O     1 
ATOM   2223 C  CB    . ALA A 1 347 ? 105.012 68.353  148.533 1.00 38.34  ? 347  ALA A CB    1 
ATOM   2224 N  N     . GLU A 1 348 ? 103.121 69.779  146.081 1.00 40.61  ? 348  GLU A N     1 
ATOM   2225 C  CA    . GLU A 1 348 ? 101.804 69.918  145.475 1.00 40.61  ? 348  GLU A CA    1 
ATOM   2226 C  C     . GLU A 1 348 ? 101.870 70.016  143.957 1.00 40.61  ? 348  GLU A C     1 
ATOM   2227 O  O     . GLU A 1 348 ? 100.924 69.609  143.277 1.00 40.61  ? 348  GLU A O     1 
ATOM   2228 C  CB    . GLU A 1 348 ? 101.091 71.145  146.061 1.00 40.61  ? 348  GLU A CB    1 
ATOM   2229 C  CG    . GLU A 1 348 ? 99.641  71.352  145.627 1.00 40.61  ? 348  GLU A CG    1 
ATOM   2230 C  CD    . GLU A 1 348 ? 98.699  70.266  146.111 1.00 40.61  ? 348  GLU A CD    1 
ATOM   2231 O  OE1   . GLU A 1 348 ? 98.959  69.674  147.180 1.00 40.61  ? 348  GLU A OE1   1 
ATOM   2232 O  OE2   . GLU A 1 348 ? 97.695  70.002  145.415 1.00 40.61  ? 348  GLU A OE2   1 
ATOM   2233 N  N     . LEU A 1 349 ? 102.986 70.511  143.413 1.00 34.66  ? 349  LEU A N     1 
ATOM   2234 C  CA    . LEU A 1 349 ? 103.188 70.505  141.968 1.00 34.66  ? 349  LEU A CA    1 
ATOM   2235 C  C     . LEU A 1 349 ? 103.288 69.088  141.422 1.00 34.66  ? 349  LEU A C     1 
ATOM   2236 O  O     . LEU A 1 349 ? 102.825 68.811  140.310 1.00 34.66  ? 349  LEU A O     1 
ATOM   2237 C  CB    . LEU A 1 349 ? 104.446 71.290  141.611 1.00 34.66  ? 349  LEU A CB    1 
ATOM   2238 C  CG    . LEU A 1 349 ? 104.387 72.804  141.734 1.00 34.66  ? 349  LEU A CG    1 
ATOM   2239 C  CD1   . LEU A 1 349 ? 105.762 73.388  141.557 1.00 34.66  ? 349  LEU A CD1   1 
ATOM   2240 C  CD2   . LEU A 1 349 ? 103.461 73.320  140.673 1.00 34.66  ? 349  LEU A CD2   1 
ATOM   2241 N  N     . HIS A 1 350 ? 103.890 68.177  142.181 1.00 40.30  ? 350  HIS A N     1 
ATOM   2242 C  CA    . HIS A 1 350 ? 103.934 66.786  141.761 1.00 40.30  ? 350  HIS A CA    1 
ATOM   2243 C  C     . HIS A 1 350 ? 102.611 66.072  141.985 1.00 40.30  ? 350  HIS A C     1 
ATOM   2244 O  O     . HIS A 1 350 ? 102.348 65.061  141.328 1.00 40.30  ? 350  HIS A O     1 
ATOM   2245 C  CB    . HIS A 1 350 ? 105.059 66.055  142.487 1.00 40.30  ? 350  HIS A CB    1 
ATOM   2246 C  CG    . HIS A 1 350 ? 106.421 66.537  142.108 1.00 40.30  ? 350  HIS A CG    1 
ATOM   2247 N  ND1   . HIS A 1 350 ? 107.045 67.584  142.749 1.00 40.30  ? 350  HIS A ND1   1 
ATOM   2248 C  CD2   . HIS A 1 350 ? 107.272 66.129  141.138 1.00 40.30  ? 350  HIS A CD2   1 
ATOM   2249 C  CE1   . HIS A 1 350 ? 108.226 67.794  142.197 1.00 40.30  ? 350  HIS A CE1   1 
ATOM   2250 N  NE2   . HIS A 1 350 ? 108.388 66.925  141.217 1.00 40.30  ? 350  HIS A NE2   1 
ATOM   2251 N  N     . GLN A 1 351 ? 101.775 66.575  142.891 1.00 44.56  ? 351  GLN A N     1 
ATOM   2252 C  CA    . GLN A 1 351 ? 100.441 66.017  143.062 1.00 44.56  ? 351  GLN A CA    1 
ATOM   2253 C  C     . GLN A 1 351 ? 99.492  66.481  141.962 1.00 44.56  ? 351  GLN A C     1 
ATOM   2254 O  O     . GLN A 1 351 ? 98.626  65.710  141.531 1.00 44.56  ? 351  GLN A O     1 
ATOM   2255 C  CB    . GLN A 1 351 ? 99.899  66.390  144.443 1.00 44.56  ? 351  GLN A CB    1 
ATOM   2256 C  CG    . GLN A 1 351 ? 98.566  65.756  144.795 1.00 44.56  ? 351  GLN A CG    1 
ATOM   2257 C  CD    . GLN A 1 351 ? 98.126  66.070  146.210 1.00 44.56  ? 351  GLN A CD    1 
ATOM   2258 O  OE1   . GLN A 1 351 ? 98.811  66.783  146.942 1.00 44.56  ? 351  GLN A OE1   1 
ATOM   2259 N  NE2   . GLN A 1 351 ? 96.976  65.536  146.604 1.00 44.56  ? 351  GLN A NE2   1 
ATOM   2260 N  N     . LEU A 1 352 ? 99.646  67.719  141.483 1.00 40.21  ? 352  LEU A N     1 
ATOM   2261 C  CA    . LEU A 1 352 ? 98.821  68.193  140.375 1.00 40.21  ? 352  LEU A CA    1 
ATOM   2262 C  C     . LEU A 1 352 ? 99.230  67.542  139.061 1.00 40.21  ? 352  LEU A C     1 
ATOM   2263 O  O     . LEU A 1 352 ? 98.372  67.092  138.292 1.00 40.21  ? 352  LEU A O     1 
ATOM   2264 C  CB    . LEU A 1 352 ? 98.904  69.715  140.262 1.00 40.21  ? 352  LEU A CB    1 
ATOM   2265 C  CG    . LEU A 1 352 ? 98.268  70.525  141.390 1.00 40.21  ? 352  LEU A CG    1 
ATOM   2266 C  CD1   . LEU A 1 352 ? 98.542  72.000  141.210 1.00 40.21  ? 352  LEU A CD1   1 
ATOM   2267 C  CD2   . LEU A 1 352 ? 96.775  70.270  141.454 1.00 40.21  ? 352  LEU A CD2   1 
ATOM   2268 N  N     . SER A 1 353 ? 100.527 67.480  138.784 1.00 42.62  ? 353  SER A N     1 
ATOM   2269 C  CA    . SER A 1 353 ? 101.013 66.852  137.562 1.00 42.62  ? 353  SER A CA    1 
ATOM   2270 C  C     . SER A 1 353 ? 100.899 65.334  137.638 1.00 42.62  ? 353  SER A C     1 
ATOM   2271 O  O     . SER A 1 353 ? 101.710 64.612  137.060 1.00 42.62  ? 353  SER A O     1 
ATOM   2272 C  CB    . SER A 1 353 ? 102.462 67.252  137.291 1.00 42.62  ? 353  SER A CB    1 
ATOM   2273 O  OG    . SER A 1 353 ? 102.955 66.600  136.135 1.00 42.62  ? 353  SER A OG    1 
ATOM   2274 N  N     . ILE A 1 367 ? 89.445  76.168  118.022 1.00 22.26  ? 367  ILE A N     1 
ATOM   2275 C  CA    . ILE A 1 367 ? 89.728  77.166  119.045 1.00 22.26  ? 367  ILE A CA    1 
ATOM   2276 C  C     . ILE A 1 367 ? 88.419  77.474  119.768 1.00 22.26  ? 367  ILE A C     1 
ATOM   2277 O  O     . ILE A 1 367 ? 88.417  77.696  120.987 1.00 22.26  ? 367  ILE A O     1 
ATOM   2278 C  CB    . ILE A 1 367 ? 90.385  78.445  118.446 1.00 22.26  ? 367  ILE A CB    1 
ATOM   2279 C  CG1   . ILE A 1 367 ? 91.724  78.122  117.785 1.00 22.26  ? 367  ILE A CG1   1 
ATOM   2280 C  CG2   . ILE A 1 367 ? 90.633  79.502  119.507 1.00 22.26  ? 367  ILE A CG2   1 
ATOM   2281 C  CD1   . ILE A 1 367 ? 91.662  77.933  116.280 1.00 22.26  ? 367  ILE A CD1   1 
ATOM   2282 N  N     . SER A 1 368 ? 87.316  77.439  119.010 1.00 19.36  ? 368  SER A N     1 
ATOM   2283 C  CA    . SER A 1 368 ? 85.956  77.694  119.499 1.00 19.36  ? 368  SER A CA    1 
ATOM   2284 C  C     . SER A 1 368 ? 85.858  79.085  120.134 1.00 19.36  ? 368  SER A C     1 
ATOM   2285 O  O     . SER A 1 368 ? 85.797  79.247  121.354 1.00 19.36  ? 368  SER A O     1 
ATOM   2286 C  CB    . SER A 1 368 ? 85.481  76.597  120.464 1.00 19.36  ? 368  SER A CB    1 
ATOM   2287 O  OG    . SER A 1 368 ? 84.181  76.877  120.947 1.00 19.36  ? 368  SER A OG    1 
ATOM   2288 N  N     . TYR A 1 369 ? 85.923  80.087  119.257 1.00 14.48  ? 369  TYR A N     1 
ATOM   2289 C  CA    . TYR A 1 369 ? 85.796  81.487  119.641 1.00 14.48  ? 369  TYR A CA    1 
ATOM   2290 C  C     . TYR A 1 369 ? 84.441  81.769  120.278 1.00 14.48  ? 369  TYR A C     1 
ATOM   2291 O  O     . TYR A 1 369 ? 83.477  81.015  120.121 1.00 14.48  ? 369  TYR A O     1 
ATOM   2292 C  CB    . TYR A 1 369 ? 85.982  82.388  118.424 1.00 14.48  ? 369  TYR A CB    1 
ATOM   2293 C  CG    . TYR A 1 369 ? 87.387  82.408  117.903 1.00 14.48  ? 369  TYR A CG    1 
ATOM   2294 C  CD1   . TYR A 1 369 ? 88.317  83.316  118.384 1.00 14.48  ? 369  TYR A CD1   1 
ATOM   2295 C  CD2   . TYR A 1 369 ? 87.798  81.488  116.952 1.00 14.48  ? 369  TYR A CD2   1 
ATOM   2296 C  CE1   . TYR A 1 369 ? 89.606  83.324  117.913 1.00 14.48  ? 369  TYR A CE1   1 
ATOM   2297 C  CE2   . TYR A 1 369 ? 89.082  81.482  116.485 1.00 14.48  ? 369  TYR A CE2   1 
ATOM   2298 C  CZ    . TYR A 1 369 ? 89.982  82.403  116.961 1.00 14.48  ? 369  TYR A CZ    1 
ATOM   2299 O  OH    . TYR A 1 369 ? 91.268  82.389  116.476 1.00 14.48  ? 369  TYR A OH    1 
ATOM   2300 N  N     . THR A 1 370 ? 84.385  82.883  121.010 1.00 13.95  ? 370  THR A N     1 
ATOM   2301 C  CA    . THR A 1 370 ? 83.195  83.219  121.783 1.00 13.95  ? 370  THR A CA    1 
ATOM   2302 C  C     . THR A 1 370 ? 82.032  83.572  120.874 1.00 13.95  ? 370  THR A C     1 
ATOM   2303 O  O     . THR A 1 370 ? 80.907  83.105  121.084 1.00 13.95  ? 370  THR A O     1 
ATOM   2304 C  CB    . THR A 1 370 ? 83.497  84.378  122.726 1.00 13.95  ? 370  THR A CB    1 
ATOM   2305 O  OG1   . THR A 1 370 ? 84.573  84.017  123.594 1.00 13.95  ? 370  THR A OG1   1 
ATOM   2306 C  CG2   . THR A 1 370 ? 82.295  84.702  123.564 1.00 13.95  ? 370  THR A CG2   1 
ATOM   2307 N  N     . THR A 1 371 ? 82.295  84.350  119.835 1.00 12.66  ? 371  THR A N     1 
ATOM   2308 C  CA    . THR A 1 371 ? 81.252  84.832  118.953 1.00 12.66  ? 371  THR A CA    1 
ATOM   2309 C  C     . THR A 1 371 ? 81.539  84.356  117.532 1.00 12.66  ? 371  THR A C     1 
ATOM   2310 O  O     . THR A 1 371 ? 82.694  84.166  117.152 1.00 12.66  ? 371  THR A O     1 
ATOM   2311 C  CB    . THR A 1 371 ? 81.166  86.346  119.018 1.00 12.66  ? 371  THR A CB    1 
ATOM   2312 O  OG1   . THR A 1 371 ? 81.381  86.768  120.366 1.00 12.66  ? 371  THR A OG1   1 
ATOM   2313 C  CG2   . THR A 1 371 ? 79.781  86.737  118.713 1.00 12.66  ? 371  THR A CG2   1 
ATOM   2314 N  N     . SER A 1 372 ? 80.476  84.164  116.750 1.00 11.50  ? 372  SER A N     1 
ATOM   2315 C  CA    . SER A 1 372 ? 80.557  83.507  115.456 1.00 11.50  ? 372  SER A CA    1 
ATOM   2316 C  C     . SER A 1 372 ? 81.257  84.386  114.421 1.00 11.50  ? 372  SER A C     1 
ATOM   2317 O  O     . SER A 1 372 ? 81.602  85.541  114.668 1.00 11.50  ? 372  SER A O     1 
ATOM   2318 C  CB    . SER A 1 372 ? 79.164  83.136  114.960 1.00 11.50  ? 372  SER A CB    1 
ATOM   2319 O  OG    . SER A 1 372 ? 78.411  84.298  114.680 1.00 11.50  ? 372  SER A OG    1 
ATOM   2320 N  N     . PHE A 1 373 ? 81.459  83.803  113.234 1.00 10.58  ? 373  PHE A N     1 
ATOM   2321 C  CA    . PHE A 1 373 ? 82.186  84.472  112.159 1.00 10.58  ? 373  PHE A CA    1 
ATOM   2322 C  C     . PHE A 1 373 ? 81.439  85.693  111.646 1.00 10.58  ? 373  PHE A C     1 
ATOM   2323 O  O     . PHE A 1 373 ? 82.035  86.757  111.456 1.00 10.58  ? 373  PHE A O     1 
ATOM   2324 C  CB    . PHE A 1 373 ? 82.439  83.493  111.016 1.00 10.58  ? 373  PHE A CB    1 
ATOM   2325 C  CG    . PHE A 1 373 ? 83.062  84.123  109.810 1.00 10.58  ? 373  PHE A CG    1 
ATOM   2326 C  CD1   . PHE A 1 373 ? 84.397  84.457  109.804 1.00 10.58  ? 373  PHE A CD1   1 
ATOM   2327 C  CD2   . PHE A 1 373 ? 82.309  84.385  108.681 1.00 10.58  ? 373  PHE A CD2   1 
ATOM   2328 C  CE1   . PHE A 1 373 ? 84.965  85.037  108.696 1.00 10.58  ? 373  PHE A CE1   1 
ATOM   2329 C  CE2   . PHE A 1 373 ? 82.877  84.974  107.582 1.00 10.58  ? 373  PHE A CE2   1 
ATOM   2330 C  CZ    . PHE A 1 373 ? 84.204  85.298  107.591 1.00 10.58  ? 373  PHE A CZ    1 
ATOM   2331 N  N     . CYS A 1 374 ? 80.135  85.557  111.398 1.00 11.65  ? 374  CYS A N     1 
ATOM   2332 C  CA    . CYS A 1 374 ? 79.371  86.652  110.812 1.00 11.65  ? 374  CYS A CA    1 
ATOM   2333 C  C     . CYS A 1 374 ? 79.177  87.809  111.774 1.00 11.65  ? 374  CYS A C     1 
ATOM   2334 O  O     . CYS A 1 374 ? 78.920  88.926  111.329 1.00 11.65  ? 374  CYS A O     1 
ATOM   2335 C  CB    . CYS A 1 374 ? 78.010  86.153  110.334 1.00 11.65  ? 374  CYS A CB    1 
ATOM   2336 S  SG    . CYS A 1 374 ? 78.081  84.972  108.970 1.00 11.65  ? 374  CYS A SG    1 
ATOM   2337 N  N     . HIS A 1 375 ? 79.287  87.569  113.076 1.00 10.54  ? 375  HIS A N     1 
ATOM   2338 C  CA    . HIS A 1 375 ? 79.242  88.667  114.032 1.00 10.54  ? 375  HIS A CA    1 
ATOM   2339 C  C     . HIS A 1 375 ? 80.562  89.412  114.065 1.00 10.54  ? 375  HIS A C     1 
ATOM   2340 O  O     . HIS A 1 375 ? 80.582  90.638  114.161 1.00 10.54  ? 375  HIS A O     1 
ATOM   2341 C  CB    . HIS A 1 375 ? 78.918  88.141  115.420 1.00 10.54  ? 375  HIS A CB    1 
ATOM   2342 C  CG    . HIS A 1 375 ? 78.660  89.212  116.430 1.00 10.54  ? 375  HIS A CG    1 
ATOM   2343 N  ND1   . HIS A 1 375 ? 77.421  89.792  116.596 1.00 10.54  ? 375  HIS A ND1   1 
ATOM   2344 C  CD2   . HIS A 1 375 ? 79.490  89.844  117.293 1.00 10.54  ? 375  HIS A CD2   1 
ATOM   2345 C  CE1   . HIS A 1 375 ? 77.489  90.706  117.546 1.00 10.54  ? 375  HIS A CE1   1 
ATOM   2346 N  NE2   . HIS A 1 375 ? 78.732  90.750  117.992 1.00 10.54  ? 375  HIS A NE2   1 
ATOM   2347 N  N     . GLN A 1 376 ? 81.674  88.688  113.995 1.00 9.10   ? 376  GLN A N     1 
ATOM   2348 C  CA    . GLN A 1 376 ? 82.978  89.334  114.033 1.00 9.10   ? 376  GLN A CA    1 
ATOM   2349 C  C     . GLN A 1 376 ? 83.278  90.061  112.737 1.00 9.10   ? 376  GLN A C     1 
ATOM   2350 O  O     . GLN A 1 376 ? 84.049  91.021  112.730 1.00 9.10   ? 376  GLN A O     1 
ATOM   2351 C  CB    . GLN A 1 376 ? 84.050  88.296  114.315 1.00 9.10   ? 376  GLN A CB    1 
ATOM   2352 C  CG    . GLN A 1 376 ? 83.896  87.653  115.658 1.00 9.10   ? 376  GLN A CG    1 
ATOM   2353 C  CD    . GLN A 1 376 ? 84.856  86.539  115.838 1.00 9.10   ? 376  GLN A CD    1 
ATOM   2354 O  OE1   . GLN A 1 376 ? 85.604  86.231  114.933 1.00 9.10   ? 376  GLN A OE1   1 
ATOM   2355 N  NE2   . GLN A 1 376 ? 84.834  85.911  116.997 1.00 9.10   ? 376  GLN A NE2   1 
ATOM   2356 N  N     . LEU A 1 377 ? 82.681  89.615  111.638 1.00 8.90   ? 377  LEU A N     1 
ATOM   2357 C  CA    . LEU A 1 377 ? 82.820  90.302  110.365 1.00 8.90   ? 377  LEU A CA    1 
ATOM   2358 C  C     . LEU A 1 377 ? 82.104  91.642  110.372 1.00 8.90   ? 377  LEU A C     1 
ATOM   2359 O  O     . LEU A 1 377 ? 82.555  92.589  109.721 1.00 8.90   ? 377  LEU A O     1 
ATOM   2360 C  CB    . LEU A 1 377 ? 82.270  89.407  109.261 1.00 8.90   ? 377  LEU A CB    1 
ATOM   2361 C  CG    . LEU A 1 377 ? 82.319  89.843  107.811 1.00 8.90   ? 377  LEU A CG    1 
ATOM   2362 C  CD1   . LEU A 1 377 ? 83.743  89.981  107.381 1.00 8.90   ? 377  LEU A CD1   1 
ATOM   2363 C  CD2   . LEU A 1 377 ? 81.607  88.804  106.990 1.00 8.90   ? 377  LEU A CD2   1 
ATOM   2364 N  N     . ARG A 1 378 ? 80.998  91.740  111.100 1.00 10.70  ? 378  ARG A N     1 
ATOM   2365 C  CA    . ARG A 1 378 ? 80.172  92.933  111.129 1.00 10.70  ? 378  ARG A CA    1 
ATOM   2366 C  C     . ARG A 1 378 ? 80.570  93.906  112.222 1.00 10.70  ? 378  ARG A C     1 
ATOM   2367 O  O     . ARG A 1 378 ? 79.842  94.870  112.457 1.00 10.70  ? 378  ARG A O     1 
ATOM   2368 C  CB    . ARG A 1 378 ? 78.703  92.550  111.298 1.00 10.70  ? 378  ARG A CB    1 
ATOM   2369 C  CG    . ARG A 1 378 ? 78.120  91.842  110.098 1.00 10.70  ? 378  ARG A CG    1 
ATOM   2370 C  CD    . ARG A 1 378 ? 76.668  91.488  110.326 1.00 10.70  ? 378  ARG A CD    1 
ATOM   2371 N  NE    . ARG A 1 378 ? 76.510  90.476  111.364 1.00 10.70  ? 378  ARG A NE    1 
ATOM   2372 C  CZ    . ARG A 1 378 ? 75.339  90.098  111.864 1.00 10.70  ? 378  ARG A CZ    1 
ATOM   2373 N  NH1   . ARG A 1 378 ? 74.220  90.653  111.422 1.00 10.70  ? 378  ARG A NH1   1 
ATOM   2374 N  NH2   . ARG A 1 378 ? 75.287  89.168  112.806 1.00 10.70  ? 378  ARG A NH2   1 
ATOM   2375 N  N     . TRP A 1 379 ? 81.683  93.671  112.902 1.00 8.46   ? 379  TRP A N     1 
ATOM   2376 C  CA    . TRP A 1 379 ? 82.244  94.624  113.847 1.00 8.46   ? 379  TRP A CA    1 
ATOM   2377 C  C     . TRP A 1 379 ? 83.662  95.033  113.516 1.00 8.46   ? 379  TRP A C     1 
ATOM   2378 O  O     . TRP A 1 379 ? 84.054  96.146  113.855 1.00 8.46   ? 379  TRP A O     1 
ATOM   2379 C  CB    . TRP A 1 379 ? 82.210  94.060  115.270 1.00 8.46   ? 379  TRP A CB    1 
ATOM   2380 C  CG    . TRP A 1 379 ? 80.860  94.072  115.879 1.00 8.46   ? 379  TRP A CG    1 
ATOM   2381 C  CD1   . TRP A 1 379 ? 79.918  93.110  115.776 1.00 8.46   ? 379  TRP A CD1   1 
ATOM   2382 C  CD2   . TRP A 1 379 ? 80.311  95.078  116.733 1.00 8.46   ? 379  TRP A CD2   1 
ATOM   2383 N  NE1   . TRP A 1 379 ? 78.800  93.456  116.479 1.00 8.46   ? 379  TRP A NE1   1 
ATOM   2384 C  CE2   . TRP A 1 379 ? 79.015  94.663  117.080 1.00 8.46   ? 379  TRP A CE2   1 
ATOM   2385 C  CE3   . TRP A 1 379 ? 80.782  96.295  117.225 1.00 8.46   ? 379  TRP A CE3   1 
ATOM   2386 C  CZ2   . TRP A 1 379 ? 78.189  95.414  117.900 1.00 8.46   ? 379  TRP A CZ2   1 
ATOM   2387 C  CZ3   . TRP A 1 379 ? 79.961  97.039  118.038 1.00 8.46   ? 379  TRP A CZ3   1 
ATOM   2388 C  CH2   . TRP A 1 379 ? 78.682  96.599  118.370 1.00 8.46   ? 379  TRP A CH2   1 
ATOM   2389 N  N     . VAL A 1 380 ? 84.440  94.165  112.872 1.00 7.81   ? 380  VAL A N     1 
ATOM   2390 C  CA    . VAL A 1 380 ? 85.742  94.575  112.361 1.00 7.81   ? 380  VAL A CA    1 
ATOM   2391 C  C     . VAL A 1 380 ? 85.567  95.565  111.221 1.00 7.81   ? 380  VAL A C     1 
ATOM   2392 O  O     . VAL A 1 380 ? 86.272  96.577  111.147 1.00 7.81   ? 380  VAL A O     1 
ATOM   2393 C  CB    . VAL A 1 380 ? 86.565  93.342  111.944 1.00 7.81   ? 380  VAL A CB    1 
ATOM   2394 C  CG1   . VAL A 1 380 ? 87.840  93.752  111.252 1.00 7.81   ? 380  VAL A CG1   1 
ATOM   2395 C  CG2   . VAL A 1 380 ? 86.910  92.526  113.158 1.00 7.81   ? 380  VAL A CG2   1 
ATOM   2396 N  N     . SER A 1 381 ? 84.595  95.318  110.342 1.00 8.91   ? 381  SER A N     1 
ATOM   2397 C  CA    . SER A 1 381 ? 84.302  96.262  109.272 1.00 8.91   ? 381  SER A CA    1 
ATOM   2398 C  C     . SER A 1 381 ? 83.577  97.494  109.785 1.00 8.91   ? 381  SER A C     1 
ATOM   2399 O  O     . SER A 1 381 ? 83.845  98.596  109.305 1.00 8.91   ? 381  SER A O     1 
ATOM   2400 C  CB    . SER A 1 381 ? 83.481  95.589  108.174 1.00 8.91   ? 381  SER A CB    1 
ATOM   2401 O  OG    . SER A 1 381 ? 82.203  95.219  108.641 1.00 8.91   ? 381  SER A OG    1 
ATOM   2402 N  N     . LYS A 1 382 ? 82.682  97.325  110.761 1.00 9.02   ? 382  LYS A N     1 
ATOM   2403 C  CA    . LYS A 1 382 ? 81.963  98.450  111.355 1.00 9.02   ? 382  LYS A CA    1 
ATOM   2404 C  C     . LYS A 1 382 ? 82.904  99.424  112.045 1.00 9.02   ? 382  LYS A C     1 
ATOM   2405 O  O     . LYS A 1 382 ? 82.724  100.640 111.945 1.00 9.02   ? 382  LYS A O     1 
ATOM   2406 C  CB    . LYS A 1 382 ? 80.931  97.930  112.344 1.00 9.02   ? 382  LYS A CB    1 
ATOM   2407 C  CG    . LYS A 1 382 ? 80.110  98.978  113.045 1.00 9.02   ? 382  LYS A CG    1 
ATOM   2408 C  CD    . LYS A 1 382 ? 79.102  98.316  113.959 1.00 9.02   ? 382  LYS A CD    1 
ATOM   2409 C  CE    . LYS A 1 382 ? 78.262  99.334  114.691 1.00 9.02   ? 382  LYS A CE    1 
ATOM   2410 N  NZ    . LYS A 1 382 ? 77.268  98.670  115.574 1.00 9.02   ? 382  LYS A NZ    1 
ATOM   2411 N  N     . ARG A 1 383 ? 83.914  98.914  112.751 1.00 9.19   ? 383  ARG A N     1 
ATOM   2412 C  CA    . ARG A 1 383 ? 84.926  99.796  113.317 1.00 9.19   ? 383  ARG A CA    1 
ATOM   2413 C  C     . ARG A 1 383 ? 85.808  100.392 112.230 1.00 9.19   ? 383  ARG A C     1 
ATOM   2414 O  O     . ARG A 1 383 ? 86.272  101.528 112.362 1.00 9.19   ? 383  ARG A O     1 
ATOM   2415 C  CB    . ARG A 1 383 ? 85.774  99.040  114.341 1.00 9.19   ? 383  ARG A CB    1 
ATOM   2416 C  CG    . ARG A 1 383 ? 86.769  99.919  115.084 1.00 9.19   ? 383  ARG A CG    1 
ATOM   2417 C  CD    . ARG A 1 383 ? 87.676  99.154  116.009 1.00 9.19   ? 383  ARG A CD    1 
ATOM   2418 N  NE    . ARG A 1 383 ? 88.490  98.198  115.271 1.00 9.19   ? 383  ARG A NE    1 
ATOM   2419 C  CZ    . ARG A 1 383 ? 89.407  97.420  115.827 1.00 9.19   ? 383  ARG A CZ    1 
ATOM   2420 N  NH1   . ARG A 1 383 ? 89.657  97.526  117.119 1.00 9.19   ? 383  ARG A NH1   1 
ATOM   2421 N  NH2   . ARG A 1 383 ? 90.096  96.562  115.089 1.00 9.19   ? 383  ARG A NH2   1 
ATOM   2422 N  N     . SER A 1 384 ? 86.022  99.658  111.138 1.00 10.38  ? 384  SER A N     1 
ATOM   2423 C  CA    . SER A 1 384 ? 86.899  100.133 110.077 1.00 10.38  ? 384  SER A CA    1 
ATOM   2424 C  C     . SER A 1 384 ? 86.248  101.204 109.217 1.00 10.38  ? 384  SER A C     1 
ATOM   2425 O  O     . SER A 1 384 ? 86.956  102.049 108.673 1.00 10.38  ? 384  SER A O     1 
ATOM   2426 C  CB    . SER A 1 384 ? 87.350  98.975  109.196 1.00 10.38  ? 384  SER A CB    1 
ATOM   2427 O  OG    . SER A 1 384 ? 88.113  98.042  109.931 1.00 10.38  ? 384  SER A OG    1 
ATOM   2428 N  N     . PHE A 1 385 ? 84.921  101.190 109.063 1.00 12.20  ? 385  PHE A N     1 
ATOM   2429 C  CA    . PHE A 1 385 ? 84.277  102.297 108.367 1.00 12.20  ? 385  PHE A CA    1 
ATOM   2430 C  C     . PHE A 1 385 ? 84.238  103.549 109.227 1.00 12.20  ? 385  PHE A C     1 
ATOM   2431 O  O     . PHE A 1 385 ? 84.240  104.663 108.695 1.00 12.20  ? 385  PHE A O     1 
ATOM   2432 C  CB    . PHE A 1 385 ? 82.861  101.948 107.923 1.00 12.20  ? 385  PHE A CB    1 
ATOM   2433 C  CG    . PHE A 1 385 ? 82.793  100.995 106.770 1.00 12.20  ? 385  PHE A CG    1 
ATOM   2434 C  CD1   . PHE A 1 385 ? 83.242  101.373 105.520 1.00 12.20  ? 385  PHE A CD1   1 
ATOM   2435 C  CD2   . PHE A 1 385 ? 82.189  99.759  106.909 1.00 12.20  ? 385  PHE A CD2   1 
ATOM   2436 C  CE1   . PHE A 1 385 ? 83.160  100.507 104.452 1.00 12.20  ? 385  PHE A CE1   1 
ATOM   2437 C  CE2   . PHE A 1 385 ? 82.096  98.892  105.845 1.00 12.20  ? 385  PHE A CE2   1 
ATOM   2438 C  CZ    . PHE A 1 385 ? 82.579  99.266  104.618 1.00 12.20  ? 385  PHE A CZ    1 
ATOM   2439 N  N     . LYS A 1 386 ? 84.191  103.393 110.545 1.00 12.58  ? 386  LYS A N     1 
ATOM   2440 C  CA    . LYS A 1 386 ? 84.214  104.547 111.428 1.00 12.58  ? 386  LYS A CA    1 
ATOM   2441 C  C     . LYS A 1 386 ? 85.572  105.229 111.452 1.00 12.58  ? 386  LYS A C     1 
ATOM   2442 O  O     . LYS A 1 386 ? 85.643  106.416 111.778 1.00 12.58  ? 386  LYS A O     1 
ATOM   2443 C  CB    . LYS A 1 386 ? 83.810  104.135 112.840 1.00 12.58  ? 386  LYS A CB    1 
ATOM   2444 C  CG    . LYS A 1 386 ? 82.361  103.719 112.949 1.00 12.58  ? 386  LYS A CG    1 
ATOM   2445 C  CD    . LYS A 1 386 ? 82.003  103.317 114.362 1.00 12.58  ? 386  LYS A CD    1 
ATOM   2446 C  CE    . LYS A 1 386 ? 80.579  102.799 114.433 1.00 12.58  ? 386  LYS A CE    1 
ATOM   2447 N  NZ    . LYS A 1 386 ? 79.585  103.869 114.159 1.00 12.58  ? 386  LYS A NZ    1 
ATOM   2448 N  N     . ASN A 1 387 ? 86.646  104.515 111.119 1.00 12.97  ? 387  ASN A N     1 
ATOM   2449 C  CA    . ASN A 1 387 ? 87.939  105.167 110.959 1.00 12.97  ? 387  ASN A CA    1 
ATOM   2450 C  C     . ASN A 1 387 ? 88.033  105.918 109.643 1.00 12.97  ? 387  ASN A C     1 
ATOM   2451 O  O     . ASN A 1 387 ? 88.799  106.880 109.540 1.00 12.97  ? 387  ASN A O     1 
ATOM   2452 C  CB    . ASN A 1 387 ? 89.080  104.152 111.036 1.00 12.97  ? 387  ASN A CB    1 
ATOM   2453 C  CG    . ASN A 1 387 ? 89.171  103.477 112.375 1.00 12.97  ? 387  ASN A CG    1 
ATOM   2454 O  OD1   . ASN A 1 387 ? 89.091  102.259 112.477 1.00 12.97  ? 387  ASN A OD1   1 
ATOM   2455 N  ND2   . ASN A 1 387 ? 89.314  104.267 113.418 1.00 12.97  ? 387  ASN A ND2   1 
ATOM   2456 N  N     . LEU A 1 388 ? 87.297  105.485 108.626 1.00 15.13  ? 388  LEU A N     1 
ATOM   2457 C  CA    . LEU A 1 388 ? 87.281  106.187 107.352 1.00 15.13  ? 388  LEU A CA    1 
ATOM   2458 C  C     . LEU A 1 388 ? 86.285  107.330 107.322 1.00 15.13  ? 388  LEU A C     1 
ATOM   2459 O  O     . LEU A 1 388 ? 86.501  108.305 106.600 1.00 15.13  ? 388  LEU A O     1 
ATOM   2460 C  CB    . LEU A 1 388 ? 86.974  105.222 106.205 1.00 15.13  ? 388  LEU A CB    1 
ATOM   2461 C  CG    . LEU A 1 388 ? 88.153  104.525 105.525 1.00 15.13  ? 388  LEU A CG    1 
ATOM   2462 C  CD1   . LEU A 1 388 ? 88.817  103.445 106.372 1.00 15.13  ? 388  LEU A CD1   1 
ATOM   2463 C  CD2   . LEU A 1 388 ? 87.702  103.966 104.194 1.00 15.13  ? 388  LEU A CD2   1 
ATOM   2464 N  N     . LEU A 1 389 ? 85.191  107.235 108.070 1.00 15.82  ? 389  LEU A N     1 
ATOM   2465 C  CA    . LEU A 1 389 ? 84.298  108.373 108.201 1.00 15.82  ? 389  LEU A CA    1 
ATOM   2466 C  C     . LEU A 1 389 ? 84.791  109.377 109.225 1.00 15.82  ? 389  LEU A C     1 
ATOM   2467 O  O     . LEU A 1 389 ? 84.269  110.493 109.275 1.00 15.82  ? 389  LEU A O     1 
ATOM   2468 C  CB    . LEU A 1 389 ? 82.892  107.912 108.579 1.00 15.82  ? 389  LEU A CB    1 
ATOM   2469 C  CG    . LEU A 1 389 ? 82.183  107.076 107.518 1.00 15.82  ? 389  LEU A CG    1 
ATOM   2470 C  CD1   . LEU A 1 389 ? 80.826  106.617 108.015 1.00 15.82  ? 389  LEU A CD1   1 
ATOM   2471 C  CD2   . LEU A 1 389 ? 82.052  107.848 106.224 1.00 15.82  ? 389  LEU A CD2   1 
ATOM   2472 N  N     . GLY A 1 390 ? 85.773  109.012 110.038 1.00 15.28  ? 390  GLY A N     1 
ATOM   2473 C  CA    . GLY A 1 390 ? 86.313  109.922 111.020 1.00 15.28  ? 390  GLY A CA    1 
ATOM   2474 C  C     . GLY A 1 390 ? 87.544  110.630 110.510 1.00 15.28  ? 390  GLY A C     1 
ATOM   2475 O  O     . GLY A 1 390 ? 87.808  111.775 110.881 1.00 15.28  ? 390  GLY A O     1 
ATOM   2476 N  N     . ASN A 1 391 ? 88.307  109.958 109.655 1.00 18.63  ? 391  ASN A N     1 
ATOM   2477 C  CA    . ASN A 1 391 ? 89.520  110.520 109.062 1.00 18.63  ? 391  ASN A CA    1 
ATOM   2478 C  C     . ASN A 1 391 ? 89.531  110.250 107.562 1.00 18.63  ? 391  ASN A C     1 
ATOM   2479 O  O     . ASN A 1 391 ? 90.287  109.399 107.083 1.00 18.63  ? 391  ASN A O     1 
ATOM   2480 C  CB    . ASN A 1 391 ? 90.758  109.917 109.725 1.00 18.63  ? 391  ASN A CB    1 
ATOM   2481 C  CG    . ASN A 1 391 ? 90.880  110.301 111.184 1.00 18.63  ? 391  ASN A CG    1 
ATOM   2482 O  OD1   . ASN A 1 391 ? 90.686  111.459 111.555 1.00 18.63  ? 391  ASN A OD1   1 
ATOM   2483 N  ND2   . ASN A 1 391 ? 91.186  109.324 112.025 1.00 18.63  ? 391  ASN A ND2   1 
ATOM   2484 N  N     . PRO A 1 392 ? 88.689  110.968 106.773 1.00 19.55  ? 392  PRO A N     1 
ATOM   2485 C  CA    . PRO A 1 392 ? 88.550  110.665 105.345 1.00 19.55  ? 392  PRO A CA    1 
ATOM   2486 C  C     . PRO A 1 392 ? 89.536  111.418 104.460 1.00 19.55  ? 392  PRO A C     1 
ATOM   2487 O  O     . PRO A 1 392 ? 89.171  111.973 103.428 1.00 19.55  ? 392  PRO A O     1 
ATOM   2488 C  CB    . PRO A 1 392 ? 87.114  111.109 105.050 1.00 19.55  ? 392  PRO A CB    1 
ATOM   2489 C  CG    . PRO A 1 392 ? 86.946  112.277 105.927 1.00 19.55  ? 392  PRO A CG    1 
ATOM   2490 C  CD    . PRO A 1 392 ? 87.733  112.014 107.180 1.00 19.55  ? 392  PRO A CD    1 
ATOM   2491 N  N     . GLN A 1 393 ? 90.806  111.436 104.852 1.00 20.64  ? 393  GLN A N     1 
ATOM   2492 C  CA    . GLN A 1 393 ? 91.778  112.167 104.046 1.00 20.64  ? 393  GLN A CA    1 
ATOM   2493 C  C     . GLN A 1 393 ? 92.149  111.386 102.796 1.00 20.64  ? 393  GLN A C     1 
ATOM   2494 O  O     . GLN A 1 393 ? 92.151  111.938 101.694 1.00 20.64  ? 393  GLN A O     1 
ATOM   2495 C  CB    . GLN A 1 393 ? 93.027  112.496 104.866 1.00 20.64  ? 393  GLN A CB    1 
ATOM   2496 C  CG    . GLN A 1 393 ? 92.823  113.567 105.926 1.00 20.64  ? 393  GLN A CG    1 
ATOM   2497 C  CD    . GLN A 1 393 ? 92.275  113.016 107.224 1.00 20.64  ? 393  GLN A CD    1 
ATOM   2498 O  OE1   . GLN A 1 393 ? 92.360  111.819 107.487 1.00 20.64  ? 393  GLN A OE1   1 
ATOM   2499 N  NE2   . GLN A 1 393 ? 91.704  113.887 108.042 1.00 20.64  ? 393  GLN A NE2   1 
ATOM   2500 N  N     . ALA A 1 394 ? 92.443  110.096 102.945 1.00 19.07  ? 394  ALA A N     1 
ATOM   2501 C  CA    . ALA A 1 394 ? 92.869  109.293 101.808 1.00 19.07  ? 394  ALA A CA    1 
ATOM   2502 C  C     . ALA A 1 394 ? 91.721  108.928 100.886 1.00 19.07  ? 394  ALA A C     1 
ATOM   2503 O  O     . ALA A 1 394 ? 91.968  108.577 99.732  1.00 19.07  ? 394  ALA A O     1 
ATOM   2504 C  CB    . ALA A 1 394 ? 93.561  108.025 102.295 1.00 19.07  ? 394  ALA A CB    1 
ATOM   2505 N  N     . SER A 1 395 ? 90.481  108.996 101.360 1.00 21.29  ? 395  SER A N     1 
ATOM   2506 C  CA    . SER A 1 395 ? 89.330  108.664 100.531 1.00 21.29  ? 395  SER A CA    1 
ATOM   2507 C  C     . SER A 1 395 ? 88.814  109.865 99.752  1.00 21.29  ? 395  SER A C     1 
ATOM   2508 O  O     . SER A 1 395 ? 88.362  109.713 98.616  1.00 21.29  ? 395  SER A O     1 
ATOM   2509 C  CB    . SER A 1 395 ? 88.212  108.085 101.398 1.00 21.29  ? 395  SER A CB    1 
ATOM   2510 O  OG    . SER A 1 395 ? 87.067  107.793 100.623 1.00 21.29  ? 395  SER A OG    1 
ATOM   2511 N  N     . ILE A 1 396 ? 88.864  111.058 100.345 1.00 20.38  ? 396  ILE A N     1 
ATOM   2512 C  CA    . ILE A 1 396 ? 88.494  112.269 99.621  1.00 20.38  ? 396  ILE A CA    1 
ATOM   2513 C  C     . ILE A 1 396 ? 89.557  112.615 98.590  1.00 20.38  ? 396  ILE A C     1 
ATOM   2514 O  O     . ILE A 1 396 ? 89.241  112.951 97.444  1.00 20.38  ? 396  ILE A O     1 
ATOM   2515 C  CB    . ILE A 1 396 ? 88.243  113.422 100.614 1.00 20.38  ? 396  ILE A CB    1 
ATOM   2516 C  CG1   . ILE A 1 396 ? 86.947  113.179 101.387 1.00 20.38  ? 396  ILE A CG1   1 
ATOM   2517 C  CG2   . ILE A 1 396 ? 88.209  114.768 99.931  1.00 20.38  ? 396  ILE A CG2   1 
ATOM   2518 C  CD1   . ILE A 1 396 ? 86.757  114.102 102.559 1.00 20.38  ? 396  ILE A CD1   1 
ATOM   2519 N  N     . ALA A 1 397 ? 90.833  112.500 98.961  1.00 20.40  ? 397  ALA A N     1 
ATOM   2520 C  CA    . ALA A 1 397 ? 91.907  112.774 98.014  1.00 20.40  ? 397  ALA A CA    1 
ATOM   2521 C  C     . ALA A 1 397 ? 92.018  111.713 96.932  1.00 20.40  ? 397  ALA A C     1 
ATOM   2522 O  O     . ALA A 1 397 ? 92.597  111.989 95.885  1.00 20.40  ? 397  ALA A O     1 
ATOM   2523 C  CB    . ALA A 1 397 ? 93.242  112.899 98.741  1.00 20.40  ? 397  ALA A CB    1 
ATOM   2524 N  N     . GLN A 1 398 ? 91.500  110.510 97.171  1.00 20.95  ? 398  GLN A N     1 
ATOM   2525 C  CA    . GLN A 1 398 ? 91.363  109.518 96.109  1.00 20.95  ? 398  GLN A CA    1 
ATOM   2526 C  C     . GLN A 1 398 ? 90.382  109.982 95.042  1.00 20.95  ? 398  GLN A C     1 
ATOM   2527 O  O     . GLN A 1 398 ? 90.676  109.917 93.847  1.00 20.95  ? 398  GLN A O     1 
ATOM   2528 C  CB    . GLN A 1 398 ? 90.902  108.189 96.696  1.00 20.95  ? 398  GLN A CB    1 
ATOM   2529 C  CG    . GLN A 1 398 ? 90.555  107.155 95.670  1.00 20.95  ? 398  GLN A CG    1 
ATOM   2530 C  CD    . GLN A 1 398 ? 91.727  106.445 95.057  1.00 20.95  ? 398  GLN A CD    1 
ATOM   2531 O  OE1   . GLN A 1 398 ? 92.566  105.907 95.763  1.00 20.95  ? 398  GLN A OE1   1 
ATOM   2532 N  NE2   . GLN A 1 398 ? 91.796  106.437 93.739  1.00 20.95  ? 398  GLN A NE2   1 
ATOM   2533 N  N     . ILE A 1 399 ? 89.206  110.451 95.462  1.00 21.47  ? 399  ILE A N     1 
ATOM   2534 C  CA    . ILE A 1 399 ? 88.144  110.800 94.524  1.00 21.47  ? 399  ILE A CA    1 
ATOM   2535 C  C     . ILE A 1 399 ? 88.468  112.097 93.787  1.00 21.47  ? 399  ILE A C     1 
ATOM   2536 O  O     . ILE A 1 399 ? 88.105  112.258 92.617  1.00 21.47  ? 399  ILE A O     1 
ATOM   2537 C  CB    . ILE A 1 399 ? 86.804  110.863 95.288  1.00 21.47  ? 399  ILE A CB    1 
ATOM   2538 C  CG1   . ILE A 1 399 ? 86.494  109.501 95.902  1.00 21.47  ? 399  ILE A CG1   1 
ATOM   2539 C  CG2   . ILE A 1 399 ? 85.646  111.239 94.391  1.00 21.47  ? 399  ILE A CG2   1 
ATOM   2540 C  CD1   . ILE A 1 399 ? 85.346  109.522 96.868  1.00 21.47  ? 399  ILE A CD1   1 
ATOM   2541 N  N     . ILE A 1 400 ? 89.196  113.014 94.427  1.00 21.86  ? 400  ILE A N     1 
ATOM   2542 C  CA    . ILE A 1 400 ? 89.527  114.287 93.792  1.00 21.86  ? 400  ILE A CA    1 
ATOM   2543 C  C     . ILE A 1 400 ? 90.504  114.084 92.639  1.00 21.86  ? 400  ILE A C     1 
ATOM   2544 O  O     . ILE A 1 400 ? 90.251  114.529 91.516  1.00 21.86  ? 400  ILE A O     1 
ATOM   2545 C  CB    . ILE A 1 400 ? 90.068  115.287 94.830  1.00 21.86  ? 400  ILE A CB    1 
ATOM   2546 C  CG1   . ILE A 1 400 ? 88.940  115.761 95.743  1.00 21.86  ? 400  ILE A CG1   1 
ATOM   2547 C  CG2   . ILE A 1 400 ? 90.736  116.466 94.158  1.00 21.86  ? 400  ILE A CG2   1 
ATOM   2548 C  CD1   . ILE A 1 400 ? 89.410  116.622 96.883  1.00 21.86  ? 400  ILE A CD1   1 
ATOM   2549 N  N     . VAL A 1 401 ? 91.614  113.377 92.877  1.00 22.35  ? 401  VAL A N     1 
ATOM   2550 C  CA    . VAL A 1 401 ? 92.589  113.180 91.805  1.00 22.35  ? 401  VAL A CA    1 
ATOM   2551 C  C     . VAL A 1 401 ? 92.194  112.078 90.839  1.00 22.35  ? 401  VAL A C     1 
ATOM   2552 O  O     . VAL A 1 401 ? 92.936  111.812 89.888  1.00 22.35  ? 401  VAL A O     1 
ATOM   2553 C  CB    . VAL A 1 401 ? 94.003  112.869 92.333  1.00 22.35  ? 401  VAL A CB    1 
ATOM   2554 C  CG1   . VAL A 1 401 ? 94.494  113.984 93.230  1.00 22.35  ? 401  VAL A CG1   1 
ATOM   2555 C  CG2   . VAL A 1 401 ? 94.033  111.543 93.036  1.00 22.35  ? 401  VAL A CG2   1 
ATOM   2556 N  N     . THR A 1 402 ? 91.060  111.419 91.052  1.00 22.90  ? 402  THR A N     1 
ATOM   2557 C  CA    . THR A 1 402 ? 90.486  110.535 90.048  1.00 22.90  ? 402  THR A CA    1 
ATOM   2558 C  C     . THR A 1 402 ? 89.585  111.306 89.093  1.00 22.90  ? 402  THR A C     1 
ATOM   2559 O  O     . THR A 1 402 ? 89.599  111.054 87.883  1.00 22.90  ? 402  THR A O     1 
ATOM   2560 C  CB    . THR A 1 402 ? 89.710  109.410 90.735  1.00 22.90  ? 402  THR A CB    1 
ATOM   2561 O  OG1   . THR A 1 402 ? 90.592  108.696 91.606  1.00 22.90  ? 402  THR A OG1   1 
ATOM   2562 C  CG2   . THR A 1 402 ? 89.153  108.443 89.738  1.00 22.90  ? 402  THR A CG2   1 
ATOM   2563 N  N     . VAL A 1 403 ? 88.820  112.263 89.621  1.00 23.84  ? 403  VAL A N     1 
ATOM   2564 C  CA    . VAL A 1 403 ? 88.026  113.151 88.779  1.00 23.84  ? 403  VAL A CA    1 
ATOM   2565 C  C     . VAL A 1 403 ? 88.930  114.048 87.945  1.00 23.84  ? 403  VAL A C     1 
ATOM   2566 O  O     . VAL A 1 403 ? 88.709  114.219 86.742  1.00 23.84  ? 403  VAL A O     1 
ATOM   2567 C  CB    . VAL A 1 403 ? 87.051  113.966 89.649  1.00 23.84  ? 403  VAL A CB    1 
ATOM   2568 C  CG1   . VAL A 1 403 ? 86.374  115.052 88.844  1.00 23.84  ? 403  VAL A CG1   1 
ATOM   2569 C  CG2   . VAL A 1 403 ? 86.001  113.059 90.242  1.00 23.84  ? 403  VAL A CG2   1 
ATOM   2570 N  N     . VAL A 1 404 ? 89.980  114.602 88.558  1.00 25.38  ? 404  VAL A N     1 
ATOM   2571 C  CA    . VAL A 1 404 ? 90.888  115.503 87.850  1.00 25.38  ? 404  VAL A CA    1 
ATOM   2572 C  C     . VAL A 1 404 ? 91.670  114.754 86.776  1.00 25.38  ? 404  VAL A C     1 
ATOM   2573 O  O     . VAL A 1 404 ? 91.836  115.250 85.658  1.00 25.38  ? 404  VAL A O     1 
ATOM   2574 C  CB    . VAL A 1 404 ? 91.814  116.211 88.858  1.00 25.38  ? 404  VAL A CB    1 
ATOM   2575 C  CG1   . VAL A 1 404 ? 92.893  117.000 88.155  1.00 25.38  ? 404  VAL A CG1   1 
ATOM   2576 C  CG2   . VAL A 1 404 ? 91.007  117.151 89.721  1.00 25.38  ? 404  VAL A CG2   1 
ATOM   2577 N  N     . LEU A 1 405 ? 92.113  113.532 87.072  1.00 26.52  ? 405  LEU A N     1 
ATOM   2578 C  CA    . LEU A 1 405 ? 92.776  112.728 86.049  1.00 26.52  ? 405  LEU A CA    1 
ATOM   2579 C  C     . LEU A 1 405 ? 91.794  112.237 84.994  1.00 26.52  ? 405  LEU A C     1 
ATOM   2580 O  O     . LEU A 1 405 ? 92.152  112.143 83.818  1.00 26.52  ? 405  LEU A O     1 
ATOM   2581 C  CB    . LEU A 1 405 ? 93.496  111.546 86.689  1.00 26.52  ? 405  LEU A CB    1 
ATOM   2582 C  CG    . LEU A 1 405 ? 94.302  110.626 85.780  1.00 26.52  ? 405  LEU A CG    1 
ATOM   2583 C  CD1   . LEU A 1 405 ? 95.418  111.388 85.112  1.00 26.52  ? 405  LEU A CD1   1 
ATOM   2584 C  CD2   . LEU A 1 405 ? 94.858  109.487 86.575  1.00 26.52  ? 405  LEU A CD2   1 
ATOM   2585 N  N     . GLY A 1 406 ? 90.555  111.941 85.386  1.00 28.26  ? 406  GLY A N     1 
ATOM   2586 C  CA    . GLY A 1 406 ? 89.559  111.524 84.416  1.00 28.26  ? 406  GLY A CA    1 
ATOM   2587 C  C     . GLY A 1 406 ? 89.132  112.631 83.475  1.00 28.26  ? 406  GLY A C     1 
ATOM   2588 O  O     . GLY A 1 406 ? 88.735  112.362 82.340  1.00 28.26  ? 406  GLY A O     1 
ATOM   2589 N  N     . LEU A 1 407 ? 89.206  113.883 83.926  1.00 28.65  ? 407  LEU A N     1 
ATOM   2590 C  CA    . LEU A 1 407 ? 88.890  115.013 83.062  1.00 28.65  ? 407  LEU A CA    1 
ATOM   2591 C  C     . LEU A 1 407 ? 90.042  115.373 82.138  1.00 28.65  ? 407  LEU A C     1 
ATOM   2592 O  O     . LEU A 1 407 ? 89.806  115.896 81.049  1.00 28.65  ? 407  LEU A O     1 
ATOM   2593 C  CB    . LEU A 1 407 ? 88.515  116.233 83.900  1.00 28.65  ? 407  LEU A CB    1 
ATOM   2594 C  CG    . LEU A 1 407 ? 87.201  116.252 84.673  1.00 28.65  ? 407  LEU A CG    1 
ATOM   2595 C  CD1   . LEU A 1 407 ? 87.193  117.438 85.601  1.00 28.65  ? 407  LEU A CD1   1 
ATOM   2596 C  CD2   . LEU A 1 407 ? 86.021  116.311 83.733  1.00 28.65  ? 407  LEU A CD2   1 
ATOM   2597 N  N     . VAL A 1 408 ? 91.283  115.126 82.554  1.00 30.72  ? 408  VAL A N     1 
ATOM   2598 C  CA    . VAL A 1 408 ? 92.436  115.434 81.713  1.00 30.72  ? 408  VAL A CA    1 
ATOM   2599 C  C     . VAL A 1 408 ? 92.568  114.422 80.583  1.00 30.72  ? 408  VAL A C     1 
ATOM   2600 O  O     . VAL A 1 408 ? 92.773  114.793 79.422  1.00 30.72  ? 408  VAL A O     1 
ATOM   2601 C  CB    . VAL A 1 408 ? 93.711  115.505 82.572  1.00 30.72  ? 408  VAL A CB    1 
ATOM   2602 C  CG1   . VAL A 1 408 ? 94.948  115.516 81.706  1.00 30.72  ? 408  VAL A CG1   1 
ATOM   2603 C  CG2   . VAL A 1 408 ? 93.685  116.762 83.414  1.00 30.72  ? 408  VAL A CG2   1 
ATOM   2604 N  N     . ILE A 1 409 ? 92.438  113.132 80.908  1.00 30.46  ? 409  ILE A N     1 
ATOM   2605 C  CA    . ILE A 1 409 ? 92.441  112.068 79.906  1.00 30.46  ? 409  ILE A CA    1 
ATOM   2606 C  C     . ILE A 1 409 ? 91.262  112.220 78.953  1.00 30.46  ? 409  ILE A C     1 
ATOM   2607 O  O     . ILE A 1 409 ? 91.374  111.936 77.755  1.00 30.46  ? 409  ILE A O     1 
ATOM   2608 C  CB    . ILE A 1 409 ? 92.450  110.701 80.623  1.00 30.46  ? 409  ILE A CB    1 
ATOM   2609 C  CG1   . ILE A 1 409 ? 93.740  110.527 81.411  1.00 30.46  ? 409  ILE A CG1   1 
ATOM   2610 C  CG2   . ILE A 1 409 ? 92.360  109.569 79.673  1.00 30.46  ? 409  ILE A CG2   1 
ATOM   2611 C  CD1   . ILE A 1 409 ? 93.762  109.295 82.270  1.00 30.46  ? 409  ILE A CD1   1 
ATOM   2612 N  N     . GLY A 1 410 ? 90.138  112.735 79.445  1.00 34.77  ? 410  GLY A N     1 
ATOM   2613 C  CA    . GLY A 1 410 ? 89.022  113.015 78.560  1.00 34.77  ? 410  GLY A CA    1 
ATOM   2614 C  C     . GLY A 1 410 ? 89.225  114.235 77.684  1.00 34.77  ? 410  GLY A C     1 
ATOM   2615 O  O     . GLY A 1 410 ? 88.635  114.330 76.608  1.00 34.77  ? 410  GLY A O     1 
ATOM   2616 N  N     . ALA A 1 411 ? 90.038  115.191 78.130  1.00 34.84  ? 411  ALA A N     1 
ATOM   2617 C  CA    . ALA A 1 411 ? 90.241  116.418 77.369  1.00 34.84  ? 411  ALA A CA    1 
ATOM   2618 C  C     . ALA A 1 411 ? 91.365  116.317 76.351  1.00 34.84  ? 411  ALA A C     1 
ATOM   2619 O  O     . ALA A 1 411 ? 91.363  117.066 75.368  1.00 34.84  ? 411  ALA A O     1 
ATOM   2620 C  CB    . ALA A 1 411 ? 90.533  117.583 78.311  1.00 34.84  ? 411  ALA A CB    1 
ATOM   2621 N  N     . ILE A 1 412 ? 92.331  115.430 76.573  1.00 37.53  ? 412  ILE A N     1 
ATOM   2622 C  CA    . ILE A 1 412 ? 93.399  115.231 75.602  1.00 37.53  ? 412  ILE A CA    1 
ATOM   2623 C  C     . ILE A 1 412 ? 92.895  114.429 74.415  1.00 37.53  ? 412  ILE A C     1 
ATOM   2624 O  O     . ILE A 1 412 ? 93.107  114.804 73.257  1.00 37.53  ? 412  ILE A O     1 
ATOM   2625 C  CB    . ILE A 1 412 ? 94.605  114.558 76.276  1.00 37.53  ? 412  ILE A CB    1 
ATOM   2626 C  CG1   . ILE A 1 412 ? 95.212  115.506 77.299  1.00 37.53  ? 412  ILE A CG1   1 
ATOM   2627 C  CG2   . ILE A 1 412 ? 95.650  114.185 75.262  1.00 37.53  ? 412  ILE A CG2   1 
ATOM   2628 C  CD1   . ILE A 1 412 ? 96.200  114.862 78.177  1.00 37.53  ? 412  ILE A CD1   1 
ATOM   2629 N  N     . TYR A 1 413 ? 92.195  113.330 74.680  1.00 40.08  ? 413  TYR A N     1 
ATOM   2630 C  CA    . TYR A 1 413 ? 91.632  112.502 73.623  1.00 40.08  ? 413  TYR A CA    1 
ATOM   2631 C  C     . TYR A 1 413 ? 90.185  112.861 73.319  1.00 40.08  ? 413  TYR A C     1 
ATOM   2632 O  O     . TYR A 1 413 ? 89.394  111.978 72.968  1.00 40.08  ? 413  TYR A O     1 
ATOM   2633 C  CB    . TYR A 1 413 ? 91.758  111.026 73.995  1.00 40.08  ? 413  TYR A CB    1 
ATOM   2634 C  CG    . TYR A 1 413 ? 93.184  110.558 74.141  1.00 40.08  ? 413  TYR A CG    1 
ATOM   2635 C  CD1   . TYR A 1 413 ? 93.953  110.260 73.028  1.00 40.08  ? 413  TYR A CD1   1 
ATOM   2636 C  CD2   . TYR A 1 413 ? 93.761  110.412 75.394  1.00 40.08  ? 413  TYR A CD2   1 
ATOM   2637 C  CE1   . TYR A 1 413 ? 95.257  109.834 73.157  1.00 40.08  ? 413  TYR A CE1   1 
ATOM   2638 C  CE2   . TYR A 1 413 ? 95.065  109.985 75.533  1.00 40.08  ? 413  TYR A CE2   1 
ATOM   2639 C  CZ    . TYR A 1 413 ? 95.806  109.699 74.411  1.00 40.08  ? 413  TYR A CZ    1 
ATOM   2640 O  OH    . TYR A 1 413 ? 97.105  109.275 74.542  1.00 40.08  ? 413  TYR A OH    1 
ATOM   2641 N  N     . PHE A 1 414 ? 89.822  114.134 73.462  1.00 42.61  ? 414  PHE A N     1 
ATOM   2642 C  CA    . PHE A 1 414 ? 88.458  114.581 73.216  1.00 42.61  ? 414  PHE A CA    1 
ATOM   2643 C  C     . PHE A 1 414 ? 88.109  114.446 71.742  1.00 42.61  ? 414  PHE A C     1 
ATOM   2644 O  O     . PHE A 1 414 ? 88.859  114.895 70.871  1.00 42.61  ? 414  PHE A O     1 
ATOM   2645 C  CB    . PHE A 1 414 ? 88.294  116.034 73.658  1.00 42.61  ? 414  PHE A CB    1 
ATOM   2646 C  CG    . PHE A 1 414 ? 86.899  116.565 73.495  1.00 42.61  ? 414  PHE A CG    1 
ATOM   2647 C  CD1   . PHE A 1 414 ? 85.908  116.225 74.399  1.00 42.61  ? 414  PHE A CD1   1 
ATOM   2648 C  CD2   . PHE A 1 414 ? 86.580  117.406 72.441  1.00 42.61  ? 414  PHE A CD2   1 
ATOM   2649 C  CE1   . PHE A 1 414 ? 84.625  116.706 74.256  1.00 42.61  ? 414  PHE A CE1   1 
ATOM   2650 C  CE2   . PHE A 1 414 ? 85.297  117.890 72.291  1.00 42.61  ? 414  PHE A CE2   1 
ATOM   2651 C  CZ    . PHE A 1 414 ? 84.318  117.539 73.201  1.00 42.61  ? 414  PHE A CZ    1 
ATOM   2652 N  N     . GLY A 1 415 ? 86.962  113.832 71.467  1.00 46.14  ? 415  GLY A N     1 
ATOM   2653 C  CA    . GLY A 1 415 ? 86.518  113.646 70.102  1.00 46.14  ? 415  GLY A CA    1 
ATOM   2654 C  C     . GLY A 1 415 ? 87.347  112.631 69.350  1.00 46.14  ? 415  GLY A C     1 
ATOM   2655 O  O     . GLY A 1 415 ? 88.097  112.987 68.438  1.00 46.14  ? 415  GLY A O     1 
ATOM   2656 N  N     . LEU A 1 416 ? 87.238  111.366 69.743  1.00 47.89  ? 416  LEU A N     1 
ATOM   2657 C  CA    . LEU A 1 416 ? 87.968  110.299 69.072  1.00 47.89  ? 416  LEU A CA    1 
ATOM   2658 C  C     . LEU A 1 416 ? 87.366  110.053 67.695  1.00 47.89  ? 416  LEU A C     1 
ATOM   2659 O  O     . LEU A 1 416 ? 86.185  109.711 67.576  1.00 47.89  ? 416  LEU A O     1 
ATOM   2660 C  CB    . LEU A 1 416 ? 87.931  109.027 69.911  1.00 47.89  ? 416  LEU A CB    1 
ATOM   2661 C  CG    . LEU A 1 416 ? 88.660  109.093 71.247  1.00 47.89  ? 416  LEU A CG    1 
ATOM   2662 C  CD1   . LEU A 1 416 ? 88.429  107.824 72.028  1.00 47.89  ? 416  LEU A CD1   1 
ATOM   2663 C  CD2   . LEU A 1 416 ? 90.133  109.317 71.020  1.00 47.89  ? 416  LEU A CD2   1 
ATOM   2664 N  N     . LYS A 1 417 ? 88.173  110.233 66.660  1.00 53.99  ? 417  LYS A N     1 
ATOM   2665 C  CA    . LYS A 1 417 ? 87.722  110.098 65.286  1.00 53.99  ? 417  LYS A CA    1 
ATOM   2666 C  C     . LYS A 1 417 ? 88.152  108.755 64.713  1.00 53.99  ? 417  LYS A C     1 
ATOM   2667 O  O     . LYS A 1 417 ? 89.000  108.055 65.270  1.00 53.99  ? 417  LYS A O     1 
ATOM   2668 C  CB    . LYS A 1 417 ? 88.275  111.237 64.428  1.00 53.99  ? 417  LYS A CB    1 
ATOM   2669 C  CG    . LYS A 1 417 ? 87.781  112.607 64.847  1.00 53.99  ? 417  LYS A CG    1 
ATOM   2670 C  CD    . LYS A 1 417 ? 88.342  113.690 63.951  1.00 53.99  ? 417  LYS A CD    1 
ATOM   2671 C  CE    . LYS A 1 417 ? 89.826  113.876 64.196  1.00 53.99  ? 417  LYS A CE    1 
ATOM   2672 N  NZ    . LYS A 1 417 ? 90.092  114.386 65.568  1.00 53.99  ? 417  LYS A NZ    1 
ATOM   2673 N  N     . ASN A 1 418 ? 87.545  108.401 63.584  1.00 59.41  ? 418  ASN A N     1 
ATOM   2674 C  CA    . ASN A 1 418 ? 87.911  107.195 62.844  1.00 59.41  ? 418  ASN A CA    1 
ATOM   2675 C  C     . ASN A 1 418 ? 88.835  107.627 61.715  1.00 59.41  ? 418  ASN A C     1 
ATOM   2676 O  O     . ASN A 1 418 ? 88.394  107.973 60.619  1.00 59.41  ? 418  ASN A O     1 
ATOM   2677 C  CB    . ASN A 1 418 ? 86.668  106.486 62.325  1.00 59.41  ? 418  ASN A CB    1 
ATOM   2678 C  CG    . ASN A 1 418 ? 85.745  106.039 63.439  1.00 59.41  ? 418  ASN A CG    1 
ATOM   2679 O  OD1   . ASN A 1 418 ? 84.619  106.517 63.558  1.00 59.41  ? 418  ASN A OD1   1 
ATOM   2680 N  ND2   . ASN A 1 418 ? 86.220  105.116 64.263  1.00 59.41  ? 418  ASN A ND2   1 
ATOM   2681 N  N     . ASP A 1 419 ? 90.134  107.612 61.984  1.00 60.22  ? 419  ASP A N     1 
ATOM   2682 C  CA    . ASP A 1 419 ? 91.112  108.163 61.057  1.00 60.22  ? 419  ASP A CA    1 
ATOM   2683 C  C     . ASP A 1 419 ? 92.288  107.191 61.006  1.00 60.22  ? 419  ASP A C     1 
ATOM   2684 O  O     . ASP A 1 419 ? 92.229  106.098 61.578  1.00 60.22  ? 419  ASP A O     1 
ATOM   2685 C  CB    . ASP A 1 419 ? 91.501  109.582 61.497  1.00 60.22  ? 419  ASP A CB    1 
ATOM   2686 C  CG    . ASP A 1 419 ? 92.082  110.420 60.369  1.00 60.22  ? 419  ASP A CG    1 
ATOM   2687 O  OD1   . ASP A 1 419 ? 92.210  109.898 59.242  1.00 60.22  ? 419  ASP A OD1   1 
ATOM   2688 O  OD2   . ASP A 1 419 ? 92.410  111.600 60.615  1.00 60.22  ? 419  ASP A OD2   1 
ATOM   2689 N  N     . SER A 1 420 ? 93.362  107.583 60.320  1.00 58.91  ? 420  SER A N     1 
ATOM   2690 C  CA    . SER A 1 420 ? 94.590  106.796 60.252  1.00 58.91  ? 420  SER A CA    1 
ATOM   2691 C  C     . SER A 1 420 ? 95.278  106.901 61.605  1.00 58.91  ? 420  SER A C     1 
ATOM   2692 O  O     . SER A 1 420 ? 95.980  105.975 62.023  1.00 58.91  ? 420  SER A O     1 
ATOM   2693 C  CB    . SER A 1 420 ? 95.509  107.285 59.131  1.00 30.00  ? 420  SER A CB    1 
ATOM   2694 O  OG    . SER A 1 420 ? 95.921  108.622 59.355  1.00 30.00  ? 420  SER A OG    1 
ATOM   2695 N  N     . THR A 1 421 ? 95.062  108.017 62.293  1.00 56.25  ? 421  THR A N     1 
ATOM   2696 C  CA    . THR A 1 421 ? 95.441  108.115 63.688  1.00 56.25  ? 421  THR A CA    1 
ATOM   2697 C  C     . THR A 1 421 ? 94.171  108.346 64.482  1.00 56.25  ? 421  THR A C     1 
ATOM   2698 O  O     . THR A 1 421 ? 93.847  109.467 64.866  1.00 56.25  ? 421  THR A O     1 
ATOM   2699 C  CB    . THR A 1 421 ? 96.432  109.261 63.943  1.00 56.25  ? 421  THR A CB    1 
ATOM   2700 O  OG1   . THR A 1 421 ? 95.817  110.508 63.600  1.00 56.25  ? 421  THR A OG1   1 
ATOM   2701 C  CG2   . THR A 1 421 ? 97.686  109.079 63.107  1.00 56.25  ? 421  THR A CG2   1 
ATOM   2702 N  N     . GLY A 1 422 ? 93.456  107.253 64.713  1.00 51.50  ? 422  GLY A N     1 
ATOM   2703 C  CA    . GLY A 1 422 ? 92.295  107.228 65.573  1.00 51.50  ? 422  GLY A CA    1 
ATOM   2704 C  C     . GLY A 1 422 ? 92.337  105.969 66.405  1.00 51.50  ? 422  GLY A C     1 
ATOM   2705 O  O     . GLY A 1 422 ? 91.567  105.805 67.350  1.00 51.50  ? 422  GLY A O     1 
ATOM   2706 N  N     . ILE A 1 423 ? 93.244  105.069 66.038  1.00 48.81  ? 423  ILE A N     1 
ATOM   2707 C  CA    . ILE A 1 423 ? 93.469  103.832 66.775  1.00 48.81  ? 423  ILE A CA    1 
ATOM   2708 C  C     . ILE A 1 423 ? 94.584  104.005 67.794  1.00 48.81  ? 423  ILE A C     1 
ATOM   2709 O  O     . ILE A 1 423 ? 94.494  103.499 68.913  1.00 48.81  ? 423  ILE A O     1 
ATOM   2710 C  CB    . ILE A 1 423 ? 93.769  102.695 65.778  1.00 48.81  ? 423  ILE A CB    1 
ATOM   2711 C  CG1   . ILE A 1 423 ? 92.567  102.470 64.871  1.00 48.81  ? 423  ILE A CG1   1 
ATOM   2712 C  CG2   . ILE A 1 423 ? 94.103  101.401 66.481  1.00 48.81  ? 423  ILE A CG2   1 
ATOM   2713 C  CD1   . ILE A 1 423 ? 92.846  101.536 63.741  1.00 48.81  ? 423  ILE A CD1   1 
ATOM   2714 N  N     . GLN A 1 424 ? 95.625  104.756 67.433  1.00 45.56  ? 424  GLN A N     1 
ATOM   2715 C  CA    . GLN A 1 424 ? 96.678  105.094 68.383  1.00 45.56  ? 424  GLN A CA    1 
ATOM   2716 C  C     . GLN A 1 424 ? 96.158  105.998 69.497  1.00 45.56  ? 424  GLN A C     1 
ATOM   2717 O  O     . GLN A 1 424 ? 96.676  105.963 70.618  1.00 45.56  ? 424  GLN A O     1 
ATOM   2718 C  CB    . GLN A 1 424 ? 97.841  105.748 67.634  1.00 45.56  ? 424  GLN A CB    1 
ATOM   2719 C  CG    . GLN A 1 424 ? 99.077  106.028 68.468  1.00 45.56  ? 424  GLN A CG    1 
ATOM   2720 C  CD    . GLN A 1 424 ? 99.717  104.763 68.999  1.00 45.56  ? 424  GLN A CD    1 
ATOM   2721 O  OE1   . GLN A 1 424 ? 99.803  103.754 68.298  1.00 45.56  ? 424  GLN A OE1   1 
ATOM   2722 N  NE2   . GLN A 1 424 ? 100.171 104.811 70.246  1.00 45.56  ? 424  GLN A NE2   1 
ATOM   2723 N  N     . ASN A 1 425 ? 95.125  106.795 69.218  1.00 44.87  ? 425  ASN A N     1 
ATOM   2724 C  CA    . ASN A 1 425 ? 94.466  107.539 70.283  1.00 44.87  ? 425  ASN A CA    1 
ATOM   2725 C  C     . ASN A 1 425 ? 93.624  106.618 71.157  1.00 44.87  ? 425  ASN A C     1 
ATOM   2726 O  O     . ASN A 1 425 ? 93.671  106.715 72.387  1.00 44.87  ? 425  ASN A O     1 
ATOM   2727 C  CB    . ASN A 1 425 ? 93.604  108.656 69.696  1.00 44.87  ? 425  ASN A CB    1 
ATOM   2728 C  CG    . ASN A 1 425 ? 94.422  109.705 68.970  1.00 44.87  ? 425  ASN A CG    1 
ATOM   2729 O  OD1   . ASN A 1 425 ? 94.297  109.876 67.759  1.00 44.87  ? 425  ASN A OD1   1 
ATOM   2730 N  ND2   . ASN A 1 425 ? 95.268  110.413 69.707  1.00 44.87  ? 425  ASN A ND2   1 
ATOM   2731 N  N     . ARG A 1 426 ? 92.856  105.714 70.543  1.00 44.92  ? 426  ARG A N     1 
ATOM   2732 C  CA    . ARG A 1 426 ? 91.994  104.821 71.312  1.00 44.92  ? 426  ARG A CA    1 
ATOM   2733 C  C     . ARG A 1 426 ? 92.794  103.754 72.044  1.00 44.92  ? 426  ARG A C     1 
ATOM   2734 O  O     . ARG A 1 426 ? 92.479  103.421 73.186  1.00 44.92  ? 426  ARG A O     1 
ATOM   2735 C  CB    . ARG A 1 426 ? 90.957  104.163 70.406  1.00 44.92  ? 426  ARG A CB    1 
ATOM   2736 C  CG    . ARG A 1 426 ? 89.825  105.052 69.978  1.00 44.92  ? 426  ARG A CG    1 
ATOM   2737 C  CD    . ARG A 1 426 ? 88.933  104.334 68.990  1.00 44.92  ? 426  ARG A CD    1 
ATOM   2738 N  NE    . ARG A 1 426 ? 87.801  105.154 68.579  1.00 44.92  ? 426  ARG A NE    1 
ATOM   2739 C  CZ    . ARG A 1 426 ? 87.833  105.997 67.557  1.00 44.92  ? 426  ARG A CZ    1 
ATOM   2740 N  NH1   . ARG A 1 426 ? 86.760  106.707 67.243  1.00 44.92  ? 426  ARG A NH1   1 
ATOM   2741 N  NH2   . ARG A 1 426 ? 88.946  106.141 66.851  1.00 44.92  ? 426  ARG A NH2   1 
ATOM   2742 N  N     . ALA A 1 427 ? 93.823  103.195 71.417  1.00 37.32  ? 427  ALA A N     1 
ATOM   2743 C  CA    . ALA A 1 427 ? 94.646  102.229 72.132  1.00 37.32  ? 427  ALA A CA    1 
ATOM   2744 C  C     . ALA A 1 427 ? 95.680  102.888 73.023  1.00 37.32  ? 427  ALA A C     1 
ATOM   2745 O  O     . ALA A 1 427 ? 96.435  102.183 73.692  1.00 37.32  ? 427  ALA A O     1 
ATOM   2746 C  CB    . ALA A 1 427 ? 95.347  101.287 71.161  1.00 37.32  ? 427  ALA A CB    1 
ATOM   2747 N  N     . GLY A 1 428 ? 95.748  104.209 73.033  1.00 35.76  ? 428  GLY A N     1 
ATOM   2748 C  CA    . GLY A 1 428 ? 96.629  104.912 73.932  1.00 35.76  ? 428  GLY A CA    1 
ATOM   2749 C  C     . GLY A 1 428 ? 95.863  105.480 75.100  1.00 35.76  ? 428  GLY A C     1 
ATOM   2750 O  O     . GLY A 1 428 ? 96.442  105.732 76.155  1.00 35.76  ? 428  GLY A O     1 
ATOM   2751 N  N     . VAL A 1 429 ? 94.558  105.694 74.929  1.00 34.00  ? 429  VAL A N     1 
ATOM   2752 C  CA    . VAL A 1 429 ? 93.761  106.153 76.059  1.00 34.00  ? 429  VAL A CA    1 
ATOM   2753 C  C     . VAL A 1 429 ? 93.436  104.984 76.982  1.00 34.00  ? 429  VAL A C     1 
ATOM   2754 O  O     . VAL A 1 429 ? 93.420  105.148 78.203  1.00 34.00  ? 429  VAL A O     1 
ATOM   2755 C  CB    . VAL A 1 429 ? 92.504  106.916 75.582  1.00 34.00  ? 429  VAL A CB    1 
ATOM   2756 C  CG1   . VAL A 1 429 ? 91.536  106.056 74.825  1.00 34.00  ? 429  VAL A CG1   1 
ATOM   2757 C  CG2   . VAL A 1 429 ? 91.782  107.521 76.727  1.00 34.00  ? 429  VAL A CG2   1 
ATOM   2758 N  N     . LEU A 1 430 ? 93.271  103.774 76.438  1.00 28.88  ? 430  LEU A N     1 
ATOM   2759 C  CA    . LEU A 1 430 ? 92.989  102.604 77.259  1.00 28.88  ? 430  LEU A CA    1 
ATOM   2760 C  C     . LEU A 1 430 ? 94.208  102.138 78.031  1.00 28.88  ? 430  LEU A C     1 
ATOM   2761 O  O     . LEU A 1 430 ? 94.070  101.351 78.968  1.00 28.88  ? 430  LEU A O     1 
ATOM   2762 C  CB    . LEU A 1 430 ? 92.490  101.456 76.393  1.00 28.88  ? 430  LEU A CB    1 
ATOM   2763 C  CG    . LEU A 1 430 ? 91.210  101.642 75.591  1.00 28.88  ? 430  LEU A CG    1 
ATOM   2764 C  CD1   . LEU A 1 430 ? 91.058  100.452 74.700  1.00 28.88  ? 430  LEU A CD1   1 
ATOM   2765 C  CD2   . LEU A 1 430 ? 90.006  101.799 76.465  1.00 28.88  ? 430  LEU A CD2   1 
ATOM   2766 N  N     . PHE A 1 431 ? 95.397  102.584 77.644  1.00 25.78  ? 431  PHE A N     1 
ATOM   2767 C  CA    . PHE A 1 431 ? 96.592  102.233 78.392  1.00 25.78  ? 431  PHE A CA    1 
ATOM   2768 C  C     . PHE A 1 431 ? 96.692  103.031 79.681  1.00 25.78  ? 431  PHE A C     1 
ATOM   2769 O  O     . PHE A 1 431 ? 97.138  102.503 80.701  1.00 25.78  ? 431  PHE A O     1 
ATOM   2770 C  CB    . PHE A 1 431 ? 97.828  102.452 77.531  1.00 25.78  ? 431  PHE A CB    1 
ATOM   2771 C  CG    . PHE A 1 431 ? 99.106  102.088 78.210  1.00 25.78  ? 431  PHE A CG    1 
ATOM   2772 C  CD1   . PHE A 1 431 ? 99.458  100.762 78.381  1.00 25.78  ? 431  PHE A CD1   1 
ATOM   2773 C  CD2   . PHE A 1 431 ? 99.962  103.072 78.670  1.00 25.78  ? 431  PHE A CD2   1 
ATOM   2774 C  CE1   . PHE A 1 431 ? 100.636 100.428 79.002  1.00 25.78  ? 431  PHE A CE1   1 
ATOM   2775 C  CE2   . PHE A 1 431 ? 101.137 102.745 79.290  1.00 25.78  ? 431  PHE A CE2   1 
ATOM   2776 C  CZ    . PHE A 1 431 ? 101.476 101.423 79.456  1.00 25.78  ? 431  PHE A CZ    1 
ATOM   2777 N  N     . PHE A 1 432 ? 96.289  104.299 79.663  1.00 24.38  ? 432  PHE A N     1 
ATOM   2778 C  CA    . PHE A 1 432 ? 96.328  105.086 80.884  1.00 24.38  ? 432  PHE A CA    1 
ATOM   2779 C  C     . PHE A 1 432 ? 95.125  104.842 81.776  1.00 24.38  ? 432  PHE A C     1 
ATOM   2780 O  O     . PHE A 1 432 ? 95.145  105.257 82.937  1.00 24.38  ? 432  PHE A O     1 
ATOM   2781 C  CB    . PHE A 1 432 ? 96.427  106.575 80.571  1.00 24.38  ? 432  PHE A CB    1 
ATOM   2782 C  CG    . PHE A 1 432 ? 97.685  106.958 79.861  1.00 24.38  ? 432  PHE A CG    1 
ATOM   2783 C  CD1   . PHE A 1 432 ? 98.901  106.910 80.510  1.00 24.38  ? 432  PHE A CD1   1 
ATOM   2784 C  CD2   . PHE A 1 432 ? 97.645  107.420 78.563  1.00 24.38  ? 432  PHE A CD2   1 
ATOM   2785 C  CE1   . PHE A 1 432 ? 100.059 107.267 79.857  1.00 24.38  ? 432  PHE A CE1   1 
ATOM   2786 C  CE2   . PHE A 1 432 ? 98.799  107.785 77.910  1.00 24.38  ? 432  PHE A CE2   1 
ATOM   2787 C  CZ    . PHE A 1 432 ? 100.003 107.709 78.556  1.00 24.38  ? 432  PHE A CZ    1 
ATOM   2788 N  N     . LEU A 1 433 ? 94.079  104.198 81.262  1.00 23.75  ? 433  LEU A N     1 
ATOM   2789 C  CA    . LEU A 1 433 ? 92.984  103.778 82.122  1.00 23.75  ? 433  LEU A CA    1 
ATOM   2790 C  C     . LEU A 1 433 ? 93.380  102.577 82.960  1.00 23.75  ? 433  LEU A C     1 
ATOM   2791 O  O     . LEU A 1 433 ? 92.938  102.453 84.104  1.00 23.75  ? 433  LEU A O     1 
ATOM   2792 C  CB    . LEU A 1 433 ? 91.756  103.436 81.288  1.00 23.75  ? 433  LEU A CB    1 
ATOM   2793 C  CG    . LEU A 1 433 ? 91.121  104.515 80.419  1.00 23.75  ? 433  LEU A CG    1 
ATOM   2794 C  CD1   . LEU A 1 433 ? 90.057  103.895 79.574  1.00 23.75  ? 433  LEU A CD1   1 
ATOM   2795 C  CD2   . LEU A 1 433 ? 90.548  105.648 81.206  1.00 23.75  ? 433  LEU A CD2   1 
ATOM   2796 N  N     . THR A 1 434 ? 94.201  101.680 82.409  1.00 22.31  ? 434  THR A N     1 
ATOM   2797 C  CA    . THR A 1 434 ? 94.637  100.509 83.158  1.00 22.31  ? 434  THR A CA    1 
ATOM   2798 C  C     . THR A 1 434 ? 95.795  100.833 84.084  1.00 22.31  ? 434  THR A C     1 
ATOM   2799 O  O     . THR A 1 434 ? 95.826  100.358 85.221  1.00 22.31  ? 434  THR A O     1 
ATOM   2800 C  CB    . THR A 1 434 ? 95.042  99.381  82.216  1.00 22.31  ? 434  THR A CB    1 
ATOM   2801 O  OG1   . THR A 1 434 ? 96.120  99.819  81.388  1.00 22.31  ? 434  THR A OG1   1 
ATOM   2802 C  CG2   . THR A 1 434 ? 93.899  98.991  81.353  1.00 22.31  ? 434  THR A CG2   1 
ATOM   2803 N  N     . THR A 1 435 ? 96.756  101.631 83.629  1.00 21.54  ? 435  THR A N     1 
ATOM   2804 C  CA    . THR A 1 435 ? 97.850  102.000 84.513  1.00 21.54  ? 435  THR A CA    1 
ATOM   2805 C  C     . THR A 1 435 ? 97.444  103.036 85.547  1.00 21.54  ? 435  THR A C     1 
ATOM   2806 O  O     . THR A 1 435 ? 98.205  103.279 86.480  1.00 21.54  ? 435  THR A O     1 
ATOM   2807 C  CB    . THR A 1 435 ? 99.055  102.503 83.717  1.00 21.54  ? 435  THR A CB    1 
ATOM   2808 O  OG1   . THR A 1 435 ? 98.706  103.678 82.986  1.00 21.54  ? 435  THR A OG1   1 
ATOM   2809 C  CG2   . THR A 1 435 ? 99.511  101.444 82.755  1.00 21.54  ? 435  THR A CG2   1 
ATOM   2810 N  N     . ASN A 1 436 ? 96.272  103.651 85.428  1.00 22.56  ? 436  ASN A N     1 
ATOM   2811 C  CA    . ASN A 1 436 ? 95.733  104.349 86.585  1.00 22.56  ? 436  ASN A CA    1 
ATOM   2812 C  C     . ASN A 1 436 ? 95.331  103.350 87.653  1.00 22.56  ? 436  ASN A C     1 
ATOM   2813 O  O     . ASN A 1 436 ? 95.744  103.465 88.807  1.00 22.56  ? 436  ASN A O     1 
ATOM   2814 C  CB    . ASN A 1 436 ? 94.528  105.200 86.205  1.00 22.56  ? 436  ASN A CB    1 
ATOM   2815 C  CG    . ASN A 1 436 ? 94.103  106.124 87.327  1.00 22.56  ? 436  ASN A CG    1 
ATOM   2816 O  OD1   . ASN A 1 436 ? 94.797  106.266 88.327  1.00 22.56  ? 436  ASN A OD1   1 
ATOM   2817 N  ND2   . ASN A 1 436 ? 92.937  106.731 87.181  1.00 22.56  ? 436  ASN A ND2   1 
ATOM   2818 N  N     . GLN A 1 437 ? 94.529  102.358 87.275  1.00 21.41  ? 437  GLN A N     1 
ATOM   2819 C  CA    . GLN A 1 437 ? 93.935  101.449 88.244  1.00 21.41  ? 437  GLN A CA    1 
ATOM   2820 C  C     . GLN A 1 437 ? 94.968  100.513 88.849  1.00 21.41  ? 437  GLN A C     1 
ATOM   2821 O  O     . GLN A 1 437 ? 94.794  100.052 89.978  1.00 21.41  ? 437  GLN A O     1 
ATOM   2822 C  CB    . GLN A 1 437 ? 92.823  100.657 87.571  1.00 21.41  ? 437  GLN A CB    1 
ATOM   2823 C  CG    . GLN A 1 437 ? 91.714  101.508 87.009  1.00 21.41  ? 437  GLN A CG    1 
ATOM   2824 C  CD    . GLN A 1 437 ? 90.966  102.263 88.073  1.00 21.41  ? 437  GLN A CD    1 
ATOM   2825 O  OE1   . GLN A 1 437 ? 91.095  103.477 88.201  1.00 21.41  ? 437  GLN A OE1   1 
ATOM   2826 N  NE2   . GLN A 1 437 ? 90.166  101.547 88.844  1.00 21.41  ? 437  GLN A NE2   1 
ATOM   2827 N  N     . CYS A 1 438 ? 96.047  100.228 88.126  1.00 20.12  ? 438  CYS A N     1 
ATOM   2828 C  CA    . CYS A 1 438 ? 97.129  99.434  88.693  1.00 20.12  ? 438  CYS A CA    1 
ATOM   2829 C  C     . CYS A 1 438 ? 97.952  100.253 89.680  1.00 20.12  ? 438  CYS A C     1 
ATOM   2830 O  O     . CYS A 1 438 ? 98.063  99.896  90.855  1.00 20.12  ? 438  CYS A O     1 
ATOM   2831 C  CB    . CYS A 1 438 ? 98.006  98.882  87.571  1.00 20.12  ? 438  CYS A CB    1 
ATOM   2832 S  SG    . CYS A 1 438 ? 97.172  97.652  86.547  1.00 20.12  ? 438  CYS A SG    1 
ATOM   2833 N  N     . PHE A 1 439 ? 98.521  101.370 89.223  1.00 20.36  ? 439  PHE A N     1 
ATOM   2834 C  CA    . PHE A 1 439 ? 99.413  102.165 90.061  1.00 20.36  ? 439  PHE A CA    1 
ATOM   2835 C  C     . PHE A 1 439 ? 98.707  102.857 91.221  1.00 20.36  ? 439  PHE A C     1 
ATOM   2836 O  O     . PHE A 1 439 ? 99.374  103.217 92.192  1.00 20.36  ? 439  PHE A O     1 
ATOM   2837 C  CB    . PHE A 1 439 ? 100.152 103.209 89.220  1.00 20.36  ? 439  PHE A CB    1 
ATOM   2838 C  CG    . PHE A 1 439 ? 101.267 102.643 88.391  1.00 20.36  ? 439  PHE A CG    1 
ATOM   2839 C  CD1   . PHE A 1 439 ? 102.484 102.357 88.969  1.00 20.36  ? 439  PHE A CD1   1 
ATOM   2840 C  CD2   . PHE A 1 439 ? 101.104 102.395 87.041  1.00 20.36  ? 439  PHE A CD2   1 
ATOM   2841 C  CE1   . PHE A 1 439 ? 103.516 101.854 88.210  1.00 20.36  ? 439  PHE A CE1   1 
ATOM   2842 C  CE2   . PHE A 1 439 ? 102.121 101.876 86.282  1.00 20.36  ? 439  PHE A CE2   1 
ATOM   2843 C  CZ    . PHE A 1 439 ? 103.326 101.600 86.864  1.00 20.36  ? 439  PHE A CZ    1 
ATOM   2844 N  N     . SER A 1 440 ? 97.389  103.049 91.162  1.00 19.66  ? 440  SER A N     1 
ATOM   2845 C  CA    . SER A 1 440 ? 96.680  103.614 92.305  1.00 19.66  ? 440  SER A CA    1 
ATOM   2846 C  C     . SER A 1 440 ? 96.479  102.616 93.433  1.00 19.66  ? 440  SER A C     1 
ATOM   2847 O  O     . SER A 1 440 ? 96.054  103.014 94.523  1.00 19.66  ? 440  SER A O     1 
ATOM   2848 C  CB    . SER A 1 440 ? 95.316  104.157 91.890  1.00 19.66  ? 440  SER A CB    1 
ATOM   2849 O  OG    . SER A 1 440 ? 94.609  104.651 93.006  1.00 19.66  ? 440  SER A OG    1 
ATOM   2850 N  N     . SER A 1 441 ? 96.769  101.342 93.204  1.00 17.46  ? 441  SER A N     1 
ATOM   2851 C  CA    . SER A 1 441 ? 96.582  100.297 94.193  1.00 17.46  ? 441  SER A CA    1 
ATOM   2852 C  C     . SER A 1 441 ? 97.792  100.110 95.093  1.00 17.46  ? 441  SER A C     1 
ATOM   2853 O  O     . SER A 1 441 ? 97.820  99.164  95.881  1.00 17.46  ? 441  SER A O     1 
ATOM   2854 C  CB    . SER A 1 441 ? 96.237  98.988  93.496  1.00 17.46  ? 441  SER A CB    1 
ATOM   2855 O  OG    . SER A 1 441 ? 95.016  99.102  92.794  1.00 17.46  ? 441  SER A OG    1 
ATOM   2856 N  N     . VAL A 1 442 ? 98.789  100.990 95.003  1.00 17.80  ? 442  VAL A N     1 
ATOM   2857 C  CA    . VAL A 1 442 ? 99.910  100.948 95.928  1.00 17.80  ? 442  VAL A CA    1 
ATOM   2858 C  C     . VAL A 1 442 ? 99.488  101.470 97.300  1.00 17.80  ? 442  VAL A C     1 
ATOM   2859 O  O     . VAL A 1 442 ? 100.096 101.125 98.315  1.00 17.80  ? 442  VAL A O     1 
ATOM   2860 C  CB    . VAL A 1 442 ? 101.087 101.724 95.295  1.00 17.80  ? 442  VAL A CB    1 
ATOM   2861 C  CG1   . VAL A 1 442 ? 102.343 101.692 96.144  1.00 17.80  ? 442  VAL A CG1   1 
ATOM   2862 C  CG2   . VAL A 1 442 ? 101.393 101.168 93.918  1.00 17.80  ? 442  VAL A CG2   1 
ATOM   2863 N  N     . SER A 1 443 ? 98.405  102.241 97.374  1.00 17.51  ? 443  SER A N     1 
ATOM   2864 C  CA    . SER A 1 443 ? 97.880  102.702 98.654  1.00 17.51  ? 443  SER A CA    1 
ATOM   2865 C  C     . SER A 1 443 ? 97.242  101.593 99.486  1.00 17.51  ? 443  SER A C     1 
ATOM   2866 O  O     . SER A 1 443 ? 96.918  101.833 100.653 1.00 17.51  ? 443  SER A O     1 
ATOM   2867 C  CB    . SER A 1 443 ? 96.857  103.807 98.415  1.00 17.51  ? 443  SER A CB    1 
ATOM   2868 O  OG    . SER A 1 443 ? 95.704  103.293 97.773  1.00 17.51  ? 443  SER A OG    1 
ATOM   2869 N  N     . ALA A 1 444 ? 97.030  100.402 98.923  1.00 16.31  ? 444  ALA A N     1 
ATOM   2870 C  CA    . ALA A 1 444 ? 96.530  99.265  99.684  1.00 16.31  ? 444  ALA A CA    1 
ATOM   2871 C  C     . ALA A 1 444 ? 97.628  98.523  100.422 1.00 16.31  ? 444  ALA A C     1 
ATOM   2872 O  O     . ALA A 1 444 ? 97.336  97.538  101.099 1.00 16.31  ? 444  ALA A O     1 
ATOM   2873 C  CB    . ALA A 1 444 ? 95.794  98.291  98.769  1.00 16.31  ? 444  ALA A CB    1 
ATOM   2874 N  N     . VAL A 1 445 ? 98.876  98.963  100.288 1.00 15.43  ? 445  VAL A N     1 
ATOM   2875 C  CA    . VAL A 1 445 ? 99.981  98.394  101.048 1.00 15.43  ? 445  VAL A CA    1 
ATOM   2876 C  C     . VAL A 1 445 ? 99.814  98.693  102.535 1.00 15.43  ? 445  VAL A C     1 
ATOM   2877 O  O     . VAL A 1 445 ? 100.089 97.843  103.389 1.00 15.43  ? 445  VAL A O     1 
ATOM   2878 C  CB    . VAL A 1 445 ? 101.305 98.927  100.464 1.00 15.43  ? 445  VAL A CB    1 
ATOM   2879 C  CG1   . VAL A 1 445 ? 102.468 98.633  101.329 1.00 15.43  ? 445  VAL A CG1   1 
ATOM   2880 C  CG2   . VAL A 1 445 ? 101.550 98.294  99.110  1.00 15.43  ? 445  VAL A CG2   1 
ATOM   2881 N  N     . GLU A 1 446 ? 99.271  99.860  102.861 1.00 16.39  ? 446  GLU A N     1 
ATOM   2882 C  CA    . GLU A 1 446 ? 99.116  100.322 104.233 1.00 16.39  ? 446  GLU A CA    1 
ATOM   2883 C  C     . GLU A 1 446 ? 97.873  99.785  104.936 1.00 16.39  ? 446  GLU A C     1 
ATOM   2884 O  O     . GLU A 1 446 ? 97.556  100.266 106.024 1.00 16.39  ? 446  GLU A O     1 
ATOM   2885 C  CB    . GLU A 1 446 ? 99.077  101.847 104.265 1.00 16.39  ? 446  GLU A CB    1 
ATOM   2886 C  CG    . GLU A 1 446 ? 100.374 102.499 103.873 1.00 16.39  ? 446  GLU A CG    1 
ATOM   2887 C  CD    . GLU A 1 446 ? 100.496 102.778 102.386 1.00 16.39  ? 446  GLU A CD    1 
ATOM   2888 O  OE1   . GLU A 1 446 ? 99.508  102.584 101.658 1.00 16.39  ? 446  GLU A OE1   1 
ATOM   2889 O  OE2   . GLU A 1 446 ? 101.588 103.185 101.942 1.00 16.39  ? 446  GLU A OE2   1 
ATOM   2890 N  N     . LEU A 1 447 ? 97.165  98.812  104.365 1.00 12.48  ? 447  LEU A N     1 
ATOM   2891 C  CA    . LEU A 1 447 ? 95.925  98.352  104.982 1.00 12.48  ? 447  LEU A CA    1 
ATOM   2892 C  C     . LEU A 1 447 ? 96.197  97.517  106.224 1.00 12.48  ? 447  LEU A C     1 
ATOM   2893 O  O     . LEU A 1 447 ? 95.533  97.684  107.251 1.00 12.48  ? 447  LEU A O     1 
ATOM   2894 C  CB    . LEU A 1 447 ? 95.106  97.550  103.973 1.00 12.48  ? 447  LEU A CB    1 
ATOM   2895 C  CG    . LEU A 1 447 ? 93.739  97.070  104.455 1.00 12.48  ? 447  LEU A CG    1 
ATOM   2896 C  CD1   . LEU A 1 447 ? 92.840  98.252  104.713 1.00 12.48  ? 447  LEU A CD1   1 
ATOM   2897 C  CD2   . LEU A 1 447 ? 93.105  96.120  103.472 1.00 12.48  ? 447  LEU A CD2   1 
ATOM   2898 N  N     . PHE A 1 448 ? 97.181  96.628  106.151 1.00 10.12  ? 448  PHE A N     1 
ATOM   2899 C  CA    . PHE A 1 448 ? 97.502  95.685  107.210 1.00 10.12  ? 448  PHE A CA    1 
ATOM   2900 C  C     . PHE A 1 448 ? 98.745  96.074  107.996 1.00 10.12  ? 448  PHE A C     1 
ATOM   2901 O  O     . PHE A 1 448 ? 99.101  95.377  108.947 1.00 10.12  ? 448  PHE A O     1 
ATOM   2902 C  CB    . PHE A 1 448 ? 97.688  94.294  106.601 1.00 10.12  ? 448  PHE A CB    1 
ATOM   2903 C  CG    . PHE A 1 448 ? 96.419  93.678  106.101 1.00 10.12  ? 448  PHE A CG    1 
ATOM   2904 C  CD1   . PHE A 1 448 ? 95.206  94.005  106.665 1.00 10.12  ? 448  PHE A CD1   1 
ATOM   2905 C  CD2   . PHE A 1 448 ? 96.435  92.812  105.024 1.00 10.12  ? 448  PHE A CD2   1 
ATOM   2906 C  CE1   . PHE A 1 448 ? 94.043  93.449  106.202 1.00 10.12  ? 448  PHE A CE1   1 
ATOM   2907 C  CE2   . PHE A 1 448 ? 95.267  92.262  104.552 1.00 10.12  ? 448  PHE A CE2   1 
ATOM   2908 C  CZ    . PHE A 1 448 ? 94.070  92.588  105.144 1.00 10.12  ? 448  PHE A CZ    1 
ATOM   2909 N  N     . VAL A 1 449 ? 99.409  97.163  107.622 1.00 12.12  ? 449  VAL A N     1 
ATOM   2910 C  CA    . VAL A 1 449 ? 100.664 97.572  108.233 1.00 12.12  ? 449  VAL A CA    1 
ATOM   2911 C  C     . VAL A 1 449 ? 100.445 98.608  109.325 1.00 12.12  ? 449  VAL A C     1 
ATOM   2912 O  O     . VAL A 1 449 ? 101.057 98.527  110.390 1.00 12.12  ? 449  VAL A O     1 
ATOM   2913 C  CB    . VAL A 1 449 ? 101.620 98.112  107.148 1.00 12.12  ? 449  VAL A CB    1 
ATOM   2914 C  CG1   . VAL A 1 449 ? 102.913 98.603  107.766 1.00 12.12  ? 449  VAL A CG1   1 
ATOM   2915 C  CG2   . VAL A 1 449 ? 101.889 97.063  106.095 1.00 12.12  ? 449  VAL A CG2   1 
ATOM   2916 N  N     . VAL A 1 450 ? 99.565  99.578  109.065 1.00 12.23  ? 450  VAL A N     1 
ATOM   2917 C  CA    . VAL A 1 450 ? 99.285  100.667 109.997 1.00 12.23  ? 450  VAL A CA    1 
ATOM   2918 C  C     . VAL A 1 450 ? 98.683  100.143 111.296 1.00 12.23  ? 450  VAL A C     1 
ATOM   2919 O  O     . VAL A 1 450 ? 98.993  100.648 112.382 1.00 12.23  ? 450  VAL A O     1 
ATOM   2920 C  CB    . VAL A 1 450 ? 98.377  101.697 109.291 1.00 12.23  ? 450  VAL A CB    1 
ATOM   2921 C  CG1   . VAL A 1 450 ? 97.934  102.799 110.217 1.00 12.23  ? 450  VAL A CG1   1 
ATOM   2922 C  CG2   . VAL A 1 450 ? 99.114  102.296 108.121 1.00 12.23  ? 450  VAL A CG2   1 
ATOM   2923 N  N     . GLU A 1 451 ? 97.880  99.086  111.225 1.00 12.15  ? 451  GLU A N     1 
ATOM   2924 C  CA    . GLU A 1 451 ? 97.294  98.477  112.411 1.00 12.15  ? 451  GLU A CA    1 
ATOM   2925 C  C     . GLU A 1 451 ? 97.815  97.064  112.645 1.00 12.15  ? 451  GLU A C     1 
ATOM   2926 O  O     . GLU A 1 451 ? 97.052  96.152  112.958 1.00 12.15  ? 451  GLU A O     1 
ATOM   2927 C  CB    . GLU A 1 451 ? 95.773  98.474  112.323 1.00 12.15  ? 451  GLU A CB    1 
ATOM   2928 C  CG    . GLU A 1 451 ? 95.163  99.863  112.295 1.00 12.15  ? 451  GLU A CG    1 
ATOM   2929 C  CD    . GLU A 1 451 ? 95.414  100.650 113.563 1.00 12.15  ? 451  GLU A CD    1 
ATOM   2930 O  OE1   . GLU A 1 451 ? 95.469  100.048 114.652 1.00 12.15  ? 451  GLU A OE1   1 
ATOM   2931 O  OE2   . GLU A 1 451 ? 95.563  101.883 113.468 1.00 12.15  ? 451  GLU A OE2   1 
ATOM   2932 N  N     . LYS A 1 452 ? 99.124  96.869  112.490 1.00 10.04  ? 452  LYS A N     1 
ATOM   2933 C  CA    . LYS A 1 452 ? 99.707  95.559  112.753 1.00 10.04  ? 452  LYS A CA    1 
ATOM   2934 C  C     . LYS A 1 452 ? 99.762  95.273  114.245 1.00 10.04  ? 452  LYS A C     1 
ATOM   2935 O  O     . LYS A 1 452 ? 99.482  94.151  114.675 1.00 10.04  ? 452  LYS A O     1 
ATOM   2936 C  CB    . LYS A 1 452 ? 101.104 95.467  112.147 1.00 10.04  ? 452  LYS A CB    1 
ATOM   2937 C  CG    . LYS A 1 452 ? 101.757 94.116  112.332 1.00 10.04  ? 452  LYS A CG    1 
ATOM   2938 C  CD    . LYS A 1 452 ? 103.173 94.109  111.830 1.00 10.04  ? 452  LYS A CD    1 
ATOM   2939 C  CE    . LYS A 1 452 ? 103.855 92.811  112.169 1.00 10.04  ? 452  LYS A CE    1 
ATOM   2940 N  NZ    . LYS A 1 452 ? 105.278 92.825  111.762 1.00 10.04  ? 452  LYS A NZ    1 
ATOM   2941 N  N     . LYS A 1 453 ? 100.117 96.279  115.046 1.00 10.54  ? 453  LYS A N     1 
ATOM   2942 C  CA    . LYS A 1 453 ? 100.249 96.092  116.485 1.00 10.54  ? 453  LYS A CA    1 
ATOM   2943 C  C     . LYS A 1 453 ? 98.900  95.826  117.138 1.00 10.54  ? 453  LYS A C     1 
ATOM   2944 O  O     . LYS A 1 453 ? 98.803  95.021  118.067 1.00 10.54  ? 453  LYS A O     1 
ATOM   2945 C  CB    . LYS A 1 453 ? 100.929 97.319  117.095 1.00 10.54  ? 453  LYS A CB    1 
ATOM   2946 C  CG    . LYS A 1 453 ? 101.125 97.273  118.594 1.00 10.54  ? 453  LYS A CG    1 
ATOM   2947 C  CD    . LYS A 1 453 ? 102.089 96.179  118.972 1.00 10.54  ? 453  LYS A CD    1 
ATOM   2948 C  CE    . LYS A 1 453 ? 102.327 96.141  120.460 1.00 10.54  ? 453  LYS A CE    1 
ATOM   2949 N  NZ    . LYS A 1 453 ? 103.225 95.022  120.843 1.00 10.54  ? 453  LYS A NZ    1 
ATOM   2950 N  N     . LEU A 1 454 ? 97.843  96.458  116.646 1.00 9.22   ? 454  LEU A N     1 
ATOM   2951 C  CA    . LEU A 1 454 ? 96.522  96.197  117.191 1.00 9.22   ? 454  LEU A CA    1 
ATOM   2952 C  C     . LEU A 1 454 ? 95.910  94.914  116.645 1.00 9.22   ? 454  LEU A C     1 
ATOM   2953 O  O     . LEU A 1 454 ? 95.059  94.323  117.310 1.00 9.22   ? 454  LEU A O     1 
ATOM   2954 C  CB    . LEU A 1 454 ? 95.612  97.390  116.919 1.00 9.22   ? 454  LEU A CB    1 
ATOM   2955 C  CG    . LEU A 1 454 ? 94.251  97.464  117.600 1.00 9.22   ? 454  LEU A CG    1 
ATOM   2956 C  CD1   . LEU A 1 454 ? 94.375  97.409  119.110 1.00 9.22   ? 454  LEU A CD1   1 
ATOM   2957 C  CD2   . LEU A 1 454 ? 93.614  98.738  117.188 1.00 9.22   ? 454  LEU A CD2   1 
ATOM   2958 N  N     . PHE A 1 455 ? 96.330  94.456  115.463 1.00 7.75   ? 455  PHE A N     1 
ATOM   2959 C  CA    . PHE A 1 455 ? 95.933  93.127  115.015 1.00 7.75   ? 455  PHE A CA    1 
ATOM   2960 C  C     . PHE A 1 455 ? 96.582  92.042  115.858 1.00 7.75   ? 455  PHE A C     1 
ATOM   2961 O  O     . PHE A 1 455 ? 95.922  91.064  116.218 1.00 7.75   ? 455  PHE A O     1 
ATOM   2962 C  CB    . PHE A 1 455 ? 96.257  92.917  113.534 1.00 7.75   ? 455  PHE A CB    1 
ATOM   2963 C  CG    . PHE A 1 455 ? 96.195  91.470  113.108 1.00 7.75   ? 455  PHE A CG    1 
ATOM   2964 C  CD1   . PHE A 1 455 ? 95.020  90.765  113.139 1.00 7.75   ? 455  PHE A CD1   1 
ATOM   2965 C  CD2   . PHE A 1 455 ? 97.329  90.827  112.665 1.00 7.75   ? 455  PHE A CD2   1 
ATOM   2966 C  CE1   . PHE A 1 455 ? 94.972  89.439  112.772 1.00 7.75   ? 455  PHE A CE1   1 
ATOM   2967 C  CE2   . PHE A 1 455 ? 97.279  89.519  112.286 1.00 7.75   ? 455  PHE A CE2   1 
ATOM   2968 C  CZ    . PHE A 1 455 ? 96.100  88.823  112.340 1.00 7.75   ? 455  PHE A CZ    1 
ATOM   2969 N  N     . ILE A 1 456 ? 97.872  92.179  116.161 1.00 9.38   ? 456  ILE A N     1 
ATOM   2970 C  CA    . ILE A 1 456 ? 98.561  91.156  116.938 1.00 9.38   ? 456  ILE A CA    1 
ATOM   2971 C  C     . ILE A 1 456 ? 98.025  91.113  118.363 1.00 9.38   ? 456  ILE A C     1 
ATOM   2972 O  O     . ILE A 1 456 ? 97.821  90.034  118.923 1.00 9.38   ? 456  ILE A O     1 
ATOM   2973 C  CB    . ILE A 1 456 ? 100.082 91.397  116.887 1.00 9.38   ? 456  ILE A CB    1 
ATOM   2974 C  CG1   . ILE A 1 456 ? 100.606 91.176  115.471 1.00 9.38   ? 456  ILE A CG1   1 
ATOM   2975 C  CG2   . ILE A 1 456 ? 100.824 90.493  117.846 1.00 9.38   ? 456  ILE A CG2   1 
ATOM   2976 C  CD1   . ILE A 1 456 ? 102.022 91.628  115.290 1.00 9.38   ? 456  ILE A CD1   1 
ATOM   2977 N  N     . HIS A 1 457 ? 97.708  92.279  118.936 1.00 9.18   ? 457  HIS A N     1 
ATOM   2978 C  CA    . HIS A 1 457 ? 97.171  92.354  120.293 1.00 9.18   ? 457  HIS A CA    1 
ATOM   2979 C  C     . HIS A 1 457 ? 95.773  91.758  120.387 1.00 9.18   ? 457  HIS A C     1 
ATOM   2980 O  O     . HIS A 1 457 ? 95.495  90.944  121.270 1.00 9.18   ? 457  HIS A O     1 
ATOM   2981 C  CB    . HIS A 1 457 ? 97.156  93.806  120.758 1.00 9.18   ? 457  HIS A CB    1 
ATOM   2982 C  CG    . HIS A 1 457 ? 96.609  93.998  122.138 1.00 9.18   ? 457  HIS A CG    1 
ATOM   2983 N  ND1   . HIS A 1 457 ? 95.272  94.216  122.383 1.00 9.18   ? 457  HIS A ND1   1 
ATOM   2984 C  CD2   . HIS A 1 457 ? 97.217  94.004  123.345 1.00 9.18   ? 457  HIS A CD2   1 
ATOM   2985 C  CE1   . HIS A 1 457 ? 95.079  94.345  123.680 1.00 9.18   ? 457  HIS A CE1   1 
ATOM   2986 N  NE2   . HIS A 1 457 ? 96.244  94.222  124.287 1.00 9.18   ? 457  HIS A NE2   1 
ATOM   2987 N  N     . GLU A 1 458 ? 94.878  92.155  119.489 1.00 8.38   ? 458  GLU A N     1 
ATOM   2988 C  CA    . GLU A 1 458 ? 93.497  91.703  119.539 1.00 8.38   ? 458  GLU A CA    1 
ATOM   2989 C  C     . GLU A 1 458 ? 93.302  90.282  119.045 1.00 8.38   ? 458  GLU A C     1 
ATOM   2990 O  O     . GLU A 1 458 ? 92.226  89.719  119.258 1.00 8.38   ? 458  GLU A O     1 
ATOM   2991 C  CB    . GLU A 1 458 ? 92.617  92.637  118.723 1.00 8.38   ? 458  GLU A CB    1 
ATOM   2992 C  CG    . GLU A 1 458 ? 92.388  93.967  119.360 1.00 8.38   ? 458  GLU A CG    1 
ATOM   2993 C  CD    . GLU A 1 458 ? 91.622  94.890  118.462 1.00 8.38   ? 458  GLU A CD    1 
ATOM   2994 O  OE1   . GLU A 1 458 ? 91.490  94.571  117.265 1.00 8.38   ? 458  GLU A OE1   1 
ATOM   2995 O  OE2   . GLU A 1 458 ? 91.131  95.922  118.951 1.00 8.38   ? 458  GLU A OE2   1 
ATOM   2996 N  N     . TYR A 1 459 ? 94.290  89.689  118.386 1.00 8.80   ? 459  TYR A N     1 
ATOM   2997 C  CA    . TYR A 1 459 ? 94.146  88.294  118.003 1.00 8.80   ? 459  TYR A CA    1 
ATOM   2998 C  C     . TYR A 1 459 ? 94.526  87.363  119.143 1.00 8.80   ? 459  TYR A C     1 
ATOM   2999 O  O     . TYR A 1 459 ? 93.827  86.378  119.402 1.00 8.80   ? 459  TYR A O     1 
ATOM   3000 C  CB    . TYR A 1 459 ? 94.980  87.987  116.769 1.00 8.80   ? 459  TYR A CB    1 
ATOM   3001 C  CG    . TYR A 1 459 ? 94.865  86.555  116.356 1.00 8.80   ? 459  TYR A CG    1 
ATOM   3002 C  CD1   . TYR A 1 459 ? 93.677  86.064  115.845 1.00 8.80   ? 459  TYR A CD1   1 
ATOM   3003 C  CD2   . TYR A 1 459 ? 95.938  85.688  116.479 1.00 8.80   ? 459  TYR A CD2   1 
ATOM   3004 C  CE1   . TYR A 1 459 ? 93.556  84.751  115.485 1.00 8.80   ? 459  TYR A CE1   1 
ATOM   3005 C  CE2   . TYR A 1 459 ? 95.828  84.375  116.111 1.00 8.80   ? 459  TYR A CE2   1 
ATOM   3006 C  CZ    . TYR A 1 459 ? 94.638  83.916  115.608 1.00 8.80   ? 459  TYR A CZ    1 
ATOM   3007 O  OH    . TYR A 1 459 ? 94.525  82.605  115.234 1.00 8.80   ? 459  TYR A OH    1 
ATOM   3008 N  N     . ILE A 1 460 ? 95.620  87.662  119.843 1.00 8.95   ? 460  ILE A N     1 
ATOM   3009 C  CA    . ILE A 1 460 ? 96.030  86.840  120.966 1.00 8.95   ? 460  ILE A CA    1 
ATOM   3010 C  C     . ILE A 1 460 ? 95.153  87.084  122.182 1.00 8.95   ? 460  ILE A C     1 
ATOM   3011 O  O     . ILE A 1 460 ? 95.153  86.273  123.112 1.00 8.95   ? 460  ILE A O     1 
ATOM   3012 C  CB    . ILE A 1 460 ? 97.514  87.086  121.280 1.00 8.95   ? 460  ILE A CB    1 
ATOM   3013 C  CG1   . ILE A 1 460 ? 97.740  88.518  121.748 1.00 8.95   ? 460  ILE A CG1   1 
ATOM   3014 C  CG2   . ILE A 1 460 ? 98.337  86.840  120.060 1.00 8.95   ? 460  ILE A CG2   1 
ATOM   3015 C  CD1   . ILE A 1 460 ? 99.155  88.811  122.167 1.00 8.95   ? 460  ILE A CD1   1 
ATOM   3016 N  N     . SER A 1 461 ? 94.407  88.187  122.205 1.00 8.93   ? 461  SER A N     1 
ATOM   3017 C  CA    . SER A 1 461 ? 93.381  88.408  123.209 1.00 8.93   ? 461  SER A CA    1 
ATOM   3018 C  C     . SER A 1 461 ? 92.070  87.728  122.860 1.00 8.93   ? 461  SER A C     1 
ATOM   3019 O  O     . SER A 1 461 ? 91.165  87.701  123.694 1.00 8.93   ? 461  SER A O     1 
ATOM   3020 C  CB    . SER A 1 461 ? 93.151  89.901  123.395 1.00 8.93   ? 461  SER A CB    1 
ATOM   3021 O  OG    . SER A 1 461 ? 94.318  90.525  123.878 1.00 8.93   ? 461  SER A OG    1 
ATOM   3022 N  N     . GLY A 1 462 ? 91.943  87.203  121.649 1.00 9.49   ? 462  GLY A N     1 
ATOM   3023 C  CA    . GLY A 1 462 ? 90.798  86.405  121.273 1.00 9.49   ? 462  GLY A CA    1 
ATOM   3024 C  C     . GLY A 1 462 ? 89.571  87.177  120.859 1.00 9.49   ? 462  GLY A C     1 
ATOM   3025 O  O     . GLY A 1 462 ? 88.458  86.786  121.220 1.00 9.49   ? 462  GLY A O     1 
ATOM   3026 N  N     . TYR A 1 463 ? 89.729  88.270  120.109 1.00 8.75   ? 463  TYR A N     1 
ATOM   3027 C  CA    . TYR A 1 463 ? 88.525  88.949  119.649 1.00 8.75   ? 463  TYR A CA    1 
ATOM   3028 C  C     . TYR A 1 463 ? 87.943  88.239  118.443 1.00 8.75   ? 463  TYR A C     1 
ATOM   3029 O  O     . TYR A 1 463 ? 86.749  87.929  118.405 1.00 8.75   ? 463  TYR A O     1 
ATOM   3030 C  CB    . TYR A 1 463 ? 88.748  90.411  119.251 1.00 8.75   ? 463  TYR A CB    1 
ATOM   3031 C  CG    . TYR A 1 463 ? 89.144  91.446  120.276 1.00 8.75   ? 463  TYR A CG    1 
ATOM   3032 C  CD1   . TYR A 1 463 ? 89.804  91.126  121.445 1.00 8.75   ? 463  TYR A CD1   1 
ATOM   3033 C  CD2   . TYR A 1 463 ? 88.701  92.742  120.121 1.00 8.75   ? 463  TYR A CD2   1 
ATOM   3034 C  CE1   . TYR A 1 463 ? 90.133  92.095  122.357 1.00 8.75   ? 463  TYR A CE1   1 
ATOM   3035 C  CE2   . TYR A 1 463 ? 88.991  93.704  121.039 1.00 8.75   ? 463  TYR A CE2   1 
ATOM   3036 C  CZ    . TYR A 1 463 ? 89.699  93.377  122.157 1.00 8.75   ? 463  TYR A CZ    1 
ATOM   3037 O  OH    . TYR A 1 463 ? 89.990  94.353  123.070 1.00 8.75   ? 463  TYR A OH    1 
ATOM   3038 N  N     . TYR A 1 464 ? 88.780  87.977  117.450 1.00 8.00   ? 464  TYR A N     1 
ATOM   3039 C  CA    . TYR A 1 464 ? 88.316  87.535  116.159 1.00 8.00   ? 464  TYR A CA    1 
ATOM   3040 C  C     . TYR A 1 464 ? 89.183  86.418  115.615 1.00 8.00   ? 464  TYR A C     1 
ATOM   3041 O  O     . TYR A 1 464 ? 90.320  86.221  116.043 1.00 8.00   ? 464  TYR A O     1 
ATOM   3042 C  CB    . TYR A 1 464 ? 88.282  88.707  115.172 1.00 8.00   ? 464  TYR A CB    1 
ATOM   3043 C  CG    . TYR A 1 464 ? 89.470  89.647  115.229 1.00 8.00   ? 464  TYR A CG    1 
ATOM   3044 C  CD1   . TYR A 1 464 ? 89.349  90.917  115.773 1.00 8.00   ? 464  TYR A CD1   1 
ATOM   3045 C  CD2   . TYR A 1 464 ? 90.733  89.257  114.781 1.00 8.00   ? 464  TYR A CD2   1 
ATOM   3046 C  CE1   . TYR A 1 464 ? 90.415  91.784  115.824 1.00 8.00   ? 464  TYR A CE1   1 
ATOM   3047 C  CE2   . TYR A 1 464 ? 91.804  90.117  114.850 1.00 8.00   ? 464  TYR A CE2   1 
ATOM   3048 C  CZ    . TYR A 1 464 ? 91.632  91.371  115.380 1.00 8.00   ? 464  TYR A CZ    1 
ATOM   3049 O  OH    . TYR A 1 464 ? 92.672  92.258  115.450 1.00 8.00   ? 464  TYR A OH    1 
ATOM   3050 N  N     . ARG A 1 465 ? 88.616  85.690  114.652 1.00 9.43   ? 465  ARG A N     1 
ATOM   3051 C  CA    . ARG A 1 465 ? 89.400  84.860  113.751 1.00 9.43   ? 465  ARG A CA    1 
ATOM   3052 C  C     . ARG A 1 465 ? 90.250  85.754  112.861 1.00 9.43   ? 465  ARG A C     1 
ATOM   3053 O  O     . ARG A 1 465 ? 89.983  86.946  112.714 1.00 9.43   ? 465  ARG A O     1 
ATOM   3054 C  CB    . ARG A 1 465 ? 88.506  84.011  112.844 1.00 9.43   ? 465  ARG A CB    1 
ATOM   3055 C  CG    . ARG A 1 465 ? 87.740  82.872  113.472 1.00 9.43   ? 465  ARG A CG    1 
ATOM   3056 C  CD    . ARG A 1 465 ? 86.349  83.307  113.868 1.00 9.43   ? 465  ARG A CD    1 
ATOM   3057 N  NE    . ARG A 1 465 ? 85.611  82.286  114.596 1.00 9.43   ? 465  ARG A NE    1 
ATOM   3058 C  CZ    . ARG A 1 465 ? 84.859  81.342  114.035 1.00 9.43   ? 465  ARG A CZ    1 
ATOM   3059 N  NH1   . ARG A 1 465 ? 84.735  81.273  112.722 1.00 9.43   ? 465  ARG A NH1   1 
ATOM   3060 N  NH2   . ARG A 1 465 ? 84.247  80.459  114.806 1.00 9.43   ? 465  ARG A NH2   1 
ATOM   3061 N  N     . VAL A 1 466 ? 91.266  85.169  112.230 1.00 7.90   ? 466  VAL A N     1 
ATOM   3062 C  CA    . VAL A 1 466 ? 91.999  85.933  111.226 1.00 7.90   ? 466  VAL A CA    1 
ATOM   3063 C  C     . VAL A 1 466 ? 91.112  86.173  110.015 1.00 7.90   ? 466  VAL A C     1 
ATOM   3064 O  O     . VAL A 1 466 ? 91.139  87.251  109.412 1.00 7.90   ? 466  VAL A O     1 
ATOM   3065 C  CB    . VAL A 1 466 ? 93.306  85.219  110.831 1.00 7.90   ? 466  VAL A CB    1 
ATOM   3066 C  CG1   . VAL A 1 466 ? 94.058  85.997  109.781 1.00 7.90   ? 466  VAL A CG1   1 
ATOM   3067 C  CG2   . VAL A 1 466 ? 94.196  85.030  112.011 1.00 7.90   ? 466  VAL A CG2   1 
ATOM   3068 N  N     . SER A 1 467 ? 90.256  85.201  109.691 1.00 8.19   ? 467  SER A N     1 
ATOM   3069 C  CA    . SER A 1 467 ? 89.441  85.275  108.486 1.00 8.19   ? 467  SER A CA    1 
ATOM   3070 C  C     . SER A 1 467 ? 88.359  86.336  108.585 1.00 8.19   ? 467  SER A C     1 
ATOM   3071 O  O     . SER A 1 467 ? 87.934  86.867  107.560 1.00 8.19   ? 467  SER A O     1 
ATOM   3072 C  CB    . SER A 1 467 ? 88.821  83.915  108.197 1.00 8.19   ? 467  SER A CB    1 
ATOM   3073 O  OG    . SER A 1 467 ? 87.888  83.568  109.197 1.00 8.19   ? 467  SER A OG    1 
ATOM   3074 N  N     . SER A 1 468 ? 87.907  86.666  109.794 1.00 7.80   ? 468  SER A N     1 
ATOM   3075 C  CA    . SER A 1 468 ? 86.951  87.750  109.981 1.00 7.80   ? 468  SER A CA    1 
ATOM   3076 C  C     . SER A 1 468 ? 87.630  89.102  110.084 1.00 7.80   ? 468  SER A C     1 
ATOM   3077 O  O     . SER A 1 468 ? 87.042  90.110  109.690 1.00 7.80   ? 468  SER A O     1 
ATOM   3078 C  CB    . SER A 1 468 ? 86.098  87.502  111.225 1.00 7.80   ? 468  SER A CB    1 
ATOM   3079 O  OG    . SER A 1 468 ? 86.888  87.579  112.388 1.00 7.80   ? 468  SER A OG    1 
ATOM   3080 N  N     . TYR A 1 469 ? 88.857  89.150  110.592 1.00 7.27   ? 469  TYR A N     1 
ATOM   3081 C  CA    . TYR A 1 469 ? 89.631  90.370  110.465 1.00 7.27   ? 469  TYR A CA    1 
ATOM   3082 C  C     . TYR A 1 469 ? 90.066  90.603  109.028 1.00 7.27   ? 469  TYR A C     1 
ATOM   3083 O  O     . TYR A 1 469 ? 90.159  91.752  108.595 1.00 7.27   ? 469  TYR A O     1 
ATOM   3084 C  CB    . TYR A 1 469 ? 90.847  90.325  111.373 1.00 7.27   ? 469  TYR A CB    1 
ATOM   3085 C  CG    . TYR A 1 469 ? 91.696  91.563  111.301 1.00 7.27   ? 469  TYR A CG    1 
ATOM   3086 C  CD1   . TYR A 1 469 ? 91.313  92.716  111.956 1.00 7.27   ? 469  TYR A CD1   1 
ATOM   3087 C  CD2   . TYR A 1 469 ? 92.864  91.583  110.566 1.00 7.27   ? 469  TYR A CD2   1 
ATOM   3088 C  CE1   . TYR A 1 469 ? 92.080  93.846  111.889 1.00 7.27   ? 469  TYR A CE1   1 
ATOM   3089 C  CE2   . TYR A 1 469 ? 93.633  92.702  110.481 1.00 7.27   ? 469  TYR A CE2   1 
ATOM   3090 C  CZ    . TYR A 1 469 ? 93.240  93.832  111.153 1.00 7.27   ? 469  TYR A CZ    1 
ATOM   3091 O  OH    . TYR A 1 469 ? 94.014  94.961  111.075 1.00 7.27   ? 469  TYR A OH    1 
ATOM   3092 N  N     . PHE A 1 470 ? 90.372  89.541  108.286 1.00 7.65   ? 470  PHE A N     1 
ATOM   3093 C  CA    . PHE A 1 470 ? 90.842  89.716  106.919 1.00 7.65   ? 470  PHE A CA    1 
ATOM   3094 C  C     . PHE A 1 470 ? 89.713  90.168  106.008 1.00 7.65   ? 470  PHE A C     1 
ATOM   3095 O  O     . PHE A 1 470 ? 89.851  91.158  105.288 1.00 7.65   ? 470  PHE A O     1 
ATOM   3096 C  CB    . PHE A 1 470 ? 91.469  88.418  106.402 1.00 7.65   ? 470  PHE A CB    1 
ATOM   3097 C  CG    . PHE A 1 470 ? 91.973  88.507  104.997 1.00 7.65   ? 470  PHE A CG    1 
ATOM   3098 C  CD1   . PHE A 1 470 ? 93.118  89.222  104.704 1.00 7.65   ? 470  PHE A CD1   1 
ATOM   3099 C  CD2   . PHE A 1 470 ? 91.308  87.864  103.968 1.00 7.65   ? 470  PHE A CD2   1 
ATOM   3100 C  CE1   . PHE A 1 470 ? 93.578  89.308  103.416 1.00 7.65   ? 470  PHE A CE1   1 
ATOM   3101 C  CE2   . PHE A 1 470 ? 91.772  87.950  102.680 1.00 7.65   ? 470  PHE A CE2   1 
ATOM   3102 C  CZ    . PHE A 1 470 ? 92.907  88.671  102.410 1.00 7.65   ? 470  PHE A CZ    1 
ATOM   3103 N  N     . LEU A 1 471 ? 88.577  89.475  106.047 1.00 8.47   ? 471  LEU A N     1 
ATOM   3104 C  CA    . LEU A 1 471 ? 87.463  89.834  105.185 1.00 8.47   ? 471  LEU A CA    1 
ATOM   3105 C  C     . LEU A 1 471 ? 86.751  91.102  105.633 1.00 8.47   ? 471  LEU A C     1 
ATOM   3106 O  O     . LEU A 1 471 ? 86.094  91.744  104.812 1.00 8.47   ? 471  LEU A O     1 
ATOM   3107 C  CB    . LEU A 1 471 ? 86.467  88.684  105.116 1.00 8.47   ? 471  LEU A CB    1 
ATOM   3108 C  CG    . LEU A 1 471 ? 86.968  87.399  104.468 1.00 8.47   ? 471  LEU A CG    1 
ATOM   3109 C  CD1   . LEU A 1 471 ? 85.884  86.350  104.516 1.00 8.47   ? 471  LEU A CD1   1 
ATOM   3110 C  CD2   . LEU A 1 471 ? 87.423  87.651  103.050 1.00 8.47   ? 471  LEU A CD2   1 
ATOM   3111 N  N     . GLY A 1 472 ? 86.853  91.476  106.908 1.00 8.90   ? 472  GLY A N     1 
ATOM   3112 C  CA    . GLY A 1 472 ? 86.252  92.714  107.363 1.00 8.90   ? 472  GLY A CA    1 
ATOM   3113 C  C     . GLY A 1 472 ? 87.072  93.942  107.070 1.00 8.90   ? 472  GLY A C     1 
ATOM   3114 O  O     . GLY A 1 472 ? 86.518  95.037  106.974 1.00 8.90   ? 472  GLY A O     1 
ATOM   3115 N  N     . LYS A 1 473 ? 88.380  93.785  106.927 1.00 9.34   ? 473  LYS A N     1 
ATOM   3116 C  CA    . LYS A 1 473 ? 89.268  94.879  106.574 1.00 9.34   ? 473  LYS A CA    1 
ATOM   3117 C  C     . LYS A 1 473 ? 89.410  95.036  105.064 1.00 9.34   ? 473  LYS A C     1 
ATOM   3118 O  O     . LYS A 1 473 ? 89.798  96.111  104.596 1.00 9.34   ? 473  LYS A O     1 
ATOM   3119 C  CB    . LYS A 1 473 ? 90.630  94.643  107.238 1.00 9.34   ? 473  LYS A CB    1 
ATOM   3120 C  CG    . LYS A 1 473 ? 91.585  95.798  107.221 1.00 9.34   ? 473  LYS A CG    1 
ATOM   3121 C  CD    . LYS A 1 473 ? 91.116  96.917  108.085 1.00 9.34   ? 473  LYS A CD    1 
ATOM   3122 C  CE    . LYS A 1 473 ? 91.359  96.578  109.501 1.00 9.34   ? 473  LYS A CE    1 
ATOM   3123 N  NZ    . LYS A 1 473 ? 92.823  96.623  109.707 1.00 9.34   ? 473  LYS A NZ    1 
ATOM   3124 N  N     . LEU A 1 474 ? 89.083  93.994  104.293 1.00 10.67  ? 474  LEU A N     1 
ATOM   3125 C  CA    . LEU A 1 474 ? 88.978  94.134  102.844 1.00 10.67  ? 474  LEU A CA    1 
ATOM   3126 C  C     . LEU A 1 474 ? 87.848  95.075  102.463 1.00 10.67  ? 474  LEU A C     1 
ATOM   3127 O  O     . LEU A 1 474 ? 88.028  95.964  101.627 1.00 10.67  ? 474  LEU A O     1 
ATOM   3128 C  CB    . LEU A 1 474 ? 88.751  92.777  102.184 1.00 10.67  ? 474  LEU A CB    1 
ATOM   3129 C  CG    . LEU A 1 474 ? 89.866  91.752  102.057 1.00 10.67  ? 474  LEU A CG    1 
ATOM   3130 C  CD1   . LEU A 1 474 ? 89.310  90.483  101.469 1.00 10.67  ? 474  LEU A CD1   1 
ATOM   3131 C  CD2   . LEU A 1 474 ? 90.937  92.298  101.183 1.00 10.67  ? 474  LEU A CD2   1 
ATOM   3132 N  N     . LEU A 1 475 ? 86.680  94.910  103.091 1.00 12.90  ? 475  LEU A N     1 
ATOM   3133 C  CA    . LEU A 1 475 ? 85.476  95.655  102.740 1.00 12.90  ? 475  LEU A CA    1 
ATOM   3134 C  C     . LEU A 1 475 ? 85.589  97.150  103.000 1.00 12.90  ? 475  LEU A C     1 
ATOM   3135 O  O     . LEU A 1 475 ? 84.780  97.914  102.469 1.00 12.90  ? 475  LEU A O     1 
ATOM   3136 C  CB    . LEU A 1 475 ? 84.282  95.108  103.513 1.00 12.90  ? 475  LEU A CB    1 
ATOM   3137 C  CG    . LEU A 1 475 ? 83.893  93.665  103.223 1.00 12.90  ? 475  LEU A CG    1 
ATOM   3138 C  CD1   . LEU A 1 475 ? 82.723  93.244  104.093 1.00 12.90  ? 475  LEU A CD1   1 
ATOM   3139 C  CD2   . LEU A 1 475 ? 83.577  93.485  101.756 1.00 12.90  ? 475  LEU A CD2   1 
ATOM   3140 N  N     . SER A 1 476 ? 86.557  97.582  103.794 1.00 14.99  ? 476  SER A N     1 
ATOM   3141 C  CA    . SER A 1 476 ? 86.829  98.990  104.013 1.00 14.99  ? 476  SER A CA    1 
ATOM   3142 C  C     . SER A 1 476 ? 87.957  99.505  103.136 1.00 14.99  ? 476  SER A C     1 
ATOM   3143 O  O     . SER A 1 476 ? 88.291  100.690 103.203 1.00 14.99  ? 476  SER A O     1 
ATOM   3144 C  CB    . SER A 1 476 ? 87.151  99.216  105.480 1.00 14.99  ? 476  SER A CB    1 
ATOM   3145 O  OG    . SER A 1 476 ? 86.048  98.778  106.248 1.00 14.99  ? 476  SER A OG    1 
ATOM   3146 N  N     . ASP A 1 477 ? 88.552  98.635  102.324 1.00 17.27  ? 477  ASP A N     1 
ATOM   3147 C  CA    . ASP A 1 477 ? 89.495  99.001  101.281 1.00 17.27  ? 477  ASP A CA    1 
ATOM   3148 C  C     . ASP A 1 477 ? 88.984  98.659  99.895  1.00 17.27  ? 477  ASP A C     1 
ATOM   3149 O  O     . ASP A 1 477 ? 89.363  99.315  98.926  1.00 17.27  ? 477  ASP A O     1 
ATOM   3150 C  CB    . ASP A 1 477 ? 90.832  98.293  101.518 1.00 17.27  ? 477  ASP A CB    1 
ATOM   3151 C  CG    . ASP A 1 477 ? 91.913  98.716  100.542 1.00 17.27  ? 477  ASP A CG    1 
ATOM   3152 O  OD1   . ASP A 1 477 ? 92.410  99.858  100.654 1.00 17.27  ? 477  ASP A OD1   1 
ATOM   3153 O  OD2   . ASP A 1 477 ? 92.283  97.892  99.678  1.00 17.27  ? 477  ASP A OD2   1 
ATOM   3154 N  N     . LEU A 1 478 ? 88.112  97.657  99.792  1.00 18.69  ? 478  LEU A N     1 
ATOM   3155 C  CA    . LEU A 1 478 ? 87.480  97.322  98.522  1.00 18.69  ? 478  LEU A CA    1 
ATOM   3156 C  C     . LEU A 1 478 ? 86.455  98.378  98.129  1.00 18.69  ? 478  LEU A C     1 
ATOM   3157 O  O     . LEU A 1 478 ? 86.528  98.954  97.039  1.00 18.69  ? 478  LEU A O     1 
ATOM   3158 C  CB    . LEU A 1 478 ? 86.832  95.940  98.631  1.00 18.69  ? 478  LEU A CB    1 
ATOM   3159 C  CG    . LEU A 1 478 ? 86.214  95.164  97.472  1.00 18.69  ? 478  LEU A CG    1 
ATOM   3160 C  CD1   . LEU A 1 478 ? 86.432  93.691  97.730  1.00 18.69  ? 478  LEU A CD1   1 
ATOM   3161 C  CD2   . LEU A 1 478 ? 84.728  95.438  97.344  1.00 18.69  ? 478  LEU A CD2   1 
ATOM   3162 N  N     . LEU A 1 479 ? 85.489  98.655  99.018  1.00 19.73  ? 479  LEU A N     1 
ATOM   3163 C  CA    . LEU A 1 479 ? 84.379  99.532  98.640  1.00 19.73  ? 479  LEU A CA    1 
ATOM   3164 C  C     . LEU A 1 479 ? 84.766  101.009 98.540  1.00 19.73  ? 479  LEU A C     1 
ATOM   3165 O  O     . LEU A 1 479 ? 84.542  101.604 97.472  1.00 19.73  ? 479  LEU A O     1 
ATOM   3166 C  CB    . LEU A 1 479 ? 83.179  99.290  99.564  1.00 19.73  ? 479  LEU A CB    1 
ATOM   3167 C  CG    . LEU A 1 479 ? 82.487  97.933  99.490  1.00 19.73  ? 479  LEU A CG    1 
ATOM   3168 C  CD1   . LEU A 1 479 ? 81.433  97.811  100.574 1.00 19.73  ? 479  LEU A CD1   1 
ATOM   3169 C  CD2   . LEU A 1 479 ? 81.864  97.743  98.133  1.00 19.73  ? 479  LEU A CD2   1 
ATOM   3170 N  N     . PRO A 1 480 ? 85.327  101.669 99.571  1.00 20.74  ? 480  PRO A N     1 
ATOM   3171 C  CA    . PRO A 1 480 ? 85.507  103.124 99.454  1.00 20.74  ? 480  PRO A CA    1 
ATOM   3172 C  C     . PRO A 1 480 ? 86.655  103.538 98.556  1.00 20.74  ? 480  PRO A C     1 
ATOM   3173 O  O     . PRO A 1 480 ? 86.729  104.713 98.178  1.00 20.74  ? 480  PRO A O     1 
ATOM   3174 C  CB    . PRO A 1 480 ? 85.793  103.561 100.897 1.00 20.74  ? 480  PRO A CB    1 
ATOM   3175 C  CG    . PRO A 1 480 ? 85.419  102.418 101.737 1.00 20.74  ? 480  PRO A CG    1 
ATOM   3176 C  CD    . PRO A 1 480 ? 85.780  101.251 100.912 1.00 20.74  ? 480  PRO A CD    1 
ATOM   3177 N  N     . MET A 1 481 ? 87.543  102.616 98.204  1.00 21.58  ? 481  MET A N     1 
ATOM   3178 C  CA    . MET A 1 481 ? 88.798  102.956 97.566  1.00 21.58  ? 481  MET A CA    1 
ATOM   3179 C  C     . MET A 1 481 ? 89.006  102.313 96.207  1.00 21.58  ? 481  MET A C     1 
ATOM   3180 O  O     . MET A 1 481 ? 89.797  102.841 95.423  1.00 21.58  ? 481  MET A O     1 
ATOM   3181 C  CB    . MET A 1 481 ? 89.975  102.561 98.469  1.00 21.58  ? 481  MET A CB    1 
ATOM   3182 C  CG    . MET A 1 481 ? 90.075  103.307 99.797  1.00 21.58  ? 481  MET A CG    1 
ATOM   3183 S  SD    . MET A 1 481 ? 90.436  105.062 99.659  1.00 21.58  ? 481  MET A SD    1 
ATOM   3184 C  CE    . MET A 1 481 ? 92.132  105.011 99.100  1.00 21.58  ? 481  MET A CE    1 
ATOM   3185 N  N     . ARG A 1 482 ? 88.346  101.196 95.902  1.00 19.22  ? 482  ARG A N     1 
ATOM   3186 C  CA    . ARG A 1 482 ? 88.609  100.516 94.637  1.00 19.22  ? 482  ARG A CA    1 
ATOM   3187 C  C     . ARG A 1 482 ? 87.350  100.313 93.804  1.00 19.22  ? 482  ARG A C     1 
ATOM   3188 O  O     . ARG A 1 482 ? 87.420  100.304 92.572  1.00 19.22  ? 482  ARG A O     1 
ATOM   3189 C  CB    . ARG A 1 482 ? 89.308  99.169  94.868  1.00 19.22  ? 482  ARG A CB    1 
ATOM   3190 C  CG    . ARG A 1 482 ? 90.823  99.273  94.845  1.00 19.22  ? 482  ARG A CG    1 
ATOM   3191 C  CD    . ARG A 1 482 ? 91.376  99.803  96.145  1.00 19.22  ? 482  ARG A CD    1 
ATOM   3192 N  NE    . ARG A 1 482 ? 92.767  100.209 96.035  1.00 19.22  ? 482  ARG A NE    1 
ATOM   3193 C  CZ    . ARG A 1 482 ? 93.446  100.783 97.018  1.00 19.22  ? 482  ARG A CZ    1 
ATOM   3194 N  NH1   . ARG A 1 482 ? 92.875  100.984 98.190  1.00 19.22  ? 482  ARG A NH1   1 
ATOM   3195 N  NH2   . ARG A 1 482 ? 94.699  101.145 96.837  1.00 19.22  ? 482  ARG A NH2   1 
ATOM   3196 N  N     . MET A 1 483 ? 86.196  100.143 94.444  1.00 22.89  ? 483  MET A N     1 
ATOM   3197 C  CA    . MET A 1 483 ? 84.964  100.040 93.672  1.00 22.89  ? 483  MET A CA    1 
ATOM   3198 C  C     . MET A 1 483 ? 84.464  101.414 93.256  1.00 22.89  ? 483  MET A C     1 
ATOM   3199 O  O     . MET A 1 483 ? 84.184  101.653 92.078  1.00 22.89  ? 483  MET A O     1 
ATOM   3200 C  CB    . MET A 1 483 ? 83.882  99.304  94.465  1.00 22.89  ? 483  MET A CB    1 
ATOM   3201 C  CG    . MET A 1 483 ? 82.580  99.166  93.690  1.00 22.89  ? 483  MET A CG    1 
ATOM   3202 S  SD    . MET A 1 483 ? 81.252  98.308  94.546  1.00 22.89  ? 483  MET A SD    1 
ATOM   3203 C  CE    . MET A 1 483 ? 81.825  96.620  94.442  1.00 22.89  ? 483  MET A CE    1 
ATOM   3204 N  N     . LEU A 1 484 ? 84.338  102.323 94.217  1.00 22.45  ? 484  LEU A N     1 
ATOM   3205 C  CA    . LEU A 1 484 ? 83.782  103.644 93.931  1.00 22.45  ? 484  LEU A CA    1 
ATOM   3206 C  C     . LEU A 1 484 ? 84.651  104.531 93.035  1.00 22.45  ? 484  LEU A C     1 
ATOM   3207 O  O     . LEU A 1 484 ? 84.073  105.221 92.179  1.00 22.45  ? 484  LEU A O     1 
ATOM   3208 C  CB    . LEU A 1 484 ? 83.435  104.341 95.256  1.00 22.45  ? 484  LEU A CB    1 
ATOM   3209 C  CG    . LEU A 1 484 ? 82.829  105.737 95.219  1.00 22.45  ? 484  LEU A CG    1 
ATOM   3210 C  CD1   . LEU A 1 484 ? 81.471  105.713 94.545  1.00 22.45  ? 484  LEU A CD1   1 
ATOM   3211 C  CD2   . LEU A 1 484 ? 82.737  106.290 96.626  1.00 22.45  ? 484  LEU A CD2   1 
ATOM   3212 N  N     . PRO A 1 485 ? 85.987  104.573 93.133  1.00 21.61  ? 485  PRO A N     1 
ATOM   3213 C  CA    . PRO A 1 485 ? 86.749  105.325 92.129  1.00 21.61  ? 485  PRO A CA    1 
ATOM   3214 C  C     . PRO A 1 485 ? 86.941  104.611 90.803  1.00 21.61  ? 485  PRO A C     1 
ATOM   3215 O  O     . PRO A 1 485 ? 87.691  105.114 89.967  1.00 21.61  ? 485  PRO A O     1 
ATOM   3216 C  CB    . PRO A 1 485 ? 88.100  105.541 92.812  1.00 21.61  ? 485  PRO A CB    1 
ATOM   3217 C  CG    . PRO A 1 485 ? 87.835  105.374 94.201  1.00 21.61  ? 485  PRO A CG    1 
ATOM   3218 C  CD    . PRO A 1 485 ? 86.850  104.316 94.298  1.00 21.61  ? 485  PRO A CD    1 
ATOM   3219 N  N     . SER A 1 486 ? 86.336  103.447 90.596  1.00 22.55  ? 486  SER A N     1 
ATOM   3220 C  CA    . SER A 1 486 ? 86.285  102.829 89.282  1.00 22.55  ? 486  SER A CA    1 
ATOM   3221 C  C     . SER A 1 486 ? 84.929  102.998 88.623  1.00 22.55  ? 486  SER A C     1 
ATOM   3222 O  O     . SER A 1 486 ? 84.816  102.793 87.413  1.00 22.55  ? 486  SER A O     1 
ATOM   3223 C  CB    . SER A 1 486 ? 86.620  101.340 89.377  1.00 22.55  ? 486  SER A CB    1 
ATOM   3224 O  OG    . SER A 1 486 ? 87.940  101.150 89.847  1.00 22.55  ? 486  SER A OG    1 
ATOM   3225 N  N     . ILE A 1 487 ? 83.907  103.349 89.401  1.00 23.69  ? 487  ILE A N     1 
ATOM   3226 C  CA    . ILE A 1 487 ? 82.623  103.751 88.844  1.00 23.69  ? 487  ILE A CA    1 
ATOM   3227 C  C     . ILE A 1 487 ? 82.700  105.178 88.328  1.00 23.69  ? 487  ILE A C     1 
ATOM   3228 O  O     . ILE A 1 487 ? 82.272  105.474 87.210  1.00 23.69  ? 487  ILE A O     1 
ATOM   3229 C  CB    . ILE A 1 487 ? 81.520  103.600 89.906  1.00 23.69  ? 487  ILE A CB    1 
ATOM   3230 C  CG1   . ILE A 1 487 ? 81.377  102.145 90.327  1.00 23.69  ? 487  ILE A CG1   1 
ATOM   3231 C  CG2   . ILE A 1 487 ? 80.200  104.122 89.392  1.00 23.69  ? 487  ILE A CG2   1 
ATOM   3232 C  CD1   . ILE A 1 487 ? 80.516  101.939 91.540  1.00 23.69  ? 487  ILE A CD1   1 
ATOM   3233 N  N     . ILE A 1 488 ? 83.265  106.073 89.139  1.00 25.59  ? 488  ILE A N     1 
ATOM   3234 C  CA    . ILE A 1 488 ? 83.365  107.487 88.797  1.00 25.59  ? 488  ILE A CA    1 
ATOM   3235 C  C     . ILE A 1 488 ? 84.312  107.693 87.623  1.00 25.59  ? 488  ILE A C     1 
ATOM   3236 O  O     . ILE A 1 488 ? 84.045  108.495 86.722  1.00 25.59  ? 488  ILE A O     1 
ATOM   3237 C  CB    . ILE A 1 488 ? 83.811  108.277 90.041  1.00 25.59  ? 488  ILE A CB    1 
ATOM   3238 C  CG1   . ILE A 1 488 ? 82.769  108.147 91.147  1.00 25.59  ? 488  ILE A CG1   1 
ATOM   3239 C  CG2   . ILE A 1 488 ? 84.049  109.735 89.728  1.00 25.59  ? 488  ILE A CG2   1 
ATOM   3240 C  CD1   . ILE A 1 488 ? 83.235  108.685 92.470  1.00 25.59  ? 488  ILE A CD1   1 
ATOM   3241 N  N     . PHE A 1 489 ? 85.410  106.945 87.593  1.00 27.02  ? 489  PHE A N     1 
ATOM   3242 C  CA    . PHE A 1 489 ? 86.427  107.119 86.566  1.00 27.02  ? 489  PHE A CA    1 
ATOM   3243 C  C     . PHE A 1 489 ? 85.981  106.575 85.221  1.00 27.02  ? 489  PHE A C     1 
ATOM   3244 O  O     . PHE A 1 489 ? 86.397  107.093 84.185  1.00 27.02  ? 489  PHE A O     1 
ATOM   3245 C  CB    . PHE A 1 489 ? 87.710  106.440 87.027  1.00 27.02  ? 489  PHE A CB    1 
ATOM   3246 C  CG    . PHE A 1 489 ? 88.875  106.653 86.132  1.00 27.02  ? 489  PHE A CG    1 
ATOM   3247 C  CD1   . PHE A 1 489 ? 89.412  107.913 85.968  1.00 27.02  ? 489  PHE A CD1   1 
ATOM   3248 C  CD2   . PHE A 1 489 ? 89.494  105.585 85.530  1.00 27.02  ? 489  PHE A CD2   1 
ATOM   3249 C  CE1   . PHE A 1 489 ? 90.507  108.110 85.162  1.00 27.02  ? 489  PHE A CE1   1 
ATOM   3250 C  CE2   . PHE A 1 489 ? 90.592  105.778 84.736  1.00 27.02  ? 489  PHE A CE2   1 
ATOM   3251 C  CZ    . PHE A 1 489 ? 91.094  107.046 84.542  1.00 27.02  ? 489  PHE A CZ    1 
ATOM   3252 N  N     . THR A 1 490 ? 85.141  105.546 85.215  1.00 27.86  ? 490  THR A N     1 
ATOM   3253 C  CA    . THR A 1 490 ? 84.574  105.042 83.972  1.00 27.86  ? 490  THR A CA    1 
ATOM   3254 C  C     . THR A 1 490 ? 83.484  105.968 83.453  1.00 27.86  ? 490  THR A C     1 
ATOM   3255 O  O     . THR A 1 490 ? 83.356  106.153 82.239  1.00 27.86  ? 490  THR A O     1 
ATOM   3256 C  CB    . THR A 1 490 ? 84.028  103.633 84.197  1.00 27.86  ? 490  THR A CB    1 
ATOM   3257 O  OG1   . THR A 1 490 ? 85.072  102.806 84.718  1.00 27.86  ? 490  THR A OG1   1 
ATOM   3258 C  CG2   . THR A 1 490 ? 83.526  103.014 82.912  1.00 27.86  ? 490  THR A CG2   1 
ATOM   3259 N  N     . CYS A 1 491 ? 82.712  106.580 84.356  1.00 30.86  ? 491  CYS A N     1 
ATOM   3260 C  CA    . CYS A 1 491 ? 81.627  107.461 83.937  1.00 30.86  ? 491  CYS A CA    1 
ATOM   3261 C  C     . CYS A 1 491 ? 82.151  108.739 83.299  1.00 30.86  ? 491  CYS A C     1 
ATOM   3262 O  O     . CYS A 1 491 ? 81.601  109.193 82.293  1.00 30.86  ? 491  CYS A O     1 
ATOM   3263 C  CB    . CYS A 1 491 ? 80.720  107.798 85.120  1.00 30.86  ? 491  CYS A CB    1 
ATOM   3264 S  SG    . CYS A 1 491 ? 79.645  106.459 85.679  1.00 30.86  ? 491  CYS A SG    1 
ATOM   3265 N  N     . ILE A 1 492 ? 83.223  109.313 83.855  1.00 32.01  ? 492  ILE A N     1 
ATOM   3266 C  CA    . ILE A 1 492 ? 83.750  110.587 83.367  1.00 32.01  ? 492  ILE A CA    1 
ATOM   3267 C  C     . ILE A 1 492 ? 84.322  110.441 81.962  1.00 32.01  ? 492  ILE A C     1 
ATOM   3268 O  O     . ILE A 1 492 ? 84.016  111.239 81.073  1.00 32.01  ? 492  ILE A O     1 
ATOM   3269 C  CB    . ILE A 1 492 ? 84.795  111.150 84.347  1.00 32.01  ? 492  ILE A CB    1 
ATOM   3270 C  CG1   . ILE A 1 492 ? 84.119  111.634 85.620  1.00 32.01  ? 492  ILE A CG1   1 
ATOM   3271 C  CG2   . ILE A 1 492 ? 85.583  112.278 83.731  1.00 32.01  ? 492  ILE A CG2   1 
ATOM   3272 C  CD1   . ILE A 1 492 ? 85.087  112.052 86.673  1.00 32.01  ? 492  ILE A CD1   1 
ATOM   3273 N  N     . VAL A 1 493 ? 85.092  109.384 81.714  1.00 33.13  ? 493  VAL A N     1 
ATOM   3274 C  CA    . VAL A 1 493 ? 85.742  109.216 80.417  1.00 33.13  ? 493  VAL A CA    1 
ATOM   3275 C  C     . VAL A 1 493 ? 84.807  108.544 79.416  1.00 33.13  ? 493  VAL A C     1 
ATOM   3276 O  O     . VAL A 1 493 ? 85.229  108.156 78.324  1.00 33.13  ? 493  VAL A O     1 
ATOM   3277 C  CB    . VAL A 1 493 ? 87.053  108.422 80.542  1.00 33.13  ? 493  VAL A CB    1 
ATOM   3278 C  CG1   . VAL A 1 493 ? 88.005  109.114 81.498  1.00 33.13  ? 493  VAL A CG1   1 
ATOM   3279 C  CG2   . VAL A 1 493 ? 86.781  107.004 80.970  1.00 33.13  ? 493  VAL A CG2   1 
ATOM   3280 N  N     . TYR A 1 494 ? 83.533  108.401 79.764  1.00 39.53  ? 494  TYR A N     1 
ATOM   3281 C  CA    . TYR A 1 494 ? 82.561  107.886 78.815  1.00 39.53  ? 494  TYR A CA    1 
ATOM   3282 C  C     . TYR A 1 494 ? 81.732  108.966 78.136  1.00 39.53  ? 494  TYR A C     1 
ATOM   3283 O  O     . TYR A 1 494 ? 81.454  108.836 76.942  1.00 39.53  ? 494  TYR A O     1 
ATOM   3284 C  CB    . TYR A 1 494 ? 81.625  106.881 79.494  1.00 39.53  ? 494  TYR A CB    1 
ATOM   3285 C  CG    . TYR A 1 494 ? 80.614  106.270 78.556  1.00 39.53  ? 494  TYR A CG    1 
ATOM   3286 C  CD1   . TYR A 1 494 ? 80.993  105.305 77.628  1.00 39.53  ? 494  TYR A CD1   1 
ATOM   3287 C  CD2   . TYR A 1 494 ? 79.275  106.657 78.600  1.00 39.53  ? 494  TYR A CD2   1 
ATOM   3288 C  CE1   . TYR A 1 494 ? 80.065  104.747 76.766  1.00 39.53  ? 494  TYR A CE1   1 
ATOM   3289 C  CE2   . TYR A 1 494 ? 78.344  106.108 77.747  1.00 39.53  ? 494  TYR A CE2   1 
ATOM   3290 C  CZ    . TYR A 1 494 ? 78.741  105.155 76.832  1.00 39.53  ? 494  TYR A CZ    1 
ATOM   3291 O  OH    . TYR A 1 494 ? 77.802  104.610 75.984  1.00 39.53  ? 494  TYR A OH    1 
ATOM   3292 N  N     . PHE A 1 495 ? 81.327  110.029 78.834  1.00 40.08  ? 495  PHE A N     1 
ATOM   3293 C  CA    . PHE A 1 495 ? 80.537  111.063 78.175  1.00 40.08  ? 495  PHE A CA    1 
ATOM   3294 C  C     . PHE A 1 495 ? 81.390  112.184 77.596  1.00 40.08  ? 495  PHE A C     1 
ATOM   3295 O  O     . PHE A 1 495 ? 80.839  113.191 77.141  1.00 40.08  ? 495  PHE A O     1 
ATOM   3296 C  CB    . PHE A 1 495 ? 79.453  111.638 79.111  1.00 40.08  ? 495  PHE A CB    1 
ATOM   3297 C  CG    . PHE A 1 495 ? 79.966  112.473 80.269  1.00 40.08  ? 495  PHE A CG    1 
ATOM   3298 C  CD1   . PHE A 1 495 ? 80.254  111.883 81.481  1.00 40.08  ? 495  PHE A CD1   1 
ATOM   3299 C  CD2   . PHE A 1 495 ? 80.067  113.858 80.172  1.00 40.08  ? 495  PHE A CD2   1 
ATOM   3300 C  CE1   . PHE A 1 495 ? 80.695  112.636 82.558  1.00 40.08  ? 495  PHE A CE1   1 
ATOM   3301 C  CE2   . PHE A 1 495 ? 80.514  114.617 81.243  1.00 40.08  ? 495  PHE A CE2   1 
ATOM   3302 C  CZ    . PHE A 1 495 ? 80.825  114.003 82.437  1.00 40.08  ? 495  PHE A CZ    1 
ATOM   3303 N  N     . MET A 1 496 ? 82.715  112.035 77.578  1.00 40.09  ? 496  MET A N     1 
ATOM   3304 C  CA    . MET A 1 496 ? 83.557  113.060 76.988  1.00 40.09  ? 496  MET A CA    1 
ATOM   3305 C  C     . MET A 1 496 ? 84.654  112.514 76.089  1.00 40.09  ? 496  MET A C     1 
ATOM   3306 O  O     . MET A 1 496 ? 85.406  113.307 75.518  1.00 40.09  ? 496  MET A O     1 
ATOM   3307 C  CB    . MET A 1 496 ? 84.179  113.938 78.083  1.00 40.09  ? 496  MET A CB    1 
ATOM   3308 C  CG    . MET A 1 496 ? 85.251  113.281 78.900  1.00 40.09  ? 496  MET A CG    1 
ATOM   3309 S  SD    . MET A 1 496 ? 85.728  114.324 80.286  1.00 40.09  ? 496  MET A SD    1 
ATOM   3310 C  CE    . MET A 1 496 ? 86.503  115.688 79.437  1.00 40.09  ? 496  MET A CE    1 
ATOM   3311 N  N     . LEU A 1 497 ? 84.772  111.198 75.936  1.00 41.87  ? 497  LEU A N     1 
ATOM   3312 C  CA    . LEU A 1 497 ? 85.671  110.647 74.931  1.00 41.87  ? 497  LEU A CA    1 
ATOM   3313 C  C     . LEU A 1 497 ? 84.951  110.216 73.669  1.00 41.87  ? 497  LEU A C     1 
ATOM   3314 O  O     . LEU A 1 497 ? 85.462  110.432 72.567  1.00 41.87  ? 497  LEU A O     1 
ATOM   3315 C  CB    . LEU A 1 497 ? 86.448  109.451 75.477  1.00 41.87  ? 497  LEU A CB    1 
ATOM   3316 C  CG    . LEU A 1 497 ? 87.557  109.734 76.478  1.00 41.87  ? 497  LEU A CG    1 
ATOM   3317 C  CD1   . LEU A 1 497 ? 88.182  108.441 76.938  1.00 41.87  ? 497  LEU A CD1   1 
ATOM   3318 C  CD2   . LEU A 1 497 ? 88.585  110.590 75.829  1.00 41.87  ? 497  LEU A CD2   1 
ATOM   3319 N  N     . GLY A 1 498 ? 83.780  109.611 73.798  1.00 43.47  ? 498  GLY A N     1 
ATOM   3320 C  CA    . GLY A 1 498 ? 83.123  109.066 72.634  1.00 43.47  ? 498  GLY A CA    1 
ATOM   3321 C  C     . GLY A 1 498 ? 83.674  107.699 72.306  1.00 43.47  ? 498  GLY A C     1 
ATOM   3322 O  O     . GLY A 1 498 ? 84.134  107.449 71.189  1.00 43.47  ? 498  GLY A O     1 
ATOM   3323 N  N     . LEU A 1 499 ? 83.634  106.803 73.291  1.00 40.88  ? 499  LEU A N     1 
ATOM   3324 C  CA    . LEU A 1 499 ? 84.033  105.412 73.125  1.00 40.88  ? 499  LEU A CA    1 
ATOM   3325 C  C     . LEU A 1 499 ? 82.888  104.619 72.505  1.00 40.88  ? 499  LEU A C     1 
ATOM   3326 O  O     . LEU A 1 499 ? 81.989  105.207 71.896  1.00 40.88  ? 499  LEU A O     1 
ATOM   3327 C  CB    . LEU A 1 499 ? 84.456  104.811 74.466  1.00 40.88  ? 499  LEU A CB    1 
ATOM   3328 C  CG    . LEU A 1 499 ? 85.683  105.428 75.141  1.00 40.88  ? 499  LEU A CG    1 
ATOM   3329 C  CD1   . LEU A 1 499 ? 85.869  104.857 76.513  1.00 40.88  ? 499  LEU A CD1   1 
ATOM   3330 C  CD2   . LEU A 1 499 ? 86.926  105.202 74.332  1.00 40.88  ? 499  LEU A CD2   1 
ATOM   3331 N  N     . LYS A 1 500 ? 82.945  103.285 72.603  1.00 43.96  ? 500  LYS A N     1 
ATOM   3332 C  CA    . LYS A 1 500 ? 81.879  102.386 72.161  1.00 43.96  ? 500  LYS A CA    1 
ATOM   3333 C  C     . LYS A 1 500 ? 80.555  102.745 72.831  1.00 43.96  ? 500  LYS A C     1 
ATOM   3334 O  O     . LYS A 1 500 ? 80.398  102.556 74.044  1.00 43.96  ? 500  LYS A O     1 
ATOM   3335 C  CB    . LYS A 1 500 ? 82.249  100.935 72.462  1.00 43.96  ? 500  LYS A CB    1 
ATOM   3336 C  CG    . LYS A 1 500 ? 81.210  99.934  72.009  1.00 43.96  ? 500  LYS A CG    1 
ATOM   3337 C  CD    . LYS A 1 500 ? 81.073  99.909  70.509  1.00 43.96  ? 500  LYS A CD    1 
ATOM   3338 C  CE    . LYS A 1 500 ? 82.311  99.332  69.879  1.00 43.96  ? 500  LYS A CE    1 
ATOM   3339 N  NZ    . LYS A 1 500 ? 82.446  97.894  70.226  1.00 43.96  ? 500  LYS A NZ    1 
ATOM   3340 N  N     . PRO A 1 501 ? 79.586  103.268 72.079  1.00 43.59  ? 501  PRO A N     1 
ATOM   3341 C  CA    . PRO A 1 501 ? 78.430  103.935 72.688  1.00 43.59  ? 501  PRO A CA    1 
ATOM   3342 C  C     . PRO A 1 501 ? 77.319  103.011 73.163  1.00 43.59  ? 501  PRO A C     1 
ATOM   3343 O  O     . PRO A 1 501 ? 76.244  103.509 73.505  1.00 43.59  ? 501  PRO A O     1 
ATOM   3344 C  CB    . PRO A 1 501 ? 77.924  104.826 71.544  1.00 43.59  ? 501  PRO A CB    1 
ATOM   3345 C  CG    . PRO A 1 501 ? 78.276  104.069 70.326  1.00 43.59  ? 501  PRO A CG    1 
ATOM   3346 C  CD    . PRO A 1 501 ? 79.574  103.377 70.610  1.00 43.59  ? 501  PRO A CD    1 
ATOM   3347 N  N     . LYS A 1 502 ? 77.529  101.700 73.203  1.00 41.56  ? 502  LYS A N     1 
ATOM   3348 C  CA    . LYS A 1 502 ? 76.465  100.796 73.605  1.00 41.56  ? 502  LYS A CA    1 
ATOM   3349 C  C     . LYS A 1 502 ? 76.291  100.806 75.121  1.00 41.56  ? 502  LYS A C     1 
ATOM   3350 O  O     . LYS A 1 502 ? 77.049  101.435 75.862  1.00 41.56  ? 502  LYS A O     1 
ATOM   3351 C  CB    . LYS A 1 502 ? 76.750  99.381  73.112  1.00 41.56  ? 502  LYS A CB    1 
ATOM   3352 C  CG    . LYS A 1 502 ? 76.715  99.237  71.607  1.00 41.56  ? 502  LYS A CG    1 
ATOM   3353 C  CD    . LYS A 1 502 ? 76.854  97.785  71.203  1.00 41.56  ? 502  LYS A CD    1 
ATOM   3354 C  CE    . LYS A 1 502 ? 78.274  97.293  71.413  1.00 41.56  ? 502  LYS A CE    1 
ATOM   3355 N  NZ    . LYS A 1 502 ? 78.454  95.902  70.918  1.00 41.56  ? 502  LYS A NZ    1 
ATOM   3356 N  N     . ALA A 1 503 ? 75.268  100.092 75.581  1.00 37.18  ? 503  ALA A N     1 
ATOM   3357 C  CA    . ALA A 1 503 ? 74.968  100.029 77.004  1.00 37.18  ? 503  ALA A CA    1 
ATOM   3358 C  C     . ALA A 1 503 ? 75.783  98.965  77.720  1.00 37.18  ? 503  ALA A C     1 
ATOM   3359 O  O     . ALA A 1 503 ? 76.245  99.195  78.840  1.00 37.18  ? 503  ALA A O     1 
ATOM   3360 C  CB    . ALA A 1 503 ? 73.477  99.762  77.218  1.00 37.18  ? 503  ALA A CB    1 
ATOM   3361 N  N     . ASP A 1 504 ? 75.969  97.801  77.097  1.00 36.42  ? 504  ASP A N     1 
ATOM   3362 C  CA    . ASP A 1 504 ? 76.701  96.722  77.747  1.00 36.42  ? 504  ASP A CA    1 
ATOM   3363 C  C     . ASP A 1 504 ? 78.199  96.972  77.767  1.00 36.42  ? 504  ASP A C     1 
ATOM   3364 O  O     . ASP A 1 504 ? 78.865  96.601  78.736  1.00 36.42  ? 504  ASP A O     1 
ATOM   3365 C  CB    . ASP A 1 504 ? 76.389  95.385  77.072  1.00 36.42  ? 504  ASP A CB    1 
ATOM   3366 C  CG    . ASP A 1 504 ? 76.641  95.402  75.577  1.00 36.42  ? 504  ASP A CG    1 
ATOM   3367 O  OD1   . ASP A 1 504 ? 76.954  96.473  75.020  1.00 36.42  ? 504  ASP A OD1   1 
ATOM   3368 O  OD2   . ASP A 1 504 ? 76.520  94.331  74.951  1.00 36.42  ? 504  ASP A OD2   1 
ATOM   3369 N  N     . ALA A 1 505 ? 78.740  97.612  76.730  1.00 33.21  ? 505  ALA A N     1 
ATOM   3370 C  CA    . ALA A 1 505 ? 80.166  97.907  76.675  1.00 33.21  ? 505  ALA A CA    1 
ATOM   3371 C  C     . ALA A 1 505 ? 80.592  98.973  77.669  1.00 33.21  ? 505  ALA A C     1 
ATOM   3372 O  O     . ALA A 1 505 ? 81.790  99.106  77.927  1.00 33.21  ? 505  ALA A O     1 
ATOM   3373 C  CB    . ALA A 1 505 ? 80.561  98.342  75.270  1.00 33.21  ? 505  ALA A CB    1 
ATOM   3374 N  N     . PHE A 1 506 ? 79.653  99.744  78.214  1.00 30.78  ? 506  PHE A N     1 
ATOM   3375 C  CA    . PHE A 1 506 ? 79.984  100.630 79.320  1.00 30.78  ? 506  PHE A CA    1 
ATOM   3376 C  C     . PHE A 1 506 ? 80.252  99.842  80.591  1.00 30.78  ? 506  PHE A C     1 
ATOM   3377 O  O     . PHE A 1 506 ? 81.209  100.131 81.315  1.00 30.78  ? 506  PHE A O     1 
ATOM   3378 C  CB    . PHE A 1 506 ? 78.857  101.633 79.540  1.00 30.78  ? 506  PHE A CB    1 
ATOM   3379 C  CG    . PHE A 1 506 ? 79.047  102.496 80.744  1.00 30.78  ? 506  PHE A CG    1 
ATOM   3380 C  CD1   . PHE A 1 506 ? 80.010  103.480 80.763  1.00 30.78  ? 506  PHE A CD1   1 
ATOM   3381 C  CD2   . PHE A 1 506 ? 78.248  102.333 81.857  1.00 30.78  ? 506  PHE A CD2   1 
ATOM   3382 C  CE1   . PHE A 1 506 ? 80.182  104.273 81.874  1.00 30.78  ? 506  PHE A CE1   1 
ATOM   3383 C  CE2   . PHE A 1 506 ? 78.420  103.126 82.966  1.00 30.78  ? 506  PHE A CE2   1 
ATOM   3384 C  CZ    . PHE A 1 506 ? 79.385  104.095 82.970  1.00 30.78  ? 506  PHE A CZ    1 
ATOM   3385 N  N     . PHE A 1 507 ? 79.423  98.838  80.875  1.00 30.21  ? 507  PHE A N     1 
ATOM   3386 C  CA    . PHE A 1 507 ? 79.569  98.071  82.103  1.00 30.21  ? 507  PHE A CA    1 
ATOM   3387 C  C     . PHE A 1 507 ? 80.644  97.003  82.003  1.00 30.21  ? 507  PHE A C     1 
ATOM   3388 O  O     . PHE A 1 507 ? 81.183  96.603  83.036  1.00 30.21  ? 507  PHE A O     1 
ATOM   3389 C  CB    . PHE A 1 507 ? 78.239  97.430  82.489  1.00 30.21  ? 507  PHE A CB    1 
ATOM   3390 C  CG    . PHE A 1 507 ? 77.188  98.418  82.892  1.00 30.21  ? 507  PHE A CG    1 
ATOM   3391 C  CD1   . PHE A 1 507 ? 77.218  99.003  84.144  1.00 30.21  ? 507  PHE A CD1   1 
ATOM   3392 C  CD2   . PHE A 1 507 ? 76.165  98.756  82.025  1.00 30.21  ? 507  PHE A CD2   1 
ATOM   3393 C  CE1   . PHE A 1 507 ? 76.251  99.914  84.521  1.00 30.21  ? 507  PHE A CE1   1 
ATOM   3394 C  CE2   . PHE A 1 507 ? 75.194  99.666  82.395  1.00 30.21  ? 507  PHE A CE2   1 
ATOM   3395 C  CZ    . PHE A 1 507 ? 75.238  100.244 83.645  1.00 30.21  ? 507  PHE A CZ    1 
ATOM   3396 N  N     . VAL A 1 508 ? 80.956  96.524  80.797  1.00 27.66  ? 508  VAL A N     1 
ATOM   3397 C  CA    . VAL A 1 508 ? 82.120  95.661  80.621  1.00 27.66  ? 508  VAL A CA    1 
ATOM   3398 C  C     . VAL A 1 508 ? 83.395  96.459  80.851  1.00 27.66  ? 508  VAL A C     1 
ATOM   3399 O  O     . VAL A 1 508 ? 84.356  95.965  81.451  1.00 27.66  ? 508  VAL A O     1 
ATOM   3400 C  CB    . VAL A 1 508 ? 82.085  95.000  79.230  1.00 27.66  ? 508  VAL A CB    1 
ATOM   3401 C  CG1   . VAL A 1 508 ? 83.346  94.216  78.955  1.00 27.66  ? 508  VAL A CG1   1 
ATOM   3402 C  CG2   . VAL A 1 508 ? 80.904  94.069  79.128  1.00 27.66  ? 508  VAL A CG2   1 
ATOM   3403 N  N     . MET A 1 509 ? 83.405  97.719  80.419  1.00 27.07  ? 509  MET A N     1 
ATOM   3404 C  CA    . MET A 1 509 ? 84.516  98.613  80.722  1.00 27.07  ? 509  MET A CA    1 
ATOM   3405 C  C     . MET A 1 509 ? 84.595  98.926  82.209  1.00 27.07  ? 509  MET A C     1 
ATOM   3406 O  O     . MET A 1 509 ? 85.688  98.963  82.778  1.00 27.07  ? 509  MET A O     1 
ATOM   3407 C  CB    . MET A 1 509 ? 84.372  99.897  79.913  1.00 27.07  ? 509  MET A CB    1 
ATOM   3408 C  CG    . MET A 1 509 ? 85.441  100.911 80.181  1.00 27.07  ? 509  MET A CG    1 
ATOM   3409 S  SD    . MET A 1 509 ? 85.234  102.370 79.169  1.00 27.07  ? 509  MET A SD    1 
ATOM   3410 C  CE    . MET A 1 509 ? 86.443  103.428 79.926  1.00 27.07  ? 509  MET A CE    1 
ATOM   3411 N  N     . MET A 1 510 ? 83.450  99.144  82.856  1.00 25.43  ? 510  MET A N     1 
ATOM   3412 C  CA    . MET A 1 510 ? 83.444  99.413  84.291  1.00 25.43  ? 510  MET A CA    1 
ATOM   3413 C  C     . MET A 1 510 ? 83.886  98.195  85.087  1.00 25.43  ? 510  MET A C     1 
ATOM   3414 O  O     . MET A 1 510 ? 84.622  98.325  86.071  1.00 25.43  ? 510  MET A O     1 
ATOM   3415 C  CB    . MET A 1 510 ? 82.058  99.858  84.735  1.00 25.43  ? 510  MET A CB    1 
ATOM   3416 C  CG    . MET A 1 510 ? 81.938  100.165 86.213  1.00 25.43  ? 510  MET A CG    1 
ATOM   3417 S  SD    . MET A 1 510 ? 80.292  100.702 86.673  1.00 25.43  ? 510  MET A SD    1 
ATOM   3418 C  CE    . MET A 1 510 ? 80.324  102.360 86.024  1.00 25.43  ? 510  MET A CE    1 
ATOM   3419 N  N     . PHE A 1 511 ? 83.453  97.005  84.672  1.00 21.99  ? 511  PHE A N     1 
ATOM   3420 C  CA    . PHE A 1 511 ? 83.861  95.780  85.347  1.00 21.99  ? 511  PHE A CA    1 
ATOM   3421 C  C     . PHE A 1 511 ? 85.338  95.486  85.131  1.00 21.99  ? 511  PHE A C     1 
ATOM   3422 O  O     . PHE A 1 511 ? 85.990  94.953  86.027  1.00 21.99  ? 511  PHE A O     1 
ATOM   3423 C  CB    . PHE A 1 511 ? 82.994  94.617  84.866  1.00 21.99  ? 511  PHE A CB    1 
ATOM   3424 C  CG    . PHE A 1 511 ? 83.305  93.312  85.519  1.00 21.99  ? 511  PHE A CG    1 
ATOM   3425 C  CD1   . PHE A 1 511 ? 82.976  93.089  86.840  1.00 21.99  ? 511  PHE A CD1   1 
ATOM   3426 C  CD2   . PHE A 1 511 ? 83.894  92.291  84.799  1.00 21.99  ? 511  PHE A CD2   1 
ATOM   3427 C  CE1   . PHE A 1 511 ? 83.256  91.883  87.436  1.00 21.99  ? 511  PHE A CE1   1 
ATOM   3428 C  CE2   . PHE A 1 511 ? 84.175  91.084  85.391  1.00 21.99  ? 511  PHE A CE2   1 
ATOM   3429 C  CZ    . PHE A 1 511 ? 83.858  90.880  86.708  1.00 21.99  ? 511  PHE A CZ    1 
ATOM   3430 N  N     . THR A 1 512 ? 85.885  95.855  83.971  1.00 21.07  ? 512  THR A N     1 
ATOM   3431 C  CA    . THR A 1 512 ? 87.290  95.584  83.680  1.00 21.07  ? 512  THR A CA    1 
ATOM   3432 C  C     . THR A 1 512 ? 88.210  96.464  84.515  1.00 21.07  ? 512  THR A C     1 
ATOM   3433 O  O     . THR A 1 512 ? 89.254  96.007  84.992  1.00 21.07  ? 512  THR A O     1 
ATOM   3434 C  CB    . THR A 1 512 ? 87.554  95.790  82.193  1.00 21.07  ? 512  THR A CB    1 
ATOM   3435 O  OG1   . THR A 1 512 ? 86.655  94.972  81.440  1.00 21.07  ? 512  THR A OG1   1 
ATOM   3436 C  CG2   . THR A 1 512 ? 88.967  95.403  81.834  1.00 21.07  ? 512  THR A CG2   1 
ATOM   3437 N  N     . LEU A 1 513 ? 87.835  97.724  84.721  1.00 20.32  ? 513  LEU A N     1 
ATOM   3438 C  CA    . LEU A 1 513 ? 88.647  98.607  85.544  1.00 20.32  ? 513  LEU A CA    1 
ATOM   3439 C  C     . LEU A 1 513 ? 88.542  98.284  87.027  1.00 20.32  ? 513  LEU A C     1 
ATOM   3440 O  O     . LEU A 1 513 ? 89.449  98.638  87.784  1.00 20.32  ? 513  LEU A O     1 
ATOM   3441 C  CB    . LEU A 1 513 ? 88.269  100.066 85.288  1.00 20.32  ? 513  LEU A CB    1 
ATOM   3442 C  CG    . LEU A 1 513 ? 88.986  100.838 84.174  1.00 20.32  ? 513  LEU A CG    1 
ATOM   3443 C  CD1   . LEU A 1 513 ? 88.625  100.371 82.806  1.00 20.32  ? 513  LEU A CD1   1 
ATOM   3444 C  CD2   . LEU A 1 513 ? 88.663  102.301 84.289  1.00 20.32  ? 513  LEU A CD2   1 
ATOM   3445 N  N     . MET A 1 514 ? 87.469  97.620  87.461  1.00 20.80  ? 514  MET A N     1 
ATOM   3446 C  CA    . MET A 1 514 ? 87.402  97.152  88.841  1.00 20.80  ? 514  MET A CA    1 
ATOM   3447 C  C     . MET A 1 514 ? 88.298  95.945  89.056  1.00 20.80  ? 514  MET A C     1 
ATOM   3448 O  O     . MET A 1 514 ? 88.920  95.808  90.113  1.00 20.80  ? 514  MET A O     1 
ATOM   3449 C  CB    . MET A 1 514 ? 85.974  96.785  89.221  1.00 20.80  ? 514  MET A CB    1 
ATOM   3450 C  CG    . MET A 1 514 ? 85.002  97.922  89.335  1.00 20.80  ? 514  MET A CG    1 
ATOM   3451 S  SD    . MET A 1 514 ? 83.413  97.233  89.805  1.00 20.80  ? 514  MET A SD    1 
ATOM   3452 C  CE    . MET A 1 514 ? 82.387  98.676  89.715  1.00 20.80  ? 514  MET A CE    1 
ATOM   3453 N  N     . MET A 1 515 ? 88.361  95.049  88.070  1.00 17.42  ? 515  MET A N     1 
ATOM   3454 C  CA    . MET A 1 515 ? 89.122  93.818  88.224  1.00 17.42  ? 515  MET A CA    1 
ATOM   3455 C  C     . MET A 1 515 ? 90.619  94.070  88.208  1.00 17.42  ? 515  MET A C     1 
ATOM   3456 O  O     . MET A 1 515 ? 91.365  93.334  88.852  1.00 17.42  ? 515  MET A O     1 
ATOM   3457 C  CB    . MET A 1 515 ? 88.743  92.825  87.132  1.00 17.42  ? 515  MET A CB    1 
ATOM   3458 C  CG    . MET A 1 515 ? 87.341  92.289  87.249  1.00 17.42  ? 515  MET A CG    1 
ATOM   3459 S  SD    . MET A 1 515 ? 87.092  91.303  88.719  1.00 17.42  ? 515  MET A SD    1 
ATOM   3460 C  CE    . MET A 1 515 ? 88.003  89.844  88.253  1.00 17.42  ? 515  MET A CE    1 
ATOM   3461 N  N     . VAL A 1 516 ? 91.087  95.087  87.485  1.00 17.08  ? 516  VAL A N     1 
ATOM   3462 C  CA    . VAL A 1 516 ? 92.501  95.431  87.583  1.00 17.08  ? 516  VAL A CA    1 
ATOM   3463 C  C     . VAL A 1 516 ? 92.790  96.259  88.820  1.00 17.08  ? 516  VAL A C     1 
ATOM   3464 O  O     . VAL A 1 516 ? 93.943  96.328  89.252  1.00 17.08  ? 516  VAL A O     1 
ATOM   3465 C  CB    . VAL A 1 516 ? 93.013  96.169  86.336  1.00 17.08  ? 516  VAL A CB    1 
ATOM   3466 C  CG1   . VAL A 1 516 ? 92.947  95.274  85.157  1.00 17.08  ? 516  VAL A CG1   1 
ATOM   3467 C  CG2   . VAL A 1 516 ? 92.191  97.376  86.063  1.00 17.08  ? 516  VAL A CG2   1 
ATOM   3468 N  N     . ALA A 1 517 ? 91.777  96.891  89.406  1.00 16.33  ? 517  ALA A N     1 
ATOM   3469 C  CA    . ALA A 1 517 ? 91.976  97.573  90.673  1.00 16.33  ? 517  ALA A CA    1 
ATOM   3470 C  C     . ALA A 1 517 ? 91.971  96.596  91.833  1.00 16.33  ? 517  ALA A C     1 
ATOM   3471 O  O     . ALA A 1 517 ? 92.694  96.804  92.807  1.00 16.33  ? 517  ALA A O     1 
ATOM   3472 C  CB    . ALA A 1 517 ? 90.905  98.640  90.873  1.00 16.33  ? 517  ALA A CB    1 
ATOM   3473 N  N     . TYR A 1 518 ? 91.179  95.528  91.744  1.00 16.17  ? 518  TYR A N     1 
ATOM   3474 C  CA    . TYR A 1 518 ? 91.170  94.509  92.786  1.00 16.17  ? 518  TYR A CA    1 
ATOM   3475 C  C     . TYR A 1 518 ? 92.397  93.617  92.711  1.00 16.17  ? 518  TYR A C     1 
ATOM   3476 O  O     . TYR A 1 518 ? 92.932  93.216  93.745  1.00 16.17  ? 518  TYR A O     1 
ATOM   3477 C  CB    . TYR A 1 518 ? 89.918  93.647  92.681  1.00 16.17  ? 518  TYR A CB    1 
ATOM   3478 C  CG    . TYR A 1 518 ? 88.638  94.333  93.055  1.00 16.17  ? 518  TYR A CG    1 
ATOM   3479 C  CD1   . TYR A 1 518 ? 88.643  95.482  93.828  1.00 16.17  ? 518  TYR A CD1   1 
ATOM   3480 C  CD2   . TYR A 1 518 ? 87.420  93.840  92.617  1.00 16.17  ? 518  TYR A CD2   1 
ATOM   3481 C  CE1   . TYR A 1 518 ? 87.474  96.116  94.163  1.00 16.17  ? 518  TYR A CE1   1 
ATOM   3482 C  CE2   . TYR A 1 518 ? 86.242  94.472  92.944  1.00 16.17  ? 518  TYR A CE2   1 
ATOM   3483 C  CZ    . TYR A 1 518 ? 86.280  95.610  93.720  1.00 16.17  ? 518  TYR A CZ    1 
ATOM   3484 O  OH    . TYR A 1 518 ? 85.119  96.249  94.059  1.00 16.17  ? 518  TYR A OH    1 
ATOM   3485 N  N     . SER A 1 519 ? 92.838  93.278  91.499  1.00 14.68  ? 519  SER A N     1 
ATOM   3486 C  CA    . SER A 1 519 ? 93.968  92.372  91.341  1.00 14.68  ? 519  SER A CA    1 
ATOM   3487 C  C     . SER A 1 519 ? 95.272  93.034  91.732  1.00 14.68  ? 519  SER A C     1 
ATOM   3488 O  O     . SER A 1 519 ? 96.172  92.369  92.249  1.00 14.68  ? 519  SER A O     1 
ATOM   3489 C  CB    . SER A 1 519 ? 94.054  91.884  89.903  1.00 14.68  ? 519  SER A CB    1 
ATOM   3490 O  OG    . SER A 1 519 ? 92.875  91.198  89.545  1.00 14.68  ? 519  SER A OG    1 
ATOM   3491 N  N     . ALA A 1 520 ? 95.402  94.329  91.482  1.00 13.96  ? 520  ALA A N     1 
ATOM   3492 C  CA    . ALA A 1 520 ? 96.595  95.039  91.899  1.00 13.96  ? 520  ALA A CA    1 
ATOM   3493 C  C     . ALA A 1 520 ? 96.541  95.442  93.361  1.00 13.96  ? 520  ALA A C     1 
ATOM   3494 O  O     . ALA A 1 520 ? 97.587  95.684  93.959  1.00 13.96  ? 520  ALA A O     1 
ATOM   3495 C  CB    . ALA A 1 520 ? 96.806  96.266  91.019  1.00 13.96  ? 520  ALA A CB    1 
ATOM   3496 N  N     . SER A 1 521 ? 95.351  95.536  93.950  1.00 13.98  ? 521  SER A N     1 
ATOM   3497 C  CA    . SER A 1 521 ? 95.263  95.740  95.387  1.00 13.98  ? 521  SER A CA    1 
ATOM   3498 C  C     . SER A 1 521 ? 95.512  94.452  96.143  1.00 13.98  ? 521  SER A C     1 
ATOM   3499 O  O     . SER A 1 521 ? 96.081  94.484  97.235  1.00 13.98  ? 521  SER A O     1 
ATOM   3500 C  CB    . SER A 1 521 ? 93.898  96.298  95.768  1.00 13.98  ? 521  SER A CB    1 
ATOM   3501 O  OG    . SER A 1 521 ? 93.697  97.565  95.183  1.00 13.98  ? 521  SER A OG    1 
ATOM   3502 N  N     . SER A 1 522 ? 95.093  93.319  95.580  1.00 11.73  ? 522  SER A N     1 
ATOM   3503 C  CA    . SER A 1 522 ? 95.367  92.026  96.188  1.00 11.73  ? 522  SER A CA    1 
ATOM   3504 C  C     . SER A 1 522 ? 96.848  91.693  96.156  1.00 11.73  ? 522  SER A C     1 
ATOM   3505 O  O     . SER A 1 522 ? 97.339  90.998  97.046  1.00 11.73  ? 522  SER A O     1 
ATOM   3506 C  CB    . SER A 1 522 ? 94.568  90.943  95.478  1.00 11.73  ? 522  SER A CB    1 
ATOM   3507 O  OG    . SER A 1 522 ? 93.185  91.192  95.596  1.00 11.73  ? 522  SER A OG    1 
ATOM   3508 N  N     . MET A 1 523 ? 97.577  92.174  95.152  1.00 13.40  ? 523  MET A N     1 
ATOM   3509 C  CA    . MET A 1 523 ? 99.022  92.021  95.156  1.00 13.40  ? 523  MET A CA    1 
ATOM   3510 C  C     . MET A 1 523 ? 99.684  93.009  96.101  1.00 13.40  ? 523  MET A C     1 
ATOM   3511 O  O     . MET A 1 523 ? 100.790 92.752  96.580  1.00 13.40  ? 523  MET A O     1 
ATOM   3512 C  CB    . MET A 1 523 ? 99.579  92.187  93.742  1.00 13.40  ? 523  MET A CB    1 
ATOM   3513 C  CG    . MET A 1 523 ? 100.983 91.634  93.588  1.00 13.40  ? 523  MET A CG    1 
ATOM   3514 S  SD    . MET A 1 523 ? 101.642 91.611  91.923  1.00 13.40  ? 523  MET A SD    1 
ATOM   3515 C  CE    . MET A 1 523 ? 102.176 93.293  91.717  1.00 13.40  ? 523  MET A CE    1 
ATOM   3516 N  N     . ALA A 1 524 ? 99.025  94.123  96.400  1.00 12.50  ? 524  ALA A N     1 
ATOM   3517 C  CA    . ALA A 1 524 ? 99.544  95.022  97.416  1.00 12.50  ? 524  ALA A CA    1 
ATOM   3518 C  C     . ALA A 1 524 ? 99.403  94.418  98.790  1.00 12.50  ? 524  ALA A C     1 
ATOM   3519 O  O     . ALA A 1 524 ? 100.240 94.656  99.660  1.00 12.50  ? 524  ALA A O     1 
ATOM   3520 C  CB    . ALA A 1 524 ? 98.824  96.362  97.348  1.00 12.50  ? 524  ALA A CB    1 
ATOM   3521 N  N     . LEU A 1 525 ? 98.365  93.619  98.988  1.00 11.57  ? 525  LEU A N     1 
ATOM   3522 C  CA    . LEU A 1 525 ? 98.156  92.953  100.257 1.00 11.57  ? 525  LEU A CA    1 
ATOM   3523 C  C     . LEU A 1 525 ? 99.021  91.717  100.392 1.00 11.57  ? 525  LEU A C     1 
ATOM   3524 O  O     . LEU A 1 525 ? 99.431  91.380  101.503 1.00 11.57  ? 525  LEU A O     1 
ATOM   3525 C  CB    . LEU A 1 525 ? 96.690  92.584  100.394 1.00 11.57  ? 525  LEU A CB    1 
ATOM   3526 C  CG    . LEU A 1 525 ? 95.789  93.806  100.440 1.00 11.57  ? 525  LEU A CG    1 
ATOM   3527 C  CD1   . LEU A 1 525 ? 94.365  93.374  100.356 1.00 11.57  ? 525  LEU A CD1   1 
ATOM   3528 C  CD2   . LEU A 1 525 ? 96.040  94.576  101.702 1.00 11.57  ? 525  LEU A CD2   1 
ATOM   3529 N  N     . ALA A 1 526 ? 99.310  91.034  99.285  1.00 10.21  ? 526  ALA A N     1 
ATOM   3530 C  CA    . ALA A 1 526 ? 100.113 89.821  99.352  1.00 10.21  ? 526  ALA A CA    1 
ATOM   3531 C  C     . ALA A 1 526 ? 101.566 90.128  99.660  1.00 10.21  ? 526  ALA A C     1 
ATOM   3532 O  O     . ALA A 1 526 ? 102.257 89.299  100.253 1.00 10.21  ? 526  ALA A O     1 
ATOM   3533 C  CB    . ALA A 1 526 ? 100.004 89.047  98.044  1.00 10.21  ? 526  ALA A CB    1 
ATOM   3534 N  N     . ILE A 1 527 ? 102.045 91.306  99.277  1.00 10.97  ? 527  ILE A N     1 
ATOM   3535 C  CA    . ILE A 1 527 ? 103.412 91.680  99.601  1.00 10.97  ? 527  ILE A CA    1 
ATOM   3536 C  C     . ILE A 1 527 ? 103.496 92.260  101.010 1.00 10.97  ? 527  ILE A C     1 
ATOM   3537 O  O     . ILE A 1 527 ? 104.476 92.027  101.725 1.00 10.97  ? 527  ILE A O     1 
ATOM   3538 C  CB    . ILE A 1 527 ? 103.938 92.655  98.531  1.00 10.97  ? 527  ILE A CB    1 
ATOM   3539 C  CG1   . ILE A 1 527 ? 103.914 91.986  97.164  1.00 10.97  ? 527  ILE A CG1   1 
ATOM   3540 C  CG2   . ILE A 1 527 ? 105.364 93.077  98.797  1.00 10.97  ? 527  ILE A CG2   1 
ATOM   3541 C  CD1   . ILE A 1 527 ? 104.190 92.921  96.035  1.00 10.97  ? 527  ILE A CD1   1 
ATOM   3542 N  N     . ALA A 1 528 ? 102.458 92.960  101.464 1.00 12.01  ? 528  ALA A N     1 
ATOM   3543 C  CA    . ALA A 1 528 ? 102.539 93.773  102.666 1.00 12.01  ? 528  ALA A CA    1 
ATOM   3544 C  C     . ALA A 1 528 ? 101.828 93.200  103.883 1.00 12.01  ? 528  ALA A C     1 
ATOM   3545 O  O     . ALA A 1 528 ? 101.798 93.871  104.917 1.00 12.01  ? 528  ALA A O     1 
ATOM   3546 C  CB    . ALA A 1 528 ? 101.976 95.162  102.389 1.00 12.01  ? 528  ALA A CB    1 
ATOM   3547 N  N     . ALA A 1 529 ? 101.251 92.006  103.805 1.00 10.32  ? 529  ALA A N     1 
ATOM   3548 C  CA    . ALA A 1 529 ? 100.572 91.445  104.965 1.00 10.32  ? 529  ALA A CA    1 
ATOM   3549 C  C     . ALA A 1 529 ? 101.587 90.986  106.001 1.00 10.32  ? 529  ALA A C     1 
ATOM   3550 O  O     . ALA A 1 529 ? 102.560 90.305  105.674 1.00 10.32  ? 529  ALA A O     1 
ATOM   3551 C  CB    . ALA A 1 529 ? 99.678  90.281  104.557 1.00 10.32  ? 529  ALA A CB    1 
ATOM   3552 N  N     . GLY A 1 530 ? 101.367 91.372  107.252 1.00 11.91  ? 530  GLY A N     1 
ATOM   3553 C  CA    . GLY A 1 530 ? 102.253 90.959  108.321 1.00 11.91  ? 530  GLY A CA    1 
ATOM   3554 C  C     . GLY A 1 530 ? 103.609 91.618  108.302 1.00 11.91  ? 530  GLY A C     1 
ATOM   3555 O  O     . GLY A 1 530 ? 104.604 90.984  108.657 1.00 11.91  ? 530  GLY A O     1 
ATOM   3556 N  N     . GLN A 1 531 ? 103.675 92.879  107.908 1.00 12.80  ? 531  GLN A N     1 
ATOM   3557 C  CA    . GLN A 1 531 ? 104.937 93.580  107.762 1.00 12.80  ? 531  GLN A CA    1 
ATOM   3558 C  C     . GLN A 1 531 ? 104.846 94.906  108.501 1.00 12.80  ? 531  GLN A C     1 
ATOM   3559 O  O     . GLN A 1 531 ? 103.787 95.535  108.530 1.00 12.80  ? 531  GLN A O     1 
ATOM   3560 C  CB    . GLN A 1 531 ? 105.268 93.761  106.280 1.00 12.80  ? 531  GLN A CB    1 
ATOM   3561 C  CG    . GLN A 1 531 ? 106.601 94.379  105.999 1.00 12.80  ? 531  GLN A CG    1 
ATOM   3562 C  CD    . GLN A 1 531 ? 106.984 94.284  104.552 1.00 12.80  ? 531  GLN A CD    1 
ATOM   3563 O  OE1   . GLN A 1 531 ? 106.295 93.656  103.755 1.00 12.80  ? 531  GLN A OE1   1 
ATOM   3564 N  NE2   . GLN A 1 531 ? 108.077 94.932  104.194 1.00 12.80  ? 531  GLN A NE2   1 
ATOM   3565 N  N     . SER A 1 532 ? 105.950 95.302  109.133 1.00 13.49  ? 532  SER A N     1 
ATOM   3566 C  CA    . SER A 1 532 ? 105.947 96.400  110.090 1.00 13.49  ? 532  SER A CA    1 
ATOM   3567 C  C     . SER A 1 532 ? 106.046 97.763  109.434 1.00 13.49  ? 532  SER A C     1 
ATOM   3568 O  O     . SER A 1 532 ? 105.445 98.723  109.926 1.00 13.49  ? 532  SER A O     1 
ATOM   3569 C  CB    . SER A 1 532 ? 107.101 96.228  111.074 1.00 13.49  ? 532  SER A CB    1 
ATOM   3570 O  OG    . SER A 1 532 ? 106.959 95.024  111.803 1.00 13.49  ? 532  SER A OG    1 
ATOM   3571 N  N     . VAL A 1 533 ? 106.800 97.873  108.345 1.00 15.11  ? 533  VAL A N     1 
ATOM   3572 C  CA    . VAL A 1 533 ? 106.920 99.108  107.588 1.00 15.11  ? 533  VAL A CA    1 
ATOM   3573 C  C     . VAL A 1 533 ? 106.443 98.851  106.168 1.00 15.11  ? 533  VAL A C     1 
ATOM   3574 O  O     . VAL A 1 533 ? 106.428 97.720  105.680 1.00 15.11  ? 533  VAL A O     1 
ATOM   3575 C  CB    . VAL A 1 533 ? 108.360 99.657  107.586 1.00 15.11  ? 533  VAL A CB    1 
ATOM   3576 C  CG1   . VAL A 1 533 ? 108.781 100.050 108.983 1.00 15.11  ? 533  VAL A CG1   1 
ATOM   3577 C  CG2   . VAL A 1 533 ? 109.307 98.623  107.029 1.00 15.11  ? 533  VAL A CG2   1 
ATOM   3578 N  N     . VAL A 1 534 ? 106.044 99.931  105.501 1.00 16.36  ? 534  VAL A N     1 
ATOM   3579 C  CA    . VAL A 1 534 ? 105.634 99.865  104.108 1.00 16.36  ? 534  VAL A CA    1 
ATOM   3580 C  C     . VAL A 1 534 ? 106.775 100.212 103.161 1.00 16.36  ? 534  VAL A C     1 
ATOM   3581 O  O     . VAL A 1 534 ? 106.542 100.378 101.970 1.00 16.36  ? 534  VAL A O     1 
ATOM   3582 C  CB    . VAL A 1 534 ? 104.423 100.770 103.842 1.00 16.36  ? 534  VAL A CB    1 
ATOM   3583 C  CG1   . VAL A 1 534 ? 103.220 100.251 104.534 1.00 16.36  ? 534  VAL A CG1   1 
ATOM   3584 C  CG2   . VAL A 1 534 ? 104.694 102.119 104.372 1.00 16.36  ? 534  VAL A CG2   1 
ATOM   3585 N  N     . SER A 1 535 ? 108.004 100.317 103.662 1.00 17.52  ? 535  SER A N     1 
ATOM   3586 C  CA    . SER A 1 535 ? 109.102 100.797 102.829 1.00 17.52  ? 535  SER A CA    1 
ATOM   3587 C  C     . SER A 1 535 ? 109.568 99.743  101.832 1.00 17.52  ? 535  SER A C     1 
ATOM   3588 O  O     . SER A 1 535 ? 109.928 100.077 100.700 1.00 17.52  ? 535  SER A O     1 
ATOM   3589 C  CB    . SER A 1 535 ? 110.268 101.249 103.707 1.00 17.52  ? 535  SER A CB    1 
ATOM   3590 O  OG    . SER A 1 535 ? 111.343 101.722 102.917 1.00 17.52  ? 535  SER A OG    1 
ATOM   3591 N  N     . VAL A 1 536 ? 109.576 98.474  102.230 1.00 16.26  ? 536  VAL A N     1 
ATOM   3592 C  CA    . VAL A 1 536 ? 109.954 97.420  101.298 1.00 16.26  ? 536  VAL A CA    1 
ATOM   3593 C  C     . VAL A 1 536 ? 108.802 97.112  100.353 1.00 16.26  ? 536  VAL A C     1 
ATOM   3594 O  O     . VAL A 1 536 ? 109.002 96.912  99.152  1.00 16.26  ? 536  VAL A O     1 
ATOM   3595 C  CB    . VAL A 1 536 ? 110.394 96.165  102.073 1.00 16.26  ? 536  VAL A CB    1 
ATOM   3596 C  CG1   . VAL A 1 536 ? 110.881 95.075  101.132 1.00 16.26  ? 536  VAL A CG1   1 
ATOM   3597 C  CG2   . VAL A 1 536 ? 111.426 96.505  103.114 1.00 16.26  ? 536  VAL A CG2   1 
ATOM   3598 N  N     . ALA A 1 537 ? 107.581 97.087  100.879 1.00 15.13  ? 537  ALA A N     1 
ATOM   3599 C  CA    . ALA A 1 537 ? 106.441 96.600  100.121 1.00 15.13  ? 537  ALA A CA    1 
ATOM   3600 C  C     . ALA A 1 537 ? 105.938 97.604  99.100  1.00 15.13  ? 537  ALA A C     1 
ATOM   3601 O  O     . ALA A 1 537 ? 105.392 97.195  98.078  1.00 15.13  ? 537  ALA A O     1 
ATOM   3602 C  CB    . ALA A 1 537 ? 105.314 96.221  101.072 1.00 15.13  ? 537  ALA A CB    1 
ATOM   3603 N  N     . THR A 1 538 ? 106.072 98.905  99.367  1.00 16.28  ? 538  THR A N     1 
ATOM   3604 C  CA    . THR A 1 538 ? 105.799 99.914  98.344  1.00 16.28  ? 538  THR A CA    1 
ATOM   3605 C  C     . THR A 1 538 ? 106.826 99.836  97.227  1.00 16.28  ? 538  THR A C     1 
ATOM   3606 O  O     . THR A 1 538 ? 106.497 100.040 96.055  1.00 16.28  ? 538  THR A O     1 
ATOM   3607 C  CB    . THR A 1 538 ? 105.794 101.309 98.983  1.00 16.28  ? 538  THR A CB    1 
ATOM   3608 O  OG1   . THR A 1 538 ? 104.795 101.356 100.006 1.00 16.28  ? 538  THR A OG1   1 
ATOM   3609 C  CG2   . THR A 1 538 ? 105.518 102.411 97.987  1.00 16.28  ? 538  THR A CG2   1 
ATOM   3610 N  N     . LEU A 1 539 ? 108.058 99.482  97.575  1.00 16.93  ? 539  LEU A N     1 
ATOM   3611 C  CA    . LEU A 1 539 ? 109.145 99.447  96.609  1.00 16.93  ? 539  LEU A CA    1 
ATOM   3612 C  C     . LEU A 1 539 ? 109.001 98.281  95.644  1.00 16.93  ? 539  LEU A C     1 
ATOM   3613 O  O     . LEU A 1 539 ? 109.171 98.449  94.434  1.00 16.93  ? 539  LEU A O     1 
ATOM   3614 C  CB    . LEU A 1 539 ? 110.463 99.369  97.358  1.00 16.93  ? 539  LEU A CB    1 
ATOM   3615 C  CG    . LEU A 1 539 ? 111.713 99.483  96.533  1.00 16.93  ? 539  LEU A CG    1 
ATOM   3616 C  CD1   . LEU A 1 539 ? 111.645 100.804 95.819  1.00 16.93  ? 539  LEU A CD1   1 
ATOM   3617 C  CD2   . LEU A 1 539 ? 112.842 99.456  97.513  1.00 16.93  ? 539  LEU A CD2   1 
ATOM   3618 N  N     . LEU A 1 540 ? 108.677 97.094  96.155  1.00 16.38  ? 540  LEU A N     1 
ATOM   3619 C  CA    . LEU A 1 540 ? 108.381 95.964  95.287  1.00 16.38  ? 540  LEU A CA    1 
ATOM   3620 C  C     . LEU A 1 540 ? 107.035 96.081  94.599  1.00 16.38  ? 540  LEU A C     1 
ATOM   3621 O  O     . LEU A 1 540 ? 106.764 95.307  93.684  1.00 16.38  ? 540  LEU A O     1 
ATOM   3622 C  CB    . LEU A 1 540 ? 108.413 94.652  96.066  1.00 16.38  ? 540  LEU A CB    1 
ATOM   3623 C  CG    . LEU A 1 540 ? 109.735 93.911  96.236  1.00 16.38  ? 540  LEU A CG    1 
ATOM   3624 C  CD1   . LEU A 1 540 ? 110.638 94.569  97.254  1.00 16.38  ? 540  LEU A CD1   1 
ATOM   3625 C  CD2   . LEU A 1 540 ? 109.442 92.485  96.622  1.00 16.38  ? 540  LEU A CD2   1 
ATOM   3626 N  N     . MET A 1 541 ? 106.184 97.010  95.017  1.00 17.02  ? 541  MET A N     1 
ATOM   3627 C  CA    . MET A 1 541 ? 104.885 97.150  94.377  1.00 17.02  ? 541  MET A CA    1 
ATOM   3628 C  C     . MET A 1 541 ? 105.001 97.911  93.069  1.00 17.02  ? 541  MET A C     1 
ATOM   3629 O  O     . MET A 1 541 ? 104.391 97.531  92.068  1.00 17.02  ? 541  MET A O     1 
ATOM   3630 C  CB    . MET A 1 541 ? 103.927 97.866  95.318  1.00 17.02  ? 541  MET A CB    1 
ATOM   3631 C  CG    . MET A 1 541 ? 102.509 97.660  94.984  1.00 17.02  ? 541  MET A CG    1 
ATOM   3632 S  SD    . MET A 1 541 ? 102.257 95.908  95.123  1.00 17.02  ? 541  MET A SD    1 
ATOM   3633 C  CE    . MET A 1 541 ? 100.849 95.760  94.084  1.00 17.02  ? 541  MET A CE    1 
ATOM   3634 N  N     . THR A 1 542 ? 105.793 98.977  93.064  1.00 17.86  ? 542  THR A N     1 
ATOM   3635 C  CA    . THR A 1 542 ? 105.896 99.847  91.905  1.00 17.86  ? 542  THR A CA    1 
ATOM   3636 C  C     . THR A 1 542 ? 106.887 99.323  90.878  1.00 17.86  ? 542  THR A C     1 
ATOM   3637 O  O     . THR A 1 542 ? 106.742 99.609  89.686  1.00 17.86  ? 542  THR A O     1 
ATOM   3638 C  CB    . THR A 1 542 ? 106.288 101.251 92.354  1.00 17.86  ? 542  THR A CB    1 
ATOM   3639 O  OG1   . THR A 1 542 ? 107.541 101.195 93.040  1.00 17.86  ? 542  THR A OG1   1 
ATOM   3640 C  CG2   . THR A 1 542 ? 105.244 101.822 93.292  1.00 17.86  ? 542  THR A CG2   1 
ATOM   3641 N  N     . ILE A 1 543 ? 107.888 98.562  91.307  1.00 18.79  ? 543  ILE A N     1 
ATOM   3642 C  CA    . ILE A 1 543 ? 108.850 98.011  90.363  1.00 18.79  ? 543  ILE A CA    1 
ATOM   3643 C  C     . ILE A 1 543 ? 108.315 96.726  89.729  1.00 18.79  ? 543  ILE A C     1 
ATOM   3644 O  O     . ILE A 1 543 ? 108.635 96.421  88.576  1.00 18.79  ? 543  ILE A O     1 
ATOM   3645 C  CB    . ILE A 1 543 ? 110.206 97.825  91.069  1.00 18.79  ? 543  ILE A CB    1 
ATOM   3646 C  CG1   . ILE A 1 543 ? 110.696 99.188  91.556  1.00 18.79  ? 543  ILE A CG1   1 
ATOM   3647 C  CG2   . ILE A 1 543 ? 111.273 97.271  90.145  1.00 18.79  ? 543  ILE A CG2   1 
ATOM   3648 C  CD1   . ILE A 1 543 ? 111.907 99.142  92.440  1.00 18.79  ? 543  ILE A CD1   1 
ATOM   3649 N  N     . CYS A 1 544 ? 107.450 95.989  90.430  1.00 19.36  ? 544  CYS A N     1 
ATOM   3650 C  CA    . CYS A 1 544 ? 106.732 94.907  89.765  1.00 19.36  ? 544  CYS A CA    1 
ATOM   3651 C  C     . CYS A 1 544 ? 105.698 95.433  88.783  1.00 19.36  ? 544  CYS A C     1 
ATOM   3652 O  O     . CYS A 1 544 ? 105.368 94.739  87.825  1.00 19.36  ? 544  CYS A O     1 
ATOM   3653 C  CB    . CYS A 1 544 ? 106.058 93.977  90.774  1.00 19.36  ? 544  CYS A CB    1 
ATOM   3654 S  SG    . CYS A 1 544 ? 107.164 92.847  91.665  1.00 19.36  ? 544  CYS A SG    1 
ATOM   3655 N  N     . PHE A 1 545 ? 105.182 96.643  88.987  1.00 18.86  ? 545  PHE A N     1 
ATOM   3656 C  CA    . PHE A 1 545 ? 104.242 97.214  88.025  1.00 18.86  ? 545  PHE A CA    1 
ATOM   3657 C  C     . PHE A 1 545 ? 104.919 97.635  86.734  1.00 18.86  ? 545  PHE A C     1 
ATOM   3658 O  O     . PHE A 1 545 ? 104.358 97.436  85.655  1.00 18.86  ? 545  PHE A O     1 
ATOM   3659 C  CB    . PHE A 1 545 ? 103.532 98.405  88.623  1.00 18.86  ? 545  PHE A CB    1 
ATOM   3660 C  CG    . PHE A 1 545 ? 102.389 98.052  89.479  1.00 18.86  ? 545  PHE A CG    1 
ATOM   3661 C  CD1   . PHE A 1 545 ? 101.748 96.840  89.330  1.00 18.86  ? 545  PHE A CD1   1 
ATOM   3662 C  CD2   . PHE A 1 545 ? 101.954 98.936  90.451  1.00 18.86  ? 545  PHE A CD2   1 
ATOM   3663 C  CE1   . PHE A 1 545 ? 100.692 96.527  90.130  1.00 18.86  ? 545  PHE A CE1   1 
ATOM   3664 C  CE2   . PHE A 1 545 ? 100.907 98.622  91.263  1.00 18.86  ? 545  PHE A CE2   1 
ATOM   3665 C  CZ    . PHE A 1 545 ? 100.263 97.434  91.097  1.00 18.86  ? 545  PHE A CZ    1 
ATOM   3666 N  N     . VAL A 1 546 ? 106.100 98.254  86.812  1.00 21.20  ? 546  VAL A N     1 
ATOM   3667 C  CA    . VAL A 1 546 ? 106.806 98.603  85.586  1.00 21.20  ? 546  VAL A CA    1 
ATOM   3668 C  C     . VAL A 1 546 ? 107.417 97.370  84.946  1.00 21.20  ? 546  VAL A C     1 
ATOM   3669 O  O     . VAL A 1 546 ? 107.777 97.404  83.769  1.00 21.20  ? 546  VAL A O     1 
ATOM   3670 C  CB    . VAL A 1 546 ? 107.880 99.674  85.840  1.00 21.20  ? 546  VAL A CB    1 
ATOM   3671 C  CG1   . VAL A 1 546 ? 107.262 100.899 86.467  1.00 21.20  ? 546  VAL A CG1   1 
ATOM   3672 C  CG2   . VAL A 1 546 ? 108.987 99.145  86.700  1.00 21.20  ? 546  VAL A CG2   1 
ATOM   3673 N  N     . PHE A 1 547 ? 107.556 96.280  85.700  1.00 23.04  ? 547  PHE A N     1 
ATOM   3674 C  CA    . PHE A 1 547 ? 107.880 94.993  85.110  1.00 23.04  ? 547  PHE A CA    1 
ATOM   3675 C  C     . PHE A 1 547 ? 106.688 94.422  84.358  1.00 23.04  ? 547  PHE A C     1 
ATOM   3676 O  O     . PHE A 1 547 ? 106.862 93.753  83.337  1.00 23.04  ? 547  PHE A O     1 
ATOM   3677 C  CB    . PHE A 1 547 ? 108.334 94.038  86.210  1.00 23.04  ? 547  PHE A CB    1 
ATOM   3678 C  CG    . PHE A 1 547 ? 108.744 92.694  85.716  1.00 23.04  ? 547  PHE A CG    1 
ATOM   3679 C  CD1   . PHE A 1 547 ? 109.979 92.509  85.131  1.00 23.04  ? 547  PHE A CD1   1 
ATOM   3680 C  CD2   . PHE A 1 547 ? 107.893 91.606  85.846  1.00 23.04  ? 547  PHE A CD2   1 
ATOM   3681 C  CE1   . PHE A 1 547 ? 110.359 91.269  84.680  1.00 23.04  ? 547  PHE A CE1   1 
ATOM   3682 C  CE2   . PHE A 1 547 ? 108.266 90.364  85.392  1.00 23.04  ? 547  PHE A CE2   1 
ATOM   3683 C  CZ    . PHE A 1 547 ? 109.504 90.195  84.809  1.00 23.04  ? 547  PHE A CZ    1 
ATOM   3684 N  N     . MET A 1 548 ? 105.478 94.669  84.850  1.00 20.55  ? 548  MET A N     1 
ATOM   3685 C  CA    . MET A 1 548 ? 104.268 94.232  84.175  1.00 20.55  ? 548  MET A CA    1 
ATOM   3686 C  C     . MET A 1 548 ? 103.826 95.189  83.082  1.00 20.55  ? 548  MET A C     1 
ATOM   3687 O  O     . MET A 1 548 ? 103.012 94.811  82.238  1.00 20.55  ? 548  MET A O     1 
ATOM   3688 C  CB    . MET A 1 548 ? 103.132 94.087  85.180  1.00 20.55  ? 548  MET A CB    1 
ATOM   3689 C  CG    . MET A 1 548 ? 103.284 92.967  86.158  1.00 20.55  ? 548  MET A CG    1 
ATOM   3690 S  SD    . MET A 1 548 ? 101.911 92.941  87.304  1.00 20.55  ? 548  MET A SD    1 
ATOM   3691 C  CE    . MET A 1 548 ? 102.445 91.622  88.372  1.00 20.55  ? 548  MET A CE    1 
ATOM   3692 N  N     . MET A 1 549 ? 104.319 96.422  83.102  1.00 23.24  ? 549  MET A N     1 
ATOM   3693 C  CA    . MET A 1 549 ? 103.964 97.420  82.106  1.00 23.24  ? 549  MET A CA    1 
ATOM   3694 C  C     . MET A 1 549 ? 104.779 97.252  80.833  1.00 23.24  ? 549  MET A C     1 
ATOM   3695 O  O     . MET A 1 549 ? 104.379 97.754  79.780  1.00 23.24  ? 549  MET A O     1 
ATOM   3696 C  CB    . MET A 1 549 ? 104.150 98.812  82.723  1.00 23.24  ? 549  MET A CB    1 
ATOM   3697 C  CG    . MET A 1 549 ? 103.575 99.986  81.974  1.00 23.24  ? 549  MET A CG    1 
ATOM   3698 S  SD    . MET A 1 549 ? 103.798 101.516 82.894  1.00 23.24  ? 549  MET A SD    1 
ATOM   3699 C  CE    . MET A 1 549 ? 105.564 101.752 82.736  1.00 23.24  ? 549  MET A CE    1 
ATOM   3700 N  N     . ILE A 1 550 ? 105.903 96.537  80.906  1.00 24.36  ? 550  ILE A N     1 
ATOM   3701 C  CA    . ILE A 1 550 ? 106.633 96.155  79.702  1.00 24.36  ? 550  ILE A CA    1 
ATOM   3702 C  C     . ILE A 1 550 ? 105.830 95.146  78.898  1.00 24.36  ? 550  ILE A C     1 
ATOM   3703 O  O     . ILE A 1 550 ? 105.667 95.277  77.681  1.00 24.36  ? 550  ILE A O     1 
ATOM   3704 C  CB    . ILE A 1 550 ? 108.012 95.585  80.070  1.00 24.36  ? 550  ILE A CB    1 
ATOM   3705 C  CG1   . ILE A 1 550 ? 108.845 96.616  80.808  1.00 24.36  ? 550  ILE A CG1   1 
ATOM   3706 C  CG2   . ILE A 1 550 ? 108.749 95.169  78.834  1.00 24.36  ? 550  ILE A CG2   1 
ATOM   3707 C  CD1   . ILE A 1 550 ? 110.033 96.022  81.474  1.00 24.36  ? 550  ILE A CD1   1 
ATOM   3708 N  N     . PHE A 1 551 ? 105.301 94.134  79.574  1.00 27.21  ? 551  PHE A N     1 
ATOM   3709 C  CA    . PHE A 1 551 ? 104.606 93.030  78.937  1.00 27.21  ? 551  PHE A CA    1 
ATOM   3710 C  C     . PHE A 1 551 ? 103.129 93.303  78.713  1.00 27.21  ? 551  PHE A C     1 
ATOM   3711 O  O     . PHE A 1 551 ? 102.383 92.367  78.423  1.00 27.21  ? 551  PHE A O     1 
ATOM   3712 C  CB    . PHE A 1 551 ? 104.776 91.767  79.776  1.00 27.21  ? 551  PHE A CB    1 
ATOM   3713 C  CG    . PHE A 1 551 ? 106.185 91.269  79.832  1.00 27.21  ? 551  PHE A CG    1 
ATOM   3714 C  CD1   . PHE A 1 551 ? 106.697 90.486  78.814  1.00 27.21  ? 551  PHE A CD1   1 
ATOM   3715 C  CD2   . PHE A 1 551 ? 107.002 91.594  80.895  1.00 27.21  ? 551  PHE A CD2   1 
ATOM   3716 C  CE1   . PHE A 1 551 ? 107.993 90.033  78.862  1.00 27.21  ? 551  PHE A CE1   1 
ATOM   3717 C  CE2   . PHE A 1 551 ? 108.301 91.143  80.946  1.00 27.21  ? 551  PHE A CE2   1 
ATOM   3718 C  CZ    . PHE A 1 551 ? 108.793 90.360  79.929  1.00 27.21  ? 551  PHE A CZ    1 
ATOM   3719 N  N     . SER A 1 552 ? 102.690 94.555  78.833  1.00 25.77  ? 552  SER A N     1 
ATOM   3720 C  CA    . SER A 1 552 ? 101.288 94.877  78.607  1.00 25.77  ? 552  SER A CA    1 
ATOM   3721 C  C     . SER A 1 552 ? 100.918 94.829  77.135  1.00 25.77  ? 552  SER A C     1 
ATOM   3722 O  O     . SER A 1 552 ? 99.741  94.656  76.810  1.00 25.77  ? 552  SER A O     1 
ATOM   3723 C  CB    . SER A 1 552 ? 100.964 96.254  79.179  1.00 25.77  ? 552  SER A CB    1 
ATOM   3724 O  OG    . SER A 1 552 ? 101.672 97.262  78.491  1.00 25.77  ? 552  SER A OG    1 
ATOM   3725 N  N     . GLY A 1 553 ? 101.891 94.968  76.245  1.00 31.37  ? 553  GLY A N     1 
ATOM   3726 C  CA    . GLY A 1 553 ? 101.647 94.851  74.829  1.00 31.37  ? 553  GLY A CA    1 
ATOM   3727 C  C     . GLY A 1 553 ? 101.408 96.151  74.110  1.00 31.37  ? 553  GLY A C     1 
ATOM   3728 O  O     . GLY A 1 553 ? 100.682 96.163  73.111  1.00 31.37  ? 553  GLY A O     1 
ATOM   3729 N  N     . LEU A 1 554 ? 101.995 97.248  74.576  1.00 32.16  ? 554  LEU A N     1 
ATOM   3730 C  CA    . LEU A 1 554 ? 101.825 98.542  73.935  1.00 32.16  ? 554  LEU A CA    1 
ATOM   3731 C  C     . LEU A 1 554 ? 103.113 99.004  73.268  1.00 32.16  ? 554  LEU A C     1 
ATOM   3732 O  O     . LEU A 1 554 ? 103.126 99.274  72.064  1.00 32.16  ? 554  LEU A O     1 
ATOM   3733 C  CB    . LEU A 1 554 ? 101.326 99.566  74.970  1.00 32.16  ? 554  LEU A CB    1 
ATOM   3734 C  CG    . LEU A 1 554 ? 100.703 100.911 74.570  1.00 32.16  ? 554  LEU A CG    1 
ATOM   3735 C  CD1   . LEU A 1 554 ? 101.710 102.005 74.267  1.00 32.16  ? 554  LEU A CD1   1 
ATOM   3736 C  CD2   . LEU A 1 554 ? 99.786  100.709 73.382  1.00 32.16  ? 554  LEU A CD2   1 
ATOM   3737 N  N     . LEU A 1 555 ? 104.211 99.088  74.017  1.00 36.63  ? 555  LEU A N     1 
ATOM   3738 C  CA    . LEU A 1 555 ? 105.455 99.578  73.437  1.00 36.63  ? 555  LEU A CA    1 
ATOM   3739 C  C     . LEU A 1 555 ? 106.187 98.481  72.678  1.00 36.63  ? 555  LEU A C     1 
ATOM   3740 O  O     . LEU A 1 555 ? 106.620 98.695  71.541  1.00 36.63  ? 555  LEU A O     1 
ATOM   3741 C  CB    . LEU A 1 555 ? 106.362 100.162 74.520  1.00 36.63  ? 555  LEU A CB    1 
ATOM   3742 C  CG    . LEU A 1 555 ? 106.095 101.577 75.049  1.00 36.63  ? 555  LEU A CG    1 
ATOM   3743 C  CD1   . LEU A 1 555 ? 104.949 101.636 76.057  1.00 36.63  ? 555  LEU A CD1   1 
ATOM   3744 C  CD2   . LEU A 1 555 ? 107.362 102.173 75.639  1.00 36.63  ? 555  LEU A CD2   1 
ATOM   3745 N  N     . VAL A 1 556 ? 106.333 97.308  73.283  1.00 38.83  ? 556  VAL A N     1 
ATOM   3746 C  CA    . VAL A 1 556 ? 107.018 96.181  72.668  1.00 38.83  ? 556  VAL A CA    1 
ATOM   3747 C  C     . VAL A 1 556 ? 105.977 95.146  72.255  1.00 38.83  ? 556  VAL A C     1 
ATOM   3748 O  O     . VAL A 1 556 ? 104.999 94.907  72.971  1.00 38.83  ? 556  VAL A O     1 
ATOM   3749 C  CB    . VAL A 1 556 ? 108.101 95.602  73.613  1.00 38.83  ? 556  VAL A CB    1 
ATOM   3750 C  CG1   . VAL A 1 556 ? 107.520 95.119  74.936  1.00 38.83  ? 556  VAL A CG1   1 
ATOM   3751 C  CG2   . VAL A 1 556 ? 108.905 94.500  72.938  1.00 38.83  ? 556  VAL A CG2   1 
ATOM   3752 N  N     . ASN A 1 557 ? 106.154 94.582  71.063  1.00 43.88  ? 557  ASN A N     1 
ATOM   3753 C  CA    . ASN A 1 557 ? 105.204 93.610  70.543  1.00 43.88  ? 557  ASN A CA    1 
ATOM   3754 C  C     . ASN A 1 557 ? 105.396 92.281  71.261  1.00 43.88  ? 557  ASN A C     1 
ATOM   3755 O  O     . ASN A 1 557 ? 106.517 91.777  71.362  1.00 43.88  ? 557  ASN A O     1 
ATOM   3756 C  CB    . ASN A 1 557 ? 105.394 93.441  69.035  1.00 43.88  ? 557  ASN A CB    1 
ATOM   3757 C  CG    . ASN A 1 557 ? 104.118 93.010  68.316  1.00 43.88  ? 557  ASN A CG    1 
ATOM   3758 O  OD1   . ASN A 1 557 ? 104.036 93.080  67.091  1.00 43.88  ? 557  ASN A OD1   1 
ATOM   3759 N  ND2   . ASN A 1 557 ? 103.113 92.589  69.074  1.00 43.88  ? 557  ASN A ND2   1 
ATOM   3760 N  N     . LEU A 1 558 ? 104.294 91.714  71.760  1.00 41.78  ? 558  LEU A N     1 
ATOM   3761 C  CA    . LEU A 1 558 ? 104.374 90.493  72.555  1.00 41.78  ? 558  LEU A CA    1 
ATOM   3762 C  C     . LEU A 1 558 ? 104.733 89.279  71.709  1.00 41.78  ? 558  LEU A C     1 
ATOM   3763 O  O     . LEU A 1 558 ? 105.293 88.309  72.230  1.00 41.78  ? 558  LEU A O     1 
ATOM   3764 C  CB    . LEU A 1 558 ? 103.052 90.256  73.281  1.00 41.78  ? 558  LEU A CB    1 
ATOM   3765 C  CG    . LEU A 1 558 ? 102.692 91.255  74.379  1.00 41.78  ? 558  LEU A CG    1 
ATOM   3766 C  CD1   . LEU A 1 558 ? 101.291 90.997  74.897  1.00 41.78  ? 558  LEU A CD1   1 
ATOM   3767 C  CD2   . LEU A 1 558 ? 103.703 91.188  75.506  1.00 41.78  ? 558  LEU A CD2   1 
ATOM   3768 N  N     . THR A 1 559 ? 104.426 89.310  70.412  1.00 47.67  ? 559  THR A N     1 
ATOM   3769 C  CA    . THR A 1 559 ? 104.769 88.192  69.542  1.00 47.67  ? 559  THR A CA    1 
ATOM   3770 C  C     . THR A 1 559 ? 106.245 88.189  69.169  1.00 47.67  ? 559  THR A C     1 
ATOM   3771 O  O     . THR A 1 559 ? 106.813 87.121  68.918  1.00 47.67  ? 559  THR A O     1 
ATOM   3772 C  CB    . THR A 1 559 ? 103.914 88.230  68.277  1.00 47.67  ? 559  THR A CB    1 
ATOM   3773 O  OG1   . THR A 1 559 ? 104.161 89.451  67.571  1.00 47.67  ? 559  THR A OG1   1 
ATOM   3774 C  CG2   . THR A 1 559 ? 102.442 88.149  68.633  1.00 47.67  ? 559  THR A CG2   1 
ATOM   3775 N  N     . THR A 1 560 ? 106.881 89.359  69.130  1.00 47.80  ? 560  THR A N     1 
ATOM   3776 C  CA    . THR A 1 560 ? 108.293 89.444  68.789  1.00 47.80  ? 560  THR A CA    1 
ATOM   3777 C  C     . THR A 1 560 ? 109.206 89.151  69.971  1.00 47.80  ? 560  THR A C     1 
ATOM   3778 O  O     . THR A 1 560 ? 110.421 89.038  69.779  1.00 47.80  ? 560  THR A O     1 
ATOM   3779 C  CB    . THR A 1 560 ? 108.619 90.829  68.227  1.00 47.80  ? 560  THR A CB    1 
ATOM   3780 O  OG1   . THR A 1 560 ? 108.389 91.821  69.234  1.00 47.80  ? 560  THR A OG1   1 
ATOM   3781 C  CG2   . THR A 1 560 ? 107.739 91.128  67.026  1.00 47.80  ? 560  THR A CG2   1 
ATOM   3782 N  N     . ILE A 1 561 ? 108.657 89.040  71.181  1.00 45.95  ? 561  ILE A N     1 
ATOM   3783 C  CA    . ILE A 1 561 ? 109.442 88.631  72.336  1.00 45.95  ? 561  ILE A CA    1 
ATOM   3784 C  C     . ILE A 1 561 ? 109.800 87.158  72.193  1.00 45.95  ? 561  ILE A C     1 
ATOM   3785 O  O     . ILE A 1 561 ? 108.978 86.345  71.747  1.00 45.95  ? 561  ILE A O     1 
ATOM   3786 C  CB    . ILE A 1 561 ? 108.654 88.920  73.629  1.00 45.95  ? 561  ILE A CB    1 
ATOM   3787 C  CG1   . ILE A 1 561 ? 108.416 90.422  73.776  1.00 45.95  ? 561  ILE A CG1   1 
ATOM   3788 C  CG2   . ILE A 1 561 ? 109.370 88.411  74.869  1.00 45.95  ? 561  ILE A CG2   1 
ATOM   3789 C  CD1   . ILE A 1 561 ? 107.459 90.776  74.888  1.00 45.95  ? 561  ILE A CD1   1 
ATOM   3790 N  N     . ALA A 1 562 ? 111.047 86.815  72.528  1.00 46.39  ? 562  ALA A N     1 
ATOM   3791 C  CA    . ALA A 1 562 ? 111.532 85.447  72.429  1.00 46.39  ? 562  ALA A CA    1 
ATOM   3792 C  C     . ALA A 1 562 ? 110.777 84.525  73.382  1.00 46.39  ? 562  ALA A C     1 
ATOM   3793 O  O     . ALA A 1 562 ? 110.157 84.961  74.354  1.00 46.39  ? 562  ALA A O     1 
ATOM   3794 C  CB    . ALA A 1 562 ? 113.029 85.391  72.726  1.00 46.39  ? 562  ALA A CB    1 
ATOM   3795 N  N     . SER A 1 563 ? 110.850 83.223  73.090  1.00 46.02  ? 563  SER A N     1 
ATOM   3796 C  CA    . SER A 1 563 ? 109.989 82.239  73.737  1.00 46.02  ? 563  SER A CA    1 
ATOM   3797 C  C     . SER A 1 563 ? 110.322 82.027  75.207  1.00 46.02  ? 563  SER A C     1 
ATOM   3798 O  O     . SER A 1 563 ? 109.460 81.564  75.961  1.00 46.02  ? 563  SER A O     1 
ATOM   3799 C  CB    . SER A 1 563 ? 110.075 80.907  72.995  1.00 46.02  ? 563  SER A CB    1 
ATOM   3800 O  OG    . SER A 1 563 ? 109.271 79.926  73.621  1.00 46.02  ? 563  SER A OG    1 
ATOM   3801 N  N     . TRP A 1 564 ? 111.536 82.360  75.631  1.00 42.74  ? 564  TRP A N     1 
ATOM   3802 C  CA    . TRP A 1 564 ? 111.944 82.195  77.018  1.00 42.74  ? 564  TRP A CA    1 
ATOM   3803 C  C     . TRP A 1 564 ? 111.616 83.407  77.880  1.00 42.74  ? 564  TRP A C     1 
ATOM   3804 O  O     . TRP A 1 564 ? 111.823 83.356  79.096  1.00 42.74  ? 564  TRP A O     1 
ATOM   3805 C  CB    . TRP A 1 564 ? 113.444 81.878  77.077  1.00 42.74  ? 564  TRP A CB    1 
ATOM   3806 C  CG    . TRP A 1 564 ? 114.318 82.955  76.525  1.00 42.74  ? 564  TRP A CG    1 
ATOM   3807 C  CD1   . TRP A 1 564 ? 114.587 83.200  75.210  1.00 42.74  ? 564  TRP A CD1   1 
ATOM   3808 C  CD2   . TRP A 1 564 ? 115.089 83.897  77.273  1.00 42.74  ? 564  TRP A CD2   1 
ATOM   3809 N  NE1   . TRP A 1 564 ? 115.446 84.263  75.093  1.00 42.74  ? 564  TRP A NE1   1 
ATOM   3810 C  CE2   . TRP A 1 564 ? 115.772 84.706  76.347  1.00 42.74  ? 564  TRP A CE2   1 
ATOM   3811 C  CE3   . TRP A 1 564 ? 115.255 84.146  78.637  1.00 42.74  ? 564  TRP A CE3   1 
ATOM   3812 C  CZ2   . TRP A 1 564 ? 116.609 85.743  76.740  1.00 42.74  ? 564  TRP A CZ2   1 
ATOM   3813 C  CZ3   . TRP A 1 564 ? 116.083 85.174  79.025  1.00 42.74  ? 564  TRP A CZ3   1 
ATOM   3814 C  CH2   . TRP A 1 564 ? 116.752 85.959  78.082  1.00 42.74  ? 564  TRP A CH2   1 
ATOM   3815 N  N     . LEU A 1 565 ? 111.106 84.488  77.282  1.00 40.12  ? 565  LEU A N     1 
ATOM   3816 C  CA    . LEU A 1 565 ? 110.578 85.631  78.015  1.00 40.12  ? 565  LEU A CA    1 
ATOM   3817 C  C     . LEU A 1 565 ? 109.115 85.917  77.730  1.00 40.12  ? 565  LEU A C     1 
ATOM   3818 O  O     . LEU A 1 565 ? 108.539 86.793  78.381  1.00 40.12  ? 565  LEU A O     1 
ATOM   3819 C  CB    . LEU A 1 565 ? 111.375 86.904  77.698  1.00 40.12  ? 565  LEU A CB    1 
ATOM   3820 C  CG    . LEU A 1 565 ? 112.770 87.082  78.284  1.00 40.12  ? 565  LEU A CG    1 
ATOM   3821 C  CD1   . LEU A 1 565 ? 113.424 88.270  77.637  1.00 40.12  ? 565  LEU A CD1   1 
ATOM   3822 C  CD2   . LEU A 1 565 ? 112.680 87.294  79.778  1.00 40.12  ? 565  LEU A CD2   1 
ATOM   3823 N  N     . SER A 1 566 ? 108.498 85.214  76.786  1.00 38.84  ? 566  SER A N     1 
ATOM   3824 C  CA    . SER A 1 566 ? 107.103 85.444  76.443  1.00 38.84  ? 566  SER A CA    1 
ATOM   3825 C  C     . SER A 1 566 ? 106.135 84.761  77.395  1.00 38.84  ? 566  SER A C     1 
ATOM   3826 O  O     . SER A 1 566 ? 104.928 84.802  77.153  1.00 38.84  ? 566  SER A O     1 
ATOM   3827 C  CB    . SER A 1 566 ? 106.833 84.972  75.015  1.00 38.84  ? 566  SER A CB    1 
ATOM   3828 O  OG    . SER A 1 566 ? 105.472 85.151  74.668  1.00 38.84  ? 566  SER A OG    1 
ATOM   3829 N  N     . TRP A 1 567 ? 106.627 84.116  78.447  1.00 33.20  ? 567  TRP A N     1 
ATOM   3830 C  CA    . TRP A 1 567 ? 105.766 83.559  79.477  1.00 33.20  ? 567  TRP A CA    1 
ATOM   3831 C  C     . TRP A 1 567 ? 105.517 84.539  80.609  1.00 33.20  ? 567  TRP A C     1 
ATOM   3832 O  O     . TRP A 1 567 ? 104.600 84.325  81.407  1.00 33.20  ? 567  TRP A O     1 
ATOM   3833 C  CB    . TRP A 1 567 ? 106.381 82.271  80.031  1.00 33.20  ? 567  TRP A CB    1 
ATOM   3834 C  CG    . TRP A 1 567 ? 107.718 82.480  80.650  1.00 33.20  ? 567  TRP A CG    1 
ATOM   3835 C  CD1   . TRP A 1 567 ? 108.919 82.485  80.014  1.00 33.20  ? 567  TRP A CD1   1 
ATOM   3836 C  CD2   . TRP A 1 567 ? 107.996 82.705  82.033  1.00 33.20  ? 567  TRP A CD2   1 
ATOM   3837 N  NE1   . TRP A 1 567 ? 109.930 82.711  80.911  1.00 33.20  ? 567  TRP A NE1   1 
ATOM   3838 C  CE2   . TRP A 1 567 ? 109.388 82.847  82.159  1.00 33.20  ? 567  TRP A CE2   1 
ATOM   3839 C  CE3   . TRP A 1 567 ? 107.203 82.804  83.175  1.00 33.20  ? 567  TRP A CE3   1 
ATOM   3840 C  CZ2   . TRP A 1 567 ? 110.002 83.082  83.381  1.00 33.20  ? 567  TRP A CZ2   1 
ATOM   3841 C  CZ3   . TRP A 1 567 ? 107.815 83.038  84.385  1.00 33.20  ? 567  TRP A CZ3   1 
ATOM   3842 C  CH2   . TRP A 1 567 ? 109.200 83.175  84.480  1.00 33.20  ? 567  TRP A CH2   1 
ATOM   3843 N  N     . LEU A 1 568 ? 106.305 85.610  80.687  1.00 30.74  ? 568  LEU A N     1 
ATOM   3844 C  CA    . LEU A 1 568 ? 106.120 86.648  81.690  1.00 30.74  ? 568  LEU A CA    1 
ATOM   3845 C  C     . LEU A 1 568 ? 104.946 87.560  81.383  1.00 30.74  ? 568  LEU A C     1 
ATOM   3846 O  O     . LEU A 1 568 ? 104.566 88.359  82.243  1.00 30.74  ? 568  LEU A O     1 
ATOM   3847 C  CB    . LEU A 1 568 ? 107.392 87.480  81.813  1.00 30.74  ? 568  LEU A CB    1 
ATOM   3848 C  CG    . LEU A 1 568 ? 108.597 86.820  82.466  1.00 30.74  ? 568  LEU A CG    1 
ATOM   3849 C  CD1   . LEU A 1 568 ? 109.839 87.647  82.253  1.00 30.74  ? 568  LEU A CD1   1 
ATOM   3850 C  CD2   . LEU A 1 568 ? 108.307 86.693  83.936  1.00 30.74  ? 568  LEU A CD2   1 
ATOM   3851 N  N     . GLN A 1 569 ? 104.373 87.475  80.185  1.00 30.56  ? 569  GLN A N     1 
ATOM   3852 C  CA    . GLN A 1 569 ? 103.196 88.260  79.855  1.00 30.56  ? 569  GLN A CA    1 
ATOM   3853 C  C     . GLN A 1 569 ? 101.940 87.727  80.518  1.00 30.56  ? 569  GLN A C     1 
ATOM   3854 O  O     . GLN A 1 569 ? 100.927 88.430  80.534  1.00 30.56  ? 569  GLN A O     1 
ATOM   3855 C  CB    . GLN A 1 569 ? 102.987 88.287  78.346  1.00 30.56  ? 569  GLN A CB    1 
ATOM   3856 C  CG    . GLN A 1 569 ? 102.557 86.958  77.783  1.00 30.56  ? 569  GLN A CG    1 
ATOM   3857 C  CD    . GLN A 1 569 ? 102.392 86.983  76.294  1.00 30.56  ? 569  GLN A CD    1 
ATOM   3858 O  OE1   . GLN A 1 569 ? 102.568 88.015  75.662  1.00 30.56  ? 569  GLN A OE1   1 
ATOM   3859 N  NE2   . GLN A 1 569 ? 102.042 85.846  75.720  1.00 30.56  ? 569  GLN A NE2   1 
ATOM   3860 N  N     . TYR A 1 570 ? 101.971 86.506  81.049  1.00 28.70  ? 570  TYR A N     1 
ATOM   3861 C  CA    . TYR A 1 570 ? 100.810 85.941  81.715  1.00 28.70  ? 570  TYR A CA    1 
ATOM   3862 C  C     . TYR A 1 570 ? 100.711 86.363  83.168  1.00 28.70  ? 570  TYR A C     1 
ATOM   3863 O  O     . TYR A 1 570 ? 99.691  86.095  83.806  1.00 28.70  ? 570  TYR A O     1 
ATOM   3864 C  CB    . TYR A 1 570 ? 100.836 84.419  81.619  1.00 28.70  ? 570  TYR A CB    1 
ATOM   3865 C  CG    . TYR A 1 570 ? 100.677 83.923  80.208  1.00 28.70  ? 570  TYR A CG    1 
ATOM   3866 C  CD1   . TYR A 1 570 ? 99.430  83.880  79.609  1.00 28.70  ? 570  TYR A CD1   1 
ATOM   3867 C  CD2   . TYR A 1 570 ? 101.775 83.505  79.473  1.00 28.70  ? 570  TYR A CD2   1 
ATOM   3868 C  CE1   . TYR A 1 570 ? 99.281  83.436  78.318  1.00 28.70  ? 570  TYR A CE1   1 
ATOM   3869 C  CE2   . TYR A 1 570 ? 101.636 83.057  78.182  1.00 28.70  ? 570  TYR A CE2   1 
ATOM   3870 C  CZ    . TYR A 1 570 ? 100.387 83.025  77.610  1.00 28.70  ? 570  TYR A CZ    1 
ATOM   3871 O  OH    . TYR A 1 570 ? 100.242 82.578  76.320  1.00 28.70  ? 570  TYR A OH    1 
ATOM   3872 N  N     . PHE A 1 571 ? 101.741 87.009  83.696  1.00 27.78  ? 571  PHE A N     1 
ATOM   3873 C  CA    . PHE A 1 571 ? 101.732 87.530  85.048  1.00 27.78  ? 571  PHE A CA    1 
ATOM   3874 C  C     . PHE A 1 571 ? 101.328 88.989  85.114  1.00 27.78  ? 571  PHE A C     1 
ATOM   3875 O  O     . PHE A 1 571 ? 101.127 89.507  86.213  1.00 27.78  ? 571  PHE A O     1 
ATOM   3876 C  CB    . PHE A 1 571 ? 103.112 87.363  85.685  1.00 27.78  ? 571  PHE A CB    1 
ATOM   3877 C  CG    . PHE A 1 571 ? 103.475 85.941  85.965  1.00 27.78  ? 571  PHE A CG    1 
ATOM   3878 C  CD1   . PHE A 1 571 ? 103.042 85.322  87.120  1.00 27.78  ? 571  PHE A CD1   1 
ATOM   3879 C  CD2   . PHE A 1 571 ? 104.233 85.218  85.067  1.00 27.78  ? 571  PHE A CD2   1 
ATOM   3880 C  CE1   . PHE A 1 571 ? 103.370 84.011  87.377  1.00 27.78  ? 571  PHE A CE1   1 
ATOM   3881 C  CE2   . PHE A 1 571 ? 104.558 83.907  85.319  1.00 27.78  ? 571  PHE A CE2   1 
ATOM   3882 C  CZ    . PHE A 1 571 ? 104.128 83.304  86.474  1.00 27.78  ? 571  PHE A CZ    1 
ATOM   3883 N  N     . SER A 1 572 ? 101.193 89.660  83.978  1.00 22.64  ? 572  SER A N     1 
ATOM   3884 C  CA    . SER A 1 572 ? 100.966 91.095  83.976  1.00 22.64  ? 572  SER A CA    1 
ATOM   3885 C  C     . SER A 1 572 ? 99.494  91.397  84.189  1.00 22.64  ? 572  SER A C     1 
ATOM   3886 O  O     . SER A 1 572 ? 98.660  91.040  83.359  1.00 22.64  ? 572  SER A O     1 
ATOM   3887 C  CB    . SER A 1 572 ? 101.446 91.712  82.670  1.00 22.64  ? 572  SER A CB    1 
ATOM   3888 O  OG    . SER A 1 572 ? 102.838 91.579  82.520  1.00 22.64  ? 572  SER A OG    1 
ATOM   3889 N  N     . ILE A 1 573 ? 99.185  92.044  85.315  1.00 19.86  ? 573  ILE A N     1 
ATOM   3890 C  CA    . ILE A 1 573 ? 97.856  92.643  85.490  1.00 19.86  ? 573  ILE A CA    1 
ATOM   3891 C  C     . ILE A 1 573 ? 97.522  93.670  84.413  1.00 19.86  ? 573  ILE A C     1 
ATOM   3892 O  O     . ILE A 1 573 ? 96.394  93.635  83.904  1.00 19.86  ? 573  ILE A O     1 
ATOM   3893 C  CB    . ILE A 1 573 ? 97.708  93.183  86.922  1.00 19.86  ? 573  ILE A CB    1 
ATOM   3894 C  CG1   . ILE A 1 573 ? 97.891  92.057  87.931  1.00 19.86  ? 573  ILE A CG1   1 
ATOM   3895 C  CG2   . ILE A 1 573 ? 96.362  93.824  87.136  1.00 19.86  ? 573  ILE A CG2   1 
ATOM   3896 C  CD1   . ILE A 1 573 ? 98.132  92.526  89.323  1.00 19.86  ? 573  ILE A CD1   1 
ATOM   3897 N  N     . PRO A 1 574 ? 98.417  94.592  83.993  1.00 21.30  ? 574  PRO A N     1 
ATOM   3898 C  CA    . PRO A 1 574 ? 98.038  95.470  82.875  1.00 21.30  ? 574  PRO A CA    1 
ATOM   3899 C  C     . PRO A 1 574 ? 97.888  94.776  81.533  1.00 21.30  ? 574  PRO A C     1 
ATOM   3900 O  O     . PRO A 1 574 ? 97.273  95.361  80.645  1.00 21.30  ? 574  PRO A O     1 
ATOM   3901 C  CB    . PRO A 1 574 ? 99.176  96.494  82.824  1.00 21.30  ? 574  PRO A CB    1 
ATOM   3902 C  CG    . PRO A 1 574 ? 99.731  96.497  84.132  1.00 21.30  ? 574  PRO A CG    1 
ATOM   3903 C  CD    . PRO A 1 574 ? 99.661  95.111  84.605  1.00 21.30  ? 574  PRO A CD    1 
ATOM   3904 N  N     . ARG A 1 575 ? 98.424  93.574  81.332  1.00 23.52  ? 575  ARG A N     1 
ATOM   3905 C  CA    . ARG A 1 575 ? 98.210  92.914  80.049  1.00 23.52  ? 575  ARG A CA    1 
ATOM   3906 C  C     . ARG A 1 575 ? 96.793  92.377  79.932  1.00 23.52  ? 575  ARG A C     1 
ATOM   3907 O  O     . ARG A 1 575 ? 96.231  92.376  78.838  1.00 23.52  ? 575  ARG A O     1 
ATOM   3908 C  CB    . ARG A 1 575 ? 99.241  91.802  79.843  1.00 23.52  ? 575  ARG A CB    1 
ATOM   3909 C  CG    . ARG A 1 575 ? 99.239  91.094  78.493  1.00 23.52  ? 575  ARG A CG    1 
ATOM   3910 C  CD    . ARG A 1 575 ? 98.566  89.740  78.582  1.00 23.52  ? 575  ARG A CD    1 
ATOM   3911 N  NE    . ARG A 1 575 ? 98.553  89.037  77.310  1.00 23.52  ? 575  ARG A NE    1 
ATOM   3912 C  CZ    . ARG A 1 575 ? 97.848  87.938  77.086  1.00 23.52  ? 575  ARG A CZ    1 
ATOM   3913 N  NH1   . ARG A 1 575 ? 97.105  87.420  78.052  1.00 23.52  ? 575  ARG A NH1   1 
ATOM   3914 N  NH2   . ARG A 1 575 ? 97.883  87.359  75.896  1.00 23.52  ? 575  ARG A NH2   1 
ATOM   3915 N  N     . TYR A 1 576 ? 96.194  91.929  81.035  1.00 21.20  ? 576  TYR A N     1 
ATOM   3916 C  CA    . TYR A 1 576 ? 94.842  91.394  80.963  1.00 21.20  ? 576  TYR A CA    1 
ATOM   3917 C  C     . TYR A 1 576 ? 93.790  92.487  80.942  1.00 21.20  ? 576  TYR A C     1 
ATOM   3918 O  O     . TYR A 1 576 ? 92.720  92.291  80.367  1.00 21.20  ? 576  TYR A O     1 
ATOM   3919 C  CB    . TYR A 1 576 ? 94.561  90.463  82.135  1.00 21.20  ? 576  TYR A CB    1 
ATOM   3920 C  CG    . TYR A 1 576 ? 95.373  89.200  82.137  1.00 21.20  ? 576  TYR A CG    1 
ATOM   3921 C  CD1   . TYR A 1 576 ? 95.127  88.197  81.218  1.00 21.20  ? 576  TYR A CD1   1 
ATOM   3922 C  CD2   . TYR A 1 576 ? 96.338  88.987  83.094  1.00 21.20  ? 576  TYR A CD2   1 
ATOM   3923 C  CE1   . TYR A 1 576 ? 95.857  87.042  81.224  1.00 21.20  ? 576  TYR A CE1   1 
ATOM   3924 C  CE2   . TYR A 1 576 ? 97.071  87.837  83.112  1.00 21.20  ? 576  TYR A CE2   1 
ATOM   3925 C  CZ    . TYR A 1 576 ? 96.824  86.866  82.177  1.00 21.20  ? 576  TYR A CZ    1 
ATOM   3926 O  OH    . TYR A 1 576 ? 97.553  85.708  82.198  1.00 21.20  ? 576  TYR A OH    1 
ATOM   3927 N  N     . GLY A 1 577 ? 94.053  93.624  81.571  1.00 21.73  ? 577  GLY A N     1 
ATOM   3928 C  CA    . GLY A 1 577 ? 93.088  94.700  81.557  1.00 21.73  ? 577  GLY A CA    1 
ATOM   3929 C  C     . GLY A 1 577 ? 93.069  95.445  80.247  1.00 21.73  ? 577  GLY A C     1 
ATOM   3930 O  O     . GLY A 1 577 ? 92.004  95.753  79.717  1.00 21.73  ? 577  GLY A O     1 
ATOM   3931 N  N     . PHE A 1 578 ? 94.253  95.730  79.710  1.00 23.95  ? 578  PHE A N     1 
ATOM   3932 C  CA    . PHE A 1 578 ? 94.371  96.452  78.451  1.00 23.95  ? 578  PHE A CA    1 
ATOM   3933 C  C     . PHE A 1 578 ? 93.977  95.596  77.256  1.00 23.95  ? 578  PHE A C     1 
ATOM   3934 O  O     . PHE A 1 578 ? 93.566  96.143  76.232  1.00 23.95  ? 578  PHE A O     1 
ATOM   3935 C  CB    . PHE A 1 578 ? 95.799  96.983  78.338  1.00 23.95  ? 578  PHE A CB    1 
ATOM   3936 C  CG    . PHE A 1 578 ? 96.090  97.753  77.098  1.00 23.95  ? 578  PHE A CG    1 
ATOM   3937 C  CD1   . PHE A 1 578 ? 95.457  98.952  76.843  1.00 23.95  ? 578  PHE A CD1   1 
ATOM   3938 C  CD2   . PHE A 1 578 ? 97.085  97.334  76.240  1.00 23.95  ? 578  PHE A CD2   1 
ATOM   3939 C  CE1   . PHE A 1 578 ? 95.755  99.678  75.718  1.00 23.95  ? 578  PHE A CE1   1 
ATOM   3940 C  CE2   . PHE A 1 578 ? 97.387  98.061  75.121  1.00 23.95  ? 578  PHE A CE2   1 
ATOM   3941 C  CZ    . PHE A 1 578 ? 96.722  99.235  74.865  1.00 23.95  ? 578  PHE A CZ    1 
ATOM   3942 N  N     . THR A 1 579 ? 94.065  94.271  77.366  1.00 23.48  ? 579  THR A N     1 
ATOM   3943 C  CA    . THR A 1 579 ? 93.536  93.408  76.315  1.00 23.48  ? 579  THR A CA    1 
ATOM   3944 C  C     . THR A 1 579 ? 92.017  93.373  76.360  1.00 23.48  ? 579  THR A C     1 
ATOM   3945 O  O     . THR A 1 579 ? 91.354  93.359  75.318  1.00 23.48  ? 579  THR A O     1 
ATOM   3946 C  CB    . THR A 1 579 ? 94.101  92.001  76.465  1.00 23.48  ? 579  THR A CB    1 
ATOM   3947 O  OG1   . THR A 1 579 ? 95.530  92.067  76.481  1.00 23.48  ? 579  THR A OG1   1 
ATOM   3948 C  CG2   . THR A 1 579 ? 93.670  91.102  75.336  1.00 23.48  ? 579  THR A CG2   1 
ATOM   3949 N  N     . ALA A 1 580 ? 91.447  93.361  77.561  1.00 24.20  ? 580  ALA A N     1 
ATOM   3950 C  CA    . ALA A 1 580 ? 90.002  93.316  77.696  1.00 24.20  ? 580  ALA A CA    1 
ATOM   3951 C  C     . ALA A 1 580 ? 89.356  94.646  77.360  1.00 24.20  ? 580  ALA A C     1 
ATOM   3952 O  O     . ALA A 1 580 ? 88.170  94.675  77.033  1.00 24.20  ? 580  ALA A O     1 
ATOM   3953 C  CB    . ALA A 1 580 ? 89.623  92.885  79.108  1.00 24.20  ? 580  ALA A CB    1 
ATOM   3954 N  N     . LEU A 1 581 ? 90.103  95.747  77.424  1.00 26.23  ? 581  LEU A N     1 
ATOM   3955 C  CA    . LEU A 1 581 ? 89.560  97.018  76.970  1.00 26.23  ? 581  LEU A CA    1 
ATOM   3956 C  C     . LEU A 1 581 ? 89.728  97.201  75.468  1.00 26.23  ? 581  LEU A C     1 
ATOM   3957 O  O     . LEU A 1 581 ? 88.911  97.880  74.842  1.00 26.23  ? 581  LEU A O     1 
ATOM   3958 C  CB    . LEU A 1 581 ? 90.215  98.175  77.718  1.00 26.23  ? 581  LEU A CB    1 
ATOM   3959 C  CG    . LEU A 1 581 ? 89.901  98.284  79.206  1.00 26.23  ? 581  LEU A CG    1 
ATOM   3960 C  CD1   . LEU A 1 581 ? 90.626  99.453  79.785  1.00 26.23  ? 581  LEU A CD1   1 
ATOM   3961 C  CD2   . LEU A 1 581 ? 88.421  98.423  79.429  1.00 26.23  ? 581  LEU A CD2   1 
ATOM   3962 N  N     . GLN A 1 582 ? 90.770  96.613  74.878  1.00 30.57  ? 582  GLN A N     1 
ATOM   3963 C  CA    . GLN A 1 582 ? 90.901  96.612  73.425  1.00 30.57  ? 582  GLN A CA    1 
ATOM   3964 C  C     . GLN A 1 582 ? 89.858  95.726  72.765  1.00 30.57  ? 582  GLN A C     1 
ATOM   3965 O  O     . GLN A 1 582 ? 89.330  96.072  71.704  1.00 30.57  ? 582  GLN A O     1 
ATOM   3966 C  CB    . GLN A 1 582 ? 92.295  96.156  73.019  1.00 30.57  ? 582  GLN A CB    1 
ATOM   3967 C  CG    . GLN A 1 582 ? 93.358  97.203  73.100  1.00 30.57  ? 582  GLN A CG    1 
ATOM   3968 C  CD    . GLN A 1 582 ? 94.700  96.653  72.701  1.00 30.57  ? 582  GLN A CD    1 
ATOM   3969 O  OE1   . GLN A 1 582 ? 94.885  95.445  72.631  1.00 30.57  ? 582  GLN A OE1   1 
ATOM   3970 N  NE2   . GLN A 1 582 ? 95.619  97.537  72.368  1.00 30.57  ? 582  GLN A NE2   1 
ATOM   3971 N  N     . HIS A 1 583 ? 89.562  94.572  73.357  1.00 33.27  ? 583  HIS A N     1 
ATOM   3972 C  CA    . HIS A 1 583 ? 88.559  93.697  72.766  1.00 33.27  ? 583  HIS A CA    1 
ATOM   3973 C  C     . HIS A 1 583 ? 87.159  94.259  72.948  1.00 33.27  ? 583  HIS A C     1 
ATOM   3974 O  O     . HIS A 1 583 ? 86.279  94.009  72.120  1.00 33.27  ? 583  HIS A O     1 
ATOM   3975 C  CB    . HIS A 1 583 ? 88.634  92.304  73.383  1.00 33.27  ? 583  HIS A CB    1 
ATOM   3976 C  CG    . HIS A 1 583 ? 87.711  91.317  72.744  1.00 33.27  ? 583  HIS A CG    1 
ATOM   3977 N  ND1   . HIS A 1 583 ? 88.054  90.587  71.628  1.00 33.27  ? 583  HIS A ND1   1 
ATOM   3978 C  CD2   . HIS A 1 583 ? 86.427  90.996  73.020  1.00 33.27  ? 583  HIS A CD2   1 
ATOM   3979 C  CE1   . HIS A 1 583 ? 87.038  89.820  71.279  1.00 33.27  ? 583  HIS A CE1   1 
ATOM   3980 N  NE2   . HIS A 1 583 ? 86.038  90.050  72.107  1.00 33.27  ? 583  HIS A NE2   1 
ATOM   3981 N  N     . ASN A 1 584 ? 86.939  95.011  74.025  1.00 33.63  ? 584  ASN A N     1 
ATOM   3982 C  CA    . ASN A 1 584 ? 85.633  95.605  74.273  1.00 33.63  ? 584  ASN A CA    1 
ATOM   3983 C  C     . ASN A 1 584 ? 85.346  96.723  73.284  1.00 33.63  ? 584  ASN A C     1 
ATOM   3984 O  O     . ASN A 1 584 ? 84.212  96.880  72.822  1.00 33.63  ? 584  ASN A O     1 
ATOM   3985 C  CB    . ASN A 1 584 ? 85.577  96.142  75.699  1.00 33.63  ? 584  ASN A CB    1 
ATOM   3986 C  CG    . ASN A 1 584 ? 84.179  96.467  76.149  1.00 33.63  ? 584  ASN A CG    1 
ATOM   3987 O  OD1   . ASN A 1 584 ? 83.206  96.179  75.463  1.00 33.63  ? 584  ASN A OD1   1 
ATOM   3988 N  ND2   . ASN A 1 584 ? 84.074  97.104  77.302  1.00 33.63  ? 584  ASN A ND2   1 
ATOM   3989 N  N     . GLU A 1 585 ? 86.362  97.506  72.946  1.00 41.34  ? 585  GLU A N     1 
ATOM   3990 C  CA    . GLU A 1 585 ? 86.158  98.689  72.127  1.00 41.34  ? 585  GLU A CA    1 
ATOM   3991 C  C     . GLU A 1 585 ? 86.360  98.416  70.642  1.00 41.34  ? 585  GLU A C     1 
ATOM   3992 O  O     . GLU A 1 585 ? 85.572  98.875  69.812  1.00 41.34  ? 585  GLU A O     1 
ATOM   3993 C  CB    . GLU A 1 585 ? 87.096  99.798  72.585  1.00 41.34  ? 585  GLU A CB    1 
ATOM   3994 C  CG    . GLU A 1 585 ? 86.896  101.065 71.825  1.00 41.34  ? 585  GLU A CG    1 
ATOM   3995 C  CD    . GLU A 1 585 ? 87.755  102.172 72.335  1.00 41.34  ? 585  GLU A CD    1 
ATOM   3996 O  OE1   . GLU A 1 585 ? 88.517  101.937 73.288  1.00 41.34  ? 585  GLU A OE1   1 
ATOM   3997 O  OE2   . GLU A 1 585 ? 87.667  103.280 71.782  1.00 41.34  ? 585  GLU A OE2   1 
ATOM   3998 N  N     . PHE A 1 586 ? 87.388  97.655  70.282  1.00 43.01  ? 586  PHE A N     1 
ATOM   3999 C  CA    . PHE A 1 586 ? 87.700  97.502  68.871  1.00 43.01  ? 586  PHE A CA    1 
ATOM   4000 C  C     . PHE A 1 586 ? 87.008  96.303  68.238  1.00 43.01  ? 586  PHE A C     1 
ATOM   4001 O  O     . PHE A 1 586 ? 87.536  95.725  67.287  1.00 43.01  ? 586  PHE A O     1 
ATOM   4002 C  CB    . PHE A 1 586 ? 89.196  97.363  68.641  1.00 43.01  ? 586  PHE A CB    1 
ATOM   4003 C  CG    . PHE A 1 586 ? 89.998  98.574  68.970  1.00 43.01  ? 586  PHE A CG    1 
ATOM   4004 C  CD1   . PHE A 1 586 ? 90.023  99.651  68.112  1.00 43.01  ? 586  PHE A CD1   1 
ATOM   4005 C  CD2   . PHE A 1 586 ? 90.789  98.605  70.101  1.00 43.01  ? 586  PHE A CD2   1 
ATOM   4006 C  CE1   . PHE A 1 586 ? 90.784  100.753 68.404  1.00 43.01  ? 586  PHE A CE1   1 
ATOM   4007 C  CE2   . PHE A 1 586 ? 91.552  99.704  70.393  1.00 43.01  ? 586  PHE A CE2   1 
ATOM   4008 C  CZ    . PHE A 1 586 ? 91.550  100.773 69.545  1.00 43.01  ? 586  PHE A CZ    1 
ATOM   4009 N  N     . LEU A 1 587 ? 85.834  95.915  68.732  1.00 46.00  ? 587  LEU A N     1 
ATOM   4010 C  CA    . LEU A 1 587 ? 84.920  95.135  67.903  1.00 46.00  ? 587  LEU A CA    1 
ATOM   4011 C  C     . LEU A 1 587 ? 84.279  96.128  66.954  1.00 46.00  ? 587  LEU A C     1 
ATOM   4012 O  O     . LEU A 1 587 ? 84.432  97.337  67.153  1.00 46.00  ? 587  LEU A O     1 
ATOM   4013 C  CB    . LEU A 1 587 ? 83.873  94.381  68.715  1.00 46.00  ? 587  LEU A CB    1 
ATOM   4014 C  CG    . LEU A 1 587 ? 84.418  93.168  69.465  1.00 46.00  ? 587  LEU A CG    1 
ATOM   4015 C  CD1   . LEU A 1 587 ? 83.314  92.503  70.274  1.00 46.00  ? 587  LEU A CD1   1 
ATOM   4016 C  CD2   . LEU A 1 587 ? 85.064  92.186  68.499  1.00 46.00  ? 587  LEU A CD2   1 
ATOM   4017 N  N     . GLY A 1 588 ? 83.481  95.663  66.000  1.00 55.56  ? 588  GLY A N     1 
ATOM   4018 C  CA    . GLY A 1 588 ? 83.561  96.217  64.654  1.00 55.56  ? 588  GLY A CA    1 
ATOM   4019 C  C     . GLY A 1 588 ? 83.278  97.688  64.386  1.00 55.56  ? 588  GLY A C     1 
ATOM   4020 O  O     . GLY A 1 588 ? 82.410  98.059  63.600  1.00 55.56  ? 588  GLY A O     1 
ATOM   4021 N  N     . GLN A 1 589 ? 84.207  98.463  64.955  1.00 57.69  ? 589  GLN A N     1 
ATOM   4022 C  CA    . GLN A 1 589 ? 84.401  99.911  64.718  1.00 57.69  ? 589  GLN A CA    1 
ATOM   4023 C  C     . GLN A 1 589 ? 85.227  99.949  63.429  1.00 57.69  ? 589  GLN A C     1 
ATOM   4024 O  O     . GLN A 1 589 ? 86.160  99.132  63.313  1.00 57.69  ? 589  GLN A O     1 
ATOM   4025 C  CB    . GLN A 1 589 ? 85.260  100.512 65.829  1.00 57.69  ? 589  GLN A CB    1 
ATOM   4026 C  CG    . GLN A 1 589 ? 84.862  100.068 67.225  1.00 57.69  ? 589  GLN A CG    1 
ATOM   4027 C  CD    . GLN A 1 589 ? 83.902  101.032 67.869  1.00 57.69  ? 589  GLN A CD    1 
ATOM   4028 O  OE1   . GLN A 1 589 ? 82.952  100.637 68.539  1.00 57.69  ? 589  GLN A OE1   1 
ATOM   4029 N  NE2   . GLN A 1 589 ? 84.146  102.315 67.664  1.00 57.69  ? 589  GLN A NE2   1 
ATOM   4030 N  N     . ASN A 1 590 ? 84.917  100.863 62.515  1.00 66.72  ? 590  ASN A N     1 
ATOM   4031 C  CA    . ASN A 1 590 ? 85.589  100.941 61.230  1.00 66.72  ? 590  ASN A CA    1 
ATOM   4032 C  C     . ASN A 1 590 ? 86.324  102.272 61.162  1.00 66.72  ? 590  ASN A C     1 
ATOM   4033 O  O     . ASN A 1 590 ? 85.815  103.291 61.635  1.00 66.72  ? 590  ASN A O     1 
ATOM   4034 C  CB    . ASN A 1 590 ? 84.580  100.799 60.091  1.00 66.72  ? 590  ASN A CB    1 
ATOM   4035 C  CG    . ASN A 1 590 ? 85.164  100.116 58.872  1.00 66.72  ? 590  ASN A CG    1 
ATOM   4036 O  OD1   . ASN A 1 590 ? 84.430  99.674  57.990  1.00 66.72  ? 590  ASN A OD1   1 
ATOM   4037 N  ND2   . ASN A 1 590 ? 86.485  100.023 58.817  1.00 66.72  ? 590  ASN A ND2   1 
ATOM   4038 N  N     . PHE A 1 591 ? 87.527  102.261 60.589  1.00 65.52  ? 591  PHE A N     1 
ATOM   4039 C  CA    . PHE A 1 591 ? 88.402  103.424 60.670  1.00 65.52  ? 591  PHE A CA    1 
ATOM   4040 C  C     . PHE A 1 591 ? 88.749  103.972 59.291  1.00 65.52  ? 591  PHE A C     1 
ATOM   4041 O  O     . PHE A 1 591 ? 88.962  105.177 59.130  1.00 65.52  ? 591  PHE A O     1 
ATOM   4042 C  CB    . PHE A 1 591 ? 89.663  103.054 61.450  1.00 65.52  ? 591  PHE A CB    1 
ATOM   4043 C  CG    . PHE A 1 591 ? 89.393  102.681 62.879  1.00 65.52  ? 591  PHE A CG    1 
ATOM   4044 C  CD1   . PHE A 1 591 ? 89.253  103.653 63.847  1.00 65.52  ? 591  PHE A CD1   1 
ATOM   4045 C  CD2   . PHE A 1 591 ? 89.247  101.361 63.251  1.00 65.52  ? 591  PHE A CD2   1 
ATOM   4046 C  CE1   . PHE A 1 591 ? 88.995  103.305 65.155  1.00 65.52  ? 591  PHE A CE1   1 
ATOM   4047 C  CE2   . PHE A 1 591 ? 88.988  101.021 64.565  1.00 65.52  ? 591  PHE A CE2   1 
ATOM   4048 C  CZ    . PHE A 1 591 ? 88.863  101.992 65.511  1.00 65.52  ? 591  PHE A CZ    1 
ATOM   4049 N  N     . CYS A 1 592 ? 88.808  103.096 58.297  1.00 85.29  ? 592  CYS A N     1 
ATOM   4050 C  CA    . CYS A 1 592 ? 88.999  103.444 56.885  1.00 85.29  ? 592  CYS A CA    1 
ATOM   4051 C  C     . CYS A 1 592 ? 87.898  104.190 56.110  1.00 85.29  ? 592  CYS A C     1 
ATOM   4052 O  O     . CYS A 1 592 ? 88.263  104.847 55.126  1.00 85.29  ? 592  CYS A O     1 
ATOM   4053 C  CB    . CYS A 1 592 ? 89.327  102.175 56.097  1.00 85.29  ? 592  CYS A CB    1 
ATOM   4054 S  SG    . CYS A 1 592 ? 90.988  101.541 56.371  1.00 85.29  ? 592  CYS A SG    1 
ATOM   4055 N  N     . PRO A 1 593 ? 86.586  104.087 56.409  1.00 88.46  ? 593  PRO A N     1 
ATOM   4056 C  CA    . PRO A 1 593 ? 85.606  104.869 55.629  1.00 88.46  ? 593  PRO A CA    1 
ATOM   4057 C  C     . PRO A 1 593 ? 85.791  106.377 55.752  1.00 88.46  ? 593  PRO A C     1 
ATOM   4058 O  O     . PRO A 1 593 ? 86.380  106.876 56.713  1.00 88.46  ? 593  PRO A O     1 
ATOM   4059 C  CB    . PRO A 1 593 ? 84.257  104.421 56.200  1.00 88.46  ? 593  PRO A CB    1 
ATOM   4060 C  CG    . PRO A 1 593 ? 84.490  103.056 56.605  1.00 88.46  ? 593  PRO A CG    1 
ATOM   4061 C  CD    . PRO A 1 593 ? 85.874  103.030 57.157  1.00 88.46  ? 593  PRO A CD    1 
ATOM   4062 N  N     . GLY A 1 594 ? 85.274  107.091 54.755  1.00 97.04  ? 594  GLY A N     1 
ATOM   4063 C  CA    . GLY A 1 594 ? 85.713  108.439 54.444  1.00 97.04  ? 594  GLY A CA    1 
ATOM   4064 C  C     . GLY A 1 594 ? 86.634  108.322 53.242  1.00 97.04  ? 594  GLY A C     1 
ATOM   4065 O  O     . GLY A 1 594 ? 87.233  109.294 52.781  1.00 97.04  ? 594  GLY A O     1 
ATOM   4066 N  N     . LEU A 1 595 ? 86.725  107.094 52.740  1.00 103.54 ? 595  LEU A N     1 
ATOM   4067 C  CA    . LEU A 1 595 ? 87.665  106.696 51.694  1.00 103.54 ? 595  LEU A CA    1 
ATOM   4068 C  C     . LEU A 1 595 ? 87.398  107.243 50.287  1.00 103.54 ? 595  LEU A C     1 
ATOM   4069 O  O     . LEU A 1 595 ? 86.299  107.696 49.970  1.00 103.54 ? 595  LEU A O     1 
ATOM   4070 C  CB    . LEU A 1 595 ? 87.720  105.163 51.655  1.00 103.54 ? 595  LEU A CB    1 
ATOM   4071 C  CG    . LEU A 1 595 ? 86.419  104.341 51.598  1.00 103.54 ? 595  LEU A CG    1 
ATOM   4072 C  CD1   . LEU A 1 595 ? 85.868  104.107 50.188  1.00 103.54 ? 595  LEU A CD1   1 
ATOM   4073 C  CD2   . LEU A 1 595 ? 86.612  103.010 52.318  1.00 103.54 ? 595  LEU A CD2   1 
ATOM   4074 N  N     . ASN A 1 596 ? 88.434  107.182 49.449  1.00 110.22 ? 596  ASN A N     1 
ATOM   4075 C  CA    . ASN A 1 596 ? 88.355  107.573 48.044  1.00 110.22 ? 596  ASN A CA    1 
ATOM   4076 C  C     . ASN A 1 596 ? 88.071  106.307 47.244  1.00 110.22 ? 596  ASN A C     1 
ATOM   4077 O  O     . ASN A 1 596 ? 87.881  105.244 47.844  1.00 110.22 ? 596  ASN A O     1 
ATOM   4078 C  CB    . ASN A 1 596 ? 89.661  108.252 47.603  1.00 110.22 ? 596  ASN A CB    1 
ATOM   4079 C  CG    . ASN A 1 596 ? 89.492  109.124 46.368  1.00 110.22 ? 596  ASN A CG    1 
ATOM   4080 O  OD1   . ASN A 1 596 ? 88.408  109.200 45.791  1.00 110.22 ? 596  ASN A OD1   1 
ATOM   4081 N  ND2   . ASN A 1 596 ? 90.567  109.792 45.963  1.00 110.22 ? 596  ASN A ND2   1 
ATOM   4082 N  N     . ALA A 1 597 ? 88.023  106.420 45.912  1.00 113.23 ? 597  ALA A N     1 
ATOM   4083 C  CA    . ALA A 1 597 ? 87.679  105.320 44.991  1.00 113.23 ? 597  ALA A CA    1 
ATOM   4084 C  C     . ALA A 1 597 ? 88.501  104.039 45.175  1.00 113.23 ? 597  ALA A C     1 
ATOM   4085 O  O     . ALA A 1 597 ? 87.950  102.988 45.504  1.00 113.23 ? 597  ALA A O     1 
ATOM   4086 C  CB    . ALA A 1 597 ? 87.805  105.801 43.555  1.00 113.23 ? 597  ALA A CB    1 
ATOM   4087 N  N     . THR A 1 598 ? 89.816  104.132 44.979  1.00 115.19 ? 598  THR A N     1 
ATOM   4088 C  CA    . THR A 1 598 ? 90.730  103.061 45.372  1.00 115.19 ? 598  THR A CA    1 
ATOM   4089 C  C     . THR A 1 598 ? 90.913  103.190 46.877  1.00 115.19 ? 598  THR A C     1 
ATOM   4090 O  O     . THR A 1 598 ? 90.641  104.259 47.432  1.00 115.19 ? 598  THR A O     1 
ATOM   4091 C  CB    . THR A 1 598 ? 92.066  103.139 44.632  1.00 115.19 ? 598  THR A CB    1 
ATOM   4092 O  OG1   . THR A 1 598 ? 92.687  104.407 44.883  1.00 115.19 ? 598  THR A OG1   1 
ATOM   4093 C  CG2   . THR A 1 598 ? 91.859  102.954 43.133  1.00 115.19 ? 598  THR A CG2   1 
ATOM   4094 N  N     . GLY A 1 599 ? 91.410  102.126 47.513  1.00 113.92 ? 599  GLY A N     1 
ATOM   4095 C  CA    . GLY A 1 599 ? 91.148  101.833 48.918  1.00 113.92 ? 599  GLY A CA    1 
ATOM   4096 C  C     . GLY A 1 599 ? 91.205  102.888 50.011  1.00 113.92 ? 599  GLY A C     1 
ATOM   4097 O  O     . GLY A 1 599 ? 90.153  103.283 50.501  1.00 113.92 ? 599  GLY A O     1 
ATOM   4098 N  N     . ASN A 1 600 ? 92.385  103.363 50.388  1.00 111.07 ? 600  ASN A N     1 
ATOM   4099 C  CA    . ASN A 1 600 ? 92.389  104.481 51.329  1.00 111.07 ? 600  ASN A CA    1 
ATOM   4100 C  C     . ASN A 1 600 ? 93.345  105.601 50.955  1.00 111.07 ? 600  ASN A C     1 
ATOM   4101 O  O     . ASN A 1 600 ? 92.989  106.775 51.090  1.00 111.07 ? 600  ASN A O     1 
ATOM   4102 C  CB    . ASN A 1 600 ? 92.735  103.961 52.727  1.00 111.07 ? 600  ASN A CB    1 
ATOM   4103 C  CG    . ASN A 1 600 ? 91.615  103.160 53.340  1.00 111.07 ? 600  ASN A CG    1 
ATOM   4104 O  OD1   . ASN A 1 600 ? 90.459  103.581 53.333  1.00 111.07 ? 600  ASN A OD1   1 
ATOM   4105 N  ND2   . ASN A 1 600 ? 91.944  101.980 53.845  1.00 111.07 ? 600  ASN A ND2   1 
ATOM   4106 N  N     . ASN A 1 601 ? 94.559  105.259 50.513  1.00 117.14 ? 601  ASN A N     1 
ATOM   4107 C  CA    . ASN A 1 601 ? 95.736  106.081 50.213  1.00 117.14 ? 601  ASN A CA    1 
ATOM   4108 C  C     . ASN A 1 601 ? 96.315  106.970 51.324  1.00 117.14 ? 601  ASN A C     1 
ATOM   4109 O  O     . ASN A 1 601 ? 96.675  108.119 51.039  1.00 117.14 ? 601  ASN A O     1 
ATOM   4110 C  CB    . ASN A 1 601 ? 95.435  106.967 48.997  1.00 117.14 ? 601  ASN A CB    1 
ATOM   4111 C  CG    . ASN A 1 601 ? 95.177  106.162 47.737  1.00 117.14 ? 601  ASN A CG    1 
ATOM   4112 O  OD1   . ASN A 1 601 ? 94.073  106.174 47.192  1.00 117.14 ? 601  ASN A OD1   1 
ATOM   4113 N  ND2   . ASN A 1 601 ? 96.199  105.457 47.267  1.00 117.14 ? 601  ASN A ND2   1 
ATOM   4114 N  N     . PRO A 1 602 ? 96.434  106.518 52.576  1.00 121.26 ? 602  PRO A N     1 
ATOM   4115 C  CA    . PRO A 1 602 ? 97.685  106.718 53.308  1.00 121.26 ? 602  PRO A CA    1 
ATOM   4116 C  C     . PRO A 1 602 ? 98.527  105.454 53.179  1.00 121.26 ? 602  PRO A C     1 
ATOM   4117 O  O     . PRO A 1 602 ? 98.101  104.453 52.600  1.00 121.26 ? 602  PRO A O     1 
ATOM   4118 C  CB    . PRO A 1 602 ? 97.234  106.937 54.760  1.00 121.26 ? 602  PRO A CB    1 
ATOM   4119 C  CG    . PRO A 1 602 ? 95.827  107.323 54.666  1.00 121.26 ? 602  PRO A CG    1 
ATOM   4120 C  CD    . PRO A 1 602 ? 95.309  106.513 53.528  1.00 121.26 ? 602  PRO A CD    1 
ATOM   4121 N  N     . CYS A 1 603 ? 99.740  105.512 53.722  1.00 126.51 ? 603  CYS A N     1 
ATOM   4122 C  CA    . CYS A 1 603 ? 100.648 104.378 53.575  1.00 126.51 ? 603  CYS A CA    1 
ATOM   4123 C  C     . CYS A 1 603 ? 101.322 103.973 54.888  1.00 126.51 ? 603  CYS A C     1 
ATOM   4124 O  O     . CYS A 1 603 ? 102.435 104.411 55.188  1.00 126.51 ? 603  CYS A O     1 
ATOM   4125 C  CB    . CYS A 1 603 ? 101.692 104.681 52.502  1.00 126.51 ? 603  CYS A CB    1 
ATOM   4126 S  SG    . CYS A 1 603 ? 102.733 103.265 52.088  1.00 126.51 ? 603  CYS A SG    1 
ATOM   4127 N  N     . ASN A 1 604 ? 100.634 103.147 55.677  1.00 123.03 ? 604  ASN A N     1 
ATOM   4128 C  CA    . ASN A 1 604 ? 101.273 101.980 56.273  1.00 123.03 ? 604  ASN A CA    1 
ATOM   4129 C  C     . ASN A 1 604 ? 100.979 100.766 55.411  1.00 123.03 ? 604  ASN A C     1 
ATOM   4130 O  O     . ASN A 1 604 ? 101.884 100.231 54.759  1.00 123.03 ? 604  ASN A O     1 
ATOM   4131 C  CB    . ASN A 1 604 ? 100.764 101.766 57.709  1.00 123.03 ? 604  ASN A CB    1 
ATOM   4132 C  CG    . ASN A 1 604 ? 101.593 100.762 58.489  1.00 123.03 ? 604  ASN A CG    1 
ATOM   4133 O  OD1   . ASN A 1 604 ? 102.593 100.238 57.997  1.00 123.03 ? 604  ASN A OD1   1 
ATOM   4134 N  ND2   . ASN A 1 604 ? 101.169 100.479 59.716  1.00 123.03 ? 604  ASN A ND2   1 
ATOM   4135 N  N     . TYR A 1 605 ? 99.730  100.315 55.403  1.00 117.38 ? 605  TYR A N     1 
ATOM   4136 C  CA    . TYR A 1 605 ? 98.875  100.471 54.240  1.00 117.38 ? 605  TYR A CA    1 
ATOM   4137 C  C     . TYR A 1 605 ? 97.651  101.168 54.811  1.00 117.38 ? 605  TYR A C     1 
ATOM   4138 O  O     . TYR A 1 605 ? 97.311  102.288 54.421  1.00 117.38 ? 605  TYR A O     1 
ATOM   4139 C  CB    . TYR A 1 605 ? 98.498  99.164  53.555  1.00 117.38 ? 605  TYR A CB    1 
ATOM   4140 C  CG    . TYR A 1 605 ? 97.626  99.423  52.343  1.00 117.38 ? 605  TYR A CG    1 
ATOM   4141 C  CD1   . TYR A 1 605 ? 98.173  99.934  51.172  1.00 117.38 ? 605  TYR A CD1   1 
ATOM   4142 C  CD2   . TYR A 1 605 ? 96.254  99.193  52.381  1.00 117.38 ? 605  TYR A CD2   1 
ATOM   4143 C  CE1   . TYR A 1 605 ? 97.385  100.191 50.065  1.00 117.38 ? 605  TYR A CE1   1 
ATOM   4144 C  CE2   . TYR A 1 605 ? 95.456  99.447  51.277  1.00 117.38 ? 605  TYR A CE2   1 
ATOM   4145 C  CZ    . TYR A 1 605 ? 96.029  99.945  50.123  1.00 117.38 ? 605  TYR A CZ    1 
ATOM   4146 O  OH    . TYR A 1 605 ? 95.245  100.199 49.022  1.00 117.38 ? 605  TYR A OH    1 
ATOM   4147 N  N     . ALA A 1 606 ? 97.064  100.475 55.793  1.00 101.27 ? 606  ALA A N     1 
ATOM   4148 C  CA    . ALA A 1 606 ? 95.932  100.895 56.612  1.00 101.27 ? 606  ALA A CA    1 
ATOM   4149 C  C     . ALA A 1 606 ? 95.658  99.787  57.620  1.00 101.27 ? 606  ALA A C     1 
ATOM   4150 O  O     . ALA A 1 606 ? 96.161  98.669  57.495  1.00 101.27 ? 606  ALA A O     1 
ATOM   4151 C  CB    . ALA A 1 606 ? 94.667  101.165 55.787  1.00 101.27 ? 606  ALA A CB    1 
ATOM   4152 N  N     . THR A 1 607 ? 94.843  100.111 58.621  1.00 82.10  ? 607  THR A N     1 
ATOM   4153 C  CA    . THR A 1 607 ? 94.204  99.127  59.496  1.00 82.10  ? 607  THR A CA    1 
ATOM   4154 C  C     . THR A 1 607 ? 92.731  99.513  59.562  1.00 82.10  ? 607  THR A C     1 
ATOM   4155 O  O     . THR A 1 607 ? 92.338  100.337 60.392  1.00 82.10  ? 607  THR A O     1 
ATOM   4156 C  CB    . THR A 1 607 ? 94.841  99.088  60.884  1.00 82.10  ? 607  THR A CB    1 
ATOM   4157 O  OG1   . THR A 1 607 ? 94.893  100.412 61.424  1.00 82.10  ? 607  THR A OG1   1 
ATOM   4158 C  CG2   . THR A 1 607 ? 96.241  98.488  60.844  1.00 82.10  ? 607  THR A CG2   1 
ATOM   4159 N  N     . CYS A 1 608 ? 91.922  98.908  58.690  1.00 74.84  ? 608  CYS A N     1 
ATOM   4160 C  CA    . CYS A 1 608 ? 90.585  99.427  58.416  1.00 74.84  ? 608  CYS A CA    1 
ATOM   4161 C  C     . CYS A 1 608 ? 89.612  99.134  59.548  1.00 74.84  ? 608  CYS A C     1 
ATOM   4162 O  O     . CYS A 1 608 ? 89.092  100.056 60.185  1.00 74.84  ? 608  CYS A O     1 
ATOM   4163 C  CB    . CYS A 1 608 ? 90.071  98.853  57.096  1.00 74.84  ? 608  CYS A CB    1 
ATOM   4164 S  SG    . CYS A 1 608 ? 90.875  99.622  55.706  1.00 74.84  ? 608  CYS A SG    1 
ATOM   4165 N  N     . THR A 1 609 ? 89.346  97.864  59.811  1.00 64.22  ? 609  THR A N     1 
ATOM   4166 C  CA    . THR A 1 609 ? 88.401  97.536  60.860  1.00 64.22  ? 609  THR A CA    1 
ATOM   4167 C  C     . THR A 1 609 ? 89.138  97.278  62.169  1.00 64.22  ? 609  THR A C     1 
ATOM   4168 O  O     . THR A 1 609 ? 90.358  97.111  62.207  1.00 64.22  ? 609  THR A O     1 
ATOM   4169 C  CB    . THR A 1 609 ? 87.548  96.330  60.460  1.00 64.22  ? 609  THR A CB    1 
ATOM   4170 O  OG1   . THR A 1 609 ? 86.532  96.117  61.448  1.00 64.22  ? 609  THR A OG1   1 
ATOM   4171 C  CG2   . THR A 1 609 ? 88.394  95.089  60.335  1.00 64.22  ? 609  THR A CG2   1 
ATOM   4172 N  N     . GLY A 1 610 ? 88.376  97.276  63.262  1.00 56.84  ? 610  GLY A N     1 
ATOM   4173 C  CA    . GLY A 1 610 ? 88.955  96.981  64.557  1.00 56.84  ? 610  GLY A CA    1 
ATOM   4174 C  C     . GLY A 1 610 ? 89.371  95.537  64.727  1.00 56.84  ? 610  GLY A C     1 
ATOM   4175 O  O     . GLY A 1 610 ? 90.199  95.241  65.591  1.00 56.84  ? 610  GLY A O     1 
ATOM   4176 N  N     . GLU A 1 611 ? 88.815  94.632  63.921  1.00 56.20  ? 611  GLU A N     1 
ATOM   4177 C  CA    . GLU A 1 611 ? 89.198  93.229  64.006  1.00 56.20  ? 611  GLU A CA    1 
ATOM   4178 C  C     . GLU A 1 611 ? 90.598  93.002  63.452  1.00 56.20  ? 611  GLU A C     1 
ATOM   4179 O  O     . GLU A 1 611 ? 91.318  92.118  63.925  1.00 56.20  ? 611  GLU A O     1 
ATOM   4180 C  CB    . GLU A 1 611 ? 88.181  92.366  63.271  1.00 56.20  ? 611  GLU A CB    1 
ATOM   4181 C  CG    . GLU A 1 611 ? 86.810  92.358  63.910  1.00 56.20  ? 611  GLU A CG    1 
ATOM   4182 C  CD    . GLU A 1 611 ? 85.819  91.488  63.165  1.00 56.20  ? 611  GLU A CD    1 
ATOM   4183 O  OE1   . GLU A 1 611 ? 86.159  90.997  62.066  1.00 56.20  ? 611  GLU A OE1   1 
ATOM   4184 O  OE2   . GLU A 1 611 ? 84.700  91.291  63.683  1.00 56.20  ? 611  GLU A OE2   1 
ATOM   4185 N  N     . GLU A 1 612 ? 91.002  93.783  62.448  1.00 57.59  ? 612  GLU A N     1 
ATOM   4186 C  CA    . GLU A 1 612 ? 92.363  93.680  61.931  1.00 57.59  ? 612  GLU A CA    1 
ATOM   4187 C  C     . GLU A 1 612 ? 93.395  94.192  62.921  1.00 57.59  ? 612  GLU A C     1 
ATOM   4188 O  O     . GLU A 1 612 ? 94.562  93.800  62.836  1.00 57.59  ? 612  GLU A O     1 
ATOM   4189 C  CB    . GLU A 1 612 ? 92.502  94.446  60.619  1.00 57.59  ? 612  GLU A CB    1 
ATOM   4190 C  CG    . GLU A 1 612 ? 91.763  93.832  59.451  1.00 57.59  ? 612  GLU A CG    1 
ATOM   4191 C  CD    . GLU A 1 612 ? 91.893  94.660  58.189  1.00 57.59  ? 612  GLU A CD    1 
ATOM   4192 O  OE1   . GLU A 1 612 ? 92.468  95.765  58.262  1.00 57.59  ? 612  GLU A OE1   1 
ATOM   4193 O  OE2   . GLU A 1 612 ? 91.419  94.211  57.125  1.00 57.59  ? 612  GLU A OE2   1 
ATOM   4194 N  N     . TYR A 1 613 ? 92.998  95.063  63.848  1.00 49.63  ? 613  TYR A N     1 
ATOM   4195 C  CA    . TYR A 1 613 ? 93.931  95.524  64.867  1.00 49.63  ? 613  TYR A CA    1 
ATOM   4196 C  C     . TYR A 1 613 ? 94.175  94.445  65.913  1.00 49.63  ? 613  TYR A C     1 
ATOM   4197 O  O     . TYR A 1 613 ? 95.287  94.317  66.431  1.00 49.63  ? 613  TYR A O     1 
ATOM   4198 C  CB    . TYR A 1 613 ? 93.404  96.803  65.512  1.00 49.63  ? 613  TYR A CB    1 
ATOM   4199 C  CG    . TYR A 1 613 ? 94.337  97.400  66.533  1.00 49.63  ? 613  TYR A CG    1 
ATOM   4200 C  CD1   . TYR A 1 613 ? 95.520  98.005  66.141  1.00 49.63  ? 613  TYR A CD1   1 
ATOM   4201 C  CD2   . TYR A 1 613 ? 94.026  97.382  67.883  1.00 49.63  ? 613  TYR A CD2   1 
ATOM   4202 C  CE1   . TYR A 1 613 ? 96.376  98.557  67.064  1.00 49.63  ? 613  TYR A CE1   1 
ATOM   4203 C  CE2   . TYR A 1 613 ? 94.877  97.934  68.816  1.00 49.63  ? 613  TYR A CE2   1 
ATOM   4204 C  CZ    . TYR A 1 613 ? 96.050  98.519  68.398  1.00 49.63  ? 613  TYR A CZ    1 
ATOM   4205 O  OH    . TYR A 1 613 ? 96.910  99.070  69.315  1.00 49.63  ? 613  TYR A OH    1 
ATOM   4206 N  N     . LEU A 1 614 ? 93.157  93.642  66.214  1.00 47.20  ? 614  LEU A N     1 
ATOM   4207 C  CA    . LEU A 1 614 ? 93.284  92.591  67.218  1.00 47.20  ? 614  LEU A CA    1 
ATOM   4208 C  C     . LEU A 1 614 ? 94.029  91.374  66.694  1.00 47.20  ? 614  LEU A C     1 
ATOM   4209 O  O     . LEU A 1 614 ? 94.645  90.646  67.480  1.00 47.20  ? 614  LEU A O     1 
ATOM   4210 C  CB    . LEU A 1 614 ? 91.901  92.178  67.720  1.00 47.20  ? 614  LEU A CB    1 
ATOM   4211 C  CG    . LEU A 1 614 ? 91.326  92.874  68.955  1.00 47.20  ? 614  LEU A CG    1 
ATOM   4212 C  CD1   . LEU A 1 614 ? 91.123  94.324  68.741  1.00 47.20  ? 614  LEU A CD1   1 
ATOM   4213 C  CD2   . LEU A 1 614 ? 90.006  92.239  69.304  1.00 47.20  ? 614  LEU A CD2   1 
ATOM   4214 N  N     . VAL A 1 615 ? 93.965  91.121  65.388  1.00 51.14  ? 615  VAL A N     1 
ATOM   4215 C  CA    . VAL A 1 615 ? 94.771  90.058  64.801  1.00 51.14  ? 615  VAL A CA    1 
ATOM   4216 C  C     . VAL A 1 615 ? 96.247  90.435  64.851  1.00 51.14  ? 615  VAL A C     1 
ATOM   4217 O  O     . VAL A 1 615 ? 97.112  89.589  65.107  1.00 51.14  ? 615  VAL A O     1 
ATOM   4218 C  CB    . VAL A 1 615 ? 94.283  89.767  63.369  1.00 51.14  ? 615  VAL A CB    1 
ATOM   4219 C  CG1   . VAL A 1 615 ? 95.171  88.756  62.661  1.00 51.14  ? 615  VAL A CG1   1 
ATOM   4220 C  CG2   . VAL A 1 615 ? 92.860  89.255  63.404  1.00 51.14  ? 615  VAL A CG2   1 
ATOM   4221 N  N     . LYS A 1 616 ? 96.551  91.722  64.659  1.00 51.33  ? 616  LYS A N     1 
ATOM   4222 C  CA    . LYS A 1 616 ? 97.927  92.194  64.763  1.00 51.33  ? 616  LYS A CA    1 
ATOM   4223 C  C     . LYS A 1 616 ? 98.431  92.143  66.201  1.00 51.33  ? 616  LYS A C     1 
ATOM   4224 O  O     . LYS A 1 616 ? 99.602  91.825  66.436  1.00 51.33  ? 616  LYS A O     1 
ATOM   4225 C  CB    . LYS A 1 616 ? 98.030  93.616  64.208  1.00 51.33  ? 616  LYS A CB    1 
ATOM   4226 C  CG    . LYS A 1 616 ? 99.441  94.180  64.167  1.00 51.33  ? 616  LYS A CG    1 
ATOM   4227 C  CD    . LYS A 1 616 ? 99.480  95.538  63.489  1.00 51.33  ? 616  LYS A CD    1 
ATOM   4228 C  CE    . LYS A 1 616 ? 98.885  96.619  64.374  1.00 51.33  ? 616  LYS A CE    1 
ATOM   4229 N  NZ    . LYS A 1 616 ? 99.735  96.897  65.565  1.00 51.33  ? 616  LYS A NZ    1 
ATOM   4230 N  N     . GLN A 1 617 ? 97.566  92.433  67.171  1.00 48.00  ? 617  GLN A N     1 
ATOM   4231 C  CA    . GLN A 1 617 ? 97.955  92.353  68.572  1.00 48.00  ? 617  GLN A CA    1 
ATOM   4232 C  C     . GLN A 1 617 ? 97.999  90.922  69.089  1.00 48.00  ? 617  GLN A C     1 
ATOM   4233 O  O     . GLN A 1 617 ? 98.720  90.648  70.054  1.00 48.00  ? 617  GLN A O     1 
ATOM   4234 C  CB    . GLN A 1 617 ? 96.994  93.169  69.437  1.00 48.00  ? 617  GLN A CB    1 
ATOM   4235 C  CG    . GLN A 1 617 ? 97.022  94.650  69.173  1.00 48.00  ? 617  GLN A CG    1 
ATOM   4236 C  CD    . GLN A 1 617 ? 98.366  95.263  69.459  1.00 48.00  ? 617  GLN A CD    1 
ATOM   4237 O  OE1   . GLN A 1 617 ? 99.091  95.647  68.544  1.00 48.00  ? 617  GLN A OE1   1 
ATOM   4238 N  NE2   . GLN A 1 617 ? 98.709  95.366  70.736  1.00 48.00  ? 617  GLN A NE2   1 
ATOM   4239 N  N     . GLY A 1 618 ? 97.252  90.009  68.477  1.00 47.36  ? 618  GLY A N     1 
ATOM   4240 C  CA    . GLY A 1 618 ? 97.195  88.646  68.956  1.00 47.36  ? 618  GLY A CA    1 
ATOM   4241 C  C     . GLY A 1 618 ? 96.064  88.366  69.914  1.00 47.36  ? 618  GLY A C     1 
ATOM   4242 O  O     . GLY A 1 618 ? 96.262  87.644  70.897  1.00 47.36  ? 618  GLY A O     1 
ATOM   4243 N  N     . ILE A 1 619 ? 94.882  88.914  69.662  1.00 41.62  ? 619  ILE A N     1 
ATOM   4244 C  CA    . ILE A 1 619 ? 93.738  88.797  70.554  1.00 41.62  ? 619  ILE A CA    1 
ATOM   4245 C  C     . ILE A 1 619 ? 92.668  87.976  69.853  1.00 41.62  ? 619  ILE A C     1 
ATOM   4246 O  O     . ILE A 1 619 ? 92.422  88.163  68.657  1.00 41.62  ? 619  ILE A O     1 
ATOM   4247 C  CB    . ILE A 1 619 ? 93.216  90.194  70.941  1.00 41.62  ? 619  ILE A CB    1 
ATOM   4248 C  CG1   . ILE A 1 619 ? 94.316  90.974  71.644  1.00 41.62  ? 619  ILE A CG1   1 
ATOM   4249 C  CG2   . ILE A 1 619 ? 92.019  90.114  71.857  1.00 41.62  ? 619  ILE A CG2   1 
ATOM   4250 C  CD1   . ILE A 1 619 ? 93.993  92.413  71.812  1.00 41.62  ? 619  ILE A CD1   1 
ATOM   4251 N  N     . ASP A 1 620 ? 92.059  87.046  70.588  1.00 41.04  ? 620  ASP A N     1 
ATOM   4252 C  CA    . ASP A 1 620 ? 90.959  86.262  70.045  1.00 41.04  ? 620  ASP A CA    1 
ATOM   4253 C  C     . ASP A 1 620 ? 89.765  87.159  69.755  1.00 41.04  ? 620  ASP A C     1 
ATOM   4254 O  O     . ASP A 1 620 ? 89.426  88.038  70.548  1.00 41.04  ? 620  ASP A O     1 
ATOM   4255 C  CB    . ASP A 1 620 ? 90.552  85.165  71.027  1.00 41.04  ? 620  ASP A CB    1 
ATOM   4256 C  CG    . ASP A 1 620 ? 91.601  84.089  71.167  1.00 41.04  ? 620  ASP A CG    1 
ATOM   4257 O  OD1   . ASP A 1 620 ? 92.340  83.846  70.190  1.00 41.04  ? 620  ASP A OD1   1 
ATOM   4258 O  OD2   . ASP A 1 620 ? 91.687  83.482  72.255  1.00 41.04  ? 620  ASP A OD2   1 
ATOM   4259 N  N     . LEU A 1 621 ? 89.140  86.946  68.603  1.00 41.71  ? 621  LEU A N     1 
ATOM   4260 C  CA    . LEU A 1 621 ? 87.947  87.686  68.219  1.00 41.71  ? 621  LEU A CA    1 
ATOM   4261 C  C     . LEU A 1 621 ? 86.674  87.058  68.761  1.00 41.71  ? 621  LEU A C     1 
ATOM   4262 O  O     . LEU A 1 621 ? 85.595  87.637  68.605  1.00 41.71  ? 621  LEU A O     1 
ATOM   4263 C  CB    . LEU A 1 621 ? 87.863  87.789  66.696  1.00 41.71  ? 621  LEU A CB    1 
ATOM   4264 C  CG    . LEU A 1 621 ? 88.980  88.593  66.035  1.00 41.71  ? 621  LEU A CG    1 
ATOM   4265 C  CD1   . LEU A 1 621 ? 88.886  88.502  64.524  1.00 41.71  ? 621  LEU A CD1   1 
ATOM   4266 C  CD2   . LEU A 1 621 ? 88.913  90.030  66.487  1.00 41.71  ? 621  LEU A CD2   1 
ATOM   4267 N  N     . SER A 1 622 ? 86.781  85.893  69.391  1.00 37.07  ? 622  SER A N     1 
ATOM   4268 C  CA    . SER A 1 622 ? 85.649  85.224  70.001  1.00 37.07  ? 622  SER A CA    1 
ATOM   4269 C  C     . SER A 1 622 ? 85.198  85.991  71.244  1.00 37.07  ? 622  SER A C     1 
ATOM   4270 O  O     . SER A 1 622 ? 85.931  86.839  71.754  1.00 37.07  ? 622  SER A O     1 
ATOM   4271 C  CB    . SER A 1 622 ? 86.046  83.790  70.355  1.00 37.07  ? 622  SER A CB    1 
ATOM   4272 O  OG    . SER A 1 622 ? 87.062  83.770  71.341  1.00 37.07  ? 622  SER A OG    1 
ATOM   4273 N  N     . PRO A 1 623 ? 83.985  85.729  71.750  1.00 33.58  ? 623  PRO A N     1 
ATOM   4274 C  CA    . PRO A 1 623 ? 83.624  86.291  73.061  1.00 33.58  ? 623  PRO A CA    1 
ATOM   4275 C  C     . PRO A 1 623 ? 84.395  85.686  74.220  1.00 33.58  ? 623  PRO A C     1 
ATOM   4276 O  O     . PRO A 1 623 ? 84.381  86.266  75.310  1.00 33.58  ? 623  PRO A O     1 
ATOM   4277 C  CB    . PRO A 1 623 ? 82.123  86.003  73.174  1.00 33.58  ? 623  PRO A CB    1 
ATOM   4278 C  CG    . PRO A 1 623 ? 81.877  84.885  72.244  1.00 33.58  ? 623  PRO A CG    1 
ATOM   4279 C  CD    . PRO A 1 623 ? 82.817  85.104  71.103  1.00 33.58  ? 623  PRO A CD    1 
ATOM   4280 N  N     . TRP A 1 624 ? 85.064  84.546  74.029  1.00 30.69  ? 624  TRP A N     1 
ATOM   4281 C  CA    . TRP A 1 624 ? 85.970  84.059  75.060  1.00 30.69  ? 624  TRP A CA    1 
ATOM   4282 C  C     . TRP A 1 624 ? 87.224  84.914  75.149  1.00 30.69  ? 624  TRP A C     1 
ATOM   4283 O  O     . TRP A 1 624 ? 87.819  85.015  76.223  1.00 30.69  ? 624  TRP A O     1 
ATOM   4284 C  CB    . TRP A 1 624 ? 86.340  82.596  74.816  1.00 30.69  ? 624  TRP A CB    1 
ATOM   4285 C  CG    . TRP A 1 624 ? 87.269  82.060  75.859  1.00 30.69  ? 624  TRP A CG    1 
ATOM   4286 C  CD1   . TRP A 1 624 ? 88.589  81.773  75.707  1.00 30.69  ? 624  TRP A CD1   1 
ATOM   4287 C  CD2   . TRP A 1 624 ? 86.962  81.818  77.236  1.00 30.69  ? 624  TRP A CD2   1 
ATOM   4288 N  NE1   . TRP A 1 624 ? 89.118  81.333  76.893  1.00 30.69  ? 624  TRP A NE1   1 
ATOM   4289 C  CE2   . TRP A 1 624 ? 88.138  81.355  77.850  1.00 30.69  ? 624  TRP A CE2   1 
ATOM   4290 C  CE3   . TRP A 1 624 ? 85.801  81.933  78.005  1.00 30.69  ? 624  TRP A CE3   1 
ATOM   4291 C  CZ2   . TRP A 1 624 ? 88.189  81.007  79.194  1.00 30.69  ? 624  TRP A CZ2   1 
ATOM   4292 C  CZ3   . TRP A 1 624 ? 85.853  81.587  79.337  1.00 30.69  ? 624  TRP A CZ3   1 
ATOM   4293 C  CH2   . TRP A 1 624 ? 87.038  81.129  79.919  1.00 30.69  ? 624  TRP A CH2   1 
ATOM   4294 N  N     . GLY A 1 625 ? 87.616  85.573  74.057  1.00 29.99  ? 625  GLY A N     1 
ATOM   4295 C  CA    . GLY A 1 625 ? 88.789  86.432  74.080  1.00 29.99  ? 625  GLY A CA    1 
ATOM   4296 C  C     . GLY A 1 625 ? 88.650  87.658  74.957  1.00 29.99  ? 625  GLY A C     1 
ATOM   4297 O  O     . GLY A 1 625 ? 89.658  88.287  75.292  1.00 29.99  ? 625  GLY A O     1 
ATOM   4298 N  N     . LEU A 1 626 ? 87.423  88.013  75.332  1.00 24.82  ? 626  LEU A N     1 
ATOM   4299 C  CA    . LEU A 1 626 ? 87.200  89.061  76.317  1.00 24.82  ? 626  LEU A CA    1 
ATOM   4300 C  C     . LEU A 1 626 ? 87.318  88.510  77.726  1.00 24.82  ? 626  LEU A C     1 
ATOM   4301 O  O     . LEU A 1 626 ? 88.097  89.016  78.538  1.00 24.82  ? 626  LEU A O     1 
ATOM   4302 C  CB    . LEU A 1 626 ? 85.820  89.681  76.106  1.00 24.82  ? 626  LEU A CB    1 
ATOM   4303 C  CG    . LEU A 1 626 ? 85.347  90.828  76.983  1.00 24.82  ? 626  LEU A CG    1 
ATOM   4304 C  CD1   . LEU A 1 626 ? 86.295  91.969  76.891  1.00 24.82  ? 626  LEU A CD1   1 
ATOM   4305 C  CD2   . LEU A 1 626 ? 83.992  91.256  76.499  1.00 24.82  ? 626  LEU A CD2   1 
ATOM   4306 N  N     . TRP A 1 627 ? 86.564  87.457  78.020  1.00 21.59  ? 627  TRP A N     1 
ATOM   4307 C  CA    . TRP A 1 627 ? 86.395  86.965  79.376  1.00 21.59  ? 627  TRP A CA    1 
ATOM   4308 C  C     . TRP A 1 627 ? 87.462  85.965  79.784  1.00 21.59  ? 627  TRP A C     1 
ATOM   4309 O  O     . TRP A 1 627 ? 87.435  85.485  80.917  1.00 21.59  ? 627  TRP A O     1 
ATOM   4310 C  CB    . TRP A 1 627 ? 85.003  86.355  79.527  1.00 21.59  ? 627  TRP A CB    1 
ATOM   4311 C  CG    . TRP A 1 627 ? 83.936  87.375  79.333  1.00 21.59  ? 627  TRP A CG    1 
ATOM   4312 C  CD1   . TRP A 1 627 ? 83.160  87.549  78.233  1.00 21.59  ? 627  TRP A CD1   1 
ATOM   4313 C  CD2   . TRP A 1 627 ? 83.567  88.406  80.250  1.00 21.59  ? 627  TRP A CD2   1 
ATOM   4314 N  NE1   . TRP A 1 627 ? 82.306  88.607  78.418  1.00 21.59  ? 627  TRP A NE1   1 
ATOM   4315 C  CE2   . TRP A 1 627 ? 82.540  89.151  79.651  1.00 21.59  ? 627  TRP A CE2   1 
ATOM   4316 C  CE3   . TRP A 1 627 ? 83.995  88.758  81.530  1.00 21.59  ? 627  TRP A CE3   1 
ATOM   4317 C  CZ2   . TRP A 1 627 ? 81.940  90.229  80.283  1.00 21.59  ? 627  TRP A CZ2   1 
ATOM   4318 C  CZ3   . TRP A 1 627 ? 83.399  89.826  82.154  1.00 21.59  ? 627  TRP A CZ3   1 
ATOM   4319 C  CH2   . TRP A 1 627 ? 82.383  90.551  81.532  1.00 21.59  ? 627  TRP A CH2   1 
ATOM   4320 N  N     . LYS A 1 628 ? 88.394  85.638  78.891  1.00 23.03  ? 628  LYS A N     1 
ATOM   4321 C  CA    . LYS A 1 628 ? 89.628  84.983  79.307  1.00 23.03  ? 628  LYS A CA    1 
ATOM   4322 C  C     . LYS A 1 628 ? 90.453  85.905  80.189  1.00 23.03  ? 628  LYS A C     1 
ATOM   4323 O  O     . LYS A 1 628 ? 91.158  85.445  81.092  1.00 23.03  ? 628  LYS A O     1 
ATOM   4324 C  CB    . LYS A 1 628 ? 90.424  84.562  78.072  1.00 23.03  ? 628  LYS A CB    1 
ATOM   4325 C  CG    . LYS A 1 628 ? 91.725  83.847  78.327  1.00 23.03  ? 628  LYS A CG    1 
ATOM   4326 C  CD    . LYS A 1 628 ? 92.304  83.343  77.023  1.00 23.03  ? 628  LYS A CD    1 
ATOM   4327 C  CE    . LYS A 1 628 ? 92.826  84.481  76.177  1.00 23.03  ? 628  LYS A CE    1 
ATOM   4328 N  NZ    . LYS A 1 628 ? 93.478  83.965  74.945  1.00 23.03  ? 628  LYS A NZ    1 
ATOM   4329 N  N     . ASN A 1 629 ? 90.356  87.208  79.948  1.00 20.23  ? 629  ASN A N     1 
ATOM   4330 C  CA    . ASN A 1 629 ? 91.110  88.207  80.679  1.00 20.23  ? 629  ASN A CA    1 
ATOM   4331 C  C     . ASN A 1 629 ? 90.517  88.500  82.045  1.00 20.23  ? 629  ASN A C     1 
ATOM   4332 O  O     . ASN A 1 629 ? 91.241  88.957  82.930  1.00 20.23  ? 629  ASN A O     1 
ATOM   4333 C  CB    . ASN A 1 629 ? 91.164  89.483  79.849  1.00 20.23  ? 629  ASN A CB    1 
ATOM   4334 C  CG    . ASN A 1 629 ? 91.863  89.282  78.527  1.00 20.23  ? 629  ASN A CG    1 
ATOM   4335 O  OD1   . ASN A 1 629 ? 92.932  88.686  78.455  1.00 20.23  ? 629  ASN A OD1   1 
ATOM   4336 N  ND2   . ASN A 1 629 ? 91.235  89.742  77.463  1.00 20.23  ? 629  ASN A ND2   1 
ATOM   4337 N  N     . HIS A 1 630 ? 89.222  88.258  82.236  1.00 19.18  ? 630  HIS A N     1 
ATOM   4338 C  CA    . HIS A 1 630 ? 88.582  88.485  83.522  1.00 19.18  ? 630  HIS A CA    1 
ATOM   4339 C  C     . HIS A 1 630 ? 88.612  87.267  84.427  1.00 19.18  ? 630  HIS A C     1 
ATOM   4340 O  O     . HIS A 1 630 ? 88.543  87.425  85.647  1.00 19.18  ? 630  HIS A O     1 
ATOM   4341 C  CB    . HIS A 1 630 ? 87.132  88.919  83.335  1.00 19.18  ? 630  HIS A CB    1 
ATOM   4342 C  CG    . HIS A 1 630 ? 86.976  90.245  82.665  1.00 19.18  ? 630  HIS A CG    1 
ATOM   4343 N  ND1   . HIS A 1 630 ? 86.850  90.378  81.301  1.00 19.18  ? 630  HIS A ND1   1 
ATOM   4344 C  CD2   . HIS A 1 630 ? 86.925  91.497  83.170  1.00 19.18  ? 630  HIS A CD2   1 
ATOM   4345 C  CE1   . HIS A 1 630 ? 86.724  91.655  80.994  1.00 19.18  ? 630  HIS A CE1   1 
ATOM   4346 N  NE2   . HIS A 1 630 ? 86.768  92.356  82.111  1.00 19.18  ? 630  HIS A NE2   1 
ATOM   4347 N  N     . VAL A 1 631 ? 88.692  86.057  83.871  1.00 16.38  ? 631  VAL A N     1 
ATOM   4348 C  CA    . VAL A 1 631 ? 88.887  84.892  84.723  1.00 16.38  ? 631  VAL A CA    1 
ATOM   4349 C  C     . VAL A 1 631 ? 90.347  84.738  85.110  1.00 16.38  ? 631  VAL A C     1 
ATOM   4350 O  O     . VAL A 1 631 ? 90.646  84.054  86.090  1.00 16.38  ? 631  VAL A O     1 
ATOM   4351 C  CB    . VAL A 1 631 ? 88.377  83.595  84.068  1.00 16.38  ? 631  VAL A CB    1 
ATOM   4352 C  CG1   . VAL A 1 631 ? 86.912  83.722  83.718  1.00 16.38  ? 631  VAL A CG1   1 
ATOM   4353 C  CG2   . VAL A 1 631 ? 89.187  83.225  82.853  1.00 16.38  ? 631  VAL A CG2   1 
ATOM   4354 N  N     . ALA A 1 632 ? 91.263  85.363  84.380  1.00 14.55  ? 632  ALA A N     1 
ATOM   4355 C  CA    . ALA A 1 632 ? 92.663  85.364  84.760  1.00 14.55  ? 632  ALA A CA    1 
ATOM   4356 C  C     . ALA A 1 632 ? 92.991  86.459  85.751  1.00 14.55  ? 632  ALA A C     1 
ATOM   4357 O  O     . ALA A 1 632 ? 93.977  86.338  86.473  1.00 14.55  ? 632  ALA A O     1 
ATOM   4358 C  CB    . ALA A 1 632 ? 93.552  85.516  83.531  1.00 14.55  ? 632  ALA A CB    1 
ATOM   4359 N  N     . LEU A 1 633 ? 92.200  87.529  85.787  1.00 14.51  ? 633  LEU A N     1 
ATOM   4360 C  CA    . LEU A 1 633 ? 92.297  88.503  86.865  1.00 14.51  ? 633  LEU A CA    1 
ATOM   4361 C  C     . LEU A 1 633 ? 91.579  88.031  88.116  1.00 14.51  ? 633  LEU A C     1 
ATOM   4362 O  O     . LEU A 1 633 ? 91.996  88.376  89.220  1.00 14.51  ? 633  LEU A O     1 
ATOM   4363 C  CB    . LEU A 1 633 ? 91.728  89.848  86.426  1.00 14.51  ? 633  LEU A CB    1 
ATOM   4364 C  CG    . LEU A 1 633 ? 92.527  90.676  85.429  1.00 14.51  ? 633  LEU A CG    1 
ATOM   4365 C  CD1   . LEU A 1 633 ? 91.669  91.801  84.934  1.00 14.51  ? 633  LEU A CD1   1 
ATOM   4366 C  CD2   . LEU A 1 633 ? 93.775  91.212  86.075  1.00 14.51  ? 633  LEU A CD2   1 
ATOM   4367 N  N     . ALA A 1 634 ? 90.506  87.250  87.968  1.00 13.74  ? 634  ALA A N     1 
ATOM   4368 C  CA    . ALA A 1 634 ? 89.834  86.682  89.131  1.00 13.74  ? 634  ALA A CA    1 
ATOM   4369 C  C     . ALA A 1 634 ? 90.667  85.595  89.790  1.00 13.74  ? 634  ALA A C     1 
ATOM   4370 O  O     . ALA A 1 634 ? 90.562  85.389  91.001  1.00 13.74  ? 634  ALA A O     1 
ATOM   4371 C  CB    . ALA A 1 634 ? 88.469  86.132  88.737  1.00 13.74  ? 634  ALA A CB    1 
ATOM   4372 N  N     . CYS A 1 635 ? 91.490  84.882  89.020  1.00 13.67  ? 635  CYS A N     1 
ATOM   4373 C  CA    . CYS A 1 635 ? 92.418  83.937  89.622  1.00 13.67  ? 635  CYS A CA    1 
ATOM   4374 C  C     . CYS A 1 635 ? 93.591  84.630  90.289  1.00 13.67  ? 635  CYS A C     1 
ATOM   4375 O  O     . CYS A 1 635 ? 94.197  84.055  91.191  1.00 13.67  ? 635  CYS A O     1 
ATOM   4376 C  CB    . CYS A 1 635 ? 92.926  82.940  88.583  1.00 13.67  ? 635  CYS A CB    1 
ATOM   4377 S  SG    . CYS A 1 635 ? 91.704  81.728  88.045  1.00 13.67  ? 635  CYS A SG    1 
ATOM   4378 N  N     . MET A 1 636 ? 93.931  85.844  89.879  1.00 13.12  ? 636  MET A N     1 
ATOM   4379 C  CA    . MET A 1 636 ? 94.958  86.600  90.575  1.00 13.12  ? 636  MET A CA    1 
ATOM   4380 C  C     . MET A 1 636 ? 94.412  87.361  91.771  1.00 13.12  ? 636  MET A C     1 
ATOM   4381 O  O     . MET A 1 636 ? 95.190  87.961  92.507  1.00 13.12  ? 636  MET A O     1 
ATOM   4382 C  CB    . MET A 1 636 ? 95.653  87.572  89.615  1.00 13.12  ? 636  MET A CB    1 
ATOM   4383 C  CG    . MET A 1 636 ? 96.425  86.874  88.510  1.00 13.12  ? 636  MET A CG    1 
ATOM   4384 S  SD    . MET A 1 636 ? 97.220  87.944  87.301  1.00 13.12  ? 636  MET A SD    1 
ATOM   4385 C  CE    . MET A 1 636 ? 98.660  88.461  88.215  1.00 13.12  ? 636  MET A CE    1 
ATOM   4386 N  N     . ILE A 1 637 ? 93.102  87.367  91.979  1.00 11.32  ? 637  ILE A N     1 
ATOM   4387 C  CA    . ILE A 1 637 ? 92.545  87.878  93.225  1.00 11.32  ? 637  ILE A CA    1 
ATOM   4388 C  C     . ILE A 1 637 ? 92.481  86.779  94.273  1.00 11.32  ? 637  ILE A C     1 
ATOM   4389 O  O     . ILE A 1 637 ? 92.843  86.997  95.427  1.00 11.32  ? 637  ILE A O     1 
ATOM   4390 C  CB    . ILE A 1 637 ? 91.160  88.502  92.966  1.00 11.32  ? 637  ILE A CB    1 
ATOM   4391 C  CG1   . ILE A 1 637 ? 91.290  89.725  92.073  1.00 11.32  ? 637  ILE A CG1   1 
ATOM   4392 C  CG2   . ILE A 1 637 ? 90.494  88.916  94.252  1.00 11.32  ? 637  ILE A CG2   1 
ATOM   4393 C  CD1   . ILE A 1 637 ? 90.000  90.170  91.482  1.00 11.32  ? 637  ILE A CD1   1 
ATOM   4394 N  N     . VAL A 1 638 ? 92.061  85.579  93.871  1.00 10.55  ? 638  VAL A N     1 
ATOM   4395 C  CA    . VAL A 1 638 ? 91.953  84.459  94.798  1.00 10.55  ? 638  VAL A CA    1 
ATOM   4396 C  C     . VAL A 1 638 ? 93.331  84.018  95.283  1.00 10.55  ? 638  VAL A C     1 
ATOM   4397 O  O     . VAL A 1 638 ? 93.515  83.715  96.465  1.00 10.55  ? 638  VAL A O     1 
ATOM   4398 C  CB    . VAL A 1 638 ? 91.173  83.311  94.130  1.00 10.55  ? 638  VAL A CB    1 
ATOM   4399 C  CG1   . VAL A 1 638 ? 91.121  82.085  95.011  1.00 10.55  ? 638  VAL A CG1   1 
ATOM   4400 C  CG2   . VAL A 1 638 ? 89.772  83.762  93.809  1.00 10.55  ? 638  VAL A CG2   1 
ATOM   4401 N  N     . ILE A 1 639 ? 94.328  84.017  94.398  1.00 9.68   ? 639  ILE A N     1 
ATOM   4402 C  CA    . ILE A 1 639 ? 95.669  83.592  94.792  1.00 9.68   ? 639  ILE A CA    1 
ATOM   4403 C  C     . ILE A 1 639 ? 96.348  84.653  95.650  1.00 9.68   ? 639  ILE A C     1 
ATOM   4404 O  O     . ILE A 1 639 ? 96.948  84.338  96.682  1.00 9.68   ? 639  ILE A O     1 
ATOM   4405 C  CB    . ILE A 1 639 ? 96.498  83.234  93.545  1.00 9.68   ? 639  ILE A CB    1 
ATOM   4406 C  CG1   . ILE A 1 639 ? 95.971  81.950  92.913  1.00 9.68   ? 639  ILE A CG1   1 
ATOM   4407 C  CG2   . ILE A 1 639 ? 97.959  83.069  93.875  1.00 9.68   ? 639  ILE A CG2   1 
ATOM   4408 C  CD1   . ILE A 1 639 ? 96.555  81.668  91.563  1.00 9.68   ? 639  ILE A CD1   1 
ATOM   4409 N  N     . PHE A 1 640 ? 96.251  85.923  95.262  1.00 9.62   ? 640  PHE A N     1 
ATOM   4410 C  CA    . PHE A 1 640 ? 96.936  86.966  96.015  1.00 9.62   ? 640  PHE A CA    1 
ATOM   4411 C  C     . PHE A 1 640 ? 96.250  87.294  97.331  1.00 9.62   ? 640  PHE A C     1 
ATOM   4412 O  O     . PHE A 1 640 ? 96.909  87.815  98.232  1.00 9.62   ? 640  PHE A O     1 
ATOM   4413 C  CB    . PHE A 1 640 ? 97.072  88.234  95.175  1.00 9.62   ? 640  PHE A CB    1 
ATOM   4414 C  CG    . PHE A 1 640 ? 98.117  88.151  94.097  1.00 9.62   ? 640  PHE A CG    1 
ATOM   4415 C  CD1   . PHE A 1 640 ? 99.134  87.224  94.166  1.00 9.62   ? 640  PHE A CD1   1 
ATOM   4416 C  CD2   . PHE A 1 640 ? 98.072  89.002  93.009  1.00 9.62   ? 640  PHE A CD2   1 
ATOM   4417 C  CE1   . PHE A 1 640 ? 100.082 87.150  93.180  1.00 9.62   ? 640  PHE A CE1   1 
ATOM   4418 C  CE2   . PHE A 1 640 ? 99.010  88.928  92.018  1.00 9.62   ? 640  PHE A CE2   1 
ATOM   4419 C  CZ    . PHE A 1 640 ? 100.018 88.003  92.104  1.00 9.62   ? 640  PHE A CZ    1 
ATOM   4420 N  N     . LEU A 1 641 ? 94.956  87.017  97.473  1.00 8.17   ? 641  LEU A N     1 
ATOM   4421 C  CA    . LEU A 1 641 ? 94.306  87.163  98.769  1.00 8.17   ? 641  LEU A CA    1 
ATOM   4422 C  C     . LEU A 1 641 ? 94.363  85.898  99.608  1.00 8.17   ? 641  LEU A C     1 
ATOM   4423 O  O     . LEU A 1 641 ? 93.934  85.924  100.763 1.00 8.17   ? 641  LEU A O     1 
ATOM   4424 C  CB    . LEU A 1 641 ? 92.842  87.576  98.621  1.00 8.17   ? 641  LEU A CB    1 
ATOM   4425 C  CG    . LEU A 1 641 ? 92.497  88.965  98.106  1.00 8.17   ? 641  LEU A CG    1 
ATOM   4426 C  CD1   . LEU A 1 641 ? 91.003  89.104  98.047  1.00 8.17   ? 641  LEU A CD1   1 
ATOM   4427 C  CD2   . LEU A 1 641 ? 93.104  90.021  98.987  1.00 8.17   ? 641  LEU A CD2   1 
ATOM   4428 N  N     . THR A 1 642 ? 94.848  84.791  99.057  1.00 7.77   ? 642  THR A N     1 
ATOM   4429 C  CA    . THR A 1 642 ? 95.168  83.624  99.863  1.00 7.77   ? 642  THR A CA    1 
ATOM   4430 C  C     . THR A 1 642 ? 96.573  83.734  100.433 1.00 7.77   ? 642  THR A C     1 
ATOM   4431 O  O     . THR A 1 642 ? 96.798  83.375  101.589 1.00 7.77   ? 642  THR A O     1 
ATOM   4432 C  CB    . THR A 1 642 ? 95.025  82.351  99.032  1.00 7.77   ? 642  THR A CB    1 
ATOM   4433 O  OG1   . THR A 1 642 ? 93.715  82.312  98.461  1.00 7.77   ? 642  THR A OG1   1 
ATOM   4434 C  CG2   . THR A 1 642 ? 95.192  81.126  99.889  1.00 7.77   ? 642  THR A CG2   1 
ATOM   4435 N  N     . ILE A 1 643 ? 97.513  84.251  99.642  1.00 7.28   ? 643  ILE A N     1 
ATOM   4436 C  CA    . ILE A 1 643 ? 98.848  84.563  100.145 1.00 7.28   ? 643  ILE A CA    1 
ATOM   4437 C  C     . ILE A 1 643 ? 98.771  85.633  101.226 1.00 7.28   ? 643  ILE A C     1 
ATOM   4438 O  O     . ILE A 1 643 ? 99.443  85.542  102.257 1.00 7.28   ? 643  ILE A O     1 
ATOM   4439 C  CB    . ILE A 1 643 ? 99.763  84.988  98.981  1.00 7.28   ? 643  ILE A CB    1 
ATOM   4440 C  CG1   . ILE A 1 643 ? 99.942  83.841  97.993  1.00 7.28   ? 643  ILE A CG1   1 
ATOM   4441 C  CG2   . ILE A 1 643 ? 101.116 85.450  99.472  1.00 7.28   ? 643  ILE A CG2   1 
ATOM   4442 C  CD1   . ILE A 1 643 ? 100.614 84.252  96.713  1.00 7.28   ? 643  ILE A CD1   1 
ATOM   4443 N  N     . ALA A 1 644 ? 97.915  86.639  101.028 1.00 7.92   ? 644  ALA A N     1 
ATOM   4444 C  CA    . ALA A 1 644 ? 97.781  87.718  102.000 1.00 7.92   ? 644  ALA A CA    1 
ATOM   4445 C  C     . ALA A 1 644 ? 97.085  87.258  103.266 1.00 7.92   ? 644  ALA A C     1 
ATOM   4446 O  O     . ALA A 1 644 ? 97.341  87.806  104.340 1.00 7.92   ? 644  ALA A O     1 
ATOM   4447 C  CB    . ALA A 1 644 ? 97.017  88.886  101.389 1.00 7.92   ? 644  ALA A CB    1 
ATOM   4448 N  N     . TYR A 1 645 ? 96.203  86.267  103.161 1.00 7.56   ? 645  TYR A N     1 
ATOM   4449 C  CA    . TYR A 1 645 ? 95.574  85.694  104.345 1.00 7.56   ? 645  TYR A CA    1 
ATOM   4450 C  C     . TYR A 1 645 ? 96.562  84.861  105.147 1.00 7.56   ? 645  TYR A C     1 
ATOM   4451 O  O     . TYR A 1 645 ? 96.644  84.989  106.373 1.00 7.56   ? 645  TYR A O     1 
ATOM   4452 C  CB    . TYR A 1 645 ? 94.374  84.846  103.938 1.00 7.56   ? 645  TYR A CB    1 
ATOM   4453 C  CG    . TYR A 1 645 ? 93.779  84.079  105.085 1.00 7.56   ? 645  TYR A CG    1 
ATOM   4454 C  CD1   . TYR A 1 645 ? 93.062  84.725  106.072 1.00 7.56   ? 645  TYR A CD1   1 
ATOM   4455 C  CD2   . TYR A 1 645 ? 93.933  82.703  105.180 1.00 7.56   ? 645  TYR A CD2   1 
ATOM   4456 C  CE1   . TYR A 1 645 ? 92.524  84.033  107.118 1.00 7.56   ? 645  TYR A CE1   1 
ATOM   4457 C  CE2   . TYR A 1 645 ? 93.396  82.002  106.230 1.00 7.56   ? 645  TYR A CE2   1 
ATOM   4458 C  CZ    . TYR A 1 645 ? 92.690  82.674  107.194 1.00 7.56   ? 645  TYR A CZ    1 
ATOM   4459 O  OH    . TYR A 1 645 ? 92.144  81.982  108.243 1.00 7.56   ? 645  TYR A OH    1 
ATOM   4460 N  N     . LEU A 1 646 ? 97.315  83.991  104.470 1.00 7.64   ? 646  LEU A N     1 
ATOM   4461 C  CA    . LEU A 1 646 ? 98.239  83.094  105.149 1.00 7.64   ? 646  LEU A CA    1 
ATOM   4462 C  C     . LEU A 1 646 ? 99.435  83.825  105.739 1.00 7.64   ? 646  LEU A C     1 
ATOM   4463 O  O     . LEU A 1 646 ? 100.054 83.310  106.673 1.00 7.64   ? 646  LEU A O     1 
ATOM   4464 C  CB    . LEU A 1 646 ? 98.720  82.014  104.184 1.00 7.64   ? 646  LEU A CB    1 
ATOM   4465 C  CG    . LEU A 1 646 ? 97.693  81.021  103.643 1.00 7.64   ? 646  LEU A CG    1 
ATOM   4466 C  CD1   . LEU A 1 646 ? 98.333  80.142  102.596 1.00 7.64   ? 646  LEU A CD1   1 
ATOM   4467 C  CD2   . LEU A 1 646 ? 97.086  80.189  104.742 1.00 7.64   ? 646  LEU A CD2   1 
ATOM   4468 N  N     . LYS A 1 647 ? 99.781  85.001  105.225 1.00 8.11   ? 647  LYS A N     1 
ATOM   4469 C  CA    . LYS A 1 647 ? 100.841 85.789  105.836 1.00 8.11   ? 647  LYS A CA    1 
ATOM   4470 C  C     . LYS A 1 647 ? 100.387 86.502  107.096 1.00 8.11   ? 647  LYS A C     1 
ATOM   4471 O  O     . LYS A 1 647 ? 101.230 86.866  107.918 1.00 8.11   ? 647  LYS A O     1 
ATOM   4472 C  CB    . LYS A 1 647 ? 101.394 86.812  104.847 1.00 8.11   ? 647  LYS A CB    1 
ATOM   4473 C  CG    . LYS A 1 647 ? 102.256 86.222  103.768 1.00 8.11   ? 647  LYS A CG    1 
ATOM   4474 C  CD    . LYS A 1 647 ? 102.669 87.278  102.799 1.00 8.11   ? 647  LYS A CD    1 
ATOM   4475 C  CE    . LYS A 1 647 ? 103.665 88.210  103.430 1.00 8.11   ? 647  LYS A CE    1 
ATOM   4476 N  NZ    . LYS A 1 647 ? 104.191 89.217  102.479 1.00 8.11   ? 647  LYS A NZ    1 
ATOM   4477 N  N     . LEU A 1 648 ? 99.084  86.735  107.249 1.00 7.71   ? 648  LEU A N     1 
ATOM   4478 C  CA    . LEU A 1 648 ? 98.538  87.195  108.519 1.00 7.71   ? 648  LEU A CA    1 
ATOM   4479 C  C     . LEU A 1 648 ? 98.294  86.037  109.467 1.00 7.71   ? 648  LEU A C     1 
ATOM   4480 O  O     . LEU A 1 648 ? 98.434  86.195  110.682 1.00 7.71   ? 648  LEU A O     1 
ATOM   4481 C  CB    . LEU A 1 648 ? 97.226  87.940  108.300 1.00 7.71   ? 648  LEU A CB    1 
ATOM   4482 C  CG    . LEU A 1 648 ? 97.218  89.266  107.555 1.00 7.71   ? 648  LEU A CG    1 
ATOM   4483 C  CD1   . LEU A 1 648 ? 95.792  89.649  107.303 1.00 7.71   ? 648  LEU A CD1   1 
ATOM   4484 C  CD2   . LEU A 1 648 ? 97.911  90.323  108.372 1.00 7.71   ? 648  LEU A CD2   1 
ATOM   4485 N  N     . LEU A 1 649 ? 97.934  84.874  108.928 1.00 8.41   ? 649  LEU A N     1 
ATOM   4486 C  CA    . LEU A 1 649 ? 97.664  83.707  109.757 1.00 8.41   ? 649  LEU A CA    1 
ATOM   4487 C  C     . LEU A 1 649 ? 98.945  83.137  110.354 1.00 8.41   ? 649  LEU A C     1 
ATOM   4488 O  O     . LEU A 1 649 ? 99.024  82.904  111.564 1.00 8.41   ? 649  LEU A O     1 
ATOM   4489 C  CB    . LEU A 1 649 ? 96.942  82.648  108.933 1.00 8.41   ? 649  LEU A CB    1 
ATOM   4490 C  CG    . LEU A 1 649 ? 96.549  81.371  109.653 1.00 8.41   ? 649  LEU A CG    1 
ATOM   4491 C  CD1   . LEU A 1 649 ? 95.553  81.682  110.733 1.00 8.41   ? 649  LEU A CD1   1 
ATOM   4492 C  CD2   . LEU A 1 649 ? 95.974  80.390  108.668 1.00 8.41   ? 649  LEU A CD2   1 
ATOM   4493 N  N     . PHE A 1 650 ? 99.960  82.902  109.524 1.00 8.76   ? 650  PHE A N     1 
ATOM   4494 C  CA    . PHE A 1 650 ? 101.209 82.319  109.990 1.00 8.76   ? 650  PHE A CA    1 
ATOM   4495 C  C     . PHE A 1 650 ? 102.216 83.363  110.437 1.00 8.76   ? 650  PHE A C     1 
ATOM   4496 O  O     . PHE A 1 650 ? 103.406 83.054  110.544 1.00 8.76   ? 650  PHE A O     1 
ATOM   4497 C  CB    . PHE A 1 650 ? 101.822 81.426  108.911 1.00 8.76   ? 650  PHE A CB    1 
ATOM   4498 C  CG    . PHE A 1 650 ? 100.998 80.221  108.596 1.00 8.76   ? 650  PHE A CG    1 
ATOM   4499 C  CD1   . PHE A 1 650 ? 100.915 79.176  109.493 1.00 8.76   ? 650  PHE A CD1   1 
ATOM   4500 C  CD2   . PHE A 1 650 ? 100.322 80.123  107.399 1.00 8.76   ? 650  PHE A CD2   1 
ATOM   4501 C  CE1   . PHE A 1 650 ? 100.154 78.067  109.211 1.00 8.76   ? 650  PHE A CE1   1 
ATOM   4502 C  CE2   . PHE A 1 650 ? 99.566  79.013  107.111 1.00 8.76   ? 650  PHE A CE2   1 
ATOM   4503 C  CZ    . PHE A 1 650 ? 99.482  77.986  108.018 1.00 8.76   ? 650  PHE A CZ    1 
ATOM   4504 N  N     . LEU A 1 651 ? 101.771 84.588  110.683 1.00 9.72   ? 651  LEU A N     1 
ATOM   4505 C  CA    . LEU A 1 651 ? 102.606 85.589  111.321 1.00 9.72   ? 651  LEU A CA    1 
ATOM   4506 C  C     . LEU A 1 651 ? 102.885 85.172  112.757 1.00 9.72   ? 651  LEU A C     1 
ATOM   4507 O  O     . LEU A 1 651 ? 102.056 84.536  113.408 1.00 9.72   ? 651  LEU A O     1 
ATOM   4508 C  CB    . LEU A 1 651 ? 101.907 86.947  111.280 1.00 9.72   ? 651  LEU A CB    1 
ATOM   4509 C  CG    . LEU A 1 651 ? 102.594 88.205  111.792 1.00 9.72   ? 651  LEU A CG    1 
ATOM   4510 C  CD1   . LEU A 1 651 ? 103.836 88.471  110.999 1.00 9.72   ? 651  LEU A CD1   1 
ATOM   4511 C  CD2   . LEU A 1 651 ? 101.652 89.370  111.685 1.00 9.72   ? 651  LEU A CD2   1 
ATOM   4512 N  N     . LYS A 1 652 ? 104.074 85.503  113.247 1.00 11.79  ? 652  LYS A N     1 
ATOM   4513 C  CA    . LYS A 1 652 ? 104.442 85.191  114.622 1.00 11.79  ? 652  LYS A CA    1 
ATOM   4514 C  C     . LYS A 1 652 ? 103.958 86.320  115.519 1.00 11.79  ? 652  LYS A C     1 
ATOM   4515 O  O     . LYS A 1 652 ? 104.496 87.430  115.478 1.00 11.79  ? 652  LYS A O     1 
ATOM   4516 C  CB    . LYS A 1 652 ? 105.946 84.981  114.751 1.00 11.79  ? 652  LYS A CB    1 
ATOM   4517 C  CG    . LYS A 1 652 ? 106.428 83.699  114.101 1.00 11.79  ? 652  LYS A CG    1 
ATOM   4518 C  CD    . LYS A 1 652 ? 107.920 83.511  114.266 1.00 11.79  ? 652  LYS A CD    1 
ATOM   4519 C  CE    . LYS A 1 652 ? 108.386 82.233  113.589 1.00 11.79  ? 652  LYS A CE    1 
ATOM   4520 N  NZ    . LYS A 1 652 ? 109.856 82.037  113.707 1.00 11.79  ? 652  LYS A NZ    1 
ATOM   4521 N  N     . LYS A 1 653 ? 102.941 86.036  116.326 1.00 11.41  ? 653  LYS A N     1 
ATOM   4522 C  CA    . LYS A 1 653 ? 102.317 87.040  117.171 1.00 11.41  ? 653  LYS A CA    1 
ATOM   4523 C  C     . LYS A 1 653 ? 102.947 87.144  118.551 1.00 11.41  ? 653  LYS A C     1 
ATOM   4524 O  O     . LYS A 1 653 ? 102.535 88.003  119.334 1.00 11.41  ? 653  LYS A O     1 
ATOM   4525 C  CB    . LYS A 1 653 ? 100.828 86.746  117.350 1.00 11.41  ? 653  LYS A CB    1 
ATOM   4526 C  CG    . LYS A 1 653 ? 99.898  87.177  116.230 1.00 11.41  ? 653  LYS A CG    1 
ATOM   4527 C  CD    . LYS A 1 653 ? 99.768  86.130  115.161 1.00 11.41  ? 653  LYS A CD    1 
ATOM   4528 C  CE    . LYS A 1 653 ? 98.678  86.487  114.193 1.00 11.41  ? 653  LYS A CE    1 
ATOM   4529 N  NZ    . LYS A 1 653 ? 98.543  85.453  113.145 1.00 11.41  ? 653  LYS A NZ    1 
ATOM   4530 N  N     . TYR A 1 654 ? 103.922 86.303  118.870 1.00 16.34  ? 654  TYR A N     1 
ATOM   4531 C  CA    . TYR A 1 654 ? 104.458 86.242  120.222 1.00 16.34  ? 654  TYR A CA    1 
ATOM   4532 C  C     . TYR A 1 654 ? 105.291 87.470  120.572 1.00 16.34  ? 654  TYR A C     1 
ATOM   4533 O  O     . TYR A 1 654 ? 105.712 88.217  119.693 1.00 16.34  ? 654  TYR A O     1 
ATOM   4534 C  CB    . TYR A 1 654 ? 105.306 84.990  120.402 1.00 16.34  ? 654  TYR A CB    1 
ATOM   4535 C  CG    . TYR A 1 654 ? 104.561 83.693  120.237 1.00 16.34  ? 654  TYR A CG    1 
ATOM   4536 C  CD1   . TYR A 1 654 ? 103.614 83.294  121.169 1.00 16.34  ? 654  TYR A CD1   1 
ATOM   4537 C  CD2   . TYR A 1 654 ? 104.854 82.833  119.189 1.00 16.34  ? 654  TYR A CD2   1 
ATOM   4538 C  CE1   . TYR A 1 654 ? 102.943 82.100  121.037 1.00 16.34  ? 654  TYR A CE1   1 
ATOM   4539 C  CE2   . TYR A 1 654 ? 104.194 81.630  119.049 1.00 16.34  ? 654  TYR A CE2   1 
ATOM   4540 C  CZ    . TYR A 1 654 ? 103.239 81.270  119.978 1.00 16.34  ? 654  TYR A CZ    1 
ATOM   4541 O  OH    . TYR A 1 654 ? 102.574 80.073  119.845 1.00 16.34  ? 654  TYR A OH    1 
ATOM   4542 N  N     . GLY B 1 34  ? 120.338 130.106 141.231 1.00 21.31  ? 34   GLY B N     1 
ATOM   4543 C  CA    . GLY B 1 34  ? 119.348 129.173 140.731 1.00 21.31  ? 34   GLY B CA    1 
ATOM   4544 C  C     . GLY B 1 34  ? 118.258 129.856 139.937 1.00 21.31  ? 34   GLY B C     1 
ATOM   4545 O  O     . GLY B 1 34  ? 118.148 131.077 139.952 1.00 21.31  ? 34   GLY B O     1 
ATOM   4546 N  N     . ALA B 1 35  ? 117.449 129.067 139.239 1.00 19.55  ? 35   ALA B N     1 
ATOM   4547 C  CA    . ALA B 1 35  ? 116.370 129.586 138.413 1.00 19.55  ? 35   ALA B CA    1 
ATOM   4548 C  C     . ALA B 1 35  ? 115.058 129.512 139.176 1.00 19.55  ? 35   ALA B C     1 
ATOM   4549 O  O     . ALA B 1 35  ? 114.701 128.456 139.704 1.00 19.55  ? 35   ALA B O     1 
ATOM   4550 C  CB    . ALA B 1 35  ? 116.262 128.807 137.104 1.00 19.55  ? 35   ALA B CB    1 
ATOM   4551 N  N     . VAL B 1 36  ? 114.351 130.630 139.237 1.00 17.92  ? 36   VAL B N     1 
ATOM   4552 C  CA    . VAL B 1 36  ? 113.074 130.722 139.924 1.00 17.92  ? 36   VAL B CA    1 
ATOM   4553 C  C     . VAL B 1 36  ? 112.010 130.794 138.841 1.00 17.92  ? 36   VAL B C     1 
ATOM   4554 O  O     . VAL B 1 36  ? 111.745 131.863 138.285 1.00 17.92  ? 36   VAL B O     1 
ATOM   4555 C  CB    . VAL B 1 36  ? 113.008 131.935 140.857 1.00 17.92  ? 36   VAL B CB    1 
ATOM   4556 C  CG1   . VAL B 1 36  ? 111.671 131.989 141.562 1.00 17.92  ? 36   VAL B CG1   1 
ATOM   4557 C  CG2   . VAL B 1 36  ? 114.140 131.902 141.859 1.00 17.92  ? 36   VAL B CG2   1 
ATOM   4558 N  N     . LEU B 1 37  ? 111.410 129.656 138.518 1.00 17.38  ? 37   LEU B N     1 
ATOM   4559 C  CA    . LEU B 1 37  ? 110.326 129.623 137.548 1.00 17.38  ? 37   LEU B CA    1 
ATOM   4560 C  C     . LEU B 1 37  ? 109.025 129.956 138.261 1.00 17.38  ? 37   LEU B C     1 
ATOM   4561 O  O     . LEU B 1 37  ? 108.667 129.304 139.244 1.00 17.38  ? 37   LEU B O     1 
ATOM   4562 C  CB    . LEU B 1 37  ? 110.264 128.255 136.871 1.00 17.38  ? 37   LEU B CB    1 
ATOM   4563 C  CG    . LEU B 1 37  ? 109.334 128.031 135.678 1.00 17.38  ? 37   LEU B CG    1 
ATOM   4564 C  CD1   . LEU B 1 37  ? 109.961 127.064 134.716 1.00 17.38  ? 37   LEU B CD1   1 
ATOM   4565 C  CD2   . LEU B 1 37  ? 108.020 127.470 136.121 1.00 17.38  ? 37   LEU B CD2   1 
ATOM   4566 N  N     . SER B 1 38  ? 108.317 130.963 137.764 1.00 19.23  ? 38   SER B N     1 
ATOM   4567 C  CA    . SER B 1 38  ? 107.077 131.426 138.368 1.00 19.23  ? 38   SER B CA    1 
ATOM   4568 C  C     . SER B 1 38  ? 106.007 131.516 137.297 1.00 19.23  ? 38   SER B C     1 
ATOM   4569 O  O     . SER B 1 38  ? 106.260 132.027 136.205 1.00 19.23  ? 38   SER B O     1 
ATOM   4570 C  CB    . SER B 1 38  ? 107.271 132.781 139.043 1.00 19.23  ? 38   SER B CB    1 
ATOM   4571 O  OG    . SER B 1 38  ? 107.610 133.770 138.096 1.00 19.23  ? 38   SER B OG    1 
ATOM   4572 N  N     . PHE B 1 39  ? 104.820 131.020 137.608 1.00 19.87  ? 39   PHE B N     1 
ATOM   4573 C  CA    . PHE B 1 39  ? 103.715 130.979 136.666 1.00 19.87  ? 39   PHE B CA    1 
ATOM   4574 C  C     . PHE B 1 39  ? 102.494 131.619 137.305 1.00 19.87  ? 39   PHE B C     1 
ATOM   4575 O  O     . PHE B 1 39  ? 102.197 131.380 138.476 1.00 19.87  ? 39   PHE B O     1 
ATOM   4576 C  CB    . PHE B 1 39  ? 103.436 129.540 136.200 1.00 19.87  ? 39   PHE B CB    1 
ATOM   4577 C  CG    . PHE B 1 39  ? 103.189 128.558 137.313 1.00 19.87  ? 39   PHE B CG    1 
ATOM   4578 C  CD1   . PHE B 1 39  ? 104.240 127.893 137.927 1.00 19.87  ? 39   PHE B CD1   1 
ATOM   4579 C  CD2   . PHE B 1 39  ? 101.909 128.248 137.705 1.00 19.87  ? 39   PHE B CD2   1 
ATOM   4580 C  CE1   . PHE B 1 39  ? 104.009 126.987 138.937 1.00 19.87  ? 39   PHE B CE1   1 
ATOM   4581 C  CE2   . PHE B 1 39  ? 101.689 127.338 138.710 1.00 19.87  ? 39   PHE B CE2   1 
ATOM   4582 C  CZ    . PHE B 1 39  ? 102.734 126.709 139.318 1.00 19.87  ? 39   PHE B CZ    1 
ATOM   4583 N  N     . HIS B 1 40  ? 101.794 132.442 136.527 1.00 24.47  ? 40   HIS B N     1 
ATOM   4584 C  CA    . HIS B 1 40  ? 100.860 133.423 137.062 1.00 24.47  ? 40   HIS B CA    1 
ATOM   4585 C  C     . HIS B 1 40  ? 99.612  133.451 136.197 1.00 24.47  ? 40   HIS B C     1 
ATOM   4586 O  O     . HIS B 1 40  ? 99.705  133.743 135.002 1.00 24.47  ? 40   HIS B O     1 
ATOM   4587 C  CB    . HIS B 1 40  ? 101.522 134.802 137.095 1.00 24.47  ? 40   HIS B CB    1 
ATOM   4588 C  CG    . HIS B 1 40  ? 100.733 135.844 137.820 1.00 24.47  ? 40   HIS B CG    1 
ATOM   4589 N  ND1   . HIS B 1 40  ? 100.984 137.191 137.682 1.00 24.47  ? 40   HIS B ND1   1 
ATOM   4590 C  CD2   . HIS B 1 40  ? 99.717  135.739 138.707 1.00 24.47  ? 40   HIS B CD2   1 
ATOM   4591 C  CE1   . HIS B 1 40  ? 100.146 137.872 138.441 1.00 24.47  ? 40   HIS B CE1   1 
ATOM   4592 N  NE2   . HIS B 1 40  ? 99.367  137.015 139.074 1.00 24.47  ? 40   HIS B NE2   1 
ATOM   4593 N  N     . ASN B 1 41  ? 98.456  133.165 136.812 1.00 22.47  ? 41   ASN B N     1 
ATOM   4594 C  CA    . ASN B 1 41  ? 97.135  133.164 136.163 1.00 22.47  ? 41   ASN B CA    1 
ATOM   4595 C  C     . ASN B 1 41  ? 97.082  132.222 134.968 1.00 22.47  ? 41   ASN B C     1 
ATOM   4596 O  O     . ASN B 1 41  ? 96.509  132.546 133.929 1.00 22.47  ? 41   ASN B O     1 
ATOM   4597 C  CB    . ASN B 1 41  ? 96.696  134.571 135.756 1.00 22.47  ? 41   ASN B CB    1 
ATOM   4598 C  CG    . ASN B 1 41  ? 96.399  135.453 136.941 1.00 22.47  ? 41   ASN B CG    1 
ATOM   4599 O  OD1   . ASN B 1 41  ? 97.078  136.450 137.174 1.00 22.47  ? 41   ASN B OD1   1 
ATOM   4600 N  ND2   . ASN B 1 41  ? 95.373  135.094 137.698 1.00 22.47  ? 41   ASN B ND2   1 
ATOM   4601 N  N     . ILE B 1 42  ? 97.675  131.042 135.119 1.00 20.78  ? 42   ILE B N     1 
ATOM   4602 C  CA    . ILE B 1 42  ? 97.722  130.075 134.031 1.00 20.78  ? 42   ILE B CA    1 
ATOM   4603 C  C     . ILE B 1 42  ? 96.339  129.475 133.835 1.00 20.78  ? 42   ILE B C     1 
ATOM   4604 O  O     . ILE B 1 42  ? 95.747  128.931 134.769 1.00 20.78  ? 42   ILE B O     1 
ATOM   4605 C  CB    . ILE B 1 42  ? 98.755  128.981 134.318 1.00 20.78  ? 42   ILE B CB    1 
ATOM   4606 C  CG1   . ILE B 1 42  ? 100.146 129.585 134.461 1.00 20.78  ? 42   ILE B CG1   1 
ATOM   4607 C  CG2   . ILE B 1 42  ? 98.732  127.933 133.232 1.00 20.78  ? 42   ILE B CG2   1 
ATOM   4608 C  CD1   . ILE B 1 42  ? 100.628 130.286 133.227 1.00 20.78  ? 42   ILE B CD1   1 
ATOM   4609 N  N     . CYS B 1 43  ? 95.814  129.586 132.623 1.00 20.94  ? 43   CYS B N     1 
ATOM   4610 C  CA    . CYS B 1 43  ? 94.629  128.854 132.217 1.00 20.94  ? 43   CYS B CA    1 
ATOM   4611 C  C     . CYS B 1 43  ? 94.950  128.110 130.932 1.00 20.94  ? 43   CYS B C     1 
ATOM   4612 O  O     . CYS B 1 43  ? 95.937  128.404 130.259 1.00 20.94  ? 43   CYS B O     1 
ATOM   4613 C  CB    . CYS B 1 43  ? 93.422  129.770 132.005 1.00 20.94  ? 43   CYS B CB    1 
ATOM   4614 S  SG    . CYS B 1 43  ? 92.857  130.641 133.467 1.00 20.94  ? 43   CYS B SG    1 
ATOM   4615 N  N     . TYR B 1 44  ? 94.116  127.135 130.593 1.00 19.76  ? 44   TYR B N     1 
ATOM   4616 C  CA    . TYR B 1 44  ? 94.312  126.416 129.348 1.00 19.76  ? 44   TYR B CA    1 
ATOM   4617 C  C     . TYR B 1 44  ? 92.949  125.989 128.822 1.00 19.76  ? 44   TYR B C     1 
ATOM   4618 O  O     . TYR B 1 44  ? 91.966  125.959 129.559 1.00 19.76  ? 44   TYR B O     1 
ATOM   4619 C  CB    . TYR B 1 44  ? 95.284  125.245 129.544 1.00 19.76  ? 44   TYR B CB    1 
ATOM   4620 C  CG    . TYR B 1 44  ? 95.670  124.564 128.262 1.00 19.76  ? 44   TYR B CG    1 
ATOM   4621 C  CD1   . TYR B 1 44  ? 96.368  125.250 127.283 1.00 19.76  ? 44   TYR B CD1   1 
ATOM   4622 C  CD2   . TYR B 1 44  ? 95.367  123.235 128.043 1.00 19.76  ? 44   TYR B CD2   1 
ATOM   4623 C  CE1   . TYR B 1 44  ? 96.716  124.646 126.104 1.00 19.76  ? 44   TYR B CE1   1 
ATOM   4624 C  CE2   . TYR B 1 44  ? 95.716  122.620 126.874 1.00 19.76  ? 44   TYR B CE2   1 
ATOM   4625 C  CZ    . TYR B 1 44  ? 96.383  123.329 125.902 1.00 19.76  ? 44   TYR B CZ    1 
ATOM   4626 O  OH    . TYR B 1 44  ? 96.737  122.705 124.731 1.00 19.76  ? 44   TYR B OH    1 
ATOM   4627 N  N     . ARG B 1 45  ? 92.872  125.758 127.514 1.00 25.14  ? 45   ARG B N     1 
ATOM   4628 C  CA    . ARG B 1 45  ? 91.650  125.298 126.870 1.00 25.14  ? 45   ARG B CA    1 
ATOM   4629 C  C     . ARG B 1 45  ? 92.008  124.334 125.753 1.00 25.14  ? 45   ARG B C     1 
ATOM   4630 O  O     . ARG B 1 45  ? 93.070  124.438 125.137 1.00 25.14  ? 45   ARG B O     1 
ATOM   4631 C  CB    . ARG B 1 45  ? 90.814  126.447 126.286 1.00 25.14  ? 45   ARG B CB    1 
ATOM   4632 C  CG    . ARG B 1 45  ? 90.105  127.337 127.293 1.00 25.14  ? 45   ARG B CG    1 
ATOM   4633 C  CD    . ARG B 1 45  ? 89.351  128.438 126.592 1.00 25.14  ? 45   ARG B CD    1 
ATOM   4634 N  NE    . ARG B 1 45  ? 90.265  129.335 125.897 1.00 25.14  ? 45   ARG B NE    1 
ATOM   4635 C  CZ    . ARG B 1 45  ? 89.880  130.309 125.080 1.00 25.14  ? 45   ARG B CZ    1 
ATOM   4636 N  NH1   . ARG B 1 45  ? 88.589  130.516 124.856 1.00 25.14  ? 45   ARG B NH1   1 
ATOM   4637 N  NH2   . ARG B 1 45  ? 90.787  131.075 124.489 1.00 25.14  ? 45   ARG B NH2   1 
ATOM   4638 N  N     . VAL B 1 46  ? 91.104  123.396 125.495 1.00 27.51  ? 46   VAL B N     1 
ATOM   4639 C  CA    . VAL B 1 46  ? 91.271  122.390 124.455 1.00 27.51  ? 46   VAL B CA    1 
ATOM   4640 C  C     . VAL B 1 46  ? 90.016  122.384 123.603 1.00 27.51  ? 46   VAL B C     1 
ATOM   4641 O  O     . VAL B 1 46  ? 88.914  122.175 124.122 1.00 27.51  ? 46   VAL B O     1 
ATOM   4642 C  CB    . VAL B 1 46  ? 91.532  120.993 125.041 1.00 27.51  ? 46   VAL B CB    1 
ATOM   4643 C  CG1   . VAL B 1 46  ? 91.351  119.931 123.990 1.00 27.51  ? 46   VAL B CG1   1 
ATOM   4644 C  CG2   . VAL B 1 46  ? 92.927  120.916 125.560 1.00 27.51  ? 46   VAL B CG2   1 
ATOM   4645 N  N     . LYS B 1 47  ? 90.179  122.612 122.303 1.00 36.67  ? 47   LYS B N     1 
ATOM   4646 C  CA    . LYS B 1 47  ? 89.073  122.519 121.359 1.00 36.67  ? 47   LYS B CA    1 
ATOM   4647 C  C     . LYS B 1 47  ? 88.910  121.065 120.937 1.00 36.67  ? 47   LYS B C     1 
ATOM   4648 O  O     . LYS B 1 47  ? 89.791  120.497 120.285 1.00 36.67  ? 47   LYS B O     1 
ATOM   4649 C  CB    . LYS B 1 47  ? 89.328  123.418 120.155 1.00 36.67  ? 47   LYS B CB    1 
ATOM   4650 C  CG    . LYS B 1 47  ? 89.360  124.887 120.495 1.00 36.67  ? 47   LYS B CG    1 
ATOM   4651 C  CD    . LYS B 1 47  ? 89.590  125.731 119.263 1.00 36.67  ? 47   LYS B CD    1 
ATOM   4652 C  CE    . LYS B 1 47  ? 89.554  127.207 119.602 1.00 36.67  ? 47   LYS B CE    1 
ATOM   4653 N  NZ    . LYS B 1 47  ? 90.695  127.597 120.474 1.00 36.67  ? 47   LYS B NZ    1 
ATOM   4654 N  N     . LEU B 1 48  ? 87.789  120.462 121.311 1.00 38.38  ? 48   LEU B N     1 
ATOM   4655 C  CA    . LEU B 1 48  ? 87.493  119.091 120.920 1.00 38.38  ? 48   LEU B CA    1 
ATOM   4656 C  C     . LEU B 1 48  ? 86.637  119.046 119.657 1.00 38.38  ? 48   LEU B C     1 
ATOM   4657 O  O     . LEU B 1 48  ? 87.047  118.501 118.633 1.00 38.38  ? 48   LEU B O     1 
ATOM   4658 C  CB    . LEU B 1 48  ? 86.789  118.353 122.057 1.00 38.38  ? 48   LEU B CB    1 
ATOM   4659 C  CG    . LEU B 1 48  ? 87.647  118.102 123.294 1.00 38.38  ? 48   LEU B CG    1 
ATOM   4660 C  CD1   . LEU B 1 48  ? 86.834  117.451 124.401 1.00 38.38  ? 48   LEU B CD1   1 
ATOM   4661 C  CD2   . LEU B 1 48  ? 88.832  117.241 122.924 1.00 38.38  ? 48   LEU B CD2   1 
ATOM   4662 N  N     . PRO B 1 58  ? 85.519  124.597 117.768 1.00 42.76  ? 58   PRO B N     1 
ATOM   4663 C  CA    . PRO B 1 58  ? 84.438  123.715 118.217 1.00 42.76  ? 58   PRO B CA    1 
ATOM   4664 C  C     . PRO B 1 58  ? 84.130  123.853 119.702 1.00 42.76  ? 58   PRO B C     1 
ATOM   4665 O  O     . PRO B 1 58  ? 84.030  124.968 120.211 1.00 42.76  ? 58   PRO B O     1 
ATOM   4666 C  CB    . PRO B 1 58  ? 84.977  122.316 117.904 1.00 42.76  ? 58   PRO B CB    1 
ATOM   4667 C  CG    . PRO B 1 58  ? 86.446  122.467 117.912 1.00 42.76  ? 58   PRO B CG    1 
ATOM   4668 C  CD    . PRO B 1 58  ? 86.718  123.841 117.371 1.00 42.76  ? 58   PRO B CD    1 
ATOM   4669 N  N     . VAL B 1 59  ? 83.982  122.721 120.381 1.00 40.92  ? 59   VAL B N     1 
ATOM   4670 C  CA    . VAL B 1 59  ? 83.631  122.694 121.796 1.00 40.92  ? 59   VAL B CA    1 
ATOM   4671 C  C     . VAL B 1 59  ? 84.912  122.785 122.613 1.00 40.92  ? 59   VAL B C     1 
ATOM   4672 O  O     . VAL B 1 59  ? 85.780  121.912 122.521 1.00 40.92  ? 59   VAL B O     1 
ATOM   4673 C  CB    . VAL B 1 59  ? 82.846  121.423 122.145 1.00 40.92  ? 59   VAL B CB    1 
ATOM   4674 C  CG1   . VAL B 1 59  ? 82.537  121.382 123.630 1.00 40.92  ? 59   VAL B CG1   1 
ATOM   4675 C  CG2   . VAL B 1 59  ? 81.574  121.343 121.319 1.00 40.92  ? 59   VAL B CG2   1 
ATOM   4676 N  N     . GLU B 1 60  ? 85.030  123.839 123.414 1.00 37.60  ? 60   GLU B N     1 
ATOM   4677 C  CA    . GLU B 1 60  ? 86.201  124.039 124.253 1.00 37.60  ? 60   GLU B CA    1 
ATOM   4678 C  C     . GLU B 1 60  ? 85.972  123.433 125.629 1.00 37.60  ? 60   GLU B C     1 
ATOM   4679 O  O     . GLU B 1 60  ? 84.861  123.474 126.162 1.00 37.60  ? 60   GLU B O     1 
ATOM   4680 C  CB    . GLU B 1 60  ? 86.533  125.525 124.392 1.00 37.60  ? 60   GLU B CB    1 
ATOM   4681 C  CG    . GLU B 1 60  ? 87.025  126.180 123.114 1.00 37.60  ? 60   GLU B CG    1 
ATOM   4682 C  CD    . GLU B 1 60  ? 85.897  126.694 122.235 1.00 37.60  ? 60   GLU B CD    1 
ATOM   4683 O  OE1   . GLU B 1 60  ? 84.725  126.628 122.663 1.00 37.60  ? 60   GLU B OE1   1 
ATOM   4684 O  OE2   . GLU B 1 60  ? 86.182  127.158 121.111 1.00 37.60  ? 60   GLU B OE2   1 
ATOM   4685 N  N     . LYS B 1 61  ? 87.030  122.862 126.193 1.00 26.81  ? 61   LYS B N     1 
ATOM   4686 C  CA    . LYS B 1 61  ? 86.996  122.302 127.534 1.00 26.81  ? 61   LYS B CA    1 
ATOM   4687 C  C     . LYS B 1 61  ? 88.144  122.891 128.333 1.00 26.81  ? 61   LYS B C     1 
ATOM   4688 O  O     . LYS B 1 61  ? 89.266  122.997 127.834 1.00 26.81  ? 61   LYS B O     1 
ATOM   4689 C  CB    . LYS B 1 61  ? 87.081  120.780 127.501 1.00 26.81  ? 61   LYS B CB    1 
ATOM   4690 C  CG    . LYS B 1 61  ? 86.969  120.124 128.860 1.00 26.81  ? 61   LYS B CG    1 
ATOM   4691 C  CD    . LYS B 1 61  ? 86.811  118.620 128.737 1.00 26.81  ? 61   LYS B CD    1 
ATOM   4692 C  CE    . LYS B 1 61  ? 88.139  117.895 128.667 1.00 26.81  ? 61   LYS B CE    1 
ATOM   4693 N  NZ    . LYS B 1 61  ? 88.679  117.845 127.286 1.00 26.81  ? 61   LYS B NZ    1 
ATOM   4694 N  N     . GLU B 1 62  ? 87.854  123.296 129.568 1.00 23.24  ? 62   GLU B N     1 
ATOM   4695 C  CA    . GLU B 1 62  ? 88.804  124.060 130.370 1.00 23.24  ? 62   GLU B CA    1 
ATOM   4696 C  C     . GLU B 1 62  ? 89.571  123.105 131.278 1.00 23.24  ? 62   GLU B C     1 
ATOM   4697 O  O     . GLU B 1 62  ? 89.243  122.893 132.443 1.00 23.24  ? 62   GLU B O     1 
ATOM   4698 C  CB    . GLU B 1 62  ? 88.090  125.147 131.158 1.00 23.24  ? 62   GLU B CB    1 
ATOM   4699 C  CG    . GLU B 1 62  ? 89.023  126.118 131.854 1.00 23.24  ? 62   GLU B CG    1 
ATOM   4700 C  CD    . GLU B 1 62  ? 88.274  127.238 132.541 1.00 23.24  ? 62   GLU B CD    1 
ATOM   4701 O  OE1   . GLU B 1 62  ? 87.026  127.234 132.486 1.00 23.24  ? 62   GLU B OE1   1 
ATOM   4702 O  OE2   . GLU B 1 62  ? 88.931  128.123 133.131 1.00 23.24  ? 62   GLU B OE2   1 
ATOM   4703 N  N     . ILE B 1 63  ? 90.596  122.493 130.699 1.00 17.93  ? 63   ILE B N     1 
ATOM   4704 C  CA    . ILE B 1 63  ? 91.663  121.893 131.480 1.00 17.93  ? 63   ILE B CA    1 
ATOM   4705 C  C     . ILE B 1 63  ? 92.478  123.032 132.063 1.00 17.93  ? 63   ILE B C     1 
ATOM   4706 O  O     . ILE B 1 63  ? 92.692  124.036 131.381 1.00 17.93  ? 63   ILE B O     1 
ATOM   4707 C  CB    . ILE B 1 63  ? 92.508  120.977 130.574 1.00 17.93  ? 63   ILE B CB    1 
ATOM   4708 C  CG1   . ILE B 1 63  ? 91.667  119.825 130.031 1.00 17.93  ? 63   ILE B CG1   1 
ATOM   4709 C  CG2   . ILE B 1 63  ? 93.668  120.383 131.297 1.00 17.93  ? 63   ILE B CG2   1 
ATOM   4710 C  CD1   . ILE B 1 63  ? 91.174  120.002 128.631 1.00 17.93  ? 63   ILE B CD1   1 
ATOM   4711 N  N     . LEU B 1 64  ? 92.905  122.910 133.329 1.00 16.32  ? 64   LEU B N     1 
ATOM   4712 C  CA    . LEU B 1 64  ? 93.721  123.930 134.005 1.00 16.32  ? 64   LEU B CA    1 
ATOM   4713 C  C     . LEU B 1 64  ? 93.091  125.310 134.189 1.00 16.32  ? 64   LEU B C     1 
ATOM   4714 O  O     . LEU B 1 64  ? 93.403  126.249 133.468 1.00 16.32  ? 64   LEU B O     1 
ATOM   4715 C  CB    . LEU B 1 64  ? 95.096  124.123 133.356 1.00 16.32  ? 64   LEU B CB    1 
ATOM   4716 C  CG    . LEU B 1 64  ? 96.296  123.354 133.869 1.00 16.32  ? 64   LEU B CG    1 
ATOM   4717 C  CD1   . LEU B 1 64  ? 96.112  121.903 133.675 1.00 16.32  ? 64   LEU B CD1   1 
ATOM   4718 C  CD2   . LEU B 1 64  ? 97.478  123.848 133.093 1.00 16.32  ? 64   LEU B CD2   1 
ATOM   4719 N  N     . SER B 1 65  ? 92.159  125.409 135.130 1.00 19.45  ? 65   SER B N     1 
ATOM   4720 C  CA    . SER B 1 65  ? 91.649  126.707 135.568 1.00 19.45  ? 65   SER B CA    1 
ATOM   4721 C  C     . SER B 1 65  ? 92.763  127.511 136.256 1.00 19.45  ? 65   SER B C     1 
ATOM   4722 O  O     . SER B 1 65  ? 93.946  127.202 136.129 1.00 19.45  ? 65   SER B O     1 
ATOM   4723 C  CB    . SER B 1 65  ? 90.450  126.513 136.484 1.00 19.45  ? 65   SER B CB    1 
ATOM   4724 O  OG    . SER B 1 65  ? 89.391  125.873 135.796 1.00 19.45  ? 65   SER B OG    1 
ATOM   4725 N  N     . ASN B 1 66  ? 92.403  128.598 136.945 1.00 21.17  ? 66   ASN B N     1 
ATOM   4726 C  CA    . ASN B 1 66  ? 93.356  129.562 137.512 1.00 21.17  ? 66   ASN B CA    1 
ATOM   4727 C  C     . ASN B 1 66  ? 94.378  128.946 138.464 1.00 21.17  ? 66   ASN B C     1 
ATOM   4728 O  O     . ASN B 1 66  ? 94.019  128.476 139.546 1.00 21.17  ? 66   ASN B O     1 
ATOM   4729 C  CB    . ASN B 1 66  ? 92.597  130.654 138.269 1.00 21.17  ? 66   ASN B CB    1 
ATOM   4730 C  CG    . ASN B 1 66  ? 91.785  131.541 137.359 1.00 21.17  ? 66   ASN B CG    1 
ATOM   4731 O  OD1   . ASN B 1 66  ? 92.268  132.010 136.333 1.00 21.17  ? 66   ASN B OD1   1 
ATOM   4732 N  ND2   . ASN B 1 66  ? 90.529  131.760 137.723 1.00 21.17  ? 66   ASN B ND2   1 
ATOM   4733 N  N     . ILE B 1 67  ? 95.647  128.926 138.060 1.00 20.55  ? 67   ILE B N     1 
ATOM   4734 C  CA    . ILE B 1 67  ? 96.716  128.268 138.805 1.00 20.55  ? 67   ILE B CA    1 
ATOM   4735 C  C     . ILE B 1 67  ? 97.881  129.235 138.929 1.00 20.55  ? 67   ILE B C     1 
ATOM   4736 O  O     . ILE B 1 67  ? 98.360  129.765 137.924 1.00 20.55  ? 67   ILE B O     1 
ATOM   4737 C  CB    . ILE B 1 67  ? 97.176  126.960 138.133 1.00 20.55  ? 67   ILE B CB    1 
ATOM   4738 C  CG1   . ILE B 1 67  ? 96.071  125.921 138.151 1.00 20.55  ? 67   ILE B CG1   1 
ATOM   4739 C  CG2   . ILE B 1 67  ? 98.309  126.345 138.884 1.00 20.55  ? 67   ILE B CG2   1 
ATOM   4740 C  CD1   . ILE B 1 67  ? 96.359  124.772 137.287 1.00 20.55  ? 67   ILE B CD1   1 
ATOM   4741 N  N     . ASN B 1 68  ? 98.341  129.452 140.155 1.00 22.19  ? 68   ASN B N     1 
ATOM   4742 C  CA    . ASN B 1 68  ? 99.403  130.392 140.465 1.00 22.19  ? 68   ASN B CA    1 
ATOM   4743 C  C     . ASN B 1 68  ? 100.439 129.691 141.323 1.00 22.19  ? 68   ASN B C     1 
ATOM   4744 O  O     . ASN B 1 68  ? 100.086 128.930 142.225 1.00 22.19  ? 68   ASN B O     1 
ATOM   4745 C  CB    . ASN B 1 68  ? 98.847  131.596 141.209 1.00 22.19  ? 68   ASN B CB    1 
ATOM   4746 C  CG    . ASN B 1 68  ? 97.943  132.432 140.352 1.00 22.19  ? 68   ASN B CG    1 
ATOM   4747 O  OD1   . ASN B 1 68  ? 98.266  132.728 139.214 1.00 22.19  ? 68   ASN B OD1   1 
ATOM   4748 N  ND2   . ASN B 1 68  ? 96.790  132.799 140.884 1.00 22.19  ? 68   ASN B ND2   1 
ATOM   4749 N  N     . GLY B 1 69  ? 101.711 129.949 141.059 1.00 20.47  ? 69   GLY B N     1 
ATOM   4750 C  CA    . GLY B 1 69  ? 102.743 129.279 141.823 1.00 20.47  ? 69   GLY B CA    1 
ATOM   4751 C  C     . GLY B 1 69  ? 104.120 129.797 141.486 1.00 20.47  ? 69   GLY B C     1 
ATOM   4752 O  O     . GLY B 1 69  ? 104.327 130.483 140.483 1.00 20.47  ? 69   GLY B O     1 
ATOM   4753 N  N     . ILE B 1 70  ? 105.059 129.465 142.370 1.00 20.03  ? 70   ILE B N     1 
ATOM   4754 C  CA    . ILE B 1 70  ? 106.472 129.805 142.259 1.00 20.03  ? 70   ILE B CA    1 
ATOM   4755 C  C     . ILE B 1 70  ? 107.251 128.534 142.543 1.00 20.03  ? 70   ILE B C     1 
ATOM   4756 O  O     . ILE B 1 70  ? 106.929 127.812 143.490 1.00 20.03  ? 70   ILE B O     1 
ATOM   4757 C  CB    . ILE B 1 70  ? 106.873 130.908 143.257 1.00 20.03  ? 70   ILE B CB    1 
ATOM   4758 C  CG1   . ILE B 1 70  ? 106.102 132.187 142.988 1.00 20.03  ? 70   ILE B CG1   1 
ATOM   4759 C  CG2   . ILE B 1 70  ? 108.350 131.221 143.185 1.00 20.03  ? 70   ILE B CG2   1 
ATOM   4760 C  CD1   . ILE B 1 70  ? 106.218 133.171 144.067 1.00 20.03  ? 70   ILE B CD1   1 
ATOM   4761 N  N     . MET B 1 71  ? 108.262 128.246 141.725 1.00 17.07  ? 71   MET B N     1 
ATOM   4762 C  CA    . MET B 1 71  ? 109.064 127.033 141.878 1.00 17.07  ? 71   MET B CA    1 
ATOM   4763 C  C     . MET B 1 71  ? 110.537 127.408 141.977 1.00 17.07  ? 71   MET B C     1 
ATOM   4764 O  O     . MET B 1 71  ? 111.234 127.530 140.971 1.00 17.07  ? 71   MET B O     1 
ATOM   4765 C  CB    . MET B 1 71  ? 108.766 126.077 140.745 1.00 17.07  ? 71   MET B CB    1 
ATOM   4766 C  CG    . MET B 1 71  ? 107.431 125.414 140.965 1.00 17.07  ? 71   MET B CG    1 
ATOM   4767 S  SD    . MET B 1 71  ? 106.763 124.447 139.637 1.00 17.07  ? 71   MET B SD    1 
ATOM   4768 C  CE    . MET B 1 71  ? 105.298 123.814 140.430 1.00 17.07  ? 71   MET B CE    1 
ATOM   4769 N  N     . LYS B 1 72  ? 110.997 127.573 143.213 1.00 17.36  ? 72   LYS B N     1 
ATOM   4770 C  CA    . LYS B 1 72  ? 112.355 127.976 143.529 1.00 17.36  ? 72   LYS B CA    1 
ATOM   4771 C  C     . LYS B 1 72  ? 113.321 126.810 143.301 1.00 17.36  ? 72   LYS B C     1 
ATOM   4772 O  O     . LYS B 1 72  ? 112.882 125.668 143.155 1.00 17.36  ? 72   LYS B O     1 
ATOM   4773 C  CB    . LYS B 1 72  ? 112.386 128.462 144.980 1.00 17.36  ? 72   LYS B CB    1 
ATOM   4774 C  CG    . LYS B 1 72  ? 111.624 129.746 145.202 1.00 17.36  ? 72   LYS B CG    1 
ATOM   4775 C  CD    . LYS B 1 72  ? 111.747 130.213 146.636 1.00 17.36  ? 72   LYS B CD    1 
ATOM   4776 C  CE    . LYS B 1 72  ? 110.948 131.481 146.859 1.00 17.36  ? 72   LYS B CE    1 
ATOM   4777 N  NZ    . LYS B 1 72  ? 111.527 132.616 146.086 1.00 17.36  ? 72   LYS B NZ    1 
ATOM   4778 N  N     . PRO B 1 73  ? 114.636 127.068 143.228 1.00 18.11  ? 73   PRO B N     1 
ATOM   4779 C  CA    . PRO B 1 73  ? 115.595 125.957 143.075 1.00 18.11  ? 73   PRO B CA    1 
ATOM   4780 C  C     . PRO B 1 73  ? 115.593 124.987 144.246 1.00 18.11  ? 73   PRO B C     1 
ATOM   4781 O  O     . PRO B 1 73  ? 115.939 125.336 145.375 1.00 18.11  ? 73   PRO B O     1 
ATOM   4782 C  CB    . PRO B 1 73  ? 116.943 126.670 142.929 1.00 18.11  ? 73   PRO B CB    1 
ATOM   4783 C  CG    . PRO B 1 73  ? 116.724 128.036 143.415 1.00 18.11  ? 73   PRO B CG    1 
ATOM   4784 C  CD    . PRO B 1 73  ? 115.324 128.358 143.040 1.00 18.11  ? 73   PRO B CD    1 
ATOM   4785 N  N     . GLY B 1 74  ? 115.205 123.752 143.949 1.00 15.91  ? 74   GLY B N     1 
ATOM   4786 C  CA    . GLY B 1 74  ? 115.052 122.691 144.915 1.00 15.91  ? 74   GLY B CA    1 
ATOM   4787 C  C     . GLY B 1 74  ? 114.428 121.489 144.241 1.00 15.91  ? 74   GLY B C     1 
ATOM   4788 O  O     . GLY B 1 74  ? 114.766 121.180 143.099 1.00 15.91  ? 74   GLY B O     1 
ATOM   4789 N  N     . LEU B 1 75  ? 113.496 120.823 144.916 1.00 13.82  ? 75   LEU B N     1 
ATOM   4790 C  CA    . LEU B 1 75  ? 112.857 119.615 144.398 1.00 13.82  ? 75   LEU B CA    1 
ATOM   4791 C  C     . LEU B 1 75  ? 111.349 119.816 144.520 1.00 13.82  ? 75   LEU B C     1 
ATOM   4792 O  O     . LEU B 1 75  ? 110.791 119.699 145.613 1.00 13.82  ? 75   LEU B O     1 
ATOM   4793 C  CB    . LEU B 1 75  ? 113.338 118.393 145.167 1.00 13.82  ? 75   LEU B CB    1 
ATOM   4794 C  CG    . LEU B 1 75  ? 113.104 117.007 144.599 1.00 13.82  ? 75   LEU B CG    1 
ATOM   4795 C  CD1   . LEU B 1 75  ? 113.869 116.884 143.307 1.00 13.82  ? 75   LEU B CD1   1 
ATOM   4796 C  CD2   . LEU B 1 75  ? 113.576 115.977 145.581 1.00 13.82  ? 75   LEU B CD2   1 
ATOM   4797 N  N     . ASN B 1 76  ? 110.694 120.104 143.394 1.00 12.39  ? 76   ASN B N     1 
ATOM   4798 C  CA    . ASN B 1 76  ? 109.329 120.626 143.349 1.00 12.39  ? 76   ASN B CA    1 
ATOM   4799 C  C     . ASN B 1 76  ? 108.392 119.543 142.829 1.00 12.39  ? 76   ASN B C     1 
ATOM   4800 O  O     . ASN B 1 76  ? 108.376 119.261 141.629 1.00 12.39  ? 76   ASN B O     1 
ATOM   4801 C  CB    . ASN B 1 76  ? 109.270 121.849 142.439 1.00 12.39  ? 76   ASN B CB    1 
ATOM   4802 C  CG    . ASN B 1 76  ? 110.186 122.953 142.888 1.00 12.39  ? 76   ASN B CG    1 
ATOM   4803 O  OD1   . ASN B 1 76  ? 110.256 123.278 144.060 1.00 12.39  ? 76   ASN B OD1   1 
ATOM   4804 N  ND2   . ASN B 1 76  ? 110.921 123.520 141.951 1.00 12.39  ? 76   ASN B ND2   1 
ATOM   4805 N  N     . ALA B 1 77  ? 107.587 118.962 143.711 1.00 11.64  ? 77   ALA B N     1 
ATOM   4806 C  CA    . ALA B 1 77  ? 106.714 117.860 143.336 1.00 11.64  ? 77   ALA B CA    1 
ATOM   4807 C  C     . ALA B 1 77  ? 105.315 118.350 143.005 1.00 11.64  ? 77   ALA B C     1 
ATOM   4808 O  O     . ALA B 1 77  ? 104.857 119.365 143.529 1.00 11.64  ? 77   ALA B O     1 
ATOM   4809 C  CB    . ALA B 1 77  ? 106.625 116.831 144.452 1.00 11.64  ? 77   ALA B CB    1 
ATOM   4810 N  N     . ILE B 1 78  ? 104.638 117.615 142.125 1.00 9.71   ? 78   ILE B N     1 
ATOM   4811 C  CA    . ILE B 1 78  ? 103.250 117.881 141.761 1.00 9.71   ? 78   ILE B CA    1 
ATOM   4812 C  C     . ILE B 1 78  ? 102.474 116.586 141.965 1.00 9.71   ? 78   ILE B C     1 
ATOM   4813 O  O     . ILE B 1 78  ? 102.665 115.624 141.219 1.00 9.71   ? 78   ILE B O     1 
ATOM   4814 C  CB    . ILE B 1 78  ? 103.100 118.372 140.316 1.00 9.71   ? 78   ILE B CB    1 
ATOM   4815 C  CG1   . ILE B 1 78  ? 103.931 119.623 140.057 1.00 9.71   ? 78   ILE B CG1   1 
ATOM   4816 C  CG2   . ILE B 1 78  ? 101.656 118.685 140.016 1.00 9.71   ? 78   ILE B CG2   1 
ATOM   4817 C  CD1   . ILE B 1 78  ? 104.047 119.949 138.591 1.00 9.71   ? 78   ILE B CD1   1 
ATOM   4818 N  N     . LEU B 1 79  ? 101.604 116.556 142.966 1.00 11.91  ? 79   LEU B N     1 
ATOM   4819 C  CA    . LEU B 1 79  ? 100.753 115.407 143.226 1.00 11.91  ? 79   LEU B CA    1 
ATOM   4820 C  C     . LEU B 1 79  ? 99.326  115.704 142.788 1.00 11.91  ? 79   LEU B C     1 
ATOM   4821 O  O     . LEU B 1 79  ? 98.946  116.854 142.580 1.00 11.91  ? 79   LEU B O     1 
ATOM   4822 C  CB    . LEU B 1 79  ? 100.764 115.033 144.708 1.00 11.91  ? 79   LEU B CB    1 
ATOM   4823 C  CG    . LEU B 1 79  ? 101.798 114.114 145.357 1.00 11.91  ? 79   LEU B CG    1 
ATOM   4824 C  CD1   . LEU B 1 79  ? 101.760 112.745 144.732 1.00 11.91  ? 79   LEU B CD1   1 
ATOM   4825 C  CD2   . LEU B 1 79  ? 103.177 114.689 145.303 1.00 11.91  ? 79   LEU B CD2   1 
ATOM   4826 N  N     . GLY B 1 80  ? 98.534  114.650 142.651 1.00 11.22  ? 80   GLY B N     1 
ATOM   4827 C  CA    . GLY B 1 80  ? 97.152  114.800 142.269 1.00 11.22  ? 80   GLY B CA    1 
ATOM   4828 C  C     . GLY B 1 80  ? 96.595  113.573 141.583 1.00 11.22  ? 80   GLY B C     1 
ATOM   4829 O  O     . GLY B 1 80  ? 97.337  112.666 141.203 1.00 11.22  ? 80   GLY B O     1 
ATOM   4830 N  N     . PRO B 1 81  ? 95.270  113.511 141.421 1.00 10.97  ? 81   PRO B N     1 
ATOM   4831 C  CA    . PRO B 1 81  ? 94.656  112.338 140.788 1.00 10.97  ? 81   PRO B CA    1 
ATOM   4832 C  C     . PRO B 1 81  ? 94.915  112.212 139.301 1.00 10.97  ? 81   PRO B C     1 
ATOM   4833 O  O     . PRO B 1 81  ? 95.523  113.088 138.684 1.00 10.97  ? 81   PRO B O     1 
ATOM   4834 C  CB    . PRO B 1 81  ? 93.164  112.536 141.068 1.00 10.97  ? 81   PRO B CB    1 
ATOM   4835 C  CG    . PRO B 1 81  ? 93.123  113.379 142.262 1.00 10.97  ? 81   PRO B CG    1 
ATOM   4836 C  CD    . PRO B 1 81  ? 94.269  114.314 142.135 1.00 10.97  ? 81   PRO B CD    1 
ATOM   4837 N  N     . THR B 1 82  ? 94.464  111.106 138.722 1.00 10.64  ? 82   THR B N     1 
ATOM   4838 C  CA    . THR B 1 82  ? 94.576  110.898 137.290 1.00 10.64  ? 82   THR B CA    1 
ATOM   4839 C  C     . THR B 1 82  ? 93.523  111.730 136.577 1.00 10.64  ? 82   THR B C     1 
ATOM   4840 O  O     . THR B 1 82  ? 92.337  111.663 136.907 1.00 10.64  ? 82   THR B O     1 
ATOM   4841 C  CB    . THR B 1 82  ? 94.417  109.420 136.948 1.00 10.64  ? 82   THR B CB    1 
ATOM   4842 O  OG1   . THR B 1 82  ? 93.135  108.960 137.381 1.00 10.64  ? 82   THR B OG1   1 
ATOM   4843 C  CG2   . THR B 1 82  ? 95.474  108.618 137.636 1.00 10.64  ? 82   THR B CG2   1 
ATOM   4844 N  N     . GLY B 1 83  ? 93.958  112.515 135.602 1.00 10.01  ? 83   GLY B N     1 
ATOM   4845 C  CA    . GLY B 1 83  ? 93.096  113.483 134.974 1.00 10.01  ? 83   GLY B CA    1 
ATOM   4846 C  C     . GLY B 1 83  ? 93.035  114.811 135.683 1.00 10.01  ? 83   GLY B C     1 
ATOM   4847 O  O     . GLY B 1 83  ? 92.158  115.621 135.369 1.00 10.01  ? 83   GLY B O     1 
ATOM   4848 N  N     . GLY B 1 84  ? 93.939  115.064 136.630 1.00 10.91  ? 84   GLY B N     1 
ATOM   4849 C  CA    . GLY B 1 84  ? 93.909  116.300 137.382 1.00 10.91  ? 84   GLY B CA    1 
ATOM   4850 C  C     . GLY B 1 84  ? 94.538  117.478 136.681 1.00 10.91  ? 84   GLY B C     1 
ATOM   4851 O  O     . GLY B 1 84  ? 94.260  118.620 137.051 1.00 10.91  ? 84   GLY B O     1 
ATOM   4852 N  N     . GLY B 1 85  ? 95.380  117.233 135.686 1.00 9.37   ? 85   GLY B N     1 
ATOM   4853 C  CA    . GLY B 1 85  ? 96.003  118.312 134.953 1.00 9.37   ? 85   GLY B CA    1 
ATOM   4854 C  C     . GLY B 1 85  ? 97.488  118.433 135.200 1.00 9.37   ? 85   GLY B C     1 
ATOM   4855 O  O     . GLY B 1 85  ? 98.051  119.518 135.059 1.00 9.37   ? 85   GLY B O     1 
ATOM   4856 N  N     . LYS B 1 86  ? 98.144  117.326 135.554 1.00 9.11   ? 86   LYS B N     1 
ATOM   4857 C  CA    . LYS B 1 86  ? 99.547  117.391 135.947 1.00 9.11   ? 86   LYS B CA    1 
ATOM   4858 C  C     . LYS B 1 86  ? 100.481 117.402 134.748 1.00 9.11   ? 86   LYS B C     1 
ATOM   4859 O  O     . LYS B 1 86  ? 101.470 118.135 134.749 1.00 9.11   ? 86   LYS B O     1 
ATOM   4860 C  CB    . LYS B 1 86  ? 99.899  116.229 136.863 1.00 9.11   ? 86   LYS B CB    1 
ATOM   4861 C  CG    . LYS B 1 86  ? 99.175  116.227 138.176 1.00 9.11   ? 86   LYS B CG    1 
ATOM   4862 C  CD    . LYS B 1 86  ? 99.700  115.123 139.044 1.00 9.11   ? 86   LYS B CD    1 
ATOM   4863 C  CE    . LYS B 1 86  ? 99.350  113.795 138.456 1.00 9.11   ? 86   LYS B CE    1 
ATOM   4864 N  NZ    . LYS B 1 86  ? 97.889  113.576 138.435 1.00 9.11   ? 86   LYS B NZ    1 
ATOM   4865 N  N     . SER B 1 87  ? 100.210 116.586 133.731 1.00 8.99   ? 87   SER B N     1 
ATOM   4866 C  CA    . SER B 1 87  ? 101.006 116.638 132.514 1.00 8.99   ? 87   SER B CA    1 
ATOM   4867 C  C     . SER B 1 87  ? 100.639 117.820 131.640 1.00 8.99   ? 87   SER B C     1 
ATOM   4868 O  O     . SER B 1 87  ? 101.396 118.158 130.729 1.00 8.99   ? 87   SER B O     1 
ATOM   4869 C  CB    . SER B 1 87  ? 100.854 115.355 131.704 1.00 8.99   ? 87   SER B CB    1 
ATOM   4870 O  OG    . SER B 1 87  ? 101.403 114.246 132.391 1.00 8.99   ? 87   SER B OG    1 
ATOM   4871 N  N     . SER B 1 88  ? 99.491  118.446 131.886 1.00 9.19   ? 88   SER B N     1 
ATOM   4872 C  CA    . SER B 1 88  ? 99.130  119.644 131.145 1.00 9.19   ? 88   SER B CA    1 
ATOM   4873 C  C     . SER B 1 88  ? 99.762  120.879 131.760 1.00 9.19   ? 88   SER B C     1 
ATOM   4874 O  O     . SER B 1 88  ? 100.142 121.802 131.040 1.00 9.19   ? 88   SER B O     1 
ATOM   4875 C  CB    . SER B 1 88  ? 97.615  119.786 131.089 1.00 9.19   ? 88   SER B CB    1 
ATOM   4876 O  OG    . SER B 1 88  ? 97.021  118.721 130.369 1.00 9.19   ? 88   SER B OG    1 
ATOM   4877 N  N     . LEU B 1 89  ? 99.888  120.911 133.087 1.00 9.28   ? 89   LEU B N     1 
ATOM   4878 C  CA    . LEU B 1 89  ? 100.608 121.994 133.742 1.00 9.28   ? 89   LEU B CA    1 
ATOM   4879 C  C     . LEU B 1 89  ? 102.093 121.921 133.454 1.00 9.28   ? 89   LEU B C     1 
ATOM   4880 O  O     . LEU B 1 89  ? 102.747 122.953 133.279 1.00 9.28   ? 89   LEU B O     1 
ATOM   4881 C  CB    . LEU B 1 89  ? 100.373 121.949 135.249 1.00 9.28   ? 89   LEU B CB    1 
ATOM   4882 C  CG    . LEU B 1 89  ? 101.014 123.062 136.078 1.00 9.28   ? 89   LEU B CG    1 
ATOM   4883 C  CD1   . LEU B 1 89  ? 100.381 124.392 135.750 1.00 9.28   ? 89   LEU B CD1   1 
ATOM   4884 C  CD2   . LEU B 1 89  ? 100.938 122.770 137.556 1.00 9.28   ? 89   LEU B CD2   1 
ATOM   4885 N  N     . LEU B 1 90  ? 102.629 120.713 133.371 1.00 8.90   ? 90   LEU B N     1 
ATOM   4886 C  CA    . LEU B 1 90  ? 104.059 120.514 133.238 1.00 8.90   ? 90   LEU B CA    1 
ATOM   4887 C  C     . LEU B 1 90  ? 104.538 120.770 131.818 1.00 8.90   ? 90   LEU B C     1 
ATOM   4888 O  O     . LEU B 1 90  ? 105.733 120.983 131.606 1.00 8.90   ? 90   LEU B O     1 
ATOM   4889 C  CB    . LEU B 1 90  ? 104.372 119.096 133.702 1.00 8.90   ? 90   LEU B CB    1 
ATOM   4890 C  CG    . LEU B 1 90  ? 105.740 118.636 134.122 1.00 8.90   ? 90   LEU B CG    1 
ATOM   4891 C  CD1   . LEU B 1 90  ? 106.169 119.490 135.249 1.00 8.90   ? 90   LEU B CD1   1 
ATOM   4892 C  CD2   . LEU B 1 90  ? 105.545 117.250 134.609 1.00 8.90   ? 90   LEU B CD2   1 
ATOM   4893 N  N     . ASP B 1 91  ? 103.623 120.776 130.853 1.00 10.84  ? 91   ASP B N     1 
ATOM   4894 C  CA    . ASP B 1 91  ? 103.888 121.203 129.487 1.00 10.84  ? 91   ASP B CA    1 
ATOM   4895 C  C     . ASP B 1 91  ? 103.717 122.699 129.280 1.00 10.84  ? 91   ASP B C     1 
ATOM   4896 O  O     . ASP B 1 91  ? 104.384 123.271 128.416 1.00 10.84  ? 91   ASP B O     1 
ATOM   4897 C  CB    . ASP B 1 91  ? 102.954 120.479 128.528 1.00 10.84  ? 91   ASP B CB    1 
ATOM   4898 C  CG    . ASP B 1 91  ? 103.385 119.077 128.227 1.00 10.84  ? 91   ASP B CG    1 
ATOM   4899 O  OD1   . ASP B 1 91  ? 104.600 118.843 128.178 1.00 10.84  ? 91   ASP B OD1   1 
ATOM   4900 O  OD2   . ASP B 1 91  ? 102.512 118.207 128.024 1.00 10.84  ? 91   ASP B OD2   1 
ATOM   4901 N  N     . VAL B 1 92  ? 102.808 123.339 130.018 1.00 11.61  ? 92   VAL B N     1 
ATOM   4902 C  CA    . VAL B 1 92  ? 102.727 124.798 130.012 1.00 11.61  ? 92   VAL B CA    1 
ATOM   4903 C  C     . VAL B 1 92  ? 104.003 125.400 130.583 1.00 11.61  ? 92   VAL B C     1 
ATOM   4904 O  O     . VAL B 1 92  ? 104.570 126.346 130.025 1.00 11.61  ? 92   VAL B O     1 
ATOM   4905 C  CB    . VAL B 1 92  ? 101.479 125.263 130.788 1.00 11.61  ? 92   VAL B CB    1 
ATOM   4906 C  CG1   . VAL B 1 92  ? 101.517 126.752 131.033 1.00 11.61  ? 92   VAL B CG1   1 
ATOM   4907 C  CG2   . VAL B 1 92  ? 100.229 124.916 130.023 1.00 11.61  ? 92   VAL B CG2   1 
ATOM   4908 N  N     . LEU B 1 93  ? 104.495 124.832 131.679 1.00 11.61  ? 93   LEU B N     1 
ATOM   4909 C  CA    . LEU B 1 93  ? 105.707 125.321 132.319 1.00 11.61  ? 93   LEU B CA    1 
ATOM   4910 C  C     . LEU B 1 93  ? 106.951 125.038 131.489 1.00 11.61  ? 93   LEU B C     1 
ATOM   4911 O  O     . LEU B 1 93  ? 107.926 125.792 131.560 1.00 11.61  ? 93   LEU B O     1 
ATOM   4912 C  CB    . LEU B 1 93  ? 105.819 124.697 133.704 1.00 11.61  ? 93   LEU B CB    1 
ATOM   4913 C  CG    . LEU B 1 93  ? 105.223 125.431 134.905 1.00 11.61  ? 93   LEU B CG    1 
ATOM   4914 C  CD1   . LEU B 1 93  ? 103.753 125.680 134.820 1.00 11.61  ? 93   LEU B CD1   1 
ATOM   4915 C  CD2   . LEU B 1 93  ? 105.521 124.614 136.138 1.00 11.61  ? 93   LEU B CD2   1 
ATOM   4916 N  N     . ALA B 1 94  ? 106.934 123.978 130.688 1.00 10.45  ? 94   ALA B N     1 
ATOM   4917 C  CA    . ALA B 1 94  ? 108.043 123.653 129.807 1.00 10.45  ? 94   ALA B CA    1 
ATOM   4918 C  C     . ALA B 1 94  ? 107.865 124.216 128.407 1.00 10.45  ? 94   ALA B C     1 
ATOM   4919 O  O     . ALA B 1 94  ? 108.650 123.866 127.523 1.00 10.45  ? 94   ALA B O     1 
ATOM   4920 C  CB    . ALA B 1 94  ? 108.234 122.139 129.738 1.00 10.45  ? 94   ALA B CB    1 
ATOM   4921 N  N     . ALA B 1 95  ? 106.845 125.061 128.198 1.00 11.83  ? 95   ALA B N     1 
ATOM   4922 C  CA    . ALA B 1 95  ? 106.562 125.764 126.938 1.00 11.83  ? 95   ALA B CA    1 
ATOM   4923 C  C     . ALA B 1 95  ? 106.331 124.799 125.782 1.00 11.83  ? 95   ALA B C     1 
ATOM   4924 O  O     . ALA B 1 95  ? 106.951 124.906 124.725 1.00 11.83  ? 95   ALA B O     1 
ATOM   4925 C  CB    . ALA B 1 95  ? 107.662 126.767 126.584 1.00 11.83  ? 95   ALA B CB    1 
ATOM   4926 N  N     . ARG B 1 96  ? 105.427 123.839 125.987 1.00 10.03  ? 96   ARG B N     1 
ATOM   4927 C  CA    . ARG B 1 96  ? 105.161 122.831 124.969 1.00 10.03  ? 96   ARG B CA    1 
ATOM   4928 C  C     . ARG B 1 96  ? 103.677 122.694 124.656 1.00 10.03  ? 96   ARG B C     1 
ATOM   4929 O  O     . ARG B 1 96  ? 103.261 121.676 124.101 1.00 10.03  ? 96   ARG B O     1 
ATOM   4930 C  CB    . ARG B 1 96  ? 105.741 121.474 125.377 1.00 10.03  ? 96   ARG B CB    1 
ATOM   4931 C  CG    . ARG B 1 96  ? 107.238 121.482 125.491 1.00 10.03  ? 96   ARG B CG    1 
ATOM   4932 C  CD    . ARG B 1 96  ? 107.819 120.116 125.569 1.00 10.03  ? 96   ARG B CD    1 
ATOM   4933 N  NE    . ARG B 1 96  ? 109.264 120.206 125.700 1.00 10.03  ? 96   ARG B NE    1 
ATOM   4934 C  CZ    . ARG B 1 96  ? 110.085 119.169 125.614 1.00 10.03  ? 96   ARG B CZ    1 
ATOM   4935 N  NH1   . ARG B 1 96  ? 111.385 119.342 125.759 1.00 10.03  ? 96   ARG B NH1   1 
ATOM   4936 N  NH2   . ARG B 1 96  ? 109.608 117.971 125.344 1.00 10.03  ? 96   ARG B NH2   1 
ATOM   4937 N  N     . LYS B 1 97  ? 102.871 123.694 124.984 1.00 14.72  ? 97   LYS B N     1 
ATOM   4938 C  CA    . LYS B 1 97  ? 101.479 123.724 124.573 1.00 14.72  ? 97   LYS B CA    1 
ATOM   4939 C  C     . LYS B 1 97  ? 101.270 124.868 123.597 1.00 14.72  ? 97   LYS B C     1 
ATOM   4940 O  O     . LYS B 1 97  ? 102.043 125.826 123.553 1.00 14.72  ? 97   LYS B O     1 
ATOM   4941 C  CB    . LYS B 1 97  ? 100.537 123.883 125.770 1.00 14.72  ? 97   LYS B CB    1 
ATOM   4942 C  CG    . LYS B 1 97  ? 100.707 122.805 126.802 1.00 14.72  ? 97   LYS B CG    1 
ATOM   4943 C  CD    . LYS B 1 97  ? 100.335 121.419 126.309 1.00 14.72  ? 97   LYS B CD    1 
ATOM   4944 C  CE    . LYS B 1 97  ? 98.918  121.060 126.585 1.00 14.72  ? 97   LYS B CE    1 
ATOM   4945 N  NZ    . LYS B 1 97  ? 98.644  119.646 126.232 1.00 14.72  ? 97   LYS B NZ    1 
ATOM   4946 N  N     . ASP B 1 98  ? 100.216 124.745 122.813 1.00 22.29  ? 98   ASP B N     1 
ATOM   4947 C  CA    . ASP B 1 98  ? 99.836  125.769 121.853 1.00 22.29  ? 98   ASP B CA    1 
ATOM   4948 C  C     . ASP B 1 98  ? 99.371  127.007 122.610 1.00 22.29  ? 98   ASP B C     1 
ATOM   4949 O  O     . ASP B 1 98  ? 98.416  126.916 123.390 1.00 22.29  ? 98   ASP B O     1 
ATOM   4950 C  CB    . ASP B 1 98  ? 98.725  125.217 120.964 1.00 22.29  ? 98   ASP B CB    1 
ATOM   4951 C  CG    . ASP B 1 98  ? 98.468  126.059 119.729 1.00 22.29  ? 98   ASP B CG    1 
ATOM   4952 O  OD1   . ASP B 1 98  ? 99.145  127.085 119.522 1.00 22.29  ? 98   ASP B OD1   1 
ATOM   4953 O  OD2   . ASP B 1 98  ? 97.568  125.683 118.952 1.00 22.29  ? 98   ASP B OD2   1 
ATOM   4954 N  N     . PRO B 1 99  ? 100.003 128.169 122.430 1.00 23.90  ? 99   PRO B N     1 
ATOM   4955 C  CA    . PRO B 1 99  ? 99.602  129.361 123.185 1.00 23.90  ? 99   PRO B CA    1 
ATOM   4956 C  C     . PRO B 1 99  ? 98.303  130.008 122.732 1.00 23.90  ? 99   PRO B C     1 
ATOM   4957 O  O     . PRO B 1 99  ? 97.953  131.065 123.262 1.00 23.90  ? 99   PRO B O     1 
ATOM   4958 C  CB    . PRO B 1 99  ? 100.785 130.316 122.964 1.00 23.90  ? 99   PRO B CB    1 
ATOM   4959 C  CG    . PRO B 1 99  ? 101.372 129.897 121.692 1.00 23.90  ? 99   PRO B CG    1 
ATOM   4960 C  CD    . PRO B 1 99  ? 101.217 128.412 121.635 1.00 23.90  ? 99   PRO B CD    1 
ATOM   4961 N  N     . SER B 1 100 ? 97.580  129.424 121.774 1.00 25.64  ? 100  SER B N     1 
ATOM   4962 C  CA    . SER B 1 100 ? 96.268  129.948 121.422 1.00 25.64  ? 100  SER B CA    1 
ATOM   4963 C  C     . SER B 1 100 ? 95.248  129.669 122.515 1.00 25.64  ? 100  SER B C     1 
ATOM   4964 O  O     . SER B 1 100 ? 94.304  130.447 122.692 1.00 25.64  ? 100  SER B O     1 
ATOM   4965 C  CB    . SER B 1 100 ? 95.798  129.351 120.098 1.00 25.64  ? 100  SER B CB    1 
ATOM   4966 O  OG    . SER B 1 100 ? 95.546  127.965 120.227 1.00 25.64  ? 100  SER B OG    1 
ATOM   4967 N  N     . GLY B 1 101 ? 95.417  128.572 123.250 1.00 23.15  ? 101  GLY B N     1 
ATOM   4968 C  CA    . GLY B 1 101 ? 94.566  128.234 124.366 1.00 23.15  ? 101  GLY B CA    1 
ATOM   4969 C  C     . GLY B 1 101 ? 95.115  128.605 125.720 1.00 23.15  ? 101  GLY B C     1 
ATOM   4970 O  O     . GLY B 1 101 ? 94.413  128.445 126.720 1.00 23.15  ? 101  GLY B O     1 
ATOM   4971 N  N     . LEU B 1 102 ? 96.340  129.109 125.786 1.00 22.14  ? 102  LEU B N     1 
ATOM   4972 C  CA    . LEU B 1 102 ? 96.997  129.414 127.046 1.00 22.14  ? 102  LEU B CA    1 
ATOM   4973 C  C     . LEU B 1 102 ? 96.720  130.861 127.425 1.00 22.14  ? 102  LEU B C     1 
ATOM   4974 O  O     . LEU B 1 102 ? 96.733  131.748 126.569 1.00 22.14  ? 102  LEU B O     1 
ATOM   4975 C  CB    . LEU B 1 102 ? 98.497  129.163 126.917 1.00 22.14  ? 102  LEU B CB    1 
ATOM   4976 C  CG    . LEU B 1 102 ? 99.409  128.988 128.124 1.00 22.14  ? 102  LEU B CG    1 
ATOM   4977 C  CD1   . LEU B 1 102 ? 100.529 128.096 127.667 1.00 22.14  ? 102  LEU B CD1   1 
ATOM   4978 C  CD2   . LEU B 1 102 ? 99.968  130.293 128.650 1.00 22.14  ? 102  LEU B CD2   1 
ATOM   4979 N  N     . SER B 1 103 ? 96.477  131.099 128.714 1.00 22.54  ? 103  SER B N     1 
ATOM   4980 C  CA    . SER B 1 103 ? 95.940  132.381 129.151 1.00 22.54  ? 103  SER B CA    1 
ATOM   4981 C  C     . SER B 1 103 ? 96.692  132.941 130.351 1.00 22.54  ? 103  SER B C     1 
ATOM   4982 O  O     . SER B 1 103 ? 96.102  133.620 131.192 1.00 22.54  ? 103  SER B O     1 
ATOM   4983 C  CB    . SER B 1 103 ? 94.453  132.254 129.475 1.00 22.54  ? 103  SER B CB    1 
ATOM   4984 O  OG    . SER B 1 103 ? 93.718  131.826 128.341 1.00 22.54  ? 103  SER B OG    1 
ATOM   4985 N  N     . GLY B 1 104 ? 97.989  132.684 130.443 1.00 23.34  ? 104  GLY B N     1 
ATOM   4986 C  CA    . GLY B 1 104 ? 98.784  133.233 131.524 1.00 23.34  ? 104  GLY B CA    1 
ATOM   4987 C  C     . GLY B 1 104 ? 100.201 133.531 131.087 1.00 23.34  ? 104  GLY B C     1 
ATOM   4988 O  O     . GLY B 1 104 ? 100.457 133.675 129.890 1.00 23.34  ? 104  GLY B O     1 
ATOM   4989 N  N     . ASP B 1 105 ? 101.134 133.631 132.032 1.00 24.40  ? 105  ASP B N     1 
ATOM   4990 C  CA    . ASP B 1 105 ? 102.535 133.839 131.694 1.00 24.40  ? 105  ASP B CA    1 
ATOM   4991 C  C     . ASP B 1 105 ? 103.443 133.081 132.649 1.00 24.40  ? 105  ASP B C     1 
ATOM   4992 O  O     . ASP B 1 105 ? 103.198 133.038 133.855 1.00 24.40  ? 105  ASP B O     1 
ATOM   4993 C  CB    . ASP B 1 105 ? 102.898 135.328 131.687 1.00 24.40  ? 105  ASP B CB    1 
ATOM   4994 C  CG    . ASP B 1 105 ? 102.467 136.041 132.943 1.00 24.40  ? 105  ASP B CG    1 
ATOM   4995 O  OD1   . ASP B 1 105 ? 101.711 135.451 133.735 1.00 24.40  ? 105  ASP B OD1   1 
ATOM   4996 O  OD2   . ASP B 1 105 ? 102.892 137.196 133.147 1.00 24.40  ? 105  ASP B OD2   1 
ATOM   4997 N  N     . VAL B 1 106 ? 104.492 132.480 132.096 1.00 20.50  ? 106  VAL B N     1 
ATOM   4998 C  CA    . VAL B 1 106 ? 105.503 131.772 132.868 1.00 20.50  ? 106  VAL B CA    1 
ATOM   4999 C  C     . VAL B 1 106 ? 106.797 132.563 132.768 1.00 20.50  ? 106  VAL B C     1 
ATOM   5000 O  O     . VAL B 1 106 ? 107.210 132.949 131.669 1.00 20.50  ? 106  VAL B O     1 
ATOM   5001 C  CB    . VAL B 1 106 ? 105.686 130.333 132.366 1.00 20.50  ? 106  VAL B CB    1 
ATOM   5002 C  CG1   . VAL B 1 106 ? 106.720 129.606 133.195 1.00 20.50  ? 106  VAL B CG1   1 
ATOM   5003 C  CG2   . VAL B 1 106 ? 104.369 129.595 132.387 1.00 20.50  ? 106  VAL B CG2   1 
ATOM   5004 N  N     . LEU B 1 107 ? 107.427 132.817 133.909 1.00 19.73  ? 107  LEU B N     1 
ATOM   5005 C  CA    . LEU B 1 107 ? 108.583 133.696 133.982 1.00 19.73  ? 107  LEU B CA    1 
ATOM   5006 C  C     . LEU B 1 107 ? 109.711 132.985 134.707 1.00 19.73  ? 107  LEU B C     1 
ATOM   5007 O  O     . LEU B 1 107 ? 109.495 132.415 135.778 1.00 19.73  ? 107  LEU B O     1 
ATOM   5008 C  CB    . LEU B 1 107 ? 108.238 134.994 134.716 1.00 19.73  ? 107  LEU B CB    1 
ATOM   5009 C  CG    . LEU B 1 107 ? 107.441 136.117 134.048 1.00 19.73  ? 107  LEU B CG    1 
ATOM   5010 C  CD1   . LEU B 1 107 ? 105.960 135.813 133.958 1.00 19.73  ? 107  LEU B CD1   1 
ATOM   5011 C  CD2   . LEU B 1 107 ? 107.657 137.400 134.807 1.00 19.73  ? 107  LEU B CD2   1 
ATOM   5012 N  N     . ILE B 1 108 ? 110.910 133.025 134.136 1.00 18.92  ? 108  ILE B N     1 
ATOM   5013 C  CA    . ILE B 1 108 ? 112.114 132.536 134.799 1.00 18.92  ? 108  ILE B CA    1 
ATOM   5014 C  C     . ILE B 1 108 ? 112.888 133.739 135.311 1.00 18.92  ? 108  ILE B C     1 
ATOM   5015 O  O     . ILE B 1 108 ? 113.299 134.596 134.522 1.00 18.92  ? 108  ILE B O     1 
ATOM   5016 C  CB    . ILE B 1 108 ? 112.982 131.676 133.867 1.00 18.92  ? 108  ILE B CB    1 
ATOM   5017 C  CG1   . ILE B 1 108 ? 112.331 130.323 133.596 1.00 18.92  ? 108  ILE B CG1   1 
ATOM   5018 C  CG2   . ILE B 1 108 ? 114.344 131.445 134.475 1.00 18.92  ? 108  ILE B CG2   1 
ATOM   5019 C  CD1   . ILE B 1 108 ? 111.523 130.253 132.356 1.00 18.92  ? 108  ILE B CD1   1 
ATOM   5020 N  N     . ASN B 1 109 ? 113.068 133.794 136.636 1.00 20.03  ? 109  ASN B N     1 
ATOM   5021 C  CA    . ASN B 1 109 ? 113.744 134.879 137.358 1.00 20.03  ? 109  ASN B CA    1 
ATOM   5022 C  C     . ASN B 1 109 ? 113.101 136.240 137.107 1.00 20.03  ? 109  ASN B C     1 
ATOM   5023 O  O     . ASN B 1 109 ? 113.787 137.263 137.084 1.00 20.03  ? 109  ASN B O     1 
ATOM   5024 C  CB    . ASN B 1 109 ? 115.241 134.935 137.037 1.00 20.03  ? 109  ASN B CB    1 
ATOM   5025 C  CG    . ASN B 1 109 ? 115.986 133.711 137.513 1.00 20.03  ? 109  ASN B CG    1 
ATOM   5026 O  OD1   . ASN B 1 109 ? 116.501 132.936 136.712 1.00 20.03  ? 109  ASN B OD1   1 
ATOM   5027 N  ND2   . ASN B 1 109 ? 116.060 133.538 138.824 1.00 20.03  ? 109  ASN B ND2   1 
ATOM   5028 N  N     . GLY B 1 110 ? 111.783 136.273 136.926 1.00 22.72  ? 110  GLY B N     1 
ATOM   5029 C  CA    . GLY B 1 110 ? 111.080 137.519 136.711 1.00 22.72  ? 110  GLY B CA    1 
ATOM   5030 C  C     . GLY B 1 110 ? 111.125 138.059 135.299 1.00 22.72  ? 110  GLY B C     1 
ATOM   5031 O  O     . GLY B 1 110 ? 110.498 139.089 135.028 1.00 22.72  ? 110  GLY B O     1 
ATOM   5032 N  N     . ALA B 1 111 ? 111.847 137.418 134.407 1.00 21.24  ? 111  ALA B N     1 
ATOM   5033 C  CA    . ALA B 1 111 ? 111.932 137.720 132.996 1.00 21.24  ? 111  ALA B CA    1 
ATOM   5034 C  C     . ALA B 1 111 ? 111.263 136.608 132.199 1.00 21.24  ? 111  ALA B C     1 
ATOM   5035 O  O     . ALA B 1 111 ? 111.205 135.470 132.669 1.00 21.24  ? 111  ALA B O     1 
ATOM   5036 C  CB    . ALA B 1 111 ? 113.397 137.856 132.564 1.00 21.24  ? 111  ALA B CB    1 
ATOM   5037 N  N     . PRO B 1 112 ? 110.737 136.884 130.998 1.00 20.93  ? 112  PRO B N     1 
ATOM   5038 C  CA    . PRO B 1 112 ? 110.145 135.796 130.207 1.00 20.93  ? 112  PRO B CA    1 
ATOM   5039 C  C     . PRO B 1 112 ? 111.179 134.825 129.658 1.00 20.93  ? 112  PRO B C     1 
ATOM   5040 O  O     . PRO B 1 112 ? 112.383 135.015 129.852 1.00 20.93  ? 112  PRO B O     1 
ATOM   5041 C  CB    . PRO B 1 112 ? 109.411 136.538 129.084 1.00 20.93  ? 112  PRO B CB    1 
ATOM   5042 C  CG    . PRO B 1 112 ? 110.094 137.832 128.977 1.00 20.93  ? 112  PRO B CG    1 
ATOM   5043 C  CD    . PRO B 1 112 ? 110.514 138.195 130.365 1.00 20.93  ? 112  PRO B CD    1 
ATOM   5044 N  N     . ARG B 1 113 ? 110.717 133.775 128.986 1.00 19.65  ? 113  ARG B N     1 
ATOM   5045 C  CA    . ARG B 1 113 ? 111.625 132.747 128.500 1.00 19.65  ? 113  ARG B CA    1 
ATOM   5046 C  C     . ARG B 1 113 ? 112.468 133.284 127.348 1.00 19.65  ? 113  ARG B C     1 
ATOM   5047 O  O     . ARG B 1 113 ? 111.959 134.017 126.496 1.00 19.65  ? 113  ARG B O     1 
ATOM   5048 C  CB    . ARG B 1 113 ? 110.860 131.522 128.010 1.00 19.65  ? 113  ARG B CB    1 
ATOM   5049 C  CG    . ARG B 1 113 ? 110.077 130.754 129.043 1.00 19.65  ? 113  ARG B CG    1 
ATOM   5050 C  CD    . ARG B 1 113 ? 109.493 129.528 128.384 1.00 19.65  ? 113  ARG B CD    1 
ATOM   5051 N  NE    . ARG B 1 113 ? 108.706 128.688 129.274 1.00 19.65  ? 113  ARG B NE    1 
ATOM   5052 C  CZ    . ARG B 1 113 ? 107.393 128.787 129.415 1.00 19.65  ? 113  ARG B CZ    1 
ATOM   5053 N  NH1   . ARG B 1 113 ? 106.716 129.690 128.728 1.00 19.65  ? 113  ARG B NH1   1 
ATOM   5054 N  NH2   . ARG B 1 113 ? 106.754 127.967 130.223 1.00 19.65  ? 113  ARG B NH2   1 
ATOM   5055 N  N     . PRO B 1 114 ? 113.751 132.924 127.282 1.00 21.64  ? 114  PRO B N     1 
ATOM   5056 C  CA    . PRO B 1 114 ? 114.551 133.260 126.097 1.00 21.64  ? 114  PRO B CA    1 
ATOM   5057 C  C     . PRO B 1 114 ? 114.205 132.364 124.919 1.00 21.64  ? 114  PRO B C     1 
ATOM   5058 O  O     . PRO B 1 114 ? 113.281 131.549 125.017 1.00 21.64  ? 114  PRO B O     1 
ATOM   5059 C  CB    . PRO B 1 114 ? 115.990 133.030 126.571 1.00 21.64  ? 114  PRO B CB    1 
ATOM   5060 C  CG    . PRO B 1 114 ? 115.917 133.059 128.058 1.00 21.64  ? 114  PRO B CG    1 
ATOM   5061 C  CD    . PRO B 1 114 ? 114.593 132.466 128.395 1.00 21.64  ? 114  PRO B CD    1 
ATOM   5062 N  N     . ALA B 1 115 ? 114.922 132.485 123.799 1.00 21.97  ? 115  ALA B N     1 
ATOM   5063 C  CA    . ALA B 1 115 ? 114.667 131.492 122.765 1.00 21.97  ? 115  ALA B CA    1 
ATOM   5064 C  C     . ALA B 1 115 ? 115.277 130.153 123.162 1.00 21.97  ? 115  ALA B C     1 
ATOM   5065 O  O     . ALA B 1 115 ? 114.537 129.212 123.461 1.00 21.97  ? 115  ALA B O     1 
ATOM   5066 C  CB    . ALA B 1 115 ? 115.219 131.973 121.424 1.00 21.97  ? 115  ALA B CB    1 
ATOM   5067 N  N     . ASN B 1 116 ? 116.599 130.014 123.105 1.00 20.72  ? 116  ASN B N     1 
ATOM   5068 C  CA    . ASN B 1 116 ? 117.490 129.625 124.217 1.00 20.72  ? 116  ASN B CA    1 
ATOM   5069 C  C     . ASN B 1 116 ? 116.842 128.944 125.460 1.00 20.72  ? 116  ASN B C     1 
ATOM   5070 O  O     . ASN B 1 116 ? 117.185 129.279 126.595 1.00 20.72  ? 116  ASN B O     1 
ATOM   5071 C  CB    . ASN B 1 116 ? 118.277 130.879 124.641 1.00 20.72  ? 116  ASN B CB    1 
ATOM   5072 C  CG    . ASN B 1 116 ? 119.592 130.555 125.339 1.00 20.72  ? 116  ASN B CG    1 
ATOM   5073 O  OD1   . ASN B 1 116 ? 119.936 129.391 125.515 1.00 20.72  ? 116  ASN B OD1   1 
ATOM   5074 N  ND2   . ASN B 1 116 ? 120.319 131.588 125.752 1.00 20.72  ? 116  ASN B ND2   1 
ATOM   5075 N  N     . PHE B 1 117 ? 115.913 128.030 125.284 1.00 16.41  ? 117  PHE B N     1 
ATOM   5076 C  CA    . PHE B 1 117 ? 115.337 127.445 126.491 1.00 16.41  ? 117  PHE B CA    1 
ATOM   5077 C  C     . PHE B 1 117 ? 115.268 125.938 126.417 1.00 16.41  ? 117  PHE B C     1 
ATOM   5078 O  O     . PHE B 1 117 ? 115.522 125.269 127.415 1.00 16.41  ? 117  PHE B O     1 
ATOM   5079 C  CB    . PHE B 1 117 ? 113.944 128.018 126.779 1.00 16.41  ? 117  PHE B CB    1 
ATOM   5080 C  CG    . PHE B 1 117 ? 113.303 127.455 128.016 1.00 16.41  ? 117  PHE B CG    1 
ATOM   5081 C  CD1   . PHE B 1 117 ? 113.775 127.790 129.271 1.00 16.41  ? 117  PHE B CD1   1 
ATOM   5082 C  CD2   . PHE B 1 117 ? 112.223 126.595 127.922 1.00 16.41  ? 117  PHE B CD2   1 
ATOM   5083 C  CE1   . PHE B 1 117 ? 113.188 127.268 130.406 1.00 16.41  ? 117  PHE B CE1   1 
ATOM   5084 C  CE2   . PHE B 1 117 ? 111.637 126.075 129.052 1.00 16.41  ? 117  PHE B CE2   1 
ATOM   5085 C  CZ    . PHE B 1 117 ? 112.120 126.414 130.293 1.00 16.41  ? 117  PHE B CZ    1 
ATOM   5086 N  N     . LYS B 1 118 ? 114.958 125.388 125.248 1.00 13.48  ? 118  LYS B N     1 
ATOM   5087 C  CA    . LYS B 1 118 ? 115.058 123.955 125.045 1.00 13.48  ? 118  LYS B CA    1 
ATOM   5088 C  C     . LYS B 1 118 ? 116.502 123.490 125.020 1.00 13.48  ? 118  LYS B C     1 
ATOM   5089 O  O     . LYS B 1 118 ? 116.764 122.305 125.234 1.00 13.48  ? 118  LYS B O     1 
ATOM   5090 C  CB    . LYS B 1 118 ? 114.340 123.584 123.756 1.00 13.48  ? 118  LYS B CB    1 
ATOM   5091 C  CG    . LYS B 1 118 ? 114.895 124.246 122.528 1.00 13.48  ? 118  LYS B CG    1 
ATOM   5092 C  CD    . LYS B 1 118 ? 114.030 123.935 121.339 1.00 13.48  ? 118  LYS B CD    1 
ATOM   5093 C  CE    . LYS B 1 118 ? 114.580 124.556 120.082 1.00 13.48  ? 118  LYS B CE    1 
ATOM   5094 N  NZ    . LYS B 1 118 ? 113.716 124.255 118.919 1.00 13.48  ? 118  LYS B NZ    1 
ATOM   5095 N  N     . CYS B 1 119 ? 117.439 124.397 124.786 1.00 17.19  ? 119  CYS B N     1 
ATOM   5096 C  CA    . CYS B 1 119 ? 118.858 124.116 124.867 1.00 17.19  ? 119  CYS B CA    1 
ATOM   5097 C  C     . CYS B 1 119 ? 119.428 124.406 126.248 1.00 17.19  ? 119  CYS B C     1 
ATOM   5098 O  O     . CYS B 1 119 ? 120.648 124.363 126.422 1.00 17.19  ? 119  CYS B O     1 
ATOM   5099 C  CB    . CYS B 1 119 ? 119.599 124.930 123.810 1.00 17.19  ? 119  CYS B CB    1 
ATOM   5100 S  SG    . CYS B 1 119 ? 119.100 124.534 122.129 1.00 17.19  ? 119  CYS B SG    1 
ATOM   5101 N  N     . ASN B 1 120 ? 118.574 124.723 127.221 1.00 17.45  ? 120  ASN B N     1 
ATOM   5102 C  CA    . ASN B 1 120 ? 118.992 124.948 128.595 1.00 17.45  ? 120  ASN B CA    1 
ATOM   5103 C  C     . ASN B 1 120 ? 118.089 124.273 129.612 1.00 17.45  ? 120  ASN B C     1 
ATOM   5104 O  O     . ASN B 1 120 ? 118.363 124.369 130.811 1.00 17.45  ? 120  ASN B O     1 
ATOM   5105 C  CB    . ASN B 1 120 ? 119.047 126.447 128.912 1.00 17.45  ? 120  ASN B CB    1 
ATOM   5106 C  CG    . ASN B 1 120 ? 120.179 127.149 128.212 1.00 17.45  ? 120  ASN B CG    1 
ATOM   5107 O  OD1   . ASN B 1 120 ? 121.284 126.625 128.109 1.00 17.45  ? 120  ASN B OD1   1 
ATOM   5108 N  ND2   . ASN B 1 120 ? 119.914 128.357 127.735 1.00 17.45  ? 120  ASN B ND2   1 
ATOM   5109 N  N     . SER B 1 121 ? 117.019 123.618 129.178 1.00 13.85  ? 121  SER B N     1 
ATOM   5110 C  CA    . SER B 1 121 ? 116.125 122.899 130.066 1.00 13.85  ? 121  SER B CA    1 
ATOM   5111 C  C     . SER B 1 121 ? 116.019 121.455 129.604 1.00 13.85  ? 121  SER B C     1 
ATOM   5112 O  O     . SER B 1 121 ? 116.511 121.085 128.537 1.00 13.85  ? 121  SER B O     1 
ATOM   5113 C  CB    . SER B 1 121 ? 114.739 123.541 130.113 1.00 13.85  ? 121  SER B CB    1 
ATOM   5114 O  OG    . SER B 1 121 ? 114.086 123.405 128.867 1.00 13.85  ? 121  SER B OG    1 
ATOM   5115 N  N     . GLY B 1 122 ? 115.370 120.636 130.426 1.00 9.83   ? 122  GLY B N     1 
ATOM   5116 C  CA    . GLY B 1 122 ? 115.118 119.256 130.074 1.00 9.83   ? 122  GLY B CA    1 
ATOM   5117 C  C     . GLY B 1 122 ? 113.733 118.823 130.486 1.00 9.83   ? 122  GLY B C     1 
ATOM   5118 O  O     . GLY B 1 122 ? 113.326 119.055 131.624 1.00 9.83   ? 122  GLY B O     1 
ATOM   5119 N  N     . TYR B 1 123 ? 112.989 118.217 129.572 1.00 8.76   ? 123  TYR B N     1 
ATOM   5120 C  CA    . TYR B 1 123 ? 111.661 117.686 129.847 1.00 8.76   ? 123  TYR B CA    1 
ATOM   5121 C  C     . TYR B 1 123 ? 111.681 116.198 129.550 1.00 8.76   ? 123  TYR B C     1 
ATOM   5122 O  O     . TYR B 1 123 ? 111.850 115.792 128.397 1.00 8.76   ? 123  TYR B O     1 
ATOM   5123 C  CB    . TYR B 1 123 ? 110.594 118.403 129.017 1.00 8.76   ? 123  TYR B CB    1 
ATOM   5124 C  CG    . TYR B 1 123 ? 109.175 117.929 129.246 1.00 8.76   ? 123  TYR B CG    1 
ATOM   5125 C  CD1   . TYR B 1 123 ? 108.511 118.233 130.400 1.00 8.76   ? 123  TYR B CD1   1 
ATOM   5126 C  CD2   . TYR B 1 123 ? 108.487 117.200 128.286 1.00 8.76   ? 123  TYR B CD2   1 
ATOM   5127 C  CE1   . TYR B 1 123 ? 107.235 117.816 130.640 1.00 8.76   ? 123  TYR B CE1   1 
ATOM   5128 C  CE2   . TYR B 1 123 ? 107.191 116.787 128.510 1.00 8.76   ? 123  TYR B CE2   1 
ATOM   5129 C  CZ    . TYR B 1 123 ? 106.578 117.094 129.695 1.00 8.76   ? 123  TYR B CZ    1 
ATOM   5130 O  OH    . TYR B 1 123 ? 105.285 116.688 129.924 1.00 8.76   ? 123  TYR B OH    1 
ATOM   5131 N  N     . VAL B 1 124 ? 111.535 115.390 130.591 1.00 7.76   ? 124  VAL B N     1 
ATOM   5132 C  CA    . VAL B 1 124 ? 111.393 113.948 130.444 1.00 7.76   ? 124  VAL B CA    1 
ATOM   5133 C  C     . VAL B 1 124 ? 109.909 113.665 130.257 1.00 7.76   ? 124  VAL B C     1 
ATOM   5134 O  O     . VAL B 1 124 ? 109.106 113.941 131.149 1.00 7.76   ? 124  VAL B O     1 
ATOM   5135 C  CB    . VAL B 1 124 ? 111.953 113.200 131.661 1.00 7.76   ? 124  VAL B CB    1 
ATOM   5136 C  CG1   . VAL B 1 124 ? 111.721 111.717 131.516 1.00 7.76   ? 124  VAL B CG1   1 
ATOM   5137 C  CG2   . VAL B 1 124 ? 113.418 113.488 131.839 1.00 7.76   ? 124  VAL B CG2   1 
ATOM   5138 N  N     . VAL B 1 125 ? 109.542 113.132 129.097 1.00 8.80   ? 125  VAL B N     1 
ATOM   5139 C  CA    . VAL B 1 125 ? 108.146 112.903 128.757 1.00 8.80   ? 125  VAL B CA    1 
ATOM   5140 C  C     . VAL B 1 125 ? 107.642 111.659 129.468 1.00 8.80   ? 125  VAL B C     1 
ATOM   5141 O  O     . VAL B 1 125 ? 108.416 110.869 130.009 1.00 8.80   ? 125  VAL B O     1 
ATOM   5142 C  CB    . VAL B 1 125 ? 107.936 112.777 127.237 1.00 8.80   ? 125  VAL B CB    1 
ATOM   5143 C  CG1   . VAL B 1 125 ? 108.331 114.040 126.551 1.00 8.80   ? 125  VAL B CG1   1 
ATOM   5144 C  CG2   . VAL B 1 125 ? 108.733 111.615 126.685 1.00 8.80   ? 125  VAL B CG2   1 
ATOM   5145 N  N     . GLN B 1 126 ? 106.324 111.468 129.449 1.00 10.88  ? 126  GLN B N     1 
ATOM   5146 C  CA    . GLN B 1 126 ? 105.739 110.370 130.205 1.00 10.88  ? 126  GLN B CA    1 
ATOM   5147 C  C     . GLN B 1 126 ? 105.817 109.053 129.443 1.00 10.88  ? 126  GLN B C     1 
ATOM   5148 O  O     . GLN B 1 126 ? 106.085 108.006 130.042 1.00 10.88  ? 126  GLN B O     1 
ATOM   5149 C  CB    . GLN B 1 126 ? 104.292 110.694 130.561 1.00 10.88  ? 126  GLN B CB    1 
ATOM   5150 C  CG    . GLN B 1 126 ? 103.665 109.694 131.501 1.00 10.88  ? 126  GLN B CG    1 
ATOM   5151 C  CD    . GLN B 1 126 ? 102.234 110.024 131.819 1.00 10.88  ? 126  GLN B CD    1 
ATOM   5152 O  OE1   . GLN B 1 126 ? 101.690 110.999 131.319 1.00 10.88  ? 126  GLN B OE1   1 
ATOM   5153 N  NE2   . GLN B 1 126 ? 101.607 109.199 132.646 1.00 10.88  ? 126  GLN B NE2   1 
ATOM   5154 N  N     . ASP B 1 127 ? 105.594 109.073 128.127 1.00 13.38  ? 127  ASP B N     1 
ATOM   5155 C  CA    . ASP B 1 127 ? 105.397 107.845 127.364 1.00 13.38  ? 127  ASP B CA    1 
ATOM   5156 C  C     . ASP B 1 127 ? 106.632 107.398 126.583 1.00 13.38  ? 127  ASP B C     1 
ATOM   5157 O  O     . ASP B 1 127 ? 106.496 106.650 125.611 1.00 13.38  ? 127  ASP B O     1 
ATOM   5158 C  CB    . ASP B 1 127 ? 104.212 107.977 126.412 1.00 13.38  ? 127  ASP B CB    1 
ATOM   5159 C  CG    . ASP B 1 127 ? 102.883 107.910 127.123 1.00 13.38  ? 127  ASP B CG    1 
ATOM   5160 O  OD1   . ASP B 1 127 ? 102.815 107.282 128.197 1.00 13.38  ? 127  ASP B OD1   1 
ATOM   5161 O  OD2   . ASP B 1 127 ? 101.899 108.472 126.596 1.00 13.38  ? 127  ASP B OD2   1 
ATOM   5162 N  N     . ASP B 1 128 ? 107.824 107.850 126.989 1.00 12.17  ? 128  ASP B N     1 
ATOM   5163 C  CA    . ASP B 1 128 ? 109.112 107.220 126.668 1.00 12.17  ? 128  ASP B CA    1 
ATOM   5164 C  C     . ASP B 1 128 ? 109.387 107.175 125.160 1.00 12.17  ? 128  ASP B C     1 
ATOM   5165 O  O     . ASP B 1 128 ? 109.379 106.118 124.529 1.00 12.17  ? 128  ASP B O     1 
ATOM   5166 C  CB    . ASP B 1 128 ? 109.179 105.810 127.266 1.00 12.17  ? 128  ASP B CB    1 
ATOM   5167 C  CG    . ASP B 1 128 ? 109.240 105.824 128.772 1.00 12.17  ? 128  ASP B CG    1 
ATOM   5168 O  OD1   . ASP B 1 128 ? 109.792 106.797 129.323 1.00 12.17  ? 128  ASP B OD1   1 
ATOM   5169 O  OD2   . ASP B 1 128 ? 108.732 104.871 129.401 1.00 12.17  ? 128  ASP B OD2   1 
ATOM   5170 N  N     . VAL B 1 129 ? 109.597 108.356 124.587 1.00 11.02  ? 129  VAL B N     1 
ATOM   5171 C  CA    . VAL B 1 129 ? 109.926 108.473 123.171 1.00 11.02  ? 129  VAL B CA    1 
ATOM   5172 C  C     . VAL B 1 129 ? 111.431 108.258 123.033 1.00 11.02  ? 129  VAL B C     1 
ATOM   5173 O  O     . VAL B 1 129 ? 112.229 109.158 123.287 1.00 11.02  ? 129  VAL B O     1 
ATOM   5174 C  CB    . VAL B 1 129 ? 109.482 109.817 122.597 1.00 11.02  ? 129  VAL B CB    1 
ATOM   5175 C  CG1   . VAL B 1 129 ? 109.792 109.885 121.118 1.00 11.02  ? 129  VAL B CG1   1 
ATOM   5176 C  CG2   . VAL B 1 129 ? 108.002 110.033 122.848 1.00 11.02  ? 129  VAL B CG2   1 
ATOM   5177 N  N     . VAL B 1 130 ? 111.820 107.053 122.629 1.00 10.60  ? 130  VAL B N     1 
ATOM   5178 C  CA    . VAL B 1 130 ? 113.219 106.661 122.505 1.00 10.60  ? 130  VAL B CA    1 
ATOM   5179 C  C     . VAL B 1 130 ? 113.344 105.746 121.292 1.00 10.60  ? 130  VAL B C     1 
ATOM   5180 O  O     . VAL B 1 130 ? 112.444 104.949 121.012 1.00 10.60  ? 130  VAL B O     1 
ATOM   5181 C  CB    . VAL B 1 130 ? 113.723 106.010 123.821 1.00 10.60  ? 130  VAL B CB    1 
ATOM   5182 C  CG1   . VAL B 1 130 ? 112.911 104.813 124.189 1.00 10.60  ? 130  VAL B CG1   1 
ATOM   5183 C  CG2   . VAL B 1 130 ? 115.177 105.627 123.747 1.00 10.60  ? 130  VAL B CG2   1 
ATOM   5184 N  N     . MET B 1 131 ? 114.424 105.910 120.527 1.00 9.20   ? 131  MET B N     1 
ATOM   5185 C  CA    . MET B 1 131 ? 114.637 105.099 119.334 1.00 9.20   ? 131  MET B CA    1 
ATOM   5186 C  C     . MET B 1 131 ? 114.991 103.666 119.715 1.00 9.20   ? 131  MET B C     1 
ATOM   5187 O  O     . MET B 1 131 ? 115.977 103.425 120.415 1.00 9.20   ? 131  MET B O     1 
ATOM   5188 C  CB    . MET B 1 131 ? 115.727 105.715 118.458 1.00 9.20   ? 131  MET B CB    1 
ATOM   5189 C  CG    . MET B 1 131 ? 116.036 104.898 117.224 1.00 9.20   ? 131  MET B CG    1 
ATOM   5190 S  SD    . MET B 1 131 ? 117.127 105.659 116.022 1.00 9.20   ? 131  MET B SD    1 
ATOM   5191 C  CE    . MET B 1 131 ? 116.006 106.680 115.104 1.00 9.20   ? 131  MET B CE    1 
ATOM   5192 N  N     . GLY B 1 132 ? 114.178 102.719 119.257 1.00 8.93   ? 132  GLY B N     1 
ATOM   5193 C  CA    . GLY B 1 132 ? 114.323 101.317 119.570 1.00 8.93   ? 132  GLY B CA    1 
ATOM   5194 C  C     . GLY B 1 132 ? 115.103 100.498 118.568 1.00 8.93   ? 132  GLY B C     1 
ATOM   5195 O  O     . GLY B 1 132 ? 115.036 99.264  118.601 1.00 8.93   ? 132  GLY B O     1 
ATOM   5196 N  N     . THR B 1 133 ? 115.813 101.126 117.653 1.00 9.32   ? 133  THR B N     1 
ATOM   5197 C  CA    . THR B 1 133 ? 116.781 100.405 116.856 1.00 9.32   ? 133  THR B CA    1 
ATOM   5198 C  C     . THR B 1 133 ? 118.191 100.718 117.299 1.00 9.32   ? 133  THR B C     1 
ATOM   5199 O  O     . THR B 1 133 ? 119.145 100.167 116.748 1.00 9.32   ? 133  THR B O     1 
ATOM   5200 C  CB    . THR B 1 133 ? 116.599 100.732 115.376 1.00 9.32   ? 133  THR B CB    1 
ATOM   5201 O  OG1   . THR B 1 133 ? 116.750 102.136 115.180 1.00 9.32   ? 133  THR B OG1   1 
ATOM   5202 C  CG2   . THR B 1 133 ? 115.224 100.314 114.918 1.00 9.32   ? 133  THR B CG2   1 
ATOM   5203 N  N     . LEU B 1 134 ? 118.339 101.601 118.265 1.00 8.67   ? 134  LEU B N     1 
ATOM   5204 C  CA    . LEU B 1 134 ? 119.600 101.859 118.923 1.00 8.67   ? 134  LEU B CA    1 
ATOM   5205 C  C     . LEU B 1 134 ? 119.634 101.171 120.277 1.00 8.67   ? 134  LEU B C     1 
ATOM   5206 O  O     . LEU B 1 134 ? 118.739 100.415 120.648 1.00 8.67   ? 134  LEU B O     1 
ATOM   5207 C  CB    . LEU B 1 134 ? 119.840 103.359 119.047 1.00 8.67   ? 134  LEU B CB    1 
ATOM   5208 C  CG    . LEU B 1 134 ? 120.774 103.988 118.023 1.00 8.67   ? 134  LEU B CG    1 
ATOM   5209 C  CD1   . LEU B 1 134 ? 120.245 103.890 116.618 1.00 8.67   ? 134  LEU B CD1   1 
ATOM   5210 C  CD2   . LEU B 1 134 ? 120.990 105.428 118.426 1.00 8.67   ? 134  LEU B CD2   1 
ATOM   5211 N  N     . THR B 1 135 ? 120.683 101.450 121.021 1.00 9.02   ? 135  THR B N     1 
ATOM   5212 C  CA    . THR B 1 135 ? 121.036 100.790 122.257 1.00 9.02   ? 135  THR B CA    1 
ATOM   5213 C  C     . THR B 1 135 ? 120.820 101.795 123.388 1.00 9.02   ? 135  THR B C     1 
ATOM   5214 O  O     . THR B 1 135 ? 120.630 102.985 123.138 1.00 9.02   ? 135  THR B O     1 
ATOM   5215 C  CB    . THR B 1 135 ? 122.488 100.309 122.141 1.00 9.02   ? 135  THR B CB    1 
ATOM   5216 O  OG1   . THR B 1 135 ? 122.647 99.645  120.886 1.00 9.02   ? 135  THR B OG1   1 
ATOM   5217 C  CG2   . THR B 1 135 ? 122.829 99.306  123.133 1.00 9.02   ? 135  THR B CG2   1 
ATOM   5218 N  N     . VAL B 1 136 ? 120.777 101.307 124.631 1.00 8.68   ? 136  VAL B N     1 
ATOM   5219 C  CA    . VAL B 1 136 ? 120.712 102.196 125.790 1.00 8.68   ? 136  VAL B CA    1 
ATOM   5220 C  C     . VAL B 1 136 ? 121.944 103.091 125.849 1.00 8.68   ? 136  VAL B C     1 
ATOM   5221 O  O     . VAL B 1 136 ? 121.844 104.286 126.132 1.00 8.68   ? 136  VAL B O     1 
ATOM   5222 C  CB    . VAL B 1 136 ? 120.528 101.369 127.076 1.00 8.68   ? 136  VAL B CB    1 
ATOM   5223 C  CG1   . VAL B 1 136 ? 120.636 102.225 128.311 1.00 8.68   ? 136  VAL B CG1   1 
ATOM   5224 C  CG2   . VAL B 1 136 ? 119.189 100.672 127.050 1.00 8.68   ? 136  VAL B CG2   1 
ATOM   5225 N  N     . ARG B 1 137 ? 123.114 102.550 125.521 1.00 9.90   ? 137  ARG B N     1 
ATOM   5226 C  CA    . ARG B 1 137 ? 124.293 103.403 125.457 1.00 9.90   ? 137  ARG B CA    1 
ATOM   5227 C  C     . ARG B 1 137 ? 124.282 104.281 124.215 1.00 9.90   ? 137  ARG B C     1 
ATOM   5228 O  O     . ARG B 1 137 ? 124.715 105.430 124.280 1.00 9.90   ? 137  ARG B O     1 
ATOM   5229 C  CB    . ARG B 1 137 ? 125.561 102.564 125.505 1.00 9.90   ? 137  ARG B CB    1 
ATOM   5230 C  CG    . ARG B 1 137 ? 126.837 103.357 125.658 1.00 9.90   ? 137  ARG B CG    1 
ATOM   5231 C  CD    . ARG B 1 137 ? 128.027 102.438 125.695 1.00 9.90   ? 137  ARG B CD    1 
ATOM   5232 N  NE    . ARG B 1 137 ? 127.991 101.575 126.864 1.00 9.90   ? 137  ARG B NE    1 
ATOM   5233 C  CZ    . ARG B 1 137 ? 128.476 101.919 128.048 1.00 9.90   ? 137  ARG B CZ    1 
ATOM   5234 N  NH1   . ARG B 1 137 ? 129.043 103.105 128.211 1.00 9.90   ? 137  ARG B NH1   1 
ATOM   5235 N  NH2   . ARG B 1 137 ? 128.399 101.074 129.063 1.00 9.90   ? 137  ARG B NH2   1 
ATOM   5236 N  N     . GLU B 1 138 ? 123.772 103.778 123.091 1.00 8.49   ? 138  GLU B N     1 
ATOM   5237 C  CA    . GLU B 1 138 ? 123.788 104.560 121.857 1.00 8.49   ? 138  GLU B CA    1 
ATOM   5238 C  C     . GLU B 1 138 ? 122.774 105.692 121.876 1.00 8.49   ? 138  GLU B C     1 
ATOM   5239 O  O     . GLU B 1 138 ? 122.981 106.712 121.214 1.00 8.49   ? 138  GLU B O     1 
ATOM   5240 C  CB    . GLU B 1 138 ? 123.536 103.662 120.654 1.00 8.49   ? 138  GLU B CB    1 
ATOM   5241 C  CG    . GLU B 1 138 ? 124.685 102.758 120.309 1.00 8.49   ? 138  GLU B CG    1 
ATOM   5242 C  CD    . GLU B 1 138 ? 124.364 101.832 119.161 1.00 8.49   ? 138  GLU B CD    1 
ATOM   5243 O  OE1   . GLU B 1 138 ? 123.190 101.780 118.753 1.00 8.49   ? 138  GLU B OE1   1 
ATOM   5244 O  OE2   . GLU B 1 138 ? 125.284 101.157 118.660 1.00 8.49   ? 138  GLU B OE2   1 
ATOM   5245 N  N     . ASN B 1 139 ? 121.673 105.533 122.605 1.00 7.64   ? 139  ASN B N     1 
ATOM   5246 C  CA    . ASN B 1 139 ? 120.733 106.629 122.775 1.00 7.64   ? 139  ASN B CA    1 
ATOM   5247 C  C     . ASN B 1 139 ? 121.262 107.673 123.738 1.00 7.64   ? 139  ASN B C     1 
ATOM   5248 O  O     . ASN B 1 139 ? 120.910 108.849 123.626 1.00 7.64   ? 139  ASN B O     1 
ATOM   5249 C  CB    . ASN B 1 139 ? 119.393 106.097 123.265 1.00 7.64   ? 139  ASN B CB    1 
ATOM   5250 C  CG    . ASN B 1 139 ? 118.630 105.376 122.192 1.00 7.64   ? 139  ASN B CG    1 
ATOM   5251 O  OD1   . ASN B 1 139 ? 118.546 105.839 121.064 1.00 7.64   ? 139  ASN B OD1   1 
ATOM   5252 N  ND2   . ASN B 1 139 ? 118.073 104.233 122.534 1.00 7.64   ? 139  ASN B ND2   1 
ATOM   5253 N  N     . LEU B 1 140 ? 122.091 107.262 124.688 1.00 8.61   ? 140  LEU B N     1 
ATOM   5254 C  CA    . LEU B 1 140 ? 122.772 108.193 125.573 1.00 8.61   ? 140  LEU B CA    1 
ATOM   5255 C  C     . LEU B 1 140 ? 123.960 108.851 124.891 1.00 8.61   ? 140  LEU B C     1 
ATOM   5256 O  O     . LEU B 1 140 ? 124.299 109.990 125.212 1.00 8.61   ? 140  LEU B O     1 
ATOM   5257 C  CB    . LEU B 1 140 ? 123.225 107.458 126.833 1.00 8.61   ? 140  LEU B CB    1 
ATOM   5258 C  CG    . LEU B 1 140 ? 122.364 107.360 128.098 1.00 8.61   ? 140  LEU B CG    1 
ATOM   5259 C  CD1   . LEU B 1 140 ? 122.316 108.681 128.774 1.00 8.61   ? 140  LEU B CD1   1 
ATOM   5260 C  CD2   . LEU B 1 140 ? 120.952 106.904 127.840 1.00 8.61   ? 140  LEU B CD2   1 
ATOM   5261 N  N     . GLN B 1 141 ? 124.608 108.154 123.960 1.00 10.01  ? 141  GLN B N     1 
ATOM   5262 C  CA    . GLN B 1 141 ? 125.699 108.762 123.209 1.00 10.01  ? 141  GLN B CA    1 
ATOM   5263 C  C     . GLN B 1 141 ? 125.190 109.771 122.199 1.00 10.01  ? 141  GLN B C     1 
ATOM   5264 O  O     . GLN B 1 141 ? 125.879 110.752 121.912 1.00 10.01  ? 141  GLN B O     1 
ATOM   5265 C  CB    . GLN B 1 141 ? 126.524 107.688 122.512 1.00 10.01  ? 141  GLN B CB    1 
ATOM   5266 C  CG    . GLN B 1 141 ? 127.438 106.913 123.426 1.00 10.01  ? 141  GLN B CG    1 
ATOM   5267 C  CD    . GLN B 1 141 ? 128.052 105.736 122.730 1.00 10.01  ? 141  GLN B CD    1 
ATOM   5268 O  OE1   . GLN B 1 141 ? 127.708 105.437 121.593 1.00 10.01  ? 141  GLN B OE1   1 
ATOM   5269 N  NE2   . GLN B 1 141 ? 128.965 105.056 123.403 1.00 10.01  ? 141  GLN B NE2   1 
ATOM   5270 N  N     . PHE B 1 142 ? 123.993 109.555 121.659 1.00 8.67   ? 142  PHE B N     1 
ATOM   5271 C  CA    . PHE B 1 142 ? 123.425 110.497 120.704 1.00 8.67   ? 142  PHE B CA    1 
ATOM   5272 C  C     . PHE B 1 142 ? 122.949 111.764 121.398 1.00 8.67   ? 142  PHE B C     1 
ATOM   5273 O  O     . PHE B 1 142 ? 123.075 112.862 120.850 1.00 8.67   ? 142  PHE B O     1 
ATOM   5274 C  CB    . PHE B 1 142 ? 122.276 109.835 119.950 1.00 8.67   ? 142  PHE B CB    1 
ATOM   5275 C  CG    . PHE B 1 142 ? 121.679 110.692 118.880 1.00 8.67   ? 142  PHE B CG    1 
ATOM   5276 C  CD1   . PHE B 1 142 ? 122.321 110.852 117.674 1.00 8.67   ? 142  PHE B CD1   1 
ATOM   5277 C  CD2   . PHE B 1 142 ? 120.475 111.336 119.076 1.00 8.67   ? 142  PHE B CD2   1 
ATOM   5278 C  CE1   . PHE B 1 142 ? 121.776 111.634 116.691 1.00 8.67   ? 142  PHE B CE1   1 
ATOM   5279 C  CE2   . PHE B 1 142 ? 119.936 112.120 118.091 1.00 8.67   ? 142  PHE B CE2   1 
ATOM   5280 C  CZ    . PHE B 1 142 ? 120.584 112.261 116.898 1.00 8.67   ? 142  PHE B CZ    1 
ATOM   5281 N  N     . SER B 1 143 ? 122.393 111.630 122.600 1.00 9.30   ? 143  SER B N     1 
ATOM   5282 C  CA    . SER B 1 143 ? 121.880 112.784 123.326 1.00 9.30   ? 143  SER B CA    1 
ATOM   5283 C  C     . SER B 1 143 ? 123.007 113.655 123.857 1.00 9.30   ? 143  SER B C     1 
ATOM   5284 O  O     . SER B 1 143 ? 122.876 114.879 123.909 1.00 9.30   ? 143  SER B O     1 
ATOM   5285 C  CB    . SER B 1 143 ? 120.986 112.314 124.464 1.00 9.30   ? 143  SER B CB    1 
ATOM   5286 O  OG    . SER B 1 143 ? 120.553 113.402 125.245 1.00 9.30   ? 143  SER B OG    1 
ATOM   5287 N  N     . ALA B 1 144 ? 124.119 113.047 124.257 1.00 10.56  ? 144  ALA B N     1 
ATOM   5288 C  CA    . ALA B 1 144 ? 125.256 113.816 124.734 1.00 10.56  ? 144  ALA B CA    1 
ATOM   5289 C  C     . ALA B 1 144 ? 126.044 114.449 123.606 1.00 10.56  ? 144  ALA B C     1 
ATOM   5290 O  O     . ALA B 1 144 ? 126.741 115.439 123.834 1.00 10.56  ? 144  ALA B O     1 
ATOM   5291 C  CB    . ALA B 1 144 ? 126.192 112.935 125.551 1.00 10.56  ? 144  ALA B CB    1 
ATOM   5292 N  N     . ALA B 1 145 ? 125.960 113.900 122.403 1.00 10.26  ? 145  ALA B N     1 
ATOM   5293 C  CA    . ALA B 1 145 ? 126.716 114.436 121.288 1.00 10.26  ? 145  ALA B CA    1 
ATOM   5294 C  C     . ALA B 1 145 ? 126.116 115.706 120.725 1.00 10.26  ? 145  ALA B C     1 
ATOM   5295 O  O     . ALA B 1 145 ? 126.828 116.474 120.078 1.00 10.26  ? 145  ALA B O     1 
ATOM   5296 C  CB    . ALA B 1 145 ? 126.806 113.402 120.180 1.00 10.26  ? 145  ALA B CB    1 
ATOM   5297 N  N     . LEU B 1 146 ? 124.829 115.938 120.939 1.00 9.86   ? 146  LEU B N     1 
ATOM   5298 C  CA    . LEU B 1 146 ? 124.155 117.081 120.356 1.00 9.86   ? 146  LEU B CA    1 
ATOM   5299 C  C     . LEU B 1 146 ? 123.691 118.094 121.383 1.00 9.86   ? 146  LEU B C     1 
ATOM   5300 O  O     . LEU B 1 146 ? 123.325 119.208 121.005 1.00 9.86   ? 146  LEU B O     1 
ATOM   5301 C  CB    . LEU B 1 146 ? 122.953 116.623 119.524 1.00 9.86   ? 146  LEU B CB    1 
ATOM   5302 C  CG    . LEU B 1 146 ? 123.319 115.785 118.309 1.00 9.86   ? 146  LEU B CG    1 
ATOM   5303 C  CD1   . LEU B 1 146 ? 122.097 115.417 117.529 1.00 9.86   ? 146  LEU B CD1   1 
ATOM   5304 C  CD2   . LEU B 1 146 ? 124.286 116.542 117.454 1.00 9.86   ? 146  LEU B CD2   1 
ATOM   5305 N  N     . ARG B 1 147 ? 123.698 117.747 122.659 1.00 10.68  ? 147  ARG B N     1 
ATOM   5306 C  CA    . ARG B 1 147 ? 123.225 118.646 123.688 1.00 10.68  ? 147  ARG B CA    1 
ATOM   5307 C  C     . ARG B 1 147 ? 124.311 119.029 124.680 1.00 10.68  ? 147  ARG B C     1 
ATOM   5308 O  O     . ARG B 1 147 ? 124.035 119.779 125.618 1.00 10.68  ? 147  ARG B O     1 
ATOM   5309 C  CB    . ARG B 1 147 ? 122.034 118.021 124.410 1.00 10.68  ? 147  ARG B CB    1 
ATOM   5310 C  CG    . ARG B 1 147 ? 120.876 117.699 123.489 1.00 10.68  ? 147  ARG B CG    1 
ATOM   5311 C  CD    . ARG B 1 147 ? 119.725 117.056 124.220 1.00 10.68  ? 147  ARG B CD    1 
ATOM   5312 N  NE    . ARG B 1 147 ? 118.990 117.978 125.073 1.00 10.68  ? 147  ARG B NE    1 
ATOM   5313 C  CZ    . ARG B 1 147 ? 118.006 117.611 125.887 1.00 10.68  ? 147  ARG B CZ    1 
ATOM   5314 N  NH1   . ARG B 1 147 ? 117.634 116.343 125.952 1.00 10.68  ? 147  ARG B NH1   1 
ATOM   5315 N  NH2   . ARG B 1 147 ? 117.395 118.518 126.636 1.00 10.68  ? 147  ARG B NH2   1 
ATOM   5316 N  N     . LEU B 1 148 ? 125.530 118.536 124.506 1.00 13.83  ? 148  LEU B N     1 
ATOM   5317 C  CA    . LEU B 1 148 ? 126.696 119.054 125.198 1.00 13.83  ? 148  LEU B CA    1 
ATOM   5318 C  C     . LEU B 1 148 ? 127.611 119.728 124.185 1.00 13.83  ? 148  LEU B C     1 
ATOM   5319 O  O     . LEU B 1 148 ? 127.618 119.376 123.004 1.00 13.83  ? 148  LEU B O     1 
ATOM   5320 C  CB    . LEU B 1 148 ? 127.450 117.946 125.935 1.00 13.83  ? 148  LEU B CB    1 
ATOM   5321 C  CG    . LEU B 1 148 ? 126.763 117.247 127.108 1.00 13.83  ? 148  LEU B CG    1 
ATOM   5322 C  CD1   . LEU B 1 148 ? 127.635 116.130 127.631 1.00 13.83  ? 148  LEU B CD1   1 
ATOM   5323 C  CD2   . LEU B 1 148 ? 126.443 118.218 128.215 1.00 13.83  ? 148  LEU B CD2   1 
ATOM   5324 N  N     . ALA B 1 149 ? 128.374 120.709 124.645 1.00 19.11  ? 149  ALA B N     1 
ATOM   5325 C  CA    . ALA B 1 149 ? 129.219 121.465 123.738 1.00 19.11  ? 149  ALA B CA    1 
ATOM   5326 C  C     . ALA B 1 149 ? 130.443 120.653 123.338 1.00 19.11  ? 149  ALA B C     1 
ATOM   5327 O  O     . ALA B 1 149 ? 130.851 119.719 124.027 1.00 19.11  ? 149  ALA B O     1 
ATOM   5328 C  CB    . ALA B 1 149 ? 129.648 122.782 124.377 1.00 19.11  ? 149  ALA B CB    1 
ATOM   5329 N  N     . THR B 1 150 ? 131.034 121.024 122.203 1.00 22.24  ? 150  THR B N     1 
ATOM   5330 C  CA    . THR B 1 150 ? 132.213 120.338 121.687 1.00 22.24  ? 150  THR B CA    1 
ATOM   5331 C  C     . THR B 1 150 ? 133.510 120.820 122.313 1.00 22.24  ? 150  THR B C     1 
ATOM   5332 O  O     . THR B 1 150 ? 134.581 120.405 121.862 1.00 22.24  ? 150  THR B O     1 
ATOM   5333 C  CB    . THR B 1 150 ? 132.305 120.488 120.171 1.00 22.24  ? 150  THR B CB    1 
ATOM   5334 O  OG1   . THR B 1 150 ? 132.324 121.878 119.824 1.00 22.24  ? 150  THR B OG1   1 
ATOM   5335 C  CG2   . THR B 1 150 ? 131.144 119.803 119.502 1.00 22.24  ? 150  THR B CG2   1 
ATOM   5336 N  N     . THR B 1 151 ? 133.448 121.686 123.324 1.00 23.48  ? 151  THR B N     1 
ATOM   5337 C  CA    . THR B 1 151 ? 134.616 121.908 124.164 1.00 23.48  ? 151  THR B CA    1 
ATOM   5338 C  C     . THR B 1 151 ? 134.958 120.656 124.958 1.00 23.48  ? 151  THR B C     1 
ATOM   5339 O  O     . THR B 1 151 ? 136.125 120.428 125.291 1.00 23.48  ? 151  THR B O     1 
ATOM   5340 C  CB    . THR B 1 151 ? 134.368 123.082 125.104 1.00 23.48  ? 151  THR B CB    1 
ATOM   5341 O  OG1   . THR B 1 151 ? 133.253 122.784 125.951 1.00 23.48  ? 151  THR B OG1   1 
ATOM   5342 C  CG2   . THR B 1 151 ? 134.065 124.335 124.308 1.00 23.48  ? 151  THR B CG2   1 
ATOM   5343 N  N     . MET B 1 152 ? 133.952 119.847 125.276 1.00 24.84  ? 152  MET B N     1 
ATOM   5344 C  CA    . MET B 1 152 ? 134.164 118.510 125.800 1.00 24.84  ? 152  MET B CA    1 
ATOM   5345 C  C     . MET B 1 152 ? 134.549 117.571 124.668 1.00 24.84  ? 152  MET B C     1 
ATOM   5346 O  O     . MET B 1 152 ? 133.928 117.585 123.602 1.00 24.84  ? 152  MET B O     1 
ATOM   5347 C  CB    . MET B 1 152 ? 132.896 118.007 126.475 1.00 24.84  ? 152  MET B CB    1 
ATOM   5348 C  CG    . MET B 1 152 ? 132.524 118.749 127.725 1.00 24.84  ? 152  MET B CG    1 
ATOM   5349 S  SD    . MET B 1 152 ? 130.946 118.143 128.297 1.00 24.84  ? 152  MET B SD    1 
ATOM   5350 C  CE    . MET B 1 152 ? 131.414 116.455 128.612 1.00 24.84  ? 152  MET B CE    1 
ATOM   5351 N  N     . THR B 1 153 ? 135.566 116.749 124.900 1.00 27.06  ? 153  THR B N     1 
ATOM   5352 C  CA    . THR B 1 153 ? 135.952 115.778 123.893 1.00 27.06  ? 153  THR B CA    1 
ATOM   5353 C  C     . THR B 1 153 ? 135.009 114.581 123.926 1.00 27.06  ? 153  THR B C     1 
ATOM   5354 O  O     . THR B 1 153 ? 134.132 114.468 124.783 1.00 27.06  ? 153  THR B O     1 
ATOM   5355 C  CB    . THR B 1 153 ? 137.399 115.337 124.099 1.00 27.06  ? 153  THR B CB    1 
ATOM   5356 O  OG1   . THR B 1 153 ? 137.792 114.469 123.028 1.00 27.06  ? 153  THR B OG1   1 
ATOM   5357 C  CG2   . THR B 1 153 ? 137.555 114.613 125.410 1.00 27.06  ? 153  THR B CG2   1 
ATOM   5358 N  N     . ASN B 1 154 ? 135.192 113.676 122.964 1.00 27.52  ? 154  ASN B N     1 
ATOM   5359 C  CA    . ASN B 1 154 ? 134.346 112.492 122.890 1.00 27.52  ? 154  ASN B CA    1 
ATOM   5360 C  C     . ASN B 1 154 ? 134.681 111.485 123.983 1.00 27.52  ? 154  ASN B C     1 
ATOM   5361 O  O     . ASN B 1 154 ? 133.858 110.614 124.278 1.00 27.52  ? 154  ASN B O     1 
ATOM   5362 C  CB    . ASN B 1 154 ? 134.483 111.839 121.515 1.00 27.52  ? 154  ASN B CB    1 
ATOM   5363 C  CG    . ASN B 1 154 ? 133.244 111.062 121.099 1.00 27.52  ? 154  ASN B CG    1 
ATOM   5364 O  OD1   . ASN B 1 154 ? 133.122 110.655 119.946 1.00 27.52  ? 154  ASN B OD1   1 
ATOM   5365 N  ND2   . ASN B 1 154 ? 132.307 110.883 122.019 1.00 27.52  ? 154  ASN B ND2   1 
ATOM   5366 N  N     . HIS B 1 155 ? 135.868 111.576 124.578 1.00 27.43  ? 155  HIS B N     1 
ATOM   5367 C  CA    . HIS B 1 155 ? 136.206 110.719 125.706 1.00 27.43  ? 155  HIS B CA    1 
ATOM   5368 C  C     . HIS B 1 155 ? 135.553 111.205 126.991 1.00 27.43  ? 155  HIS B C     1 
ATOM   5369 O  O     . HIS B 1 155 ? 135.078 110.393 127.790 1.00 27.43  ? 155  HIS B O     1 
ATOM   5370 C  CB    . HIS B 1 155 ? 137.722 110.655 125.875 1.00 27.43  ? 155  HIS B CB    1 
ATOM   5371 C  CG    . HIS B 1 155 ? 138.166 109.791 127.011 1.00 27.43  ? 155  HIS B CG    1 
ATOM   5372 N  ND1   . HIS B 1 155 ? 138.137 108.414 126.954 1.00 27.43  ? 155  HIS B ND1   1 
ATOM   5373 C  CD2   . HIS B 1 155 ? 138.649 110.107 128.235 1.00 27.43  ? 155  HIS B CD2   1 
ATOM   5374 C  CE1   . HIS B 1 155 ? 138.583 107.920 128.095 1.00 27.43  ? 155  HIS B CE1   1 
ATOM   5375 N  NE2   . HIS B 1 155 ? 138.901 108.926 128.889 1.00 27.43  ? 155  HIS B NE2   1 
ATOM   5376 N  N     . GLU B 1 156 ? 135.522 112.523 127.209 1.00 27.02  ? 156  GLU B N     1 
ATOM   5377 C  CA    . GLU B 1 156 ? 134.908 113.066 128.416 1.00 27.02  ? 156  GLU B CA    1 
ATOM   5378 C  C     . GLU B 1 156 ? 133.394 112.971 128.374 1.00 27.02  ? 156  GLU B C     1 
ATOM   5379 O  O     . GLU B 1 156 ? 132.754 112.946 129.429 1.00 27.02  ? 156  GLU B O     1 
ATOM   5380 C  CB    . GLU B 1 156 ? 135.328 114.518 128.626 1.00 27.02  ? 156  GLU B CB    1 
ATOM   5381 C  CG    . GLU B 1 156 ? 136.773 114.700 129.043 1.00 27.02  ? 156  GLU B CG    1 
ATOM   5382 C  CD    . GLU B 1 156 ? 137.159 116.161 129.171 1.00 27.02  ? 156  GLU B CD    1 
ATOM   5383 O  OE1   . GLU B 1 156 ? 136.335 117.027 128.812 1.00 27.02  ? 156  GLU B OE1   1 
ATOM   5384 O  OE2   . GLU B 1 156 ? 138.286 116.444 129.627 1.00 27.02  ? 156  GLU B OE2   1 
ATOM   5385 N  N     . LYS B 1 157 ? 132.801 112.932 127.180 1.00 20.55  ? 157  LYS B N     1 
ATOM   5386 C  CA    . LYS B 1 157 ? 131.364 112.707 127.093 1.00 20.55  ? 157  LYS B CA    1 
ATOM   5387 C  C     . LYS B 1 157 ? 131.010 111.278 127.466 1.00 20.55  ? 157  LYS B C     1 
ATOM   5388 O  O     . LYS B 1 157 ? 130.032 111.048 128.181 1.00 20.55  ? 157  LYS B O     1 
ATOM   5389 C  CB    . LYS B 1 157 ? 130.848 113.036 125.695 1.00 20.55  ? 157  LYS B CB    1 
ATOM   5390 C  CG    . LYS B 1 157 ? 130.785 114.515 125.389 1.00 20.55  ? 157  LYS B CG    1 
ATOM   5391 C  CD    . LYS B 1 157 ? 130.172 114.759 124.032 1.00 20.55  ? 157  LYS B CD    1 
ATOM   5392 C  CE    . LYS B 1 157 ? 130.103 116.230 123.715 1.00 20.55  ? 157  LYS B CE    1 
ATOM   5393 N  NZ    . LYS B 1 157 ? 129.519 116.468 122.374 1.00 20.55  ? 157  LYS B NZ    1 
ATOM   5394 N  N     . ASN B 1 158 ? 131.806 110.308 127.017 1.00 21.45  ? 158  ASN B N     1 
ATOM   5395 C  CA    . ASN B 1 158 ? 131.543 108.913 127.347 1.00 21.45  ? 158  ASN B CA    1 
ATOM   5396 C  C     . ASN B 1 158 ? 131.872 108.577 128.794 1.00 21.45  ? 158  ASN B C     1 
ATOM   5397 O  O     . ASN B 1 158 ? 131.395 107.557 129.296 1.00 21.45  ? 158  ASN B O     1 
ATOM   5398 C  CB    . ASN B 1 158 ? 132.325 107.992 126.415 1.00 21.45  ? 158  ASN B CB    1 
ATOM   5399 C  CG    . ASN B 1 158 ? 131.781 107.995 125.006 1.00 21.45  ? 158  ASN B CG    1 
ATOM   5400 O  OD1   . ASN B 1 158 ? 130.572 107.981 124.797 1.00 21.45  ? 158  ASN B OD1   1 
ATOM   5401 N  ND2   . ASN B 1 158 ? 132.674 108.010 124.029 1.00 21.45  ? 158  ASN B ND2   1 
ATOM   5402 N  N     . GLU B 1 159 ? 132.682 109.390 129.472 1.00 23.86  ? 159  GLU B N     1 
ATOM   5403 C  CA    . GLU B 1 159 ? 132.868 109.200 130.905 1.00 23.86  ? 159  GLU B CA    1 
ATOM   5404 C  C     . GLU B 1 159 ? 131.631 109.626 131.677 1.00 23.86  ? 159  GLU B C     1 
ATOM   5405 O  O     . GLU B 1 159 ? 131.288 109.018 132.695 1.00 23.86  ? 159  GLU B O     1 
ATOM   5406 C  CB    . GLU B 1 159 ? 134.081 109.979 131.399 1.00 23.86  ? 159  GLU B CB    1 
ATOM   5407 C  CG    . GLU B 1 159 ? 135.413 109.434 130.948 1.00 23.86  ? 159  GLU B CG    1 
ATOM   5408 C  CD    . GLU B 1 159 ? 136.566 110.279 131.446 1.00 23.86  ? 159  GLU B CD    1 
ATOM   5409 O  OE1   . GLU B 1 159 ? 136.303 111.347 132.037 1.00 23.86  ? 159  GLU B OE1   1 
ATOM   5410 O  OE2   . GLU B 1 159 ? 137.732 109.881 131.246 1.00 23.86  ? 159  GLU B OE2   1 
ATOM   5411 N  N     . ARG B 1 160 ? 130.958 110.678 131.218 1.00 20.60  ? 160  ARG B N     1 
ATOM   5412 C  CA    . ARG B 1 160 ? 129.716 111.105 131.839 1.00 20.60  ? 160  ARG B CA    1 
ATOM   5413 C  C     . ARG B 1 160 ? 128.539 110.224 131.454 1.00 20.60  ? 160  ARG B C     1 
ATOM   5414 O  O     . ARG B 1 160 ? 127.555 110.182 132.192 1.00 20.60  ? 160  ARG B O     1 
ATOM   5415 C  CB    . ARG B 1 160 ? 129.423 112.558 131.474 1.00 20.60  ? 160  ARG B CB    1 
ATOM   5416 C  CG    . ARG B 1 160 ? 130.387 113.535 132.101 1.00 20.60  ? 160  ARG B CG    1 
ATOM   5417 C  CD    . ARG B 1 160 ? 130.108 114.959 131.676 1.00 20.60  ? 160  ARG B CD    1 
ATOM   5418 N  NE    . ARG B 1 160 ? 128.793 115.428 132.096 1.00 20.60  ? 160  ARG B NE    1 
ATOM   5419 C  CZ    . ARG B 1 160 ? 128.533 115.962 133.284 1.00 20.60  ? 160  ARG B CZ    1 
ATOM   5420 N  NH1   . ARG B 1 160 ? 129.498 116.088 134.185 1.00 20.60  ? 160  ARG B NH1   1 
ATOM   5421 N  NH2   . ARG B 1 160 ? 127.302 116.362 133.577 1.00 20.60  ? 160  ARG B NH2   1 
ATOM   5422 N  N     . ILE B 1 161 ? 128.613 109.527 130.323 1.00 17.18  ? 161  ILE B N     1 
ATOM   5423 C  CA    . ILE B 1 161 ? 127.581 108.559 129.970 1.00 17.18  ? 161  ILE B CA    1 
ATOM   5424 C  C     . ILE B 1 161 ? 127.721 107.298 130.810 1.00 17.18  ? 161  ILE B C     1 
ATOM   5425 O  O     . ILE B 1 161 ? 126.723 106.731 131.265 1.00 17.18  ? 161  ILE B O     1 
ATOM   5426 C  CB    . ILE B 1 161 ? 127.639 108.271 128.460 1.00 17.18  ? 161  ILE B CB    1 
ATOM   5427 C  CG1   . ILE B 1 161 ? 127.218 109.516 127.693 1.00 17.18  ? 161  ILE B CG1   1 
ATOM   5428 C  CG2   . ILE B 1 161 ? 126.742 107.128 128.068 1.00 17.18  ? 161  ILE B CG2   1 
ATOM   5429 C  CD1   . ILE B 1 161 ? 127.609 109.496 126.264 1.00 17.18  ? 161  ILE B CD1   1 
ATOM   5430 N  N     . ASN B 1 162 ? 128.959 106.863 131.062 1.00 17.61  ? 162  ASN B N     1 
ATOM   5431 C  CA    . ASN B 1 162 ? 129.191 105.722 131.942 1.00 17.61  ? 162  ASN B CA    1 
ATOM   5432 C  C     . ASN B 1 162 ? 128.772 106.015 133.373 1.00 17.61  ? 162  ASN B C     1 
ATOM   5433 O  O     . ASN B 1 162 ? 128.338 105.107 134.082 1.00 17.61  ? 162  ASN B O     1 
ATOM   5434 C  CB    . ASN B 1 162 ? 130.662 105.323 131.916 1.00 17.61  ? 162  ASN B CB    1 
ATOM   5435 C  CG    . ASN B 1 162 ? 131.063 104.668 130.622 1.00 17.61  ? 162  ASN B CG    1 
ATOM   5436 O  OD1   . ASN B 1 162 ? 130.326 103.856 130.072 1.00 17.61  ? 162  ASN B OD1   1 
ATOM   5437 N  ND2   . ASN B 1 162 ? 132.246 105.006 130.130 1.00 17.61  ? 162  ASN B ND2   1 
ATOM   5438 N  N     . ARG B 1 163 ? 128.884 107.268 133.807 1.00 19.93  ? 163  ARG B N     1 
ATOM   5439 C  CA    . ARG B 1 163 ? 128.487 107.632 135.162 1.00 19.93  ? 163  ARG B CA    1 
ATOM   5440 C  C     . ARG B 1 163 ? 126.973 107.617 135.317 1.00 19.93  ? 163  ARG B C     1 
ATOM   5441 O  O     . ARG B 1 163 ? 126.455 107.212 136.362 1.00 19.93  ? 163  ARG B O     1 
ATOM   5442 C  CB    . ARG B 1 163 ? 129.054 109.005 135.508 1.00 19.93  ? 163  ARG B CB    1 
ATOM   5443 C  CG    . ARG B 1 163 ? 128.831 109.444 136.933 1.00 19.93  ? 163  ARG B CG    1 
ATOM   5444 C  CD    . ARG B 1 163 ? 129.460 110.805 137.197 1.00 19.93  ? 163  ARG B CD    1 
ATOM   5445 N  NE    . ARG B 1 163 ? 130.911 110.773 137.038 1.00 19.93  ? 163  ARG B NE    1 
ATOM   5446 C  CZ    . ARG B 1 163 ? 131.584 111.464 136.123 1.00 19.93  ? 163  ARG B CZ    1 
ATOM   5447 N  NH1   . ARG B 1 163 ? 130.941 112.265 135.288 1.00 19.93  ? 163  ARG B NH1   1 
ATOM   5448 N  NH2   . ARG B 1 163 ? 132.903 111.364 136.050 1.00 19.93  ? 163  ARG B NH2   1 
ATOM   5449 N  N     . VAL B 1 164 ? 126.246 108.043 134.283 1.00 16.46  ? 164  VAL B N     1 
ATOM   5450 C  CA    . VAL B 1 164 ? 124.788 108.065 134.341 1.00 16.46  ? 164  VAL B CA    1 
ATOM   5451 C  C     . VAL B 1 164 ? 124.218 106.654 134.251 1.00 16.46  ? 164  VAL B C     1 
ATOM   5452 O  O     . VAL B 1 164 ? 123.204 106.345 134.887 1.00 16.46  ? 164  VAL B O     1 
ATOM   5453 C  CB    . VAL B 1 164 ? 124.268 109.015 133.244 1.00 16.46  ? 164  VAL B CB    1 
ATOM   5454 C  CG1   . VAL B 1 164 ? 122.775 108.942 133.065 1.00 16.46  ? 164  VAL B CG1   1 
ATOM   5455 C  CG2   . VAL B 1 164 ? 124.619 110.418 133.627 1.00 16.46  ? 164  VAL B CG2   1 
ATOM   5456 N  N     . ILE B 1 165 ? 124.886 105.762 133.519 1.00 15.21  ? 165  ILE B N     1 
ATOM   5457 C  CA    . ILE B 1 165 ? 124.470 104.363 133.468 1.00 15.21  ? 165  ILE B CA    1 
ATOM   5458 C  C     . ILE B 1 165 ? 124.671 103.685 134.822 1.00 15.21  ? 165  ILE B C     1 
ATOM   5459 O  O     . ILE B 1 165 ? 123.831 102.890 135.260 1.00 15.21  ? 165  ILE B O     1 
ATOM   5460 C  CB    . ILE B 1 165 ? 125.213 103.648 132.321 1.00 15.21  ? 165  ILE B CB    1 
ATOM   5461 C  CG1   . ILE B 1 165 ? 124.693 104.145 130.976 1.00 15.21  ? 165  ILE B CG1   1 
ATOM   5462 C  CG2   . ILE B 1 165 ? 125.073 102.152 132.384 1.00 15.21  ? 165  ILE B CG2   1 
ATOM   5463 C  CD1   . ILE B 1 165 ? 125.484 103.670 129.813 1.00 15.21  ? 165  ILE B CD1   1 
ATOM   5464 N  N     . GLN B 1 166 ? 125.744 104.032 135.538 1.00 18.42  ? 166  GLN B N     1 
ATOM   5465 C  CA    . GLN B 1 166 ? 125.950 103.480 136.876 1.00 18.42  ? 166  GLN B CA    1 
ATOM   5466 C  C     . GLN B 1 166 ? 124.947 104.039 137.878 1.00 18.42  ? 166  GLN B C     1 
ATOM   5467 O  O     . GLN B 1 166 ? 124.399 103.292 138.694 1.00 18.42  ? 166  GLN B O     1 
ATOM   5468 C  CB    . GLN B 1 166 ? 127.369 103.761 137.360 1.00 18.42  ? 166  GLN B CB    1 
ATOM   5469 C  CG    . GLN B 1 166 ? 128.460 103.058 136.587 1.00 18.42  ? 166  GLN B CG    1 
ATOM   5470 C  CD    . GLN B 1 166 ? 128.414 101.564 136.741 1.00 18.42  ? 166  GLN B CD    1 
ATOM   5471 O  OE1   . GLN B 1 166 ? 128.114 101.051 137.813 1.00 18.42  ? 166  GLN B OE1   1 
ATOM   5472 N  NE2   . GLN B 1 166 ? 128.732 100.851 135.670 1.00 18.42  ? 166  GLN B NE2   1 
ATOM   5473 N  N     . GLU B 1 167 ? 124.692 105.346 137.831 1.00 19.43  ? 167  GLU B N     1 
ATOM   5474 C  CA    . GLU B 1 167 ? 123.816 105.982 138.807 1.00 19.43  ? 167  GLU B CA    1 
ATOM   5475 C  C     . GLU B 1 167 ? 122.347 105.651 138.597 1.00 19.43  ? 167  GLU B C     1 
ATOM   5476 O  O     . GLU B 1 167 ? 121.572 105.729 139.553 1.00 19.43  ? 167  GLU B O     1 
ATOM   5477 C  CB    . GLU B 1 167 ? 124.029 107.491 138.775 1.00 19.43  ? 167  GLU B CB    1 
ATOM   5478 C  CG    . GLU B 1 167 ? 125.338 107.903 139.407 1.00 19.43  ? 167  GLU B CG    1 
ATOM   5479 C  CD    . GLU B 1 167 ? 125.660 109.365 139.219 1.00 19.43  ? 167  GLU B CD    1 
ATOM   5480 O  OE1   . GLU B 1 167 ? 124.990 110.024 138.396 1.00 19.43  ? 167  GLU B OE1   1 
ATOM   5481 O  OE2   . GLU B 1 167 ? 126.578 109.857 139.908 1.00 19.43  ? 167  GLU B OE2   1 
ATOM   5482 N  N     . LEU B 1 168 ? 121.944 105.277 137.388 1.00 13.30  ? 168  LEU B N     1 
ATOM   5483 C  CA    . LEU B 1 168 ? 120.569 104.873 137.138 1.00 13.30  ? 168  LEU B CA    1 
ATOM   5484 C  C     . LEU B 1 168 ? 120.364 103.369 137.181 1.00 13.30  ? 168  LEU B C     1 
ATOM   5485 O  O     . LEU B 1 168 ? 119.218 102.920 137.132 1.00 13.30  ? 168  LEU B O     1 
ATOM   5486 C  CB    . LEU B 1 168 ? 120.099 105.401 135.786 1.00 13.30  ? 168  LEU B CB    1 
ATOM   5487 C  CG    . LEU B 1 168 ? 119.857 106.897 135.681 1.00 13.30  ? 168  LEU B CG    1 
ATOM   5488 C  CD1   . LEU B 1 168 ? 119.668 107.224 134.260 1.00 13.30  ? 168  LEU B CD1   1 
ATOM   5489 C  CD2   . LEU B 1 168 ? 118.621 107.275 136.449 1.00 13.30  ? 168  LEU B CD2   1 
ATOM   5490 N  N     . GLY B 1 169 ? 121.428 102.584 137.273 1.00 15.27  ? 169  GLY B N     1 
ATOM   5491 C  CA    . GLY B 1 169 ? 121.278 101.145 137.330 1.00 15.27  ? 169  GLY B CA    1 
ATOM   5492 C  C     . GLY B 1 169 ? 121.030 100.503 135.988 1.00 15.27  ? 169  GLY B C     1 
ATOM   5493 O  O     . GLY B 1 169 ? 120.203 99.593  135.882 1.00 15.27  ? 169  GLY B O     1 
ATOM   5494 N  N     . LEU B 1 170 ? 121.734 100.946 134.956 1.00 13.40  ? 170  LEU B N     1 
ATOM   5495 C  CA    . LEU B 1 170 ? 121.519 100.478 133.596 1.00 13.40  ? 170  LEU B CA    1 
ATOM   5496 C  C     . LEU B 1 170 ? 122.679 99.628  133.089 1.00 13.40  ? 170  LEU B C     1 
ATOM   5497 O  O     . LEU B 1 170 ? 122.918 99.569  131.886 1.00 13.40  ? 170  LEU B O     1 
ATOM   5498 C  CB    . LEU B 1 170 ? 121.298 101.671 132.670 1.00 13.40  ? 170  LEU B CB    1 
ATOM   5499 C  CG    . LEU B 1 170 ? 120.025 102.485 132.851 1.00 13.40  ? 170  LEU B CG    1 
ATOM   5500 C  CD1   . LEU B 1 170 ? 120.124 103.773 132.080 1.00 13.40  ? 170  LEU B CD1   1 
ATOM   5501 C  CD2   . LEU B 1 170 ? 118.856 101.671 132.366 1.00 13.40  ? 170  LEU B CD2   1 
ATOM   5502 N  N     . ASP B 1 171 ? 123.406 98.966  133.993 1.00 17.04  ? 171  ASP B N     1 
ATOM   5503 C  CA    . ASP B 1 171 ? 124.634 98.278  133.600 1.00 17.04  ? 171  ASP B CA    1 
ATOM   5504 C  C     . ASP B 1 171 ? 124.351 97.014  132.806 1.00 17.04  ? 171  ASP B C     1 
ATOM   5505 O  O     . ASP B 1 171 ? 125.032 96.734  131.814 1.00 17.04  ? 171  ASP B O     1 
ATOM   5506 C  CB    . ASP B 1 171 ? 125.458 97.924  134.828 1.00 17.04  ? 171  ASP B CB    1 
ATOM   5507 C  CG    . ASP B 1 171 ? 126.081 99.119  135.465 1.00 17.04  ? 171  ASP B CG    1 
ATOM   5508 O  OD1   . ASP B 1 171 ? 126.302 100.123 134.761 1.00 17.04  ? 171  ASP B OD1   1 
ATOM   5509 O  OD2   . ASP B 1 171 ? 126.392 99.044  136.665 1.00 17.04  ? 171  ASP B OD2   1 
ATOM   5510 N  N     . LYS B 1 172 ? 123.365 96.232  133.236 1.00 17.49  ? 172  LYS B N     1 
ATOM   5511 C  CA    . LYS B 1 172 ? 123.074 94.966  132.582 1.00 17.49  ? 172  LYS B CA    1 
ATOM   5512 C  C     . LYS B 1 172 ? 122.420 95.148  131.222 1.00 17.49  ? 172  LYS B C     1 
ATOM   5513 O  O     . LYS B 1 172 ? 122.400 94.202  130.431 1.00 17.49  ? 172  LYS B O     1 
ATOM   5514 C  CB    . LYS B 1 172 ? 122.184 94.115  133.485 1.00 17.49  ? 172  LYS B CB    1 
ATOM   5515 C  CG    . LYS B 1 172 ? 122.875 93.663  134.754 1.00 17.49  ? 172  LYS B CG    1 
ATOM   5516 C  CD    . LYS B 1 172 ? 121.954 92.836  135.627 1.00 17.49  ? 172  LYS B CD    1 
ATOM   5517 C  CE    . LYS B 1 172 ? 122.704 92.272  136.819 1.00 17.49  ? 172  LYS B CE    1 
ATOM   5518 N  NZ    . LYS B 1 172 ? 123.184 93.343  137.732 1.00 17.49  ? 172  LYS B NZ    1 
ATOM   5519 N  N     . VAL B 1 173 ? 121.882 96.330  130.932 1.00 12.67  ? 173  VAL B N     1 
ATOM   5520 C  CA    . VAL B 1 173 ? 121.204 96.580  129.671 1.00 12.67  ? 173  VAL B CA    1 
ATOM   5521 C  C     . VAL B 1 173 ? 121.810 97.760  128.918 1.00 12.67  ? 173  VAL B C     1 
ATOM   5522 O  O     . VAL B 1 173 ? 121.195 98.267  128.004 1.00 12.67  ? 173  VAL B O     1 
ATOM   5523 C  CB    . VAL B 1 173 ? 119.693 96.784  129.883 1.00 12.67  ? 173  VAL B CB    1 
ATOM   5524 C  CG1   . VAL B 1 173 ? 119.063 95.517  130.404 1.00 12.67  ? 173  VAL B CG1   1 
ATOM   5525 C  CG2   . VAL B 1 173 ? 119.445 97.931  130.823 1.00 12.67  ? 173  VAL B CG2   1 
ATOM   5526 N  N     . ALA B 1 174 ? 123.021 98.189  129.282 1.00 11.96  ? 174  ALA B N     1 
ATOM   5527 C  CA    . ALA B 1 174 ? 123.664 99.300  128.584 1.00 11.96  ? 174  ALA B CA    1 
ATOM   5528 C  C     . ALA B 1 174 ? 123.999 98.950  127.145 1.00 11.96  ? 174  ALA B C     1 
ATOM   5529 O  O     . ALA B 1 174 ? 123.927 99.813  126.268 1.00 11.96  ? 174  ALA B O     1 
ATOM   5530 C  CB    . ALA B 1 174 ? 124.937 99.725  129.308 1.00 11.96  ? 174  ALA B CB    1 
ATOM   5531 N  N     . ASP B 1 175 ? 124.353 97.697  126.881 1.00 14.94  ? 175  ASP B N     1 
ATOM   5532 C  CA    . ASP B 1 175 ? 124.669 97.242  125.539 1.00 14.94  ? 175  ASP B CA    1 
ATOM   5533 C  C     . ASP B 1 175 ? 123.536 96.431  124.925 1.00 14.94  ? 175  ASP B C     1 
ATOM   5534 O  O     . ASP B 1 175 ? 123.766 95.679  123.975 1.00 14.94  ? 175  ASP B O     1 
ATOM   5535 C  CB    . ASP B 1 175 ? 125.966 96.440  125.557 1.00 14.94  ? 175  ASP B CB    1 
ATOM   5536 C  CG    . ASP B 1 175 ? 127.179 97.301  125.872 1.00 14.94  ? 175  ASP B CG    1 
ATOM   5537 O  OD1   . ASP B 1 175 ? 127.186 98.493  125.503 1.00 14.94  ? 175  ASP B OD1   1 
ATOM   5538 O  OD2   . ASP B 1 175 ? 128.124 96.788  126.502 1.00 14.94  ? 175  ASP B OD2   1 
ATOM   5539 N  N     . SER B 1 176 ? 122.316 96.596  125.429 1.00 12.33  ? 176  SER B N     1 
ATOM   5540 C  CA    . SER B 1 176 ? 121.136 95.916  124.916 1.00 12.33  ? 176  SER B CA    1 
ATOM   5541 C  C     . SER B 1 176 ? 120.250 96.899  124.169 1.00 12.33  ? 176  SER B C     1 
ATOM   5542 O  O     . SER B 1 176 ? 120.150 98.069  124.539 1.00 12.33  ? 176  SER B O     1 
ATOM   5543 C  CB    . SER B 1 176 ? 120.327 95.267  126.042 1.00 12.33  ? 176  SER B CB    1 
ATOM   5544 O  OG    . SER B 1 176 ? 121.059 94.246  126.691 1.00 12.33  ? 176  SER B OG    1 
ATOM   5545 N  N     . LYS B 1 177 ? 119.590 96.403  123.127 1.00 9.66   ? 177  LYS B N     1 
ATOM   5546 C  CA    . LYS B 1 177 ? 118.752 97.243  122.283 1.00 9.66   ? 177  LYS B CA    1 
ATOM   5547 C  C     . LYS B 1 177 ? 117.501 97.645  123.047 1.00 9.66   ? 177  LYS B C     1 
ATOM   5548 O  O     . LYS B 1 177 ? 116.867 96.805  123.690 1.00 9.66   ? 177  LYS B O     1 
ATOM   5549 C  CB    . LYS B 1 177 ? 118.355 96.492  121.015 1.00 9.66   ? 177  LYS B CB    1 
ATOM   5550 C  CG    . LYS B 1 177 ? 119.503 95.864  120.258 1.00 9.66   ? 177  LYS B CG    1 
ATOM   5551 C  CD    . LYS B 1 177 ? 120.416 96.873  119.624 1.00 9.66   ? 177  LYS B CD    1 
ATOM   5552 C  CE    . LYS B 1 177 ? 119.763 97.470  118.417 1.00 9.66   ? 177  LYS B CE    1 
ATOM   5553 N  NZ    . LYS B 1 177 ? 120.690 98.383  117.696 1.00 9.66   ? 177  LYS B NZ    1 
ATOM   5554 N  N     . VAL B 1 178 ? 117.167 98.937  123.009 1.00 9.08   ? 178  VAL B N     1 
ATOM   5555 C  CA    . VAL B 1 178 ? 115.842 99.363  123.431 1.00 9.08   ? 178  VAL B CA    1 
ATOM   5556 C  C     . VAL B 1 178 ? 114.854 98.747  122.460 1.00 9.08   ? 178  VAL B C     1 
ATOM   5557 O  O     . VAL B 1 178 ? 115.130 98.645  121.266 1.00 9.08   ? 178  VAL B O     1 
ATOM   5558 C  CB    . VAL B 1 178 ? 115.751 100.898 123.444 1.00 9.08   ? 178  VAL B CB    1 
ATOM   5559 C  CG1   . VAL B 1 178 ? 114.401 101.366 123.946 1.00 9.08   ? 178  VAL B CG1   1 
ATOM   5560 C  CG2   . VAL B 1 178 ? 116.857 101.487 124.273 1.00 9.08   ? 178  VAL B CG2   1 
ATOM   5561 N  N     . GLY B 1 179 ? 113.740 98.262  122.957 1.00 9.26   ? 179  GLY B N     1 
ATOM   5562 C  CA    . GLY B 1 179 ? 112.827 97.565  122.083 1.00 9.26   ? 179  GLY B CA    1 
ATOM   5563 C  C     . GLY B 1 179 ? 112.005 98.487  121.208 1.00 9.26   ? 179  GLY B C     1 
ATOM   5564 O  O     . GLY B 1 179 ? 111.840 99.674  121.468 1.00 9.26   ? 179  GLY B O     1 
ATOM   5565 N  N     . THR B 1 180 ? 111.491 97.921  120.129 1.00 10.61  ? 180  THR B N     1 
ATOM   5566 C  CA    . THR B 1 180 ? 110.394 98.526  119.400 1.00 10.61  ? 180  THR B CA    1 
ATOM   5567 C  C     . THR B 1 180 ? 109.104 97.893  119.906 1.00 10.61  ? 180  THR B C     1 
ATOM   5568 O  O     . THR B 1 180 ? 109.105 97.129  120.874 1.00 10.61  ? 180  THR B O     1 
ATOM   5569 C  CB    . THR B 1 180 ? 110.576 98.358  117.890 1.00 10.61  ? 180  THR B CB    1 
ATOM   5570 O  OG1   . THR B 1 180 ? 110.526 96.971  117.547 1.00 10.61  ? 180  THR B OG1   1 
ATOM   5571 C  CG2   . THR B 1 180 ? 111.909 98.913  117.459 1.00 10.61  ? 180  THR B CG2   1 
ATOM   5572 N  N     . GLN B 1 181 ? 107.988 98.204  119.262 1.00 12.50  ? 181  GLN B N     1 
ATOM   5573 C  CA    . GLN B 1 181 ? 106.719 97.615  119.657 1.00 12.50  ? 181  GLN B CA    1 
ATOM   5574 C  C     . GLN B 1 181 ? 106.477 96.260  119.017 1.00 12.50  ? 181  GLN B C     1 
ATOM   5575 O  O     . GLN B 1 181 ? 105.447 95.642  119.287 1.00 12.50  ? 181  GLN B O     1 
ATOM   5576 C  CB    . GLN B 1 181 ? 105.559 98.556  119.322 1.00 12.50  ? 181  GLN B CB    1 
ATOM   5577 C  CG    . GLN B 1 181 ? 105.356 98.789  117.854 1.00 12.50  ? 181  GLN B CG    1 
ATOM   5578 C  CD    . GLN B 1 181 ? 104.231 99.751  117.574 1.00 12.50  ? 181  GLN B CD    1 
ATOM   5579 O  OE1   . GLN B 1 181 ? 103.572 100.230 118.492 1.00 12.50  ? 181  GLN B OE1   1 
ATOM   5580 N  NE2   . GLN B 1 181 ? 103.994 100.035 116.300 1.00 12.50  ? 181  GLN B NE2   1 
ATOM   5581 N  N     . PHE B 1 182 ? 107.391 95.783  118.186 1.00 11.43  ? 182  PHE B N     1 
ATOM   5582 C  CA    . PHE B 1 182 ? 107.265 94.456  117.608 1.00 11.43  ? 182  PHE B CA    1 
ATOM   5583 C  C     . PHE B 1 182 ? 108.385 93.526  118.023 1.00 11.43  ? 182  PHE B C     1 
ATOM   5584 O  O     . PHE B 1 182 ? 108.141 92.344  118.254 1.00 11.43  ? 182  PHE B O     1 
ATOM   5585 C  CB    . PHE B 1 182 ? 107.208 94.543  116.083 1.00 11.43  ? 182  PHE B CB    1 
ATOM   5586 C  CG    . PHE B 1 182 ? 106.039 95.319  115.584 1.00 11.43  ? 182  PHE B CG    1 
ATOM   5587 C  CD1   . PHE B 1 182 ? 104.769 94.787  115.654 1.00 11.43  ? 182  PHE B CD1   1 
ATOM   5588 C  CD2   . PHE B 1 182 ? 106.207 96.580  115.048 1.00 11.43  ? 182  PHE B CD2   1 
ATOM   5589 C  CE1   . PHE B 1 182 ? 103.691 95.501  115.214 1.00 11.43  ? 182  PHE B CE1   1 
ATOM   5590 C  CE2   . PHE B 1 182 ? 105.129 97.291  114.595 1.00 11.43  ? 182  PHE B CE2   1 
ATOM   5591 C  CZ    . PHE B 1 182 ? 103.871 96.750  114.679 1.00 11.43  ? 182  PHE B CZ    1 
ATOM   5592 N  N     . ILE B 1 183 ? 109.605 94.030  118.132 1.00 10.12  ? 183  ILE B N     1 
ATOM   5593 C  CA    . ILE B 1 183 ? 110.714 93.274  118.689 1.00 10.12  ? 183  ILE B CA    1 
ATOM   5594 C  C     . ILE B 1 183 ? 110.892 93.732  120.125 1.00 10.12  ? 183  ILE B C     1 
ATOM   5595 O  O     . ILE B 1 183 ? 111.248 94.888  120.380 1.00 10.12  ? 183  ILE B O     1 
ATOM   5596 C  CB    . ILE B 1 183 ? 112.014 93.450  117.890 1.00 10.12  ? 183  ILE B CB    1 
ATOM   5597 C  CG1   . ILE B 1 183 ? 111.875 92.920  116.463 1.00 10.12  ? 183  ILE B CG1   1 
ATOM   5598 C  CG2   . ILE B 1 183 ? 113.145 92.729  118.578 1.00 10.12  ? 183  ILE B CG2   1 
ATOM   5599 C  CD1   . ILE B 1 183 ? 111.579 93.983  115.436 1.00 10.12  ? 183  ILE B CD1   1 
ATOM   5600 N  N     . ARG B 1 184 ? 110.617 92.826  121.054 1.00 9.06   ? 184  ARG B N     1 
ATOM   5601 C  CA    . ARG B 1 184 ? 110.829 93.064  122.470 1.00 9.06   ? 184  ARG B CA    1 
ATOM   5602 C  C     . ARG B 1 184 ? 112.308 93.262  122.774 1.00 9.06   ? 184  ARG B C     1 
ATOM   5603 O  O     . ARG B 1 184 ? 113.173 92.555  122.255 1.00 9.06   ? 184  ARG B O     1 
ATOM   5604 C  CB    . ARG B 1 184 ? 110.269 91.880  123.254 1.00 9.06   ? 184  ARG B CB    1 
ATOM   5605 C  CG    . ARG B 1 184 ? 110.623 91.812  124.708 1.00 9.06   ? 184  ARG B CG    1 
ATOM   5606 C  CD    . ARG B 1 184 ? 109.997 92.896  125.506 1.00 9.06   ? 184  ARG B CD    1 
ATOM   5607 N  NE    . ARG B 1 184 ? 110.362 92.745  126.904 1.00 9.06   ? 184  ARG B NE    1 
ATOM   5608 C  CZ    . ARG B 1 184 ? 109.680 92.000  127.760 1.00 9.06   ? 184  ARG B CZ    1 
ATOM   5609 N  NH1   . ARG B 1 184 ? 110.076 91.919  129.005 1.00 9.06   ? 184  ARG B NH1   1 
ATOM   5610 N  NH2   . ARG B 1 184 ? 108.600 91.335  127.372 1.00 9.06   ? 184  ARG B NH2   1 
ATOM   5611 N  N     . GLY B 1 185 ? 112.598 94.255  123.604 1.00 8.49   ? 185  GLY B N     1 
ATOM   5612 C  CA    . GLY B 1 185 ? 113.950 94.462  124.068 1.00 8.49   ? 185  GLY B CA    1 
ATOM   5613 C  C     . GLY B 1 185 ? 114.003 94.776  125.544 1.00 8.49   ? 185  GLY B C     1 
ATOM   5614 O  O     . GLY B 1 185 ? 113.486 94.027  126.371 1.00 8.49   ? 185  GLY B O     1 
ATOM   5615 N  N     . VAL B 1 186 ? 114.663 95.879  125.866 1.00 9.63   ? 186  VAL B N     1 
ATOM   5616 C  CA    . VAL B 1 186 ? 114.721 96.501  127.185 1.00 9.63   ? 186  VAL B CA    1 
ATOM   5617 C  C     . VAL B 1 186 ? 113.330 96.694  127.790 1.00 9.63   ? 186  VAL B C     1 
ATOM   5618 O  O     . VAL B 1 186 ? 112.389 97.094  127.096 1.00 9.63   ? 186  VAL B O     1 
ATOM   5619 C  CB    . VAL B 1 186 ? 115.507 97.818  127.039 1.00 9.63   ? 186  VAL B CB    1 
ATOM   5620 C  CG1   . VAL B 1 186 ? 115.185 98.809  128.084 1.00 9.63   ? 186  VAL B CG1   1 
ATOM   5621 C  CG2   . VAL B 1 186 ? 116.978 97.516  127.093 1.00 9.63   ? 186  VAL B CG2   1 
ATOM   5622 N  N     . SER B 1 187 ? 113.186 96.380  129.079 1.00 9.07   ? 187  SER B N     1 
ATOM   5623 C  CA    . SER B 1 187 ? 111.906 96.375  129.770 1.00 9.07   ? 187  SER B CA    1 
ATOM   5624 C  C     . SER B 1 187 ? 111.367 97.790  129.962 1.00 9.07   ? 187  SER B C     1 
ATOM   5625 O  O     . SER B 1 187 ? 112.014 98.783  129.639 1.00 9.07   ? 187  SER B O     1 
ATOM   5626 C  CB    . SER B 1 187 ? 112.037 95.667  131.112 1.00 9.07   ? 187  SER B CB    1 
ATOM   5627 O  OG    . SER B 1 187 ? 112.865 96.380  131.999 1.00 9.07   ? 187  SER B OG    1 
ATOM   5628 N  N     . GLY B 1 188 ? 110.158 97.876  130.520 1.00 9.07   ? 188  GLY B N     1 
ATOM   5629 C  CA    . GLY B 1 188 ? 109.456 99.145  130.579 1.00 9.07   ? 188  GLY B CA    1 
ATOM   5630 C  C     . GLY B 1 188 ? 110.022 100.121 131.584 1.00 9.07   ? 188  GLY B C     1 
ATOM   5631 O  O     . GLY B 1 188 ? 109.935 101.333 131.388 1.00 9.07   ? 188  GLY B O     1 
ATOM   5632 N  N     . GLY B 1 189 ? 110.597 99.620  132.667 1.00 8.84   ? 189  GLY B N     1 
ATOM   5633 C  CA    . GLY B 1 189 ? 111.227 100.478 133.645 1.00 8.84   ? 189  GLY B CA    1 
ATOM   5634 C  C     . GLY B 1 189 ? 112.656 100.791 133.280 1.00 8.84   ? 189  GLY B C     1 
ATOM   5635 O  O     . GLY B 1 189 ? 113.188 101.837 133.645 1.00 8.84   ? 189  GLY B O     1 
ATOM   5636 N  N     . GLU B 1 190 ? 113.291 99.877  132.556 1.00 9.65   ? 190  GLU B N     1 
ATOM   5637 C  CA    . GLU B 1 190 ? 114.637 100.113 132.058 1.00 9.65   ? 190  GLU B CA    1 
ATOM   5638 C  C     . GLU B 1 190 ? 114.645 101.061 130.871 1.00 9.65   ? 190  GLU B C     1 
ATOM   5639 O  O     . GLU B 1 190 ? 115.646 101.740 130.634 1.00 9.65   ? 190  GLU B O     1 
ATOM   5640 C  CB    . GLU B 1 190 ? 115.286 98.787  131.681 1.00 9.65   ? 190  GLU B CB    1 
ATOM   5641 C  CG    . GLU B 1 190 ? 115.648 97.914  132.841 1.00 9.65   ? 190  GLU B CG    1 
ATOM   5642 C  CD    . GLU B 1 190 ? 116.154 96.573  132.404 1.00 9.65   ? 190  GLU B CD    1 
ATOM   5643 O  OE1   . GLU B 1 190 ? 115.988 96.249  131.215 1.00 9.65   ? 190  GLU B OE1   1 
ATOM   5644 O  OE2   . GLU B 1 190 ? 116.726 95.845  133.238 1.00 9.65   ? 190  GLU B OE2   1 
ATOM   5645 N  N     . ARG B 1 191 ? 113.552 101.104 130.110 1.00 9.74   ? 191  ARG B N     1 
ATOM   5646 C  CA    . ARG B 1 191 ? 113.363 102.108 129.072 1.00 9.74   ? 191  ARG B CA    1 
ATOM   5647 C  C     . ARG B 1 191 ? 112.999 103.460 129.661 1.00 9.74   ? 191  ARG B C     1 
ATOM   5648 O  O     . ARG B 1 191 ? 113.343 104.495 129.084 1.00 9.74   ? 191  ARG B O     1 
ATOM   5649 C  CB    . ARG B 1 191 ? 112.273 101.644 128.109 1.00 9.74   ? 191  ARG B CB    1 
ATOM   5650 C  CG    . ARG B 1 191 ? 112.041 102.520 126.911 1.00 9.74   ? 191  ARG B CG    1 
ATOM   5651 C  CD    . ARG B 1 191 ? 110.945 101.967 126.037 1.00 9.74   ? 191  ARG B CD    1 
ATOM   5652 N  NE    . ARG B 1 191 ? 109.657 101.984 126.715 1.00 9.74   ? 191  ARG B NE    1 
ATOM   5653 C  CZ    . ARG B 1 191 ? 108.986 100.895 127.068 1.00 9.74   ? 191  ARG B CZ    1 
ATOM   5654 N  NH1   . ARG B 1 191 ? 109.486 99.694  126.814 1.00 9.74   ? 191  ARG B NH1   1 
ATOM   5655 N  NH2   . ARG B 1 191 ? 107.820 101.008 127.684 1.00 9.74   ? 191  ARG B NH2   1 
ATOM   5656 N  N     . LYS B 1 192 ? 112.304 103.467 130.799 1.00 9.06   ? 192  LYS B N     1 
ATOM   5657 C  CA    . LYS B 1 192 ? 111.989 104.712 131.489 1.00 9.06   ? 192  LYS B CA    1 
ATOM   5658 C  C     . LYS B 1 192 ? 113.247 105.415 131.971 1.00 9.06   ? 192  LYS B C     1 
ATOM   5659 O  O     . LYS B 1 192 ? 113.385 106.631 131.811 1.00 9.06   ? 192  LYS B O     1 
ATOM   5660 C  CB    . LYS B 1 192 ? 111.064 104.432 132.670 1.00 9.06   ? 192  LYS B CB    1 
ATOM   5661 C  CG    . LYS B 1 192 ? 110.649 105.666 133.430 1.00 9.06   ? 192  LYS B CG    1 
ATOM   5662 C  CD    . LYS B 1 192 ? 109.711 106.473 132.582 1.00 9.06   ? 192  LYS B CD    1 
ATOM   5663 C  CE    . LYS B 1 192 ? 109.157 107.647 133.317 1.00 9.06   ? 192  LYS B CE    1 
ATOM   5664 N  NZ    . LYS B 1 192 ? 108.224 108.423 132.474 1.00 9.06   ? 192  LYS B NZ    1 
ATOM   5665 N  N     . ARG B 1 193 ? 114.176 104.668 132.558 1.00 9.18   ? 193  ARG B N     1 
ATOM   5666 C  CA    . ARG B 1 193 ? 115.410 105.263 133.043 1.00 9.18   ? 193  ARG B CA    1 
ATOM   5667 C  C     . ARG B 1 193 ? 116.358 105.640 131.922 1.00 9.18   ? 193  ARG B C     1 
ATOM   5668 O  O     . ARG B 1 193 ? 117.250 106.462 132.139 1.00 9.18   ? 193  ARG B O     1 
ATOM   5669 C  CB    . ARG B 1 193 ? 116.103 104.315 134.007 1.00 9.18   ? 193  ARG B CB    1 
ATOM   5670 C  CG    . ARG B 1 193 ? 115.399 104.193 135.318 1.00 9.18   ? 193  ARG B CG    1 
ATOM   5671 C  CD    . ARG B 1 193 ? 116.099 103.196 136.170 1.00 9.18   ? 193  ARG B CD    1 
ATOM   5672 N  NE    . ARG B 1 193 ? 115.923 101.851 135.653 1.00 9.18   ? 193  ARG B NE    1 
ATOM   5673 C  CZ    . ARG B 1 193 ? 116.572 100.795 136.113 1.00 9.18   ? 193  ARG B CZ    1 
ATOM   5674 N  NH1   . ARG B 1 193 ? 117.450 100.933 137.089 1.00 9.18   ? 193  ARG B NH1   1 
ATOM   5675 N  NH2   . ARG B 1 193 ? 116.344 99.606  135.602 1.00 9.18   ? 193  ARG B NH2   1 
ATOM   5676 N  N     . THR B 1 194 ? 116.201 105.051 130.739 1.00 8.64   ? 194  THR B N     1 
ATOM   5677 C  CA    . THR B 1 194 ? 116.933 105.538 129.578 1.00 8.64   ? 194  THR B CA    1 
ATOM   5678 C  C     . THR B 1 194 ? 116.427 106.915 129.176 1.00 8.64   ? 194  THR B C     1 
ATOM   5679 O  O     . THR B 1 194 ? 117.216 107.796 128.826 1.00 8.64   ? 194  THR B O     1 
ATOM   5680 C  CB    . THR B 1 194 ? 116.800 104.545 128.422 1.00 8.64   ? 194  THR B CB    1 
ATOM   5681 O  OG1   . THR B 1 194 ? 117.197 103.249 128.872 1.00 8.64   ? 194  THR B OG1   1 
ATOM   5682 C  CG2   . THR B 1 194 ? 117.692 104.936 127.258 1.00 8.64   ? 194  THR B CG2   1 
ATOM   5683 N  N     . SER B 1 195 ? 115.112 107.128 129.263 1.00 8.07   ? 195  SER B N     1 
ATOM   5684 C  CA    . SER B 1 195 ? 114.535 108.432 128.965 1.00 8.07   ? 195  SER B CA    1 
ATOM   5685 C  C     . SER B 1 195 ? 114.912 109.459 130.016 1.00 8.07   ? 195  SER B C     1 
ATOM   5686 O  O     . SER B 1 195 ? 115.117 110.626 129.693 1.00 8.07   ? 195  SER B O     1 
ATOM   5687 C  CB    . SER B 1 195 ? 113.018 108.324 128.865 1.00 8.07   ? 195  SER B CB    1 
ATOM   5688 O  OG    . SER B 1 195 ? 112.640 107.481 127.795 1.00 8.07   ? 195  SER B OG    1 
ATOM   5689 N  N     . ILE B 1 196 ? 114.999 109.043 131.280 1.00 7.83   ? 196  ILE B N     1 
ATOM   5690 C  CA    . ILE B 1 196 ? 115.462 109.929 132.345 1.00 7.83   ? 196  ILE B CA    1 
ATOM   5691 C  C     . ILE B 1 196 ? 116.912 110.325 132.113 1.00 7.83   ? 196  ILE B C     1 
ATOM   5692 O  O     . ILE B 1 196 ? 117.278 111.495 132.242 1.00 7.83   ? 196  ILE B O     1 
ATOM   5693 C  CB    . ILE B 1 196 ? 115.273 109.252 133.716 1.00 7.83   ? 196  ILE B CB    1 
ATOM   5694 C  CG1   . ILE B 1 196 ? 113.793 109.074 134.032 1.00 7.83   ? 196  ILE B CG1   1 
ATOM   5695 C  CG2   . ILE B 1 196 ? 115.947 110.033 134.824 1.00 7.83   ? 196  ILE B CG2   1 
ATOM   5696 C  CD1   . ILE B 1 196 ? 113.554 108.241 135.251 1.00 7.83   ? 196  ILE B CD1   1 
ATOM   5697 N  N     . GLY B 1 197 ? 117.746 109.365 131.712 1.00 9.33   ? 197  GLY B N     1 
ATOM   5698 C  CA    . GLY B 1 197 ? 119.168 109.601 131.547 1.00 9.33   ? 197  GLY B CA    1 
ATOM   5699 C  C     . GLY B 1 197 ? 119.554 110.430 130.349 1.00 9.33   ? 197  GLY B C     1 
ATOM   5700 O  O     . GLY B 1 197 ? 120.615 111.054 130.373 1.00 9.33   ? 197  GLY B O     1 
ATOM   5701 N  N     . MET B 1 198 ? 118.730 110.453 129.301 1.00 9.19   ? 198  MET B N     1 
ATOM   5702 C  CA    . MET B 1 198 ? 119.065 111.268 128.140 1.00 9.19   ? 198  MET B CA    1 
ATOM   5703 C  C     . MET B 1 198 ? 118.882 112.750 128.417 1.00 9.19   ? 198  MET B C     1 
ATOM   5704 O  O     . MET B 1 198 ? 119.637 113.569 127.886 1.00 9.19   ? 198  MET B O     1 
ATOM   5705 C  CB    . MET B 1 198 ? 118.239 110.851 126.932 1.00 9.19   ? 198  MET B CB    1 
ATOM   5706 C  CG    . MET B 1 198 ? 118.639 109.515 126.373 1.00 9.19   ? 198  MET B CG    1 
ATOM   5707 S  SD    . MET B 1 198 ? 117.746 109.084 124.890 1.00 9.19   ? 198  MET B SD    1 
ATOM   5708 C  CE    . MET B 1 198 ? 116.156 108.707 125.576 1.00 9.19   ? 198  MET B CE    1 
ATOM   5709 N  N     . GLU B 1 199 ? 117.899 113.117 129.239 1.00 10.25  ? 199  GLU B N     1 
ATOM   5710 C  CA    . GLU B 1 199 ? 117.753 114.486 129.717 1.00 10.25  ? 199  GLU B CA    1 
ATOM   5711 C  C     . GLU B 1 199 ? 118.479 114.728 131.030 1.00 10.25  ? 199  GLU B C     1 
ATOM   5712 O  O     . GLU B 1 199 ? 118.094 115.623 131.787 1.00 10.25  ? 199  GLU B O     1 
ATOM   5713 C  CB    . GLU B 1 199 ? 116.277 114.857 129.850 1.00 10.25  ? 199  GLU B CB    1 
ATOM   5714 C  CG    . GLU B 1 199 ? 115.607 115.285 128.549 1.00 10.25  ? 199  GLU B CG    1 
ATOM   5715 C  CD    . GLU B 1 199 ? 115.066 114.144 127.712 1.00 10.25  ? 199  GLU B CD    1 
ATOM   5716 O  OE1   . GLU B 1 199 ? 115.092 112.991 128.174 1.00 10.25  ? 199  GLU B OE1   1 
ATOM   5717 O  OE2   . GLU B 1 199 ? 114.620 114.398 126.580 1.00 10.25  ? 199  GLU B OE2   1 
ATOM   5718 N  N     . LEU B 1 200 ? 119.524 113.958 131.316 1.00 10.93  ? 200  LEU B N     1 
ATOM   5719 C  CA    . LEU B 1 200 ? 120.272 114.072 132.557 1.00 10.93  ? 200  LEU B CA    1 
ATOM   5720 C  C     . LEU B 1 200 ? 121.775 114.117 132.344 1.00 10.93  ? 200  LEU B C     1 
ATOM   5721 O  O     . LEU B 1 200 ? 122.484 114.649 133.205 1.00 10.93  ? 200  LEU B O     1 
ATOM   5722 C  CB    . LEU B 1 200 ? 119.909 112.909 133.488 1.00 10.93  ? 200  LEU B CB    1 
ATOM   5723 C  CG    . LEU B 1 200 ? 120.223 112.888 134.973 1.00 10.93  ? 200  LEU B CG    1 
ATOM   5724 C  CD1   . LEU B 1 200 ? 119.078 112.200 135.670 1.00 10.93  ? 200  LEU B CD1   1 
ATOM   5725 C  CD2   . LEU B 1 200 ? 121.494 112.126 135.227 1.00 10.93  ? 200  LEU B CD2   1 
ATOM   5726 N  N     . ILE B 1 201 ? 122.283 113.587 131.231 1.00 12.54  ? 201  ILE B N     1 
ATOM   5727 C  CA    . ILE B 1 201 ? 123.657 113.841 130.815 1.00 12.54  ? 201  ILE B CA    1 
ATOM   5728 C  C     . ILE B 1 201 ? 123.858 115.297 130.433 1.00 12.54  ? 201  ILE B C     1 
ATOM   5729 O  O     . ILE B 1 201 ? 124.963 115.832 130.567 1.00 12.54  ? 201  ILE B O     1 
ATOM   5730 C  CB    . ILE B 1 201 ? 124.020 112.905 129.652 1.00 12.54  ? 201  ILE B CB    1 
ATOM   5731 C  CG1   . ILE B 1 201 ? 122.873 112.882 128.654 1.00 12.54  ? 201  ILE B CG1   1 
ATOM   5732 C  CG2   . ILE B 1 201 ? 124.362 111.530 130.139 1.00 12.54  ? 201  ILE B CG2   1 
ATOM   5733 C  CD1   . ILE B 1 201 ? 123.137 112.066 127.470 1.00 12.54  ? 201  ILE B CD1   1 
ATOM   5734 N  N     . THR B 1 202 ? 122.803 115.966 129.979 1.00 13.19  ? 202  THR B N     1 
ATOM   5735 C  CA    . THR B 1 202 ? 122.892 117.322 129.468 1.00 13.19  ? 202  THR B CA    1 
ATOM   5736 C  C     . THR B 1 202 ? 122.930 118.373 130.569 1.00 13.19  ? 202  THR B C     1 
ATOM   5737 O  O     . THR B 1 202 ? 123.054 119.559 130.249 1.00 13.19  ? 202  THR B O     1 
ATOM   5738 C  CB    . THR B 1 202 ? 121.702 117.588 128.548 1.00 13.19  ? 202  THR B CB    1 
ATOM   5739 O  OG1   . THR B 1 202 ? 120.514 117.696 129.332 1.00 13.19  ? 202  THR B OG1   1 
ATOM   5740 C  CG2   . THR B 1 202 ? 121.512 116.416 127.628 1.00 13.19  ? 202  THR B CG2   1 
ATOM   5741 N  N     . ASP B 1 203 ? 122.779 117.953 131.841 1.00 15.98  ? 203  ASP B N     1 
ATOM   5742 C  CA    . ASP B 1 203 ? 122.663 118.634 133.139 1.00 15.98  ? 203  ASP B CA    1 
ATOM   5743 C  C     . ASP B 1 203 ? 122.049 120.036 133.063 1.00 15.98  ? 203  ASP B C     1 
ATOM   5744 O  O     . ASP B 1 203 ? 122.713 121.037 133.359 1.00 15.98  ? 203  ASP B O     1 
ATOM   5745 C  CB    . ASP B 1 203 ? 123.993 118.600 133.931 1.00 15.98  ? 203  ASP B CB    1 
ATOM   5746 C  CG    . ASP B 1 203 ? 125.172 119.315 133.267 1.00 15.98  ? 203  ASP B CG    1 
ATOM   5747 O  OD1   . ASP B 1 203 ? 125.059 119.882 132.171 1.00 15.98  ? 203  ASP B OD1   1 
ATOM   5748 O  OD2   . ASP B 1 203 ? 126.249 119.316 133.896 1.00 15.98  ? 203  ASP B OD2   1 
ATOM   5749 N  N     . PRO B 1 204 ? 120.771 120.151 132.693 1.00 14.23  ? 204  PRO B N     1 
ATOM   5750 C  CA    . PRO B 1 204 ? 120.169 121.479 132.564 1.00 14.23  ? 204  PRO B CA    1 
ATOM   5751 C  C     . PRO B 1 204 ? 119.846 122.069 133.925 1.00 14.23  ? 204  PRO B C     1 
ATOM   5752 O  O     . PRO B 1 204 ? 119.783 121.354 134.925 1.00 14.23  ? 204  PRO B O     1 
ATOM   5753 C  CB    . PRO B 1 204 ? 118.900 121.201 131.766 1.00 14.23  ? 204  PRO B CB    1 
ATOM   5754 C  CG    . PRO B 1 204 ? 118.521 119.856 132.183 1.00 14.23  ? 204  PRO B CG    1 
ATOM   5755 C  CD    . PRO B 1 204 ? 119.779 119.094 132.430 1.00 14.23  ? 204  PRO B CD    1 
ATOM   5756 N  N     . SER B 1 205 ? 119.636 123.386 133.962 1.00 13.83  ? 205  SER B N     1 
ATOM   5757 C  CA    . SER B 1 205 ? 119.356 124.048 135.232 1.00 13.83  ? 205  SER B CA    1 
ATOM   5758 C  C     . SER B 1 205 ? 117.901 123.889 135.646 1.00 13.83  ? 205  SER B C     1 
ATOM   5759 O  O     . SER B 1 205 ? 117.613 123.698 136.829 1.00 13.83  ? 205  SER B O     1 
ATOM   5760 C  CB    . SER B 1 205 ? 119.727 125.524 135.154 1.00 13.83  ? 205  SER B CB    1 
ATOM   5761 O  OG    . SER B 1 205 ? 121.123 125.681 134.997 1.00 13.83  ? 205  SER B OG    1 
ATOM   5762 N  N     . ILE B 1 206 ? 116.973 123.977 134.703 1.00 11.55  ? 206  ILE B N     1 
ATOM   5763 C  CA    . ILE B 1 206 ? 115.567 123.696 134.956 1.00 11.55  ? 206  ILE B CA    1 
ATOM   5764 C  C     . ILE B 1 206 ? 115.275 122.333 134.358 1.00 11.55  ? 206  ILE B C     1 
ATOM   5765 O  O     . ILE B 1 206 ? 115.588 122.085 133.191 1.00 11.55  ? 206  ILE B O     1 
ATOM   5766 C  CB    . ILE B 1 206 ? 114.646 124.768 134.354 1.00 11.55  ? 206  ILE B CB    1 
ATOM   5767 C  CG1   . ILE B 1 206 ? 115.084 126.152 134.799 1.00 11.55  ? 206  ILE B CG1   1 
ATOM   5768 C  CG2   . ILE B 1 206 ? 113.238 124.570 134.846 1.00 11.55  ? 206  ILE B CG2   1 
ATOM   5769 C  CD1   . ILE B 1 206 ? 114.388 127.260 134.093 1.00 11.55  ? 206  ILE B CD1   1 
ATOM   5770 N  N     . LEU B 1 207 ? 114.685 121.447 135.146 1.00 8.80   ? 207  LEU B N     1 
ATOM   5771 C  CA    . LEU B 1 207 ? 114.581 120.055 134.743 1.00 8.80   ? 207  LEU B CA    1 
ATOM   5772 C  C     . LEU B 1 207 ? 113.192 119.540 135.080 1.00 8.80   ? 207  LEU B C     1 
ATOM   5773 O  O     . LEU B 1 207 ? 112.820 119.469 136.251 1.00 8.80   ? 207  LEU B O     1 
ATOM   5774 C  CB    . LEU B 1 207 ? 115.696 119.249 135.410 1.00 8.80   ? 207  LEU B CB    1 
ATOM   5775 C  CG    . LEU B 1 207 ? 116.021 117.800 135.089 1.00 8.80   ? 207  LEU B CG    1 
ATOM   5776 C  CD1   . LEU B 1 207 ? 117.500 117.656 134.998 1.00 8.80   ? 207  LEU B CD1   1 
ATOM   5777 C  CD2   . LEU B 1 207 ? 115.611 117.021 136.254 1.00 8.80   ? 207  LEU B CD2   1 
ATOM   5778 N  N     . PHE B 1 208 ? 112.420 119.221 134.048 1.00 8.12   ? 208  PHE B N     1 
ATOM   5779 C  CA    . PHE B 1 208 ? 111.043 118.775 134.187 1.00 8.12   ? 208  PHE B CA    1 
ATOM   5780 C  C     . PHE B 1 208 ? 110.983 117.267 133.980 1.00 8.12   ? 208  PHE B C     1 
ATOM   5781 O  O     . PHE B 1 208 ? 111.608 116.749 133.054 1.00 8.12   ? 208  PHE B O     1 
ATOM   5782 C  CB    . PHE B 1 208 ? 110.141 119.454 133.160 1.00 8.12   ? 208  PHE B CB    1 
ATOM   5783 C  CG    . PHE B 1 208 ? 110.069 120.943 133.264 1.00 8.12   ? 208  PHE B CG    1 
ATOM   5784 C  CD1   . PHE B 1 208 ? 109.179 121.552 134.123 1.00 8.12   ? 208  PHE B CD1   1 
ATOM   5785 C  CD2   . PHE B 1 208 ? 110.877 121.737 132.472 1.00 8.12   ? 208  PHE B CD2   1 
ATOM   5786 C  CE1   . PHE B 1 208 ? 109.112 122.916 134.206 1.00 8.12   ? 208  PHE B CE1   1 
ATOM   5787 C  CE2   . PHE B 1 208 ? 110.816 123.097 132.557 1.00 8.12   ? 208  PHE B CE2   1 
ATOM   5788 C  CZ    . PHE B 1 208 ? 109.932 123.687 133.422 1.00 8.12   ? 208  PHE B CZ    1 
ATOM   5789 N  N     . LEU B 1 209 ? 110.226 116.562 134.819 1.00 7.81   ? 209  LEU B N     1 
ATOM   5790 C  CA    . LEU B 1 209 ? 110.048 115.126 134.632 1.00 7.81   ? 209  LEU B CA    1 
ATOM   5791 C  C     . LEU B 1 209 ? 108.574 114.800 134.760 1.00 7.81   ? 209  LEU B C     1 
ATOM   5792 O  O     . LEU B 1 209 ? 107.923 115.245 135.702 1.00 7.81   ? 209  LEU B O     1 
ATOM   5793 C  CB    . LEU B 1 209 ? 110.824 114.281 135.644 1.00 7.81   ? 209  LEU B CB    1 
ATOM   5794 C  CG    . LEU B 1 209 ? 112.327 114.434 135.804 1.00 7.81   ? 209  LEU B CG    1 
ATOM   5795 C  CD1   . LEU B 1 209 ? 112.504 115.361 136.940 1.00 7.81   ? 209  LEU B CD1   1 
ATOM   5796 C  CD2   . LEU B 1 209 ? 113.052 113.142 136.042 1.00 7.81   ? 209  LEU B CD2   1 
ATOM   5797 N  N     . ASP B 1 210 ? 108.052 114.020 133.834 1.00 9.15   ? 210  ASP B N     1 
ATOM   5798 C  CA    . ASP B 1 210 ? 106.635 113.681 133.816 1.00 9.15   ? 210  ASP B CA    1 
ATOM   5799 C  C     . ASP B 1 210 ? 106.514 112.248 134.316 1.00 9.15   ? 210  ASP B C     1 
ATOM   5800 O  O     . ASP B 1 210 ? 106.699 111.302 133.549 1.00 9.15   ? 210  ASP B O     1 
ATOM   5801 C  CB    . ASP B 1 210 ? 106.061 113.850 132.417 1.00 9.15   ? 210  ASP B CB    1 
ATOM   5802 C  CG    . ASP B 1 210 ? 104.558 113.959 132.406 1.00 9.15   ? 210  ASP B CG    1 
ATOM   5803 O  OD1   . ASP B 1 210 ? 103.930 113.863 133.476 1.00 9.15   ? 210  ASP B OD1   1 
ATOM   5804 O  OD2   . ASP B 1 210 ? 103.998 114.171 131.313 1.00 9.15   ? 210  ASP B OD2   1 
ATOM   5805 N  N     . GLN B 1 211 ? 106.214 112.107 135.612 1.00 9.34   ? 211  GLN B N     1 
ATOM   5806 C  CA    . GLN B 1 211 ? 106.088 110.865 136.371 1.00 9.34   ? 211  GLN B CA    1 
ATOM   5807 C  C     . GLN B 1 211 ? 107.307 109.968 136.218 1.00 9.34   ? 211  GLN B C     1 
ATOM   5808 O  O     . GLN B 1 211 ? 107.213 108.914 135.582 1.00 9.34   ? 211  GLN B O     1 
ATOM   5809 C  CB    . GLN B 1 211 ? 104.827 110.126 135.946 1.00 9.34   ? 211  GLN B CB    1 
ATOM   5810 C  CG    . GLN B 1 211 ? 103.594 110.908 136.243 1.00 9.34   ? 211  GLN B CG    1 
ATOM   5811 C  CD    . GLN B 1 211 ? 102.378 110.285 135.648 1.00 9.34   ? 211  GLN B CD    1 
ATOM   5812 O  OE1   . GLN B 1 211 ? 101.287 110.844 135.698 1.00 9.34   ? 211  GLN B OE1   1 
ATOM   5813 N  NE2   . GLN B 1 211 ? 102.536 109.079 135.147 1.00 9.34   ? 211  GLN B NE2   1 
ATOM   5814 N  N     . PRO B 1 212 ? 108.455 110.338 136.796 1.00 9.00   ? 212  PRO B N     1 
ATOM   5815 C  CA    . PRO B 1 212 ? 109.689 109.598 136.513 1.00 9.00   ? 212  PRO B CA    1 
ATOM   5816 C  C     . PRO B 1 212 ? 109.778 108.245 137.176 1.00 9.00   ? 212  PRO B C     1 
ATOM   5817 O  O     . PRO B 1 212 ? 110.629 107.441 136.777 1.00 9.00   ? 212  PRO B O     1 
ATOM   5818 C  CB    . PRO B 1 212 ? 110.772 110.518 137.065 1.00 9.00   ? 212  PRO B CB    1 
ATOM   5819 C  CG    . PRO B 1 212 ? 110.096 111.272 138.137 1.00 9.00   ? 212  PRO B CG    1 
ATOM   5820 C  CD    . PRO B 1 212 ? 108.697 111.471 137.704 1.00 9.00   ? 212  PRO B CD    1 
ATOM   5821 N  N     . THR B 1 213 ? 108.958 107.985 138.186 1.00 9.85   ? 213  THR B N     1 
ATOM   5822 C  CA    . THR B 1 213 ? 108.975 106.738 138.924 1.00 9.85   ? 213  THR B CA    1 
ATOM   5823 C  C     . THR B 1 213 ? 107.832 105.827 138.539 1.00 9.85   ? 213  THR B C     1 
ATOM   5824 O  O     . THR B 1 213 ? 107.685 104.753 139.121 1.00 9.85   ? 213  THR B O     1 
ATOM   5825 C  CB    . THR B 1 213 ? 108.920 107.033 140.412 1.00 9.85   ? 213  THR B CB    1 
ATOM   5826 O  OG1   . THR B 1 213 ? 107.690 107.698 140.715 1.00 9.85   ? 213  THR B OG1   1 
ATOM   5827 C  CG2   . THR B 1 213 ? 110.035 107.936 140.755 1.00 9.85   ? 213  THR B CG2   1 
ATOM   5828 N  N     . THR B 1 214 ? 107.001 106.252 137.605 1.00 10.43  ? 214  THR B N     1 
ATOM   5829 C  CA    . THR B 1 214 ? 105.963 105.412 137.036 1.00 10.43  ? 214  THR B CA    1 
ATOM   5830 C  C     . THR B 1 214 ? 106.621 104.374 136.143 1.00 10.43  ? 214  THR B C     1 
ATOM   5831 O  O     . THR B 1 214 ? 107.193 104.709 135.102 1.00 10.43  ? 214  THR B O     1 
ATOM   5832 C  CB    . THR B 1 214 ? 104.970 106.290 136.285 1.00 10.43  ? 214  THR B CB    1 
ATOM   5833 O  OG1   . THR B 1 214 ? 104.238 107.075 137.234 1.00 10.43  ? 214  THR B OG1   1 
ATOM   5834 C  CG2   . THR B 1 214 ? 104.018 105.490 135.457 1.00 10.43  ? 214  THR B CG2   1 
ATOM   5835 N  N     . GLY B 1 215 ? 106.591 103.120 136.585 1.00 10.36  ? 215  GLY B N     1 
ATOM   5836 C  CA    . GLY B 1 215 ? 107.306 102.041 135.944 1.00 10.36  ? 215  GLY B CA    1 
ATOM   5837 C  C     . GLY B 1 215 ? 108.471 101.512 136.743 1.00 10.36  ? 215  GLY B C     1 
ATOM   5838 O  O     . GLY B 1 215 ? 109.055 100.499 136.350 1.00 10.36  ? 215  GLY B O     1 
ATOM   5839 N  N     . LEU B 1 216 ? 108.828 102.158 137.848 1.00 10.17  ? 216  LEU B N     1 
ATOM   5840 C  CA    . LEU B 1 216 ? 109.924 101.739 138.705 1.00 10.17  ? 216  LEU B CA    1 
ATOM   5841 C  C     . LEU B 1 216 ? 109.362 101.184 140.004 1.00 10.17  ? 216  LEU B C     1 
ATOM   5842 O  O     . LEU B 1 216 ? 108.237 101.493 140.390 1.00 10.17  ? 216  LEU B O     1 
ATOM   5843 C  CB    . LEU B 1 216 ? 110.865 102.908 139.008 1.00 10.17  ? 216  LEU B CB    1 
ATOM   5844 C  CG    . LEU B 1 216 ? 111.492 103.692 137.855 1.00 10.17  ? 216  LEU B CG    1 
ATOM   5845 C  CD1   . LEU B 1 216 ? 112.379 104.786 138.407 1.00 10.17  ? 216  LEU B CD1   1 
ATOM   5846 C  CD2   . LEU B 1 216 ? 112.242 102.812 136.889 1.00 10.17  ? 216  LEU B CD2   1 
ATOM   5847 N  N     . ASP B 1 217 ? 110.160 100.371 140.691 1.00 13.57  ? 217  ASP B N     1 
ATOM   5848 C  CA    . ASP B 1 217 ? 109.720 99.761  141.937 1.00 13.57  ? 217  ASP B CA    1 
ATOM   5849 C  C     . ASP B 1 217 ? 110.001 100.687 143.117 1.00 13.57  ? 217  ASP B C     1 
ATOM   5850 O  O     . ASP B 1 217 ? 110.370 101.845 142.943 1.00 13.57  ? 217  ASP B O     1 
ATOM   5851 C  CB    . ASP B 1 217 ? 110.376 98.405  142.150 1.00 13.57  ? 217  ASP B CB    1 
ATOM   5852 C  CG    . ASP B 1 217 ? 111.859 98.483  142.178 1.00 13.57  ? 217  ASP B CG    1 
ATOM   5853 O  OD1   . ASP B 1 217 ? 112.392 99.450  141.637 1.00 13.57  ? 217  ASP B OD1   1 
ATOM   5854 O  OD2   . ASP B 1 217 ? 112.493 97.633  142.823 1.00 13.57  ? 217  ASP B OD2   1 
ATOM   5855 N  N     . SER B 1 218 ? 109.849 100.170 144.337 1.00 15.69  ? 218  SER B N     1 
ATOM   5856 C  CA    . SER B 1 218 ? 109.983 100.997 145.531 1.00 15.69  ? 218  SER B CA    1 
ATOM   5857 C  C     . SER B 1 218 ? 111.420 101.431 145.783 1.00 15.69  ? 218  SER B C     1 
ATOM   5858 O  O     . SER B 1 218 ? 111.645 102.466 146.416 1.00 15.69  ? 218  SER B O     1 
ATOM   5859 C  CB    . SER B 1 218 ? 109.464 100.244 146.757 1.00 15.69  ? 218  SER B CB    1 
ATOM   5860 O  OG    . SER B 1 218 ? 108.076 99.988  146.680 1.00 15.69  ? 218  SER B OG    1 
ATOM   5861 N  N     . SER B 1 219 ? 112.400 100.666 145.311 1.00 16.07  ? 219  SER B N     1 
ATOM   5862 C  CA    . SER B 1 219 ? 113.787 100.931 145.666 1.00 16.07  ? 219  SER B CA    1 
ATOM   5863 C  C     . SER B 1 219 ? 114.580 101.628 144.573 1.00 16.07  ? 219  SER B C     1 
ATOM   5864 O  O     . SER B 1 219 ? 115.513 102.368 144.889 1.00 16.07  ? 219  SER B O     1 
ATOM   5865 C  CB    . SER B 1 219 ? 114.491 99.631  146.053 1.00 16.07  ? 219  SER B CB    1 
ATOM   5866 O  OG    . SER B 1 219 ? 115.823 99.877  146.458 1.00 16.07  ? 219  SER B OG    1 
ATOM   5867 N  N     . THR B 1 220 ? 114.262 101.405 143.297 1.00 14.29  ? 220  THR B N     1 
ATOM   5868 C  CA    . THR B 1 220 ? 114.893 102.200 142.251 1.00 14.29  ? 220  THR B CA    1 
ATOM   5869 C  C     . THR B 1 220 ? 114.329 103.612 142.229 1.00 14.29  ? 220  THR B C     1 
ATOM   5870 O  O     . THR B 1 220 ? 115.073 104.563 141.979 1.00 14.29  ? 220  THR B O     1 
ATOM   5871 C  CB    . THR B 1 220 ? 114.722 101.533 140.886 1.00 14.29  ? 220  THR B CB    1 
ATOM   5872 O  OG1   . THR B 1 220 ? 115.167 100.177 140.969 1.00 14.29  ? 220  THR B OG1   1 
ATOM   5873 C  CG2   . THR B 1 220 ? 115.546 102.217 139.821 1.00 14.29  ? 220  THR B CG2   1 
ATOM   5874 N  N     . ALA B 1 221 ? 113.037 103.769 142.536 1.00 14.11  ? 221  ALA B N     1 
ATOM   5875 C  CA    . ALA B 1 221 ? 112.432 105.095 142.604 1.00 14.11  ? 221  ALA B CA    1 
ATOM   5876 C  C     . ALA B 1 221 ? 113.016 105.939 143.722 1.00 14.11  ? 221  ALA B C     1 
ATOM   5877 O  O     . ALA B 1 221 ? 113.126 107.158 143.577 1.00 14.11  ? 221  ALA B O     1 
ATOM   5878 C  CB    . ALA B 1 221 ? 110.930 104.985 142.797 1.00 14.11  ? 221  ALA B CB    1 
ATOM   5879 N  N     . ASN B 1 222 ? 113.383 105.321 144.841 1.00 15.20  ? 222  ASN B N     1 
ATOM   5880 C  CA    . ASN B 1 222 ? 114.097 106.052 145.876 1.00 15.20  ? 222  ASN B CA    1 
ATOM   5881 C  C     . ASN B 1 222 ? 115.497 106.409 145.407 1.00 15.20  ? 222  ASN B C     1 
ATOM   5882 O  O     . ASN B 1 222 ? 116.009 107.482 145.730 1.00 15.20  ? 222  ASN B O     1 
ATOM   5883 C  CB    . ASN B 1 222 ? 114.155 105.223 147.154 1.00 15.20  ? 222  ASN B CB    1 
ATOM   5884 C  CG    . ASN B 1 222 ? 114.284 106.071 148.410 1.00 15.20  ? 222  ASN B CG    1 
ATOM   5885 O  OD1   . ASN B 1 222 ? 114.101 105.571 149.514 1.00 15.20  ? 222  ASN B OD1   1 
ATOM   5886 N  ND2   . ASN B 1 222 ? 114.573 107.354 148.250 1.00 15.20  ? 222  ASN B ND2   1 
ATOM   5887 N  N     . ALA B 1 223 ? 116.128 105.525 144.636 1.00 16.05  ? 223  ALA B N     1 
ATOM   5888 C  CA    . ALA B 1 223 ? 117.468 105.804 144.141 1.00 16.05  ? 223  ALA B CA    1 
ATOM   5889 C  C     . ALA B 1 223 ? 117.454 106.849 143.036 1.00 16.05  ? 223  ALA B C     1 
ATOM   5890 O  O     . ALA B 1 223 ? 118.463 107.524 142.818 1.00 16.05  ? 223  ALA B O     1 
ATOM   5891 C  CB    . ALA B 1 223 ? 118.118 104.517 143.651 1.00 16.05  ? 223  ALA B CB    1 
ATOM   5892 N  N     . VAL B 1 224 ? 116.331 107.001 142.336 1.00 14.07  ? 224  VAL B N     1 
ATOM   5893 C  CA    . VAL B 1 224 ? 116.212 108.051 141.332 1.00 14.07  ? 224  VAL B CA    1 
ATOM   5894 C  C     . VAL B 1 224 ? 115.997 109.407 141.991 1.00 14.07  ? 224  VAL B C     1 
ATOM   5895 O  O     . VAL B 1 224 ? 116.647 110.391 141.628 1.00 14.07  ? 224  VAL B O     1 
ATOM   5896 C  CB    . VAL B 1 224 ? 115.095 107.707 140.329 1.00 14.07  ? 224  VAL B CB    1 
ATOM   5897 C  CG1   . VAL B 1 224 ? 114.746 108.896 139.469 1.00 14.07  ? 224  VAL B CG1   1 
ATOM   5898 C  CG2   . VAL B 1 224 ? 115.552 106.587 139.435 1.00 14.07  ? 224  VAL B CG2   1 
ATOM   5899 N  N     . LEU B 1 225 ? 115.113 109.492 142.986 1.00 14.95  ? 225  LEU B N     1 
ATOM   5900 C  CA    . LEU B 1 225 ? 114.919 110.789 143.623 1.00 14.95  ? 225  LEU B CA    1 
ATOM   5901 C  C     . LEU B 1 225 ? 116.034 111.178 144.576 1.00 14.95  ? 225  LEU B C     1 
ATOM   5902 O  O     . LEU B 1 225 ? 116.170 112.365 144.874 1.00 14.95  ? 225  LEU B O     1 
ATOM   5903 C  CB    . LEU B 1 225 ? 113.592 110.880 144.367 1.00 14.95  ? 225  LEU B CB    1 
ATOM   5904 C  CG    . LEU B 1 225 ? 112.541 111.483 143.440 1.00 14.95  ? 225  LEU B CG    1 
ATOM   5905 C  CD1   . LEU B 1 225 ? 111.882 110.443 142.599 1.00 14.95  ? 225  LEU B CD1   1 
ATOM   5906 C  CD2   . LEU B 1 225 ? 111.546 112.342 144.164 1.00 14.95  ? 225  LEU B CD2   1 
ATOM   5907 N  N     . LEU B 1 226 ? 116.829 110.232 145.066 1.00 16.26  ? 226  LEU B N     1 
ATOM   5908 C  CA    . LEU B 1 226 ? 118.034 110.632 145.777 1.00 16.26  ? 226  LEU B CA    1 
ATOM   5909 C  C     . LEU B 1 226 ? 119.102 111.109 144.812 1.00 16.26  ? 226  LEU B C     1 
ATOM   5910 O  O     . LEU B 1 226 ? 119.976 111.890 145.196 1.00 16.26  ? 226  LEU B O     1 
ATOM   5911 C  CB    . LEU B 1 226 ? 118.552 109.487 146.634 1.00 16.26  ? 226  LEU B CB    1 
ATOM   5912 C  CG    . LEU B 1 226 ? 117.713 109.227 147.878 1.00 16.26  ? 226  LEU B CG    1 
ATOM   5913 C  CD1   . LEU B 1 226 ? 118.079 107.897 148.467 1.00 16.26  ? 226  LEU B CD1   1 
ATOM   5914 C  CD2   . LEU B 1 226 ? 117.921 110.337 148.884 1.00 16.26  ? 226  LEU B CD2   1 
ATOM   5915 N  N     . LEU B 1 227 ? 119.053 110.644 143.564 1.00 16.58  ? 227  LEU B N     1 
ATOM   5916 C  CA    . LEU B 1 227 ? 119.895 111.215 142.521 1.00 16.58  ? 227  LEU B CA    1 
ATOM   5917 C  C     . LEU B 1 227 ? 119.461 112.631 142.187 1.00 16.58  ? 227  LEU B C     1 
ATOM   5918 O  O     . LEU B 1 227 ? 120.301 113.502 141.946 1.00 16.58  ? 227  LEU B O     1 
ATOM   5919 C  CB    . LEU B 1 227 ? 119.844 110.331 141.277 1.00 16.58  ? 227  LEU B CB    1 
ATOM   5920 C  CG    . LEU B 1 227 ? 120.562 110.777 140.013 1.00 16.58  ? 227  LEU B CG    1 
ATOM   5921 C  CD1   . LEU B 1 227 ? 122.045 110.881 140.268 1.00 16.58  ? 227  LEU B CD1   1 
ATOM   5922 C  CD2   . LEU B 1 227 ? 120.262 109.799 138.904 1.00 16.58  ? 227  LEU B CD2   1 
ATOM   5923 N  N     . LEU B 1 228 ? 118.154 112.880 142.182 1.00 14.16  ? 228  LEU B N     1 
ATOM   5924 C  CA    . LEU B 1 228 ? 117.656 114.212 141.869 1.00 14.16  ? 228  LEU B CA    1 
ATOM   5925 C  C     . LEU B 1 228 ? 117.850 115.160 143.041 1.00 14.16  ? 228  LEU B C     1 
ATOM   5926 O  O     . LEU B 1 228 ? 118.117 116.347 142.841 1.00 14.16  ? 228  LEU B O     1 
ATOM   5927 C  CB    . LEU B 1 228 ? 116.184 114.140 141.471 1.00 14.16  ? 228  LEU B CB    1 
ATOM   5928 C  CG    . LEU B 1 228 ? 115.854 113.393 140.180 1.00 14.16  ? 228  LEU B CG    1 
ATOM   5929 C  CD1   . LEU B 1 228 ? 114.362 113.285 139.988 1.00 14.16  ? 228  LEU B CD1   1 
ATOM   5930 C  CD2   . LEU B 1 228 ? 116.490 114.082 139.012 1.00 14.16  ? 228  LEU B CD2   1 
ATOM   5931 N  N     . LYS B 1 229 ? 117.717 114.656 144.270 1.00 15.64  ? 229  LYS B N     1 
ATOM   5932 C  CA    . LYS B 1 229 ? 117.943 115.483 145.452 1.00 15.64  ? 229  LYS B CA    1 
ATOM   5933 C  C     . LYS B 1 229 ? 119.408 115.882 145.574 1.00 15.64  ? 229  LYS B C     1 
ATOM   5934 O  O     . LYS B 1 229 ? 119.720 116.994 146.007 1.00 15.64  ? 229  LYS B O     1 
ATOM   5935 C  CB    . LYS B 1 229 ? 117.479 114.737 146.701 1.00 15.64  ? 229  LYS B CB    1 
ATOM   5936 C  CG    . LYS B 1 229 ? 117.624 115.493 148.004 1.00 15.64  ? 229  LYS B CG    1 
ATOM   5937 C  CD    . LYS B 1 229 ? 116.639 116.633 148.094 1.00 15.64  ? 229  LYS B CD    1 
ATOM   5938 C  CE    . LYS B 1 229 ? 116.691 117.297 149.447 1.00 15.64  ? 229  LYS B CE    1 
ATOM   5939 N  NZ    . LYS B 1 229 ? 115.754 118.439 149.510 1.00 15.64  ? 229  LYS B NZ    1 
ATOM   5940 N  N     . ARG B 1 230 ? 120.318 114.989 145.188 1.00 18.87  ? 230  ARG B N     1 
ATOM   5941 C  CA    . ARG B 1 230 ? 121.732 115.335 145.105 1.00 18.87  ? 230  ARG B CA    1 
ATOM   5942 C  C     . ARG B 1 230 ? 121.981 116.364 144.014 1.00 18.87  ? 230  ARG B C     1 
ATOM   5943 O  O     . ARG B 1 230 ? 122.853 117.225 144.155 1.00 18.87  ? 230  ARG B O     1 
ATOM   5944 C  CB    . ARG B 1 230 ? 122.550 114.069 144.844 1.00 18.87  ? 230  ARG B CB    1 
ATOM   5945 C  CG    . ARG B 1 230 ? 124.041 114.252 144.883 1.00 18.87  ? 230  ARG B CG    1 
ATOM   5946 C  CD    . ARG B 1 230 ? 124.765 112.954 144.576 1.00 18.87  ? 230  ARG B CD    1 
ATOM   5947 N  NE    . ARG B 1 230 ? 124.568 112.518 143.196 1.00 18.87  ? 230  ARG B NE    1 
ATOM   5948 C  CZ    . ARG B 1 230 ? 125.284 112.954 142.163 1.00 18.87  ? 230  ARG B CZ    1 
ATOM   5949 N  NH1   . ARG B 1 230 ? 126.251 113.840 142.344 1.00 18.87  ? 230  ARG B NH1   1 
ATOM   5950 N  NH2   . ARG B 1 230 ? 125.039 112.503 140.942 1.00 18.87  ? 230  ARG B NH2   1 
ATOM   5951 N  N     . MET B 1 231 ? 121.204 116.300 142.937 1.00 16.90  ? 231  MET B N     1 
ATOM   5952 C  CA    . MET B 1 231 ? 121.341 117.211 141.811 1.00 16.90  ? 231  MET B CA    1 
ATOM   5953 C  C     . MET B 1 231 ? 120.689 118.559 142.087 1.00 16.90  ? 231  MET B C     1 
ATOM   5954 O  O     . MET B 1 231 ? 121.162 119.586 141.594 1.00 16.90  ? 231  MET B O     1 
ATOM   5955 C  CB    . MET B 1 231 ? 120.727 116.552 140.579 1.00 16.90  ? 231  MET B CB    1 
ATOM   5956 C  CG    . MET B 1 231 ? 120.933 117.254 139.279 1.00 16.90  ? 231  MET B CG    1 
ATOM   5957 S  SD    . MET B 1 231 ? 120.168 116.276 137.984 1.00 16.90  ? 231  MET B SD    1 
ATOM   5958 C  CE    . MET B 1 231 ? 121.252 114.858 138.006 1.00 16.90  ? 231  MET B CE    1 
ATOM   5959 N  N     . SER B 1 232 ? 119.617 118.573 142.878 1.00 16.52  ? 232  SER B N     1 
ATOM   5960 C  CA    . SER B 1 232 ? 118.911 119.801 143.206 1.00 16.52  ? 232  SER B CA    1 
ATOM   5961 C  C     . SER B 1 232 ? 119.664 120.668 144.196 1.00 16.52  ? 232  SER B C     1 
ATOM   5962 O  O     . SER B 1 232 ? 119.413 121.874 144.255 1.00 16.52  ? 232  SER B O     1 
ATOM   5963 C  CB    . SER B 1 232 ? 117.541 119.477 143.782 1.00 16.52  ? 232  SER B CB    1 
ATOM   5964 O  OG    . SER B 1 232 ? 117.675 118.852 145.041 1.00 16.52  ? 232  SER B OG    1 
ATOM   5965 N  N     . LYS B 1 233 ? 120.565 120.088 144.982 1.00 18.00  ? 233  LYS B N     1 
ATOM   5966 C  CA    . LYS B 1 233 ? 121.374 120.849 145.922 1.00 18.00  ? 233  LYS B CA    1 
ATOM   5967 C  C     . LYS B 1 233 ? 122.586 121.493 145.268 1.00 18.00  ? 233  LYS B C     1 
ATOM   5968 O  O     . LYS B 1 233 ? 123.368 122.150 145.960 1.00 18.00  ? 233  LYS B O     1 
ATOM   5969 C  CB    . LYS B 1 233 ? 121.815 119.949 147.073 1.00 18.00  ? 233  LYS B CB    1 
ATOM   5970 C  CG    . LYS B 1 233 ? 120.672 119.505 147.961 1.00 18.00  ? 233  LYS B CG    1 
ATOM   5971 C  CD    . LYS B 1 233 ? 121.174 118.719 149.151 1.00 18.00  ? 233  LYS B CD    1 
ATOM   5972 C  CE    . LYS B 1 233 ? 121.633 117.337 148.728 1.00 18.00  ? 233  LYS B CE    1 
ATOM   5973 N  NZ    . LYS B 1 233 ? 122.026 116.494 149.883 1.00 18.00  ? 233  LYS B NZ    1 
ATOM   5974 N  N     . GLN B 1 234 ? 122.764 121.313 143.964 1.00 19.67  ? 234  GLN B N     1 
ATOM   5975 C  CA    . GLN B 1 234 ? 123.756 122.047 143.198 1.00 19.67  ? 234  GLN B CA    1 
ATOM   5976 C  C     . GLN B 1 234 ? 123.211 123.355 142.645 1.00 19.67  ? 234  GLN B C     1 
ATOM   5977 O  O     . GLN B 1 234 ? 123.973 124.124 142.051 1.00 19.67  ? 234  GLN B O     1 
ATOM   5978 C  CB    . GLN B 1 234 ? 124.264 121.187 142.040 1.00 19.67  ? 234  GLN B CB    1 
ATOM   5979 C  CG    . GLN B 1 234 ? 124.992 119.938 142.474 1.00 19.67  ? 234  GLN B CG    1 
ATOM   5980 C  CD    . GLN B 1 234 ? 125.382 119.064 141.303 1.00 19.67  ? 234  GLN B CD    1 
ATOM   5981 O  OE1   . GLN B 1 234 ? 125.070 119.373 140.155 1.00 19.67  ? 234  GLN B OE1   1 
ATOM   5982 N  NE2   . GLN B 1 234 ? 126.055 117.960 141.588 1.00 19.67  ? 234  GLN B NE2   1 
ATOM   5983 N  N     . GLY B 1 235 ? 121.918 123.620 142.819 1.00 19.12  ? 235  GLY B N     1 
ATOM   5984 C  CA    . GLY B 1 235 ? 121.294 124.821 142.306 1.00 19.12  ? 235  GLY B CA    1 
ATOM   5985 C  C     . GLY B 1 235 ? 120.286 124.594 141.205 1.00 19.12  ? 235  GLY B C     1 
ATOM   5986 O  O     . GLY B 1 235 ? 119.746 125.572 140.677 1.00 19.12  ? 235  GLY B O     1 
ATOM   5987 N  N     . ARG B 1 236 ? 120.017 123.351 140.832 1.00 17.07  ? 236  ARG B N     1 
ATOM   5988 C  CA    . ARG B 1 236 ? 119.036 123.070 139.798 1.00 17.07  ? 236  ARG B CA    1 
ATOM   5989 C  C     . ARG B 1 236 ? 117.634 123.092 140.379 1.00 17.07  ? 236  ARG B C     1 
ATOM   5990 O  O     . ARG B 1 236 ? 117.405 122.624 141.495 1.00 17.07  ? 236  ARG B O     1 
ATOM   5991 C  CB    . ARG B 1 236 ? 119.295 121.709 139.155 1.00 17.07  ? 236  ARG B CB    1 
ATOM   5992 C  CG    . ARG B 1 236 ? 120.391 121.688 138.120 1.00 17.07  ? 236  ARG B CG    1 
ATOM   5993 C  CD    . ARG B 1 236 ? 121.742 121.388 138.713 1.00 17.07  ? 236  ARG B CD    1 
ATOM   5994 N  NE    . ARG B 1 236 ? 122.745 121.189 137.674 1.00 17.07  ? 236  ARG B NE    1 
ATOM   5995 C  CZ    . ARG B 1 236 ? 123.529 122.154 137.210 1.00 17.07  ? 236  ARG B CZ    1 
ATOM   5996 N  NH1   . ARG B 1 236 ? 123.424 123.382 137.695 1.00 17.07  ? 236  ARG B NH1   1 
ATOM   5997 N  NH2   . ARG B 1 236 ? 124.418 121.894 136.263 1.00 17.07  ? 236  ARG B NH2   1 
ATOM   5998 N  N     . THR B 1 237 ? 116.693 123.644 139.622 1.00 12.99  ? 237  THR B N     1 
ATOM   5999 C  CA    . THR B 1 237 ? 115.286 123.517 139.968 1.00 12.99  ? 237  THR B CA    1 
ATOM   6000 C  C     . THR B 1 237 ? 114.687 122.340 139.209 1.00 12.99  ? 237  THR B C     1 
ATOM   6001 O  O     . THR B 1 237 ? 114.863 122.207 137.996 1.00 12.99  ? 237  THR B O     1 
ATOM   6002 C  CB    . THR B 1 237 ? 114.518 124.823 139.719 1.00 12.99  ? 237  THR B CB    1 
ATOM   6003 O  OG1   . THR B 1 237 ? 113.119 124.625 139.947 1.00 12.99  ? 237  THR B OG1   1 
ATOM   6004 C  CG2   . THR B 1 237 ? 114.756 125.394 138.364 1.00 12.99  ? 237  THR B CG2   1 
ATOM   6005 N  N     . ILE B 1 238 ? 114.034 121.452 139.945 1.00 10.56  ? 238  ILE B N     1 
ATOM   6006 C  CA    . ILE B 1 238 ? 113.541 120.194 139.412 1.00 10.56  ? 238  ILE B CA    1 
ATOM   6007 C  C     . ILE B 1 238 ? 112.050 120.152 139.683 1.00 10.56  ? 238  ILE B C     1 
ATOM   6008 O  O     . ILE B 1 238 ? 111.626 120.046 140.838 1.00 10.56  ? 238  ILE B O     1 
ATOM   6009 C  CB    . ILE B 1 238 ? 114.262 118.989 140.029 1.00 10.56  ? 238  ILE B CB    1 
ATOM   6010 C  CG1   . ILE B 1 238 ? 115.740 119.009 139.658 1.00 10.56  ? 238  ILE B CG1   1 
ATOM   6011 C  CG2   . ILE B 1 238 ? 113.651 117.697 139.565 1.00 10.56  ? 238  ILE B CG2   1 
ATOM   6012 C  CD1   . ILE B 1 238 ? 116.556 118.072 140.447 1.00 10.56  ? 238  ILE B CD1   1 
ATOM   6013 N  N     . ILE B 1 239 ? 111.254 120.254 138.626 1.00 8.76   ? 239  ILE B N     1 
ATOM   6014 C  CA    . ILE B 1 239 ? 109.801 120.240 138.718 1.00 8.76   ? 239  ILE B CA    1 
ATOM   6015 C  C     . ILE B 1 239 ? 109.333 118.896 138.192 1.00 8.76   ? 239  ILE B C     1 
ATOM   6016 O  O     . ILE B 1 239 ? 109.628 118.543 137.051 1.00 8.76   ? 239  ILE B O     1 
ATOM   6017 C  CB    . ILE B 1 239 ? 109.158 121.377 137.909 1.00 8.76   ? 239  ILE B CB    1 
ATOM   6018 C  CG1   . ILE B 1 239 ? 109.667 122.753 138.334 1.00 8.76   ? 239  ILE B CG1   1 
ATOM   6019 C  CG2   . ILE B 1 239 ? 107.670 121.319 138.059 1.00 8.76   ? 239  ILE B CG2   1 
ATOM   6020 C  CD1   . ILE B 1 239 ? 110.738 123.336 137.452 1.00 8.76   ? 239  ILE B CD1   1 
ATOM   6021 N  N     . PHE B 1 240 ? 108.601 118.142 138.996 1.00 8.73   ? 240  PHE B N     1 
ATOM   6022 C  CA    . PHE B 1 240 ? 108.118 116.862 138.509 1.00 8.73   ? 240  PHE B CA    1 
ATOM   6023 C  C     . PHE B 1 240 ? 106.729 116.584 139.041 1.00 8.73   ? 240  PHE B C     1 
ATOM   6024 O  O     . PHE B 1 240 ? 106.337 117.079 140.096 1.00 8.73   ? 240  PHE B O     1 
ATOM   6025 C  CB    . PHE B 1 240 ? 109.076 115.700 138.861 1.00 8.73   ? 240  PHE B CB    1 
ATOM   6026 C  CG    . PHE B 1 240 ? 109.313 115.524 140.324 1.00 8.73   ? 240  PHE B CG    1 
ATOM   6027 C  CD1   . PHE B 1 240 ? 110.312 116.232 140.951 1.00 8.73   ? 240  PHE B CD1   1 
ATOM   6028 C  CD2   . PHE B 1 240 ? 108.557 114.642 141.071 1.00 8.73   ? 240  PHE B CD2   1 
ATOM   6029 C  CE1   . PHE B 1 240 ? 110.523 116.091 142.275 1.00 8.73   ? 240  PHE B CE1   1 
ATOM   6030 C  CE2   . PHE B 1 240 ? 108.777 114.504 142.406 1.00 8.73   ? 240  PHE B CE2   1 
ATOM   6031 C  CZ    . PHE B 1 240 ? 109.763 115.230 143.003 1.00 8.73   ? 240  PHE B CZ    1 
ATOM   6032 N  N     . SER B 1 241 ? 105.982 115.806 138.276 1.00 8.33   ? 241  SER B N     1 
ATOM   6033 C  CA    . SER B 1 241 ? 104.767 115.169 138.747 1.00 8.33   ? 241  SER B CA    1 
ATOM   6034 C  C     . SER B 1 241 ? 105.107 113.753 139.187 1.00 8.33   ? 241  SER B C     1 
ATOM   6035 O  O     . SER B 1 241 ? 106.063 113.160 138.697 1.00 8.33   ? 241  SER B O     1 
ATOM   6036 C  CB    . SER B 1 241 ? 103.697 115.165 137.657 1.00 8.33   ? 241  SER B CB    1 
ATOM   6037 O  OG    . SER B 1 241 ? 104.085 114.371 136.560 1.00 8.33   ? 241  SER B OG    1 
ATOM   6038 N  N     . ILE B 1 242 ? 104.348 113.220 140.137 1.00 9.10   ? 242  ILE B N     1 
ATOM   6039 C  CA    . ILE B 1 242 ? 104.667 111.903 140.673 1.00 9.10   ? 242  ILE B CA    1 
ATOM   6040 C  C     . ILE B 1 242 ? 103.378 111.236 141.137 1.00 9.10   ? 242  ILE B C     1 
ATOM   6041 O  O     . ILE B 1 242 ? 102.437 111.900 141.574 1.00 9.10   ? 242  ILE B O     1 
ATOM   6042 C  CB    . ILE B 1 242 ? 105.740 112.005 141.790 1.00 9.10   ? 242  ILE B CB    1 
ATOM   6043 C  CG1   . ILE B 1 242 ? 106.312 110.637 142.169 1.00 9.10   ? 242  ILE B CG1   1 
ATOM   6044 C  CG2   . ILE B 1 242 ? 105.229 112.725 143.005 1.00 9.10   ? 242  ILE B CG2   1 
ATOM   6045 C  CD1   . ILE B 1 242 ? 107.538 110.710 143.028 1.00 9.10   ? 242  ILE B CD1   1 
ATOM   6046 N  N     . HIS B 1 243 ? 103.309 109.923 140.962 1.00 9.72   ? 243  HIS B N     1 
ATOM   6047 C  CA    . HIS B 1 243 ? 102.252 109.097 141.522 1.00 9.72   ? 243  HIS B CA    1 
ATOM   6048 C  C     . HIS B 1 243 ? 102.849 108.140 142.531 1.00 9.72   ? 243  HIS B C     1 
ATOM   6049 O  O     . HIS B 1 243 ? 103.898 107.543 142.279 1.00 9.72   ? 243  HIS B O     1 
ATOM   6050 C  CB    . HIS B 1 243 ? 101.500 108.287 140.477 1.00 9.72   ? 243  HIS B CB    1 
ATOM   6051 C  CG    . HIS B 1 243 ? 100.618 109.094 139.585 1.00 9.72   ? 243  HIS B CG    1 
ATOM   6052 N  ND1   . HIS B 1 243 ? 99.548  109.816 140.061 1.00 9.72   ? 243  HIS B ND1   1 
ATOM   6053 C  CD2   . HIS B 1 243 ? 100.588 109.220 138.239 1.00 9.72   ? 243  HIS B CD2   1 
ATOM   6054 C  CE1   . HIS B 1 243 ? 98.925  110.393 139.053 1.00 9.72   ? 243  HIS B CE1   1 
ATOM   6055 N  NE2   . HIS B 1 243 ? 99.535  110.047 137.936 1.00 9.72   ? 243  HIS B NE2   1 
ATOM   6056 N  N     . GLN B 1 244 ? 102.150 108.000 143.654 1.00 11.31  ? 244  GLN B N     1 
ATOM   6057 C  CA    . GLN B 1 244 ? 102.513 107.104 144.746 1.00 11.31  ? 244  GLN B CA    1 
ATOM   6058 C  C     . GLN B 1 244 ? 103.943 107.241 145.278 1.00 11.31  ? 244  GLN B C     1 
ATOM   6059 O  O     . GLN B 1 244 ? 104.736 106.298 145.180 1.00 11.31  ? 244  GLN B O     1 
ATOM   6060 C  CB    . GLN B 1 244 ? 102.261 105.668 144.303 1.00 11.31  ? 244  GLN B CB    1 
ATOM   6061 C  CG    . GLN B 1 244 ? 100.877 105.424 143.791 1.00 11.31  ? 244  GLN B CG    1 
ATOM   6062 C  CD    . GLN B 1 244 ? 100.766 104.095 143.102 1.00 11.31  ? 244  GLN B CD    1 
ATOM   6063 O  OE1   . GLN B 1 244 ? 101.734 103.346 143.032 1.00 11.31  ? 244  GLN B OE1   1 
ATOM   6064 N  NE2   . GLN B 1 244 ? 99.605  103.811 142.541 1.00 11.31  ? 244  GLN B NE2   1 
ATOM   6065 N  N     . PRO B 1 245 ? 104.317 108.383 145.864 1.00 12.99  ? 245  PRO B N     1 
ATOM   6066 C  CA    . PRO B 1 245 ? 105.621 108.427 146.523 1.00 12.99  ? 245  PRO B CA    1 
ATOM   6067 C  C     . PRO B 1 245 ? 105.538 107.820 147.911 1.00 12.99  ? 245  PRO B C     1 
ATOM   6068 O  O     . PRO B 1 245 ? 104.567 108.015 148.645 1.00 12.99  ? 245  PRO B O     1 
ATOM   6069 C  CB    . PRO B 1 245 ? 105.937 109.922 146.579 1.00 12.99  ? 245  PRO B CB    1 
ATOM   6070 C  CG    . PRO B 1 245 ? 104.655 110.559 146.628 1.00 12.99  ? 245  PRO B CG    1 
ATOM   6071 C  CD    . PRO B 1 245 ? 103.708 109.728 145.845 1.00 12.99  ? 245  PRO B CD    1 
ATOM   6072 N  N     . ARG B 1 246 ? 106.560 107.058 148.271 1.00 16.87  ? 246  ARG B N     1 
ATOM   6073 C  CA    . ARG B 1 246 ? 106.596 106.542 149.624 1.00 16.87  ? 246  ARG B CA    1 
ATOM   6074 C  C     . ARG B 1 246 ? 107.136 107.618 150.559 1.00 16.87  ? 246  ARG B C     1 
ATOM   6075 O  O     . ARG B 1 246 ? 107.485 108.721 150.137 1.00 16.87  ? 246  ARG B O     1 
ATOM   6076 C  CB    . ARG B 1 246 ? 107.413 105.259 149.685 1.00 16.87  ? 246  ARG B CB    1 
ATOM   6077 C  CG    . ARG B 1 246 ? 108.888 105.408 149.451 1.00 16.87  ? 246  ARG B CG    1 
ATOM   6078 C  CD    . ARG B 1 246 ? 109.520 104.043 149.572 1.00 16.87  ? 246  ARG B CD    1 
ATOM   6079 N  NE    . ARG B 1 246 ? 110.969 104.072 149.514 1.00 16.87  ? 246  ARG B NE    1 
ATOM   6080 C  CZ    . ARG B 1 246 ? 111.726 102.992 149.649 1.00 16.87  ? 246  ARG B CZ    1 
ATOM   6081 N  NH1   . ARG B 1 246 ? 111.160 101.813 149.844 1.00 16.87  ? 246  ARG B NH1   1 
ATOM   6082 N  NH2   . ARG B 1 246 ? 113.044 103.089 149.594 1.00 16.87  ? 246  ARG B NH2   1 
ATOM   6083 N  N     . TYR B 1 247 ? 107.195 107.306 151.851 1.00 18.71  ? 247  TYR B N     1 
ATOM   6084 C  CA    . TYR B 1 247 ? 107.567 108.315 152.833 1.00 18.71  ? 247  TYR B CA    1 
ATOM   6085 C  C     . TYR B 1 247 ? 109.037 108.700 152.743 1.00 18.71  ? 247  TYR B C     1 
ATOM   6086 O  O     . TYR B 1 247 ? 109.394 109.822 153.107 1.00 18.71  ? 247  TYR B O     1 
ATOM   6087 C  CB    . TYR B 1 247 ? 107.220 107.825 154.238 1.00 18.71  ? 247  TYR B CB    1 
ATOM   6088 C  CG    . TYR B 1 247 ? 107.528 108.821 155.322 1.00 18.71  ? 247  TYR B CG    1 
ATOM   6089 C  CD1   . TYR B 1 247 ? 106.755 109.956 155.482 1.00 18.71  ? 247  TYR B CD1   1 
ATOM   6090 C  CD2   . TYR B 1 247 ? 108.601 108.631 156.179 1.00 18.71  ? 247  TYR B CD2   1 
ATOM   6091 C  CE1   . TYR B 1 247 ? 107.034 110.877 156.465 1.00 18.71  ? 247  TYR B CE1   1 
ATOM   6092 C  CE2   . TYR B 1 247 ? 108.892 109.546 157.168 1.00 18.71  ? 247  TYR B CE2   1 
ATOM   6093 C  CZ    . TYR B 1 247 ? 108.104 110.667 157.307 1.00 18.71  ? 247  TYR B CZ    1 
ATOM   6094 O  OH    . TYR B 1 247 ? 108.390 111.579 158.295 1.00 18.71  ? 247  TYR B OH    1 
ATOM   6095 N  N     . SER B 1 248 ? 109.889 107.814 152.235 1.00 17.15  ? 248  SER B N     1 
ATOM   6096 C  CA    . SER B 1 248 ? 111.273 108.191 151.992 1.00 17.15  ? 248  SER B CA    1 
ATOM   6097 C  C     . SER B 1 248 ? 111.392 109.147 150.815 1.00 17.15  ? 248  SER B C     1 
ATOM   6098 O  O     . SER B 1 248 ? 112.336 109.939 150.757 1.00 17.15  ? 248  SER B O     1 
ATOM   6099 C  CB    . SER B 1 248 ? 112.114 106.944 151.739 1.00 17.15  ? 248  SER B CB    1 
ATOM   6100 O  OG    . SER B 1 248 ? 112.119 106.092 152.870 1.00 17.15  ? 248  SER B OG    1 
ATOM   6101 N  N     . ILE B 1 249 ? 110.449 109.087 149.876 1.00 15.17  ? 249  ILE B N     1 
ATOM   6102 C  CA    . ILE B 1 249 ? 110.472 109.965 148.713 1.00 15.17  ? 249  ILE B CA    1 
ATOM   6103 C  C     . ILE B 1 249 ? 109.782 111.286 149.022 1.00 15.17  ? 249  ILE B C     1 
ATOM   6104 O  O     . ILE B 1 249 ? 110.260 112.353 148.625 1.00 15.17  ? 249  ILE B O     1 
ATOM   6105 C  CB    . ILE B 1 249 ? 109.838 109.245 147.508 1.00 15.17  ? 249  ILE B CB    1 
ATOM   6106 C  CG1   . ILE B 1 249 ? 110.722 108.097 147.034 1.00 15.17  ? 249  ILE B CG1   1 
ATOM   6107 C  CG2   . ILE B 1 249 ? 109.595 110.172 146.363 1.00 15.17  ? 249  ILE B CG2   1 
ATOM   6108 C  CD1   . ILE B 1 249 ? 110.060 107.245 145.998 1.00 15.17  ? 249  ILE B CD1   1 
ATOM   6109 N  N     . PHE B 1 250 ? 108.672 111.239 149.766 1.00 16.82  ? 250  PHE B N     1 
ATOM   6110 C  CA    . PHE B 1 250 ? 107.946 112.451 150.131 1.00 16.82  ? 250  PHE B CA    1 
ATOM   6111 C  C     . PHE B 1 250 ? 108.757 113.346 151.059 1.00 16.82  ? 250  PHE B C     1 
ATOM   6112 O  O     . PHE B 1 250 ? 108.581 114.568 151.051 1.00 16.82  ? 250  PHE B O     1 
ATOM   6113 C  CB    . PHE B 1 250 ? 106.614 112.086 150.788 1.00 16.82  ? 250  PHE B CB    1 
ATOM   6114 C  CG    . PHE B 1 250 ? 105.786 113.276 151.177 1.00 16.82  ? 250  PHE B CG    1 
ATOM   6115 C  CD1   . PHE B 1 250 ? 105.045 113.956 150.228 1.00 16.82  ? 250  PHE B CD1   1 
ATOM   6116 C  CD2   . PHE B 1 250 ? 105.764 113.730 152.488 1.00 16.82  ? 250  PHE B CD2   1 
ATOM   6117 C  CE1   . PHE B 1 250 ? 104.296 115.054 150.577 1.00 16.82  ? 250  PHE B CE1   1 
ATOM   6118 C  CE2   . PHE B 1 250 ? 105.023 114.830 152.834 1.00 16.82  ? 250  PHE B CE2   1 
ATOM   6119 C  CZ    . PHE B 1 250 ? 104.288 115.490 151.878 1.00 16.82  ? 250  PHE B CZ    1 
ATOM   6120 N  N     . LYS B 1 251 ? 109.650 112.764 151.855 1.00 16.43  ? 251  LYS B N     1 
ATOM   6121 C  CA    . LYS B 1 251 ? 110.478 113.532 152.774 1.00 16.43  ? 251  LYS B CA    1 
ATOM   6122 C  C     . LYS B 1 251 ? 111.511 114.383 152.040 1.00 16.43  ? 251  LYS B C     1 
ATOM   6123 O  O     . LYS B 1 251 ? 112.012 115.362 152.602 1.00 16.43  ? 251  LYS B O     1 
ATOM   6124 C  CB    . LYS B 1 251 ? 111.139 112.557 153.751 1.00 16.43  ? 251  LYS B CB    1 
ATOM   6125 C  CG    . LYS B 1 251 ? 111.886 113.150 154.927 1.00 16.43  ? 251  LYS B CG    1 
ATOM   6126 C  CD    . LYS B 1 251 ? 112.405 112.056 155.848 1.00 16.43  ? 251  LYS B CD    1 
ATOM   6127 C  CE    . LYS B 1 251 ? 113.772 111.545 155.406 1.00 16.43  ? 251  LYS B CE    1 
ATOM   6128 N  NZ    . LYS B 1 251 ? 113.693 110.455 154.392 1.00 16.43  ? 251  LYS B NZ    1 
ATOM   6129 N  N     . LEU B 1 252 ? 111.805 114.054 150.783 1.00 15.35  ? 252  LEU B N     1 
ATOM   6130 C  CA    . LEU B 1 252 ? 112.788 114.769 149.983 1.00 15.35  ? 252  LEU B CA    1 
ATOM   6131 C  C     . LEU B 1 252 ? 112.246 116.039 149.345 1.00 15.35  ? 252  LEU B C     1 
ATOM   6132 O  O     . LEU B 1 252 ? 113.035 116.811 148.797 1.00 15.35  ? 252  LEU B O     1 
ATOM   6133 C  CB    . LEU B 1 252 ? 113.317 113.858 148.875 1.00 15.35  ? 252  LEU B CB    1 
ATOM   6134 C  CG    . LEU B 1 252 ? 114.034 112.576 149.281 1.00 15.35  ? 252  LEU B CG    1 
ATOM   6135 C  CD1   . LEU B 1 252 ? 114.373 111.786 148.046 1.00 15.35  ? 252  LEU B CD1   1 
ATOM   6136 C  CD2   . LEU B 1 252 ? 115.275 112.886 150.080 1.00 15.35  ? 252  LEU B CD2   1 
ATOM   6137 N  N     . PHE B 1 253 ? 110.938 116.273 149.396 1.00 14.95  ? 253  PHE B N     1 
ATOM   6138 C  CA    . PHE B 1 253 ? 110.339 117.358 148.629 1.00 14.95  ? 253  PHE B CA    1 
ATOM   6139 C  C     . PHE B 1 253 ? 110.641 118.703 149.274 1.00 14.95  ? 253  PHE B C     1 
ATOM   6140 O  O     . PHE B 1 253 ? 110.673 118.829 150.499 1.00 14.95  ? 253  PHE B O     1 
ATOM   6141 C  CB    . PHE B 1 253 ? 108.822 117.185 148.523 1.00 14.95  ? 253  PHE B CB    1 
ATOM   6142 C  CG    . PHE B 1 253 ? 108.378 115.991 147.722 1.00 14.95  ? 253  PHE B CG    1 
ATOM   6143 C  CD1   . PHE B 1 253 ? 109.236 115.333 146.861 1.00 14.95  ? 253  PHE B CD1   1 
ATOM   6144 C  CD2   . PHE B 1 253 ? 107.083 115.528 147.839 1.00 14.95  ? 253  PHE B CD2   1 
ATOM   6145 C  CE1   . PHE B 1 253 ? 108.810 114.236 146.153 1.00 14.95  ? 253  PHE B CE1   1 
ATOM   6146 C  CE2   . PHE B 1 253 ? 106.656 114.432 147.122 1.00 14.95  ? 253  PHE B CE2   1 
ATOM   6147 C  CZ    . PHE B 1 253 ? 107.519 113.792 146.279 1.00 14.95  ? 253  PHE B CZ    1 
ATOM   6148 N  N     . ASP B 1 254 ? 110.863 119.712 148.438 1.00 17.10  ? 254  ASP B N     1 
ATOM   6149 C  CA    . ASP B 1 254 ? 111.064 121.079 148.898 1.00 17.10  ? 254  ASP B CA    1 
ATOM   6150 C  C     . ASP B 1 254 ? 109.838 121.950 148.701 1.00 17.10  ? 254  ASP B C     1 
ATOM   6151 O  O     . ASP B 1 254 ? 109.655 122.923 149.436 1.00 17.10  ? 254  ASP B O     1 
ATOM   6152 C  CB    . ASP B 1 254 ? 112.251 121.713 148.168 1.00 17.10  ? 254  ASP B CB    1 
ATOM   6153 C  CG    . ASP B 1 254 ? 113.573 121.109 148.581 1.00 17.10  ? 254  ASP B CG    1 
ATOM   6154 O  OD1   . ASP B 1 254 ? 113.695 120.707 149.753 1.00 17.10  ? 254  ASP B OD1   1 
ATOM   6155 O  OD2   . ASP B 1 254 ? 114.484 121.016 147.736 1.00 17.10  ? 254  ASP B OD2   1 
ATOM   6156 N  N     . SER B 1 255 ? 109.005 121.616 147.725 1.00 15.80  ? 255  SER B N     1 
ATOM   6157 C  CA    . SER B 1 255 ? 107.773 122.326 147.437 1.00 15.80  ? 255  SER B CA    1 
ATOM   6158 C  C     . SER B 1 255 ? 106.743 121.316 146.970 1.00 15.80  ? 255  SER B C     1 
ATOM   6159 O  O     . SER B 1 255 ? 107.080 120.356 146.275 1.00 15.80  ? 255  SER B O     1 
ATOM   6160 C  CB    . SER B 1 255 ? 107.985 123.399 146.372 1.00 15.80  ? 255  SER B CB    1 
ATOM   6161 O  OG    . SER B 1 255 ? 106.764 124.001 145.987 1.00 15.80  ? 255  SER B OG    1 
ATOM   6162 N  N     . LEU B 1 256 ? 105.492 121.533 147.349 1.00 16.40  ? 256  LEU B N     1 
ATOM   6163 C  CA    . LEU B 1 256 ? 104.421 120.605 147.035 1.00 16.40  ? 256  LEU B CA    1 
ATOM   6164 C  C     . LEU B 1 256 ? 103.305 121.342 146.314 1.00 16.40  ? 256  LEU B C     1 
ATOM   6165 O  O     . LEU B 1 256 ? 102.942 122.456 146.692 1.00 16.40  ? 256  LEU B O     1 
ATOM   6166 C  CB    . LEU B 1 256 ? 103.890 119.943 148.301 1.00 16.40  ? 256  LEU B CB    1 
ATOM   6167 C  CG    . LEU B 1 256 ? 102.844 118.863 148.092 1.00 16.40  ? 256  LEU B CG    1 
ATOM   6168 C  CD1   . LEU B 1 256 ? 103.468 117.752 147.324 1.00 16.40  ? 256  LEU B CD1   1 
ATOM   6169 C  CD2   . LEU B 1 256 ? 102.339 118.372 149.400 1.00 16.40  ? 256  LEU B CD2   1 
ATOM   6170 N  N     . THR B 1 257 ? 102.770 120.712 145.273 1.00 14.29  ? 257  THR B N     1 
ATOM   6171 C  CA    . THR B 1 257 ? 101.708 121.266 144.447 1.00 14.29  ? 257  THR B CA    1 
ATOM   6172 C  C     . THR B 1 257 ? 100.649 120.192 144.267 1.00 14.29  ? 257  THR B C     1 
ATOM   6173 O  O     . THR B 1 257 ? 100.970 119.074 143.864 1.00 14.29  ? 257  THR B O     1 
ATOM   6174 C  CB    . THR B 1 257 ? 102.266 121.715 143.091 1.00 14.29  ? 257  THR B CB    1 
ATOM   6175 O  OG1   . THR B 1 257 ? 103.259 122.726 143.287 1.00 14.29  ? 257  THR B OG1   1 
ATOM   6176 C  CG2   . THR B 1 257 ? 101.190 122.256 142.210 1.00 14.29  ? 257  THR B CG2   1 
ATOM   6177 N  N     . LEU B 1 258 ? 99.397  120.512 144.577 1.00 15.43  ? 258  LEU B N     1 
ATOM   6178 C  CA    . LEU B 1 258 ? 98.308  119.539 144.512 1.00 15.43  ? 258  LEU B CA    1 
ATOM   6179 C  C     . LEU B 1 258 ? 97.278  119.986 143.485 1.00 15.43  ? 258  LEU B C     1 
ATOM   6180 O  O     . LEU B 1 258 ? 96.566  120.969 143.703 1.00 15.43  ? 258  LEU B O     1 
ATOM   6181 C  CB    . LEU B 1 258 ? 97.655  119.353 145.878 1.00 15.43  ? 258  LEU B CB    1 
ATOM   6182 C  CG    . LEU B 1 258 ? 98.439  118.646 146.975 1.00 15.43  ? 258  LEU B CG    1 
ATOM   6183 C  CD1   . LEU B 1 258 ? 97.722  118.792 148.272 1.00 15.43  ? 258  LEU B CD1   1 
ATOM   6184 C  CD2   . LEU B 1 258 ? 98.545  117.197 146.650 1.00 15.43  ? 258  LEU B CD2   1 
ATOM   6185 N  N     . LEU B 1 259 ? 97.187  119.252 142.383 1.00 14.62  ? 259  LEU B N     1 
ATOM   6186 C  CA    . LEU B 1 259 ? 96.199  119.476 141.339 1.00 14.62  ? 259  LEU B CA    1 
ATOM   6187 C  C     . LEU B 1 259 ? 95.026  118.533 141.530 1.00 14.62  ? 259  LEU B C     1 
ATOM   6188 O  O     . LEU B 1 259 ? 95.198  117.401 141.973 1.00 14.62  ? 259  LEU B O     1 
ATOM   6189 C  CB    . LEU B 1 259 ? 96.797  119.244 139.950 1.00 14.62  ? 259  LEU B CB    1 
ATOM   6190 C  CG    . LEU B 1 259 ? 97.427  120.362 139.129 1.00 14.62  ? 259  LEU B CG    1 
ATOM   6191 C  CD1   . LEU B 1 259 ? 96.358  121.337 138.766 1.00 14.62  ? 259  LEU B CD1   1 
ATOM   6192 C  CD2   . LEU B 1 259 ? 98.527  121.054 139.878 1.00 14.62  ? 259  LEU B CD2   1 
ATOM   6193 N  N     . ALA B 1 260 ? 93.831  119.001 141.180 1.00 17.24  ? 260  ALA B N     1 
ATOM   6194 C  CA    . ALA B 1 260 ? 92.655  118.137 141.144 1.00 17.24  ? 260  ALA B CA    1 
ATOM   6195 C  C     . ALA B 1 260 ? 91.647  118.763 140.196 1.00 17.24  ? 260  ALA B C     1 
ATOM   6196 O  O     . ALA B 1 260 ? 91.132  119.848 140.481 1.00 17.24  ? 260  ALA B O     1 
ATOM   6197 C  CB    . ALA B 1 260 ? 92.057  117.954 142.528 1.00 17.24  ? 260  ALA B CB    1 
ATOM   6198 N  N     . SER B 1 261 ? 91.373  118.070 139.086 1.00 17.71  ? 261  SER B N     1 
ATOM   6199 C  CA    . SER B 1 261 ? 90.434  118.490 138.036 1.00 17.71  ? 261  SER B CA    1 
ATOM   6200 C  C     . SER B 1 261 ? 90.763  119.876 137.484 1.00 17.71  ? 261  SER B C     1 
ATOM   6201 O  O     . SER B 1 261 ? 89.873  120.680 137.208 1.00 17.71  ? 261  SER B O     1 
ATOM   6202 C  CB    . SER B 1 261 ? 88.984  118.433 138.516 1.00 17.71  ? 261  SER B CB    1 
ATOM   6203 O  OG    . SER B 1 261 ? 88.715  119.461 139.447 1.00 17.71  ? 261  SER B OG    1 
ATOM   6204 N  N     . GLY B 1 262 ? 92.052  120.161 137.322 1.00 18.32  ? 262  GLY B N     1 
ATOM   6205 C  CA    . GLY B 1 262 ? 92.492  121.402 136.735 1.00 18.32  ? 262  GLY B CA    1 
ATOM   6206 C  C     . GLY B 1 262 ? 92.684  122.546 137.702 1.00 18.32  ? 262  GLY B C     1 
ATOM   6207 O  O     . GLY B 1 262 ? 93.286  123.553 137.326 1.00 18.32  ? 262  GLY B O     1 
ATOM   6208 N  N     . ARG B 1 263 ? 92.195  122.434 138.925 1.00 21.64  ? 263  ARG B N     1 
ATOM   6209 C  CA    . ARG B 1 263 ? 92.345  123.497 139.902 1.00 21.64  ? 263  ARG B CA    1 
ATOM   6210 C  C     . ARG B 1 263 ? 93.401  123.121 140.929 1.00 21.64  ? 263  ARG B C     1 
ATOM   6211 O  O     . ARG B 1 263 ? 93.782  121.961 141.072 1.00 21.64  ? 263  ARG B O     1 
ATOM   6212 C  CB    . ARG B 1 263 ? 91.009  123.796 140.584 1.00 21.64  ? 263  ARG B CB    1 
ATOM   6213 C  CG    . ARG B 1 263 ? 89.981  124.403 139.646 1.00 21.64  ? 263  ARG B CG    1 
ATOM   6214 C  CD    . ARG B 1 263 ? 88.633  124.565 140.309 1.00 21.64  ? 263  ARG B CD    1 
ATOM   6215 N  NE    . ARG B 1 263 ? 88.649  125.548 141.387 1.00 21.64  ? 263  ARG B NE    1 
ATOM   6216 C  CZ    . ARG B 1 263 ? 88.399  126.843 141.221 1.00 21.64  ? 263  ARG B CZ    1 
ATOM   6217 N  NH1   . ARG B 1 263 ? 88.111  127.317 140.017 1.00 21.64  ? 263  ARG B NH1   1 
ATOM   6218 N  NH2   . ARG B 1 263 ? 88.434  127.666 142.261 1.00 21.64  ? 263  ARG B NH2   1 
ATOM   6219 N  N     . LEU B 1 264 ? 93.872  124.128 141.646 1.00 20.85  ? 264  LEU B N     1 
ATOM   6220 C  CA    . LEU B 1 264 ? 94.987  123.993 142.570 1.00 20.85  ? 264  LEU B CA    1 
ATOM   6221 C  C     . LEU B 1 264 ? 94.438  123.779 143.975 1.00 20.85  ? 264  LEU B C     1 
ATOM   6222 O  O     . LEU B 1 264 ? 93.749  124.651 144.512 1.00 20.85  ? 264  LEU B O     1 
ATOM   6223 C  CB    . LEU B 1 264 ? 95.858  125.243 142.511 1.00 20.85  ? 264  LEU B CB    1 
ATOM   6224 C  CG    . LEU B 1 264 ? 97.210  125.268 143.198 1.00 20.85  ? 264  LEU B CG    1 
ATOM   6225 C  CD1   . LEU B 1 264 ? 98.121  124.309 142.495 1.00 20.85  ? 264  LEU B CD1   1 
ATOM   6226 C  CD2   . LEU B 1 264 ? 97.774  126.662 143.157 1.00 20.85  ? 264  LEU B CD2   1 
ATOM   6227 N  N     . MET B 1 265 ? 94.734  122.620 144.567 1.00 22.19  ? 265  MET B N     1 
ATOM   6228 C  CA    . MET B 1 265 ? 94.268  122.347 145.922 1.00 22.19  ? 265  MET B CA    1 
ATOM   6229 C  C     . MET B 1 265 ? 95.205  122.919 146.969 1.00 22.19  ? 265  MET B C     1 
ATOM   6230 O  O     . MET B 1 265 ? 94.747  123.332 148.037 1.00 22.19  ? 265  MET B O     1 
ATOM   6231 C  CB    . MET B 1 265 ? 94.121  120.845 146.153 1.00 22.19  ? 265  MET B CB    1 
ATOM   6232 C  CG    . MET B 1 265 ? 93.106  120.147 145.283 1.00 22.19  ? 265  MET B CG    1 
ATOM   6233 S  SD    . MET B 1 265 ? 91.405  120.665 145.495 1.00 22.19  ? 265  MET B SD    1 
ATOM   6234 C  CE    . MET B 1 265 ? 91.148  121.640 144.023 1.00 22.19  ? 265  MET B CE    1 
ATOM   6235 N  N     . PHE B 1 266 ? 96.504  122.941 146.685 1.00 21.38  ? 266  PHE B N     1 
ATOM   6236 C  CA    . PHE B 1 266 ? 97.508  123.452 147.604 1.00 21.38  ? 266  PHE B CA    1 
ATOM   6237 C  C     . PHE B 1 266 ? 98.783  123.720 146.825 1.00 21.38  ? 266  PHE B C     1 
ATOM   6238 O  O     . PHE B 1 266 ? 99.118  122.978 145.904 1.00 21.38  ? 266  PHE B O     1 
ATOM   6239 C  CB    . PHE B 1 266 ? 97.780  122.463 148.743 1.00 21.38  ? 266  PHE B CB    1 
ATOM   6240 C  CG    . PHE B 1 266 ? 98.846  122.909 149.694 1.00 21.38  ? 266  PHE B CG    1 
ATOM   6241 C  CD1   . PHE B 1 266 ? 98.592  123.898 150.622 1.00 21.38  ? 266  PHE B CD1   1 
ATOM   6242 C  CD2   . PHE B 1 266 ? 100.103 122.337 149.660 1.00 21.38  ? 266  PHE B CD2   1 
ATOM   6243 C  CE1   . PHE B 1 266 ? 99.571  124.312 151.493 1.00 21.38  ? 266  PHE B CE1   1 
ATOM   6244 C  CE2   . PHE B 1 266 ? 101.084 122.753 150.524 1.00 21.38  ? 266  PHE B CE2   1 
ATOM   6245 C  CZ    . PHE B 1 266 ? 100.816 123.737 151.445 1.00 21.38  ? 266  PHE B CZ    1 
ATOM   6246 N  N     . HIS B 1 267 ? 99.479  124.790 147.192 1.00 19.78  ? 267  HIS B N     1 
ATOM   6247 C  CA    . HIS B 1 267 ? 100.830 125.042 146.715 1.00 19.78  ? 267  HIS B CA    1 
ATOM   6248 C  C     . HIS B 1 267 ? 101.610 125.713 147.831 1.00 19.78  ? 267  HIS B C     1 
ATOM   6249 O  O     . HIS B 1 267 ? 101.146 126.696 148.410 1.00 19.78  ? 267  HIS B O     1 
ATOM   6250 C  CB    . HIS B 1 267 ? 100.848 125.917 145.463 1.00 19.78  ? 267  HIS B CB    1 
ATOM   6251 C  CG    . HIS B 1 267 ? 102.225 126.250 144.986 1.00 19.78  ? 267  HIS B CG    1 
ATOM   6252 N  ND1   . HIS B 1 267 ? 103.018 125.348 144.313 1.00 19.78  ? 267  HIS B ND1   1 
ATOM   6253 C  CD2   . HIS B 1 267 ? 102.962 127.377 145.108 1.00 19.78  ? 267  HIS B CD2   1 
ATOM   6254 C  CE1   . HIS B 1 267 ? 104.178 125.908 144.031 1.00 19.78  ? 267  HIS B CE1   1 
ATOM   6255 N  NE2   . HIS B 1 267 ? 104.171 127.140 144.504 1.00 19.78  ? 267  HIS B NE2   1 
ATOM   6256 N  N     . GLY B 1 268 ? 102.786 125.182 148.127 1.00 20.54  ? 268  GLY B N     1 
ATOM   6257 C  CA    . GLY B 1 268 ? 103.628 125.727 149.159 1.00 20.54  ? 268  GLY B CA    1 
ATOM   6258 C  C     . GLY B 1 268 ? 104.712 124.742 149.522 1.00 20.54  ? 268  GLY B C     1 
ATOM   6259 O  O     . GLY B 1 268 ? 105.070 123.872 148.724 1.00 20.54  ? 268  GLY B O     1 
ATOM   6260 N  N     . PRO B 1 269 ? 105.270 124.866 150.723 1.00 25.19  ? 269  PRO B N     1 
ATOM   6261 C  CA    . PRO B 1 269 ? 106.230 123.868 151.195 1.00 25.19  ? 269  PRO B CA    1 
ATOM   6262 C  C     . PRO B 1 269 ? 105.555 122.534 151.465 1.00 25.19  ? 269  PRO B C     1 
ATOM   6263 O  O     . PRO B 1 269 ? 104.358 122.452 151.737 1.00 25.19  ? 269  PRO B O     1 
ATOM   6264 C  CB    . PRO B 1 269 ? 106.776 124.484 152.485 1.00 25.19  ? 269  PRO B CB    1 
ATOM   6265 C  CG    . PRO B 1 269 ? 106.544 125.935 152.331 1.00 25.19  ? 269  PRO B CG    1 
ATOM   6266 C  CD    . PRO B 1 269 ? 105.252 126.050 151.594 1.00 25.19  ? 269  PRO B CD    1 
ATOM   6267 N  N     . ALA B 1 270 ? 106.351 121.471 151.368 1.00 23.94  ? 270  ALA B N     1 
ATOM   6268 C  CA    . ALA B 1 270 ? 105.821 120.134 151.587 1.00 23.94  ? 270  ALA B CA    1 
ATOM   6269 C  C     . ALA B 1 270 ? 105.786 119.769 153.061 1.00 23.94  ? 270  ALA B C     1 
ATOM   6270 O  O     . ALA B 1 270 ? 104.940 118.972 153.478 1.00 23.94  ? 270  ALA B O     1 
ATOM   6271 C  CB    . ALA B 1 270 ? 106.649 119.112 150.821 1.00 23.94  ? 270  ALA B CB    1 
ATOM   6272 N  N     . GLN B 1 271 ? 106.691 120.334 153.860 1.00 30.09  ? 271  GLN B N     1 
ATOM   6273 C  CA    . GLN B 1 271 ? 106.683 120.073 155.291 1.00 30.09  ? 271  GLN B CA    1 
ATOM   6274 C  C     . GLN B 1 271 ? 105.553 120.803 155.997 1.00 30.09  ? 271  GLN B C     1 
ATOM   6275 O  O     . GLN B 1 271 ? 105.187 120.421 157.113 1.00 30.09  ? 271  GLN B O     1 
ATOM   6276 C  CB    . GLN B 1 271 ? 108.027 120.468 155.903 1.00 30.09  ? 271  GLN B CB    1 
ATOM   6277 C  CG    . GLN B 1 271 ? 108.305 121.968 155.922 1.00 30.09  ? 271  GLN B CG    1 
ATOM   6278 C  CD    . GLN B 1 271 ? 108.984 122.469 154.658 1.00 30.09  ? 271  GLN B CD    1 
ATOM   6279 O  OE1   . GLN B 1 271 ? 109.038 121.771 153.645 1.00 30.09  ? 271  GLN B OE1   1 
ATOM   6280 N  NE2   . GLN B 1 271 ? 109.498 123.692 154.712 1.00 30.09  ? 271  GLN B NE2   1 
ATOM   6281 N  N     . GLU B 1 272 ? 104.991 121.834 155.371 1.00 31.68  ? 272  GLU B N     1 
ATOM   6282 C  CA    . GLU B 1 272 ? 103.902 122.613 155.936 1.00 31.68  ? 272  GLU B CA    1 
ATOM   6283 C  C     . GLU B 1 272 ? 102.563 122.262 155.316 1.00 31.68  ? 272  GLU B C     1 
ATOM   6284 O  O     . GLU B 1 272 ? 101.589 122.986 155.519 1.00 31.68  ? 272  GLU B O     1 
ATOM   6285 C  CB    . GLU B 1 272 ? 104.186 124.103 155.761 1.00 31.68  ? 272  GLU B CB    1 
ATOM   6286 C  CG    . GLU B 1 272 ? 105.427 124.567 156.496 1.00 31.68  ? 272  GLU B CG    1 
ATOM   6287 C  CD    . GLU B 1 272 ? 105.723 126.032 156.274 1.00 31.68  ? 272  GLU B CD    1 
ATOM   6288 O  OE1   . GLU B 1 272 ? 105.015 126.668 155.467 1.00 31.68  ? 272  GLU B OE1   1 
ATOM   6289 O  OE2   . GLU B 1 272 ? 106.671 126.547 156.904 1.00 31.68  ? 272  GLU B OE2   1 
ATOM   6290 N  N     . ALA B 1 273 ? 102.496 121.168 154.564 1.00 28.06  ? 273  ALA B N     1 
ATOM   6291 C  CA    . ALA B 1 273 ? 101.259 120.735 153.934 1.00 28.06  ? 273  ALA B CA    1 
ATOM   6292 C  C     . ALA B 1 273 ? 100.406 119.878 154.845 1.00 28.06  ? 273  ALA B C     1 
ATOM   6293 O  O     . ALA B 1 273 ? 99.177  119.906 154.736 1.00 28.06  ? 273  ALA B O     1 
ATOM   6294 C  CB    . ALA B 1 273 ? 101.565 119.941 152.667 1.00 28.06  ? 273  ALA B CB    1 
ATOM   6295 N  N     . LEU B 1 274 ? 101.036 119.103 155.726 1.00 30.55  ? 274  LEU B N     1 
ATOM   6296 C  CA    . LEU B 1 274 ? 100.286 118.235 156.624 1.00 30.55  ? 274  LEU B CA    1 
ATOM   6297 C  C     . LEU B 1 274 ? 99.597  119.044 157.711 1.00 30.55  ? 274  LEU B C     1 
ATOM   6298 O  O     . LEU B 1 274 ? 98.473  118.727 158.113 1.00 30.55  ? 274  LEU B O     1 
ATOM   6299 C  CB    . LEU B 1 274 ? 101.220 117.193 157.231 1.00 30.55  ? 274  LEU B CB    1 
ATOM   6300 C  CG    . LEU B 1 274 ? 100.554 116.098 158.051 1.00 30.55  ? 274  LEU B CG    1 
ATOM   6301 C  CD1   . LEU B 1 274 ? 99.655  115.290 157.147 1.00 30.55  ? 274  LEU B CD1   1 
ATOM   6302 C  CD2   . LEU B 1 274 ? 101.599 115.219 158.705 1.00 30.55  ? 274  LEU B CD2   1 
ATOM   6303 N  N     . GLY B 1 275 ? 100.249 120.103 158.187 1.00 31.28  ? 275  GLY B N     1 
ATOM   6304 C  CA    . GLY B 1 275 ? 99.625  121.029 159.111 1.00 31.28  ? 275  GLY B CA    1 
ATOM   6305 C  C     . GLY B 1 275 ? 98.656  121.996 158.477 1.00 31.28  ? 275  GLY B C     1 
ATOM   6306 O  O     . GLY B 1 275 ? 98.035  122.792 159.185 1.00 31.28  ? 275  GLY B O     1 
ATOM   6307 N  N     . TYR B 1 276 ? 98.529  121.955 157.153 1.00 29.88  ? 276  TYR B N     1 
ATOM   6308 C  CA    . TYR B 1 276 ? 97.537  122.756 156.453 1.00 29.88  ? 276  TYR B CA    1 
ATOM   6309 C  C     . TYR B 1 276 ? 96.176  122.072 156.445 1.00 29.88  ? 276  TYR B C     1 
ATOM   6310 O  O     . TYR B 1 276 ? 95.153  122.706 156.719 1.00 29.88  ? 276  TYR B O     1 
ATOM   6311 C  CB    . TYR B 1 276 ? 98.013  123.027 155.028 1.00 29.88  ? 276  TYR B CB    1 
ATOM   6312 C  CG    . TYR B 1 276 ? 97.001  123.746 154.191 1.00 29.88  ? 276  TYR B CG    1 
ATOM   6313 C  CD1   . TYR B 1 276 ? 96.752  125.094 154.378 1.00 29.88  ? 276  TYR B CD1   1 
ATOM   6314 C  CD2   . TYR B 1 276 ? 96.288  123.072 153.213 1.00 29.88  ? 276  TYR B CD2   1 
ATOM   6315 C  CE1   . TYR B 1 276 ? 95.820  125.744 153.615 1.00 29.88  ? 276  TYR B CE1   1 
ATOM   6316 C  CE2   . TYR B 1 276 ? 95.356  123.711 152.454 1.00 29.88  ? 276  TYR B CE2   1 
ATOM   6317 C  CZ    . TYR B 1 276 ? 95.131  125.040 152.655 1.00 29.88  ? 276  TYR B CZ    1 
ATOM   6318 O  OH    . TYR B 1 276 ? 94.198  125.660 151.886 1.00 29.88  ? 276  TYR B OH    1 
ATOM   6319 N  N     . PHE B 1 277 ? 96.144  120.780 156.121 1.00 30.54  ? 277  PHE B N     1 
ATOM   6320 C  CA    . PHE B 1 277 ? 94.890  120.043 156.078 1.00 30.54  ? 277  PHE B CA    1 
ATOM   6321 C  C     . PHE B 1 277 ? 94.352  119.705 157.460 1.00 30.54  ? 277  PHE B C     1 
ATOM   6322 O  O     . PHE B 1 277 ? 93.174  119.358 157.581 1.00 30.54  ? 277  PHE B O     1 
ATOM   6323 C  CB    . PHE B 1 277 ? 95.056  118.759 155.269 1.00 30.54  ? 277  PHE B CB    1 
ATOM   6324 C  CG    . PHE B 1 277 ? 95.244  118.989 153.803 1.00 30.54  ? 277  PHE B CG    1 
ATOM   6325 C  CD1   . PHE B 1 277 ? 94.162  119.281 152.997 1.00 30.54  ? 277  PHE B CD1   1 
ATOM   6326 C  CD2   . PHE B 1 277 ? 96.497  118.901 153.228 1.00 30.54  ? 277  PHE B CD2   1 
ATOM   6327 C  CE1   . PHE B 1 277 ? 94.327  119.492 151.648 1.00 30.54  ? 277  PHE B CE1   1 
ATOM   6328 C  CE2   . PHE B 1 277 ? 96.667  119.109 151.877 1.00 30.54  ? 277  PHE B CE2   1 
ATOM   6329 C  CZ    . PHE B 1 277 ? 95.579  119.404 151.090 1.00 30.54  ? 277  PHE B CZ    1 
ATOM   6330 N  N     . GLU B 1 278 ? 95.183  119.779 158.500 1.00 35.14  ? 278  GLU B N     1 
ATOM   6331 C  CA    . GLU B 1 278 ? 94.662  119.665 159.855 1.00 35.14  ? 278  GLU B CA    1 
ATOM   6332 C  C     . GLU B 1 278 ? 93.908  120.915 160.273 1.00 35.14  ? 278  GLU B C     1 
ATOM   6333 O  O     . GLU B 1 278 ? 93.034  120.837 161.141 1.00 35.14  ? 278  GLU B O     1 
ATOM   6334 C  CB    . GLU B 1 278 ? 95.793  119.372 160.837 1.00 35.14  ? 278  GLU B CB    1 
ATOM   6335 C  CG    . GLU B 1 278 ? 96.383  117.984 160.677 1.00 35.14  ? 278  GLU B CG    1 
ATOM   6336 C  CD    . GLU B 1 278 ? 97.520  117.718 161.638 1.00 35.14  ? 278  GLU B CD    1 
ATOM   6337 O  OE1   . GLU B 1 278 ? 97.938  118.663 162.341 1.00 35.14  ? 278  GLU B OE1   1 
ATOM   6338 O  OE2   . GLU B 1 278 ? 97.995  116.564 161.689 1.00 35.14  ? 278  GLU B OE2   1 
ATOM   6339 N  N     . SER B 1 279 ? 94.225  122.060 159.670 1.00 33.92  ? 279  SER B N     1 
ATOM   6340 C  CA    . SER B 1 279 ? 93.444  123.265 159.910 1.00 33.92  ? 279  SER B CA    1 
ATOM   6341 C  C     . SER B 1 279 ? 92.109  123.219 159.181 1.00 33.92  ? 279  SER B C     1 
ATOM   6342 O  O     . SER B 1 279 ? 91.139  123.838 159.631 1.00 33.92  ? 279  SER B O     1 
ATOM   6343 C  CB    . SER B 1 279 ? 94.241  124.493 159.481 1.00 33.92  ? 279  SER B CB    1 
ATOM   6344 O  OG    . SER B 1 279 ? 93.485  125.674 159.661 1.00 33.92  ? 279  SER B OG    1 
ATOM   6345 N  N     . ALA B 1 280 ? 92.036  122.496 158.068 1.00 34.63  ? 280  ALA B N     1 
ATOM   6346 C  CA    . ALA B 1 280 ? 90.810  122.379 157.291 1.00 34.63  ? 280  ALA B CA    1 
ATOM   6347 C  C     . ALA B 1 280 ? 89.908  121.249 157.768 1.00 34.63  ? 280  ALA B C     1 
ATOM   6348 O  O     . ALA B 1 280 ? 88.871  121.002 157.146 1.00 34.63  ? 280  ALA B O     1 
ATOM   6349 C  CB    . ALA B 1 280 ? 91.142  122.184 155.810 1.00 34.63  ? 280  ALA B CB    1 
ATOM   6350 N  N     . GLY B 1 281 ? 90.274  120.559 158.842 1.00 36.42  ? 281  GLY B N     1 
ATOM   6351 C  CA    . GLY B 1 281 ? 89.427  119.546 159.430 1.00 36.42  ? 281  GLY B CA    1 
ATOM   6352 C  C     . GLY B 1 281 ? 89.786  118.113 159.116 1.00 36.42  ? 281  GLY B C     1 
ATOM   6353 O  O     . GLY B 1 281 ? 88.968  117.223 159.369 1.00 36.42  ? 281  GLY B O     1 
ATOM   6354 N  N     . TYR B 1 282 ? 90.979  117.855 158.585 1.00 35.15  ? 282  TYR B N     1 
ATOM   6355 C  CA    . TYR B 1 282 ? 91.398  116.513 158.196 1.00 35.15  ? 282  TYR B CA    1 
ATOM   6356 C  C     . TYR B 1 282 ? 92.609  116.121 159.028 1.00 35.15  ? 282  TYR B C     1 
ATOM   6357 O  O     . TYR B 1 282 ? 93.701  116.658 158.825 1.00 35.15  ? 282  TYR B O     1 
ATOM   6358 C  CB    . TYR B 1 282 ? 91.730  116.456 156.709 1.00 35.15  ? 282  TYR B CB    1 
ATOM   6359 C  CG    . TYR B 1 282 ? 90.555  116.692 155.803 1.00 35.15  ? 282  TYR B CG    1 
ATOM   6360 C  CD1   . TYR B 1 282 ? 89.639  115.683 155.554 1.00 35.15  ? 282  TYR B CD1   1 
ATOM   6361 C  CD2   . TYR B 1 282 ? 90.371  117.917 155.182 1.00 35.15  ? 282  TYR B CD2   1 
ATOM   6362 C  CE1   . TYR B 1 282 ? 88.564  115.891 154.721 1.00 35.15  ? 282  TYR B CE1   1 
ATOM   6363 C  CE2   . TYR B 1 282 ? 89.300  118.136 154.346 1.00 35.15  ? 282  TYR B CE2   1 
ATOM   6364 C  CZ    . TYR B 1 282 ? 88.400  117.119 154.119 1.00 35.15  ? 282  TYR B CZ    1 
ATOM   6365 O  OH    . TYR B 1 282 ? 87.328  117.326 153.286 1.00 35.15  ? 282  TYR B OH    1 
ATOM   6366 N  N     . HIS B 1 283 ? 92.428  115.181 159.948 1.00 40.68  ? 283  HIS B N     1 
ATOM   6367 C  CA    . HIS B 1 283 ? 93.517  114.751 160.810 1.00 40.68  ? 283  HIS B CA    1 
ATOM   6368 C  C     . HIS B 1 283 ? 94.259  113.580 160.178 1.00 40.68  ? 283  HIS B C     1 
ATOM   6369 O  O     . HIS B 1 283 ? 93.674  112.755 159.474 1.00 40.68  ? 283  HIS B O     1 
ATOM   6370 C  CB    . HIS B 1 283 ? 92.994  114.378 162.196 1.00 40.68  ? 283  HIS B CB    1 
ATOM   6371 C  CG    . HIS B 1 283 ? 92.432  115.540 162.955 1.00 40.68  ? 283  HIS B CG    1 
ATOM   6372 N  ND1   . HIS B 1 283 ? 91.751  115.396 164.145 1.00 40.68  ? 283  HIS B ND1   1 
ATOM   6373 C  CD2   . HIS B 1 283 ? 92.440  116.867 162.686 1.00 40.68  ? 283  HIS B CD2   1 
ATOM   6374 C  CE1   . HIS B 1 283 ? 91.369  116.584 164.578 1.00 40.68  ? 283  HIS B CE1   1 
ATOM   6375 N  NE2   . HIS B 1 283 ? 91.775  117.493 163.711 1.00 40.68  ? 283  HIS B NE2   1 
ATOM   6376 N  N     . CYS B 1 284 ? 95.562  113.509 160.458 1.00 44.20  ? 284  CYS B N     1 
ATOM   6377 C  CA    . CYS B 1 284 ? 96.459  112.672 159.665 1.00 44.20  ? 284  CYS B CA    1 
ATOM   6378 C  C     . CYS B 1 284 ? 96.376  111.200 160.051 1.00 44.20  ? 284  CYS B C     1 
ATOM   6379 O  O     . CYS B 1 284 ? 96.220  110.333 159.184 1.00 44.20  ? 284  CYS B O     1 
ATOM   6380 C  CB    . CYS B 1 284 ? 97.899  113.163 159.804 1.00 44.20  ? 284  CYS B CB    1 
ATOM   6381 S  SG    . CYS B 1 284 ? 99.081  112.132 158.910 1.00 44.20  ? 284  CYS B SG    1 
ATOM   6382 N  N     . GLU B 1 285 ? 96.481  110.896 161.345 1.00 48.18  ? 285  GLU B N     1 
ATOM   6383 C  CA    . GLU B 1 285 ? 96.935  109.575 161.771 1.00 48.18  ? 285  GLU B CA    1 
ATOM   6384 C  C     . GLU B 1 285 ? 95.879  108.492 161.584 1.00 48.18  ? 285  GLU B C     1 
ATOM   6385 O  O     . GLU B 1 285 ? 95.328  107.955 162.548 1.00 48.18  ? 285  GLU B O     1 
ATOM   6386 C  CB    . GLU B 1 285 ? 97.388  109.616 163.228 1.00 48.18  ? 285  GLU B CB    1 
ATOM   6387 C  CG    . GLU B 1 285 ? 98.633  110.458 163.439 1.00 48.18  ? 285  GLU B CG    1 
ATOM   6388 C  CD    . GLU B 1 285 ? 99.859  109.889 162.739 1.00 48.18  ? 285  GLU B CD    1 
ATOM   6389 O  OE1   . GLU B 1 285 ? 99.985  108.649 162.644 1.00 48.18  ? 285  GLU B OE1   1 
ATOM   6390 O  OE2   . GLU B 1 285 ? 100.696 110.691 162.274 1.00 48.18  ? 285  GLU B OE2   1 
ATOM   6391 N  N     . ALA B 1 286 ? 95.611  108.179 160.324 1.00 43.71  ? 286  ALA B N     1 
ATOM   6392 C  CA    . ALA B 1 286 ? 94.992  106.938 159.902 1.00 43.71  ? 286  ALA B CA    1 
ATOM   6393 C  C     . ALA B 1 286 ? 95.811  106.505 158.698 1.00 43.71  ? 286  ALA B C     1 
ATOM   6394 O  O     . ALA B 1 286 ? 95.503  105.523 158.023 1.00 43.71  ? 286  ALA B O     1 
ATOM   6395 C  CB    . ALA B 1 286 ? 93.532  107.130 159.551 1.00 43.71  ? 286  ALA B CB    1 
ATOM   6396 N  N     . TYR B 1 287 ? 96.873  107.275 158.449 1.00 38.65  ? 287  TYR B N     1 
ATOM   6397 C  CA    . TYR B 1 287 ? 97.769  107.079 157.314 1.00 38.65  ? 287  TYR B CA    1 
ATOM   6398 C  C     . TYR B 1 287 ? 99.180  107.418 157.774 1.00 38.65  ? 287  TYR B C     1 
ATOM   6399 O  O     . TYR B 1 287 ? 99.437  108.546 158.201 1.00 38.65  ? 287  TYR B O     1 
ATOM   6400 C  CB    . TYR B 1 287 ? 97.365  107.959 156.129 1.00 38.65  ? 287  TYR B CB    1 
ATOM   6401 C  CG    . TYR B 1 287 ? 96.019  107.620 155.541 1.00 38.65  ? 287  TYR B CG    1 
ATOM   6402 C  CD1   . TYR B 1 287 ? 95.869  106.539 154.684 1.00 38.65  ? 287  TYR B CD1   1 
ATOM   6403 C  CD2   . TYR B 1 287 ? 94.898  108.381 155.844 1.00 38.65  ? 287  TYR B CD2   1 
ATOM   6404 C  CE1   . TYR B 1 287 ? 94.637  106.219 154.149 1.00 38.65  ? 287  TYR B CE1   1 
ATOM   6405 C  CE2   . TYR B 1 287 ? 93.664  108.076 155.311 1.00 38.65  ? 287  TYR B CE2   1 
ATOM   6406 C  CZ    . TYR B 1 287 ? 93.537  106.993 154.466 1.00 38.65  ? 287  TYR B CZ    1 
ATOM   6407 O  OH    . TYR B 1 287 ? 92.305  106.685 153.931 1.00 38.65  ? 287  TYR B OH    1 
ATOM   6408 N  N     . ASN B 1 288 ? 100.094 106.451 157.681 1.00 36.96  ? 288  ASN B N     1 
ATOM   6409 C  CA    . ASN B 1 288 ? 101.479 106.711 158.057 1.00 36.96  ? 288  ASN B CA    1 
ATOM   6410 C  C     . ASN B 1 288 ? 102.237 107.483 156.985 1.00 36.96  ? 288  ASN B C     1 
ATOM   6411 O  O     . ASN B 1 288 ? 103.326 107.995 157.262 1.00 36.96  ? 288  ASN B O     1 
ATOM   6412 C  CB    . ASN B 1 288 ? 102.205 105.399 158.358 1.00 36.96  ? 288  ASN B CB    1 
ATOM   6413 C  CG    . ASN B 1 288 ? 101.757 104.769 159.660 1.00 36.96  ? 288  ASN B CG    1 
ATOM   6414 O  OD1   . ASN B 1 288 ? 101.570 105.457 160.663 1.00 36.96  ? 288  ASN B OD1   1 
ATOM   6415 N  ND2   . ASN B 1 288 ? 101.588 103.454 159.654 1.00 36.96  ? 288  ASN B ND2   1 
ATOM   6416 N  N     . ASN B 1 289 ? 101.692 107.571 155.775 1.00 27.30  ? 289  ASN B N     1 
ATOM   6417 C  CA    . ASN B 1 289 ? 102.305 108.302 154.679 1.00 27.30  ? 289  ASN B CA    1 
ATOM   6418 C  C     . ASN B 1 289 ? 101.497 109.563 154.425 1.00 27.30  ? 289  ASN B C     1 
ATOM   6419 O  O     . ASN B 1 289 ? 100.281 109.467 154.207 1.00 27.30  ? 289  ASN B O     1 
ATOM   6420 C  CB    . ASN B 1 289 ? 102.349 107.427 153.430 1.00 27.30  ? 289  ASN B CB    1 
ATOM   6421 C  CG    . ASN B 1 289 ? 103.199 108.010 152.317 1.00 27.30  ? 289  ASN B CG    1 
ATOM   6422 O  OD1   . ASN B 1 289 ? 103.792 109.075 152.450 1.00 27.30  ? 289  ASN B OD1   1 
ATOM   6423 N  ND2   . ASN B 1 289 ? 103.250 107.304 151.199 1.00 27.30  ? 289  ASN B ND2   1 
ATOM   6424 N  N     . PRO B 1 290 ? 102.104 110.753 154.474 1.00 24.81  ? 290  PRO B N     1 
ATOM   6425 C  CA    . PRO B 1 290 ? 101.337 111.973 154.190 1.00 24.81  ? 290  PRO B CA    1 
ATOM   6426 C  C     . PRO B 1 290 ? 100.883 112.088 152.751 1.00 24.81  ? 290  PRO B C     1 
ATOM   6427 O  O     . PRO B 1 290 ? 99.824  112.672 152.504 1.00 24.81  ? 290  PRO B O     1 
ATOM   6428 C  CB    . PRO B 1 290 ? 102.317 113.093 154.558 1.00 24.81  ? 290  PRO B CB    1 
ATOM   6429 C  CG    . PRO B 1 290 ? 103.239 112.478 155.516 1.00 24.81  ? 290  PRO B CG    1 
ATOM   6430 C  CD    . PRO B 1 290 ? 103.407 111.066 155.074 1.00 24.81  ? 290  PRO B CD    1 
ATOM   6431 N  N     . ALA B 1 291 ? 101.639 111.554 151.793 1.00 21.55  ? 291  ALA B N     1 
ATOM   6432 C  CA    . ALA B 1 291 ? 101.212 111.620 150.402 1.00 21.55  ? 291  ALA B CA    1 
ATOM   6433 C  C     . ALA B 1 291 ? 100.055 110.682 150.112 1.00 21.55  ? 291  ALA B C     1 
ATOM   6434 O  O     . ALA B 1 291 ? 99.318  110.907 149.149 1.00 21.55  ? 291  ALA B O     1 
ATOM   6435 C  CB    . ALA B 1 291 ? 102.378 111.302 149.473 1.00 21.55  ? 291  ALA B CB    1 
ATOM   6436 N  N     . ASP B 1 292 ? 99.889  109.628 150.907 1.00 23.94  ? 292  ASP B N     1 
ATOM   6437 C  CA    . ASP B 1 292 ? 98.707  108.790 150.798 1.00 23.94  ? 292  ASP B CA    1 
ATOM   6438 C  C     . ASP B 1 292 ? 97.511  109.424 151.477 1.00 23.94  ? 292  ASP B C     1 
ATOM   6439 O  O     . ASP B 1 292 ? 96.375  109.058 151.174 1.00 23.94  ? 292  ASP B O     1 
ATOM   6440 C  CB    . ASP B 1 292 ? 98.971  107.411 151.403 1.00 23.94  ? 292  ASP B CB    1 
ATOM   6441 C  CG    . ASP B 1 292 ? 100.000 106.615 150.626 1.00 23.94  ? 292  ASP B CG    1 
ATOM   6442 O  OD1   . ASP B 1 292 ? 100.175 106.865 149.418 1.00 23.94  ? 292  ASP B OD1   1 
ATOM   6443 O  OD2   . ASP B 1 292 ? 100.621 105.713 151.218 1.00 23.94  ? 292  ASP B OD2   1 
ATOM   6444 N  N     . PHE B 1 293 ? 97.749  110.367 152.384 1.00 27.35  ? 293  PHE B N     1 
ATOM   6445 C  CA    . PHE B 1 293 ? 96.678  111.101 153.040 1.00 27.35  ? 293  PHE B CA    1 
ATOM   6446 C  C     . PHE B 1 293 ? 96.216  112.294 152.221 1.00 27.35  ? 293  PHE B C     1 
ATOM   6447 O  O     . PHE B 1 293 ? 95.039  112.657 152.275 1.00 27.35  ? 293  PHE B O     1 
ATOM   6448 C  CB    . PHE B 1 293 ? 97.148  111.554 154.421 1.00 27.35  ? 293  PHE B CB    1 
ATOM   6449 C  CG    . PHE B 1 293 ? 96.165  112.417 155.143 1.00 27.35  ? 293  PHE B CG    1 
ATOM   6450 C  CD1   . PHE B 1 293 ? 94.980  111.886 155.616 1.00 27.35  ? 293  PHE B CD1   1 
ATOM   6451 C  CD2   . PHE B 1 293 ? 96.436  113.755 155.367 1.00 27.35  ? 293  PHE B CD2   1 
ATOM   6452 C  CE1   . PHE B 1 293 ? 94.075  112.674 156.276 1.00 27.35  ? 293  PHE B CE1   1 
ATOM   6453 C  CE2   . PHE B 1 293 ? 95.538  114.546 156.033 1.00 27.35  ? 293  PHE B CE2   1 
ATOM   6454 C  CZ    . PHE B 1 293 ? 94.355  114.004 156.488 1.00 27.35  ? 293  PHE B CZ    1 
ATOM   6455 N  N     . PHE B 1 294 ? 97.122  112.904 151.455 1.00 22.01  ? 294  PHE B N     1 
ATOM   6456 C  CA    . PHE B 1 294 ? 96.788  114.106 150.701 1.00 22.01  ? 294  PHE B CA    1 
ATOM   6457 C  C     . PHE B 1 294 ? 95.895  113.794 149.520 1.00 22.01  ? 294  PHE B C     1 
ATOM   6458 O  O     . PHE B 1 294 ? 95.094  114.638 149.110 1.00 22.01  ? 294  PHE B O     1 
ATOM   6459 C  CB    . PHE B 1 294 ? 98.058  114.794 150.207 1.00 22.01  ? 294  PHE B CB    1 
ATOM   6460 C  CG    . PHE B 1 294 ? 98.865  115.426 151.290 1.00 22.01  ? 294  PHE B CG    1 
ATOM   6461 C  CD1   . PHE B 1 294 ? 98.307  115.698 152.524 1.00 22.01  ? 294  PHE B CD1   1 
ATOM   6462 C  CD2   . PHE B 1 294 ? 100.186 115.738 151.081 1.00 22.01  ? 294  PHE B CD2   1 
ATOM   6463 C  CE1   . PHE B 1 294 ? 99.047  116.270 153.518 1.00 22.01  ? 294  PHE B CE1   1 
ATOM   6464 C  CE2   . PHE B 1 294 ? 100.930 116.314 152.077 1.00 22.01  ? 294  PHE B CE2   1 
ATOM   6465 C  CZ    . PHE B 1 294 ? 100.360 116.576 153.294 1.00 22.01  ? 294  PHE B CZ    1 
ATOM   6466 N  N     . LEU B 1 295 ? 96.014  112.599 148.964 1.00 19.86  ? 295  LEU B N     1 
ATOM   6467 C  CA    . LEU B 1 295 ? 95.261  112.231 147.783 1.00 19.86  ? 295  LEU B CA    1 
ATOM   6468 C  C     . LEU B 1 295 ? 94.055  111.372 148.104 1.00 19.86  ? 295  LEU B C     1 
ATOM   6469 O  O     . LEU B 1 295 ? 93.374  110.927 147.187 1.00 19.86  ? 295  LEU B O     1 
ATOM   6470 C  CB    . LEU B 1 295 ? 96.159  111.516 146.770 1.00 19.86  ? 295  LEU B CB    1 
ATOM   6471 C  CG    . LEU B 1 295 ? 97.002  112.412 145.860 1.00 19.86  ? 295  LEU B CG    1 
ATOM   6472 C  CD1   . LEU B 1 295 ? 98.229  112.997 146.532 1.00 19.86  ? 295  LEU B CD1   1 
ATOM   6473 C  CD2   . LEU B 1 295 ? 97.401  111.637 144.666 1.00 19.86  ? 295  LEU B CD2   1 
ATOM   6474 N  N     . ASP B 1 296 ? 93.784  111.112 149.375 1.00 24.75  ? 296  ASP B N     1 
ATOM   6475 C  CA    . ASP B 1 296 ? 92.481  110.603 149.760 1.00 24.75  ? 296  ASP B CA    1 
ATOM   6476 C  C     . ASP B 1 296 ? 91.516  111.719 150.098 1.00 24.75  ? 296  ASP B C     1 
ATOM   6477 O  O     . ASP B 1 296 ? 90.302  111.497 150.090 1.00 24.75  ? 296  ASP B O     1 
ATOM   6478 C  CB    . ASP B 1 296 ? 92.598  109.663 150.954 1.00 24.75  ? 296  ASP B CB    1 
ATOM   6479 C  CG    . ASP B 1 296 ? 93.265  108.369 150.597 1.00 24.75  ? 296  ASP B CG    1 
ATOM   6480 O  OD1   . ASP B 1 296 ? 93.202  107.973 149.420 1.00 24.75  ? 296  ASP B OD1   1 
ATOM   6481 O  OD2   . ASP B 1 296 ? 93.840  107.732 151.490 1.00 24.75  ? 296  ASP B OD2   1 
ATOM   6482 N  N     . ILE B 1 297 ? 92.030  112.909 150.389 1.00 25.04  ? 297  ILE B N     1 
ATOM   6483 C  CA    . ILE B 1 297 ? 91.170  114.065 150.580 1.00 25.04  ? 297  ILE B CA    1 
ATOM   6484 C  C     . ILE B 1 297 ? 90.665  114.577 149.241 1.00 25.04  ? 297  ILE B C     1 
ATOM   6485 O  O     . ILE B 1 297 ? 89.460  114.762 149.047 1.00 25.04  ? 297  ILE B O     1 
ATOM   6486 C  CB    . ILE B 1 297 ? 91.923  115.167 151.342 1.00 25.04  ? 297  ILE B CB    1 
ATOM   6487 C  CG1   . ILE B 1 297 ? 92.412  114.654 152.685 1.00 25.04  ? 297  ILE B CG1   1 
ATOM   6488 C  CG2   . ILE B 1 297 ? 91.024  116.356 151.572 1.00 25.04  ? 297  ILE B CG2   1 
ATOM   6489 C  CD1   . ILE B 1 297 ? 93.371  115.593 153.338 1.00 25.04  ? 297  ILE B CD1   1 
ATOM   6490 N  N     . ILE B 1 298 ? 91.572  114.780 148.287 1.00 21.67  ? 298  ILE B N     1 
ATOM   6491 C  CA    . ILE B 1 298 ? 91.263  115.512 147.066 1.00 21.67  ? 298  ILE B CA    1 
ATOM   6492 C  C     . ILE B 1 298 ? 90.736  114.573 145.988 1.00 21.67  ? 298  ILE B C     1 
ATOM   6493 O  O     . ILE B 1 298 ? 90.545  114.979 144.837 1.00 21.67  ? 298  ILE B O     1 
ATOM   6494 C  CB    . ILE B 1 298 ? 92.495  116.293 146.572 1.00 21.67  ? 298  ILE B CB    1 
ATOM   6495 C  CG1   . ILE B 1 298 ? 93.600  115.352 146.110 1.00 21.67  ? 298  ILE B CG1   1 
ATOM   6496 C  CG2   . ILE B 1 298 ? 93.044  117.151 147.681 1.00 21.67  ? 298  ILE B CG2   1 
ATOM   6497 C  CD1   . ILE B 1 298 ? 94.747  116.061 145.442 1.00 21.67  ? 298  ILE B CD1   1 
ATOM   6498 N  N     . ASN B 1 299 ? 90.482  113.316 146.349 1.00 22.77  ? 299  ASN B N     1 
ATOM   6499 C  CA    . ASN B 1 299 ? 89.953  112.334 145.413 1.00 22.77  ? 299  ASN B CA    1 
ATOM   6500 C  C     . ASN B 1 299 ? 88.729  111.632 145.989 1.00 22.77  ? 299  ASN B C     1 
ATOM   6501 O  O     . ASN B 1 299 ? 88.293  110.612 145.445 1.00 22.77  ? 299  ASN B O     1 
ATOM   6502 C  CB    . ASN B 1 299 ? 91.037  111.310 145.056 1.00 22.77  ? 299  ASN B CB    1 
ATOM   6503 C  CG    . ASN B 1 299 ? 90.798  110.623 143.735 1.00 22.77  ? 299  ASN B CG    1 
ATOM   6504 O  OD1   . ASN B 1 299 ? 89.895  110.981 142.995 1.00 22.77  ? 299  ASN B OD1   1 
ATOM   6505 N  ND2   . ASN B 1 299 ? 91.591  109.609 143.450 1.00 22.77  ? 299  ASN B ND2   1 
ATOM   6506 N  N     . GLY B 1 300 ? 88.161  112.154 147.078 1.00 27.47  ? 300  GLY B N     1 
ATOM   6507 C  CA    . GLY B 1 300 ? 87.034  111.507 147.719 1.00 27.47  ? 300  GLY B CA    1 
ATOM   6508 C  C     . GLY B 1 300 ? 85.753  111.558 146.919 1.00 27.47  ? 300  GLY B C     1 
ATOM   6509 O  O     . GLY B 1 300 ? 84.886  110.702 147.110 1.00 27.47  ? 300  GLY B O     1 
ATOM   6510 N  N     . ASP B 1 301 ? 85.622  112.527 146.013 1.00 31.58  ? 301  ASP B N     1 
ATOM   6511 C  CA    . ASP B 1 301 ? 84.439  112.642 145.171 1.00 31.58  ? 301  ASP B CA    1 
ATOM   6512 C  C     . ASP B 1 301 ? 84.477  111.737 143.948 1.00 31.58  ? 301  ASP B C     1 
ATOM   6513 O  O     . ASP B 1 301 ? 83.555  111.799 143.132 1.00 31.58  ? 301  ASP B O     1 
ATOM   6514 C  CB    . ASP B 1 301 ? 84.247  114.093 144.719 1.00 31.58  ? 301  ASP B CB    1 
ATOM   6515 C  CG    . ASP B 1 301 ? 85.439  114.639 143.944 1.00 31.58  ? 301  ASP B CG    1 
ATOM   6516 O  OD1   . ASP B 1 301 ? 86.503  113.989 143.895 1.00 31.58  ? 301  ASP B OD1   1 
ATOM   6517 O  OD2   . ASP B 1 301 ? 85.300  115.728 143.357 1.00 31.58  ? 301  ASP B OD2   1 
ATOM   6518 N  N     . SER B 1 302 ? 85.520  110.929 143.790 1.00 27.57  ? 302  SER B N     1 
ATOM   6519 C  CA    . SER B 1 302 ? 85.629  110.068 142.624 1.00 27.57  ? 302  SER B CA    1 
ATOM   6520 C  C     . SER B 1 302 ? 84.660  108.908 142.730 1.00 27.57  ? 302  SER B C     1 
ATOM   6521 O  O     . SER B 1 302 ? 84.457  108.342 143.806 1.00 27.57  ? 302  SER B O     1 
ATOM   6522 C  CB    . SER B 1 302 ? 87.049  109.534 142.484 1.00 27.57  ? 302  SER B CB    1 
ATOM   6523 O  OG    . SER B 1 302 ? 87.156  108.658 141.374 1.00 27.57  ? 302  SER B OG    1 
ATOM   6524 N  N     . THR B 1 303 ? 84.059  108.556 141.596 1.00 23.66  ? 303  THR B N     1 
ATOM   6525 C  CA    . THR B 1 303 ? 83.097  107.467 141.569 1.00 23.66  ? 303  THR B CA    1 
ATOM   6526 C  C     . THR B 1 303 ? 83.768  106.104 141.655 1.00 23.66  ? 303  THR B C     1 
ATOM   6527 O  O     . THR B 1 303 ? 83.101  105.125 141.992 1.00 23.66  ? 303  THR B O     1 
ATOM   6528 C  CB    . THR B 1 303 ? 82.236  107.577 140.311 1.00 23.66  ? 303  THR B CB    1 
ATOM   6529 O  OG1   . THR B 1 303 ? 81.236  106.552 140.306 1.00 23.66  ? 303  THR B OG1   1 
ATOM   6530 C  CG2   . THR B 1 303 ? 83.089  107.472 139.077 1.00 23.66  ? 303  THR B CG2   1 
ATOM   6531 N  N     . ALA B 1 304 ? 85.069  106.013 141.376 1.00 24.25  ? 304  ALA B N     1 
ATOM   6532 C  CA    . ALA B 1 304 ? 85.775  104.762 141.619 1.00 24.25  ? 304  ALA B CA    1 
ATOM   6533 C  C     . ALA B 1 304 ? 85.919  104.508 143.110 1.00 24.25  ? 304  ALA B C     1 
ATOM   6534 O  O     . ALA B 1 304 ? 85.780  103.371 143.572 1.00 24.25  ? 304  ALA B O     1 
ATOM   6535 C  CB    . ALA B 1 304 ? 87.144  104.785 140.947 1.00 24.25  ? 304  ALA B CB    1 
ATOM   6536 N  N     . VAL B 1 305 ? 86.176  105.564 143.878 1.00 25.14  ? 305  VAL B N     1 
ATOM   6537 C  CA    . VAL B 1 305 ? 86.366  105.434 145.314 1.00 25.14  ? 305  VAL B CA    1 
ATOM   6538 C  C     . VAL B 1 305 ? 85.021  105.307 146.016 1.00 25.14  ? 305  VAL B C     1 
ATOM   6539 O  O     . VAL B 1 305 ? 84.904  104.611 147.030 1.00 25.14  ? 305  VAL B O     1 
ATOM   6540 C  CB    . VAL B 1 305 ? 87.184  106.639 145.809 1.00 25.14  ? 305  VAL B CB    1 
ATOM   6541 C  CG1   . VAL B 1 305 ? 87.495  106.546 147.294 1.00 25.14  ? 305  VAL B CG1   1 
ATOM   6542 C  CG2   . VAL B 1 305 ? 88.455  106.768 144.993 1.00 25.14  ? 305  VAL B CG2   1 
ATOM   6543 N  N     . ALA B 1 306 ? 83.982  105.934 145.470 1.00 26.92  ? 306  ALA B N     1 
ATOM   6544 C  CA    . ALA B 1 306 ? 82.659  105.875 146.074 1.00 26.92  ? 306  ALA B CA    1 
ATOM   6545 C  C     . ALA B 1 306 ? 81.969  104.537 145.846 1.00 26.92  ? 306  ALA B C     1 
ATOM   6546 O  O     . ALA B 1 306 ? 81.066  104.178 146.606 1.00 26.92  ? 306  ALA B O     1 
ATOM   6547 C  CB    . ALA B 1 306 ? 81.790  107.006 145.529 1.00 26.92  ? 306  ALA B CB    1 
ATOM   6548 N  N     . LEU B 1 307 ? 82.361  103.793 144.815 1.00 25.55  ? 307  LEU B N     1 
ATOM   6549 C  CA    . LEU B 1 307 ? 81.758  102.501 144.520 1.00 25.55  ? 307  LEU B CA    1 
ATOM   6550 C  C     . LEU B 1 307 ? 82.566  101.317 145.033 1.00 25.55  ? 307  LEU B C     1 
ATOM   6551 O  O     . LEU B 1 307 ? 82.073  100.186 144.976 1.00 25.55  ? 307  LEU B O     1 
ATOM   6552 C  CB    . LEU B 1 307 ? 81.542  102.347 143.008 1.00 25.55  ? 307  LEU B CB    1 
ATOM   6553 C  CG    . LEU B 1 307 ? 80.205  102.783 142.402 1.00 25.55  ? 307  LEU B CG    1 
ATOM   6554 C  CD1   . LEU B 1 307 ? 79.970  104.279 142.453 1.00 25.55  ? 307  LEU B CD1   1 
ATOM   6555 C  CD2   . LEU B 1 307 ? 80.123  102.295 140.976 1.00 25.55  ? 307  LEU B CD2   1 
ATOM   6556 N  N     . ASN B 1 308 ? 83.778  101.541 145.533 1.00 26.31  ? 308  ASN B N     1 
ATOM   6557 C  CA    . ASN B 1 308 ? 84.657  100.468 145.983 1.00 26.31  ? 308  ASN B CA    1 
ATOM   6558 C  C     . ASN B 1 308 ? 85.044  100.743 147.428 1.00 26.31  ? 308  ASN B C     1 
ATOM   6559 O  O     . ASN B 1 308 ? 85.759  101.715 147.700 1.00 26.31  ? 308  ASN B O     1 
ATOM   6560 C  CB    . ASN B 1 308 ? 85.884  100.364 145.082 1.00 26.31  ? 308  ASN B CB    1 
ATOM   6561 C  CG    . ASN B 1 308 ? 85.540  99.866  143.691 1.00 26.31  ? 308  ASN B CG    1 
ATOM   6562 O  OD1   . ASN B 1 308 ? 84.762  98.926  143.533 1.00 26.31  ? 308  ASN B OD1   1 
ATOM   6563 N  ND2   . ASN B 1 308 ? 86.101  100.507 142.676 1.00 26.31  ? 308  ASN B ND2   1 
ATOM   6564 N  N     . ARG B 1 309 ? 84.506  99.911  148.342 1.00 33.27  ? 309  ARG B N     1 
ATOM   6565 C  CA    . ARG B 1 309 ? 84.632  99.901  149.808 1.00 33.27  ? 309  ARG B CA    1 
ATOM   6566 C  C     . ARG B 1 309 ? 83.819  101.037 150.444 1.00 33.27  ? 309  ARG B C     1 
ATOM   6567 O  O     . ARG B 1 309 ? 83.632  101.076 151.665 1.00 33.27  ? 309  ARG B O     1 
ATOM   6568 C  CB    . ARG B 1 309 ? 86.115  99.936  150.237 1.00 33.27  ? 309  ARG B CB    1 
ATOM   6569 C  CG    . ARG B 1 309 ? 86.454  99.686  151.711 1.00 33.27  ? 309  ARG B CG    1 
ATOM   6570 C  CD    . ARG B 1 309 ? 87.943  99.827  151.957 1.00 33.27  ? 309  ARG B CD    1 
ATOM   6571 N  NE    . ARG B 1 309 ? 88.284  99.706  153.369 1.00 33.27  ? 309  ARG B NE    1 
ATOM   6572 C  CZ    . ARG B 1 309 ? 88.320  100.732 154.212 1.00 33.27  ? 309  ARG B CZ    1 
ATOM   6573 N  NH1   . ARG B 1 309 ? 88.032  101.954 153.785 1.00 33.27  ? 309  ARG B NH1   1 
ATOM   6574 N  NH2   . ARG B 1 309 ? 88.644  100.538 155.483 1.00 33.27  ? 309  ARG B NH2   1 
ATOM   6575 N  N     . GLU B 1 310 ? 83.253  101.920 149.629 1.00 34.68  ? 310  GLU B N     1 
ATOM   6576 C  CA    . GLU B 1 310 ? 82.454  103.022 150.145 1.00 34.68  ? 310  GLU B CA    1 
ATOM   6577 C  C     . GLU B 1 310 ? 81.065  103.007 149.526 1.00 34.68  ? 310  GLU B C     1 
ATOM   6578 O  O     . GLU B 1 310 ? 80.603  101.970 149.050 1.00 34.68  ? 310  GLU B O     1 
ATOM   6579 C  CB    . GLU B 1 310 ? 83.145  104.358 149.876 1.00 34.68  ? 310  GLU B CB    1 
ATOM   6580 C  CG    . GLU B 1 310 ? 84.455  104.527 150.622 1.00 34.68  ? 310  GLU B CG    1 
ATOM   6581 C  CD    . GLU B 1 310 ? 85.103  105.867 150.368 1.00 34.68  ? 310  GLU B CD    1 
ATOM   6582 O  OE1   . GLU B 1 310 ? 84.596  106.623 149.516 1.00 34.68  ? 310  GLU B OE1   1 
ATOM   6583 O  OE2   . GLU B 1 310 ? 86.120  106.166 151.025 1.00 34.68  ? 310  GLU B OE2   1 
ATOM   6584 N  N     . LYS B 1 326 ? 79.826  123.397 147.433 1.00 47.19  ? 326  LYS B N     1 
ATOM   6585 C  CA    . LYS B 1 326 ? 79.099  122.142 147.620 1.00 47.19  ? 326  LYS B CA    1 
ATOM   6586 C  C     . LYS B 1 326 ? 79.780  120.873 147.031 1.00 47.19  ? 326  LYS B C     1 
ATOM   6587 O  O     . LYS B 1 326 ? 79.686  119.817 147.654 1.00 47.19  ? 326  LYS B O     1 
ATOM   6588 C  CB    . LYS B 1 326 ? 77.664  122.276 147.078 1.00 47.19  ? 326  LYS B CB    1 
ATOM   6589 C  CG    . LYS B 1 326 ? 76.834  123.352 147.760 1.00 47.19  ? 326  LYS B CG    1 
ATOM   6590 C  CD    . LYS B 1 326 ? 76.510  122.978 149.196 1.00 47.19  ? 326  LYS B CD    1 
ATOM   6591 C  CE    . LYS B 1 326 ? 75.691  124.061 149.875 1.00 47.19  ? 326  LYS B CE    1 
ATOM   6592 N  NZ    . LYS B 1 326 ? 74.327  124.168 149.294 1.00 47.19  ? 326  LYS B NZ    1 
ATOM   6593 N  N     . PRO B 1 327 ? 80.453  120.927 145.872 1.00 42.27  ? 327  PRO B N     1 
ATOM   6594 C  CA    . PRO B 1 327 ? 81.343  119.813 145.530 1.00 42.27  ? 327  PRO B CA    1 
ATOM   6595 C  C     . PRO B 1 327 ? 82.595  119.836 146.390 1.00 42.27  ? 327  PRO B C     1 
ATOM   6596 O  O     . PRO B 1 327 ? 82.934  120.840 147.017 1.00 42.27  ? 327  PRO B O     1 
ATOM   6597 C  CB    . PRO B 1 327 ? 81.681  120.049 144.054 1.00 42.27  ? 327  PRO B CB    1 
ATOM   6598 C  CG    . PRO B 1 327 ? 80.589  120.867 143.548 1.00 42.27  ? 327  PRO B CG    1 
ATOM   6599 C  CD    . PRO B 1 327 ? 80.242  121.773 144.676 1.00 42.27  ? 327  PRO B CD    1 
ATOM   6600 N  N     . LEU B 1 328 ? 83.291  118.698 146.407 1.00 35.99  ? 328  LEU B N     1 
ATOM   6601 C  CA    . LEU B 1 328 ? 84.503  118.587 147.211 1.00 35.99  ? 328  LEU B CA    1 
ATOM   6602 C  C     . LEU B 1 328 ? 85.659  119.365 146.601 1.00 35.99  ? 328  LEU B C     1 
ATOM   6603 O  O     . LEU B 1 328 ? 86.498  119.895 147.336 1.00 35.99  ? 328  LEU B O     1 
ATOM   6604 C  CB    . LEU B 1 328 ? 84.876  117.117 147.385 1.00 35.99  ? 328  LEU B CB    1 
ATOM   6605 C  CG    . LEU B 1 328 ? 86.109  116.756 148.210 1.00 35.99  ? 328  LEU B CG    1 
ATOM   6606 C  CD1   . LEU B 1 328 ? 85.980  117.274 149.625 1.00 35.99  ? 328  LEU B CD1   1 
ATOM   6607 C  CD2   . LEU B 1 328 ? 86.293  115.255 148.210 1.00 35.99  ? 328  LEU B CD2   1 
ATOM   6608 N  N     . ILE B 1 329 ? 85.719  119.453 145.273 1.00 32.72  ? 329  ILE B N     1 
ATOM   6609 C  CA    . ILE B 1 329 ? 86.795  120.199 144.626 1.00 32.72  ? 329  ILE B CA    1 
ATOM   6610 C  C     . ILE B 1 329 ? 86.603  121.694 144.829 1.00 32.72  ? 329  ILE B C     1 
ATOM   6611 O  O     . ILE B 1 329 ? 87.543  122.412 145.185 1.00 32.72  ? 329  ILE B O     1 
ATOM   6612 C  CB    . ILE B 1 329 ? 86.881  119.835 143.134 1.00 32.72  ? 329  ILE B CB    1 
ATOM   6613 C  CG1   . ILE B 1 329 ? 87.213  118.356 142.982 1.00 32.72  ? 329  ILE B CG1   1 
ATOM   6614 C  CG2   . ILE B 1 329 ? 87.914  120.681 142.426 1.00 32.72  ? 329  ILE B CG2   1 
ATOM   6615 C  CD1   . ILE B 1 329 ? 88.505  117.960 143.644 1.00 32.72  ? 329  ILE B CD1   1 
ATOM   6616 N  N     . GLU B 1 330 ? 85.377  122.182 144.641 1.00 35.83  ? 330  GLU B N     1 
ATOM   6617 C  CA    . GLU B 1 330 ? 85.119  123.604 144.819 1.00 35.83  ? 330  GLU B CA    1 
ATOM   6618 C  C     . GLU B 1 330 ? 85.132  124.014 146.283 1.00 35.83  ? 330  GLU B C     1 
ATOM   6619 O  O     . GLU B 1 330 ? 85.249  125.207 146.576 1.00 35.83  ? 330  GLU B O     1 
ATOM   6620 C  CB    . GLU B 1 330 ? 83.789  123.978 144.172 1.00 35.83  ? 330  GLU B CB    1 
ATOM   6621 C  CG    . GLU B 1 330 ? 83.773  123.758 142.671 1.00 35.83  ? 330  GLU B CG    1 
ATOM   6622 C  CD    . GLU B 1 330 ? 84.755  124.650 141.933 1.00 35.83  ? 330  GLU B CD    1 
ATOM   6623 O  OE1   . GLU B 1 330 ? 84.959  125.809 142.356 1.00 35.83  ? 330  GLU B OE1   1 
ATOM   6624 O  OE2   . GLU B 1 330 ? 85.336  124.183 140.931 1.00 35.83  ? 330  GLU B OE2   1 
ATOM   6625 N  N     . LYS B 1 331 ? 85.020  123.057 147.203 1.00 35.20  ? 331  LYS B N     1 
ATOM   6626 C  CA    . LYS B 1 331 ? 85.208  123.346 148.618 1.00 35.20  ? 331  LYS B CA    1 
ATOM   6627 C  C     . LYS B 1 331 ? 86.684  123.495 148.956 1.00 35.20  ? 331  LYS B C     1 
ATOM   6628 O  O     . LYS B 1 331 ? 87.081  124.465 149.607 1.00 35.20  ? 331  LYS B O     1 
ATOM   6629 C  CB    . LYS B 1 331 ? 84.580  122.241 149.460 1.00 35.20  ? 331  LYS B CB    1 
ATOM   6630 C  CG    . LYS B 1 331 ? 84.622  122.473 150.949 1.00 35.20  ? 331  LYS B CG    1 
ATOM   6631 C  CD    . LYS B 1 331 ? 84.000  121.295 151.667 1.00 35.20  ? 331  LYS B CD    1 
ATOM   6632 C  CE    . LYS B 1 331 ? 82.499  121.280 151.460 1.00 35.20  ? 331  LYS B CE    1 
ATOM   6633 N  NZ    . LYS B 1 331 ? 81.833  120.200 152.233 1.00 35.20  ? 331  LYS B NZ    1 
ATOM   6634 N  N     . LEU B 1 332 ? 87.511  122.544 148.514 1.00 32.07  ? 332  LEU B N     1 
ATOM   6635 C  CA    . LEU B 1 332 ? 88.932  122.572 148.843 1.00 32.07  ? 332  LEU B CA    1 
ATOM   6636 C  C     . LEU B 1 332 ? 89.681  123.647 148.072 1.00 32.07  ? 332  LEU B C     1 
ATOM   6637 O  O     . LEU B 1 332 ? 90.717  124.130 148.541 1.00 32.07  ? 332  LEU B O     1 
ATOM   6638 C  CB    . LEU B 1 332 ? 89.562  121.211 148.573 1.00 32.07  ? 332  LEU B CB    1 
ATOM   6639 C  CG    . LEU B 1 332 ? 89.169  120.062 149.488 1.00 32.07  ? 332  LEU B CG    1 
ATOM   6640 C  CD1   . LEU B 1 332 ? 89.753  118.777 148.958 1.00 32.07  ? 332  LEU B CD1   1 
ATOM   6641 C  CD2   . LEU B 1 332 ? 89.670  120.336 150.890 1.00 32.07  ? 332  LEU B CD2   1 
ATOM   6642 N  N     . ALA B 1 333 ? 89.194  124.026 146.892 1.00 31.36  ? 333  ALA B N     1 
ATOM   6643 C  CA    . ALA B 1 333 ? 89.827  125.118 146.169 1.00 31.36  ? 333  ALA B CA    1 
ATOM   6644 C  C     . ALA B 1 333 ? 89.456  126.469 146.755 1.00 31.36  ? 333  ALA B C     1 
ATOM   6645 O  O     . ALA B 1 333 ? 90.232  127.421 146.638 1.00 31.36  ? 333  ALA B O     1 
ATOM   6646 C  CB    . ALA B 1 333 ? 89.450  125.064 144.691 1.00 31.36  ? 333  ALA B CB    1 
ATOM   6647 N  N     . GLU B 1 334 ? 88.285  126.574 147.383 1.00 35.58  ? 334  GLU B N     1 
ATOM   6648 C  CA    . GLU B 1 334 ? 87.891  127.816 148.035 1.00 35.58  ? 334  GLU B CA    1 
ATOM   6649 C  C     . GLU B 1 334 ? 88.660  128.036 149.331 1.00 35.58  ? 334  GLU B C     1 
ATOM   6650 O  O     . GLU B 1 334 ? 88.916  129.184 149.710 1.00 35.58  ? 334  GLU B O     1 
ATOM   6651 C  CB    . GLU B 1 334 ? 86.384  127.805 148.300 1.00 35.58  ? 334  GLU B CB    1 
ATOM   6652 C  CG    . GLU B 1 334 ? 85.799  129.122 148.784 1.00 35.58  ? 334  GLU B CG    1 
ATOM   6653 C  CD    . GLU B 1 334 ? 84.297  129.052 148.981 1.00 35.58  ? 334  GLU B CD    1 
ATOM   6654 O  OE1   . GLU B 1 334 ? 83.722  127.960 148.787 1.00 35.58  ? 334  GLU B OE1   1 
ATOM   6655 O  OE2   . GLU B 1 334 ? 83.692  130.089 149.323 1.00 35.58  ? 334  GLU B OE2   1 
ATOM   6656 N  N     . ILE B 1 335 ? 89.039  126.951 150.012 1.00 30.99  ? 335  ILE B N     1 
ATOM   6657 C  CA    . ILE B 1 335 ? 89.848  127.058 151.221 1.00 30.99  ? 335  ILE B CA    1 
ATOM   6658 C  C     . ILE B 1 335 ? 91.245  127.565 150.888 1.00 30.99  ? 335  ILE B C     1 
ATOM   6659 O  O     . ILE B 1 335 ? 91.818  128.374 151.628 1.00 30.99  ? 335  ILE B O     1 
ATOM   6660 C  CB    . ILE B 1 335 ? 89.885  125.700 151.949 1.00 30.99  ? 335  ILE B CB    1 
ATOM   6661 C  CG1   . ILE B 1 335 ? 88.489  125.315 152.418 1.00 30.99  ? 335  ILE B CG1   1 
ATOM   6662 C  CG2   . ILE B 1 335 ? 90.793  125.731 153.157 1.00 30.99  ? 335  ILE B CG2   1 
ATOM   6663 C  CD1   . ILE B 1 335 ? 88.392  123.899 152.906 1.00 30.99  ? 335  ILE B CD1   1 
ATOM   6664 N  N     . TYR B 1 336 ? 91.797  127.141 149.748 1.00 27.64  ? 336  TYR B N     1 
ATOM   6665 C  CA    . TYR B 1 336 ? 93.176  127.500 149.434 1.00 27.64  ? 336  TYR B CA    1 
ATOM   6666 C  C     . TYR B 1 336 ? 93.304  128.958 149.024 1.00 27.64  ? 336  TYR B C     1 
ATOM   6667 O  O     . TYR B 1 336 ? 94.284  129.613 149.386 1.00 27.64  ? 336  TYR B O     1 
ATOM   6668 C  CB    . TYR B 1 336 ? 93.752  126.580 148.356 1.00 27.64  ? 336  TYR B CB    1 
ATOM   6669 C  CG    . TYR B 1 336 ? 95.157  126.979 147.988 1.00 27.64  ? 336  TYR B CG    1 
ATOM   6670 C  CD1   . TYR B 1 336 ? 96.196  126.831 148.893 1.00 27.64  ? 336  TYR B CD1   1 
ATOM   6671 C  CD2   . TYR B 1 336 ? 95.443  127.524 146.748 1.00 27.64  ? 336  TYR B CD2   1 
ATOM   6672 C  CE1   . TYR B 1 336 ? 97.476  127.217 148.573 1.00 27.64  ? 336  TYR B CE1   1 
ATOM   6673 C  CE2   . TYR B 1 336 ? 96.720  127.908 146.419 1.00 27.64  ? 336  TYR B CE2   1 
ATOM   6674 C  CZ    . TYR B 1 336 ? 97.728  127.752 147.333 1.00 27.64  ? 336  TYR B CZ    1 
ATOM   6675 O  OH    . TYR B 1 336 ? 98.996  128.141 146.998 1.00 27.64  ? 336  TYR B OH    1 
ATOM   6676 N  N     . VAL B 1 337 ? 92.325  129.487 148.286 1.00 32.25  ? 337  VAL B N     1 
ATOM   6677 C  CA    . VAL B 1 337 ? 92.371  130.886 147.865 1.00 32.25  ? 337  VAL B CA    1 
ATOM   6678 C  C     . VAL B 1 337 ? 92.234  131.811 149.071 1.00 32.25  ? 337  VAL B C     1 
ATOM   6679 O  O     . VAL B 1 337 ? 92.917  132.838 149.169 1.00 32.25  ? 337  VAL B O     1 
ATOM   6680 C  CB    . VAL B 1 337 ? 91.285  131.144 146.804 1.00 32.25  ? 337  VAL B CB    1 
ATOM   6681 C  CG1   . VAL B 1 337 ? 91.221  132.604 146.422 1.00 32.25  ? 337  VAL B CG1   1 
ATOM   6682 C  CG2   . VAL B 1 337 ? 91.556  130.310 145.576 1.00 32.25  ? 337  VAL B CG2   1 
ATOM   6683 N  N     . ASN B 1 338 ? 91.409  131.428 150.038 1.00 34.27  ? 338  ASN B N     1 
ATOM   6684 C  CA    . ASN B 1 338 ? 91.246  132.192 151.266 1.00 34.27  ? 338  ASN B CA    1 
ATOM   6685 C  C     . ASN B 1 338 ? 92.372  131.967 152.266 1.00 34.27  ? 338  ASN B C     1 
ATOM   6686 O  O     . ASN B 1 338 ? 92.370  132.606 153.323 1.00 34.27  ? 338  ASN B O     1 
ATOM   6687 C  CB    . ASN B 1 338 ? 89.912  131.835 151.919 1.00 34.27  ? 338  ASN B CB    1 
ATOM   6688 C  CG    . ASN B 1 338 ? 88.729  132.263 151.086 1.00 34.27  ? 338  ASN B CG    1 
ATOM   6689 O  OD1   . ASN B 1 338 ? 88.716  133.355 150.520 1.00 34.27  ? 338  ASN B OD1   1 
ATOM   6690 N  ND2   . ASN B 1 338 ? 87.727  131.401 150.999 1.00 34.27  ? 338  ASN B ND2   1 
ATOM   6691 N  N     . SER B 1 339 ? 93.327  131.091 151.966 1.00 34.46  ? 339  SER B N     1 
ATOM   6692 C  CA    . SER B 1 339 ? 94.357  130.711 152.919 1.00 34.46  ? 339  SER B CA    1 
ATOM   6693 C  C     . SER B 1 339 ? 95.493  131.728 152.934 1.00 34.46  ? 339  SER B C     1 
ATOM   6694 O  O     . SER B 1 339 ? 95.464  132.752 152.249 1.00 34.46  ? 339  SER B O     1 
ATOM   6695 C  CB    . SER B 1 339 ? 94.897  129.324 152.592 1.00 34.46  ? 339  SER B CB    1 
ATOM   6696 O  OG    . SER B 1 339 ? 95.960  128.987 153.461 1.00 34.46  ? 339  SER B OG    1 
ATOM   6697 N  N     . SER B 1 340 ? 96.514  131.436 153.737 1.00 36.37  ? 340  SER B N     1 
ATOM   6698 C  CA    . SER B 1 340 ? 97.703  132.270 153.803 1.00 36.37  ? 340  SER B CA    1 
ATOM   6699 C  C     . SER B 1 340 ? 98.784  131.839 152.829 1.00 36.37  ? 340  SER B C     1 
ATOM   6700 O  O     . SER B 1 340 ? 99.639  132.657 152.479 1.00 36.37  ? 340  SER B O     1 
ATOM   6701 C  CB    . SER B 1 340 ? 98.285  132.265 155.216 1.00 36.37  ? 340  SER B CB    1 
ATOM   6702 O  OG    . SER B 1 340 ? 99.475  133.030 155.265 1.00 36.37  ? 340  SER B OG    1 
ATOM   6703 N  N     . PHE B 1 341 ? 98.774  130.577 152.394 1.00 34.04  ? 341  PHE B N     1 
ATOM   6704 C  CA    . PHE B 1 341 ? 99.736  130.118 151.402 1.00 34.04  ? 341  PHE B CA    1 
ATOM   6705 C  C     . PHE B 1 341 ? 99.480  130.724 150.032 1.00 34.04  ? 341  PHE B C     1 
ATOM   6706 O  O     . PHE B 1 341 ? 100.410 130.818 149.227 1.00 34.04  ? 341  PHE B O     1 
ATOM   6707 C  CB    . PHE B 1 341 ? 99.710  128.595 151.308 1.00 34.04  ? 341  PHE B CB    1 
ATOM   6708 C  CG    . PHE B 1 341 ? 100.252 127.901 152.520 1.00 34.04  ? 341  PHE B CG    1 
ATOM   6709 C  CD1   . PHE B 1 341 ? 101.612 127.725 152.679 1.00 34.04  ? 341  PHE B CD1   1 
ATOM   6710 C  CD2   . PHE B 1 341 ? 99.402  127.422 153.499 1.00 34.04  ? 341  PHE B CD2   1 
ATOM   6711 C  CE1   . PHE B 1 341 ? 102.113 127.083 153.790 1.00 34.04  ? 341  PHE B CE1   1 
ATOM   6712 C  CE2   . PHE B 1 341 ? 99.899  126.781 154.612 1.00 34.04  ? 341  PHE B CE2   1 
ATOM   6713 C  CZ    . PHE B 1 341 ? 101.256 126.613 154.756 1.00 34.04  ? 341  PHE B CZ    1 
ATOM   6714 N  N     . TYR B 1 342 ? 98.243  131.127 149.750 1.00 33.57  ? 342  TYR B N     1 
ATOM   6715 C  CA    . TYR B 1 342 ? 97.933  131.817 148.506 1.00 33.57  ? 342  TYR B CA    1 
ATOM   6716 C  C     . TYR B 1 342 ? 98.299  133.289 148.589 1.00 33.57  ? 342  TYR B C     1 
ATOM   6717 O  O     . TYR B 1 342 ? 98.730  133.879 147.594 1.00 33.57  ? 342  TYR B O     1 
ATOM   6718 C  CB    . TYR B 1 342 ? 96.453  131.657 148.193 1.00 33.57  ? 342  TYR B CB    1 
ATOM   6719 C  CG    . TYR B 1 342 ? 95.975  132.281 146.913 1.00 33.57  ? 342  TYR B CG    1 
ATOM   6720 C  CD1   . TYR B 1 342 ? 96.200  131.666 145.692 1.00 33.57  ? 342  TYR B CD1   1 
ATOM   6721 C  CD2   . TYR B 1 342 ? 95.272  133.477 146.928 1.00 33.57  ? 342  TYR B CD2   1 
ATOM   6722 C  CE1   . TYR B 1 342 ? 95.749  132.232 144.519 1.00 33.57  ? 342  TYR B CE1   1 
ATOM   6723 C  CE2   . TYR B 1 342 ? 94.819  134.051 145.761 1.00 33.57  ? 342  TYR B CE2   1 
ATOM   6724 C  CZ    . TYR B 1 342 ? 95.059  133.424 144.560 1.00 33.57  ? 342  TYR B CZ    1 
ATOM   6725 O  OH    . TYR B 1 342 ? 94.607  133.999 143.398 1.00 33.57  ? 342  TYR B OH    1 
ATOM   6726 N  N     . LYS B 1 343 ? 98.129  133.897 149.764 1.00 37.02  ? 343  LYS B N     1 
ATOM   6727 C  CA    . LYS B 1 343 ? 98.479  135.301 149.935 1.00 37.02  ? 343  LYS B CA    1 
ATOM   6728 C  C     . LYS B 1 343 ? 99.986  135.510 149.915 1.00 37.02  ? 343  LYS B C     1 
ATOM   6729 O  O     . LYS B 1 343 ? 100.454 136.562 149.470 1.00 37.02  ? 343  LYS B O     1 
ATOM   6730 C  CB    . LYS B 1 343 ? 97.896  135.832 151.240 1.00 37.02  ? 343  LYS B CB    1 
ATOM   6731 C  CG    . LYS B 1 343 ? 96.383  135.852 151.299 1.00 37.02  ? 343  LYS B CG    1 
ATOM   6732 C  CD    . LYS B 1 343 ? 95.918  136.414 152.635 1.00 37.02  ? 343  LYS B CD    1 
ATOM   6733 C  CE    . LYS B 1 343 ? 94.407  136.533 152.706 1.00 37.02  ? 343  LYS B CE    1 
ATOM   6734 N  NZ    . LYS B 1 343 ? 93.736  135.207 152.729 1.00 37.02  ? 343  LYS B NZ    1 
ATOM   6735 N  N     . GLU B 1 344 ? 100.757 134.531 150.399 1.00 38.44  ? 344  GLU B N     1 
ATOM   6736 C  CA    . GLU B 1 344 ? 102.210 134.607 150.294 1.00 38.44  ? 344  GLU B CA    1 
ATOM   6737 C  C     . GLU B 1 344 ? 102.675 134.470 148.855 1.00 38.44  ? 344  GLU B C     1 
ATOM   6738 O  O     . GLU B 1 344 ? 103.677 135.081 148.470 1.00 38.44  ? 344  GLU B O     1 
ATOM   6739 C  CB    . GLU B 1 344 ? 102.869 133.520 151.143 1.00 38.44  ? 344  GLU B CB    1 
ATOM   6740 C  CG    . GLU B 1 344 ? 102.763 133.718 152.641 1.00 38.44  ? 344  GLU B CG    1 
ATOM   6741 C  CD    . GLU B 1 344 ? 103.402 132.582 153.422 1.00 38.44  ? 344  GLU B CD    1 
ATOM   6742 O  OE1   . GLU B 1 344 ? 103.793 131.574 152.797 1.00 38.44  ? 344  GLU B OE1   1 
ATOM   6743 O  OE2   . GLU B 1 344 ? 103.519 132.698 154.659 1.00 38.44  ? 344  GLU B OE2   1 
ATOM   6744 N  N     . THR B 1 345 ? 101.972 133.674 148.052 1.00 35.60  ? 345  THR B N     1 
ATOM   6745 C  CA    . THR B 1 345 ? 102.385 133.455 146.672 1.00 35.60  ? 345  THR B CA    1 
ATOM   6746 C  C     . THR B 1 345 ? 102.054 134.661 145.802 1.00 35.60  ? 345  THR B C     1 
ATOM   6747 O  O     . THR B 1 345 ? 102.908 135.136 145.048 1.00 35.60  ? 345  THR B O     1 
ATOM   6748 C  CB    . THR B 1 345 ? 101.728 132.186 146.125 1.00 35.60  ? 345  THR B CB    1 
ATOM   6749 O  OG1   . THR B 1 345 ? 102.118 131.067 146.927 1.00 35.60  ? 345  THR B OG1   1 
ATOM   6750 C  CG2   . THR B 1 345 ? 102.164 131.924 144.703 1.00 35.60  ? 345  THR B CG2   1 
ATOM   6751 N  N     . LYS B 1 346 ? 100.830 135.185 145.915 1.00 35.61  ? 346  LYS B N     1 
ATOM   6752 C  CA    . LYS B 1 346 ? 100.409 136.312 145.084 1.00 35.61  ? 346  LYS B CA    1 
ATOM   6753 C  C     . LYS B 1 346 ? 101.150 137.596 145.431 1.00 35.61  ? 346  LYS B C     1 
ATOM   6754 O  O     . LYS B 1 346 ? 101.304 138.468 144.571 1.00 35.61  ? 346  LYS B O     1 
ATOM   6755 C  CB    . LYS B 1 346 ? 98.906  136.530 145.222 1.00 35.61  ? 346  LYS B CB    1 
ATOM   6756 C  CG    . LYS B 1 346 ? 98.071  135.382 144.712 1.00 35.61  ? 346  LYS B CG    1 
ATOM   6757 C  CD    . LYS B 1 346 ? 98.127  135.255 143.204 1.00 35.61  ? 346  LYS B CD    1 
ATOM   6758 C  CE    . LYS B 1 346 ? 97.306  136.351 142.547 1.00 35.61  ? 346  LYS B CE    1 
ATOM   6759 N  NZ    . LYS B 1 346 ? 97.202  136.183 141.074 1.00 35.61  ? 346  LYS B NZ    1 
ATOM   6760 N  N     . ALA B 1 347 ? 101.613 137.737 146.671 1.00 38.16  ? 347  ALA B N     1 
ATOM   6761 C  CA    . ALA B 1 347 ? 102.400 138.904 147.038 1.00 38.16  ? 347  ALA B CA    1 
ATOM   6762 C  C     . ALA B 1 347 ? 103.832 138.831 146.533 1.00 38.16  ? 347  ALA B C     1 
ATOM   6763 O  O     . ALA B 1 347 ? 104.525 139.853 146.544 1.00 38.16  ? 347  ALA B O     1 
ATOM   6764 C  CB    . ALA B 1 347 ? 102.404 139.088 148.554 1.00 38.16  ? 347  ALA B CB    1 
ATOM   6765 N  N     . GLU B 1 348 ? 104.294 137.660 146.102 1.00 40.50  ? 348  GLU B N     1 
ATOM   6766 C  CA    . GLU B 1 348 ? 105.610 137.520 145.495 1.00 40.50  ? 348  GLU B CA    1 
ATOM   6767 C  C     . GLU B 1 348 ? 105.542 137.419 143.977 1.00 40.50  ? 348  GLU B C     1 
ATOM   6768 O  O     . GLU B 1 348 ? 106.488 137.826 143.296 1.00 40.50  ? 348  GLU B O     1 
ATOM   6769 C  CB    . GLU B 1 348 ? 106.325 136.295 146.083 1.00 40.50  ? 348  GLU B CB    1 
ATOM   6770 C  CG    . GLU B 1 348 ? 107.775 136.088 145.648 1.00 40.50  ? 348  GLU B CG    1 
ATOM   6771 C  CD    . GLU B 1 348 ? 108.716 137.176 146.128 1.00 40.50  ? 348  GLU B CD    1 
ATOM   6772 O  OE1   . GLU B 1 348 ? 108.457 137.769 147.196 1.00 40.50  ? 348  GLU B OE1   1 
ATOM   6773 O  OE2   . GLU B 1 348 ? 109.720 137.439 145.431 1.00 40.50  ? 348  GLU B OE2   1 
ATOM   6774 N  N     . LEU B 1 349 ? 104.427 136.923 143.436 1.00 34.50  ? 349  LEU B N     1 
ATOM   6775 C  CA    . LEU B 1 349 ? 104.223 136.926 141.991 1.00 34.50  ? 349  LEU B CA    1 
ATOM   6776 C  C     . LEU B 1 349 ? 104.121 138.342 141.442 1.00 34.50  ? 349  LEU B C     1 
ATOM   6777 O  O     . LEU B 1 349 ? 104.583 138.617 140.330 1.00 34.50  ? 349  LEU B O     1 
ATOM   6778 C  CB    . LEU B 1 349 ? 102.965 136.139 141.636 1.00 34.50  ? 349  LEU B CB    1 
ATOM   6779 C  CG    . LEU B 1 349 ? 103.025 134.625 141.762 1.00 34.50  ? 349  LEU B CG    1 
ATOM   6780 C  CD1   . LEU B 1 349 ? 101.650 134.040 141.587 1.00 34.50  ? 349  LEU B CD1   1 
ATOM   6781 C  CD2   . LEU B 1 349 ? 103.951 134.109 140.702 1.00 34.50  ? 349  LEU B CD2   1 
ATOM   6782 N  N     . HIS B 1 350 ? 103.520 139.253 142.201 1.00 40.06  ? 350  HIS B N     1 
ATOM   6783 C  CA    . HIS B 1 350 ? 103.475 140.644 141.777 1.00 40.06  ? 350  HIS B CA    1 
ATOM   6784 C  C     . HIS B 1 350 ? 104.797 141.360 141.999 1.00 40.06  ? 350  HIS B C     1 
ATOM   6785 O  O     . HIS B 1 350 ? 105.058 142.370 141.340 1.00 40.06  ? 350  HIS B O     1 
ATOM   6786 C  CB    . HIS B 1 350 ? 102.350 141.376 142.504 1.00 40.06  ? 350  HIS B CB    1 
ATOM   6787 C  CG    . HIS B 1 350 ? 100.987 140.892 142.127 1.00 40.06  ? 350  HIS B CG    1 
ATOM   6788 N  ND1   . HIS B 1 350 ? 100.365 139.846 142.771 1.00 40.06  ? 350  HIS B ND1   1 
ATOM   6789 C  CD2   . HIS B 1 350 ? 100.135 141.298 141.158 1.00 40.06  ? 350  HIS B CD2   1 
ATOM   6790 C  CE1   . HIS B 1 350 ? 99.184  139.634 142.220 1.00 40.06  ? 350  HIS B CE1   1 
ATOM   6791 N  NE2   . HIS B 1 350 ? 99.020  140.501 141.239 1.00 40.06  ? 350  HIS B NE2   1 
ATOM   6792 N  N     . GLN B 1 351 ? 105.635 140.859 142.905 1.00 44.28  ? 351  GLN B N     1 
ATOM   6793 C  CA    . GLN B 1 351 ? 106.968 141.417 143.073 1.00 44.28  ? 351  GLN B CA    1 
ATOM   6794 C  C     . GLN B 1 351 ? 107.917 140.953 141.973 1.00 44.28  ? 351  GLN B C     1 
ATOM   6795 O  O     . GLN B 1 351 ? 108.781 141.723 141.540 1.00 44.28  ? 351  GLN B O     1 
ATOM   6796 C  CB    . GLN B 1 351 ? 107.512 141.048 144.455 1.00 44.28  ? 351  GLN B CB    1 
ATOM   6797 C  CG    . GLN B 1 351 ? 108.845 141.683 144.804 1.00 44.28  ? 351  GLN B CG    1 
ATOM   6798 C  CD    . GLN B 1 351 ? 109.287 141.373 146.219 1.00 44.28  ? 351  GLN B CD    1 
ATOM   6799 O  OE1   . GLN B 1 351 ? 108.603 140.660 146.953 1.00 44.28  ? 351  GLN B OE1   1 
ATOM   6800 N  NE2   . GLN B 1 351 ? 110.437 141.908 146.610 1.00 44.28  ? 351  GLN B NE2   1 
ATOM   6801 N  N     . LEU B 1 352 ? 107.763 139.714 141.497 1.00 40.22  ? 352  LEU B N     1 
ATOM   6802 C  CA    . LEU B 1 352 ? 108.587 139.238 140.389 1.00 40.22  ? 352  LEU B CA    1 
ATOM   6803 C  C     . LEU B 1 352 ? 108.176 139.887 139.074 1.00 40.22  ? 352  LEU B C     1 
ATOM   6804 O  O     . LEU B 1 352 ? 109.032 140.336 138.304 1.00 40.22  ? 352  LEU B O     1 
ATOM   6805 C  CB    . LEU B 1 352 ? 108.504 137.716 140.279 1.00 40.22  ? 352  LEU B CB    1 
ATOM   6806 C  CG    . LEU B 1 352 ? 109.143 136.908 141.408 1.00 40.22  ? 352  LEU B CG    1 
ATOM   6807 C  CD1   . LEU B 1 352 ? 108.869 135.433 141.231 1.00 40.22  ? 352  LEU B CD1   1 
ATOM   6808 C  CD2   . LEU B 1 352 ? 110.636 137.164 141.469 1.00 40.22  ? 352  LEU B CD2   1 
ATOM   6809 N  N     . SER B 1 353 ? 106.879 139.947 138.798 1.00 42.82  ? 353  SER B N     1 
ATOM   6810 C  CA    . SER B 1 353 ? 106.391 140.572 137.576 1.00 42.82  ? 353  SER B CA    1 
ATOM   6811 C  C     . SER B 1 353 ? 106.504 142.091 137.649 1.00 42.82  ? 353  SER B C     1 
ATOM   6812 O  O     . SER B 1 353 ? 105.692 142.812 137.070 1.00 42.82  ? 353  SER B O     1 
ATOM   6813 C  CB    . SER B 1 353 ? 104.942 140.171 137.307 1.00 42.82  ? 353  SER B CB    1 
ATOM   6814 O  OG    . SER B 1 353 ? 104.447 140.821 136.150 1.00 42.82  ? 353  SER B OG    1 
ATOM   6815 N  N     . ILE B 1 367 ? 117.944 131.229 118.040 1.00 22.44  ? 367  ILE B N     1 
ATOM   6816 C  CA    . ILE B 1 367 ? 117.663 130.233 119.065 1.00 22.44  ? 367  ILE B CA    1 
ATOM   6817 C  C     . ILE B 1 367 ? 118.973 129.927 119.788 1.00 22.44  ? 367  ILE B C     1 
ATOM   6818 O  O     . ILE B 1 367 ? 118.976 129.707 121.006 1.00 22.44  ? 367  ILE B O     1 
ATOM   6819 C  CB    . ILE B 1 367 ? 117.006 128.952 118.470 1.00 22.44  ? 367  ILE B CB    1 
ATOM   6820 C  CG1   . ILE B 1 367 ? 115.666 129.273 117.809 1.00 22.44  ? 367  ILE B CG1   1 
ATOM   6821 C  CG2   . ILE B 1 367 ? 116.760 127.897 119.533 1.00 22.44  ? 367  ILE B CG2   1 
ATOM   6822 C  CD1   . ILE B 1 367 ? 115.727 129.460 116.304 1.00 22.44  ? 367  ILE B CD1   1 
ATOM   6823 N  N     . SER B 1 368 ? 120.075 129.961 119.028 1.00 19.72  ? 368  SER B N     1 
ATOM   6824 C  CA    . SER B 1 368 ? 121.435 129.709 119.516 1.00 19.72  ? 368  SER B CA    1 
ATOM   6825 C  C     . SER B 1 368 ? 121.535 128.318 120.154 1.00 19.72  ? 368  SER B C     1 
ATOM   6826 O  O     . SER B 1 368 ? 121.598 128.159 121.374 1.00 19.72  ? 368  SER B O     1 
ATOM   6827 C  CB    . SER B 1 368 ? 121.911 130.808 120.478 1.00 19.72  ? 368  SER B CB    1 
ATOM   6828 O  OG    . SER B 1 368 ? 123.211 130.529 120.960 1.00 19.72  ? 368  SER B OG    1 
ATOM   6829 N  N     . TYR B 1 369 ? 121.470 127.314 119.279 1.00 14.97  ? 369  TYR B N     1 
ATOM   6830 C  CA    . TYR B 1 369 ? 121.599 125.916 119.664 1.00 14.97  ? 369  TYR B CA    1 
ATOM   6831 C  C     . TYR B 1 369 ? 122.954 125.636 120.301 1.00 14.97  ? 369  TYR B C     1 
ATOM   6832 O  O     . TYR B 1 369 ? 123.917 126.390 120.141 1.00 14.97  ? 369  TYR B O     1 
ATOM   6833 C  CB    . TYR B 1 369 ? 121.412 125.013 118.449 1.00 14.97  ? 369  TYR B CB    1 
ATOM   6834 C  CG    . TYR B 1 369 ? 120.006 124.991 117.930 1.00 14.97  ? 369  TYR B CG    1 
ATOM   6835 C  CD1   . TYR B 1 369 ? 119.078 124.082 118.414 1.00 14.97  ? 369  TYR B CD1   1 
ATOM   6836 C  CD2   . TYR B 1 369 ? 119.594 125.909 116.977 1.00 14.97  ? 369  TYR B CD2   1 
ATOM   6837 C  CE1   . TYR B 1 369 ? 117.788 124.073 117.944 1.00 14.97  ? 369  TYR B CE1   1 
ATOM   6838 C  CE2   . TYR B 1 369 ? 118.309 125.912 116.512 1.00 14.97  ? 369  TYR B CE2   1 
ATOM   6839 C  CZ    . TYR B 1 369 ? 117.411 124.992 116.991 1.00 14.97  ? 369  TYR B CZ    1 
ATOM   6840 O  OH    . TYR B 1 369 ? 116.124 125.004 116.507 1.00 14.97  ? 369  TYR B OH    1 
ATOM   6841 N  N     . THR B 1 370 ? 123.012 124.523 121.034 1.00 14.66  ? 370  THR B N     1 
ATOM   6842 C  CA    . THR B 1 370 ? 124.203 124.190 121.807 1.00 14.66  ? 370  THR B CA    1 
ATOM   6843 C  C     . THR B 1 370 ? 125.365 123.836 120.898 1.00 14.66  ? 370  THR B C     1 
ATOM   6844 O  O     . THR B 1 370 ? 126.491 124.303 121.105 1.00 14.66  ? 370  THR B O     1 
ATOM   6845 C  CB    . THR B 1 370 ? 123.903 123.032 122.753 1.00 14.66  ? 370  THR B CB    1 
ATOM   6846 O  OG1   . THR B 1 370 ? 122.828 123.394 123.621 1.00 14.66  ? 370  THR B OG1   1 
ATOM   6847 C  CG2   . THR B 1 370 ? 125.106 122.710 123.590 1.00 14.66  ? 370  THR B CG2   1 
ATOM   6848 N  N     . THR B 1 371 ? 125.102 123.055 119.860 1.00 13.61  ? 371  THR B N     1 
ATOM   6849 C  CA    . THR B 1 371 ? 126.144 122.573 118.978 1.00 13.61  ? 371  THR B CA    1 
ATOM   6850 C  C     . THR B 1 371 ? 125.856 123.046 117.556 1.00 13.61  ? 371  THR B C     1 
ATOM   6851 O  O     . THR B 1 371 ? 124.699 123.234 117.177 1.00 13.61  ? 371  THR B O     1 
ATOM   6852 C  CB    . THR B 1 371 ? 126.231 121.059 119.045 1.00 13.61  ? 371  THR B CB    1 
ATOM   6853 O  OG1   . THR B 1 371 ? 126.018 120.639 120.395 1.00 13.61  ? 371  THR B OG1   1 
ATOM   6854 C  CG2   . THR B 1 371 ? 127.616 120.669 118.740 1.00 13.61  ? 371  THR B CG2   1 
ATOM   6855 N  N     . SER B 1 372 ? 126.917 123.237 116.773 1.00 12.67  ? 372  SER B N     1 
ATOM   6856 C  CA    . SER B 1 372 ? 126.834 123.891 115.478 1.00 12.67  ? 372  SER B CA    1 
ATOM   6857 C  C     . SER B 1 372 ? 126.134 123.010 114.445 1.00 12.67  ? 372  SER B C     1 
ATOM   6858 O  O     . SER B 1 372 ? 125.790 121.856 114.695 1.00 12.67  ? 372  SER B O     1 
ATOM   6859 C  CB    . SER B 1 372 ? 128.227 124.262 114.980 1.00 12.67  ? 372  SER B CB    1 
ATOM   6860 O  OG    . SER B 1 372 ? 128.981 123.101 114.701 1.00 12.67  ? 372  SER B OG    1 
ATOM   6861 N  N     . PHE B 1 373 ? 125.930 123.591 113.258 1.00 11.65  ? 373  PHE B N     1 
ATOM   6862 C  CA    . PHE B 1 373 ? 125.202 122.920 112.184 1.00 11.65  ? 373  PHE B CA    1 
ATOM   6863 C  C     . PHE B 1 373 ? 125.950 121.698 111.673 1.00 11.65  ? 373  PHE B C     1 
ATOM   6864 O  O     . PHE B 1 373 ? 125.354 120.634 111.485 1.00 11.65  ? 373  PHE B O     1 
ATOM   6865 C  CB    . PHE B 1 373 ? 124.947 123.897 111.040 1.00 11.65  ? 373  PHE B CB    1 
ATOM   6866 C  CG    . PHE B 1 373 ? 124.324 123.264 109.836 1.00 11.65  ? 373  PHE B CG    1 
ATOM   6867 C  CD1   . PHE B 1 373 ? 122.989 122.928 109.832 1.00 11.65  ? 373  PHE B CD1   1 
ATOM   6868 C  CD2   . PHE B 1 373 ? 125.076 123.000 108.706 1.00 11.65  ? 373  PHE B CD2   1 
ATOM   6869 C  CE1   . PHE B 1 373 ? 122.420 122.346 108.725 1.00 11.65  ? 373  PHE B CE1   1 
ATOM   6870 C  CE2   . PHE B 1 373 ? 124.506 122.409 107.609 1.00 11.65  ? 373  PHE B CE2   1 
ATOM   6871 C  CZ    . PHE B 1 373 ? 123.180 122.084 107.620 1.00 11.65  ? 373  PHE B CZ    1 
ATOM   6872 N  N     . CYS B 1 374 ? 127.253 121.835 111.423 1.00 12.81  ? 374  CYS B N     1 
ATOM   6873 C  CA    . CYS B 1 374 ? 128.017 120.739 110.838 1.00 12.81  ? 374  CYS B CA    1 
ATOM   6874 C  C     . CYS B 1 374 ? 128.213 119.584 111.802 1.00 12.81  ? 374  CYS B C     1 
ATOM   6875 O  O     . CYS B 1 374 ? 128.471 118.466 111.359 1.00 12.81  ? 374  CYS B O     1 
ATOM   6876 C  CB    . CYS B 1 374 ? 129.378 121.239 110.358 1.00 12.81  ? 374  CYS B CB    1 
ATOM   6877 S  SG    . CYS B 1 374 ? 129.304 122.417 108.992 1.00 12.81  ? 374  CYS B SG    1 
ATOM   6878 N  N     . HIS B 1 375 ? 128.105 119.826 113.104 1.00 11.44  ? 375  HIS B N     1 
ATOM   6879 C  CA    . HIS B 1 375 ? 128.152 118.730 114.061 1.00 11.44  ? 375  HIS B CA    1 
ATOM   6880 C  C     . HIS B 1 375 ? 126.832 117.984 114.097 1.00 11.44  ? 375  HIS B C     1 
ATOM   6881 O  O     . HIS B 1 375 ? 126.813 116.759 114.196 1.00 11.44  ? 375  HIS B O     1 
ATOM   6882 C  CB    . HIS B 1 375 ? 128.476 119.259 115.449 1.00 11.44  ? 375  HIS B CB    1 
ATOM   6883 C  CG    . HIS B 1 375 ? 128.736 118.189 116.460 1.00 11.44  ? 375  HIS B CG    1 
ATOM   6884 N  ND1   . HIS B 1 375 ? 129.976 117.611 116.626 1.00 11.44  ? 375  HIS B ND1   1 
ATOM   6885 C  CD2   . HIS B 1 375 ? 127.908 117.559 117.325 1.00 11.44  ? 375  HIS B CD2   1 
ATOM   6886 C  CE1   . HIS B 1 375 ? 129.910 116.699 117.578 1.00 11.44  ? 375  HIS B CE1   1 
ATOM   6887 N  NE2   . HIS B 1 375 ? 128.668 116.655 118.025 1.00 11.44  ? 375  HIS B NE2   1 
ATOM   6888 N  N     . GLN B 1 376 ? 125.719 118.707 114.028 1.00 9.97   ? 376  GLN B N     1 
ATOM   6889 C  CA    . GLN B 1 376 ? 124.416 118.061 114.068 1.00 9.97   ? 376  GLN B CA    1 
ATOM   6890 C  C     . GLN B 1 376 ? 124.115 117.331 112.774 1.00 9.97   ? 376  GLN B C     1 
ATOM   6891 O  O     . GLN B 1 376 ? 123.345 116.371 112.769 1.00 9.97   ? 376  GLN B O     1 
ATOM   6892 C  CB    . GLN B 1 376 ? 123.344 119.098 114.350 1.00 9.97   ? 376  GLN B CB    1 
ATOM   6893 C  CG    . GLN B 1 376 ? 123.499 119.743 115.691 1.00 9.97   ? 376  GLN B CG    1 
ATOM   6894 C  CD    . GLN B 1 376 ? 122.538 120.857 115.869 1.00 9.97   ? 376  GLN B CD    1 
ATOM   6895 O  OE1   . GLN B 1 376 ? 121.789 121.163 114.965 1.00 9.97   ? 376  GLN B OE1   1 
ATOM   6896 N  NE2   . GLN B 1 376 ? 122.560 121.488 117.027 1.00 9.97   ? 376  GLN B NE2   1 
ATOM   6897 N  N     . LEU B 1 377 ? 124.711 117.776 111.674 1.00 9.74   ? 377  LEU B N     1 
ATOM   6898 C  CA    . LEU B 1 377 ? 124.570 117.086 110.402 1.00 9.74   ? 377  LEU B CA    1 
ATOM   6899 C  C     . LEU B 1 377 ? 125.288 115.747 110.410 1.00 9.74   ? 377  LEU B C     1 
ATOM   6900 O  O     . LEU B 1 377 ? 124.836 114.798 109.761 1.00 9.74   ? 377  LEU B O     1 
ATOM   6901 C  CB    . LEU B 1 377 ? 125.119 117.979 109.296 1.00 9.74   ? 377  LEU B CB    1 
ATOM   6902 C  CG    . LEU B 1 377 ? 125.069 117.541 107.846 1.00 9.74   ? 377  LEU B CG    1 
ATOM   6903 C  CD1   . LEU B 1 377 ? 123.644 117.401 107.418 1.00 9.74   ? 377  LEU B CD1   1 
ATOM   6904 C  CD2   . LEU B 1 377 ? 125.779 118.578 107.022 1.00 9.74   ? 377  LEU B CD2   1 
ATOM   6905 N  N     . ARG B 1 378 ? 126.395 115.650 111.137 1.00 11.47  ? 378  ARG B N     1 
ATOM   6906 C  CA    . ARG B 1 378 ? 127.221 114.458 111.167 1.00 11.47  ? 378  ARG B CA    1 
ATOM   6907 C  C     . ARG B 1 378 ? 126.826 113.487 112.262 1.00 11.47  ? 378  ARG B C     1 
ATOM   6908 O  O     . ARG B 1 378 ? 127.554 112.523 112.499 1.00 11.47  ? 378  ARG B O     1 
ATOM   6909 C  CB    . ARG B 1 378 ? 128.690 114.843 111.334 1.00 11.47  ? 378  ARG B CB    1 
ATOM   6910 C  CG    . ARG B 1 378 ? 129.272 115.549 110.132 1.00 11.47  ? 378  ARG B CG    1 
ATOM   6911 C  CD    . ARG B 1 378 ? 130.724 115.904 110.358 1.00 11.47  ? 378  ARG B CD    1 
ATOM   6912 N  NE    . ARG B 1 378 ? 130.882 116.918 111.394 1.00 11.47  ? 378  ARG B NE    1 
ATOM   6913 C  CZ    . ARG B 1 378 ? 132.053 117.298 111.892 1.00 11.47  ? 378  ARG B CZ    1 
ATOM   6914 N  NH1   . ARG B 1 378 ? 133.172 116.743 111.450 1.00 11.47  ? 378  ARG B NH1   1 
ATOM   6915 N  NH2   . ARG B 1 378 ? 132.105 118.230 112.833 1.00 11.47  ? 378  ARG B NH2   1 
ATOM   6916 N  N     . TRP B 1 379 ? 125.712 113.722 112.944 1.00 9.12   ? 379  TRP B N     1 
ATOM   6917 C  CA    . TRP B 1 379 ? 125.153 112.770 113.890 1.00 9.12   ? 379  TRP B CA    1 
ATOM   6918 C  C     . TRP B 1 379 ? 123.735 112.360 113.562 1.00 9.12   ? 379  TRP B C     1 
ATOM   6919 O  O     . TRP B 1 379 ? 123.344 111.247 113.903 1.00 9.12   ? 379  TRP B O     1 
ATOM   6920 C  CB    . TRP B 1 379 ? 125.188 113.337 115.313 1.00 9.12   ? 379  TRP B CB    1 
ATOM   6921 C  CG    . TRP B 1 379 ? 126.539 113.327 115.920 1.00 9.12   ? 379  TRP B CG    1 
ATOM   6922 C  CD1   . TRP B 1 379 ? 127.480 114.290 115.815 1.00 9.12   ? 379  TRP B CD1   1 
ATOM   6923 C  CD2   . TRP B 1 379 ? 127.090 112.323 116.775 1.00 9.12   ? 379  TRP B CD2   1 
ATOM   6924 N  NE1   . TRP B 1 379 ? 128.599 113.946 116.517 1.00 9.12   ? 379  TRP B NE1   1 
ATOM   6925 C  CE2   . TRP B 1 379 ? 128.386 112.739 117.120 1.00 9.12   ? 379  TRP B CE2   1 
ATOM   6926 C  CE3   . TRP B 1 379 ? 126.620 111.107 117.270 1.00 9.12   ? 379  TRP B CE3   1 
ATOM   6927 C  CZ2   . TRP B 1 379 ? 129.214 111.991 117.940 1.00 9.12   ? 379  TRP B CZ2   1 
ATOM   6928 C  CZ3   . TRP B 1 379 ? 127.443 110.365 118.084 1.00 9.12   ? 379  TRP B CZ3   1 
ATOM   6929 C  CH2   . TRP B 1 379 ? 128.722 110.806 118.413 1.00 9.12   ? 379  TRP B CH2   1 
ATOM   6930 N  N     . VAL B 1 380 ? 122.956 113.227 112.917 1.00 8.15   ? 380  VAL B N     1 
ATOM   6931 C  CA    . VAL B 1 380 ? 121.654 112.814 112.409 1.00 8.15   ? 380  VAL B CA    1 
ATOM   6932 C  C     . VAL B 1 380 ? 121.828 111.822 111.270 1.00 8.15   ? 380  VAL B C     1 
ATOM   6933 O  O     . VAL B 1 380 ? 121.124 110.810 111.198 1.00 8.15   ? 380  VAL B O     1 
ATOM   6934 C  CB    . VAL B 1 380 ? 120.830 114.046 111.990 1.00 8.15   ? 380  VAL B CB    1 
ATOM   6935 C  CG1   . VAL B 1 380 ? 119.554 113.634 111.300 1.00 8.15   ? 380  VAL B CG1   1 
ATOM   6936 C  CG2   . VAL B 1 380 ? 120.486 114.864 113.203 1.00 8.15   ? 380  VAL B CG2   1 
ATOM   6937 N  N     . SER B 1 381 ? 122.799 112.068 110.389 1.00 9.17   ? 381  SER B N     1 
ATOM   6938 C  CA    . SER B 1 381 ? 123.092 111.122 109.321 1.00 9.17   ? 381  SER B CA    1 
ATOM   6939 C  C     . SER B 1 381 ? 123.818 109.892 109.835 1.00 9.17   ? 381  SER B C     1 
ATOM   6940 O  O     . SER B 1 381 ? 123.550 108.789 109.358 1.00 9.17   ? 381  SER B O     1 
ATOM   6941 C  CB    . SER B 1 381 ? 123.911 111.795 108.221 1.00 9.17   ? 381  SER B CB    1 
ATOM   6942 O  OG    . SER B 1 381 ? 125.189 112.166 108.686 1.00 9.17   ? 381  SER B OG    1 
ATOM   6943 N  N     . LYS B 1 382 ? 124.714 110.063 110.810 1.00 9.36   ? 382  LYS B N     1 
ATOM   6944 C  CA    . LYS B 1 382 ? 125.435 108.940 111.405 1.00 9.36   ? 382  LYS B CA    1 
ATOM   6945 C  C     . LYS B 1 382 ? 124.495 107.967 112.098 1.00 9.36   ? 382  LYS B C     1 
ATOM   6946 O  O     . LYS B 1 382 ? 124.676 106.751 112.000 1.00 9.36   ? 382  LYS B O     1 
ATOM   6947 C  CB    . LYS B 1 382 ? 126.467 109.463 112.392 1.00 9.36   ? 382  LYS B CB    1 
ATOM   6948 C  CG    . LYS B 1 382 ? 127.290 108.416 113.095 1.00 9.36   ? 382  LYS B CG    1 
ATOM   6949 C  CD    . LYS B 1 382 ? 128.298 109.082 114.006 1.00 9.36   ? 382  LYS B CD    1 
ATOM   6950 C  CE    . LYS B 1 382 ? 129.140 108.065 114.739 1.00 9.36   ? 382  LYS B CE    1 
ATOM   6951 N  NZ    . LYS B 1 382 ? 130.134 108.732 115.619 1.00 9.36   ? 382  LYS B NZ    1 
ATOM   6952 N  N     . ARG B 1 383 ? 123.486 108.477 112.805 1.00 9.44   ? 383  ARG B N     1 
ATOM   6953 C  CA    . ARG B 1 383 ? 122.474 107.596 113.373 1.00 9.44   ? 383  ARG B CA    1 
ATOM   6954 C  C     . ARG B 1 383 ? 121.592 106.997 112.288 1.00 9.44   ? 383  ARG B C     1 
ATOM   6955 O  O     . ARG B 1 383 ? 121.129 105.861 112.422 1.00 9.44   ? 383  ARG B O     1 
ATOM   6956 C  CB    . ARG B 1 383 ? 121.627 108.353 114.396 1.00 9.44   ? 383  ARG B CB    1 
ATOM   6957 C  CG    . ARG B 1 383 ? 120.633 107.475 115.142 1.00 9.44   ? 383  ARG B CG    1 
ATOM   6958 C  CD    . ARG B 1 383 ? 119.727 108.241 116.067 1.00 9.44   ? 383  ARG B CD    1 
ATOM   6959 N  NE    . ARG B 1 383 ? 118.912 109.195 115.328 1.00 9.44   ? 383  ARG B NE    1 
ATOM   6960 C  CZ    . ARG B 1 383 ? 117.995 109.973 115.883 1.00 9.44   ? 383  ARG B CZ    1 
ATOM   6961 N  NH1   . ARG B 1 383 ? 117.746 109.869 117.176 1.00 9.44   ? 383  ARG B NH1   1 
ATOM   6962 N  NH2   . ARG B 1 383 ? 117.304 110.830 115.145 1.00 9.44   ? 383  ARG B NH2   1 
ATOM   6963 N  N     . SER B 1 384 ? 121.376 107.729 111.195 1.00 10.64  ? 384  SER B N     1 
ATOM   6964 C  CA    . SER B 1 384 ? 120.498 107.251 110.136 1.00 10.64  ? 384  SER B CA    1 
ATOM   6965 C  C     . SER B 1 384 ? 121.149 106.179 109.277 1.00 10.64  ? 384  SER B C     1 
ATOM   6966 O  O     . SER B 1 384 ? 120.441 105.333 108.736 1.00 10.64  ? 384  SER B O     1 
ATOM   6967 C  CB    . SER B 1 384 ? 120.046 108.408 109.253 1.00 10.64  ? 384  SER B CB    1 
ATOM   6968 O  OG    . SER B 1 384 ? 119.282 109.341 109.988 1.00 10.64  ? 384  SER B OG    1 
ATOM   6969 N  N     . PHE B 1 385 ? 122.476 106.194 109.121 1.00 12.42  ? 385  PHE B N     1 
ATOM   6970 C  CA    . PHE B 1 385 ? 123.119 105.086 108.427 1.00 12.42  ? 385  PHE B CA    1 
ATOM   6971 C  C     . PHE B 1 385 ? 123.160 103.835 109.289 1.00 12.42  ? 385  PHE B C     1 
ATOM   6972 O  O     . PHE B 1 385 ? 123.159 102.720 108.759 1.00 12.42  ? 385  PHE B O     1 
ATOM   6973 C  CB    . PHE B 1 385 ? 124.535 105.436 107.981 1.00 12.42  ? 385  PHE B CB    1 
ATOM   6974 C  CG    . PHE B 1 385 ? 124.601 106.387 106.826 1.00 12.42  ? 385  PHE B CG    1 
ATOM   6975 C  CD1   . PHE B 1 385 ? 124.151 106.006 105.577 1.00 12.42  ? 385  PHE B CD1   1 
ATOM   6976 C  CD2   . PHE B 1 385 ? 125.205 107.623 106.962 1.00 12.42  ? 385  PHE B CD2   1 
ATOM   6977 C  CE1   . PHE B 1 385 ? 124.232 106.870 104.508 1.00 12.42  ? 385  PHE B CE1   1 
ATOM   6978 C  CE2   . PHE B 1 385 ? 125.295 108.488 105.897 1.00 12.42  ? 385  PHE B CE2   1 
ATOM   6979 C  CZ    . PHE B 1 385 ? 124.811 108.112 104.671 1.00 12.42  ? 385  PHE B CZ    1 
ATOM   6980 N  N     . LYS B 1 386 ? 123.209 103.994 110.607 1.00 12.89  ? 386  LYS B N     1 
ATOM   6981 C  CA    . LYS B 1 386 ? 123.188 102.842 111.492 1.00 12.89  ? 386  LYS B CA    1 
ATOM   6982 C  C     . LYS B 1 386 ? 121.830 102.159 111.519 1.00 12.89  ? 386  LYS B C     1 
ATOM   6983 O  O     . LYS B 1 386 ? 121.761 100.972 111.847 1.00 12.89  ? 386  LYS B O     1 
ATOM   6984 C  CB    . LYS B 1 386 ? 123.593 103.257 112.902 1.00 12.89  ? 386  LYS B CB    1 
ATOM   6985 C  CG    . LYS B 1 386 ? 125.042 103.674 113.009 1.00 12.89  ? 386  LYS B CG    1 
ATOM   6986 C  CD    . LYS B 1 386 ? 125.401 104.079 114.421 1.00 12.89  ? 386  LYS B CD    1 
ATOM   6987 C  CE    . LYS B 1 386 ? 126.824 104.598 114.489 1.00 12.89  ? 386  LYS B CE    1 
ATOM   6988 N  NZ    . LYS B 1 386 ? 127.819 103.528 114.217 1.00 12.89  ? 386  LYS B NZ    1 
ATOM   6989 N  N     . ASN B 1 387 ? 120.755 102.871 111.186 1.00 13.16  ? 387  ASN B N     1 
ATOM   6990 C  CA    . ASN B 1 387 ? 119.463 102.219 111.029 1.00 13.16  ? 387  ASN B CA    1 
ATOM   6991 C  C     . ASN B 1 387 ? 119.368 101.465 109.714 1.00 13.16  ? 387  ASN B C     1 
ATOM   6992 O  O     . ASN B 1 387 ? 118.603 100.503 109.614 1.00 13.16  ? 387  ASN B O     1 
ATOM   6993 C  CB    . ASN B 1 387 ? 118.322 103.232 111.105 1.00 13.16  ? 387  ASN B CB    1 
ATOM   6994 C  CG    . ASN B 1 387 ? 118.231 103.910 112.443 1.00 13.16  ? 387  ASN B CG    1 
ATOM   6995 O  OD1   . ASN B 1 387 ? 118.310 105.129 112.542 1.00 13.16  ? 387  ASN B OD1   1 
ATOM   6996 N  ND2   . ASN B 1 387 ? 118.090 103.122 113.487 1.00 13.16  ? 387  ASN B ND2   1 
ATOM   6997 N  N     . LEU B 1 388 ? 120.103 101.897 108.695 1.00 15.35  ? 388  LEU B N     1 
ATOM   6998 C  CA    . LEU B 1 388 ? 120.117 101.192 107.422 1.00 15.35  ? 388  LEU B CA    1 
ATOM   6999 C  C     . LEU B 1 388 ? 121.114 100.050 107.393 1.00 15.35  ? 388  LEU B C     1 
ATOM   7000 O  O     . LEU B 1 388 ? 120.898 99.074  106.673 1.00 15.35  ? 388  LEU B O     1 
ATOM   7001 C  CB    . LEU B 1 388 ? 120.423 102.155 106.274 1.00 15.35  ? 388  LEU B CB    1 
ATOM   7002 C  CG    . LEU B 1 388 ? 119.242 102.850 105.593 1.00 15.35  ? 388  LEU B CG    1 
ATOM   7003 C  CD1   . LEU B 1 388 ? 118.579 103.932 106.439 1.00 15.35  ? 388  LEU B CD1   1 
ATOM   7004 C  CD2   . LEU B 1 388 ? 119.691 103.407 104.261 1.00 15.35  ? 388  LEU B CD2   1 
ATOM   7005 N  N     . LEU B 1 389 ? 122.209 100.147 108.140 1.00 16.18  ? 389  LEU B N     1 
ATOM   7006 C  CA    . LEU B 1 389 ? 123.103 99.010  108.272 1.00 16.18  ? 389  LEU B CA    1 
ATOM   7007 C  C     . LEU B 1 389 ? 122.611 98.007  109.299 1.00 16.18  ? 389  LEU B C     1 
ATOM   7008 O  O     . LEU B 1 389 ? 123.135 96.892  109.350 1.00 16.18  ? 389  LEU B O     1 
ATOM   7009 C  CB    . LEU B 1 389 ? 124.509 99.473  108.648 1.00 16.18  ? 389  LEU B CB    1 
ATOM   7010 C  CG    . LEU B 1 389 ? 125.216 100.307 107.585 1.00 16.18  ? 389  LEU B CG    1 
ATOM   7011 C  CD1   . LEU B 1 389 ? 126.574 100.768 108.079 1.00 16.18  ? 389  LEU B CD1   1 
ATOM   7012 C  CD2   . LEU B 1 389 ? 125.346 99.533  106.291 1.00 16.18  ? 389  LEU B CD2   1 
ATOM   7013 N  N     . GLY B 1 390 ? 121.630 98.373  110.112 1.00 15.82  ? 390  GLY B N     1 
ATOM   7014 C  CA    . GLY B 1 390 ? 121.093 97.465  111.096 1.00 15.82  ? 390  GLY B CA    1 
ATOM   7015 C  C     . GLY B 1 390 ? 119.861 96.755  110.589 1.00 15.82  ? 390  GLY B C     1 
ATOM   7016 O  O     . GLY B 1 390 ? 119.598 95.611  110.962 1.00 15.82  ? 390  GLY B O     1 
ATOM   7017 N  N     . ASN B 1 391 ? 119.096 97.424  109.734 1.00 18.96  ? 391  ASN B N     1 
ATOM   7018 C  CA    . ASN B 1 391 ? 117.883 96.861  109.143 1.00 18.96  ? 391  ASN B CA    1 
ATOM   7019 C  C     . ASN B 1 391 ? 117.871 97.128  107.643 1.00 18.96  ? 391  ASN B C     1 
ATOM   7020 O  O     . ASN B 1 391 ? 117.113 97.977  107.162 1.00 18.96  ? 391  ASN B O     1 
ATOM   7021 C  CB    . ASN B 1 391 ? 116.646 97.464  109.806 1.00 18.96  ? 391  ASN B CB    1 
ATOM   7022 C  CG    . ASN B 1 391 ? 116.526 97.083  111.266 1.00 18.96  ? 391  ASN B CG    1 
ATOM   7023 O  OD1   . ASN B 1 391 ? 116.720 95.926  111.638 1.00 18.96  ? 391  ASN B OD1   1 
ATOM   7024 N  ND2   . ASN B 1 391 ? 116.220 98.061  112.105 1.00 18.96  ? 391  ASN B ND2   1 
ATOM   7025 N  N     . PRO B 1 392 ? 118.712 96.410  106.854 1.00 19.97  ? 392  PRO B N     1 
ATOM   7026 C  CA    . PRO B 1 392 ? 118.850 96.710  105.425 1.00 19.97  ? 392  PRO B CA    1 
ATOM   7027 C  C     . PRO B 1 392 ? 117.863 95.955  104.543 1.00 19.97  ? 392  PRO B C     1 
ATOM   7028 O  O     . PRO B 1 392 ? 118.227 95.397  103.510 1.00 19.97  ? 392  PRO B O     1 
ATOM   7029 C  CB    . PRO B 1 392 ? 120.286 96.266  105.129 1.00 19.97  ? 392  PRO B CB    1 
ATOM   7030 C  CG    . PRO B 1 392 ? 120.455 95.100  106.008 1.00 19.97  ? 392  PRO B CG    1 
ATOM   7031 C  CD    . PRO B 1 392 ? 119.669 95.365  107.262 1.00 19.97  ? 392  PRO B CD    1 
ATOM   7032 N  N     . GLN B 1 393 ? 116.593 95.936  104.936 1.00 21.31  ? 393  GLN B N     1 
ATOM   7033 C  CA    . GLN B 1 393 ? 115.621 95.203  104.133 1.00 21.31  ? 393  GLN B CA    1 
ATOM   7034 C  C     . GLN B 1 393 ? 115.248 95.981  102.881 1.00 21.31  ? 393  GLN B C     1 
ATOM   7035 O  O     . GLN B 1 393 ? 115.245 95.428  101.780 1.00 21.31  ? 393  GLN B O     1 
ATOM   7036 C  CB    . GLN B 1 393 ? 114.373 94.874  104.954 1.00 21.31  ? 393  GLN B CB    1 
ATOM   7037 C  CG    . GLN B 1 393 ? 114.579 93.806  106.016 1.00 21.31  ? 393  GLN B CG    1 
ATOM   7038 C  CD    . GLN B 1 393 ? 115.128 94.360  107.312 1.00 21.31  ? 393  GLN B CD    1 
ATOM   7039 O  OE1   . GLN B 1 393 ? 115.043 95.557  107.573 1.00 21.31  ? 393  GLN B OE1   1 
ATOM   7040 N  NE2   . GLN B 1 393 ? 115.701 93.491  108.131 1.00 21.31  ? 393  GLN B NE2   1 
ATOM   7041 N  N     . ALA B 1 394 ? 114.953 97.272  103.028 1.00 19.75  ? 394  ALA B N     1 
ATOM   7042 C  CA    . ALA B 1 394 ? 114.526 98.073  101.890 1.00 19.75  ? 394  ALA B CA    1 
ATOM   7043 C  C     . ALA B 1 394 ? 115.672 98.437  100.966 1.00 19.75  ? 394  ALA B C     1 
ATOM   7044 O  O     . ALA B 1 394 ? 115.423 98.785  99.812  1.00 19.75  ? 394  ALA B O     1 
ATOM   7045 C  CB    . ALA B 1 394 ? 113.833 99.341  102.375 1.00 19.75  ? 394  ALA B CB    1 
ATOM   7046 N  N     . SER B 1 395 ? 116.913 98.370  101.438 1.00 21.73  ? 395  SER B N     1 
ATOM   7047 C  CA    . SER B 1 395 ? 118.063 98.702  100.608 1.00 21.73  ? 395  SER B CA    1 
ATOM   7048 C  C     . SER B 1 395 ? 118.579 97.499  99.831  1.00 21.73  ? 395  SER B C     1 
ATOM   7049 O  O     . SER B 1 395 ? 119.029 97.649  98.694  1.00 21.73  ? 395  SER B O     1 
ATOM   7050 C  CB    . SER B 1 395 ? 119.181 99.283  101.472 1.00 21.73  ? 395  SER B CB    1 
ATOM   7051 O  OG    . SER B 1 395 ? 120.325 99.574  100.696 1.00 21.73  ? 395  SER B OG    1 
ATOM   7052 N  N     . ILE B 1 396 ? 118.530 96.307  100.426 1.00 20.75  ? 396  ILE B N     1 
ATOM   7053 C  CA    . ILE B 1 396 ? 118.900 95.095  99.704  1.00 20.75  ? 396  ILE B CA    1 
ATOM   7054 C  C     . ILE B 1 396 ? 117.836 94.747  98.674  1.00 20.75  ? 396  ILE B C     1 
ATOM   7055 O  O     . ILE B 1 396 ? 118.152 94.409  97.528  1.00 20.75  ? 396  ILE B O     1 
ATOM   7056 C  CB    . ILE B 1 396 ? 119.153 93.945  100.698 1.00 20.75  ? 396  ILE B CB    1 
ATOM   7057 C  CG1   . ILE B 1 396 ? 120.450 94.190  101.470 1.00 20.75  ? 396  ILE B CG1   1 
ATOM   7058 C  CG2   . ILE B 1 396 ? 119.187 92.597  100.018 1.00 20.75  ? 396  ILE B CG2   1 
ATOM   7059 C  CD1   . ILE B 1 396 ? 120.642 93.269  102.643 1.00 20.75  ? 396  ILE B CD1   1 
ATOM   7060 N  N     . ALA B 1 397 ? 116.561 94.862  99.046  1.00 20.99  ? 397  ALA B N     1 
ATOM   7061 C  CA    . ALA B 1 397 ? 115.486 94.585  98.101  1.00 20.99  ? 397  ALA B CA    1 
ATOM   7062 C  C     . ALA B 1 397 ? 115.373 95.644  97.018  1.00 20.99  ? 397  ALA B C     1 
ATOM   7063 O  O     . ALA B 1 397 ? 114.793 95.366  95.972  1.00 20.99  ? 397  ALA B O     1 
ATOM   7064 C  CB    . ALA B 1 397 ? 114.152 94.460  98.830  1.00 20.99  ? 397  ALA B CB    1 
ATOM   7065 N  N     . GLN B 1 398 ? 115.891 96.848  97.254  1.00 21.22  ? 398  GLN B N     1 
ATOM   7066 C  CA    . GLN B 1 398 ? 116.026 97.838  96.189  1.00 21.22  ? 398  GLN B CA    1 
ATOM   7067 C  C     . GLN B 1 398 ? 117.006 97.373  95.123  1.00 21.22  ? 398  GLN B C     1 
ATOM   7068 O  O     . GLN B 1 398 ? 116.710 97.435  93.927  1.00 21.22  ? 398  GLN B O     1 
ATOM   7069 C  CB    . GLN B 1 398 ? 116.487 99.169  96.774  1.00 21.22  ? 398  GLN B CB    1 
ATOM   7070 C  CG    . GLN B 1 398 ? 116.832 100.201 95.746  1.00 21.22  ? 398  GLN B CG    1 
ATOM   7071 C  CD    . GLN B 1 398 ? 115.658 100.909 95.132  1.00 21.22  ? 398  GLN B CD    1 
ATOM   7072 O  OE1   . GLN B 1 398 ? 114.819 101.447 95.838  1.00 21.22  ? 398  GLN B OE1   1 
ATOM   7073 N  NE2   . GLN B 1 398 ? 115.588 100.914 93.815  1.00 21.22  ? 398  GLN B NE2   1 
ATOM   7074 N  N     . ILE B 1 399 ? 118.182 96.905  95.542  1.00 21.77  ? 399  ILE B N     1 
ATOM   7075 C  CA    . ILE B 1 399 ? 119.243 96.555  94.604  1.00 21.77  ? 399  ILE B CA    1 
ATOM   7076 C  C     . ILE B 1 399 ? 118.920 95.257  93.869  1.00 21.77  ? 399  ILE B C     1 
ATOM   7077 O  O     . ILE B 1 399 ? 119.281 95.094  92.699  1.00 21.77  ? 399  ILE B O     1 
ATOM   7078 C  CB    . ILE B 1 399 ? 120.584 96.495  95.366  1.00 21.77  ? 399  ILE B CB    1 
ATOM   7079 C  CG1   . ILE B 1 399 ? 120.894 97.858  95.977  1.00 21.77  ? 399  ILE B CG1   1 
ATOM   7080 C  CG2   . ILE B 1 399 ? 121.742 96.118  94.469  1.00 21.77  ? 399  ILE B CG2   1 
ATOM   7081 C  CD1   . ILE B 1 399 ? 122.043 97.839  96.943  1.00 21.77  ? 399  ILE B CD1   1 
ATOM   7082 N  N     . ILE B 1 400 ? 118.194 94.340  94.512  1.00 22.37  ? 400  ILE B N     1 
ATOM   7083 C  CA    . ILE B 1 400 ? 117.862 93.066  93.879  1.00 22.37  ? 400  ILE B CA    1 
ATOM   7084 C  C     . ILE B 1 400 ? 116.884 93.266  92.727  1.00 22.37  ? 400  ILE B C     1 
ATOM   7085 O  O     . ILE B 1 400 ? 117.136 92.820  91.605  1.00 22.37  ? 400  ILE B O     1 
ATOM   7086 C  CB    . ILE B 1 400 ? 117.323 92.068  94.920  1.00 22.37  ? 400  ILE B CB    1 
ATOM   7087 C  CG1   . ILE B 1 400 ? 118.453 91.597  95.832  1.00 22.37  ? 400  ILE B CG1   1 
ATOM   7088 C  CG2   . ILE B 1 400 ? 116.656 90.887  94.251  1.00 22.37  ? 400  ILE B CG2   1 
ATOM   7089 C  CD1   . ILE B 1 400 ? 117.984 90.737  96.975  1.00 22.37  ? 400  ILE B CD1   1 
ATOM   7090 N  N     . VAL B 1 401 ? 115.774 93.973  92.965  1.00 22.57  ? 401  VAL B N     1 
ATOM   7091 C  CA    . VAL B 1 401 ? 114.797 94.167  91.894  1.00 22.57  ? 401  VAL B CA    1 
ATOM   7092 C  C     . VAL B 1 401 ? 115.191 95.268  90.925  1.00 22.57  ? 401  VAL B C     1 
ATOM   7093 O  O     . VAL B 1 401 ? 114.448 95.532  89.975  1.00 22.57  ? 401  VAL B O     1 
ATOM   7094 C  CB    . VAL B 1 401 ? 113.384 94.478  92.423  1.00 22.57  ? 401  VAL B CB    1 
ATOM   7095 C  CG1   . VAL B 1 401 ? 112.895 93.364  93.322  1.00 22.57  ? 401  VAL B CG1   1 
ATOM   7096 C  CG2   . VAL B 1 401 ? 113.354 95.805  93.124  1.00 22.57  ? 401  VAL B CG2   1 
ATOM   7097 N  N     . THR B 1 402 ? 116.324 95.928  91.136  1.00 23.24  ? 402  THR B N     1 
ATOM   7098 C  CA    . THR B 1 402 ? 116.897 96.811  90.130  1.00 23.24  ? 402  THR B CA    1 
ATOM   7099 C  C     . THR B 1 402 ? 117.797 96.039  89.175  1.00 23.24  ? 402  THR B C     1 
ATOM   7100 O  O     . THR B 1 402 ? 117.782 96.288  87.965  1.00 23.24  ? 402  THR B O     1 
ATOM   7101 C  CB    . THR B 1 402 ? 117.673 97.937  90.814  1.00 23.24  ? 402  THR B CB    1 
ATOM   7102 O  OG1   . THR B 1 402 ? 116.791 98.653  91.684  1.00 23.24  ? 402  THR B OG1   1 
ATOM   7103 C  CG2   . THR B 1 402 ? 118.228 98.903  89.814  1.00 23.24  ? 402  THR B CG2   1 
ATOM   7104 N  N     . VAL B 1 403 ? 118.564 95.083  89.704  1.00 24.22  ? 403  VAL B N     1 
ATOM   7105 C  CA    . VAL B 1 403 ? 119.358 94.194  88.863  1.00 24.22  ? 403  VAL B CA    1 
ATOM   7106 C  C     . VAL B 1 403 ? 118.453 93.295  88.031  1.00 24.22  ? 403  VAL B C     1 
ATOM   7107 O  O     . VAL B 1 403 ? 118.673 93.122  86.829  1.00 24.22  ? 403  VAL B O     1 
ATOM   7108 C  CB    . VAL B 1 403 ? 120.333 93.381  89.733  1.00 24.22  ? 403  VAL B CB    1 
ATOM   7109 C  CG1   . VAL B 1 403 ? 121.011 92.295  88.929  1.00 24.22  ? 403  VAL B CG1   1 
ATOM   7110 C  CG2   . VAL B 1 403 ? 121.384 94.290  90.323  1.00 24.22  ? 403  VAL B CG2   1 
ATOM   7111 N  N     . VAL B 1 404 ? 117.404 92.741  88.646  1.00 25.53  ? 404  VAL B N     1 
ATOM   7112 C  CA    . VAL B 1 404 ? 116.495 91.839  87.942  1.00 25.53  ? 404  VAL B CA    1 
ATOM   7113 C  C     . VAL B 1 404 ? 115.712 92.585  86.867  1.00 25.53  ? 404  VAL B C     1 
ATOM   7114 O  O     . VAL B 1 404 ? 115.545 92.086  85.749  1.00 25.53  ? 404  VAL B O     1 
ATOM   7115 C  CB    . VAL B 1 404 ? 115.572 91.131  88.951  1.00 25.53  ? 404  VAL B CB    1 
ATOM   7116 C  CG1   . VAL B 1 404 ? 114.493 90.341  88.251  1.00 25.53  ? 404  VAL B CG1   1 
ATOM   7117 C  CG2   . VAL B 1 404 ? 116.380 90.194  89.816  1.00 25.53  ? 404  VAL B CG2   1 
ATOM   7118 N  N     . LEU B 1 405 ? 115.268 93.807  87.161  1.00 26.82  ? 405  LEU B N     1 
ATOM   7119 C  CA    . LEU B 1 405 ? 114.604 94.609  86.137  1.00 26.82  ? 405  LEU B CA    1 
ATOM   7120 C  C     . LEU B 1 405 ? 115.584 95.099  85.081  1.00 26.82  ? 405  LEU B C     1 
ATOM   7121 O  O     . LEU B 1 405 ? 115.225 95.190  83.904  1.00 26.82  ? 405  LEU B O     1 
ATOM   7122 C  CB    . LEU B 1 405 ? 113.884 95.791  86.776  1.00 26.82  ? 405  LEU B CB    1 
ATOM   7123 C  CG    . LEU B 1 405 ? 113.076 96.709  85.866  1.00 26.82  ? 405  LEU B CG    1 
ATOM   7124 C  CD1   . LEU B 1 405 ? 111.960 95.945  85.201  1.00 26.82  ? 405  LEU B CD1   1 
ATOM   7125 C  CD2   . LEU B 1 405 ? 112.520 97.849  86.660  1.00 26.82  ? 405  LEU B CD2   1 
ATOM   7126 N  N     . GLY B 1 406 ? 116.824 95.396  85.471  1.00 28.66  ? 406  GLY B N     1 
ATOM   7127 C  CA    . GLY B 1 406 ? 117.818 95.812  84.498  1.00 28.66  ? 406  GLY B CA    1 
ATOM   7128 C  C     . GLY B 1 406 ? 118.245 94.704  83.559  1.00 28.66  ? 406  GLY B C     1 
ATOM   7129 O  O     . GLY B 1 406 ? 118.640 94.971  82.423  1.00 28.66  ? 406  GLY B O     1 
ATOM   7130 N  N     . LEU B 1 407 ? 118.173 93.453  84.012  1.00 29.15  ? 407  LEU B N     1 
ATOM   7131 C  CA    . LEU B 1 407 ? 118.488 92.321  83.150  1.00 29.15  ? 407  LEU B CA    1 
ATOM   7132 C  C     . LEU B 1 407 ? 117.335 91.959  82.228  1.00 29.15  ? 407  LEU B C     1 
ATOM   7133 O  O     . LEU B 1 407 ? 117.571 91.434  81.139  1.00 29.15  ? 407  LEU B O     1 
ATOM   7134 C  CB    . LEU B 1 407 ? 118.865 91.103  83.990  1.00 29.15  ? 407  LEU B CB    1 
ATOM   7135 C  CG    . LEU B 1 407 ? 120.180 91.086  84.761  1.00 29.15  ? 407  LEU B CG    1 
ATOM   7136 C  CD1   . LEU B 1 407 ? 120.190 89.902  85.691  1.00 29.15  ? 407  LEU B CD1   1 
ATOM   7137 C  CD2   . LEU B 1 407 ? 121.359 91.026  83.820  1.00 29.15  ? 407  LEU B CD2   1 
ATOM   7138 N  N     . VAL B 1 408 ? 116.095 92.206  82.645  1.00 31.04  ? 408  VAL B N     1 
ATOM   7139 C  CA    . VAL B 1 408 ? 114.941 91.896  81.806  1.00 31.04  ? 408  VAL B CA    1 
ATOM   7140 C  C     . VAL B 1 408 ? 114.807 92.905  80.674  1.00 31.04  ? 408  VAL B C     1 
ATOM   7141 O  O     . VAL B 1 408 ? 114.601 92.531  79.514  1.00 31.04  ? 408  VAL B O     1 
ATOM   7142 C  CB    . VAL B 1 408 ? 113.667 91.825  82.666  1.00 31.04  ? 408  VAL B CB    1 
ATOM   7143 C  CG1   . VAL B 1 408 ? 112.430 91.812  81.802  1.00 31.04  ? 408  VAL B CG1   1 
ATOM   7144 C  CG2   . VAL B 1 408 ? 113.694 90.570  83.511  1.00 31.04  ? 408  VAL B CG2   1 
ATOM   7145 N  N     . ILE B 1 409 ? 114.937 94.196  80.996  1.00 31.03  ? 409  ILE B N     1 
ATOM   7146 C  CA    . ILE B 1 409 ? 114.932 95.258  79.992  1.00 31.03  ? 409  ILE B CA    1 
ATOM   7147 C  C     . ILE B 1 409 ? 116.110 95.105  79.039  1.00 31.03  ? 409  ILE B C     1 
ATOM   7148 O  O     . ILE B 1 409 ? 115.997 95.387  77.841  1.00 31.03  ? 409  ILE B O     1 
ATOM   7149 C  CB    . ILE B 1 409 ? 114.923 96.626  80.707  1.00 31.03  ? 409  ILE B CB    1 
ATOM   7150 C  CG1   . ILE B 1 409 ? 113.633 96.800  81.497  1.00 31.03  ? 409  ILE B CG1   1 
ATOM   7151 C  CG2   . ILE B 1 409 ? 115.011 97.756  79.755  1.00 31.03  ? 409  ILE B CG2   1 
ATOM   7152 C  CD1   . ILE B 1 409 ? 113.611 98.034  82.353  1.00 31.03  ? 409  ILE B CD1   1 
ATOM   7153 N  N     . GLY B 1 410 ? 117.235 94.591  79.530  1.00 35.23  ? 410  GLY B N     1 
ATOM   7154 C  CA    . GLY B 1 410 ? 118.350 94.311  78.644  1.00 35.23  ? 410  GLY B CA    1 
ATOM   7155 C  C     . GLY B 1 410 ? 118.147 93.089  77.771  1.00 35.23  ? 410  GLY B C     1 
ATOM   7156 O  O     . GLY B 1 410 ? 118.736 92.992  76.694  1.00 35.23  ? 410  GLY B O     1 
ATOM   7157 N  N     . ALA B 1 411 ? 117.334 92.134  78.219  1.00 35.42  ? 411  ALA B N     1 
ATOM   7158 C  CA    . ALA B 1 411 ? 117.132 90.905  77.461  1.00 35.42  ? 411  ALA B CA    1 
ATOM   7159 C  C     . ALA B 1 411 ? 116.007 91.003  76.445  1.00 35.42  ? 411  ALA B C     1 
ATOM   7160 O  O     . ALA B 1 411 ? 116.008 90.253  75.463  1.00 35.42  ? 411  ALA B O     1 
ATOM   7161 C  CB    . ALA B 1 411 ? 116.841 89.741  78.406  1.00 35.42  ? 411  ALA B CB    1 
ATOM   7162 N  N     . ILE B 1 412 ? 115.040 91.889  76.665  1.00 37.75  ? 412  ILE B N     1 
ATOM   7163 C  CA    . ILE B 1 412 ? 113.971 92.086  75.696  1.00 37.75  ? 412  ILE B CA    1 
ATOM   7164 C  C     . ILE B 1 412 ? 114.473 92.886  74.506  1.00 37.75  ? 412  ILE B C     1 
ATOM   7165 O  O     . ILE B 1 412 ? 114.260 92.509  73.349  1.00 37.75  ? 412  ILE B O     1 
ATOM   7166 C  CB    . ILE B 1 412 ? 112.765 92.759  76.370  1.00 37.75  ? 412  ILE B CB    1 
ATOM   7167 C  CG1   . ILE B 1 412 ? 112.160 91.813  77.395  1.00 37.75  ? 412  ILE B CG1   1 
ATOM   7168 C  CG2   . ILE B 1 412 ? 111.719 93.130  75.356  1.00 37.75  ? 412  ILE B CG2   1 
ATOM   7169 C  CD1   . ILE B 1 412 ? 111.173 92.458  78.273  1.00 37.75  ? 412  ILE B CD1   1 
ATOM   7170 N  N     . TYR B 1 413 ? 115.172 93.987  74.768  1.00 40.13  ? 413  TYR B N     1 
ATOM   7171 C  CA    . TYR B 1 413 ? 115.734 94.813  73.710  1.00 40.13  ? 413  TYR B CA    1 
ATOM   7172 C  C     . TYR B 1 413 ? 117.181 94.455  73.405  1.00 40.13  ? 413  TYR B C     1 
ATOM   7173 O  O     . TYR B 1 413 ? 117.971 95.337  73.051  1.00 40.13  ? 413  TYR B O     1 
ATOM   7174 C  CB    . TYR B 1 413 ? 115.608 96.290  74.079  1.00 40.13  ? 413  TYR B CB    1 
ATOM   7175 C  CG    . TYR B 1 413 ? 114.181 96.757  74.226  1.00 40.13  ? 413  TYR B CG    1 
ATOM   7176 C  CD1   . TYR B 1 413 ? 113.411 97.052  73.113  1.00 40.13  ? 413  TYR B CD1   1 
ATOM   7177 C  CD2   . TYR B 1 413 ? 113.605 96.904  75.479  1.00 40.13  ? 413  TYR B CD2   1 
ATOM   7178 C  CE1   . TYR B 1 413 ? 112.107 97.477  73.243  1.00 40.13  ? 413  TYR B CE1   1 
ATOM   7179 C  CE2   . TYR B 1 413 ? 112.301 97.331  75.618  1.00 40.13  ? 413  TYR B CE2   1 
ATOM   7180 C  CZ    . TYR B 1 413 ? 111.559 97.614  74.497  1.00 40.13  ? 413  TYR B CZ    1 
ATOM   7181 O  OH    . TYR B 1 413 ? 110.260 98.038  74.629  1.00 40.13  ? 413  TYR B OH    1 
ATOM   7182 N  N     . PHE B 1 414 ? 117.545 93.182  73.550  1.00 42.63  ? 414  PHE B N     1 
ATOM   7183 C  CA    . PHE B 1 414 ? 118.909 92.735  73.303  1.00 42.63  ? 414  PHE B CA    1 
ATOM   7184 C  C     . PHE B 1 414 ? 119.257 92.868  71.828  1.00 42.63  ? 414  PHE B C     1 
ATOM   7185 O  O     . PHE B 1 414 ? 118.505 92.417  70.959  1.00 42.63  ? 414  PHE B O     1 
ATOM   7186 C  CB    . PHE B 1 414 ? 119.075 91.283  73.747  1.00 42.63  ? 414  PHE B CB    1 
ATOM   7187 C  CG    . PHE B 1 414 ? 120.470 90.753  73.584  1.00 42.63  ? 414  PHE B CG    1 
ATOM   7188 C  CD1   . PHE B 1 414 ? 121.462 91.095  74.486  1.00 42.63  ? 414  PHE B CD1   1 
ATOM   7189 C  CD2   . PHE B 1 414 ? 120.788 89.911  72.531  1.00 42.63  ? 414  PHE B CD2   1 
ATOM   7190 C  CE1   . PHE B 1 414 ? 122.745 90.615  74.343  1.00 42.63  ? 414  PHE B CE1   1 
ATOM   7191 C  CE2   . PHE B 1 414 ? 122.072 89.427  72.380  1.00 42.63  ? 414  PHE B CE2   1 
ATOM   7192 C  CZ    . PHE B 1 414 ? 123.051 89.780  73.289  1.00 42.63  ? 414  PHE B CZ    1 
ATOM   7193 N  N     . GLY B 1 415 ? 120.402 93.483  71.550  1.00 45.74  ? 415  GLY B N     1 
ATOM   7194 C  CA    . GLY B 1 415 ? 120.846 93.666  70.185  1.00 45.74  ? 415  GLY B CA    1 
ATOM   7195 C  C     . GLY B 1 415 ? 120.015 94.679  69.432  1.00 45.74  ? 415  GLY B C     1 
ATOM   7196 O  O     . GLY B 1 415 ? 119.264 94.321  68.521  1.00 45.74  ? 415  GLY B O     1 
ATOM   7197 N  N     . LEU B 1 416 ? 120.123 95.945  69.823  1.00 47.45  ? 416  LEU B N     1 
ATOM   7198 C  CA    . LEU B 1 416 ? 119.392 97.010  69.151  1.00 47.45  ? 416  LEU B CA    1 
ATOM   7199 C  C     . LEU B 1 416 ? 119.992 97.254  67.773  1.00 47.45  ? 416  LEU B C     1 
ATOM   7200 O  O     . LEU B 1 416 ? 121.172 97.597  67.652  1.00 47.45  ? 416  LEU B O     1 
ATOM   7201 C  CB    . LEU B 1 416 ? 119.429 98.284  69.987  1.00 47.45  ? 416  LEU B CB    1 
ATOM   7202 C  CG    . LEU B 1 416 ? 118.701 98.220  71.324  1.00 47.45  ? 416  LEU B CG    1 
ATOM   7203 C  CD1   . LEU B 1 416 ? 118.932 99.490  72.103  1.00 47.45  ? 416  LEU B CD1   1 
ATOM   7204 C  CD2   . LEU B 1 416 ? 117.228 97.994  71.099  1.00 47.45  ? 416  LEU B CD2   1 
ATOM   7205 N  N     . LYS B 1 417 ? 119.184 97.071  66.739  1.00 53.98  ? 417  LYS B N     1 
ATOM   7206 C  CA    . LYS B 1 417 ? 119.633 97.205  65.364  1.00 53.98  ? 417  LYS B CA    1 
ATOM   7207 C  C     . LYS B 1 417 ? 119.202 98.546  64.789  1.00 53.98  ? 417  LYS B C     1 
ATOM   7208 O  O     . LYS B 1 417 ? 118.354 99.247  65.346  1.00 53.98  ? 417  LYS B O     1 
ATOM   7209 C  CB    . LYS B 1 417 ? 119.080 96.063  64.509  1.00 53.98  ? 417  LYS B CB    1 
ATOM   7210 C  CG    . LYS B 1 417 ? 119.575 94.694  64.930  1.00 53.98  ? 417  LYS B CG    1 
ATOM   7211 C  CD    . LYS B 1 417 ? 119.015 93.609  64.036  1.00 53.98  ? 417  LYS B CD    1 
ATOM   7212 C  CE    . LYS B 1 417 ? 117.531 93.423  64.283  1.00 53.98  ? 417  LYS B CE    1 
ATOM   7213 N  NZ    . LYS B 1 417 ? 117.267 92.916  65.657  1.00 53.98  ? 417  LYS B NZ    1 
ATOM   7214 N  N     . ASN B 1 418 ? 119.807 98.899  63.659  1.00 59.73  ? 418  ASN B N     1 
ATOM   7215 C  CA    . ASN B 1 418 ? 119.440 100.103 62.917  1.00 59.73  ? 418  ASN B CA    1 
ATOM   7216 C  C     . ASN B 1 418 ? 118.515 99.668  61.789  1.00 59.73  ? 418  ASN B C     1 
ATOM   7217 O  O     . ASN B 1 418 ? 118.954 99.321  60.694  1.00 59.73  ? 418  ASN B O     1 
ATOM   7218 C  CB    . ASN B 1 418 ? 120.682 100.812 62.396  1.00 59.73  ? 418  ASN B CB    1 
ATOM   7219 C  CG    . ASN B 1 418 ? 121.605 101.261 63.507  1.00 59.73  ? 418  ASN B CG    1 
ATOM   7220 O  OD1   . ASN B 1 418 ? 122.732 100.784 63.626  1.00 59.73  ? 418  ASN B OD1   1 
ATOM   7221 N  ND2   . ASN B 1 418 ? 121.131 102.185 64.330  1.00 59.73  ? 418  ASN B ND2   1 
ATOM   7222 N  N     . ASP B 1 419 ? 117.216 99.683  62.061  1.00 60.06  ? 419  ASP B N     1 
ATOM   7223 C  CA    . ASP B 1 419 ? 116.238 99.129  61.135  1.00 60.06  ? 419  ASP B CA    1 
ATOM   7224 C  C     . ASP B 1 419 ? 115.061 100.101 61.083  1.00 60.06  ? 419  ASP B C     1 
ATOM   7225 O  O     . ASP B 1 419 ? 115.119 101.195 61.653  1.00 60.06  ? 419  ASP B O     1 
ATOM   7226 C  CB    . ASP B 1 419 ? 115.850 97.711  61.579  1.00 60.06  ? 419  ASP B CB    1 
ATOM   7227 C  CG    . ASP B 1 419 ? 115.268 96.871  60.452  1.00 60.06  ? 419  ASP B CG    1 
ATOM   7228 O  OD1   . ASP B 1 419 ? 115.138 97.391  59.324  1.00 60.06  ? 419  ASP B OD1   1 
ATOM   7229 O  OD2   . ASP B 1 419 ? 114.942 95.691  60.700  1.00 60.06  ? 419  ASP B OD2   1 
ATOM   7230 N  N     . SER B 1 420 ? 113.986 99.706  60.400  1.00 58.90  ? 420  SER B N     1 
ATOM   7231 C  CA    . SER B 1 420 ? 112.758 100.493 60.332  1.00 58.90  ? 420  SER B CA    1 
ATOM   7232 C  C     . SER B 1 420 ? 112.071 100.390 61.685  1.00 58.90  ? 420  SER B C     1 
ATOM   7233 O  O     . SER B 1 420 ? 111.369 101.316 62.102  1.00 58.90  ? 420  SER B O     1 
ATOM   7234 C  CB    . SER B 1 420 ? 111.838 100.003 59.212  1.00 30.00  ? 420  SER B CB    1 
ATOM   7235 O  OG    . SER B 1 420 ? 111.426 98.666  59.438  1.00 30.00  ? 420  SER B OG    1 
ATOM   7236 N  N     . THR B 1 421 ? 112.289 99.275  62.375  1.00 55.69  ? 421  THR B N     1 
ATOM   7237 C  CA    . THR B 1 421 ? 111.911 99.179  63.771  1.00 55.69  ? 421  THR B CA    1 
ATOM   7238 C  C     . THR B 1 421 ? 113.182 98.950  64.564  1.00 55.69  ? 421  THR B C     1 
ATOM   7239 O  O     . THR B 1 421 ? 113.507 97.830  64.950  1.00 55.69  ? 421  THR B O     1 
ATOM   7240 C  CB    . THR B 1 421 ? 110.921 98.033  64.029  1.00 55.69  ? 421  THR B CB    1 
ATOM   7241 O  OG1   . THR B 1 421 ? 111.537 96.786  63.687  1.00 55.69  ? 421  THR B OG1   1 
ATOM   7242 C  CG2   . THR B 1 421 ? 109.666 98.213  63.194  1.00 55.69  ? 421  THR B CG2   1 
ATOM   7243 N  N     . GLY B 1 422 ? 113.897 100.045 64.792  1.00 50.91  ? 422  GLY B N     1 
ATOM   7244 C  CA    . GLY B 1 422 ? 115.059 100.072 65.651  1.00 50.91  ? 422  GLY B CA    1 
ATOM   7245 C  C     . GLY B 1 422 ? 115.016 101.332 66.481  1.00 50.91  ? 422  GLY B C     1 
ATOM   7246 O  O     . GLY B 1 422 ? 115.788 101.498 67.425  1.00 50.91  ? 422  GLY B O     1 
ATOM   7247 N  N     . ILE B 1 423 ? 114.108 102.231 66.113  1.00 48.25  ? 423  ILE B N     1 
ATOM   7248 C  CA    . ILE B 1 423 ? 113.884 103.469 66.848  1.00 48.25  ? 423  ILE B CA    1 
ATOM   7249 C  C     . ILE B 1 423 ? 112.770 103.298 67.869  1.00 48.25  ? 423  ILE B C     1 
ATOM   7250 O  O     . ILE B 1 423 ? 112.861 103.805 68.986  1.00 48.25  ? 423  ILE B O     1 
ATOM   7251 C  CB    . ILE B 1 423 ? 113.582 104.604 65.849  1.00 48.25  ? 423  ILE B CB    1 
ATOM   7252 C  CG1   . ILE B 1 423 ? 114.783 104.829 64.940  1.00 48.25  ? 423  ILE B CG1   1 
ATOM   7253 C  CG2   . ILE B 1 423 ? 113.248 105.899 66.550  1.00 48.25  ? 423  ILE B CG2   1 
ATOM   7254 C  CD1   . ILE B 1 423 ? 114.501 105.760 63.809  1.00 48.25  ? 423  ILE B CD1   1 
ATOM   7255 N  N     . GLN B 1 424 ? 111.729 102.545 67.510  1.00 45.26  ? 424  GLN B N     1 
ATOM   7256 C  CA    . GLN B 1 424 ? 110.677 102.207 68.461  1.00 45.26  ? 424  GLN B CA    1 
ATOM   7257 C  C     . GLN B 1 424 ? 111.199 101.306 69.576  1.00 45.26  ? 424  GLN B C     1 
ATOM   7258 O  O     . GLN B 1 424 ? 110.683 101.343 70.699  1.00 45.26  ? 424  GLN B O     1 
ATOM   7259 C  CB    . GLN B 1 424 ? 109.514 101.552 67.715  1.00 45.26  ? 424  GLN B CB    1 
ATOM   7260 C  CG    . GLN B 1 424 ? 108.279 101.273 68.551  1.00 45.26  ? 424  GLN B CG    1 
ATOM   7261 C  CD    . GLN B 1 424 ? 107.639 102.538 69.080  1.00 45.26  ? 424  GLN B CD    1 
ATOM   7262 O  OE1   . GLN B 1 424 ? 107.551 103.545 68.378  1.00 45.26  ? 424  GLN B OE1   1 
ATOM   7263 N  NE2   . GLN B 1 424 ? 107.186 102.492 70.328  1.00 45.26  ? 424  GLN B NE2   1 
ATOM   7264 N  N     . ASN B 1 425 ? 112.232 100.510 69.298  1.00 44.18  ? 425  ASN B N     1 
ATOM   7265 C  CA    . ASN B 1 425 ? 112.893 99.768  70.364  1.00 44.18  ? 425  ASN B CA    1 
ATOM   7266 C  C     . ASN B 1 425 ? 113.735 100.691 71.235  1.00 44.18  ? 425  ASN B C     1 
ATOM   7267 O  O     . ASN B 1 425 ? 113.690 100.597 72.465  1.00 44.18  ? 425  ASN B O     1 
ATOM   7268 C  CB    . ASN B 1 425 ? 113.755 98.650  69.778  1.00 44.18  ? 425  ASN B CB    1 
ATOM   7269 C  CG    . ASN B 1 425 ? 112.937 97.599  69.054  1.00 44.18  ? 425  ASN B CG    1 
ATOM   7270 O  OD1   . ASN B 1 425 ? 113.060 97.426  67.844  1.00 44.18  ? 425  ASN B OD1   1 
ATOM   7271 N  ND2   . ASN B 1 425 ? 112.093 96.892  69.794  1.00 44.18  ? 425  ASN B ND2   1 
ATOM   7272 N  N     . ARG B 1 426 ? 114.502 101.594 70.618  1.00 44.65  ? 426  ARG B N     1 
ATOM   7273 C  CA    . ARG B 1 426 ? 115.364 102.490 71.385  1.00 44.65  ? 426  ARG B CA    1 
ATOM   7274 C  C     . ARG B 1 426 ? 114.564 103.557 72.116  1.00 44.65  ? 426  ARG B C     1 
ATOM   7275 O  O     . ARG B 1 426 ? 114.880 103.893 73.257  1.00 44.65  ? 426  ARG B O     1 
ATOM   7276 C  CB    . ARG B 1 426 ? 116.399 103.147 70.476  1.00 44.65  ? 426  ARG B CB    1 
ATOM   7277 C  CG    . ARG B 1 426 ? 117.532 102.257 70.049  1.00 44.65  ? 426  ARG B CG    1 
ATOM   7278 C  CD    . ARG B 1 426 ? 118.423 102.974 69.058  1.00 44.65  ? 426  ARG B CD    1 
ATOM   7279 N  NE    . ARG B 1 426 ? 119.555 102.155 68.648  1.00 44.65  ? 426  ARG B NE    1 
ATOM   7280 C  CZ    . ARG B 1 426 ? 119.522 101.309 67.628  1.00 44.65  ? 426  ARG B CZ    1 
ATOM   7281 N  NH1   . ARG B 1 426 ? 120.595 100.600 67.314  1.00 44.65  ? 426  ARG B NH1   1 
ATOM   7282 N  NH2   . ARG B 1 426 ? 118.409 101.164 66.923  1.00 44.65  ? 426  ARG B NH2   1 
ATOM   7283 N  N     . ALA B 1 427 ? 113.534 104.114 71.489  1.00 37.16  ? 427  ALA B N     1 
ATOM   7284 C  CA    . ALA B 1 427 ? 112.712 105.081 72.204  1.00 37.16  ? 427  ALA B CA    1 
ATOM   7285 C  C     . ALA B 1 427 ? 111.679 104.423 73.096  1.00 37.16  ? 427  ALA B C     1 
ATOM   7286 O  O     . ALA B 1 427 ? 110.924 105.129 73.765  1.00 37.16  ? 427  ALA B O     1 
ATOM   7287 C  CB    . ALA B 1 427 ? 112.008 106.021 71.231  1.00 37.16  ? 427  ALA B CB    1 
ATOM   7288 N  N     . GLY B 1 428 ? 111.612 103.102 73.109  1.00 35.92  ? 428  GLY B N     1 
ATOM   7289 C  CA    . GLY B 1 428 ? 110.732 102.400 74.010  1.00 35.92  ? 428  GLY B CA    1 
ATOM   7290 C  C     . GLY B 1 428 ? 111.500 101.834 75.179  1.00 35.92  ? 428  GLY B C     1 
ATOM   7291 O  O     . GLY B 1 428 ? 110.922 101.584 76.235  1.00 35.92  ? 428  GLY B O     1 
ATOM   7292 N  N     . VAL B 1 429 ? 112.805 101.622 75.006  1.00 33.92  ? 429  VAL B N     1 
ATOM   7293 C  CA    . VAL B 1 429 ? 113.603 101.165 76.137  1.00 33.92  ? 429  VAL B CA    1 
ATOM   7294 C  C     . VAL B 1 429 ? 113.929 102.336 77.057  1.00 33.92  ? 429  VAL B C     1 
ATOM   7295 O  O     . VAL B 1 429 ? 113.946 102.174 78.278  1.00 33.92  ? 429  VAL B O     1 
ATOM   7296 C  CB    . VAL B 1 429 ? 114.861 100.401 75.659  1.00 33.92  ? 429  VAL B CB    1 
ATOM   7297 C  CG1   . VAL B 1 429 ? 115.827 101.261 74.899  1.00 33.92  ? 429  VAL B CG1   1 
ATOM   7298 C  CG2   . VAL B 1 429 ? 115.584 99.799  76.804  1.00 33.92  ? 429  VAL B CG2   1 
ATOM   7299 N  N     . LEU B 1 430 ? 114.092 103.545 76.511  1.00 28.67  ? 430  LEU B N     1 
ATOM   7300 C  CA    . LEU B 1 430 ? 114.374 104.717 77.329  1.00 28.67  ? 430  LEU B CA    1 
ATOM   7301 C  C     . LEU B 1 430 ? 113.155 105.183 78.102  1.00 28.67  ? 430  LEU B C     1 
ATOM   7302 O  O     . LEU B 1 430 ? 113.294 105.972 79.037  1.00 28.67  ? 430  LEU B O     1 
ATOM   7303 C  CB    . LEU B 1 430 ? 114.871 105.863 76.461  1.00 28.67  ? 430  LEU B CB    1 
ATOM   7304 C  CG    . LEU B 1 430 ? 116.151 105.677 75.658  1.00 28.67  ? 430  LEU B CG    1 
ATOM   7305 C  CD1   . LEU B 1 430 ? 116.301 106.866 74.764  1.00 28.67  ? 430  LEU B CD1   1 
ATOM   7306 C  CD2   . LEU B 1 430 ? 117.356 105.522 76.530  1.00 28.67  ? 430  LEU B CD2   1 
ATOM   7307 N  N     . PHE B 1 431 ? 111.966 104.735 77.716  1.00 25.52  ? 431  PHE B N     1 
ATOM   7308 C  CA    . PHE B 1 431 ? 110.772 105.087 78.465  1.00 25.52  ? 431  PHE B CA    1 
ATOM   7309 C  C     . PHE B 1 431 ? 110.674 104.291 79.756  1.00 25.52  ? 431  PHE B C     1 
ATOM   7310 O  O     . PHE B 1 431 ? 110.229 104.821 80.775  1.00 25.52  ? 431  PHE B O     1 
ATOM   7311 C  CB    . PHE B 1 431 ? 109.535 104.865 77.606  1.00 25.52  ? 431  PHE B CB    1 
ATOM   7312 C  CG    . PHE B 1 431 ? 108.258 105.230 78.286  1.00 25.52  ? 431  PHE B CG    1 
ATOM   7313 C  CD1   . PHE B 1 431 ? 107.905 106.556 78.455  1.00 25.52  ? 431  PHE B CD1   1 
ATOM   7314 C  CD2   . PHE B 1 431 ? 107.403 104.246 78.749  1.00 25.52  ? 431  PHE B CD2   1 
ATOM   7315 C  CE1   . PHE B 1 431 ? 106.728 106.890 79.077  1.00 25.52  ? 431  PHE B CE1   1 
ATOM   7316 C  CE2   . PHE B 1 431 ? 106.229 104.573 79.369  1.00 25.52  ? 431  PHE B CE2   1 
ATOM   7317 C  CZ    . PHE B 1 431 ? 105.889 105.895 79.533  1.00 25.52  ? 431  PHE B CZ    1 
ATOM   7318 N  N     . PHE B 1 432 ? 111.078 103.024 79.740  1.00 24.74  ? 432  PHE B N     1 
ATOM   7319 C  CA    . PHE B 1 432 ? 111.041 102.239 80.963  1.00 24.74  ? 432  PHE B CA    1 
ATOM   7320 C  C     . PHE B 1 432 ? 112.245 102.486 81.853  1.00 24.74  ? 432  PHE B C     1 
ATOM   7321 O  O     . PHE B 1 432 ? 112.227 102.073 83.014  1.00 24.74  ? 432  PHE B O     1 
ATOM   7322 C  CB    . PHE B 1 432 ? 110.942 100.749 80.652  1.00 24.74  ? 432  PHE B CB    1 
ATOM   7323 C  CG    . PHE B 1 432 ? 109.684 100.364 79.944  1.00 24.74  ? 432  PHE B CG    1 
ATOM   7324 C  CD1   . PHE B 1 432 ? 108.469 100.412 80.595  1.00 24.74  ? 432  PHE B CD1   1 
ATOM   7325 C  CD2   . PHE B 1 432 ? 109.723 99.900  78.647  1.00 24.74  ? 432  PHE B CD2   1 
ATOM   7326 C  CE1   . PHE B 1 432 ? 107.311 100.054 79.943  1.00 24.74  ? 432  PHE B CE1   1 
ATOM   7327 C  CE2   . PHE B 1 432 ? 108.569 99.533  77.996  1.00 24.74  ? 432  PHE B CE2   1 
ATOM   7328 C  CZ    . PHE B 1 432 ? 107.365 99.609  78.643  1.00 24.74  ? 432  PHE B CZ    1 
ATOM   7329 N  N     . LEU B 1 433 ? 113.290 103.129 81.337  1.00 23.76  ? 433  LEU B N     1 
ATOM   7330 C  CA    . LEU B 1 433 ? 114.385 103.551 82.194  1.00 23.76  ? 433  LEU B CA    1 
ATOM   7331 C  C     . LEU B 1 433 ? 113.990 104.754 83.031  1.00 23.76  ? 433  LEU B C     1 
ATOM   7332 O  O     . LEU B 1 433 ? 114.433 104.881 84.174  1.00 23.76  ? 433  LEU B O     1 
ATOM   7333 C  CB    . LEU B 1 433 ? 115.612 103.892 81.358  1.00 23.76  ? 433  LEU B CB    1 
ATOM   7334 C  CG    . LEU B 1 433 ? 116.247 102.813 80.491  1.00 23.76  ? 433  LEU B CG    1 
ATOM   7335 C  CD1   . LEU B 1 433 ? 117.309 103.432 79.643  1.00 23.76  ? 433  LEU B CD1   1 
ATOM   7336 C  CD2   . LEU B 1 433 ? 116.821 101.682 81.279  1.00 23.76  ? 433  LEU B CD2   1 
ATOM   7337 N  N     . THR B 1 434 ? 113.168 105.649 82.479  1.00 22.16  ? 434  THR B N     1 
ATOM   7338 C  CA    . THR B 1 434 ? 112.731 106.822 83.226  1.00 22.16  ? 434  THR B CA    1 
ATOM   7339 C  C     . THR B 1 434 ? 111.574 106.498 84.154  1.00 22.16  ? 434  THR B C     1 
ATOM   7340 O  O     . THR B 1 434 ? 111.544 106.975 85.290  1.00 22.16  ? 434  THR B O     1 
ATOM   7341 C  CB    . THR B 1 434 ? 112.324 107.947 82.282  1.00 22.16  ? 434  THR B CB    1 
ATOM   7342 O  OG1   . THR B 1 434 ? 111.245 107.507 81.457  1.00 22.16  ? 434  THR B OG1   1 
ATOM   7343 C  CG2   . THR B 1 434 ? 113.466 108.336 81.417  1.00 22.16  ? 434  THR B CG2   1 
ATOM   7344 N  N     . THR B 1 435 ? 110.613 105.698 83.701  1.00 21.58  ? 435  THR B N     1 
ATOM   7345 C  CA    . THR B 1 435 ? 109.521 105.330 84.587  1.00 21.58  ? 435  THR B CA    1 
ATOM   7346 C  C     . THR B 1 435 ? 109.929 104.296 85.623  1.00 21.58  ? 435  THR B C     1 
ATOM   7347 O  O     . THR B 1 435 ? 109.169 104.054 86.557  1.00 21.58  ? 435  THR B O     1 
ATOM   7348 C  CB    . THR B 1 435 ? 108.315 104.825 83.794  1.00 21.58  ? 435  THR B CB    1 
ATOM   7349 O  OG1   . THR B 1 435 ? 108.665 103.649 83.064  1.00 21.58  ? 435  THR B OG1   1 
ATOM   7350 C  CG2   . THR B 1 435 ? 107.857 105.882 82.830  1.00 21.58  ? 435  THR B CG2   1 
ATOM   7351 N  N     . ASN B 1 436 ? 111.101 103.682 85.504  1.00 22.74  ? 436  ASN B N     1 
ATOM   7352 C  CA    . ASN B 1 436 ? 111.642 102.987 86.661  1.00 22.74  ? 436  ASN B CA    1 
ATOM   7353 C  C     . ASN B 1 436 ? 112.044 103.987 87.727  1.00 22.74  ? 436  ASN B C     1 
ATOM   7354 O  O     . ASN B 1 436 ? 111.632 103.875 88.882  1.00 22.74  ? 436  ASN B O     1 
ATOM   7355 C  CB    . ASN B 1 436 ? 112.846 102.136 86.281  1.00 22.74  ? 436  ASN B CB    1 
ATOM   7356 C  CG    . ASN B 1 436 ? 113.274 101.214 87.404  1.00 22.74  ? 436  ASN B CG    1 
ATOM   7357 O  OD1   . ASN B 1 436 ? 112.581 101.074 88.406  1.00 22.74  ? 436  ASN B OD1   1 
ATOM   7358 N  ND2   . ASN B 1 436 ? 114.439 100.608 87.259  1.00 22.74  ? 436  ASN B ND2   1 
ATOM   7359 N  N     . GLN B 1 437 ? 112.845 104.980 87.346  1.00 21.47  ? 437  GLN B N     1 
ATOM   7360 C  CA    . GLN B 1 437 ? 113.439 105.891 88.313  1.00 21.47  ? 437  GLN B CA    1 
ATOM   7361 C  C     . GLN B 1 437 ? 112.406 106.827 88.917  1.00 21.47  ? 437  GLN B C     1 
ATOM   7362 O  O     . GLN B 1 437 ? 112.581 107.290 90.045  1.00 21.47  ? 437  GLN B O     1 
ATOM   7363 C  CB    . GLN B 1 437 ? 114.550 106.682 87.638  1.00 21.47  ? 437  GLN B CB    1 
ATOM   7364 C  CG    . GLN B 1 437 ? 115.659 105.831 87.076  1.00 21.47  ? 437  GLN B CG    1 
ATOM   7365 C  CD    . GLN B 1 437 ? 116.409 105.079 88.141  1.00 21.47  ? 437  GLN B CD    1 
ATOM   7366 O  OE1   . GLN B 1 437 ? 116.281 103.865 88.270  1.00 21.47  ? 437  GLN B OE1   1 
ATOM   7367 N  NE2   . GLN B 1 437 ? 117.209 105.796 88.909  1.00 21.47  ? 437  GLN B NE2   1 
ATOM   7368 N  N     . CYS B 1 438 ? 111.326 107.110 88.195  1.00 20.09  ? 438  CYS B N     1 
ATOM   7369 C  CA    . CYS B 1 438 ? 110.244 107.904 88.762  1.00 20.09  ? 438  CYS B CA    1 
ATOM   7370 C  C     . CYS B 1 438 ? 109.423 107.087 89.751  1.00 20.09  ? 438  CYS B C     1 
ATOM   7371 O  O     . CYS B 1 438 ? 109.313 107.446 90.926  1.00 20.09  ? 438  CYS B O     1 
ATOM   7372 C  CB    . CYS B 1 438 ? 109.365 108.453 87.640  1.00 20.09  ? 438  CYS B CB    1 
ATOM   7373 S  SG    . CYS B 1 438 ? 110.198 109.682 86.612  1.00 20.09  ? 438  CYS B SG    1 
ATOM   7374 N  N     . PHE B 1 439 ? 108.855 105.968 89.297  1.00 20.23  ? 439  PHE B N     1 
ATOM   7375 C  CA    . PHE B 1 439 ? 107.964 105.174 90.137  1.00 20.23  ? 439  PHE B CA    1 
ATOM   7376 C  C     . PHE B 1 439 ? 108.672 104.485 91.297  1.00 20.23  ? 439  PHE B C     1 
ATOM   7377 O  O     . PHE B 1 439 ? 108.006 104.126 92.270  1.00 20.23  ? 439  PHE B O     1 
ATOM   7378 C  CB    . PHE B 1 439 ? 107.225 104.129 89.299  1.00 20.23  ? 439  PHE B CB    1 
ATOM   7379 C  CG    . PHE B 1 439 ? 106.108 104.692 88.470  1.00 20.23  ? 439  PHE B CG    1 
ATOM   7380 C  CD1   . PHE B 1 439 ? 104.891 104.978 89.049  1.00 20.23  ? 439  PHE B CD1   1 
ATOM   7381 C  CD2   . PHE B 1 439 ? 106.270 104.938 87.119  1.00 20.23  ? 439  PHE B CD2   1 
ATOM   7382 C  CE1   . PHE B 1 439 ? 103.859 105.479 88.290  1.00 20.23  ? 439  PHE B CE1   1 
ATOM   7383 C  CE2   . PHE B 1 439 ? 105.251 105.455 86.361  1.00 20.23  ? 439  PHE B CE2   1 
ATOM   7384 C  CZ    . PHE B 1 439 ? 104.047 105.730 86.944  1.00 20.23  ? 439  PHE B CZ    1 
ATOM   7385 N  N     . SER B 1 440 ? 109.990 104.294 91.238  1.00 19.79  ? 440  SER B N     1 
ATOM   7386 C  CA    . SER B 1 440 ? 110.700 103.732 92.381  1.00 19.79  ? 440  SER B CA    1 
ATOM   7387 C  C     . SER B 1 440 ? 110.902 104.732 93.507  1.00 19.79  ? 440  SER B C     1 
ATOM   7388 O  O     . SER B 1 440 ? 111.328 104.335 94.597  1.00 19.79  ? 440  SER B O     1 
ATOM   7389 C  CB    . SER B 1 440 ? 112.064 103.189 91.965  1.00 19.79  ? 440  SER B CB    1 
ATOM   7390 O  OG    . SER B 1 440 ? 112.773 102.698 93.082  1.00 19.79  ? 440  SER B OG    1 
ATOM   7391 N  N     . SER B 1 441 ? 110.611 106.005 93.276  1.00 17.51  ? 441  SER B N     1 
ATOM   7392 C  CA    . SER B 1 441 ? 110.798 107.051 94.263  1.00 17.51  ? 441  SER B CA    1 
ATOM   7393 C  C     . SER B 1 441 ? 109.589 107.240 95.164  1.00 17.51  ? 441  SER B C     1 
ATOM   7394 O  O     . SER B 1 441 ? 109.561 108.187 95.950  1.00 17.51  ? 441  SER B O     1 
ATOM   7395 C  CB    . SER B 1 441 ? 111.141 108.360 93.563  1.00 17.51  ? 441  SER B CB    1 
ATOM   7396 O  OG    . SER B 1 441 ? 112.362 108.246 92.860  1.00 17.51  ? 441  SER B OG    1 
ATOM   7397 N  N     . VAL B 1 442 ? 108.592 106.359 95.076  1.00 17.75  ? 442  VAL B N     1 
ATOM   7398 C  CA    . VAL B 1 442 ? 107.472 106.402 96.003  1.00 17.75  ? 442  VAL B CA    1 
ATOM   7399 C  C     . VAL B 1 442 ? 107.896 105.883 97.376  1.00 17.75  ? 442  VAL B C     1 
ATOM   7400 O  O     . VAL B 1 442 ? 107.289 106.229 98.390  1.00 17.75  ? 442  VAL B O     1 
ATOM   7401 C  CB    . VAL B 1 442 ? 106.295 105.623 95.372  1.00 17.75  ? 442  VAL B CB    1 
ATOM   7402 C  CG1   . VAL B 1 442 ? 105.040 105.657 96.222  1.00 17.75  ? 442  VAL B CG1   1 
ATOM   7403 C  CG2   . VAL B 1 442 ? 105.988 106.177 93.995  1.00 17.75  ? 442  VAL B CG2   1 
ATOM   7404 N  N     . SER B 1 443 ? 108.980 105.112 97.449  1.00 17.47  ? 443  SER B N     1 
ATOM   7405 C  CA    . SER B 1 443 ? 109.506 104.654 98.729  1.00 17.47  ? 443  SER B CA    1 
ATOM   7406 C  C     . SER B 1 443 ? 110.145 105.765 99.559  1.00 17.47  ? 443  SER B C     1 
ATOM   7407 O  O     . SER B 1 443 ? 110.470 105.527 100.726 1.00 17.47  ? 443  SER B O     1 
ATOM   7408 C  CB    . SER B 1 443 ? 110.530 103.549 98.492  1.00 17.47  ? 443  SER B CB    1 
ATOM   7409 O  OG    . SER B 1 443 ? 111.682 104.063 97.847  1.00 17.47  ? 443  SER B OG    1 
ATOM   7410 N  N     . ALA B 1 444 ? 110.355 106.955 98.994  1.00 16.21  ? 444  ALA B N     1 
ATOM   7411 C  CA    . ALA B 1 444 ? 110.855 108.093 99.752  1.00 16.21  ? 444  ALA B CA    1 
ATOM   7412 C  C     . ALA B 1 444 ? 109.757 108.836 100.489 1.00 16.21  ? 444  ALA B C     1 
ATOM   7413 O  O     . ALA B 1 444 ? 110.050 109.823 101.165 1.00 16.21  ? 444  ALA B O     1 
ATOM   7414 C  CB    . ALA B 1 444 ? 111.589 109.066 98.834  1.00 16.21  ? 444  ALA B CB    1 
ATOM   7415 N  N     . VAL B 1 445 ? 108.510 108.395 100.357 1.00 15.38  ? 445  VAL B N     1 
ATOM   7416 C  CA    . VAL B 1 445 ? 107.405 108.965 101.118 1.00 15.38  ? 445  VAL B CA    1 
ATOM   7417 C  C     . VAL B 1 445 ? 107.574 108.669 102.605 1.00 15.38  ? 445  VAL B C     1 
ATOM   7418 O  O     . VAL B 1 445 ? 107.299 109.520 103.458 1.00 15.38  ? 445  VAL B O     1 
ATOM   7419 C  CB    . VAL B 1 445 ? 106.081 108.430 100.536 1.00 15.38  ? 445  VAL B CB    1 
ATOM   7420 C  CG1   . VAL B 1 445 ? 104.919 108.725 101.402 1.00 15.38  ? 445  VAL B CG1   1 
ATOM   7421 C  CG2   . VAL B 1 445 ? 105.834 109.060 99.182  1.00 15.38  ? 445  VAL B CG2   1 
ATOM   7422 N  N     . GLU B 1 446 ? 108.118 107.502 102.933 1.00 16.40  ? 446  GLU B N     1 
ATOM   7423 C  CA    . GLU B 1 446 ? 108.275 107.043 104.306 1.00 16.40  ? 446  GLU B CA    1 
ATOM   7424 C  C     . GLU B 1 446 ? 109.519 107.582 105.006 1.00 16.40  ? 446  GLU B C     1 
ATOM   7425 O  O     . GLU B 1 446 ? 109.837 107.104 106.095 1.00 16.40  ? 446  GLU B O     1 
ATOM   7426 C  CB    . GLU B 1 446 ? 108.315 105.519 104.341 1.00 16.40  ? 446  GLU B CB    1 
ATOM   7427 C  CG    . GLU B 1 446 ? 107.019 104.865 103.951 1.00 16.40  ? 446  GLU B CG    1 
ATOM   7428 C  CD    . GLU B 1 446 ? 106.895 104.583 102.465 1.00 16.40  ? 446  GLU B CD    1 
ATOM   7429 O  OE1   . GLU B 1 446 ? 107.882 104.776 101.735 1.00 16.40  ? 446  GLU B OE1   1 
ATOM   7430 O  OE2   . GLU B 1 446 ? 105.802 104.175 102.023 1.00 16.40  ? 446  GLU B OE2   1 
ATOM   7431 N  N     . LEU B 1 447 ? 110.226 108.555 104.433 1.00 12.44  ? 447  LEU B N     1 
ATOM   7432 C  CA    . LEU B 1 447 ? 111.466 109.017 105.048 1.00 12.44  ? 447  LEU B CA    1 
ATOM   7433 C  C     . LEU B 1 447 ? 111.194 109.854 106.288 1.00 12.44  ? 447  LEU B C     1 
ATOM   7434 O  O     . LEU B 1 447 ? 111.859 109.689 107.315 1.00 12.44  ? 447  LEU B O     1 
ATOM   7435 C  CB    . LEU B 1 447 ? 112.283 109.818 104.036 1.00 12.44  ? 447  LEU B CB    1 
ATOM   7436 C  CG    . LEU B 1 447 ? 113.650 110.299 104.516 1.00 12.44  ? 447  LEU B CG    1 
ATOM   7437 C  CD1   . LEU B 1 447 ? 114.550 109.119 104.774 1.00 12.44  ? 447  LEU B CD1   1 
ATOM   7438 C  CD2   . LEU B 1 447 ? 114.282 111.248 103.530 1.00 12.44  ? 447  LEU B CD2   1 
ATOM   7439 N  N     . PHE B 1 448 ? 110.210 110.742 106.215 1.00 10.10  ? 448  PHE B N     1 
ATOM   7440 C  CA    . PHE B 1 448 ? 109.889 111.687 107.272 1.00 10.10  ? 448  PHE B CA    1 
ATOM   7441 C  C     . PHE B 1 448 ? 108.647 111.298 108.060 1.00 10.10  ? 448  PHE B C     1 
ATOM   7442 O  O     . PHE B 1 448 ? 108.292 111.997 109.010 1.00 10.10  ? 448  PHE B O     1 
ATOM   7443 C  CB    . PHE B 1 448 ? 109.702 113.076 106.661 1.00 10.10  ? 448  PHE B CB    1 
ATOM   7444 C  CG    . PHE B 1 448 ? 110.969 113.693 106.159 1.00 10.10  ? 448  PHE B CG    1 
ATOM   7445 C  CD1   . PHE B 1 448 ? 112.183 113.367 106.722 1.00 10.10  ? 448  PHE B CD1   1 
ATOM   7446 C  CD2   . PHE B 1 448 ? 110.952 114.557 105.080 1.00 10.10  ? 448  PHE B CD2   1 
ATOM   7447 C  CE1   . PHE B 1 448 ? 113.345 113.923 106.256 1.00 10.10  ? 448  PHE B CE1   1 
ATOM   7448 C  CE2   . PHE B 1 448 ? 112.118 115.107 104.606 1.00 10.10  ? 448  PHE B CE2   1 
ATOM   7449 C  CZ    . PHE B 1 448 ? 113.316 114.782 105.196 1.00 10.10  ? 448  PHE B CZ    1 
ATOM   7450 N  N     . VAL B 1 449 ? 107.984 110.208 107.689 1.00 12.01  ? 449  VAL B N     1 
ATOM   7451 C  CA    . VAL B 1 449 ? 106.729 109.799 108.302 1.00 12.01  ? 449  VAL B CA    1 
ATOM   7452 C  C     . VAL B 1 449 ? 106.951 108.766 109.396 1.00 12.01  ? 449  VAL B C     1 
ATOM   7453 O  O     . VAL B 1 449 ? 106.339 108.848 110.462 1.00 12.01  ? 449  VAL B O     1 
ATOM   7454 C  CB    . VAL B 1 449 ? 105.773 109.256 107.219 1.00 12.01  ? 449  VAL B CB    1 
ATOM   7455 C  CG1   . VAL B 1 449 ? 104.480 108.766 107.840 1.00 12.01  ? 449  VAL B CG1   1 
ATOM   7456 C  CG2   . VAL B 1 449 ? 105.502 110.303 106.164 1.00 12.01  ? 449  VAL B CG2   1 
ATOM   7457 N  N     . VAL B 1 450 ? 107.831 107.796 109.136 1.00 12.11  ? 450  VAL B N     1 
ATOM   7458 C  CA    . VAL B 1 450 ? 108.113 106.709 110.070 1.00 12.11  ? 450  VAL B CA    1 
ATOM   7459 C  C     . VAL B 1 450 ? 108.716 107.236 111.368 1.00 12.11  ? 450  VAL B C     1 
ATOM   7460 O  O     . VAL B 1 450 ? 108.408 106.732 112.455 1.00 12.11  ? 450  VAL B O     1 
ATOM   7461 C  CB    . VAL B 1 450 ? 109.020 105.678 109.365 1.00 12.11  ? 450  VAL B CB    1 
ATOM   7462 C  CG1   . VAL B 1 450 ? 109.465 104.578 110.293 1.00 12.11  ? 450  VAL B CG1   1 
ATOM   7463 C  CG2   . VAL B 1 450 ? 108.283 105.076 108.197 1.00 12.11  ? 450  VAL B CG2   1 
ATOM   7464 N  N     . GLU B 1 451 ? 109.518 108.292 111.293 1.00 12.07  ? 451  GLU B N     1 
ATOM   7465 C  CA    . GLU B 1 451 ? 110.105 108.905 112.478 1.00 12.07  ? 451  GLU B CA    1 
ATOM   7466 C  C     . GLU B 1 451 ? 109.583 110.317 112.710 1.00 12.07  ? 451  GLU B C     1 
ATOM   7467 O  O     . GLU B 1 451 ? 110.345 111.230 113.021 1.00 12.07  ? 451  GLU B O     1 
ATOM   7468 C  CB    . GLU B 1 451 ? 111.626 108.909 112.388 1.00 12.07  ? 451  GLU B CB    1 
ATOM   7469 C  CG    . GLU B 1 451 ? 112.237 107.519 112.362 1.00 12.07  ? 451  GLU B CG    1 
ATOM   7470 C  CD    . GLU B 1 451 ? 111.987 106.734 113.632 1.00 12.07  ? 451  GLU B CD    1 
ATOM   7471 O  OE1   . GLU B 1 451 ? 111.933 107.338 114.720 1.00 12.07  ? 451  GLU B OE1   1 
ATOM   7472 O  OE2   . GLU B 1 451 ? 111.840 105.502 113.540 1.00 12.07  ? 451  GLU B OE2   1 
ATOM   7473 N  N     . LYS B 1 452 ? 108.273 110.512 112.556 1.00 9.89   ? 452  LYS B N     1 
ATOM   7474 C  CA    . LYS B 1 452 ? 107.690 111.821 112.817 1.00 9.89   ? 452  LYS B CA    1 
ATOM   7475 C  C     . LYS B 1 452 ? 107.636 112.110 114.309 1.00 9.89   ? 452  LYS B C     1 
ATOM   7476 O  O     . LYS B 1 452 ? 107.916 113.233 114.736 1.00 9.89   ? 452  LYS B O     1 
ATOM   7477 C  CB    . LYS B 1 452 ? 106.293 111.911 112.213 1.00 9.89   ? 452  LYS B CB    1 
ATOM   7478 C  CG    . LYS B 1 452 ? 105.638 113.262 112.396 1.00 9.89   ? 452  LYS B CG    1 
ATOM   7479 C  CD    . LYS B 1 452 ? 104.222 113.267 111.896 1.00 9.89   ? 452  LYS B CD    1 
ATOM   7480 C  CE    . LYS B 1 452 ? 103.540 114.566 112.233 1.00 9.89   ? 452  LYS B CE    1 
ATOM   7481 N  NZ    . LYS B 1 452 ? 102.116 114.550 111.828 1.00 9.89   ? 452  LYS B NZ    1 
ATOM   7482 N  N     . LYS B 1 453 ? 107.283 111.105 115.112 1.00 10.29  ? 453  LYS B N     1 
ATOM   7483 C  CA    . LYS B 1 453 ? 107.152 111.294 116.551 1.00 10.29  ? 453  LYS B CA    1 
ATOM   7484 C  C     . LYS B 1 453 ? 108.502 111.563 117.202 1.00 10.29  ? 453  LYS B C     1 
ATOM   7485 O  O     . LYS B 1 453 ? 108.599 112.370 118.130 1.00 10.29  ? 453  LYS B O     1 
ATOM   7486 C  CB    . LYS B 1 453 ? 106.474 110.068 117.164 1.00 10.29  ? 453  LYS B CB    1 
ATOM   7487 C  CG    . LYS B 1 453 ? 106.280 110.117 118.663 1.00 10.29  ? 453  LYS B CG    1 
ATOM   7488 C  CD    . LYS B 1 453 ? 105.315 111.211 119.040 1.00 10.29  ? 453  LYS B CD    1 
ATOM   7489 C  CE    . LYS B 1 453 ? 105.079 111.252 120.529 1.00 10.29  ? 453  LYS B CE    1 
ATOM   7490 N  NZ    . LYS B 1 453 ? 104.181 112.371 120.910 1.00 10.29  ? 453  LYS B NZ    1 
ATOM   7491 N  N     . LEU B 1 454 ? 109.559 110.931 116.710 1.00 9.16   ? 454  LEU B N     1 
ATOM   7492 C  CA    . LEU B 1 454 ? 110.880 111.194 117.253 1.00 9.16   ? 454  LEU B CA    1 
ATOM   7493 C  C     . LEU B 1 454 ? 111.491 112.476 116.704 1.00 9.16   ? 454  LEU B C     1 
ATOM   7494 O  O     . LEU B 1 454 ? 112.342 113.069 117.367 1.00 9.16   ? 454  LEU B O     1 
ATOM   7495 C  CB    . LEU B 1 454 ? 111.791 110.000 116.982 1.00 9.16   ? 454  LEU B CB    1 
ATOM   7496 C  CG    . LEU B 1 454 ? 113.152 109.929 117.662 1.00 9.16   ? 454  LEU B CG    1 
ATOM   7497 C  CD1   . LEU B 1 454 ? 113.030 109.986 119.172 1.00 9.16   ? 454  LEU B CD1   1 
ATOM   7498 C  CD2   . LEU B 1 454 ? 113.790 108.655 117.252 1.00 9.16   ? 454  LEU B CD2   1 
ATOM   7499 N  N     . PHE B 1 455 ? 111.069 112.932 115.522 1.00 7.70   ? 455  PHE B N     1 
ATOM   7500 C  CA    . PHE B 1 455 ? 111.464 114.260 115.071 1.00 7.70   ? 455  PHE B CA    1 
ATOM   7501 C  C     . PHE B 1 455 ? 110.816 115.346 115.913 1.00 7.70   ? 455  PHE B C     1 
ATOM   7502 O  O     . PHE B 1 455 ? 111.476 116.326 116.270 1.00 7.70   ? 455  PHE B O     1 
ATOM   7503 C  CB    . PHE B 1 455 ? 111.139 114.467 113.590 1.00 7.70   ? 455  PHE B CB    1 
ATOM   7504 C  CG    . PHE B 1 455 ? 111.200 115.914 113.161 1.00 7.70   ? 455  PHE B CG    1 
ATOM   7505 C  CD1   . PHE B 1 455 ? 112.374 116.620 113.190 1.00 7.70   ? 455  PHE B CD1   1 
ATOM   7506 C  CD2   . PHE B 1 455 ? 110.064 116.555 112.718 1.00 7.70   ? 455  PHE B CD2   1 
ATOM   7507 C  CE1   . PHE B 1 455 ? 112.420 117.945 112.820 1.00 7.70   ? 455  PHE B CE1   1 
ATOM   7508 C  CE2   . PHE B 1 455 ? 110.113 117.862 112.337 1.00 7.70   ? 455  PHE B CE2   1 
ATOM   7509 C  CZ    . PHE B 1 455 ? 111.292 118.560 112.388 1.00 7.70   ? 455  PHE B CZ    1 
ATOM   7510 N  N     . ILE B 1 456 ? 109.527 115.208 116.217 1.00 9.33   ? 456  ILE B N     1 
ATOM   7511 C  CA    . ILE B 1 456 ? 108.837 116.233 116.993 1.00 9.33   ? 456  ILE B CA    1 
ATOM   7512 C  C     . ILE B 1 456 ? 109.375 116.278 118.418 1.00 9.33   ? 456  ILE B C     1 
ATOM   7513 O  O     . ILE B 1 456 ? 109.579 117.359 118.975 1.00 9.33   ? 456  ILE B O     1 
ATOM   7514 C  CB    . ILE B 1 456 ? 107.317 115.991 116.944 1.00 9.33   ? 456  ILE B CB    1 
ATOM   7515 C  CG1   . ILE B 1 456 ? 106.791 116.208 115.529 1.00 9.33   ? 456  ILE B CG1   1 
ATOM   7516 C  CG2   . ILE B 1 456 ? 106.575 116.896 117.902 1.00 9.33   ? 456  ILE B CG2   1 
ATOM   7517 C  CD1   . ILE B 1 456 ? 105.375 115.755 115.350 1.00 9.33   ? 456  ILE B CD1   1 
ATOM   7518 N  N     . HIS B 1 457 ? 109.693 115.114 118.992 1.00 9.10   ? 457  HIS B N     1 
ATOM   7519 C  CA    . HIS B 1 457 ? 110.232 115.042 120.349 1.00 9.10   ? 457  HIS B CA    1 
ATOM   7520 C  C     . HIS B 1 457 ? 111.629 115.639 120.440 1.00 9.10   ? 457  HIS B C     1 
ATOM   7521 O  O     . HIS B 1 457 ? 111.907 116.455 121.322 1.00 9.10   ? 457  HIS B O     1 
ATOM   7522 C  CB    . HIS B 1 457 ? 110.248 113.590 120.817 1.00 9.10   ? 457  HIS B CB    1 
ATOM   7523 C  CG    . HIS B 1 457 ? 110.797 113.402 122.196 1.00 9.10   ? 457  HIS B CG    1 
ATOM   7524 N  ND1   . HIS B 1 457 ? 112.134 113.185 122.440 1.00 9.10   ? 457  HIS B ND1   1 
ATOM   7525 C  CD2   . HIS B 1 457 ? 110.190 113.397 123.404 1.00 9.10   ? 457  HIS B CD2   1 
ATOM   7526 C  CE1   . HIS B 1 457 ? 112.329 113.058 123.738 1.00 9.10   ? 457  HIS B CE1   1 
ATOM   7527 N  NE2   . HIS B 1 457 ? 111.164 113.182 124.346 1.00 9.10   ? 457  HIS B NE2   1 
ATOM   7528 N  N     . GLU B 1 458 ? 112.524 115.241 119.542 1.00 8.38   ? 458  GLU B N     1 
ATOM   7529 C  CA    . GLU B 1 458 ? 113.905 115.694 119.589 1.00 8.38   ? 458  GLU B CA    1 
ATOM   7530 C  C     . GLU B 1 458 ? 114.098 117.115 119.093 1.00 8.38   ? 458  GLU B C     1 
ATOM   7531 O  O     . GLU B 1 458 ? 115.174 117.679 119.304 1.00 8.38   ? 458  GLU B O     1 
ATOM   7532 C  CB    . GLU B 1 458 ? 114.785 114.759 118.775 1.00 8.38   ? 458  GLU B CB    1 
ATOM   7533 C  CG    . GLU B 1 458 ? 115.015 113.430 119.414 1.00 8.38   ? 458  GLU B CG    1 
ATOM   7534 C  CD    . GLU B 1 458 ? 115.781 112.507 118.516 1.00 8.38   ? 458  GLU B CD    1 
ATOM   7535 O  OE1   . GLU B 1 458 ? 115.911 112.823 117.319 1.00 8.38   ? 458  GLU B OE1   1 
ATOM   7536 O  OE2   . GLU B 1 458 ? 116.273 111.475 119.006 1.00 8.38   ? 458  GLU B OE2   1 
ATOM   7537 N  N     . TYR B 1 459 ? 113.108 117.706 118.434 1.00 8.90   ? 459  TYR B N     1 
ATOM   7538 C  CA    . TYR B 1 459 ? 113.252 119.100 118.049 1.00 8.90   ? 459  TYR B CA    1 
ATOM   7539 C  C     . TYR B 1 459 ? 112.872 120.033 119.187 1.00 8.90   ? 459  TYR B C     1 
ATOM   7540 O  O     . TYR B 1 459 ? 113.571 121.019 119.443 1.00 8.90   ? 459  TYR B O     1 
ATOM   7541 C  CB    . TYR B 1 459 ? 112.415 119.404 116.815 1.00 8.90   ? 459  TYR B CB    1 
ATOM   7542 C  CG    . TYR B 1 459 ? 112.530 120.835 116.399 1.00 8.90   ? 459  TYR B CG    1 
ATOM   7543 C  CD1   . TYR B 1 459 ? 113.717 121.326 115.885 1.00 8.90   ? 459  TYR B CD1   1 
ATOM   7544 C  CD2   . TYR B 1 459 ? 111.456 121.702 116.521 1.00 8.90   ? 459  TYR B CD2   1 
ATOM   7545 C  CE1   . TYR B 1 459 ? 113.836 122.638 115.523 1.00 8.90   ? 459  TYR B CE1   1 
ATOM   7546 C  CE2   . TYR B 1 459 ? 111.565 123.015 116.151 1.00 8.90   ? 459  TYR B CE2   1 
ATOM   7547 C  CZ    . TYR B 1 459 ? 112.753 123.473 115.646 1.00 8.90   ? 459  TYR B CZ    1 
ATOM   7548 O  OH    . TYR B 1 459 ? 112.865 124.783 115.269 1.00 8.90   ? 459  TYR B OH    1 
ATOM   7549 N  N     . ILE B 1 460 ? 111.779 119.734 119.888 1.00 9.09   ? 460  ILE B N     1 
ATOM   7550 C  CA    . ILE B 1 460 ? 111.369 120.558 121.011 1.00 9.09   ? 460  ILE B CA    1 
ATOM   7551 C  C     . ILE B 1 460 ? 112.248 120.316 122.226 1.00 9.09   ? 460  ILE B C     1 
ATOM   7552 O  O     . ILE B 1 460 ? 112.249 121.129 123.154 1.00 9.09   ? 460  ILE B O     1 
ATOM   7553 C  CB    . ILE B 1 460 ? 109.886 120.312 121.327 1.00 9.09   ? 460  ILE B CB    1 
ATOM   7554 C  CG1   . ILE B 1 460 ? 109.662 118.881 121.797 1.00 9.09   ? 460  ILE B CG1   1 
ATOM   7555 C  CG2   . ILE B 1 460 ? 109.061 120.555 120.107 1.00 9.09   ? 460  ILE B CG2   1 
ATOM   7556 C  CD1   . ILE B 1 460 ? 108.247 118.586 122.218 1.00 9.09   ? 460  ILE B CD1   1 
ATOM   7557 N  N     . SER B 1 461 ? 112.995 119.215 122.250 1.00 9.01   ? 461  SER B N     1 
ATOM   7558 C  CA    . SER B 1 461 ? 114.022 118.996 123.254 1.00 9.01   ? 461  SER B CA    1 
ATOM   7559 C  C     . SER B 1 461 ? 115.333 119.676 122.902 1.00 9.01   ? 461  SER B C     1 
ATOM   7560 O  O     . SER B 1 461 ? 116.238 119.705 123.735 1.00 9.01   ? 461  SER B O     1 
ATOM   7561 C  CB    . SER B 1 461 ? 114.254 117.503 123.442 1.00 9.01   ? 461  SER B CB    1 
ATOM   7562 O  OG    . SER B 1 461 ? 113.087 116.879 123.928 1.00 9.01   ? 461  SER B OG    1 
ATOM   7563 N  N     . GLY B 1 462 ? 115.458 120.199 121.690 1.00 9.38   ? 462  GLY B N     1 
ATOM   7564 C  CA    . GLY B 1 462 ? 116.602 120.997 121.311 1.00 9.38   ? 462  GLY B CA    1 
ATOM   7565 C  C     . GLY B 1 462 ? 117.829 120.225 120.897 1.00 9.38   ? 462  GLY B C     1 
ATOM   7566 O  O     . GLY B 1 462 ? 118.942 120.617 121.256 1.00 9.38   ? 462  GLY B O     1 
ATOM   7567 N  N     . TYR B 1 463 ? 117.671 119.131 120.149 1.00 8.94   ? 463  TYR B N     1 
ATOM   7568 C  CA    . TYR B 1 463 ? 118.875 118.451 119.689 1.00 8.94   ? 463  TYR B CA    1 
ATOM   7569 C  C     . TYR B 1 463 ? 119.455 119.160 118.482 1.00 8.94   ? 463  TYR B C     1 
ATOM   7570 O  O     . TYR B 1 463 ? 120.648 119.471 118.441 1.00 8.94   ? 463  TYR B O     1 
ATOM   7571 C  CB    . TYR B 1 463 ? 118.653 116.988 119.294 1.00 8.94   ? 463  TYR B CB    1 
ATOM   7572 C  CG    . TYR B 1 463 ? 118.259 115.956 120.321 1.00 8.94   ? 463  TYR B CG    1 
ATOM   7573 C  CD1   . TYR B 1 463 ? 117.599 116.277 121.490 1.00 8.94   ? 463  TYR B CD1   1 
ATOM   7574 C  CD2   . TYR B 1 463 ? 118.702 114.659 120.168 1.00 8.94   ? 463  TYR B CD2   1 
ATOM   7575 C  CE1   . TYR B 1 463 ? 117.272 115.310 122.404 1.00 8.94   ? 463  TYR B CE1   1 
ATOM   7576 C  CE2   . TYR B 1 463 ? 118.414 113.699 121.088 1.00 8.94   ? 463  TYR B CE2   1 
ATOM   7577 C  CZ    . TYR B 1 463 ? 117.706 114.028 122.207 1.00 8.94   ? 463  TYR B CZ    1 
ATOM   7578 O  OH    . TYR B 1 463 ? 117.417 113.053 123.122 1.00 8.94   ? 463  TYR B OH    1 
ATOM   7579 N  N     . TYR B 1 464 ? 118.617 119.420 117.489 1.00 8.27   ? 464  TYR B N     1 
ATOM   7580 C  CA    . TYR B 1 464 ? 119.079 119.859 116.197 1.00 8.27   ? 464  TYR B CA    1 
ATOM   7581 C  C     . TYR B 1 464 ? 118.211 120.975 115.652 1.00 8.27   ? 464  TYR B C     1 
ATOM   7582 O  O     . TYR B 1 464 ? 117.074 121.171 116.080 1.00 8.27   ? 464  TYR B O     1 
ATOM   7583 C  CB    . TYR B 1 464 ? 119.113 118.685 115.212 1.00 8.27   ? 464  TYR B CB    1 
ATOM   7584 C  CG    . TYR B 1 464 ? 117.926 117.745 115.272 1.00 8.27   ? 464  TYR B CG    1 
ATOM   7585 C  CD1   . TYR B 1 464 ? 118.048 116.476 115.818 1.00 8.27   ? 464  TYR B CD1   1 
ATOM   7586 C  CD2   . TYR B 1 464 ? 116.661 118.133 114.824 1.00 8.27   ? 464  TYR B CD2   1 
ATOM   7587 C  CE1   . TYR B 1 464 ? 116.983 115.609 115.871 1.00 8.27   ? 464  TYR B CE1   1 
ATOM   7588 C  CE2   . TYR B 1 464 ? 115.591 117.272 114.896 1.00 8.27   ? 464  TYR B CE2   1 
ATOM   7589 C  CZ    . TYR B 1 464 ? 115.765 116.020 115.428 1.00 8.27   ? 464  TYR B CZ    1 
ATOM   7590 O  OH    . TYR B 1 464 ? 114.726 115.132 115.501 1.00 8.27   ? 464  TYR B OH    1 
ATOM   7591 N  N     . ARG B 1 465 ? 118.776 121.702 114.686 1.00 9.97   ? 465  ARG B N     1 
ATOM   7592 C  CA    . ARG B 1 465 ? 117.991 122.530 113.785 1.00 9.97   ? 465  ARG B CA    1 
ATOM   7593 C  C     . ARG B 1 465 ? 117.140 121.633 112.897 1.00 9.97   ? 465  ARG B C     1 
ATOM   7594 O  O     . ARG B 1 465 ? 117.407 120.441 112.752 1.00 9.97   ? 465  ARG B O     1 
ATOM   7595 C  CB    . ARG B 1 465 ? 118.883 123.378 112.876 1.00 9.97   ? 465  ARG B CB    1 
ATOM   7596 C  CG    . ARG B 1 465 ? 119.649 124.518 113.500 1.00 9.97   ? 465  ARG B CG    1 
ATOM   7597 C  CD    . ARG B 1 465 ? 121.040 124.084 113.895 1.00 9.97   ? 465  ARG B CD    1 
ATOM   7598 N  NE    . ARG B 1 465 ? 121.779 125.108 114.621 1.00 9.97   ? 465  ARG B NE    1 
ATOM   7599 C  CZ    . ARG B 1 465 ? 122.529 126.051 114.057 1.00 9.97   ? 465  ARG B CZ    1 
ATOM   7600 N  NH1   . ARG B 1 465 ? 122.652 126.118 112.744 1.00 9.97   ? 465  ARG B NH1   1 
ATOM   7601 N  NH2   . ARG B 1 465 ? 123.141 126.936 114.826 1.00 9.97   ? 465  ARG B NH2   1 
ATOM   7602 N  N     . VAL B 1 466 ? 116.123 122.216 112.266 1.00 8.30   ? 466  VAL B N     1 
ATOM   7603 C  CA    . VAL B 1 466 ? 115.389 121.450 111.265 1.00 8.30   ? 466  VAL B CA    1 
ATOM   7604 C  C     . VAL B 1 466 ? 116.276 121.208 110.053 1.00 8.30   ? 466  VAL B C     1 
ATOM   7605 O  O     . VAL B 1 466 ? 116.248 120.129 109.452 1.00 8.30   ? 466  VAL B O     1 
ATOM   7606 C  CB    . VAL B 1 466 ? 114.081 122.162 110.870 1.00 8.30   ? 466  VAL B CB    1 
ATOM   7607 C  CG1   . VAL B 1 466 ? 113.329 121.382 109.822 1.00 8.30   ? 466  VAL B CG1   1 
ATOM   7608 C  CG2   . VAL B 1 466 ? 113.193 122.353 112.050 1.00 8.30   ? 466  VAL B CG2   1 
ATOM   7609 N  N     . SER B 1 467 ? 117.131 122.181 109.727 1.00 8.64   ? 467  SER B N     1 
ATOM   7610 C  CA    . SER B 1 467 ? 117.944 122.105 108.521 1.00 8.64   ? 467  SER B CA    1 
ATOM   7611 C  C     . SER B 1 467 ? 119.027 121.045 108.621 1.00 8.64   ? 467  SER B C     1 
ATOM   7612 O  O     . SER B 1 467 ? 119.451 120.512 107.596 1.00 8.64   ? 467  SER B O     1 
ATOM   7613 C  CB    . SER B 1 467 ? 118.563 123.465 108.228 1.00 8.64   ? 467  SER B CB    1 
ATOM   7614 O  OG    . SER B 1 467 ? 119.497 123.814 109.227 1.00 8.64   ? 467  SER B OG    1 
ATOM   7615 N  N     . SER B 1 468 ? 119.480 120.717 109.829 1.00 8.10   ? 468  SER B N     1 
ATOM   7616 C  CA    . SER B 1 468 ? 120.437 119.635 110.018 1.00 8.10   ? 468  SER B CA    1 
ATOM   7617 C  C     . SER B 1 468 ? 119.759 118.282 110.124 1.00 8.10   ? 468  SER B C     1 
ATOM   7618 O  O     . SER B 1 468 ? 120.347 117.274 109.731 1.00 8.10   ? 468  SER B O     1 
ATOM   7619 C  CB    . SER B 1 468 ? 121.292 119.885 111.260 1.00 8.10   ? 468  SER B CB    1 
ATOM   7620 O  OG    . SER B 1 468 ? 120.502 119.810 112.424 1.00 8.10   ? 468  SER B OG    1 
ATOM   7621 N  N     . TYR B 1 469 ? 118.533 118.235 110.633 1.00 7.42   ? 469  TYR B N     1 
ATOM   7622 C  CA    . TYR B 1 469 ? 117.760 117.013 110.510 1.00 7.42   ? 469  TYR B CA    1 
ATOM   7623 C  C     . TYR B 1 469 ? 117.323 116.778 109.073 1.00 7.42   ? 469  TYR B C     1 
ATOM   7624 O  O     . TYR B 1 469 ? 117.231 115.627 108.642 1.00 7.42   ? 469  TYR B O     1 
ATOM   7625 C  CB    . TYR B 1 469 ? 116.544 117.059 111.418 1.00 7.42   ? 469  TYR B CB    1 
ATOM   7626 C  CG    . TYR B 1 469 ? 115.697 115.820 111.349 1.00 7.42   ? 469  TYR B CG    1 
ATOM   7627 C  CD1   . TYR B 1 469 ? 116.081 114.669 112.006 1.00 7.42   ? 469  TYR B CD1   1 
ATOM   7628 C  CD2   . TYR B 1 469 ? 114.528 115.798 110.616 1.00 7.42   ? 469  TYR B CD2   1 
ATOM   7629 C  CE1   . TYR B 1 469 ? 115.315 113.539 111.942 1.00 7.42   ? 469  TYR B CE1   1 
ATOM   7630 C  CE2   . TYR B 1 469 ? 113.759 114.679 110.534 1.00 7.42   ? 469  TYR B CE2   1 
ATOM   7631 C  CZ    . TYR B 1 469 ? 114.154 113.550 111.207 1.00 7.42   ? 469  TYR B CZ    1 
ATOM   7632 O  OH    . TYR B 1 469 ? 113.380 112.420 111.132 1.00 7.42   ? 469  TYR B OH    1 
ATOM   7633 N  N     . PHE B 1 470 ? 117.016 117.838 108.330 1.00 7.95   ? 470  PHE B N     1 
ATOM   7634 C  CA    . PHE B 1 470 ? 116.544 117.660 106.963 1.00 7.95   ? 470  PHE B CA    1 
ATOM   7635 C  C     . PHE B 1 470 ? 117.672 117.207 106.051 1.00 7.95   ? 470  PHE B C     1 
ATOM   7636 O  O     . PHE B 1 470 ? 117.534 116.216 105.333 1.00 7.95   ? 470  PHE B O     1 
ATOM   7637 C  CB    . PHE B 1 470 ? 115.916 118.957 106.445 1.00 7.95   ? 470  PHE B CB    1 
ATOM   7638 C  CG    . PHE B 1 470 ? 115.410 118.865 105.040 1.00 7.95   ? 470  PHE B CG    1 
ATOM   7639 C  CD1   . PHE B 1 470 ? 114.266 118.149 104.750 1.00 7.95   ? 470  PHE B CD1   1 
ATOM   7640 C  CD2   . PHE B 1 470 ? 116.074 119.506 104.009 1.00 7.95   ? 470  PHE B CD2   1 
ATOM   7641 C  CE1   . PHE B 1 470 ? 113.804 118.060 103.463 1.00 7.95   ? 470  PHE B CE1   1 
ATOM   7642 C  CE2   . PHE B 1 470 ? 115.609 119.418 102.722 1.00 7.95   ? 470  PHE B CE2   1 
ATOM   7643 C  CZ    . PHE B 1 470 ? 114.474 118.695 102.454 1.00 7.95   ? 470  PHE B CZ    1 
ATOM   7644 N  N     . LEU B 1 471 ? 118.808 117.901 106.088 1.00 8.78   ? 471  LEU B N     1 
ATOM   7645 C  CA    . LEU B 1 471 ? 119.921 117.541 105.225 1.00 8.78   ? 471  LEU B CA    1 
ATOM   7646 C  C     . LEU B 1 471 ? 120.635 116.275 105.675 1.00 8.78   ? 471  LEU B C     1 
ATOM   7647 O  O     . LEU B 1 471 ? 121.292 115.632 104.855 1.00 8.78   ? 471  LEU B O     1 
ATOM   7648 C  CB    . LEU B 1 471 ? 120.916 118.692 105.153 1.00 8.78   ? 471  LEU B CB    1 
ATOM   7649 C  CG    . LEU B 1 471 ? 120.414 119.976 104.504 1.00 8.78   ? 471  LEU B CG    1 
ATOM   7650 C  CD1   . LEU B 1 471 ? 121.497 121.025 104.549 1.00 8.78   ? 471  LEU B CD1   1 
ATOM   7651 C  CD2   . LEU B 1 471 ? 119.958 119.720 103.087 1.00 8.78   ? 471  LEU B CD2   1 
ATOM   7652 N  N     . GLY B 1 472 ? 120.535 115.903 106.951 1.00 9.28   ? 472  GLY B N     1 
ATOM   7653 C  CA    . GLY B 1 472 ? 121.137 114.666 107.408 1.00 9.28   ? 472  GLY B CA    1 
ATOM   7654 C  C     . GLY B 1 472 ? 120.317 113.437 107.118 1.00 9.28   ? 472  GLY B C     1 
ATOM   7655 O  O     . GLY B 1 472 ? 120.873 112.342 107.023 1.00 9.28   ? 472  GLY B O     1 
ATOM   7656 N  N     . LYS B 1 473 ? 119.009 113.593 106.976 1.00 9.48   ? 473  LYS B N     1 
ATOM   7657 C  CA    . LYS B 1 473 ? 118.122 112.497 106.626 1.00 9.48   ? 473  LYS B CA    1 
ATOM   7658 C  C     . LYS B 1 473 ? 117.978 112.337 105.116 1.00 9.48   ? 473  LYS B C     1 
ATOM   7659 O  O     . LYS B 1 473 ? 117.590 111.262 104.651 1.00 9.48   ? 473  LYS B O     1 
ATOM   7660 C  CB    . LYS B 1 473 ? 116.760 112.734 107.291 1.00 9.48   ? 473  LYS B CB    1 
ATOM   7661 C  CG    . LYS B 1 473 ? 115.806 111.578 107.277 1.00 9.48   ? 473  LYS B CG    1 
ATOM   7662 C  CD    . LYS B 1 473 ? 116.277 110.460 108.143 1.00 9.48   ? 473  LYS B CD    1 
ATOM   7663 C  CE    . LYS B 1 473 ? 116.035 110.802 109.558 1.00 9.48   ? 473  LYS B CE    1 
ATOM   7664 N  NZ    . LYS B 1 473 ? 114.571 110.757 109.766 1.00 9.48   ? 473  LYS B NZ    1 
ATOM   7665 N  N     . LEU B 1 474 ? 118.303 113.378 104.343 1.00 10.87  ? 474  LEU B N     1 
ATOM   7666 C  CA    . LEU B 1 474 ? 118.408 113.236 102.895 1.00 10.87  ? 474  LEU B CA    1 
ATOM   7667 C  C     . LEU B 1 474 ? 119.537 112.295 102.513 1.00 10.87  ? 474  LEU B C     1 
ATOM   7668 O  O     . LEU B 1 474 ? 119.357 111.404 101.679 1.00 10.87  ? 474  LEU B O     1 
ATOM   7669 C  CB    . LEU B 1 474 ? 118.633 114.592 102.231 1.00 10.87  ? 474  LEU B CB    1 
ATOM   7670 C  CG    . LEU B 1 474 ? 117.516 115.616 102.104 1.00 10.87  ? 474  LEU B CG    1 
ATOM   7671 C  CD1   . LEU B 1 474 ? 118.071 116.884 101.513 1.00 10.87  ? 474  LEU B CD1   1 
ATOM   7672 C  CD2   . LEU B 1 474 ? 116.445 115.068 101.232 1.00 10.87  ? 474  LEU B CD2   1 
ATOM   7673 N  N     . LEU B 1 475 ? 120.706 112.462 103.140 1.00 13.16  ? 475  LEU B N     1 
ATOM   7674 C  CA    . LEU B 1 475 ? 121.910 111.717 102.789 1.00 13.16  ? 475  LEU B CA    1 
ATOM   7675 C  C     . LEU B 1 475 ? 121.798 110.223 103.052 1.00 13.16  ? 475  LEU B C     1 
ATOM   7676 O  O     . LEU B 1 475 ? 122.608 109.458 102.521 1.00 13.16  ? 475  LEU B O     1 
ATOM   7677 C  CB    . LEU B 1 475 ? 123.105 112.266 103.560 1.00 13.16  ? 475  LEU B CB    1 
ATOM   7678 C  CG    . LEU B 1 475 ? 123.492 113.710 103.267 1.00 13.16  ? 475  LEU B CG    1 
ATOM   7679 C  CD1   . LEU B 1 475 ? 124.662 114.133 104.134 1.00 13.16  ? 475  LEU B CD1   1 
ATOM   7680 C  CD2   . LEU B 1 475 ? 123.807 113.887 101.799 1.00 13.16  ? 475  LEU B CD2   1 
ATOM   7681 N  N     . SER B 1 476 ? 120.831 109.791 103.848 1.00 15.32  ? 476  SER B N     1 
ATOM   7682 C  CA    . SER B 1 476 ? 120.561 108.383 104.069 1.00 15.32  ? 476  SER B CA    1 
ATOM   7683 C  C     . SER B 1 476 ? 119.432 107.866 103.194 1.00 15.32  ? 476  SER B C     1 
ATOM   7684 O  O     . SER B 1 476 ? 119.099 106.681 103.264 1.00 15.32  ? 476  SER B O     1 
ATOM   7685 C  CB    . SER B 1 476 ? 120.240 108.160 105.537 1.00 15.32  ? 476  SER B CB    1 
ATOM   7686 O  OG    . SER B 1 476 ? 121.344 108.600 106.304 1.00 15.32  ? 476  SER B OG    1 
ATOM   7687 N  N     . ASP B 1 477 ? 118.836 108.734 102.382 1.00 17.22  ? 477  ASP B N     1 
ATOM   7688 C  CA    . ASP B 1 477 ? 117.892 108.366 101.340 1.00 17.22  ? 477  ASP B CA    1 
ATOM   7689 C  C     . ASP B 1 477 ? 118.401 108.706 99.953  1.00 17.22  ? 477  ASP B C     1 
ATOM   7690 O  O     . ASP B 1 477 ? 118.021 108.047 98.987  1.00 17.22  ? 477  ASP B O     1 
ATOM   7691 C  CB    . ASP B 1 477 ? 116.554 109.073 101.578 1.00 17.22  ? 477  ASP B CB    1 
ATOM   7692 C  CG    . ASP B 1 477 ? 115.473 108.647 100.604 1.00 17.22  ? 477  ASP B CG    1 
ATOM   7693 O  OD1   . ASP B 1 477 ? 114.976 107.505 100.718 1.00 17.22  ? 477  ASP B OD1   1 
ATOM   7694 O  OD2   . ASP B 1 477 ? 115.101 109.470 99.739  1.00 17.22  ? 477  ASP B OD2   1 
ATOM   7695 N  N     . LEU B 1 478 ? 119.272 109.708 99.847  1.00 18.66  ? 478  LEU B N     1 
ATOM   7696 C  CA    . LEU B 1 478 ? 119.903 110.041 98.577  1.00 18.66  ? 478  LEU B CA    1 
ATOM   7697 C  C     . LEU B 1 478 ? 120.928 108.985 98.184  1.00 18.66  ? 478  LEU B C     1 
ATOM   7698 O  O     . LEU B 1 478 ? 120.855 108.407 97.096  1.00 18.66  ? 478  LEU B O     1 
ATOM   7699 C  CB    . LEU B 1 478 ? 120.550 111.424 98.682  1.00 18.66  ? 478  LEU B CB    1 
ATOM   7700 C  CG    . LEU B 1 478 ? 121.166 112.198 97.522  1.00 18.66  ? 478  LEU B CG    1 
ATOM   7701 C  CD1   . LEU B 1 478 ? 120.947 113.671 97.777  1.00 18.66  ? 478  LEU B CD1   1 
ATOM   7702 C  CD2   . LEU B 1 478 ? 122.652 111.925 97.391  1.00 18.66  ? 478  LEU B CD2   1 
ATOM   7703 N  N     . LEU B 1 479 ? 121.895 108.710 99.072  1.00 19.66  ? 479  LEU B N     1 
ATOM   7704 C  CA    . LEU B 1 479 ? 123.006 107.834 98.695  1.00 19.66  ? 479  LEU B CA    1 
ATOM   7705 C  C     . LEU B 1 479 ? 122.620 106.356 98.598  1.00 19.66  ? 479  LEU B C     1 
ATOM   7706 O  O     . LEU B 1 479 ? 122.843 105.759 97.531  1.00 19.66  ? 479  LEU B O     1 
ATOM   7707 C  CB    . LEU B 1 479 ? 124.206 108.078 99.617  1.00 19.66  ? 479  LEU B CB    1 
ATOM   7708 C  CG    . LEU B 1 479 ? 124.897 109.435 99.540  1.00 19.66  ? 479  LEU B CG    1 
ATOM   7709 C  CD1   . LEU B 1 479 ? 125.952 109.560 100.623 1.00 19.66  ? 479  LEU B CD1   1 
ATOM   7710 C  CD2   . LEU B 1 479 ? 125.518 109.623 98.182  1.00 19.66  ? 479  LEU B CD2   1 
ATOM   7711 N  N     . PRO B 1 480 ? 122.060 105.698 99.631  1.00 20.90  ? 480  PRO B N     1 
ATOM   7712 C  CA    . PRO B 1 480 ? 121.881 104.242 99.516  1.00 20.90  ? 480  PRO B CA    1 
ATOM   7713 C  C     . PRO B 1 480 ? 120.732 103.826 98.621  1.00 20.90  ? 480  PRO B C     1 
ATOM   7714 O  O     . PRO B 1 480 ? 120.658 102.650 98.245  1.00 20.90  ? 480  PRO B O     1 
ATOM   7715 C  CB    . PRO B 1 480 ? 121.597 103.808 100.961 1.00 20.90  ? 480  PRO B CB    1 
ATOM   7716 C  CG    . PRO B 1 480 ? 121.970 104.953 101.799 1.00 20.90  ? 480  PRO B CG    1 
ATOM   7717 C  CD    . PRO B 1 480 ? 121.608 106.118 100.971 1.00 20.90  ? 480  PRO B CD    1 
ATOM   7718 N  N     . MET B 1 481 ? 119.843 104.746 98.268  1.00 21.52  ? 481  MET B N     1 
ATOM   7719 C  CA    . MET B 1 481 ? 118.587 104.405 97.632  1.00 21.52  ? 481  MET B CA    1 
ATOM   7720 C  C     . MET B 1 481 ? 118.378 105.044 96.272  1.00 21.52  ? 481  MET B C     1 
ATOM   7721 O  O     . MET B 1 481 ? 117.586 104.515 95.489  1.00 21.52  ? 481  MET B O     1 
ATOM   7722 C  CB    . MET B 1 481 ? 117.411 104.801 98.536  1.00 21.52  ? 481  MET B CB    1 
ATOM   7723 C  CG    . MET B 1 481 ? 117.313 104.056 99.865  1.00 21.52  ? 481  MET B CG    1 
ATOM   7724 S  SD    . MET B 1 481 ? 116.953 102.301 99.730  1.00 21.52  ? 481  MET B SD    1 
ATOM   7725 C  CE    . MET B 1 481 ? 115.256 102.350 99.173  1.00 21.52  ? 481  MET B CE    1 
ATOM   7726 N  N     . ARG B 1 482 ? 119.036 106.162 95.964  1.00 19.11  ? 482  ARG B N     1 
ATOM   7727 C  CA    . ARG B 1 482 ? 118.772 106.839 94.699  1.00 19.11  ? 482  ARG B CA    1 
ATOM   7728 C  C     . ARG B 1 482 ? 120.030 107.041 93.863  1.00 19.11  ? 482  ARG B C     1 
ATOM   7729 O  O     . ARG B 1 482 ? 119.958 107.048 92.632  1.00 19.11  ? 482  ARG B O     1 
ATOM   7730 C  CB    . ARG B 1 482 ? 118.072 108.186 94.927  1.00 19.11  ? 482  ARG B CB    1 
ATOM   7731 C  CG    . ARG B 1 482 ? 116.557 108.081 94.907  1.00 19.11  ? 482  ARG B CG    1 
ATOM   7732 C  CD    . ARG B 1 482 ? 116.006 107.553 96.208  1.00 19.11  ? 482  ARG B CD    1 
ATOM   7733 N  NE    . ARG B 1 482 ? 114.615 107.146 96.101  1.00 19.11  ? 482  ARG B NE    1 
ATOM   7734 C  CZ    . ARG B 1 482 ? 113.938 106.573 97.085  1.00 19.11  ? 482  ARG B CZ    1 
ATOM   7735 N  NH1   . ARG B 1 482 ? 114.510 106.375 98.256  1.00 19.11  ? 482  ARG B NH1   1 
ATOM   7736 N  NH2   . ARG B 1 482 ? 112.685 106.210 96.906  1.00 19.11  ? 482  ARG B NH2   1 
ATOM   7737 N  N     . MET B 1 483 ? 121.184 107.214 94.502  1.00 23.05  ? 483  MET B N     1 
ATOM   7738 C  CA    . MET B 1 483 ? 122.415 107.316 93.729  1.00 23.05  ? 483  MET B CA    1 
ATOM   7739 C  C     . MET B 1 483 ? 122.915 105.942 93.314  1.00 23.05  ? 483  MET B C     1 
ATOM   7740 O  O     . MET B 1 483 ? 123.194 105.701 92.137  1.00 23.05  ? 483  MET B O     1 
ATOM   7741 C  CB    . MET B 1 483 ? 123.497 108.054 94.519  1.00 23.05  ? 483  MET B CB    1 
ATOM   7742 C  CG    . MET B 1 483 ? 124.798 108.192 93.742  1.00 23.05  ? 483  MET B CG    1 
ATOM   7743 S  SD    . MET B 1 483 ? 126.127 109.052 94.595  1.00 23.05  ? 483  MET B SD    1 
ATOM   7744 C  CE    . MET B 1 483 ? 125.553 110.740 94.489  1.00 23.05  ? 483  MET B CE    1 
ATOM   7745 N  N     . LEU B 1 484 ? 123.043 105.034 94.277  1.00 22.67  ? 484  LEU B N     1 
ATOM   7746 C  CA    . LEU B 1 484 ? 123.600 103.714 93.993  1.00 22.67  ? 484  LEU B CA    1 
ATOM   7747 C  C     . LEU B 1 484 ? 122.731 102.824 93.099  1.00 22.67  ? 484  LEU B C     1 
ATOM   7748 O  O     . LEU B 1 484 ? 123.308 102.133 92.244  1.00 22.67  ? 484  LEU B O     1 
ATOM   7749 C  CB    . LEU B 1 484 ? 123.949 103.019 95.319  1.00 22.67  ? 484  LEU B CB    1 
ATOM   7750 C  CG    . LEU B 1 484 ? 124.556 101.623 95.283  1.00 22.67  ? 484  LEU B CG    1 
ATOM   7751 C  CD1   . LEU B 1 484 ? 125.913 101.648 94.608  1.00 22.67  ? 484  LEU B CD1   1 
ATOM   7752 C  CD2   . LEU B 1 484 ? 124.649 101.073 96.691  1.00 22.67  ? 484  LEU B CD2   1 
ATOM   7753 N  N     . PRO B 1 485 ? 121.395 102.782 93.199  1.00 21.91  ? 485  PRO B N     1 
ATOM   7754 C  CA    . PRO B 1 485 ? 120.633 102.027 92.197  1.00 21.91  ? 485  PRO B CA    1 
ATOM   7755 C  C     . PRO B 1 485 ? 120.439 102.738 90.870  1.00 21.91  ? 485  PRO B C     1 
ATOM   7756 O  O     . PRO B 1 485 ? 119.687 102.234 90.036  1.00 21.91  ? 485  PRO B O     1 
ATOM   7757 C  CB    . PRO B 1 485 ? 119.282 101.812 92.882  1.00 21.91  ? 485  PRO B CB    1 
ATOM   7758 C  CG    . PRO B 1 485 ? 119.549 101.981 94.271  1.00 21.91  ? 485  PRO B CG    1 
ATOM   7759 C  CD    . PRO B 1 485 ? 120.533 103.040 94.364  1.00 21.91  ? 485  PRO B CD    1 
ATOM   7760 N  N     . SER B 1 486 ? 121.042 103.903 90.660  1.00 22.96  ? 486  SER B N     1 
ATOM   7761 C  CA    . SER B 1 486 ? 121.092 104.518 89.345  1.00 22.96  ? 486  SER B CA    1 
ATOM   7762 C  C     . SER B 1 486 ? 122.446 104.349 88.685  1.00 22.96  ? 486  SER B C     1 
ATOM   7763 O  O     . SER B 1 486 ? 122.559 104.551 87.474  1.00 22.96  ? 486  SER B O     1 
ATOM   7764 C  CB    . SER B 1 486 ? 120.756 106.008 89.438  1.00 22.96  ? 486  SER B CB    1 
ATOM   7765 O  OG    . SER B 1 486 ? 119.436 106.197 89.909  1.00 22.96  ? 486  SER B OG    1 
ATOM   7766 N  N     . ILE B 1 487 ? 123.470 104.000 89.462  1.00 24.19  ? 487  ILE B N     1 
ATOM   7767 C  CA    . ILE B 1 487 ? 124.753 103.598 88.905  1.00 24.19  ? 487  ILE B CA    1 
ATOM   7768 C  C     . ILE B 1 487 ? 124.677 102.170 88.392  1.00 24.19  ? 487  ILE B C     1 
ATOM   7769 O  O     . ILE B 1 487 ? 125.104 101.872 87.273  1.00 24.19  ? 487  ILE B O     1 
ATOM   7770 C  CB    . ILE B 1 487 ? 125.858 103.751 89.965  1.00 24.19  ? 487  ILE B CB    1 
ATOM   7771 C  CG1   . ILE B 1 487 ? 126.000 105.208 90.383  1.00 24.19  ? 487  ILE B CG1   1 
ATOM   7772 C  CG2   . ILE B 1 487 ? 127.177 103.229 89.451  1.00 24.19  ? 487  ILE B CG2   1 
ATOM   7773 C  CD1   . ILE B 1 487 ? 126.862 105.416 91.596  1.00 24.19  ? 487  ILE B CD1   1 
ATOM   7774 N  N     . ILE B 1 488 ? 124.113 101.276 89.205  1.00 26.12  ? 488  ILE B N     1 
ATOM   7775 C  CA    . ILE B 1 488 ? 124.014 99.861  88.865  1.00 26.12  ? 488  ILE B CA    1 
ATOM   7776 C  C     . ILE B 1 488 ? 123.066 99.653  87.692  1.00 26.12  ? 488  ILE B C     1 
ATOM   7777 O  O     . ILE B 1 488 ? 123.332 98.850  86.793  1.00 26.12  ? 488  ILE B O     1 
ATOM   7778 C  CB    . ILE B 1 488 ? 123.570 99.074  90.111  1.00 26.12  ? 488  ILE B CB    1 
ATOM   7779 C  CG1   . ILE B 1 488 ? 124.614 99.206  91.215  1.00 26.12  ? 488  ILE B CG1   1 
ATOM   7780 C  CG2   . ILE B 1 488 ? 123.333 97.615  89.801  1.00 26.12  ? 488  ILE B CG2   1 
ATOM   7781 C  CD1   . ILE B 1 488 ? 124.149 98.670  92.540  1.00 26.12  ? 488  ILE B CD1   1 
ATOM   7782 N  N     . PHE B 1 489 ? 121.968 100.400 87.663  1.00 27.42  ? 489  PHE B N     1 
ATOM   7783 C  CA    . PHE B 1 489 ? 120.950 100.223 86.637  1.00 27.42  ? 489  PHE B CA    1 
ATOM   7784 C  C     . PHE B 1 489 ? 121.393 100.765 85.290  1.00 27.42  ? 489  PHE B C     1 
ATOM   7785 O  O     . PHE B 1 489 ? 120.977 100.245 84.256  1.00 27.42  ? 489  PHE B O     1 
ATOM   7786 C  CB    . PHE B 1 489 ? 119.666 100.902 87.098  1.00 27.42  ? 489  PHE B CB    1 
ATOM   7787 C  CG    . PHE B 1 489 ? 118.500 100.686 86.205  1.00 27.42  ? 489  PHE B CG    1 
ATOM   7788 C  CD1   . PHE B 1 489 ? 117.964 99.426  86.043  1.00 27.42  ? 489  PHE B CD1   1 
ATOM   7789 C  CD2   . PHE B 1 489 ? 117.880 101.753 85.601  1.00 27.42  ? 489  PHE B CD2   1 
ATOM   7790 C  CE1   . PHE B 1 489 ? 116.869 99.226  85.239  1.00 27.42  ? 489  PHE B CE1   1 
ATOM   7791 C  CE2   . PHE B 1 489 ? 116.781 101.558 84.810  1.00 27.42  ? 489  PHE B CE2   1 
ATOM   7792 C  CZ    . PHE B 1 489 ? 116.280 100.289 84.618  1.00 27.42  ? 489  PHE B CZ    1 
ATOM   7793 N  N     . THR B 1 490 ? 122.233 101.795 85.282  1.00 28.71  ? 490  THR B N     1 
ATOM   7794 C  CA    . THR B 1 490 ? 122.798 102.296 84.038  1.00 28.71  ? 490  THR B CA    1 
ATOM   7795 C  C     . THR B 1 490 ? 123.888 101.370 83.519  1.00 28.71  ? 490  THR B C     1 
ATOM   7796 O  O     . THR B 1 490 ? 124.015 101.183 82.305  1.00 28.71  ? 490  THR B O     1 
ATOM   7797 C  CB    . THR B 1 490 ? 123.344 103.706 84.259  1.00 28.71  ? 490  THR B CB    1 
ATOM   7798 O  OG1   . THR B 1 490 ? 122.300 104.534 84.780  1.00 28.71  ? 490  THR B OG1   1 
ATOM   7799 C  CG2   . THR B 1 490 ? 123.844 104.323 82.972  1.00 28.71  ? 490  THR B CG2   1 
ATOM   7800 N  N     . CYS B 1 491 ? 124.662 100.761 84.422  1.00 31.59  ? 491  CYS B N     1 
ATOM   7801 C  CA    . CYS B 1 491 ? 125.747 99.879  84.004  1.00 31.59  ? 491  CYS B CA    1 
ATOM   7802 C  C     . CYS B 1 491 ? 125.223 98.600  83.369  1.00 31.59  ? 491  CYS B C     1 
ATOM   7803 O  O     . CYS B 1 491 ? 125.773 98.145  82.363  1.00 31.59  ? 491  CYS B O     1 
ATOM   7804 C  CB    . CYS B 1 491 ? 126.655 99.546  85.186  1.00 31.59  ? 491  CYS B CB    1 
ATOM   7805 S  SG    . CYS B 1 491 ? 127.730 100.886 85.741  1.00 31.59  ? 491  CYS B SG    1 
ATOM   7806 N  N     . ILE B 1 492 ? 124.153 98.026  83.927  1.00 33.01  ? 492  ILE B N     1 
ATOM   7807 C  CA    . ILE B 1 492 ? 123.625 96.751  83.441  1.00 33.01  ? 492  ILE B CA    1 
ATOM   7808 C  C     . ILE B 1 492 ? 123.052 96.894  82.037  1.00 33.01  ? 492  ILE B C     1 
ATOM   7809 O  O     . ILE B 1 492 ? 123.358 96.095  81.149  1.00 33.01  ? 492  ILE B O     1 
ATOM   7810 C  CB    . ILE B 1 492 ? 122.582 96.189  84.423  1.00 33.01  ? 492  ILE B CB    1 
ATOM   7811 C  CG1   . ILE B 1 492 ? 123.260 95.708  85.697  1.00 33.01  ? 492  ILE B CG1   1 
ATOM   7812 C  CG2   . ILE B 1 492 ? 121.794 95.059  83.811  1.00 33.01  ? 492  ILE B CG2   1 
ATOM   7813 C  CD1   . ILE B 1 492 ? 122.293 95.291  86.751  1.00 33.01  ? 492  ILE B CD1   1 
ATOM   7814 N  N     . VAL B 1 493 ? 122.281 97.951  81.787  1.00 34.19  ? 493  VAL B N     1 
ATOM   7815 C  CA    . VAL B 1 493 ? 121.629 98.116  80.491  1.00 34.19  ? 493  VAL B CA    1 
ATOM   7816 C  C     . VAL B 1 493 ? 122.563 98.786  79.488  1.00 34.19  ? 493  VAL B C     1 
ATOM   7817 O  O     . VAL B 1 493 ? 122.139 99.172  78.396  1.00 34.19  ? 493  VAL B O     1 
ATOM   7818 C  CB    . VAL B 1 493 ? 120.318 98.909  80.617  1.00 34.19  ? 493  VAL B CB    1 
ATOM   7819 C  CG1   . VAL B 1 493 ? 119.367 98.218  81.575  1.00 34.19  ? 493  VAL B CG1   1 
ATOM   7820 C  CG2   . VAL B 1 493 ? 120.589 100.328 81.041  1.00 34.19  ? 493  VAL B CG2   1 
ATOM   7821 N  N     . TYR B 1 494 ? 123.837 98.931  79.834  1.00 40.37  ? 494  TYR B N     1 
ATOM   7822 C  CA    . TYR B 1 494 ? 124.807 99.444  78.883  1.00 40.37  ? 494  TYR B CA    1 
ATOM   7823 C  C     . TYR B 1 494 ? 125.636 98.364  78.205  1.00 40.37  ? 494  TYR B C     1 
ATOM   7824 O  O     . TYR B 1 494 ? 125.913 98.492  77.011  1.00 40.37  ? 494  TYR B O     1 
ATOM   7825 C  CB    . TYR B 1 494 ? 125.743 100.451 79.559  1.00 40.37  ? 494  TYR B CB    1 
ATOM   7826 C  CG    . TYR B 1 494 ? 126.753 101.062 78.619  1.00 40.37  ? 494  TYR B CG    1 
ATOM   7827 C  CD1   . TYR B 1 494 ? 126.373 102.025 77.690  1.00 40.37  ? 494  TYR B CD1   1 
ATOM   7828 C  CD2   . TYR B 1 494 ? 128.092 100.676 78.662  1.00 40.37  ? 494  TYR B CD2   1 
ATOM   7829 C  CE1   . TYR B 1 494 ? 127.299 102.582 76.825  1.00 40.37  ? 494  TYR B CE1   1 
ATOM   7830 C  CE2   . TYR B 1 494 ? 129.022 101.224 77.807  1.00 40.37  ? 494  TYR B CE2   1 
ATOM   7831 C  CZ    . TYR B 1 494 ? 128.624 102.175 76.892  1.00 40.37  ? 494  TYR B CZ    1 
ATOM   7832 O  OH    . TYR B 1 494 ? 129.561 102.719 76.041  1.00 40.37  ? 494  TYR B OH    1 
ATOM   7833 N  N     . PHE B 1 495 ? 126.043 97.303  78.905  1.00 40.77  ? 495  PHE B N     1 
ATOM   7834 C  CA    . PHE B 1 495 ? 126.833 96.268  78.247  1.00 40.77  ? 495  PHE B CA    1 
ATOM   7835 C  C     . PHE B 1 495 ? 125.980 95.145  77.671  1.00 40.77  ? 495  PHE B C     1 
ATOM   7836 O  O     . PHE B 1 495 ? 126.532 94.138  77.217  1.00 40.77  ? 495  PHE B O     1 
ATOM   7837 C  CB    . PHE B 1 495 ? 127.918 95.695  79.182  1.00 40.77  ? 495  PHE B CB    1 
ATOM   7838 C  CG    . PHE B 1 495 ? 127.408 94.862  80.343  1.00 40.77  ? 495  PHE B CG    1 
ATOM   7839 C  CD1   . PHE B 1 495 ? 127.120 95.455  81.554  1.00 40.77  ? 495  PHE B CD1   1 
ATOM   7840 C  CD2   . PHE B 1 495 ? 127.307 93.477  80.248  1.00 40.77  ? 495  PHE B CD2   1 
ATOM   7841 C  CE1   . PHE B 1 495 ? 126.681 94.703  82.632  1.00 40.77  ? 495  PHE B CE1   1 
ATOM   7842 C  CE2   . PHE B 1 495 ? 126.862 92.720  81.321  1.00 40.77  ? 495  PHE B CE2   1 
ATOM   7843 C  CZ    . PHE B 1 495 ? 126.552 93.336  82.514  1.00 40.77  ? 495  PHE B CZ    1 
ATOM   7844 N  N     . MET B 1 496 ? 124.655 95.293  77.654  1.00 40.84  ? 496  MET B N     1 
ATOM   7845 C  CA    . MET B 1 496 ? 123.813 94.266  77.067  1.00 40.84  ? 496  MET B CA    1 
ATOM   7846 C  C     . MET B 1 496 ? 122.715 94.810  76.168  1.00 40.84  ? 496  MET B C     1 
ATOM   7847 O  O     . MET B 1 496 ? 121.963 94.016  75.599  1.00 40.84  ? 496  MET B O     1 
ATOM   7848 C  CB    . MET B 1 496 ? 123.193 93.390  78.164  1.00 40.84  ? 496  MET B CB    1 
ATOM   7849 C  CG    . MET B 1 496 ? 122.122 94.048  78.981  1.00 40.84  ? 496  MET B CG    1 
ATOM   7850 S  SD    . MET B 1 496 ? 121.647 93.007  80.369  1.00 40.84  ? 496  MET B SD    1 
ATOM   7851 C  CE    . MET B 1 496 ? 120.872 91.641  79.524  1.00 40.84  ? 496  MET B CE    1 
ATOM   7852 N  N     . LEU B 1 497 ? 122.596 96.126  76.013  1.00 42.31  ? 497  LEU B N     1 
ATOM   7853 C  CA    . LEU B 1 497 ? 121.695 96.674  75.008  1.00 42.31  ? 497  LEU B CA    1 
ATOM   7854 C  C     . LEU B 1 497 ? 122.413 97.103  73.744  1.00 42.31  ? 497  LEU B C     1 
ATOM   7855 O  O     . LEU B 1 497 ? 121.902 96.885  72.643  1.00 42.31  ? 497  LEU B O     1 
ATOM   7856 C  CB    . LEU B 1 497 ? 120.918 97.871  75.552  1.00 42.31  ? 497  LEU B CB    1 
ATOM   7857 C  CG    . LEU B 1 497 ? 119.810 97.589  76.555  1.00 42.31  ? 497  LEU B CG    1 
ATOM   7858 C  CD1   . LEU B 1 497 ? 119.185 98.882  77.014  1.00 42.31  ? 497  LEU B CD1   1 
ATOM   7859 C  CD2   . LEU B 1 497 ? 118.783 96.731  75.909  1.00 42.31  ? 497  LEU B CD2   1 
ATOM   7860 N  N     . GLY B 1 498 ? 123.584 97.709  73.871  1.00 43.40  ? 498  GLY B N     1 
ATOM   7861 C  CA    . GLY B 1 498 ? 124.239 98.253  72.705  1.00 43.40  ? 498  GLY B CA    1 
ATOM   7862 C  C     . GLY B 1 498 ? 123.687 99.620  72.375  1.00 43.40  ? 498  GLY B C     1 
ATOM   7863 O  O     . GLY B 1 498 ? 123.226 99.867  71.258  1.00 43.40  ? 498  GLY B O     1 
ATOM   7864 N  N     . LEU B 1 499 ? 123.728 100.517 73.359  1.00 41.18  ? 499  LEU B N     1 
ATOM   7865 C  CA    . LEU B 1 499 ? 123.327 101.908 73.190  1.00 41.18  ? 499  LEU B CA    1 
ATOM   7866 C  C     . LEU B 1 499 ? 124.471 102.700 72.568  1.00 41.18  ? 499  LEU B C     1 
ATOM   7867 O  O     . LEU B 1 499 ? 125.370 102.112 71.959  1.00 41.18  ? 499  LEU B O     1 
ATOM   7868 C  CB    . LEU B 1 499 ? 122.905 102.511 74.530  1.00 41.18  ? 499  LEU B CB    1 
ATOM   7869 C  CG    . LEU B 1 499 ? 121.680 101.894 75.208  1.00 41.18  ? 499  LEU B CG    1 
ATOM   7870 C  CD1   . LEU B 1 499 ? 121.495 102.468 76.579  1.00 41.18  ? 499  LEU B CD1   1 
ATOM   7871 C  CD2   . LEU B 1 499 ? 120.435 102.117 74.400  1.00 41.18  ? 499  LEU B CD2   1 
ATOM   7872 N  N     . LYS B 1 500 ? 124.414 104.034 72.663  1.00 44.26  ? 500  LYS B N     1 
ATOM   7873 C  CA    . LYS B 1 500 ? 125.478 104.933 72.218  1.00 44.26  ? 500  LYS B CA    1 
ATOM   7874 C  C     . LYS B 1 500 ? 126.803 104.576 72.888  1.00 44.26  ? 500  LYS B C     1 
ATOM   7875 O  O     . LYS B 1 500 ? 126.961 104.767 74.100  1.00 44.26  ? 500  LYS B O     1 
ATOM   7876 C  CB    . LYS B 1 500 ? 125.108 106.385 72.517  1.00 44.26  ? 500  LYS B CB    1 
ATOM   7877 C  CG    . LYS B 1 500 ? 126.146 107.386 72.061  1.00 44.26  ? 500  LYS B CG    1 
ATOM   7878 C  CD    . LYS B 1 500 ? 126.281 107.407 70.561  1.00 44.26  ? 500  LYS B CD    1 
ATOM   7879 C  CE    . LYS B 1 500 ? 125.042 107.983 69.931  1.00 44.26  ? 500  LYS B CE    1 
ATOM   7880 N  NZ    . LYS B 1 500 ? 124.906 109.421 70.276  1.00 44.26  ? 500  LYS B NZ    1 
ATOM   7881 N  N     . PRO B 1 501 ? 127.772 104.053 72.135  1.00 44.59  ? 501  PRO B N     1 
ATOM   7882 C  CA    . PRO B 1 501 ? 128.929 103.387 72.745  1.00 44.59  ? 501  PRO B CA    1 
ATOM   7883 C  C     . PRO B 1 501 ? 130.040 104.313 73.216  1.00 44.59  ? 501  PRO B C     1 
ATOM   7884 O  O     . PRO B 1 501 ? 131.116 103.817 73.558  1.00 44.59  ? 501  PRO B O     1 
ATOM   7885 C  CB    . PRO B 1 501 ? 129.434 102.495 71.602  1.00 44.59  ? 501  PRO B CB    1 
ATOM   7886 C  CG    . PRO B 1 501 ? 129.081 103.249 70.383  1.00 44.59  ? 501  PRO B CG    1 
ATOM   7887 C  CD    . PRO B 1 501 ? 127.782 103.941 70.666  1.00 44.59  ? 501  PRO B CD    1 
ATOM   7888 N  N     . LYS B 1 502 ? 129.829 105.624 73.255  1.00 42.21  ? 502  LYS B N     1 
ATOM   7889 C  CA    . LYS B 1 502 ? 130.893 106.530 73.654  1.00 42.21  ? 502  LYS B CA    1 
ATOM   7890 C  C     . LYS B 1 502 ? 131.068 106.522 75.170  1.00 42.21  ? 502  LYS B C     1 
ATOM   7891 O  O     . LYS B 1 502 ? 130.312 105.894 75.912  1.00 42.21  ? 502  LYS B O     1 
ATOM   7892 C  CB    . LYS B 1 502 ? 130.607 107.944 73.159  1.00 42.21  ? 502  LYS B CB    1 
ATOM   7893 C  CG    . LYS B 1 502 ? 130.640 108.085 71.653  1.00 42.21  ? 502  LYS B CG    1 
ATOM   7894 C  CD    . LYS B 1 502 ? 130.500 109.536 71.246  1.00 42.21  ? 502  LYS B CD    1 
ATOM   7895 C  CE    . LYS B 1 502 ? 129.079 110.027 71.458  1.00 42.21  ? 502  LYS B CE    1 
ATOM   7896 N  NZ    . LYS B 1 502 ? 128.898 111.418 70.960  1.00 42.21  ? 502  LYS B NZ    1 
ATOM   7897 N  N     . ALA B 1 503 ? 132.091 107.238 75.627  1.00 37.76  ? 503  ALA B N     1 
ATOM   7898 C  CA    . ALA B 1 503 ? 132.393 107.304 77.049  1.00 37.76  ? 503  ALA B CA    1 
ATOM   7899 C  C     . ALA B 1 503 ? 131.578 108.369 77.764  1.00 37.76  ? 503  ALA B C     1 
ATOM   7900 O  O     . ALA B 1 503 ? 131.118 108.140 78.885  1.00 37.76  ? 503  ALA B O     1 
ATOM   7901 C  CB    . ALA B 1 503 ? 133.884 107.572 77.261  1.00 37.76  ? 503  ALA B CB    1 
ATOM   7902 N  N     . ASP B 1 504 ? 131.391 109.532 77.140  1.00 37.00  ? 504  ASP B N     1 
ATOM   7903 C  CA    . ASP B 1 504 ? 130.658 110.611 77.789  1.00 37.00  ? 504  ASP B CA    1 
ATOM   7904 C  C     . ASP B 1 504 ? 129.160 110.360 77.811  1.00 37.00  ? 504  ASP B C     1 
ATOM   7905 O  O     . ASP B 1 504 ? 128.495 110.732 78.780  1.00 37.00  ? 504  ASP B O     1 
ATOM   7906 C  CB    . ASP B 1 504 ? 130.969 111.947 77.111  1.00 37.00  ? 504  ASP B CB    1 
ATOM   7907 C  CG    . ASP B 1 504 ? 130.716 111.927 75.616  1.00 37.00  ? 504  ASP B CG    1 
ATOM   7908 O  OD1   . ASP B 1 504 ? 130.403 110.855 75.061  1.00 37.00  ? 504  ASP B OD1   1 
ATOM   7909 O  OD2   . ASP B 1 504 ? 130.835 112.997 74.988  1.00 37.00  ? 504  ASP B OD2   1 
ATOM   7910 N  N     . ALA B 1 505 ? 128.619 109.718 76.775  1.00 33.89  ? 505  ALA B N     1 
ATOM   7911 C  CA    . ALA B 1 505 ? 127.193 109.422 76.722  1.00 33.89  ? 505  ALA B CA    1 
ATOM   7912 C  C     . ALA B 1 505 ? 126.769 108.357 77.719  1.00 33.89  ? 505  ALA B C     1 
ATOM   7913 O  O     . ALA B 1 505 ? 125.572 108.224 77.979  1.00 33.89  ? 505  ALA B O     1 
ATOM   7914 C  CB    . ALA B 1 505 ? 126.797 108.984 75.318  1.00 33.89  ? 505  ALA B CB    1 
ATOM   7915 N  N     . PHE B 1 506 ? 127.709 107.588 78.264  1.00 31.56  ? 506  PHE B N     1 
ATOM   7916 C  CA    . PHE B 1 506 ? 127.380 106.703 79.372  1.00 31.56  ? 506  PHE B CA    1 
ATOM   7917 C  C     . PHE B 1 506 ? 127.113 107.493 80.642  1.00 31.56  ? 506  PHE B C     1 
ATOM   7918 O  O     . PHE B 1 506 ? 126.157 107.205 81.368  1.00 31.56  ? 506  PHE B O     1 
ATOM   7919 C  CB    . PHE B 1 506 ? 128.508 105.701 79.593  1.00 31.56  ? 506  PHE B CB    1 
ATOM   7920 C  CG    . PHE B 1 506 ? 128.320 104.841 80.799  1.00 31.56  ? 506  PHE B CG    1 
ATOM   7921 C  CD1   . PHE B 1 506 ? 127.357 103.856 80.820  1.00 31.56  ? 506  PHE B CD1   1 
ATOM   7922 C  CD2   . PHE B 1 506 ? 129.120 105.006 81.910  1.00 31.56  ? 506  PHE B CD2   1 
ATOM   7923 C  CE1   . PHE B 1 506 ? 127.188 103.065 81.933  1.00 31.56  ? 506  PHE B CE1   1 
ATOM   7924 C  CE2   . PHE B 1 506 ? 128.949 104.215 83.021  1.00 31.56  ? 506  PHE B CE2   1 
ATOM   7925 C  CZ    . PHE B 1 506 ? 127.986 103.246 83.028  1.00 31.56  ? 506  PHE B CZ    1 
ATOM   7926 N  N     . PHE B 1 507 ? 127.942 108.499 80.924  1.00 31.03  ? 507  PHE B N     1 
ATOM   7927 C  CA    . PHE B 1 507 ? 127.797 109.268 82.150  1.00 31.03  ? 507  PHE B CA    1 
ATOM   7928 C  C     . PHE B 1 507 ? 126.721 110.335 82.050  1.00 31.03  ? 507  PHE B C     1 
ATOM   7929 O  O     . PHE B 1 507 ? 126.182 110.737 83.082  1.00 31.03  ? 507  PHE B O     1 
ATOM   7930 C  CB    . PHE B 1 507 ? 129.127 109.911 82.533  1.00 31.03  ? 507  PHE B CB    1 
ATOM   7931 C  CG    . PHE B 1 507 ? 130.178 108.924 82.937  1.00 31.03  ? 507  PHE B CG    1 
ATOM   7932 C  CD1   . PHE B 1 507 ? 130.150 108.342 84.190  1.00 31.03  ? 507  PHE B CD1   1 
ATOM   7933 C  CD2   . PHE B 1 507 ? 131.201 108.586 82.069  1.00 31.03  ? 507  PHE B CD2   1 
ATOM   7934 C  CE1   . PHE B 1 507 ? 131.118 107.432 84.568  1.00 31.03  ? 507  PHE B CE1   1 
ATOM   7935 C  CE2   . PHE B 1 507 ? 132.173 107.676 82.440  1.00 31.03  ? 507  PHE B CE2   1 
ATOM   7936 C  CZ    . PHE B 1 507 ? 132.130 107.100 83.691  1.00 31.03  ? 507  PHE B CZ    1 
ATOM   7937 N  N     . VAL B 1 508 ? 126.407 110.812 80.843  1.00 28.32  ? 508  VAL B N     1 
ATOM   7938 C  CA    . VAL B 1 508 ? 125.242 111.673 80.667  1.00 28.32  ? 508  VAL B CA    1 
ATOM   7939 C  C     . VAL B 1 508 ? 123.968 110.875 80.899  1.00 28.32  ? 508  VAL B C     1 
ATOM   7940 O  O     . VAL B 1 508 ? 123.007 111.369 81.500  1.00 28.32  ? 508  VAL B O     1 
ATOM   7941 C  CB    . VAL B 1 508 ? 125.275 112.332 79.274  1.00 28.32  ? 508  VAL B CB    1 
ATOM   7942 C  CG1   . VAL B 1 508 ? 124.013 113.114 78.999  1.00 28.32  ? 508  VAL B CG1   1 
ATOM   7943 C  CG2   . VAL B 1 508 ? 126.455 113.264 79.169  1.00 28.32  ? 508  VAL B CG2   1 
ATOM   7944 N  N     . MET B 1 509 ? 123.958 109.614 80.470  1.00 27.72  ? 509  MET B N     1 
ATOM   7945 C  CA    . MET B 1 509 ? 122.848 108.720 80.775  1.00 27.72  ? 509  MET B CA    1 
ATOM   7946 C  C     . MET B 1 509 ? 122.770 108.409 82.263  1.00 27.72  ? 509  MET B C     1 
ATOM   7947 O  O     . MET B 1 509 ? 121.679 108.373 82.834  1.00 27.72  ? 509  MET B O     1 
ATOM   7948 C  CB    . MET B 1 509 ? 122.992 107.435 79.969  1.00 27.72  ? 509  MET B CB    1 
ATOM   7949 C  CG    . MET B 1 509 ? 121.924 106.420 80.239  1.00 27.72  ? 509  MET B CG    1 
ATOM   7950 S  SD    . MET B 1 509 ? 122.131 104.959 79.230  1.00 27.72  ? 509  MET B SD    1 
ATOM   7951 C  CE    . MET B 1 509 ? 120.924 103.902 79.991  1.00 27.72  ? 509  MET B CE    1 
ATOM   7952 N  N     . MET B 1 510 ? 123.917 108.194 82.910  1.00 26.36  ? 510  MET B N     1 
ATOM   7953 C  CA    . MET B 1 510 ? 123.924 107.928 84.345  1.00 26.36  ? 510  MET B CA    1 
ATOM   7954 C  C     . MET B 1 510 ? 123.483 109.146 85.139  1.00 26.36  ? 510  MET B C     1 
ATOM   7955 O  O     . MET B 1 510 ? 122.748 109.018 86.124  1.00 26.36  ? 510  MET B O     1 
ATOM   7956 C  CB    . MET B 1 510 ? 125.312 107.484 84.788  1.00 26.36  ? 510  MET B CB    1 
ATOM   7957 C  CG    . MET B 1 510 ? 125.433 107.180 86.266  1.00 26.36  ? 510  MET B CG    1 
ATOM   7958 S  SD    . MET B 1 510 ? 127.080 106.645 86.725  1.00 26.36  ? 510  MET B SD    1 
ATOM   7959 C  CE    . MET B 1 510 ? 127.048 104.985 86.080  1.00 26.36  ? 510  MET B CE    1 
ATOM   7960 N  N     . PHE B 1 511 ? 123.915 110.336 84.721  1.00 22.82  ? 511  PHE B N     1 
ATOM   7961 C  CA    . PHE B 1 511 ? 123.506 111.561 85.395  1.00 22.82  ? 511  PHE B CA    1 
ATOM   7962 C  C     . PHE B 1 511 ? 122.029 111.854 85.180  1.00 22.82  ? 511  PHE B C     1 
ATOM   7963 O  O     . PHE B 1 511 ? 121.377 112.388 86.076  1.00 22.82  ? 511  PHE B O     1 
ATOM   7964 C  CB    . PHE B 1 511 ? 124.371 112.724 84.910  1.00 22.82  ? 511  PHE B CB    1 
ATOM   7965 C  CG    . PHE B 1 511 ? 124.060 114.031 85.561  1.00 22.82  ? 511  PHE B CG    1 
ATOM   7966 C  CD1   . PHE B 1 511 ? 124.391 114.256 86.882  1.00 22.82  ? 511  PHE B CD1   1 
ATOM   7967 C  CD2   . PHE B 1 511 ? 123.470 115.050 84.841  1.00 22.82  ? 511  PHE B CD2   1 
ATOM   7968 C  CE1   . PHE B 1 511 ? 124.110 115.463 87.476  1.00 22.82  ? 511  PHE B CE1   1 
ATOM   7969 C  CE2   . PHE B 1 511 ? 123.188 116.257 85.431  1.00 22.82  ? 511  PHE B CE2   1 
ATOM   7970 C  CZ    . PHE B 1 511 ? 123.507 116.464 86.746  1.00 22.82  ? 511  PHE B CZ    1 
ATOM   7971 N  N     . THR B 1 512 ? 121.481 111.483 84.021  1.00 21.73  ? 512  THR B N     1 
ATOM   7972 C  CA    . THR B 1 512 ? 120.076 111.752 83.731  1.00 21.73  ? 512  THR B CA    1 
ATOM   7973 C  C     . THR B 1 512 ? 119.156 110.873 84.569  1.00 21.73  ? 512  THR B C     1 
ATOM   7974 O  O     . THR B 1 512 ? 118.112 111.330 85.046  1.00 21.73  ? 512  THR B O     1 
ATOM   7975 C  CB    . THR B 1 512 ? 119.809 111.543 82.245  1.00 21.73  ? 512  THR B CB    1 
ATOM   7976 O  OG1   . THR B 1 512 ? 120.708 112.361 81.489  1.00 21.73  ? 512  THR B OG1   1 
ATOM   7977 C  CG2   . THR B 1 512 ? 118.396 111.929 81.886  1.00 21.73  ? 512  THR B CG2   1 
ATOM   7978 N  N     . LEU B 1 513 ? 119.533 109.614 84.777  1.00 20.91  ? 513  LEU B N     1 
ATOM   7979 C  CA    . LEU B 1 513 ? 118.722 108.731 85.602  1.00 20.91  ? 513  LEU B CA    1 
ATOM   7980 C  C     . LEU B 1 513 ? 118.828 109.058 87.085  1.00 20.91  ? 513  LEU B C     1 
ATOM   7981 O  O     . LEU B 1 513 ? 117.923 108.705 87.843  1.00 20.91  ? 513  LEU B O     1 
ATOM   7982 C  CB    . LEU B 1 513 ? 119.101 107.273 85.348  1.00 20.91  ? 513  LEU B CB    1 
ATOM   7983 C  CG    . LEU B 1 513 ? 118.384 106.498 84.237  1.00 20.91  ? 513  LEU B CG    1 
ATOM   7984 C  CD1   . LEU B 1 513 ? 118.742 106.963 82.867  1.00 20.91  ? 513  LEU B CD1   1 
ATOM   7985 C  CD2   . LEU B 1 513 ? 118.708 105.036 84.354  1.00 20.91  ? 513  LEU B CD2   1 
ATOM   7986 N  N     . MET B 1 514 ? 119.902 109.723 87.516  1.00 21.26  ? 514  MET B N     1 
ATOM   7987 C  CA    . MET B 1 514 ? 119.970 110.194 88.895  1.00 21.26  ? 514  MET B CA    1 
ATOM   7988 C  C     . MET B 1 514 ? 119.073 111.401 89.108  1.00 21.26  ? 514  MET B C     1 
ATOM   7989 O  O     . MET B 1 514 ? 118.452 111.538 90.166  1.00 21.26  ? 514  MET B O     1 
ATOM   7990 C  CB    . MET B 1 514 ? 121.398 110.562 89.273  1.00 21.26  ? 514  MET B CB    1 
ATOM   7991 C  CG    . MET B 1 514 ? 122.371 109.426 89.388  1.00 21.26  ? 514  MET B CG    1 
ATOM   7992 S  SD    . MET B 1 514 ? 123.960 110.118 89.855  1.00 21.26  ? 514  MET B SD    1 
ATOM   7993 C  CE    . MET B 1 514 ? 124.987 108.674 89.767  1.00 21.26  ? 514  MET B CE    1 
ATOM   7994 N  N     . MET B 1 515 ? 119.009 112.294 88.121  1.00 17.85  ? 515  MET B N     1 
ATOM   7995 C  CA    . MET B 1 515 ? 118.246 113.525 88.274  1.00 17.85  ? 515  MET B CA    1 
ATOM   7996 C  C     . MET B 1 515 ? 116.750 113.272 88.260  1.00 17.85  ? 515  MET B C     1 
ATOM   7997 O  O     . MET B 1 515 ? 116.005 114.009 88.904  1.00 17.85  ? 515  MET B O     1 
ATOM   7998 C  CB    . MET B 1 515 ? 118.624 114.516 87.180  1.00 17.85  ? 515  MET B CB    1 
ATOM   7999 C  CG    . MET B 1 515 ? 120.025 115.054 87.294  1.00 17.85  ? 515  MET B CG    1 
ATOM   8000 S  SD    . MET B 1 515 ? 120.275 116.043 88.762  1.00 17.85  ? 515  MET B SD    1 
ATOM   8001 C  CE    . MET B 1 515 ? 119.363 117.500 88.295  1.00 17.85  ? 515  MET B CE    1 
ATOM   8002 N  N     . VAL B 1 516 ? 116.282 112.253 87.539  1.00 17.37  ? 516  VAL B N     1 
ATOM   8003 C  CA    . VAL B 1 516 ? 114.868 111.909 87.639  1.00 17.37  ? 516  VAL B CA    1 
ATOM   8004 C  C     . VAL B 1 516 ? 114.581 111.083 88.879  1.00 17.37  ? 516  VAL B C     1 
ATOM   8005 O  O     . VAL B 1 516 ? 113.428 111.014 89.312  1.00 17.37  ? 516  VAL B O     1 
ATOM   8006 C  CB    . VAL B 1 516 ? 114.356 111.168 86.394  1.00 17.37  ? 516  VAL B CB    1 
ATOM   8007 C  CG1   . VAL B 1 516 ? 114.419 112.061 85.213  1.00 17.37  ? 516  VAL B CG1   1 
ATOM   8008 C  CG2   . VAL B 1 516 ? 115.178 109.961 86.123  1.00 17.37  ? 516  VAL B CG2   1 
ATOM   8009 N  N     . ALA B 1 517 ? 115.595 110.453 89.465  1.00 16.57  ? 517  ALA B N     1 
ATOM   8010 C  CA    . ALA B 1 517 ? 115.398 109.772 90.733  1.00 16.57  ? 517  ALA B CA    1 
ATOM   8011 C  C     . ALA B 1 517 ? 115.404 110.751 91.891  1.00 16.57  ? 517  ALA B C     1 
ATOM   8012 O  O     . ALA B 1 517 ? 114.682 110.545 92.866  1.00 16.57  ? 517  ALA B O     1 
ATOM   8013 C  CB    . ALA B 1 517 ? 116.470 108.707 90.934  1.00 16.57  ? 517  ALA B CB    1 
ATOM   8014 N  N     . TYR B 1 518 ? 116.195 111.820 91.799  1.00 16.29  ? 518  TYR B N     1 
ATOM   8015 C  CA    . TYR B 1 518 ? 116.204 112.841 92.840  1.00 16.29  ? 518  TYR B CA    1 
ATOM   8016 C  C     . TYR B 1 518 ? 114.977 113.732 92.764  1.00 16.29  ? 518  TYR B C     1 
ATOM   8017 O  O     . TYR B 1 518 ? 114.442 114.135 93.798  1.00 16.29  ? 518  TYR B O     1 
ATOM   8018 C  CB    . TYR B 1 518 ? 117.456 113.704 92.731  1.00 16.29  ? 518  TYR B CB    1 
ATOM   8019 C  CG    . TYR B 1 518 ? 118.736 113.019 93.105  1.00 16.29  ? 518  TYR B CG    1 
ATOM   8020 C  CD1   . TYR B 1 518 ? 118.734 111.871 93.881  1.00 16.29  ? 518  TYR B CD1   1 
ATOM   8021 C  CD2   . TYR B 1 518 ? 119.954 113.512 92.665  1.00 16.29  ? 518  TYR B CD2   1 
ATOM   8022 C  CE1   . TYR B 1 518 ? 119.903 111.239 94.215  1.00 16.29  ? 518  TYR B CE1   1 
ATOM   8023 C  CE2   . TYR B 1 518 ? 121.133 112.882 92.992  1.00 16.29  ? 518  TYR B CE2   1 
ATOM   8024 C  CZ    . TYR B 1 518 ? 121.096 111.746 93.769  1.00 16.29  ? 518  TYR B CZ    1 
ATOM   8025 O  OH    . TYR B 1 518 ? 122.258 111.108 94.109  1.00 16.29  ? 518  TYR B OH    1 
ATOM   8026 N  N     . SER B 1 519 ? 114.534 114.069 91.552  1.00 14.74  ? 519  SER B N     1 
ATOM   8027 C  CA    . SER B 1 519 ? 113.403 114.973 91.394  1.00 14.74  ? 519  SER B CA    1 
ATOM   8028 C  C     . SER B 1 519 ? 112.100 114.311 91.787  1.00 14.74  ? 519  SER B C     1 
ATOM   8029 O  O     . SER B 1 519 ? 111.201 114.977 92.304  1.00 14.74  ? 519  SER B O     1 
ATOM   8030 C  CB    . SER B 1 519 ? 113.315 115.459 89.955  1.00 14.74  ? 519  SER B CB    1 
ATOM   8031 O  OG    . SER B 1 519 ? 114.493 116.145 89.594  1.00 14.74  ? 519  SER B OG    1 
ATOM   8032 N  N     . ALA B 1 520 ? 111.971 113.016 91.539  1.00 13.97  ? 520  ALA B N     1 
ATOM   8033 C  CA    . ALA B 1 520 ? 110.779 112.306 91.959  1.00 13.97  ? 520  ALA B CA    1 
ATOM   8034 C  C     . ALA B 1 520 ? 110.835 111.905 93.422  1.00 13.97  ? 520  ALA B C     1 
ATOM   8035 O  O     . ALA B 1 520 ? 109.789 111.664 94.022  1.00 13.97  ? 520  ALA B O     1 
ATOM   8036 C  CB    . ALA B 1 520 ? 110.568 111.077 91.082  1.00 13.97  ? 520  ALA B CB    1 
ATOM   8037 N  N     . SER B 1 521 ? 112.025 111.813 94.010  1.00 14.06  ? 521  SER B N     1 
ATOM   8038 C  CA    . SER B 1 521 ? 112.115 111.611 95.447  1.00 14.06  ? 521  SER B CA    1 
ATOM   8039 C  C     . SER B 1 521 ? 111.866 112.901 96.201  1.00 14.06  ? 521  SER B C     1 
ATOM   8040 O  O     . SER B 1 521 ? 111.298 112.871 97.293  1.00 14.06  ? 521  SER B O     1 
ATOM   8041 C  CB    . SER B 1 521 ? 113.481 111.056 95.828  1.00 14.06  ? 521  SER B CB    1 
ATOM   8042 O  OG    . SER B 1 521 ? 113.682 109.788 95.244  1.00 14.06  ? 521  SER B OG    1 
ATOM   8043 N  N     . SER B 1 522 ? 112.284 114.033 95.635  1.00 11.93  ? 522  SER B N     1 
ATOM   8044 C  CA    . SER B 1 522 ? 112.009 115.327 96.241  1.00 11.93  ? 522  SER B CA    1 
ATOM   8045 C  C     . SER B 1 522 ? 110.528 115.660 96.210  1.00 11.93  ? 522  SER B C     1 
ATOM   8046 O  O     . SER B 1 522 ? 110.037 116.356 97.099  1.00 11.93  ? 522  SER B O     1 
ATOM   8047 C  CB    . SER B 1 522 ? 112.807 116.409 95.528  1.00 11.93  ? 522  SER B CB    1 
ATOM   8048 O  OG    . SER B 1 522 ? 114.190 116.162 95.646  1.00 11.93  ? 522  SER B OG    1 
ATOM   8049 N  N     . MET B 1 523 ? 109.799 115.176 95.208  1.00 13.58  ? 523  MET B N     1 
ATOM   8050 C  CA    . MET B 1 523 ? 108.354 115.328 95.213  1.00 13.58  ? 523  MET B CA    1 
ATOM   8051 C  C     . MET B 1 523 ? 107.692 114.341 96.161  1.00 13.58  ? 523  MET B C     1 
ATOM   8052 O  O     . MET B 1 523 ? 106.587 114.598 96.640  1.00 13.58  ? 523  MET B O     1 
ATOM   8053 C  CB    . MET B 1 523 ? 107.795 115.159 93.801  1.00 13.58  ? 523  MET B CB    1 
ATOM   8054 C  CG    . MET B 1 523 ? 106.390 115.711 93.647  1.00 13.58  ? 523  MET B CG    1 
ATOM   8055 S  SD    . MET B 1 523 ? 105.729 115.730 91.983  1.00 13.58  ? 523  MET B SD    1 
ATOM   8056 C  CE    . MET B 1 523 ? 105.196 114.048 91.780  1.00 13.58  ? 523  MET B CE    1 
ATOM   8057 N  N     . ALA B 1 524 ? 108.353 113.228 96.461  1.00 12.66  ? 524  ALA B N     1 
ATOM   8058 C  CA    . ALA B 1 524 ? 107.836 112.330 97.479  1.00 12.66  ? 524  ALA B CA    1 
ATOM   8059 C  C     . ALA B 1 524 ? 107.978 112.937 98.852  1.00 12.66  ? 524  ALA B C     1 
ATOM   8060 O  O     . ALA B 1 524 ? 107.142 112.700 99.724  1.00 12.66  ? 524  ALA B O     1 
ATOM   8061 C  CB    . ALA B 1 524 ? 108.557 110.991 97.413  1.00 12.66  ? 524  ALA B CB    1 
ATOM   8062 N  N     . LEU B 1 525 ? 109.016 113.737 99.048  1.00 11.79  ? 525  LEU B N     1 
ATOM   8063 C  CA    . LEU B 1 525 ? 109.225 114.406 100.315 1.00 11.79  ? 525  LEU B CA    1 
ATOM   8064 C  C     . LEU B 1 525 ? 108.359 115.641 100.449 1.00 11.79  ? 525  LEU B C     1 
ATOM   8065 O  O     . LEU B 1 525 ? 107.951 115.980 101.559 1.00 11.79  ? 525  LEU B O     1 
ATOM   8066 C  CB    . LEU B 1 525 ? 110.691 114.776 100.450 1.00 11.79  ? 525  LEU B CB    1 
ATOM   8067 C  CG    . LEU B 1 525 ? 111.593 113.554 100.497 1.00 11.79  ? 525  LEU B CG    1 
ATOM   8068 C  CD1   . LEU B 1 525 ? 113.017 113.988 100.411 1.00 11.79  ? 525  LEU B CD1   1 
ATOM   8069 C  CD2   . LEU B 1 525 ? 111.344 112.786 101.761 1.00 11.79  ? 525  LEU B CD2   1 
ATOM   8070 N  N     . ALA B 1 526 ? 108.069 116.322 99.341  1.00 10.41  ? 526  ALA B N     1 
ATOM   8071 C  CA    . ALA B 1 526 ? 107.265 117.534 99.406  1.00 10.41  ? 526  ALA B CA    1 
ATOM   8072 C  C     . ALA B 1 526 ? 105.813 117.227 99.717  1.00 10.41  ? 526  ALA B C     1 
ATOM   8073 O  O     . ALA B 1 526 ? 105.122 118.056 100.309 1.00 10.41  ? 526  ALA B O     1 
ATOM   8074 C  CB    . ALA B 1 526 ? 107.372 118.306 98.097  1.00 10.41  ? 526  ALA B CB    1 
ATOM   8075 N  N     . ILE B 1 527 ? 105.335 116.048 99.337  1.00 11.19  ? 527  ILE B N     1 
ATOM   8076 C  CA    . ILE B 1 527 ? 103.967 115.674 99.663  1.00 11.19  ? 527  ILE B CA    1 
ATOM   8077 C  C     . ILE B 1 527 ? 103.886 115.096 101.073 1.00 11.19  ? 527  ILE B C     1 
ATOM   8078 O  O     . ILE B 1 527 ? 102.906 115.330 101.788 1.00 11.19  ? 527  ILE B O     1 
ATOM   8079 C  CB    . ILE B 1 527 ? 103.441 114.696 98.595  1.00 11.19  ? 527  ILE B CB    1 
ATOM   8080 C  CG1   . ILE B 1 527 ? 103.463 115.363 97.227  1.00 11.19  ? 527  ILE B CG1   1 
ATOM   8081 C  CG2   . ILE B 1 527 ? 102.016 114.274 98.863  1.00 11.19  ? 527  ILE B CG2   1 
ATOM   8082 C  CD1   . ILE B 1 527 ? 103.187 114.426 96.100  1.00 11.19  ? 527  ILE B CD1   1 
ATOM   8083 N  N     . ALA B 1 528 ? 104.925 114.398 101.526 1.00 12.07  ? 528  ALA B N     1 
ATOM   8084 C  CA    . ALA B 1 528 ? 104.846 113.587 102.731 1.00 12.07  ? 528  ALA B CA    1 
ATOM   8085 C  C     . ALA B 1 528 ? 105.557 114.162 103.946 1.00 12.07  ? 528  ALA B C     1 
ATOM   8086 O  O     . ALA B 1 528 ? 105.589 113.494 104.981 1.00 12.07  ? 528  ALA B O     1 
ATOM   8087 C  CB    . ALA B 1 528 ? 105.410 112.198 102.455 1.00 12.07  ? 528  ALA B CB    1 
ATOM   8088 N  N     . ALA B 1 529 ? 106.134 115.357 103.865 1.00 10.47  ? 529  ALA B N     1 
ATOM   8089 C  CA    . ALA B 1 529 ? 106.814 115.921 105.023 1.00 10.47  ? 529  ALA B CA    1 
ATOM   8090 C  C     . ALA B 1 529 ? 105.799 116.381 106.059 1.00 10.47  ? 529  ALA B C     1 
ATOM   8091 O  O     . ALA B 1 529 ? 104.825 117.060 105.732 1.00 10.47  ? 529  ALA B O     1 
ATOM   8092 C  CB    . ALA B 1 529 ? 107.706 117.085 104.611 1.00 10.47  ? 529  ALA B CB    1 
ATOM   8093 N  N     . GLY B 1 530 ? 106.021 115.997 107.311 1.00 11.92  ? 530  GLY B N     1 
ATOM   8094 C  CA    . GLY B 1 530 ? 105.136 116.412 108.380 1.00 11.92  ? 530  GLY B CA    1 
ATOM   8095 C  C     . GLY B 1 530 ? 103.781 115.752 108.363 1.00 11.92  ? 530  GLY B C     1 
ATOM   8096 O  O     . GLY B 1 530 ? 102.785 116.385 108.719 1.00 11.92  ? 530  GLY B O     1 
ATOM   8097 N  N     . GLN B 1 531 ? 103.715 114.490 107.972 1.00 12.61  ? 531  GLN B N     1 
ATOM   8098 C  CA    . GLN B 1 531 ? 102.453 113.787 107.829 1.00 12.61  ? 531  GLN B CA    1 
ATOM   8099 C  C     . GLN B 1 531 ? 102.546 112.463 108.570 1.00 12.61  ? 531  GLN B C     1 
ATOM   8100 O  O     . GLN B 1 531 ? 103.605 111.835 108.599 1.00 12.61  ? 531  GLN B O     1 
ATOM   8101 C  CB    . GLN B 1 531 ? 102.121 113.604 106.347 1.00 12.61  ? 531  GLN B CB    1 
ATOM   8102 C  CG    . GLN B 1 531 ? 100.787 112.985 106.069 1.00 12.61  ? 531  GLN B CG    1 
ATOM   8103 C  CD    . GLN B 1 531 ? 100.403 113.076 104.622 1.00 12.61  ? 531  GLN B CD    1 
ATOM   8104 O  OE1   . GLN B 1 531 ? 101.090 113.704 103.823 1.00 12.61  ? 531  GLN B OE1   1 
ATOM   8105 N  NE2   . GLN B 1 531 ? 99.310  112.427 104.266 1.00 12.61  ? 531  GLN B NE2   1 
ATOM   8106 N  N     . SER B 1 532 ? 101.443 112.067 109.204 1.00 12.94  ? 532  SER B N     1 
ATOM   8107 C  CA    . SER B 1 532 ? 101.447 110.971 110.163 1.00 12.94  ? 532  SER B CA    1 
ATOM   8108 C  C     . SER B 1 532 ? 101.349 109.606 109.509 1.00 12.94  ? 532  SER B C     1 
ATOM   8109 O  O     . SER B 1 532 ? 101.951 108.648 110.002 1.00 12.94  ? 532  SER B O     1 
ATOM   8110 C  CB    . SER B 1 532 ? 100.295 111.144 111.148 1.00 12.94  ? 532  SER B CB    1 
ATOM   8111 O  OG    . SER B 1 532 ? 100.437 112.349 111.875 1.00 12.94  ? 532  SER B OG    1 
ATOM   8112 N  N     . VAL B 1 533 ? 100.594 109.495 108.422 1.00 14.62  ? 533  VAL B N     1 
ATOM   8113 C  CA    . VAL B 1 533 ? 100.474 108.258 107.667 1.00 14.62  ? 533  VAL B CA    1 
ATOM   8114 C  C     . VAL B 1 533 ? 100.949 108.512 106.246 1.00 14.62  ? 533  VAL B C     1 
ATOM   8115 O  O     . VAL B 1 533 ? 100.962 109.643 105.756 1.00 14.62  ? 533  VAL B O     1 
ATOM   8116 C  CB    . VAL B 1 533 ? 99.034  107.707 107.667 1.00 14.62  ? 533  VAL B CB    1 
ATOM   8117 C  CG1   . VAL B 1 533 ? 98.615  107.317 109.066 1.00 14.62  ? 533  VAL B CG1   1 
ATOM   8118 C  CG2   . VAL B 1 533 ? 98.086  108.741 107.109 1.00 14.62  ? 533  VAL B CG2   1 
ATOM   8119 N  N     . VAL B 1 534 ? 101.348 107.432 105.581 1.00 16.15  ? 534  VAL B N     1 
ATOM   8120 C  CA    . VAL B 1 534 ? 101.756 107.496 104.187 1.00 16.15  ? 534  VAL B CA    1 
ATOM   8121 C  C     . VAL B 1 534 ? 100.615 107.146 103.242 1.00 16.15  ? 534  VAL B C     1 
ATOM   8122 O  O     . VAL B 1 534 ? 100.846 106.978 102.051 1.00 16.15  ? 534  VAL B O     1 
ATOM   8123 C  CB    . VAL B 1 534 ? 102.968 106.591 103.922 1.00 16.15  ? 534  VAL B CB    1 
ATOM   8124 C  CG1   . VAL B 1 534 ? 104.171 107.112 104.610 1.00 16.15  ? 534  VAL B CG1   1 
ATOM   8125 C  CG2   . VAL B 1 534 ? 102.698 105.243 104.454 1.00 16.15  ? 534  VAL B CG2   1 
ATOM   8126 N  N     . SER B 1 535 ? 99.386  107.041 103.744 1.00 17.11  ? 535  SER B N     1 
ATOM   8127 C  CA    . SER B 1 535 ? 98.288  106.558 102.914 1.00 17.11  ? 535  SER B CA    1 
ATOM   8128 C  C     . SER B 1 535 ? 97.820  107.610 101.915 1.00 17.11  ? 535  SER B C     1 
ATOM   8129 O  O     . SER B 1 535 ? 97.459  107.274 100.784 1.00 17.11  ? 535  SER B O     1 
ATOM   8130 C  CB    . SER B 1 535 ? 97.123  106.108 103.794 1.00 17.11  ? 535  SER B CB    1 
ATOM   8131 O  OG    . SER B 1 535 ? 96.047  105.632 103.006 1.00 17.11  ? 535  SER B OG    1 
ATOM   8132 N  N     . VAL B 1 536 ? 97.812  108.880 102.310 1.00 16.03  ? 536  VAL B N     1 
ATOM   8133 C  CA    . VAL B 1 536 ? 97.432  109.932 101.377 1.00 16.03  ? 536  VAL B CA    1 
ATOM   8134 C  C     . VAL B 1 536 ? 98.582  110.240 100.431 1.00 16.03  ? 536  VAL B C     1 
ATOM   8135 O  O     . VAL B 1 536 ? 98.381  110.437 99.229  1.00 16.03  ? 536  VAL B O     1 
ATOM   8136 C  CB    . VAL B 1 536 ? 96.992  111.189 102.150 1.00 16.03  ? 536  VAL B CB    1 
ATOM   8137 C  CG1   . VAL B 1 536 ? 96.503  112.276 101.208 1.00 16.03  ? 536  VAL B CG1   1 
ATOM   8138 C  CG2   . VAL B 1 536 ? 95.961  110.849 103.193 1.00 16.03  ? 536  VAL B CG2   1 
ATOM   8139 N  N     . ALA B 1 537 ? 99.804  110.266 100.955 1.00 14.76  ? 537  ALA B N     1 
ATOM   8140 C  CA    . ALA B 1 537 ? 100.943 110.752 100.195 1.00 14.76  ? 537  ALA B CA    1 
ATOM   8141 C  C     . ALA B 1 537 ? 101.446 109.747 99.175  1.00 14.76  ? 537  ALA B C     1 
ATOM   8142 O  O     . ALA B 1 537 ? 101.990 110.154 98.152  1.00 14.76  ? 537  ALA B O     1 
ATOM   8143 C  CB    . ALA B 1 537 ? 102.071 111.134 101.143 1.00 14.76  ? 537  ALA B CB    1 
ATOM   8144 N  N     . THR B 1 538 ? 101.313 108.446 99.444  1.00 16.02  ? 538  THR B N     1 
ATOM   8145 C  CA    . THR B 1 538 ? 101.585 107.436 98.423  1.00 16.02  ? 538  THR B CA    1 
ATOM   8146 C  C     . THR B 1 538 ? 100.557 107.511 97.308  1.00 16.02  ? 538  THR B C     1 
ATOM   8147 O  O     . THR B 1 538 ? 100.885 107.305 96.135  1.00 16.02  ? 538  THR B O     1 
ATOM   8148 C  CB    . THR B 1 538 ? 101.592 106.042 99.065  1.00 16.02  ? 538  THR B CB    1 
ATOM   8149 O  OG1   . THR B 1 538 ? 102.593 105.998 100.087 1.00 16.02  ? 538  THR B OG1   1 
ATOM   8150 C  CG2   . THR B 1 538 ? 101.867 104.938 98.071  1.00 16.02  ? 538  THR B CG2   1 
ATOM   8151 N  N     . LEU B 1 539 ? 99.325  107.865 97.656  1.00 16.71  ? 539  LEU B N     1 
ATOM   8152 C  CA    . LEU B 1 539 ? 98.237  107.897 96.691  1.00 16.71  ? 539  LEU B CA    1 
ATOM   8153 C  C     . LEU B 1 539 ? 98.379  109.062 95.724  1.00 16.71  ? 539  LEU B C     1 
ATOM   8154 O  O     . LEU B 1 539 ? 98.208  108.892 94.514  1.00 16.71  ? 539  LEU B O     1 
ATOM   8155 C  CB    . LEU B 1 539 ? 96.920  107.976 97.441  1.00 16.71  ? 539  LEU B CB    1 
ATOM   8156 C  CG    . LEU B 1 539 ? 95.669  107.859 96.618  1.00 16.71  ? 539  LEU B CG    1 
ATOM   8157 C  CD1   . LEU B 1 539 ? 95.737  106.537 95.906  1.00 16.71  ? 539  LEU B CD1   1 
ATOM   8158 C  CD2   . LEU B 1 539 ? 94.541  107.888 97.599  1.00 16.71  ? 539  LEU B CD2   1 
ATOM   8159 N  N     . LEU B 1 540 ? 98.703  110.249 96.232  1.00 16.05  ? 540  LEU B N     1 
ATOM   8160 C  CA    . LEU B 1 540 ? 98.997  111.379 95.362  1.00 16.05  ? 540  LEU B CA    1 
ATOM   8161 C  C     . LEU B 1 540 ? 100.343 111.261 94.673  1.00 16.05  ? 540  LEU B C     1 
ATOM   8162 O  O     . LEU B 1 540 ? 100.612 112.034 93.756  1.00 16.05  ? 540  LEU B O     1 
ATOM   8163 C  CB    . LEU B 1 540 ? 98.965  112.692 96.139  1.00 16.05  ? 540  LEU B CB    1 
ATOM   8164 C  CG    . LEU B 1 540 ? 97.643  113.432 96.309  1.00 16.05  ? 540  LEU B CG    1 
ATOM   8165 C  CD1   . LEU B 1 540 ? 96.741  112.775 97.329  1.00 16.05  ? 540  LEU B CD1   1 
ATOM   8166 C  CD2   . LEU B 1 540 ? 97.935  114.859 96.692  1.00 16.05  ? 540  LEU B CD2   1 
ATOM   8167 N  N     . MET B 1 541 ? 101.195 110.334 95.091  1.00 16.90  ? 541  MET B N     1 
ATOM   8168 C  CA    . MET B 1 541 ? 102.493 110.193 94.451  1.00 16.90  ? 541  MET B CA    1 
ATOM   8169 C  C     . MET B 1 541 ? 102.376 109.430 93.144  1.00 16.90  ? 541  MET B C     1 
ATOM   8170 O  O     . MET B 1 541 ? 102.985 109.808 92.141  1.00 16.90  ? 541  MET B O     1 
ATOM   8171 C  CB    . MET B 1 541 ? 103.452 109.479 95.392  1.00 16.90  ? 541  MET B CB    1 
ATOM   8172 C  CG    . MET B 1 541 ? 104.870 109.686 95.056  1.00 16.90  ? 541  MET B CG    1 
ATOM   8173 S  SD    . MET B 1 541 ? 105.121 111.438 95.191  1.00 16.90  ? 541  MET B SD    1 
ATOM   8174 C  CE    . MET B 1 541 ? 106.528 111.586 94.150  1.00 16.90  ? 541  MET B CE    1 
ATOM   8175 N  N     . THR B 1 542 ? 101.584 108.363 93.142  1.00 17.68  ? 542  THR B N     1 
ATOM   8176 C  CA    . THR B 1 542 ? 101.482 107.491 91.984  1.00 17.68  ? 542  THR B CA    1 
ATOM   8177 C  C     . THR B 1 542 ? 100.489 108.012 90.957  1.00 17.68  ? 542  THR B C     1 
ATOM   8178 O  O     . THR B 1 542 ? 100.633 107.724 89.765  1.00 17.68  ? 542  THR B O     1 
ATOM   8179 C  CB    . THR B 1 542 ? 101.091 106.088 92.436  1.00 17.68  ? 542  THR B CB    1 
ATOM   8180 O  OG1   . THR B 1 542 ? 99.838  106.144 93.124  1.00 17.68  ? 542  THR B OG1   1 
ATOM   8181 C  CG2   . THR B 1 542 ? 102.137 105.519 93.374  1.00 17.68  ? 542  THR B CG2   1 
ATOM   8182 N  N     . ILE B 1 543 ? 99.488  108.773 91.386  1.00 18.73  ? 543  ILE B N     1 
ATOM   8183 C  CA    . ILE B 1 543 ? 98.524  109.322 90.442  1.00 18.73  ? 543  ILE B CA    1 
ATOM   8184 C  C     . ILE B 1 543 ? 99.058  110.606 89.806  1.00 18.73  ? 543  ILE B C     1 
ATOM   8185 O  O     . ILE B 1 543 ? 98.736  110.909 88.652  1.00 18.73  ? 543  ILE B O     1 
ATOM   8186 C  CB    . ILE B 1 543 ? 97.169  109.508 91.149  1.00 18.73  ? 543  ILE B CB    1 
ATOM   8187 C  CG1   . ILE B 1 543 ? 96.681  108.146 91.639  1.00 18.73  ? 543  ILE B CG1   1 
ATOM   8188 C  CG2   . ILE B 1 543 ? 96.101  110.060 90.225  1.00 18.73  ? 543  ILE B CG2   1 
ATOM   8189 C  CD1   . ILE B 1 543 ? 95.470  108.193 92.524  1.00 18.73  ? 543  ILE B CD1   1 
ATOM   8190 N  N     . CYS B 1 544 ? 99.923  111.345 90.503  1.00 19.08  ? 544  CYS B N     1 
ATOM   8191 C  CA    . CYS B 1 544 ? 100.639 112.427 89.836  1.00 19.08  ? 544  CYS B CA    1 
ATOM   8192 C  C     . CYS B 1 544 ? 101.672 111.900 88.854  1.00 19.08  ? 544  CYS B C     1 
ATOM   8193 O  O     . CYS B 1 544 ? 102.001 112.592 87.894  1.00 19.08  ? 544  CYS B O     1 
ATOM   8194 C  CB    . CYS B 1 544 ? 101.314 113.359 90.842  1.00 19.08  ? 544  CYS B CB    1 
ATOM   8195 S  SG    . CYS B 1 544 ? 100.207 114.490 91.733  1.00 19.08  ? 544  CYS B SG    1 
ATOM   8196 N  N     . PHE B 1 545 ? 102.190 110.690 89.060  1.00 18.69  ? 545  PHE B N     1 
ATOM   8197 C  CA    . PHE B 1 545 ? 103.129 110.119 88.097  1.00 18.69  ? 545  PHE B CA    1 
ATOM   8198 C  C     . PHE B 1 545 ? 102.451 109.694 86.808  1.00 18.69  ? 545  PHE B C     1 
ATOM   8199 O  O     . PHE B 1 545 ? 103.010 109.892 85.728  1.00 18.69  ? 545  PHE B O     1 
ATOM   8200 C  CB    . PHE B 1 545 ? 103.841 108.929 88.697  1.00 18.69  ? 545  PHE B CB    1 
ATOM   8201 C  CG    . PHE B 1 545 ? 104.984 109.284 89.551  1.00 18.69  ? 545  PHE B CG    1 
ATOM   8202 C  CD1   . PHE B 1 545 ? 105.625 110.496 89.399  1.00 18.69  ? 545  PHE B CD1   1 
ATOM   8203 C  CD2   . PHE B 1 545 ? 105.421 108.403 90.524  1.00 18.69  ? 545  PHE B CD2   1 
ATOM   8204 C  CE1   . PHE B 1 545 ? 106.681 110.811 90.198  1.00 18.69  ? 545  PHE B CE1   1 
ATOM   8205 C  CE2   . PHE B 1 545 ? 106.469 108.719 91.335  1.00 18.69  ? 545  PHE B CE2   1 
ATOM   8206 C  CZ    . PHE B 1 545 ? 107.112 109.906 91.165  1.00 18.69  ? 545  PHE B CZ    1 
ATOM   8207 N  N     . VAL B 1 546 ? 101.271 109.074 86.889  1.00 20.90  ? 546  VAL B N     1 
ATOM   8208 C  CA    . VAL B 1 546 ? 100.564 108.723 85.664  1.00 20.90  ? 546  VAL B CA    1 
ATOM   8209 C  C     . VAL B 1 546 ? 99.951  109.955 85.022  1.00 20.90  ? 546  VAL B C     1 
ATOM   8210 O  O     . VAL B 1 546 ? 99.589  109.918 83.846  1.00 20.90  ? 546  VAL B O     1 
ATOM   8211 C  CB    . VAL B 1 546 ? 99.490  107.651 85.921  1.00 20.90  ? 546  VAL B CB    1 
ATOM   8212 C  CG1   . VAL B 1 546 ? 100.110 106.429 86.549  1.00 20.90  ? 546  VAL B CG1   1 
ATOM   8213 C  CG2   . VAL B 1 546 ? 98.384  108.181 86.782  1.00 20.90  ? 546  VAL B CG2   1 
ATOM   8214 N  N     . PHE B 1 547 ? 99.812  111.045 85.774  1.00 22.52  ? 547  PHE B N     1 
ATOM   8215 C  CA    . PHE B 1 547 ? 99.486  112.332 85.182  1.00 22.52  ? 547  PHE B CA    1 
ATOM   8216 C  C     . PHE B 1 547 ? 100.677 112.901 84.428  1.00 22.52  ? 547  PHE B C     1 
ATOM   8217 O  O     . PHE B 1 547 ? 100.502 113.569 83.406  1.00 22.52  ? 547  PHE B O     1 
ATOM   8218 C  CB    . PHE B 1 547 ? 99.033  113.288 86.281  1.00 22.52  ? 547  PHE B CB    1 
ATOM   8219 C  CG    . PHE B 1 547 ? 98.622  114.631 85.785  1.00 22.52  ? 547  PHE B CG    1 
ATOM   8220 C  CD1   . PHE B 1 547 ? 97.385  114.814 85.201  1.00 22.52  ? 547  PHE B CD1   1 
ATOM   8221 C  CD2   . PHE B 1 547 ? 99.471  115.720 85.913  1.00 22.52  ? 547  PHE B CD2   1 
ATOM   8222 C  CE1   . PHE B 1 547 ? 97.004  116.052 84.748  1.00 22.52  ? 547  PHE B CE1   1 
ATOM   8223 C  CE2   . PHE B 1 547 ? 99.097  116.961 85.457  1.00 22.52  ? 547  PHE B CE2   1 
ATOM   8224 C  CZ    . PHE B 1 547 ? 97.858  117.127 84.875  1.00 22.52  ? 547  PHE B CZ    1 
ATOM   8225 N  N     . MET B 1 548 ? 101.888 112.656 84.919  1.00 20.06  ? 548  MET B N     1 
ATOM   8226 C  CA    . MET B 1 548 ? 103.097 113.094 84.242  1.00 20.06  ? 548  MET B CA    1 
ATOM   8227 C  C     . MET B 1 548 ? 103.538 112.135 83.151  1.00 20.06  ? 548  MET B C     1 
ATOM   8228 O  O     . MET B 1 548 ? 104.351 112.512 82.305  1.00 20.06  ? 548  MET B O     1 
ATOM   8229 C  CB    . MET B 1 548 ? 104.233 113.241 85.246  1.00 20.06  ? 548  MET B CB    1 
ATOM   8230 C  CG    . MET B 1 548 ? 104.082 114.362 86.222  1.00 20.06  ? 548  MET B CG    1 
ATOM   8231 S  SD    . MET B 1 548 ? 105.457 114.392 87.366  1.00 20.06  ? 548  MET B SD    1 
ATOM   8232 C  CE    . MET B 1 548 ? 104.923 115.712 88.432  1.00 20.06  ? 548  MET B CE    1 
ATOM   8233 N  N     . MET B 1 549 ? 103.046 110.901 83.173  1.00 22.69  ? 549  MET B N     1 
ATOM   8234 C  CA    . MET B 1 549 ? 103.401 109.902 82.179  1.00 22.69  ? 549  MET B CA    1 
ATOM   8235 C  C     . MET B 1 549 ? 102.584 110.067 80.906  1.00 22.69  ? 549  MET B C     1 
ATOM   8236 O  O     . MET B 1 549 ? 102.983 109.563 79.854  1.00 22.69  ? 549  MET B O     1 
ATOM   8237 C  CB    . MET B 1 549 ? 103.216 108.511 82.798  1.00 22.69  ? 549  MET B CB    1 
ATOM   8238 C  CG    . MET B 1 549 ? 103.791 107.335 82.051  1.00 22.69  ? 549  MET B CG    1 
ATOM   8239 S  SD    . MET B 1 549 ? 103.570 105.807 82.974  1.00 22.69  ? 549  MET B SD    1 
ATOM   8240 C  CE    . MET B 1 549 ? 101.805 105.569 82.818  1.00 22.69  ? 549  MET B CE    1 
ATOM   8241 N  N     . ILE B 1 550 ? 101.460 110.781 80.979  1.00 23.69  ? 550  ILE B N     1 
ATOM   8242 C  CA    . ILE B 1 550 ? 100.728 111.160 79.775  1.00 23.69  ? 550  ILE B CA    1 
ATOM   8243 C  C     . ILE B 1 550 ? 101.530 112.169 78.969  1.00 23.69  ? 550  ILE B C     1 
ATOM   8244 O  O     . ILE B 1 550 ? 101.691 112.035 77.752  1.00 23.69  ? 550  ILE B O     1 
ATOM   8245 C  CB    . ILE B 1 550 ? 99.350  111.730 80.144  1.00 23.69  ? 550  ILE B CB    1 
ATOM   8246 C  CG1   . ILE B 1 550 ? 98.517  110.699 80.885  1.00 23.69  ? 550  ILE B CG1   1 
ATOM   8247 C  CG2   . ILE B 1 550 ? 98.610  112.144 78.908  1.00 23.69  ? 550  ILE B CG2   1 
ATOM   8248 C  CD1   . ILE B 1 550 ? 97.330  111.295 81.551  1.00 23.69  ? 550  ILE B CD1   1 
ATOM   8249 N  N     . PHE B 1 551 ? 102.059 113.182 79.642  1.00 26.33  ? 551  PHE B N     1 
ATOM   8250 C  CA    . PHE B 1 551 ? 102.753 114.286 79.003  1.00 26.33  ? 551  PHE B CA    1 
ATOM   8251 C  C     . PHE B 1 551 ? 104.229 114.013 78.777  1.00 26.33  ? 551  PHE B C     1 
ATOM   8252 O  O     . PHE B 1 551 ? 104.975 114.949 78.485  1.00 26.33  ? 551  PHE B O     1 
ATOM   8253 C  CB    . PHE B 1 551 ? 102.582 115.550 79.839  1.00 26.33  ? 551  PHE B CB    1 
ATOM   8254 C  CG    . PHE B 1 551 ? 101.173 116.046 79.896  1.00 26.33  ? 551  PHE B CG    1 
ATOM   8255 C  CD1   . PHE B 1 551 ? 100.660 116.827 78.878  1.00 26.33  ? 551  PHE B CD1   1 
ATOM   8256 C  CD2   . PHE B 1 551 ? 100.357 115.723 80.961  1.00 26.33  ? 551  PHE B CD2   1 
ATOM   8257 C  CE1   . PHE B 1 551 ? 99.363  117.280 78.926  1.00 26.33  ? 551  PHE B CE1   1 
ATOM   8258 C  CE2   . PHE B 1 551 ? 99.058  116.174 81.011  1.00 26.33  ? 551  PHE B CE2   1 
ATOM   8259 C  CZ    . PHE B 1 551 ? 98.564  116.955 79.994  1.00 26.33  ? 551  PHE B CZ    1 
ATOM   8260 N  N     . SER B 1 552 ? 104.670 112.761 78.899  1.00 25.23  ? 552  SER B N     1 
ATOM   8261 C  CA    . SER B 1 552 ? 106.072 112.440 78.672  1.00 25.23  ? 552  SER B CA    1 
ATOM   8262 C  C     . SER B 1 552 ? 106.439 112.486 77.200  1.00 25.23  ? 552  SER B C     1 
ATOM   8263 O  O     . SER B 1 552 ? 107.616 112.659 76.873  1.00 25.23  ? 552  SER B O     1 
ATOM   8264 C  CB    . SER B 1 552 ? 106.396 111.065 79.246  1.00 25.23  ? 552  SER B CB    1 
ATOM   8265 O  OG    . SER B 1 552 ? 105.689 110.055 78.561  1.00 25.23  ? 552  SER B OG    1 
ATOM   8266 N  N     . GLY B 1 553 ? 105.466 112.344 76.311  1.00 30.66  ? 553  GLY B N     1 
ATOM   8267 C  CA    . GLY B 1 553 ? 105.708 112.459 74.895  1.00 30.66  ? 553  GLY B CA    1 
ATOM   8268 C  C     . GLY B 1 553 ? 105.947 111.158 74.177  1.00 30.66  ? 553  GLY B C     1 
ATOM   8269 O  O     . GLY B 1 553 ? 106.672 111.145 73.178  1.00 30.66  ? 553  GLY B O     1 
ATOM   8270 N  N     . LEU B 1 554 ? 105.361 110.061 74.646  1.00 31.68  ? 554  LEU B N     1 
ATOM   8271 C  CA    . LEU B 1 554 ? 105.532 108.766 74.007  1.00 31.68  ? 554  LEU B CA    1 
ATOM   8272 C  C     . LEU B 1 554 ? 104.243 108.302 73.342  1.00 31.68  ? 554  LEU B C     1 
ATOM   8273 O  O     . LEU B 1 554 ? 104.229 108.030 72.139  1.00 31.68  ? 554  LEU B O     1 
ATOM   8274 C  CB    . LEU B 1 554 ? 106.032 107.744 75.044  1.00 31.68  ? 554  LEU B CB    1 
ATOM   8275 C  CG    . LEU B 1 554 ? 106.656 106.399 74.645  1.00 31.68  ? 554  LEU B CG    1 
ATOM   8276 C  CD1   . LEU B 1 554 ? 105.650 105.304 74.345  1.00 31.68  ? 554  LEU B CD1   1 
ATOM   8277 C  CD2   . LEU B 1 554 ? 107.572 106.600 73.456  1.00 31.68  ? 554  LEU B CD2   1 
ATOM   8278 N  N     . LEU B 1 555 ? 103.146 108.219 74.093  1.00 35.80  ? 555  LEU B N     1 
ATOM   8279 C  CA    . LEU B 1 555 ? 101.902 107.727 73.515  1.00 35.80  ? 555  LEU B CA    1 
ATOM   8280 C  C     . LEU B 1 555 ? 101.168 108.822 72.755  1.00 35.80  ? 555  LEU B C     1 
ATOM   8281 O  O     . LEU B 1 555 ? 100.734 108.606 71.619  1.00 35.80  ? 555  LEU B O     1 
ATOM   8282 C  CB    . LEU B 1 555 ? 100.997 107.144 74.600  1.00 35.80  ? 555  LEU B CB    1 
ATOM   8283 C  CG    . LEU B 1 555 ? 101.265 105.730 75.132  1.00 35.80  ? 555  LEU B CG    1 
ATOM   8284 C  CD1   . LEU B 1 555 ? 102.412 105.674 76.139  1.00 35.80  ? 555  LEU B CD1   1 
ATOM   8285 C  CD2   . LEU B 1 555 ? 99.999  105.134 75.724  1.00 35.80  ? 555  LEU B CD2   1 
ATOM   8286 N  N     . VAL B 1 556 ? 101.022 109.996 73.359  1.00 37.57  ? 556  VAL B N     1 
ATOM   8287 C  CA    . VAL B 1 556 ? 100.336 111.122 72.741  1.00 37.57  ? 556  VAL B CA    1 
ATOM   8288 C  C     . VAL B 1 556 ? 101.375 112.157 72.326  1.00 37.57  ? 556  VAL B C     1 
ATOM   8289 O  O     . VAL B 1 556 ? 102.354 112.397 73.040  1.00 37.57  ? 556  VAL B O     1 
ATOM   8290 C  CB    . VAL B 1 556 ? 99.253  111.701 73.687  1.00 37.57  ? 556  VAL B CB    1 
ATOM   8291 C  CG1   . VAL B 1 556 ? 99.835  112.187 75.009  1.00 37.57  ? 556  VAL B CG1   1 
ATOM   8292 C  CG2   . VAL B 1 556 ? 98.448  112.801 73.011  1.00 37.57  ? 556  VAL B CG2   1 
ATOM   8293 N  N     . ASN B 1 557 ? 101.196 112.718 71.133  1.00 42.45  ? 557  ASN B N     1 
ATOM   8294 C  CA    . ASN B 1 557 ? 102.146 113.690 70.610  1.00 42.45  ? 557  ASN B CA    1 
ATOM   8295 C  C     . ASN B 1 557 ? 101.953 115.020 71.326  1.00 42.45  ? 557  ASN B C     1 
ATOM   8296 O  O     . ASN B 1 557 ? 100.832 115.523 71.427  1.00 42.45  ? 557  ASN B O     1 
ATOM   8297 C  CB    . ASN B 1 557 ? 101.954 113.855 69.102  1.00 42.45  ? 557  ASN B CB    1 
ATOM   8298 C  CG    . ASN B 1 557 ? 103.229 114.287 68.381  1.00 42.45  ? 557  ASN B CG    1 
ATOM   8299 O  OD1   . ASN B 1 557 ? 103.309 114.214 67.156  1.00 42.45  ? 557  ASN B OD1   1 
ATOM   8300 N  ND2   . ASN B 1 557 ? 104.234 114.710 69.137  1.00 42.45  ? 557  ASN B ND2   1 
ATOM   8301 N  N     . LEU B 1 558 ? 103.055 115.588 71.823  1.00 40.40  ? 558  LEU B N     1 
ATOM   8302 C  CA    . LEU B 1 558 ? 102.975 116.811 72.615  1.00 40.40  ? 558  LEU B CA    1 
ATOM   8303 C  C     . LEU B 1 558 ? 102.614 118.023 71.767  1.00 40.40  ? 558  LEU B C     1 
ATOM   8304 O  O     . LEU B 1 558 ? 102.055 118.993 72.288  1.00 40.40  ? 558  LEU B O     1 
ATOM   8305 C  CB    . LEU B 1 558 ? 104.298 117.050 73.339  1.00 40.40  ? 558  LEU B CB    1 
ATOM   8306 C  CG    . LEU B 1 558 ? 104.660 116.054 74.439  1.00 40.40  ? 558  LEU B CG    1 
ATOM   8307 C  CD1   . LEU B 1 558 ? 106.062 116.313 74.955  1.00 40.40  ? 558  LEU B CD1   1 
ATOM   8308 C  CD2   . LEU B 1 558 ? 103.650 116.122 75.567  1.00 40.40  ? 558  LEU B CD2   1 
ATOM   8309 N  N     . THR B 1 559 ? 102.920 117.990 70.471  1.00 46.24  ? 559  THR B N     1 
ATOM   8310 C  CA    . THR B 1 559 ? 102.575 119.106 69.599  1.00 46.24  ? 559  THR B CA    1 
ATOM   8311 C  C     . THR B 1 559 ? 101.099 119.107 69.228  1.00 46.24  ? 559  THR B C     1 
ATOM   8312 O  O     . THR B 1 559 ? 100.530 120.174 68.975  1.00 46.24  ? 559  THR B O     1 
ATOM   8313 C  CB    . THR B 1 559 ? 103.429 119.067 68.333  1.00 46.24  ? 559  THR B CB    1 
ATOM   8314 O  OG1   . THR B 1 559 ? 103.182 117.844 67.629  1.00 46.24  ? 559  THR B OG1   1 
ATOM   8315 C  CG2   . THR B 1 559 ? 104.902 119.150 68.687  1.00 46.24  ? 559  THR B CG2   1 
ATOM   8316 N  N     . THR B 1 560 ? 100.464 117.937 69.192  1.00 46.39  ? 560  THR B N     1 
ATOM   8317 C  CA    . THR B 1 560 ? 99.051  117.850 68.852  1.00 46.39  ? 560  THR B CA    1 
ATOM   8318 C  C     . THR B 1 560 ? 98.139  118.145 70.035  1.00 46.39  ? 560  THR B C     1 
ATOM   8319 O  O     . THR B 1 560 ? 96.924  118.257 69.843  1.00 46.39  ? 560  THR B O     1 
ATOM   8320 C  CB    . THR B 1 560 ? 98.726  116.464 68.293  1.00 46.39  ? 560  THR B CB    1 
ATOM   8321 O  OG1   . THR B 1 560 ? 98.958  115.474 69.301  1.00 46.39  ? 560  THR B OG1   1 
ATOM   8322 C  CG2   . THR B 1 560 ? 99.605  116.164 67.092  1.00 46.39  ? 560  THR B CG2   1 
ATOM   8323 N  N     . ILE B 1 561 ? 98.690  118.258 71.243  1.00 44.33  ? 561  ILE B N     1 
ATOM   8324 C  CA    . ILE B 1 561 ? 97.905  118.669 72.399  1.00 44.33  ? 561  ILE B CA    1 
ATOM   8325 C  C     . ILE B 1 561 ? 97.547  120.142 72.253  1.00 44.33  ? 561  ILE B C     1 
ATOM   8326 O  O     . ILE B 1 561 ? 98.367  120.954 71.805  1.00 44.33  ? 561  ILE B O     1 
ATOM   8327 C  CB    . ILE B 1 561 ? 98.695  118.383 73.691  1.00 44.33  ? 561  ILE B CB    1 
ATOM   8328 C  CG1   . ILE B 1 561 ? 98.935  116.881 73.841  1.00 44.33  ? 561  ILE B CG1   1 
ATOM   8329 C  CG2   . ILE B 1 561 ? 97.981  118.894 74.931  1.00 44.33  ? 561  ILE B CG2   1 
ATOM   8330 C  CD1   . ILE B 1 561 ? 99.893  116.530 74.953  1.00 44.33  ? 561  ILE B CD1   1 
ATOM   8331 N  N     . ALA B 1 562 ? 96.300  120.484 72.589  1.00 45.01  ? 562  ALA B N     1 
ATOM   8332 C  CA    . ALA B 1 562 ? 95.813  121.852 72.488  1.00 45.01  ? 562  ALA B CA    1 
ATOM   8333 C  C     . ALA B 1 562 ? 96.569  122.776 73.439  1.00 45.01  ? 562  ALA B C     1 
ATOM   8334 O  O     . ALA B 1 562 ? 97.191  122.342 74.410  1.00 45.01  ? 562  ALA B O     1 
ATOM   8335 C  CB    . ALA B 1 562 ? 94.317  121.907 72.786  1.00 45.01  ? 562  ALA B CB    1 
ATOM   8336 N  N     . SER B 1 563 ? 96.495  124.077 73.144  1.00 44.83  ? 563  SER B N     1 
ATOM   8337 C  CA    . SER B 1 563 ? 97.356  125.063 73.789  1.00 44.83  ? 563  SER B CA    1 
ATOM   8338 C  C     . SER B 1 563 ? 97.025  125.277 75.259  1.00 44.83  ? 563  SER B C     1 
ATOM   8339 O  O     . SER B 1 563 ? 97.887  125.742 76.011  1.00 44.83  ? 563  SER B O     1 
ATOM   8340 C  CB    . SER B 1 563 ? 97.268  126.394 73.045  1.00 44.83  ? 563  SER B CB    1 
ATOM   8341 O  OG    . SER B 1 563 ? 98.073  127.377 73.668  1.00 44.83  ? 563  SER B OG    1 
ATOM   8342 N  N     . TRP B 1 564 ? 95.811  124.945 75.685  1.00 41.94  ? 564  TRP B N     1 
ATOM   8343 C  CA    . TRP B 1 564 ? 95.404  125.112 77.071  1.00 41.94  ? 564  TRP B CA    1 
ATOM   8344 C  C     . TRP B 1 564 ? 95.734  123.901 77.935  1.00 41.94  ? 564  TRP B C     1 
ATOM   8345 O  O     . TRP B 1 564 ? 95.529  123.954 79.151  1.00 41.94  ? 564  TRP B O     1 
ATOM   8346 C  CB    . TRP B 1 564 ? 93.904  125.428 77.131  1.00 41.94  ? 564  TRP B CB    1 
ATOM   8347 C  CG    . TRP B 1 564 ? 93.030  124.349 76.582  1.00 41.94  ? 564  TRP B CG    1 
ATOM   8348 C  CD1   . TRP B 1 564 ? 92.760  124.102 75.268  1.00 41.94  ? 564  TRP B CD1   1 
ATOM   8349 C  CD2   . TRP B 1 564 ? 92.260  123.408 77.333  1.00 41.94  ? 564  TRP B CD2   1 
ATOM   8350 N  NE1   . TRP B 1 564 ? 91.902  123.037 75.154  1.00 41.94  ? 564  TRP B NE1   1 
ATOM   8351 C  CE2   . TRP B 1 564 ? 91.577  122.596 76.409  1.00 41.94  ? 564  TRP B CE2   1 
ATOM   8352 C  CE3   . TRP B 1 564 ? 92.096  123.162 78.698  1.00 41.94  ? 564  TRP B CE3   1 
ATOM   8353 C  CZ2   . TRP B 1 564 ? 90.742  121.560 76.805  1.00 41.94  ? 564  TRP B CZ2   1 
ATOM   8354 C  CZ3   . TRP B 1 564 ? 91.269  122.133 79.089  1.00 41.94  ? 564  TRP B CZ3   1 
ATOM   8355 C  CH2   . TRP B 1 564 ? 90.600  121.346 78.147  1.00 41.94  ? 564  TRP B CH2   1 
ATOM   8356 N  N     . LEU B 1 565 ? 96.244  122.820 77.339  1.00 39.05  ? 565  LEU B N     1 
ATOM   8357 C  CA    . LEU B 1 565 ? 96.774  121.678 78.073  1.00 39.05  ? 565  LEU B CA    1 
ATOM   8358 C  C     . LEU B 1 565 ? 98.237  121.393 77.787  1.00 39.05  ? 565  LEU B C     1 
ATOM   8359 O  O     . LEU B 1 565 ? 98.814  120.518 78.440  1.00 39.05  ? 565  LEU B O     1 
ATOM   8360 C  CB    . LEU B 1 565 ? 95.977  120.404 77.759  1.00 39.05  ? 565  LEU B CB    1 
ATOM   8361 C  CG    . LEU B 1 565 ? 94.583  120.227 78.348  1.00 39.05  ? 565  LEU B CG    1 
ATOM   8362 C  CD1   . LEU B 1 565 ? 93.930  119.037 77.704  1.00 39.05  ? 565  LEU B CD1   1 
ATOM   8363 C  CD2   . LEU B 1 565 ? 94.675  120.017 79.841  1.00 39.05  ? 565  LEU B CD2   1 
ATOM   8364 N  N     . SER B 1 566 ? 98.853  122.094 76.841  1.00 37.64  ? 566  SER B N     1 
ATOM   8365 C  CA    . SER B 1 566 ? 100.247 121.865 76.497  1.00 37.64  ? 566  SER B CA    1 
ATOM   8366 C  C     . SER B 1 566 ? 101.215 122.551 77.447  1.00 37.64  ? 566  SER B C     1 
ATOM   8367 O  O     . SER B 1 566 ? 102.423 122.510 77.204  1.00 37.64  ? 566  SER B O     1 
ATOM   8368 C  CB    . SER B 1 566 ? 100.515 122.334 75.068  1.00 37.64  ? 566  SER B CB    1 
ATOM   8369 O  OG    . SER B 1 566 ? 101.876 122.156 74.720  1.00 37.64  ? 566  SER B OG    1 
ATOM   8370 N  N     . TRP B 1 567 ? 100.724 123.197 78.499  1.00 32.78  ? 567  TRP B N     1 
ATOM   8371 C  CA    . TRP B 1 567 ? 101.586 123.757 79.526  1.00 32.78  ? 567  TRP B CA    1 
ATOM   8372 C  C     . TRP B 1 567 ? 101.837 122.779 80.660  1.00 32.78  ? 567  TRP B C     1 
ATOM   8373 O  O     . TRP B 1 567 ? 102.755 122.995 81.456  1.00 32.78  ? 567  TRP B O     1 
ATOM   8374 C  CB    . TRP B 1 567 ? 100.971 125.045 80.078  1.00 32.78  ? 567  TRP B CB    1 
ATOM   8375 C  CG    . TRP B 1 567 ? 99.634  124.836 80.700  1.00 32.78  ? 567  TRP B CG    1 
ATOM   8376 C  CD1   . TRP B 1 567 ? 98.433  124.829 80.065  1.00 32.78  ? 567  TRP B CD1   1 
ATOM   8377 C  CD2   . TRP B 1 567 ? 99.358  124.614 82.083  1.00 32.78  ? 567  TRP B CD2   1 
ATOM   8378 N  NE1   . TRP B 1 567 ? 97.423  124.604 80.963  1.00 32.78  ? 567  TRP B NE1   1 
ATOM   8379 C  CE2   . TRP B 1 567 ? 97.966  124.471 82.212  1.00 32.78  ? 567  TRP B CE2   1 
ATOM   8380 C  CE3   . TRP B 1 567 ? 100.152 124.517 83.225  1.00 32.78  ? 567  TRP B CE3   1 
ATOM   8381 C  CZ2   . TRP B 1 567 ? 97.354  124.238 83.434  1.00 32.78  ? 567  TRP B CZ2   1 
ATOM   8382 C  CZ3   . TRP B 1 567 ? 99.542  124.285 84.435  1.00 32.78  ? 567  TRP B CZ3   1 
ATOM   8383 C  CH2   . TRP B 1 567 ? 98.158  124.147 84.532  1.00 32.78  ? 567  TRP B CH2   1 
ATOM   8384 N  N     . LEU B 1 568 ? 101.049 121.707 80.741  1.00 30.26  ? 568  LEU B N     1 
ATOM   8385 C  CA    . LEU B 1 568 ? 101.237 120.672 81.745  1.00 30.26  ? 568  LEU B CA    1 
ATOM   8386 C  C     . LEU B 1 568 ? 102.411 119.759 81.439  1.00 30.26  ? 568  LEU B C     1 
ATOM   8387 O  O     . LEU B 1 568 ? 102.792 118.963 82.300  1.00 30.26  ? 568  LEU B O     1 
ATOM   8388 C  CB    . LEU B 1 568 ? 99.965  119.839 81.872  1.00 30.26  ? 568  LEU B CB    1 
ATOM   8389 C  CG    . LEU B 1 568 ? 98.761  120.499 82.525  1.00 30.26  ? 568  LEU B CG    1 
ATOM   8390 C  CD1   . LEU B 1 568 ? 97.519  119.671 82.314  1.00 30.26  ? 568  LEU B CD1   1 
ATOM   8391 C  CD2   . LEU B 1 568 ? 99.052  120.628 83.994  1.00 30.26  ? 568  LEU B CD2   1 
ATOM   8392 N  N     . GLN B 1 569 ? 102.982 119.843 80.240  1.00 30.09  ? 569  GLN B N     1 
ATOM   8393 C  CA    . GLN B 1 569 ? 104.159 119.058 79.910  1.00 30.09  ? 569  GLN B CA    1 
ATOM   8394 C  C     . GLN B 1 569 ? 105.417 119.593 80.571  1.00 30.09  ? 569  GLN B C     1 
ATOM   8395 O  O     . GLN B 1 569 ? 106.430 118.891 80.587  1.00 30.09  ? 569  GLN B O     1 
ATOM   8396 C  CB    . GLN B 1 569 ? 104.367 119.028 78.401  1.00 30.09  ? 569  GLN B CB    1 
ATOM   8397 C  CG    . GLN B 1 569 ? 104.795 120.357 77.835  1.00 30.09  ? 569  GLN B CG    1 
ATOM   8398 C  CD    . GLN B 1 569 ? 104.959 120.329 76.346  1.00 30.09  ? 569  GLN B CD    1 
ATOM   8399 O  OE1   . GLN B 1 569 ? 104.783 119.296 75.716  1.00 30.09  ? 569  GLN B OE1   1 
ATOM   8400 N  NE2   . GLN B 1 569 ? 105.308 121.465 75.769  1.00 30.09  ? 569  GLN B NE2   1 
ATOM   8401 N  N     . TYR B 1 570 ? 105.385 120.815 81.100  1.00 28.59  ? 570  TYR B N     1 
ATOM   8402 C  CA    . TYR B 1 570 ? 106.546 121.382 81.763  1.00 28.59  ? 570  TYR B CA    1 
ATOM   8403 C  C     . TYR B 1 570 ? 106.647 120.963 83.217  1.00 28.59  ? 570  TYR B C     1 
ATOM   8404 O  O     . TYR B 1 570 ? 107.668 121.232 83.854  1.00 28.59  ? 570  TYR B O     1 
ATOM   8405 C  CB    . TYR B 1 570 ? 106.519 122.904 81.664  1.00 28.59  ? 570  TYR B CB    1 
ATOM   8406 C  CG    . TYR B 1 570 ? 106.676 123.398 80.253  1.00 28.59  ? 570  TYR B CG    1 
ATOM   8407 C  CD1   . TYR B 1 570 ? 107.922 123.440 79.652  1.00 28.59  ? 570  TYR B CD1   1 
ATOM   8408 C  CD2   . TYR B 1 570 ? 105.577 123.813 79.518  1.00 28.59  ? 570  TYR B CD2   1 
ATOM   8409 C  CE1   . TYR B 1 570 ? 108.070 123.882 78.360  1.00 28.59  ? 570  TYR B CE1   1 
ATOM   8410 C  CE2   . TYR B 1 570 ? 105.714 124.259 78.226  1.00 28.59  ? 570  TYR B CE2   1 
ATOM   8411 C  CZ    . TYR B 1 570 ? 106.962 124.291 77.652  1.00 28.59  ? 570  TYR B CZ    1 
ATOM   8412 O  OH    . TYR B 1 570 ? 107.106 124.736 76.362  1.00 28.59  ? 570  TYR B OH    1 
ATOM   8413 N  N     . PHE B 1 571 ? 105.618 120.317 83.747  1.00 27.82  ? 571  PHE B N     1 
ATOM   8414 C  CA    . PHE B 1 571 ? 105.629 119.799 85.100  1.00 27.82  ? 571  PHE B CA    1 
ATOM   8415 C  C     . PHE B 1 571 ? 106.035 118.340 85.168  1.00 27.82  ? 571  PHE B C     1 
ATOM   8416 O  O     . PHE B 1 571 ? 106.236 117.824 86.268  1.00 27.82  ? 571  PHE B O     1 
ATOM   8417 C  CB    . PHE B 1 571 ? 104.249 119.966 85.738  1.00 27.82  ? 571  PHE B CB    1 
ATOM   8418 C  CG    . PHE B 1 571 ? 103.886 121.388 86.017  1.00 27.82  ? 571  PHE B CG    1 
ATOM   8419 C  CD1   . PHE B 1 571 ? 104.320 122.010 87.170  1.00 27.82  ? 571  PHE B CD1   1 
ATOM   8420 C  CD2   . PHE B 1 571 ? 103.126 122.109 85.118  1.00 27.82  ? 571  PHE B CD2   1 
ATOM   8421 C  CE1   . PHE B 1 571 ? 103.991 123.320 87.425  1.00 27.82  ? 571  PHE B CE1   1 
ATOM   8422 C  CE2   . PHE B 1 571 ? 102.800 123.420 85.368  1.00 27.82  ? 571  PHE B CE2   1 
ATOM   8423 C  CZ    . PHE B 1 571 ? 103.231 124.025 86.521  1.00 27.82  ? 571  PHE B CZ    1 
ATOM   8424 N  N     . SER B 1 572 ? 106.168 117.667 84.034  1.00 22.53  ? 572  SER B N     1 
ATOM   8425 C  CA    . SER B 1 572 ? 106.396 116.232 84.034  1.00 22.53  ? 572  SER B CA    1 
ATOM   8426 C  C     . SER B 1 572 ? 107.869 115.932 84.246  1.00 22.53  ? 572  SER B C     1 
ATOM   8427 O  O     . SER B 1 572 ? 108.702 116.288 83.414  1.00 22.53  ? 572  SER B O     1 
ATOM   8428 C  CB    . SER B 1 572 ? 105.915 115.613 82.730  1.00 22.53  ? 572  SER B CB    1 
ATOM   8429 O  OG    . SER B 1 572 ? 104.523 115.744 82.581  1.00 22.53  ? 572  SER B OG    1 
ATOM   8430 N  N     . ILE B 1 573 ? 108.180 115.286 85.372  1.00 19.80  ? 573  ILE B N     1 
ATOM   8431 C  CA    . ILE B 1 573 ? 109.509 114.690 85.547  1.00 19.80  ? 573  ILE B CA    1 
ATOM   8432 C  C     . ILE B 1 573 ? 109.842 113.661 84.472  1.00 19.80  ? 573  ILE B C     1 
ATOM   8433 O  O     . ILE B 1 573 ? 110.970 113.696 83.961  1.00 19.80  ? 573  ILE B O     1 
ATOM   8434 C  CB    . ILE B 1 573 ? 109.659 114.152 86.980  1.00 19.80  ? 573  ILE B CB    1 
ATOM   8435 C  CG1   . ILE B 1 573 ? 109.476 115.279 87.987  1.00 19.80  ? 573  ILE B CG1   1 
ATOM   8436 C  CG2   . ILE B 1 573 ? 111.006 113.512 87.194  1.00 19.80  ? 573  ILE B CG2   1 
ATOM   8437 C  CD1   . ILE B 1 573 ? 109.238 114.813 89.380  1.00 19.80  ? 573  ILE B CD1   1 
ATOM   8438 N  N     . PRO B 1 574 ? 108.947 112.737 84.054  1.00 21.20  ? 574  PRO B N     1 
ATOM   8439 C  CA    . PRO B 1 574 ? 109.326 111.857 82.938  1.00 21.20  ? 574  PRO B CA    1 
ATOM   8440 C  C     . PRO B 1 574 ? 109.474 112.549 81.595  1.00 21.20  ? 574  PRO B C     1 
ATOM   8441 O  O     . PRO B 1 574 ? 110.088 111.962 80.707  1.00 21.20  ? 574  PRO B O     1 
ATOM   8442 C  CB    . PRO B 1 574 ? 108.189 110.832 82.890  1.00 21.20  ? 574  PRO B CB    1 
ATOM   8443 C  CG    . PRO B 1 574 ? 107.635 110.831 84.198  1.00 21.20  ? 574  PRO B CG    1 
ATOM   8444 C  CD    . PRO B 1 574 ? 107.705 112.218 84.669  1.00 21.20  ? 574  PRO B CD    1 
ATOM   8445 N  N     . ARG B 1 575 ? 108.937 113.750 81.392  1.00 23.13  ? 575  ARG B N     1 
ATOM   8446 C  CA    . ARG B 1 575 ? 109.150 114.408 80.107  1.00 23.13  ? 575  ARG B CA    1 
ATOM   8447 C  C     . ARG B 1 575 ? 110.566 114.945 79.988  1.00 23.13  ? 575  ARG B C     1 
ATOM   8448 O  O     . ARG B 1 575 ? 111.126 114.945 78.893  1.00 23.13  ? 575  ARG B O     1 
ATOM   8449 C  CB    . ARG B 1 575 ? 108.118 115.519 79.900  1.00 23.13  ? 575  ARG B CB    1 
ATOM   8450 C  CG    . ARG B 1 575 ? 108.117 116.225 78.549  1.00 23.13  ? 575  ARG B CG    1 
ATOM   8451 C  CD    . ARG B 1 575 ? 108.790 117.579 78.635  1.00 23.13  ? 575  ARG B CD    1 
ATOM   8452 N  NE    . ARG B 1 575 ? 108.800 118.279 77.361  1.00 23.13  ? 575  ARG B NE    1 
ATOM   8453 C  CZ    . ARG B 1 575 ? 109.505 119.379 77.134  1.00 23.13  ? 575  ARG B CZ    1 
ATOM   8454 N  NH1   . ARG B 1 575 ? 110.249 119.899 78.098  1.00 23.13  ? 575  ARG B NH1   1 
ATOM   8455 N  NH2   . ARG B 1 575 ? 109.468 119.956 75.944  1.00 23.13  ? 575  ARG B NH2   1 
ATOM   8456 N  N     . TYR B 1 576 ? 111.166 115.396 81.089  1.00 21.24  ? 576  TYR B N     1 
ATOM   8457 C  CA    . TYR B 1 576 ? 112.517 115.932 81.015  1.00 21.24  ? 576  TYR B CA    1 
ATOM   8458 C  C     . TYR B 1 576 ? 113.570 114.839 80.995  1.00 21.24  ? 576  TYR B C     1 
ATOM   8459 O  O     . TYR B 1 576 ? 114.640 115.035 80.418  1.00 21.24  ? 576  TYR B O     1 
ATOM   8460 C  CB    . TYR B 1 576 ? 112.799 116.866 82.185  1.00 21.24  ? 576  TYR B CB    1 
ATOM   8461 C  CG    . TYR B 1 576 ? 111.986 118.127 82.185  1.00 21.24  ? 576  TYR B CG    1 
ATOM   8462 C  CD1   . TYR B 1 576 ? 112.230 119.130 81.264  1.00 21.24  ? 576  TYR B CD1   1 
ATOM   8463 C  CD2   . TYR B 1 576 ? 111.021 118.342 83.143  1.00 21.24  ? 576  TYR B CD2   1 
ATOM   8464 C  CE1   . TYR B 1 576 ? 111.499 120.284 81.269  1.00 21.24  ? 576  TYR B CE1   1 
ATOM   8465 C  CE2   . TYR B 1 576 ? 110.288 119.491 83.160  1.00 21.24  ? 576  TYR B CE2   1 
ATOM   8466 C  CZ    . TYR B 1 576 ? 110.533 120.460 82.223  1.00 21.24  ? 576  TYR B CZ    1 
ATOM   8467 O  OH    . TYR B 1 576 ? 109.803 121.618 82.242  1.00 21.24  ? 576  TYR B OH    1 
ATOM   8468 N  N     . GLY B 1 577 ? 113.309 113.704 81.626  1.00 21.55  ? 577  GLY B N     1 
ATOM   8469 C  CA    . GLY B 1 577 ? 114.274 112.629 81.613  1.00 21.55  ? 577  GLY B CA    1 
ATOM   8470 C  C     . GLY B 1 577 ? 114.292 111.881 80.304  1.00 21.55  ? 577  GLY B C     1 
ATOM   8471 O  O     . GLY B 1 577 ? 115.357 111.573 79.774  1.00 21.55  ? 577  GLY B O     1 
ATOM   8472 N  N     . PHE B 1 578 ? 113.108 111.594 79.769  1.00 23.84  ? 578  PHE B N     1 
ATOM   8473 C  CA    . PHE B 1 578 ? 112.989 110.870 78.512  1.00 23.84  ? 578  PHE B CA    1 
ATOM   8474 C  C     . PHE B 1 578 ? 113.381 111.724 77.314  1.00 23.84  ? 578  PHE B C     1 
ATOM   8475 O  O     . PHE B 1 578 ? 113.792 111.176 76.290  1.00 23.84  ? 578  PHE B O     1 
ATOM   8476 C  CB    . PHE B 1 578 ? 111.561 110.338 78.401  1.00 23.84  ? 578  PHE B CB    1 
ATOM   8477 C  CG    . PHE B 1 578 ? 111.269 109.565 77.163  1.00 23.84  ? 578  PHE B CG    1 
ATOM   8478 C  CD1   . PHE B 1 578 ? 111.903 108.367 76.909  1.00 23.84  ? 578  PHE B CD1   1 
ATOM   8479 C  CD2   . PHE B 1 578 ? 110.273 109.981 76.305  1.00 23.84  ? 578  PHE B CD2   1 
ATOM   8480 C  CE1   . PHE B 1 578 ? 111.604 107.638 75.786  1.00 23.84  ? 578  PHE B CE1   1 
ATOM   8481 C  CE2   . PHE B 1 578 ? 109.970 109.253 75.188  1.00 23.84  ? 578  PHE B CE2   1 
ATOM   8482 C  CZ    . PHE B 1 578 ? 110.636 108.079 74.933  1.00 23.84  ? 578  PHE B CZ    1 
ATOM   8483 N  N     . THR B 1 579 ? 113.292 113.049 77.422  1.00 23.36  ? 579  THR B N     1 
ATOM   8484 C  CA    . THR B 1 579 ? 113.820 113.910 76.369  1.00 23.36  ? 579  THR B CA    1 
ATOM   8485 C  C     . THR B 1 579 ? 115.339 113.946 76.412  1.00 23.36  ? 579  THR B C     1 
ATOM   8486 O  O     . THR B 1 579 ? 116.001 113.959 75.369  1.00 23.36  ? 579  THR B O     1 
ATOM   8487 C  CB    . THR B 1 579 ? 113.253 115.318 76.517  1.00 23.36  ? 579  THR B CB    1 
ATOM   8488 O  OG1   . THR B 1 579 ? 111.825 115.250 76.534  1.00 23.36  ? 579  THR B OG1   1 
ATOM   8489 C  CG2   . THR B 1 579 ? 113.683 116.214 75.386  1.00 23.36  ? 579  THR B CG2   1 
ATOM   8490 N  N     . ALA B 1 580 ? 115.910 113.961 77.613  1.00 24.21  ? 580  ALA B N     1 
ATOM   8491 C  CA    . ALA B 1 580 ? 117.355 114.007 77.746  1.00 24.21  ? 580  ALA B CA    1 
ATOM   8492 C  C     . ALA B 1 580 ? 118.001 112.677 77.411  1.00 24.21  ? 580  ALA B C     1 
ATOM   8493 O  O     . ALA B 1 580 ? 119.187 112.648 77.083  1.00 24.21  ? 580  ALA B O     1 
ATOM   8494 C  CB    . ALA B 1 580 ? 117.735 114.441 79.157  1.00 24.21  ? 580  ALA B CB    1 
ATOM   8495 N  N     . LEU B 1 581 ? 117.256 111.576 77.479  1.00 26.02  ? 581  LEU B N     1 
ATOM   8496 C  CA    . LEU B 1 581 ? 117.798 110.305 77.026  1.00 26.02  ? 581  LEU B CA    1 
ATOM   8497 C  C     . LEU B 1 581 ? 117.630 110.119 75.525  1.00 26.02  ? 581  LEU B C     1 
ATOM   8498 O  O     . LEU B 1 581 ? 118.446 109.439 74.899  1.00 26.02  ? 581  LEU B O     1 
ATOM   8499 C  CB    . LEU B 1 581 ? 117.146 109.148 77.777  1.00 26.02  ? 581  LEU B CB    1 
ATOM   8500 C  CG    . LEU B 1 581 ? 117.461 109.042 79.265  1.00 26.02  ? 581  LEU B CG    1 
ATOM   8501 C  CD1   . LEU B 1 581 ? 116.737 107.874 79.846  1.00 26.02  ? 581  LEU B CD1   1 
ATOM   8502 C  CD2   . LEU B 1 581 ? 118.941 108.905 79.486  1.00 26.02  ? 581  LEU B CD2   1 
ATOM   8503 N  N     . GLN B 1 582 ? 116.586 110.705 74.935  1.00 30.41  ? 582  GLN B N     1 
ATOM   8504 C  CA    . GLN B 1 582 ? 116.453 110.703 73.482  1.00 30.41  ? 582  GLN B CA    1 
ATOM   8505 C  C     . GLN B 1 582 ? 117.495 111.589 72.819  1.00 30.41  ? 582  GLN B C     1 
ATOM   8506 O  O     . GLN B 1 582 ? 118.022 111.241 71.758  1.00 30.41  ? 582  GLN B O     1 
ATOM   8507 C  CB    . GLN B 1 582 ? 115.059 111.157 73.076  1.00 30.41  ? 582  GLN B CB    1 
ATOM   8508 C  CG    . GLN B 1 582 ? 113.997 110.110 73.161  1.00 30.41  ? 582  GLN B CG    1 
ATOM   8509 C  CD    . GLN B 1 582 ? 112.654 110.658 72.762  1.00 30.41  ? 582  GLN B CD    1 
ATOM   8510 O  OE1   . GLN B 1 582 ? 112.468 111.866 72.690  1.00 30.41  ? 582  GLN B OE1   1 
ATOM   8511 N  NE2   . GLN B 1 582 ? 111.735 109.773 72.432  1.00 30.41  ? 582  GLN B NE2   1 
ATOM   8512 N  N     . HIS B 1 583 ? 117.792 112.744 73.409  1.00 33.20  ? 583  HIS B N     1 
ATOM   8513 C  CA    . HIS B 1 583 ? 118.793 113.619 72.815  1.00 33.20  ? 583  HIS B CA    1 
ATOM   8514 C  C     . HIS B 1 583 ? 120.193 113.058 72.997  1.00 33.20  ? 583  HIS B C     1 
ATOM   8515 O  O     . HIS B 1 583 ? 121.073 113.307 72.167  1.00 33.20  ? 583  HIS B O     1 
ATOM   8516 C  CB    . HIS B 1 583 ? 118.718 115.012 73.429  1.00 33.20  ? 583  HIS B CB    1 
ATOM   8517 C  CG    . HIS B 1 583 ? 119.640 115.999 72.787  1.00 33.20  ? 583  HIS B CG    1 
ATOM   8518 N  ND1   . HIS B 1 583 ? 119.294 116.726 71.671  1.00 33.20  ? 583  HIS B ND1   1 
ATOM   8519 C  CD2   . HIS B 1 583 ? 120.924 116.321 73.062  1.00 33.20  ? 583  HIS B CD2   1 
ATOM   8520 C  CE1   . HIS B 1 583 ? 120.310 117.493 71.319  1.00 33.20  ? 583  HIS B CE1   1 
ATOM   8521 N  NE2   . HIS B 1 583 ? 121.311 117.266 72.147  1.00 33.20  ? 583  HIS B NE2   1 
ATOM   8522 N  N     . ASN B 1 584 ? 120.415 112.308 74.075  1.00 33.55  ? 584  ASN B N     1 
ATOM   8523 C  CA    . ASN B 1 584 ? 121.722 111.715 74.322  1.00 33.55  ? 584  ASN B CA    1 
ATOM   8524 C  C     . ASN B 1 584 ? 122.008 110.595 73.335  1.00 33.55  ? 584  ASN B C     1 
ATOM   8525 O  O     . ASN B 1 584 ? 123.142 110.439 72.872  1.00 33.55  ? 584  ASN B O     1 
ATOM   8526 C  CB    . ASN B 1 584 ? 121.780 111.180 75.749  1.00 33.55  ? 584  ASN B CB    1 
ATOM   8527 C  CG    . ASN B 1 584 ? 123.178 110.858 76.198  1.00 33.55  ? 584  ASN B CG    1 
ATOM   8528 O  OD1   . ASN B 1 584 ? 124.151 111.146 75.510  1.00 33.55  ? 584  ASN B OD1   1 
ATOM   8529 N  ND2   . ASN B 1 584 ? 123.285 110.223 77.352  1.00 33.55  ? 584  ASN B ND2   1 
ATOM   8530 N  N     . GLU B 1 585 ? 120.993 109.811 72.999  1.00 41.42  ? 585  GLU B N     1 
ATOM   8531 C  CA    . GLU B 1 585 ? 121.197 108.627 72.183  1.00 41.42  ? 585  GLU B CA    1 
ATOM   8532 C  C     . GLU B 1 585 ? 120.993 108.898 70.697  1.00 41.42  ? 585  GLU B C     1 
ATOM   8533 O  O     . GLU B 1 585 ? 121.780 108.437 69.867  1.00 41.42  ? 585  GLU B O     1 
ATOM   8534 C  CB    . GLU B 1 585 ? 120.260 107.518 72.644  1.00 41.42  ? 585  GLU B CB    1 
ATOM   8535 C  CG    . GLU B 1 585 ? 120.460 106.250 71.886  1.00 41.42  ? 585  GLU B CG    1 
ATOM   8536 C  CD    . GLU B 1 585 ? 119.603 105.143 72.399  1.00 41.42  ? 585  GLU B CD    1 
ATOM   8537 O  OE1   . GLU B 1 585 ? 118.841 105.379 73.352  1.00 41.42  ? 585  GLU B OE1   1 
ATOM   8538 O  OE2   . GLU B 1 585 ? 119.691 104.034 71.848  1.00 41.42  ? 585  GLU B OE2   1 
ATOM   8539 N  N     . PHE B 1 586 ? 119.964 109.657 70.337  1.00 42.78  ? 586  PHE B N     1 
ATOM   8540 C  CA    . PHE B 1 586 ? 119.650 109.807 68.926  1.00 42.78  ? 586  PHE B CA    1 
ATOM   8541 C  C     . PHE B 1 586 ? 120.341 111.005 68.290  1.00 42.78  ? 586  PHE B C     1 
ATOM   8542 O  O     . PHE B 1 586 ? 119.812 111.581 67.338  1.00 42.78  ? 586  PHE B O     1 
ATOM   8543 C  CB    . PHE B 1 586 ? 118.154 109.945 68.698  1.00 42.78  ? 586  PHE B CB    1 
ATOM   8544 C  CG    . PHE B 1 586 ? 117.354 108.733 69.030  1.00 42.78  ? 586  PHE B CG    1 
ATOM   8545 C  CD1   . PHE B 1 586 ? 117.328 107.655 68.174  1.00 42.78  ? 586  PHE B CD1   1 
ATOM   8546 C  CD2   . PHE B 1 586 ? 116.564 108.704 70.161  1.00 42.78  ? 586  PHE B CD2   1 
ATOM   8547 C  CE1   . PHE B 1 586 ? 116.568 106.553 68.468  1.00 42.78  ? 586  PHE B CE1   1 
ATOM   8548 C  CE2   . PHE B 1 586 ? 115.802 107.605 70.456  1.00 42.78  ? 586  PHE B CE2   1 
ATOM   8549 C  CZ    . PHE B 1 586 ? 115.803 106.534 69.610  1.00 42.78  ? 586  PHE B CZ    1 
ATOM   8550 N  N     . LEU B 1 587 ? 121.515 111.395 68.782  1.00 45.93  ? 587  LEU B N     1 
ATOM   8551 C  CA    . LEU B 1 587 ? 122.427 112.175 67.951  1.00 45.93  ? 587  LEU B CA    1 
ATOM   8552 C  C     . LEU B 1 587 ? 123.068 111.180 67.003  1.00 45.93  ? 587  LEU B C     1 
ATOM   8553 O  O     . LEU B 1 587 ? 122.917 109.971 67.204  1.00 45.93  ? 587  LEU B O     1 
ATOM   8554 C  CB    . LEU B 1 587 ? 123.475 112.930 68.760  1.00 45.93  ? 587  LEU B CB    1 
ATOM   8555 C  CG    . LEU B 1 587 ? 122.930 114.144 69.509  1.00 45.93  ? 587  LEU B CG    1 
ATOM   8556 C  CD1   . LEU B 1 587 ? 124.034 114.812 70.315  1.00 45.93  ? 587  LEU B CD1   1 
ATOM   8557 C  CD2   . LEU B 1 587 ? 122.282 115.124 68.542  1.00 45.93  ? 587  LEU B CD2   1 
ATOM   8558 N  N     . GLY B 1 588 ? 123.865 111.644 66.047  1.00 54.94  ? 588  GLY B N     1 
ATOM   8559 C  CA    . GLY B 1 588 ? 123.784 111.087 64.703  1.00 54.94  ? 588  GLY B CA    1 
ATOM   8560 C  C     . GLY B 1 588 ? 124.067 109.616 64.436  1.00 54.94  ? 588  GLY B C     1 
ATOM   8561 O  O     . GLY B 1 588 ? 124.935 109.244 63.650  1.00 54.94  ? 588  GLY B O     1 
ATOM   8562 N  N     . GLN B 1 589 ? 123.140 108.841 65.009  1.00 57.82  ? 589  GLN B N     1 
ATOM   8563 C  CA    . GLN B 1 589 ? 122.947 107.394 64.772  1.00 57.82  ? 589  GLN B CA    1 
ATOM   8564 C  C     . GLN B 1 589 ? 122.121 107.355 63.483  1.00 57.82  ? 589  GLN B C     1 
ATOM   8565 O  O     . GLN B 1 589 ? 121.191 108.174 63.363  1.00 57.82  ? 589  GLN B O     1 
ATOM   8566 C  CB    . GLN B 1 589 ? 122.085 106.793 65.882  1.00 57.82  ? 589  GLN B CB    1 
ATOM   8567 C  CG    . GLN B 1 589 ? 122.470 107.250 67.278  1.00 57.82  ? 589  GLN B CG    1 
ATOM   8568 C  CD    . GLN B 1 589 ? 123.466 106.318 67.917  1.00 57.82  ? 589  GLN B CD    1 
ATOM   8569 O  OE1   . GLN B 1 589 ? 124.440 106.746 68.528  1.00 57.82  ? 589  GLN B OE1   1 
ATOM   8570 N  NE2   . GLN B 1 589 ? 123.222 105.028 67.773  1.00 57.82  ? 589  GLN B NE2   1 
ATOM   8571 N  N     . ASN B 1 590 ? 122.429 106.436 62.573  1.00 66.95  ? 590  ASN B N     1 
ATOM   8572 C  CA    . ASN B 1 590 ? 121.755 106.356 61.289  1.00 66.95  ? 590  ASN B CA    1 
ATOM   8573 C  C     . ASN B 1 590 ? 121.021 105.024 61.224  1.00 66.95  ? 590  ASN B C     1 
ATOM   8574 O  O     . ASN B 1 590 ? 121.532 104.006 61.698  1.00 66.95  ? 590  ASN B O     1 
ATOM   8575 C  CB    . ASN B 1 590 ? 122.763 106.497 60.148  1.00 66.95  ? 590  ASN B CB    1 
ATOM   8576 C  CG    . ASN B 1 590 ? 122.177 107.177 58.929  1.00 66.95  ? 590  ASN B CG    1 
ATOM   8577 O  OD1   . ASN B 1 590 ? 122.910 107.617 58.045  1.00 66.95  ? 590  ASN B OD1   1 
ATOM   8578 N  ND2   . ASN B 1 590 ? 120.856 107.269 58.875  1.00 66.95  ? 590  ASN B ND2   1 
ATOM   8579 N  N     . PHE B 1 591 ? 119.818 105.033 60.652  1.00 65.61  ? 591  PHE B N     1 
ATOM   8580 C  CA    . PHE B 1 591 ? 118.944 103.870 60.737  1.00 65.61  ? 591  PHE B CA    1 
ATOM   8581 C  C     . PHE B 1 591 ? 118.596 103.319 59.359  1.00 65.61  ? 591  PHE B C     1 
ATOM   8582 O  O     . PHE B 1 591 ? 118.384 102.114 59.200  1.00 65.61  ? 591  PHE B O     1 
ATOM   8583 C  CB    . PHE B 1 591 ? 117.683 104.240 61.517  1.00 65.61  ? 591  PHE B CB    1 
ATOM   8584 C  CG    . PHE B 1 591 ? 117.955 104.616 62.946  1.00 65.61  ? 591  PHE B CG    1 
ATOM   8585 C  CD1   . PHE B 1 591 ? 118.096 103.646 63.915  1.00 65.61  ? 591  PHE B CD1   1 
ATOM   8586 C  CD2   . PHE B 1 591 ? 118.100 105.936 63.315  1.00 65.61  ? 591  PHE B CD2   1 
ATOM   8587 C  CE1   . PHE B 1 591 ? 118.355 103.996 65.222  1.00 65.61  ? 591  PHE B CE1   1 
ATOM   8588 C  CE2   . PHE B 1 591 ? 118.360 106.279 64.628  1.00 65.61  ? 591  PHE B CE2   1 
ATOM   8589 C  CZ    . PHE B 1 591 ? 118.487 105.310 65.575  1.00 65.61  ? 591  PHE B CZ    1 
ATOM   8590 N  N     . CYS B 1 592 ? 118.535 104.193 58.364  1.00 85.95  ? 592  CYS B N     1 
ATOM   8591 C  CA    . CYS B 1 592 ? 118.343 103.843 56.953  1.00 85.95  ? 592  CYS B CA    1 
ATOM   8592 C  C     . CYS B 1 592 ? 119.443 103.096 56.178  1.00 85.95  ? 592  CYS B C     1 
ATOM   8593 O  O     . CYS B 1 592 ? 119.078 102.437 55.195  1.00 85.95  ? 592  CYS B O     1 
ATOM   8594 C  CB    . CYS B 1 592 ? 118.013 105.109 56.163  1.00 85.95  ? 592  CYS B CB    1 
ATOM   8595 S  SG    . CYS B 1 592 ? 116.352 105.743 56.437  1.00 85.95  ? 592  CYS B SG    1 
ATOM   8596 N  N     . PRO B 1 593 ? 120.755 103.200 56.475  1.00 89.21  ? 593  PRO B N     1 
ATOM   8597 C  CA    . PRO B 1 593 ? 121.736 102.417 55.695  1.00 89.21  ? 593  PRO B CA    1 
ATOM   8598 C  C     . PRO B 1 593 ? 121.552 100.910 55.821  1.00 89.21  ? 593  PRO B C     1 
ATOM   8599 O  O     . PRO B 1 593 ? 120.964 100.412 56.784  1.00 89.21  ? 593  PRO B O     1 
ATOM   8600 C  CB    . PRO B 1 593 ? 123.085 102.868 56.264  1.00 89.21  ? 593  PRO B CB    1 
ATOM   8601 C  CG    . PRO B 1 593 ? 122.851 104.233 56.667  1.00 89.21  ? 593  PRO B CG    1 
ATOM   8602 C  CD    . PRO B 1 593 ? 121.467 104.259 57.220  1.00 89.21  ? 593  PRO B CD    1 
ATOM   8603 N  N     . GLY B 1 594 ? 122.067 100.194 54.825  1.00 98.30  ? 594  GLY B N     1 
ATOM   8604 C  CA    . GLY B 1 594 ? 121.630 98.845  54.517  1.00 98.30  ? 594  GLY B CA    1 
ATOM   8605 C  C     . GLY B 1 594 ? 120.707 98.959  53.315  1.00 98.30  ? 594  GLY B C     1 
ATOM   8606 O  O     . GLY B 1 594 ? 120.108 97.987  52.857  1.00 98.30  ? 594  GLY B O     1 
ATOM   8607 N  N     . LEU B 1 595 ? 120.614 100.187 52.811  1.00 104.91 ? 595  LEU B N     1 
ATOM   8608 C  CA    . LEU B 1 595 ? 119.673 100.582 51.766  1.00 104.91 ? 595  LEU B CA    1 
ATOM   8609 C  C     . LEU B 1 595 ? 119.938 100.033 50.359  1.00 104.91 ? 595  LEU B C     1 
ATOM   8610 O  O     . LEU B 1 595 ? 121.038 99.580  50.042  1.00 104.91 ? 595  LEU B O     1 
ATOM   8611 C  CB    . LEU B 1 595 ? 119.617 102.115 51.724  1.00 104.91 ? 595  LEU B CB    1 
ATOM   8612 C  CG    . LEU B 1 595 ? 120.918 102.938 51.664  1.00 104.91 ? 595  LEU B CG    1 
ATOM   8613 C  CD1   . LEU B 1 595 ? 121.467 103.169 50.253  1.00 104.91 ? 595  LEU B CD1   1 
ATOM   8614 C  CD2   . LEU B 1 595 ? 120.724 104.270 52.382  1.00 104.91 ? 595  LEU B CD2   1 
ATOM   8615 N  N     . ASN B 1 596 ? 118.902 100.091 49.522  1.00 112.14 ? 596  ASN B N     1 
ATOM   8616 C  CA    . ASN B 1 596 ? 118.979 99.697  48.118  1.00 112.14 ? 596  ASN B CA    1 
ATOM   8617 C  C     . ASN B 1 596 ? 119.262 100.963 47.316  1.00 112.14 ? 596  ASN B C     1 
ATOM   8618 O  O     . ASN B 1 596 ? 119.452 102.027 47.913  1.00 112.14 ? 596  ASN B O     1 
ATOM   8619 C  CB    . ASN B 1 596 ? 117.674 99.017  47.680  1.00 112.14 ? 596  ASN B CB    1 
ATOM   8620 C  CG    . ASN B 1 596 ? 117.842 98.143  46.446  1.00 112.14 ? 596  ASN B CG    1 
ATOM   8621 O  OD1   . ASN B 1 596 ? 118.926 98.066  45.868  1.00 112.14 ? 596  ASN B OD1   1 
ATOM   8622 N  ND2   . ASN B 1 596 ? 116.767 97.473  46.044  1.00 112.14 ? 596  ASN B ND2   1 
ATOM   8623 N  N     . ALA B 1 597 ? 119.308 100.847 45.984  1.00 115.38 ? 597  ALA B N     1 
ATOM   8624 C  CA    . ALA B 1 597 ? 119.651 101.946 45.060  1.00 115.38 ? 597  ALA B CA    1 
ATOM   8625 C  C     . ALA B 1 597 ? 118.828 103.226 45.243  1.00 115.38 ? 597  ALA B C     1 
ATOM   8626 O  O     . ALA B 1 597 ? 119.379 104.278 45.569  1.00 115.38 ? 597  ALA B O     1 
ATOM   8627 C  CB    . ALA B 1 597 ? 119.524 101.462 43.625  1.00 115.38 ? 597  ALA B CB    1 
ATOM   8628 N  N     . THR B 1 598 ? 117.512 103.132 45.049  1.00 117.78 ? 598  THR B N     1 
ATOM   8629 C  CA    . THR B 1 598 ? 116.599 104.203 45.441  1.00 117.78 ? 598  THR B CA    1 
ATOM   8630 C  C     . THR B 1 598 ? 116.417 104.077 46.945  1.00 117.78 ? 598  THR B C     1 
ATOM   8631 O  O     . THR B 1 598 ? 116.691 103.009 47.503  1.00 117.78 ? 598  THR B O     1 
ATOM   8632 C  CB    . THR B 1 598 ? 115.262 104.123 44.702  1.00 117.78 ? 598  THR B CB    1 
ATOM   8633 O  OG1   . THR B 1 598 ? 114.642 102.855 44.956  1.00 117.78 ? 598  THR B OG1   1 
ATOM   8634 C  CG2   . THR B 1 598 ? 115.467 104.306 43.203  1.00 117.78 ? 598  THR B CG2   1 
ATOM   8635 N  N     . GLY B 1 599 ? 115.921 105.141 47.580  1.00 115.69 ? 599  GLY B N     1 
ATOM   8636 C  CA    . GLY B 1 599 ? 116.183 105.437 48.985  1.00 115.69 ? 599  GLY B CA    1 
ATOM   8637 C  C     . GLY B 1 599 ? 116.128 104.384 50.079  1.00 115.69 ? 599  GLY B C     1 
ATOM   8638 O  O     . GLY B 1 599 ? 117.181 103.990 50.569  1.00 115.69 ? 599  GLY B O     1 
ATOM   8639 N  N     . ASN B 1 600 ? 114.949 103.910 50.459  1.00 112.77 ? 600  ASN B N     1 
ATOM   8640 C  CA    . ASN B 1 600 ? 114.947 102.793 51.402  1.00 112.77 ? 600  ASN B CA    1 
ATOM   8641 C  C     . ASN B 1 600 ? 113.991 101.671 51.031  1.00 112.77 ? 600  ASN B C     1 
ATOM   8642 O  O     . ASN B 1 600 ? 114.348 100.497 51.168  1.00 112.77 ? 600  ASN B O     1 
ATOM   8643 C  CB    . ASN B 1 600 ? 114.602 103.315 52.799  1.00 112.77 ? 600  ASN B CB    1 
ATOM   8644 C  CG    . ASN B 1 600 ? 115.722 104.118 53.409  1.00 112.77 ? 600  ASN B CG    1 
ATOM   8645 O  OD1   . ASN B 1 600 ? 116.878 103.698 53.402  1.00 112.77 ? 600  ASN B OD1   1 
ATOM   8646 N  ND2   . ASN B 1 600 ? 115.393 105.299 53.913  1.00 112.77 ? 600  ASN B ND2   1 
ATOM   8647 N  N     . ASN B 1 601 ? 112.776 102.011 50.590  1.00 119.39 ? 601  ASN B N     1 
ATOM   8648 C  CA    . ASN B 1 601 ? 111.600 101.189 50.292  1.00 119.39 ? 601  ASN B CA    1 
ATOM   8649 C  C     . ASN B 1 601 ? 111.023 100.301 51.406  1.00 119.39 ? 601  ASN B C     1 
ATOM   8650 O  O     . ASN B 1 601 ? 110.663 99.151  51.123  1.00 119.39 ? 601  ASN B O     1 
ATOM   8651 C  CB    . ASN B 1 601 ? 111.900 100.300 49.078  1.00 119.39 ? 601  ASN B CB    1 
ATOM   8652 C  CG    . ASN B 1 601 ? 112.156 101.103 47.816  1.00 119.39 ? 601  ASN B CG    1 
ATOM   8653 O  OD1   . ASN B 1 601 ? 113.260 101.091 47.270  1.00 119.39 ? 601  ASN B OD1   1 
ATOM   8654 N  ND2   . ASN B 1 601 ? 111.133 101.807 47.346  1.00 119.39 ? 601  ASN B ND2   1 
ATOM   8655 N  N     . PRO B 1 602 ? 110.905 100.755 52.657  1.00 122.93 ? 602  PRO B N     1 
ATOM   8656 C  CA    . PRO B 1 602 ? 109.655 100.556 53.391  1.00 122.93 ? 602  PRO B CA    1 
ATOM   8657 C  C     . PRO B 1 602 ? 108.812 101.819 53.261  1.00 122.93 ? 602  PRO B C     1 
ATOM   8658 O  O     . PRO B 1 602 ? 109.237 102.819 52.679  1.00 122.93 ? 602  PRO B O     1 
ATOM   8659 C  CB    . PRO B 1 602 ? 110.108 100.340 54.843  1.00 122.93 ? 602  PRO B CB    1 
ATOM   8660 C  CG    . PRO B 1 602 ? 111.515 99.955  54.747  1.00 122.93 ? 602  PRO B CG    1 
ATOM   8661 C  CD    . PRO B 1 602 ? 112.031 100.762 53.607  1.00 122.93 ? 602  PRO B CD    1 
ATOM   8662 N  N     . CYS B 1 603 ? 107.599 101.761 53.805  1.00 127.42 ? 603  CYS B N     1 
ATOM   8663 C  CA    . CYS B 1 603 ? 106.691 102.895 53.657  1.00 127.42 ? 603  CYS B CA    1 
ATOM   8664 C  C     . CYS B 1 603 ? 106.018 103.301 54.969  1.00 127.42 ? 603  CYS B C     1 
ATOM   8665 O  O     . CYS B 1 603 ? 104.905 102.863 55.272  1.00 127.42 ? 603  CYS B O     1 
ATOM   8666 C  CB    . CYS B 1 603 ? 105.646 102.588 52.585  1.00 127.42 ? 603  CYS B CB    1 
ATOM   8667 S  SG    . CYS B 1 603 ? 104.603 104.003 52.170  1.00 127.42 ? 603  CYS B SG    1 
ATOM   8668 N  N     . ASN B 1 604 ? 106.706 104.129 55.756  1.00 123.84 ? 604  ASN B N     1 
ATOM   8669 C  CA    . ASN B 1 604 ? 106.067 105.296 56.351  1.00 123.84 ? 604  ASN B CA    1 
ATOM   8670 C  C     . ASN B 1 604 ? 106.359 106.510 55.487  1.00 123.84 ? 604  ASN B C     1 
ATOM   8671 O  O     . ASN B 1 604 ? 105.453 107.042 54.834  1.00 123.84 ? 604  ASN B O     1 
ATOM   8672 C  CB    . ASN B 1 604 ? 106.577 105.514 57.786  1.00 123.84 ? 604  ASN B CB    1 
ATOM   8673 C  CG    . ASN B 1 604 ? 105.748 106.519 58.565  1.00 123.84 ? 604  ASN B CG    1 
ATOM   8674 O  OD1   . ASN B 1 604 ? 104.748 107.040 58.074  1.00 123.84 ? 604  ASN B OD1   1 
ATOM   8675 N  ND2   . ASN B 1 604 ? 106.173 106.803 59.791  1.00 123.84 ? 604  ASN B ND2   1 
ATOM   8676 N  N     . TYR B 1 605 ? 107.608 106.961 55.477  1.00 118.22 ? 605  TYR B N     1 
ATOM   8677 C  CA    . TYR B 1 605 ? 108.461 106.803 54.313  1.00 118.22 ? 605  TYR B CA    1 
ATOM   8678 C  C     . TYR B 1 605 ? 109.687 106.108 54.883  1.00 118.22 ? 605  TYR B C     1 
ATOM   8679 O  O     . TYR B 1 605 ? 110.027 104.988 54.495  1.00 118.22 ? 605  TYR B O     1 
ATOM   8680 C  CB    . TYR B 1 605 ? 108.837 108.109 53.624  1.00 118.22 ? 605  TYR B CB    1 
ATOM   8681 C  CG    . TYR B 1 605 ? 109.707 107.849 52.413  1.00 118.22 ? 605  TYR B CG    1 
ATOM   8682 C  CD1   . TYR B 1 605 ? 109.159 107.335 51.243  1.00 118.22 ? 605  TYR B CD1   1 
ATOM   8683 C  CD2   . TYR B 1 605 ? 111.079 108.080 52.449  1.00 118.22 ? 605  TYR B CD2   1 
ATOM   8684 C  CE1   . TYR B 1 605 ? 109.947 107.077 50.136  1.00 118.22 ? 605  TYR B CE1   1 
ATOM   8685 C  CE2   . TYR B 1 605 ? 111.877 107.824 51.345  1.00 118.22 ? 605  TYR B CE2   1 
ATOM   8686 C  CZ    . TYR B 1 605 ? 111.303 107.324 50.192  1.00 118.22 ? 605  TYR B CZ    1 
ATOM   8687 O  OH    . TYR B 1 605 ? 112.086 107.069 49.090  1.00 118.22 ? 605  TYR B OH    1 
ATOM   8688 N  N     . ALA B 1 606 ? 110.274 106.804 55.863  1.00 101.21 ? 606  ALA B N     1 
ATOM   8689 C  CA    . ALA B 1 606 ? 111.407 106.386 56.682  1.00 101.21 ? 606  ALA B CA    1 
ATOM   8690 C  C     . ALA B 1 606 ? 111.682 107.496 57.688  1.00 101.21 ? 606  ALA B C     1 
ATOM   8691 O  O     . ALA B 1 606 ? 111.178 108.614 57.561  1.00 101.21 ? 606  ALA B O     1 
ATOM   8692 C  CB    . ALA B 1 606 ? 112.672 106.116 55.857  1.00 101.21 ? 606  ALA B CB    1 
ATOM   8693 N  N     . THR B 1 607 ? 112.498 107.174 58.688  1.00 82.23  ? 607  THR B N     1 
ATOM   8694 C  CA    . THR B 1 607 ? 113.137 108.160 59.561  1.00 82.23  ? 607  THR B CA    1 
ATOM   8695 C  C     . THR B 1 607 ? 114.611 107.775 59.626  1.00 82.23  ? 607  THR B C     1 
ATOM   8696 O  O     . THR B 1 607 ? 115.005 106.953 60.458  1.00 82.23  ? 607  THR B O     1 
ATOM   8697 C  CB    . THR B 1 607 ? 112.502 108.201 60.950  1.00 82.23  ? 607  THR B CB    1 
ATOM   8698 O  OG1   . THR B 1 607 ? 112.451 106.878 61.493  1.00 82.23  ? 607  THR B OG1   1 
ATOM   8699 C  CG2   . THR B 1 607 ? 111.101 108.800 60.910  1.00 82.23  ? 607  THR B CG2   1 
ATOM   8700 N  N     . CYS B 1 608 ? 115.418 108.380 58.753  1.00 74.95  ? 608  CYS B N     1 
ATOM   8701 C  CA    . CYS B 1 608 ? 116.755 107.861 58.477  1.00 74.95  ? 608  CYS B CA    1 
ATOM   8702 C  C     . CYS B 1 608 ? 117.729 108.156 59.608  1.00 74.95  ? 608  CYS B C     1 
ATOM   8703 O  O     . CYS B 1 608 ? 118.251 107.236 60.246  1.00 74.95  ? 608  CYS B O     1 
ATOM   8704 C  CB    . CYS B 1 608 ? 117.267 108.433 57.156  1.00 74.95  ? 608  CYS B CB    1 
ATOM   8705 S  SG    . CYS B 1 608 ? 116.463 107.661 55.768  1.00 74.95  ? 608  CYS B SG    1 
ATOM   8706 N  N     . THR B 1 609 ? 117.994 109.427 59.869  1.00 63.97  ? 609  THR B N     1 
ATOM   8707 C  CA    . THR B 1 609 ? 118.941 109.758 60.916  1.00 63.97  ? 609  THR B CA    1 
ATOM   8708 C  C     . THR B 1 609 ? 118.205 110.018 62.225  1.00 63.97  ? 609  THR B C     1 
ATOM   8709 O  O     . THR B 1 609 ? 116.985 110.184 62.264  1.00 63.97  ? 609  THR B O     1 
ATOM   8710 C  CB    . THR B 1 609 ? 119.793 110.963 60.512  1.00 63.97  ? 609  THR B CB    1 
ATOM   8711 O  OG1   . THR B 1 609 ? 120.810 111.179 61.499  1.00 63.97  ? 609  THR B OG1   1 
ATOM   8712 C  CG2   . THR B 1 609 ? 118.945 112.204 60.387  1.00 63.97  ? 609  THR B CG2   1 
ATOM   8713 N  N     . GLY B 1 610 ? 118.968 110.022 63.317  1.00 56.50  ? 610  GLY B N     1 
ATOM   8714 C  CA    . GLY B 1 610 ? 118.391 110.319 64.613  1.00 56.50  ? 610  GLY B CA    1 
ATOM   8715 C  C     . GLY B 1 610 ? 117.974 111.763 64.780  1.00 56.50  ? 610  GLY B C     1 
ATOM   8716 O  O     . GLY B 1 610 ? 117.146 112.060 65.645  1.00 56.50  ? 610  GLY B O     1 
ATOM   8717 N  N     . GLU B 1 611 ? 118.528 112.667 63.972  1.00 55.75  ? 611  GLU B N     1 
ATOM   8718 C  CA    . GLU B 1 611 ? 118.144 114.070 64.055  1.00 55.75  ? 611  GLU B CA    1 
ATOM   8719 C  C     . GLU B 1 611 ? 116.744 114.295 63.502  1.00 55.75  ? 611  GLU B C     1 
ATOM   8720 O  O     . GLU B 1 611 ? 116.023 115.179 63.974  1.00 55.75  ? 611  GLU B O     1 
ATOM   8721 C  CB    . GLU B 1 611 ? 119.159 114.933 63.317  1.00 55.75  ? 611  GLU B CB    1 
ATOM   8722 C  CG    . GLU B 1 611 ? 120.531 114.942 63.955  1.00 55.75  ? 611  GLU B CG    1 
ATOM   8723 C  CD    . GLU B 1 611 ? 121.521 115.812 63.207  1.00 55.75  ? 611  GLU B CD    1 
ATOM   8724 O  OE1   . GLU B 1 611 ? 121.179 116.301 62.107  1.00 55.75  ? 611  GLU B OE1   1 
ATOM   8725 O  OE2   . GLU B 1 611 ? 122.640 116.010 63.723  1.00 55.75  ? 611  GLU B OE2   1 
ATOM   8726 N  N     . GLU B 1 612 ? 116.339 113.512 62.500  1.00 57.50  ? 612  GLU B N     1 
ATOM   8727 C  CA    . GLU B 1 612 ? 114.977 113.613 61.985  1.00 57.50  ? 612  GLU B CA    1 
ATOM   8728 C  C     . GLU B 1 612 ? 113.946 113.102 62.976  1.00 57.50  ? 612  GLU B C     1 
ATOM   8729 O  O     . GLU B 1 612 ? 112.779 113.493 62.891  1.00 57.50  ? 612  GLU B O     1 
ATOM   8730 C  CB    . GLU B 1 612 ? 114.837 112.845 60.674  1.00 57.50  ? 612  GLU B CB    1 
ATOM   8731 C  CG    . GLU B 1 612 ? 115.575 113.457 59.504  1.00 57.50  ? 612  GLU B CG    1 
ATOM   8732 C  CD    . GLU B 1 612 ? 115.443 112.627 58.244  1.00 57.50  ? 612  GLU B CD    1 
ATOM   8733 O  OE1   . GLU B 1 612 ? 114.870 111.521 58.319  1.00 57.50  ? 612  GLU B OE1   1 
ATOM   8734 O  OE2   . GLU B 1 612 ? 115.916 113.074 57.178  1.00 57.50  ? 612  GLU B OE2   1 
ATOM   8735 N  N     . TYR B 1 613 ? 114.345 112.233 63.905  1.00 49.65  ? 613  TYR B N     1 
ATOM   8736 C  CA    . TYR B 1 613 ? 113.413 111.773 64.925  1.00 49.65  ? 613  TYR B CA    1 
ATOM   8737 C  C     . TYR B 1 613 ? 113.169 112.854 65.969  1.00 49.65  ? 613  TYR B C     1 
ATOM   8738 O  O     . TYR B 1 613 ? 112.058 112.982 66.489  1.00 49.65  ? 613  TYR B O     1 
ATOM   8739 C  CB    . TYR B 1 613 ? 113.942 110.496 65.572  1.00 49.65  ? 613  TYR B CB    1 
ATOM   8740 C  CG    . TYR B 1 613 ? 113.010 109.900 66.595  1.00 49.65  ? 613  TYR B CG    1 
ATOM   8741 C  CD1   . TYR B 1 613 ? 111.828 109.294 66.205  1.00 49.65  ? 613  TYR B CD1   1 
ATOM   8742 C  CD2   . TYR B 1 613 ? 113.323 109.920 67.945  1.00 49.65  ? 613  TYR B CD2   1 
ATOM   8743 C  CE1   . TYR B 1 613 ? 110.973 108.743 67.130  1.00 49.65  ? 613  TYR B CE1   1 
ATOM   8744 C  CE2   . TYR B 1 613 ? 112.474 109.370 68.879  1.00 49.65  ? 613  TYR B CE2   1 
ATOM   8745 C  CZ    . TYR B 1 613 ? 111.301 108.783 68.464  1.00 49.65  ? 613  TYR B CZ    1 
ATOM   8746 O  OH    . TYR B 1 613 ? 110.442 108.233 69.383  1.00 49.65  ? 613  TYR B OH    1 
ATOM   8747 N  N     . LEU B 1 614 ? 114.188 113.658 66.268  1.00 46.80  ? 614  LEU B N     1 
ATOM   8748 C  CA    . LEU B 1 614 ? 114.061 114.711 67.270  1.00 46.80  ? 614  LEU B CA    1 
ATOM   8749 C  C     . LEU B 1 614 ? 113.314 115.927 66.745  1.00 46.80  ? 614  LEU B C     1 
ATOM   8750 O  O     . LEU B 1 614 ? 112.699 116.655 67.531  1.00 46.80  ? 614  LEU B O     1 
ATOM   8751 C  CB    . LEU B 1 614 ? 115.444 115.125 67.770  1.00 46.80  ? 614  LEU B CB    1 
ATOM   8752 C  CG    . LEU B 1 614 ? 116.021 114.433 69.005  1.00 46.80  ? 614  LEU B CG    1 
ATOM   8753 C  CD1   . LEU B 1 614 ? 116.225 112.983 68.794  1.00 46.80  ? 614  LEU B CD1   1 
ATOM   8754 C  CD2   . LEU B 1 614 ? 117.341 115.070 69.352  1.00 46.80  ? 614  LEU B CD2   1 
ATOM   8755 N  N     . VAL B 1 615 ? 113.377 116.178 65.439  1.00 50.99  ? 615  VAL B N     1 
ATOM   8756 C  CA    . VAL B 1 615 ? 112.569 117.239 64.851  1.00 50.99  ? 615  VAL B CA    1 
ATOM   8757 C  C     . VAL B 1 615 ? 111.094 116.860 64.903  1.00 50.99  ? 615  VAL B C     1 
ATOM   8758 O  O     . VAL B 1 615 ? 110.228 117.706 65.157  1.00 50.99  ? 615  VAL B O     1 
ATOM   8759 C  CB    . VAL B 1 615 ? 113.056 117.528 63.417  1.00 50.99  ? 615  VAL B CB    1 
ATOM   8760 C  CG1   . VAL B 1 615 ? 112.166 118.536 62.708  1.00 50.99  ? 615  VAL B CG1   1 
ATOM   8761 C  CG2   . VAL B 1 615 ? 114.479 118.040 63.449  1.00 50.99  ? 615  VAL B CG2   1 
ATOM   8762 N  N     . LYS B 1 616 ? 110.791 115.573 64.713  1.00 51.44  ? 616  LYS B N     1 
ATOM   8763 C  CA    . LYS B 1 616 ? 109.415 115.100 64.820  1.00 51.44  ? 616  LYS B CA    1 
ATOM   8764 C  C     . LYS B 1 616 ? 108.912 115.154 66.258  1.00 51.44  ? 616  LYS B C     1 
ATOM   8765 O  O     . LYS B 1 616 ? 107.742 115.471 66.493  1.00 51.44  ? 616  LYS B O     1 
ATOM   8766 C  CB    . LYS B 1 616 ? 109.313 113.677 64.267  1.00 51.44  ? 616  LYS B CB    1 
ATOM   8767 C  CG    . LYS B 1 616 ? 107.902 113.113 64.229  1.00 51.44  ? 616  LYS B CG    1 
ATOM   8768 C  CD    . LYS B 1 616 ? 107.863 111.753 63.553  1.00 51.44  ? 616  LYS B CD    1 
ATOM   8769 C  CE    . LYS B 1 616 ? 108.459 110.674 64.440  1.00 51.44  ? 616  LYS B CE    1 
ATOM   8770 N  NZ    . LYS B 1 616 ? 107.611 110.397 65.632  1.00 51.44  ? 616  LYS B NZ    1 
ATOM   8771 N  N     . GLN B 1 617 ? 109.779 114.866 67.228  1.00 48.05  ? 617  GLN B N     1 
ATOM   8772 C  CA    . GLN B 1 617 ? 109.391 114.949 68.629  1.00 48.05  ? 617  GLN B CA    1 
ATOM   8773 C  C     . GLN B 1 617 ? 109.347 116.380 69.143  1.00 48.05  ? 617  GLN B C     1 
ATOM   8774 O  O     . GLN B 1 617 ? 108.627 116.655 70.108  1.00 48.05  ? 617  GLN B O     1 
ATOM   8775 C  CB    . GLN B 1 617 ? 110.353 114.134 69.495  1.00 48.05  ? 617  GLN B CB    1 
ATOM   8776 C  CG    . GLN B 1 617 ? 110.327 112.653 69.233  1.00 48.05  ? 617  GLN B CG    1 
ATOM   8777 C  CD    . GLN B 1 617 ? 108.983 112.040 69.521  1.00 48.05  ? 617  GLN B CD    1 
ATOM   8778 O  OE1   . GLN B 1 617 ? 108.258 111.653 68.608  1.00 48.05  ? 617  GLN B OE1   1 
ATOM   8779 N  NE2   . GLN B 1 617 ? 108.642 111.938 70.799  1.00 48.05  ? 617  GLN B NE2   1 
ATOM   8780 N  N     . GLY B 1 618 ? 110.093 117.293 68.529  1.00 47.28  ? 618  GLY B N     1 
ATOM   8781 C  CA    . GLY B 1 618 ? 110.149 118.657 69.006  1.00 47.28  ? 618  GLY B CA    1 
ATOM   8782 C  C     . GLY B 1 618 ? 111.281 118.939 69.962  1.00 47.28  ? 618  GLY B C     1 
ATOM   8783 O  O     . GLY B 1 618 ? 111.084 119.663 70.944  1.00 47.28  ? 618  GLY B O     1 
ATOM   8784 N  N     . ILE B 1 619 ? 112.463 118.391 69.709  1.00 41.29  ? 619  ILE B N     1 
ATOM   8785 C  CA    . ILE B 1 619 ? 113.608 118.511 70.600  1.00 41.29  ? 619  ILE B CA    1 
ATOM   8786 C  C     . ILE B 1 619 ? 114.676 119.331 69.896  1.00 41.29  ? 619  ILE B C     1 
ATOM   8787 O  O     . ILE B 1 619 ? 114.922 119.142 68.700  1.00 41.29  ? 619  ILE B O     1 
ATOM   8788 C  CB    . ILE B 1 619 ? 114.131 117.115 70.989  1.00 41.29  ? 619  ILE B CB    1 
ATOM   8789 C  CG1   . ILE B 1 619 ? 113.033 116.335 71.694  1.00 41.29  ? 619  ILE B CG1   1 
ATOM   8790 C  CG2   . ILE B 1 619 ? 115.329 117.197 71.903  1.00 41.29  ? 619  ILE B CG2   1 
ATOM   8791 C  CD1   . ILE B 1 619 ? 113.357 114.897 71.864  1.00 41.29  ? 619  ILE B CD1   1 
ATOM   8792 N  N     . ASP B 1 620 ? 115.286 120.263 70.629  1.00 41.09  ? 620  ASP B N     1 
ATOM   8793 C  CA    . ASP B 1 620 ? 116.385 121.046 70.083  1.00 41.09  ? 620  ASP B CA    1 
ATOM   8794 C  C     . ASP B 1 620 ? 117.579 120.150 69.794  1.00 41.09  ? 620  ASP B C     1 
ATOM   8795 O  O     . ASP B 1 620 ? 117.919 119.273 70.587  1.00 41.09  ? 620  ASP B O     1 
ATOM   8796 C  CB    . ASP B 1 620 ? 116.792 122.146 71.062  1.00 41.09  ? 620  ASP B CB    1 
ATOM   8797 C  CG    . ASP B 1 620 ? 115.742 123.222 71.202  1.00 41.09  ? 620  ASP B CG    1 
ATOM   8798 O  OD1   . ASP B 1 620 ? 115.003 123.462 70.225  1.00 41.09  ? 620  ASP B OD1   1 
ATOM   8799 O  OD2   . ASP B 1 620 ? 115.657 123.830 72.289  1.00 41.09  ? 620  ASP B OD2   1 
ATOM   8800 N  N     . LEU B 1 621 ? 118.203 120.361 68.641  1.00 42.18  ? 621  LEU B N     1 
ATOM   8801 C  CA    . LEU B 1 621 ? 119.395 119.621 68.256  1.00 42.18  ? 621  LEU B CA    1 
ATOM   8802 C  C     . LEU B 1 621 ? 120.669 120.251 68.796  1.00 42.18  ? 621  LEU B C     1 
ATOM   8803 O  O     . LEU B 1 621 ? 121.748 119.673 68.640  1.00 42.18  ? 621  LEU B O     1 
ATOM   8804 C  CB    . LEU B 1 621 ? 119.478 119.516 66.734  1.00 42.18  ? 621  LEU B CB    1 
ATOM   8805 C  CG    . LEU B 1 621 ? 118.361 118.710 66.075  1.00 42.18  ? 621  LEU B CG    1 
ATOM   8806 C  CD1   . LEU B 1 621 ? 118.453 118.799 64.564  1.00 42.18  ? 621  LEU B CD1   1 
ATOM   8807 C  CD2   . LEU B 1 621 ? 118.429 117.274 66.530  1.00 42.18  ? 621  LEU B CD2   1 
ATOM   8808 N  N     . SER B 1 622 ? 120.562 121.417 69.424  1.00 38.08  ? 622  SER B N     1 
ATOM   8809 C  CA    . SER B 1 622 ? 121.693 122.088 70.031  1.00 38.08  ? 622  SER B CA    1 
ATOM   8810 C  C     . SER B 1 622 ? 122.147 121.324 71.275  1.00 38.08  ? 622  SER B C     1 
ATOM   8811 O  O     . SER B 1 622 ? 121.415 120.476 71.787  1.00 38.08  ? 622  SER B O     1 
ATOM   8812 C  CB    . SER B 1 622 ? 121.296 123.523 70.383  1.00 38.08  ? 622  SER B CB    1 
ATOM   8813 O  OG    . SER B 1 622 ? 120.281 123.544 71.370  1.00 38.08  ? 622  SER B OG    1 
ATOM   8814 N  N     . PRO B 1 623 ? 123.360 121.588 71.780  1.00 34.59  ? 623  PRO B N     1 
ATOM   8815 C  CA    . PRO B 1 623 ? 123.723 121.028 73.091  1.00 34.59  ? 623  PRO B CA    1 
ATOM   8816 C  C     . PRO B 1 623 ? 122.953 121.635 74.249  1.00 34.59  ? 623  PRO B C     1 
ATOM   8817 O  O     . PRO B 1 623 ? 122.968 121.057 75.341  1.00 34.59  ? 623  PRO B O     1 
ATOM   8818 C  CB    . PRO B 1 623 ? 125.224 121.318 73.202  1.00 34.59  ? 623  PRO B CB    1 
ATOM   8819 C  CG    . PRO B 1 623 ? 125.468 122.434 72.269  1.00 34.59  ? 623  PRO B CG    1 
ATOM   8820 C  CD    . PRO B 1 623 ? 124.526 122.212 71.130  1.00 34.59  ? 623  PRO B CD    1 
ATOM   8821 N  N     . TRP B 1 624 ? 122.283 122.774 74.057  1.00 31.65  ? 624  TRP B N     1 
ATOM   8822 C  CA    . TRP B 1 624 ? 121.378 123.262 75.089  1.00 31.65  ? 624  TRP B CA    1 
ATOM   8823 C  C     . TRP B 1 624 ? 120.125 122.407 75.181  1.00 31.65  ? 624  TRP B C     1 
ATOM   8824 O  O     . TRP B 1 624 ? 119.531 122.307 76.255  1.00 31.65  ? 624  TRP B O     1 
ATOM   8825 C  CB    . TRP B 1 624 ? 121.007 124.724 74.842  1.00 31.65  ? 624  TRP B CB    1 
ATOM   8826 C  CG    . TRP B 1 624 ? 120.078 125.262 75.885  1.00 31.65  ? 624  TRP B CG    1 
ATOM   8827 C  CD1   . TRP B 1 624 ? 118.757 125.548 75.734  1.00 31.65  ? 624  TRP B CD1   1 
ATOM   8828 C  CD2   . TRP B 1 624 ? 120.386 125.506 77.262  1.00 31.65  ? 624  TRP B CD2   1 
ATOM   8829 N  NE1   . TRP B 1 624 ? 118.230 125.990 76.921  1.00 31.65  ? 624  TRP B NE1   1 
ATOM   8830 C  CE2   . TRP B 1 624 ? 119.211 125.971 77.876  1.00 31.65  ? 624  TRP B CE2   1 
ATOM   8831 C  CE3   . TRP B 1 624 ? 121.548 125.394 78.030  1.00 31.65  ? 624  TRP B CE3   1 
ATOM   8832 C  CZ2   . TRP B 1 624 ? 119.161 126.320 79.220  1.00 31.65  ? 624  TRP B CZ2   1 
ATOM   8833 C  CZ3   . TRP B 1 624 ? 121.498 125.742 79.361  1.00 31.65  ? 624  TRP B CZ3   1 
ATOM   8834 C  CH2   . TRP B 1 624 ? 120.313 126.200 79.943  1.00 31.65  ? 624  TRP B CH2   1 
ATOM   8835 N  N     . GLY B 1 625 ? 119.732 121.745 74.090  1.00 30.74  ? 625  GLY B N     1 
ATOM   8836 C  CA    . GLY B 1 625 ? 118.559 120.886 74.116  1.00 30.74  ? 625  GLY B CA    1 
ATOM   8837 C  C     . GLY B 1 625 ? 118.700 119.661 74.995  1.00 30.74  ? 625  GLY B C     1 
ATOM   8838 O  O     . GLY B 1 625 ? 117.693 119.033 75.332  1.00 30.74  ? 625  GLY B O     1 
ATOM   8839 N  N     . LEU B 1 626 ? 119.927 119.308 75.369  1.00 25.51  ? 626  LEU B N     1 
ATOM   8840 C  CA    . LEU B 1 626 ? 120.152 118.262 76.356  1.00 25.51  ? 626  LEU B CA    1 
ATOM   8841 C  C     . LEU B 1 626 ? 120.036 118.815 77.764  1.00 25.51  ? 626  LEU B C     1 
ATOM   8842 O  O     . LEU B 1 626 ? 119.258 118.310 78.578  1.00 25.51  ? 626  LEU B O     1 
ATOM   8843 C  CB    . LEU B 1 626 ? 121.533 117.642 76.145  1.00 25.51  ? 626  LEU B CB    1 
ATOM   8844 C  CG    . LEU B 1 626 ? 122.008 116.497 77.023  1.00 25.51  ? 626  LEU B CG    1 
ATOM   8845 C  CD1   . LEU B 1 626 ? 121.060 115.356 76.934  1.00 25.51  ? 626  LEU B CD1   1 
ATOM   8846 C  CD2   . LEU B 1 626 ? 123.362 116.070 76.539  1.00 25.51  ? 626  LEU B CD2   1 
ATOM   8847 N  N     . TRP B 1 627 ? 120.789 119.870 78.055  1.00 22.61  ? 627  TRP B N     1 
ATOM   8848 C  CA    . TRP B 1 627 ? 120.959 120.364 79.410  1.00 22.61  ? 627  TRP B CA    1 
ATOM   8849 C  C     . TRP B 1 627 ? 119.892 121.364 79.818  1.00 22.61  ? 627  TRP B C     1 
ATOM   8850 O  O     . TRP B 1 627 ? 119.920 121.847 80.950  1.00 22.61  ? 627  TRP B O     1 
ATOM   8851 C  CB    . TRP B 1 627 ? 122.351 120.975 79.559  1.00 22.61  ? 627  TRP B CB    1 
ATOM   8852 C  CG    . TRP B 1 627 ? 123.419 119.956 79.366  1.00 22.61  ? 627  TRP B CG    1 
ATOM   8853 C  CD1   . TRP B 1 627 ? 124.194 119.780 78.265  1.00 22.61  ? 627  TRP B CD1   1 
ATOM   8854 C  CD2   . TRP B 1 627 ? 123.789 118.927 80.284  1.00 22.61  ? 627  TRP B CD2   1 
ATOM   8855 N  NE1   . TRP B 1 627 ? 125.049 118.724 78.451  1.00 22.61  ? 627  TRP B NE1   1 
ATOM   8856 C  CE2   . TRP B 1 627 ? 124.816 118.181 79.685  1.00 22.61  ? 627  TRP B CE2   1 
ATOM   8857 C  CE3   . TRP B 1 627 ? 123.363 118.577 81.565  1.00 22.61  ? 627  TRP B CE3   1 
ATOM   8858 C  CZ2   . TRP B 1 627 ? 125.418 117.104 80.318  1.00 22.61  ? 627  TRP B CZ2   1 
ATOM   8859 C  CZ3   . TRP B 1 627 ? 123.960 117.510 82.190  1.00 22.61  ? 627  TRP B CZ3   1 
ATOM   8860 C  CH2   . TRP B 1 627 ? 124.976 116.785 81.568  1.00 22.61  ? 627  TRP B CH2   1 
ATOM   8861 N  N     . LYS B 1 628 ? 118.959 121.689 78.925  1.00 23.60  ? 628  LYS B N     1 
ATOM   8862 C  CA    . LYS B 1 628 ? 117.725 122.343 79.341  1.00 23.60  ? 628  LYS B CA    1 
ATOM   8863 C  C     . LYS B 1 628 ? 116.901 121.423 80.226  1.00 23.60  ? 628  LYS B C     1 
ATOM   8864 O  O     . LYS B 1 628 ? 116.197 121.884 81.129  1.00 23.60  ? 628  LYS B O     1 
ATOM   8865 C  CB    . LYS B 1 628 ? 116.927 122.762 78.107  1.00 23.60  ? 628  LYS B CB    1 
ATOM   8866 C  CG    . LYS B 1 628 ? 115.626 123.476 78.361  1.00 23.60  ? 628  LYS B CG    1 
ATOM   8867 C  CD    . LYS B 1 628 ? 115.045 123.978 77.057  1.00 23.60  ? 628  LYS B CD    1 
ATOM   8868 C  CE    . LYS B 1 628 ? 114.523 122.838 76.214  1.00 23.60  ? 628  LYS B CE    1 
ATOM   8869 N  NZ    . LYS B 1 628 ? 113.869 123.351 74.982  1.00 23.60  ? 628  LYS B NZ    1 
ATOM   8870 N  N     . ASN B 1 629 ? 116.999 120.120 79.988  1.00 20.80  ? 629  ASN B N     1 
ATOM   8871 C  CA    . ASN B 1 629 ? 116.246 119.121 80.721  1.00 20.80  ? 629  ASN B CA    1 
ATOM   8872 C  C     . ASN B 1 629 ? 116.841 118.831 82.087  1.00 20.80  ? 629  ASN B C     1 
ATOM   8873 O  O     . ASN B 1 629 ? 116.119 118.375 82.973  1.00 20.80  ? 629  ASN B O     1 
ATOM   8874 C  CB    . ASN B 1 629 ? 116.193 117.844 79.894  1.00 20.80  ? 629  ASN B CB    1 
ATOM   8875 C  CG    . ASN B 1 629 ? 115.492 118.042 78.571  1.00 20.80  ? 629  ASN B CG    1 
ATOM   8876 O  OD1   . ASN B 1 629 ? 114.423 118.637 78.500  1.00 20.80  ? 629  ASN B OD1   1 
ATOM   8877 N  ND2   . ASN B 1 629 ? 116.119 117.580 77.507  1.00 20.80  ? 629  ASN B ND2   1 
ATOM   8878 N  N     . HIS B 1 630 ? 118.136 119.074 82.276  1.00 19.77  ? 630  HIS B N     1 
ATOM   8879 C  CA    . HIS B 1 630 ? 118.777 118.850 83.562  1.00 19.77  ? 630  HIS B CA    1 
ATOM   8880 C  C     . HIS B 1 630 ? 118.748 120.070 84.464  1.00 19.77  ? 630  HIS B C     1 
ATOM   8881 O  O     . HIS B 1 630 ? 118.819 119.914 85.685  1.00 19.77  ? 630  HIS B O     1 
ATOM   8882 C  CB    . HIS B 1 630 ? 120.228 118.417 83.374  1.00 19.77  ? 630  HIS B CB    1 
ATOM   8883 C  CG    . HIS B 1 630 ? 120.385 117.090 82.706  1.00 19.77  ? 630  HIS B CG    1 
ATOM   8884 N  ND1   . HIS B 1 630 ? 120.508 116.954 81.342  1.00 19.77  ? 630  HIS B ND1   1 
ATOM   8885 C  CD2   . HIS B 1 630 ? 120.437 115.838 83.214  1.00 19.77  ? 630  HIS B CD2   1 
ATOM   8886 C  CE1   . HIS B 1 630 ? 120.635 115.677 81.038  1.00 19.77  ? 630  HIS B CE1   1 
ATOM   8887 N  NE2   . HIS B 1 630 ? 120.593 114.978 82.156  1.00 19.77  ? 630  HIS B NE2   1 
ATOM   8888 N  N     . VAL B 1 631 ? 118.667 121.279 83.907  1.00 17.31  ? 631  VAL B N     1 
ATOM   8889 C  CA    . VAL B 1 631 ? 118.471 122.445 84.756  1.00 17.31  ? 631  VAL B CA    1 
ATOM   8890 C  C     . VAL B 1 631 ? 117.012 122.599 85.145  1.00 17.31  ? 631  VAL B C     1 
ATOM   8891 O  O     . VAL B 1 631 ? 116.714 123.284 86.124  1.00 17.31  ? 631  VAL B O     1 
ATOM   8892 C  CB    . VAL B 1 631 ? 118.980 123.741 84.098  1.00 17.31  ? 631  VAL B CB    1 
ATOM   8893 C  CG1   . VAL B 1 631 ? 120.445 123.614 83.747  1.00 17.31  ? 631  VAL B CG1   1 
ATOM   8894 C  CG2   . VAL B 1 631 ? 118.168 124.108 82.883  1.00 17.31  ? 631  VAL B CG2   1 
ATOM   8895 N  N     . ALA B 1 632 ? 116.096 121.971 84.416  1.00 15.30  ? 632  ALA B N     1 
ATOM   8896 C  CA    . ALA B 1 632 ? 114.696 121.971 84.799  1.00 15.30  ? 632  ALA B CA    1 
ATOM   8897 C  C     . ALA B 1 632 ? 114.370 120.877 85.792  1.00 15.30  ? 632  ALA B C     1 
ATOM   8898 O  O     . ALA B 1 632 ? 113.384 120.998 86.515  1.00 15.30  ? 632  ALA B O     1 
ATOM   8899 C  CB    . ALA B 1 632 ? 113.806 121.816 83.571  1.00 15.30  ? 632  ALA B CB    1 
ATOM   8900 N  N     . LEU B 1 633 ? 115.162 119.807 85.828  1.00 15.08  ? 633  LEU B N     1 
ATOM   8901 C  CA    . LEU B 1 633 ? 115.067 118.836 86.909  1.00 15.08  ? 633  LEU B CA    1 
ATOM   8902 C  C     . LEU B 1 633 ? 115.786 119.311 88.157  1.00 15.08  ? 633  LEU B C     1 
ATOM   8903 O  O     . LEU B 1 633 ? 115.370 118.967 89.263  1.00 15.08  ? 633  LEU B O     1 
ATOM   8904 C  CB    . LEU B 1 633 ? 115.636 117.490 86.471  1.00 15.08  ? 633  LEU B CB    1 
ATOM   8905 C  CG    . LEU B 1 633 ? 114.836 116.660 85.477  1.00 15.08  ? 633  LEU B CG    1 
ATOM   8906 C  CD1   . LEU B 1 633 ? 115.694 115.535 84.983  1.00 15.08  ? 633  LEU B CD1   1 
ATOM   8907 C  CD2   . LEU B 1 633 ? 113.589 116.124 86.125  1.00 15.08  ? 633  LEU B CD2   1 
ATOM   8908 N  N     . ALA B 1 634 ? 116.858 120.092 88.007  1.00 14.53  ? 634  ALA B N     1 
ATOM   8909 C  CA    . ALA B 1 634 ? 117.531 120.662 89.168  1.00 14.53  ? 634  ALA B CA    1 
ATOM   8910 C  C     . ALA B 1 634 ? 116.697 121.750 89.826  1.00 14.53  ? 634  ALA B C     1 
ATOM   8911 O  O     . ALA B 1 634 ? 116.804 121.958 91.037  1.00 14.53  ? 634  ALA B O     1 
ATOM   8912 C  CB    . ALA B 1 634 ? 118.895 121.213 88.772  1.00 14.53  ? 634  ALA B CB    1 
ATOM   8913 N  N     . CYS B 1 635 ? 115.874 122.461 89.056  1.00 14.67  ? 635  CYS B N     1 
ATOM   8914 C  CA    . CYS B 1 635 ? 114.946 123.407 89.657  1.00 14.67  ? 635  CYS B CA    1 
ATOM   8915 C  C     . CYS B 1 635 ? 113.773 122.713 90.327  1.00 14.67  ? 635  CYS B C     1 
ATOM   8916 O  O     . CYS B 1 635 ? 113.168 123.290 91.229  1.00 14.67  ? 635  CYS B O     1 
ATOM   8917 C  CB    . CYS B 1 635 ? 114.435 124.401 88.617  1.00 14.67  ? 635  CYS B CB    1 
ATOM   8918 S  SG    . CYS B 1 635 ? 115.656 125.613 88.076  1.00 14.67  ? 635  CYS B SG    1 
ATOM   8919 N  N     . MET B 1 636 ? 113.434 121.499 89.920  1.00 13.92  ? 636  MET B N     1 
ATOM   8920 C  CA    . MET B 1 636 ? 112.408 120.744 90.618  1.00 13.92  ? 636  MET B CA    1 
ATOM   8921 C  C     . MET B 1 636 ? 112.956 119.985 91.815  1.00 13.92  ? 636  MET B C     1 
ATOM   8922 O  O     . MET B 1 636 ? 112.180 119.386 92.553  1.00 13.92  ? 636  MET B O     1 
ATOM   8923 C  CB    . MET B 1 636 ? 111.713 119.769 89.661  1.00 13.92  ? 636  MET B CB    1 
ATOM   8924 C  CG    . MET B 1 636 ? 110.939 120.465 88.555  1.00 13.92  ? 636  MET B CG    1 
ATOM   8925 S  SD    . MET B 1 636 ? 110.144 119.392 87.349  1.00 13.92  ? 636  MET B SD    1 
ATOM   8926 C  CE    . MET B 1 636 ? 108.705 118.875 88.266  1.00 13.92  ? 636  MET B CE    1 
ATOM   8927 N  N     . ILE B 1 637 ? 114.266 119.980 92.022  1.00 12.11  ? 637  ILE B N     1 
ATOM   8928 C  CA    . ILE B 1 637 ? 114.825 119.472 93.268  1.00 12.11  ? 637  ILE B CA    1 
ATOM   8929 C  C     . ILE B 1 637 ? 114.890 120.573 94.313  1.00 12.11  ? 637  ILE B C     1 
ATOM   8930 O  O     . ILE B 1 637 ? 114.529 120.356 95.468  1.00 12.11  ? 637  ILE B O     1 
ATOM   8931 C  CB    . ILE B 1 637 ? 116.210 118.849 93.008  1.00 12.11  ? 637  ILE B CB    1 
ATOM   8932 C  CG1   . ILE B 1 637 ? 116.080 117.623 92.118  1.00 12.11  ? 637  ILE B CG1   1 
ATOM   8933 C  CG2   . ILE B 1 637 ? 116.878 118.437 94.294  1.00 12.11  ? 637  ILE B CG2   1 
ATOM   8934 C  CD1   . ILE B 1 637 ? 117.370 117.179 91.526  1.00 12.11  ? 637  ILE B CD1   1 
ATOM   8935 N  N     . VAL B 1 638 ? 115.308 121.772 93.909  1.00 11.44  ? 638  VAL B N     1 
ATOM   8936 C  CA    . VAL B 1 638 ? 115.417 122.894 94.834  1.00 11.44  ? 638  VAL B CA    1 
ATOM   8937 C  C     . VAL B 1 638 ? 114.039 123.335 95.320  1.00 11.44  ? 638  VAL B C     1 
ATOM   8938 O  O     . VAL B 1 638 ? 113.856 123.640 96.501  1.00 11.44  ? 638  VAL B O     1 
ATOM   8939 C  CB    . VAL B 1 638 ? 116.195 124.042 94.163  1.00 11.44  ? 638  VAL B CB    1 
ATOM   8940 C  CG1   . VAL B 1 638 ? 116.247 125.269 95.042  1.00 11.44  ? 638  VAL B CG1   1 
ATOM   8941 C  CG2   . VAL B 1 638 ? 117.596 123.591 93.841  1.00 11.44  ? 638  VAL B CG2   1 
ATOM   8942 N  N     . ILE B 1 639 ? 113.041 123.334 94.436  1.00 10.48  ? 639  ILE B N     1 
ATOM   8943 C  CA    . ILE B 1 639 ? 111.700 123.758 94.830  1.00 10.48  ? 639  ILE B CA    1 
ATOM   8944 C  C     . ILE B 1 639 ? 111.022 122.699 95.691  1.00 10.48  ? 639  ILE B C     1 
ATOM   8945 O  O     . ILE B 1 639 ? 110.423 123.015 96.723  1.00 10.48  ? 639  ILE B O     1 
ATOM   8946 C  CB    . ILE B 1 639 ? 110.869 124.114 93.584  1.00 10.48  ? 639  ILE B CB    1 
ATOM   8947 C  CG1   . ILE B 1 639 ? 111.394 125.397 92.949  1.00 10.48  ? 639  ILE B CG1   1 
ATOM   8948 C  CG2   . ILE B 1 639 ? 109.409 124.278 93.915  1.00 10.48  ? 639  ILE B CG2   1 
ATOM   8949 C  CD1   . ILE B 1 639 ? 110.809 125.676 91.599  1.00 10.48  ? 639  ILE B CD1   1 
ATOM   8950 N  N     . PHE B 1 640 ? 111.120 121.428 95.305  1.00 10.29  ? 640  PHE B N     1 
ATOM   8951 C  CA    . PHE B 1 640 ? 110.436 120.386 96.061  1.00 10.29  ? 640  PHE B CA    1 
ATOM   8952 C  C     . PHE B 1 640 ? 111.124 120.060 97.377  1.00 10.29  ? 640  PHE B C     1 
ATOM   8953 O  O     . PHE B 1 640 ? 110.467 119.540 98.279  1.00 10.29  ? 640  PHE B O     1 
ATOM   8954 C  CB    . PHE B 1 640 ? 110.301 119.116 95.224  1.00 10.29  ? 640  PHE B CB    1 
ATOM   8955 C  CG    . PHE B 1 640 ? 109.254 119.196 94.146  1.00 10.29  ? 640  PHE B CG    1 
ATOM   8956 C  CD1   . PHE B 1 640 ? 108.237 120.123 94.215  1.00 10.29  ? 640  PHE B CD1   1 
ATOM   8957 C  CD2   . PHE B 1 640 ? 109.299 118.343 93.060  1.00 10.29  ? 640  PHE B CD2   1 
ATOM   8958 C  CE1   . PHE B 1 640 ? 107.287 120.194 93.229  1.00 10.29  ? 640  PHE B CE1   1 
ATOM   8959 C  CE2   . PHE B 1 640 ? 108.359 118.415 92.070  1.00 10.29  ? 640  PHE B CE2   1 
ATOM   8960 C  CZ    . PHE B 1 640 ? 107.351 119.339 92.155  1.00 10.29  ? 640  PHE B CZ    1 
ATOM   8961 N  N     . LEU B 1 641 ? 112.418 120.339 97.517  1.00 8.81   ? 641  LEU B N     1 
ATOM   8962 C  CA    . LEU B 1 641 ? 113.070 120.196 98.812  1.00 8.81   ? 641  LEU B CA    1 
ATOM   8963 C  C     . LEU B 1 641 ? 113.013 121.462 99.650  1.00 8.81   ? 641  LEU B C     1 
ATOM   8964 O  O     . LEU B 1 641 ? 113.443 121.438 100.804 1.00 8.81   ? 641  LEU B O     1 
ATOM   8965 C  CB    . LEU B 1 641 ? 114.534 119.783 98.663  1.00 8.81   ? 641  LEU B CB    1 
ATOM   8966 C  CG    . LEU B 1 641 ? 114.879 118.393 98.151  1.00 8.81   ? 641  LEU B CG    1 
ATOM   8967 C  CD1   . LEU B 1 641 ? 116.373 118.256 98.090  1.00 8.81   ? 641  LEU B CD1   1 
ATOM   8968 C  CD2   . LEU B 1 641 ? 114.274 117.339 99.035  1.00 8.81   ? 641  LEU B CD2   1 
ATOM   8969 N  N     . THR B 1 642 ? 112.527 122.567 99.096  1.00 8.51   ? 642  THR B N     1 
ATOM   8970 C  CA    . THR B 1 642 ? 112.206 123.736 99.901  1.00 8.51   ? 642  THR B CA    1 
ATOM   8971 C  C     . THR B 1 642 ? 110.803 123.626 100.473 1.00 8.51   ? 642  THR B C     1 
ATOM   8972 O  O     . THR B 1 642 ? 110.578 123.987 101.628 1.00 8.51   ? 642  THR B O     1 
ATOM   8973 C  CB    . THR B 1 642 ? 112.348 125.008 99.068  1.00 8.51   ? 642  THR B CB    1 
ATOM   8974 O  OG1   . THR B 1 642 ? 113.657 125.047 98.494  1.00 8.51   ? 642  THR B OG1   1 
ATOM   8975 C  CG2   . THR B 1 642 ? 112.181 126.234 99.923  1.00 8.51   ? 642  THR B CG2   1 
ATOM   8976 N  N     . ILE B 1 643 ? 109.861 123.107 99.683  1.00 7.87   ? 643  ILE B N     1 
ATOM   8977 C  CA    . ILE B 1 643 ? 108.528 122.795 100.189 1.00 7.87   ? 643  ILE B CA    1 
ATOM   8978 C  C     . ILE B 1 643 ? 108.606 121.727 101.272 1.00 7.87   ? 643  ILE B C     1 
ATOM   8979 O  O     . ILE B 1 643 ? 107.935 121.820 102.303 1.00 7.87   ? 643  ILE B O     1 
ATOM   8980 C  CB    . ILE B 1 643 ? 107.612 122.367 99.026  1.00 7.87   ? 643  ILE B CB    1 
ATOM   8981 C  CG1   . ILE B 1 643 ? 107.431 123.513 98.036  1.00 7.87   ? 643  ILE B CG1   1 
ATOM   8982 C  CG2   . ILE B 1 643 ? 106.260 121.906 99.520  1.00 7.87   ? 643  ILE B CG2   1 
ATOM   8983 C  CD1   . ILE B 1 643 ? 106.757 123.098 96.758  1.00 7.87   ? 643  ILE B CD1   1 
ATOM   8984 N  N     . ALA B 1 644 ? 109.463 120.721 101.075 1.00 8.44   ? 644  ALA B N     1 
ATOM   8985 C  CA    . ALA B 1 644 ? 109.598 119.644 102.048 1.00 8.44   ? 644  ALA B CA    1 
ATOM   8986 C  C     . ALA B 1 644 ? 110.295 120.107 103.313 1.00 8.44   ? 644  ALA B C     1 
ATOM   8987 O  O     . ALA B 1 644 ? 110.042 119.561 104.388 1.00 8.44   ? 644  ALA B O     1 
ATOM   8988 C  CB    . ALA B 1 644 ? 110.362 118.476 101.439 1.00 8.44   ? 644  ALA B CB    1 
ATOM   8989 N  N     . TYR B 1 645 ? 111.177 121.099 103.205 1.00 8.07   ? 645  TYR B N     1 
ATOM   8990 C  CA    . TYR B 1 645 ? 111.806 121.674 104.387 1.00 8.07   ? 645  TYR B CA    1 
ATOM   8991 C  C     . TYR B 1 645 ? 110.819 122.508 105.189 1.00 8.07   ? 645  TYR B C     1 
ATOM   8992 O  O     . TYR B 1 645 ? 110.738 122.382 106.415 1.00 8.07   ? 645  TYR B O     1 
ATOM   8993 C  CB    . TYR B 1 645 ? 113.005 122.522 103.977 1.00 8.07   ? 645  TYR B CB    1 
ATOM   8994 C  CG    . TYR B 1 645 ? 113.602 123.291 105.122 1.00 8.07   ? 645  TYR B CG    1 
ATOM   8995 C  CD1   . TYR B 1 645 ? 114.320 122.648 106.110 1.00 8.07   ? 645  TYR B CD1   1 
ATOM   8996 C  CD2   . TYR B 1 645 ? 113.447 124.667 105.215 1.00 8.07   ? 645  TYR B CD2   1 
ATOM   8997 C  CE1   . TYR B 1 645 ? 114.859 123.343 107.154 1.00 8.07   ? 645  TYR B CE1   1 
ATOM   8998 C  CE2   . TYR B 1 645 ? 113.984 125.371 106.263 1.00 8.07   ? 645  TYR B CE2   1 
ATOM   8999 C  CZ    . TYR B 1 645 ? 114.691 124.701 107.227 1.00 8.07   ? 645  TYR B CZ    1 
ATOM   9000 O  OH    . TYR B 1 645 ? 115.238 125.396 108.275 1.00 8.07   ? 645  TYR B OH    1 
ATOM   9001 N  N     . LEU B 1 646 ? 110.065 123.376 104.511 1.00 8.04   ? 646  LEU B N     1 
ATOM   9002 C  CA    . LEU B 1 646 ? 109.140 124.273 105.189 1.00 8.04   ? 646  LEU B CA    1 
ATOM   9003 C  C     . LEU B 1 646 ? 107.945 123.543 105.782 1.00 8.04   ? 646  LEU B C     1 
ATOM   9004 O  O     . LEU B 1 646 ? 107.328 124.059 106.715 1.00 8.04   ? 646  LEU B O     1 
ATOM   9005 C  CB    . LEU B 1 646 ? 108.658 125.352 104.223 1.00 8.04   ? 646  LEU B CB    1 
ATOM   9006 C  CG    . LEU B 1 646 ? 109.684 126.345 103.679 1.00 8.04   ? 646  LEU B CG    1 
ATOM   9007 C  CD1   . LEU B 1 646 ? 109.042 127.221 102.631 1.00 8.04   ? 646  LEU B CD1   1 
ATOM   9008 C  CD2   . LEU B 1 646 ? 110.291 127.179 104.776 1.00 8.04   ? 646  LEU B CD2   1 
ATOM   9009 N  N     . LYS B 1 647 ? 107.600 122.365 105.270 1.00 8.50   ? 647  LYS B N     1 
ATOM   9010 C  CA    . LYS B 1 647 ? 106.541 121.578 105.884 1.00 8.50   ? 647  LYS B CA    1 
ATOM   9011 C  C     . LYS B 1 647 ? 106.998 120.867 107.145 1.00 8.50   ? 647  LYS B C     1 
ATOM   9012 O  O     . LYS B 1 647 ? 106.156 120.505 107.968 1.00 8.50   ? 647  LYS B O     1 
ATOM   9013 C  CB    . LYS B 1 647 ? 105.988 120.552 104.898 1.00 8.50   ? 647  LYS B CB    1 
ATOM   9014 C  CG    . LYS B 1 647 ? 105.125 121.141 103.819 1.00 8.50   ? 647  LYS B CG    1 
ATOM   9015 C  CD    . LYS B 1 647 ? 104.712 120.082 102.851 1.00 8.50   ? 647  LYS B CD    1 
ATOM   9016 C  CE    . LYS B 1 647 ? 103.717 119.151 103.486 1.00 8.50   ? 647  LYS B CE    1 
ATOM   9017 N  NZ    . LYS B 1 647 ? 103.191 118.141 102.537 1.00 8.50   ? 647  LYS B NZ    1 
ATOM   9018 N  N     . LEU B 1 648 ? 108.301 120.636 107.297 1.00 8.04   ? 648  LEU B N     1 
ATOM   9019 C  CA    . LEU B 1 648 ? 108.848 120.179 108.567 1.00 8.04   ? 648  LEU B CA    1 
ATOM   9020 C  C     . LEU B 1 648 ? 109.093 121.338 109.513 1.00 8.04   ? 648  LEU B C     1 
ATOM   9021 O  O     . LEU B 1 648 ? 108.954 121.182 110.728 1.00 8.04   ? 648  LEU B O     1 
ATOM   9022 C  CB    . LEU B 1 648 ? 110.161 119.434 108.348 1.00 8.04   ? 648  LEU B CB    1 
ATOM   9023 C  CG    . LEU B 1 648 ? 110.168 118.107 107.606 1.00 8.04   ? 648  LEU B CG    1 
ATOM   9024 C  CD1   . LEU B 1 648 ? 111.595 117.725 107.353 1.00 8.04   ? 648  LEU B CD1   1 
ATOM   9025 C  CD2   . LEU B 1 648 ? 109.477 117.051 108.425 1.00 8.04   ? 648  LEU B CD2   1 
ATOM   9026 N  N     . LEU B 1 649 ? 109.451 122.500 108.971 1.00 8.96   ? 649  LEU B N     1 
ATOM   9027 C  CA    . LEU B 1 649 ? 109.721 123.670 109.798 1.00 8.96   ? 649  LEU B CA    1 
ATOM   9028 C  C     . LEU B 1 649 ? 108.441 124.239 110.395 1.00 8.96   ? 649  LEU B C     1 
ATOM   9029 O  O     . LEU B 1 649 ? 108.362 124.475 111.605 1.00 8.96   ? 649  LEU B O     1 
ATOM   9030 C  CB    . LEU B 1 649 ? 110.442 124.727 108.971 1.00 8.96   ? 649  LEU B CB    1 
ATOM   9031 C  CG    . LEU B 1 649 ? 110.834 126.006 109.689 1.00 8.96   ? 649  LEU B CG    1 
ATOM   9032 C  CD1   . LEU B 1 649 ? 111.831 125.697 110.768 1.00 8.96   ? 649  LEU B CD1   1 
ATOM   9033 C  CD2   . LEU B 1 649 ? 111.407 126.985 108.701 1.00 8.96   ? 649  LEU B CD2   1 
ATOM   9034 N  N     . PHE B 1 650 ? 107.424 124.472 109.566 1.00 9.21   ? 650  PHE B N     1 
ATOM   9035 C  CA    . PHE B 1 650 ? 106.176 125.056 110.032 1.00 9.21   ? 650  PHE B CA    1 
ATOM   9036 C  C     . PHE B 1 650 ? 105.169 124.012 110.482 1.00 9.21   ? 650  PHE B C     1 
ATOM   9037 O  O     . PHE B 1 650 ? 103.980 124.320 110.590 1.00 9.21   ? 650  PHE B O     1 
ATOM   9038 C  CB    . PHE B 1 650 ? 105.561 125.945 108.953 1.00 9.21   ? 650  PHE B CB    1 
ATOM   9039 C  CG    . PHE B 1 650 ? 106.384 127.151 108.634 1.00 9.21   ? 650  PHE B CG    1 
ATOM   9040 C  CD1   . PHE B 1 650 ? 106.466 128.198 109.529 1.00 9.21   ? 650  PHE B CD1   1 
ATOM   9041 C  CD2   . PHE B 1 650 ? 107.058 127.247 107.436 1.00 9.21   ? 650  PHE B CD2   1 
ATOM   9042 C  CE1   . PHE B 1 650 ? 107.226 129.306 109.244 1.00 9.21   ? 650  PHE B CE1   1 
ATOM   9043 C  CE2   . PHE B 1 650 ? 107.813 128.357 107.145 1.00 9.21   ? 650  PHE B CE2   1 
ATOM   9044 C  CZ    . PHE B 1 650 ? 107.897 129.386 108.050 1.00 9.21   ? 650  PHE B CZ    1 
ATOM   9045 N  N     . LEU B 1 651 ? 105.616 122.787 110.730 1.00 10.16  ? 651  LEU B N     1 
ATOM   9046 C  CA    . LEU B 1 651 ? 104.782 121.786 111.371 1.00 10.16  ? 651  LEU B CA    1 
ATOM   9047 C  C     . LEU B 1 651 ? 104.505 122.206 112.807 1.00 10.16  ? 651  LEU B C     1 
ATOM   9048 O  O     . LEU B 1 651 ? 105.334 122.844 113.455 1.00 10.16  ? 651  LEU B O     1 
ATOM   9049 C  CB    . LEU B 1 651 ? 105.482 120.429 111.331 1.00 10.16  ? 651  LEU B CB    1 
ATOM   9050 C  CG    . LEU B 1 651 ? 104.797 119.171 111.846 1.00 10.16  ? 651  LEU B CG    1 
ATOM   9051 C  CD1   . LEU B 1 651 ? 103.554 118.903 111.055 1.00 10.16  ? 651  LEU B CD1   1 
ATOM   9052 C  CD2   . LEU B 1 651 ? 105.740 118.007 111.740 1.00 10.16  ? 651  LEU B CD2   1 
ATOM   9053 N  N     . LYS B 1 652 ? 103.316 121.876 113.298 1.00 12.46  ? 652  LYS B N     1 
ATOM   9054 C  CA    . LYS B 1 652 ? 102.949 122.189 114.673 1.00 12.46  ? 652  LYS B CA    1 
ATOM   9055 C  C     . LYS B 1 652 ? 103.435 121.062 115.571 1.00 12.46  ? 652  LYS B C     1 
ATOM   9056 O  O     . LYS B 1 652 ? 102.898 119.952 115.533 1.00 12.46  ? 652  LYS B O     1 
ATOM   9057 C  CB    . LYS B 1 652 ? 101.446 122.399 114.803 1.00 12.46  ? 652  LYS B CB    1 
ATOM   9058 C  CG    . LYS B 1 652 ? 100.962 123.679 114.151 1.00 12.46  ? 652  LYS B CG    1 
ATOM   9059 C  CD    . LYS B 1 652 ? 99.470  123.866 114.318 1.00 12.46  ? 652  LYS B CD    1 
ATOM   9060 C  CE    . LYS B 1 652 ? 99.003  125.143 113.638 1.00 12.46  ? 652  LYS B CE    1 
ATOM   9061 N  NZ    . LYS B 1 652 ? 97.533  125.337 113.758 1.00 12.46  ? 652  LYS B NZ    1 
ATOM   9062 N  N     . LYS B 1 653 ? 104.453 121.348 116.377 1.00 11.90  ? 653  LYS B N     1 
ATOM   9063 C  CA    . LYS B 1 653 ? 105.079 120.347 117.223 1.00 11.90  ? 653  LYS B CA    1 
ATOM   9064 C  C     . LYS B 1 653 ? 104.450 120.245 118.603 1.00 11.90  ? 653  LYS B C     1 
ATOM   9065 O  O     . LYS B 1 653 ? 104.864 119.387 119.388 1.00 11.90  ? 653  LYS B O     1 
ATOM   9066 C  CB    . LYS B 1 653 ? 106.568 120.642 117.400 1.00 11.90  ? 653  LYS B CB    1 
ATOM   9067 C  CG    . LYS B 1 653 ? 107.496 120.210 116.280 1.00 11.90  ? 653  LYS B CG    1 
ATOM   9068 C  CD    . LYS B 1 653 ? 107.625 121.255 115.208 1.00 11.90  ? 653  LYS B CD    1 
ATOM   9069 C  CE    . LYS B 1 653 ? 108.715 120.896 114.240 1.00 11.90  ? 653  LYS B CE    1 
ATOM   9070 N  NZ    . LYS B 1 653 ? 108.847 121.929 113.190 1.00 11.90  ? 653  LYS B NZ    1 
ATOM   9071 N  N     . TYR B 1 654 ? 103.476 121.086 118.922 1.00 17.10  ? 654  TYR B N     1 
ATOM   9072 C  CA    . TYR B 1 654 ? 102.940 121.149 120.274 1.00 17.10  ? 654  TYR B CA    1 
ATOM   9073 C  C     . TYR B 1 654 ? 102.108 119.921 120.627 1.00 17.10  ? 654  TYR B C     1 
ATOM   9074 O  O     . TYR B 1 654 ? 101.688 119.172 119.750 1.00 17.10  ? 654  TYR B O     1 
ATOM   9075 C  CB    . TYR B 1 654 ? 102.092 122.400 120.453 1.00 17.10  ? 654  TYR B CB    1 
ATOM   9076 C  CG    . TYR B 1 654 ? 102.836 123.697 120.285 1.00 17.10  ? 654  TYR B CG    1 
ATOM   9077 C  CD1   . TYR B 1 654 ? 103.783 124.099 121.216 1.00 17.10  ? 654  TYR B CD1   1 
ATOM   9078 C  CD2   . TYR B 1 654 ? 102.541 124.556 119.236 1.00 17.10  ? 654  TYR B CD2   1 
ATOM   9079 C  CE1   . TYR B 1 654 ? 104.453 125.293 121.081 1.00 17.10  ? 654  TYR B CE1   1 
ATOM   9080 C  CE2   . TYR B 1 654 ? 103.200 125.758 119.094 1.00 17.10  ? 654  TYR B CE2   1 
ATOM   9081 C  CZ    . TYR B 1 654 ? 104.155 126.121 120.020 1.00 17.10  ? 654  TYR B CZ    1 
ATOM   9082 O  OH    . TYR B 1 654 ? 104.820 127.318 119.884 1.00 17.10  ? 654  TYR B OH    1 
HETATM 9083 P  PG    . ATP C 2 .   ? 109.620 96.237  134.616 1.00 9.36   ? 1501 ATP A PG    1 
HETATM 9084 O  O1G   . ATP C 2 .   ? 108.711 96.259  133.420 1.00 9.36   ? 1501 ATP A O1G   1 
HETATM 9085 O  O2G   . ATP C 2 .   ? 110.541 97.410  134.734 1.00 9.36   ? 1501 ATP A O2G   1 
HETATM 9086 O  O3G   . ATP C 2 .   ? 108.955 95.853  135.904 1.00 9.36   ? 1501 ATP A O3G   1 
HETATM 9087 P  PB    . ATP C 2 .   ? 110.142 93.508  134.342 1.00 9.36   ? 1501 ATP A PB    1 
HETATM 9088 O  O1B   . ATP C 2 .   ? 108.815 93.390  133.667 1.00 9.36   ? 1501 ATP A O1B   1 
HETATM 9089 O  O2B   . ATP C 2 .   ? 110.334 93.001  135.736 1.00 9.36   ? 1501 ATP A O2B   1 
HETATM 9090 O  O3B   . ATP C 2 .   ? 110.622 95.032  134.304 1.00 9.36   ? 1501 ATP A O3B   1 
HETATM 9091 P  PA    . ATP C 2 .   ? 110.902 92.025  132.076 1.00 9.36   ? 1501 ATP A PA    1 
HETATM 9092 O  O1A   . ATP C 2 .   ? 110.254 92.931  131.079 1.00 9.36   ? 1501 ATP A O1A   1 
HETATM 9093 O  O2A   . ATP C 2 .   ? 110.223 90.740  132.392 1.00 9.36   ? 1501 ATP A O2A   1 
HETATM 9094 O  O3A   . ATP C 2 .   ? 111.248 92.830  133.413 1.00 9.36   ? 1501 ATP A O3A   1 
HETATM 9095 O  "O5'" . ATP C 2 .   ? 112.369 91.703  131.546 1.00 9.36   ? 1501 ATP A "O5'" 1 
HETATM 9096 C  "C5'" . ATP C 2 .   ? 113.359 91.174  132.415 1.00 9.36   ? 1501 ATP A "C5'" 1 
HETATM 9097 C  "C4'" . ATP C 2 .   ? 114.716 91.486  131.811 1.00 9.36   ? 1501 ATP A "C4'" 1 
HETATM 9098 O  "O4'" . ATP C 2 .   ? 114.931 90.629  130.707 1.00 9.36   ? 1501 ATP A "O4'" 1 
HETATM 9099 C  "C3'" . ATP C 2 .   ? 114.789 92.899  131.277 1.00 9.36   ? 1501 ATP A "C3'" 1 
HETATM 9100 O  "O3'" . ATP C 2 .   ? 115.956 93.512  131.817 1.00 9.36   ? 1501 ATP A "O3'" 1 
HETATM 9101 C  "C2'" . ATP C 2 .   ? 114.959 92.794  129.783 1.00 9.36   ? 1501 ATP A "C2'" 1 
HETATM 9102 O  "O2'" . ATP C 2 .   ? 116.041 93.628  129.379 1.00 9.36   ? 1501 ATP A "O2'" 1 
HETATM 9103 C  "C1'" . ATP C 2 .   ? 115.302 91.343  129.538 1.00 9.36   ? 1501 ATP A "C1'" 1 
HETATM 9104 N  N9    . ATP C 2 .   ? 114.526 90.782  128.413 1.00 9.36   ? 1501 ATP A N9    1 
HETATM 9105 C  C8    . ATP C 2 .   ? 113.384 90.093  128.532 1.00 9.36   ? 1501 ATP A C8    1 
HETATM 9106 N  N7    . ATP C 2 .   ? 112.919 89.701  127.328 1.00 9.36   ? 1501 ATP A N7    1 
HETATM 9107 C  C5    . ATP C 2 .   ? 113.788 90.146  126.411 1.00 9.36   ? 1501 ATP A C5    1 
HETATM 9108 C  C6    . ATP C 2 .   ? 113.900 90.082  124.944 1.00 9.36   ? 1501 ATP A C6    1 
HETATM 9109 N  N6    . ATP C 2 .   ? 112.968 89.444  124.201 1.00 9.36   ? 1501 ATP A N6    1 
HETATM 9110 N  N1    . ATP C 2 .   ? 114.966 90.670  124.373 1.00 9.36   ? 1501 ATP A N1    1 
HETATM 9111 C  C2    . ATP C 2 .   ? 115.902 91.303  125.099 1.00 9.36   ? 1501 ATP A C2    1 
HETATM 9112 N  N3    . ATP C 2 .   ? 115.863 91.402  126.433 1.00 9.36   ? 1501 ATP A N3    1 
HETATM 9113 C  C4    . ATP C 2 .   ? 114.848 90.851  127.130 1.00 9.36   ? 1501 ATP A C4    1 
HETATM 9114 MG MG    . MG  D 3 .   ? 105.895 94.091  135.480 1.00 8.26   ? 1502 MG  A MG    1 
HETATM 9115 P  PG    . ATP E 2 .   ? 97.801  111.176 134.692 1.00 9.47   ? 1501 ATP B PG    1 
HETATM 9116 O  O1G   . ATP E 2 .   ? 98.709  111.153 133.496 1.00 9.47   ? 1501 ATP B O1G   1 
HETATM 9117 O  O2G   . ATP E 2 .   ? 96.881  110.002 134.814 1.00 9.47   ? 1501 ATP B O2G   1 
HETATM 9118 O  O3G   . ATP E 2 .   ? 98.468  111.563 135.979 1.00 9.47   ? 1501 ATP B O3G   1 
HETATM 9119 P  PB    . ATP E 2 .   ? 97.277  113.904 134.415 1.00 9.47   ? 1501 ATP B PB    1 
HETATM 9120 O  O1B   . ATP E 2 .   ? 98.603  114.021 133.737 1.00 9.47   ? 1501 ATP B O1B   1 
HETATM 9121 O  O2B   . ATP E 2 .   ? 97.086  114.414 135.807 1.00 9.47   ? 1501 ATP B O2B   1 
HETATM 9122 O  O3B   . ATP E 2 .   ? 96.798  112.380 134.379 1.00 9.47   ? 1501 ATP B O3B   1 
HETATM 9123 P  PA    . ATP E 2 .   ? 96.514  115.383 132.147 1.00 9.47   ? 1501 ATP B PA    1 
HETATM 9124 O  O1A   . ATP E 2 .   ? 97.161  114.475 131.150 1.00 9.47   ? 1501 ATP B O1A   1 
HETATM 9125 O  O2A   . ATP E 2 .   ? 97.192  116.668 132.459 1.00 9.47   ? 1501 ATP B O2A   1 
HETATM 9126 O  O3A   . ATP E 2 .   ? 96.169  114.580 133.486 1.00 9.47   ? 1501 ATP B O3A   1 
HETATM 9127 O  "O5'" . ATP E 2 .   ? 95.046  115.702 131.617 1.00 9.47   ? 1501 ATP B "O5'" 1 
HETATM 9128 C  "C5'" . ATP E 2 .   ? 94.056  116.232 132.486 1.00 9.47   ? 1501 ATP B "C5'" 1 
HETATM 9129 C  "C4'" . ATP E 2 .   ? 92.699  115.918 131.884 1.00 9.47   ? 1501 ATP B "C4'" 1 
HETATM 9130 O  "O4'" . ATP E 2 .   ? 92.482  116.774 130.779 1.00 9.47   ? 1501 ATP B "O4'" 1 
HETATM 9131 C  "C3'" . ATP E 2 .   ? 92.627  114.505 131.353 1.00 9.47   ? 1501 ATP B "C3'" 1 
HETATM 9132 O  "O3'" . ATP E 2 .   ? 91.461  113.891 131.895 1.00 9.47   ? 1501 ATP B "O3'" 1 
HETATM 9133 C  "C2'" . ATP E 2 .   ? 92.455  114.607 129.859 1.00 9.47   ? 1501 ATP B "C2'" 1 
HETATM 9134 O  "O2'" . ATP E 2 .   ? 91.372  113.771 129.457 1.00 9.47   ? 1501 ATP B "O2'" 1 
HETATM 9135 C  "C1'" . ATP E 2 .   ? 92.110  116.057 129.612 1.00 9.47   ? 1501 ATP B "C1'" 1 
HETATM 9136 N  N9    . ATP E 2 .   ? 92.884  116.616 128.485 1.00 9.47   ? 1501 ATP B N9    1 
HETATM 9137 C  C8    . ATP E 2 .   ? 94.026  117.306 128.601 1.00 9.47   ? 1501 ATP B C8    1 
HETATM 9138 N  N7    . ATP E 2 .   ? 94.489  117.696 127.397 1.00 9.47   ? 1501 ATP B N7    1 
HETATM 9139 C  C5    . ATP E 2 .   ? 93.620  117.249 126.481 1.00 9.47   ? 1501 ATP B C5    1 
HETATM 9140 C  C6    . ATP E 2 .   ? 93.506  117.311 125.014 1.00 9.47   ? 1501 ATP B C6    1 
HETATM 9141 N  N6    . ATP E 2 .   ? 94.437  117.948 124.269 1.00 9.47   ? 1501 ATP B N6    1 
HETATM 9142 N  N1    . ATP E 2 .   ? 92.440  116.720 124.446 1.00 9.47   ? 1501 ATP B N1    1 
HETATM 9143 C  C2    . ATP E 2 .   ? 91.505  116.089 125.174 1.00 9.47   ? 1501 ATP B C2    1 
HETATM 9144 N  N3    . ATP E 2 .   ? 91.546  115.992 126.507 1.00 9.47   ? 1501 ATP B N3    1 
HETATM 9145 C  C4    . ATP E 2 .   ? 92.561  116.545 127.203 1.00 9.47   ? 1501 ATP B C4    1 
HETATM 9146 MG MG    . MG  F 3 .   ? 101.526 113.326 135.548 1.00 8.45   ? 1502 MG  B MG    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   SER 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   ?   ?   ?   A . n 
A 1 5   ASN 5   5   ?   ?   ?   A . n 
A 1 6   VAL 6   6   ?   ?   ?   A . n 
A 1 7   GLU 7   7   ?   ?   ?   A . n 
A 1 8   VAL 8   8   ?   ?   ?   A . n 
A 1 9   PHE 9   9   ?   ?   ?   A . n 
A 1 10  ILE 10  10  ?   ?   ?   A . n 
A 1 11  PRO 11  11  ?   ?   ?   A . n 
A 1 12  VAL 12  12  ?   ?   ?   A . n 
A 1 13  SER 13  13  ?   ?   ?   A . n 
A 1 14  GLN 14  14  ?   ?   ?   A . n 
A 1 15  GLY 15  15  ?   ?   ?   A . n 
A 1 16  ASN 16  16  ?   ?   ?   A . n 
A 1 17  THR 17  17  ?   ?   ?   A . n 
A 1 18  ASN 18  18  ?   ?   ?   A . n 
A 1 19  GLY 19  19  ?   ?   ?   A . n 
A 1 20  PHE 20  20  ?   ?   ?   A . n 
A 1 21  PRO 21  21  ?   ?   ?   A . n 
A 1 22  ALA 22  22  ?   ?   ?   A . n 
A 1 23  THR 23  23  ?   ?   ?   A . n 
A 1 24  ALA 24  24  ?   ?   ?   A . n 
A 1 25  SER 25  25  ?   ?   ?   A . n 
A 1 26  ASN 26  26  ?   ?   ?   A . n 
A 1 27  ASP 27  27  ?   ?   ?   A . n 
A 1 28  LEU 28  28  ?   ?   ?   A . n 
A 1 29  LYS 29  29  ?   ?   ?   A . n 
A 1 30  ALA 30  30  ?   ?   ?   A . n 
A 1 31  PHE 31  31  ?   ?   ?   A . n 
A 1 32  THR 32  32  ?   ?   ?   A . n 
A 1 33  GLU 33  33  ?   ?   ?   A . n 
A 1 34  GLY 34  34  34  GLY GLY A . n 
A 1 35  ALA 35  35  35  ALA ALA A . n 
A 1 36  VAL 36  36  36  VAL VAL A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  SER 38  38  38  SER SER A . n 
A 1 39  PHE 39  39  39  PHE PHE A . n 
A 1 40  HIS 40  40  40  HIS HIS A . n 
A 1 41  ASN 41  41  41  ASN ASN A . n 
A 1 42  ILE 42  42  42  ILE ILE A . n 
A 1 43  CYS 43  43  43  CYS CYS A . n 
A 1 44  TYR 44  44  44  TYR TYR A . n 
A 1 45  ARG 45  45  45  ARG ARG A . n 
A 1 46  VAL 46  46  46  VAL VAL A . n 
A 1 47  LYS 47  47  47  LYS LYS A . n 
A 1 48  LEU 48  48  48  LEU LEU A . n 
A 1 49  LYS 49  49  ?   ?   ?   A . n 
A 1 50  SER 50  50  ?   ?   ?   A . n 
A 1 51  GLY 51  51  ?   ?   ?   A . n 
A 1 52  PHE 52  52  ?   ?   ?   A . n 
A 1 53  LEU 53  53  ?   ?   ?   A . n 
A 1 54  PRO 54  54  ?   ?   ?   A . n 
A 1 55  CYS 55  55  ?   ?   ?   A . n 
A 1 56  ARG 56  56  ?   ?   ?   A . n 
A 1 57  LYS 57  57  ?   ?   ?   A . n 
A 1 58  PRO 58  58  58  PRO PRO A . n 
A 1 59  VAL 59  59  59  VAL VAL A . n 
A 1 60  GLU 60  60  60  GLU GLU A . n 
A 1 61  LYS 61  61  61  LYS LYS A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  ILE 63  63  63  ILE ILE A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  SER 65  65  65  SER SER A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  ILE 67  67  67  ILE ILE A . n 
A 1 68  ASN 68  68  68  ASN ASN A . n 
A 1 69  GLY 69  69  69  GLY GLY A . n 
A 1 70  ILE 70  70  70  ILE ILE A . n 
A 1 71  MET 71  71  71  MET MET A . n 
A 1 72  LYS 72  72  72  LYS LYS A . n 
A 1 73  PRO 73  73  73  PRO PRO A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  ASN 76  76  76  ASN ASN A . n 
A 1 77  ALA 77  77  77  ALA ALA A . n 
A 1 78  ILE 78  78  78  ILE ILE A . n 
A 1 79  LEU 79  79  79  LEU LEU A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  PRO 81  81  81  PRO PRO A . n 
A 1 82  THR 82  82  82  THR THR A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  GLY 84  84  84  GLY GLY A . n 
A 1 85  GLY 85  85  85  GLY GLY A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  SER 87  87  87  SER SER A . n 
A 1 88  SER 88  88  88  SER SER A . n 
A 1 89  LEU 89  89  89  LEU LEU A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  ASP 91  91  91  ASP ASP A . n 
A 1 92  VAL 92  92  92  VAL VAL A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  ALA 94  94  94  ALA ALA A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  ARG 96  96  96  ARG ARG A . n 
A 1 97  LYS 97  97  97  LYS LYS A . n 
A 1 98  ASP 98  98  98  ASP ASP A . n 
A 1 99  PRO 99  99  99  PRO PRO A . n 
A 1 100 SER 100 100 100 SER SER A . n 
A 1 101 GLY 101 101 101 GLY GLY A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 ASP 105 105 105 ASP ASP A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 ASN 109 109 109 ASN ASN A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 ALA 111 111 111 ALA ALA A . n 
A 1 112 PRO 112 112 112 PRO PRO A . n 
A 1 113 ARG 113 113 113 ARG ARG A . n 
A 1 114 PRO 114 114 114 PRO PRO A . n 
A 1 115 ALA 115 115 115 ALA ALA A . n 
A 1 116 ASN 116 116 116 ASN ASN A . n 
A 1 117 PHE 117 117 117 PHE PHE A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 CYS 119 119 119 CYS CYS A . n 
A 1 120 ASN 120 120 120 ASN ASN A . n 
A 1 121 SER 121 121 121 SER SER A . n 
A 1 122 GLY 122 122 122 GLY GLY A . n 
A 1 123 TYR 123 123 123 TYR TYR A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 VAL 125 125 125 VAL VAL A . n 
A 1 126 GLN 126 126 126 GLN GLN A . n 
A 1 127 ASP 127 127 127 ASP ASP A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 VAL 130 130 130 VAL VAL A . n 
A 1 131 MET 131 131 131 MET MET A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 THR 133 133 133 THR THR A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 THR 135 135 135 THR THR A . n 
A 1 136 VAL 136 136 136 VAL VAL A . n 
A 1 137 ARG 137 137 137 ARG ARG A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 ASN 139 139 139 ASN ASN A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 GLN 141 141 141 GLN GLN A . n 
A 1 142 PHE 142 142 142 PHE PHE A . n 
A 1 143 SER 143 143 143 SER SER A . n 
A 1 144 ALA 144 144 144 ALA ALA A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 ARG 147 147 147 ARG ARG A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 ALA 149 149 149 ALA ALA A . n 
A 1 150 THR 150 150 150 THR THR A . n 
A 1 151 THR 151 151 151 THR THR A . n 
A 1 152 MET 152 152 152 MET MET A . n 
A 1 153 THR 153 153 153 THR THR A . n 
A 1 154 ASN 154 154 154 ASN ASN A . n 
A 1 155 HIS 155 155 155 HIS HIS A . n 
A 1 156 GLU 156 156 156 GLU GLU A . n 
A 1 157 LYS 157 157 157 LYS LYS A . n 
A 1 158 ASN 158 158 158 ASN ASN A . n 
A 1 159 GLU 159 159 159 GLU GLU A . n 
A 1 160 ARG 160 160 160 ARG ARG A . n 
A 1 161 ILE 161 161 161 ILE ILE A . n 
A 1 162 ASN 162 162 162 ASN ASN A . n 
A 1 163 ARG 163 163 163 ARG ARG A . n 
A 1 164 VAL 164 164 164 VAL VAL A . n 
A 1 165 ILE 165 165 165 ILE ILE A . n 
A 1 166 GLN 166 166 166 GLN GLN A . n 
A 1 167 GLU 167 167 167 GLU GLU A . n 
A 1 168 LEU 168 168 168 LEU LEU A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 ASP 171 171 171 ASP ASP A . n 
A 1 172 LYS 172 172 172 LYS LYS A . n 
A 1 173 VAL 173 173 173 VAL VAL A . n 
A 1 174 ALA 174 174 174 ALA ALA A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 SER 176 176 176 SER SER A . n 
A 1 177 LYS 177 177 177 LYS LYS A . n 
A 1 178 VAL 178 178 178 VAL VAL A . n 
A 1 179 GLY 179 179 179 GLY GLY A . n 
A 1 180 THR 180 180 180 THR THR A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 PHE 182 182 182 PHE PHE A . n 
A 1 183 ILE 183 183 183 ILE ILE A . n 
A 1 184 ARG 184 184 184 ARG ARG A . n 
A 1 185 GLY 185 185 185 GLY GLY A . n 
A 1 186 VAL 186 186 186 VAL VAL A . n 
A 1 187 SER 187 187 187 SER SER A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 GLU 190 190 190 GLU GLU A . n 
A 1 191 ARG 191 191 191 ARG ARG A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 ARG 193 193 193 ARG ARG A . n 
A 1 194 THR 194 194 194 THR THR A . n 
A 1 195 SER 195 195 195 SER SER A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 GLY 197 197 197 GLY GLY A . n 
A 1 198 MET 198 198 198 MET MET A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 ILE 201 201 201 ILE ILE A . n 
A 1 202 THR 202 202 202 THR THR A . n 
A 1 203 ASP 203 203 203 ASP ASP A . n 
A 1 204 PRO 204 204 204 PRO PRO A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 ILE 206 206 206 ILE ILE A . n 
A 1 207 LEU 207 207 207 LEU LEU A . n 
A 1 208 PHE 208 208 208 PHE PHE A . n 
A 1 209 LEU 209 209 209 LEU LEU A . n 
A 1 210 ASP 210 210 210 ASP ASP A . n 
A 1 211 GLN 211 211 211 GLN GLN A . n 
A 1 212 PRO 212 212 212 PRO PRO A . n 
A 1 213 THR 213 213 213 THR THR A . n 
A 1 214 THR 214 214 214 THR THR A . n 
A 1 215 GLY 215 215 215 GLY GLY A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 SER 218 218 218 SER SER A . n 
A 1 219 SER 219 219 219 SER SER A . n 
A 1 220 THR 220 220 220 THR THR A . n 
A 1 221 ALA 221 221 221 ALA ALA A . n 
A 1 222 ASN 222 222 222 ASN ASN A . n 
A 1 223 ALA 223 223 223 ALA ALA A . n 
A 1 224 VAL 224 224 224 VAL VAL A . n 
A 1 225 LEU 225 225 225 LEU LEU A . n 
A 1 226 LEU 226 226 226 LEU LEU A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 LEU 228 228 228 LEU LEU A . n 
A 1 229 LYS 229 229 229 LYS LYS A . n 
A 1 230 ARG 230 230 230 ARG ARG A . n 
A 1 231 MET 231 231 231 MET MET A . n 
A 1 232 SER 232 232 232 SER SER A . n 
A 1 233 LYS 233 233 233 LYS LYS A . n 
A 1 234 GLN 234 234 234 GLN GLN A . n 
A 1 235 GLY 235 235 235 GLY GLY A . n 
A 1 236 ARG 236 236 236 ARG ARG A . n 
A 1 237 THR 237 237 237 THR THR A . n 
A 1 238 ILE 238 238 238 ILE ILE A . n 
A 1 239 ILE 239 239 239 ILE ILE A . n 
A 1 240 PHE 240 240 240 PHE PHE A . n 
A 1 241 SER 241 241 241 SER SER A . n 
A 1 242 ILE 242 242 242 ILE ILE A . n 
A 1 243 HIS 243 243 243 HIS HIS A . n 
A 1 244 GLN 244 244 244 GLN GLN A . n 
A 1 245 PRO 245 245 245 PRO PRO A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 TYR 247 247 247 TYR TYR A . n 
A 1 248 SER 248 248 248 SER SER A . n 
A 1 249 ILE 249 249 249 ILE ILE A . n 
A 1 250 PHE 250 250 250 PHE PHE A . n 
A 1 251 LYS 251 251 251 LYS LYS A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 PHE 253 253 253 PHE PHE A . n 
A 1 254 ASP 254 254 254 ASP ASP A . n 
A 1 255 SER 255 255 255 SER SER A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 THR 257 257 257 THR THR A . n 
A 1 258 LEU 258 258 258 LEU LEU A . n 
A 1 259 LEU 259 259 259 LEU LEU A . n 
A 1 260 ALA 260 260 260 ALA ALA A . n 
A 1 261 SER 261 261 261 SER SER A . n 
A 1 262 GLY 262 262 262 GLY GLY A . n 
A 1 263 ARG 263 263 263 ARG ARG A . n 
A 1 264 LEU 264 264 264 LEU LEU A . n 
A 1 265 MET 265 265 265 MET MET A . n 
A 1 266 PHE 266 266 266 PHE PHE A . n 
A 1 267 HIS 267 267 267 HIS HIS A . n 
A 1 268 GLY 268 268 268 GLY GLY A . n 
A 1 269 PRO 269 269 269 PRO PRO A . n 
A 1 270 ALA 270 270 270 ALA ALA A . n 
A 1 271 GLN 271 271 271 GLN GLN A . n 
A 1 272 GLU 272 272 272 GLU GLU A . n 
A 1 273 ALA 273 273 273 ALA ALA A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 GLY 275 275 275 GLY GLY A . n 
A 1 276 TYR 276 276 276 TYR TYR A . n 
A 1 277 PHE 277 277 277 PHE PHE A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 SER 279 279 279 SER SER A . n 
A 1 280 ALA 280 280 280 ALA ALA A . n 
A 1 281 GLY 281 281 281 GLY GLY A . n 
A 1 282 TYR 282 282 282 TYR TYR A . n 
A 1 283 HIS 283 283 283 HIS HIS A . n 
A 1 284 CYS 284 284 284 CYS CYS A . n 
A 1 285 GLU 285 285 285 GLU GLU A . n 
A 1 286 ALA 286 286 286 ALA ALA A . n 
A 1 287 TYR 287 287 287 TYR TYR A . n 
A 1 288 ASN 288 288 288 ASN ASN A . n 
A 1 289 ASN 289 289 289 ASN ASN A . n 
A 1 290 PRO 290 290 290 PRO PRO A . n 
A 1 291 ALA 291 291 291 ALA ALA A . n 
A 1 292 ASP 292 292 292 ASP ASP A . n 
A 1 293 PHE 293 293 293 PHE PHE A . n 
A 1 294 PHE 294 294 294 PHE PHE A . n 
A 1 295 LEU 295 295 295 LEU LEU A . n 
A 1 296 ASP 296 296 296 ASP ASP A . n 
A 1 297 ILE 297 297 297 ILE ILE A . n 
A 1 298 ILE 298 298 298 ILE ILE A . n 
A 1 299 ASN 299 299 299 ASN ASN A . n 
A 1 300 GLY 300 300 300 GLY GLY A . n 
A 1 301 ASP 301 301 301 ASP ASP A . n 
A 1 302 SER 302 302 302 SER SER A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 ALA 304 304 304 ALA ALA A . n 
A 1 305 VAL 305 305 305 VAL VAL A . n 
A 1 306 ALA 306 306 306 ALA ALA A . n 
A 1 307 LEU 307 307 307 LEU LEU A . n 
A 1 308 ASN 308 308 308 ASN ASN A . n 
A 1 309 ARG 309 309 309 ARG ARG A . n 
A 1 310 GLU 310 310 310 GLU GLU A . n 
A 1 311 GLU 311 311 ?   ?   ?   A . n 
A 1 312 ASP 312 312 ?   ?   ?   A . n 
A 1 313 PHE 313 313 ?   ?   ?   A . n 
A 1 314 LYS 314 314 ?   ?   ?   A . n 
A 1 315 ALA 315 315 ?   ?   ?   A . n 
A 1 316 THR 316 316 ?   ?   ?   A . n 
A 1 317 GLU 317 317 ?   ?   ?   A . n 
A 1 318 ILE 318 318 ?   ?   ?   A . n 
A 1 319 ILE 319 319 ?   ?   ?   A . n 
A 1 320 GLU 320 320 ?   ?   ?   A . n 
A 1 321 PRO 321 321 ?   ?   ?   A . n 
A 1 322 SER 322 322 ?   ?   ?   A . n 
A 1 323 LYS 323 323 ?   ?   ?   A . n 
A 1 324 GLN 324 324 ?   ?   ?   A . n 
A 1 325 ASP 325 325 ?   ?   ?   A . n 
A 1 326 LYS 326 326 326 LYS LYS A . n 
A 1 327 PRO 327 327 327 PRO PRO A . n 
A 1 328 LEU 328 328 328 LEU LEU A . n 
A 1 329 ILE 329 329 329 ILE ILE A . n 
A 1 330 GLU 330 330 330 GLU GLU A . n 
A 1 331 LYS 331 331 331 LYS LYS A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 ALA 333 333 333 ALA ALA A . n 
A 1 334 GLU 334 334 334 GLU GLU A . n 
A 1 335 ILE 335 335 335 ILE ILE A . n 
A 1 336 TYR 336 336 336 TYR TYR A . n 
A 1 337 VAL 337 337 337 VAL VAL A . n 
A 1 338 ASN 338 338 338 ASN ASN A . n 
A 1 339 SER 339 339 339 SER SER A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 PHE 341 341 341 PHE PHE A . n 
A 1 342 TYR 342 342 342 TYR TYR A . n 
A 1 343 LYS 343 343 343 LYS LYS A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 THR 345 345 345 THR THR A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ALA 347 347 347 ALA ALA A . n 
A 1 348 GLU 348 348 348 GLU GLU A . n 
A 1 349 LEU 349 349 349 LEU LEU A . n 
A 1 350 HIS 350 350 350 HIS HIS A . n 
A 1 351 GLN 351 351 351 GLN GLN A . n 
A 1 352 LEU 352 352 352 LEU LEU A . n 
A 1 353 SER 353 353 353 SER SER A . n 
A 1 354 GLY 354 354 ?   ?   ?   A . n 
A 1 355 GLY 355 355 ?   ?   ?   A . n 
A 1 356 GLU 356 356 ?   ?   ?   A . n 
A 1 357 LYS 357 357 ?   ?   ?   A . n 
A 1 358 LYS 358 358 ?   ?   ?   A . n 
A 1 359 LYS 359 359 ?   ?   ?   A . n 
A 1 360 LYS 360 360 ?   ?   ?   A . n 
A 1 361 ILE 361 361 ?   ?   ?   A . n 
A 1 362 THR 362 362 ?   ?   ?   A . n 
A 1 363 VAL 363 363 ?   ?   ?   A . n 
A 1 364 PHE 364 364 ?   ?   ?   A . n 
A 1 365 LYS 365 365 ?   ?   ?   A . n 
A 1 366 GLU 366 366 ?   ?   ?   A . n 
A 1 367 ILE 367 367 367 ILE ILE A . n 
A 1 368 SER 368 368 368 SER SER A . n 
A 1 369 TYR 369 369 369 TYR TYR A . n 
A 1 370 THR 370 370 370 THR THR A . n 
A 1 371 THR 371 371 371 THR THR A . n 
A 1 372 SER 372 372 372 SER SER A . n 
A 1 373 PHE 373 373 373 PHE PHE A . n 
A 1 374 CYS 374 374 374 CYS CYS A . n 
A 1 375 HIS 375 375 375 HIS HIS A . n 
A 1 376 GLN 376 376 376 GLN GLN A . n 
A 1 377 LEU 377 377 377 LEU LEU A . n 
A 1 378 ARG 378 378 378 ARG ARG A . n 
A 1 379 TRP 379 379 379 TRP TRP A . n 
A 1 380 VAL 380 380 380 VAL VAL A . n 
A 1 381 SER 381 381 381 SER SER A . n 
A 1 382 LYS 382 382 382 LYS LYS A . n 
A 1 383 ARG 383 383 383 ARG ARG A . n 
A 1 384 SER 384 384 384 SER SER A . n 
A 1 385 PHE 385 385 385 PHE PHE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 LEU 388 388 388 LEU LEU A . n 
A 1 389 LEU 389 389 389 LEU LEU A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 ASN 391 391 391 ASN ASN A . n 
A 1 392 PRO 392 392 392 PRO PRO A . n 
A 1 393 GLN 393 393 393 GLN GLN A . n 
A 1 394 ALA 394 394 394 ALA ALA A . n 
A 1 395 SER 395 395 395 SER SER A . n 
A 1 396 ILE 396 396 396 ILE ILE A . n 
A 1 397 ALA 397 397 397 ALA ALA A . n 
A 1 398 GLN 398 398 398 GLN GLN A . n 
A 1 399 ILE 399 399 399 ILE ILE A . n 
A 1 400 ILE 400 400 400 ILE ILE A . n 
A 1 401 VAL 401 401 401 VAL VAL A . n 
A 1 402 THR 402 402 402 THR THR A . n 
A 1 403 VAL 403 403 403 VAL VAL A . n 
A 1 404 VAL 404 404 404 VAL VAL A . n 
A 1 405 LEU 405 405 405 LEU LEU A . n 
A 1 406 GLY 406 406 406 GLY GLY A . n 
A 1 407 LEU 407 407 407 LEU LEU A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ILE 409 409 409 ILE ILE A . n 
A 1 410 GLY 410 410 410 GLY GLY A . n 
A 1 411 ALA 411 411 411 ALA ALA A . n 
A 1 412 ILE 412 412 412 ILE ILE A . n 
A 1 413 TYR 413 413 413 TYR TYR A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 LEU 416 416 416 LEU LEU A . n 
A 1 417 LYS 417 417 417 LYS LYS A . n 
A 1 418 ASN 418 418 418 ASN ASN A . n 
A 1 419 ASP 419 419 419 ASP ASP A . n 
A 1 420 SER 420 420 420 SER SER A . n 
A 1 421 THR 421 421 421 THR THR A . n 
A 1 422 GLY 422 422 422 GLY GLY A . n 
A 1 423 ILE 423 423 423 ILE ILE A . n 
A 1 424 GLN 424 424 424 GLN GLN A . n 
A 1 425 ASN 425 425 425 ASN ASN A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 GLY 428 428 428 GLY GLY A . n 
A 1 429 VAL 429 429 429 VAL VAL A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 PHE 431 431 431 PHE PHE A . n 
A 1 432 PHE 432 432 432 PHE PHE A . n 
A 1 433 LEU 433 433 433 LEU LEU A . n 
A 1 434 THR 434 434 434 THR THR A . n 
A 1 435 THR 435 435 435 THR THR A . n 
A 1 436 ASN 436 436 436 ASN ASN A . n 
A 1 437 GLN 437 437 437 GLN GLN A . n 
A 1 438 CYS 438 438 438 CYS CYS A . n 
A 1 439 PHE 439 439 439 PHE PHE A . n 
A 1 440 SER 440 440 440 SER SER A . n 
A 1 441 SER 441 441 441 SER SER A . n 
A 1 442 VAL 442 442 442 VAL VAL A . n 
A 1 443 SER 443 443 443 SER SER A . n 
A 1 444 ALA 444 444 444 ALA ALA A . n 
A 1 445 VAL 445 445 445 VAL VAL A . n 
A 1 446 GLU 446 446 446 GLU GLU A . n 
A 1 447 LEU 447 447 447 LEU LEU A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 VAL 449 449 449 VAL VAL A . n 
A 1 450 VAL 450 450 450 VAL VAL A . n 
A 1 451 GLU 451 451 451 GLU GLU A . n 
A 1 452 LYS 452 452 452 LYS LYS A . n 
A 1 453 LYS 453 453 453 LYS LYS A . n 
A 1 454 LEU 454 454 454 LEU LEU A . n 
A 1 455 PHE 455 455 455 PHE PHE A . n 
A 1 456 ILE 456 456 456 ILE ILE A . n 
A 1 457 HIS 457 457 457 HIS HIS A . n 
A 1 458 GLU 458 458 458 GLU GLU A . n 
A 1 459 TYR 459 459 459 TYR TYR A . n 
A 1 460 ILE 460 460 460 ILE ILE A . n 
A 1 461 SER 461 461 461 SER SER A . n 
A 1 462 GLY 462 462 462 GLY GLY A . n 
A 1 463 TYR 463 463 463 TYR TYR A . n 
A 1 464 TYR 464 464 464 TYR TYR A . n 
A 1 465 ARG 465 465 465 ARG ARG A . n 
A 1 466 VAL 466 466 466 VAL VAL A . n 
A 1 467 SER 467 467 467 SER SER A . n 
A 1 468 SER 468 468 468 SER SER A . n 
A 1 469 TYR 469 469 469 TYR TYR A . n 
A 1 470 PHE 470 470 470 PHE PHE A . n 
A 1 471 LEU 471 471 471 LEU LEU A . n 
A 1 472 GLY 472 472 472 GLY GLY A . n 
A 1 473 LYS 473 473 473 LYS LYS A . n 
A 1 474 LEU 474 474 474 LEU LEU A . n 
A 1 475 LEU 475 475 475 LEU LEU A . n 
A 1 476 SER 476 476 476 SER SER A . n 
A 1 477 ASP 477 477 477 ASP ASP A . n 
A 1 478 LEU 478 478 478 LEU LEU A . n 
A 1 479 LEU 479 479 479 LEU LEU A . n 
A 1 480 PRO 480 480 480 PRO PRO A . n 
A 1 481 MET 481 481 481 MET MET A . n 
A 1 482 ARG 482 482 482 ARG ARG A . n 
A 1 483 MET 483 483 483 MET MET A . n 
A 1 484 LEU 484 484 484 LEU LEU A . n 
A 1 485 PRO 485 485 485 PRO PRO A . n 
A 1 486 SER 486 486 486 SER SER A . n 
A 1 487 ILE 487 487 487 ILE ILE A . n 
A 1 488 ILE 488 488 488 ILE ILE A . n 
A 1 489 PHE 489 489 489 PHE PHE A . n 
A 1 490 THR 490 490 490 THR THR A . n 
A 1 491 CYS 491 491 491 CYS CYS A . n 
A 1 492 ILE 492 492 492 ILE ILE A . n 
A 1 493 VAL 493 493 493 VAL VAL A . n 
A 1 494 TYR 494 494 494 TYR TYR A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 MET 496 496 496 MET MET A . n 
A 1 497 LEU 497 497 497 LEU LEU A . n 
A 1 498 GLY 498 498 498 GLY GLY A . n 
A 1 499 LEU 499 499 499 LEU LEU A . n 
A 1 500 LYS 500 500 500 LYS LYS A . n 
A 1 501 PRO 501 501 501 PRO PRO A . n 
A 1 502 LYS 502 502 502 LYS LYS A . n 
A 1 503 ALA 503 503 503 ALA ALA A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 ALA 505 505 505 ALA ALA A . n 
A 1 506 PHE 506 506 506 PHE PHE A . n 
A 1 507 PHE 507 507 507 PHE PHE A . n 
A 1 508 VAL 508 508 508 VAL VAL A . n 
A 1 509 MET 509 509 509 MET MET A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 PHE 511 511 511 PHE PHE A . n 
A 1 512 THR 512 512 512 THR THR A . n 
A 1 513 LEU 513 513 513 LEU LEU A . n 
A 1 514 MET 514 514 514 MET MET A . n 
A 1 515 MET 515 515 515 MET MET A . n 
A 1 516 VAL 516 516 516 VAL VAL A . n 
A 1 517 ALA 517 517 517 ALA ALA A . n 
A 1 518 TYR 518 518 518 TYR TYR A . n 
A 1 519 SER 519 519 519 SER SER A . n 
A 1 520 ALA 520 520 520 ALA ALA A . n 
A 1 521 SER 521 521 521 SER SER A . n 
A 1 522 SER 522 522 522 SER SER A . n 
A 1 523 MET 523 523 523 MET MET A . n 
A 1 524 ALA 524 524 524 ALA ALA A . n 
A 1 525 LEU 525 525 525 LEU LEU A . n 
A 1 526 ALA 526 526 526 ALA ALA A . n 
A 1 527 ILE 527 527 527 ILE ILE A . n 
A 1 528 ALA 528 528 528 ALA ALA A . n 
A 1 529 ALA 529 529 529 ALA ALA A . n 
A 1 530 GLY 530 530 530 GLY GLY A . n 
A 1 531 GLN 531 531 531 GLN GLN A . n 
A 1 532 SER 532 532 532 SER SER A . n 
A 1 533 VAL 533 533 533 VAL VAL A . n 
A 1 534 VAL 534 534 534 VAL VAL A . n 
A 1 535 SER 535 535 535 SER SER A . n 
A 1 536 VAL 536 536 536 VAL VAL A . n 
A 1 537 ALA 537 537 537 ALA ALA A . n 
A 1 538 THR 538 538 538 THR THR A . n 
A 1 539 LEU 539 539 539 LEU LEU A . n 
A 1 540 LEU 540 540 540 LEU LEU A . n 
A 1 541 MET 541 541 541 MET MET A . n 
A 1 542 THR 542 542 542 THR THR A . n 
A 1 543 ILE 543 543 543 ILE ILE A . n 
A 1 544 CYS 544 544 544 CYS CYS A . n 
A 1 545 PHE 545 545 545 PHE PHE A . n 
A 1 546 VAL 546 546 546 VAL VAL A . n 
A 1 547 PHE 547 547 547 PHE PHE A . n 
A 1 548 MET 548 548 548 MET MET A . n 
A 1 549 MET 549 549 549 MET MET A . n 
A 1 550 ILE 550 550 550 ILE ILE A . n 
A 1 551 PHE 551 551 551 PHE PHE A . n 
A 1 552 SER 552 552 552 SER SER A . n 
A 1 553 GLY 553 553 553 GLY GLY A . n 
A 1 554 LEU 554 554 554 LEU LEU A . n 
A 1 555 LEU 555 555 555 LEU LEU A . n 
A 1 556 VAL 556 556 556 VAL VAL A . n 
A 1 557 ASN 557 557 557 ASN ASN A . n 
A 1 558 LEU 558 558 558 LEU LEU A . n 
A 1 559 THR 559 559 559 THR THR A . n 
A 1 560 THR 560 560 560 THR THR A . n 
A 1 561 ILE 561 561 561 ILE ILE A . n 
A 1 562 ALA 562 562 562 ALA ALA A . n 
A 1 563 SER 563 563 563 SER SER A . n 
A 1 564 TRP 564 564 564 TRP TRP A . n 
A 1 565 LEU 565 565 565 LEU LEU A . n 
A 1 566 SER 566 566 566 SER SER A . n 
A 1 567 TRP 567 567 567 TRP TRP A . n 
A 1 568 LEU 568 568 568 LEU LEU A . n 
A 1 569 GLN 569 569 569 GLN GLN A . n 
A 1 570 TYR 570 570 570 TYR TYR A . n 
A 1 571 PHE 571 571 571 PHE PHE A . n 
A 1 572 SER 572 572 572 SER SER A . n 
A 1 573 ILE 573 573 573 ILE ILE A . n 
A 1 574 PRO 574 574 574 PRO PRO A . n 
A 1 575 ARG 575 575 575 ARG ARG A . n 
A 1 576 TYR 576 576 576 TYR TYR A . n 
A 1 577 GLY 577 577 577 GLY GLY A . n 
A 1 578 PHE 578 578 578 PHE PHE A . n 
A 1 579 THR 579 579 579 THR THR A . n 
A 1 580 ALA 580 580 580 ALA ALA A . n 
A 1 581 LEU 581 581 581 LEU LEU A . n 
A 1 582 GLN 582 582 582 GLN GLN A . n 
A 1 583 HIS 583 583 583 HIS HIS A . n 
A 1 584 ASN 584 584 584 ASN ASN A . n 
A 1 585 GLU 585 585 585 GLU GLU A . n 
A 1 586 PHE 586 586 586 PHE PHE A . n 
A 1 587 LEU 587 587 587 LEU LEU A . n 
A 1 588 GLY 588 588 588 GLY GLY A . n 
A 1 589 GLN 589 589 589 GLN GLN A . n 
A 1 590 ASN 590 590 590 ASN ASN A . n 
A 1 591 PHE 591 591 591 PHE PHE A . n 
A 1 592 CYS 592 592 592 CYS CYS A . n 
A 1 593 PRO 593 593 593 PRO PRO A . n 
A 1 594 GLY 594 594 594 GLY GLY A . n 
A 1 595 LEU 595 595 595 LEU LEU A . n 
A 1 596 ASN 596 596 596 ASN ASN A . n 
A 1 597 ALA 597 597 597 ALA ALA A . n 
A 1 598 THR 598 598 598 THR THR A . n 
A 1 599 GLY 599 599 599 GLY GLY A . n 
A 1 600 ASN 600 600 600 ASN ASN A . n 
A 1 601 ASN 601 601 601 ASN ASN A . n 
A 1 602 PRO 602 602 602 PRO PRO A . n 
A 1 603 CYS 603 603 603 CYS CYS A . n 
A 1 604 ASN 604 604 604 ASN ASN A . n 
A 1 605 TYR 605 605 605 TYR TYR A . n 
A 1 606 ALA 606 606 606 ALA ALA A . n 
A 1 607 THR 607 607 607 THR THR A . n 
A 1 608 CYS 608 608 608 CYS CYS A . n 
A 1 609 THR 609 609 609 THR THR A . n 
A 1 610 GLY 610 610 610 GLY GLY A . n 
A 1 611 GLU 611 611 611 GLU GLU A . n 
A 1 612 GLU 612 612 612 GLU GLU A . n 
A 1 613 TYR 613 613 613 TYR TYR A . n 
A 1 614 LEU 614 614 614 LEU LEU A . n 
A 1 615 VAL 615 615 615 VAL VAL A . n 
A 1 616 LYS 616 616 616 LYS LYS A . n 
A 1 617 GLN 617 617 617 GLN GLN A . n 
A 1 618 GLY 618 618 618 GLY GLY A . n 
A 1 619 ILE 619 619 619 ILE ILE A . n 
A 1 620 ASP 620 620 620 ASP ASP A . n 
A 1 621 LEU 621 621 621 LEU LEU A . n 
A 1 622 SER 622 622 622 SER SER A . n 
A 1 623 PRO 623 623 623 PRO PRO A . n 
A 1 624 TRP 624 624 624 TRP TRP A . n 
A 1 625 GLY 625 625 625 GLY GLY A . n 
A 1 626 LEU 626 626 626 LEU LEU A . n 
A 1 627 TRP 627 627 627 TRP TRP A . n 
A 1 628 LYS 628 628 628 LYS LYS A . n 
A 1 629 ASN 629 629 629 ASN ASN A . n 
A 1 630 HIS 630 630 630 HIS HIS A . n 
A 1 631 VAL 631 631 631 VAL VAL A . n 
A 1 632 ALA 632 632 632 ALA ALA A . n 
A 1 633 LEU 633 633 633 LEU LEU A . n 
A 1 634 ALA 634 634 634 ALA ALA A . n 
A 1 635 CYS 635 635 635 CYS CYS A . n 
A 1 636 MET 636 636 636 MET MET A . n 
A 1 637 ILE 637 637 637 ILE ILE A . n 
A 1 638 VAL 638 638 638 VAL VAL A . n 
A 1 639 ILE 639 639 639 ILE ILE A . n 
A 1 640 PHE 640 640 640 PHE PHE A . n 
A 1 641 LEU 641 641 641 LEU LEU A . n 
A 1 642 THR 642 642 642 THR THR A . n 
A 1 643 ILE 643 643 643 ILE ILE A . n 
A 1 644 ALA 644 644 644 ALA ALA A . n 
A 1 645 TYR 645 645 645 TYR TYR A . n 
A 1 646 LEU 646 646 646 LEU LEU A . n 
A 1 647 LYS 647 647 647 LYS LYS A . n 
A 1 648 LEU 648 648 648 LEU LEU A . n 
A 1 649 LEU 649 649 649 LEU LEU A . n 
A 1 650 PHE 650 650 650 PHE PHE A . n 
A 1 651 LEU 651 651 651 LEU LEU A . n 
A 1 652 LYS 652 652 652 LYS LYS A . n 
A 1 653 LYS 653 653 653 LYS LYS A . n 
A 1 654 TYR 654 654 654 TYR TYR A . n 
A 1 655 SER 655 655 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   SER 2   2   ?   ?   ?   B . n 
B 1 3   SER 3   3   ?   ?   ?   B . n 
B 1 4   SER 4   4   ?   ?   ?   B . n 
B 1 5   ASN 5   5   ?   ?   ?   B . n 
B 1 6   VAL 6   6   ?   ?   ?   B . n 
B 1 7   GLU 7   7   ?   ?   ?   B . n 
B 1 8   VAL 8   8   ?   ?   ?   B . n 
B 1 9   PHE 9   9   ?   ?   ?   B . n 
B 1 10  ILE 10  10  ?   ?   ?   B . n 
B 1 11  PRO 11  11  ?   ?   ?   B . n 
B 1 12  VAL 12  12  ?   ?   ?   B . n 
B 1 13  SER 13  13  ?   ?   ?   B . n 
B 1 14  GLN 14  14  ?   ?   ?   B . n 
B 1 15  GLY 15  15  ?   ?   ?   B . n 
B 1 16  ASN 16  16  ?   ?   ?   B . n 
B 1 17  THR 17  17  ?   ?   ?   B . n 
B 1 18  ASN 18  18  ?   ?   ?   B . n 
B 1 19  GLY 19  19  ?   ?   ?   B . n 
B 1 20  PHE 20  20  ?   ?   ?   B . n 
B 1 21  PRO 21  21  ?   ?   ?   B . n 
B 1 22  ALA 22  22  ?   ?   ?   B . n 
B 1 23  THR 23  23  ?   ?   ?   B . n 
B 1 24  ALA 24  24  ?   ?   ?   B . n 
B 1 25  SER 25  25  ?   ?   ?   B . n 
B 1 26  ASN 26  26  ?   ?   ?   B . n 
B 1 27  ASP 27  27  ?   ?   ?   B . n 
B 1 28  LEU 28  28  ?   ?   ?   B . n 
B 1 29  LYS 29  29  ?   ?   ?   B . n 
B 1 30  ALA 30  30  ?   ?   ?   B . n 
B 1 31  PHE 31  31  ?   ?   ?   B . n 
B 1 32  THR 32  32  ?   ?   ?   B . n 
B 1 33  GLU 33  33  ?   ?   ?   B . n 
B 1 34  GLY 34  34  34  GLY GLY B . n 
B 1 35  ALA 35  35  35  ALA ALA B . n 
B 1 36  VAL 36  36  36  VAL VAL B . n 
B 1 37  LEU 37  37  37  LEU LEU B . n 
B 1 38  SER 38  38  38  SER SER B . n 
B 1 39  PHE 39  39  39  PHE PHE B . n 
B 1 40  HIS 40  40  40  HIS HIS B . n 
B 1 41  ASN 41  41  41  ASN ASN B . n 
B 1 42  ILE 42  42  42  ILE ILE B . n 
B 1 43  CYS 43  43  43  CYS CYS B . n 
B 1 44  TYR 44  44  44  TYR TYR B . n 
B 1 45  ARG 45  45  45  ARG ARG B . n 
B 1 46  VAL 46  46  46  VAL VAL B . n 
B 1 47  LYS 47  47  47  LYS LYS B . n 
B 1 48  LEU 48  48  48  LEU LEU B . n 
B 1 49  LYS 49  49  ?   ?   ?   B . n 
B 1 50  SER 50  50  ?   ?   ?   B . n 
B 1 51  GLY 51  51  ?   ?   ?   B . n 
B 1 52  PHE 52  52  ?   ?   ?   B . n 
B 1 53  LEU 53  53  ?   ?   ?   B . n 
B 1 54  PRO 54  54  ?   ?   ?   B . n 
B 1 55  CYS 55  55  ?   ?   ?   B . n 
B 1 56  ARG 56  56  ?   ?   ?   B . n 
B 1 57  LYS 57  57  ?   ?   ?   B . n 
B 1 58  PRO 58  58  58  PRO PRO B . n 
B 1 59  VAL 59  59  59  VAL VAL B . n 
B 1 60  GLU 60  60  60  GLU GLU B . n 
B 1 61  LYS 61  61  61  LYS LYS B . n 
B 1 62  GLU 62  62  62  GLU GLU B . n 
B 1 63  ILE 63  63  63  ILE ILE B . n 
B 1 64  LEU 64  64  64  LEU LEU B . n 
B 1 65  SER 65  65  65  SER SER B . n 
B 1 66  ASN 66  66  66  ASN ASN B . n 
B 1 67  ILE 67  67  67  ILE ILE B . n 
B 1 68  ASN 68  68  68  ASN ASN B . n 
B 1 69  GLY 69  69  69  GLY GLY B . n 
B 1 70  ILE 70  70  70  ILE ILE B . n 
B 1 71  MET 71  71  71  MET MET B . n 
B 1 72  LYS 72  72  72  LYS LYS B . n 
B 1 73  PRO 73  73  73  PRO PRO B . n 
B 1 74  GLY 74  74  74  GLY GLY B . n 
B 1 75  LEU 75  75  75  LEU LEU B . n 
B 1 76  ASN 76  76  76  ASN ASN B . n 
B 1 77  ALA 77  77  77  ALA ALA B . n 
B 1 78  ILE 78  78  78  ILE ILE B . n 
B 1 79  LEU 79  79  79  LEU LEU B . n 
B 1 80  GLY 80  80  80  GLY GLY B . n 
B 1 81  PRO 81  81  81  PRO PRO B . n 
B 1 82  THR 82  82  82  THR THR B . n 
B 1 83  GLY 83  83  83  GLY GLY B . n 
B 1 84  GLY 84  84  84  GLY GLY B . n 
B 1 85  GLY 85  85  85  GLY GLY B . n 
B 1 86  LYS 86  86  86  LYS LYS B . n 
B 1 87  SER 87  87  87  SER SER B . n 
B 1 88  SER 88  88  88  SER SER B . n 
B 1 89  LEU 89  89  89  LEU LEU B . n 
B 1 90  LEU 90  90  90  LEU LEU B . n 
B 1 91  ASP 91  91  91  ASP ASP B . n 
B 1 92  VAL 92  92  92  VAL VAL B . n 
B 1 93  LEU 93  93  93  LEU LEU B . n 
B 1 94  ALA 94  94  94  ALA ALA B . n 
B 1 95  ALA 95  95  95  ALA ALA B . n 
B 1 96  ARG 96  96  96  ARG ARG B . n 
B 1 97  LYS 97  97  97  LYS LYS B . n 
B 1 98  ASP 98  98  98  ASP ASP B . n 
B 1 99  PRO 99  99  99  PRO PRO B . n 
B 1 100 SER 100 100 100 SER SER B . n 
B 1 101 GLY 101 101 101 GLY GLY B . n 
B 1 102 LEU 102 102 102 LEU LEU B . n 
B 1 103 SER 103 103 103 SER SER B . n 
B 1 104 GLY 104 104 104 GLY GLY B . n 
B 1 105 ASP 105 105 105 ASP ASP B . n 
B 1 106 VAL 106 106 106 VAL VAL B . n 
B 1 107 LEU 107 107 107 LEU LEU B . n 
B 1 108 ILE 108 108 108 ILE ILE B . n 
B 1 109 ASN 109 109 109 ASN ASN B . n 
B 1 110 GLY 110 110 110 GLY GLY B . n 
B 1 111 ALA 111 111 111 ALA ALA B . n 
B 1 112 PRO 112 112 112 PRO PRO B . n 
B 1 113 ARG 113 113 113 ARG ARG B . n 
B 1 114 PRO 114 114 114 PRO PRO B . n 
B 1 115 ALA 115 115 115 ALA ALA B . n 
B 1 116 ASN 116 116 116 ASN ASN B . n 
B 1 117 PHE 117 117 117 PHE PHE B . n 
B 1 118 LYS 118 118 118 LYS LYS B . n 
B 1 119 CYS 119 119 119 CYS CYS B . n 
B 1 120 ASN 120 120 120 ASN ASN B . n 
B 1 121 SER 121 121 121 SER SER B . n 
B 1 122 GLY 122 122 122 GLY GLY B . n 
B 1 123 TYR 123 123 123 TYR TYR B . n 
B 1 124 VAL 124 124 124 VAL VAL B . n 
B 1 125 VAL 125 125 125 VAL VAL B . n 
B 1 126 GLN 126 126 126 GLN GLN B . n 
B 1 127 ASP 127 127 127 ASP ASP B . n 
B 1 128 ASP 128 128 128 ASP ASP B . n 
B 1 129 VAL 129 129 129 VAL VAL B . n 
B 1 130 VAL 130 130 130 VAL VAL B . n 
B 1 131 MET 131 131 131 MET MET B . n 
B 1 132 GLY 132 132 132 GLY GLY B . n 
B 1 133 THR 133 133 133 THR THR B . n 
B 1 134 LEU 134 134 134 LEU LEU B . n 
B 1 135 THR 135 135 135 THR THR B . n 
B 1 136 VAL 136 136 136 VAL VAL B . n 
B 1 137 ARG 137 137 137 ARG ARG B . n 
B 1 138 GLU 138 138 138 GLU GLU B . n 
B 1 139 ASN 139 139 139 ASN ASN B . n 
B 1 140 LEU 140 140 140 LEU LEU B . n 
B 1 141 GLN 141 141 141 GLN GLN B . n 
B 1 142 PHE 142 142 142 PHE PHE B . n 
B 1 143 SER 143 143 143 SER SER B . n 
B 1 144 ALA 144 144 144 ALA ALA B . n 
B 1 145 ALA 145 145 145 ALA ALA B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 ARG 147 147 147 ARG ARG B . n 
B 1 148 LEU 148 148 148 LEU LEU B . n 
B 1 149 ALA 149 149 149 ALA ALA B . n 
B 1 150 THR 150 150 150 THR THR B . n 
B 1 151 THR 151 151 151 THR THR B . n 
B 1 152 MET 152 152 152 MET MET B . n 
B 1 153 THR 153 153 153 THR THR B . n 
B 1 154 ASN 154 154 154 ASN ASN B . n 
B 1 155 HIS 155 155 155 HIS HIS B . n 
B 1 156 GLU 156 156 156 GLU GLU B . n 
B 1 157 LYS 157 157 157 LYS LYS B . n 
B 1 158 ASN 158 158 158 ASN ASN B . n 
B 1 159 GLU 159 159 159 GLU GLU B . n 
B 1 160 ARG 160 160 160 ARG ARG B . n 
B 1 161 ILE 161 161 161 ILE ILE B . n 
B 1 162 ASN 162 162 162 ASN ASN B . n 
B 1 163 ARG 163 163 163 ARG ARG B . n 
B 1 164 VAL 164 164 164 VAL VAL B . n 
B 1 165 ILE 165 165 165 ILE ILE B . n 
B 1 166 GLN 166 166 166 GLN GLN B . n 
B 1 167 GLU 167 167 167 GLU GLU B . n 
B 1 168 LEU 168 168 168 LEU LEU B . n 
B 1 169 GLY 169 169 169 GLY GLY B . n 
B 1 170 LEU 170 170 170 LEU LEU B . n 
B 1 171 ASP 171 171 171 ASP ASP B . n 
B 1 172 LYS 172 172 172 LYS LYS B . n 
B 1 173 VAL 173 173 173 VAL VAL B . n 
B 1 174 ALA 174 174 174 ALA ALA B . n 
B 1 175 ASP 175 175 175 ASP ASP B . n 
B 1 176 SER 176 176 176 SER SER B . n 
B 1 177 LYS 177 177 177 LYS LYS B . n 
B 1 178 VAL 178 178 178 VAL VAL B . n 
B 1 179 GLY 179 179 179 GLY GLY B . n 
B 1 180 THR 180 180 180 THR THR B . n 
B 1 181 GLN 181 181 181 GLN GLN B . n 
B 1 182 PHE 182 182 182 PHE PHE B . n 
B 1 183 ILE 183 183 183 ILE ILE B . n 
B 1 184 ARG 184 184 184 ARG ARG B . n 
B 1 185 GLY 185 185 185 GLY GLY B . n 
B 1 186 VAL 186 186 186 VAL VAL B . n 
B 1 187 SER 187 187 187 SER SER B . n 
B 1 188 GLY 188 188 188 GLY GLY B . n 
B 1 189 GLY 189 189 189 GLY GLY B . n 
B 1 190 GLU 190 190 190 GLU GLU B . n 
B 1 191 ARG 191 191 191 ARG ARG B . n 
B 1 192 LYS 192 192 192 LYS LYS B . n 
B 1 193 ARG 193 193 193 ARG ARG B . n 
B 1 194 THR 194 194 194 THR THR B . n 
B 1 195 SER 195 195 195 SER SER B . n 
B 1 196 ILE 196 196 196 ILE ILE B . n 
B 1 197 GLY 197 197 197 GLY GLY B . n 
B 1 198 MET 198 198 198 MET MET B . n 
B 1 199 GLU 199 199 199 GLU GLU B . n 
B 1 200 LEU 200 200 200 LEU LEU B . n 
B 1 201 ILE 201 201 201 ILE ILE B . n 
B 1 202 THR 202 202 202 THR THR B . n 
B 1 203 ASP 203 203 203 ASP ASP B . n 
B 1 204 PRO 204 204 204 PRO PRO B . n 
B 1 205 SER 205 205 205 SER SER B . n 
B 1 206 ILE 206 206 206 ILE ILE B . n 
B 1 207 LEU 207 207 207 LEU LEU B . n 
B 1 208 PHE 208 208 208 PHE PHE B . n 
B 1 209 LEU 209 209 209 LEU LEU B . n 
B 1 210 ASP 210 210 210 ASP ASP B . n 
B 1 211 GLN 211 211 211 GLN GLN B . n 
B 1 212 PRO 212 212 212 PRO PRO B . n 
B 1 213 THR 213 213 213 THR THR B . n 
B 1 214 THR 214 214 214 THR THR B . n 
B 1 215 GLY 215 215 215 GLY GLY B . n 
B 1 216 LEU 216 216 216 LEU LEU B . n 
B 1 217 ASP 217 217 217 ASP ASP B . n 
B 1 218 SER 218 218 218 SER SER B . n 
B 1 219 SER 219 219 219 SER SER B . n 
B 1 220 THR 220 220 220 THR THR B . n 
B 1 221 ALA 221 221 221 ALA ALA B . n 
B 1 222 ASN 222 222 222 ASN ASN B . n 
B 1 223 ALA 223 223 223 ALA ALA B . n 
B 1 224 VAL 224 224 224 VAL VAL B . n 
B 1 225 LEU 225 225 225 LEU LEU B . n 
B 1 226 LEU 226 226 226 LEU LEU B . n 
B 1 227 LEU 227 227 227 LEU LEU B . n 
B 1 228 LEU 228 228 228 LEU LEU B . n 
B 1 229 LYS 229 229 229 LYS LYS B . n 
B 1 230 ARG 230 230 230 ARG ARG B . n 
B 1 231 MET 231 231 231 MET MET B . n 
B 1 232 SER 232 232 232 SER SER B . n 
B 1 233 LYS 233 233 233 LYS LYS B . n 
B 1 234 GLN 234 234 234 GLN GLN B . n 
B 1 235 GLY 235 235 235 GLY GLY B . n 
B 1 236 ARG 236 236 236 ARG ARG B . n 
B 1 237 THR 237 237 237 THR THR B . n 
B 1 238 ILE 238 238 238 ILE ILE B . n 
B 1 239 ILE 239 239 239 ILE ILE B . n 
B 1 240 PHE 240 240 240 PHE PHE B . n 
B 1 241 SER 241 241 241 SER SER B . n 
B 1 242 ILE 242 242 242 ILE ILE B . n 
B 1 243 HIS 243 243 243 HIS HIS B . n 
B 1 244 GLN 244 244 244 GLN GLN B . n 
B 1 245 PRO 245 245 245 PRO PRO B . n 
B 1 246 ARG 246 246 246 ARG ARG B . n 
B 1 247 TYR 247 247 247 TYR TYR B . n 
B 1 248 SER 248 248 248 SER SER B . n 
B 1 249 ILE 249 249 249 ILE ILE B . n 
B 1 250 PHE 250 250 250 PHE PHE B . n 
B 1 251 LYS 251 251 251 LYS LYS B . n 
B 1 252 LEU 252 252 252 LEU LEU B . n 
B 1 253 PHE 253 253 253 PHE PHE B . n 
B 1 254 ASP 254 254 254 ASP ASP B . n 
B 1 255 SER 255 255 255 SER SER B . n 
B 1 256 LEU 256 256 256 LEU LEU B . n 
B 1 257 THR 257 257 257 THR THR B . n 
B 1 258 LEU 258 258 258 LEU LEU B . n 
B 1 259 LEU 259 259 259 LEU LEU B . n 
B 1 260 ALA 260 260 260 ALA ALA B . n 
B 1 261 SER 261 261 261 SER SER B . n 
B 1 262 GLY 262 262 262 GLY GLY B . n 
B 1 263 ARG 263 263 263 ARG ARG B . n 
B 1 264 LEU 264 264 264 LEU LEU B . n 
B 1 265 MET 265 265 265 MET MET B . n 
B 1 266 PHE 266 266 266 PHE PHE B . n 
B 1 267 HIS 267 267 267 HIS HIS B . n 
B 1 268 GLY 268 268 268 GLY GLY B . n 
B 1 269 PRO 269 269 269 PRO PRO B . n 
B 1 270 ALA 270 270 270 ALA ALA B . n 
B 1 271 GLN 271 271 271 GLN GLN B . n 
B 1 272 GLU 272 272 272 GLU GLU B . n 
B 1 273 ALA 273 273 273 ALA ALA B . n 
B 1 274 LEU 274 274 274 LEU LEU B . n 
B 1 275 GLY 275 275 275 GLY GLY B . n 
B 1 276 TYR 276 276 276 TYR TYR B . n 
B 1 277 PHE 277 277 277 PHE PHE B . n 
B 1 278 GLU 278 278 278 GLU GLU B . n 
B 1 279 SER 279 279 279 SER SER B . n 
B 1 280 ALA 280 280 280 ALA ALA B . n 
B 1 281 GLY 281 281 281 GLY GLY B . n 
B 1 282 TYR 282 282 282 TYR TYR B . n 
B 1 283 HIS 283 283 283 HIS HIS B . n 
B 1 284 CYS 284 284 284 CYS CYS B . n 
B 1 285 GLU 285 285 285 GLU GLU B . n 
B 1 286 ALA 286 286 286 ALA ALA B . n 
B 1 287 TYR 287 287 287 TYR TYR B . n 
B 1 288 ASN 288 288 288 ASN ASN B . n 
B 1 289 ASN 289 289 289 ASN ASN B . n 
B 1 290 PRO 290 290 290 PRO PRO B . n 
B 1 291 ALA 291 291 291 ALA ALA B . n 
B 1 292 ASP 292 292 292 ASP ASP B . n 
B 1 293 PHE 293 293 293 PHE PHE B . n 
B 1 294 PHE 294 294 294 PHE PHE B . n 
B 1 295 LEU 295 295 295 LEU LEU B . n 
B 1 296 ASP 296 296 296 ASP ASP B . n 
B 1 297 ILE 297 297 297 ILE ILE B . n 
B 1 298 ILE 298 298 298 ILE ILE B . n 
B 1 299 ASN 299 299 299 ASN ASN B . n 
B 1 300 GLY 300 300 300 GLY GLY B . n 
B 1 301 ASP 301 301 301 ASP ASP B . n 
B 1 302 SER 302 302 302 SER SER B . n 
B 1 303 THR 303 303 303 THR THR B . n 
B 1 304 ALA 304 304 304 ALA ALA B . n 
B 1 305 VAL 305 305 305 VAL VAL B . n 
B 1 306 ALA 306 306 306 ALA ALA B . n 
B 1 307 LEU 307 307 307 LEU LEU B . n 
B 1 308 ASN 308 308 308 ASN ASN B . n 
B 1 309 ARG 309 309 309 ARG ARG B . n 
B 1 310 GLU 310 310 310 GLU GLU B . n 
B 1 311 GLU 311 311 ?   ?   ?   B . n 
B 1 312 ASP 312 312 ?   ?   ?   B . n 
B 1 313 PHE 313 313 ?   ?   ?   B . n 
B 1 314 LYS 314 314 ?   ?   ?   B . n 
B 1 315 ALA 315 315 ?   ?   ?   B . n 
B 1 316 THR 316 316 ?   ?   ?   B . n 
B 1 317 GLU 317 317 ?   ?   ?   B . n 
B 1 318 ILE 318 318 ?   ?   ?   B . n 
B 1 319 ILE 319 319 ?   ?   ?   B . n 
B 1 320 GLU 320 320 ?   ?   ?   B . n 
B 1 321 PRO 321 321 ?   ?   ?   B . n 
B 1 322 SER 322 322 ?   ?   ?   B . n 
B 1 323 LYS 323 323 ?   ?   ?   B . n 
B 1 324 GLN 324 324 ?   ?   ?   B . n 
B 1 325 ASP 325 325 ?   ?   ?   B . n 
B 1 326 LYS 326 326 326 LYS LYS B . n 
B 1 327 PRO 327 327 327 PRO PRO B . n 
B 1 328 LEU 328 328 328 LEU LEU B . n 
B 1 329 ILE 329 329 329 ILE ILE B . n 
B 1 330 GLU 330 330 330 GLU GLU B . n 
B 1 331 LYS 331 331 331 LYS LYS B . n 
B 1 332 LEU 332 332 332 LEU LEU B . n 
B 1 333 ALA 333 333 333 ALA ALA B . n 
B 1 334 GLU 334 334 334 GLU GLU B . n 
B 1 335 ILE 335 335 335 ILE ILE B . n 
B 1 336 TYR 336 336 336 TYR TYR B . n 
B 1 337 VAL 337 337 337 VAL VAL B . n 
B 1 338 ASN 338 338 338 ASN ASN B . n 
B 1 339 SER 339 339 339 SER SER B . n 
B 1 340 SER 340 340 340 SER SER B . n 
B 1 341 PHE 341 341 341 PHE PHE B . n 
B 1 342 TYR 342 342 342 TYR TYR B . n 
B 1 343 LYS 343 343 343 LYS LYS B . n 
B 1 344 GLU 344 344 344 GLU GLU B . n 
B 1 345 THR 345 345 345 THR THR B . n 
B 1 346 LYS 346 346 346 LYS LYS B . n 
B 1 347 ALA 347 347 347 ALA ALA B . n 
B 1 348 GLU 348 348 348 GLU GLU B . n 
B 1 349 LEU 349 349 349 LEU LEU B . n 
B 1 350 HIS 350 350 350 HIS HIS B . n 
B 1 351 GLN 351 351 351 GLN GLN B . n 
B 1 352 LEU 352 352 352 LEU LEU B . n 
B 1 353 SER 353 353 353 SER SER B . n 
B 1 354 GLY 354 354 ?   ?   ?   B . n 
B 1 355 GLY 355 355 ?   ?   ?   B . n 
B 1 356 GLU 356 356 ?   ?   ?   B . n 
B 1 357 LYS 357 357 ?   ?   ?   B . n 
B 1 358 LYS 358 358 ?   ?   ?   B . n 
B 1 359 LYS 359 359 ?   ?   ?   B . n 
B 1 360 LYS 360 360 ?   ?   ?   B . n 
B 1 361 ILE 361 361 ?   ?   ?   B . n 
B 1 362 THR 362 362 ?   ?   ?   B . n 
B 1 363 VAL 363 363 ?   ?   ?   B . n 
B 1 364 PHE 364 364 ?   ?   ?   B . n 
B 1 365 LYS 365 365 ?   ?   ?   B . n 
B 1 366 GLU 366 366 ?   ?   ?   B . n 
B 1 367 ILE 367 367 367 ILE ILE B . n 
B 1 368 SER 368 368 368 SER SER B . n 
B 1 369 TYR 369 369 369 TYR TYR B . n 
B 1 370 THR 370 370 370 THR THR B . n 
B 1 371 THR 371 371 371 THR THR B . n 
B 1 372 SER 372 372 372 SER SER B . n 
B 1 373 PHE 373 373 373 PHE PHE B . n 
B 1 374 CYS 374 374 374 CYS CYS B . n 
B 1 375 HIS 375 375 375 HIS HIS B . n 
B 1 376 GLN 376 376 376 GLN GLN B . n 
B 1 377 LEU 377 377 377 LEU LEU B . n 
B 1 378 ARG 378 378 378 ARG ARG B . n 
B 1 379 TRP 379 379 379 TRP TRP B . n 
B 1 380 VAL 380 380 380 VAL VAL B . n 
B 1 381 SER 381 381 381 SER SER B . n 
B 1 382 LYS 382 382 382 LYS LYS B . n 
B 1 383 ARG 383 383 383 ARG ARG B . n 
B 1 384 SER 384 384 384 SER SER B . n 
B 1 385 PHE 385 385 385 PHE PHE B . n 
B 1 386 LYS 386 386 386 LYS LYS B . n 
B 1 387 ASN 387 387 387 ASN ASN B . n 
B 1 388 LEU 388 388 388 LEU LEU B . n 
B 1 389 LEU 389 389 389 LEU LEU B . n 
B 1 390 GLY 390 390 390 GLY GLY B . n 
B 1 391 ASN 391 391 391 ASN ASN B . n 
B 1 392 PRO 392 392 392 PRO PRO B . n 
B 1 393 GLN 393 393 393 GLN GLN B . n 
B 1 394 ALA 394 394 394 ALA ALA B . n 
B 1 395 SER 395 395 395 SER SER B . n 
B 1 396 ILE 396 396 396 ILE ILE B . n 
B 1 397 ALA 397 397 397 ALA ALA B . n 
B 1 398 GLN 398 398 398 GLN GLN B . n 
B 1 399 ILE 399 399 399 ILE ILE B . n 
B 1 400 ILE 400 400 400 ILE ILE B . n 
B 1 401 VAL 401 401 401 VAL VAL B . n 
B 1 402 THR 402 402 402 THR THR B . n 
B 1 403 VAL 403 403 403 VAL VAL B . n 
B 1 404 VAL 404 404 404 VAL VAL B . n 
B 1 405 LEU 405 405 405 LEU LEU B . n 
B 1 406 GLY 406 406 406 GLY GLY B . n 
B 1 407 LEU 407 407 407 LEU LEU B . n 
B 1 408 VAL 408 408 408 VAL VAL B . n 
B 1 409 ILE 409 409 409 ILE ILE B . n 
B 1 410 GLY 410 410 410 GLY GLY B . n 
B 1 411 ALA 411 411 411 ALA ALA B . n 
B 1 412 ILE 412 412 412 ILE ILE B . n 
B 1 413 TYR 413 413 413 TYR TYR B . n 
B 1 414 PHE 414 414 414 PHE PHE B . n 
B 1 415 GLY 415 415 415 GLY GLY B . n 
B 1 416 LEU 416 416 416 LEU LEU B . n 
B 1 417 LYS 417 417 417 LYS LYS B . n 
B 1 418 ASN 418 418 418 ASN ASN B . n 
B 1 419 ASP 419 419 419 ASP ASP B . n 
B 1 420 SER 420 420 420 SER SER B . n 
B 1 421 THR 421 421 421 THR THR B . n 
B 1 422 GLY 422 422 422 GLY GLY B . n 
B 1 423 ILE 423 423 423 ILE ILE B . n 
B 1 424 GLN 424 424 424 GLN GLN B . n 
B 1 425 ASN 425 425 425 ASN ASN B . n 
B 1 426 ARG 426 426 426 ARG ARG B . n 
B 1 427 ALA 427 427 427 ALA ALA B . n 
B 1 428 GLY 428 428 428 GLY GLY B . n 
B 1 429 VAL 429 429 429 VAL VAL B . n 
B 1 430 LEU 430 430 430 LEU LEU B . n 
B 1 431 PHE 431 431 431 PHE PHE B . n 
B 1 432 PHE 432 432 432 PHE PHE B . n 
B 1 433 LEU 433 433 433 LEU LEU B . n 
B 1 434 THR 434 434 434 THR THR B . n 
B 1 435 THR 435 435 435 THR THR B . n 
B 1 436 ASN 436 436 436 ASN ASN B . n 
B 1 437 GLN 437 437 437 GLN GLN B . n 
B 1 438 CYS 438 438 438 CYS CYS B . n 
B 1 439 PHE 439 439 439 PHE PHE B . n 
B 1 440 SER 440 440 440 SER SER B . n 
B 1 441 SER 441 441 441 SER SER B . n 
B 1 442 VAL 442 442 442 VAL VAL B . n 
B 1 443 SER 443 443 443 SER SER B . n 
B 1 444 ALA 444 444 444 ALA ALA B . n 
B 1 445 VAL 445 445 445 VAL VAL B . n 
B 1 446 GLU 446 446 446 GLU GLU B . n 
B 1 447 LEU 447 447 447 LEU LEU B . n 
B 1 448 PHE 448 448 448 PHE PHE B . n 
B 1 449 VAL 449 449 449 VAL VAL B . n 
B 1 450 VAL 450 450 450 VAL VAL B . n 
B 1 451 GLU 451 451 451 GLU GLU B . n 
B 1 452 LYS 452 452 452 LYS LYS B . n 
B 1 453 LYS 453 453 453 LYS LYS B . n 
B 1 454 LEU 454 454 454 LEU LEU B . n 
B 1 455 PHE 455 455 455 PHE PHE B . n 
B 1 456 ILE 456 456 456 ILE ILE B . n 
B 1 457 HIS 457 457 457 HIS HIS B . n 
B 1 458 GLU 458 458 458 GLU GLU B . n 
B 1 459 TYR 459 459 459 TYR TYR B . n 
B 1 460 ILE 460 460 460 ILE ILE B . n 
B 1 461 SER 461 461 461 SER SER B . n 
B 1 462 GLY 462 462 462 GLY GLY B . n 
B 1 463 TYR 463 463 463 TYR TYR B . n 
B 1 464 TYR 464 464 464 TYR TYR B . n 
B 1 465 ARG 465 465 465 ARG ARG B . n 
B 1 466 VAL 466 466 466 VAL VAL B . n 
B 1 467 SER 467 467 467 SER SER B . n 
B 1 468 SER 468 468 468 SER SER B . n 
B 1 469 TYR 469 469 469 TYR TYR B . n 
B 1 470 PHE 470 470 470 PHE PHE B . n 
B 1 471 LEU 471 471 471 LEU LEU B . n 
B 1 472 GLY 472 472 472 GLY GLY B . n 
B 1 473 LYS 473 473 473 LYS LYS B . n 
B 1 474 LEU 474 474 474 LEU LEU B . n 
B 1 475 LEU 475 475 475 LEU LEU B . n 
B 1 476 SER 476 476 476 SER SER B . n 
B 1 477 ASP 477 477 477 ASP ASP B . n 
B 1 478 LEU 478 478 478 LEU LEU B . n 
B 1 479 LEU 479 479 479 LEU LEU B . n 
B 1 480 PRO 480 480 480 PRO PRO B . n 
B 1 481 MET 481 481 481 MET MET B . n 
B 1 482 ARG 482 482 482 ARG ARG B . n 
B 1 483 MET 483 483 483 MET MET B . n 
B 1 484 LEU 484 484 484 LEU LEU B . n 
B 1 485 PRO 485 485 485 PRO PRO B . n 
B 1 486 SER 486 486 486 SER SER B . n 
B 1 487 ILE 487 487 487 ILE ILE B . n 
B 1 488 ILE 488 488 488 ILE ILE B . n 
B 1 489 PHE 489 489 489 PHE PHE B . n 
B 1 490 THR 490 490 490 THR THR B . n 
B 1 491 CYS 491 491 491 CYS CYS B . n 
B 1 492 ILE 492 492 492 ILE ILE B . n 
B 1 493 VAL 493 493 493 VAL VAL B . n 
B 1 494 TYR 494 494 494 TYR TYR B . n 
B 1 495 PHE 495 495 495 PHE PHE B . n 
B 1 496 MET 496 496 496 MET MET B . n 
B 1 497 LEU 497 497 497 LEU LEU B . n 
B 1 498 GLY 498 498 498 GLY GLY B . n 
B 1 499 LEU 499 499 499 LEU LEU B . n 
B 1 500 LYS 500 500 500 LYS LYS B . n 
B 1 501 PRO 501 501 501 PRO PRO B . n 
B 1 502 LYS 502 502 502 LYS LYS B . n 
B 1 503 ALA 503 503 503 ALA ALA B . n 
B 1 504 ASP 504 504 504 ASP ASP B . n 
B 1 505 ALA 505 505 505 ALA ALA B . n 
B 1 506 PHE 506 506 506 PHE PHE B . n 
B 1 507 PHE 507 507 507 PHE PHE B . n 
B 1 508 VAL 508 508 508 VAL VAL B . n 
B 1 509 MET 509 509 509 MET MET B . n 
B 1 510 MET 510 510 510 MET MET B . n 
B 1 511 PHE 511 511 511 PHE PHE B . n 
B 1 512 THR 512 512 512 THR THR B . n 
B 1 513 LEU 513 513 513 LEU LEU B . n 
B 1 514 MET 514 514 514 MET MET B . n 
B 1 515 MET 515 515 515 MET MET B . n 
B 1 516 VAL 516 516 516 VAL VAL B . n 
B 1 517 ALA 517 517 517 ALA ALA B . n 
B 1 518 TYR 518 518 518 TYR TYR B . n 
B 1 519 SER 519 519 519 SER SER B . n 
B 1 520 ALA 520 520 520 ALA ALA B . n 
B 1 521 SER 521 521 521 SER SER B . n 
B 1 522 SER 522 522 522 SER SER B . n 
B 1 523 MET 523 523 523 MET MET B . n 
B 1 524 ALA 524 524 524 ALA ALA B . n 
B 1 525 LEU 525 525 525 LEU LEU B . n 
B 1 526 ALA 526 526 526 ALA ALA B . n 
B 1 527 ILE 527 527 527 ILE ILE B . n 
B 1 528 ALA 528 528 528 ALA ALA B . n 
B 1 529 ALA 529 529 529 ALA ALA B . n 
B 1 530 GLY 530 530 530 GLY GLY B . n 
B 1 531 GLN 531 531 531 GLN GLN B . n 
B 1 532 SER 532 532 532 SER SER B . n 
B 1 533 VAL 533 533 533 VAL VAL B . n 
B 1 534 VAL 534 534 534 VAL VAL B . n 
B 1 535 SER 535 535 535 SER SER B . n 
B 1 536 VAL 536 536 536 VAL VAL B . n 
B 1 537 ALA 537 537 537 ALA ALA B . n 
B 1 538 THR 538 538 538 THR THR B . n 
B 1 539 LEU 539 539 539 LEU LEU B . n 
B 1 540 LEU 540 540 540 LEU LEU B . n 
B 1 541 MET 541 541 541 MET MET B . n 
B 1 542 THR 542 542 542 THR THR B . n 
B 1 543 ILE 543 543 543 ILE ILE B . n 
B 1 544 CYS 544 544 544 CYS CYS B . n 
B 1 545 PHE 545 545 545 PHE PHE B . n 
B 1 546 VAL 546 546 546 VAL VAL B . n 
B 1 547 PHE 547 547 547 PHE PHE B . n 
B 1 548 MET 548 548 548 MET MET B . n 
B 1 549 MET 549 549 549 MET MET B . n 
B 1 550 ILE 550 550 550 ILE ILE B . n 
B 1 551 PHE 551 551 551 PHE PHE B . n 
B 1 552 SER 552 552 552 SER SER B . n 
B 1 553 GLY 553 553 553 GLY GLY B . n 
B 1 554 LEU 554 554 554 LEU LEU B . n 
B 1 555 LEU 555 555 555 LEU LEU B . n 
B 1 556 VAL 556 556 556 VAL VAL B . n 
B 1 557 ASN 557 557 557 ASN ASN B . n 
B 1 558 LEU 558 558 558 LEU LEU B . n 
B 1 559 THR 559 559 559 THR THR B . n 
B 1 560 THR 560 560 560 THR THR B . n 
B 1 561 ILE 561 561 561 ILE ILE B . n 
B 1 562 ALA 562 562 562 ALA ALA B . n 
B 1 563 SER 563 563 563 SER SER B . n 
B 1 564 TRP 564 564 564 TRP TRP B . n 
B 1 565 LEU 565 565 565 LEU LEU B . n 
B 1 566 SER 566 566 566 SER SER B . n 
B 1 567 TRP 567 567 567 TRP TRP B . n 
B 1 568 LEU 568 568 568 LEU LEU B . n 
B 1 569 GLN 569 569 569 GLN GLN B . n 
B 1 570 TYR 570 570 570 TYR TYR B . n 
B 1 571 PHE 571 571 571 PHE PHE B . n 
B 1 572 SER 572 572 572 SER SER B . n 
B 1 573 ILE 573 573 573 ILE ILE B . n 
B 1 574 PRO 574 574 574 PRO PRO B . n 
B 1 575 ARG 575 575 575 ARG ARG B . n 
B 1 576 TYR 576 576 576 TYR TYR B . n 
B 1 577 GLY 577 577 577 GLY GLY B . n 
B 1 578 PHE 578 578 578 PHE PHE B . n 
B 1 579 THR 579 579 579 THR THR B . n 
B 1 580 ALA 580 580 580 ALA ALA B . n 
B 1 581 LEU 581 581 581 LEU LEU B . n 
B 1 582 GLN 582 582 582 GLN GLN B . n 
B 1 583 HIS 583 583 583 HIS HIS B . n 
B 1 584 ASN 584 584 584 ASN ASN B . n 
B 1 585 GLU 585 585 585 GLU GLU B . n 
B 1 586 PHE 586 586 586 PHE PHE B . n 
B 1 587 LEU 587 587 587 LEU LEU B . n 
B 1 588 GLY 588 588 588 GLY GLY B . n 
B 1 589 GLN 589 589 589 GLN GLN B . n 
B 1 590 ASN 590 590 590 ASN ASN B . n 
B 1 591 PHE 591 591 591 PHE PHE B . n 
B 1 592 CYS 592 592 592 CYS CYS B . n 
B 1 593 PRO 593 593 593 PRO PRO B . n 
B 1 594 GLY 594 594 594 GLY GLY B . n 
B 1 595 LEU 595 595 595 LEU LEU B . n 
B 1 596 ASN 596 596 596 ASN ASN B . n 
B 1 597 ALA 597 597 597 ALA ALA B . n 
B 1 598 THR 598 598 598 THR THR B . n 
B 1 599 GLY 599 599 599 GLY GLY B . n 
B 1 600 ASN 600 600 600 ASN ASN B . n 
B 1 601 ASN 601 601 601 ASN ASN B . n 
B 1 602 PRO 602 602 602 PRO PRO B . n 
B 1 603 CYS 603 603 603 CYS CYS B . n 
B 1 604 ASN 604 604 604 ASN ASN B . n 
B 1 605 TYR 605 605 605 TYR TYR B . n 
B 1 606 ALA 606 606 606 ALA ALA B . n 
B 1 607 THR 607 607 607 THR THR B . n 
B 1 608 CYS 608 608 608 CYS CYS B . n 
B 1 609 THR 609 609 609 THR THR B . n 
B 1 610 GLY 610 610 610 GLY GLY B . n 
B 1 611 GLU 611 611 611 GLU GLU B . n 
B 1 612 GLU 612 612 612 GLU GLU B . n 
B 1 613 TYR 613 613 613 TYR TYR B . n 
B 1 614 LEU 614 614 614 LEU LEU B . n 
B 1 615 VAL 615 615 615 VAL VAL B . n 
B 1 616 LYS 616 616 616 LYS LYS B . n 
B 1 617 GLN 617 617 617 GLN GLN B . n 
B 1 618 GLY 618 618 618 GLY GLY B . n 
B 1 619 ILE 619 619 619 ILE ILE B . n 
B 1 620 ASP 620 620 620 ASP ASP B . n 
B 1 621 LEU 621 621 621 LEU LEU B . n 
B 1 622 SER 622 622 622 SER SER B . n 
B 1 623 PRO 623 623 623 PRO PRO B . n 
B 1 624 TRP 624 624 624 TRP TRP B . n 
B 1 625 GLY 625 625 625 GLY GLY B . n 
B 1 626 LEU 626 626 626 LEU LEU B . n 
B 1 627 TRP 627 627 627 TRP TRP B . n 
B 1 628 LYS 628 628 628 LYS LYS B . n 
B 1 629 ASN 629 629 629 ASN ASN B . n 
B 1 630 HIS 630 630 630 HIS HIS B . n 
B 1 631 VAL 631 631 631 VAL VAL B . n 
B 1 632 ALA 632 632 632 ALA ALA B . n 
B 1 633 LEU 633 633 633 LEU LEU B . n 
B 1 634 ALA 634 634 634 ALA ALA B . n 
B 1 635 CYS 635 635 635 CYS CYS B . n 
B 1 636 MET 636 636 636 MET MET B . n 
B 1 637 ILE 637 637 637 ILE ILE B . n 
B 1 638 VAL 638 638 638 VAL VAL B . n 
B 1 639 ILE 639 639 639 ILE ILE B . n 
B 1 640 PHE 640 640 640 PHE PHE B . n 
B 1 641 LEU 641 641 641 LEU LEU B . n 
B 1 642 THR 642 642 642 THR THR B . n 
B 1 643 ILE 643 643 643 ILE ILE B . n 
B 1 644 ALA 644 644 644 ALA ALA B . n 
B 1 645 TYR 645 645 645 TYR TYR B . n 
B 1 646 LEU 646 646 646 LEU LEU B . n 
B 1 647 LYS 647 647 647 LYS LYS B . n 
B 1 648 LEU 648 648 648 LEU LEU B . n 
B 1 649 LEU 649 649 649 LEU LEU B . n 
B 1 650 PHE 650 650 650 PHE PHE B . n 
B 1 651 LEU 651 651 651 LEU LEU B . n 
B 1 652 LYS 652 652 652 LYS LYS B . n 
B 1 653 LYS 653 653 653 LYS LYS B . n 
B 1 654 TYR 654 654 654 TYR TYR B . n 
B 1 655 SER 655 655 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ATP 1 1501 1501 ATP ATP A . 
D 3 MG  1 1502 1502 MG  MG  A . 
E 2 ATP 1 1501 1501 ATP ATP B . 
F 3 MG  1 1502 1502 MG  MG  B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 11050 ? 
1 MORE         -89   ? 
1 'SSA (A^2)'  44040 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 OE1 ? A GLN 211 ? A GLN 211 ? 1_555 MG ? D MG . ? A MG 1502 ? 1_555 OG ? A SER 241 ? A SER 241 ? 1_555 114.5 ? 
2 OE1 ? B GLN 211 ? B GLN 211 ? 1_555 MG ? F MG . ? B MG 1502 ? 1_555 OG ? B SER 241 ? B SER 241 ? 1_555 114.5 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-11-07 
2 'Structure model' 1 1 2018-11-21 
3 'Structure model' 1 2 2019-10-23 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
3 3 'Structure model' 'Data collection'     
4 3 'Structure model' Other                 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation   
2 3 'Structure model' atom_sites 
3 3 'Structure model' cell       
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.journal_id_ISSN'             
2  2 'Structure model' '_citation.journal_volume'              
3  2 'Structure model' '_citation.page_first'                  
4  2 'Structure model' '_citation.page_last'                   
5  2 'Structure model' '_citation.pdbx_database_id_PubMed'     
6  2 'Structure model' '_citation.title'                       
7  3 'Structure model' '_atom_sites.fract_transf_matrix[1][1]' 
8  3 'Structure model' '_atom_sites.fract_transf_matrix[2][2]' 
9  3 'Structure model' '_atom_sites.fract_transf_matrix[3][3]' 
10 3 'Structure model' '_cell.Z_PDB'                           
# 
_software.citation_id            ? 
_software.classification         refinement 
_software.compiler_name          ? 
_software.compiler_version       ? 
_software.contact_author         ? 
_software.contact_author_email   ? 
_software.date                   ? 
_software.description            ? 
_software.dependencies           ? 
_software.hardware               ? 
_software.language               ? 
_software.location               ? 
_software.mods                   ? 
_software.name                   PHENIX 
_software.os                     ? 
_software.os_version             ? 
_software.type                   ? 
_software.version                1.13_2998: 
_software.pdbx_ordinal           1 
# 
_em_3d_fitting.entry_id          6HBU 
_em_3d_fitting.id                1 
_em_3d_fitting.details           ? 
_em_3d_fitting.overall_b_value   136 
_em_3d_fitting.ref_protocol      ? 
_em_3d_fitting.ref_space         ? 
_em_3d_fitting.target_criteria   ? 
_em_3d_fitting.method            ? 
# 
_em_3d_reconstruction.entry_id                    6HBU 
_em_3d_reconstruction.id                          1 
_em_3d_reconstruction.algorithm                   ? 
_em_3d_reconstruction.details                     ? 
_em_3d_reconstruction.refinement_type             ? 
_em_3d_reconstruction.image_processing_id         1 
_em_3d_reconstruction.num_class_averages          ? 
_em_3d_reconstruction.num_particles               288447 
_em_3d_reconstruction.resolution                  3.09 
_em_3d_reconstruction.resolution_method           'FSC 0.143 CUT-OFF' 
_em_3d_reconstruction.symmetry_type               POINT 
_em_3d_reconstruction.method                      ? 
_em_3d_reconstruction.nominal_pixel_size          ? 
_em_3d_reconstruction.actual_pixel_size           ? 
_em_3d_reconstruction.magnification_calibration   ? 
_em_3d_reconstruction.citation_id                 ? 
_em_3d_reconstruction.euler_angles_details        ? 
# 
_em_buffer.id            1 
_em_buffer.details       ? 
_em_buffer.pH            7.5 
_em_buffer.specimen_id   1 
_em_buffer.name          ? 
# 
loop_
_em_entity_assembly.id 
_em_entity_assembly.parent_id 
_em_entity_assembly.details 
_em_entity_assembly.name 
_em_entity_assembly.source 
_em_entity_assembly.type 
_em_entity_assembly.entity_id_list 
_em_entity_assembly.synonym 
_em_entity_assembly.oligomeric_details 
1 0 ? 'inhibitor-bound ABCG2'                                              'MULTIPLE SOURCES' COMPLEX 1 ? ? 
2 1 ? 'A mutant (E211Q) of the ATP-binding cassette sub-family G member 2' RECOMBINANT        COMPLEX 1 ? ? 
# 
_em_imaging.id                              1 
_em_imaging.entry_id                        6HBU 
_em_imaging.accelerating_voltage            300 
_em_imaging.alignment_procedure             ? 
_em_imaging.c2_aperture_diameter            ? 
_em_imaging.calibrated_defocus_max          ? 
_em_imaging.calibrated_defocus_min          ? 
_em_imaging.calibrated_magnification        ? 
_em_imaging.cryogen                         ? 
_em_imaging.details                         ? 
_em_imaging.electron_source                 'FIELD EMISSION GUN' 
_em_imaging.illumination_mode               'FLOOD BEAM' 
_em_imaging.microscope_model                'FEI TITAN KRIOS' 
_em_imaging.mode                            'BRIGHT FIELD' 
_em_imaging.nominal_cs                      ? 
_em_imaging.nominal_defocus_max             ? 
_em_imaging.nominal_defocus_min             ? 
_em_imaging.nominal_magnification           165000 
_em_imaging.recording_temperature_maximum   ? 
_em_imaging.recording_temperature_minimum   ? 
_em_imaging.residual_tilt                   ? 
_em_imaging.specimen_holder_model           ? 
_em_imaging.specimen_id                     1 
_em_imaging.citation_id                     ? 
_em_imaging.date                            ? 
_em_imaging.temperature                     ? 
_em_imaging.tilt_angle_min                  ? 
_em_imaging.tilt_angle_max                  ? 
_em_imaging.astigmatism                     ? 
_em_imaging.detector_distance               ? 
_em_imaging.electron_beam_tilt_params       ? 
_em_imaging.specimen_holder_type            ? 
# 
_em_sample_support.id               1 
_em_sample_support.specimen_id      1 
_em_sample_support.details          ? 
_em_sample_support.grid_material    COPPER 
_em_sample_support.grid_mesh_size   300 
_em_sample_support.grid_type        'Quantifoil R1.2/1.3' 
_em_sample_support.method           ? 
_em_sample_support.film_material    ? 
_em_sample_support.citation_id      ? 
# 
_em_vitrification.id                    1 
_em_vitrification.specimen_id           1 
_em_vitrification.chamber_temperature   277 
_em_vitrification.cryogen_name          ETHANE-PROPANE 
_em_vitrification.details               ? 
_em_vitrification.humidity              100 
_em_vitrification.instrument            'FEI VITROBOT MARK IV' 
_em_vitrification.entry_id              6HBU 
_em_vitrification.citation_id           ? 
_em_vitrification.method                ? 
_em_vitrification.temp                  ? 
_em_vitrification.time_resolved_state   ? 
# 
_em_experiment.entry_id                6HBU 
_em_experiment.id                      1 
_em_experiment.aggregation_state       PARTICLE 
_em_experiment.reconstruction_method   'SINGLE PARTICLE' 
_em_experiment.entity_assembly_id      2 
# 
_em_single_particle_entity.entry_id              6HBU 
_em_single_particle_entity.id                    1 
_em_single_particle_entity.image_processing_id   1 
_em_single_particle_entity.point_symmetry        C1 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 CE B LYS 500 ? ? OE1 B GLN 589 ? ? 1.96 
2 1 CE A LYS 500 ? ? OE1 A GLN 589 ? ? 1.98 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 64  ? ? 61.22   77.67   
2  1 SER A 65  ? ? -65.65  -168.02 
3  1 ALA A 115 ? ? -73.89  -73.25  
4  1 ASN A 116 ? ? 17.76   42.13   
5  1 PHE A 117 ? ? -132.84 -37.96  
6  1 ASP A 128 ? ? 61.04   68.07   
7  1 ASP A 203 ? ? 28.45   66.12   
8  1 GLN A 211 ? ? 52.25   70.72   
9  1 ARG A 309 ? ? 73.88   -6.73   
10 1 SER A 368 ? ? 57.89   70.99   
11 1 PRO A 392 ? ? -89.29  46.38   
12 1 TYR A 413 ? ? -94.79  32.50   
13 1 THR A 421 ? ? -117.92 79.89   
14 1 ASN A 600 ? ? -134.30 -42.61  
15 1 ASN A 604 ? ? -96.64  -69.80  
16 1 TYR A 605 ? ? -125.53 -58.22  
17 1 LEU B 64  ? ? 62.24   74.62   
18 1 SER B 65  ? ? -65.35  -167.01 
19 1 ALA B 115 ? ? -73.85  -73.30  
20 1 ASN B 116 ? ? 17.76   42.16   
21 1 PHE B 117 ? ? -132.87 -37.96  
22 1 ASP B 128 ? ? 61.00   68.05   
23 1 ASP B 203 ? ? 28.48   66.07   
24 1 GLN B 211 ? ? 52.27   70.74   
25 1 ARG B 309 ? ? 73.81   -6.65   
26 1 SER B 368 ? ? 57.96   70.97   
27 1 PRO B 392 ? ? -89.25  46.31   
28 1 TYR B 413 ? ? -94.72  32.48   
29 1 THR B 421 ? ? -117.96 79.87   
30 1 ASN B 600 ? ? -134.23 -42.61  
31 1 ASN B 604 ? ? -96.66  -69.76  
32 1 TYR B 605 ? ? -125.60 -58.16  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1  1 ALA A 115 ? ? ASN A 116 ? ? 123.00  
2  1 LEU A 587 ? ? GLY A 588 ? ? -138.04 
3  1 ASN A 601 ? ? PRO A 602 ? ? 132.96  
4  1 CYS A 603 ? ? ASN A 604 ? ? 133.34  
5  1 ASN A 604 ? ? TYR A 605 ? ? 108.79  
6  1 ALA B 115 ? ? ASN B 116 ? ? 123.00  
7  1 LEU B 587 ? ? GLY B 588 ? ? -138.06 
8  1 ASN B 601 ? ? PRO B 602 ? ? 132.92  
9  1 CYS B 603 ? ? ASN B 604 ? ? 133.35  
10 1 ASN B 604 ? ? TYR B 605 ? ? 108.75  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 1   ? A MET 1   
2   1 Y 1 A SER 2   ? A SER 2   
3   1 Y 1 A SER 3   ? A SER 3   
4   1 Y 1 A SER 4   ? A SER 4   
5   1 Y 1 A ASN 5   ? A ASN 5   
6   1 Y 1 A VAL 6   ? A VAL 6   
7   1 Y 1 A GLU 7   ? A GLU 7   
8   1 Y 1 A VAL 8   ? A VAL 8   
9   1 Y 1 A PHE 9   ? A PHE 9   
10  1 Y 1 A ILE 10  ? A ILE 10  
11  1 Y 1 A PRO 11  ? A PRO 11  
12  1 Y 1 A VAL 12  ? A VAL 12  
13  1 Y 1 A SER 13  ? A SER 13  
14  1 Y 1 A GLN 14  ? A GLN 14  
15  1 Y 1 A GLY 15  ? A GLY 15  
16  1 Y 1 A ASN 16  ? A ASN 16  
17  1 Y 1 A THR 17  ? A THR 17  
18  1 Y 1 A ASN 18  ? A ASN 18  
19  1 Y 1 A GLY 19  ? A GLY 19  
20  1 Y 1 A PHE 20  ? A PHE 20  
21  1 Y 1 A PRO 21  ? A PRO 21  
22  1 Y 1 A ALA 22  ? A ALA 22  
23  1 Y 1 A THR 23  ? A THR 23  
24  1 Y 1 A ALA 24  ? A ALA 24  
25  1 Y 1 A SER 25  ? A SER 25  
26  1 Y 1 A ASN 26  ? A ASN 26  
27  1 Y 1 A ASP 27  ? A ASP 27  
28  1 Y 1 A LEU 28  ? A LEU 28  
29  1 Y 1 A LYS 29  ? A LYS 29  
30  1 Y 1 A ALA 30  ? A ALA 30  
31  1 Y 1 A PHE 31  ? A PHE 31  
32  1 Y 1 A THR 32  ? A THR 32  
33  1 Y 1 A GLU 33  ? A GLU 33  
34  1 Y 1 A LYS 49  ? A LYS 49  
35  1 Y 1 A SER 50  ? A SER 50  
36  1 Y 1 A GLY 51  ? A GLY 51  
37  1 Y 1 A PHE 52  ? A PHE 52  
38  1 Y 1 A LEU 53  ? A LEU 53  
39  1 Y 1 A PRO 54  ? A PRO 54  
40  1 Y 1 A CYS 55  ? A CYS 55  
41  1 Y 1 A ARG 56  ? A ARG 56  
42  1 Y 1 A LYS 57  ? A LYS 57  
43  1 Y 1 A GLU 311 ? A GLU 311 
44  1 Y 1 A ASP 312 ? A ASP 312 
45  1 Y 1 A PHE 313 ? A PHE 313 
46  1 Y 1 A LYS 314 ? A LYS 314 
47  1 Y 1 A ALA 315 ? A ALA 315 
48  1 Y 1 A THR 316 ? A THR 316 
49  1 Y 1 A GLU 317 ? A GLU 317 
50  1 Y 1 A ILE 318 ? A ILE 318 
51  1 Y 1 A ILE 319 ? A ILE 319 
52  1 Y 1 A GLU 320 ? A GLU 320 
53  1 Y 1 A PRO 321 ? A PRO 321 
54  1 Y 1 A SER 322 ? A SER 322 
55  1 Y 1 A LYS 323 ? A LYS 323 
56  1 Y 1 A GLN 324 ? A GLN 324 
57  1 Y 1 A ASP 325 ? A ASP 325 
58  1 Y 1 A GLY 354 ? A GLY 354 
59  1 Y 1 A GLY 355 ? A GLY 355 
60  1 Y 1 A GLU 356 ? A GLU 356 
61  1 Y 1 A LYS 357 ? A LYS 357 
62  1 Y 1 A LYS 358 ? A LYS 358 
63  1 Y 1 A LYS 359 ? A LYS 359 
64  1 Y 1 A LYS 360 ? A LYS 360 
65  1 Y 1 A ILE 361 ? A ILE 361 
66  1 Y 1 A THR 362 ? A THR 362 
67  1 Y 1 A VAL 363 ? A VAL 363 
68  1 Y 1 A PHE 364 ? A PHE 364 
69  1 Y 1 A LYS 365 ? A LYS 365 
70  1 Y 1 A GLU 366 ? A GLU 366 
71  1 Y 1 A SER 655 ? A SER 655 
72  1 Y 1 B MET 1   ? B MET 1   
73  1 Y 1 B SER 2   ? B SER 2   
74  1 Y 1 B SER 3   ? B SER 3   
75  1 Y 1 B SER 4   ? B SER 4   
76  1 Y 1 B ASN 5   ? B ASN 5   
77  1 Y 1 B VAL 6   ? B VAL 6   
78  1 Y 1 B GLU 7   ? B GLU 7   
79  1 Y 1 B VAL 8   ? B VAL 8   
80  1 Y 1 B PHE 9   ? B PHE 9   
81  1 Y 1 B ILE 10  ? B ILE 10  
82  1 Y 1 B PRO 11  ? B PRO 11  
83  1 Y 1 B VAL 12  ? B VAL 12  
84  1 Y 1 B SER 13  ? B SER 13  
85  1 Y 1 B GLN 14  ? B GLN 14  
86  1 Y 1 B GLY 15  ? B GLY 15  
87  1 Y 1 B ASN 16  ? B ASN 16  
88  1 Y 1 B THR 17  ? B THR 17  
89  1 Y 1 B ASN 18  ? B ASN 18  
90  1 Y 1 B GLY 19  ? B GLY 19  
91  1 Y 1 B PHE 20  ? B PHE 20  
92  1 Y 1 B PRO 21  ? B PRO 21  
93  1 Y 1 B ALA 22  ? B ALA 22  
94  1 Y 1 B THR 23  ? B THR 23  
95  1 Y 1 B ALA 24  ? B ALA 24  
96  1 Y 1 B SER 25  ? B SER 25  
97  1 Y 1 B ASN 26  ? B ASN 26  
98  1 Y 1 B ASP 27  ? B ASP 27  
99  1 Y 1 B LEU 28  ? B LEU 28  
100 1 Y 1 B LYS 29  ? B LYS 29  
101 1 Y 1 B ALA 30  ? B ALA 30  
102 1 Y 1 B PHE 31  ? B PHE 31  
103 1 Y 1 B THR 32  ? B THR 32  
104 1 Y 1 B GLU 33  ? B GLU 33  
105 1 Y 1 B LYS 49  ? B LYS 49  
106 1 Y 1 B SER 50  ? B SER 50  
107 1 Y 1 B GLY 51  ? B GLY 51  
108 1 Y 1 B PHE 52  ? B PHE 52  
109 1 Y 1 B LEU 53  ? B LEU 53  
110 1 Y 1 B PRO 54  ? B PRO 54  
111 1 Y 1 B CYS 55  ? B CYS 55  
112 1 Y 1 B ARG 56  ? B ARG 56  
113 1 Y 1 B LYS 57  ? B LYS 57  
114 1 Y 1 B GLU 311 ? B GLU 311 
115 1 Y 1 B ASP 312 ? B ASP 312 
116 1 Y 1 B PHE 313 ? B PHE 313 
117 1 Y 1 B LYS 314 ? B LYS 314 
118 1 Y 1 B ALA 315 ? B ALA 315 
119 1 Y 1 B THR 316 ? B THR 316 
120 1 Y 1 B GLU 317 ? B GLU 317 
121 1 Y 1 B ILE 318 ? B ILE 318 
122 1 Y 1 B ILE 319 ? B ILE 319 
123 1 Y 1 B GLU 320 ? B GLU 320 
124 1 Y 1 B PRO 321 ? B PRO 321 
125 1 Y 1 B SER 322 ? B SER 322 
126 1 Y 1 B LYS 323 ? B LYS 323 
127 1 Y 1 B GLN 324 ? B GLN 324 
128 1 Y 1 B ASP 325 ? B ASP 325 
129 1 Y 1 B GLY 354 ? B GLY 354 
130 1 Y 1 B GLY 355 ? B GLY 355 
131 1 Y 1 B GLU 356 ? B GLU 356 
132 1 Y 1 B LYS 357 ? B LYS 357 
133 1 Y 1 B LYS 358 ? B LYS 358 
134 1 Y 1 B LYS 359 ? B LYS 359 
135 1 Y 1 B LYS 360 ? B LYS 360 
136 1 Y 1 B ILE 361 ? B ILE 361 
137 1 Y 1 B THR 362 ? B THR 362 
138 1 Y 1 B VAL 363 ? B VAL 363 
139 1 Y 1 B PHE 364 ? B PHE 364 
140 1 Y 1 B LYS 365 ? B LYS 365 
141 1 Y 1 B GLU 366 ? B GLU 366 
142 1 Y 1 B SER 655 ? B SER 655 
# 
_em_ctf_correction.id                       1 
_em_ctf_correction.em_image_processing_id   1 
_em_ctf_correction.type                     'PHASE FLIPPING AND AMPLITUDE CORRECTION' 
_em_ctf_correction.details                  ? 
# 
_em_entity_assembly_naturalsource.id                   1 
_em_entity_assembly_naturalsource.entity_assembly_id   2 
_em_entity_assembly_naturalsource.cell                 ? 
_em_entity_assembly_naturalsource.cellular_location    ? 
_em_entity_assembly_naturalsource.ncbi_tax_id          9606 
_em_entity_assembly_naturalsource.organ                ? 
_em_entity_assembly_naturalsource.organelle            ? 
_em_entity_assembly_naturalsource.organism             'HOMO SAPIENS' 
_em_entity_assembly_naturalsource.strain               ? 
_em_entity_assembly_naturalsource.tissue               ? 
# 
_em_entity_assembly_recombinant.entity_assembly_id   2 
_em_entity_assembly_recombinant.id                   1 
_em_entity_assembly_recombinant.ncbi_tax_id          9606 
_em_entity_assembly_recombinant.organism             'HOMO SAPIENS' 
_em_entity_assembly_recombinant.plasmid              ? 
_em_entity_assembly_recombinant.strain               ? 
_em_entity_assembly_recombinant.cell                 ? 
# 
_em_image_processing.id                   1 
_em_image_processing.image_recording_id   1 
_em_image_processing.details              ? 
# 
_em_image_recording.id                            1 
_em_image_recording.imaging_id                    1 
_em_image_recording.avg_electron_dose_per_image   2 
_em_image_recording.average_exposure_time         0.2 
_em_image_recording.details                       ? 
_em_image_recording.detector_mode                 ? 
_em_image_recording.film_or_detector_model        'GATAN K2 SUMMIT (4k x 4k)' 
_em_image_recording.num_diffraction_images        ? 
_em_image_recording.num_grids_imaged              ? 
_em_image_recording.num_real_images               4905 
# 
_em_imaging_optics.id                         1 
_em_imaging_optics.imaging_id                 1 
_em_imaging_optics.chr_aberration_corrector   ? 
_em_imaging_optics.energyfilter_lower         ? 
_em_imaging_optics.energyfilter_name          ? 
_em_imaging_optics.energyfilter_upper         ? 
_em_imaging_optics.energyfilter_slit_width    ? 
_em_imaging_optics.phase_plate                ? 
_em_imaging_optics.sph_aberration_corrector   ? 
# 
loop_
_em_software.id 
_em_software.category 
_em_software.details 
_em_software.name 
_em_software.version 
_em_software.image_processing_id 
_em_software.fitting_id 
_em_software.imaging_id 
1  'PARTICLE SELECTION'            ? ?        ? 1 ? ? 
2  'IMAGE ACQUISITION'             ? SerialEM ? ? ? 1 
3  MASKING                         ? ?        ? ? ? ? 
4  'CTF CORRECTION'                ? ?        ? 1 ? ? 
5  'LAYERLINE INDEXING'            ? ?        ? ? ? ? 
6  'DIFFRACTION INDEXING'          ? ?        ? ? ? ? 
7  'MODEL FITTING'                 ? ?        ? ? 1 ? 
8  OTHER                           ? ?        ? ? ? ? 
9  'INITIAL EULER ASSIGNMENT'      ? ?        ? 1 ? ? 
10 'FINAL EULER ASSIGNMENT'        ? ?        ? 1 ? ? 
11 CLASSIFICATION                  ? ?        ? 1 ? ? 
12 RECONSTRUCTION                  ? RELION   2 1 ? ? 
13 'MODEL REFINEMENT'              ? ?        ? ? 1 ? 
14 'VOLUME SELECTION'              ? ?        ? 1 1 1 
15 'SERIES ALIGNMENT'              ? ?        ? 1 1 1 
16 'MOLECULAR REPLACEMENT'         ? ?        ? 1 1 1 
17 'LATTICE DISTORTION CORRECTION' ? ?        ? 1 1 1 
18 'SYMMETRY DETERMINATION'        ? ?        ? 1 1 1 
19 'CRYSTALLOGRAPHY MERGING'       ? ?        ? 1 1 1 
# 
_em_specimen.id                      1 
_em_specimen.experiment_id           1 
_em_specimen.concentration           0.4 
_em_specimen.details                 ? 
_em_specimen.embedding_applied       NO 
_em_specimen.shadowing_applied       NO 
_em_specimen.staining_applied        NO 
_em_specimen.vitrification_applied   YES 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'Swiss National Science Foundation' Switzerland ?           1 
?                                   Switzerland ETH-22-14-1 2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "ADENOSINE-5'-TRIPHOSPHATE" ATP 
3 'MAGNESIUM ION'             MG  
# 
loop_
_pdbx_struct_assembly_auth_evidence.id 
_pdbx_struct_assembly_auth_evidence.assembly_id 
_pdbx_struct_assembly_auth_evidence.experimental_support 
_pdbx_struct_assembly_auth_evidence.details 
1 1 'gel filtration' ? 
2 1 microscopy       ? 
#