data_6J7Z
# 
_entry.id   6J7Z 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.313 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6J7Z         
WWPDB D_1300010598 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6J7Z 
_pdbx_database_status.recvd_initial_deposition_date   2019-01-18 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Chu, L.Y.'   1 0000-0003-4770-7700 
'Agrawal, S.' 2 0000-0001-8549-9602 
'Yuan, H.S.'  3 0000-0001-9671-6967 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Rna 
_citation.journal_id_ASTM           RNARFU 
_citation.journal_id_CSD            2122 
_citation.journal_id_ISSN           1469-9001 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            25 
_citation.language                  ? 
_citation.page_first                737 
_citation.page_last                 746 
_citation.title                     'Structural insights into nanoRNA degradation by human Rexo2.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1261/rna.070557.119 
_citation.pdbx_database_id_PubMed   30926754 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Chu, L.Y.'   1 ?                   
primary 'Agrawal, S.' 2 ?                   
primary 'Chen, Y.P.'  3 ?                   
primary 'Yang, W.Z.'  4 ?                   
primary 'Yuan, H.S.'  5 0000-0001-9671-6967 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6J7Z 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     86.192 
_cell.length_a_esd                 ? 
_cell.length_b                     125.892 
_cell.length_b_esd                 ? 
_cell.length_c                     86.008 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        16 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6J7Z 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Oligoribonuclease, mitochondrial' 21527.777 2   3.1.-.- D199A ? ? 
2 polymer     syn 
;RNA (5'-R(P*UP*U)-3')
;
567.374   1   ?       ?     ? ? 
3 non-polymer syn 'CITRIC ACID'                      192.124   1   ?       ?     ? ? 
4 non-polymer syn 'MAGNESIUM ION'                    24.305    2   ?       ?     ? ? 
5 water       nat water                              18.015    124 ?       ?     ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RNA exonuclease 2 homolog,Small fragment nuclease' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'   no no 
;MAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKE
STITLQQAEYEFLSFVRQQTPPGLCPLAGNSVHEDKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEFAPKKAA
SHRALDAISESIKELQFYRNNIFKKK
;
;MAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKE
STITLQQAEYEFLSFVRQQTPPGLCPLAGNSVHEDKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEFAPKKAA
SHRALDAISESIKELQFYRNNIFKKK
;
A,B ? 
2 polyribonucleotide no no UU UU C   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ALA n 
1 4   GLY n 
1 5   GLU n 
1 6   SER n 
1 7   MET n 
1 8   ALA n 
1 9   GLN n 
1 10  ARG n 
1 11  MET n 
1 12  VAL n 
1 13  TRP n 
1 14  VAL n 
1 15  ASP n 
1 16  LEU n 
1 17  GLU n 
1 18  MET n 
1 19  THR n 
1 20  GLY n 
1 21  LEU n 
1 22  ASP n 
1 23  ILE n 
1 24  GLU n 
1 25  LYS n 
1 26  ASP n 
1 27  GLN n 
1 28  ILE n 
1 29  ILE n 
1 30  GLU n 
1 31  MET n 
1 32  ALA n 
1 33  CYS n 
1 34  LEU n 
1 35  ILE n 
1 36  THR n 
1 37  ASP n 
1 38  SER n 
1 39  ASP n 
1 40  LEU n 
1 41  ASN n 
1 42  ILE n 
1 43  LEU n 
1 44  ALA n 
1 45  GLU n 
1 46  GLY n 
1 47  PRO n 
1 48  ASN n 
1 49  LEU n 
1 50  ILE n 
1 51  ILE n 
1 52  LYS n 
1 53  GLN n 
1 54  PRO n 
1 55  ASP n 
1 56  GLU n 
1 57  LEU n 
1 58  LEU n 
1 59  ASP n 
1 60  SER n 
1 61  MET n 
1 62  SER n 
1 63  ASP n 
1 64  TRP n 
1 65  CYS n 
1 66  LYS n 
1 67  GLU n 
1 68  HIS n 
1 69  HIS n 
1 70  GLY n 
1 71  LYS n 
1 72  SER n 
1 73  GLY n 
1 74  LEU n 
1 75  THR n 
1 76  LYS n 
1 77  ALA n 
1 78  VAL n 
1 79  LYS n 
1 80  GLU n 
1 81  SER n 
1 82  THR n 
1 83  ILE n 
1 84  THR n 
1 85  LEU n 
1 86  GLN n 
1 87  GLN n 
1 88  ALA n 
1 89  GLU n 
1 90  TYR n 
1 91  GLU n 
1 92  PHE n 
1 93  LEU n 
1 94  SER n 
1 95  PHE n 
1 96  VAL n 
1 97  ARG n 
1 98  GLN n 
1 99  GLN n 
1 100 THR n 
1 101 PRO n 
1 102 PRO n 
1 103 GLY n 
1 104 LEU n 
1 105 CYS n 
1 106 PRO n 
1 107 LEU n 
1 108 ALA n 
1 109 GLY n 
1 110 ASN n 
1 111 SER n 
1 112 VAL n 
1 113 HIS n 
1 114 GLU n 
1 115 ASP n 
1 116 LYS n 
1 117 LYS n 
1 118 PHE n 
1 119 LEU n 
1 120 ASP n 
1 121 LYS n 
1 122 TYR n 
1 123 MET n 
1 124 PRO n 
1 125 GLN n 
1 126 PHE n 
1 127 MET n 
1 128 LYS n 
1 129 HIS n 
1 130 LEU n 
1 131 HIS n 
1 132 TYR n 
1 133 ARG n 
1 134 ILE n 
1 135 ILE n 
1 136 ASP n 
1 137 VAL n 
1 138 SER n 
1 139 THR n 
1 140 VAL n 
1 141 LYS n 
1 142 GLU n 
1 143 LEU n 
1 144 CYS n 
1 145 ARG n 
1 146 ARG n 
1 147 TRP n 
1 148 TYR n 
1 149 PRO n 
1 150 GLU n 
1 151 GLU n 
1 152 TYR n 
1 153 GLU n 
1 154 PHE n 
1 155 ALA n 
1 156 PRO n 
1 157 LYS n 
1 158 LYS n 
1 159 ALA n 
1 160 ALA n 
1 161 SER n 
1 162 HIS n 
1 163 ARG n 
1 164 ALA n 
1 165 LEU n 
1 166 ASP n 
1 167 ALA n 
1 168 ILE n 
1 169 SER n 
1 170 GLU n 
1 171 SER n 
1 172 ILE n 
1 173 LYS n 
1 174 GLU n 
1 175 LEU n 
1 176 GLN n 
1 177 PHE n 
1 178 TYR n 
1 179 ARG n 
1 180 ASN n 
1 181 ASN n 
1 182 ILE n 
1 183 PHE n 
1 184 LYS n 
1 185 LYS n 
1 186 LYS n 
2 1   U   n 
2 2   U   n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   186 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'REXO2, SFN, SMFN, CGI-114' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       2 
_pdbx_entity_src_syn.organism_scientific    'synthetic construct' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP ORN_HUMAN Q9Y3B8 ? 1 
;MAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGPNLIIKQPDELLDSMSDWCKEHHGKSGLTKAVKE
STITLQQAEYEFLSFVRQQTPPGLCPLAGNSVHEDKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWYPEEYEFAPKKAA
SHRALDDISESIKELQFYRNNIFKKK
;
33 
2 PDB 6J7Z      6J7Z   ? 2 ? 1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6J7Z A 1 ? 186 ? Q9Y3B8 33 ? 218 ? 33 218 
2 1 6J7Z B 1 ? 186 ? Q9Y3B8 33 ? 218 ? 33 218 
3 2 6J7Z C 1 ? 2   ? 6J7Z   11 ? 12  ? 11 12  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6J7Z ALA A 167 ? UNP Q9Y3B8 ASP 199 'engineered mutation' 199 1 
2 6J7Z ALA B 167 ? UNP Q9Y3B8 ASP 199 'engineered mutation' 199 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'     133.103 
CIT non-polymer         . 'CITRIC ACID'              ? 'C6 H8 O7'       192.124 
CYS 'L-peptide linking' y CYSTEINE                   ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                      ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION'            ? 'Mg 2'           24.305  
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'    181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE" ? 'C9 H13 N2 O9 P' 324.181 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6J7Z 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.67 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         54.01 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.2 M Ammonium citrate dibasic, 20% w/v PEG 3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX300HE' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-09-11 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSRRC BEAMLINE BL15A1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL15A1 
_diffrn_source.pdbx_synchrotron_site       NSRRC 
# 
_reflns.B_iso_Wilson_estimate            33.370 
_reflns.entry_id                         6J7Z 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.000 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       31548 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.600 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.500 
_reflns.pdbx_Rmerge_I_obs                0.076 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            17.100 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 2.932 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.083 
_reflns.pdbx_Rpim_I_all                  0.033 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.000 2.030  ? ? ? ? ? ? 1540 100.000 ? ? ? ? 0.508 ? ? ? ? ? ? ? ? 6.900 ? 1.519 ? ? 0.549 0.208 ? 1  1 0.926 ? 
2.030 2.070  ? ? ? ? ? ? 1546 100.000 ? ? ? ? 0.415 ? ? ? ? ? ? ? ? 6.900 ? 1.635 ? ? 0.449 0.170 ? 2  1 0.941 ? 
2.070 2.110  ? ? ? ? ? ? 1590 100.000 ? ? ? ? 0.369 ? ? ? ? ? ? ? ? 6.900 ? 1.622 ? ? 0.399 0.151 ? 3  1 0.960 ? 
2.110 2.150  ? ? ? ? ? ? 1554 100.000 ? ? ? ? 0.332 ? ? ? ? ? ? ? ? 6.900 ? 1.769 ? ? 0.359 0.135 ? 4  1 0.962 ? 
2.150 2.200  ? ? ? ? ? ? 1582 99.900  ? ? ? ? 0.275 ? ? ? ? ? ? ? ? 6.900 ? 1.921 ? ? 0.298 0.113 ? 5  1 0.969 ? 
2.200 2.250  ? ? ? ? ? ? 1550 100.000 ? ? ? ? 0.237 ? ? ? ? ? ? ? ? 6.900 ? 2.113 ? ? 0.256 0.097 ? 6  1 0.980 ? 
2.250 2.310  ? ? ? ? ? ? 1560 100.000 ? ? ? ? 0.212 ? ? ? ? ? ? ? ? 6.900 ? 2.354 ? ? 0.229 0.087 ? 7  1 0.981 ? 
2.310 2.370  ? ? ? ? ? ? 1572 99.900  ? ? ? ? 0.186 ? ? ? ? ? ? ? ? 6.800 ? 2.474 ? ? 0.201 0.077 ? 8  1 0.984 ? 
2.370 2.440  ? ? ? ? ? ? 1569 100.000 ? ? ? ? 0.168 ? ? ? ? ? ? ? ? 6.800 ? 2.586 ? ? 0.182 0.070 ? 9  1 0.987 ? 
2.440 2.520  ? ? ? ? ? ? 1567 100.000 ? ? ? ? 0.145 ? ? ? ? ? ? ? ? 6.800 ? 2.736 ? ? 0.157 0.060 ? 10 1 0.990 ? 
2.520 2.610  ? ? ? ? ? ? 1590 100.000 ? ? ? ? 0.130 ? ? ? ? ? ? ? ? 6.800 ? 2.982 ? ? 0.141 0.054 ? 11 1 0.991 ? 
2.610 2.710  ? ? ? ? ? ? 1562 99.900  ? ? ? ? 0.112 ? ? ? ? ? ? ? ? 6.700 ? 3.207 ? ? 0.122 0.047 ? 12 1 0.992 ? 
2.710 2.840  ? ? ? ? ? ? 1565 99.900  ? ? ? ? 0.098 ? ? ? ? ? ? ? ? 6.600 ? 3.454 ? ? 0.106 0.041 ? 13 1 0.993 ? 
2.840 2.990  ? ? ? ? ? ? 1581 100.000 ? ? ? ? 0.087 ? ? ? ? ? ? ? ? 6.500 ? 3.823 ? ? 0.095 0.037 ? 14 1 0.995 ? 
2.990 3.170  ? ? ? ? ? ? 1609 100.000 ? ? ? ? 0.079 ? ? ? ? ? ? ? ? 6.100 ? 4.243 ? ? 0.087 0.035 ? 15 1 0.996 ? 
3.170 3.420  ? ? ? ? ? ? 1573 100.000 ? ? ? ? 0.068 ? ? ? ? ? ? ? ? 5.900 ? 4.447 ? ? 0.075 0.030 ? 16 1 0.996 ? 
3.420 3.760  ? ? ? ? ? ? 1594 99.900  ? ? ? ? 0.061 ? ? ? ? ? ? ? ? 6.000 ? 4.561 ? ? 0.067 0.027 ? 17 1 0.995 ? 
3.760 4.310  ? ? ? ? ? ? 1602 99.700  ? ? ? ? 0.055 ? ? ? ? ? ? ? ? 6.000 ? 4.394 ? ? 0.060 0.024 ? 18 1 0.997 ? 
4.310 5.430  ? ? ? ? ? ? 1638 99.800  ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 6.000 ? 4.299 ? ? 0.057 0.023 ? 19 1 0.997 ? 
5.430 50.000 ? ? ? ? ? ? 1604 94.200  ? ? ? ? 0.046 ? ? ? ? ? ? ? ? 5.600 ? 3.663 ? ? 0.050 0.020 ? 20 1 0.997 ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                119.310 
_refine.B_iso_mean                               45.4916 
_refine.B_iso_min                                19.300 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6J7Z 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.0050 
_refine.ls_d_res_low                             27.4050 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     31521 
_refine.ls_number_reflns_R_free                  2000 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.4800 
_refine.ls_percent_reflns_R_free                 6.3400 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2072 
_refine.ls_R_factor_R_free                       0.2277 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2058 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.350 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2IGI 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 23.3300 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.1800 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.0050 
_refine_hist.d_res_low                        27.4050 
_refine_hist.pdbx_number_atoms_ligand         15 
_refine_hist.number_atoms_solvent             124 
_refine_hist.number_atoms_total               2808 
_refine_hist.pdbx_number_residues_total       323 
_refine_hist.pdbx_B_iso_mean_ligand           75.28 
_refine_hist.pdbx_B_iso_mean_solvent          50.11 
_refine_hist.pdbx_number_atoms_protein        2629 
_refine_hist.pdbx_number_atoms_nucleic_acid   40 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.0052 2.0554  2170 . 138 2032 97.0000  . . . 0.2554 0.0000 0.2367 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 2.0554 2.1109  2226 . 141 2085 100.0000 . . . 0.2436 0.0000 0.2349 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 2.1109 2.1730  2234 . 142 2092 100.0000 . . . 0.2688 0.0000 0.2331 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 2.1730 2.2431  2244 . 142 2102 100.0000 . . . 0.2509 0.0000 0.2256 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 2.2431 2.3233  2228 . 141 2087 100.0000 . . . 0.2732 0.0000 0.2287 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 2.3233 2.4162  2216 . 141 2075 100.0000 . . . 0.2775 0.0000 0.2306 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 2.4162 2.5261  2268 . 144 2124 100.0000 . . . 0.2748 0.0000 0.2283 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 2.5261 2.6592  2249 . 143 2106 100.0000 . . . 0.2286 0.0000 0.2286 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 2.6592 2.8256  2266 . 143 2123 100.0000 . . . 0.2467 0.0000 0.2328 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 2.8256 3.0436  2261 . 143 2118 100.0000 . . . 0.2792 0.0000 0.2250 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 3.0436 3.3494  2262 . 144 2118 100.0000 . . . 0.2251 0.0000 0.2186 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 3.3494 3.8329  2289 . 146 2143 100.0000 . . . 0.1906 0.0000 0.1870 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 3.8329 4.8247  2302 . 146 2156 100.0000 . . . 0.1741 0.0000 0.1670 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 4.8247 27.4071 2306 . 146 2160 96.0000  . . . 0.2377 0.0000 0.1987 . . . . . . 14 . . . 
# 
_struct.entry_id                     6J7Z 
_struct.title                        'Human mitochondrial Oligoribonuclease in complex with RNA' 
_struct.pdbx_descriptor              'Oligoribonuclease, mitochondrial/RNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6J7Z 
_struct_keywords.text            'Exoribonuclease, Mitochonrial Oligoribonuclease, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 4   ? GLN A 9   ? GLY A 36  GLN A 41  1 ? 6  
HELX_P HELX_P2  AA2 THR A 84  ? THR A 100 ? THR A 116 THR A 132 1 ? 17 
HELX_P HELX_P3  AA3 VAL A 112 ? MET A 123 ? VAL A 144 MET A 155 1 ? 12 
HELX_P HELX_P4  AA4 MET A 123 ? HIS A 129 ? MET A 155 HIS A 161 1 ? 7  
HELX_P HELX_P5  AA5 VAL A 137 ? TYR A 148 ? VAL A 169 TYR A 180 1 ? 12 
HELX_P HELX_P6  AA6 TYR A 148 ? GLU A 153 ? TYR A 180 GLU A 185 1 ? 6  
HELX_P HELX_P7  AA7 ARG A 163 ? PHE A 183 ? ARG A 195 PHE A 215 1 ? 21 
HELX_P HELX_P8  AA8 SER B 6   ? ARG B 10  ? SER B 38  ARG B 42  5 ? 5  
HELX_P HELX_P9  AA9 PRO B 54  ? SER B 60  ? PRO B 86  SER B 92  1 ? 7  
HELX_P HELX_P10 AB1 SER B 62  ? SER B 72  ? SER B 94  SER B 104 1 ? 11 
HELX_P HELX_P11 AB2 GLY B 73  ? SER B 81  ? GLY B 105 SER B 113 1 ? 9  
HELX_P HELX_P12 AB3 THR B 84  ? THR B 100 ? THR B 116 THR B 132 1 ? 17 
HELX_P HELX_P13 AB4 VAL B 112 ? MET B 123 ? VAL B 144 MET B 155 1 ? 12 
HELX_P HELX_P14 AB5 MET B 123 ? HIS B 129 ? MET B 155 HIS B 161 1 ? 7  
HELX_P HELX_P15 AB6 VAL B 137 ? TYR B 148 ? VAL B 169 TYR B 180 1 ? 12 
HELX_P HELX_P16 AB7 TYR B 148 ? PHE B 154 ? TYR B 180 PHE B 186 1 ? 7  
HELX_P HELX_P17 AB8 ARG B 163 ? PHE B 183 ? ARG B 195 PHE B 215 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B ASP 15 OD1 ? ? ? 1_555 F MG  . MG ? ? B ASP 47  B MG  302 1_555 ? ? ? ? ? ? ? 2.898 ? 
metalc2 metalc ? ? B GLU 17 OE2 ? ? ? 1_555 E MG  . MG ? ? B GLU 49  B MG  301 1_555 ? ? ? ? ? ? ? 2.381 ? 
metalc3 metalc ? ? C U   2  OP1 ? ? ? 1_555 E MG  . MG ? ? C U   12  B MG  301 1_555 ? ? ? ? ? ? ? 2.439 ? 
metalc4 metalc ? ? E MG  .  MG  ? ? ? 1_555 H HOH . O  ? ? B MG  301 B HOH 455 1_555 ? ? ? ? ? ? ? 2.894 ? 
metalc5 metalc ? ? F MG  .  MG  ? ? ? 1_555 I HOH . O  ? ? B MG  302 C HOH 103 1_555 ? ? ? ? ? ? ? 2.866 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? parallel      
AA2 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 42  ? ILE A 51  ? ILE A 74  ILE A 83  
AA1 2 ILE A 29  ? THR A 36  ? ILE A 61  THR A 68  
AA1 3 MET A 11  ? GLU A 17  ? MET A 43  GLU A 49  
AA1 4 LEU A 107 ? GLY A 109 ? LEU A 139 GLY A 141 
AA1 5 ILE A 134 ? ASP A 136 ? ILE A 166 ASP A 168 
AA2 1 ILE B 42  ? ILE B 50  ? ILE B 74  ILE B 82  
AA2 2 ILE B 28  ? THR B 36  ? ILE B 60  THR B 68  
AA2 3 MET B 11  ? MET B 18  ? MET B 43  MET B 50  
AA2 4 LEU B 107 ? GLY B 109 ? LEU B 139 GLY B 141 
AA2 5 ILE B 134 ? ASP B 136 ? ILE B 166 ASP B 168 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O LEU A 43  ? O LEU A 75  N ILE A 35  ? N ILE A 67  
AA1 2 3 O GLU A 30  ? O GLU A 62  N GLU A 17  ? N GLU A 49  
AA1 3 4 N VAL A 14  ? N VAL A 46  O ALA A 108 ? O ALA A 140 
AA1 4 5 N LEU A 107 ? N LEU A 139 O ILE A 135 ? O ILE A 167 
AA2 1 2 O LEU B 43  ? O LEU B 75  N ILE B 35  ? N ILE B 67  
AA2 2 3 O ILE B 29  ? O ILE B 61  N GLU B 17  ? N GLU B 49  
AA2 3 4 N VAL B 14  ? N VAL B 46  O ALA B 108 ? O ALA B 140 
AA2 4 5 N LEU B 107 ? N LEU B 139 O ILE B 135 ? O ILE B 167 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CIT 301 ? 8 'binding site for residue CIT A 301' 
AC2 Software B MG  301 ? 5 'binding site for residue MG B 301'  
AC3 Software B MG  302 ? 4 'binding site for residue MG B 302'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8 LEU A 93  ? LEU A 125 . ? 1_555 ? 
2  AC1 8 ARG A 97  ? ARG A 129 . ? 1_555 ? 
3  AC1 8 GLN A 125 ? GLN A 157 . ? 1_555 ? 
4  AC1 8 LYS A 128 ? LYS A 160 . ? 1_555 ? 
5  AC1 8 HIS A 129 ? HIS A 161 . ? 1_555 ? 
6  AC1 8 LEU B 43  ? LEU B 75  . ? 8_575 ? 
7  AC1 8 ALA B 44  ? ALA B 76  . ? 8_575 ? 
8  AC1 8 GLU B 45  ? GLU B 77  . ? 8_575 ? 
9  AC2 5 ASP B 15  ? ASP B 47  . ? 1_555 ? 
10 AC2 5 GLU B 17  ? GLU B 49  . ? 1_555 ? 
11 AC2 5 HIS B 162 ? HIS B 194 . ? 1_555 ? 
12 AC2 5 HOH H .   ? HOH B 455 . ? 1_555 ? 
13 AC2 5 U   C 2   ? U   C 12  . ? 1_555 ? 
14 AC3 4 ASP B 15  ? ASP B 47  . ? 1_555 ? 
15 AC3 4 U   C 1   ? U   C 11  . ? 1_555 ? 
16 AC3 4 U   C 2   ? U   C 12  . ? 1_555 ? 
17 AC3 4 HOH I .   ? HOH C 103 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6J7Z 
_atom_sites.fract_transf_matrix[1][1]   0.011602 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007943 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011627 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1 1   ? 32.131 140.766 -25.720 1.00 55.32  ? 33  MET A N     1 
ATOM   2    C  CA    . MET A 1 1   ? 32.244 142.194 -25.451 1.00 54.23  ? 33  MET A CA    1 
ATOM   3    C  C     . MET A 1 1   ? 33.488 142.776 -26.110 1.00 43.75  ? 33  MET A C     1 
ATOM   4    O  O     . MET A 1 1   ? 34.269 142.054 -26.728 1.00 40.40  ? 33  MET A O     1 
ATOM   5    C  CB    . MET A 1 1   ? 32.282 142.456 -23.945 1.00 55.97  ? 33  MET A CB    1 
ATOM   6    C  CG    . MET A 1 1   ? 31.620 141.375 -23.106 1.00 63.48  ? 33  MET A CG    1 
ATOM   7    S  SD    . MET A 1 1   ? 31.852 141.648 -21.340 1.00 70.19  ? 33  MET A SD    1 
ATOM   8    C  CE    . MET A 1 1   ? 31.003 143.211 -21.134 1.00 71.24  ? 33  MET A CE    1 
ATOM   9    N  N     . ALA A 1 2   ? 33.665 144.088 -25.974 1.00 34.19  ? 34  ALA A N     1 
ATOM   10   C  CA    . ALA A 1 2   ? 34.855 144.740 -26.498 1.00 38.11  ? 34  ALA A CA    1 
ATOM   11   C  C     . ALA A 1 2   ? 36.097 144.246 -25.766 1.00 40.48  ? 34  ALA A C     1 
ATOM   12   O  O     . ALA A 1 2   ? 36.038 143.826 -24.607 1.00 37.21  ? 34  ALA A O     1 
ATOM   13   C  CB    . ALA A 1 2   ? 34.738 146.258 -26.367 1.00 40.01  ? 34  ALA A CB    1 
ATOM   14   N  N     . ALA A 1 3   ? 37.230 144.295 -26.463 1.00 36.35  ? 35  ALA A N     1 
ATOM   15   C  CA    . ALA A 1 3   ? 38.485 143.834 -25.886 1.00 39.05  ? 35  ALA A CA    1 
ATOM   16   C  C     . ALA A 1 3   ? 38.857 144.673 -24.670 1.00 39.73  ? 35  ALA A C     1 
ATOM   17   O  O     . ALA A 1 3   ? 38.841 145.906 -24.720 1.00 46.59  ? 35  ALA A O     1 
ATOM   18   C  CB    . ALA A 1 3   ? 39.599 143.893 -26.931 1.00 32.98  ? 35  ALA A CB    1 
ATOM   19   N  N     . GLY A 1 4   ? 39.183 143.995 -23.571 1.00 39.62  ? 36  GLY A N     1 
ATOM   20   C  CA    . GLY A 1 4   ? 39.598 144.638 -22.348 1.00 39.89  ? 36  GLY A CA    1 
ATOM   21   C  C     . GLY A 1 4   ? 38.510 144.792 -21.307 1.00 33.68  ? 36  GLY A C     1 
ATOM   22   O  O     . GLY A 1 4   ? 38.826 145.014 -20.132 1.00 32.91  ? 36  GLY A O     1 
ATOM   23   N  N     . GLU A 1 5   ? 37.239 144.676 -21.700 1.00 32.13  ? 37  GLU A N     1 
ATOM   24   C  CA    . GLU A 1 5   ? 36.157 144.885 -20.744 1.00 33.31  ? 37  GLU A CA    1 
ATOM   25   C  C     . GLU A 1 5   ? 36.087 143.752 -19.727 1.00 38.08  ? 37  GLU A C     1 
ATOM   26   O  O     . GLU A 1 5   ? 35.821 143.990 -18.542 1.00 36.51  ? 37  GLU A O     1 
ATOM   27   C  CB    . GLU A 1 5   ? 34.826 145.033 -21.479 1.00 44.96  ? 37  GLU A CB    1 
ATOM   28   C  CG    . GLU A 1 5   ? 33.704 145.596 -20.620 1.00 63.68  ? 37  GLU A CG    1 
ATOM   29   C  CD    . GLU A 1 5   ? 33.717 147.113 -20.546 1.00 88.22  ? 37  GLU A CD    1 
ATOM   30   O  OE1   . GLU A 1 5   ? 32.655 147.725 -20.783 1.00 96.64  ? 37  GLU A OE1   1 
ATOM   31   O  OE2   . GLU A 1 5   ? 34.782 147.695 -20.246 1.00 95.43  ? 37  GLU A OE2   1 
ATOM   32   N  N     . SER A 1 6   ? 36.320 142.514 -20.171 1.00 28.95  ? 38  SER A N     1 
ATOM   33   C  CA    . SER A 1 6   ? 36.313 141.387 -19.244 1.00 36.48  ? 38  SER A CA    1 
ATOM   34   C  C     . SER A 1 6   ? 37.403 141.543 -18.191 1.00 33.65  ? 38  SER A C     1 
ATOM   35   O  O     . SER A 1 6   ? 37.218 141.160 -17.030 1.00 32.65  ? 38  SER A O     1 
ATOM   36   C  CB    . SER A 1 6   ? 36.486 140.074 -20.009 1.00 41.69  ? 38  SER A CB    1 
ATOM   37   O  OG    . SER A 1 6   ? 37.753 140.014 -20.639 1.00 52.86  ? 38  SER A OG    1 
ATOM   38   N  N     . MET A 1 7   ? 38.548 142.109 -18.578 1.00 28.17  ? 39  MET A N     1 
ATOM   39   C  CA    . MET A 1 7   ? 39.606 142.375 -17.611 1.00 33.78  ? 39  MET A CA    1 
ATOM   40   C  C     . MET A 1 7   ? 39.231 143.531 -16.690 1.00 29.88  ? 39  MET A C     1 
ATOM   41   O  O     . MET A 1 7   ? 39.559 143.515 -15.498 1.00 29.39  ? 39  MET A O     1 
ATOM   42   C  CB    . MET A 1 7   ? 40.913 142.668 -18.343 1.00 41.64  ? 39  MET A CB    1 
ATOM   43   C  CG    . MET A 1 7   ? 42.126 142.742 -17.440 1.00 51.99  ? 39  MET A CG    1 
ATOM   44   S  SD    . MET A 1 7   ? 43.655 142.772 -18.388 1.00 62.04  ? 39  MET A SD    1 
ATOM   45   C  CE    . MET A 1 7   ? 43.235 143.986 -19.634 1.00 65.81  ? 39  MET A CE    1 
ATOM   46   N  N     . ALA A 1 8   ? 38.544 144.544 -17.224 1.00 31.14  ? 40  ALA A N     1 
ATOM   47   C  CA    . ALA A 1 8   ? 38.089 145.652 -16.395 1.00 36.83  ? 40  ALA A CA    1 
ATOM   48   C  C     . ALA A 1 8   ? 36.985 145.236 -15.432 1.00 37.09  ? 40  ALA A C     1 
ATOM   49   O  O     . ALA A 1 8   ? 36.706 145.968 -14.476 1.00 36.52  ? 40  ALA A O     1 
ATOM   50   C  CB    . ALA A 1 8   ? 37.605 146.806 -17.274 1.00 35.51  ? 40  ALA A CB    1 
ATOM   51   N  N     . GLN A 1 9   ? 36.350 144.087 -15.662 1.00 25.88  ? 41  GLN A N     1 
ATOM   52   C  CA    . GLN A 1 9   ? 35.293 143.595 -14.789 1.00 25.80  ? 41  GLN A CA    1 
ATOM   53   C  C     . GLN A 1 9   ? 35.782 142.522 -13.819 1.00 26.73  ? 41  GLN A C     1 
ATOM   54   O  O     . GLN A 1 9   ? 34.962 141.813 -13.224 1.00 25.47  ? 41  GLN A O     1 
ATOM   55   C  CB    . GLN A 1 9   ? 34.125 143.068 -15.622 1.00 26.83  ? 41  GLN A CB    1 
ATOM   56   C  CG    . GLN A 1 9   ? 33.386 144.156 -16.384 1.00 32.84  ? 41  GLN A CG    1 
ATOM   57   C  CD    . GLN A 1 9   ? 32.138 143.646 -17.073 1.00 36.73  ? 41  GLN A CD    1 
ATOM   58   O  OE1   . GLN A 1 9   ? 31.776 142.478 -16.942 1.00 33.77  ? 41  GLN A OE1   1 
ATOM   59   N  NE2   . GLN A 1 9   ? 31.471 144.524 -17.813 1.00 39.55  ? 41  GLN A NE2   1 
ATOM   60   N  N     . ARG A 1 10  ? 37.094 142.391 -13.643 1.00 24.55  ? 42  ARG A N     1 
ATOM   61   C  CA    . ARG A 1 10  ? 37.623 141.453 -12.667 1.00 22.28  ? 42  ARG A CA    1 
ATOM   62   C  C     . ARG A 1 10  ? 37.399 141.982 -11.250 1.00 25.00  ? 42  ARG A C     1 
ATOM   63   O  O     . ARG A 1 10  ? 37.023 143.138 -11.037 1.00 23.32  ? 42  ARG A O     1 
ATOM   64   C  CB    . ARG A 1 10  ? 39.110 141.197 -12.919 1.00 30.46  ? 42  ARG A CB    1 
ATOM   65   C  CG    . ARG A 1 10  ? 39.387 140.339 -14.146 1.00 25.39  ? 42  ARG A CG    1 
ATOM   66   C  CD    . ARG A 1 10  ? 40.873 140.268 -14.466 1.00 29.60  ? 42  ARG A CD    1 
ATOM   67   N  NE    . ARG A 1 10  ? 41.133 139.398 -15.611 1.00 32.52  ? 42  ARG A NE    1 
ATOM   68   C  CZ    . ARG A 1 10  ? 42.344 139.115 -16.080 1.00 36.31  ? 42  ARG A CZ    1 
ATOM   69   N  NH1   . ARG A 1 10  ? 43.422 139.633 -15.506 1.00 30.63  ? 42  ARG A NH1   1 
ATOM   70   N  NH2   . ARG A 1 10  ? 42.477 138.311 -17.127 1.00 33.44  ? 42  ARG A NH2   1 
ATOM   71   N  N     . MET A 1 11  ? 37.628 141.110 -10.270 1.00 24.70  ? 43  MET A N     1 
ATOM   72   C  CA    . MET A 1 11  ? 37.487 141.452 -8.862  1.00 28.58  ? 43  MET A CA    1 
ATOM   73   C  C     . MET A 1 11  ? 38.743 141.046 -8.110  1.00 28.48  ? 43  MET A C     1 
ATOM   74   O  O     . MET A 1 11  ? 39.304 139.970 -8.360  1.00 25.95  ? 43  MET A O     1 
ATOM   75   C  CB    . MET A 1 11  ? 36.276 140.761 -8.224  1.00 26.55  ? 43  MET A CB    1 
ATOM   76   C  CG    . MET A 1 11  ? 34.971 140.905 -8.982  1.00 30.78  ? 43  MET A CG    1 
ATOM   77   S  SD    . MET A 1 11  ? 33.663 139.967 -8.170  1.00 30.90  ? 43  MET A SD    1 
ATOM   78   C  CE    . MET A 1 11  ? 32.352 140.071 -9.384  1.00 30.71  ? 43  MET A CE    1 
ATOM   79   N  N     . VAL A 1 12  ? 39.170 141.900 -7.180  1.00 25.56  ? 44  VAL A N     1 
ATOM   80   C  CA    . VAL A 1 12  ? 40.330 141.642 -6.335  1.00 26.95  ? 44  VAL A CA    1 
ATOM   81   C  C     . VAL A 1 12  ? 39.795 141.239 -4.966  1.00 27.52  ? 44  VAL A C     1 
ATOM   82   O  O     . VAL A 1 12  ? 39.387 142.088 -4.172  1.00 25.57  ? 44  VAL A O     1 
ATOM   83   C  CB    . VAL A 1 12  ? 41.248 142.864 -6.245  1.00 23.64  ? 44  VAL A CB    1 
ATOM   84   C  CG1   . VAL A 1 12  ? 42.479 142.547 -5.406  1.00 27.14  ? 44  VAL A CG1   1 
ATOM   85   C  CG2   . VAL A 1 12  ? 41.644 143.339 -7.637  1.00 25.12  ? 44  VAL A CG2   1 
ATOM   86   N  N     . TRP A 1 13  ? 39.774 139.940 -4.688  1.00 24.90  ? 45  TRP A N     1 
ATOM   87   C  CA    . TRP A 1 13  ? 39.281 139.436 -3.414  1.00 25.50  ? 45  TRP A CA    1 
ATOM   88   C  C     . TRP A 1 13  ? 40.405 139.460 -2.391  1.00 28.90  ? 45  TRP A C     1 
ATOM   89   O  O     . TRP A 1 13  ? 41.497 138.946 -2.652  1.00 33.47  ? 45  TRP A O     1 
ATOM   90   C  CB    . TRP A 1 13  ? 38.744 138.013 -3.569  1.00 24.16  ? 45  TRP A CB    1 
ATOM   91   C  CG    . TRP A 1 13  ? 37.520 137.942 -4.409  1.00 26.97  ? 45  TRP A CG    1 
ATOM   92   C  CD1   . TRP A 1 13  ? 37.452 138.032 -5.767  1.00 27.66  ? 45  TRP A CD1   1 
ATOM   93   C  CD2   . TRP A 1 13  ? 36.177 137.774 -3.948  1.00 27.38  ? 45  TRP A CD2   1 
ATOM   94   N  NE1   . TRP A 1 13  ? 36.148 137.928 -6.183  1.00 24.47  ? 45  TRP A NE1   1 
ATOM   95   C  CE2   . TRP A 1 13  ? 35.344 137.770 -5.085  1.00 25.68  ? 45  TRP A CE2   1 
ATOM   96   C  CE3   . TRP A 1 13  ? 35.595 137.629 -2.685  1.00 23.05  ? 45  TRP A CE3   1 
ATOM   97   C  CZ2   . TRP A 1 13  ? 33.962 137.624 -4.996  1.00 26.46  ? 45  TRP A CZ2   1 
ATOM   98   C  CZ3   . TRP A 1 13  ? 34.223 137.484 -2.600  1.00 28.34  ? 45  TRP A CZ3   1 
ATOM   99   C  CH2   . TRP A 1 13  ? 33.422 137.482 -3.748  1.00 27.58  ? 45  TRP A CH2   1 
ATOM   100  N  N     . VAL A 1 14  ? 40.140 140.057 -1.228  1.00 27.31  ? 46  VAL A N     1 
ATOM   101  C  CA    . VAL A 1 14  ? 41.141 140.095 -0.168  1.00 31.68  ? 46  VAL A CA    1 
ATOM   102  C  C     . VAL A 1 14  ? 40.512 139.688 1.156   1.00 33.75  ? 46  VAL A C     1 
ATOM   103  O  O     . VAL A 1 14  ? 39.300 139.791 1.358   1.00 35.07  ? 46  VAL A O     1 
ATOM   104  C  CB    . VAL A 1 14  ? 41.817 141.477 -0.016  1.00 36.92  ? 46  VAL A CB    1 
ATOM   105  C  CG1   . VAL A 1 14  ? 42.489 141.901 -1.315  1.00 34.24  ? 46  VAL A CG1   1 
ATOM   106  C  CG2   . VAL A 1 14  ? 40.815 142.515 0.470   1.00 48.53  ? 46  VAL A CG2   1 
ATOM   107  N  N     . ASP A 1 15  ? 41.366 139.222 2.064   1.00 32.60  ? 47  ASP A N     1 
ATOM   108  C  CA    . ASP A 1 15  ? 40.937 138.959 3.429   1.00 38.58  ? 47  ASP A CA    1 
ATOM   109  C  C     . ASP A 1 15  ? 42.103 139.139 4.386   1.00 40.29  ? 47  ASP A C     1 
ATOM   110  O  O     . ASP A 1 15  ? 43.234 138.727 4.097   1.00 40.57  ? 47  ASP A O     1 
ATOM   111  C  CB    . ASP A 1 15  ? 40.348 137.555 3.593   1.00 40.47  ? 47  ASP A CB    1 
ATOM   112  C  CG    . ASP A 1 15  ? 39.724 137.350 4.959   1.00 51.57  ? 47  ASP A CG    1 
ATOM   113  O  OD1   . ASP A 1 15  ? 38.642 137.920 5.213   1.00 51.81  ? 47  ASP A OD1   1 
ATOM   114  O  OD2   . ASP A 1 15  ? 40.320 136.631 5.786   1.00 50.31  ? 47  ASP A OD2   1 
ATOM   115  N  N     . LEU A 1 16  ? 41.808 139.757 5.529   1.00 29.61  ? 48  LEU A N     1 
ATOM   116  C  CA    . LEU A 1 16  ? 42.773 139.995 6.590   1.00 41.57  ? 48  LEU A CA    1 
ATOM   117  C  C     . LEU A 1 16  ? 42.244 139.406 7.889   1.00 40.72  ? 48  LEU A C     1 
ATOM   118  O  O     . LEU A 1 16  ? 41.055 139.540 8.203   1.00 44.18  ? 48  LEU A O     1 
ATOM   119  C  CB    . LEU A 1 16  ? 43.044 141.495 6.773   1.00 48.02  ? 48  LEU A CB    1 
ATOM   120  C  CG    . LEU A 1 16  ? 43.994 142.236 5.826   1.00 57.02  ? 48  LEU A CG    1 
ATOM   121  C  CD1   . LEU A 1 16  ? 43.540 142.188 4.374   1.00 59.38  ? 48  LEU A CD1   1 
ATOM   122  C  CD2   . LEU A 1 16  ? 44.120 143.672 6.281   1.00 62.68  ? 48  LEU A CD2   1 
ATOM   123  N  N     . GLU A 1 17  ? 43.129 138.751 8.638   1.00 42.67  ? 49  GLU A N     1 
ATOM   124  C  CA    . GLU A 1 17  ? 42.768 138.108 9.897   1.00 52.52  ? 49  GLU A CA    1 
ATOM   125  C  C     . GLU A 1 17  ? 43.810 138.450 10.951  1.00 51.44  ? 49  GLU A C     1 
ATOM   126  O  O     . GLU A 1 17  ? 45.005 138.210 10.744  1.00 51.62  ? 49  GLU A O     1 
ATOM   127  C  CB    . GLU A 1 17  ? 42.646 136.589 9.731   1.00 54.89  ? 49  GLU A CB    1 
ATOM   128  C  CG    . GLU A 1 17  ? 41.601 136.147 8.713   1.00 58.37  ? 49  GLU A CG    1 
ATOM   129  C  CD    . GLU A 1 17  ? 40.178 136.345 9.207   1.00 64.09  ? 49  GLU A CD    1 
ATOM   130  O  OE1   . GLU A 1 17  ? 39.283 136.597 8.370   1.00 60.44  ? 49  GLU A OE1   1 
ATOM   131  O  OE2   . GLU A 1 17  ? 39.953 136.250 10.432  1.00 70.86  ? 49  GLU A OE2   1 
ATOM   132  N  N     . MET A 1 18  ? 43.359 138.999 12.077  1.00 56.27  ? 50  MET A N     1 
ATOM   133  C  CA    . MET A 1 18  ? 44.257 139.335 13.178  1.00 70.69  ? 50  MET A CA    1 
ATOM   134  C  C     . MET A 1 18  ? 44.415 138.154 14.130  1.00 68.45  ? 50  MET A C     1 
ATOM   135  O  O     . MET A 1 18  ? 45.212 137.249 13.883  1.00 69.75  ? 50  MET A O     1 
ATOM   136  C  CB    . MET A 1 18  ? 43.747 140.561 13.943  1.00 82.51  ? 50  MET A CB    1 
ATOM   137  C  CG    . MET A 1 18  ? 44.039 141.897 13.268  1.00 93.20  ? 50  MET A CG    1 
ATOM   138  S  SD    . MET A 1 18  ? 43.015 142.189 11.811  1.00 99.78  ? 50  MET A SD    1 
ATOM   139  C  CE    . MET A 1 18  ? 42.856 143.973 11.845  1.00 95.47  ? 50  MET A CE    1 
ATOM   140  N  N     . ILE A 1 28  ? 50.121 140.496 14.797  1.00 62.40  ? 60  ILE A N     1 
ATOM   141  C  CA    . ILE A 1 28  ? 50.298 139.584 13.674  1.00 65.56  ? 60  ILE A CA    1 
ATOM   142  C  C     . ILE A 1 28  ? 49.021 139.511 12.842  1.00 62.43  ? 60  ILE A C     1 
ATOM   143  O  O     . ILE A 1 28  ? 47.966 139.114 13.336  1.00 67.36  ? 60  ILE A O     1 
ATOM   144  C  CB    . ILE A 1 28  ? 50.716 138.186 14.157  1.00 66.27  ? 60  ILE A CB    1 
ATOM   145  C  CG1   . ILE A 1 28  ? 52.025 138.265 14.945  1.00 67.27  ? 60  ILE A CG1   1 
ATOM   146  C  CG2   . ILE A 1 28  ? 50.858 137.238 12.978  1.00 63.18  ? 60  ILE A CG2   1 
ATOM   147  C  CD1   . ILE A 1 28  ? 53.188 138.785 14.140  1.00 66.06  ? 60  ILE A CD1   1 
ATOM   148  N  N     . ILE A 1 29  ? 49.132 139.895 11.573  1.00 51.04  ? 61  ILE A N     1 
ATOM   149  C  CA    . ILE A 1 29  ? 48.009 139.947 10.647  1.00 45.51  ? 61  ILE A CA    1 
ATOM   150  C  C     . ILE A 1 29  ? 48.329 139.061 9.453   1.00 50.11  ? 61  ILE A C     1 
ATOM   151  O  O     . ILE A 1 29  ? 49.387 139.210 8.828   1.00 51.04  ? 61  ILE A O     1 
ATOM   152  C  CB    . ILE A 1 29  ? 47.718 141.388 10.186  1.00 50.37  ? 61  ILE A CB    1 
ATOM   153  C  CG1   . ILE A 1 29  ? 47.088 142.199 11.320  1.00 54.20  ? 61  ILE A CG1   1 
ATOM   154  C  CG2   . ILE A 1 29  ? 46.818 141.388 8.956   1.00 53.87  ? 61  ILE A CG2   1 
ATOM   155  C  CD1   . ILE A 1 29  ? 47.108 143.694 11.080  1.00 60.41  ? 61  ILE A CD1   1 
ATOM   156  N  N     . GLU A 1 30  ? 47.423 138.138 9.145   1.00 49.12  ? 62  GLU A N     1 
ATOM   157  C  CA    . GLU A 1 30  ? 47.506 137.344 7.930   1.00 50.79  ? 62  GLU A CA    1 
ATOM   158  C  C     . GLU A 1 30  ? 46.691 138.027 6.841   1.00 42.08  ? 62  GLU A C     1 
ATOM   159  O  O     . GLU A 1 30  ? 45.561 138.462 7.086   1.00 44.65  ? 62  GLU A O     1 
ATOM   160  C  CB    . GLU A 1 30  ? 46.990 135.924 8.174   1.00 56.40  ? 62  GLU A CB    1 
ATOM   161  C  CG    . GLU A 1 30  ? 47.215 134.975 7.011   1.00 67.50  ? 62  GLU A CG    1 
ATOM   162  C  CD    . GLU A 1 30  ? 46.416 133.693 7.140   1.00 74.74  ? 62  GLU A CD    1 
ATOM   163  O  OE1   . GLU A 1 30  ? 45.992 133.360 8.268   1.00 77.25  ? 62  GLU A OE1   1 
ATOM   164  O  OE2   . GLU A 1 30  ? 46.206 133.019 6.110   1.00 76.33  ? 62  GLU A OE2   1 
ATOM   165  N  N     . MET A 1 31  ? 47.264 138.130 5.645   1.00 40.95  ? 63  MET A N     1 
ATOM   166  C  CA    . MET A 1 31  ? 46.586 138.770 4.525   1.00 37.36  ? 63  MET A CA    1 
ATOM   167  C  C     . MET A 1 31  ? 46.686 137.886 3.292   1.00 37.09  ? 63  MET A C     1 
ATOM   168  O  O     . MET A 1 31  ? 47.779 137.434 2.932   1.00 36.46  ? 63  MET A O     1 
ATOM   169  C  CB    . MET A 1 31  ? 47.173 140.154 4.229   1.00 38.90  ? 63  MET A CB    1 
ATOM   170  C  CG    . MET A 1 31  ? 46.546 140.827 3.018   1.00 43.80  ? 63  MET A CG    1 
ATOM   171  S  SD    . MET A 1 31  ? 46.941 142.580 2.873   1.00 45.16  ? 63  MET A SD    1 
ATOM   172  C  CE    . MET A 1 31  ? 46.213 142.948 1.278   1.00 43.20  ? 63  MET A CE    1 
ATOM   173  N  N     . ALA A 1 32  ? 45.545 137.647 2.648   1.00 38.17  ? 64  ALA A N     1 
ATOM   174  C  CA    . ALA A 1 32  ? 45.491 136.865 1.423   1.00 39.26  ? 64  ALA A CA    1 
ATOM   175  C  C     . ALA A 1 32  ? 44.711 137.627 0.361   1.00 34.21  ? 64  ALA A C     1 
ATOM   176  O  O     . ALA A 1 32  ? 43.839 138.448 0.667   1.00 36.95  ? 64  ALA A O     1 
ATOM   177  C  CB    . ALA A 1 32  ? 44.857 135.486 1.654   1.00 50.20  ? 64  ALA A CB    1 
ATOM   178  N  N     . CYS A 1 33  ? 45.030 137.327 -0.898  1.00 31.75  ? 65  CYS A N     1 
ATOM   179  C  CA    . CYS A 1 33  ? 44.445 138.016 -2.038  1.00 35.33  ? 65  CYS A CA    1 
ATOM   180  C  C     . CYS A 1 33  ? 44.412 137.081 -3.239  1.00 36.67  ? 65  CYS A C     1 
ATOM   181  O  O     . CYS A 1 33  ? 45.327 136.278 -3.436  1.00 34.26  ? 65  CYS A O     1 
ATOM   182  C  CB    . CYS A 1 33  ? 45.237 139.285 -2.379  1.00 34.88  ? 65  CYS A CB    1 
ATOM   183  S  SG    . CYS A 1 33  ? 44.832 140.028 -3.978  1.00 37.55  ? 65  CYS A SG    1 
ATOM   184  N  N     . LEU A 1 34  ? 43.347 137.187 -4.031  1.00 31.82  ? 66  LEU A N     1 
ATOM   185  C  CA    . LEU A 1 34  ? 43.270 136.492 -5.310  1.00 32.05  ? 66  LEU A CA    1 
ATOM   186  C  C     . LEU A 1 34  ? 42.413 137.304 -6.271  1.00 32.96  ? 66  LEU A C     1 
ATOM   187  O  O     . LEU A 1 34  ? 41.840 138.335 -5.911  1.00 34.19  ? 66  LEU A O     1 
ATOM   188  C  CB    . LEU A 1 34  ? 42.732 135.060 -5.156  1.00 35.24  ? 66  LEU A CB    1 
ATOM   189  C  CG    . LEU A 1 34  ? 41.381 134.769 -4.498  1.00 30.11  ? 66  LEU A CG    1 
ATOM   190  C  CD1   . LEU A 1 34  ? 40.218 134.960 -5.464  1.00 38.34  ? 66  LEU A CD1   1 
ATOM   191  C  CD2   . LEU A 1 34  ? 41.375 133.350 -3.939  1.00 38.58  ? 66  LEU A CD2   1 
ATOM   192  N  N     . ILE A 1 35  ? 42.334 136.825 -7.510  1.00 26.97  ? 67  ILE A N     1 
ATOM   193  C  CA    . ILE A 1 35  ? 41.632 137.517 -8.583  1.00 24.39  ? 67  ILE A CA    1 
ATOM   194  C  C     . ILE A 1 35  ? 40.553 136.601 -9.135  1.00 26.08  ? 67  ILE A C     1 
ATOM   195  O  O     . ILE A 1 35  ? 40.794 135.409 -9.358  1.00 31.59  ? 67  ILE A O     1 
ATOM   196  C  CB    . ILE A 1 35  ? 42.598 137.944 -9.707  1.00 23.62  ? 67  ILE A CB    1 
ATOM   197  C  CG1   . ILE A 1 35  ? 43.759 138.759 -9.135  1.00 28.83  ? 67  ILE A CG1   1 
ATOM   198  C  CG2   . ILE A 1 35  ? 41.857 138.725 -10.784 1.00 25.08  ? 67  ILE A CG2   1 
ATOM   199  C  CD1   . ILE A 1 35  ? 43.347 140.094 -8.556  1.00 29.84  ? 67  ILE A CD1   1 
ATOM   200  N  N     . THR A 1 36  ? 39.363 137.154 -9.355  1.00 26.89  ? 68  THR A N     1 
ATOM   201  C  CA    . THR A 1 36  ? 38.325 136.437 -10.079 1.00 20.96  ? 68  THR A CA    1 
ATOM   202  C  C     . THR A 1 36  ? 37.892 137.242 -11.295 1.00 27.69  ? 68  THR A C     1 
ATOM   203  O  O     . THR A 1 36  ? 38.075 138.460 -11.359 1.00 29.46  ? 68  THR A O     1 
ATOM   204  C  CB    . THR A 1 36  ? 37.095 136.140 -9.204  1.00 20.86  ? 68  THR A CB    1 
ATOM   205  O  OG1   . THR A 1 36  ? 36.458 137.367 -8.826  1.00 27.51  ? 68  THR A OG1   1 
ATOM   206  C  CG2   . THR A 1 36  ? 37.490 135.357 -7.962  1.00 27.93  ? 68  THR A CG2   1 
ATOM   207  N  N     . ASP A 1 37  ? 37.318 136.541 -12.269 1.00 28.47  ? 69  ASP A N     1 
ATOM   208  C  CA    . ASP A 1 37  ? 36.662 137.222 -13.370 1.00 29.04  ? 69  ASP A CA    1 
ATOM   209  C  C     . ASP A 1 37  ? 35.291 137.714 -12.911 1.00 25.36  ? 69  ASP A C     1 
ATOM   210  O  O     . ASP A 1 37  ? 34.899 137.550 -11.751 1.00 29.40  ? 69  ASP A O     1 
ATOM   211  C  CB    . ASP A 1 37  ? 36.568 136.307 -14.593 1.00 30.33  ? 69  ASP A CB    1 
ATOM   212  C  CG    . ASP A 1 37  ? 35.818 135.010 -14.317 1.00 45.12  ? 69  ASP A CG    1 
ATOM   213  O  OD1   . ASP A 1 37  ? 35.146 134.892 -13.271 1.00 41.40  ? 69  ASP A OD1   1 
ATOM   214  O  OD2   . ASP A 1 37  ? 35.899 134.097 -15.167 1.00 48.36  ? 69  ASP A OD2   1 
ATOM   215  N  N     . SER A 1 38  ? 34.543 138.324 -13.832 1.00 29.28  ? 70  SER A N     1 
ATOM   216  C  CA    . SER A 1 38  ? 33.224 138.836 -13.482 1.00 31.52  ? 70  SER A CA    1 
ATOM   217  C  C     . SER A 1 38  ? 32.257 137.725 -13.092 1.00 36.89  ? 70  SER A C     1 
ATOM   218  O  O     . SER A 1 38  ? 31.256 137.999 -12.420 1.00 30.12  ? 70  SER A O     1 
ATOM   219  C  CB    . SER A 1 38  ? 32.650 139.647 -14.645 1.00 28.82  ? 70  SER A CB    1 
ATOM   220  O  OG    . SER A 1 38  ? 32.442 138.828 -15.781 1.00 34.01  ? 70  SER A OG    1 
ATOM   221  N  N     . ASP A 1 39  ? 32.533 136.481 -13.486 1.00 29.23  ? 71  ASP A N     1 
ATOM   222  C  CA    . ASP A 1 39  ? 31.678 135.347 -13.164 1.00 26.51  ? 71  ASP A CA    1 
ATOM   223  C  C     . ASP A 1 39  ? 32.199 134.538 -11.980 1.00 31.56  ? 71  ASP A C     1 
ATOM   224  O  O     . ASP A 1 39  ? 31.774 133.393 -11.787 1.00 36.83  ? 71  ASP A O     1 
ATOM   225  C  CB    . ASP A 1 39  ? 31.512 134.447 -14.389 1.00 32.34  ? 71  ASP A CB    1 
ATOM   226  C  CG    . ASP A 1 39  ? 30.690 135.100 -15.481 1.00 44.01  ? 71  ASP A CG    1 
ATOM   227  O  OD1   . ASP A 1 39  ? 29.715 135.809 -15.153 1.00 37.59  ? 71  ASP A OD1   1 
ATOM   228  O  OD2   . ASP A 1 39  ? 31.023 134.909 -16.670 1.00 48.16  ? 71  ASP A OD2   1 
ATOM   229  N  N     . LEU A 1 40  ? 33.118 135.110 -11.197 1.00 28.03  ? 72  LEU A N     1 
ATOM   230  C  CA    . LEU A 1 40  ? 33.611 134.554 -9.937  1.00 27.34  ? 72  LEU A CA    1 
ATOM   231  C  C     . LEU A 1 40  ? 34.521 133.343 -10.124 1.00 33.86  ? 72  LEU A C     1 
ATOM   232  O  O     . LEU A 1 40  ? 34.781 132.614 -9.161  1.00 31.91  ? 72  LEU A O     1 
ATOM   233  C  CB    . LEU A 1 40  ? 32.458 134.199 -8.987  1.00 26.97  ? 72  LEU A CB    1 
ATOM   234  C  CG    . LEU A 1 40  ? 31.424 135.299 -8.726  1.00 25.82  ? 72  LEU A CG    1 
ATOM   235  C  CD1   . LEU A 1 40  ? 30.386 134.846 -7.709  1.00 27.63  ? 72  LEU A CD1   1 
ATOM   236  C  CD2   . LEU A 1 40  ? 32.109 136.577 -8.267  1.00 28.00  ? 72  LEU A CD2   1 
ATOM   237  N  N     . ASN A 1 41  ? 35.023 133.110 -11.333 1.00 33.46  ? 73  ASN A N     1 
ATOM   238  C  CA    . ASN A 1 41  ? 36.023 132.070 -11.543 1.00 37.25  ? 73  ASN A CA    1 
ATOM   239  C  C     . ASN A 1 41  ? 37.391 132.579 -11.108 1.00 37.55  ? 73  ASN A C     1 
ATOM   240  O  O     . ASN A 1 41  ? 37.831 133.649 -11.540 1.00 31.71  ? 73  ASN A O     1 
ATOM   241  C  CB    . ASN A 1 41  ? 36.062 131.644 -13.010 1.00 35.62  ? 73  ASN A CB    1 
ATOM   242  C  CG    . ASN A 1 41  ? 34.739 131.091 -13.491 1.00 39.62  ? 73  ASN A CG    1 
ATOM   243  O  OD1   . ASN A 1 41  ? 34.201 130.147 -12.913 1.00 45.49  ? 73  ASN A OD1   1 
ATOM   244  N  ND2   . ASN A 1 41  ? 34.206 131.677 -14.556 1.00 38.64  ? 73  ASN A ND2   1 
ATOM   245  N  N     . ILE A 1 42  ? 38.064 131.813 -10.251 1.00 40.12  ? 74  ILE A N     1 
ATOM   246  C  CA    . ILE A 1 42  ? 39.377 132.212 -9.756  1.00 37.87  ? 74  ILE A CA    1 
ATOM   247  C  C     . ILE A 1 42  ? 40.380 132.147 -10.900 1.00 34.50  ? 74  ILE A C     1 
ATOM   248  O  O     . ILE A 1 42  ? 40.562 131.097 -11.529 1.00 34.39  ? 74  ILE A O     1 
ATOM   249  C  CB    . ILE A 1 42  ? 39.815 131.329 -8.582  1.00 40.08  ? 74  ILE A CB    1 
ATOM   250  C  CG1   . ILE A 1 42  ? 38.925 131.584 -7.364  1.00 35.26  ? 74  ILE A CG1   1 
ATOM   251  C  CG2   . ILE A 1 42  ? 41.275 131.586 -8.240  1.00 40.74  ? 74  ILE A CG2   1 
ATOM   252  C  CD1   . ILE A 1 42  ? 39.287 130.741 -6.161  1.00 39.29  ? 74  ILE A CD1   1 
ATOM   253  N  N     . LEU A 1 43  ? 41.038 133.272 -11.175 1.00 32.05  ? 75  LEU A N     1 
ATOM   254  C  CA    . LEU A 1 43  ? 42.015 133.369 -12.252 1.00 33.91  ? 75  LEU A CA    1 
ATOM   255  C  C     . LEU A 1 43  ? 43.453 133.254 -11.766 1.00 35.82  ? 75  LEU A C     1 
ATOM   256  O  O     . LEU A 1 43  ? 44.288 132.659 -12.455 1.00 38.12  ? 75  LEU A O     1 
ATOM   257  C  CB    . LEU A 1 43  ? 41.847 134.694 -13.003 1.00 28.57  ? 75  LEU A CB    1 
ATOM   258  C  CG    . LEU A 1 43  ? 40.472 135.002 -13.595 1.00 32.67  ? 75  LEU A CG    1 
ATOM   259  C  CD1   . LEU A 1 43  ? 40.476 136.378 -14.242 1.00 33.47  ? 75  LEU A CD1   1 
ATOM   260  C  CD2   . LEU A 1 43  ? 40.066 133.938 -14.601 1.00 32.60  ? 75  LEU A CD2   1 
ATOM   261  N  N     . ALA A 1 44  ? 43.764 133.816 -10.600 1.00 30.81  ? 76  ALA A N     1 
ATOM   262  C  CA    . ALA A 1 44  ? 45.126 133.807 -10.089 1.00 32.66  ? 76  ALA A CA    1 
ATOM   263  C  C     . ALA A 1 44  ? 45.093 133.980 -8.578  1.00 33.58  ? 76  ALA A C     1 
ATOM   264  O  O     . ALA A 1 44  ? 44.233 134.687 -8.046  1.00 33.75  ? 76  ALA A O     1 
ATOM   265  C  CB    . ALA A 1 44  ? 45.971 134.913 -10.731 1.00 36.32  ? 76  ALA A CB    1 
ATOM   266  N  N     . GLU A 1 45  ? 46.028 133.326 -7.897  1.00 29.67  ? 77  GLU A N     1 
ATOM   267  C  CA    . GLU A 1 45  ? 46.169 133.434 -6.452  1.00 33.94  ? 77  GLU A CA    1 
ATOM   268  C  C     . GLU A 1 45  ? 47.369 134.314 -6.132  1.00 35.25  ? 77  GLU A C     1 
ATOM   269  O  O     . GLU A 1 45  ? 48.472 134.075 -6.635  1.00 35.75  ? 77  GLU A O     1 
ATOM   270  C  CB    . GLU A 1 45  ? 46.330 132.055 -5.810  1.00 47.70  ? 77  GLU A CB    1 
ATOM   271  C  CG    . GLU A 1 45  ? 45.013 131.343 -5.539  1.00 66.61  ? 77  GLU A CG    1 
ATOM   272  C  CD    . GLU A 1 45  ? 45.022 129.901 -6.008  1.00 85.57  ? 77  GLU A CD    1 
ATOM   273  O  OE1   . GLU A 1 45  ? 46.074 129.239 -5.882  1.00 93.35  ? 77  GLU A OE1   1 
ATOM   274  O  OE2   . GLU A 1 45  ? 43.976 129.429 -6.501  1.00 91.24  ? 77  GLU A OE2   1 
ATOM   275  N  N     . GLY A 1 46  ? 47.150 135.329 -5.304  1.00 35.98  ? 78  GLY A N     1 
ATOM   276  C  CA    . GLY A 1 46  ? 48.194 136.261 -4.956  1.00 35.12  ? 78  GLY A CA    1 
ATOM   277  C  C     . GLY A 1 46  ? 48.966 135.836 -3.726  1.00 40.47  ? 78  GLY A C     1 
ATOM   278  O  O     . GLY A 1 46  ? 48.905 134.683 -3.289  1.00 43.06  ? 78  GLY A O     1 
ATOM   279  N  N     . PRO A 1 47  ? 49.717 136.770 -3.147  1.00 38.39  ? 79  PRO A N     1 
ATOM   280  C  CA    . PRO A 1 47  ? 50.508 136.444 -1.955  1.00 37.94  ? 79  PRO A CA    1 
ATOM   281  C  C     . PRO A 1 47  ? 49.626 136.111 -0.763  1.00 38.65  ? 79  PRO A C     1 
ATOM   282  O  O     . PRO A 1 47  ? 48.497 136.592 -0.634  1.00 34.56  ? 79  PRO A O     1 
ATOM   283  C  CB    . PRO A 1 47  ? 51.316 137.723 -1.702  1.00 40.43  ? 79  PRO A CB    1 
ATOM   284  C  CG    . PRO A 1 47  ? 51.284 138.472 -2.998  1.00 35.45  ? 79  PRO A CG    1 
ATOM   285  C  CD    . PRO A 1 47  ? 49.963 138.142 -3.617  1.00 37.39  ? 79  PRO A CD    1 
ATOM   286  N  N     . ASN A 1 48  ? 50.163 135.264 0.112   1.00 39.22  ? 80  ASN A N     1 
ATOM   287  C  CA    . ASN A 1 48  ? 49.548 134.929 1.395   1.00 46.11  ? 80  ASN A CA    1 
ATOM   288  C  C     . ASN A 1 48  ? 50.605 135.226 2.454   1.00 46.11  ? 80  ASN A C     1 
ATOM   289  O  O     . ASN A 1 48  ? 51.504 134.412 2.684   1.00 43.27  ? 80  ASN A O     1 
ATOM   290  C  CB    . ASN A 1 48  ? 49.096 133.472 1.433   1.00 49.31  ? 80  ASN A CB    1 
ATOM   291  C  CG    . ASN A 1 48  ? 48.026 133.221 2.473   1.00 54.91  ? 80  ASN A CG    1 
ATOM   292  O  OD1   . ASN A 1 48  ? 48.065 133.783 3.567   1.00 58.16  ? 80  ASN A OD1   1 
ATOM   293  N  ND2   . ASN A 1 48  ? 47.063 132.371 2.139   1.00 63.52  ? 80  ASN A ND2   1 
ATOM   294  N  N     . LEU A 1 49  ? 50.505 136.391 3.089   1.00 44.41  ? 81  LEU A N     1 
ATOM   295  C  CA    . LEU A 1 49  ? 51.609 136.936 3.863   1.00 49.09  ? 81  LEU A CA    1 
ATOM   296  C  C     . LEU A 1 49  ? 51.216 137.176 5.315   1.00 48.40  ? 81  LEU A C     1 
ATOM   297  O  O     . LEU A 1 49  ? 50.035 137.236 5.668   1.00 43.75  ? 81  LEU A O     1 
ATOM   298  C  CB    . LEU A 1 49  ? 52.115 138.245 3.244   1.00 50.08  ? 81  LEU A CB    1 
ATOM   299  C  CG    . LEU A 1 49  ? 52.608 138.135 1.800   1.00 50.36  ? 81  LEU A CG    1 
ATOM   300  C  CD1   . LEU A 1 49  ? 52.876 139.511 1.215   1.00 46.10  ? 81  LEU A CD1   1 
ATOM   301  C  CD2   . LEU A 1 49  ? 53.853 137.264 1.723   1.00 52.09  ? 81  LEU A CD2   1 
ATOM   302  N  N     . ILE A 1 50  ? 52.244 137.316 6.150   1.00 49.96  ? 82  ILE A N     1 
ATOM   303  C  CA    . ILE A 1 50  ? 52.106 137.611 7.571   1.00 50.09  ? 82  ILE A CA    1 
ATOM   304  C  C     . ILE A 1 50  ? 52.873 138.894 7.860   1.00 46.99  ? 82  ILE A C     1 
ATOM   305  O  O     . ILE A 1 50  ? 54.063 138.998 7.537   1.00 47.37  ? 82  ILE A O     1 
ATOM   306  C  CB    . ILE A 1 50  ? 52.626 136.453 8.443   1.00 53.45  ? 82  ILE A CB    1 
ATOM   307  C  CG1   . ILE A 1 50  ? 51.704 135.237 8.333   1.00 58.23  ? 82  ILE A CG1   1 
ATOM   308  C  CG2   . ILE A 1 50  ? 52.778 136.896 9.891   1.00 52.77  ? 82  ILE A CG2   1 
ATOM   309  C  CD1   . ILE A 1 50  ? 50.414 135.381 9.098   1.00 60.56  ? 82  ILE A CD1   1 
ATOM   310  N  N     . ILE A 1 51  ? 52.192 139.868 8.465   1.00 50.45  ? 83  ILE A N     1 
ATOM   311  C  CA    . ILE A 1 51  ? 52.752 141.187 8.724   1.00 54.85  ? 83  ILE A CA    1 
ATOM   312  C  C     . ILE A 1 51  ? 52.543 141.510 10.199  1.00 57.05  ? 83  ILE A C     1 
ATOM   313  O  O     . ILE A 1 51  ? 51.718 140.901 10.880  1.00 59.54  ? 83  ILE A O     1 
ATOM   314  C  CB    . ILE A 1 51  ? 52.118 142.265 7.806   1.00 56.83  ? 83  ILE A CB    1 
ATOM   315  C  CG1   . ILE A 1 51  ? 52.276 141.867 6.338   1.00 56.57  ? 83  ILE A CG1   1 
ATOM   316  C  CG2   . ILE A 1 51  ? 52.760 143.627 7.994   1.00 66.31  ? 83  ILE A CG2   1 
ATOM   317  C  CD1   . ILE A 1 51  ? 51.053 141.213 5.733   1.00 61.02  ? 83  ILE A CD1   1 
ATOM   318  N  N     . LYS A 1 52  ? 53.329 142.458 10.701  1.00 65.27  ? 84  LYS A N     1 
ATOM   319  C  CA    . LYS A 1 52  ? 53.255 142.855 12.103  1.00 66.76  ? 84  LYS A CA    1 
ATOM   320  C  C     . LYS A 1 52  ? 52.636 144.240 12.260  1.00 69.21  ? 84  LYS A C     1 
ATOM   321  O  O     . LYS A 1 52  ? 51.418 144.382 12.362  1.00 71.15  ? 84  LYS A O     1 
ATOM   322  C  CB    . LYS A 1 52  ? 54.646 142.830 12.735  1.00 74.25  ? 84  LYS A CB    1 
ATOM   323  C  CG    . LYS A 1 52  ? 55.670 142.058 11.925  1.00 83.79  ? 84  LYS A CG    1 
ATOM   324  C  CD    . LYS A 1 52  ? 55.477 140.558 12.086  1.00 87.97  ? 84  LYS A CD    1 
ATOM   325  C  CE    . LYS A 1 52  ? 56.311 139.783 11.081  1.00 82.88  ? 84  LYS A CE    1 
ATOM   326  N  NZ    . LYS A 1 52  ? 56.132 138.315 11.244  1.00 77.47  ? 84  LYS A NZ    1 
ATOM   327  N  N     . THR A 1 82  ? 55.655 137.219 7.649   1.00 94.34  ? 114 THR A N     1 
ATOM   328  C  CA    . THR A 1 82  ? 56.932 137.220 8.349   1.00 91.37  ? 114 THR A CA    1 
ATOM   329  C  C     . THR A 1 82  ? 57.803 138.364 7.851   1.00 89.50  ? 114 THR A C     1 
ATOM   330  O  O     . THR A 1 82  ? 59.017 138.372 8.058   1.00 89.77  ? 114 THR A O     1 
ATOM   331  C  CB    . THR A 1 82  ? 57.680 135.888 8.166   1.00 91.18  ? 114 THR A CB    1 
ATOM   332  O  OG1   . THR A 1 82  ? 59.001 136.000 8.708   1.00 99.78  ? 114 THR A OG1   1 
ATOM   333  C  CG2   . THR A 1 82  ? 57.769 135.528 6.690   1.00 84.83  ? 114 THR A CG2   1 
ATOM   334  N  N     . ILE A 1 83  ? 57.170 139.333 7.192   1.00 77.79  ? 115 ILE A N     1 
ATOM   335  C  CA    . ILE A 1 83  ? 57.853 140.429 6.528   1.00 64.97  ? 115 ILE A CA    1 
ATOM   336  C  C     . ILE A 1 83  ? 57.244 141.747 6.994   1.00 53.77  ? 115 ILE A C     1 
ATOM   337  O  O     . ILE A 1 83  ? 56.315 141.777 7.799   1.00 55.31  ? 115 ILE A O     1 
ATOM   338  C  CB    . ILE A 1 83  ? 57.792 140.303 4.992   1.00 59.88  ? 115 ILE A CB    1 
ATOM   339  C  CG1   . ILE A 1 83  ? 56.345 140.402 4.510   1.00 52.25  ? 115 ILE A CG1   1 
ATOM   340  C  CG2   . ILE A 1 83  ? 58.413 138.995 4.537   1.00 63.61  ? 115 ILE A CG2   1 
ATOM   341  C  CD1   . ILE A 1 83  ? 56.190 140.241 3.014   1.00 48.99  ? 115 ILE A CD1   1 
ATOM   342  N  N     . THR A 1 84  ? 57.780 142.843 6.467   1.00 47.76  ? 116 THR A N     1 
ATOM   343  C  CA    . THR A 1 84  ? 57.349 144.170 6.881   1.00 47.18  ? 116 THR A CA    1 
ATOM   344  C  C     . THR A 1 84  ? 56.166 144.640 6.038   1.00 46.86  ? 116 THR A C     1 
ATOM   345  O  O     . THR A 1 84  ? 55.884 144.106 4.962   1.00 42.50  ? 116 THR A O     1 
ATOM   346  C  CB    . THR A 1 84  ? 58.505 145.167 6.783   1.00 57.19  ? 116 THR A CB    1 
ATOM   347  O  OG1   . THR A 1 84  ? 58.295 146.245 7.703   1.00 75.27  ? 116 THR A OG1   1 
ATOM   348  C  CG2   . THR A 1 84  ? 58.602 145.735 5.387   1.00 41.76  ? 116 THR A CG2   1 
ATOM   349  N  N     . LEU A 1 85  ? 55.483 145.667 6.550   1.00 42.86  ? 117 LEU A N     1 
ATOM   350  C  CA    . LEU A 1 85  ? 54.274 146.169 5.904   1.00 47.10  ? 117 LEU A CA    1 
ATOM   351  C  C     . LEU A 1 85  ? 54.560 146.696 4.501   1.00 41.55  ? 117 LEU A C     1 
ATOM   352  O  O     . LEU A 1 85  ? 53.777 146.465 3.570   1.00 37.68  ? 117 LEU A O     1 
ATOM   353  C  CB    . LEU A 1 85  ? 53.644 147.259 6.774   1.00 46.10  ? 117 LEU A CB    1 
ATOM   354  C  CG    . LEU A 1 85  ? 52.337 147.903 6.313   1.00 47.30  ? 117 LEU A CG    1 
ATOM   355  C  CD1   . LEU A 1 85  ? 51.216 146.879 6.269   1.00 47.23  ? 117 LEU A CD1   1 
ATOM   356  C  CD2   . LEU A 1 85  ? 51.966 149.069 7.219   1.00 54.78  ? 117 LEU A CD2   1 
ATOM   357  N  N     . GLN A 1 86  ? 55.686 147.389 4.323   1.00 37.72  ? 118 GLN A N     1 
ATOM   358  C  CA    . GLN A 1 86  ? 55.983 147.987 3.025   1.00 41.50  ? 118 GLN A CA    1 
ATOM   359  C  C     . GLN A 1 86  ? 56.309 146.923 1.980   1.00 38.19  ? 118 GLN A C     1 
ATOM   360  O  O     . GLN A 1 86  ? 55.860 147.017 0.831   1.00 35.71  ? 118 GLN A O     1 
ATOM   361  C  CB    . GLN A 1 86  ? 57.128 148.991 3.162   1.00 41.52  ? 118 GLN A CB    1 
ATOM   362  C  CG    . GLN A 1 86  ? 56.702 150.356 3.701   1.00 53.71  ? 118 GLN A CG    1 
ATOM   363  C  CD    . GLN A 1 86  ? 56.495 150.359 5.208   1.00 66.64  ? 118 GLN A CD    1 
ATOM   364  O  OE1   . GLN A 1 86  ? 56.989 149.483 5.917   1.00 64.04  ? 118 GLN A OE1   1 
ATOM   365  N  NE2   . GLN A 1 86  ? 55.754 151.347 5.702   1.00 71.12  ? 118 GLN A NE2   1 
ATOM   366  N  N     . GLN A 1 87  ? 57.076 145.897 2.362   1.00 34.46  ? 119 GLN A N     1 
ATOM   367  C  CA    . GLN A 1 87  ? 57.389 144.820 1.424   1.00 36.71  ? 119 GLN A CA    1 
ATOM   368  C  C     . GLN A 1 87  ? 56.136 144.041 1.034   1.00 32.58  ? 119 GLN A C     1 
ATOM   369  O  O     . GLN A 1 87  ? 55.957 143.684 -0.138  1.00 44.64  ? 119 GLN A O     1 
ATOM   370  C  CB    . GLN A 1 87  ? 58.434 143.881 2.029   1.00 36.25  ? 119 GLN A CB    1 
ATOM   371  C  CG    . GLN A 1 87  ? 59.752 144.549 2.407   1.00 46.83  ? 119 GLN A CG    1 
ATOM   372  C  CD    . GLN A 1 87  ? 60.601 144.915 1.206   1.00 42.21  ? 119 GLN A CD    1 
ATOM   373  O  OE1   . GLN A 1 87  ? 60.328 144.488 0.085   1.00 42.77  ? 119 GLN A OE1   1 
ATOM   374  N  NE2   . GLN A 1 87  ? 61.649 145.699 1.438   1.00 41.88  ? 119 GLN A NE2   1 
ATOM   375  N  N     . ALA A 1 88  ? 55.261 143.762 2.004   1.00 35.94  ? 120 ALA A N     1 
ATOM   376  C  CA    . ALA A 1 88  ? 54.016 143.065 1.696   1.00 30.80  ? 120 ALA A CA    1 
ATOM   377  C  C     . ALA A 1 88  ? 53.130 143.901 0.784   1.00 36.87  ? 120 ALA A C     1 
ATOM   378  O  O     . ALA A 1 88  ? 52.501 143.372 -0.145  1.00 34.00  ? 120 ALA A O     1 
ATOM   379  C  CB    . ALA A 1 88  ? 53.278 142.714 2.987   1.00 35.91  ? 120 ALA A CB    1 
ATOM   380  N  N     . GLU A 1 89  ? 53.056 145.210 1.041   1.00 36.83  ? 121 GLU A N     1 
ATOM   381  C  CA    . GLU A 1 89  ? 52.313 146.090 0.147   1.00 33.40  ? 121 GLU A CA    1 
ATOM   382  C  C     . GLU A 1 89  ? 52.891 146.047 -1.260  1.00 29.97  ? 121 GLU A C     1 
ATOM   383  O  O     . GLU A 1 89  ? 52.141 146.026 -2.242  1.00 32.43  ? 121 GLU A O     1 
ATOM   384  C  CB    . GLU A 1 89  ? 52.315 147.520 0.683   1.00 38.95  ? 121 GLU A CB    1 
ATOM   385  C  CG    . GLU A 1 89  ? 51.562 148.501 -0.201  1.00 45.88  ? 121 GLU A CG    1 
ATOM   386  C  CD    . GLU A 1 89  ? 51.803 149.944 0.189   1.00 47.85  ? 121 GLU A CD    1 
ATOM   387  O  OE1   . GLU A 1 89  ? 52.905 150.251 0.689   1.00 50.83  ? 121 GLU A OE1   1 
ATOM   388  O  OE2   . GLU A 1 89  ? 50.889 150.773 -0.008  1.00 46.40  ? 121 GLU A OE2   1 
ATOM   389  N  N     . TYR A 1 90  ? 54.222 146.029 -1.379  1.00 32.69  ? 122 TYR A N     1 
ATOM   390  C  CA    . TYR A 1 90  ? 54.837 145.930 -2.700  1.00 37.39  ? 122 TYR A CA    1 
ATOM   391  C  C     . TYR A 1 90  ? 54.456 144.628 -3.392  1.00 40.66  ? 122 TYR A C     1 
ATOM   392  O  O     . TYR A 1 90  ? 54.178 144.615 -4.597  1.00 31.73  ? 122 TYR A O     1 
ATOM   393  C  CB    . TYR A 1 90  ? 56.358 146.043 -2.598  1.00 35.76  ? 122 TYR A CB    1 
ATOM   394  C  CG    . TYR A 1 90  ? 57.050 145.847 -3.930  1.00 41.66  ? 122 TYR A CG    1 
ATOM   395  C  CD1   . TYR A 1 90  ? 57.061 146.858 -4.883  1.00 43.47  ? 122 TYR A CD1   1 
ATOM   396  C  CD2   . TYR A 1 90  ? 57.675 144.645 -4.243  1.00 40.18  ? 122 TYR A CD2   1 
ATOM   397  C  CE1   . TYR A 1 90  ? 57.683 146.683 -6.105  1.00 41.42  ? 122 TYR A CE1   1 
ATOM   398  C  CE2   . TYR A 1 90  ? 58.300 144.461 -5.463  1.00 46.80  ? 122 TYR A CE2   1 
ATOM   399  C  CZ    . TYR A 1 90  ? 58.300 145.483 -6.390  1.00 46.96  ? 122 TYR A CZ    1 
ATOM   400  O  OH    . TYR A 1 90  ? 58.922 145.304 -7.605  1.00 40.85  ? 122 TYR A OH    1 
ATOM   401  N  N     . GLU A 1 91  ? 54.450 143.520 -2.648  1.00 35.24  ? 123 GLU A N     1 
ATOM   402  C  CA    . GLU A 1 91  ? 54.080 142.235 -3.238  1.00 38.97  ? 123 GLU A CA    1 
ATOM   403  C  C     . GLU A 1 91  ? 52.649 142.266 -3.766  1.00 30.76  ? 123 GLU A C     1 
ATOM   404  O  O     . GLU A 1 91  ? 52.385 141.893 -4.920  1.00 32.12  ? 123 GLU A O     1 
ATOM   405  C  CB    . GLU A 1 91  ? 54.253 141.117 -2.208  1.00 38.01  ? 123 GLU A CB    1 
ATOM   406  C  CG    . GLU A 1 91  ? 55.691 140.899 -1.758  1.00 43.85  ? 123 GLU A CG    1 
ATOM   407  C  CD    . GLU A 1 91  ? 55.909 139.534 -1.133  1.00 55.59  ? 123 GLU A CD    1 
ATOM   408  O  OE1   . GLU A 1 91  ? 55.041 138.653 -1.308  1.00 56.72  ? 123 GLU A OE1   1 
ATOM   409  O  OE2   . GLU A 1 91  ? 56.948 139.342 -0.466  1.00 59.48  ? 123 GLU A OE2   1 
ATOM   410  N  N     . PHE A 1 92  ? 51.709 142.721 -2.932  1.00 26.09  ? 124 PHE A N     1 
ATOM   411  C  CA    . PHE A 1 92  ? 50.310 142.761 -3.354  1.00 29.08  ? 124 PHE A CA    1 
ATOM   412  C  C     . PHE A 1 92  ? 50.111 143.721 -4.522  1.00 30.28  ? 124 PHE A C     1 
ATOM   413  O  O     . PHE A 1 92  ? 49.336 143.438 -5.448  1.00 29.81  ? 124 PHE A O     1 
ATOM   414  C  CB    . PHE A 1 92  ? 49.415 143.146 -2.175  1.00 31.24  ? 124 PHE A CB    1 
ATOM   415  C  CG    . PHE A 1 92  ? 49.231 142.042 -1.171  1.00 37.65  ? 124 PHE A CG    1 
ATOM   416  C  CD1   . PHE A 1 92  ? 48.539 140.892 -1.509  1.00 34.72  ? 124 PHE A CD1   1 
ATOM   417  C  CD2   . PHE A 1 92  ? 49.754 142.152 0.106   1.00 39.48  ? 124 PHE A CD2   1 
ATOM   418  C  CE1   . PHE A 1 92  ? 48.371 139.872 -0.593  1.00 36.33  ? 124 PHE A CE1   1 
ATOM   419  C  CE2   . PHE A 1 92  ? 49.590 141.135 1.028   1.00 39.37  ? 124 PHE A CE2   1 
ATOM   420  C  CZ    . PHE A 1 92  ? 48.898 139.993 0.676   1.00 35.18  ? 124 PHE A CZ    1 
ATOM   421  N  N     . LEU A 1 93  ? 50.816 144.856 -4.506  1.00 30.74  ? 125 LEU A N     1 
ATOM   422  C  CA    . LEU A 1 93  ? 50.688 145.827 -5.585  1.00 28.34  ? 125 LEU A CA    1 
ATOM   423  C  C     . LEU A 1 93  ? 51.217 145.267 -6.897  1.00 27.08  ? 125 LEU A C     1 
ATOM   424  O  O     . LEU A 1 93  ? 50.586 145.440 -7.943  1.00 29.37  ? 125 LEU A O     1 
ATOM   425  C  CB    . LEU A 1 93  ? 51.418 147.119 -5.216  1.00 28.79  ? 125 LEU A CB    1 
ATOM   426  C  CG    . LEU A 1 93  ? 51.446 148.213 -6.286  1.00 27.69  ? 125 LEU A CG    1 
ATOM   427  C  CD1   . LEU A 1 93  ? 50.035 148.578 -6.727  1.00 32.72  ? 125 LEU A CD1   1 
ATOM   428  C  CD2   . LEU A 1 93  ? 52.186 149.440 -5.775  1.00 32.58  ? 125 LEU A CD2   1 
ATOM   429  N  N     . SER A 1 94  ? 52.371 144.595 -6.866  1.00 27.31  ? 126 SER A N     1 
ATOM   430  C  CA    . SER A 1 94  ? 52.895 143.974 -8.079  1.00 30.72  ? 126 SER A CA    1 
ATOM   431  C  C     . SER A 1 94  ? 51.929 142.927 -8.618  1.00 33.97  ? 126 SER A C     1 
ATOM   432  O  O     . SER A 1 94  ? 51.693 142.849 -9.833  1.00 39.89  ? 126 SER A O     1 
ATOM   433  C  CB    . SER A 1 94  ? 54.262 143.350 -7.800  1.00 34.32  ? 126 SER A CB    1 
ATOM   434  O  OG    . SER A 1 94  ? 55.156 144.304 -7.257  1.00 49.31  ? 126 SER A OG    1 
ATOM   435  N  N     . PHE A 1 95  ? 51.346 142.122 -7.725  1.00 33.88  ? 127 PHE A N     1 
ATOM   436  C  CA    . PHE A 1 95  ? 50.381 141.119 -8.168  1.00 32.74  ? 127 PHE A CA    1 
ATOM   437  C  C     . PHE A 1 95  ? 49.195 141.768 -8.879  1.00 33.36  ? 127 PHE A C     1 
ATOM   438  O  O     . PHE A 1 95  ? 48.865 141.411 -10.020 1.00 34.15  ? 127 PHE A O     1 
ATOM   439  C  CB    . PHE A 1 95  ? 49.911 140.282 -6.980  1.00 31.02  ? 127 PHE A CB    1 
ATOM   440  C  CG    . PHE A 1 95  ? 48.867 139.266 -7.335  1.00 31.82  ? 127 PHE A CG    1 
ATOM   441  C  CD1   . PHE A 1 95  ? 49.168 138.206 -8.175  1.00 30.70  ? 127 PHE A CD1   1 
ATOM   442  C  CD2   . PHE A 1 95  ? 47.580 139.377 -6.839  1.00 32.73  ? 127 PHE A CD2   1 
ATOM   443  C  CE1   . PHE A 1 95  ? 48.206 137.272 -8.507  1.00 34.91  ? 127 PHE A CE1   1 
ATOM   444  C  CE2   . PHE A 1 95  ? 46.613 138.448 -7.167  1.00 35.99  ? 127 PHE A CE2   1 
ATOM   445  C  CZ    . PHE A 1 95  ? 46.926 137.393 -8.003  1.00 35.57  ? 127 PHE A CZ    1 
ATOM   446  N  N     . VAL A 1 96  ? 48.547 142.739 -8.229  1.00 26.78  ? 128 VAL A N     1 
ATOM   447  C  CA    . VAL A 1 96  ? 47.358 143.325 -8.847  1.00 26.98  ? 128 VAL A CA    1 
ATOM   448  C  C     . VAL A 1 96  ? 47.726 144.131 -10.088 1.00 26.98  ? 128 VAL A C     1 
ATOM   449  O  O     . VAL A 1 96  ? 46.907 144.271 -11.006 1.00 31.23  ? 128 VAL A O     1 
ATOM   450  C  CB    . VAL A 1 96  ? 46.563 144.173 -7.838  1.00 29.52  ? 128 VAL A CB    1 
ATOM   451  C  CG1   . VAL A 1 96  ? 45.965 143.281 -6.762  1.00 31.33  ? 128 VAL A CG1   1 
ATOM   452  C  CG2   . VAL A 1 96  ? 47.433 145.263 -7.236  1.00 25.22  ? 128 VAL A CG2   1 
ATOM   453  N  N     . ARG A 1 97  ? 48.949 144.665 -10.150 1.00 29.45  ? 129 ARG A N     1 
ATOM   454  C  CA    . ARG A 1 97  ? 49.414 145.307 -11.374 1.00 33.91  ? 129 ARG A CA    1 
ATOM   455  C  C     . ARG A 1 97  ? 49.479 144.306 -12.514 1.00 34.19  ? 129 ARG A C     1 
ATOM   456  O  O     . ARG A 1 97  ? 49.143 144.628 -13.659 1.00 33.11  ? 129 ARG A O     1 
ATOM   457  C  CB    . ARG A 1 97  ? 50.788 145.934 -11.153 1.00 36.43  ? 129 ARG A CB    1 
ATOM   458  C  CG    . ARG A 1 97  ? 50.762 147.289 -10.488 1.00 36.04  ? 129 ARG A CG    1 
ATOM   459  C  CD    . ARG A 1 97  ? 52.171 147.818 -10.305 1.00 28.86  ? 129 ARG A CD    1 
ATOM   460  N  NE    . ARG A 1 97  ? 52.184 149.187 -9.806  1.00 37.29  ? 129 ARG A NE    1 
ATOM   461  C  CZ    . ARG A 1 97  ? 53.256 149.780 -9.295  1.00 33.75  ? 129 ARG A CZ    1 
ATOM   462  N  NH1   . ARG A 1 97  ? 54.403 149.120 -9.215  1.00 34.43  ? 129 ARG A NH1   1 
ATOM   463  N  NH2   . ARG A 1 97  ? 53.182 151.031 -8.863  1.00 39.17  ? 129 ARG A NH2   1 
ATOM   464  N  N     . GLN A 1 98  ? 49.925 143.085 -12.218 1.00 33.19  ? 130 GLN A N     1 
ATOM   465  C  CA    . GLN A 1 98  ? 49.921 142.047 -13.240 1.00 36.46  ? 130 GLN A CA    1 
ATOM   466  C  C     . GLN A 1 98  ? 48.516 141.566 -13.575 1.00 39.67  ? 130 GLN A C     1 
ATOM   467  O  O     . GLN A 1 98  ? 48.305 141.029 -14.667 1.00 31.58  ? 130 GLN A O     1 
ATOM   468  C  CB    . GLN A 1 98  ? 50.778 140.863 -12.796 1.00 35.05  ? 130 GLN A CB    1 
ATOM   469  C  CG    . GLN A 1 98  ? 52.263 141.156 -12.772 1.00 39.86  ? 130 GLN A CG    1 
ATOM   470  C  CD    . GLN A 1 98  ? 53.058 140.042 -12.127 1.00 59.09  ? 130 GLN A CD    1 
ATOM   471  O  OE1   . GLN A 1 98  ? 53.797 140.266 -11.170 1.00 67.41  ? 130 GLN A OE1   1 
ATOM   472  N  NE2   . GLN A 1 98  ? 52.912 138.830 -12.651 1.00 65.43  ? 130 GLN A NE2   1 
ATOM   473  N  N     . GLN A 1 99  ? 47.549 141.750 -12.674 1.00 36.50  ? 131 GLN A N     1 
ATOM   474  C  CA    . GLN A 1 99  ? 46.236 141.140 -12.859 1.00 30.33  ? 131 GLN A CA    1 
ATOM   475  C  C     . GLN A 1 99  ? 45.124 142.097 -13.276 1.00 35.91  ? 131 GLN A C     1 
ATOM   476  O  O     . GLN A 1 99  ? 44.214 141.673 -13.992 1.00 30.87  ? 131 GLN A O     1 
ATOM   477  C  CB    . GLN A 1 99  ? 45.810 140.415 -11.578 1.00 30.80  ? 131 GLN A CB    1 
ATOM   478  C  CG    . GLN A 1 99  ? 46.664 139.197 -11.266 1.00 31.98  ? 131 GLN A CG    1 
ATOM   479  C  CD    . GLN A 1 99  ? 46.611 138.153 -12.367 1.00 39.09  ? 131 GLN A CD    1 
ATOM   480  O  OE1   . GLN A 1 99  ? 45.563 137.923 -12.971 1.00 39.34  ? 131 GLN A OE1   1 
ATOM   481  N  NE2   . GLN A 1 99  ? 47.747 137.517 -12.636 1.00 39.23  ? 131 GLN A NE2   1 
ATOM   482  N  N     . THR A 1 100 ? 45.147 143.357 -12.850 1.00 28.54  ? 132 THR A N     1 
ATOM   483  C  CA    . THR A 1 100 ? 44.042 144.258 -13.147 1.00 26.30  ? 132 THR A CA    1 
ATOM   484  C  C     . THR A 1 100 ? 44.551 145.582 -13.698 1.00 25.62  ? 132 THR A C     1 
ATOM   485  O  O     . THR A 1 100 ? 45.658 146.015 -13.362 1.00 31.19  ? 132 THR A O     1 
ATOM   486  C  CB    . THR A 1 100 ? 43.188 144.534 -11.897 1.00 24.73  ? 132 THR A CB    1 
ATOM   487  O  OG1   . THR A 1 100 ? 43.979 145.208 -10.910 1.00 34.14  ? 132 THR A OG1   1 
ATOM   488  C  CG2   . THR A 1 100 ? 42.639 143.239 -11.312 1.00 29.30  ? 132 THR A CG2   1 
ATOM   489  N  N     . PRO A 1 101 ? 43.762 146.247 -14.548 1.00 35.38  ? 133 PRO A N     1 
ATOM   490  C  CA    . PRO A 1 101 ? 44.156 147.572 -15.021 1.00 36.06  ? 133 PRO A CA    1 
ATOM   491  C  C     . PRO A 1 101 ? 44.053 148.595 -13.896 1.00 34.37  ? 133 PRO A C     1 
ATOM   492  O  O     . PRO A 1 101 ? 43.270 148.415 -12.952 1.00 32.90  ? 133 PRO A O     1 
ATOM   493  C  CB    . PRO A 1 101 ? 43.144 147.869 -16.142 1.00 38.86  ? 133 PRO A CB    1 
ATOM   494  C  CG    . PRO A 1 101 ? 42.521 146.549 -16.476 1.00 44.45  ? 133 PRO A CG    1 
ATOM   495  C  CD    . PRO A 1 101 ? 42.530 145.775 -15.201 1.00 37.73  ? 133 PRO A CD    1 
ATOM   496  N  N     . PRO A 1 102 ? 44.822 149.679 -13.969 1.00 39.73  ? 134 PRO A N     1 
ATOM   497  C  CA    . PRO A 1 102 ? 44.861 150.628 -12.845 1.00 38.09  ? 134 PRO A CA    1 
ATOM   498  C  C     . PRO A 1 102 ? 43.525 151.329 -12.638 1.00 37.59  ? 134 PRO A C     1 
ATOM   499  O  O     . PRO A 1 102 ? 42.969 151.933 -13.558 1.00 33.49  ? 134 PRO A O     1 
ATOM   500  C  CB    . PRO A 1 102 ? 45.957 151.619 -13.258 1.00 39.51  ? 134 PRO A CB    1 
ATOM   501  C  CG    . PRO A 1 102 ? 46.770 150.894 -14.282 1.00 40.57  ? 134 PRO A CG    1 
ATOM   502  C  CD    . PRO A 1 102 ? 45.803 150.017 -15.011 1.00 42.09  ? 134 PRO A CD    1 
ATOM   503  N  N     . GLY A 1 103 ? 43.012 151.238 -11.411 1.00 35.74  ? 135 GLY A N     1 
ATOM   504  C  CA    . GLY A 1 103 ? 41.850 151.990 -10.985 1.00 33.65  ? 135 GLY A CA    1 
ATOM   505  C  C     . GLY A 1 103 ? 40.504 151.444 -11.410 1.00 34.82  ? 135 GLY A C     1 
ATOM   506  O  O     . GLY A 1 103 ? 39.483 152.075 -11.111 1.00 34.63  ? 135 GLY A O     1 
ATOM   507  N  N     . LEU A 1 104 ? 40.456 150.292 -12.078 1.00 29.09  ? 136 LEU A N     1 
ATOM   508  C  CA    . LEU A 1 104 ? 39.209 149.812 -12.661 1.00 32.51  ? 136 LEU A CA    1 
ATOM   509  C  C     . LEU A 1 104 ? 38.531 148.709 -11.860 1.00 33.73  ? 136 LEU A C     1 
ATOM   510  O  O     . LEU A 1 104 ? 37.310 148.549 -11.974 1.00 31.66  ? 136 LEU A O     1 
ATOM   511  C  CB    . LEU A 1 104 ? 39.452 149.303 -14.088 1.00 37.13  ? 136 LEU A CB    1 
ATOM   512  C  CG    . LEU A 1 104 ? 39.949 150.333 -15.102 1.00 39.58  ? 136 LEU A CG    1 
ATOM   513  C  CD1   . LEU A 1 104 ? 39.844 149.786 -16.518 1.00 42.55  ? 136 LEU A CD1   1 
ATOM   514  C  CD2   . LEU A 1 104 ? 39.179 151.638 -14.971 1.00 40.35  ? 136 LEU A CD2   1 
ATOM   515  N  N     . CYS A 1 105 ? 39.274 147.950 -11.057 1.00 26.49  ? 137 CYS A N     1 
ATOM   516  C  CA    . CYS A 1 105 ? 38.668 146.781 -10.439 1.00 25.75  ? 137 CYS A CA    1 
ATOM   517  C  C     . CYS A 1 105 ? 38.465 146.984 -8.939  1.00 20.85  ? 137 CYS A C     1 
ATOM   518  O  O     . CYS A 1 105 ? 39.272 147.641 -8.274  1.00 27.46  ? 137 CYS A O     1 
ATOM   519  C  CB    . CYS A 1 105 ? 39.526 145.532 -10.674 1.00 27.89  ? 137 CYS A CB    1 
ATOM   520  S  SG    . CYS A 1 105 ? 39.650 145.070 -12.420 1.00 32.77  ? 137 CYS A SG    1 
ATOM   521  N  N     . PRO A 1 106 ? 37.393 146.430 -8.380  1.00 24.01  ? 138 PRO A N     1 
ATOM   522  C  CA    . PRO A 1 106 ? 37.076 146.661 -6.971  1.00 28.06  ? 138 PRO A CA    1 
ATOM   523  C  C     . PRO A 1 106 ? 37.576 145.570 -6.037  1.00 27.20  ? 138 PRO A C     1 
ATOM   524  O  O     . PRO A 1 106 ? 37.780 144.409 -6.415  1.00 29.33  ? 138 PRO A O     1 
ATOM   525  C  CB    . PRO A 1 106 ? 35.542 146.684 -6.982  1.00 24.64  ? 138 PRO A CB    1 
ATOM   526  C  CG    . PRO A 1 106 ? 35.187 145.694 -8.040  1.00 28.58  ? 138 PRO A CG    1 
ATOM   527  C  CD    . PRO A 1 106 ? 36.287 145.757 -9.084  1.00 24.89  ? 138 PRO A CD    1 
ATOM   528  N  N     . LEU A 1 107 ? 37.763 145.986 -4.784  1.00 25.29  ? 139 LEU A N     1 
ATOM   529  C  CA    . LEU A 1 107 ? 37.964 145.059 -3.682  1.00 25.78  ? 139 LEU A CA    1 
ATOM   530  C  C     . LEU A 1 107 ? 36.710 144.221 -3.461  1.00 29.24  ? 139 LEU A C     1 
ATOM   531  O  O     . LEU A 1 107 ? 35.583 144.679 -3.666  1.00 31.02  ? 139 LEU A O     1 
ATOM   532  C  CB    . LEU A 1 107 ? 38.304 145.820 -2.399  1.00 29.32  ? 139 LEU A CB    1 
ATOM   533  C  CG    . LEU A 1 107 ? 39.761 145.896 -1.946  1.00 40.30  ? 139 LEU A CG    1 
ATOM   534  C  CD1   . LEU A 1 107 ? 39.830 146.109 -0.442  1.00 47.29  ? 139 LEU A CD1   1 
ATOM   535  C  CD2   . LEU A 1 107 ? 40.498 144.640 -2.350  1.00 34.53  ? 139 LEU A CD2   1 
ATOM   536  N  N     . ALA A 1 108 ? 36.915 142.981 -3.029  1.00 26.01  ? 140 ALA A N     1 
ATOM   537  C  CA    . ALA A 1 108 ? 35.811 142.062 -2.808  1.00 23.67  ? 140 ALA A CA    1 
ATOM   538  C  C     . ALA A 1 108 ? 36.087 141.199 -1.584  1.00 20.96  ? 140 ALA A C     1 
ATOM   539  O  O     . ALA A 1 108 ? 37.237 140.851 -1.281  1.00 28.34  ? 140 ALA A O     1 
ATOM   540  C  CB    . ALA A 1 108 ? 35.556 141.181 -4.038  1.00 25.41  ? 140 ALA A CB    1 
ATOM   541  N  N     . GLY A 1 109 ? 35.009 140.870 -0.887  1.00 26.43  ? 141 GLY A N     1 
ATOM   542  C  CA    . GLY A 1 109 ? 35.081 140.076 0.321   1.00 29.46  ? 141 GLY A CA    1 
ATOM   543  C  C     . GLY A 1 109 ? 33.851 140.298 1.177   1.00 29.63  ? 141 GLY A C     1 
ATOM   544  O  O     . GLY A 1 109 ? 32.989 141.124 0.872   1.00 30.43  ? 141 GLY A O     1 
ATOM   545  N  N     . ASN A 1 110 ? 33.789 139.530 2.263   1.00 33.53  ? 142 ASN A N     1 
ATOM   546  C  CA    . ASN A 1 110 ? 32.700 139.646 3.226   1.00 39.22  ? 142 ASN A CA    1 
ATOM   547  C  C     . ASN A 1 110 ? 33.005 140.779 4.198   1.00 43.63  ? 142 ASN A C     1 
ATOM   548  O  O     . ASN A 1 110 ? 34.043 140.762 4.870   1.00 48.30  ? 142 ASN A O     1 
ATOM   549  C  CB    . ASN A 1 110 ? 32.504 138.332 3.978   1.00 43.75  ? 142 ASN A CB    1 
ATOM   550  C  CG    . ASN A 1 110 ? 31.363 137.506 3.419   1.00 48.63  ? 142 ASN A CG    1 
ATOM   551  O  OD1   . ASN A 1 110 ? 31.563 136.383 2.958   1.00 50.86  ? 142 ASN A OD1   1 
ATOM   552  N  ND2   . ASN A 1 110 ? 30.155 138.059 3.459   1.00 55.73  ? 142 ASN A ND2   1 
ATOM   553  N  N     . SER A 1 111 ? 32.096 141.753 4.281   1.00 48.14  ? 143 SER A N     1 
ATOM   554  C  CA    . SER A 1 111 ? 32.317 142.970 5.065   1.00 67.78  ? 143 SER A CA    1 
ATOM   555  C  C     . SER A 1 111 ? 33.662 143.600 4.716   1.00 72.76  ? 143 SER A C     1 
ATOM   556  O  O     . SER A 1 111 ? 34.429 144.014 5.587   1.00 77.19  ? 143 SER A O     1 
ATOM   557  C  CB    . SER A 1 111 ? 32.210 142.692 6.566   1.00 73.43  ? 143 SER A CB    1 
ATOM   558  O  OG    . SER A 1 111 ? 30.900 142.956 7.037   1.00 75.40  ? 143 SER A OG    1 
ATOM   559  N  N     . VAL A 1 112 ? 33.946 143.671 3.413   1.00 63.07  ? 144 VAL A N     1 
ATOM   560  C  CA    . VAL A 1 112 ? 35.232 144.158 2.930   1.00 44.35  ? 144 VAL A CA    1 
ATOM   561  C  C     . VAL A 1 112 ? 35.445 145.640 3.205   1.00 44.99  ? 144 VAL A C     1 
ATOM   562  O  O     . VAL A 1 112 ? 36.541 146.152 2.959   1.00 39.13  ? 144 VAL A O     1 
ATOM   563  C  CB    . VAL A 1 112 ? 35.355 143.853 1.422   1.00 45.32  ? 144 VAL A CB    1 
ATOM   564  C  CG1   . VAL A 1 112 ? 34.559 144.856 0.605   1.00 50.17  ? 144 VAL A CG1   1 
ATOM   565  C  CG2   . VAL A 1 112 ? 36.816 143.811 0.982   1.00 49.59  ? 144 VAL A CG2   1 
ATOM   566  N  N     . HIS A 1 113 ? 34.435 146.344 3.724   1.00 41.15  ? 145 HIS A N     1 
ATOM   567  C  CA    . HIS A 1 113 ? 34.621 147.760 4.024   1.00 48.81  ? 145 HIS A CA    1 
ATOM   568  C  C     . HIS A 1 113 ? 35.586 147.971 5.187   1.00 43.89  ? 145 HIS A C     1 
ATOM   569  O  O     . HIS A 1 113 ? 36.349 148.941 5.183   1.00 45.46  ? 145 HIS A O     1 
ATOM   570  C  CB    . HIS A 1 113 ? 33.275 148.429 4.310   1.00 50.23  ? 145 HIS A CB    1 
ATOM   571  C  CG    . HIS A 1 113 ? 32.375 147.634 5.204   1.00 61.94  ? 145 HIS A CG    1 
ATOM   572  N  ND1   . HIS A 1 113 ? 31.624 146.571 4.751   1.00 67.09  ? 145 HIS A ND1   1 
ATOM   573  C  CD2   . HIS A 1 113 ? 32.095 147.758 6.522   1.00 68.46  ? 145 HIS A CD2   1 
ATOM   574  C  CE1   . HIS A 1 113 ? 30.925 146.070 5.753   1.00 68.44  ? 145 HIS A CE1   1 
ATOM   575  N  NE2   . HIS A 1 113 ? 31.193 146.771 6.840   1.00 68.15  ? 145 HIS A NE2   1 
ATOM   576  N  N     . GLU A 1 114 ? 35.593 147.070 6.173   1.00 46.04  ? 146 GLU A N     1 
ATOM   577  C  CA    . GLU A 1 114 ? 36.564 147.182 7.260   1.00 50.35  ? 146 GLU A CA    1 
ATOM   578  C  C     . GLU A 1 114 ? 37.983 146.927 6.762   1.00 49.10  ? 146 GLU A C     1 
ATOM   579  O  O     . GLU A 1 114 ? 38.923 147.653 7.125   1.00 43.49  ? 146 GLU A O     1 
ATOM   580  C  CB    . GLU A 1 114 ? 36.205 146.208 8.382   1.00 61.66  ? 146 GLU A CB    1 
ATOM   581  C  CG    . GLU A 1 114 ? 35.109 146.704 9.312   1.00 74.75  ? 146 GLU A CG    1 
ATOM   582  C  CD    . GLU A 1 114 ? 35.488 147.984 10.029  1.00 84.15  ? 146 GLU A CD    1 
ATOM   583  O  OE1   . GLU A 1 114 ? 34.926 149.047 9.690   1.00 85.12  ? 146 GLU A OE1   1 
ATOM   584  O  OE2   . GLU A 1 114 ? 36.350 147.928 10.931  1.00 88.58  ? 146 GLU A OE2   1 
ATOM   585  N  N     . ASP A 1 115 ? 38.158 145.896 5.932   1.00 48.17  ? 147 ASP A N     1 
ATOM   586  C  CA    . ASP A 1 115 ? 39.466 145.638 5.341   1.00 45.82  ? 147 ASP A CA    1 
ATOM   587  C  C     . ASP A 1 115 ? 39.918 146.813 4.485   1.00 38.00  ? 147 ASP A C     1 
ATOM   588  O  O     . ASP A 1 115 ? 41.104 147.161 4.473   1.00 42.08  ? 147 ASP A O     1 
ATOM   589  C  CB    . ASP A 1 115 ? 39.427 144.353 4.516   1.00 54.91  ? 147 ASP A CB    1 
ATOM   590  C  CG    . ASP A 1 115 ? 39.353 143.109 5.378   1.00 67.09  ? 147 ASP A CG    1 
ATOM   591  O  OD1   . ASP A 1 115 ? 39.493 143.232 6.614   1.00 67.02  ? 147 ASP A OD1   1 
ATOM   592  O  OD2   . ASP A 1 115 ? 39.155 142.008 4.822   1.00 69.63  ? 147 ASP A OD2   1 
ATOM   593  N  N     . LYS A 1 116 ? 38.985 147.447 3.771   1.00 40.68  ? 148 LYS A N     1 
ATOM   594  C  CA    . LYS A 1 116 ? 39.339 148.621 2.981   1.00 38.63  ? 148 LYS A CA    1 
ATOM   595  C  C     . LYS A 1 116 ? 39.714 149.794 3.877   1.00 41.02  ? 148 LYS A C     1 
ATOM   596  O  O     . LYS A 1 116 ? 40.613 150.570 3.542   1.00 39.75  ? 148 LYS A O     1 
ATOM   597  C  CB    . LYS A 1 116 ? 38.189 149.008 2.053   1.00 36.10  ? 148 LYS A CB    1 
ATOM   598  C  CG    . LYS A 1 116 ? 38.516 150.187 1.148   1.00 40.59  ? 148 LYS A CG    1 
ATOM   599  C  CD    . LYS A 1 116 ? 37.359 150.525 0.233   1.00 44.27  ? 148 LYS A CD    1 
ATOM   600  C  CE    . LYS A 1 116 ? 37.776 151.503 -0.852  1.00 55.06  ? 148 LYS A CE    1 
ATOM   601  N  NZ    . LYS A 1 116 ? 37.902 152.889 -0.328  1.00 52.52  ? 148 LYS A NZ    1 
ATOM   602  N  N     . LYS A 1 117 ? 39.033 149.942 5.014   1.00 42.56  ? 149 LYS A N     1 
ATOM   603  C  CA    . LYS A 1 117 ? 39.405 150.981 5.968   1.00 47.72  ? 149 LYS A CA    1 
ATOM   604  C  C     . LYS A 1 117 ? 40.830 150.779 6.464   1.00 44.27  ? 149 LYS A C     1 
ATOM   605  O  O     . LYS A 1 117 ? 41.591 151.743 6.607   1.00 46.53  ? 149 LYS A O     1 
ATOM   606  C  CB    . LYS A 1 117 ? 38.423 150.995 7.140   1.00 55.67  ? 149 LYS A CB    1 
ATOM   607  C  CG    . LYS A 1 117 ? 38.773 151.986 8.240   1.00 60.24  ? 149 LYS A CG    1 
ATOM   608  C  CD    . LYS A 1 117 ? 37.545 152.755 8.697   1.00 69.31  ? 149 LYS A CD    1 
ATOM   609  C  CE    . LYS A 1 117 ? 37.490 152.865 10.212  1.00 77.71  ? 149 LYS A CE    1 
ATOM   610  N  NZ    . LYS A 1 117 ? 36.201 153.446 10.677  1.00 79.95  ? 149 LYS A NZ    1 
ATOM   611  N  N     . PHE A 1 118 ? 41.211 149.527 6.725   1.00 44.85  ? 150 PHE A N     1 
ATOM   612  C  CA    . PHE A 1 118 ? 42.584 149.251 7.147   1.00 41.09  ? 150 PHE A CA    1 
ATOM   613  C  C     . PHE A 1 118 ? 43.577 149.523 6.018   1.00 38.24  ? 150 PHE A C     1 
ATOM   614  O  O     . PHE A 1 118 ? 44.623 150.155 6.228   1.00 36.30  ? 150 PHE A O     1 
ATOM   615  C  CB    . PHE A 1 118 ? 42.703 147.803 7.630   1.00 39.39  ? 150 PHE A CB    1 
ATOM   616  C  CG    . PHE A 1 118 ? 44.088 147.424 8.085   1.00 42.97  ? 150 PHE A CG    1 
ATOM   617  C  CD1   . PHE A 1 118 ? 44.997 146.866 7.199   1.00 36.56  ? 150 PHE A CD1   1 
ATOM   618  C  CD2   . PHE A 1 118 ? 44.478 147.620 9.399   1.00 49.43  ? 150 PHE A CD2   1 
ATOM   619  C  CE1   . PHE A 1 118 ? 46.268 146.515 7.613   1.00 42.76  ? 150 PHE A CE1   1 
ATOM   620  C  CE2   . PHE A 1 118 ? 45.749 147.270 9.820   1.00 51.83  ? 150 PHE A CE2   1 
ATOM   621  C  CZ    . PHE A 1 118 ? 46.645 146.717 8.925   1.00 50.63  ? 150 PHE A CZ    1 
ATOM   622  N  N     . LEU A 1 119 ? 43.261 149.054 4.808   1.00 33.95  ? 151 LEU A N     1 
ATOM   623  C  CA    . LEU A 1 119 ? 44.218 149.110 3.708   1.00 36.72  ? 151 LEU A CA    1 
ATOM   624  C  C     . LEU A 1 119 ? 44.391 150.524 3.166   1.00 25.49  ? 151 LEU A C     1 
ATOM   625  O  O     . LEU A 1 119 ? 45.487 150.880 2.723   1.00 33.01  ? 151 LEU A O     1 
ATOM   626  C  CB    . LEU A 1 119 ? 43.785 148.160 2.592   1.00 35.31  ? 151 LEU A CB    1 
ATOM   627  C  CG    . LEU A 1 119 ? 43.833 146.663 2.910   1.00 32.67  ? 151 LEU A CG    1 
ATOM   628  C  CD1   . LEU A 1 119 ? 43.111 145.860 1.837   1.00 30.13  ? 151 LEU A CD1   1 
ATOM   629  C  CD2   . LEU A 1 119 ? 45.270 146.189 3.066   1.00 33.29  ? 151 LEU A CD2   1 
ATOM   630  N  N     . ASP A 1 120 ? 43.332 151.339 3.182   1.00 31.27  ? 152 ASP A N     1 
ATOM   631  C  CA    . ASP A 1 120 ? 43.454 152.727 2.747   1.00 35.38  ? 152 ASP A CA    1 
ATOM   632  C  C     . ASP A 1 120 ? 44.470 153.483 3.588   1.00 36.92  ? 152 ASP A C     1 
ATOM   633  O  O     . ASP A 1 120 ? 45.126 154.405 3.092   1.00 37.72  ? 152 ASP A O     1 
ATOM   634  C  CB    . ASP A 1 120 ? 42.095 153.426 2.821   1.00 35.61  ? 152 ASP A CB    1 
ATOM   635  C  CG    . ASP A 1 120 ? 41.176 153.047 1.677   1.00 43.51  ? 152 ASP A CG    1 
ATOM   636  O  OD1   . ASP A 1 120 ? 41.649 152.414 0.711   1.00 47.58  ? 152 ASP A OD1   1 
ATOM   637  O  OD2   . ASP A 1 120 ? 39.976 153.386 1.747   1.00 45.58  ? 152 ASP A OD2   1 
ATOM   638  N  N     . LYS A 1 121 ? 44.614 153.106 4.857   1.00 38.60  ? 153 LYS A N     1 
ATOM   639  C  CA    . LYS A 1 121 ? 45.546 153.772 5.755   1.00 39.63  ? 153 LYS A CA    1 
ATOM   640  C  C     . LYS A 1 121 ? 46.934 153.141 5.732   1.00 33.28  ? 153 LYS A C     1 
ATOM   641  O  O     . LYS A 1 121 ? 47.936 153.864 5.747   1.00 43.97  ? 153 LYS A O     1 
ATOM   642  C  CB    . LYS A 1 121 ? 44.995 153.763 7.184   1.00 35.55  ? 153 LYS A CB    1 
ATOM   643  C  CG    . LYS A 1 121 ? 45.916 154.408 8.207   1.00 42.85  ? 153 LYS A CG    1 
ATOM   644  C  CD    . LYS A 1 121 ? 45.214 154.597 9.539   1.00 54.73  ? 153 LYS A CD    1 
ATOM   645  C  CE    . LYS A 1 121 ? 46.202 154.968 10.632  1.00 61.23  ? 153 LYS A CE    1 
ATOM   646  N  NZ    . LYS A 1 121 ? 47.084 156.094 10.219  1.00 62.24  ? 153 LYS A NZ    1 
ATOM   647  N  N     . TYR A 1 122 ? 47.023 151.808 5.685   1.00 37.16  ? 154 TYR A N     1 
ATOM   648  C  CA    . TYR A 1 122 ? 48.314 151.143 5.816   1.00 39.38  ? 154 TYR A CA    1 
ATOM   649  C  C     . TYR A 1 122 ? 48.882 150.589 4.516   1.00 35.93  ? 154 TYR A C     1 
ATOM   650  O  O     . TYR A 1 122 ? 50.084 150.313 4.462   1.00 35.78  ? 154 TYR A O     1 
ATOM   651  C  CB    . TYR A 1 122 ? 48.225 150.016 6.855   1.00 47.72  ? 154 TYR A CB    1 
ATOM   652  C  CG    . TYR A 1 122 ? 47.999 150.546 8.253   1.00 51.84  ? 154 TYR A CG    1 
ATOM   653  C  CD1   . TYR A 1 122 ? 49.029 151.160 8.954   1.00 53.59  ? 154 TYR A CD1   1 
ATOM   654  C  CD2   . TYR A 1 122 ? 46.754 150.457 8.859   1.00 52.54  ? 154 TYR A CD2   1 
ATOM   655  C  CE1   . TYR A 1 122 ? 48.828 151.659 10.226  1.00 58.39  ? 154 TYR A CE1   1 
ATOM   656  C  CE2   . TYR A 1 122 ? 46.544 150.953 10.133  1.00 52.55  ? 154 TYR A CE2   1 
ATOM   657  C  CZ    . TYR A 1 122 ? 47.584 151.553 10.812  1.00 59.81  ? 154 TYR A CZ    1 
ATOM   658  O  OH    . TYR A 1 122 ? 47.379 152.048 12.080  1.00 65.18  ? 154 TYR A OH    1 
ATOM   659  N  N     . MET A 1 123 ? 48.067 150.422 3.478   1.00 37.17  ? 155 MET A N     1 
ATOM   660  C  CA    . MET A 1 123 ? 48.550 150.036 2.150   1.00 39.89  ? 155 MET A CA    1 
ATOM   661  C  C     . MET A 1 123 ? 47.944 150.956 1.095   1.00 33.53  ? 155 MET A C     1 
ATOM   662  O  O     . MET A 1 123 ? 47.217 150.508 0.202   1.00 30.29  ? 155 MET A O     1 
ATOM   663  C  CB    . MET A 1 123 ? 48.223 148.573 1.855   1.00 28.59  ? 155 MET A CB    1 
ATOM   664  C  CG    . MET A 1 123 ? 49.017 147.575 2.687   1.00 36.74  ? 155 MET A CG    1 
ATOM   665  S  SD    . MET A 1 123 ? 48.952 145.895 2.031   1.00 41.05  ? 155 MET A SD    1 
ATOM   666  C  CE    . MET A 1 123 ? 50.006 145.037 3.198   1.00 39.86  ? 155 MET A CE    1 
ATOM   667  N  N     . PRO A 1 124 ? 48.236 152.260 1.161   1.00 34.08  ? 156 PRO A N     1 
ATOM   668  C  CA    . PRO A 1 124 ? 47.550 153.199 0.261   1.00 34.67  ? 156 PRO A CA    1 
ATOM   669  C  C     . PRO A 1 124 ? 47.954 153.049 -1.194  1.00 33.22  ? 156 PRO A C     1 
ATOM   670  O  O     . PRO A 1 124 ? 47.123 153.289 -2.079  1.00 35.17  ? 156 PRO A O     1 
ATOM   671  C  CB    . PRO A 1 124 ? 47.950 154.571 0.820   1.00 38.51  ? 156 PRO A CB    1 
ATOM   672  C  CG    . PRO A 1 124 ? 49.280 154.336 1.446   1.00 40.93  ? 156 PRO A CG    1 
ATOM   673  C  CD    . PRO A 1 124 ? 49.239 152.936 2.004   1.00 36.86  ? 156 PRO A CD    1 
ATOM   674  N  N     . GLN A 1 125 ? 49.202 152.664 -1.475  1.00 30.37  ? 157 GLN A N     1 
ATOM   675  C  CA    . GLN A 1 125 ? 49.615 152.484 -2.863  1.00 33.07  ? 157 GLN A CA    1 
ATOM   676  C  C     . GLN A 1 125 ? 48.922 151.282 -3.489  1.00 35.44  ? 157 GLN A C     1 
ATOM   677  O  O     . GLN A 1 125 ? 48.576 151.305 -4.676  1.00 32.34  ? 157 GLN A O     1 
ATOM   678  C  CB    . GLN A 1 125 ? 51.133 152.338 -2.949  1.00 33.66  ? 157 GLN A CB    1 
ATOM   679  C  CG    . GLN A 1 125 ? 51.903 153.461 -2.274  1.00 46.43  ? 157 GLN A CG    1 
ATOM   680  C  CD    . GLN A 1 125 ? 51.296 154.827 -2.534  1.00 55.29  ? 157 GLN A CD    1 
ATOM   681  O  OE1   . GLN A 1 125 ? 50.973 155.560 -1.599  1.00 55.98  ? 157 GLN A OE1   1 
ATOM   682  N  NE2   . GLN A 1 125 ? 51.147 155.181 -3.807  1.00 53.07  ? 157 GLN A NE2   1 
ATOM   683  N  N     . PHE A 1 126 ? 48.710 150.224 -2.704  1.00 30.10  ? 158 PHE A N     1 
ATOM   684  C  CA    . PHE A 1 126 ? 47.937 149.086 -3.188  1.00 32.30  ? 158 PHE A CA    1 
ATOM   685  C  C     . PHE A 1 126 ? 46.501 149.491 -3.491  1.00 31.23  ? 158 PHE A C     1 
ATOM   686  O  O     . PHE A 1 126 ? 45.939 149.096 -4.520  1.00 30.52  ? 158 PHE A O     1 
ATOM   687  C  CB    . PHE A 1 126 ? 47.978 147.958 -2.155  1.00 32.73  ? 158 PHE A CB    1 
ATOM   688  C  CG    . PHE A 1 126 ? 47.032 146.826 -2.446  1.00 36.54  ? 158 PHE A CG    1 
ATOM   689  C  CD1   . PHE A 1 126 ? 47.252 145.978 -3.517  1.00 36.50  ? 158 PHE A CD1   1 
ATOM   690  C  CD2   . PHE A 1 126 ? 45.928 146.602 -1.639  1.00 43.40  ? 158 PHE A CD2   1 
ATOM   691  C  CE1   . PHE A 1 126 ? 46.389 144.933 -3.781  1.00 35.86  ? 158 PHE A CE1   1 
ATOM   692  C  CE2   . PHE A 1 126 ? 45.059 145.557 -1.900  1.00 43.14  ? 158 PHE A CE2   1 
ATOM   693  C  CZ    . PHE A 1 126 ? 45.290 144.722 -2.973  1.00 32.98  ? 158 PHE A CZ    1 
ATOM   694  N  N     . MET A 1 127 ? 45.896 150.296 -2.614  1.00 29.84  ? 159 MET A N     1 
ATOM   695  C  CA    . MET A 1 127 ? 44.504 150.691 -2.808  1.00 29.30  ? 159 MET A CA    1 
ATOM   696  C  C     . MET A 1 127 ? 44.345 151.673 -3.962  1.00 27.13  ? 159 MET A C     1 
ATOM   697  O  O     . MET A 1 127 ? 43.290 151.699 -4.607  1.00 28.53  ? 159 MET A O     1 
ATOM   698  C  CB    . MET A 1 127 ? 43.946 151.290 -1.519  1.00 36.12  ? 159 MET A CB    1 
ATOM   699  C  CG    . MET A 1 127 ? 43.885 150.306 -0.367  1.00 35.85  ? 159 MET A CG    1 
ATOM   700  S  SD    . MET A 1 127 ? 42.992 148.806 -0.820  1.00 39.72  ? 159 MET A SD    1 
ATOM   701  C  CE    . MET A 1 127 ? 41.347 149.463 -1.067  1.00 40.32  ? 159 MET A CE    1 
ATOM   702  N  N     . LYS A 1 128 ? 45.369 152.484 -4.238  1.00 28.30  ? 160 LYS A N     1 
ATOM   703  C  CA    . LYS A 1 128 ? 45.292 153.427 -5.350  1.00 32.19  ? 160 LYS A CA    1 
ATOM   704  C  C     . LYS A 1 128 ? 45.174 152.718 -6.693  1.00 33.75  ? 160 LYS A C     1 
ATOM   705  O  O     . LYS A 1 128 ? 44.645 153.299 -7.648  1.00 31.57  ? 160 LYS A O     1 
ATOM   706  C  CB    . LYS A 1 128 ? 46.515 154.348 -5.343  1.00 33.57  ? 160 LYS A CB    1 
ATOM   707  C  CG    . LYS A 1 128 ? 46.407 155.529 -6.295  1.00 41.54  ? 160 LYS A CG    1 
ATOM   708  C  CD    . LYS A 1 128 ? 47.667 156.379 -6.285  1.00 54.58  ? 160 LYS A CD    1 
ATOM   709  C  CE    . LYS A 1 128 ? 47.604 157.450 -5.210  1.00 64.24  ? 160 LYS A CE    1 
ATOM   710  N  NZ    . LYS A 1 128 ? 48.187 158.736 -5.684  1.00 70.26  ? 160 LYS A NZ    1 
ATOM   711  N  N     . HIS A 1 129 ? 45.648 151.474 -6.787  1.00 30.30  ? 161 HIS A N     1 
ATOM   712  C  CA    . HIS A 1 129 ? 45.495 150.703 -8.014  1.00 30.10  ? 161 HIS A CA    1 
ATOM   713  C  C     . HIS A 1 129 ? 44.064 150.227 -8.222  1.00 32.00  ? 161 HIS A C     1 
ATOM   714  O  O     . HIS A 1 129 ? 43.694 149.887 -9.350  1.00 29.65  ? 161 HIS A O     1 
ATOM   715  C  CB    . HIS A 1 129 ? 46.446 149.504 -7.998  1.00 30.20  ? 161 HIS A CB    1 
ATOM   716  C  CG    . HIS A 1 129 ? 46.402 148.678 -9.245  1.00 33.84  ? 161 HIS A CG    1 
ATOM   717  N  ND1   . HIS A 1 129 ? 47.065 149.036 -10.399 1.00 35.82  ? 161 HIS A ND1   1 
ATOM   718  C  CD2   . HIS A 1 129 ? 45.772 147.511 -9.520  1.00 36.42  ? 161 HIS A CD2   1 
ATOM   719  C  CE1   . HIS A 1 129 ? 46.847 148.124 -11.331 1.00 38.97  ? 161 HIS A CE1   1 
ATOM   720  N  NE2   . HIS A 1 129 ? 46.065 147.189 -10.823 1.00 36.27  ? 161 HIS A NE2   1 
ATOM   721  N  N     . LEU A 1 130 ? 43.254 150.210 -7.170  1.00 27.14  ? 162 LEU A N     1 
ATOM   722  C  CA    . LEU A 1 130 ? 41.913 149.650 -7.213  1.00 30.26  ? 162 LEU A CA    1 
ATOM   723  C  C     . LEU A 1 130 ? 40.869 150.750 -7.363  1.00 33.56  ? 162 LEU A C     1 
ATOM   724  O  O     . LEU A 1 130 ? 41.130 151.930 -7.118  1.00 27.70  ? 162 LEU A O     1 
ATOM   725  C  CB    . LEU A 1 130 ? 41.632 148.840 -5.944  1.00 26.92  ? 162 LEU A CB    1 
ATOM   726  C  CG    . LEU A 1 130 ? 42.077 147.378 -5.843  1.00 41.97  ? 162 LEU A CG    1 
ATOM   727  C  CD1   . LEU A 1 130 ? 43.405 147.118 -6.535  1.00 39.07  ? 162 LEU A CD1   1 
ATOM   728  C  CD2   . LEU A 1 130 ? 42.169 146.993 -4.381  1.00 37.05  ? 162 LEU A CD2   1 
ATOM   729  N  N     . HIS A 1 131 ? 39.671 150.342 -7.775  1.00 28.85  ? 163 HIS A N     1 
ATOM   730  C  CA    . HIS A 1 131 ? 38.532 151.245 -7.788  1.00 36.47  ? 163 HIS A CA    1 
ATOM   731  C  C     . HIS A 1 131 ? 38.152 151.625 -6.359  1.00 33.03  ? 163 HIS A C     1 
ATOM   732  O  O     . HIS A 1 131 ? 38.546 150.972 -5.389  1.00 29.67  ? 163 HIS A O     1 
ATOM   733  C  CB    . HIS A 1 131 ? 37.345 150.591 -8.497  1.00 39.99  ? 163 HIS A CB    1 
ATOM   734  C  CG    . HIS A 1 131 ? 36.365 151.566 -9.072  1.00 42.73  ? 163 HIS A CG    1 
ATOM   735  N  ND1   . HIS A 1 131 ? 35.265 152.016 -8.374  1.00 37.98  ? 163 HIS A ND1   1 
ATOM   736  C  CD2   . HIS A 1 131 ? 36.314 152.170 -10.283 1.00 46.22  ? 163 HIS A CD2   1 
ATOM   737  C  CE1   . HIS A 1 131 ? 34.582 152.859 -9.128  1.00 41.58  ? 163 HIS A CE1   1 
ATOM   738  N  NE2   . HIS A 1 131 ? 35.197 152.970 -10.291 1.00 44.61  ? 163 HIS A NE2   1 
ATOM   739  N  N     . TYR A 1 132 ? 37.381 152.706 -6.228  1.00 29.13  ? 164 TYR A N     1 
ATOM   740  C  CA    . TYR A 1 132 ? 36.912 153.096 -4.905  1.00 32.59  ? 164 TYR A CA    1 
ATOM   741  C  C     . TYR A 1 132 ? 35.669 152.326 -4.481  1.00 31.44  ? 164 TYR A C     1 
ATOM   742  O  O     . TYR A 1 132 ? 35.399 152.223 -3.280  1.00 32.46  ? 164 TYR A O     1 
ATOM   743  C  CB    . TYR A 1 132 ? 36.652 154.606 -4.846  1.00 36.24  ? 164 TYR A CB    1 
ATOM   744  C  CG    . TYR A 1 132 ? 35.497 155.105 -5.687  1.00 35.98  ? 164 TYR A CG    1 
ATOM   745  C  CD1   . TYR A 1 132 ? 34.199 155.116 -5.189  1.00 40.21  ? 164 TYR A CD1   1 
ATOM   746  C  CD2   . TYR A 1 132 ? 35.710 155.594 -6.970  1.00 33.27  ? 164 TYR A CD2   1 
ATOM   747  C  CE1   . TYR A 1 132 ? 33.144 155.581 -5.951  1.00 40.93  ? 164 TYR A CE1   1 
ATOM   748  C  CE2   . TYR A 1 132 ? 34.662 156.063 -7.738  1.00 38.55  ? 164 TYR A CE2   1 
ATOM   749  C  CZ    . TYR A 1 132 ? 33.382 156.054 -7.224  1.00 42.96  ? 164 TYR A CZ    1 
ATOM   750  O  OH    . TYR A 1 132 ? 32.335 156.520 -7.986  1.00 39.03  ? 164 TYR A OH    1 
ATOM   751  N  N     . ARG A 1 133 ? 34.915 151.782 -5.433  1.00 24.79  ? 165 ARG A N     1 
ATOM   752  C  CA    . ARG A 1 133 ? 33.778 150.944 -5.096  1.00 26.31  ? 165 ARG A CA    1 
ATOM   753  C  C     . ARG A 1 133 ? 34.250 149.574 -4.621  1.00 28.33  ? 165 ARG A C     1 
ATOM   754  O  O     . ARG A 1 133 ? 35.356 149.122 -4.931  1.00 23.95  ? 165 ARG A O     1 
ATOM   755  C  CB    . ARG A 1 133 ? 32.848 150.783 -6.298  1.00 29.35  ? 165 ARG A CB    1 
ATOM   756  C  CG    . ARG A 1 133 ? 32.030 152.018 -6.618  1.00 29.51  ? 165 ARG A CG    1 
ATOM   757  C  CD    . ARG A 1 133 ? 31.364 151.893 -7.975  1.00 28.16  ? 165 ARG A CD    1 
ATOM   758  N  NE    . ARG A 1 133 ? 30.655 153.113 -8.346  1.00 30.05  ? 165 ARG A NE    1 
ATOM   759  C  CZ    . ARG A 1 133 ? 30.357 153.450 -9.595  1.00 38.59  ? 165 ARG A CZ    1 
ATOM   760  N  NH1   . ARG A 1 133 ? 30.707 152.656 -10.598 1.00 33.10  ? 165 ARG A NH1   1 
ATOM   761  N  NH2   . ARG A 1 133 ? 29.710 154.581 -9.842  1.00 43.07  ? 165 ARG A NH2   1 
ATOM   762  N  N     . ILE A 1 134 ? 33.389 148.911 -3.851  1.00 25.52  ? 166 ILE A N     1 
ATOM   763  C  CA    . ILE A 1 134 ? 33.673 147.586 -3.325  1.00 28.82  ? 166 ILE A CA    1 
ATOM   764  C  C     . ILE A 1 134 ? 32.534 146.653 -3.702  1.00 30.98  ? 166 ILE A C     1 
ATOM   765  O  O     . ILE A 1 134 ? 31.412 147.079 -3.986  1.00 33.10  ? 166 ILE A O     1 
ATOM   766  C  CB    . ILE A 1 134 ? 33.867 147.585 -1.793  1.00 30.12  ? 166 ILE A CB    1 
ATOM   767  C  CG1   . ILE A 1 134 ? 32.551 147.927 -1.088  1.00 32.21  ? 166 ILE A CG1   1 
ATOM   768  C  CG2   . ILE A 1 134 ? 34.957 148.556 -1.393  1.00 29.37  ? 166 ILE A CG2   1 
ATOM   769  C  CD1   . ILE A 1 134 ? 32.652 147.948 0.421   1.00 37.78  ? 166 ILE A CD1   1 
ATOM   770  N  N     . ILE A 1 135 ? 32.841 145.360 -3.704  1.00 22.47  ? 167 ILE A N     1 
ATOM   771  C  CA    . ILE A 1 135 ? 31.809 144.340 -3.828  1.00 22.10  ? 167 ILE A CA    1 
ATOM   772  C  C     . ILE A 1 135 ? 31.681 143.660 -2.474  1.00 28.31  ? 167 ILE A C     1 
ATOM   773  O  O     . ILE A 1 135 ? 32.419 142.721 -2.156  1.00 28.33  ? 167 ILE A O     1 
ATOM   774  C  CB    . ILE A 1 135 ? 32.126 143.342 -4.955  1.00 25.45  ? 167 ILE A CB    1 
ATOM   775  C  CG1   . ILE A 1 135 ? 32.133 144.075 -6.298  1.00 28.32  ? 167 ILE A CG1   1 
ATOM   776  C  CG2   . ILE A 1 135 ? 31.103 142.211 -4.970  1.00 26.60  ? 167 ILE A CG2   1 
ATOM   777  C  CD1   . ILE A 1 135 ? 32.259 143.173 -7.496  1.00 35.80  ? 167 ILE A CD1   1 
ATOM   778  N  N     . ASP A 1 136 ? 30.757 144.159 -1.658  1.00 24.47  ? 168 ASP A N     1 
ATOM   779  C  CA    . ASP A 1 136 ? 30.571 143.690 -0.291  1.00 24.37  ? 168 ASP A CA    1 
ATOM   780  C  C     . ASP A 1 136 ? 29.568 142.543 -0.305  1.00 25.03  ? 168 ASP A C     1 
ATOM   781  O  O     . ASP A 1 136 ? 28.370 142.758 -0.516  1.00 26.39  ? 168 ASP A O     1 
ATOM   782  C  CB    . ASP A 1 136 ? 30.096 144.835 0.600   1.00 29.22  ? 168 ASP A CB    1 
ATOM   783  C  CG    . ASP A 1 136 ? 29.834 144.397 2.025   1.00 43.06  ? 168 ASP A CG    1 
ATOM   784  O  OD1   . ASP A 1 136 ? 30.456 143.410 2.467   1.00 46.21  ? 168 ASP A OD1   1 
ATOM   785  O  OD2   . ASP A 1 136 ? 29.007 145.045 2.702   1.00 42.02  ? 168 ASP A OD2   1 
ATOM   786  N  N     . VAL A 1 137 ? 30.061 141.320 -0.085  1.00 24.15  ? 169 VAL A N     1 
ATOM   787  C  CA    . VAL A 1 137 ? 29.178 140.158 -0.053  1.00 26.60  ? 169 VAL A CA    1 
ATOM   788  C  C     . VAL A 1 137 ? 28.180 140.273 1.091   1.00 26.36  ? 169 VAL A C     1 
ATOM   789  O  O     . VAL A 1 137 ? 27.067 139.740 1.009   1.00 22.33  ? 169 VAL A O     1 
ATOM   790  C  CB    . VAL A 1 137 ? 30.012 138.863 0.039   1.00 28.63  ? 169 VAL A CB    1 
ATOM   791  C  CG1   . VAL A 1 137 ? 29.111 137.634 0.052   1.00 24.56  ? 169 VAL A CG1   1 
ATOM   792  C  CG2   . VAL A 1 137 ? 30.994 138.789 -1.118  1.00 25.81  ? 169 VAL A CG2   1 
ATOM   793  N  N     . SER A 1 138 ? 28.546 140.981 2.164   1.00 27.08  ? 170 SER A N     1 
ATOM   794  C  CA    . SER A 1 138 ? 27.627 141.150 3.286   1.00 31.42  ? 170 SER A CA    1 
ATOM   795  C  C     . SER A 1 138 ? 26.404 141.970 2.895   1.00 24.87  ? 170 SER A C     1 
ATOM   796  O  O     . SER A 1 138 ? 25.322 141.777 3.460   1.00 27.72  ? 170 SER A O     1 
ATOM   797  C  CB    . SER A 1 138 ? 28.350 141.801 4.465   1.00 34.94  ? 170 SER A CB    1 
ATOM   798  O  OG    . SER A 1 138 ? 29.274 140.898 5.047   1.00 52.77  ? 170 SER A OG    1 
ATOM   799  N  N     . THR A 1 139 ? 26.548 142.879 1.929   1.00 21.92  ? 171 THR A N     1 
ATOM   800  C  CA    . THR A 1 139 ? 25.392 143.619 1.433   1.00 28.43  ? 171 THR A CA    1 
ATOM   801  C  C     . THR A 1 139 ? 24.386 142.678 0.778   1.00 28.89  ? 171 THR A C     1 
ATOM   802  O  O     . THR A 1 139 ? 23.182 142.729 1.068   1.00 25.15  ? 171 THR A O     1 
ATOM   803  C  CB    . THR A 1 139 ? 25.849 144.697 0.448   1.00 26.60  ? 171 THR A CB    1 
ATOM   804  O  OG1   . THR A 1 139 ? 26.430 145.790 1.170   1.00 25.52  ? 171 THR A OG1   1 
ATOM   805  C  CG2   . THR A 1 139 ? 24.678 145.206 -0.379  1.00 25.34  ? 171 THR A CG2   1 
ATOM   806  N  N     . VAL A 1 140 ? 24.869 141.801 -0.106  1.00 24.28  ? 172 VAL A N     1 
ATOM   807  C  CA    . VAL A 1 140 ? 23.994 140.817 -0.732  1.00 22.51  ? 172 VAL A CA    1 
ATOM   808  C  C     . VAL A 1 140 ? 23.432 139.862 0.310   1.00 20.38  ? 172 VAL A C     1 
ATOM   809  O  O     . VAL A 1 140 ? 22.293 139.402 0.189   1.00 27.47  ? 172 VAL A O     1 
ATOM   810  C  CB    . VAL A 1 140 ? 24.749 140.064 -1.845  1.00 22.87  ? 172 VAL A CB    1 
ATOM   811  C  CG1   . VAL A 1 140 ? 23.794 139.178 -2.629  1.00 25.66  ? 172 VAL A CG1   1 
ATOM   812  C  CG2   . VAL A 1 140 ? 25.447 141.049 -2.769  1.00 22.67  ? 172 VAL A CG2   1 
ATOM   813  N  N     . LYS A 1 141 ? 24.208 139.561 1.354   1.00 20.58  ? 173 LYS A N     1 
ATOM   814  C  CA    . LYS A 1 141 ? 23.714 138.701 2.425   1.00 26.62  ? 173 LYS A CA    1 
ATOM   815  C  C     . LYS A 1 141 ? 22.545 139.348 3.158   1.00 29.83  ? 173 LYS A C     1 
ATOM   816  O  O     . LYS A 1 141 ? 21.540 138.688 3.445   1.00 29.36  ? 173 LYS A O     1 
ATOM   817  C  CB    . LYS A 1 141 ? 24.849 138.379 3.398   1.00 28.95  ? 173 LYS A CB    1 
ATOM   818  C  CG    . LYS A 1 141 ? 24.422 137.595 4.630   1.00 37.73  ? 173 LYS A CG    1 
ATOM   819  C  CD    . LYS A 1 141 ? 25.516 137.605 5.687   1.00 50.91  ? 173 LYS A CD    1 
ATOM   820  C  CE    . LYS A 1 141 ? 25.127 136.777 6.901   1.00 53.82  ? 173 LYS A CE    1 
ATOM   821  N  NZ    . LYS A 1 141 ? 25.138 135.318 6.607   1.00 52.79  ? 173 LYS A NZ    1 
ATOM   822  N  N     . GLU A 1 142 ? 22.662 140.640 3.469   1.00 27.97  ? 174 GLU A N     1 
ATOM   823  C  CA    . GLU A 1 142 ? 21.565 141.350 4.121   1.00 32.39  ? 174 GLU A CA    1 
ATOM   824  C  C     . GLU A 1 142 ? 20.341 141.422 3.216   1.00 33.15  ? 174 GLU A C     1 
ATOM   825  O  O     . GLU A 1 142 ? 19.204 141.236 3.672   1.00 36.19  ? 174 GLU A O     1 
ATOM   826  C  CB    . GLU A 1 142 ? 22.018 142.754 4.523   1.00 29.77  ? 174 GLU A CB    1 
ATOM   827  C  CG    . GLU A 1 142 ? 22.791 142.807 5.829   1.00 45.34  ? 174 GLU A CG    1 
ATOM   828  C  CD    . GLU A 1 142 ? 21.996 142.257 6.996   1.00 48.72  ? 174 GLU A CD    1 
ATOM   829  O  OE1   . GLU A 1 142 ? 22.531 141.403 7.733   1.00 58.14  ? 174 GLU A OE1   1 
ATOM   830  O  OE2   . GLU A 1 142 ? 20.834 142.679 7.176   1.00 53.37  ? 174 GLU A OE2   1 
ATOM   831  N  N     . LEU A 1 143 ? 20.555 141.689 1.925   1.00 26.34  ? 175 LEU A N     1 
ATOM   832  C  CA    . LEU A 1 143 ? 19.432 141.742 0.993   1.00 27.84  ? 175 LEU A CA    1 
ATOM   833  C  C     . LEU A 1 143 ? 18.756 140.381 0.862   1.00 30.87  ? 175 LEU A C     1 
ATOM   834  O  O     . LEU A 1 143 ? 17.531 140.304 0.729   1.00 32.51  ? 175 LEU A O     1 
ATOM   835  C  CB    . LEU A 1 143 ? 19.902 142.249 -0.369  1.00 26.82  ? 175 LEU A CB    1 
ATOM   836  C  CG    . LEU A 1 143 ? 20.372 143.705 -0.403  1.00 31.12  ? 175 LEU A CG    1 
ATOM   837  C  CD1   . LEU A 1 143 ? 20.725 144.120 -1.821  1.00 29.49  ? 175 LEU A CD1   1 
ATOM   838  C  CD2   . LEU A 1 143 ? 19.315 144.631 0.186   1.00 29.85  ? 175 LEU A CD2   1 
ATOM   839  N  N     . CYS A 1 144 ? 19.535 139.298 0.905   1.00 26.32  ? 176 CYS A N     1 
ATOM   840  C  CA    . CYS A 1 144 ? 18.956 137.960 0.852   1.00 29.74  ? 176 CYS A CA    1 
ATOM   841  C  C     . CYS A 1 144 ? 18.195 137.639 2.131   1.00 27.78  ? 176 CYS A C     1 
ATOM   842  O  O     . CYS A 1 144 ? 17.127 137.020 2.086   1.00 29.26  ? 176 CYS A O     1 
ATOM   843  C  CB    . CYS A 1 144 ? 20.056 136.925 0.607   1.00 27.70  ? 176 CYS A CB    1 
ATOM   844  S  SG    . CYS A 1 144 ? 19.478 135.215 0.483   1.00 31.64  ? 176 CYS A SG    1 
ATOM   845  N  N     . ARG A 1 145 ? 18.733 138.051 3.280   1.00 27.14  ? 177 ARG A N     1 
ATOM   846  C  CA    . ARG A 1 145 ? 18.039 137.835 4.544   1.00 30.77  ? 177 ARG A CA    1 
ATOM   847  C  C     . ARG A 1 145 ? 16.700 138.562 4.567   1.00 33.34  ? 177 ARG A C     1 
ATOM   848  O  O     . ARG A 1 145 ? 15.706 138.033 5.077   1.00 33.45  ? 177 ARG A O     1 
ATOM   849  C  CB    . ARG A 1 145 ? 18.919 138.295 5.707   1.00 36.05  ? 177 ARG A CB    1 
ATOM   850  C  CG    . ARG A 1 145 ? 18.422 137.867 7.076   1.00 47.78  ? 177 ARG A CG    1 
ATOM   851  C  CD    . ARG A 1 145 ? 19.342 138.371 8.176   1.00 59.30  ? 177 ARG A CD    1 
ATOM   852  N  NE    . ARG A 1 145 ? 19.362 139.830 8.248   1.00 58.06  ? 177 ARG A NE    1 
ATOM   853  C  CZ    . ARG A 1 145 ? 18.463 140.558 8.902   1.00 68.76  ? 177 ARG A CZ    1 
ATOM   854  N  NH1   . ARG A 1 145 ? 17.468 139.964 9.545   1.00 72.83  ? 177 ARG A NH1   1 
ATOM   855  N  NH2   . ARG A 1 145 ? 18.559 141.880 8.915   1.00 70.45  ? 177 ARG A NH2   1 
ATOM   856  N  N     . ARG A 1 146 ? 16.654 139.772 4.007   1.00 26.44  ? 178 ARG A N     1 
ATOM   857  C  CA    . ARG A 1 146 ? 15.421 140.552 4.041   1.00 31.55  ? 178 ARG A CA    1 
ATOM   858  C  C     . ARG A 1 146 ? 14.422 140.088 2.985   1.00 33.58  ? 178 ARG A C     1 
ATOM   859  O  O     . ARG A 1 146 ? 13.236 139.903 3.281   1.00 32.33  ? 178 ARG A O     1 
ATOM   860  C  CB    . ARG A 1 146 ? 15.736 142.036 3.853   1.00 31.12  ? 178 ARG A CB    1 
ATOM   861  C  CG    . ARG A 1 146 ? 16.352 142.691 5.071   1.00 32.72  ? 178 ARG A CG    1 
ATOM   862  C  CD    . ARG A 1 146 ? 16.746 144.128 4.781   1.00 39.14  ? 178 ARG A CD    1 
ATOM   863  N  NE    . ARG A 1 146 ? 16.915 144.902 6.007   1.00 46.02  ? 178 ARG A NE    1 
ATOM   864  C  CZ    . ARG A 1 146 ? 18.004 144.867 6.766   1.00 42.54  ? 178 ARG A CZ    1 
ATOM   865  N  NH1   . ARG A 1 146 ? 19.027 144.093 6.427   1.00 45.50  ? 178 ARG A NH1   1 
ATOM   866  N  NH2   . ARG A 1 146 ? 18.071 145.604 7.866   1.00 36.64  ? 178 ARG A NH2   1 
ATOM   867  N  N     . TRP A 1 147 ? 14.879 139.900 1.749   1.00 28.97  ? 179 TRP A N     1 
ATOM   868  C  CA    . TRP A 1 147 ? 13.979 139.663 0.629   1.00 25.77  ? 179 TRP A CA    1 
ATOM   869  C  C     . TRP A 1 147 ? 13.777 138.190 0.300   1.00 28.95  ? 179 TRP A C     1 
ATOM   870  O  O     . TRP A 1 147 ? 12.758 137.848 -0.309  1.00 28.61  ? 179 TRP A O     1 
ATOM   871  C  CB    . TRP A 1 147 ? 14.494 140.387 -0.620  1.00 27.22  ? 179 TRP A CB    1 
ATOM   872  C  CG    . TRP A 1 147 ? 14.613 141.876 -0.456  1.00 31.79  ? 179 TRP A CG    1 
ATOM   873  C  CD1   . TRP A 1 147 ? 14.036 142.647 0.512   1.00 29.44  ? 179 TRP A CD1   1 
ATOM   874  C  CD2   . TRP A 1 147 ? 15.358 142.772 -1.290  1.00 23.22  ? 179 TRP A CD2   1 
ATOM   875  N  NE1   . TRP A 1 147 ? 14.375 143.967 0.332   1.00 29.77  ? 179 TRP A NE1   1 
ATOM   876  C  CE2   . TRP A 1 147 ? 15.186 144.070 -0.768  1.00 30.22  ? 179 TRP A CE2   1 
ATOM   877  C  CE3   . TRP A 1 147 ? 16.153 142.603 -2.428  1.00 20.53  ? 179 TRP A CE3   1 
ATOM   878  C  CZ2   . TRP A 1 147 ? 15.779 145.191 -1.344  1.00 29.11  ? 179 TRP A CZ2   1 
ATOM   879  C  CZ3   . TRP A 1 147 ? 16.741 143.717 -2.999  1.00 26.90  ? 179 TRP A CZ3   1 
ATOM   880  C  CH2   . TRP A 1 147 ? 16.551 144.994 -2.456  1.00 25.92  ? 179 TRP A CH2   1 
ATOM   881  N  N     . TYR A 1 148 ? 14.707 137.313 0.679   1.00 30.48  ? 180 TYR A N     1 
ATOM   882  C  CA    . TYR A 1 148 ? 14.632 135.888 0.341   1.00 31.44  ? 180 TYR A CA    1 
ATOM   883  C  C     . TYR A 1 148 ? 15.012 135.048 1.554   1.00 31.55  ? 180 TYR A C     1 
ATOM   884  O  O     . TYR A 1 148 ? 16.028 134.343 1.549   1.00 31.04  ? 180 TYR A O     1 
ATOM   885  C  CB    . TYR A 1 148 ? 15.537 135.571 -0.852  1.00 28.29  ? 180 TYR A CB    1 
ATOM   886  C  CG    . TYR A 1 148 ? 15.197 136.352 -2.101  1.00 28.92  ? 180 TYR A CG    1 
ATOM   887  C  CD1   . TYR A 1 148 ? 14.295 135.851 -3.031  1.00 29.01  ? 180 TYR A CD1   1 
ATOM   888  C  CD2   . TYR A 1 148 ? 15.774 137.591 -2.349  1.00 28.32  ? 180 TYR A CD2   1 
ATOM   889  C  CE1   . TYR A 1 148 ? 13.978 136.561 -4.172  1.00 29.58  ? 180 TYR A CE1   1 
ATOM   890  C  CE2   . TYR A 1 148 ? 15.461 138.310 -3.487  1.00 24.54  ? 180 TYR A CE2   1 
ATOM   891  C  CZ    . TYR A 1 148 ? 14.563 137.789 -4.395  1.00 29.42  ? 180 TYR A CZ    1 
ATOM   892  O  OH    . TYR A 1 148 ? 14.248 138.498 -5.531  1.00 29.36  ? 180 TYR A OH    1 
ATOM   893  N  N     . PRO A 1 149 ? 14.200 135.085 2.615   1.00 33.85  ? 181 PRO A N     1 
ATOM   894  C  CA    . PRO A 1 149 ? 14.578 134.353 3.839   1.00 34.84  ? 181 PRO A CA    1 
ATOM   895  C  C     . PRO A 1 149 ? 14.619 132.844 3.657   1.00 33.31  ? 181 PRO A C     1 
ATOM   896  O  O     . PRO A 1 149 ? 15.515 132.178 4.200   1.00 43.75  ? 181 PRO A O     1 
ATOM   897  C  CB    . PRO A 1 149 ? 13.499 134.783 4.844   1.00 34.68  ? 181 PRO A CB    1 
ATOM   898  C  CG    . PRO A 1 149 ? 12.325 135.155 3.998   1.00 37.69  ? 181 PRO A CG    1 
ATOM   899  C  CD    . PRO A 1 149 ? 12.899 135.765 2.754   1.00 30.28  ? 181 PRO A CD    1 
ATOM   900  N  N     . GLU A 1 150 ? 13.668 132.288 2.901   1.00 35.25  ? 182 GLU A N     1 
ATOM   901  C  CA    . GLU A 1 150 ? 13.666 130.852 2.640   1.00 40.19  ? 182 GLU A CA    1 
ATOM   902  C  C     . GLU A 1 150 ? 14.973 130.415 1.991   1.00 35.54  ? 182 GLU A C     1 
ATOM   903  O  O     . GLU A 1 150 ? 15.615 129.458 2.439   1.00 39.77  ? 182 GLU A O     1 
ATOM   904  C  CB    . GLU A 1 150 ? 12.474 130.480 1.757   1.00 43.71  ? 182 GLU A CB    1 
ATOM   905  C  CG    . GLU A 1 150 ? 11.162 131.124 2.172   1.00 60.70  ? 182 GLU A CG    1 
ATOM   906  C  CD    . GLU A 1 150 ? 10.081 130.962 1.121   1.00 80.42  ? 182 GLU A CD    1 
ATOM   907  O  OE1   . GLU A 1 150 ? 9.160  130.146 1.334   1.00 87.79  ? 182 GLU A OE1   1 
ATOM   908  O  OE2   . GLU A 1 150 ? 10.154 131.650 0.081   1.00 86.37  ? 182 GLU A OE2   1 
ATOM   909  N  N     . GLU A 1 151 ? 15.386 131.114 0.931   1.00 31.77  ? 183 GLU A N     1 
ATOM   910  C  CA    . GLU A 1 151 ? 16.680 130.832 0.321   1.00 32.71  ? 183 GLU A CA    1 
ATOM   911  C  C     . GLU A 1 151 ? 17.824 131.174 1.265   1.00 41.05  ? 183 GLU A C     1 
ATOM   912  O  O     . GLU A 1 151 ? 18.874 130.522 1.230   1.00 39.20  ? 183 GLU A O     1 
ATOM   913  C  CB    . GLU A 1 151 ? 16.828 131.611 -0.987  1.00 30.31  ? 183 GLU A CB    1 
ATOM   914  C  CG    . GLU A 1 151 ? 15.868 131.184 -2.087  1.00 36.85  ? 183 GLU A CG    1 
ATOM   915  C  CD    . GLU A 1 151 ? 14.549 131.934 -2.043  1.00 41.69  ? 183 GLU A CD    1 
ATOM   916  O  OE1   . GLU A 1 151 ? 14.260 132.581 -1.014  1.00 38.33  ? 183 GLU A OE1   1 
ATOM   917  O  OE2   . GLU A 1 151 ? 13.799 131.875 -3.041  1.00 36.78  ? 183 GLU A OE2   1 
ATOM   918  N  N     . TYR A 1 152 ? 17.639 132.190 2.114   1.00 34.72  ? 184 TYR A N     1 
ATOM   919  C  CA    . TYR A 1 152 ? 18.708 132.611 3.014   1.00 31.40  ? 184 TYR A CA    1 
ATOM   920  C  C     . TYR A 1 152 ? 19.076 131.503 3.991   1.00 38.35  ? 184 TYR A C     1 
ATOM   921  O  O     . TYR A 1 152 ? 20.248 131.355 4.359   1.00 36.93  ? 184 TYR A O     1 
ATOM   922  C  CB    . TYR A 1 152 ? 18.292 133.873 3.771   1.00 39.91  ? 184 TYR A CB    1 
ATOM   923  C  CG    . TYR A 1 152 ? 19.301 134.324 4.803   1.00 35.65  ? 184 TYR A CG    1 
ATOM   924  C  CD1   . TYR A 1 152 ? 20.432 135.038 4.430   1.00 38.25  ? 184 TYR A CD1   1 
ATOM   925  C  CD2   . TYR A 1 152 ? 19.122 134.035 6.150   1.00 42.04  ? 184 TYR A CD2   1 
ATOM   926  C  CE1   . TYR A 1 152 ? 21.358 135.452 5.369   1.00 41.37  ? 184 TYR A CE1   1 
ATOM   927  C  CE2   . TYR A 1 152 ? 20.042 134.445 7.096   1.00 48.61  ? 184 TYR A CE2   1 
ATOM   928  C  CZ    . TYR A 1 152 ? 21.157 135.153 6.701   1.00 51.60  ? 184 TYR A CZ    1 
ATOM   929  O  OH    . TYR A 1 152 ? 22.075 135.563 7.641   1.00 60.25  ? 184 TYR A OH    1 
ATOM   930  N  N     . GLU A 1 153 ? 18.092 130.710 4.421   1.00 35.94  ? 185 GLU A N     1 
ATOM   931  C  CA    . GLU A 1 153 ? 18.388 129.647 5.378   1.00 44.01  ? 185 GLU A CA    1 
ATOM   932  C  C     . GLU A 1 153 ? 19.296 128.564 4.799   1.00 44.65  ? 185 GLU A C     1 
ATOM   933  O  O     . GLU A 1 153 ? 19.878 127.791 5.568   1.00 44.56  ? 185 GLU A O     1 
ATOM   934  C  CB    . GLU A 1 153 ? 17.093 129.017 5.898   1.00 46.64  ? 185 GLU A CB    1 
ATOM   935  C  CG    . GLU A 1 153 ? 16.102 130.012 6.492   1.00 66.42  ? 185 GLU A CG    1 
ATOM   936  C  CD    . GLU A 1 153 ? 16.713 130.899 7.568   1.00 82.61  ? 185 GLU A CD    1 
ATOM   937  O  OE1   . GLU A 1 153 ? 17.596 130.429 8.317   1.00 87.66  ? 185 GLU A OE1   1 
ATOM   938  O  OE2   . GLU A 1 153 ? 16.302 132.075 7.665   1.00 87.80  ? 185 GLU A OE2   1 
ATOM   939  N  N     . PHE A 1 154 ? 19.443 128.496 3.476   1.00 37.04  ? 186 PHE A N     1 
ATOM   940  C  CA    . PHE A 1 154 ? 20.301 127.509 2.829   1.00 36.87  ? 186 PHE A CA    1 
ATOM   941  C  C     . PHE A 1 154 ? 21.678 128.053 2.471   1.00 38.93  ? 186 PHE A C     1 
ATOM   942  O  O     . PHE A 1 154 ? 22.515 127.297 1.968   1.00 34.65  ? 186 PHE A O     1 
ATOM   943  C  CB    . PHE A 1 154 ? 19.629 126.973 1.558   1.00 34.04  ? 186 PHE A CB    1 
ATOM   944  C  CG    . PHE A 1 154 ? 18.417 126.125 1.818   1.00 35.44  ? 186 PHE A CG    1 
ATOM   945  C  CD1   . PHE A 1 154 ? 18.549 124.783 2.134   1.00 32.00  ? 186 PHE A CD1   1 
ATOM   946  C  CD2   . PHE A 1 154 ? 17.145 126.667 1.734   1.00 38.97  ? 186 PHE A CD2   1 
ATOM   947  C  CE1   . PHE A 1 154 ? 17.435 123.999 2.369   1.00 33.41  ? 186 PHE A CE1   1 
ATOM   948  C  CE2   . PHE A 1 154 ? 16.027 125.888 1.968   1.00 40.25  ? 186 PHE A CE2   1 
ATOM   949  C  CZ    . PHE A 1 154 ? 16.172 124.552 2.286   1.00 43.46  ? 186 PHE A CZ    1 
ATOM   950  N  N     . ALA A 1 155 ? 21.936 129.335 2.721   1.00 34.79  ? 187 ALA A N     1 
ATOM   951  C  CA    . ALA A 1 155 ? 23.157 129.960 2.240   1.00 33.22  ? 187 ALA A CA    1 
ATOM   952  C  C     . ALA A 1 155 ? 24.375 129.463 3.017   1.00 36.05  ? 187 ALA A C     1 
ATOM   953  O  O     . ALA A 1 155 ? 24.267 129.089 4.188   1.00 41.69  ? 187 ALA A O     1 
ATOM   954  C  CB    . ALA A 1 155 ? 23.058 131.478 2.354   1.00 29.96  ? 187 ALA A CB    1 
ATOM   955  N  N     . PRO A 1 156 ? 25.548 129.444 2.384   1.00 42.25  ? 188 PRO A N     1 
ATOM   956  C  CA    . PRO A 1 156 ? 26.773 129.107 3.117   1.00 54.75  ? 188 PRO A CA    1 
ATOM   957  C  C     . PRO A 1 156 ? 27.135 130.203 4.106   1.00 50.66  ? 188 PRO A C     1 
ATOM   958  O  O     . PRO A 1 156 ? 26.993 131.395 3.822   1.00 51.92  ? 188 PRO A O     1 
ATOM   959  C  CB    . PRO A 1 156 ? 27.832 128.980 2.013   1.00 56.14  ? 188 PRO A CB    1 
ATOM   960  C  CG    . PRO A 1 156 ? 27.064 128.886 0.727   1.00 51.37  ? 188 PRO A CG    1 
ATOM   961  C  CD    . PRO A 1 156 ? 25.804 129.654 0.950   1.00 45.92  ? 188 PRO A CD    1 
ATOM   962  N  N     . LYS A 1 157 ? 27.601 129.788 5.280   1.00 58.27  ? 189 LYS A N     1 
ATOM   963  C  CA    . LYS A 1 157 ? 27.991 130.727 6.326   1.00 70.29  ? 189 LYS A CA    1 
ATOM   964  C  C     . LYS A 1 157 ? 29.314 130.317 6.964   1.00 71.89  ? 189 LYS A C     1 
ATOM   965  O  O     . LYS A 1 157 ? 30.241 131.120 7.062   1.00 73.47  ? 189 LYS A O     1 
ATOM   966  C  CB    . LYS A 1 157 ? 26.900 130.828 7.395   1.00 76.66  ? 189 LYS A CB    1 
ATOM   967  C  CG    . LYS A 1 157 ? 25.549 131.291 6.870   1.00 78.69  ? 189 LYS A CG    1 
ATOM   968  C  CD    . LYS A 1 157 ? 24.439 131.012 7.868   1.00 78.86  ? 189 LYS A CD    1 
ATOM   969  C  CE    . LYS A 1 157 ? 23.086 130.936 7.179   1.00 76.25  ? 189 LYS A CE    1 
ATOM   970  N  NZ    . LYS A 1 157 ? 22.756 132.195 6.457   1.00 70.51  ? 189 LYS A NZ    1 
ATOM   971  N  N     . SER A 1 161 ? 37.675 127.741 8.784   1.00 79.41  ? 193 SER A N     1 
ATOM   972  C  CA    . SER A 1 161 ? 38.850 128.029 9.598   1.00 80.57  ? 193 SER A CA    1 
ATOM   973  C  C     . SER A 1 161 ? 39.056 129.530 9.761   1.00 82.19  ? 193 SER A C     1 
ATOM   974  O  O     . SER A 1 161 ? 38.213 130.331 9.357   1.00 82.07  ? 193 SER A O     1 
ATOM   975  C  CB    . SER A 1 161 ? 40.098 127.398 8.981   1.00 79.55  ? 193 SER A CB    1 
ATOM   976  O  OG    . SER A 1 161 ? 40.523 128.126 7.843   1.00 74.49  ? 193 SER A OG    1 
ATOM   977  N  N     . HIS A 1 162 ? 40.185 129.908 10.355  1.00 81.69  ? 194 HIS A N     1 
ATOM   978  C  CA    . HIS A 1 162 ? 40.522 131.307 10.571  1.00 78.89  ? 194 HIS A CA    1 
ATOM   979  C  C     . HIS A 1 162 ? 41.565 131.817 9.584   1.00 61.04  ? 194 HIS A C     1 
ATOM   980  O  O     . HIS A 1 162 ? 42.048 132.943 9.736   1.00 54.65  ? 194 HIS A O     1 
ATOM   981  C  CB    . HIS A 1 162 ? 41.011 131.516 12.006  1.00 93.34  ? 194 HIS A CB    1 
ATOM   982  C  CG    . HIS A 1 162 ? 40.124 130.899 13.043  1.00 105.74 ? 194 HIS A CG    1 
ATOM   983  N  ND1   . HIS A 1 162 ? 38.753 130.836 12.909  1.00 107.33 ? 194 HIS A ND1   1 
ATOM   984  C  CD2   . HIS A 1 162 ? 40.413 130.319 14.231  1.00 109.38 ? 194 HIS A CD2   1 
ATOM   985  C  CE1   . HIS A 1 162 ? 38.237 130.242 13.971  1.00 108.30 ? 194 HIS A CE1   1 
ATOM   986  N  NE2   . HIS A 1 162 ? 39.222 129.919 14.788  1.00 109.35 ? 194 HIS A NE2   1 
ATOM   987  N  N     . ARG A 1 163 ? 41.925 131.018 8.582   1.00 47.54  ? 195 ARG A N     1 
ATOM   988  C  CA    . ARG A 1 163 ? 42.897 131.446 7.587   1.00 50.32  ? 195 ARG A CA    1 
ATOM   989  C  C     . ARG A 1 163 ? 42.221 132.305 6.525   1.00 49.29  ? 195 ARG A C     1 
ATOM   990  O  O     . ARG A 1 163 ? 41.064 132.074 6.162   1.00 44.13  ? 195 ARG A O     1 
ATOM   991  C  CB    . ARG A 1 163 ? 43.571 130.235 6.945   1.00 55.09  ? 195 ARG A CB    1 
ATOM   992  C  CG    . ARG A 1 163 ? 44.551 129.521 7.865   1.00 71.48  ? 195 ARG A CG    1 
ATOM   993  C  CD    . ARG A 1 163 ? 45.556 128.694 7.080   1.00 84.03  ? 195 ARG A CD    1 
ATOM   994  N  NE    . ARG A 1 163 ? 46.775 129.441 6.782   1.00 93.18  ? 195 ARG A NE    1 
ATOM   995  C  CZ    . ARG A 1 163 ? 46.985 130.112 5.654   1.00 97.72  ? 195 ARG A CZ    1 
ATOM   996  N  NH1   . ARG A 1 163 ? 46.056 130.134 4.708   1.00 95.54  ? 195 ARG A NH1   1 
ATOM   997  N  NH2   . ARG A 1 163 ? 48.127 130.762 5.471   1.00 100.54 ? 195 ARG A NH2   1 
ATOM   998  N  N     . ALA A 1 164 ? 42.957 133.302 6.026   1.00 47.81  ? 196 ALA A N     1 
ATOM   999  C  CA    . ALA A 1 164 ? 42.353 134.303 5.151   1.00 44.51  ? 196 ALA A CA    1 
ATOM   1000 C  C     . ALA A 1 164 ? 41.927 133.706 3.814   1.00 38.49  ? 196 ALA A C     1 
ATOM   1001 O  O     . ALA A 1 164 ? 40.889 134.090 3.259   1.00 39.72  ? 196 ALA A O     1 
ATOM   1002 C  CB    . ALA A 1 164 ? 43.323 135.465 4.937   1.00 45.66  ? 196 ALA A CB    1 
ATOM   1003 N  N     . LEU A 1 165 ? 42.715 132.769 3.279   1.00 36.68  ? 197 LEU A N     1 
ATOM   1004 C  CA    . LEU A 1 165 ? 42.373 132.156 1.998   1.00 45.05  ? 197 LEU A CA    1 
ATOM   1005 C  C     . LEU A 1 165 ? 41.053 131.399 2.083   1.00 47.47  ? 197 LEU A C     1 
ATOM   1006 O  O     . LEU A 1 165 ? 40.233 131.453 1.157   1.00 46.88  ? 197 LEU A O     1 
ATOM   1007 C  CB    . LEU A 1 165 ? 43.503 131.229 1.550   1.00 54.33  ? 197 LEU A CB    1 
ATOM   1008 C  CG    . LEU A 1 165 ? 43.731 131.074 0.046   1.00 57.99  ? 197 LEU A CG    1 
ATOM   1009 C  CD1   . LEU A 1 165 ? 43.618 132.414 -0.664  1.00 50.86  ? 197 LEU A CD1   1 
ATOM   1010 C  CD2   . LEU A 1 165 ? 45.087 130.438 -0.216  1.00 62.54  ? 197 LEU A CD2   1 
ATOM   1011 N  N     . ASP A 1 166 ? 40.825 130.695 3.194   1.00 47.51  ? 198 ASP A N     1 
ATOM   1012 C  CA    . ASP A 1 166 ? 39.563 129.986 3.376   1.00 47.44  ? 198 ASP A CA    1 
ATOM   1013 C  C     . ASP A 1 166 ? 38.397 130.960 3.498   1.00 40.57  ? 198 ASP A C     1 
ATOM   1014 O  O     . ASP A 1 166 ? 37.292 130.678 3.019   1.00 39.62  ? 198 ASP A O     1 
ATOM   1015 C  CB    . ASP A 1 166 ? 39.643 129.081 4.606   1.00 50.66  ? 198 ASP A CB    1 
ATOM   1016 C  CG    . ASP A 1 166 ? 40.712 128.012 4.474   1.00 64.05  ? 198 ASP A CG    1 
ATOM   1017 O  OD1   . ASP A 1 166 ? 41.119 127.711 3.332   1.00 68.45  ? 198 ASP A OD1   1 
ATOM   1018 O  OD2   . ASP A 1 166 ? 41.145 127.472 5.514   1.00 73.62  ? 198 ASP A OD2   1 
ATOM   1019 N  N     . ALA A 1 167 ? 38.625 132.114 4.131   1.00 39.49  ? 199 ALA A N     1 
ATOM   1020 C  CA    . ALA A 1 167 ? 37.581 133.131 4.203   1.00 43.31  ? 199 ALA A CA    1 
ATOM   1021 C  C     . ALA A 1 167 ? 37.242 133.664 2.816   1.00 39.50  ? 199 ALA A C     1 
ATOM   1022 O  O     . ALA A 1 167 ? 36.066 133.876 2.495   1.00 37.27  ? 199 ALA A O     1 
ATOM   1023 C  CB    . ALA A 1 167 ? 38.016 134.268 5.127   1.00 39.39  ? 199 ALA A CB    1 
ATOM   1024 N  N     . ILE A 1 168 ? 38.260 133.879 1.979   1.00 39.50  ? 200 ILE A N     1 
ATOM   1025 C  CA    . ILE A 1 168 ? 38.012 134.304 0.603   1.00 36.10  ? 200 ILE A CA    1 
ATOM   1026 C  C     . ILE A 1 168 ? 37.206 133.249 -0.145  1.00 35.94  ? 200 ILE A C     1 
ATOM   1027 O  O     . ILE A 1 168 ? 36.256 133.569 -0.875  1.00 35.63  ? 200 ILE A O     1 
ATOM   1028 C  CB    . ILE A 1 168 ? 39.341 134.605 -0.114  1.00 34.23  ? 200 ILE A CB    1 
ATOM   1029 C  CG1   . ILE A 1 168 ? 40.042 135.801 0.529   1.00 37.78  ? 200 ILE A CG1   1 
ATOM   1030 C  CG2   . ILE A 1 168 ? 39.098 134.871 -1.586  1.00 29.41  ? 200 ILE A CG2   1 
ATOM   1031 C  CD1   . ILE A 1 168 ? 41.348 136.174 -0.140  1.00 39.06  ? 200 ILE A CD1   1 
ATOM   1032 N  N     . SER A 1 169 ? 37.583 131.977 0.011   1.00 30.79  ? 201 SER A N     1 
ATOM   1033 C  CA    . SER A 1 169 ? 36.857 130.900 -0.657  1.00 31.88  ? 201 SER A CA    1 
ATOM   1034 C  C     . SER A 1 169 ? 35.394 130.877 -0.227  1.00 27.07  ? 201 SER A C     1 
ATOM   1035 O  O     . SER A 1 169 ? 34.488 130.755 -1.063  1.00 33.36  ? 201 SER A O     1 
ATOM   1036 C  CB    . SER A 1 169 ? 37.525 129.555 -0.366  1.00 38.11  ? 201 SER A CB    1 
ATOM   1037 O  OG    . SER A 1 169 ? 38.691 129.378 -1.151  1.00 47.41  ? 201 SER A OG    1 
ATOM   1038 N  N     . GLU A 1 170 ? 35.147 131.002 1.080   1.00 31.95  ? 202 GLU A N     1 
ATOM   1039 C  CA    . GLU A 1 170 ? 33.774 131.011 1.577   1.00 35.64  ? 202 GLU A CA    1 
ATOM   1040 C  C     . GLU A 1 170 ? 32.998 132.206 1.039   1.00 34.71  ? 202 GLU A C     1 
ATOM   1041 O  O     . GLU A 1 170 ? 31.818 132.081 0.696   1.00 29.53  ? 202 GLU A O     1 
ATOM   1042 C  CB    . GLU A 1 170 ? 33.762 131.014 3.107   1.00 44.69  ? 202 GLU A CB    1 
ATOM   1043 C  CG    . GLU A 1 170 ? 32.414 130.647 3.725   1.00 60.75  ? 202 GLU A CG    1 
ATOM   1044 C  CD    . GLU A 1 170 ? 31.419 131.796 3.711   1.00 78.24  ? 202 GLU A CD    1 
ATOM   1045 O  OE1   . GLU A 1 170 ? 31.856 132.963 3.806   1.00 81.97  ? 202 GLU A OE1   1 
ATOM   1046 O  OE2   . GLU A 1 170 ? 30.202 131.533 3.599   1.00 81.11  ? 202 GLU A OE2   1 
ATOM   1047 N  N     . SER A 1 171 ? 33.638 133.377 0.970   1.00 31.25  ? 203 SER A N     1 
ATOM   1048 C  CA    . SER A 1 171 ? 32.952 134.556 0.450   1.00 29.42  ? 203 SER A CA    1 
ATOM   1049 C  C     . SER A 1 171 ? 32.564 134.366 -1.011  1.00 24.93  ? 203 SER A C     1 
ATOM   1050 O  O     . SER A 1 171 ? 31.448 134.718 -1.420  1.00 28.04  ? 203 SER A O     1 
ATOM   1051 C  CB    . SER A 1 171 ? 33.836 135.792 0.616   1.00 37.03  ? 203 SER A CB    1 
ATOM   1052 O  OG    . SER A 1 171 ? 34.101 136.049 1.984   1.00 50.78  ? 203 SER A OG    1 
ATOM   1053 N  N     . ILE A 1 172 ? 33.472 133.803 -1.810  1.00 23.06  ? 204 ILE A N     1 
ATOM   1054 C  CA    . ILE A 1 172 ? 33.166 133.553 -3.217  1.00 25.84  ? 204 ILE A CA    1 
ATOM   1055 C  C     . ILE A 1 172 ? 32.017 132.561 -3.345  1.00 30.89  ? 204 ILE A C     1 
ATOM   1056 O  O     . ILE A 1 172 ? 31.095 132.755 -4.150  1.00 29.89  ? 204 ILE A O     1 
ATOM   1057 C  CB    . ILE A 1 172 ? 34.421 133.068 -3.963  1.00 29.60  ? 204 ILE A CB    1 
ATOM   1058 C  CG1   . ILE A 1 172 ? 35.477 134.175 -3.993  1.00 28.63  ? 204 ILE A CG1   1 
ATOM   1059 C  CG2   . ILE A 1 172 ? 34.066 132.629 -5.377  1.00 31.81  ? 204 ILE A CG2   1 
ATOM   1060 C  CD1   . ILE A 1 172 ? 36.801 133.741 -4.576  1.00 29.61  ? 204 ILE A CD1   1 
ATOM   1061 N  N     . LYS A 1 173 ? 32.046 131.486 -2.550  1.00 32.61  ? 205 LYS A N     1 
ATOM   1062 C  CA    . LYS A 1 173 ? 30.975 130.495 -2.624  1.00 28.09  ? 205 LYS A CA    1 
ATOM   1063 C  C     . LYS A 1 173 ? 29.640 131.088 -2.185  1.00 28.94  ? 205 LYS A C     1 
ATOM   1064 O  O     . LYS A 1 173 ? 28.588 130.755 -2.744  1.00 27.47  ? 205 LYS A O     1 
ATOM   1065 C  CB    . LYS A 1 173 ? 31.329 129.272 -1.777  1.00 32.12  ? 205 LYS A CB    1 
ATOM   1066 C  CG    . LYS A 1 173 ? 32.580 128.544 -2.247  1.00 41.17  ? 205 LYS A CG    1 
ATOM   1067 C  CD    . LYS A 1 173 ? 32.410 127.035 -2.205  1.00 57.51  ? 205 LYS A CD    1 
ATOM   1068 C  CE    . LYS A 1 173 ? 33.739 126.333 -2.440  1.00 67.15  ? 205 LYS A CE    1 
ATOM   1069 N  NZ    . LYS A 1 173 ? 34.718 126.628 -1.357  1.00 71.34  ? 205 LYS A NZ    1 
ATOM   1070 N  N     . GLU A 1 174 ? 29.664 131.987 -1.200  1.00 30.44  ? 206 GLU A N     1 
ATOM   1071 C  CA    . GLU A 1 174 ? 28.436 132.626 -0.737  1.00 32.38  ? 206 GLU A CA    1 
ATOM   1072 C  C     . GLU A 1 174 ? 27.848 133.527 -1.816  1.00 29.35  ? 206 GLU A C     1 
ATOM   1073 O  O     . GLU A 1 174 ? 26.637 133.494 -2.081  1.00 28.47  ? 206 GLU A O     1 
ATOM   1074 C  CB    . GLU A 1 174 ? 28.723 133.417 0.540   1.00 33.12  ? 206 GLU A CB    1 
ATOM   1075 C  CG    . GLU A 1 174 ? 27.491 133.897 1.281   1.00 36.70  ? 206 GLU A CG    1 
ATOM   1076 C  CD    . GLU A 1 174 ? 27.840 134.678 2.533   1.00 38.11  ? 206 GLU A CD    1 
ATOM   1077 O  OE1   . GLU A 1 174 ? 28.963 134.502 3.050   1.00 42.66  ? 206 GLU A OE1   1 
ATOM   1078 O  OE2   . GLU A 1 174 ? 26.996 135.473 2.997   1.00 35.79  ? 206 GLU A OE2   1 
ATOM   1079 N  N     . LEU A 1 175 ? 28.694 134.342 -2.454  1.00 30.88  ? 207 LEU A N     1 
ATOM   1080 C  CA    . LEU A 1 175 ? 28.209 135.197 -3.533  1.00 32.10  ? 207 LEU A CA    1 
ATOM   1081 C  C     . LEU A 1 175 ? 27.688 134.367 -4.701  1.00 28.03  ? 207 LEU A C     1 
ATOM   1082 O  O     . LEU A 1 175 ? 26.703 134.741 -5.349  1.00 26.83  ? 207 LEU A O     1 
ATOM   1083 C  CB    . LEU A 1 175 ? 29.312 136.148 -3.997  1.00 26.58  ? 207 LEU A CB    1 
ATOM   1084 C  CG    . LEU A 1 175 ? 28.881 137.194 -5.029  1.00 27.20  ? 207 LEU A CG    1 
ATOM   1085 C  CD1   . LEU A 1 175 ? 27.679 137.984 -4.528  1.00 22.81  ? 207 LEU A CD1   1 
ATOM   1086 C  CD2   . LEU A 1 175 ? 30.032 138.125 -5.372  1.00 24.05  ? 207 LEU A CD2   1 
ATOM   1087 N  N     . GLN A 1 176 ? 28.328 133.227 -4.977  1.00 27.88  ? 208 GLN A N     1 
ATOM   1088 C  CA    . GLN A 1 176 ? 27.840 132.357 -6.043  1.00 28.76  ? 208 GLN A CA    1 
ATOM   1089 C  C     . GLN A 1 176 ? 26.485 131.757 -5.687  1.00 25.09  ? 208 GLN A C     1 
ATOM   1090 O  O     . GLN A 1 176 ? 25.605 131.644 -6.548  1.00 30.94  ? 208 GLN A O     1 
ATOM   1091 C  CB    . GLN A 1 176 ? 28.857 131.256 -6.336  1.00 39.42  ? 208 GLN A CB    1 
ATOM   1092 C  CG    . GLN A 1 176 ? 28.464 130.345 -7.489  1.00 46.64  ? 208 GLN A CG    1 
ATOM   1093 C  CD    . GLN A 1 176 ? 28.297 131.098 -8.797  1.00 48.70  ? 208 GLN A CD    1 
ATOM   1094 O  OE1   . GLN A 1 176 ? 27.245 131.036 -9.432  1.00 56.84  ? 208 GLN A OE1   1 
ATOM   1095 N  NE2   . GLN A 1 176 ? 29.339 131.813 -9.205  1.00 47.00  ? 208 GLN A NE2   1 
ATOM   1096 N  N     . PHE A 1 177 ? 26.304 131.359 -4.424  1.00 26.23  ? 209 PHE A N     1 
ATOM   1097 C  CA    . PHE A 1 177 ? 24.997 130.893 -3.970  1.00 29.27  ? 209 PHE A CA    1 
ATOM   1098 C  C     . PHE A 1 177 ? 23.937 131.962 -4.189  1.00 25.82  ? 209 PHE A C     1 
ATOM   1099 O  O     . PHE A 1 177 ? 22.830 131.674 -4.664  1.00 26.53  ? 209 PHE A O     1 
ATOM   1100 C  CB    . PHE A 1 177 ? 25.068 130.501 -2.491  1.00 25.66  ? 209 PHE A CB    1 
ATOM   1101 C  CG    . PHE A 1 177 ? 23.740 130.102 -1.897  1.00 32.44  ? 209 PHE A CG    1 
ATOM   1102 C  CD1   . PHE A 1 177 ? 22.877 131.056 -1.373  1.00 32.11  ? 209 PHE A CD1   1 
ATOM   1103 C  CD2   . PHE A 1 177 ? 23.362 128.771 -1.850  1.00 31.56  ? 209 PHE A CD2   1 
ATOM   1104 C  CE1   . PHE A 1 177 ? 21.659 130.690 -0.830  1.00 33.69  ? 209 PHE A CE1   1 
ATOM   1105 C  CE2   . PHE A 1 177 ? 22.146 128.398 -1.303  1.00 35.59  ? 209 PHE A CE2   1 
ATOM   1106 C  CZ    . PHE A 1 177 ? 21.295 129.359 -0.791  1.00 36.50  ? 209 PHE A CZ    1 
ATOM   1107 N  N     . TYR A 1 178 ? 24.259 133.207 -3.830  1.00 24.79  ? 210 TYR A N     1 
ATOM   1108 C  CA    . TYR A 1 178 ? 23.304 134.296 -4.010  1.00 26.28  ? 210 TYR A CA    1 
ATOM   1109 C  C     . TYR A 1 178 ? 22.959 134.486 -5.482  1.00 23.85  ? 210 TYR A C     1 
ATOM   1110 O  O     . TYR A 1 178 ? 21.785 134.620 -5.842  1.00 27.14  ? 210 TYR A O     1 
ATOM   1111 C  CB    . TYR A 1 178 ? 23.857 135.589 -3.411  1.00 23.58  ? 210 TYR A CB    1 
ATOM   1112 C  CG    . TYR A 1 178 ? 23.976 135.541 -1.908  1.00 28.62  ? 210 TYR A CG    1 
ATOM   1113 C  CD1   . TYR A 1 178 ? 23.035 134.865 -1.141  1.00 29.38  ? 210 TYR A CD1   1 
ATOM   1114 C  CD2   . TYR A 1 178 ? 25.031 136.162 -1.256  1.00 29.42  ? 210 TYR A CD2   1 
ATOM   1115 C  CE1   . TYR A 1 178 ? 23.141 134.814 0.234   1.00 32.43  ? 210 TYR A CE1   1 
ATOM   1116 C  CE2   . TYR A 1 178 ? 25.144 136.119 0.118   1.00 29.04  ? 210 TYR A CE2   1 
ATOM   1117 C  CZ    . TYR A 1 178 ? 24.198 135.442 0.858   1.00 30.29  ? 210 TYR A CZ    1 
ATOM   1118 O  OH    . TYR A 1 178 ? 24.309 135.393 2.227   1.00 32.36  ? 210 TYR A OH    1 
ATOM   1119 N  N     . ARG A 1 179 ? 23.972 134.493 -6.353  1.00 25.74  ? 211 ARG A N     1 
ATOM   1120 C  CA    . ARG A 1 179 ? 23.695 134.639 -7.779  1.00 26.07  ? 211 ARG A CA    1 
ATOM   1121 C  C     . ARG A 1 179 ? 22.820 133.501 -8.290  1.00 31.54  ? 211 ARG A C     1 
ATOM   1122 O  O     . ARG A 1 179 ? 21.907 133.720 -9.095  1.00 29.15  ? 211 ARG A O     1 
ATOM   1123 C  CB    . ARG A 1 179 ? 24.993 134.703 -8.585  1.00 26.37  ? 211 ARG A CB    1 
ATOM   1124 C  CG    . ARG A 1 179 ? 24.731 134.820 -10.082 1.00 29.34  ? 211 ARG A CG    1 
ATOM   1125 C  CD    . ARG A 1 179 ? 25.994 134.937 -10.917 1.00 32.92  ? 211 ARG A CD    1 
ATOM   1126 N  NE    . ARG A 1 179 ? 25.669 135.339 -12.285 1.00 30.50  ? 211 ARG A NE    1 
ATOM   1127 C  CZ    . ARG A 1 179 ? 26.545 135.406 -13.281 1.00 32.82  ? 211 ARG A CZ    1 
ATOM   1128 N  NH1   . ARG A 1 179 ? 27.816 135.091 -13.074 1.00 33.48  ? 211 ARG A NH1   1 
ATOM   1129 N  NH2   . ARG A 1 179 ? 26.149 135.784 -14.489 1.00 33.01  ? 211 ARG A NH2   1 
ATOM   1130 N  N     . ASN A 1 180 ? 23.076 132.278 -7.822  1.00 26.66  ? 212 ASN A N     1 
ATOM   1131 C  CA    . ASN A 1 180 ? 22.313 131.133 -8.302  1.00 30.65  ? 212 ASN A CA    1 
ATOM   1132 C  C     . ASN A 1 180 ? 20.878 131.147 -7.796  1.00 32.03  ? 212 ASN A C     1 
ATOM   1133 O  O     . ASN A 1 180 ? 19.979 130.653 -8.486  1.00 35.83  ? 212 ASN A O     1 
ATOM   1134 C  CB    . ASN A 1 180 ? 22.995 129.831 -7.883  1.00 33.07  ? 212 ASN A CB    1 
ATOM   1135 C  CG    . ASN A 1 180 ? 24.283 129.580 -8.635  1.00 44.57  ? 212 ASN A CG    1 
ATOM   1136 O  OD1   . ASN A 1 180 ? 24.527 130.174 -9.685  1.00 51.41  ? 212 ASN A OD1   1 
ATOM   1137 N  ND2   . ASN A 1 180 ? 25.117 128.694 -8.102  1.00 47.72  ? 212 ASN A ND2   1 
ATOM   1138 N  N     . ASN A 1 181 ? 20.632 131.699 -6.604  1.00 24.31  ? 213 ASN A N     1 
ATOM   1139 C  CA    . ASN A 1 181 ? 19.351 131.465 -5.952  1.00 26.08  ? 213 ASN A CA    1 
ATOM   1140 C  C     . ASN A 1 181 ? 18.457 132.689 -5.786  1.00 32.93  ? 213 ASN A C     1 
ATOM   1141 O  O     . ASN A 1 181 ? 17.251 132.513 -5.592  1.00 28.63  ? 213 ASN A O     1 
ATOM   1142 C  CB    . ASN A 1 181 ? 19.577 130.825 -4.573  1.00 28.31  ? 213 ASN A CB    1 
ATOM   1143 C  CG    . ASN A 1 181 ? 20.049 129.384 -4.674  1.00 34.39  ? 213 ASN A CG    1 
ATOM   1144 O  OD1   . ASN A 1 181 ? 19.256 128.474 -4.916  1.00 41.59  ? 213 ASN A OD1   1 
ATOM   1145 N  ND2   . ASN A 1 181 ? 21.349 129.172 -4.499  1.00 27.67  ? 213 ASN A ND2   1 
ATOM   1146 N  N     . ILE A 1 182 ? 18.982 133.913 -5.846  1.00 30.03  ? 214 ILE A N     1 
ATOM   1147 C  CA    . ILE A 1 182 ? 18.110 135.060 -5.600  1.00 29.23  ? 214 ILE A CA    1 
ATOM   1148 C  C     . ILE A 1 182 ? 18.171 136.075 -6.736  1.00 29.74  ? 214 ILE A C     1 
ATOM   1149 O  O     . ILE A 1 182 ? 17.427 137.062 -6.735  1.00 30.14  ? 214 ILE A O     1 
ATOM   1150 C  CB    . ILE A 1 182 ? 18.431 135.738 -4.256  1.00 29.61  ? 214 ILE A CB    1 
ATOM   1151 C  CG1   . ILE A 1 182 ? 19.774 136.466 -4.320  1.00 32.81  ? 214 ILE A CG1   1 
ATOM   1152 C  CG2   . ILE A 1 182 ? 18.394 134.729 -3.115  1.00 24.14  ? 214 ILE A CG2   1 
ATOM   1153 C  CD1   . ILE A 1 182 ? 20.041 137.341 -3.119  1.00 31.94  ? 214 ILE A CD1   1 
ATOM   1154 N  N     . PHE A 1 183 ? 19.044 135.851 -7.709  1.00 27.86  ? 215 PHE A N     1 
ATOM   1155 C  CA    . PHE A 1 183 ? 19.136 136.739 -8.857  1.00 24.18  ? 215 PHE A CA    1 
ATOM   1156 C  C     . PHE A 1 183 ? 18.369 136.161 -10.041 1.00 26.26  ? 215 PHE A C     1 
ATOM   1157 O  O     . PHE A 1 183 ? 18.157 134.951 -10.146 1.00 30.58  ? 215 PHE A O     1 
ATOM   1158 C  CB    . PHE A 1 183 ? 20.597 136.993 -9.236  1.00 23.89  ? 215 PHE A CB    1 
ATOM   1159 C  CG    . PHE A 1 183 ? 21.276 138.027 -8.379  1.00 25.72  ? 215 PHE A CG    1 
ATOM   1160 C  CD1   . PHE A 1 183 ? 21.846 137.677 -7.165  1.00 27.49  ? 215 PHE A CD1   1 
ATOM   1161 C  CD2   . PHE A 1 183 ? 21.339 139.350 -8.786  1.00 29.73  ? 215 PHE A CD2   1 
ATOM   1162 C  CE1   . PHE A 1 183 ? 22.472 138.628 -6.375  1.00 25.59  ? 215 PHE A CE1   1 
ATOM   1163 C  CE2   . PHE A 1 183 ? 21.962 140.304 -8.002  1.00 29.04  ? 215 PHE A CE2   1 
ATOM   1164 C  CZ    . PHE A 1 183 ? 22.530 139.943 -6.796  1.00 23.13  ? 215 PHE A CZ    1 
ATOM   1165 N  N     . LYS A 1 184 ? 17.950 137.055 -10.936 1.00 25.80  ? 216 LYS A N     1 
ATOM   1166 C  CA    . LYS A 1 184 ? 17.118 136.664 -12.068 1.00 31.62  ? 216 LYS A CA    1 
ATOM   1167 C  C     . LYS A 1 184 ? 17.856 135.686 -12.974 1.00 37.64  ? 216 LYS A C     1 
ATOM   1168 O  O     . LYS A 1 184 ? 19.015 135.908 -13.337 1.00 33.97  ? 216 LYS A O     1 
ATOM   1169 C  CB    . LYS A 1 184 ? 16.694 137.902 -12.859 1.00 32.66  ? 216 LYS A CB    1 
ATOM   1170 C  CG    . LYS A 1 184 ? 15.810 137.602 -14.057 1.00 44.85  ? 216 LYS A CG    1 
ATOM   1171 C  CD    . LYS A 1 184 ? 15.303 138.879 -14.710 1.00 39.13  ? 216 LYS A CD    1 
ATOM   1172 C  CE    . LYS A 1 184 ? 16.402 139.579 -15.492 1.00 36.34  ? 216 LYS A CE    1 
ATOM   1173 N  NZ    . LYS A 1 184 ? 15.907 140.811 -16.167 1.00 35.66  ? 216 LYS A NZ    1 
ATOM   1174 N  N     . LYS A 1 185 ? 17.177 134.603 -13.337 1.00 36.22  ? 217 LYS A N     1 
ATOM   1175 C  CA    . LYS A 1 185 ? 17.760 133.576 -14.192 1.00 50.64  ? 217 LYS A CA    1 
ATOM   1176 C  C     . LYS A 1 185 ? 17.983 134.099 -15.607 1.00 55.05  ? 217 LYS A C     1 
ATOM   1177 O  O     . LYS A 1 185 ? 17.067 134.102 -16.429 1.00 57.62  ? 217 LYS A O     1 
ATOM   1178 C  CB    . LYS A 1 185 ? 16.864 132.336 -14.225 1.00 56.32  ? 217 LYS A CB    1 
ATOM   1179 C  CG    . LYS A 1 185 ? 17.135 131.345 -13.105 1.00 61.94  ? 217 LYS A CG    1 
ATOM   1180 C  CD    . LYS A 1 185 ? 18.573 130.853 -13.142 1.00 66.32  ? 217 LYS A CD    1 
ATOM   1181 C  CE    . LYS A 1 185 ? 18.948 130.139 -11.853 1.00 68.81  ? 217 LYS A CE    1 
ATOM   1182 N  NZ    . LYS A 1 185 ? 20.401 130.267 -11.554 1.00 70.58  ? 217 LYS A NZ    1 
ATOM   1183 N  N     . SER B 1 6   ? 10.711 143.543 11.946  1.00 78.42  ? 38  SER B N     1 
ATOM   1184 C  CA    . SER B 1 6   ? 10.011 144.744 11.506  1.00 79.03  ? 38  SER B CA    1 
ATOM   1185 C  C     . SER B 1 6   ? 10.914 145.970 11.609  1.00 73.46  ? 38  SER B C     1 
ATOM   1186 O  O     . SER B 1 6   ? 11.577 146.348 10.643  1.00 69.00  ? 38  SER B O     1 
ATOM   1187 C  CB    . SER B 1 6   ? 8.734  144.951 12.327  1.00 77.50  ? 38  SER B CB    1 
ATOM   1188 O  OG    . SER B 1 6   ? 8.962  144.706 13.705  1.00 76.11  ? 38  SER B OG    1 
ATOM   1189 N  N     . MET B 1 7   ? 10.931 146.586 12.796  1.00 72.02  ? 39  MET B N     1 
ATOM   1190 C  CA    . MET B 1 7   ? 11.791 147.745 13.016  1.00 68.63  ? 39  MET B CA    1 
ATOM   1191 C  C     . MET B 1 7   ? 13.265 147.363 12.974  1.00 64.62  ? 39  MET B C     1 
ATOM   1192 O  O     . MET B 1 7   ? 14.104 148.181 12.589  1.00 60.17  ? 39  MET B O     1 
ATOM   1193 C  CB    . MET B 1 7   ? 11.455 148.408 14.353  1.00 72.50  ? 39  MET B CB    1 
ATOM   1194 C  CG    . MET B 1 7   ? 9.972  148.645 14.583  1.00 84.08  ? 39  MET B CG    1 
ATOM   1195 S  SD    . MET B 1 7   ? 9.502  150.371 14.368  1.00 97.34  ? 39  MET B SD    1 
ATOM   1196 C  CE    . MET B 1 7   ? 9.677  151.008 16.033  1.00 97.39  ? 39  MET B CE    1 
ATOM   1197 N  N     . ALA B 1 8   ? 13.599 146.130 13.361  1.00 60.18  ? 40  ALA B N     1 
ATOM   1198 C  CA    . ALA B 1 8   ? 14.978 145.669 13.274  1.00 57.35  ? 40  ALA B CA    1 
ATOM   1199 C  C     . ALA B 1 8   ? 15.444 145.510 11.833  1.00 53.65  ? 40  ALA B C     1 
ATOM   1200 O  O     . ALA B 1 8   ? 16.653 145.438 11.589  1.00 61.61  ? 40  ALA B O     1 
ATOM   1201 C  CB    . ALA B 1 8   ? 15.135 144.343 14.023  1.00 66.27  ? 40  ALA B CB    1 
ATOM   1202 N  N     . GLN B 1 9   ? 14.518 145.452 10.879  1.00 47.21  ? 41  GLN B N     1 
ATOM   1203 C  CA    . GLN B 1 9   ? 14.857 145.363 9.468   1.00 53.85  ? 41  GLN B CA    1 
ATOM   1204 C  C     . GLN B 1 9   ? 14.726 146.703 8.752   1.00 42.93  ? 41  GLN B C     1 
ATOM   1205 O  O     . GLN B 1 9   ? 14.776 146.741 7.519   1.00 45.42  ? 41  GLN B O     1 
ATOM   1206 C  CB    . GLN B 1 9   ? 13.990 144.305 8.784   1.00 51.30  ? 41  GLN B CB    1 
ATOM   1207 C  CG    . GLN B 1 9   ? 14.332 142.879 9.195   1.00 54.51  ? 41  GLN B CG    1 
ATOM   1208 C  CD    . GLN B 1 9   ? 13.880 141.849 8.179   1.00 56.42  ? 41  GLN B CD    1 
ATOM   1209 O  OE1   . GLN B 1 9   ? 13.311 142.192 7.143   1.00 41.49  ? 41  GLN B OE1   1 
ATOM   1210 N  NE2   . GLN B 1 9   ? 14.136 140.578 8.469   1.00 59.86  ? 41  GLN B NE2   1 
ATOM   1211 N  N     . ARG B 1 10  ? 14.556 147.795 9.495   1.00 41.35  ? 42  ARG B N     1 
ATOM   1212 C  CA    . ARG B 1 10  ? 14.586 149.121 8.897   1.00 39.84  ? 42  ARG B CA    1 
ATOM   1213 C  C     . ARG B 1 10  ? 16.008 149.477 8.470   1.00 38.70  ? 42  ARG B C     1 
ATOM   1214 O  O     . ARG B 1 10  ? 16.994 148.952 8.994   1.00 40.93  ? 42  ARG B O     1 
ATOM   1215 C  CB    . ARG B 1 10  ? 14.059 150.169 9.879   1.00 37.15  ? 42  ARG B CB    1 
ATOM   1216 C  CG    . ARG B 1 10  ? 12.571 150.075 10.179  1.00 38.03  ? 42  ARG B CG    1 
ATOM   1217 C  CD    . ARG B 1 10  ? 12.130 151.231 11.066  1.00 42.62  ? 42  ARG B CD    1 
ATOM   1218 N  NE    . ARG B 1 10  ? 10.682 151.278 11.246  1.00 42.16  ? 42  ARG B NE    1 
ATOM   1219 C  CZ    . ARG B 1 10  ? 10.026 152.320 11.748  1.00 51.84  ? 42  ARG B CZ    1 
ATOM   1220 N  NH1   . ARG B 1 10  ? 10.690 153.404 12.128  1.00 54.23  ? 42  ARG B NH1   1 
ATOM   1221 N  NH2   . ARG B 1 10  ? 8.707  152.277 11.877  1.00 55.79  ? 42  ARG B NH2   1 
ATOM   1222 N  N     . MET B 1 11  ? 16.107 150.383 7.500   1.00 29.80  ? 43  MET B N     1 
ATOM   1223 C  CA    . MET B 1 11  ? 17.385 150.845 6.979   1.00 31.09  ? 43  MET B CA    1 
ATOM   1224 C  C     . MET B 1 11  ? 17.519 152.346 7.193   1.00 30.39  ? 43  MET B C     1 
ATOM   1225 O  O     . MET B 1 11  ? 16.560 153.103 6.971   1.00 29.01  ? 43  MET B O     1 
ATOM   1226 C  CB    . MET B 1 11  ? 17.532 150.536 5.488   1.00 31.89  ? 43  MET B CB    1 
ATOM   1227 C  CG    . MET B 1 11  ? 17.244 149.101 5.092   1.00 35.84  ? 43  MET B CG    1 
ATOM   1228 S  SD    . MET B 1 11  ? 17.419 148.900 3.309   1.00 35.54  ? 43  MET B SD    1 
ATOM   1229 C  CE    . MET B 1 11  ? 16.709 147.275 3.068   1.00 40.30  ? 43  MET B CE    1 
ATOM   1230 N  N     . VAL B 1 12  ? 18.717 152.767 7.606   1.00 31.69  ? 44  VAL B N     1 
ATOM   1231 C  CA    . VAL B 1 12  ? 19.040 154.174 7.812   1.00 34.86  ? 44  VAL B CA    1 
ATOM   1232 C  C     . VAL B 1 12  ? 19.876 154.610 6.614   1.00 33.77  ? 44  VAL B C     1 
ATOM   1233 O  O     . VAL B 1 12  ? 21.075 154.327 6.538   1.00 31.47  ? 44  VAL B O     1 
ATOM   1234 C  CB    . VAL B 1 12  ? 19.778 154.397 9.134   1.00 27.84  ? 44  VAL B CB    1 
ATOM   1235 C  CG1   . VAL B 1 12  ? 20.096 155.874 9.327   1.00 28.85  ? 44  VAL B CG1   1 
ATOM   1236 C  CG2   . VAL B 1 12  ? 18.955 153.860 10.298  1.00 28.94  ? 44  VAL B CG2   1 
ATOM   1237 N  N     . TRP B 1 13  ? 19.238 155.275 5.656   1.00 27.03  ? 45  TRP B N     1 
ATOM   1238 C  CA    . TRP B 1 13  ? 19.909 155.768 4.463   1.00 24.64  ? 45  TRP B CA    1 
ATOM   1239 C  C     . TRP B 1 13  ? 20.537 157.120 4.760   1.00 32.64  ? 45  TRP B C     1 
ATOM   1240 O  O     . TRP B 1 13  ? 19.871 158.013 5.288   1.00 27.88  ? 45  TRP B O     1 
ATOM   1241 C  CB    . TRP B 1 13  ? 18.918 155.886 3.306   1.00 25.40  ? 45  TRP B CB    1 
ATOM   1242 C  CG    . TRP B 1 13  ? 18.410 154.568 2.851   1.00 28.27  ? 45  TRP B CG    1 
ATOM   1243 C  CD1   . TRP B 1 13  ? 17.487 153.785 3.478   1.00 27.41  ? 45  TRP B CD1   1 
ATOM   1244 C  CD2   . TRP B 1 13  ? 18.808 153.859 1.675   1.00 25.34  ? 45  TRP B CD2   1 
ATOM   1245 N  NE1   . TRP B 1 13  ? 17.281 152.632 2.761   1.00 25.24  ? 45  TRP B NE1   1 
ATOM   1246 C  CE2   . TRP B 1 13  ? 18.081 152.653 1.649   1.00 27.88  ? 45  TRP B CE2   1 
ATOM   1247 C  CE3   . TRP B 1 13  ? 19.708 154.128 0.639   1.00 28.08  ? 45  TRP B CE3   1 
ATOM   1248 C  CZ2   . TRP B 1 13  ? 18.225 151.716 0.629   1.00 23.81  ? 45  TRP B CZ2   1 
ATOM   1249 C  CZ3   . TRP B 1 13  ? 19.849 153.198 -0.373  1.00 26.54  ? 45  TRP B CZ3   1 
ATOM   1250 C  CH2   . TRP B 1 13  ? 19.112 152.007 -0.371  1.00 30.03  ? 45  TRP B CH2   1 
ATOM   1251 N  N     . VAL B 1 14  ? 21.811 157.272 4.419   1.00 28.33  ? 46  VAL B N     1 
ATOM   1252 C  CA    . VAL B 1 14  ? 22.535 158.501 4.731   1.00 28.00  ? 46  VAL B CA    1 
ATOM   1253 C  C     . VAL B 1 14  ? 23.414 158.880 3.549   1.00 33.43  ? 46  VAL B C     1 
ATOM   1254 O  O     . VAL B 1 14  ? 24.082 158.025 2.959   1.00 34.89  ? 46  VAL B O     1 
ATOM   1255 C  CB    . VAL B 1 14  ? 23.377 158.351 6.018   1.00 32.07  ? 46  VAL B CB    1 
ATOM   1256 C  CG1   . VAL B 1 14  ? 24.453 159.416 6.088   1.00 39.73  ? 46  VAL B CG1   1 
ATOM   1257 C  CG2   . VAL B 1 14  ? 22.486 158.423 7.249   1.00 31.99  ? 46  VAL B CG2   1 
ATOM   1258 N  N     . ASP B 1 15  ? 23.407 160.166 3.198   1.00 29.83  ? 47  ASP B N     1 
ATOM   1259 C  CA    . ASP B 1 15  ? 24.377 160.693 2.248   1.00 31.29  ? 47  ASP B CA    1 
ATOM   1260 C  C     . ASP B 1 15  ? 25.056 161.929 2.816   1.00 33.52  ? 47  ASP B C     1 
ATOM   1261 O  O     . ASP B 1 15  ? 24.424 162.755 3.489   1.00 34.67  ? 47  ASP B O     1 
ATOM   1262 C  CB    . ASP B 1 15  ? 23.753 161.033 0.894   1.00 31.30  ? 47  ASP B CB    1 
ATOM   1263 C  CG    . ASP B 1 15  ? 24.805 161.334 -0.161  1.00 47.47  ? 47  ASP B CG    1 
ATOM   1264 O  OD1   . ASP B 1 15  ? 25.665 160.462 -0.409  1.00 48.94  ? 47  ASP B OD1   1 
ATOM   1265 O  OD2   . ASP B 1 15  ? 24.788 162.447 -0.728  1.00 51.01  ? 47  ASP B OD2   1 
ATOM   1266 N  N     . LEU B 1 16  ? 26.349 162.043 2.524   1.00 30.13  ? 48  LEU B N     1 
ATOM   1267 C  CA    . LEU B 1 16  ? 27.199 163.127 2.985   1.00 32.30  ? 48  LEU B CA    1 
ATOM   1268 C  C     . LEU B 1 16  ? 27.795 163.867 1.797   1.00 37.18  ? 48  LEU B C     1 
ATOM   1269 O  O     . LEU B 1 16  ? 28.088 163.275 0.754   1.00 33.94  ? 48  LEU B O     1 
ATOM   1270 C  CB    . LEU B 1 16  ? 28.348 162.607 3.861   1.00 37.40  ? 48  LEU B CB    1 
ATOM   1271 C  CG    . LEU B 1 16  ? 28.223 162.589 5.384   1.00 48.42  ? 48  LEU B CG    1 
ATOM   1272 C  CD1   . LEU B 1 16  ? 26.919 161.960 5.812   1.00 43.45  ? 48  LEU B CD1   1 
ATOM   1273 C  CD2   . LEU B 1 16  ? 29.399 161.842 5.989   1.00 43.14  ? 48  LEU B CD2   1 
ATOM   1274 N  N     . GLU B 1 17  ? 27.969 165.172 1.971   1.00 36.49  ? 49  GLU B N     1 
ATOM   1275 C  CA    . GLU B 1 17  ? 28.816 165.991 1.119   1.00 42.04  ? 49  GLU B CA    1 
ATOM   1276 C  C     . GLU B 1 17  ? 29.919 166.560 1.996   1.00 49.15  ? 49  GLU B C     1 
ATOM   1277 O  O     . GLU B 1 17  ? 29.633 167.172 3.033   1.00 59.58  ? 49  GLU B O     1 
ATOM   1278 C  CB    . GLU B 1 17  ? 28.031 167.123 0.449   1.00 41.75  ? 49  GLU B CB    1 
ATOM   1279 C  CG    . GLU B 1 17  ? 26.735 166.687 -0.212  1.00 44.37  ? 49  GLU B CG    1 
ATOM   1280 C  CD    . GLU B 1 17  ? 26.962 165.939 -1.511  1.00 43.95  ? 49  GLU B CD    1 
ATOM   1281 O  OE1   . GLU B 1 17  ? 28.080 166.020 -2.061  1.00 48.38  ? 49  GLU B OE1   1 
ATOM   1282 O  OE2   . GLU B 1 17  ? 26.018 165.271 -1.983  1.00 43.33  ? 49  GLU B OE2   1 
ATOM   1283 N  N     . MET B 1 18  ? 31.166 166.343 1.589   1.00 47.50  ? 50  MET B N     1 
ATOM   1284 C  CA    . MET B 1 18  ? 32.338 166.768 2.338   1.00 39.49  ? 50  MET B CA    1 
ATOM   1285 C  C     . MET B 1 18  ? 33.174 167.722 1.495   1.00 48.98  ? 50  MET B C     1 
ATOM   1286 O  O     . MET B 1 18  ? 32.925 167.922 0.303   1.00 42.27  ? 50  MET B O     1 
ATOM   1287 C  CB    . MET B 1 18  ? 33.189 165.563 2.765   1.00 40.83  ? 50  MET B CB    1 
ATOM   1288 C  CG    . MET B 1 18  ? 32.425 164.474 3.501   1.00 39.36  ? 50  MET B CG    1 
ATOM   1289 S  SD    . MET B 1 18  ? 31.697 163.252 2.390   1.00 46.53  ? 50  MET B SD    1 
ATOM   1290 C  CE    . MET B 1 18  ? 33.164 162.433 1.767   1.00 52.24  ? 50  MET B CE    1 
ATOM   1291 N  N     . THR B 1 19  ? 34.184 168.312 2.133   1.00 47.43  ? 51  THR B N     1 
ATOM   1292 C  CA    . THR B 1 19  ? 35.148 169.148 1.430   1.00 52.60  ? 51  THR B CA    1 
ATOM   1293 C  C     . THR B 1 19  ? 36.201 168.331 0.691   1.00 57.46  ? 51  THR B C     1 
ATOM   1294 O  O     . THR B 1 19  ? 37.074 168.920 0.043   1.00 59.41  ? 51  THR B O     1 
ATOM   1295 C  CB    . THR B 1 19  ? 35.832 170.110 2.408   1.00 56.09  ? 51  THR B CB    1 
ATOM   1296 O  OG1   . THR B 1 19  ? 36.368 169.374 3.513   1.00 57.07  ? 51  THR B OG1   1 
ATOM   1297 C  CG2   . THR B 1 19  ? 34.840 171.141 2.925   1.00 54.16  ? 51  THR B CG2   1 
ATOM   1298 N  N     . GLY B 1 20  ? 36.139 167.009 0.770   1.00 50.45  ? 52  GLY B N     1 
ATOM   1299 C  CA    . GLY B 1 20  ? 37.092 166.163 0.083   1.00 53.11  ? 52  GLY B CA    1 
ATOM   1300 C  C     . GLY B 1 20  ? 37.105 164.771 0.688   1.00 49.49  ? 52  GLY B C     1 
ATOM   1301 O  O     . GLY B 1 20  ? 36.323 164.453 1.583   1.00 51.30  ? 52  GLY B O     1 
ATOM   1302 N  N     . LEU B 1 21  ? 38.024 163.948 0.173   1.00 54.67  ? 53  LEU B N     1 
ATOM   1303 C  CA    . LEU B 1 21  ? 38.160 162.564 0.615   1.00 57.26  ? 53  LEU B CA    1 
ATOM   1304 C  C     . LEU B 1 21  ? 39.142 162.385 1.763   1.00 63.00  ? 53  LEU B C     1 
ATOM   1305 O  O     . LEU B 1 21  ? 39.114 161.338 2.421   1.00 70.94  ? 53  LEU B O     1 
ATOM   1306 C  CB    . LEU B 1 21  ? 38.612 161.664 -0.544  1.00 59.10  ? 53  LEU B CB    1 
ATOM   1307 C  CG    . LEU B 1 21  ? 37.567 161.178 -1.550  1.00 63.35  ? 53  LEU B CG    1 
ATOM   1308 C  CD1   . LEU B 1 21  ? 36.297 160.710 -0.853  1.00 66.16  ? 53  LEU B CD1   1 
ATOM   1309 C  CD2   . LEU B 1 21  ? 37.265 162.262 -2.558  1.00 63.10  ? 53  LEU B CD2   1 
ATOM   1310 N  N     . ASP B 1 22  ? 40.013 163.361 2.015   1.00 57.51  ? 54  ASP B N     1 
ATOM   1311 C  CA    . ASP B 1 22  ? 41.029 163.229 3.057   1.00 59.80  ? 54  ASP B CA    1 
ATOM   1312 C  C     . ASP B 1 22  ? 40.357 163.174 4.425   1.00 59.46  ? 54  ASP B C     1 
ATOM   1313 O  O     . ASP B 1 22  ? 39.893 164.197 4.940   1.00 61.88  ? 54  ASP B O     1 
ATOM   1314 C  CB    . ASP B 1 22  ? 42.018 164.387 2.980   1.00 64.53  ? 54  ASP B CB    1 
ATOM   1315 C  CG    . ASP B 1 22  ? 43.345 164.064 3.637   1.00 70.30  ? 54  ASP B CG    1 
ATOM   1316 O  OD1   . ASP B 1 22  ? 43.357 163.301 4.627   1.00 70.52  ? 54  ASP B OD1   1 
ATOM   1317 O  OD2   . ASP B 1 22  ? 44.380 164.573 3.158   1.00 75.19  ? 54  ASP B OD2   1 
ATOM   1318 N  N     . ILE B 1 23  ? 40.309 161.977 5.018   1.00 57.48  ? 55  ILE B N     1 
ATOM   1319 C  CA    . ILE B 1 23  ? 39.702 161.805 6.332   1.00 58.39  ? 55  ILE B CA    1 
ATOM   1320 C  C     . ILE B 1 23  ? 40.470 162.558 7.410   1.00 55.70  ? 55  ILE B C     1 
ATOM   1321 O  O     . ILE B 1 23  ? 39.895 162.923 8.441   1.00 55.92  ? 55  ILE B O     1 
ATOM   1322 C  CB    . ILE B 1 23  ? 39.595 160.298 6.666   1.00 61.94  ? 55  ILE B CB    1 
ATOM   1323 C  CG1   . ILE B 1 23  ? 38.787 160.077 7.948   1.00 61.98  ? 55  ILE B CG1   1 
ATOM   1324 C  CG2   . ILE B 1 23  ? 40.978 159.665 6.772   1.00 61.98  ? 55  ILE B CG2   1 
ATOM   1325 C  CD1   . ILE B 1 23  ? 37.384 160.644 7.890   1.00 57.11  ? 55  ILE B CD1   1 
ATOM   1326 N  N     . GLU B 1 24  ? 41.760 162.819 7.191   1.00 59.44  ? 56  GLU B N     1 
ATOM   1327 C  CA    . GLU B 1 24  ? 42.566 163.528 8.177   1.00 66.76  ? 56  GLU B CA    1 
ATOM   1328 C  C     . GLU B 1 24  ? 42.341 165.034 8.160   1.00 67.62  ? 56  GLU B C     1 
ATOM   1329 O  O     . GLU B 1 24  ? 42.676 165.705 9.142   1.00 68.72  ? 56  GLU B O     1 
ATOM   1330 C  CB    . GLU B 1 24  ? 44.052 163.239 7.945   1.00 72.45  ? 56  GLU B CB    1 
ATOM   1331 C  CG    . GLU B 1 24  ? 44.463 161.803 8.218   1.00 77.00  ? 56  GLU B CG    1 
ATOM   1332 C  CD    . GLU B 1 24  ? 44.096 161.351 9.616   1.00 86.07  ? 56  GLU B CD    1 
ATOM   1333 O  OE1   . GLU B 1 24  ? 43.441 160.295 9.748   1.00 88.41  ? 56  GLU B OE1   1 
ATOM   1334 O  OE2   . GLU B 1 24  ? 44.459 162.052 10.584  1.00 92.16  ? 56  GLU B OE2   1 
ATOM   1335 N  N     . LYS B 1 25  ? 41.785 165.577 7.086   1.00 65.52  ? 57  LYS B N     1 
ATOM   1336 C  CA    . LYS B 1 25  ? 41.707 167.027 6.940   1.00 68.75  ? 57  LYS B CA    1 
ATOM   1337 C  C     . LYS B 1 25  ? 40.314 167.533 6.594   1.00 67.51  ? 57  LYS B C     1 
ATOM   1338 O  O     . LYS B 1 25  ? 39.912 168.589 7.091   1.00 65.47  ? 57  LYS B O     1 
ATOM   1339 C  CB    . LYS B 1 25  ? 42.708 167.488 5.866   1.00 70.54  ? 57  LYS B CB    1 
ATOM   1340 C  CG    . LYS B 1 25  ? 42.823 168.996 5.719   1.00 80.02  ? 57  LYS B CG    1 
ATOM   1341 C  CD    . LYS B 1 25  ? 44.184 169.388 5.168   1.00 88.52  ? 57  LYS B CD    1 
ATOM   1342 C  CE    . LYS B 1 25  ? 45.303 168.953 6.101   1.00 89.73  ? 57  LYS B CE    1 
ATOM   1343 N  NZ    . LYS B 1 25  ? 45.164 169.564 7.452   1.00 87.98  ? 57  LYS B NZ    1 
ATOM   1344 N  N     . ASP B 1 26  ? 39.569 166.812 5.764   1.00 64.93  ? 58  ASP B N     1 
ATOM   1345 C  CA    . ASP B 1 26  ? 38.302 167.317 5.262   1.00 63.81  ? 58  ASP B CA    1 
ATOM   1346 C  C     . ASP B 1 26  ? 37.181 167.107 6.278   1.00 57.16  ? 58  ASP B C     1 
ATOM   1347 O  O     . ASP B 1 26  ? 37.247 166.236 7.150   1.00 53.71  ? 58  ASP B O     1 
ATOM   1348 C  CB    . ASP B 1 26  ? 37.954 166.646 3.935   1.00 67.05  ? 58  ASP B CB    1 
ATOM   1349 C  CG    . ASP B 1 26  ? 38.880 167.070 2.812   1.00 69.25  ? 58  ASP B CG    1 
ATOM   1350 O  OD1   . ASP B 1 26  ? 39.008 168.290 2.576   1.00 68.86  ? 58  ASP B OD1   1 
ATOM   1351 O  OD2   . ASP B 1 26  ? 39.486 166.187 2.171   1.00 68.86  ? 58  ASP B OD2   1 
ATOM   1352 N  N     . GLN B 1 27  ? 36.140 167.926 6.150   1.00 55.25  ? 59  GLN B N     1 
ATOM   1353 C  CA    . GLN B 1 27  ? 35.009 167.934 7.066   1.00 59.48  ? 59  GLN B CA    1 
ATOM   1354 C  C     . GLN B 1 27  ? 33.708 167.721 6.300   1.00 54.19  ? 59  GLN B C     1 
ATOM   1355 O  O     . GLN B 1 27  ? 33.659 167.802 5.071   1.00 59.65  ? 59  GLN B O     1 
ATOM   1356 C  CB    . GLN B 1 27  ? 34.945 169.250 7.850   1.00 65.35  ? 59  GLN B CB    1 
ATOM   1357 C  CG    . GLN B 1 27  ? 36.272 169.698 8.439   1.00 73.84  ? 59  GLN B CG    1 
ATOM   1358 C  CD    . GLN B 1 27  ? 36.660 168.908 9.670   1.00 78.87  ? 59  GLN B CD    1 
ATOM   1359 O  OE1   . GLN B 1 27  ? 35.812 168.563 10.493  1.00 77.10  ? 59  GLN B OE1   1 
ATOM   1360 N  NE2   . GLN B 1 27  ? 37.949 168.617 9.805   1.00 83.71  ? 59  GLN B NE2   1 
ATOM   1361 N  N     . ILE B 1 28  ? 32.643 167.458 7.053   1.00 48.40  ? 60  ILE B N     1 
ATOM   1362 C  CA    . ILE B 1 28  ? 31.311 167.254 6.494   1.00 48.28  ? 60  ILE B CA    1 
ATOM   1363 C  C     . ILE B 1 28  ? 30.625 168.606 6.358   1.00 53.46  ? 60  ILE B C     1 
ATOM   1364 O  O     . ILE B 1 28  ? 30.543 169.369 7.328   1.00 56.25  ? 60  ILE B O     1 
ATOM   1365 C  CB    . ILE B 1 28  ? 30.485 166.306 7.380   1.00 46.79  ? 60  ILE B CB    1 
ATOM   1366 C  CG1   . ILE B 1 28  ? 31.207 164.968 7.552   1.00 43.91  ? 60  ILE B CG1   1 
ATOM   1367 C  CG2   . ILE B 1 28  ? 29.091 166.104 6.802   1.00 43.59  ? 60  ILE B CG2   1 
ATOM   1368 C  CD1   . ILE B 1 28  ? 30.628 164.099 8.648   1.00 45.19  ? 60  ILE B CD1   1 
ATOM   1369 N  N     . ILE B 1 29  ? 30.132 168.908 5.159   1.00 50.54  ? 61  ILE B N     1 
ATOM   1370 C  CA    . ILE B 1 29  ? 29.429 170.162 4.922   1.00 51.05  ? 61  ILE B CA    1 
ATOM   1371 C  C     . ILE B 1 29  ? 27.938 169.971 4.671   1.00 49.64  ? 61  ILE B C     1 
ATOM   1372 O  O     . ILE B 1 29  ? 27.174 170.933 4.846   1.00 50.49  ? 61  ILE B O     1 
ATOM   1373 C  CB    . ILE B 1 29  ? 30.064 170.963 3.764   1.00 48.00  ? 61  ILE B CB    1 
ATOM   1374 C  CG1   . ILE B 1 29  ? 30.159 170.117 2.495   1.00 53.81  ? 61  ILE B CG1   1 
ATOM   1375 C  CG2   . ILE B 1 29  ? 31.430 171.488 4.166   1.00 50.43  ? 61  ILE B CG2   1 
ATOM   1376 C  CD1   . ILE B 1 29  ? 30.800 170.836 1.328   1.00 55.18  ? 61  ILE B CD1   1 
ATOM   1377 N  N     . GLU B 1 30  ? 27.494 168.780 4.272   1.00 49.28  ? 62  GLU B N     1 
ATOM   1378 C  CA    . GLU B 1 30  ? 26.066 168.539 4.114   1.00 49.22  ? 62  GLU B CA    1 
ATOM   1379 C  C     . GLU B 1 30  ? 25.754 167.096 4.478   1.00 46.17  ? 62  GLU B C     1 
ATOM   1380 O  O     . GLU B 1 30  ? 26.560 166.195 4.238   1.00 40.29  ? 62  GLU B O     1 
ATOM   1381 C  CB    . GLU B 1 30  ? 25.586 168.842 2.688   1.00 53.43  ? 62  GLU B CB    1 
ATOM   1382 C  CG    . GLU B 1 30  ? 24.072 168.975 2.568   1.00 53.08  ? 62  GLU B CG    1 
ATOM   1383 C  CD    . GLU B 1 30  ? 23.614 169.280 1.155   1.00 52.67  ? 62  GLU B CD    1 
ATOM   1384 O  OE1   . GLU B 1 30  ? 24.297 168.856 0.200   1.00 52.67  ? 62  GLU B OE1   1 
ATOM   1385 O  OE2   . GLU B 1 30  ? 22.567 169.944 1.001   1.00 53.47  ? 62  GLU B OE2   1 
ATOM   1386 N  N     . MET B 1 31  ? 24.571 166.882 5.049   1.00 39.14  ? 63  MET B N     1 
ATOM   1387 C  CA    . MET B 1 31  ? 24.166 165.542 5.450   1.00 34.91  ? 63  MET B CA    1 
ATOM   1388 C  C     . MET B 1 31  ? 22.657 165.395 5.330   1.00 36.18  ? 63  MET B C     1 
ATOM   1389 O  O     . MET B 1 31  ? 21.902 166.295 5.713   1.00 36.68  ? 63  MET B O     1 
ATOM   1390 C  CB    . MET B 1 31  ? 24.614 165.228 6.882   1.00 31.84  ? 63  MET B CB    1 
ATOM   1391 C  CG    . MET B 1 31  ? 24.307 163.806 7.321   1.00 39.75  ? 63  MET B CG    1 
ATOM   1392 S  SD    . MET B 1 31  ? 25.079 163.371 8.891   1.00 44.79  ? 63  MET B SD    1 
ATOM   1393 C  CE    . MET B 1 31  ? 24.254 161.822 9.249   1.00 38.20  ? 63  MET B CE    1 
ATOM   1394 N  N     . ALA B 1 32  ? 22.225 164.249 4.801   1.00 31.35  ? 64  ALA B N     1 
ATOM   1395 C  CA    . ALA B 1 32  ? 20.806 163.934 4.710   1.00 34.93  ? 64  ALA B CA    1 
ATOM   1396 C  C     . ALA B 1 32  ? 20.576 162.481 5.099   1.00 34.33  ? 64  ALA B C     1 
ATOM   1397 O  O     . ALA B 1 32  ? 21.407 161.607 4.827   1.00 31.41  ? 64  ALA B O     1 
ATOM   1398 C  CB    . ALA B 1 32  ? 20.249 164.194 3.306   1.00 39.85  ? 64  ALA B CB    1 
ATOM   1399 N  N     . CYS B 1 33  ? 19.424 162.233 5.726   1.00 27.92  ? 65  CYS B N     1 
ATOM   1400 C  CA    . CYS B 1 33  ? 19.085 160.923 6.262   1.00 30.03  ? 65  CYS B CA    1 
ATOM   1401 C  C     . CYS B 1 33  ? 17.618 160.604 6.009   1.00 29.40  ? 65  CYS B C     1 
ATOM   1402 O  O     . CYS B 1 33  ? 16.747 161.463 6.167   1.00 29.92  ? 65  CYS B O     1 
ATOM   1403 C  CB    . CYS B 1 33  ? 19.375 160.851 7.768   1.00 31.53  ? 65  CYS B CB    1 
ATOM   1404 S  SG    . CYS B 1 33  ? 18.942 159.273 8.540   1.00 35.36  ? 65  CYS B SG    1 
ATOM   1405 N  N     . LEU B 1 34  ? 17.361 159.358 5.617   1.00 25.56  ? 66  LEU B N     1 
ATOM   1406 C  CA    . LEU B 1 34  ? 16.020 158.817 5.459   1.00 32.05  ? 66  LEU B CA    1 
ATOM   1407 C  C     . LEU B 1 34  ? 15.941 157.479 6.182   1.00 41.77  ? 66  LEU B C     1 
ATOM   1408 O  O     . LEU B 1 34  ? 16.958 156.834 6.446   1.00 44.74  ? 66  LEU B O     1 
ATOM   1409 C  CB    . LEU B 1 34  ? 15.647 158.635 3.976   1.00 29.50  ? 66  LEU B CB    1 
ATOM   1410 C  CG    . LEU B 1 34  ? 15.742 159.854 3.051   1.00 40.54  ? 66  LEU B CG    1 
ATOM   1411 C  CD1   . LEU B 1 34  ? 15.441 159.467 1.609   1.00 39.89  ? 66  LEU B CD1   1 
ATOM   1412 C  CD2   . LEU B 1 34  ? 14.806 160.958 3.510   1.00 40.64  ? 66  LEU B CD2   1 
ATOM   1413 N  N     . ILE B 1 35  ? 14.720 157.064 6.506   1.00 29.42  ? 67  ILE B N     1 
ATOM   1414 C  CA    . ILE B 1 35  ? 14.457 155.781 7.146   1.00 26.19  ? 67  ILE B CA    1 
ATOM   1415 C  C     . ILE B 1 35  ? 13.470 155.023 6.277   1.00 32.70  ? 67  ILE B C     1 
ATOM   1416 O  O     . ILE B 1 35  ? 12.353 155.507 6.040   1.00 31.60  ? 67  ILE B O     1 
ATOM   1417 C  CB    . ILE B 1 35  ? 13.900 155.943 8.568   1.00 30.65  ? 67  ILE B CB    1 
ATOM   1418 C  CG1   . ILE B 1 35  ? 14.857 156.758 9.435   1.00 34.89  ? 67  ILE B CG1   1 
ATOM   1419 C  CG2   . ILE B 1 35  ? 13.636 154.578 9.190   1.00 33.31  ? 67  ILE B CG2   1 
ATOM   1420 C  CD1   . ILE B 1 35  ? 16.183 156.089 9.673   1.00 30.44  ? 67  ILE B CD1   1 
ATOM   1421 N  N     . THR B 1 36  ? 13.875 153.838 5.817   1.00 28.89  ? 68  THR B N     1 
ATOM   1422 C  CA    . THR B 1 36  ? 12.999 152.970 5.044   1.00 26.29  ? 68  THR B CA    1 
ATOM   1423 C  C     . THR B 1 36  ? 12.759 151.666 5.793   1.00 28.13  ? 68  THR B C     1 
ATOM   1424 O  O     . THR B 1 36  ? 13.488 151.315 6.723   1.00 29.69  ? 68  THR B O     1 
ATOM   1425 C  CB    . THR B 1 36  ? 13.575 152.651 3.655   1.00 27.51  ? 68  THR B CB    1 
ATOM   1426 O  OG1   . THR B 1 36  ? 14.655 151.716 3.782   1.00 31.85  ? 68  THR B OG1   1 
ATOM   1427 C  CG2   . THR B 1 36  ? 14.068 153.913 2.967   1.00 22.98  ? 68  THR B CG2   1 
ATOM   1428 N  N     . ASP B 1 37  ? 11.718 150.947 5.378   1.00 28.35  ? 69  ASP B N     1 
ATOM   1429 C  CA    . ASP B 1 37  ? 11.537 149.585 5.849   1.00 28.30  ? 69  ASP B CA    1 
ATOM   1430 C  C     . ASP B 1 37  ? 12.408 148.647 5.015   1.00 31.36  ? 69  ASP B C     1 
ATOM   1431 O  O     . ASP B 1 37  ? 13.154 149.073 4.130   1.00 25.32  ? 69  ASP B O     1 
ATOM   1432 C  CB    . ASP B 1 37  ? 10.059 149.191 5.815   1.00 28.33  ? 69  ASP B CB    1 
ATOM   1433 C  CG    . ASP B 1 37  ? 9.443  149.290 4.425   1.00 31.63  ? 69  ASP B CG    1 
ATOM   1434 O  OD1   . ASP B 1 37  ? 10.184 149.362 3.423   1.00 34.35  ? 69  ASP B OD1   1 
ATOM   1435 O  OD2   . ASP B 1 37  ? 8.196  149.289 4.336   1.00 38.09  ? 69  ASP B OD2   1 
ATOM   1436 N  N     . SER B 1 38  ? 12.312 147.345 5.291   1.00 27.69  ? 70  SER B N     1 
ATOM   1437 C  CA    . SER B 1 38  ? 13.133 146.386 4.563   1.00 29.33  ? 70  SER B CA    1 
ATOM   1438 C  C     . SER B 1 38  ? 12.752 146.293 3.090   1.00 31.13  ? 70  SER B C     1 
ATOM   1439 O  O     . SER B 1 38  ? 13.541 145.776 2.292   1.00 35.38  ? 70  SER B O     1 
ATOM   1440 C  CB    . SER B 1 38  ? 13.038 145.008 5.217   1.00 37.27  ? 70  SER B CB    1 
ATOM   1441 O  OG    . SER B 1 38  ? 11.704 144.533 5.200   1.00 48.07  ? 70  SER B OG    1 
ATOM   1442 N  N     . ASP B 1 39  ? 11.570 146.783 2.712   1.00 28.45  ? 71  ASP B N     1 
ATOM   1443 C  CA    . ASP B 1 39  ? 11.118 146.777 1.328   1.00 29.12  ? 71  ASP B CA    1 
ATOM   1444 C  C     . ASP B 1 39  ? 11.351 148.114 0.631   1.00 28.40  ? 71  ASP B C     1 
ATOM   1445 O  O     . ASP B 1 39  ? 10.747 148.372 -0.417  1.00 29.86  ? 71  ASP B O     1 
ATOM   1446 C  CB    . ASP B 1 39  ? 9.638  146.394 1.257   1.00 33.38  ? 71  ASP B CB    1 
ATOM   1447 C  CG    . ASP B 1 39  ? 9.403  144.921 1.529   1.00 42.97  ? 71  ASP B CG    1 
ATOM   1448 O  OD1   . ASP B 1 39  ? 10.234 144.093 1.099   1.00 39.35  ? 71  ASP B OD1   1 
ATOM   1449 O  OD2   . ASP B 1 39  ? 8.387  144.590 2.175   1.00 45.24  ? 71  ASP B OD2   1 
ATOM   1450 N  N     . LEU B 1 40  ? 12.206 148.967 1.198   1.00 24.86  ? 72  LEU B N     1 
ATOM   1451 C  CA    . LEU B 1 40  ? 12.644 150.245 0.636   1.00 25.60  ? 72  LEU B CA    1 
ATOM   1452 C  C     . LEU B 1 40  ? 11.553 151.309 0.619   1.00 28.65  ? 72  LEU B C     1 
ATOM   1453 O  O     . LEU B 1 40  ? 11.724 152.345 -0.038  1.00 27.96  ? 72  LEU B O     1 
ATOM   1454 C  CB    . LEU B 1 40  ? 13.214 150.083 -0.779  1.00 30.98  ? 72  LEU B CB    1 
ATOM   1455 C  CG    . LEU B 1 40  ? 14.294 149.014 -0.961  1.00 29.10  ? 72  LEU B CG    1 
ATOM   1456 C  CD1   . LEU B 1 40  ? 14.803 149.001 -2.394  1.00 26.43  ? 72  LEU B CD1   1 
ATOM   1457 C  CD2   . LEU B 1 40  ? 15.436 149.236 0.017   1.00 27.50  ? 72  LEU B CD2   1 
ATOM   1458 N  N     . ASN B 1 41  ? 10.442 151.096 1.319   1.00 29.15  ? 73  ASN B N     1 
ATOM   1459 C  CA    . ASN B 1 41  ? 9.423  152.130 1.457   1.00 27.87  ? 73  ASN B CA    1 
ATOM   1460 C  C     . ASN B 1 41  ? 9.904  153.171 2.460   1.00 25.43  ? 73  ASN B C     1 
ATOM   1461 O  O     . ASN B 1 41  ? 10.229 152.832 3.602   1.00 25.83  ? 73  ASN B O     1 
ATOM   1462 C  CB    . ASN B 1 41  ? 8.095  151.525 1.909   1.00 34.55  ? 73  ASN B CB    1 
ATOM   1463 C  CG    . ASN B 1 41  ? 7.585  150.460 0.960   1.00 41.13  ? 73  ASN B CG    1 
ATOM   1464 O  OD1   . ASN B 1 41  ? 7.471  150.687 -0.244  1.00 41.03  ? 73  ASN B OD1   1 
ATOM   1465 N  ND2   . ASN B 1 41  ? 7.274  149.287 1.500   1.00 37.88  ? 73  ASN B ND2   1 
ATOM   1466 N  N     . ILE B 1 42  ? 9.948  154.434 2.039   1.00 27.58  ? 74  ILE B N     1 
ATOM   1467 C  CA    . ILE B 1 42  ? 10.434 155.496 2.912   1.00 27.94  ? 74  ILE B CA    1 
ATOM   1468 C  C     . ILE B 1 42  ? 9.444  155.695 4.052   1.00 29.73  ? 74  ILE B C     1 
ATOM   1469 O  O     . ILE B 1 42  ? 8.294  156.095 3.836   1.00 29.67  ? 74  ILE B O     1 
ATOM   1470 C  CB    . ILE B 1 42  ? 10.651 156.797 2.130   1.00 27.96  ? 74  ILE B CB    1 
ATOM   1471 C  CG1   . ILE B 1 42  ? 11.755 156.610 1.088   1.00 27.15  ? 74  ILE B CG1   1 
ATOM   1472 C  CG2   . ILE B 1 42  ? 11.003 157.933 3.081   1.00 34.52  ? 74  ILE B CG2   1 
ATOM   1473 C  CD1   . ILE B 1 42  ? 11.812 157.713 0.055   1.00 33.81  ? 74  ILE B CD1   1 
ATOM   1474 N  N     . LEU B 1 43  ? 9.889  155.411 5.274   1.00 29.75  ? 75  LEU B N     1 
ATOM   1475 C  CA    . LEU B 1 43  ? 9.048  155.594 6.448   1.00 32.55  ? 75  LEU B CA    1 
ATOM   1476 C  C     . LEU B 1 43  ? 9.188  156.987 7.041   1.00 40.79  ? 75  LEU B C     1 
ATOM   1477 O  O     . LEU B 1 43  ? 8.198  157.561 7.509   1.00 34.00  ? 75  LEU B O     1 
ATOM   1478 C  CB    . LEU B 1 43  ? 9.385  154.545 7.510   1.00 30.06  ? 75  LEU B CB    1 
ATOM   1479 C  CG    . LEU B 1 43  ? 9.330  153.084 7.065   1.00 32.22  ? 75  LEU B CG    1 
ATOM   1480 C  CD1   . LEU B 1 43  ? 9.623  152.164 8.237   1.00 31.55  ? 75  LEU B CD1   1 
ATOM   1481 C  CD2   . LEU B 1 43  ? 7.978  152.761 6.450   1.00 38.83  ? 75  LEU B CD2   1 
ATOM   1482 N  N     . ALA B 1 44  ? 10.394 157.549 7.031   1.00 34.24  ? 76  ALA B N     1 
ATOM   1483 C  CA    . ALA B 1 44  ? 10.592 158.849 7.660   1.00 30.85  ? 76  ALA B CA    1 
ATOM   1484 C  C     . ALA B 1 44  ? 11.671 159.635 6.932   1.00 29.72  ? 76  ALA B C     1 
ATOM   1485 O  O     . ALA B 1 44  ? 12.682 159.072 6.509   1.00 34.73  ? 76  ALA B O     1 
ATOM   1486 C  CB    . ALA B 1 44  ? 10.958 158.698 9.141   1.00 30.28  ? 76  ALA B CB    1 
ATOM   1487 N  N     . GLU B 1 45  ? 11.449 160.939 6.794   1.00 31.27  ? 77  GLU B N     1 
ATOM   1488 C  CA    . GLU B 1 45  ? 12.437 161.848 6.228   1.00 29.59  ? 77  GLU B CA    1 
ATOM   1489 C  C     . GLU B 1 45  ? 13.111 162.599 7.369   1.00 32.59  ? 77  GLU B C     1 
ATOM   1490 O  O     . GLU B 1 45  ? 12.450 163.334 8.109   1.00 37.90  ? 77  GLU B O     1 
ATOM   1491 C  CB    . GLU B 1 45  ? 11.792 162.822 5.244   1.00 34.67  ? 77  GLU B CB    1 
ATOM   1492 C  CG    . GLU B 1 45  ? 12.772 163.795 4.607   1.00 42.61  ? 77  GLU B CG    1 
ATOM   1493 C  CD    . GLU B 1 45  ? 12.345 164.228 3.218   1.00 48.64  ? 77  GLU B CD    1 
ATOM   1494 O  OE1   . GLU B 1 45  ? 11.773 163.394 2.485   1.00 50.60  ? 77  GLU B OE1   1 
ATOM   1495 O  OE2   . GLU B 1 45  ? 12.579 165.401 2.860   1.00 48.23  ? 77  GLU B OE2   1 
ATOM   1496 N  N     . GLY B 1 46  ? 14.418 162.408 7.511   1.00 35.71  ? 78  GLY B N     1 
ATOM   1497 C  CA    . GLY B 1 46  ? 15.155 163.000 8.600   1.00 37.83  ? 78  GLY B CA    1 
ATOM   1498 C  C     . GLY B 1 46  ? 15.696 164.372 8.270   1.00 36.01  ? 78  GLY B C     1 
ATOM   1499 O  O     . GLY B 1 46  ? 15.324 164.992 7.268   1.00 38.02  ? 78  GLY B O     1 
ATOM   1500 N  N     . PRO B 1 47  ? 16.588 164.877 9.121   1.00 40.14  ? 79  PRO B N     1 
ATOM   1501 C  CA    . PRO B 1 47  ? 17.166 166.202 8.882   1.00 38.00  ? 79  PRO B CA    1 
ATOM   1502 C  C     . PRO B 1 47  ? 17.958 166.245 7.584   1.00 32.23  ? 79  PRO B C     1 
ATOM   1503 O  O     . PRO B 1 47  ? 18.562 165.258 7.158   1.00 31.39  ? 79  PRO B O     1 
ATOM   1504 C  CB    . PRO B 1 47  ? 18.077 166.419 10.097  1.00 43.50  ? 79  PRO B CB    1 
ATOM   1505 C  CG    . PRO B 1 47  ? 17.543 165.499 11.145  1.00 43.38  ? 79  PRO B CG    1 
ATOM   1506 C  CD    . PRO B 1 47  ? 17.026 164.304 10.405  1.00 37.74  ? 79  PRO B CD    1 
ATOM   1507 N  N     . ASN B 1 48  ? 17.934 167.414 6.951   1.00 33.95  ? 80  ASN B N     1 
ATOM   1508 C  CA    . ASN B 1 48  ? 18.714 167.701 5.750   1.00 36.24  ? 80  ASN B CA    1 
ATOM   1509 C  C     . ASN B 1 48  ? 19.464 168.995 6.045   1.00 34.79  ? 80  ASN B C     1 
ATOM   1510 O  O     . ASN B 1 48  ? 18.902 170.087 5.915   1.00 40.45  ? 80  ASN B O     1 
ATOM   1511 C  CB    . ASN B 1 48  ? 17.817 167.827 4.523   1.00 40.73  ? 80  ASN B CB    1 
ATOM   1512 C  CG    . ASN B 1 48  ? 18.565 168.310 3.300   1.00 43.77  ? 80  ASN B CG    1 
ATOM   1513 O  OD1   . ASN B 1 48  ? 19.717 167.942 3.075   1.00 37.66  ? 80  ASN B OD1   1 
ATOM   1514 N  ND2   . ASN B 1 48  ? 17.909 169.141 2.499   1.00 45.70  ? 80  ASN B ND2   1 
ATOM   1515 N  N     . LEU B 1 49  ? 20.724 168.876 6.458   1.00 34.83  ? 81  LEU B N     1 
ATOM   1516 C  CA    . LEU B 1 49  ? 21.434 169.986 7.074   1.00 44.83  ? 81  LEU B CA    1 
ATOM   1517 C  C     . LEU B 1 49  ? 22.709 170.327 6.315   1.00 40.63  ? 81  LEU B C     1 
ATOM   1518 O  O     . LEU B 1 49  ? 23.379 169.453 5.753   1.00 39.15  ? 81  LEU B O     1 
ATOM   1519 C  CB    . LEU B 1 49  ? 21.779 169.674 8.537   1.00 43.71  ? 81  LEU B CB    1 
ATOM   1520 C  CG    . LEU B 1 49  ? 20.607 169.264 9.430   1.00 41.39  ? 81  LEU B CG    1 
ATOM   1521 C  CD1   . LEU B 1 49  ? 21.089 168.942 10.835  1.00 42.39  ? 81  LEU B CD1   1 
ATOM   1522 C  CD2   . LEU B 1 49  ? 19.549 170.357 9.458   1.00 41.07  ? 81  LEU B CD2   1 
ATOM   1523 N  N     . ILE B 1 50  ? 23.030 171.618 6.313   1.00 38.99  ? 82  ILE B N     1 
ATOM   1524 C  CA    . ILE B 1 50  ? 24.287 172.143 5.796   1.00 51.17  ? 82  ILE B CA    1 
ATOM   1525 C  C     . ILE B 1 50  ? 25.108 172.604 6.993   1.00 51.96  ? 82  ILE B C     1 
ATOM   1526 O  O     . ILE B 1 50  ? 24.650 173.437 7.785   1.00 49.26  ? 82  ILE B O     1 
ATOM   1527 C  CB    . ILE B 1 50  ? 24.057 173.293 4.803   1.00 49.63  ? 82  ILE B CB    1 
ATOM   1528 C  CG1   . ILE B 1 50  ? 23.378 172.773 3.534   1.00 51.99  ? 82  ILE B CG1   1 
ATOM   1529 C  CG2   . ILE B 1 50  ? 25.369 173.983 4.472   1.00 48.08  ? 82  ILE B CG2   1 
ATOM   1530 C  CD1   . ILE B 1 50  ? 22.345 173.719 2.965   1.00 56.26  ? 82  ILE B CD1   1 
ATOM   1531 N  N     . ILE B 1 51  ? 26.318 172.067 7.127   1.00 50.43  ? 83  ILE B N     1 
ATOM   1532 C  CA    . ILE B 1 51  ? 27.123 172.235 8.332   1.00 50.20  ? 83  ILE B CA    1 
ATOM   1533 C  C     . ILE B 1 51  ? 28.155 173.328 8.096   1.00 55.11  ? 83  ILE B C     1 
ATOM   1534 O  O     . ILE B 1 51  ? 28.880 173.308 7.093   1.00 52.98  ? 83  ILE B O     1 
ATOM   1535 C  CB    . ILE B 1 51  ? 27.796 170.913 8.741   1.00 51.25  ? 83  ILE B CB    1 
ATOM   1536 C  CG1   . ILE B 1 51  ? 26.832 170.041 9.553   1.00 58.45  ? 83  ILE B CG1   1 
ATOM   1537 C  CG2   . ILE B 1 51  ? 29.056 171.176 9.551   1.00 48.08  ? 83  ILE B CG2   1 
ATOM   1538 C  CD1   . ILE B 1 51  ? 25.700 169.435 8.749   1.00 61.94  ? 83  ILE B CD1   1 
ATOM   1539 N  N     . LYS B 1 52  ? 28.223 174.281 9.025   1.00 55.78  ? 84  LYS B N     1 
ATOM   1540 C  CA    . LYS B 1 52  ? 29.173 175.380 8.919   1.00 58.90  ? 84  LYS B CA    1 
ATOM   1541 C  C     . LYS B 1 52  ? 30.605 174.868 9.025   1.00 62.43  ? 84  LYS B C     1 
ATOM   1542 O  O     . LYS B 1 52  ? 30.926 174.041 9.883   1.00 60.59  ? 84  LYS B O     1 
ATOM   1543 C  CB    . LYS B 1 52  ? 28.898 176.411 10.015  1.00 61.98  ? 84  LYS B CB    1 
ATOM   1544 C  CG    . LYS B 1 52  ? 30.061 177.341 10.323  1.00 68.70  ? 84  LYS B CG    1 
ATOM   1545 C  CD    . LYS B 1 52  ? 30.339 178.295 9.171   1.00 69.65  ? 84  LYS B CD    1 
ATOM   1546 C  CE    . LYS B 1 52  ? 30.770 179.662 9.677   1.00 75.05  ? 84  LYS B CE    1 
ATOM   1547 N  NZ    . LYS B 1 52  ? 31.091 180.580 8.550   1.00 71.82  ? 84  LYS B NZ    1 
ATOM   1548 N  N     . GLN B 1 53  ? 31.464 175.366 8.141   1.00 62.68  ? 85  GLN B N     1 
ATOM   1549 C  CA    . GLN B 1 53  ? 32.882 175.044 8.130   1.00 65.46  ? 85  GLN B CA    1 
ATOM   1550 C  C     . GLN B 1 53  ? 33.670 176.309 7.827   1.00 73.79  ? 85  GLN B C     1 
ATOM   1551 O  O     . GLN B 1 53  ? 33.156 177.217 7.162   1.00 72.60  ? 85  GLN B O     1 
ATOM   1552 C  CB    . GLN B 1 53  ? 33.208 173.953 7.095   1.00 64.88  ? 85  GLN B CB    1 
ATOM   1553 C  CG    . GLN B 1 53  ? 32.567 172.599 7.391   1.00 57.67  ? 85  GLN B CG    1 
ATOM   1554 C  CD    . GLN B 1 53  ? 33.077 171.964 8.675   1.00 66.08  ? 85  GLN B CD    1 
ATOM   1555 O  OE1   . GLN B 1 53  ? 34.104 172.368 9.221   1.00 75.38  ? 85  GLN B OE1   1 
ATOM   1556 N  NE2   . GLN B 1 53  ? 32.359 170.957 9.159   1.00 61.87  ? 85  GLN B NE2   1 
ATOM   1557 N  N     . PRO B 1 54  ? 34.911 176.402 8.309   1.00 76.88  ? 86  PRO B N     1 
ATOM   1558 C  CA    . PRO B 1 54  ? 35.676 177.646 8.153   1.00 80.99  ? 86  PRO B CA    1 
ATOM   1559 C  C     . PRO B 1 54  ? 35.921 178.000 6.693   1.00 78.91  ? 86  PRO B C     1 
ATOM   1560 O  O     . PRO B 1 54  ? 35.905 177.149 5.801   1.00 75.21  ? 86  PRO B O     1 
ATOM   1561 C  CB    . PRO B 1 54  ? 36.994 177.348 8.880   1.00 80.10  ? 86  PRO B CB    1 
ATOM   1562 C  CG    . PRO B 1 54  ? 36.666 176.237 9.822   1.00 80.38  ? 86  PRO B CG    1 
ATOM   1563 C  CD    . PRO B 1 54  ? 35.633 175.410 9.124   1.00 76.42  ? 86  PRO B CD    1 
ATOM   1564 N  N     . ASP B 1 55  ? 36.159 179.295 6.462   1.00 79.98  ? 87  ASP B N     1 
ATOM   1565 C  CA    . ASP B 1 55  ? 36.367 179.785 5.103   1.00 84.60  ? 87  ASP B CA    1 
ATOM   1566 C  C     . ASP B 1 55  ? 37.676 179.284 4.510   1.00 83.49  ? 87  ASP B C     1 
ATOM   1567 O  O     . ASP B 1 55  ? 37.767 179.090 3.293   1.00 85.08  ? 87  ASP B O     1 
ATOM   1568 C  CB    . ASP B 1 55  ? 36.337 181.313 5.085   1.00 92.30  ? 87  ASP B CB    1 
ATOM   1569 C  CG    . ASP B 1 55  ? 34.934 181.870 5.199   1.00 99.36  ? 87  ASP B CG    1 
ATOM   1570 O  OD1   . ASP B 1 55  ? 34.556 182.306 6.306   1.00 103.97 ? 87  ASP B OD1   1 
ATOM   1571 O  OD2   . ASP B 1 55  ? 34.211 181.873 4.181   1.00 101.08 ? 87  ASP B OD2   1 
ATOM   1572 N  N     . GLU B 1 56  ? 38.699 179.077 5.344   1.00 83.85  ? 88  GLU B N     1 
ATOM   1573 C  CA    . GLU B 1 56  ? 39.993 178.642 4.828   1.00 84.23  ? 88  GLU B CA    1 
ATOM   1574 C  C     . GLU B 1 56  ? 39.906 177.250 4.211   1.00 76.38  ? 88  GLU B C     1 
ATOM   1575 O  O     . GLU B 1 56  ? 40.491 176.997 3.151   1.00 74.52  ? 88  GLU B O     1 
ATOM   1576 C  CB    . GLU B 1 56  ? 41.040 178.678 5.942   1.00 92.83  ? 88  GLU B CB    1 
ATOM   1577 C  CG    . GLU B 1 56  ? 40.598 178.022 7.241   1.00 97.59  ? 88  GLU B CG    1 
ATOM   1578 C  CD    . GLU B 1 56  ? 41.286 178.614 8.456   1.00 106.23 ? 88  GLU B CD    1 
ATOM   1579 O  OE1   . GLU B 1 56  ? 40.581 178.979 9.420   1.00 108.41 ? 88  GLU B OE1   1 
ATOM   1580 O  OE2   . GLU B 1 56  ? 42.530 178.717 8.445   1.00 108.03 ? 88  GLU B OE2   1 
ATOM   1581 N  N     . LEU B 1 57  ? 39.170 176.339 4.852   1.00 73.73  ? 89  LEU B N     1 
ATOM   1582 C  CA    . LEU B 1 57  ? 39.026 174.993 4.309   1.00 69.13  ? 89  LEU B CA    1 
ATOM   1583 C  C     . LEU B 1 57  ? 38.258 175.007 2.994   1.00 63.34  ? 89  LEU B C     1 
ATOM   1584 O  O     . LEU B 1 57  ? 38.591 174.261 2.065   1.00 65.38  ? 89  LEU B O     1 
ATOM   1585 C  CB    . LEU B 1 57  ? 38.332 174.089 5.326   1.00 73.39  ? 89  LEU B CB    1 
ATOM   1586 C  CG    . LEU B 1 57  ? 38.295 172.599 4.978   1.00 74.63  ? 89  LEU B CG    1 
ATOM   1587 C  CD1   . LEU B 1 57  ? 39.643 171.949 5.247   1.00 76.61  ? 89  LEU B CD1   1 
ATOM   1588 C  CD2   . LEU B 1 57  ? 37.191 171.895 5.748   1.00 77.52  ? 89  LEU B CD2   1 
ATOM   1589 N  N     . LEU B 1 58  ? 37.225 175.847 2.897   1.00 59.18  ? 90  LEU B N     1 
ATOM   1590 C  CA    . LEU B 1 58  ? 36.462 175.940 1.657   1.00 63.67  ? 90  LEU B CA    1 
ATOM   1591 C  C     . LEU B 1 58  ? 37.300 176.542 0.536   1.00 69.22  ? 90  LEU B C     1 
ATOM   1592 O  O     . LEU B 1 58  ? 37.217 176.098 -0.615  1.00 67.96  ? 90  LEU B O     1 
ATOM   1593 C  CB    . LEU B 1 58  ? 35.194 176.763 1.882   1.00 68.68  ? 90  LEU B CB    1 
ATOM   1594 C  CG    . LEU B 1 58  ? 34.193 176.203 2.894   1.00 61.58  ? 90  LEU B CG    1 
ATOM   1595 C  CD1   . LEU B 1 58  ? 33.093 177.214 3.168   1.00 59.15  ? 90  LEU B CD1   1 
ATOM   1596 C  CD2   . LEU B 1 58  ? 33.611 174.888 2.400   1.00 54.83  ? 90  LEU B CD2   1 
ATOM   1597 N  N     . ASP B 1 59  ? 38.114 177.552 0.852   1.00 73.88  ? 91  ASP B N     1 
ATOM   1598 C  CA    . ASP B 1 59  ? 38.997 178.137 -0.150  1.00 80.65  ? 91  ASP B CA    1 
ATOM   1599 C  C     . ASP B 1 59  ? 40.165 177.221 -0.497  1.00 81.05  ? 91  ASP B C     1 
ATOM   1600 O  O     . ASP B 1 59  ? 40.808 177.424 -1.532  1.00 84.09  ? 91  ASP B O     1 
ATOM   1601 C  CB    . ASP B 1 59  ? 39.526 179.489 0.334   1.00 87.29  ? 91  ASP B CB    1 
ATOM   1602 C  CG    . ASP B 1 59  ? 38.416 180.477 0.638   1.00 96.15  ? 91  ASP B CG    1 
ATOM   1603 O  OD1   . ASP B 1 59  ? 37.308 180.321 0.082   1.00 98.86  ? 91  ASP B OD1   1 
ATOM   1604 O  OD2   . ASP B 1 59  ? 38.652 181.411 1.433   1.00 101.48 ? 91  ASP B OD2   1 
ATOM   1605 N  N     . SER B 1 60  ? 40.453 176.227 0.343   1.00 79.05  ? 92  SER B N     1 
ATOM   1606 C  CA    . SER B 1 60  ? 41.541 175.287 0.115   1.00 82.04  ? 92  SER B CA    1 
ATOM   1607 C  C     . SER B 1 60  ? 41.069 173.956 -0.461  1.00 75.20  ? 92  SER B C     1 
ATOM   1608 O  O     . SER B 1 60  ? 41.846 172.997 -0.487  1.00 78.87  ? 92  SER B O     1 
ATOM   1609 C  CB    . SER B 1 60  ? 42.303 175.042 1.420   1.00 90.45  ? 92  SER B CB    1 
ATOM   1610 O  OG    . SER B 1 60  ? 41.662 174.048 2.203   1.00 95.81  ? 92  SER B OG    1 
ATOM   1611 N  N     . MET B 1 61  ? 39.822 173.873 -0.917  1.00 69.77  ? 93  MET B N     1 
ATOM   1612 C  CA    . MET B 1 61  ? 39.300 172.618 -1.437  1.00 67.99  ? 93  MET B CA    1 
ATOM   1613 C  C     . MET B 1 61  ? 39.945 172.272 -2.776  1.00 70.98  ? 93  MET B C     1 
ATOM   1614 O  O     . MET B 1 61  ? 40.576 173.106 -3.430  1.00 74.33  ? 93  MET B O     1 
ATOM   1615 C  CB    . MET B 1 61  ? 37.781 172.688 -1.599  1.00 63.29  ? 93  MET B CB    1 
ATOM   1616 C  CG    . MET B 1 61  ? 37.008 172.575 -0.297  1.00 61.04  ? 93  MET B CG    1 
ATOM   1617 S  SD    . MET B 1 61  ? 35.232 172.391 -0.558  1.00 61.87  ? 93  MET B SD    1 
ATOM   1618 C  CE    . MET B 1 61  ? 34.849 173.919 -1.412  1.00 63.97  ? 93  MET B CE    1 
ATOM   1619 N  N     . SER B 1 62  ? 39.776 171.015 -3.181  1.00 65.39  ? 94  SER B N     1 
ATOM   1620 C  CA    . SER B 1 62  ? 40.297 170.560 -4.459  1.00 70.99  ? 94  SER B CA    1 
ATOM   1621 C  C     . SER B 1 62  ? 39.520 171.201 -5.608  1.00 81.49  ? 94  SER B C     1 
ATOM   1622 O  O     . SER B 1 62  ? 38.464 171.813 -5.422  1.00 84.20  ? 94  SER B O     1 
ATOM   1623 C  CB    . SER B 1 62  ? 40.231 169.036 -4.552  1.00 65.93  ? 94  SER B CB    1 
ATOM   1624 O  OG    . SER B 1 62  ? 38.889 168.581 -4.536  1.00 59.94  ? 94  SER B OG    1 
ATOM   1625 N  N     . ASP B 1 63  ? 40.063 171.050 -6.819  1.00 85.32  ? 95  ASP B N     1 
ATOM   1626 C  CA    . ASP B 1 63  ? 39.427 171.641 -7.993  1.00 86.65  ? 95  ASP B CA    1 
ATOM   1627 C  C     . ASP B 1 63  ? 38.049 171.038 -8.238  1.00 78.24  ? 95  ASP B C     1 
ATOM   1628 O  O     . ASP B 1 63  ? 37.086 171.765 -8.511  1.00 80.51  ? 95  ASP B O     1 
ATOM   1629 C  CB    . ASP B 1 63  ? 40.321 171.462 -9.220  1.00 95.48  ? 95  ASP B CB    1 
ATOM   1630 C  CG    . ASP B 1 63  ? 41.637 172.206 -9.094  1.00 103.14 ? 95  ASP B CG    1 
ATOM   1631 O  OD1   . ASP B 1 63  ? 42.390 171.927 -8.137  1.00 104.69 ? 95  ASP B OD1   1 
ATOM   1632 O  OD2   . ASP B 1 63  ? 41.917 173.071 -9.950  1.00 107.61 ? 95  ASP B OD2   1 
ATOM   1633 N  N     . TRP B 1 64  ? 37.936 169.710 -8.142  1.00 68.33  ? 96  TRP B N     1 
ATOM   1634 C  CA    . TRP B 1 64  ? 36.635 169.061 -8.269  1.00 65.79  ? 96  TRP B CA    1 
ATOM   1635 C  C     . TRP B 1 64  ? 35.657 169.599 -7.233  1.00 65.75  ? 96  TRP B C     1 
ATOM   1636 O  O     . TRP B 1 64  ? 34.535 170.000 -7.568  1.00 63.40  ? 96  TRP B O     1 
ATOM   1637 C  CB    . TRP B 1 64  ? 36.790 167.546 -8.121  1.00 62.96  ? 96  TRP B CB    1 
ATOM   1638 C  CG    . TRP B 1 64  ? 35.541 166.759 -8.422  1.00 66.30  ? 96  TRP B CG    1 
ATOM   1639 C  CD1   . TRP B 1 64  ? 35.251 166.098 -9.580  1.00 66.72  ? 96  TRP B CD1   1 
ATOM   1640 C  CD2   . TRP B 1 64  ? 34.422 166.544 -7.549  1.00 67.12  ? 96  TRP B CD2   1 
ATOM   1641 N  NE1   . TRP B 1 64  ? 34.024 165.489 -9.485  1.00 69.39  ? 96  TRP B NE1   1 
ATOM   1642 C  CE2   . TRP B 1 64  ? 33.493 165.747 -8.248  1.00 69.30  ? 96  TRP B CE2   1 
ATOM   1643 C  CE3   . TRP B 1 64  ? 34.114 166.949 -6.246  1.00 68.06  ? 96  TRP B CE3   1 
ATOM   1644 C  CZ2   . TRP B 1 64  ? 32.281 165.348 -7.689  1.00 68.18  ? 96  TRP B CZ2   1 
ATOM   1645 C  CZ3   . TRP B 1 64  ? 32.910 166.552 -5.693  1.00 67.76  ? 96  TRP B CZ3   1 
ATOM   1646 C  CH2   . TRP B 1 64  ? 32.009 165.760 -6.413  1.00 66.62  ? 96  TRP B CH2   1 
ATOM   1647 N  N     . CYS B 1 65  ? 36.070 169.610 -5.964  1.00 65.86  ? 97  CYS B N     1 
ATOM   1648 C  CA    . CYS B 1 65  ? 35.181 170.041 -4.891  1.00 62.50  ? 97  CYS B CA    1 
ATOM   1649 C  C     . CYS B 1 65  ? 34.808 171.509 -5.041  1.00 68.19  ? 97  CYS B C     1 
ATOM   1650 O  O     . CYS B 1 65  ? 33.633 171.869 -4.934  1.00 67.95  ? 97  CYS B O     1 
ATOM   1651 C  CB    . CYS B 1 65  ? 35.832 169.781 -3.533  1.00 61.45  ? 97  CYS B CB    1 
ATOM   1652 S  SG    . CYS B 1 65  ? 35.640 168.085 -2.941  1.00 58.60  ? 97  CYS B SG    1 
ATOM   1653 N  N     . LYS B 1 66  ? 35.794 172.373 -5.291  1.00 66.09  ? 98  LYS B N     1 
ATOM   1654 C  CA    . LYS B 1 66  ? 35.497 173.792 -5.465  1.00 68.82  ? 98  LYS B CA    1 
ATOM   1655 C  C     . LYS B 1 66  ? 34.519 174.006 -6.614  1.00 67.66  ? 98  LYS B C     1 
ATOM   1656 O  O     . LYS B 1 66  ? 33.478 174.650 -6.444  1.00 64.60  ? 98  LYS B O     1 
ATOM   1657 C  CB    . LYS B 1 66  ? 36.789 174.578 -5.691  1.00 69.11  ? 98  LYS B CB    1 
ATOM   1658 C  CG    . LYS B 1 66  ? 37.498 174.967 -4.402  1.00 70.89  ? 98  LYS B CG    1 
ATOM   1659 C  CD    . LYS B 1 66  ? 38.296 176.252 -4.556  1.00 75.19  ? 98  LYS B CD    1 
ATOM   1660 C  CE    . LYS B 1 66  ? 39.766 175.964 -4.818  1.00 75.38  ? 98  LYS B CE    1 
ATOM   1661 N  NZ    . LYS B 1 66  ? 40.651 176.932 -4.112  1.00 83.07  ? 98  LYS B NZ    1 
ATOM   1662 N  N     . GLU B 1 67  ? 34.819 173.432 -7.783  1.00 71.72  ? 99  GLU B N     1 
ATOM   1663 C  CA    . GLU B 1 67  ? 33.950 173.594 -8.945  1.00 79.27  ? 99  GLU B CA    1 
ATOM   1664 C  C     . GLU B 1 67  ? 32.529 173.123 -8.649  1.00 72.19  ? 99  GLU B C     1 
ATOM   1665 O  O     . GLU B 1 67  ? 31.560 173.868 -8.850  1.00 72.30  ? 99  GLU B O     1 
ATOM   1666 C  CB    . GLU B 1 67  ? 34.533 172.832 -10.136 1.00 88.86  ? 99  GLU B CB    1 
ATOM   1667 C  CG    . GLU B 1 67  ? 33.854 173.121 -11.468 1.00 100.35 ? 99  GLU B CG    1 
ATOM   1668 C  CD    . GLU B 1 67  ? 33.556 171.855 -12.251 1.00 107.16 ? 99  GLU B CD    1 
ATOM   1669 O  OE1   . GLU B 1 67  ? 32.403 171.692 -12.703 1.00 108.87 ? 99  GLU B OE1   1 
ATOM   1670 O  OE2   . GLU B 1 67  ? 34.472 171.021 -12.410 1.00 108.17 ? 99  GLU B OE2   1 
ATOM   1671 N  N     . HIS B 1 68  ? 32.383 171.892 -8.149  1.00 65.12  ? 100 HIS B N     1 
ATOM   1672 C  CA    . HIS B 1 68  ? 31.053 171.308 -8.009  1.00 66.90  ? 100 HIS B CA    1 
ATOM   1673 C  C     . HIS B 1 68  ? 30.270 171.961 -6.874  1.00 60.44  ? 100 HIS B C     1 
ATOM   1674 O  O     . HIS B 1 68  ? 29.102 172.326 -7.048  1.00 58.61  ? 100 HIS B O     1 
ATOM   1675 C  CB    . HIS B 1 68  ? 31.166 169.798 -7.804  1.00 71.68  ? 100 HIS B CB    1 
ATOM   1676 C  CG    . HIS B 1 68  ? 31.534 169.052 -9.049  1.00 80.55  ? 100 HIS B CG    1 
ATOM   1677 N  ND1   . HIS B 1 68  ? 32.837 168.914 -9.476  1.00 84.20  ? 100 HIS B ND1   1 
ATOM   1678 C  CD2   . HIS B 1 68  ? 30.768 168.414 -9.966  1.00 83.13  ? 100 HIS B CD2   1 
ATOM   1679 C  CE1   . HIS B 1 68  ? 32.859 168.219 -10.599 1.00 84.09  ? 100 HIS B CE1   1 
ATOM   1680 N  NE2   . HIS B 1 68  ? 31.617 167.902 -10.918 1.00 83.45  ? 100 HIS B NE2   1 
ATOM   1681 N  N     . HIS B 1 69  ? 30.888 172.114 -5.699  1.00 57.21  ? 101 HIS B N     1 
ATOM   1682 C  CA    . HIS B 1 69  ? 30.223 172.772 -4.584  1.00 54.97  ? 101 HIS B CA    1 
ATOM   1683 C  C     . HIS B 1 69  ? 30.024 174.266 -4.811  1.00 61.73  ? 101 HIS B C     1 
ATOM   1684 O  O     . HIS B 1 69  ? 29.313 174.901 -4.025  1.00 69.69  ? 101 HIS B O     1 
ATOM   1685 C  CB    . HIS B 1 69  ? 31.017 172.542 -3.295  1.00 46.42  ? 101 HIS B CB    1 
ATOM   1686 C  CG    . HIS B 1 69  ? 31.090 171.106 -2.878  1.00 52.53  ? 101 HIS B CG    1 
ATOM   1687 N  ND1   . HIS B 1 69  ? 30.229 170.145 -3.363  1.00 51.90  ? 101 HIS B ND1   1 
ATOM   1688 C  CD2   . HIS B 1 69  ? 31.922 170.468 -2.021  1.00 55.65  ? 101 HIS B CD2   1 
ATOM   1689 C  CE1   . HIS B 1 69  ? 30.527 168.976 -2.823  1.00 50.55  ? 101 HIS B CE1   1 
ATOM   1690 N  NE2   . HIS B 1 69  ? 31.551 169.145 -2.005  1.00 48.60  ? 101 HIS B NE2   1 
ATOM   1691 N  N     . GLY B 1 70  ? 30.628 174.843 -5.850  1.00 61.16  ? 102 GLY B N     1 
ATOM   1692 C  CA    . GLY B 1 70  ? 30.305 176.205 -6.214  1.00 54.63  ? 102 GLY B CA    1 
ATOM   1693 C  C     . GLY B 1 70  ? 29.143 176.278 -7.181  1.00 58.93  ? 102 GLY B C     1 
ATOM   1694 O  O     . GLY B 1 70  ? 28.245 177.110 -7.017  1.00 67.05  ? 102 GLY B O     1 
ATOM   1695 N  N     . LYS B 1 71  ? 29.144 175.405 -8.194  1.00 61.55  ? 103 LYS B N     1 
ATOM   1696 C  CA    . LYS B 1 71  ? 28.059 175.425 -9.171  1.00 69.18  ? 103 LYS B CA    1 
ATOM   1697 C  C     . LYS B 1 71  ? 26.727 175.025 -8.547  1.00 67.55  ? 103 LYS B C     1 
ATOM   1698 O  O     . LYS B 1 71  ? 25.673 175.494 -8.991  1.00 73.01  ? 103 LYS B O     1 
ATOM   1699 C  CB    . LYS B 1 71  ? 28.393 174.514 -10.355 1.00 74.10  ? 103 LYS B CB    1 
ATOM   1700 C  CG    . LYS B 1 71  ? 28.222 173.030 -10.078 1.00 81.01  ? 103 LYS B CG    1 
ATOM   1701 C  CD    . LYS B 1 71  ? 28.531 172.189 -11.304 1.00 84.28  ? 103 LYS B CD    1 
ATOM   1702 C  CE    . LYS B 1 71  ? 27.838 170.838 -11.222 1.00 84.12  ? 103 LYS B CE    1 
ATOM   1703 N  NZ    . LYS B 1 71  ? 27.723 170.360 -9.815  1.00 83.07  ? 103 LYS B NZ    1 
ATOM   1704 N  N     . SER B 1 72  ? 26.749 174.176 -7.520  1.00 62.04  ? 104 SER B N     1 
ATOM   1705 C  CA    . SER B 1 72  ? 25.528 173.753 -6.847  1.00 60.00  ? 104 SER B CA    1 
ATOM   1706 C  C     . SER B 1 72  ? 25.076 174.729 -5.771  1.00 63.76  ? 104 SER B C     1 
ATOM   1707 O  O     . SER B 1 72  ? 24.022 174.510 -5.164  1.00 64.14  ? 104 SER B O     1 
ATOM   1708 C  CB    . SER B 1 72  ? 25.721 172.365 -6.229  1.00 64.53  ? 104 SER B CB    1 
ATOM   1709 O  OG    . SER B 1 72  ? 26.522 172.437 -5.062  1.00 64.84  ? 104 SER B OG    1 
ATOM   1710 N  N     . GLY B 1 73  ? 25.836 175.793 -5.522  1.00 63.21  ? 105 GLY B N     1 
ATOM   1711 C  CA    . GLY B 1 73  ? 25.510 176.713 -4.452  1.00 73.50  ? 105 GLY B CA    1 
ATOM   1712 C  C     . GLY B 1 73  ? 25.750 176.178 -3.061  1.00 68.26  ? 105 GLY B C     1 
ATOM   1713 O  O     . GLY B 1 73  ? 25.290 176.788 -2.091  1.00 66.23  ? 105 GLY B O     1 
ATOM   1714 N  N     . LEU B 1 74  ? 26.461 175.055 -2.931  1.00 62.74  ? 106 LEU B N     1 
ATOM   1715 C  CA    . LEU B 1 74  ? 26.683 174.468 -1.614  1.00 61.98  ? 106 LEU B CA    1 
ATOM   1716 C  C     . LEU B 1 74  ? 27.711 175.262 -0.816  1.00 61.69  ? 106 LEU B C     1 
ATOM   1717 O  O     . LEU B 1 74  ? 27.575 175.407 0.403   1.00 61.39  ? 106 LEU B O     1 
ATOM   1718 C  CB    . LEU B 1 74  ? 27.121 173.010 -1.755  1.00 60.85  ? 106 LEU B CB    1 
ATOM   1719 C  CG    . LEU B 1 74  ? 27.369 172.249 -0.451  1.00 56.38  ? 106 LEU B CG    1 
ATOM   1720 C  CD1   . LEU B 1 74  ? 26.175 172.383 0.483   1.00 57.07  ? 106 LEU B CD1   1 
ATOM   1721 C  CD2   . LEU B 1 74  ? 27.674 170.785 -0.728  1.00 56.68  ? 106 LEU B CD2   1 
ATOM   1722 N  N     . THR B 1 75  ? 28.746 175.782 -1.483  1.00 61.22  ? 107 THR B N     1 
ATOM   1723 C  CA    . THR B 1 75  ? 29.771 176.546 -0.776  1.00 58.59  ? 107 THR B CA    1 
ATOM   1724 C  C     . THR B 1 75  ? 29.189 177.814 -0.160  1.00 61.12  ? 107 THR B C     1 
ATOM   1725 O  O     . THR B 1 75  ? 29.500 178.159 0.988   1.00 65.29  ? 107 THR B O     1 
ATOM   1726 C  CB    . THR B 1 75  ? 30.919 176.892 -1.726  1.00 57.68  ? 107 THR B CB    1 
ATOM   1727 O  OG1   . THR B 1 75  ? 31.479 175.687 -2.262  1.00 51.62  ? 107 THR B OG1   1 
ATOM   1728 C  CG2   . THR B 1 75  ? 32.005 177.667 -0.994  1.00 59.08  ? 107 THR B CG2   1 
ATOM   1729 N  N     . LYS B 1 76  ? 28.337 178.519 -0.909  1.00 61.84  ? 108 LYS B N     1 
ATOM   1730 C  CA    . LYS B 1 76  ? 27.697 179.715 -0.373  1.00 66.08  ? 108 LYS B CA    1 
ATOM   1731 C  C     . LYS B 1 76  ? 26.783 179.371 0.796   1.00 64.15  ? 108 LYS B C     1 
ATOM   1732 O  O     . LYS B 1 76  ? 26.699 180.125 1.771   1.00 64.70  ? 108 LYS B O     1 
ATOM   1733 C  CB    . LYS B 1 76  ? 26.918 180.431 -1.477  1.00 64.52  ? 108 LYS B CB    1 
ATOM   1734 C  CG    . LYS B 1 76  ? 26.188 181.681 -1.014  1.00 73.46  ? 108 LYS B CG    1 
ATOM   1735 C  CD    . LYS B 1 76  ? 25.242 182.196 -2.086  1.00 77.82  ? 108 LYS B CD    1 
ATOM   1736 C  CE    . LYS B 1 76  ? 23.862 182.479 -1.513  1.00 79.41  ? 108 LYS B CE    1 
ATOM   1737 N  NZ    . LYS B 1 76  ? 23.248 181.257 -0.921  1.00 75.64  ? 108 LYS B NZ    1 
ATOM   1738 N  N     . ALA B 1 77  ? 26.097 178.228 0.721   1.00 63.60  ? 109 ALA B N     1 
ATOM   1739 C  CA    . ALA B 1 77  ? 25.238 177.811 1.825   1.00 64.68  ? 109 ALA B CA    1 
ATOM   1740 C  C     . ALA B 1 77  ? 26.058 177.471 3.064   1.00 63.38  ? 109 ALA B C     1 
ATOM   1741 O  O     . ALA B 1 77  ? 25.650 177.782 4.189   1.00 65.36  ? 109 ALA B O     1 
ATOM   1742 C  CB    . ALA B 1 77  ? 24.380 176.619 1.403   1.00 60.76  ? 109 ALA B CB    1 
ATOM   1743 N  N     . VAL B 1 78  ? 27.215 176.832 2.876   1.00 57.46  ? 110 VAL B N     1 
ATOM   1744 C  CA    . VAL B 1 78  ? 28.094 176.531 4.003   1.00 53.50  ? 110 VAL B CA    1 
ATOM   1745 C  C     . VAL B 1 78  ? 28.602 177.820 4.633   1.00 56.69  ? 110 VAL B C     1 
ATOM   1746 O  O     . VAL B 1 78  ? 28.672 177.943 5.863   1.00 63.80  ? 110 VAL B O     1 
ATOM   1747 C  CB    . VAL B 1 78  ? 29.255 175.624 3.551   1.00 52.59  ? 110 VAL B CB    1 
ATOM   1748 C  CG1   . VAL B 1 78  ? 30.258 175.438 4.678   1.00 59.28  ? 110 VAL B CG1   1 
ATOM   1749 C  CG2   . VAL B 1 78  ? 28.727 174.278 3.088   1.00 43.39  ? 110 VAL B CG2   1 
ATOM   1750 N  N     . LYS B 1 79  ? 28.963 178.802 3.801   1.00 64.79  ? 111 LYS B N     1 
ATOM   1751 C  CA    . LYS B 1 79  ? 29.316 180.119 4.327   1.00 70.78  ? 111 LYS B CA    1 
ATOM   1752 C  C     . LYS B 1 79  ? 28.147 180.752 5.069   1.00 69.83  ? 111 LYS B C     1 
ATOM   1753 O  O     . LYS B 1 79  ? 28.352 181.498 6.034   1.00 68.00  ? 111 LYS B O     1 
ATOM   1754 C  CB    . LYS B 1 79  ? 29.776 181.041 3.196   1.00 76.93  ? 111 LYS B CB    1 
ATOM   1755 C  CG    . LYS B 1 79  ? 31.061 180.620 2.508   1.00 79.96  ? 111 LYS B CG    1 
ATOM   1756 C  CD    . LYS B 1 79  ? 31.498 181.676 1.506   1.00 86.32  ? 111 LYS B CD    1 
ATOM   1757 C  CE    . LYS B 1 79  ? 32.591 181.158 0.589   1.00 87.34  ? 111 LYS B CE    1 
ATOM   1758 N  NZ    . LYS B 1 79  ? 33.828 180.811 1.338   1.00 86.36  ? 111 LYS B NZ    1 
ATOM   1759 N  N     . GLU B 1 80  ? 26.919 180.461 4.637   1.00 69.52  ? 112 GLU B N     1 
ATOM   1760 C  CA    . GLU B 1 80  ? 25.724 181.041 5.235   1.00 77.13  ? 112 GLU B CA    1 
ATOM   1761 C  C     . GLU B 1 80  ? 25.258 180.302 6.482   1.00 72.63  ? 112 GLU B C     1 
ATOM   1762 O  O     . GLU B 1 80  ? 24.581 180.903 7.323   1.00 67.59  ? 112 GLU B O     1 
ATOM   1763 C  CB    . GLU B 1 80  ? 24.591 181.051 4.207   1.00 89.29  ? 112 GLU B CB    1 
ATOM   1764 C  CG    . GLU B 1 80  ? 23.464 182.017 4.512   1.00 103.40 ? 112 GLU B CG    1 
ATOM   1765 C  CD    . GLU B 1 80  ? 23.131 182.903 3.333   1.00 114.75 ? 112 GLU B CD    1 
ATOM   1766 O  OE1   . GLU B 1 80  ? 22.063 183.549 3.356   1.00 119.31 ? 112 GLU B OE1   1 
ATOM   1767 O  OE2   . GLU B 1 80  ? 23.939 182.951 2.381   1.00 116.65 ? 112 GLU B OE2   1 
ATOM   1768 N  N     . SER B 1 81  ? 25.606 179.026 6.624   1.00 68.66  ? 113 SER B N     1 
ATOM   1769 C  CA    . SER B 1 81  ? 25.040 178.201 7.682   1.00 63.99  ? 113 SER B CA    1 
ATOM   1770 C  C     . SER B 1 81  ? 25.527 178.634 9.061   1.00 68.84  ? 113 SER B C     1 
ATOM   1771 O  O     . SER B 1 81  ? 26.650 179.119 9.231   1.00 65.92  ? 113 SER B O     1 
ATOM   1772 C  CB    . SER B 1 81  ? 25.389 176.728 7.454   1.00 56.39  ? 113 SER B CB    1 
ATOM   1773 O  OG    . SER B 1 81  ? 25.142 175.958 8.617   1.00 61.80  ? 113 SER B OG    1 
ATOM   1774 N  N     . THR B 1 82  ? 24.657 178.447 10.053  1.00 70.37  ? 114 THR B N     1 
ATOM   1775 C  CA    . THR B 1 82  ? 25.001 178.605 11.460  1.00 74.83  ? 114 THR B CA    1 
ATOM   1776 C  C     . THR B 1 82  ? 24.927 177.283 12.213  1.00 75.13  ? 114 THR B C     1 
ATOM   1777 O  O     . THR B 1 82  ? 24.980 177.275 13.448  1.00 78.81  ? 114 THR B O     1 
ATOM   1778 C  CB    . THR B 1 82  ? 24.086 179.636 12.124  1.00 71.41  ? 114 THR B CB    1 
ATOM   1779 O  OG1   . THR B 1 82  ? 22.717 179.256 11.934  1.00 70.01  ? 114 THR B OG1   1 
ATOM   1780 C  CG2   . THR B 1 82  ? 24.311 181.017 11.524  1.00 69.00  ? 114 THR B CG2   1 
ATOM   1781 N  N     . ILE B 1 83  ? 24.804 176.170 11.498  1.00 68.13  ? 115 ILE B N     1 
ATOM   1782 C  CA    . ILE B 1 83  ? 24.666 174.853 12.108  1.00 62.48  ? 115 ILE B CA    1 
ATOM   1783 C  C     . ILE B 1 83  ? 26.054 174.262 12.314  1.00 61.41  ? 115 ILE B C     1 
ATOM   1784 O  O     . ILE B 1 83  ? 26.786 174.020 11.349  1.00 55.84  ? 115 ILE B O     1 
ATOM   1785 C  CB    . ILE B 1 83  ? 23.799 173.929 11.239  1.00 58.37  ? 115 ILE B CB    1 
ATOM   1786 C  CG1   . ILE B 1 83  ? 22.378 174.483 11.124  1.00 56.96  ? 115 ILE B CG1   1 
ATOM   1787 C  CG2   . ILE B 1 83  ? 23.782 172.518 11.809  1.00 53.33  ? 115 ILE B CG2   1 
ATOM   1788 C  CD1   . ILE B 1 83  ? 21.461 173.634 10.269  1.00 55.66  ? 115 ILE B CD1   1 
ATOM   1789 N  N     . THR B 1 84  ? 26.415 174.031 13.572  1.00 59.06  ? 116 THR B N     1 
ATOM   1790 C  CA    . THR B 1 84  ? 27.682 173.395 13.886  1.00 52.75  ? 116 THR B CA    1 
ATOM   1791 C  C     . THR B 1 84  ? 27.577 171.883 13.696  1.00 50.79  ? 116 THR B C     1 
ATOM   1792 O  O     . THR B 1 84  ? 26.492 171.323 13.520  1.00 51.93  ? 116 THR B O     1 
ATOM   1793 C  CB    . THR B 1 84  ? 28.107 173.722 15.316  1.00 58.18  ? 116 THR B CB    1 
ATOM   1794 O  OG1   . THR B 1 84  ? 27.287 172.991 16.236  1.00 59.34  ? 116 THR B OG1   1 
ATOM   1795 C  CG2   . THR B 1 84  ? 27.958 175.211 15.588  1.00 53.29  ? 116 THR B CG2   1 
ATOM   1796 N  N     . LEU B 1 85  ? 28.735 171.220 13.730  1.00 49.64  ? 117 LEU B N     1 
ATOM   1797 C  CA    . LEU B 1 85  ? 28.755 169.765 13.613  1.00 51.99  ? 117 LEU B CA    1 
ATOM   1798 C  C     . LEU B 1 85  ? 28.048 169.112 14.794  1.00 47.23  ? 117 LEU B C     1 
ATOM   1799 O  O     . LEU B 1 85  ? 27.365 168.091 14.637  1.00 47.74  ? 117 LEU B O     1 
ATOM   1800 C  CB    . LEU B 1 85  ? 30.198 169.271 13.509  1.00 55.95  ? 117 LEU B CB    1 
ATOM   1801 C  CG    . LEU B 1 85  ? 30.418 167.762 13.396  1.00 53.06  ? 117 LEU B CG    1 
ATOM   1802 C  CD1   . LEU B 1 85  ? 29.987 167.261 12.028  1.00 47.71  ? 117 LEU B CD1   1 
ATOM   1803 C  CD2   . LEU B 1 85  ? 31.873 167.407 13.668  1.00 56.35  ? 117 LEU B CD2   1 
ATOM   1804 N  N     . GLN B 1 86  ? 28.191 169.697 15.985  1.00 53.67  ? 118 GLN B N     1 
ATOM   1805 C  CA    . GLN B 1 86  ? 27.584 169.118 17.178  1.00 58.03  ? 118 GLN B CA    1 
ATOM   1806 C  C     . GLN B 1 86  ? 26.064 169.218 17.132  1.00 53.73  ? 118 GLN B C     1 
ATOM   1807 O  O     . GLN B 1 86  ? 25.365 168.266 17.496  1.00 57.18  ? 118 GLN B O     1 
ATOM   1808 C  CB    . GLN B 1 86  ? 28.137 169.803 18.429  1.00 68.03  ? 118 GLN B CB    1 
ATOM   1809 C  CG    . GLN B 1 86  ? 29.641 169.627 18.630  1.00 81.13  ? 118 GLN B CG    1 
ATOM   1810 C  CD    . GLN B 1 86  ? 30.470 170.526 17.727  1.00 92.18  ? 118 GLN B CD    1 
ATOM   1811 O  OE1   . GLN B 1 86  ? 30.046 171.624 17.365  1.00 98.96  ? 118 GLN B OE1   1 
ATOM   1812 N  NE2   . GLN B 1 86  ? 31.658 170.061 17.356  1.00 93.76  ? 118 GLN B NE2   1 
ATOM   1813 N  N     . GLN B 1 87  ? 25.533 170.359 16.684  1.00 49.88  ? 119 GLN B N     1 
ATOM   1814 C  CA    . GLN B 1 87  ? 24.085 170.495 16.549  1.00 50.51  ? 119 GLN B CA    1 
ATOM   1815 C  C     . GLN B 1 87  ? 23.536 169.527 15.507  1.00 43.38  ? 119 GLN B C     1 
ATOM   1816 O  O     . GLN B 1 87  ? 22.466 168.931 15.697  1.00 48.93  ? 119 GLN B O     1 
ATOM   1817 C  CB    . GLN B 1 87  ? 23.728 171.939 16.190  1.00 51.31  ? 119 GLN B CB    1 
ATOM   1818 C  CG    . GLN B 1 87  ? 22.470 172.079 15.348  1.00 64.48  ? 119 GLN B CG    1 
ATOM   1819 C  CD    . GLN B 1 87  ? 21.888 173.477 15.389  1.00 77.51  ? 119 GLN B CD    1 
ATOM   1820 O  OE1   . GLN B 1 87  ? 22.538 174.422 15.836  1.00 86.36  ? 119 GLN B OE1   1 
ATOM   1821 N  NE2   . GLN B 1 87  ? 20.652 173.615 14.921  1.00 79.78  ? 119 GLN B NE2   1 
ATOM   1822 N  N     . ALA B 1 88  ? 24.260 169.353 14.398  1.00 41.93  ? 120 ALA B N     1 
ATOM   1823 C  CA    . ALA B 1 88  ? 23.835 168.401 13.379  1.00 40.39  ? 120 ALA B CA    1 
ATOM   1824 C  C     . ALA B 1 88  ? 23.812 166.982 13.929  1.00 43.88  ? 120 ALA B C     1 
ATOM   1825 O  O     . ALA B 1 88  ? 22.862 166.227 13.683  1.00 42.58  ? 120 ALA B O     1 
ATOM   1826 C  CB    . ALA B 1 88  ? 24.753 168.489 12.160  1.00 38.21  ? 120 ALA B CB    1 
ATOM   1827 N  N     . GLU B 1 89  ? 24.853 166.596 14.673  1.00 45.68  ? 121 GLU B N     1 
ATOM   1828 C  CA    . GLU B 1 89  ? 24.859 165.266 15.270  1.00 46.07  ? 121 GLU B CA    1 
ATOM   1829 C  C     . GLU B 1 89  ? 23.728 165.114 16.277  1.00 36.79  ? 121 GLU B C     1 
ATOM   1830 O  O     . GLU B 1 89  ? 23.115 164.047 16.370  1.00 38.89  ? 121 GLU B O     1 
ATOM   1831 C  CB    . GLU B 1 89  ? 26.205 164.972 15.931  1.00 46.08  ? 121 GLU B CB    1 
ATOM   1832 C  CG    . GLU B 1 89  ? 26.374 163.500 16.288  1.00 45.89  ? 121 GLU B CG    1 
ATOM   1833 C  CD    . GLU B 1 89  ? 27.598 163.229 17.137  1.00 57.48  ? 121 GLU B CD    1 
ATOM   1834 O  OE1   . GLU B 1 89  ? 28.267 164.200 17.550  1.00 61.61  ? 121 GLU B OE1   1 
ATOM   1835 O  OE2   . GLU B 1 89  ? 27.889 162.042 17.393  1.00 57.44  ? 121 GLU B OE2   1 
ATOM   1836 N  N     . TYR B 1 90  ? 23.431 166.173 17.034  1.00 40.90  ? 122 TYR B N     1 
ATOM   1837 C  CA    . TYR B 1 90  ? 22.299 166.136 17.956  1.00 52.19  ? 122 TYR B CA    1 
ATOM   1838 C  C     . TYR B 1 90  ? 21.003 165.840 17.214  1.00 51.38  ? 122 TYR B C     1 
ATOM   1839 O  O     . TYR B 1 90  ? 20.239 164.947 17.601  1.00 50.74  ? 122 TYR B O     1 
ATOM   1840 C  CB    . TYR B 1 90  ? 22.207 167.464 18.716  1.00 45.45  ? 122 TYR B CB    1 
ATOM   1841 C  CG    . TYR B 1 90  ? 20.800 167.924 19.050  1.00 47.20  ? 122 TYR B CG    1 
ATOM   1842 C  CD1   . TYR B 1 90  ? 20.013 167.228 19.961  1.00 45.79  ? 122 TYR B CD1   1 
ATOM   1843 C  CD2   . TYR B 1 90  ? 20.266 169.066 18.467  1.00 53.87  ? 122 TYR B CD2   1 
ATOM   1844 C  CE1   . TYR B 1 90  ? 18.731 167.649 20.271  1.00 44.40  ? 122 TYR B CE1   1 
ATOM   1845 C  CE2   . TYR B 1 90  ? 18.986 169.496 18.772  1.00 56.73  ? 122 TYR B CE2   1 
ATOM   1846 C  CZ    . TYR B 1 90  ? 18.223 168.784 19.674  1.00 51.14  ? 122 TYR B CZ    1 
ATOM   1847 O  OH    . TYR B 1 90  ? 16.950 169.207 19.981  1.00 52.70  ? 122 TYR B OH    1 
ATOM   1848 N  N     . GLU B 1 91  ? 20.751 166.573 16.127  1.00 44.70  ? 123 GLU B N     1 
ATOM   1849 C  CA    . GLU B 1 91  ? 19.509 166.390 15.382  1.00 43.61  ? 123 GLU B CA    1 
ATOM   1850 C  C     . GLU B 1 91  ? 19.425 164.989 14.781  1.00 39.70  ? 123 GLU B C     1 
ATOM   1851 O  O     . GLU B 1 91  ? 18.393 164.312 14.892  1.00 41.28  ? 123 GLU B O     1 
ATOM   1852 C  CB    . GLU B 1 91  ? 19.388 167.458 14.291  1.00 43.24  ? 123 GLU B CB    1 
ATOM   1853 C  CG    . GLU B 1 91  ? 19.338 168.880 14.830  1.00 53.01  ? 123 GLU B CG    1 
ATOM   1854 C  CD    . GLU B 1 91  ? 18.760 169.871 13.836  1.00 64.54  ? 123 GLU B CD    1 
ATOM   1855 O  OE1   . GLU B 1 91  ? 17.896 169.472 13.027  1.00 68.49  ? 123 GLU B OE1   1 
ATOM   1856 O  OE2   . GLU B 1 91  ? 19.166 171.052 13.867  1.00 70.41  ? 123 GLU B OE2   1 
ATOM   1857 N  N     . PHE B 1 92  ? 20.512 164.528 14.155  1.00 33.92  ? 124 PHE B N     1 
ATOM   1858 C  CA    . PHE B 1 92  ? 20.483 163.220 13.506  1.00 33.11  ? 124 PHE B CA    1 
ATOM   1859 C  C     . PHE B 1 92  ? 20.357 162.093 14.526  1.00 39.91  ? 124 PHE B C     1 
ATOM   1860 O  O     . PHE B 1 92  ? 19.628 161.118 14.296  1.00 32.86  ? 124 PHE B O     1 
ATOM   1861 C  CB    . PHE B 1 92  ? 21.729 163.037 12.639  1.00 39.16  ? 124 PHE B CB    1 
ATOM   1862 C  CG    . PHE B 1 92  ? 21.651 163.742 11.314  1.00 38.40  ? 124 PHE B CG    1 
ATOM   1863 C  CD1   . PHE B 1 92  ? 20.771 163.308 10.337  1.00 35.12  ? 124 PHE B CD1   1 
ATOM   1864 C  CD2   . PHE B 1 92  ? 22.451 164.840 11.047  1.00 40.65  ? 124 PHE B CD2   1 
ATOM   1865 C  CE1   . PHE B 1 92  ? 20.693 163.954 9.118   1.00 41.71  ? 124 PHE B CE1   1 
ATOM   1866 C  CE2   . PHE B 1 92  ? 22.377 165.492 9.831   1.00 43.67  ? 124 PHE B CE2   1 
ATOM   1867 C  CZ    . PHE B 1 92  ? 21.495 165.048 8.866   1.00 39.17  ? 124 PHE B CZ    1 
ATOM   1868 N  N     . LEU B 1 93  ? 21.053 162.209 15.661  1.00 37.88  ? 125 LEU B N     1 
ATOM   1869 C  CA    . LEU B 1 93  ? 20.962 161.196 16.704  1.00 39.04  ? 125 LEU B CA    1 
ATOM   1870 C  C     . LEU B 1 93  ? 19.560 161.140 17.294  1.00 33.07  ? 125 LEU B C     1 
ATOM   1871 O  O     . LEU B 1 93  ? 19.018 160.051 17.503  1.00 42.85  ? 125 LEU B O     1 
ATOM   1872 C  CB    . LEU B 1 93  ? 21.997 161.478 17.794  1.00 45.18  ? 125 LEU B CB    1 
ATOM   1873 C  CG    . LEU B 1 93  ? 22.157 160.446 18.910  1.00 46.66  ? 125 LEU B CG    1 
ATOM   1874 C  CD1   . LEU B 1 93  ? 22.591 159.104 18.344  1.00 43.23  ? 125 LEU B CD1   1 
ATOM   1875 C  CD2   . LEU B 1 93  ? 23.154 160.941 19.947  1.00 49.84  ? 125 LEU B CD2   1 
ATOM   1876 N  N     . SER B 1 94  ? 18.954 162.302 17.562  1.00 36.26  ? 126 SER B N     1 
ATOM   1877 C  CA    . SER B 1 94  ? 17.575 162.318 18.041  1.00 40.39  ? 126 SER B CA    1 
ATOM   1878 C  C     . SER B 1 94  ? 16.635 161.655 17.039  1.00 43.04  ? 126 SER B C     1 
ATOM   1879 O  O     . SER B 1 94  ? 15.779 160.839 17.417  1.00 43.84  ? 126 SER B O     1 
ATOM   1880 C  CB    . SER B 1 94  ? 17.141 163.756 18.322  1.00 41.74  ? 126 SER B CB    1 
ATOM   1881 O  OG    . SER B 1 94  ? 15.767 163.821 18.658  1.00 53.60  ? 126 SER B OG    1 
ATOM   1882 N  N     . PHE B 1 95  ? 16.799 161.972 15.752  1.00 36.20  ? 127 PHE B N     1 
ATOM   1883 C  CA    . PHE B 1 95  ? 15.926 161.396 14.733  1.00 36.58  ? 127 PHE B CA    1 
ATOM   1884 C  C     . PHE B 1 95  ? 16.050 159.876 14.692  1.00 39.50  ? 127 PHE B C     1 
ATOM   1885 O  O     . PHE B 1 95  ? 15.043 159.155 14.748  1.00 41.25  ? 127 PHE B O     1 
ATOM   1886 C  CB    . PHE B 1 95  ? 16.244 162.002 13.367  1.00 37.11  ? 127 PHE B CB    1 
ATOM   1887 C  CG    . PHE B 1 95  ? 15.485 161.372 12.239  1.00 33.55  ? 127 PHE B CG    1 
ATOM   1888 C  CD1   . PHE B 1 95  ? 14.119 161.565 12.113  1.00 41.28  ? 127 PHE B CD1   1 
ATOM   1889 C  CD2   . PHE B 1 95  ? 16.133 160.575 11.312  1.00 31.42  ? 127 PHE B CD2   1 
ATOM   1890 C  CE1   . PHE B 1 95  ? 13.414 160.981 11.078  1.00 35.23  ? 127 PHE B CE1   1 
ATOM   1891 C  CE2   . PHE B 1 95  ? 15.435 159.988 10.276  1.00 36.25  ? 127 PHE B CE2   1 
ATOM   1892 C  CZ    . PHE B 1 95  ? 14.072 160.187 10.161  1.00 30.88  ? 127 PHE B CZ    1 
ATOM   1893 N  N     . VAL B 1 96  ? 17.280 159.364 14.603  1.00 34.26  ? 128 VAL B N     1 
ATOM   1894 C  CA    . VAL B 1 96  ? 17.436 157.916 14.485  1.00 36.95  ? 128 VAL B CA    1 
ATOM   1895 C  C     . VAL B 1 96  ? 17.052 157.214 15.779  1.00 36.69  ? 128 VAL B C     1 
ATOM   1896 O  O     . VAL B 1 96  ? 16.592 156.064 15.752  1.00 40.16  ? 128 VAL B O     1 
ATOM   1897 C  CB    . VAL B 1 96  ? 18.863 157.541 14.045  1.00 38.35  ? 128 VAL B CB    1 
ATOM   1898 C  CG1   . VAL B 1 96  ? 19.129 158.054 12.641  1.00 40.88  ? 128 VAL B CG1   1 
ATOM   1899 C  CG2   . VAL B 1 96  ? 19.895 158.060 15.035  1.00 31.71  ? 128 VAL B CG2   1 
ATOM   1900 N  N     . ARG B 1 97  ? 17.216 157.875 16.928  1.00 34.73  ? 129 ARG B N     1 
ATOM   1901 C  CA    . ARG B 1 97  ? 16.789 157.266 18.184  1.00 36.67  ? 129 ARG B CA    1 
ATOM   1902 C  C     . ARG B 1 97  ? 15.276 157.160 18.261  1.00 41.83  ? 129 ARG B C     1 
ATOM   1903 O  O     . ARG B 1 97  ? 14.755 156.224 18.878  1.00 45.66  ? 129 ARG B O     1 
ATOM   1904 C  CB    . ARG B 1 97  ? 17.328 158.062 19.370  1.00 37.46  ? 129 ARG B CB    1 
ATOM   1905 C  CG    . ARG B 1 97  ? 18.732 157.676 19.778  1.00 37.50  ? 129 ARG B CG    1 
ATOM   1906 C  CD    . ARG B 1 97  ? 19.213 158.523 20.936  1.00 41.74  ? 129 ARG B CD    1 
ATOM   1907 N  NE    . ARG B 1 97  ? 20.580 158.186 21.316  1.00 46.37  ? 129 ARG B NE    1 
ATOM   1908 C  CZ    . ARG B 1 97  ? 21.328 158.915 22.136  1.00 48.08  ? 129 ARG B CZ    1 
ATOM   1909 N  NH1   . ARG B 1 97  ? 20.841 160.029 22.667  1.00 41.98  ? 129 ARG B NH1   1 
ATOM   1910 N  NH2   . ARG B 1 97  ? 22.563 158.532 22.424  1.00 51.59  ? 129 ARG B NH2   1 
ATOM   1911 N  N     . GLN B 1 98  ? 14.559 158.107 17.646  1.00 38.15  ? 130 GLN B N     1 
ATOM   1912 C  CA    . GLN B 1 98  ? 13.107 158.006 17.606  1.00 47.43  ? 130 GLN B CA    1 
ATOM   1913 C  C     . GLN B 1 98  ? 12.607 157.104 16.486  1.00 43.53  ? 130 GLN B C     1 
ATOM   1914 O  O     . GLN B 1 98  ? 11.441 156.700 16.512  1.00 49.16  ? 130 GLN B O     1 
ATOM   1915 C  CB    . GLN B 1 98  ? 12.466 159.385 17.472  1.00 52.67  ? 130 GLN B CB    1 
ATOM   1916 C  CG    . GLN B 1 98  ? 12.000 159.964 18.788  1.00 73.15  ? 130 GLN B CG    1 
ATOM   1917 C  CD    . GLN B 1 98  ? 11.079 159.033 19.539  1.00 83.79  ? 130 GLN B CD    1 
ATOM   1918 O  OE1   . GLN B 1 98  ? 9.924  158.830 19.159  1.00 85.09  ? 130 GLN B OE1   1 
ATOM   1919 N  NE2   . GLN B 1 98  ? 11.584 158.468 20.626  1.00 85.80  ? 130 GLN B NE2   1 
ATOM   1920 N  N     . GLN B 1 99  ? 13.448 156.778 15.503  1.00 39.66  ? 131 GLN B N     1 
ATOM   1921 C  CA    . GLN B 1 99  ? 12.996 155.990 14.360  1.00 38.24  ? 131 GLN B CA    1 
ATOM   1922 C  C     . GLN B 1 99  ? 13.485 154.544 14.335  1.00 42.48  ? 131 GLN B C     1 
ATOM   1923 O  O     . GLN B 1 99  ? 12.851 153.712 13.674  1.00 43.44  ? 131 GLN B O     1 
ATOM   1924 C  CB    . GLN B 1 99  ? 13.419 156.667 13.046  1.00 36.81  ? 131 GLN B CB    1 
ATOM   1925 C  CG    . GLN B 1 99  ? 12.766 158.020 12.806  1.00 42.91  ? 131 GLN B CG    1 
ATOM   1926 C  CD    . GLN B 1 99  ? 11.251 157.944 12.739  1.00 41.23  ? 131 GLN B CD    1 
ATOM   1927 O  OE1   . GLN B 1 99  ? 10.682 156.972 12.237  1.00 48.19  ? 131 GLN B OE1   1 
ATOM   1928 N  NE2   . GLN B 1 99  ? 10.589 158.968 13.261  1.00 43.96  ? 131 GLN B NE2   1 
ATOM   1929 N  N     . THR B 1 100 ? 14.585 154.221 15.008  1.00 42.30  ? 132 THR B N     1 
ATOM   1930 C  CA    . THR B 1 100 ? 15.161 152.887 14.920  1.00 42.20  ? 132 THR B CA    1 
ATOM   1931 C  C     . THR B 1 100 ? 15.529 152.370 16.302  1.00 43.20  ? 132 THR B C     1 
ATOM   1932 O  O     . THR B 1 100 ? 15.865 153.155 17.197  1.00 40.28  ? 132 THR B O     1 
ATOM   1933 C  CB    . THR B 1 100 ? 16.416 152.865 14.030  1.00 43.66  ? 132 THR B CB    1 
ATOM   1934 O  OG1   . THR B 1 100 ? 17.355 153.842 14.496  1.00 47.48  ? 132 THR B OG1   1 
ATOM   1935 C  CG2   . THR B 1 100 ? 16.055 153.154 12.580  1.00 40.09  ? 132 THR B CG2   1 
ATOM   1936 N  N     . PRO B 1 101 ? 15.479 151.051 16.501  1.00 48.83  ? 133 PRO B N     1 
ATOM   1937 C  CA    . PRO B 1 101 ? 15.950 150.484 17.762  1.00 53.36  ? 133 PRO B CA    1 
ATOM   1938 C  C     . PRO B 1 101 ? 17.470 150.511 17.825  1.00 49.78  ? 133 PRO B C     1 
ATOM   1939 O  O     . PRO B 1 101 ? 18.146 150.436 16.786  1.00 48.96  ? 133 PRO B O     1 
ATOM   1940 C  CB    . PRO B 1 101 ? 15.414 149.042 17.724  1.00 53.01  ? 133 PRO B CB    1 
ATOM   1941 C  CG    . PRO B 1 101 ? 15.293 148.734 16.270  1.00 55.48  ? 133 PRO B CG    1 
ATOM   1942 C  CD    . PRO B 1 101 ? 14.904 150.027 15.609  1.00 53.63  ? 133 PRO B CD    1 
ATOM   1943 N  N     . PRO B 1 102 ? 18.044 150.611 19.024  1.00 49.66  ? 134 PRO B N     1 
ATOM   1944 C  CA    . PRO B 1 102 ? 19.499 150.808 19.131  1.00 48.28  ? 134 PRO B CA    1 
ATOM   1945 C  C     . PRO B 1 102 ? 20.285 149.594 18.651  1.00 48.85  ? 134 PRO B C     1 
ATOM   1946 O  O     . PRO B 1 102 ? 20.018 148.461 19.056  1.00 50.96  ? 134 PRO B O     1 
ATOM   1947 C  CB    . PRO B 1 102 ? 19.714 151.056 20.630  1.00 50.18  ? 134 PRO B CB    1 
ATOM   1948 C  CG    . PRO B 1 102 ? 18.370 151.473 21.153  1.00 52.04  ? 134 PRO B CG    1 
ATOM   1949 C  CD    . PRO B 1 102 ? 17.378 150.708 20.332  1.00 55.21  ? 134 PRO B CD    1 
ATOM   1950 N  N     . GLY B 1 103 ? 21.260 149.847 17.777  1.00 39.99  ? 135 GLY B N     1 
ATOM   1951 C  CA    . GLY B 1 103 ? 22.252 148.864 17.392  1.00 35.95  ? 135 GLY B CA    1 
ATOM   1952 C  C     . GLY B 1 103 ? 21.805 147.801 16.413  1.00 47.30  ? 135 GLY B C     1 
ATOM   1953 O  O     . GLY B 1 103 ? 22.560 146.850 16.177  1.00 57.05  ? 135 GLY B O     1 
ATOM   1954 N  N     . LEU B 1 104 ? 20.618 147.928 15.819  1.00 43.08  ? 136 LEU B N     1 
ATOM   1955 C  CA    . LEU B 1 104 ? 20.084 146.873 14.968  1.00 44.07  ? 136 LEU B CA    1 
ATOM   1956 C  C     . LEU B 1 104 ? 19.972 147.244 13.496  1.00 48.02  ? 136 LEU B C     1 
ATOM   1957 O  O     . LEU B 1 104 ? 19.867 146.340 12.661  1.00 49.66  ? 136 LEU B O     1 
ATOM   1958 C  CB    . LEU B 1 104 ? 18.698 146.438 15.467  1.00 43.51  ? 136 LEU B CB    1 
ATOM   1959 C  CG    . LEU B 1 104 ? 18.639 145.867 16.885  1.00 47.02  ? 136 LEU B CG    1 
ATOM   1960 C  CD1   . LEU B 1 104 ? 17.235 145.384 17.212  1.00 49.64  ? 136 LEU B CD1   1 
ATOM   1961 C  CD2   . LEU B 1 104 ? 19.650 144.744 17.054  1.00 48.63  ? 136 LEU B CD2   1 
ATOM   1962 N  N     . CYS B 1 105 ? 19.996 148.530 13.153  1.00 39.88  ? 137 CYS B N     1 
ATOM   1963 C  CA    . CYS B 1 105 ? 19.714 148.881 11.770  1.00 39.23  ? 137 CYS B CA    1 
ATOM   1964 C  C     . CYS B 1 105 ? 20.975 149.307 11.029  1.00 35.25  ? 137 CYS B C     1 
ATOM   1965 O  O     . CYS B 1 105 ? 21.862 149.936 11.617  1.00 32.83  ? 137 CYS B O     1 
ATOM   1966 C  CB    . CYS B 1 105 ? 18.677 150.007 11.698  1.00 42.19  ? 137 CYS B CB    1 
ATOM   1967 S  SG    . CYS B 1 105 ? 17.092 149.585 12.458  1.00 45.72  ? 137 CYS B SG    1 
ATOM   1968 N  N     . PRO B 1 106 ? 21.083 148.978 9.745   1.00 31.16  ? 138 PRO B N     1 
ATOM   1969 C  CA    . PRO B 1 106 ? 22.297 149.294 8.992   1.00 31.18  ? 138 PRO B CA    1 
ATOM   1970 C  C     . PRO B 1 106 ? 22.237 150.614 8.239   1.00 37.03  ? 138 PRO B C     1 
ATOM   1971 O  O     . PRO B 1 106 ? 21.176 151.097 7.828   1.00 35.85  ? 138 PRO B O     1 
ATOM   1972 C  CB    . PRO B 1 106 ? 22.388 148.121 8.007   1.00 28.98  ? 138 PRO B CB    1 
ATOM   1973 C  CG    . PRO B 1 106 ? 20.958 147.810 7.712   1.00 28.78  ? 138 PRO B CG    1 
ATOM   1974 C  CD    . PRO B 1 106 ? 20.180 148.097 8.981   1.00 28.19  ? 138 PRO B CD    1 
ATOM   1975 N  N     . LEU B 1 107 ? 23.427 151.189 8.067   1.00 29.66  ? 139 LEU B N     1 
ATOM   1976 C  CA    . LEU B 1 107 ? 23.621 152.312 7.161   1.00 31.89  ? 139 LEU B CA    1 
ATOM   1977 C  C     . LEU B 1 107 ? 23.414 151.860 5.722   1.00 31.11  ? 139 LEU B C     1 
ATOM   1978 O  O     . LEU B 1 107 ? 23.767 150.737 5.350   1.00 31.18  ? 139 LEU B O     1 
ATOM   1979 C  CB    . LEU B 1 107 ? 25.029 152.888 7.321   1.00 30.49  ? 139 LEU B CB    1 
ATOM   1980 C  CG    . LEU B 1 107 ? 25.227 154.212 8.059   1.00 45.47  ? 139 LEU B CG    1 
ATOM   1981 C  CD1   . LEU B 1 107 ? 26.613 154.767 7.767   1.00 47.48  ? 139 LEU B CD1   1 
ATOM   1982 C  CD2   . LEU B 1 107 ? 24.155 155.209 7.673   1.00 36.56  ? 139 LEU B CD2   1 
ATOM   1983 N  N     . ALA B 1 108 ? 22.844 152.744 4.907   1.00 23.58  ? 140 ALA B N     1 
ATOM   1984 C  CA    . ALA B 1 108 ? 22.566 152.429 3.515   1.00 27.57  ? 140 ALA B CA    1 
ATOM   1985 C  C     . ALA B 1 108 ? 22.849 153.639 2.638   1.00 27.07  ? 140 ALA B C     1 
ATOM   1986 O  O     . ALA B 1 108 ? 22.712 154.793 3.065   1.00 31.21  ? 140 ALA B O     1 
ATOM   1987 C  CB    . ALA B 1 108 ? 21.118 151.961 3.320   1.00 27.89  ? 140 ALA B CB    1 
ATOM   1988 N  N     . GLY B 1 109 ? 23.250 153.357 1.407   1.00 27.20  ? 141 GLY B N     1 
ATOM   1989 C  CA    . GLY B 1 109 ? 23.585 154.392 0.452   1.00 28.77  ? 141 GLY B CA    1 
ATOM   1990 C  C     . GLY B 1 109 ? 24.525 153.858 -0.608  1.00 31.69  ? 141 GLY B C     1 
ATOM   1991 O  O     . GLY B 1 109 ? 24.882 152.679 -0.623  1.00 29.08  ? 141 GLY B O     1 
ATOM   1992 N  N     . ASN B 1 110 ? 24.917 154.760 -1.505  1.00 29.07  ? 142 ASN B N     1 
ATOM   1993 C  CA    . ASN B 1 110 ? 25.863 154.444 -2.569  1.00 35.98  ? 142 ASN B CA    1 
ATOM   1994 C  C     . ASN B 1 110 ? 27.283 154.617 -2.046  1.00 37.60  ? 142 ASN B C     1 
ATOM   1995 O  O     . ASN B 1 110 ? 27.658 155.716 -1.624  1.00 31.84  ? 142 ASN B O     1 
ATOM   1996 C  CB    . ASN B 1 110 ? 25.635 155.340 -3.786  1.00 34.21  ? 142 ASN B CB    1 
ATOM   1997 C  CG    . ASN B 1 110 ? 24.648 154.750 -4.770  1.00 40.00  ? 142 ASN B CG    1 
ATOM   1998 O  OD1   . ASN B 1 110 ? 23.535 155.249 -4.923  1.00 39.84  ? 142 ASN B OD1   1 
ATOM   1999 N  ND2   . ASN B 1 110 ? 25.053 153.681 -5.446  1.00 40.55  ? 142 ASN B ND2   1 
ATOM   2000 N  N     . SER B 1 111 ? 28.069 153.540 -2.087  1.00 35.14  ? 143 SER B N     1 
ATOM   2001 C  CA    . SER B 1 111 ? 29.439 153.538 -1.568  1.00 36.57  ? 143 SER B CA    1 
ATOM   2002 C  C     . SER B 1 111 ? 29.482 154.123 -0.158  1.00 39.57  ? 143 SER B C     1 
ATOM   2003 O  O     . SER B 1 111 ? 30.315 154.972 0.171   1.00 36.94  ? 143 SER B O     1 
ATOM   2004 C  CB    . SER B 1 111 ? 30.382 154.294 -2.507  1.00 40.22  ? 143 SER B CB    1 
ATOM   2005 O  OG    . SER B 1 111 ? 30.555 153.599 -3.729  1.00 39.31  ? 143 SER B OG    1 
ATOM   2006 N  N     . VAL B 1 112 ? 28.567 153.645 0.686   1.00 35.48  ? 144 VAL B N     1 
ATOM   2007 C  CA    . VAL B 1 112 ? 28.291 154.264 1.979   1.00 37.33  ? 144 VAL B CA    1 
ATOM   2008 C  C     . VAL B 1 112 ? 29.406 153.990 2.983   1.00 34.54  ? 144 VAL B C     1 
ATOM   2009 O  O     . VAL B 1 112 ? 29.361 154.483 4.114   1.00 28.85  ? 144 VAL B O     1 
ATOM   2010 C  CB    . VAL B 1 112 ? 26.926 153.781 2.513   1.00 38.74  ? 144 VAL B CB    1 
ATOM   2011 C  CG1   . VAL B 1 112 ? 27.057 152.411 3.167   1.00 33.65  ? 144 VAL B CG1   1 
ATOM   2012 C  CG2   . VAL B 1 112 ? 26.317 154.809 3.466   1.00 36.60  ? 144 VAL B CG2   1 
ATOM   2013 N  N     . HIS B 1 113 ? 30.420 153.217 2.584   1.00 31.25  ? 145 HIS B N     1 
ATOM   2014 C  CA    . HIS B 1 113 ? 31.548 152.984 3.484   1.00 36.30  ? 145 HIS B CA    1 
ATOM   2015 C  C     . HIS B 1 113 ? 32.357 154.257 3.719   1.00 22.80  ? 145 HIS B C     1 
ATOM   2016 O  O     . HIS B 1 113 ? 32.895 154.457 4.814   1.00 33.61  ? 145 HIS B O     1 
ATOM   2017 C  CB    . HIS B 1 113 ? 32.448 151.871 2.940   1.00 40.78  ? 145 HIS B CB    1 
ATOM   2018 C  CG    . HIS B 1 113 ? 32.634 151.914 1.457   1.00 37.65  ? 145 HIS B CG    1 
ATOM   2019 N  ND1   . HIS B 1 113 ? 33.662 152.607 0.855   1.00 37.42  ? 145 HIS B ND1   1 
ATOM   2020 C  CD2   . HIS B 1 113 ? 31.925 151.347 0.452   1.00 37.33  ? 145 HIS B CD2   1 
ATOM   2021 C  CE1   . HIS B 1 113 ? 33.578 152.468 -0.457  1.00 39.52  ? 145 HIS B CE1   1 
ATOM   2022 N  NE2   . HIS B 1 113 ? 32.532 151.708 -0.727  1.00 38.01  ? 145 HIS B NE2   1 
ATOM   2023 N  N     . GLU B 1 114 ? 32.442 155.134 2.717   1.00 35.55  ? 146 GLU B N     1 
ATOM   2024 C  CA    . GLU B 1 114 ? 33.110 156.420 2.908   1.00 37.59  ? 146 GLU B CA    1 
ATOM   2025 C  C     . GLU B 1 114 ? 32.335 157.300 3.884   1.00 37.03  ? 146 GLU B C     1 
ATOM   2026 O  O     . GLU B 1 114 ? 32.920 157.927 4.784   1.00 42.03  ? 146 GLU B O     1 
ATOM   2027 C  CB    . GLU B 1 114 ? 33.273 157.122 1.558   1.00 44.50  ? 146 GLU B CB    1 
ATOM   2028 C  CG    . GLU B 1 114 ? 34.115 158.385 1.601   1.00 56.90  ? 146 GLU B CG    1 
ATOM   2029 C  CD    . GLU B 1 114 ? 35.600 158.093 1.653   1.00 66.85  ? 146 GLU B CD    1 
ATOM   2030 O  OE1   . GLU B 1 114 ? 35.986 156.928 1.419   1.00 68.40  ? 146 GLU B OE1   1 
ATOM   2031 O  OE2   . GLU B 1 114 ? 36.382 159.026 1.931   1.00 71.36  ? 146 GLU B OE2   1 
ATOM   2032 N  N     . ASP B 1 115 ? 31.013 157.373 3.704   1.00 34.94  ? 147 ASP B N     1 
ATOM   2033 C  CA    . ASP B 1 115 ? 30.171 158.080 4.662   1.00 40.04  ? 147 ASP B CA    1 
ATOM   2034 C  C     . ASP B 1 115 ? 30.335 157.497 6.057   1.00 36.53  ? 147 ASP B C     1 
ATOM   2035 O  O     . ASP B 1 115 ? 30.361 158.236 7.046   1.00 35.65  ? 147 ASP B O     1 
ATOM   2036 C  CB    . ASP B 1 115 ? 28.706 158.018 4.229   1.00 45.65  ? 147 ASP B CB    1 
ATOM   2037 C  CG    . ASP B 1 115 ? 28.499 158.480 2.801   1.00 52.54  ? 147 ASP B CG    1 
ATOM   2038 O  OD1   . ASP B 1 115 ? 28.786 157.694 1.874   1.00 53.36  ? 147 ASP B OD1   1 
ATOM   2039 O  OD2   . ASP B 1 115 ? 28.045 159.627 2.607   1.00 49.51  ? 147 ASP B OD2   1 
ATOM   2040 N  N     . LYS B 1 116 ? 30.456 156.171 6.155   1.00 32.92  ? 148 LYS B N     1 
ATOM   2041 C  CA    . LYS B 1 116 ? 30.636 155.537 7.456   1.00 35.81  ? 148 LYS B CA    1 
ATOM   2042 C  C     . LYS B 1 116 ? 31.975 155.915 8.073   1.00 36.89  ? 148 LYS B C     1 
ATOM   2043 O  O     . LYS B 1 116 ? 32.068 156.106 9.287   1.00 41.91  ? 148 LYS B O     1 
ATOM   2044 C  CB    . LYS B 1 116 ? 30.517 154.019 7.329   1.00 39.32  ? 148 LYS B CB    1 
ATOM   2045 C  CG    . LYS B 1 116 ? 30.775 153.279 8.632   1.00 43.94  ? 148 LYS B CG    1 
ATOM   2046 C  CD    . LYS B 1 116 ? 30.448 151.801 8.516   1.00 51.18  ? 148 LYS B CD    1 
ATOM   2047 C  CE    . LYS B 1 116 ? 30.692 151.083 9.833   1.00 57.74  ? 148 LYS B CE    1 
ATOM   2048 N  NZ    . LYS B 1 116 ? 32.107 151.208 10.280  1.00 57.61  ? 148 LYS B NZ    1 
ATOM   2049 N  N     . LYS B 1 117 ? 33.024 156.017 7.257   1.00 35.67  ? 149 LYS B N     1 
ATOM   2050 C  CA    . LYS B 1 117 ? 34.315 156.480 7.761   1.00 40.92  ? 149 LYS B CA    1 
ATOM   2051 C  C     . LYS B 1 117 ? 34.194 157.881 8.354   1.00 44.42  ? 149 LYS B C     1 
ATOM   2052 O  O     . LYS B 1 117 ? 34.601 158.131 9.501   1.00 38.85  ? 149 LYS B O     1 
ATOM   2053 C  CB    . LYS B 1 117 ? 35.348 156.453 6.632   1.00 39.97  ? 149 LYS B CB    1 
ATOM   2054 C  CG    . LYS B 1 117 ? 36.742 156.916 7.026   1.00 52.31  ? 149 LYS B CG    1 
ATOM   2055 C  CD    . LYS B 1 117 ? 37.751 156.636 5.917   1.00 62.25  ? 149 LYS B CD    1 
ATOM   2056 C  CE    . LYS B 1 117 ? 37.414 157.404 4.646   1.00 66.28  ? 149 LYS B CE    1 
ATOM   2057 N  NZ    . LYS B 1 117 ? 38.311 157.037 3.514   1.00 68.51  ? 149 LYS B NZ    1 
ATOM   2058 N  N     . PHE B 1 118 ? 33.613 158.805 7.585   1.00 36.61  ? 150 PHE B N     1 
ATOM   2059 C  CA    . PHE B 1 118 ? 33.494 160.179 8.068   1.00 34.00  ? 150 PHE B CA    1 
ATOM   2060 C  C     . PHE B 1 118 ? 32.588 160.278 9.292   1.00 35.39  ? 150 PHE B C     1 
ATOM   2061 O  O     . PHE B 1 118 ? 32.854 161.082 10.193  1.00 37.30  ? 150 PHE B O     1 
ATOM   2062 C  CB    . PHE B 1 118 ? 32.994 161.091 6.949   1.00 42.64  ? 150 PHE B CB    1 
ATOM   2063 C  CG    . PHE B 1 118 ? 34.093 161.629 6.078   1.00 47.53  ? 150 PHE B CG    1 
ATOM   2064 C  CD1   . PHE B 1 118 ? 34.542 160.909 4.983   1.00 45.88  ? 150 PHE B CD1   1 
ATOM   2065 C  CD2   . PHE B 1 118 ? 34.689 162.846 6.364   1.00 49.32  ? 150 PHE B CD2   1 
ATOM   2066 C  CE1   . PHE B 1 118 ? 35.559 161.398 4.184   1.00 51.14  ? 150 PHE B CE1   1 
ATOM   2067 C  CE2   . PHE B 1 118 ? 35.706 163.340 5.569   1.00 54.01  ? 150 PHE B CE2   1 
ATOM   2068 C  CZ    . PHE B 1 118 ? 36.142 162.616 4.477   1.00 53.14  ? 150 PHE B CZ    1 
ATOM   2069 N  N     . LEU B 1 119 ? 31.535 159.459 9.357   1.00 35.96  ? 151 LEU B N     1 
ATOM   2070 C  CA    . LEU B 1 119 ? 30.632 159.500 10.504  1.00 38.20  ? 151 LEU B CA    1 
ATOM   2071 C  C     . LEU B 1 119 ? 31.271 158.870 11.736  1.00 35.50  ? 151 LEU B C     1 
ATOM   2072 O  O     . LEU B 1 119 ? 31.093 159.365 12.854  1.00 36.55  ? 151 LEU B O     1 
ATOM   2073 C  CB    . LEU B 1 119 ? 29.318 158.798 10.160  1.00 35.23  ? 151 LEU B CB    1 
ATOM   2074 C  CG    . LEU B 1 119 ? 28.396 159.505 9.164   1.00 33.13  ? 151 LEU B CG    1 
ATOM   2075 C  CD1   . LEU B 1 119 ? 27.237 158.600 8.765   1.00 28.36  ? 151 LEU B CD1   1 
ATOM   2076 C  CD2   . LEU B 1 119 ? 27.888 160.817 9.739   1.00 36.52  ? 151 LEU B CD2   1 
ATOM   2077 N  N     . ASP B 1 120 ? 32.008 157.771 11.555  1.00 36.08  ? 152 ASP B N     1 
ATOM   2078 C  CA    . ASP B 1 120 ? 32.751 157.179 12.659  1.00 40.27  ? 152 ASP B CA    1 
ATOM   2079 C  C     . ASP B 1 120 ? 33.741 158.175 13.239  1.00 43.35  ? 152 ASP B C     1 
ATOM   2080 O  O     . ASP B 1 120 ? 33.954 158.213 14.457  1.00 51.00  ? 152 ASP B O     1 
ATOM   2081 C  CB    . ASP B 1 120 ? 33.485 155.922 12.188  1.00 43.37  ? 152 ASP B CB    1 
ATOM   2082 C  CG    . ASP B 1 120 ? 32.568 154.724 12.043  1.00 51.37  ? 152 ASP B CG    1 
ATOM   2083 O  OD1   . ASP B 1 120 ? 31.540 154.665 12.749  1.00 55.09  ? 152 ASP B OD1   1 
ATOM   2084 O  OD2   . ASP B 1 120 ? 32.881 153.837 11.222  1.00 54.52  ? 152 ASP B OD2   1 
ATOM   2085 N  N     . LYS B 1 121 ? 34.357 158.996 12.385  1.00 37.72  ? 153 LYS B N     1 
ATOM   2086 C  CA    . LYS B 1 121 ? 35.297 159.980 12.911  1.00 39.13  ? 153 LYS B CA    1 
ATOM   2087 C  C     . LYS B 1 121 ? 34.574 161.139 13.594  1.00 49.32  ? 153 LYS B C     1 
ATOM   2088 O  O     . LYS B 1 121 ? 34.955 161.554 14.695  1.00 51.60  ? 153 LYS B O     1 
ATOM   2089 C  CB    . LYS B 1 121 ? 36.215 160.504 11.808  1.00 45.66  ? 153 LYS B CB    1 
ATOM   2090 C  CG    . LYS B 1 121 ? 37.285 161.441 12.355  1.00 49.86  ? 153 LYS B CG    1 
ATOM   2091 C  CD    . LYS B 1 121 ? 38.243 161.931 11.287  1.00 49.19  ? 153 LYS B CD    1 
ATOM   2092 C  CE    . LYS B 1 121 ? 39.226 162.935 11.871  1.00 65.38  ? 153 LYS B CE    1 
ATOM   2093 N  NZ    . LYS B 1 121 ? 40.003 163.641 10.817  1.00 69.85  ? 153 LYS B NZ    1 
ATOM   2094 N  N     . TYR B 1 122 ? 33.524 161.676 12.964  1.00 47.08  ? 154 TYR B N     1 
ATOM   2095 C  CA    . TYR B 1 122 ? 32.968 162.953 13.393  1.00 42.33  ? 154 TYR B CA    1 
ATOM   2096 C  C     . TYR B 1 122 ? 31.606 162.871 14.072  1.00 38.79  ? 154 TYR B C     1 
ATOM   2097 O  O     . TYR B 1 122 ? 31.227 163.826 14.757  1.00 45.37  ? 154 TYR B O     1 
ATOM   2098 C  CB    . TYR B 1 122 ? 32.870 163.913 12.199  1.00 47.76  ? 154 TYR B CB    1 
ATOM   2099 C  CG    . TYR B 1 122 ? 34.220 164.397 11.722  1.00 47.29  ? 154 TYR B CG    1 
ATOM   2100 C  CD1   . TYR B 1 122 ? 34.963 165.292 12.479  1.00 54.41  ? 154 TYR B CD1   1 
ATOM   2101 C  CD2   . TYR B 1 122 ? 34.757 163.947 10.523  1.00 49.69  ? 154 TYR B CD2   1 
ATOM   2102 C  CE1   . TYR B 1 122 ? 36.201 165.734 12.053  1.00 58.68  ? 154 TYR B CE1   1 
ATOM   2103 C  CE2   . TYR B 1 122 ? 35.994 164.384 10.088  1.00 56.97  ? 154 TYR B CE2   1 
ATOM   2104 C  CZ    . TYR B 1 122 ? 36.712 165.276 10.857  1.00 61.39  ? 154 TYR B CZ    1 
ATOM   2105 O  OH    . TYR B 1 122 ? 37.944 165.713 10.428  1.00 61.13  ? 154 TYR B OH    1 
ATOM   2106 N  N     . MET B 1 123 ? 30.862 161.780 13.908  1.00 40.89  ? 155 MET B N     1 
ATOM   2107 C  CA    . MET B 1 123 ? 29.577 161.592 14.584  1.00 44.20  ? 155 MET B CA    1 
ATOM   2108 C  C     . MET B 1 123 ? 29.541 160.203 15.210  1.00 45.43  ? 155 MET B C     1 
ATOM   2109 O  O     . MET B 1 123 ? 28.762 159.337 14.793  1.00 39.45  ? 155 MET B O     1 
ATOM   2110 C  CB    . MET B 1 123 ? 28.411 161.792 13.616  1.00 45.74  ? 155 MET B CB    1 
ATOM   2111 C  CG    . MET B 1 123 ? 28.237 163.228 13.136  1.00 50.16  ? 155 MET B CG    1 
ATOM   2112 S  SD    . MET B 1 123 ? 26.647 163.509 12.330  1.00 43.85  ? 155 MET B SD    1 
ATOM   2113 C  CE    . MET B 1 123 ? 26.817 165.222 11.836  1.00 43.33  ? 155 MET B CE    1 
ATOM   2114 N  N     . PRO B 1 124 ? 30.368 159.960 16.233  1.00 45.51  ? 156 PRO B N     1 
ATOM   2115 C  CA    . PRO B 1 124 ? 30.509 158.585 16.740  1.00 39.46  ? 156 PRO B CA    1 
ATOM   2116 C  C     . PRO B 1 124 ? 29.288 158.071 17.486  1.00 38.13  ? 156 PRO B C     1 
ATOM   2117 O  O     . PRO B 1 124 ? 29.026 156.864 17.447  1.00 41.28  ? 156 PRO B O     1 
ATOM   2118 C  CB    . PRO B 1 124 ? 31.738 158.676 17.654  1.00 41.99  ? 156 PRO B CB    1 
ATOM   2119 C  CG    . PRO B 1 124 ? 31.760 160.093 18.105  1.00 48.88  ? 156 PRO B CG    1 
ATOM   2120 C  CD    . PRO B 1 124 ? 31.232 160.910 16.957  1.00 44.56  ? 156 PRO B CD    1 
ATOM   2121 N  N     . GLN B 1 125 ? 28.532 158.938 18.165  1.00 38.67  ? 157 GLN B N     1 
ATOM   2122 C  CA    . GLN B 1 125 ? 27.324 158.479 18.849  1.00 48.26  ? 157 GLN B CA    1 
ATOM   2123 C  C     . GLN B 1 125 ? 26.262 158.033 17.849  1.00 45.93  ? 157 GLN B C     1 
ATOM   2124 O  O     . GLN B 1 125 ? 25.610 156.993 18.036  1.00 47.55  ? 157 GLN B O     1 
ATOM   2125 C  CB    . GLN B 1 125 ? 26.783 159.587 19.751  1.00 53.70  ? 157 GLN B CB    1 
ATOM   2126 C  CG    . GLN B 1 125 ? 27.679 159.923 20.932  1.00 69.11  ? 157 GLN B CG    1 
ATOM   2127 C  CD    . GLN B 1 125 ? 27.926 158.729 21.831  1.00 79.44  ? 157 GLN B CD    1 
ATOM   2128 O  OE1   . GLN B 1 125 ? 29.064 158.291 22.002  1.00 83.53  ? 157 GLN B OE1   1 
ATOM   2129 N  NE2   . GLN B 1 125 ? 26.858 158.192 22.410  1.00 81.11  ? 157 GLN B NE2   1 
ATOM   2130 N  N     . PHE B 1 126 ? 26.077 158.818 16.784  1.00 40.76  ? 158 PHE B N     1 
ATOM   2131 C  CA    . PHE B 1 126 ? 25.159 158.447 15.714  1.00 39.16  ? 158 PHE B CA    1 
ATOM   2132 C  C     . PHE B 1 126 ? 25.472 157.055 15.183  1.00 41.57  ? 158 PHE B C     1 
ATOM   2133 O  O     . PHE B 1 126 ? 24.575 156.221 15.018  1.00 44.84  ? 158 PHE B O     1 
ATOM   2134 C  CB    . PHE B 1 126 ? 25.233 159.489 14.595  1.00 36.14  ? 158 PHE B CB    1 
ATOM   2135 C  CG    . PHE B 1 126 ? 24.373 159.172 13.405  1.00 36.85  ? 158 PHE B CG    1 
ATOM   2136 C  CD1   . PHE B 1 126 ? 23.055 159.589 13.357  1.00 35.86  ? 158 PHE B CD1   1 
ATOM   2137 C  CD2   . PHE B 1 126 ? 24.888 158.467 12.328  1.00 33.64  ? 158 PHE B CD2   1 
ATOM   2138 C  CE1   . PHE B 1 126 ? 22.266 159.305 12.262  1.00 35.12  ? 158 PHE B CE1   1 
ATOM   2139 C  CE2   . PHE B 1 126 ? 24.100 158.176 11.231  1.00 37.42  ? 158 PHE B CE2   1 
ATOM   2140 C  CZ    . PHE B 1 126 ? 22.787 158.595 11.199  1.00 38.03  ? 158 PHE B CZ    1 
ATOM   2141 N  N     . MET B 1 127 ? 26.753 156.783 14.917  1.00 38.50  ? 159 MET B N     1 
ATOM   2142 C  CA    . MET B 1 127 ? 27.139 155.463 14.427  1.00 32.25  ? 159 MET B CA    1 
ATOM   2143 C  C     . MET B 1 127 ? 26.980 154.395 15.501  1.00 37.08  ? 159 MET B C     1 
ATOM   2144 O  O     . MET B 1 127 ? 26.698 153.234 15.177  1.00 37.53  ? 159 MET B O     1 
ATOM   2145 C  CB    . MET B 1 127 ? 28.579 155.495 13.917  1.00 41.52  ? 159 MET B CB    1 
ATOM   2146 C  CG    . MET B 1 127 ? 28.758 156.292 12.640  1.00 46.02  ? 159 MET B CG    1 
ATOM   2147 S  SD    . MET B 1 127 ? 27.668 155.716 11.325  1.00 44.37  ? 159 MET B SD    1 
ATOM   2148 C  CE    . MET B 1 127 ? 28.202 154.014 11.161  1.00 45.04  ? 159 MET B CE    1 
ATOM   2149 N  N     . LYS B 1 128 ? 27.161 154.765 16.775  1.00 35.88  ? 160 LYS B N     1 
ATOM   2150 C  CA    . LYS B 1 128 ? 26.974 153.812 17.863  1.00 44.22  ? 160 LYS B CA    1 
ATOM   2151 C  C     . LYS B 1 128 ? 25.525 153.369 17.967  1.00 48.19  ? 160 LYS B C     1 
ATOM   2152 O  O     . LYS B 1 128 ? 25.243 152.271 18.462  1.00 47.03  ? 160 LYS B O     1 
ATOM   2153 C  CB    . LYS B 1 128 ? 27.440 154.418 19.189  1.00 50.72  ? 160 LYS B CB    1 
ATOM   2154 C  CG    . LYS B 1 128 ? 27.860 153.374 20.214  1.00 60.44  ? 160 LYS B CG    1 
ATOM   2155 C  CD    . LYS B 1 128 ? 28.536 154.008 21.422  1.00 71.54  ? 160 LYS B CD    1 
ATOM   2156 C  CE    . LYS B 1 128 ? 29.895 154.586 21.058  1.00 78.38  ? 160 LYS B CE    1 
ATOM   2157 N  NZ    . LYS B 1 128 ? 30.068 155.965 21.591  1.00 78.58  ? 160 LYS B NZ    1 
ATOM   2158 N  N     . HIS B 1 129 ? 24.592 154.217 17.533  1.00 44.58  ? 161 HIS B N     1 
ATOM   2159 C  CA    . HIS B 1 129 ? 23.193 153.800 17.504  1.00 43.31  ? 161 HIS B CA    1 
ATOM   2160 C  C     . HIS B 1 129 ? 22.914 152.746 16.436  1.00 39.13  ? 161 HIS B C     1 
ATOM   2161 O  O     . HIS B 1 129 ? 21.891 152.057 16.515  1.00 40.63  ? 161 HIS B O     1 
ATOM   2162 C  CB    . HIS B 1 129 ? 22.276 155.005 17.277  1.00 44.70  ? 161 HIS B CB    1 
ATOM   2163 C  CG    . HIS B 1 129 ? 20.821 154.684 17.400  1.00 43.73  ? 161 HIS B CG    1 
ATOM   2164 N  ND1   . HIS B 1 129 ? 20.193 154.542 18.618  1.00 42.56  ? 161 HIS B ND1   1 
ATOM   2165 C  CD2   . HIS B 1 129 ? 19.875 154.458 16.458  1.00 42.07  ? 161 HIS B CD2   1 
ATOM   2166 C  CE1   . HIS B 1 129 ? 18.920 154.251 18.421  1.00 46.50  ? 161 HIS B CE1   1 
ATOM   2167 N  NE2   . HIS B 1 129 ? 18.702 154.194 17.120  1.00 42.22  ? 161 HIS B NE2   1 
ATOM   2168 N  N     . LEU B 1 130 ? 23.793 152.594 15.453  1.00 32.65  ? 162 LEU B N     1 
ATOM   2169 C  CA    . LEU B 1 130 ? 23.529 151.754 14.295  1.00 39.24  ? 162 LEU B CA    1 
ATOM   2170 C  C     . LEU B 1 130 ? 24.264 150.420 14.380  1.00 46.52  ? 162 LEU B C     1 
ATOM   2171 O  O     . LEU B 1 130 ? 25.212 150.244 15.150  1.00 43.08  ? 162 LEU B O     1 
ATOM   2172 C  CB    . LEU B 1 130 ? 23.929 152.473 13.004  1.00 37.74  ? 162 LEU B CB    1 
ATOM   2173 C  CG    . LEU B 1 130 ? 23.208 153.784 12.692  1.00 44.24  ? 162 LEU B CG    1 
ATOM   2174 C  CD1   . LEU B 1 130 ? 23.695 154.364 11.375  1.00 42.40  ? 162 LEU B CD1   1 
ATOM   2175 C  CD2   . LEU B 1 130 ? 21.707 153.565 12.662  1.00 42.11  ? 162 LEU B CD2   1 
ATOM   2176 N  N     . HIS B 1 131 ? 23.804 149.475 13.562  1.00 47.23  ? 163 HIS B N     1 
ATOM   2177 C  CA    . HIS B 1 131 ? 24.487 148.206 13.373  1.00 48.50  ? 163 HIS B CA    1 
ATOM   2178 C  C     . HIS B 1 131 ? 25.798 148.427 12.616  1.00 51.50  ? 163 HIS B C     1 
ATOM   2179 O  O     . HIS B 1 131 ? 26.024 149.472 12.000  1.00 50.93  ? 163 HIS B O     1 
ATOM   2180 C  CB    . HIS B 1 131 ? 23.578 147.234 12.618  1.00 54.33  ? 163 HIS B CB    1 
ATOM   2181 C  CG    . HIS B 1 131 ? 24.010 145.802 12.699  1.00 55.46  ? 163 HIS B CG    1 
ATOM   2182 N  ND1   . HIS B 1 131 ? 24.678 145.167 11.675  1.00 55.70  ? 163 HIS B ND1   1 
ATOM   2183 C  CD2   . HIS B 1 131 ? 23.855 144.878 13.677  1.00 59.05  ? 163 HIS B CD2   1 
ATOM   2184 C  CE1   . HIS B 1 131 ? 24.922 143.915 12.019  1.00 57.53  ? 163 HIS B CE1   1 
ATOM   2185 N  NE2   . HIS B 1 131 ? 24.433 143.714 13.230  1.00 57.42  ? 163 HIS B NE2   1 
ATOM   2186 N  N     . TYR B 1 132 ? 26.676 147.422 12.665  1.00 48.56  ? 164 TYR B N     1 
ATOM   2187 C  CA    . TYR B 1 132 ? 27.970 147.524 11.997  1.00 43.93  ? 164 TYR B CA    1 
ATOM   2188 C  C     . TYR B 1 132 ? 27.912 147.174 10.515  1.00 42.57  ? 164 TYR B C     1 
ATOM   2189 O  O     . TYR B 1 132 ? 28.748 147.658 9.743   1.00 47.45  ? 164 TYR B O     1 
ATOM   2190 C  CB    . TYR B 1 132 ? 29.007 146.632 12.692  1.00 49.74  ? 164 TYR B CB    1 
ATOM   2191 C  CG    . TYR B 1 132 ? 28.654 145.159 12.742  1.00 55.66  ? 164 TYR B CG    1 
ATOM   2192 C  CD1   . TYR B 1 132 ? 29.048 144.293 11.729  1.00 60.40  ? 164 TYR B CD1   1 
ATOM   2193 C  CD2   . TYR B 1 132 ? 27.941 144.634 13.812  1.00 62.01  ? 164 TYR B CD2   1 
ATOM   2194 C  CE1   . TYR B 1 132 ? 28.732 142.948 11.776  1.00 69.92  ? 164 TYR B CE1   1 
ATOM   2195 C  CE2   . TYR B 1 132 ? 27.622 143.290 13.868  1.00 71.96  ? 164 TYR B CE2   1 
ATOM   2196 C  CZ    . TYR B 1 132 ? 28.020 142.452 12.846  1.00 77.63  ? 164 TYR B CZ    1 
ATOM   2197 O  OH    . TYR B 1 132 ? 27.706 141.113 12.891  1.00 84.82  ? 164 TYR B OH    1 
ATOM   2198 N  N     . ARG B 1 133 ? 26.955 146.350 10.096  1.00 40.49  ? 165 ARG B N     1 
ATOM   2199 C  CA    . ARG B 1 133 ? 26.827 146.013 8.685   1.00 43.65  ? 165 ARG B CA    1 
ATOM   2200 C  C     . ARG B 1 133 ? 26.277 147.194 7.892   1.00 39.06  ? 165 ARG B C     1 
ATOM   2201 O  O     . ARG B 1 133 ? 25.590 148.067 8.428   1.00 34.85  ? 165 ARG B O     1 
ATOM   2202 C  CB    . ARG B 1 133 ? 25.915 144.798 8.500   1.00 55.20  ? 165 ARG B CB    1 
ATOM   2203 C  CG    . ARG B 1 133 ? 26.518 143.480 8.953   1.00 63.91  ? 165 ARG B CG    1 
ATOM   2204 C  CD    . ARG B 1 133 ? 25.931 142.311 8.176   1.00 70.17  ? 165 ARG B CD    1 
ATOM   2205 N  NE    . ARG B 1 133 ? 26.197 141.032 8.828   1.00 78.92  ? 165 ARG B NE    1 
ATOM   2206 C  CZ    . ARG B 1 133 ? 27.341 140.363 8.725   1.00 84.65  ? 165 ARG B CZ    1 
ATOM   2207 N  NH1   . ARG B 1 133 ? 28.334 140.849 7.992   1.00 82.86  ? 165 ARG B NH1   1 
ATOM   2208 N  NH2   . ARG B 1 133 ? 27.494 139.206 9.355   1.00 87.73  ? 165 ARG B NH2   1 
ATOM   2209 N  N     . ILE B 1 134 ? 26.590 147.215 6.598   1.00 30.31  ? 166 ILE B N     1 
ATOM   2210 C  CA    . ILE B 1 134 ? 26.115 148.257 5.700   1.00 29.50  ? 166 ILE B CA    1 
ATOM   2211 C  C     . ILE B 1 134 ? 25.372 147.609 4.539   1.00 31.37  ? 166 ILE B C     1 
ATOM   2212 O  O     . ILE B 1 134 ? 25.538 146.425 4.238   1.00 31.70  ? 166 ILE B O     1 
ATOM   2213 C  CB    . ILE B 1 134 ? 27.260 149.148 5.174   1.00 34.47  ? 166 ILE B CB    1 
ATOM   2214 C  CG1   . ILE B 1 134 ? 28.224 148.322 4.316   1.00 37.17  ? 166 ILE B CG1   1 
ATOM   2215 C  CG2   . ILE B 1 134 ? 27.992 149.818 6.328   1.00 32.80  ? 166 ILE B CG2   1 
ATOM   2216 C  CD1   . ILE B 1 134 ? 29.175 149.151 3.476   1.00 44.12  ? 166 ILE B CD1   1 
ATOM   2217 N  N     . ILE B 1 135 ? 24.535 148.410 3.887   1.00 27.65  ? 167 ILE B N     1 
ATOM   2218 C  CA    . ILE B 1 135 ? 23.851 148.015 2.661   1.00 26.70  ? 167 ILE B CA    1 
ATOM   2219 C  C     . ILE B 1 135 ? 24.360 148.952 1.575   1.00 29.82  ? 167 ILE B C     1 
ATOM   2220 O  O     . ILE B 1 135 ? 23.887 150.088 1.443   1.00 25.84  ? 167 ILE B O     1 
ATOM   2221 C  CB    . ILE B 1 135 ? 22.325 148.074 2.795   1.00 31.92  ? 167 ILE B CB    1 
ATOM   2222 C  CG1   . ILE B 1 135 ? 21.854 147.064 3.843   1.00 31.13  ? 167 ILE B CG1   1 
ATOM   2223 C  CG2   . ILE B 1 135 ? 21.655 147.796 1.455   1.00 30.21  ? 167 ILE B CG2   1 
ATOM   2224 C  CD1   . ILE B 1 135 ? 20.354 146.916 3.922   1.00 39.50  ? 167 ILE B CD1   1 
ATOM   2225 N  N     . ASP B 1 136 ? 25.343 148.489 0.807   1.00 22.47  ? 168 ASP B N     1 
ATOM   2226 C  CA    . ASP B 1 136 ? 26.004 149.309 -0.202  1.00 28.17  ? 168 ASP B CA    1 
ATOM   2227 C  C     . ASP B 1 136 ? 25.322 149.078 -1.544  1.00 30.29  ? 168 ASP B C     1 
ATOM   2228 O  O     . ASP B 1 136 ? 25.443 147.999 -2.134  1.00 27.54  ? 168 ASP B O     1 
ATOM   2229 C  CB    . ASP B 1 136 ? 27.492 148.976 -0.269  1.00 28.88  ? 168 ASP B CB    1 
ATOM   2230 C  CG    . ASP B 1 136 ? 28.265 149.908 -1.186  1.00 37.33  ? 168 ASP B CG    1 
ATOM   2231 O  OD1   . ASP B 1 136 ? 27.649 150.810 -1.795  1.00 34.61  ? 168 ASP B OD1   1 
ATOM   2232 O  OD2   . ASP B 1 136 ? 29.496 149.735 -1.299  1.00 44.94  ? 168 ASP B OD2   1 
ATOM   2233 N  N     . VAL B 1 137 ? 24.608 150.097 -2.027  1.00 24.66  ? 169 VAL B N     1 
ATOM   2234 C  CA    . VAL B 1 137 ? 23.951 150.002 -3.326  1.00 25.49  ? 169 VAL B CA    1 
ATOM   2235 C  C     . VAL B 1 137 ? 24.975 149.836 -4.440  1.00 28.30  ? 169 VAL B C     1 
ATOM   2236 O  O     . VAL B 1 137 ? 24.689 149.209 -5.467  1.00 23.95  ? 169 VAL B O     1 
ATOM   2237 C  CB    . VAL B 1 137 ? 23.058 151.239 -3.557  1.00 28.63  ? 169 VAL B CB    1 
ATOM   2238 C  CG1   . VAL B 1 137 ? 22.338 151.148 -4.899  1.00 25.11  ? 169 VAL B CG1   1 
ATOM   2239 C  CG2   . VAL B 1 137 ? 22.058 151.381 -2.425  1.00 24.77  ? 169 VAL B CG2   1 
ATOM   2240 N  N     . SER B 1 138 ? 26.183 150.376 -4.258  1.00 21.98  ? 170 SER B N     1 
ATOM   2241 C  CA    . SER B 1 138 ? 27.189 150.299 -5.312  1.00 27.35  ? 170 SER B CA    1 
ATOM   2242 C  C     . SER B 1 138 ? 27.680 148.872 -5.529  1.00 21.20  ? 170 SER B C     1 
ATOM   2243 O  O     . SER B 1 138 ? 28.100 148.528 -6.640  1.00 27.25  ? 170 SER B O     1 
ATOM   2244 C  CB    . SER B 1 138 ? 28.359 151.227 -4.989  1.00 30.03  ? 170 SER B CB    1 
ATOM   2245 O  OG    . SER B 1 138 ? 27.973 152.584 -5.122  1.00 39.21  ? 170 SER B OG    1 
ATOM   2246 N  N     . THR B 1 139 ? 27.630 148.029 -4.495  1.00 22.90  ? 171 THR B N     1 
ATOM   2247 C  CA    . THR B 1 139 ? 27.916 146.610 -4.687  1.00 25.45  ? 171 THR B CA    1 
ATOM   2248 C  C     . THR B 1 139 ? 26.932 145.990 -5.673  1.00 29.62  ? 171 THR B C     1 
ATOM   2249 O  O     . THR B 1 139 ? 27.328 145.298 -6.623  1.00 24.02  ? 171 THR B O     1 
ATOM   2250 C  CB    . THR B 1 139 ? 27.865 145.879 -3.344  1.00 25.02  ? 171 THR B CB    1 
ATOM   2251 O  OG1   . THR B 1 139 ? 28.997 146.250 -2.547  1.00 26.09  ? 171 THR B OG1   1 
ATOM   2252 C  CG2   . THR B 1 139 ? 27.869 144.371 -3.552  1.00 23.75  ? 171 THR B CG2   1 
ATOM   2253 N  N     . VAL B 1 140 ? 25.637 146.239 -5.463  1.00 25.54  ? 172 VAL B N     1 
ATOM   2254 C  CA    . VAL B 1 140 ? 24.621 145.756 -6.391  1.00 23.91  ? 172 VAL B CA    1 
ATOM   2255 C  C     . VAL B 1 140 ? 24.801 146.392 -7.761  1.00 22.90  ? 172 VAL B C     1 
ATOM   2256 O  O     . VAL B 1 140 ? 24.535 145.758 -8.786  1.00 26.57  ? 172 VAL B O     1 
ATOM   2257 C  CB    . VAL B 1 140 ? 23.212 146.024 -5.826  1.00 27.18  ? 172 VAL B CB    1 
ATOM   2258 C  CG1   . VAL B 1 140 ? 22.158 145.317 -6.664  1.00 25.74  ? 172 VAL B CG1   1 
ATOM   2259 C  CG2   . VAL B 1 140 ? 23.133 145.584 -4.373  1.00 25.84  ? 172 VAL B CG2   1 
ATOM   2260 N  N     . LYS B 1 141 ? 25.268 147.641 -7.806  1.00 25.25  ? 173 LYS B N     1 
ATOM   2261 C  CA    . LYS B 1 141 ? 25.490 148.308 -9.085  1.00 24.07  ? 173 LYS B CA    1 
ATOM   2262 C  C     . LYS B 1 141 ? 26.583 147.610 -9.885  1.00 24.44  ? 173 LYS B C     1 
ATOM   2263 O  O     . LYS B 1 141 ? 26.433 147.366 -11.087 1.00 25.60  ? 173 LYS B O     1 
ATOM   2264 C  CB    . LYS B 1 141 ? 25.846 149.776 -8.850  1.00 22.99  ? 173 LYS B CB    1 
ATOM   2265 C  CG    . LYS B 1 141 ? 26.364 150.501 -10.080 1.00 28.68  ? 173 LYS B CG    1 
ATOM   2266 C  CD    . LYS B 1 141 ? 27.372 151.575 -9.700  1.00 32.79  ? 173 LYS B CD    1 
ATOM   2267 C  CE    . LYS B 1 141 ? 26.754 152.617 -8.780  1.00 35.02  ? 173 LYS B CE    1 
ATOM   2268 N  NZ    . LYS B 1 141 ? 25.726 153.438 -9.479  1.00 39.32  ? 173 LYS B NZ    1 
ATOM   2269 N  N     . GLU B 1 142 ? 27.697 147.283 -9.228  1.00 21.72  ? 174 GLU B N     1 
ATOM   2270 C  CA    . GLU B 1 142 ? 28.779 146.573 -9.905  1.00 27.95  ? 174 GLU B CA    1 
ATOM   2271 C  C     . GLU B 1 142 ? 28.342 145.175 -10.330 1.00 26.98  ? 174 GLU B C     1 
ATOM   2272 O  O     . GLU B 1 142 ? 28.648 144.731 -11.447 1.00 29.70  ? 174 GLU B O     1 
ATOM   2273 C  CB    . GLU B 1 142 ? 30.006 146.507 -8.995  1.00 24.78  ? 174 GLU B CB    1 
ATOM   2274 C  CG    . GLU B 1 142 ? 30.707 147.844 -8.815  1.00 33.14  ? 174 GLU B CG    1 
ATOM   2275 C  CD    . GLU B 1 142 ? 31.261 148.385 -10.119 1.00 42.35  ? 174 GLU B CD    1 
ATOM   2276 O  OE1   . GLU B 1 142 ? 31.881 147.604 -10.870 1.00 43.38  ? 174 GLU B OE1   1 
ATOM   2277 O  OE2   . GLU B 1 142 ? 31.072 149.588 -10.397 1.00 48.75  ? 174 GLU B OE2   1 
ATOM   2278 N  N     . LEU B 1 143 ? 27.611 144.473 -9.458  1.00 23.47  ? 175 LEU B N     1 
ATOM   2279 C  CA    . LEU B 1 143 ? 27.118 143.147 -9.820  1.00 24.67  ? 175 LEU B CA    1 
ATOM   2280 C  C     . LEU B 1 143 ? 26.161 143.215 -11.004 1.00 29.36  ? 175 LEU B C     1 
ATOM   2281 O  O     . LEU B 1 143 ? 26.169 142.331 -11.867 1.00 26.96  ? 175 LEU B O     1 
ATOM   2282 C  CB    . LEU B 1 143 ? 26.440 142.491 -8.619  1.00 26.20  ? 175 LEU B CB    1 
ATOM   2283 C  CG    . LEU B 1 143 ? 27.365 142.132 -7.458  1.00 28.49  ? 175 LEU B CG    1 
ATOM   2284 C  CD1   . LEU B 1 143 ? 26.582 141.439 -6.357  1.00 25.24  ? 175 LEU B CD1   1 
ATOM   2285 C  CD2   . LEU B 1 143 ? 28.518 141.261 -7.939  1.00 27.44  ? 175 LEU B CD2   1 
ATOM   2286 N  N     . CYS B 1 144 ? 25.329 144.256 -11.063 1.00 25.08  ? 176 CYS B N     1 
ATOM   2287 C  CA    . CYS B 1 144 ? 24.411 144.416 -12.184 1.00 20.88  ? 176 CYS B CA    1 
ATOM   2288 C  C     . CYS B 1 144 ? 25.164 144.749 -13.464 1.00 26.07  ? 176 CYS B C     1 
ATOM   2289 O  O     . CYS B 1 144 ? 24.838 144.229 -14.537 1.00 28.81  ? 176 CYS B O     1 
ATOM   2290 C  CB    . CYS B 1 144 ? 23.385 145.504 -11.863 1.00 25.66  ? 176 CYS B CB    1 
ATOM   2291 S  SG    . CYS B 1 144 ? 22.196 145.847 -13.177 1.00 29.40  ? 176 CYS B SG    1 
ATOM   2292 N  N     . ARG B 1 145 ? 26.175 145.614 -13.367 1.00 25.60  ? 177 ARG B N     1 
ATOM   2293 C  CA    . ARG B 1 145 ? 26.997 145.934 -14.528 1.00 33.55  ? 177 ARG B CA    1 
ATOM   2294 C  C     . ARG B 1 145 ? 27.657 144.683 -15.092 1.00 33.98  ? 177 ARG B C     1 
ATOM   2295 O  O     . ARG B 1 145 ? 27.771 144.528 -16.314 1.00 26.76  ? 177 ARG B O     1 
ATOM   2296 C  CB    . ARG B 1 145 ? 28.046 146.978 -14.144 1.00 32.65  ? 177 ARG B CB    1 
ATOM   2297 C  CG    . ARG B 1 145 ? 29.184 147.141 -15.136 1.00 42.25  ? 177 ARG B CG    1 
ATOM   2298 C  CD    . ARG B 1 145 ? 30.071 148.318 -14.754 1.00 47.52  ? 177 ARG B CD    1 
ATOM   2299 N  NE    . ARG B 1 145 ? 31.439 148.154 -15.236 1.00 62.74  ? 177 ARG B NE    1 
ATOM   2300 C  CZ    . ARG B 1 145 ? 32.479 147.877 -14.456 1.00 65.44  ? 177 ARG B CZ    1 
ATOM   2301 N  NH1   . ARG B 1 145 ? 32.309 147.730 -13.150 1.00 64.81  ? 177 ARG B NH1   1 
ATOM   2302 N  NH2   . ARG B 1 145 ? 33.689 147.747 -14.981 1.00 68.20  ? 177 ARG B NH2   1 
ATOM   2303 N  N     . ARG B 1 146 ? 28.079 143.768 -14.218 1.00 26.47  ? 178 ARG B N     1 
ATOM   2304 C  CA    . ARG B 1 146 ? 28.748 142.562 -14.699 1.00 27.21  ? 178 ARG B CA    1 
ATOM   2305 C  C     . ARG B 1 146 ? 27.758 141.524 -15.223 1.00 31.96  ? 178 ARG B C     1 
ATOM   2306 O  O     . ARG B 1 146 ? 27.914 141.016 -16.339 1.00 27.73  ? 178 ARG B O     1 
ATOM   2307 C  CB    . ARG B 1 146 ? 29.609 141.961 -13.589 1.00 25.35  ? 178 ARG B CB    1 
ATOM   2308 C  CG    . ARG B 1 146 ? 30.893 142.719 -13.353 1.00 21.44  ? 178 ARG B CG    1 
ATOM   2309 C  CD    . ARG B 1 146 ? 31.536 142.309 -12.044 1.00 23.76  ? 178 ARG B CD    1 
ATOM   2310 N  NE    . ARG B 1 146 ? 32.861 142.899 -11.889 1.00 28.97  ? 178 ARG B NE    1 
ATOM   2311 C  CZ    . ARG B 1 146 ? 33.079 144.162 -11.542 1.00 29.27  ? 178 ARG B CZ    1 
ATOM   2312 N  NH1   . ARG B 1 146 ? 32.058 144.977 -11.310 1.00 25.06  ? 178 ARG B NH1   1 
ATOM   2313 N  NH2   . ARG B 1 146 ? 34.320 144.612 -11.427 1.00 24.04  ? 178 ARG B NH2   1 
ATOM   2314 N  N     . TRP B 1 147 ? 26.737 141.194 -14.433 1.00 24.13  ? 179 TRP B N     1 
ATOM   2315 C  CA    . TRP B 1 147 ? 25.863 140.065 -14.732 1.00 24.87  ? 179 TRP B CA    1 
ATOM   2316 C  C     . TRP B 1 147 ? 24.640 140.437 -15.559 1.00 32.82  ? 179 TRP B C     1 
ATOM   2317 O  O     . TRP B 1 147 ? 24.071 139.560 -16.220 1.00 28.53  ? 179 TRP B O     1 
ATOM   2318 C  CB    . TRP B 1 147 ? 25.397 139.402 -13.431 1.00 24.96  ? 179 TRP B CB    1 
ATOM   2319 C  CG    . TRP B 1 147 ? 26.519 138.907 -12.562 1.00 25.01  ? 179 TRP B CG    1 
ATOM   2320 C  CD1   . TRP B 1 147 ? 27.811 138.680 -12.938 1.00 22.37  ? 179 TRP B CD1   1 
ATOM   2321 C  CD2   . TRP B 1 147 ? 26.444 138.580 -11.168 1.00 25.17  ? 179 TRP B CD2   1 
ATOM   2322 N  NE1   . TRP B 1 147 ? 28.545 138.232 -11.866 1.00 28.62  ? 179 TRP B NE1   1 
ATOM   2323 C  CE2   . TRP B 1 147 ? 27.729 138.161 -10.768 1.00 27.38  ? 179 TRP B CE2   1 
ATOM   2324 C  CE3   . TRP B 1 147 ? 25.415 138.602 -10.220 1.00 25.38  ? 179 TRP B CE3   1 
ATOM   2325 C  CZ2   . TRP B 1 147 ? 28.012 137.767 -9.462  1.00 26.98  ? 179 TRP B CZ2   1 
ATOM   2326 C  CZ3   . TRP B 1 147 ? 25.699 138.209 -8.923  1.00 23.80  ? 179 TRP B CZ3   1 
ATOM   2327 C  CH2   . TRP B 1 147 ? 26.986 137.797 -8.557  1.00 27.15  ? 179 TRP B CH2   1 
ATOM   2328 N  N     . TYR B 1 148 ? 24.212 141.698 -15.534 1.00 26.12  ? 180 TYR B N     1 
ATOM   2329 C  CA    . TYR B 1 148 ? 23.013 142.138 -16.251 1.00 27.06  ? 180 TYR B CA    1 
ATOM   2330 C  C     . TYR B 1 148 ? 23.299 143.465 -16.941 1.00 31.58  ? 180 TYR B C     1 
ATOM   2331 O  O     . TYR B 1 148 ? 22.747 144.509 -16.576 1.00 30.20  ? 180 TYR B O     1 
ATOM   2332 C  CB    . TYR B 1 148 ? 21.822 142.252 -15.296 1.00 27.31  ? 180 TYR B CB    1 
ATOM   2333 C  CG    . TYR B 1 148 ? 21.505 140.965 -14.565 1.00 26.68  ? 180 TYR B CG    1 
ATOM   2334 C  CD1   . TYR B 1 148 ? 22.083 140.681 -13.334 1.00 19.93  ? 180 TYR B CD1   1 
ATOM   2335 C  CD2   . TYR B 1 148 ? 20.633 140.032 -15.111 1.00 26.62  ? 180 TYR B CD2   1 
ATOM   2336 C  CE1   . TYR B 1 148 ? 21.800 139.504 -12.666 1.00 23.63  ? 180 TYR B CE1   1 
ATOM   2337 C  CE2   . TYR B 1 148 ? 20.343 138.853 -14.450 1.00 31.64  ? 180 TYR B CE2   1 
ATOM   2338 C  CZ    . TYR B 1 148 ? 20.929 138.594 -13.229 1.00 28.73  ? 180 TYR B CZ    1 
ATOM   2339 O  OH    . TYR B 1 148 ? 20.644 137.421 -12.570 1.00 28.86  ? 180 TYR B OH    1 
ATOM   2340 N  N     . PRO B 1 149 ? 24.164 143.457 -17.962 1.00 29.80  ? 181 PRO B N     1 
ATOM   2341 C  CA    . PRO B 1 149 ? 24.528 144.730 -18.610 1.00 32.51  ? 181 PRO B CA    1 
ATOM   2342 C  C     . PRO B 1 149 ? 23.363 145.407 -19.309 1.00 34.09  ? 181 PRO B C     1 
ATOM   2343 O  O     . PRO B 1 149 ? 23.266 146.643 -19.291 1.00 34.88  ? 181 PRO B O     1 
ATOM   2344 C  CB    . PRO B 1 149 ? 25.626 144.312 -19.598 1.00 31.79  ? 181 PRO B CB    1 
ATOM   2345 C  CG    . PRO B 1 149 ? 25.360 142.868 -19.870 1.00 35.94  ? 181 PRO B CG    1 
ATOM   2346 C  CD    . PRO B 1 149 ? 24.824 142.300 -18.592 1.00 31.19  ? 181 PRO B CD    1 
ATOM   2347 N  N     . GLU B 1 150 ? 22.470 144.629 -19.925 1.00 34.25  ? 182 GLU B N     1 
ATOM   2348 C  CA    . GLU B 1 150 ? 21.299 145.214 -20.571 1.00 33.17  ? 182 GLU B CA    1 
ATOM   2349 C  C     . GLU B 1 150 ? 20.449 145.978 -19.565 1.00 34.66  ? 182 GLU B C     1 
ATOM   2350 O  O     . GLU B 1 150 ? 20.092 147.140 -19.791 1.00 37.32  ? 182 GLU B O     1 
ATOM   2351 C  CB    . GLU B 1 150 ? 20.477 144.121 -21.255 1.00 40.76  ? 182 GLU B CB    1 
ATOM   2352 C  CG    . GLU B 1 150 ? 19.182 144.618 -21.878 1.00 55.33  ? 182 GLU B CG    1 
ATOM   2353 C  CD    . GLU B 1 150 ? 18.390 143.506 -22.540 1.00 69.56  ? 182 GLU B CD    1 
ATOM   2354 O  OE1   . GLU B 1 150 ? 17.164 143.429 -22.312 1.00 72.87  ? 182 GLU B OE1   1 
ATOM   2355 O  OE2   . GLU B 1 150 ? 18.995 142.708 -23.287 1.00 73.82  ? 182 GLU B OE2   1 
ATOM   2356 N  N     . GLU B 1 151 ? 20.121 145.341 -18.438 1.00 30.03  ? 183 GLU B N     1 
ATOM   2357 C  CA    . GLU B 1 151 ? 19.358 146.024 -17.401 1.00 31.66  ? 183 GLU B CA    1 
ATOM   2358 C  C     . GLU B 1 151 ? 20.151 147.186 -16.815 1.00 33.12  ? 183 GLU B C     1 
ATOM   2359 O  O     . GLU B 1 151 ? 19.576 148.218 -16.448 1.00 32.98  ? 183 GLU B O     1 
ATOM   2360 C  CB    . GLU B 1 151 ? 18.965 145.034 -16.302 1.00 33.21  ? 183 GLU B CB    1 
ATOM   2361 C  CG    . GLU B 1 151 ? 17.936 143.994 -16.730 1.00 35.20  ? 183 GLU B CG    1 
ATOM   2362 C  CD    . GLU B 1 151 ? 18.551 142.812 -17.464 1.00 39.77  ? 183 GLU B CD    1 
ATOM   2363 O  OE1   . GLU B 1 151 ? 19.764 142.853 -17.764 1.00 39.63  ? 183 GLU B OE1   1 
ATOM   2364 O  OE2   . GLU B 1 151 ? 17.818 141.839 -17.743 1.00 45.42  ? 183 GLU B OE2   1 
ATOM   2365 N  N     . TYR B 1 152 ? 21.475 147.036 -16.722 1.00 28.82  ? 184 TYR B N     1 
ATOM   2366 C  CA    . TYR B 1 152 ? 22.304 148.094 -16.156 1.00 29.74  ? 184 TYR B CA    1 
ATOM   2367 C  C     . TYR B 1 152 ? 22.256 149.354 -17.011 1.00 35.66  ? 184 TYR B C     1 
ATOM   2368 O  O     . TYR B 1 152 ? 22.297 150.473 -16.485 1.00 31.53  ? 184 TYR B O     1 
ATOM   2369 C  CB    . TYR B 1 152 ? 23.745 147.606 -16.005 1.00 28.52  ? 184 TYR B CB    1 
ATOM   2370 C  CG    . TYR B 1 152 ? 24.658 148.612 -15.347 1.00 32.00  ? 184 TYR B CG    1 
ATOM   2371 C  CD1   . TYR B 1 152 ? 24.522 148.924 -14.001 1.00 31.92  ? 184 TYR B CD1   1 
ATOM   2372 C  CD2   . TYR B 1 152 ? 25.653 149.254 -16.072 1.00 38.56  ? 184 TYR B CD2   1 
ATOM   2373 C  CE1   . TYR B 1 152 ? 25.353 149.845 -13.394 1.00 30.66  ? 184 TYR B CE1   1 
ATOM   2374 C  CE2   . TYR B 1 152 ? 26.490 150.177 -15.473 1.00 41.68  ? 184 TYR B CE2   1 
ATOM   2375 C  CZ    . TYR B 1 152 ? 26.336 150.469 -14.134 1.00 41.03  ? 184 TYR B CZ    1 
ATOM   2376 O  OH    . TYR B 1 152 ? 27.165 151.387 -13.529 1.00 41.52  ? 184 TYR B OH    1 
ATOM   2377 N  N     . GLU B 1 153 ? 22.166 149.194 -18.334 1.00 28.62  ? 185 GLU B N     1 
ATOM   2378 C  CA    . GLU B 1 153 ? 22.134 150.361 -19.211 1.00 35.94  ? 185 GLU B CA    1 
ATOM   2379 C  C     . GLU B 1 153 ? 20.883 151.205 -18.992 1.00 39.21  ? 185 GLU B C     1 
ATOM   2380 O  O     . GLU B 1 153 ? 20.920 152.426 -19.189 1.00 36.61  ? 185 GLU B O     1 
ATOM   2381 C  CB    . GLU B 1 153 ? 22.229 149.925 -20.672 1.00 35.98  ? 185 GLU B CB    1 
ATOM   2382 C  CG    . GLU B 1 153 ? 22.605 151.049 -21.624 1.00 45.08  ? 185 GLU B CG    1 
ATOM   2383 C  CD    . GLU B 1 153 ? 23.990 151.606 -21.352 1.00 51.37  ? 185 GLU B CD    1 
ATOM   2384 O  OE1   . GLU B 1 153 ? 24.896 150.819 -21.004 1.00 51.44  ? 185 GLU B OE1   1 
ATOM   2385 O  OE2   . GLU B 1 153 ? 24.176 152.834 -21.488 1.00 52.37  ? 185 GLU B OE2   1 
ATOM   2386 N  N     . PHE B 1 154 ? 19.777 150.588 -18.582 1.00 34.37  ? 186 PHE B N     1 
ATOM   2387 C  CA    . PHE B 1 154 ? 18.524 151.299 -18.363 1.00 35.84  ? 186 PHE B CA    1 
ATOM   2388 C  C     . PHE B 1 154 ? 18.315 151.706 -16.911 1.00 39.69  ? 186 PHE B C     1 
ATOM   2389 O  O     . PHE B 1 154 ? 17.254 152.243 -16.580 1.00 41.30  ? 186 PHE B O     1 
ATOM   2390 C  CB    . PHE B 1 154 ? 17.344 150.443 -18.835 1.00 36.99  ? 186 PHE B CB    1 
ATOM   2391 C  CG    . PHE B 1 154 ? 17.417 150.059 -20.286 1.00 48.40  ? 186 PHE B CG    1 
ATOM   2392 C  CD1   . PHE B 1 154 ? 17.240 151.009 -21.278 1.00 54.40  ? 186 PHE B CD1   1 
ATOM   2393 C  CD2   . PHE B 1 154 ? 17.667 148.750 -20.657 1.00 44.31  ? 186 PHE B CD2   1 
ATOM   2394 C  CE1   . PHE B 1 154 ? 17.310 150.659 -22.613 1.00 50.63  ? 186 PHE B CE1   1 
ATOM   2395 C  CE2   . PHE B 1 154 ? 17.740 148.393 -21.991 1.00 46.45  ? 186 PHE B CE2   1 
ATOM   2396 C  CZ    . PHE B 1 154 ? 17.560 149.349 -22.970 1.00 48.57  ? 186 PHE B CZ    1 
ATOM   2397 N  N     . ALA B 1 155 ? 19.295 151.470 -16.043 1.00 33.48  ? 187 ALA B N     1 
ATOM   2398 C  CA    . ALA B 1 155 ? 19.154 151.829 -14.642 1.00 36.70  ? 187 ALA B CA    1 
ATOM   2399 C  C     . ALA B 1 155 ? 19.166 153.349 -14.474 1.00 47.57  ? 187 ALA B C     1 
ATOM   2400 O  O     . ALA B 1 155 ? 19.770 154.066 -15.277 1.00 55.14  ? 187 ALA B O     1 
ATOM   2401 C  CB    . ALA B 1 155 ? 20.278 151.207 -13.818 1.00 34.70  ? 187 ALA B CB    1 
ATOM   2402 N  N     . PRO B 1 156 ? 18.494 153.869 -13.435 1.00 55.43  ? 188 PRO B N     1 
ATOM   2403 C  CA    . PRO B 1 156 ? 18.510 155.311 -13.166 1.00 66.98  ? 188 PRO B CA    1 
ATOM   2404 C  C     . PRO B 1 156 ? 19.855 155.784 -12.622 1.00 69.10  ? 188 PRO B C     1 
ATOM   2405 O  O     . PRO B 1 156 ? 20.538 155.002 -11.958 1.00 68.02  ? 188 PRO B O     1 
ATOM   2406 C  CB    . PRO B 1 156 ? 17.406 155.481 -12.118 1.00 64.09  ? 188 PRO B CB    1 
ATOM   2407 C  CG    . PRO B 1 156 ? 17.349 154.165 -11.426 1.00 53.54  ? 188 PRO B CG    1 
ATOM   2408 C  CD    . PRO B 1 156 ? 17.631 153.142 -12.488 1.00 49.30  ? 188 PRO B CD    1 
ATOM   2409 N  N     . SER B 1 161 ? 23.199 167.099 -9.623  1.00 86.89  ? 193 SER B N     1 
ATOM   2410 C  CA    . SER B 1 161 ? 23.372 167.945 -8.448  1.00 88.05  ? 193 SER B CA    1 
ATOM   2411 C  C     . SER B 1 161 ? 23.945 167.150 -7.279  1.00 80.11  ? 193 SER B C     1 
ATOM   2412 O  O     . SER B 1 161 ? 23.332 166.191 -6.809  1.00 77.94  ? 193 SER B O     1 
ATOM   2413 C  CB    . SER B 1 161 ? 22.041 168.585 -8.046  1.00 92.32  ? 193 SER B CB    1 
ATOM   2414 O  OG    . SER B 1 161 ? 21.083 167.598 -7.704  1.00 90.56  ? 193 SER B OG    1 
ATOM   2415 N  N     . HIS B 1 162 ? 25.125 167.555 -6.811  1.00 68.83  ? 194 HIS B N     1 
ATOM   2416 C  CA    . HIS B 1 162 ? 25.791 166.874 -5.701  1.00 62.39  ? 194 HIS B CA    1 
ATOM   2417 C  C     . HIS B 1 162 ? 25.278 167.433 -4.373  1.00 54.02  ? 194 HIS B C     1 
ATOM   2418 O  O     . HIS B 1 162 ? 25.979 168.112 -3.620  1.00 47.20  ? 194 HIS B O     1 
ATOM   2419 C  CB    . HIS B 1 162 ? 27.304 167.005 -5.826  1.00 70.56  ? 194 HIS B CB    1 
ATOM   2420 C  CG    . HIS B 1 162 ? 27.923 165.991 -6.737  1.00 76.13  ? 194 HIS B CG    1 
ATOM   2421 N  ND1   . HIS B 1 162 ? 28.152 164.687 -6.353  1.00 76.41  ? 194 HIS B ND1   1 
ATOM   2422 C  CD2   . HIS B 1 162 ? 28.357 166.088 -8.016  1.00 77.92  ? 194 HIS B CD2   1 
ATOM   2423 C  CE1   . HIS B 1 162 ? 28.703 164.025 -7.355  1.00 75.04  ? 194 HIS B CE1   1 
ATOM   2424 N  NE2   . HIS B 1 162 ? 28.838 164.852 -8.376  1.00 76.52  ? 194 HIS B NE2   1 
ATOM   2425 N  N     . ARG B 1 163 ? 24.011 167.132 -4.099  1.00 42.83  ? 195 ARG B N     1 
ATOM   2426 C  CA    . ARG B 1 163 ? 23.365 167.483 -2.844  1.00 42.55  ? 195 ARG B CA    1 
ATOM   2427 C  C     . ARG B 1 163 ? 22.882 166.210 -2.161  1.00 34.30  ? 195 ARG B C     1 
ATOM   2428 O  O     . ARG B 1 163 ? 22.474 165.250 -2.821  1.00 39.26  ? 195 ARG B O     1 
ATOM   2429 C  CB    . ARG B 1 163 ? 22.199 168.455 -3.067  1.00 36.02  ? 195 ARG B CB    1 
ATOM   2430 C  CG    . ARG B 1 163 ? 22.605 169.757 -3.747  1.00 50.17  ? 195 ARG B CG    1 
ATOM   2431 C  CD    . ARG B 1 163 ? 23.186 170.754 -2.751  1.00 61.36  ? 195 ARG B CD    1 
ATOM   2432 N  NE    . ARG B 1 163 ? 22.346 170.900 -1.565  1.00 81.43  ? 195 ARG B NE    1 
ATOM   2433 C  CZ    . ARG B 1 163 ? 21.197 171.570 -1.537  1.00 91.94  ? 195 ARG B CZ    1 
ATOM   2434 N  NH1   . ARG B 1 163 ? 20.745 172.168 -2.631  1.00 93.70  ? 195 ARG B NH1   1 
ATOM   2435 N  NH2   . ARG B 1 163 ? 20.500 171.645 -0.412  1.00 94.49  ? 195 ARG B NH2   1 
ATOM   2436 N  N     . ALA B 1 164 ? 22.925 166.217 -0.827  1.00 33.48  ? 196 ALA B N     1 
ATOM   2437 C  CA    . ALA B 1 164 ? 22.796 164.978 -0.064  1.00 31.33  ? 196 ALA B CA    1 
ATOM   2438 C  C     . ALA B 1 164 ? 21.416 164.345 -0.229  1.00 30.05  ? 196 ALA B C     1 
ATOM   2439 O  O     . ALA B 1 164 ? 21.303 163.135 -0.467  1.00 34.44  ? 196 ALA B O     1 
ATOM   2440 C  CB    . ALA B 1 164 ? 23.099 165.245 1.410   1.00 31.12  ? 196 ALA B CB    1 
ATOM   2441 N  N     . LEU B 1 165 ? 20.353 165.143 -0.098  1.00 32.77  ? 197 LEU B N     1 
ATOM   2442 C  CA    . LEU B 1 165 ? 19.002 164.589 -0.144  1.00 31.89  ? 197 LEU B CA    1 
ATOM   2443 C  C     . LEU B 1 165 ? 18.698 163.985 -1.512  1.00 30.59  ? 197 LEU B C     1 
ATOM   2444 O  O     . LEU B 1 165 ? 18.169 162.869 -1.611  1.00 33.60  ? 197 LEU B O     1 
ATOM   2445 C  CB    . LEU B 1 165 ? 17.982 165.671 0.210   1.00 34.56  ? 197 LEU B CB    1 
ATOM   2446 C  CG    . LEU B 1 165 ? 16.533 165.211 0.377   1.00 35.02  ? 197 LEU B CG    1 
ATOM   2447 C  CD1   . LEU B 1 165 ? 16.446 164.054 1.360   1.00 31.69  ? 197 LEU B CD1   1 
ATOM   2448 C  CD2   . LEU B 1 165 ? 15.654 166.368 0.828   1.00 31.89  ? 197 LEU B CD2   1 
ATOM   2449 N  N     . ASP B 1 166 ? 19.026 164.717 -2.580  1.00 33.42  ? 198 ASP B N     1 
ATOM   2450 C  CA    . ASP B 1 166 ? 18.828 164.200 -3.929  1.00 35.06  ? 198 ASP B CA    1 
ATOM   2451 C  C     . ASP B 1 166 ? 19.613 162.913 -4.146  1.00 31.43  ? 198 ASP B C     1 
ATOM   2452 O  O     . ASP B 1 166 ? 19.093 161.943 -4.715  1.00 38.64  ? 198 ASP B O     1 
ATOM   2453 C  CB    . ASP B 1 166 ? 19.238 165.258 -4.952  1.00 35.57  ? 198 ASP B CB    1 
ATOM   2454 C  CG    . ASP B 1 166 ? 18.563 166.590 -4.708  1.00 52.35  ? 198 ASP B CG    1 
ATOM   2455 O  OD1   . ASP B 1 166 ? 17.317 166.625 -4.720  1.00 49.22  ? 198 ASP B OD1   1 
ATOM   2456 O  OD2   . ASP B 1 166 ? 19.272 167.598 -4.500  1.00 55.39  ? 198 ASP B OD2   1 
ATOM   2457 N  N     . ALA B 1 167 ? 20.864 162.882 -3.681  1.00 32.77  ? 199 ALA B N     1 
ATOM   2458 C  CA    . ALA B 1 167 ? 21.699 161.703 -3.874  1.00 34.83  ? 199 ALA B CA    1 
ATOM   2459 C  C     . ALA B 1 167 ? 21.127 160.489 -3.153  1.00 30.37  ? 199 ALA B C     1 
ATOM   2460 O  O     . ALA B 1 167 ? 21.100 159.386 -3.710  1.00 29.77  ? 199 ALA B O     1 
ATOM   2461 C  CB    . ALA B 1 167 ? 23.124 161.987 -3.400  1.00 35.92  ? 199 ALA B CB    1 
ATOM   2462 N  N     . ILE B 1 168 ? 20.653 160.667 -1.917  1.00 26.57  ? 200 ILE B N     1 
ATOM   2463 C  CA    . ILE B 1 168 ? 20.155 159.507 -1.180  1.00 30.48  ? 200 ILE B CA    1 
ATOM   2464 C  C     . ILE B 1 168 ? 18.812 159.037 -1.740  1.00 26.90  ? 200 ILE B C     1 
ATOM   2465 O  O     . ILE B 1 168 ? 18.538 157.825 -1.787  1.00 32.75  ? 200 ILE B O     1 
ATOM   2466 C  CB    . ILE B 1 168 ? 20.093 159.815 0.331   1.00 36.16  ? 200 ILE B CB    1 
ATOM   2467 C  CG1   . ILE B 1 168 ? 19.993 158.517 1.134   1.00 38.38  ? 200 ILE B CG1   1 
ATOM   2468 C  CG2   . ILE B 1 168 ? 18.948 160.759 0.668   1.00 31.13  ? 200 ILE B CG2   1 
ATOM   2469 C  CD1   . ILE B 1 168 ? 21.190 157.603 0.969   1.00 39.81  ? 200 ILE B CD1   1 
ATOM   2470 N  N     . SER B 1 169 ? 17.969 159.967 -2.204  1.00 32.91  ? 201 SER B N     1 
ATOM   2471 C  CA    . SER B 1 169 ? 16.735 159.570 -2.877  1.00 34.74  ? 201 SER B CA    1 
ATOM   2472 C  C     . SER B 1 169 ? 17.039 158.751 -4.127  1.00 30.60  ? 201 SER B C     1 
ATOM   2473 O  O     . SER B 1 169 ? 16.415 157.707 -4.377  1.00 32.02  ? 201 SER B O     1 
ATOM   2474 C  CB    . SER B 1 169 ? 15.913 160.813 -3.224  1.00 38.59  ? 201 SER B CB    1 
ATOM   2475 O  OG    . SER B 1 169 ? 14.995 160.551 -4.271  1.00 51.28  ? 201 SER B OG    1 
ATOM   2476 N  N     . GLU B 1 170 ? 18.012 159.207 -4.922  1.00 29.33  ? 202 GLU B N     1 
ATOM   2477 C  CA    . GLU B 1 170 ? 18.392 158.462 -6.117  1.00 29.56  ? 202 GLU B CA    1 
ATOM   2478 C  C     . GLU B 1 170 ? 19.021 157.119 -5.768  1.00 24.71  ? 202 GLU B C     1 
ATOM   2479 O  O     . GLU B 1 170 ? 18.868 156.157 -6.524  1.00 26.43  ? 202 GLU B O     1 
ATOM   2480 C  CB    . GLU B 1 170 ? 19.339 159.298 -6.976  1.00 36.98  ? 202 GLU B CB    1 
ATOM   2481 C  CG    . GLU B 1 170 ? 18.684 160.542 -7.560  1.00 64.44  ? 202 GLU B CG    1 
ATOM   2482 C  CD    . GLU B 1 170 ? 19.665 161.438 -8.287  1.00 84.58  ? 202 GLU B CD    1 
ATOM   2483 O  OE1   . GLU B 1 170 ? 19.384 161.816 -9.444  1.00 90.37  ? 202 GLU B OE1   1 
ATOM   2484 O  OE2   . GLU B 1 170 ? 20.718 161.766 -7.701  1.00 89.17  ? 202 GLU B OE2   1 
ATOM   2485 N  N     . SER B 1 171 ? 19.717 157.026 -4.633  1.00 27.19  ? 203 SER B N     1 
ATOM   2486 C  CA    . SER B 1 171 ? 20.256 155.738 -4.201  1.00 27.11  ? 203 SER B CA    1 
ATOM   2487 C  C     . SER B 1 171 ? 19.134 154.748 -3.911  1.00 33.66  ? 203 SER B C     1 
ATOM   2488 O  O     . SER B 1 171 ? 19.187 153.579 -4.328  1.00 25.35  ? 203 SER B O     1 
ATOM   2489 C  CB    . SER B 1 171 ? 21.137 155.929 -2.966  1.00 33.50  ? 203 SER B CB    1 
ATOM   2490 O  OG    . SER B 1 171 ? 22.193 156.838 -3.222  1.00 44.05  ? 203 SER B OG    1 
ATOM   2491 N  N     . ILE B 1 172 ? 18.113 155.200 -3.178  1.00 30.82  ? 204 ILE B N     1 
ATOM   2492 C  CA    . ILE B 1 172 ? 16.967 154.338 -2.889  1.00 28.57  ? 204 ILE B CA    1 
ATOM   2493 C  C     . ILE B 1 172 ? 16.311 153.881 -4.187  1.00 26.79  ? 204 ILE B C     1 
ATOM   2494 O  O     . ILE B 1 172 ? 15.990 152.695 -4.362  1.00 28.33  ? 204 ILE B O     1 
ATOM   2495 C  CB    . ILE B 1 172 ? 15.962 155.059 -1.973  1.00 31.81  ? 204 ILE B CB    1 
ATOM   2496 C  CG1   . ILE B 1 172 ? 16.559 155.253 -0.581  1.00 27.42  ? 204 ILE B CG1   1 
ATOM   2497 C  CG2   . ILE B 1 172 ? 14.664 154.275 -1.885  1.00 28.64  ? 204 ILE B CG2   1 
ATOM   2498 C  CD1   . ILE B 1 172 ? 15.664 156.014 0.368   1.00 28.63  ? 204 ILE B CD1   1 
ATOM   2499 N  N     . LYS B 1 173 ? 16.110 154.817 -5.125  1.00 26.35  ? 205 LYS B N     1 
ATOM   2500 C  CA    . LYS B 1 173 ? 15.481 154.438 -6.389  1.00 27.83  ? 205 LYS B CA    1 
ATOM   2501 C  C     . LYS B 1 173 ? 16.357 153.464 -7.177  1.00 31.90  ? 205 LYS B C     1 
ATOM   2502 O  O     . LYS B 1 173 ? 15.833 152.532 -7.796  1.00 28.13  ? 205 LYS B O     1 
ATOM   2503 C  CB    . LYS B 1 173 ? 15.142 155.687 -7.222  1.00 37.59  ? 205 LYS B CB    1 
ATOM   2504 C  CG    . LYS B 1 173 ? 14.933 155.443 -8.726  1.00 56.80  ? 205 LYS B CG    1 
ATOM   2505 C  CD    . LYS B 1 173 ? 13.737 154.523 -9.032  1.00 71.10  ? 205 LYS B CD    1 
ATOM   2506 C  CE    . LYS B 1 173 ? 13.375 154.557 -10.507 1.00 74.27  ? 205 LYS B CE    1 
ATOM   2507 N  NZ    . LYS B 1 173 ? 13.513 155.931 -11.069 1.00 70.40  ? 205 LYS B NZ    1 
ATOM   2508 N  N     . GLU B 1 174 ? 17.684 153.639 -7.147  1.00 30.39  ? 206 GLU B N     1 
ATOM   2509 C  CA    . GLU B 1 174 ? 18.574 152.725 -7.860  1.00 32.93  ? 206 GLU B CA    1 
ATOM   2510 C  C     . GLU B 1 174 ? 18.464 151.310 -7.305  1.00 27.89  ? 206 GLU B C     1 
ATOM   2511 O  O     . GLU B 1 174 ? 18.356 150.340 -8.070  1.00 28.03  ? 206 GLU B O     1 
ATOM   2512 C  CB    . GLU B 1 174 ? 20.015 153.230 -7.780  1.00 27.79  ? 206 GLU B CB    1 
ATOM   2513 C  CG    . GLU B 1 174 ? 20.969 152.535 -8.735  1.00 32.31  ? 206 GLU B CG    1 
ATOM   2514 C  CD    . GLU B 1 174 ? 22.414 152.818 -8.408  1.00 36.72  ? 206 GLU B CD    1 
ATOM   2515 O  OE1   . GLU B 1 174 ? 22.668 153.761 -7.629  1.00 34.90  ? 206 GLU B OE1   1 
ATOM   2516 O  OE2   . GLU B 1 174 ? 23.292 152.096 -8.923  1.00 32.59  ? 206 GLU B OE2   1 
ATOM   2517 N  N     . LEU B 1 175 ? 18.463 151.175 -5.976  1.00 26.49  ? 207 LEU B N     1 
ATOM   2518 C  CA    . LEU B 1 175 ? 18.297 149.847 -5.390  1.00 22.55  ? 207 LEU B CA    1 
ATOM   2519 C  C     . LEU B 1 175 ? 16.928 149.262 -5.725  1.00 26.70  ? 207 LEU B C     1 
ATOM   2520 O  O     . LEU B 1 175 ? 16.798 148.049 -5.944  1.00 26.16  ? 207 LEU B O     1 
ATOM   2521 C  CB    . LEU B 1 175 ? 18.502 149.895 -3.877  1.00 26.95  ? 207 LEU B CB    1 
ATOM   2522 C  CG    . LEU B 1 175 ? 18.465 148.518 -3.208  1.00 26.30  ? 207 LEU B CG    1 
ATOM   2523 C  CD1   . LEU B 1 175 ? 19.468 147.571 -3.860  1.00 26.73  ? 207 LEU B CD1   1 
ATOM   2524 C  CD2   . LEU B 1 175 ? 18.721 148.630 -1.716  1.00 19.30  ? 207 LEU B CD2   1 
ATOM   2525 N  N     . GLN B 1 176 ? 15.892 150.106 -5.776  1.00 26.25  ? 208 GLN B N     1 
ATOM   2526 C  CA    . GLN B 1 176 ? 14.566 149.608 -6.135  1.00 26.65  ? 208 GLN B CA    1 
ATOM   2527 C  C     . GLN B 1 176 ? 14.540 149.095 -7.571  1.00 29.28  ? 208 GLN B C     1 
ATOM   2528 O  O     . GLN B 1 176 ? 13.936 148.053 -7.855  1.00 26.09  ? 208 GLN B O     1 
ATOM   2529 C  CB    . GLN B 1 176 ? 13.519 150.705 -5.938  1.00 28.72  ? 208 GLN B CB    1 
ATOM   2530 C  CG    . GLN B 1 176 ? 12.086 150.229 -6.117  1.00 39.37  ? 208 GLN B CG    1 
ATOM   2531 C  CD    . GLN B 1 176 ? 11.674 149.209 -5.072  1.00 44.70  ? 208 GLN B CD    1 
ATOM   2532 O  OE1   . GLN B 1 176 ? 11.557 149.529 -3.889  1.00 49.97  ? 208 GLN B OE1   1 
ATOM   2533 N  NE2   . GLN B 1 176 ? 11.452 147.973 -5.505  1.00 40.63  ? 208 GLN B NE2   1 
ATOM   2534 N  N     . PHE B 1 177 ? 15.183 149.821 -8.489  1.00 27.66  ? 209 PHE B N     1 
ATOM   2535 C  CA    . PHE B 1 177 ? 15.292 149.350 -9.866  1.00 29.97  ? 209 PHE B CA    1 
ATOM   2536 C  C     . PHE B 1 177 ? 16.006 148.008 -9.924  1.00 30.88  ? 209 PHE B C     1 
ATOM   2537 O  O     . PHE B 1 177 ? 15.584 147.099 -10.652 1.00 27.47  ? 209 PHE B O     1 
ATOM   2538 C  CB    . PHE B 1 177 ? 16.028 150.380 -10.728 1.00 28.83  ? 209 PHE B CB    1 
ATOM   2539 C  CG    . PHE B 1 177 ? 16.312 149.908 -12.135 1.00 29.82  ? 209 PHE B CG    1 
ATOM   2540 C  CD1   . PHE B 1 177 ? 17.478 149.215 -12.433 1.00 31.94  ? 209 PHE B CD1   1 
ATOM   2541 C  CD2   . PHE B 1 177 ? 15.412 150.161 -13.158 1.00 34.28  ? 209 PHE B CD2   1 
ATOM   2542 C  CE1   . PHE B 1 177 ? 17.733 148.775 -13.720 1.00 33.29  ? 209 PHE B CE1   1 
ATOM   2543 C  CE2   . PHE B 1 177 ? 15.665 149.728 -14.448 1.00 34.23  ? 209 PHE B CE2   1 
ATOM   2544 C  CZ    . PHE B 1 177 ? 16.827 149.036 -14.729 1.00 34.12  ? 209 PHE B CZ    1 
ATOM   2545 N  N     . TYR B 1 178 ? 17.101 147.871 -9.171  1.00 24.12  ? 210 TYR B N     1 
ATOM   2546 C  CA    . TYR B 1 178 ? 17.827 146.605 -9.166  1.00 30.59  ? 210 TYR B CA    1 
ATOM   2547 C  C     . TYR B 1 178 ? 16.939 145.467 -8.677  1.00 27.77  ? 210 TYR B C     1 
ATOM   2548 O  O     . TYR B 1 178 ? 16.898 144.393 -9.288  1.00 26.35  ? 210 TYR B O     1 
ATOM   2549 C  CB    . TYR B 1 178 ? 19.089 146.715 -8.311  1.00 25.43  ? 210 TYR B CB    1 
ATOM   2550 C  CG    . TYR B 1 178 ? 20.138 147.615 -8.916  1.00 25.39  ? 210 TYR B CG    1 
ATOM   2551 C  CD1   . TYR B 1 178 ? 20.293 147.702 -10.294 1.00 22.40  ? 210 TYR B CD1   1 
ATOM   2552 C  CD2   . TYR B 1 178 ? 20.968 148.383 -8.113  1.00 22.02  ? 210 TYR B CD2   1 
ATOM   2553 C  CE1   . TYR B 1 178 ? 21.247 148.528 -10.855 1.00 22.65  ? 210 TYR B CE1   1 
ATOM   2554 C  CE2   . TYR B 1 178 ? 21.926 149.210 -8.663  1.00 21.64  ? 210 TYR B CE2   1 
ATOM   2555 C  CZ    . TYR B 1 178 ? 22.060 149.281 -10.034 1.00 22.74  ? 210 TYR B CZ    1 
ATOM   2556 O  OH    . TYR B 1 178 ? 23.011 150.106 -10.585 1.00 29.87  ? 210 TYR B OH    1 
ATOM   2557 N  N     . ARG B 1 179 ? 16.205 145.688 -7.583  1.00 22.00  ? 211 ARG B N     1 
ATOM   2558 C  CA    . ARG B 1 179 ? 15.325 144.632 -7.088  1.00 28.96  ? 211 ARG B CA    1 
ATOM   2559 C  C     . ARG B 1 179 ? 14.245 144.292 -8.107  1.00 33.87  ? 211 ARG B C     1 
ATOM   2560 O  O     . ARG B 1 179 ? 13.909 143.117 -8.297  1.00 31.69  ? 211 ARG B O     1 
ATOM   2561 C  CB    . ARG B 1 179 ? 14.683 145.024 -5.757  1.00 29.99  ? 211 ARG B CB    1 
ATOM   2562 C  CG    . ARG B 1 179 ? 13.871 143.877 -5.162  1.00 28.78  ? 211 ARG B CG    1 
ATOM   2563 C  CD    . ARG B 1 179 ? 13.089 144.252 -3.917  1.00 31.95  ? 211 ARG B CD    1 
ATOM   2564 N  NE    . ARG B 1 179 ? 12.451 143.071 -3.337  1.00 30.43  ? 211 ARG B NE    1 
ATOM   2565 C  CZ    . ARG B 1 179 ? 11.739 143.073 -2.215  1.00 32.76  ? 211 ARG B CZ    1 
ATOM   2566 N  NH1   . ARG B 1 179 ? 11.563 144.199 -1.538  1.00 31.73  ? 211 ARG B NH1   1 
ATOM   2567 N  NH2   . ARG B 1 179 ? 11.201 141.946 -1.768  1.00 39.80  ? 211 ARG B NH2   1 
ATOM   2568 N  N     . ASN B 1 180 ? 13.697 145.305 -8.781  1.00 28.22  ? 212 ASN B N     1 
ATOM   2569 C  CA    . ASN B 1 180 ? 12.634 145.051 -9.744  1.00 28.80  ? 212 ASN B CA    1 
ATOM   2570 C  C     . ASN B 1 180 ? 13.141 144.320 -10.980 1.00 33.90  ? 212 ASN B C     1 
ATOM   2571 O  O     . ASN B 1 180 ? 12.375 143.586 -11.615 1.00 36.56  ? 212 ASN B O     1 
ATOM   2572 C  CB    . ASN B 1 180 ? 11.967 146.364 -10.157 1.00 32.01  ? 212 ASN B CB    1 
ATOM   2573 C  CG    . ASN B 1 180 ? 11.150 146.980 -9.043  1.00 35.67  ? 212 ASN B CG    1 
ATOM   2574 O  OD1   . ASN B 1 180 ? 10.872 146.335 -8.032  1.00 38.47  ? 212 ASN B OD1   1 
ATOM   2575 N  ND2   . ASN B 1 180 ? 10.755 148.235 -9.222  1.00 38.26  ? 212 ASN B ND2   1 
ATOM   2576 N  N     . ASN B 1 181 ? 14.414 144.499 -11.344 1.00 32.38  ? 213 ASN B N     1 
ATOM   2577 C  CA    . ASN B 1 181 ? 14.859 144.074 -12.664 1.00 30.97  ? 213 ASN B CA    1 
ATOM   2578 C  C     . ASN B 1 181 ? 15.871 142.935 -12.693 1.00 36.05  ? 213 ASN B C     1 
ATOM   2579 O  O     . ASN B 1 181 ? 15.947 142.243 -13.713 1.00 30.04  ? 213 ASN B O     1 
ATOM   2580 C  CB    . ASN B 1 181 ? 15.447 145.269 -13.428 1.00 32.96  ? 213 ASN B CB    1 
ATOM   2581 C  CG    . ASN B 1 181 ? 14.380 146.242 -13.885 1.00 37.10  ? 213 ASN B CG    1 
ATOM   2582 O  OD1   . ASN B 1 181 ? 13.825 146.102 -14.975 1.00 39.55  ? 213 ASN B OD1   1 
ATOM   2583 N  ND2   . ASN B 1 181 ? 14.079 147.229 -13.050 1.00 33.43  ? 213 ASN B ND2   1 
ATOM   2584 N  N     . ILE B 1 182 ? 16.658 142.718 -11.638 1.00 30.40  ? 214 ILE B N     1 
ATOM   2585 C  CA    . ILE B 1 182 ? 17.705 141.701 -11.728 1.00 30.45  ? 214 ILE B CA    1 
ATOM   2586 C  C     . ILE B 1 182 ? 17.592 140.663 -10.618 1.00 29.30  ? 214 ILE B C     1 
ATOM   2587 O  O     . ILE B 1 182 ? 18.331 139.672 -10.612 1.00 29.53  ? 214 ILE B O     1 
ATOM   2588 C  CB    . ILE B 1 182 ? 19.111 142.336 -11.721 1.00 23.62  ? 214 ILE B CB    1 
ATOM   2589 C  CG1   . ILE B 1 182 ? 19.450 142.887 -10.335 1.00 28.59  ? 214 ILE B CG1   1 
ATOM   2590 C  CG2   . ILE B 1 182 ? 19.227 143.413 -12.792 1.00 24.90  ? 214 ILE B CG2   1 
ATOM   2591 C  CD1   . ILE B 1 182 ? 20.899 143.287 -10.183 1.00 30.23  ? 214 ILE B CD1   1 
ATOM   2592 N  N     . PHE B 1 183 ? 16.683 140.870 -9.673  1.00 27.87  ? 215 PHE B N     1 
ATOM   2593 C  CA    . PHE B 1 183 ? 16.482 139.898 -8.609  1.00 26.61  ? 215 PHE B CA    1 
ATOM   2594 C  C     . PHE B 1 183 ? 15.338 138.956 -8.963  1.00 30.45  ? 215 PHE B C     1 
ATOM   2595 O  O     . PHE B 1 183 ? 14.442 139.299 -9.738  1.00 31.43  ? 215 PHE B O     1 
ATOM   2596 C  CB    . PHE B 1 183 ? 16.209 140.594 -7.275  1.00 27.99  ? 215 PHE B CB    1 
ATOM   2597 C  CG    . PHE B 1 183 ? 17.454 141.069 -6.577  1.00 25.86  ? 215 PHE B CG    1 
ATOM   2598 C  CD1   . PHE B 1 183 ? 18.026 142.287 -6.907  1.00 27.52  ? 215 PHE B CD1   1 
ATOM   2599 C  CD2   . PHE B 1 183 ? 18.057 140.292 -5.601  1.00 30.07  ? 215 PHE B CD2   1 
ATOM   2600 C  CE1   . PHE B 1 183 ? 19.173 142.725 -6.270  1.00 26.66  ? 215 PHE B CE1   1 
ATOM   2601 C  CE2   . PHE B 1 183 ? 19.206 140.725 -4.960  1.00 26.94  ? 215 PHE B CE2   1 
ATOM   2602 C  CZ    . PHE B 1 183 ? 19.765 141.943 -5.296  1.00 25.57  ? 215 PHE B CZ    1 
ATOM   2603 N  N     . LYS B 1 184 ? 15.385 137.756 -8.387  1.00 28.50  ? 216 LYS B N     1 
ATOM   2604 C  CA    . LYS B 1 184 ? 14.427 136.713 -8.731  1.00 30.73  ? 216 LYS B CA    1 
ATOM   2605 C  C     . LYS B 1 184 ? 13.005 137.129 -8.373  1.00 30.14  ? 216 LYS B C     1 
ATOM   2606 O  O     . LYS B 1 184 ? 12.747 137.666 -7.292  1.00 32.36  ? 216 LYS B O     1 
ATOM   2607 C  CB    . LYS B 1 184 ? 14.788 135.412 -8.012  1.00 34.04  ? 216 LYS B CB    1 
ATOM   2608 C  CG    . LYS B 1 184 ? 13.963 134.208 -8.438  1.00 46.41  ? 216 LYS B CG    1 
ATOM   2609 C  CD    . LYS B 1 184 ? 14.416 132.950 -7.716  1.00 45.88  ? 216 LYS B CD    1 
ATOM   2610 C  CE    . LYS B 1 184 ? 14.140 133.040 -6.223  1.00 43.29  ? 216 LYS B CE    1 
ATOM   2611 N  NZ    . LYS B 1 184 ? 14.529 131.789 -5.514  1.00 43.25  ? 216 LYS B NZ    1 
ATOM   2612 N  N     . LYS B 1 185 ? 12.078 136.875 -9.293  1.00 31.71  ? 217 LYS B N     1 
ATOM   2613 C  CA    . LYS B 1 185 ? 10.671 137.160 -9.055  1.00 46.13  ? 217 LYS B CA    1 
ATOM   2614 C  C     . LYS B 1 185 ? 10.051 136.067 -8.194  1.00 50.14  ? 217 LYS B C     1 
ATOM   2615 O  O     . LYS B 1 185 ? 10.376 134.885 -8.336  1.00 52.82  ? 217 LYS B O     1 
ATOM   2616 C  CB    . LYS B 1 185 ? 9.915  137.274 -10.379 1.00 54.01  ? 217 LYS B CB    1 
ATOM   2617 C  CG    . LYS B 1 185 ? 10.319 138.466 -11.231 1.00 59.88  ? 217 LYS B CG    1 
ATOM   2618 C  CD    . LYS B 1 185 ? 9.716  139.757 -10.701 1.00 68.94  ? 217 LYS B CD    1 
ATOM   2619 C  CE    . LYS B 1 185 ? 9.987  140.919 -11.644 1.00 74.23  ? 217 LYS B CE    1 
ATOM   2620 N  NZ    . LYS B 1 185 ? 9.391  142.190 -11.146 1.00 76.77  ? 217 LYS B NZ    1 
ATOM   2621 N  N     . LYS B 1 186 ? 9.153  136.469 -7.302  1.00 52.23  ? 218 LYS B N     1 
ATOM   2622 C  CA    . LYS B 1 186 ? 8.493  135.528 -6.403  1.00 65.75  ? 218 LYS B CA    1 
ATOM   2623 C  C     . LYS B 1 186 ? 7.104  135.160 -6.914  1.00 67.91  ? 218 LYS B C     1 
ATOM   2624 O  O     . LYS B 1 186 ? 6.950  134.239 -7.716  1.00 68.99  ? 218 LYS B O     1 
ATOM   2625 C  CB    . LYS B 1 186 ? 8.398  136.112 -4.993  1.00 71.29  ? 218 LYS B CB    1 
ATOM   2626 C  CG    . LYS B 1 186 ? 9.710  136.663 -4.462  1.00 72.14  ? 218 LYS B CG    1 
ATOM   2627 C  CD    . LYS B 1 186 ? 9.658  136.860 -2.956  1.00 69.40  ? 218 LYS B CD    1 
ATOM   2628 C  CE    . LYS B 1 186 ? 10.831 136.178 -2.274  1.00 64.25  ? 218 LYS B CE    1 
ATOM   2629 N  NZ    . LYS B 1 186 ? 10.646 136.078 -0.800  1.00 63.69  ? 218 LYS B NZ    1 
ATOM   2630 P  P     . U   C 2 1   ? 28.965 155.755 -6.447  1.00 42.07  ? 11  U   C P     1 
ATOM   2631 O  OP1   . U   C 2 1   ? 29.067 154.277 -6.332  1.00 39.18  ? 11  U   C OP1   1 
ATOM   2632 O  OP2   . U   C 2 1   ? 29.772 156.465 -7.471  1.00 40.99  ? 11  U   C OP2   1 
ATOM   2633 O  "O5'" . U   C 2 1   ? 29.317 156.365 -5.019  1.00 45.43  ? 11  U   C "O5'" 1 
ATOM   2634 C  "C5'" . U   C 2 1   ? 29.646 157.738 -4.866  1.00 49.84  ? 11  U   C "C5'" 1 
ATOM   2635 C  "C4'" . U   C 2 1   ? 30.360 157.984 -3.561  1.00 60.10  ? 11  U   C "C4'" 1 
ATOM   2636 O  "O4'" . U   C 2 1   ? 31.631 157.288 -3.561  1.00 63.01  ? 11  U   C "O4'" 1 
ATOM   2637 C  "C3'" . U   C 2 1   ? 30.728 159.427 -3.255  1.00 66.99  ? 11  U   C "C3'" 1 
ATOM   2638 O  "O3'" . U   C 2 1   ? 29.641 160.166 -2.725  1.00 59.89  ? 11  U   C "O3'" 1 
ATOM   2639 C  "C2'" . U   C 2 1   ? 31.893 159.279 -2.280  1.00 68.08  ? 11  U   C "C2'" 1 
ATOM   2640 O  "O2'" . U   C 2 1   ? 31.419 159.035 -0.963  1.00 65.63  ? 11  U   C "O2'" 1 
ATOM   2641 C  "C1'" . U   C 2 1   ? 32.574 158.005 -2.793  1.00 62.96  ? 11  U   C "C1'" 1 
ATOM   2642 N  N1    . U   C 2 1   ? 33.769 158.286 -3.624  1.00 52.82  ? 11  U   C N1    1 
ATOM   2643 C  C2    . U   C 2 1   ? 34.994 157.989 -3.059  1.00 51.99  ? 11  U   C C2    1 
ATOM   2644 O  O2    . U   C 2 1   ? 35.103 157.511 -1.942  1.00 57.68  ? 11  U   C O2    1 
ATOM   2645 N  N3    . U   C 2 1   ? 36.085 158.257 -3.848  1.00 56.25  ? 11  U   C N3    1 
ATOM   2646 C  C4    . U   C 2 1   ? 36.076 158.791 -5.119  1.00 56.44  ? 11  U   C C4    1 
ATOM   2647 O  O4    . U   C 2 1   ? 37.145 158.978 -5.704  1.00 61.49  ? 11  U   C O4    1 
ATOM   2648 C  C5    . U   C 2 1   ? 34.772 159.078 -5.635  1.00 54.14  ? 11  U   C C5    1 
ATOM   2649 C  C6    . U   C 2 1   ? 33.691 158.823 -4.889  1.00 49.21  ? 11  U   C C6    1 
ATOM   2650 P  P     . U   C 2 2   ? 29.135 161.511 -3.445  1.00 50.39  ? 12  U   C P     1 
ATOM   2651 O  OP1   . U   C 2 2   ? 27.817 161.871 -2.861  1.00 47.32  ? 12  U   C OP1   1 
ATOM   2652 O  OP2   . U   C 2 2   ? 29.258 161.327 -4.914  1.00 51.31  ? 12  U   C OP2   1 
ATOM   2653 O  "O5'" . U   C 2 2   ? 30.193 162.614 -2.995  1.00 47.30  ? 12  U   C "O5'" 1 
ATOM   2654 C  "C5'" . U   C 2 2   ? 30.608 162.716 -1.641  1.00 48.93  ? 12  U   C "C5'" 1 
ATOM   2655 C  "C4'" . U   C 2 2   ? 31.785 163.648 -1.482  1.00 52.45  ? 12  U   C "C4'" 1 
ATOM   2656 O  "O4'" . U   C 2 2   ? 32.990 163.038 -2.012  1.00 56.28  ? 12  U   C "O4'" 1 
ATOM   2657 C  "C3'" . U   C 2 2   ? 31.699 164.978 -2.212  1.00 48.09  ? 12  U   C "C3'" 1 
ATOM   2658 O  "O3'" . U   C 2 2   ? 30.886 165.926 -1.540  1.00 47.55  ? 12  U   C "O3'" 1 
ATOM   2659 C  "C2'" . U   C 2 2   ? 33.162 165.396 -2.313  1.00 49.55  ? 12  U   C "C2'" 1 
ATOM   2660 O  "O2'" . U   C 2 2   ? 33.605 165.962 -1.089  1.00 51.48  ? 12  U   C "O2'" 1 
ATOM   2661 C  "C1'" . U   C 2 2   ? 33.858 164.043 -2.496  1.00 60.65  ? 12  U   C "C1'" 1 
ATOM   2662 N  N1    . U   C 2 2   ? 34.237 163.775 -3.909  1.00 70.46  ? 12  U   C N1    1 
ATOM   2663 C  C2    . U   C 2 2   ? 33.474 162.977 -4.755  1.00 74.67  ? 12  U   C C2    1 
ATOM   2664 O  O2    . U   C 2 2   ? 32.435 162.421 -4.450  1.00 78.04  ? 12  U   C O2    1 
ATOM   2665 N  N3    . U   C 2 2   ? 33.975 162.837 -6.026  1.00 79.02  ? 12  U   C N3    1 
ATOM   2666 C  C4    . U   C 2 2   ? 35.127 163.388 -6.545  1.00 80.03  ? 12  U   C C4    1 
ATOM   2667 O  O4    . U   C 2 2   ? 35.433 163.159 -7.716  1.00 85.02  ? 12  U   C O4    1 
ATOM   2668 C  C5    . U   C 2 2   ? 35.862 164.192 -5.620  1.00 75.84  ? 12  U   C C5    1 
ATOM   2669 C  C6    . U   C 2 2   ? 35.396 164.353 -4.378  1.00 72.74  ? 12  U   C C6    1 
HETATM 2670 C  C1    . CIT D 3 .   ? 50.598 153.195 -6.732  1.00 68.81  ? 301 CIT A C1    1 
HETATM 2671 O  O1    . CIT D 3 .   ? 51.728 152.815 -6.358  1.00 57.50  ? 301 CIT A O1    1 
HETATM 2672 O  O2    . CIT D 3 .   ? 50.054 154.148 -6.133  1.00 65.55  ? 301 CIT A O2    1 
HETATM 2673 C  C2    . CIT D 3 .   ? 49.904 152.503 -7.882  1.00 74.57  ? 301 CIT A C2    1 
HETATM 2674 C  C3    . CIT D 3 .   ? 50.334 153.130 -9.208  1.00 83.97  ? 301 CIT A C3    1 
HETATM 2675 O  O7    . CIT D 3 .   ? 51.645 153.713 -9.006  1.00 90.07  ? 301 CIT A O7    1 
HETATM 2676 C  C4    . CIT D 3 .   ? 50.454 152.130 -10.354 1.00 79.64  ? 301 CIT A C4    1 
HETATM 2677 C  C5    . CIT D 3 .   ? 49.267 151.201 -10.457 1.00 72.20  ? 301 CIT A C5    1 
HETATM 2678 O  O3    . CIT D 3 .   ? 49.425 150.041 -10.885 1.00 76.45  ? 301 CIT A O3    1 
HETATM 2679 O  O4    . CIT D 3 .   ? 48.112 151.562 -10.138 1.00 69.69  ? 301 CIT A O4    1 
HETATM 2680 C  C6    . CIT D 3 .   ? 49.393 154.247 -9.631  1.00 90.30  ? 301 CIT A C6    1 
HETATM 2681 O  O5    . CIT D 3 .   ? 49.664 154.957 -10.623 1.00 93.96  ? 301 CIT A O5    1 
HETATM 2682 O  O6    . CIT D 3 .   ? 48.342 154.466 -8.991  1.00 91.34  ? 301 CIT A O6    1 
HETATM 2683 MG MG    . MG  E 4 .   ? 26.468 163.710 -3.724  1.00 59.00  ? 301 MG  B MG    1 
HETATM 2684 MG MG    . MG  F 4 .   ? 26.168 159.188 -2.963  0.69 43.46  ? 302 MG  B MG    1 
HETATM 2685 O  O     . HOH G 5 .   ? 58.694 143.177 -1.165  1.00 53.56  ? 401 HOH A O     1 
HETATM 2686 O  O     . HOH G 5 .   ? 36.007 139.233 -16.137 1.00 31.84  ? 402 HOH A O     1 
HETATM 2687 O  O     . HOH G 5 .   ? 24.592 133.908 4.635   1.00 49.87  ? 403 HOH A O     1 
HETATM 2688 O  O     . HOH G 5 .   ? 55.181 149.618 -0.106  1.00 38.70  ? 404 HOH A O     1 
HETATM 2689 O  O     . HOH G 5 .   ? 11.693 133.196 -3.295  1.00 53.59  ? 405 HOH A O     1 
HETATM 2690 O  O     . HOH G 5 .   ? 42.935 155.139 -7.657  1.00 60.25  ? 406 HOH A O     1 
HETATM 2691 O  O     . HOH G 5 .   ? 42.242 147.702 -10.771 1.00 31.35  ? 407 HOH A O     1 
HETATM 2692 O  O     . HOH G 5 .   ? 29.819 138.282 -15.767 1.00 37.67  ? 408 HOH A O     1 
HETATM 2693 O  O     . HOH G 5 .   ? 20.752 133.318 -11.357 1.00 44.67  ? 409 HOH A O     1 
HETATM 2694 O  O     . HOH G 5 .   ? 39.757 141.503 -21.287 1.00 40.59  ? 410 HOH A O     1 
HETATM 2695 O  O     . HOH G 5 .   ? 45.131 135.925 -14.578 1.00 49.74  ? 411 HOH A O     1 
HETATM 2696 O  O     . HOH G 5 .   ? 18.284 133.647 -18.688 1.00 70.76  ? 412 HOH A O     1 
HETATM 2697 O  O     . HOH G 5 .   ? 55.039 136.743 5.158   1.00 62.16  ? 413 HOH A O     1 
HETATM 2698 O  O     . HOH G 5 .   ? 40.760 146.606 -19.360 1.00 37.26  ? 414 HOH A O     1 
HETATM 2699 O  O     . HOH G 5 .   ? 53.745 139.832 -5.816  1.00 41.67  ? 415 HOH A O     1 
HETATM 2700 O  O     . HOH G 5 .   ? 17.830 132.580 -9.033  1.00 37.63  ? 416 HOH A O     1 
HETATM 2701 O  O     . HOH G 5 .   ? 28.920 133.260 -11.403 1.00 36.67  ? 417 HOH A O     1 
HETATM 2702 O  O     . HOH G 5 .   ? 37.933 148.804 -3.963  1.00 26.81  ? 418 HOH A O     1 
HETATM 2703 O  O     . HOH G 5 .   ? 14.119 127.916 4.066   1.00 42.72  ? 419 HOH A O     1 
HETATM 2704 O  O     . HOH G 5 .   ? 34.990 147.178 -11.929 1.00 38.27  ? 420 HOH A O     1 
HETATM 2705 O  O     . HOH G 5 .   ? 12.129 133.640 0.264   1.00 43.08  ? 421 HOH A O     1 
HETATM 2706 O  O     . HOH G 5 .   ? 35.662 139.738 -26.665 1.00 57.88  ? 422 HOH A O     1 
HETATM 2707 O  O     . HOH G 5 .   ? 45.118 155.111 -1.586  1.00 43.39  ? 423 HOH A O     1 
HETATM 2708 O  O     . HOH G 5 .   ? 46.716 134.225 -1.641  1.00 51.01  ? 424 HOH A O     1 
HETATM 2709 O  O     . HOH G 5 .   ? 40.618 152.133 -3.937  1.00 39.76  ? 425 HOH A O     1 
HETATM 2710 O  O     . HOH G 5 .   ? 47.679 131.560 -9.323  1.00 57.55  ? 426 HOH A O     1 
HETATM 2711 O  O     . HOH G 5 .   ? 15.691 136.064 7.090   1.00 45.58  ? 427 HOH A O     1 
HETATM 2712 O  O     . HOH G 5 .   ? 41.139 154.490 6.183   1.00 43.17  ? 428 HOH A O     1 
HETATM 2713 O  O     . HOH G 5 .   ? 43.193 151.921 -16.387 1.00 51.68  ? 429 HOH A O     1 
HETATM 2714 O  O     . HOH G 5 .   ? 36.144 141.446 -23.062 1.00 40.27  ? 430 HOH A O     1 
HETATM 2715 O  O     . HOH G 5 .   ? 38.866 138.204 -16.859 1.00 34.97  ? 431 HOH A O     1 
HETATM 2716 O  O     . HOH G 5 .   ? 45.529 153.667 -10.337 1.00 58.92  ? 432 HOH A O     1 
HETATM 2717 O  O     . HOH G 5 .   ? 37.126 129.214 -9.534  1.00 39.97  ? 433 HOH A O     1 
HETATM 2718 O  O     . HOH G 5 .   ? 37.112 140.651 3.031   1.00 53.00  ? 434 HOH A O     1 
HETATM 2719 O  O     . HOH G 5 .   ? 35.634 150.487 -13.302 1.00 44.59  ? 435 HOH A O     1 
HETATM 2720 O  O     . HOH G 5 .   ? 50.539 137.445 -11.721 1.00 50.92  ? 436 HOH A O     1 
HETATM 2721 O  O     . HOH G 5 .   ? 56.025 146.810 9.430   1.00 56.68  ? 437 HOH A O     1 
HETATM 2722 O  O     . HOH G 5 .   ? 12.261 140.561 -4.891  1.00 39.91  ? 438 HOH A O     1 
HETATM 2723 O  O     . HOH G 5 .   ? 34.367 134.526 4.836   1.00 43.69  ? 439 HOH A O     1 
HETATM 2724 O  O     . HOH G 5 .   ? 27.569 136.741 -16.993 1.00 59.14  ? 440 HOH A O     1 
HETATM 2725 O  O     . HOH G 5 .   ? 14.423 134.171 -12.261 1.00 46.06  ? 441 HOH A O     1 
HETATM 2726 O  O     . HOH G 5 .   ? 29.033 142.973 -18.576 1.00 54.42  ? 442 HOH A O     1 
HETATM 2727 O  O     . HOH G 5 .   ? 36.453 129.306 11.569  1.00 71.02  ? 443 HOH A O     1 
HETATM 2728 O  O     . HOH G 5 .   ? 31.547 130.401 -11.453 1.00 61.90  ? 444 HOH A O     1 
HETATM 2729 O  O     . HOH G 5 .   ? 16.479 129.319 -5.771  1.00 44.66  ? 445 HOH A O     1 
HETATM 2730 O  O     . HOH G 5 .   ? 55.502 146.292 -9.622  1.00 45.61  ? 446 HOH A O     1 
HETATM 2731 O  O     . HOH G 5 .   ? 60.524 142.313 5.201   1.00 48.48  ? 447 HOH A O     1 
HETATM 2732 O  O     . HOH G 5 .   ? 12.802 129.021 -2.511  1.00 57.19  ? 448 HOH A O     1 
HETATM 2733 O  O     . HOH G 5 .   ? 33.829 136.169 -16.705 1.00 52.03  ? 449 HOH A O     1 
HETATM 2734 O  O     . HOH G 5 .   ? 48.343 147.557 -14.230 1.00 38.48  ? 450 HOH A O     1 
HETATM 2735 O  O     . HOH G 5 .   ? 39.207 140.912 -23.848 1.00 48.19  ? 451 HOH A O     1 
HETATM 2736 O  O     . HOH G 5 .   ? 19.956 144.468 10.086  1.00 57.00  ? 452 HOH A O     1 
HETATM 2737 O  O     . HOH G 5 .   ? 13.771 139.366 -17.961 1.00 60.47  ? 453 HOH A O     1 
HETATM 2738 O  O     . HOH G 5 .   ? 24.526 125.892 0.000   0.50 44.72  ? 454 HOH A O     1 
HETATM 2739 O  O     . HOH G 5 .   ? 40.443 154.804 -6.032  1.00 62.37  ? 455 HOH A O     1 
HETATM 2740 O  O     . HOH G 5 .   ? 16.740 136.817 9.703   1.00 50.85  ? 456 HOH A O     1 
HETATM 2741 O  O     . HOH G 5 .   ? 10.488 138.935 1.829   1.00 59.52  ? 457 HOH A O     1 
HETATM 2742 O  O     . HOH G 5 .   ? 21.898 133.360 -13.391 1.00 71.33  ? 458 HOH A O     1 
HETATM 2743 O  O     . HOH G 5 .   ? 30.481 159.457 -10.897 1.00 60.59  ? 459 HOH A O     1 
HETATM 2744 O  O     . HOH H 5 .   ? 38.971 168.825 -1.484  1.00 59.98  ? 401 HOH B O     1 
HETATM 2745 O  O     . HOH H 5 .   ? 19.297 170.012 -4.970  1.00 46.85  ? 402 HOH B O     1 
HETATM 2746 O  O     . HOH H 5 .   ? 28.027 158.156 -0.475  0.74 36.28  ? 403 HOH B O     1 
HETATM 2747 O  O     . HOH H 5 .   ? 30.976 150.591 -3.152  1.00 38.06  ? 404 HOH B O     1 
HETATM 2748 O  O     . HOH H 5 .   ? 23.011 160.877 -7.067  1.00 49.68  ? 405 HOH B O     1 
HETATM 2749 O  O     . HOH H 5 .   ? 29.168 160.711 0.598   1.00 49.63  ? 406 HOH B O     1 
HETATM 2750 O  O     . HOH H 5 .   ? 27.790 170.276 -4.475  1.00 51.31  ? 407 HOH B O     1 
HETATM 2751 O  O     . HOH H 5 .   ? 11.639 142.007 13.851  1.00 61.01  ? 408 HOH B O     1 
HETATM 2752 O  O     . HOH H 5 .   ? 11.173 161.345 14.203  1.00 47.88  ? 409 HOH B O     1 
HETATM 2753 O  O     . HOH H 5 .   ? 19.734 150.928 14.752  1.00 40.92  ? 410 HOH B O     1 
HETATM 2754 O  O     . HOH H 5 .   ? 25.957 153.384 -12.099 1.00 44.56  ? 411 HOH B O     1 
HETATM 2755 O  O     . HOH H 5 .   ? 20.539 168.208 0.582   1.00 37.34  ? 412 HOH B O     1 
HETATM 2756 O  O     . HOH H 5 .   ? 32.622 179.587 6.128   1.00 78.01  ? 413 HOH B O     1 
HETATM 2757 O  O     . HOH H 5 .   ? 10.878 154.377 -1.517  1.00 40.02  ? 414 HOH B O     1 
HETATM 2758 O  O     . HOH H 5 .   ? 11.898 142.803 3.191   1.00 43.28  ? 415 HOH B O     1 
HETATM 2759 O  O     . HOH H 5 .   ? 23.010 158.735 -5.518  0.80 28.55  ? 416 HOH B O     1 
HETATM 2760 O  O     . HOH H 5 .   ? 21.563 141.607 -19.370 1.00 33.73  ? 417 HOH B O     1 
HETATM 2761 O  O     . HOH H 5 .   ? 16.016 165.641 14.655  1.00 42.11  ? 418 HOH B O     1 
HETATM 2762 O  O     . HOH H 5 .   ? 27.556 150.531 -21.565 1.00 63.41  ? 419 HOH B O     1 
HETATM 2763 O  O     . HOH H 5 .   ? 23.722 136.946 -15.477 1.00 50.35  ? 420 HOH B O     1 
HETATM 2764 O  O     . HOH H 5 .   ? 34.319 152.512 6.117   1.00 52.10  ? 421 HOH B O     1 
HETATM 2765 O  O     . HOH H 5 .   ? 11.103 146.661 -2.655  1.00 37.06  ? 422 HOH B O     1 
HETATM 2766 O  O     . HOH H 5 .   ? 8.796  155.141 -0.348  1.00 31.43  ? 423 HOH B O     1 
HETATM 2767 O  O     . HOH H 5 .   ? 25.243 157.313 0.575   1.00 42.50  ? 424 HOH B O     1 
HETATM 2768 O  O     . HOH H 5 .   ? 32.624 165.015 16.808  1.00 68.06  ? 425 HOH B O     1 
HETATM 2769 O  O     . HOH H 5 .   ? 21.644 155.304 20.841  1.00 56.08  ? 426 HOH B O     1 
HETATM 2770 O  O     . HOH H 5 .   ? 9.912  141.385 0.616   1.00 47.82  ? 427 HOH B O     1 
HETATM 2771 O  O     . HOH H 5 .   ? 23.847 152.389 -15.207 1.00 53.30  ? 428 HOH B O     1 
HETATM 2772 O  O     . HOH H 5 .   ? 29.568 152.224 -14.668 1.00 58.13  ? 429 HOH B O     1 
HETATM 2773 O  O     . HOH H 5 .   ? 9.155  149.701 -2.459  1.00 54.49  ? 430 HOH B O     1 
HETATM 2774 O  O     . HOH H 5 .   ? 13.633 140.947 -11.891 1.00 53.11  ? 431 HOH B O     1 
HETATM 2775 O  O     . HOH H 5 .   ? 16.583 164.132 4.879   1.00 39.02  ? 432 HOH B O     1 
HETATM 2776 O  O     . HOH H 5 .   ? 11.985 141.002 -8.267  1.00 50.15  ? 433 HOH B O     1 
HETATM 2777 O  O     . HOH H 5 .   ? 10.782 146.542 7.574   1.00 46.80  ? 434 HOH B O     1 
HETATM 2778 O  O     . HOH H 5 .   ? 23.744 158.226 -1.242  1.00 59.74  ? 435 HOH B O     1 
HETATM 2779 O  O     . HOH H 5 .   ? 23.219 152.340 -12.397 1.00 45.85  ? 436 HOH B O     1 
HETATM 2780 O  O     . HOH H 5 .   ? 22.901 135.738 -13.312 1.00 34.77  ? 437 HOH B O     1 
HETATM 2781 O  O     . HOH H 5 .   ? 25.688 148.257 -19.453 1.00 43.89  ? 438 HOH B O     1 
HETATM 2782 O  O     . HOH H 5 .   ? 37.031 156.818 10.440  1.00 52.32  ? 439 HOH B O     1 
HETATM 2783 O  O     . HOH H 5 .   ? 26.987 153.458 -20.976 1.00 55.84  ? 440 HOH B O     1 
HETATM 2784 O  O     . HOH H 5 .   ? 12.612 130.237 -7.095  1.00 56.77  ? 441 HOH B O     1 
HETATM 2785 O  O     . HOH H 5 .   ? 7.910  156.327 11.508  1.00 63.14  ? 442 HOH B O     1 
HETATM 2786 O  O     . HOH H 5 .   ? 32.545 164.110 -11.626 1.00 74.58  ? 443 HOH B O     1 
HETATM 2787 O  O     . HOH H 5 .   ? 8.292  146.073 4.727   1.00 58.79  ? 444 HOH B O     1 
HETATM 2788 O  O     . HOH H 5 .   ? 20.500 143.435 12.723  1.00 60.72  ? 445 HOH B O     1 
HETATM 2789 O  O     . HOH H 5 .   ? 6.892  153.439 -1.215  1.00 54.25  ? 446 HOH B O     1 
HETATM 2790 O  O     . HOH H 5 .   ? 25.712 156.074 -8.063  1.00 47.83  ? 447 HOH B O     1 
HETATM 2791 O  O     . HOH H 5 .   ? 28.004 146.744 -18.313 1.00 46.17  ? 448 HOH B O     1 
HETATM 2792 O  O     . HOH H 5 .   ? 14.037 143.514 -16.596 1.00 59.55  ? 449 HOH B O     1 
HETATM 2793 O  O     . HOH H 5 .   ? 32.873 150.809 -12.606 1.00 48.57  ? 450 HOH B O     1 
HETATM 2794 O  O     . HOH H 5 .   ? 13.652 157.886 -2.955  1.00 31.75  ? 451 HOH B O     1 
HETATM 2795 O  O     . HOH H 5 .   ? 30.218 148.267 -18.104 1.00 52.30  ? 452 HOH B O     1 
HETATM 2796 O  O     . HOH H 5 .   ? 12.699 160.224 -2.164  1.00 42.47  ? 453 HOH B O     1 
HETATM 2797 O  O     . HOH H 5 .   ? 30.043 165.262 -11.649 1.00 77.82  ? 454 HOH B O     1 
HETATM 2798 O  O     . HOH H 5 .   ? 25.311 163.270 -6.340  0.95 58.16  ? 455 HOH B O     1 
HETATM 2799 O  O     . HOH H 5 .   ? 22.271 175.870 -9.625  1.00 73.54  ? 456 HOH B O     1 
HETATM 2800 O  O     . HOH H 5 .   ? 21.840 175.741 -2.186  1.00 60.59  ? 457 HOH B O     1 
HETATM 2801 O  O     . HOH H 5 .   ? 8.963  144.837 -4.180  1.00 69.90  ? 458 HOH B O     1 
HETATM 2802 O  O     . HOH H 5 .   ? 12.410 153.623 -5.100  1.00 45.51  ? 459 HOH B O     1 
HETATM 2803 O  O     . HOH H 5 .   ? 11.878 155.922 -3.609  1.00 38.57  ? 460 HOH B O     1 
HETATM 2804 O  O     . HOH H 5 .   ? 11.061 153.394 -7.477  1.00 47.12  ? 461 HOH B O     1 
HETATM 2805 O  O     . HOH H 5 .   ? 25.145 150.879 23.195  1.00 71.98  ? 462 HOH B O     1 
HETATM 2806 O  O     . HOH I 5 .   ? 28.953 158.642 -8.761  1.00 56.62  ? 101 HOH C O     1 
HETATM 2807 O  O     . HOH I 5 .   ? 27.207 160.714 -6.678  1.00 61.31  ? 102 HOH C O     1 
HETATM 2808 O  O     . HOH I 5 .   ? 25.940 158.289 -5.675  0.85 45.12  ? 103 HOH C O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N     . MET A 1   ? 0.5865 0.9328 0.5825 0.0204  0.0243  -0.0325 33  MET A N     
2    C  CA    . MET A 1   ? 0.5803 0.9147 0.5655 0.0216  0.0273  -0.0095 33  MET A CA    
3    C  C     . MET A 1   ? 0.4449 0.7908 0.4266 0.0232  0.0324  0.0006  33  MET A C     
4    O  O     . MET A 1   ? 0.3949 0.7583 0.3820 0.0236  0.0331  -0.0105 33  MET A O     
5    C  CB    . MET A 1   ? 0.6144 0.9090 0.6033 0.0155  0.0259  -0.0023 33  MET A CB    
6    C  CG    . MET A 1   ? 0.7114 0.9907 0.7100 0.0115  0.0214  -0.0165 33  MET A CG    
7    S  SD    . MET A 1   ? 0.8093 1.0462 0.8114 0.0050  0.0201  -0.0076 33  MET A SD    
8    C  CE    . MET A 1   ? 0.8296 1.0592 0.8181 0.0079  0.0219  0.0109  33  MET A CE    
9    N  N     . ALA A 2   ? 0.3298 0.6658 0.3036 0.0239  0.0363  0.0214  34  ALA A N     
10   C  CA    . ALA A 2   ? 0.3775 0.7213 0.3494 0.0240  0.0421  0.0331  34  ALA A CA    
11   C  C     . ALA A 2   ? 0.4096 0.7354 0.3930 0.0170  0.0416  0.0276  34  ALA A C     
12   O  O     . ALA A 2   ? 0.3749 0.6737 0.3651 0.0118  0.0377  0.0221  34  ALA A O     
13   C  CB    . ALA A 2   ? 0.4083 0.7397 0.3722 0.0252  0.0471  0.0566  34  ALA A CB    
14   N  N     . ALA A 3   ? 0.3510 0.6941 0.3362 0.0173  0.0458  0.0297  35  ALA A N     
15   C  CA    . ALA A 3   ? 0.3853 0.7166 0.3818 0.0117  0.0456  0.0246  35  ALA A CA    
16   C  C     . ALA A 3   ? 0.4042 0.7022 0.4031 0.0047  0.0460  0.0371  35  ALA A C     
17   O  O     . ALA A 3   ? 0.4951 0.7872 0.4881 0.0039  0.0505  0.0541  35  ALA A O     
18   C  CB    . ALA A 3   ? 0.2989 0.6580 0.2962 0.0137  0.0510  0.0265  35  ALA A CB    
19   N  N     . GLY A 4   ? 0.4067 0.6837 0.4149 0.0000  0.0415  0.0285  36  GLY A N     
20   C  CA    . GLY A 4   ? 0.4185 0.6673 0.4299 -0.0067 0.0409  0.0368  36  GLY A CA    
21   C  C     . GLY A 4   ? 0.3493 0.5731 0.3572 -0.0081 0.0369  0.0377  36  GLY A C     
22   O  O     . GLY A 4   ? 0.3458 0.5469 0.3576 -0.0135 0.0349  0.0399  36  GLY A O     
23   N  N     . GLU A 5   ? 0.3300 0.5599 0.3310 -0.0033 0.0357  0.0355  37  GLU A N     
24   C  CA    . GLU A 5   ? 0.3533 0.5615 0.3509 -0.0043 0.0325  0.0370  37  GLU A CA    
25   C  C     . GLU A 5   ? 0.4158 0.6093 0.4216 -0.0071 0.0271  0.0249  37  GLU A C     
26   O  O     . GLU A 5   ? 0.4036 0.5742 0.4095 -0.0105 0.0249  0.0279  37  GLU A O     
27   C  CB    . GLU A 5   ? 0.4990 0.7211 0.4880 0.0020  0.0327  0.0376  37  GLU A CB    
28   C  CG    . GLU A 5   ? 0.7446 0.9464 0.7286 0.0019  0.0311  0.0431  37  GLU A CG    
29   C  CD    . GLU A 5   ? 1.0613 1.2521 1.0387 0.0022  0.0359  0.0606  37  GLU A CD    
30   O  OE1   . GLU A 5   ? 1.1696 1.3625 1.1396 0.0074  0.0370  0.0675  37  GLU A OE1   
31   O  OE2   . GLU A 5   ? 1.1549 1.3352 1.1357 -0.0026 0.0388  0.0673  37  GLU A OE2   
32   N  N     . SER A 6   ? 0.2933 0.5002 0.3067 -0.0053 0.0254  0.0112  38  SER A N     
33   C  CA    . SER A 6   ? 0.3902 0.5827 0.4133 -0.0074 0.0214  0.0012  38  SER A CA    
34   C  C     . SER A 6   ? 0.3582 0.5339 0.3865 -0.0118 0.0205  0.0063  38  SER A C     
35   O  O     . SER A 6   ? 0.3507 0.5076 0.3824 -0.0139 0.0173  0.0055  38  SER A O     
36   C  CB    . SER A 6   ? 0.4474 0.6571 0.4797 -0.0044 0.0209  -0.0146 38  SER A CB    
37   O  OG    . SER A 6   ? 0.5826 0.8070 0.6188 -0.0035 0.0234  -0.0155 38  SER A OG    
38   N  N     . MET A 7   ? 0.2856 0.4699 0.3147 -0.0130 0.0234  0.0118  39  MET A N     
39   C  CA    . MET A 7   ? 0.3591 0.5310 0.3934 -0.0177 0.0224  0.0164  39  MET A CA    
40   C  C     . MET A 7   ? 0.3184 0.4708 0.3459 -0.0220 0.0222  0.0267  39  MET A C     
41   O  O     . MET A 7   ? 0.3162 0.4536 0.3468 -0.0255 0.0192  0.0274  39  MET A O     
42   C  CB    . MET A 7   ? 0.4516 0.6405 0.4901 -0.0185 0.0260  0.0188  39  MET A CB    
43   C  CG    . MET A 7   ? 0.5822 0.7642 0.6288 -0.0230 0.0246  0.0207  39  MET A CG    
44   S  SD    . MET A 7   ? 0.6988 0.9053 0.7532 -0.0232 0.0288  0.0206  39  MET A SD    
45   C  CE    . MET A 7   ? 0.7460 0.9647 0.7898 -0.0231 0.0357  0.0310  39  MET A CE    
46   N  N     . ALA A 8   ? 0.3372 0.4905 0.3555 -0.0212 0.0256  0.0347  40  ALA A N     
47   C  CA    . ALA A 8   ? 0.4177 0.5515 0.4303 -0.0246 0.0260  0.0433  40  ALA A CA    
48   C  C     . ALA A 8   ? 0.4269 0.5455 0.4367 -0.0237 0.0218  0.0395  40  ALA A C     
49   O  O     . ALA A 8   ? 0.4266 0.5278 0.4331 -0.0267 0.0212  0.0440  40  ALA A O     
50   C  CB    . ALA A 8   ? 0.4020 0.5406 0.4066 -0.0224 0.0315  0.0539  40  ALA A CB    
51   N  N     . GLN A 9   ? 0.2821 0.4072 0.2941 -0.0200 0.0193  0.0306  41  GLN A N     
52   C  CA    . GLN A 9   ? 0.2857 0.3981 0.2966 -0.0195 0.0160  0.0272  41  GLN A CA    
53   C  C     . GLN A 9   ? 0.2973 0.4015 0.3169 -0.0211 0.0123  0.0214  41  GLN A C     
54   O  O     . GLN A 9   ? 0.2834 0.3799 0.3045 -0.0204 0.0102  0.0177  41  GLN A O     
55   C  CB    . GLN A 9   ? 0.2954 0.4198 0.3043 -0.0151 0.0161  0.0215  41  GLN A CB    
56   C  CG    . GLN A 9   ? 0.3724 0.5041 0.3714 -0.0119 0.0192  0.0292  41  GLN A CG    
57   C  CD    . GLN A 9   ? 0.4175 0.5633 0.4146 -0.0075 0.0184  0.0229  41  GLN A CD    
58   O  OE1   . GLN A 9   ? 0.3770 0.5249 0.3811 -0.0080 0.0158  0.0119  41  GLN A OE1   
59   N  NE2   . GLN A 9   ? 0.4527 0.6087 0.4412 -0.0032 0.0209  0.0300  41  GLN A NE2   
60   N  N     . ARG A 10  ? 0.2668 0.3735 0.2926 -0.0230 0.0120  0.0214  42  ARG A N     
61   C  CA    . ARG A 10  ? 0.2377 0.3375 0.2715 -0.0233 0.0086  0.0181  42  ARG A CA    
62   C  C     . ARG A 10  ? 0.2791 0.3626 0.3083 -0.0263 0.0062  0.0236  42  ARG A C     
63   O  O     . ARG A 10  ? 0.2627 0.3397 0.2837 -0.0288 0.0074  0.0288  42  ARG A O     
64   C  CB    . ARG A 10  ? 0.3349 0.4453 0.3771 -0.0236 0.0088  0.0167  42  ARG A CB    
65   C  CG    . ARG A 10  ? 0.2629 0.3899 0.3119 -0.0196 0.0108  0.0088  42  ARG A CG    
66   C  CD    . ARG A 10  ? 0.3094 0.4491 0.3661 -0.0197 0.0117  0.0082  42  ARG A CD    
67   N  NE    . ARG A 10  ? 0.3386 0.4950 0.4020 -0.0152 0.0137  -0.0009 42  ARG A NE    
68   C  CZ    . ARG A 10  ? 0.3791 0.5499 0.4506 -0.0137 0.0151  -0.0036 42  ARG A CZ    
69   N  NH1   . ARG A 10  ? 0.3060 0.4773 0.3803 -0.0169 0.0144  0.0023  42  ARG A NH1   
70   N  NH2   . ARG A 10  ? 0.3356 0.5220 0.4129 -0.0092 0.0172  -0.0134 42  ARG A NH2   
71   N  N     . MET A 11  ? 0.2754 0.3531 0.3102 -0.0254 0.0032  0.0223  43  MET A N     
72   C  CA    . MET A 11  ? 0.3298 0.3958 0.3602 -0.0275 0.0005  0.0267  43  MET A CA    
73   C  C     . MET A 11  ? 0.3250 0.3948 0.3623 -0.0275 -0.0023 0.0275  43  MET A C     
74   O  O     . MET A 11  ? 0.2878 0.3635 0.3348 -0.0239 -0.0027 0.0247  43  MET A O     
75   C  CB    . MET A 11  ? 0.3077 0.3641 0.3368 -0.0254 -0.0002 0.0265  43  MET A CB    
76   C  CG    . MET A 11  ? 0.3630 0.4190 0.3875 -0.0245 0.0021  0.0244  43  MET A CG    
77   S  SD    . MET A 11  ? 0.3671 0.4136 0.3933 -0.0231 0.0017  0.0239  43  MET A SD    
78   C  CE    . MET A 11  ? 0.3633 0.4165 0.3871 -0.0221 0.0042  0.0189  43  MET A CE    
79   N  N     . VAL A 12  ? 0.2904 0.3574 0.3232 -0.0312 -0.0043 0.0306  44  VAL A N     
80   C  CA    . VAL A 12  ? 0.3040 0.3776 0.3424 -0.0313 -0.0078 0.0314  44  VAL A CA    
81   C  C     . VAL A 12  ? 0.3149 0.3814 0.3494 -0.0293 -0.0108 0.0345  44  VAL A C     
82   O  O     . VAL A 12  ? 0.2948 0.3558 0.3209 -0.0325 -0.0119 0.0356  44  VAL A O     
83   C  CB    . VAL A 12  ? 0.2605 0.3398 0.2981 -0.0376 -0.0079 0.0313  44  VAL A CB    
84   C  CG1   . VAL A 12  ? 0.2988 0.3893 0.3430 -0.0375 -0.0121 0.0311  44  VAL A CG1   
85   C  CG2   . VAL A 12  ? 0.2760 0.3620 0.3165 -0.0397 -0.0036 0.0303  44  VAL A CG2   
86   N  N     . TRP A 13  ? 0.2794 0.3460 0.3206 -0.0237 -0.0117 0.0360  45  TRP A N     
87   C  CA    . TRP A 13  ? 0.2898 0.3510 0.3281 -0.0208 -0.0138 0.0410  45  TRP A CA    
88   C  C     . TRP A 13  ? 0.3287 0.4007 0.3685 -0.0197 -0.0180 0.0440  45  TRP A C     
89   O  O     . TRP A 13  ? 0.3800 0.4624 0.4293 -0.0170 -0.0191 0.0437  45  TRP A O     
90   C  CB    . TRP A 13  ? 0.2721 0.3273 0.3187 -0.0153 -0.0118 0.0426  45  TRP A CB    
91   C  CG    . TRP A 13  ? 0.3109 0.3578 0.3561 -0.0166 -0.0082 0.0387  45  TRP A CG    
92   C  CD1   . TRP A 13  ? 0.3175 0.3678 0.3657 -0.0177 -0.0057 0.0323  45  TRP A CD1   
93   C  CD2   . TRP A 13  ? 0.3208 0.3579 0.3616 -0.0169 -0.0067 0.0409  45  TRP A CD2   
94   N  NE1   . TRP A 13  ? 0.2800 0.3241 0.3257 -0.0185 -0.0033 0.0298  45  TRP A NE1   
95   C  CE2   . TRP A 13  ? 0.2995 0.3349 0.3413 -0.0182 -0.0037 0.0349  45  TRP A CE2   
96   C  CE3   . TRP A 13  ? 0.2694 0.3011 0.3053 -0.0158 -0.0074 0.0474  45  TRP A CE3   
97   C  CZ2   . TRP A 13  ? 0.3125 0.3410 0.3517 -0.0190 -0.0017 0.0347  45  TRP A CZ2   
98   C  CZ3   . TRP A 13  ? 0.3400 0.3637 0.3731 -0.0167 -0.0048 0.0478  45  TRP A CZ3   
99   C  CH2   . TRP A 13  ? 0.3301 0.3522 0.3654 -0.0185 -0.0021 0.0413  45  TRP A CH2   
100  N  N     . VAL A 14  ? 0.3118 0.3837 0.3424 -0.0215 -0.0206 0.0462  46  VAL A N     
101  C  CA    . VAL A 14  ? 0.3623 0.4482 0.3934 -0.0203 -0.0252 0.0483  46  VAL A CA    
102  C  C     . VAL A 14  ? 0.3910 0.4760 0.4153 -0.0162 -0.0269 0.0548  46  VAL A C     
103  O  O     . VAL A 14  ? 0.4140 0.4874 0.4311 -0.0168 -0.0246 0.0561  46  VAL A O     
104  C  CB    . VAL A 14  ? 0.4272 0.5211 0.4545 -0.0279 -0.0273 0.0420  46  VAL A CB    
105  C  CG1   . VAL A 14  ? 0.3901 0.4863 0.4246 -0.0321 -0.0248 0.0374  46  VAL A CG1   
106  C  CG2   . VAL A 14  ? 0.5816 0.6654 0.5970 -0.0327 -0.0264 0.0394  46  VAL A CG2   
107  N  N     . ASP A 15  ? 0.3707 0.4704 0.3975 -0.0115 -0.0309 0.0594  47  ASP A N     
108  C  CA    . ASP A 15  ? 0.4475 0.5516 0.4666 -0.0073 -0.0329 0.0665  47  ASP A CA    
109  C  C     . ASP A 15  ? 0.4616 0.5889 0.4802 -0.0053 -0.0388 0.0671  47  ASP A C     
110  O  O     . ASP A 15  ? 0.4579 0.5971 0.4865 -0.0024 -0.0408 0.0676  47  ASP A O     
111  C  CB    . ASP A 15  ? 0.4725 0.5682 0.4971 0.0007  -0.0298 0.0771  47  ASP A CB    
112  C  CG    . ASP A 15  ? 0.6150 0.7143 0.6303 0.0047  -0.0305 0.0858  47  ASP A CG    
113  O  OD1   . ASP A 15  ? 0.6240 0.7152 0.6294 0.0008  -0.0287 0.0838  47  ASP A OD1   
114  O  OD2   . ASP A 15  ? 0.5938 0.7060 0.6117 0.0123  -0.0327 0.0953  47  ASP A OD2   
115  N  N     . LEU A 16  ? 0.3275 0.4629 0.3345 -0.0067 -0.0416 0.0664  48  LEU A N     
116  C  CA    . LEU A 16  ? 0.4713 0.6323 0.4758 -0.0050 -0.0477 0.0658  48  LEU A CA    
117  C  C     . LEU A 16  ? 0.4607 0.6298 0.4565 0.0028  -0.0488 0.0763  48  LEU A C     
118  O  O     . LEU A 16  ? 0.5116 0.6686 0.4985 0.0020  -0.0457 0.0781  48  LEU A O     
119  C  CB    . LEU A 16  ? 0.5526 0.7204 0.5515 -0.0153 -0.0503 0.0517  48  LEU A CB    
120  C  CG    . LEU A 16  ? 0.6628 0.8327 0.6710 -0.0234 -0.0506 0.0416  48  LEU A CG    
121  C  CD1   . LEU A 16  ? 0.6983 0.8458 0.7120 -0.0260 -0.0446 0.0414  48  LEU A CD1   
122  C  CD2   . LEU A 16  ? 0.7344 0.9098 0.7372 -0.0333 -0.0525 0.0286  48  LEU A CD2   
123  N  N     . GLU A 17  ? 0.4770 0.6685 0.4758 0.0109  -0.0530 0.0841  49  GLU A N     
124  C  CA    . GLU A 17  ? 0.6004 0.8036 0.5914 0.0199  -0.0539 0.0968  49  GLU A CA    
125  C  C     . GLU A 17  ? 0.5767 0.8145 0.5634 0.0226  -0.0615 0.0948  49  GLU A C     
126  O  O     . GLU A 17  ? 0.5704 0.8242 0.5669 0.0253  -0.0651 0.0945  49  GLU A O     
127  C  CB    . GLU A 17  ? 0.6302 0.8241 0.6312 0.0306  -0.0497 0.1137  49  GLU A CB    
128  C  CG    . GLU A 17  ? 0.6830 0.8451 0.6897 0.0279  -0.0423 0.1146  49  GLU A CG    
129  C  CD    . GLU A 17  ? 0.7630 0.9133 0.7586 0.0256  -0.0386 0.1171  49  GLU A CD    
130  O  OE1   . GLU A 17  ? 0.7237 0.8526 0.7200 0.0192  -0.0342 0.1109  49  GLU A OE1   
131  O  OE2   . GLU A 17  ? 0.8473 1.0120 0.8331 0.0305  -0.0399 0.1254  49  GLU A OE2   
132  N  N     . MET A 18  ? 0.6380 0.8897 0.6105 0.0221  -0.0639 0.0928  50  MET A N     
133  C  CA    . MET A 18  ? 0.8102 1.0986 0.7771 0.0248  -0.0715 0.0897  50  MET A CA    
134  C  C     . MET A 18  ? 0.7760 1.0837 0.7409 0.0397  -0.0725 0.1097  50  MET A C     
135  O  O     . MET A 18  ? 0.7866 1.1005 0.7629 0.0481  -0.0732 0.1202  50  MET A O     
136  C  CB    . MET A 18  ? 0.9617 1.2587 0.9144 0.0170  -0.0736 0.0754  50  MET A CB    
137  C  CG    . MET A 18  ? 1.0985 1.3877 1.0548 0.0028  -0.0745 0.0541  50  MET A CG    
138  S  SD    . MET A 18  ? 1.1953 1.4395 1.1562 -0.0051 -0.0661 0.0512  50  MET A SD    
139  C  CE    . MET A 18  ? 1.1437 1.3843 1.0996 -0.0192 -0.0666 0.0285  50  MET A CE    
140  N  N     . ILE A 28  ? 0.6460 1.0885 0.6364 0.0253  -0.1046 0.0589  60  ILE A N     
141  C  CA    . ILE A 28  ? 0.6893 1.1086 0.6931 0.0304  -0.0996 0.0705  60  ILE A CA    
142  C  C     . ILE A 28  ? 0.6657 1.0394 0.6670 0.0263  -0.0908 0.0734  60  ILE A C     
143  O  O     . ILE A 28  ? 0.7358 1.0972 0.7265 0.0315  -0.0875 0.0836  60  ILE A O     
144  C  CB    . ILE A 28  ? 0.6914 1.1276 0.6988 0.0489  -0.1008 0.0925  60  ILE A CB    
145  C  CG1   . ILE A 28  ? 0.6911 1.1636 0.7012 0.0523  -0.1058 0.0872  60  ILE A CG1   
146  C  CG2   . ILE A 28  ? 0.6560 1.0662 0.6785 0.0541  -0.0949 0.1024  60  ILE A CG2   
147  C  CD1   . ILE A 28  ? 0.6667 1.1513 0.6919 0.0440  -0.1093 0.0734  60  ILE A CD1   
148  N  N     . ILE A 29  ? 0.5257 0.8767 0.5371 0.0169  -0.0870 0.0647  61  ILE A N     
149  C  CA    . ILE A 29  ? 0.4694 0.7804 0.4795 0.0119  -0.0792 0.0650  61  ILE A CA    
150  C  C     . ILE A 29  ? 0.5282 0.8231 0.5528 0.0163  -0.0749 0.0722  61  ILE A C     
151  O  O     . ILE A 29  ? 0.5324 0.8380 0.5688 0.0134  -0.0766 0.0661  61  ILE A O     
152  C  CB    . ILE A 29  ? 0.5361 0.8342 0.5434 -0.0038 -0.0778 0.0466  61  ILE A CB    
153  C  CG1   . ILE A 29  ? 0.5868 0.8936 0.5792 -0.0075 -0.0802 0.0391  61  ILE A CG1   
154  C  CG2   . ILE A 29  ? 0.5922 0.8528 0.6018 -0.0081 -0.0701 0.0474  61  ILE A CG2   
155  C  CD1   . ILE A 29  ? 0.6673 0.9686 0.6596 -0.0226 -0.0800 0.0193  61  ILE A CD1   
156  N  N     . GLU A 30  ? 0.5238 0.7942 0.5482 0.0229  -0.0691 0.0842  62  GLU A N     
157  C  CA    . GLU A 30  ? 0.5471 0.7980 0.5848 0.0258  -0.0640 0.0883  62  GLU A CA    
158  C  C     . GLU A 30  ? 0.4466 0.6695 0.4828 0.0147  -0.0588 0.0784  62  GLU A C     
159  O  O     . GLU A 30  ? 0.4878 0.6958 0.5130 0.0105  -0.0564 0.0770  62  GLU A O     
160  C  CB    . GLU A 30  ? 0.6207 0.8607 0.6616 0.0387  -0.0601 0.1059  62  GLU A CB    
161  C  CG    . GLU A 30  ? 0.7615 0.9849 0.8184 0.0432  -0.0551 0.1092  62  GLU A CG    
162  C  CD    . GLU A 30  ? 0.8581 1.0624 0.9191 0.0528  -0.0493 0.1241  62  GLU A CD    
163  O  OE1   . GLU A 30  ? 0.8905 1.1010 0.9437 0.0591  -0.0498 0.1361  62  GLU A OE1   
164  O  OE2   . GLU A 30  ? 0.8812 1.0649 0.9539 0.0538  -0.0438 0.1236  62  GLU A OE2   
165  N  N     . MET A 31  ? 0.4303 0.6482 0.4775 0.0106  -0.0568 0.0719  63  MET A N     
166  C  CA    . MET A 31  ? 0.3928 0.5875 0.4391 0.0012  -0.0518 0.0636  63  MET A CA    
167  C  C     . MET A 31  ? 0.3896 0.5717 0.4481 0.0053  -0.0471 0.0660  63  MET A C     
168  O  O     . MET A 31  ? 0.3730 0.5689 0.4432 0.0094  -0.0483 0.0663  63  MET A O     
169  C  CB    . MET A 31  ? 0.4097 0.6127 0.4557 -0.0108 -0.0536 0.0502  63  MET A CB    
170  C  CG    . MET A 31  ? 0.4794 0.6600 0.5250 -0.0193 -0.0479 0.0438  63  MET A CG    
171  S  SD    . MET A 31  ? 0.4958 0.6802 0.5398 -0.0339 -0.0483 0.0302  63  MET A SD    
172  C  CE    . MET A 31  ? 0.4791 0.6380 0.5243 -0.0389 -0.0405 0.0286  63  MET A CE    
173  N  N     . ALA A 32  ? 0.4120 0.5699 0.4683 0.0042  -0.0417 0.0667  64  ALA A N     
174  C  CA    . ALA A 32  ? 0.4263 0.5719 0.4934 0.0070  -0.0369 0.0663  64  ALA A CA    
175  C  C     . ALA A 32  ? 0.3691 0.4989 0.4319 -0.0018 -0.0328 0.0580  64  ALA A C     
176  O  O     . ALA A 32  ? 0.4104 0.5317 0.4618 -0.0076 -0.0325 0.0560  64  ALA A O     
177  C  CB    . ALA A 32  ? 0.5672 0.7005 0.6394 0.0166  -0.0337 0.0763  64  ALA A CB    
178  N  N     . CYS A 33  ? 0.3356 0.4631 0.4078 -0.0017 -0.0296 0.0537  65  CYS A N     
179  C  CA    . CYS A 33  ? 0.3854 0.5024 0.4543 -0.0088 -0.0257 0.0467  65  CYS A CA    
180  C  C     . CYS A 33  ? 0.4006 0.5128 0.4800 -0.0046 -0.0215 0.0442  65  CYS A C     
181  O  O     . CYS A 33  ? 0.3631 0.4847 0.4541 0.0015  -0.0218 0.0448  65  CYS A O     
182  C  CB    . CYS A 33  ? 0.3766 0.5046 0.4441 -0.0172 -0.0267 0.0407  65  CYS A CB    
183  S  SG    . CYS A 33  ? 0.4135 0.5335 0.4798 -0.0237 -0.0210 0.0347  65  CYS A SG    
184  N  N     . LEU A 34  ? 0.3448 0.4438 0.4203 -0.0074 -0.0176 0.0407  66  LEU A N     
185  C  CA    . LEU A 34  ? 0.3454 0.4426 0.4298 -0.0049 -0.0136 0.0352  66  LEU A CA    
186  C  C     . LEU A 34  ? 0.3613 0.4532 0.4377 -0.0109 -0.0106 0.0302  66  LEU A C     
187  O  O     . LEU A 34  ? 0.3824 0.4692 0.4474 -0.0163 -0.0112 0.0317  66  LEU A O     
188  C  CB    . LEU A 34  ? 0.3863 0.4730 0.4796 0.0022  -0.0116 0.0372  66  LEU A CB    
189  C  CG    . LEU A 34  ? 0.3284 0.3992 0.4163 0.0020  -0.0104 0.0415  66  LEU A CG    
190  C  CD1   . LEU A 34  ? 0.4366 0.4992 0.5211 -0.0023 -0.0070 0.0346  66  LEU A CD1   
191  C  CD2   . LEU A 34  ? 0.4340 0.4979 0.5339 0.0098  -0.0089 0.0473  66  LEU A CD2   
192  N  N     . ILE A 35  ? 0.2826 0.3768 0.3652 -0.0093 -0.0072 0.0238  67  ILE A N     
193  C  CA    . ILE A 35  ? 0.2522 0.3463 0.3281 -0.0134 -0.0042 0.0194  67  ILE A CA    
194  C  C     . ILE A 35  ? 0.2749 0.3615 0.3544 -0.0106 -0.0016 0.0143  67  ILE A C     
195  O  O     . ILE A 35  ? 0.3406 0.4275 0.4323 -0.0057 -0.0005 0.0103  67  ILE A O     
196  C  CB    . ILE A 35  ? 0.2361 0.3459 0.3154 -0.0147 -0.0023 0.0155  67  ILE A CB    
197  C  CG1   . ILE A 35  ? 0.2993 0.4178 0.3783 -0.0182 -0.0046 0.0195  67  ILE A CG1   
198  C  CG2   . ILE A 35  ? 0.2568 0.3683 0.3279 -0.0180 0.0011  0.0133  67  ILE A CG2   
199  C  CD1   . ILE A 35  ? 0.3183 0.4298 0.3858 -0.0251 -0.0054 0.0237  67  ILE A CD1   
200  N  N     . THR A 36  ? 0.2903 0.3708 0.3606 -0.0138 -0.0005 0.0139  68  THR A N     
201  C  CA    . THR A 36  ? 0.2149 0.2929 0.2887 -0.0125 0.0020  0.0071  68  THR A CA    
202  C  C     . THR A 36  ? 0.2993 0.3871 0.3657 -0.0146 0.0041  0.0031  68  THR A C     
203  O  O     . THR A 36  ? 0.3240 0.4147 0.3807 -0.0176 0.0040  0.0082  68  THR A O     
204  C  CB    . THR A 36  ? 0.2193 0.2829 0.2905 -0.0132 0.0018  0.0103  68  THR A CB    
205  O  OG1   . THR A 36  ? 0.3093 0.3695 0.3665 -0.0170 0.0009  0.0155  68  THR A OG1   
206  C  CG2   . THR A 36  ? 0.3095 0.3645 0.3873 -0.0103 0.0003  0.0166  68  THR A CG2   
207  N  N     . ASP A 37  ? 0.3054 0.3992 0.3772 -0.0128 0.0062  -0.0061 69  ASP A N     
208  C  CA    . ASP A 37  ? 0.3115 0.4166 0.3753 -0.0138 0.0079  -0.0092 69  ASP A CA    
209  C  C     . ASP A 37  ? 0.2709 0.3668 0.3258 -0.0158 0.0074  -0.0055 69  ASP A C     
210  O  O     . ASP A 37  ? 0.3271 0.4083 0.3818 -0.0169 0.0060  -0.0008 69  ASP A O     
211  C  CB    . ASP A 37  ? 0.3202 0.4394 0.3928 -0.0110 0.0100  -0.0222 69  ASP A CB    
212  C  CG    . ASP A 37  ? 0.5066 0.6167 0.5909 -0.0103 0.0103  -0.0304 69  ASP A CG    
213  O  OD1   . ASP A 37  ? 0.4650 0.5592 0.5488 -0.0121 0.0093  -0.0248 69  ASP A OD1   
214  O  OD2   . ASP A 37  ? 0.5410 0.6605 0.6361 -0.0082 0.0121  -0.0430 69  ASP A OD2   
215  N  N     . SER A 38  ? 0.3196 0.4260 0.3671 -0.0156 0.0088  -0.0072 70  SER A N     
216  C  CA    . SER A 38  ? 0.3527 0.4527 0.3921 -0.0167 0.0085  -0.0038 70  SER A CA    
217  C  C     . SER A 38  ? 0.4200 0.5137 0.4678 -0.0171 0.0082  -0.0103 70  SER A C     
218  O  O     . SER A 38  ? 0.3387 0.4239 0.3818 -0.0184 0.0078  -0.0064 70  SER A O     
219  C  CB    . SER A 38  ? 0.3162 0.4320 0.3469 -0.0149 0.0102  -0.0038 70  SER A CB    
220  O  OG    . SER A 38  ? 0.3739 0.5075 0.4110 -0.0127 0.0110  -0.0155 70  SER A OG    
221  N  N     . ASP A 39  ? 0.3173 0.4146 0.3786 -0.0162 0.0089  -0.0204 71  ASP A N     
222  C  CA    . ASP A 39  ? 0.2815 0.3716 0.3541 -0.0175 0.0097  -0.0273 71  ASP A CA    
223  C  C     . ASP A 39  ? 0.3483 0.4207 0.4303 -0.0175 0.0097  -0.0224 71  ASP A C     
224  O  O     . ASP A 39  ? 0.4129 0.4781 0.5084 -0.0182 0.0115  -0.0281 71  ASP A O     
225  C  CB    . ASP A 39  ? 0.3467 0.4518 0.4304 -0.0168 0.0113  -0.0432 71  ASP A CB    
226  C  CG    . ASP A 39  ? 0.4906 0.6160 0.5655 -0.0163 0.0112  -0.0482 71  ASP A CG    
227  O  OD1   . ASP A 39  ? 0.4130 0.5367 0.4787 -0.0173 0.0104  -0.0420 71  ASP A OD1   
228  O  OD2   . ASP A 39  ? 0.5360 0.6808 0.6131 -0.0142 0.0119  -0.0581 71  ASP A OD2   
229  N  N     . LEU A 40  ? 0.3077 0.3738 0.3834 -0.0167 0.0080  -0.0120 72  LEU A N     
230  C  CA    . LEU A 40  ? 0.3019 0.3539 0.3830 -0.0156 0.0073  -0.0043 72  LEU A CA    
231  C  C     . LEU A 40  ? 0.3794 0.4306 0.4766 -0.0122 0.0087  -0.0092 72  LEU A C     
232  O  O     . LEU A 40  ? 0.3560 0.3957 0.4609 -0.0101 0.0090  -0.0032 72  LEU A O     
233  C  CB    . LEU A 40  ? 0.3011 0.3407 0.3831 -0.0174 0.0082  -0.0001 72  LEU A CB    
234  C  CG    . LEU A 40  ? 0.2913 0.3311 0.3588 -0.0200 0.0074  0.0042  72  LEU A CG    
235  C  CD1   . LEU A 40  ? 0.3171 0.3460 0.3868 -0.0215 0.0087  0.0089  72  LEU A CD1   
236  C  CD2   . LEU A 40  ? 0.3233 0.3636 0.3769 -0.0200 0.0048  0.0124  72  LEU A CD2   
237  N  N     . ASN A 41  ? 0.3682 0.4322 0.4709 -0.0107 0.0097  -0.0196 73  ASN A N     
238  C  CA    . ASN A 41  ? 0.4110 0.4753 0.5289 -0.0065 0.0112  -0.0246 73  ASN A CA    
239  C  C     . ASN A 41  ? 0.4149 0.4831 0.5289 -0.0039 0.0088  -0.0161 73  ASN A C     
240  O  O     . ASN A 41  ? 0.3407 0.4204 0.4437 -0.0055 0.0074  -0.0143 73  ASN A O     
241  C  CB    . ASN A 41  ? 0.3830 0.4623 0.5082 -0.0056 0.0133  -0.0404 73  ASN A CB    
242  C  CG    . ASN A 41  ? 0.4319 0.5107 0.5629 -0.0086 0.0154  -0.0513 73  ASN A CG    
243  O  OD1   . ASN A 41  ? 0.5070 0.5711 0.6503 -0.0095 0.0174  -0.0524 73  ASN A OD1   
244  N  ND2   . ASN A 41  ? 0.4163 0.5127 0.5392 -0.0102 0.0150  -0.0590 73  ASN A ND2   
245  N  N     . ILE A 42  ? 0.4470 0.5066 0.5707 0.0002  0.0087  -0.0105 74  ILE A N     
246  C  CA    . ILE A 42  ? 0.4172 0.4829 0.5388 0.0029  0.0060  -0.0028 74  ILE A CA    
247  C  C     . ILE A 42  ? 0.3672 0.4490 0.4946 0.0053  0.0071  -0.0116 74  ILE A C     
248  O  O     . ILE A 42  ? 0.3607 0.4436 0.5025 0.0093  0.0100  -0.0210 74  ILE A O     
249  C  CB    . ILE A 42  ? 0.4455 0.5008 0.5766 0.0082  0.0057  0.0061  74  ILE A CB    
250  C  CG1   . ILE A 42  ? 0.3914 0.4346 0.5138 0.0058  0.0045  0.0166  74  ILE A CG1   
251  C  CG2   . ILE A 42  ? 0.4499 0.5164 0.5817 0.0120  0.0028  0.0114  74  ILE A CG2   
252  C  CD1   . ILE A 42  ? 0.4425 0.4773 0.5729 0.0117  0.0045  0.0276  74  ILE A CD1   
253  N  N     . LEU A 43  ? 0.3353 0.4300 0.4526 0.0027  0.0053  -0.0088 75  LEU A N     
254  C  CA    . LEU A 43  ? 0.3515 0.4642 0.4728 0.0044  0.0068  -0.0155 75  LEU A CA    
255  C  C     . LEU A 43  ? 0.3709 0.4910 0.4991 0.0081  0.0051  -0.0107 75  LEU A C     
256  O  O     . LEU A 43  ? 0.3927 0.5240 0.5317 0.0127  0.0070  -0.0175 75  LEU A O     
257  C  CB    . LEU A 43  ? 0.2847 0.4087 0.3920 -0.0010 0.0071  -0.0149 75  LEU A CB    
258  C  CG    . LEU A 43  ? 0.3402 0.4621 0.4392 -0.0039 0.0085  -0.0188 75  LEU A CG    
259  C  CD1   . LEU A 43  ? 0.3510 0.4839 0.4368 -0.0078 0.0093  -0.0148 75  LEU A CD1   
260  C  CD2   . LEU A 43  ? 0.3339 0.4619 0.4429 -0.0008 0.0112  -0.0327 75  LEU A CD2   
261  N  N     . ALA A 44  ? 0.3108 0.4269 0.4331 0.0064  0.0015  -0.0001 76  ALA A N     
262  C  CA    . ALA A 44  ? 0.3286 0.4553 0.4569 0.0095  -0.0008 0.0045  76  ALA A CA    
263  C  C     . ALA A 44  ? 0.3445 0.4634 0.4682 0.0094  -0.0048 0.0152  76  ALA A C     
264  O  O     . ALA A 44  ? 0.3537 0.4634 0.4653 0.0042  -0.0061 0.0192  76  ALA A O     
265  C  CB    . ALA A 44  ? 0.3706 0.5152 0.4942 0.0047  -0.0007 0.0035  76  ALA A CB    
266  N  N     . GLU A 45  ? 0.2899 0.4142 0.4232 0.0161  -0.0068 0.0198  77  GLU A N     
267  C  CA    . GLU A 45  ? 0.3459 0.4684 0.4752 0.0175  -0.0110 0.0302  77  GLU A CA    
268  C  C     . GLU A 45  ? 0.3566 0.4987 0.4839 0.0147  -0.0149 0.0319  77  GLU A C     
269  O  O     . GLU A 45  ? 0.3544 0.5119 0.4919 0.0181  -0.0145 0.0289  77  GLU A O     
270  C  CB    . GLU A 45  ? 0.5181 0.6342 0.6599 0.0279  -0.0104 0.0361  77  GLU A CB    
271  C  CG    . GLU A 45  ? 0.7647 0.8593 0.9068 0.0288  -0.0074 0.0384  77  GLU A CG    
272  C  CD    . GLU A 45  ? 1.0019 1.0873 1.1621 0.0368  -0.0027 0.0351  77  GLU A CD    
273  O  OE1   . GLU A 45  ? 1.0937 1.1870 1.2662 0.0453  -0.0028 0.0377  77  GLU A OE1   
274  O  OE2   . GLU A 45  ? 1.0776 1.1484 1.2409 0.0346  0.0014  0.0293  77  GLU A OE2   
275  N  N     . GLY A 46  ? 0.3699 0.5122 0.4851 0.0083  -0.0182 0.0358  78  GLY A N     
276  C  CA    . GLY A 46  ? 0.3534 0.5138 0.4673 0.0036  -0.0218 0.0358  78  GLY A CA    
277  C  C     . GLY A 46  ? 0.4157 0.5883 0.5337 0.0099  -0.0268 0.0425  78  GLY A C     
278  O  O     . GLY A 46  ? 0.4477 0.6161 0.5723 0.0197  -0.0267 0.0483  78  GLY A O     
279  N  N     . PRO A 47  ? 0.3848 0.5739 0.4999 0.0043  -0.0309 0.0418  79  PRO A N     
280  C  CA    . PRO A 47  ? 0.3723 0.5786 0.4906 0.0103  -0.0365 0.0476  79  PRO A CA    
281  C  C     . PRO A 47  ? 0.3878 0.5838 0.4969 0.0144  -0.0386 0.0556  79  PRO A C     
282  O  O     . PRO A 47  ? 0.3454 0.5246 0.4430 0.0089  -0.0371 0.0550  79  PRO A O     
283  C  CB    . PRO A 47  ? 0.3982 0.6234 0.5145 0.0003  -0.0400 0.0419  79  PRO A CB    
284  C  CG    . PRO A 47  ? 0.3366 0.5565 0.4537 -0.0086 -0.0350 0.0346  79  PRO A CG    
285  C  CD    . PRO A 47  ? 0.3718 0.5663 0.4824 -0.0076 -0.0303 0.0353  79  PRO A CD    
286  N  N     . ASN A 48  ? 0.3893 0.5971 0.5037 0.0249  -0.0417 0.0641  80  ASN A N     
287  C  CA    . ASN A 48  ? 0.4803 0.6851 0.5865 0.0301  -0.0441 0.0740  80  ASN A CA    
288  C  C     . ASN A 48  ? 0.4704 0.7052 0.5763 0.0327  -0.0511 0.0765  80  ASN A C     
289  O  O     . ASN A 48  ? 0.4256 0.6763 0.5422 0.0434  -0.0529 0.0828  80  ASN A O     
290  C  CB    . ASN A 48  ? 0.5231 0.7130 0.6372 0.0420  -0.0401 0.0841  80  ASN A CB    
291  C  CG    . ASN A 48  ? 0.6013 0.7797 0.7052 0.0445  -0.0398 0.0939  80  ASN A CG    
292  O  OD1   . ASN A 48  ? 0.6414 0.8337 0.7346 0.0433  -0.0446 0.0972  80  ASN A OD1   
293  N  ND2   . ASN A 48  ? 0.7170 0.8716 0.8249 0.0475  -0.0339 0.0979  80  ASN A ND2   
294  N  N     . LEU A 49  ? 0.4498 0.6933 0.5442 0.0234  -0.0550 0.0709  81  LEU A N     
295  C  CA    . LEU A 49  ? 0.4981 0.7735 0.5936 0.0221  -0.0618 0.0678  81  LEU A CA    
296  C  C     . LEU A 49  ? 0.4902 0.7761 0.5728 0.0238  -0.0666 0.0722  81  LEU A C     
297  O  O     . LEU A 49  ? 0.4413 0.7084 0.5124 0.0226  -0.0644 0.0753  81  LEU A O     
298  C  CB    . LEU A 49  ? 0.5079 0.7899 0.6049 0.0076  -0.0622 0.0536  81  LEU A CB    
299  C  CG    . LEU A 49  ? 0.5092 0.7861 0.6183 0.0054  -0.0574 0.0490  81  LEU A CG    
300  C  CD1   . LEU A 49  ? 0.4546 0.7334 0.5636 -0.0098 -0.0561 0.0372  81  LEU A CD1   
301  C  CD2   . LEU A 49  ? 0.5184 0.8185 0.6424 0.0156  -0.0595 0.0529  81  LEU A CD2   
302  N  N     . ILE A 50  ? 0.4982 0.8173 0.5829 0.0267  -0.0734 0.0719  82  ILE A N     
303  C  CA    . ILE A 50  ? 0.4973 0.8357 0.5701 0.0286  -0.0791 0.0742  82  ILE A CA    
304  C  C     . ILE A 50  ? 0.4499 0.8130 0.5224 0.0164  -0.0846 0.0584  82  ILE A C     
305  O  O     . ILE A 50  ? 0.4433 0.8283 0.5281 0.0151  -0.0873 0.0532  82  ILE A O     
306  C  CB    . ILE A 50  ? 0.5315 0.8917 0.6075 0.0457  -0.0826 0.0900  82  ILE A CB    
307  C  CG1   . ILE A 50  ? 0.6012 0.9341 0.6774 0.0566  -0.0763 0.1059  82  ILE A CG1   
308  C  CG2   . ILE A 50  ? 0.5165 0.9074 0.5809 0.0471  -0.0899 0.0900  82  ILE A CG2   
309  C  CD1   . ILE A 50  ? 0.6407 0.9595 0.7008 0.0554  -0.0746 0.1108  82  ILE A CD1   
310  N  N     . ILE A 51  ? 0.4993 0.8588 0.5589 0.0072  -0.0858 0.0500  83  ILE A N     
311  C  CA    . ILE A 51  ? 0.5489 0.9264 0.6088 -0.0063 -0.0897 0.0328  83  ILE A CA    
312  C  C     . ILE A 51  ? 0.5736 0.9734 0.6205 -0.0047 -0.0958 0.0305  83  ILE A C     
313  O  O     . ILE A 51  ? 0.6108 1.0050 0.6463 0.0047  -0.0953 0.0420  83  ILE A O     
314  C  CB    . ILE A 51  ? 0.5843 0.9318 0.6432 -0.0213 -0.0837 0.0214  83  ILE A CB    
315  C  CG1   . ILE A 51  ? 0.5837 0.9118 0.6539 -0.0214 -0.0775 0.0248  83  ILE A CG1   
316  C  CG2   . ILE A 51  ? 0.6978 1.0610 0.7606 -0.0361 -0.0864 0.0034  83  ILE A CG2   
317  C  CD1   . ILE A 51  ? 0.6534 0.9475 0.7177 -0.0161 -0.0711 0.0343  83  ILE A CD1   
318  N  N     . LYS A 52  ? 0.6675 1.0952 0.7171 -0.0139 -0.1014 0.0152  84  LYS A N     
319  C  CA    . LYS A 52  ? 0.6812 1.1362 0.7192 -0.0133 -0.1079 0.0095  84  LYS A CA    
320  C  C     . LYS A 52  ? 0.7188 1.1608 0.7501 -0.0287 -0.1063 -0.0087 84  LYS A C     
321  O  O     . LYS A 52  ? 0.7563 1.1720 0.7753 -0.0289 -0.1020 -0.0063 84  LYS A O     
322  C  CB    . LYS A 52  ? 0.7586 1.2579 0.8047 -0.0108 -0.1153 0.0044  84  LYS A CB    
323  C  CG    . LYS A 52  ? 0.8714 1.3782 0.9340 -0.0046 -0.1149 0.0123  84  LYS A CG    
324  C  CD    . LYS A 52  ? 0.9259 1.4301 0.9862 0.0151  -0.1138 0.0355  84  LYS A CD    
325  C  CE    . LYS A 52  ? 0.8553 1.3607 0.9332 0.0213  -0.1122 0.0428  84  LYS A CE    
326  N  NZ    . LYS A 52  ? 0.7888 1.2883 0.8665 0.0406  -0.1100 0.0648  84  LYS A NZ    
327  N  N     . THR A 82  ? 1.0199 1.4403 1.1244 0.0387  -0.0912 0.0703  114 THR A N     
328  C  CA    . THR A 82  ? 0.9651 1.4298 1.0766 0.0436  -0.0990 0.0693  114 THR A CA    
329  C  C     . THR A 82  ? 0.9331 1.4145 1.0532 0.0280  -0.1010 0.0510  114 THR A C     
330  O  O     . THR A 82  ? 0.9208 1.4383 1.0519 0.0301  -0.1063 0.0477  114 THR A O     
331  C  CB    . THR A 82  ? 0.9545 1.4303 1.0796 0.0614  -0.0987 0.0834  114 THR A CB    
332  O  OG1   . THR A 82  ? 1.0487 1.5625 1.1799 0.0641  -0.1044 0.0795  114 THR A OG1   
333  C  CG2   . THR A 82  ? 0.8780 1.3291 1.0159 0.0600  -0.0913 0.0812  114 THR A CG2   
334  N  N     . ILE A 83  ? 0.7947 1.2501 0.9107 0.0123  -0.0964 0.0397  115 ILE A N     
335  C  CA    . ILE A 83  ? 0.6267 1.0895 0.7522 -0.0037 -0.0957 0.0239  115 ILE A CA    
336  C  C     . ILE A 83  ? 0.4910 0.9462 0.6059 -0.0190 -0.0963 0.0108  115 ILE A C     
337  O  O     . ILE A 83  ? 0.5186 0.9644 0.6186 -0.0166 -0.0975 0.0137  115 ILE A O     
338  C  CB    . ILE A 83  ? 0.5680 1.0049 0.7023 -0.0071 -0.0874 0.0240  115 ILE A CB    
339  C  CG1   . ILE A 83  ? 0.4896 0.8839 0.6117 -0.0101 -0.0808 0.0266  115 ILE A CG1   
340  C  CG2   . ILE A 83  ? 0.6087 1.0533 0.7547 0.0085  -0.0865 0.0349  115 ILE A CG2   
341  C  CD1   . ILE A 83  ? 0.4538 0.8248 0.5828 -0.0124 -0.0729 0.0268  115 ILE A CD1   
342  N  N     . THR A 84  ? 0.4106 0.8697 0.5345 -0.0349 -0.0948 -0.0035 116 THR A N     
343  C  CA    . THR A 84  ? 0.4074 0.8603 0.5249 -0.0503 -0.0949 -0.0178 116 THR A CA    
344  C  C     . THR A 84  ? 0.4206 0.8289 0.5308 -0.0570 -0.0863 -0.0173 116 THR A C     
345  O  O     . THR A 84  ? 0.3719 0.7582 0.4846 -0.0529 -0.0802 -0.0089 116 THR A O     
346  C  CB    . THR A 84  ? 0.5205 0.9991 0.6534 -0.0650 -0.0968 -0.0337 116 THR A CB    
347  O  OG1   . THR A 84  ? 0.7489 1.2349 0.8763 -0.0764 -0.1001 -0.0485 116 THR A OG1   
348  C  CG2   . THR A 84  ? 0.3292 0.7850 0.4725 -0.0762 -0.0881 -0.0367 116 THR A CG2   
349  N  N     . LEU A 85  ? 0.3768 0.7738 0.4781 -0.0671 -0.0859 -0.0272 117 LEU A N     
350  C  CA    . LEU A 85  ? 0.4467 0.8033 0.5396 -0.0724 -0.0783 -0.0264 117 LEU A CA    
351  C  C     . LEU A 85  ? 0.3779 0.7183 0.4825 -0.0818 -0.0707 -0.0285 117 LEU A C     
352  O  O     . LEU A 85  ? 0.3398 0.6515 0.4403 -0.0792 -0.0642 -0.0208 117 LEU A O     
353  C  CB    . LEU A 85  ? 0.4388 0.7902 0.5224 -0.0815 -0.0794 -0.0385 117 LEU A CB    
354  C  CG    . LEU A 85  ? 0.4703 0.7825 0.5445 -0.0864 -0.0721 -0.0388 117 LEU A CG    
355  C  CD1   . LEU A 85  ? 0.4803 0.7730 0.5414 -0.0731 -0.0704 -0.0239 117 LEU A CD1   
356  C  CD2   . LEU A 85  ? 0.5668 0.8790 0.6355 -0.0962 -0.0734 -0.0537 117 LEU A CD2   
357  N  N     . GLN A 86  ? 0.3177 0.6783 0.4371 -0.0927 -0.0713 -0.0387 118 GLN A N     
358  C  CA    . GLN A 86  ? 0.3663 0.7133 0.4971 -0.1025 -0.0633 -0.0401 118 GLN A CA    
359  C  C     . GLN A 86  ? 0.3225 0.6697 0.4588 -0.0925 -0.0605 -0.0283 118 GLN A C     
360  O  O     . GLN A 86  ? 0.2989 0.6228 0.4351 -0.0939 -0.0529 -0.0234 118 GLN A O     
361  C  CB    . GLN A 86  ? 0.3534 0.7236 0.5006 -0.1176 -0.0642 -0.0541 118 GLN A CB    
362  C  CG    . GLN A 86  ? 0.5123 0.8705 0.6580 -0.1319 -0.0626 -0.0678 118 GLN A CG    
363  C  CD    . GLN A 86  ? 0.6736 1.0490 0.8095 -0.1291 -0.0712 -0.0760 118 GLN A CD    
364  O  OE1   . GLN A 86  ? 0.6314 1.0363 0.7654 -0.1188 -0.0792 -0.0729 118 GLN A OE1   
365  N  NE2   . GLN A 86  ? 0.7381 1.0962 0.8677 -0.1376 -0.0693 -0.0861 118 GLN A NE2   
366  N  N     . GLN A 87  ? 0.2647 0.6389 0.4058 -0.0815 -0.0664 -0.0238 119 GLN A N     
367  C  CA    . GLN A 87  ? 0.2910 0.6655 0.4383 -0.0707 -0.0637 -0.0138 119 GLN A CA    
368  C  C     . GLN A 87  ? 0.2533 0.5967 0.3879 -0.0605 -0.0600 -0.0033 119 GLN A C     
369  O  O     . GLN A 87  ? 0.4099 0.7388 0.5474 -0.0581 -0.0539 0.0012  119 GLN A O     
370  C  CB    . GLN A 87  ? 0.2708 0.6804 0.4263 -0.0597 -0.0708 -0.0108 119 GLN A CB    
371  C  CG    . GLN A 87  ? 0.3878 0.8339 0.5577 -0.0691 -0.0751 -0.0217 119 GLN A CG    
372  C  CD    . GLN A 87  ? 0.3219 0.7740 0.5080 -0.0775 -0.0691 -0.0250 119 GLN A CD    
373  O  OE1   . GLN A 87  ? 0.3349 0.7686 0.5215 -0.0733 -0.0625 -0.0181 119 GLN A OE1   
374  N  NE2   . GLN A 87  ? 0.3037 0.7838 0.5036 -0.0894 -0.0713 -0.0360 119 GLN A NE2   
375  N  N     . ALA A 88  ? 0.3033 0.6380 0.4244 -0.0546 -0.0635 0.0001  120 ALA A N     
376  C  CA    . ALA A 88  ? 0.2515 0.5570 0.3616 -0.0462 -0.0598 0.0093  120 ALA A CA    
377  C  C     . ALA A 88  ? 0.3399 0.6162 0.4448 -0.0555 -0.0525 0.0065  120 ALA A C     
378  O  O     . ALA A 88  ? 0.3105 0.5676 0.4136 -0.0508 -0.0474 0.0122  120 ALA A O     
379  C  CB    . ALA A 88  ? 0.3209 0.6254 0.4180 -0.0393 -0.0645 0.0136  120 ALA A CB    
380  N  N     . GLU A 89  ? 0.3410 0.6143 0.4442 -0.0684 -0.0518 -0.0025 121 GLU A N     
381  C  CA    . GLU A 89  ? 0.3073 0.5543 0.4073 -0.0768 -0.0444 -0.0040 121 GLU A CA    
382  C  C     . GLU A 89  ? 0.2600 0.5078 0.3708 -0.0789 -0.0384 -0.0018 121 GLU A C     
383  O  O     . GLU A 89  ? 0.2995 0.5268 0.4060 -0.0776 -0.0324 0.0028  121 GLU A O     
384  C  CB    . GLU A 89  ? 0.3784 0.6233 0.4783 -0.0904 -0.0440 -0.0146 121 GLU A CB    
385  C  CG    . GLU A 89  ? 0.4761 0.6934 0.5736 -0.0984 -0.0357 -0.0148 121 GLU A CG    
386  C  CD    . GLU A 89  ? 0.5000 0.7154 0.6026 -0.1128 -0.0341 -0.0259 121 GLU A CD    
387  O  OE1   . GLU A 89  ? 0.5260 0.7655 0.6398 -0.1196 -0.0378 -0.0344 121 GLU A OE1   
388  O  OE2   . GLU A 89  ? 0.4920 0.6824 0.5886 -0.1172 -0.0288 -0.0265 121 GLU A OE2   
389  N  N     . TYR A 90  ? 0.2811 0.5549 0.4060 -0.0816 -0.0401 -0.0052 122 TYR A N     
390  C  CA    . TYR A 90  ? 0.3358 0.6139 0.4711 -0.0828 -0.0343 -0.0029 122 TYR A CA    
391  C  C     . TYR A 90  ? 0.3802 0.6519 0.5129 -0.0692 -0.0328 0.0050  122 TYR A C     
392  O  O     . TYR A 90  ? 0.2705 0.5316 0.4036 -0.0692 -0.0263 0.0078  122 TYR A O     
393  C  CB    . TYR A 90  ? 0.2987 0.6093 0.4505 -0.0873 -0.0368 -0.0081 122 TYR A CB    
394  C  CG    . TYR A 90  ? 0.3670 0.6858 0.5301 -0.0874 -0.0308 -0.0054 122 TYR A CG    
395  C  CD1   . TYR A 90  ? 0.3917 0.7013 0.5587 -0.0987 -0.0226 -0.0060 122 TYR A CD1   
396  C  CD2   . TYR A 90  ? 0.3404 0.6762 0.5102 -0.0755 -0.0325 -0.0018 122 TYR A CD2   
397  C  CE1   . TYR A 90  ? 0.3593 0.6788 0.5356 -0.0984 -0.0166 -0.0030 122 TYR A CE1   
398  C  CE2   . TYR A 90  ? 0.4178 0.7629 0.5975 -0.0751 -0.0267 -0.0004 122 TYR A CE2   
399  C  CZ    . TYR A 90  ? 0.4214 0.7593 0.6037 -0.0867 -0.0189 -0.0009 122 TYR A CZ    
400  O  OH    . TYR A 90  ? 0.3370 0.6867 0.5284 -0.0859 -0.0127 0.0010  122 TYR A OH    
401  N  N     . GLU A 91  ? 0.3098 0.5886 0.4406 -0.0574 -0.0385 0.0087  123 GLU A N     
402  C  CA    . GLU A 91  ? 0.3597 0.6307 0.4903 -0.0447 -0.0367 0.0151  123 GLU A CA    
403  C  C     . GLU A 91  ? 0.2697 0.5107 0.3882 -0.0443 -0.0320 0.0179  123 GLU A C     
404  O  O     . GLU A 91  ? 0.2890 0.5222 0.4091 -0.0414 -0.0268 0.0191  123 GLU A O     
405  C  CB    . GLU A 91  ? 0.3440 0.6252 0.4750 -0.0323 -0.0429 0.0200  123 GLU A CB    
406  C  CG    . GLU A 91  ? 0.4026 0.7170 0.5466 -0.0298 -0.0478 0.0184  123 GLU A CG    
407  C  CD    . GLU A 91  ? 0.5471 0.8706 0.6943 -0.0138 -0.0519 0.0262  123 GLU A CD    
408  O  OE1   . GLU A 91  ? 0.5700 0.8726 0.7125 -0.0051 -0.0494 0.0325  123 GLU A OE1   
409  O  OE2   . GLU A 91  ? 0.5842 0.9362 0.7394 -0.0100 -0.0573 0.0264  123 GLU A OE2   
410  N  N     . PHE A 92  ? 0.2194 0.4458 0.3260 -0.0469 -0.0339 0.0181  124 PHE A N     
411  C  CA    . PHE A 92  ? 0.2698 0.4698 0.3653 -0.0462 -0.0298 0.0207  124 PHE A CA    
412  C  C     . PHE A 92  ? 0.2881 0.4790 0.3833 -0.0546 -0.0232 0.0187  124 PHE A C     
413  O  O     . PHE A 92  ? 0.2878 0.4655 0.3792 -0.0515 -0.0188 0.0211  124 PHE A O     
414  C  CB    . PHE A 92  ? 0.3049 0.4938 0.3883 -0.0476 -0.0330 0.0210  124 PHE A CB    
415  C  CG    . PHE A 92  ? 0.3856 0.5784 0.4664 -0.0371 -0.0378 0.0264  124 PHE A CG    
416  C  CD1   . PHE A 92  ? 0.3529 0.5335 0.4330 -0.0277 -0.0357 0.0323  124 PHE A CD1   
417  C  CD2   . PHE A 92  ? 0.4034 0.6133 0.4833 -0.0367 -0.0440 0.0255  124 PHE A CD2   
418  C  CE1   . PHE A 92  ? 0.3727 0.5555 0.4520 -0.0181 -0.0389 0.0391  124 PHE A CE1   
419  C  CE2   . PHE A 92  ? 0.4013 0.6162 0.4785 -0.0261 -0.0478 0.0328  124 PHE A CE2   
420  C  CZ    . PHE A 92  ? 0.3531 0.5531 0.4303 -0.0168 -0.0449 0.0404  124 PHE A CZ    
421  N  N     . LEU A 93  ? 0.2896 0.4886 0.3898 -0.0653 -0.0222 0.0145  125 LEU A N     
422  C  CA    . LEU A 93  ? 0.2617 0.4524 0.3627 -0.0732 -0.0150 0.0147  125 LEU A CA    
423  C  C     . LEU A 93  ? 0.2398 0.4407 0.3484 -0.0693 -0.0106 0.0170  125 LEU A C     
424  O  O     . LEU A 93  ? 0.2737 0.4642 0.3779 -0.0689 -0.0049 0.0200  125 LEU A O     
425  C  CB    . LEU A 93  ? 0.2630 0.4603 0.3708 -0.0860 -0.0142 0.0095  125 LEU A CB    
426  C  CG    . LEU A 93  ? 0.2505 0.4399 0.3617 -0.0950 -0.0057 0.0114  125 LEU A CG    
427  C  CD1   . LEU A 93  ? 0.3270 0.4907 0.4256 -0.0930 -0.0013 0.0162  125 LEU A CD1   
428  C  CD2   . LEU A 93  ? 0.3075 0.5022 0.4281 -0.1085 -0.0048 0.0052  125 LEU A CD2   
429  N  N     . SER A 94  ? 0.2315 0.4548 0.3514 -0.0659 -0.0133 0.0153  126 SER A N     
430  C  CA    . SER A 94  ? 0.2683 0.5031 0.3958 -0.0611 -0.0092 0.0163  126 SER A CA    
431  C  C     . SER A 94  ? 0.3159 0.5380 0.4367 -0.0505 -0.0080 0.0183  126 SER A C     
432  O  O     . SER A 94  ? 0.3914 0.6129 0.5116 -0.0491 -0.0025 0.0188  126 SER A O     
433  C  CB    . SER A 94  ? 0.3005 0.5618 0.4417 -0.0576 -0.0128 0.0139  126 SER A CB    
434  O  OG    . SER A 94  ? 0.4832 0.7587 0.6318 -0.0682 -0.0143 0.0105  126 SER A OG    
435  N  N     . PHE A 95  ? 0.3193 0.5323 0.4355 -0.0434 -0.0129 0.0192  127 PHE A N     
436  C  CA    . PHE A 95  ? 0.3107 0.5105 0.4226 -0.0346 -0.0115 0.0202  127 PHE A CA    
437  C  C     . PHE A 95  ? 0.3279 0.5107 0.4288 -0.0385 -0.0069 0.0210  127 PHE A C     
438  O  O     . PHE A 95  ? 0.3379 0.5208 0.4388 -0.0352 -0.0027 0.0198  127 PHE A O     
439  C  CB    . PHE A 95  ? 0.2927 0.4842 0.4018 -0.0277 -0.0167 0.0227  127 PHE A CB    
440  C  CG    . PHE A 95  ? 0.3088 0.4850 0.4152 -0.0201 -0.0148 0.0233  127 PHE A CG    
441  C  CD1   . PHE A 95  ? 0.2896 0.4712 0.4056 -0.0125 -0.0123 0.0204  127 PHE A CD1   
442  C  CD2   . PHE A 95  ? 0.3304 0.4875 0.4259 -0.0209 -0.0152 0.0256  127 PHE A CD2   
443  C  CE1   . PHE A 95  ? 0.3477 0.5154 0.4634 -0.0067 -0.0103 0.0191  127 PHE A CE1   
444  C  CE2   . PHE A 95  ? 0.3761 0.5203 0.4710 -0.0150 -0.0132 0.0253  127 PHE A CE2   
445  C  CZ    . PHE A 95  ? 0.3657 0.5148 0.4711 -0.0084 -0.0108 0.0217  127 PHE A CZ    
446  N  N     . VAL A 96  ? 0.2521 0.4218 0.3438 -0.0450 -0.0077 0.0228  128 VAL A N     
447  C  CA    . VAL A 96  ? 0.2633 0.4171 0.3448 -0.0471 -0.0035 0.0246  128 VAL A CA    
448  C  C     . VAL A 96  ? 0.2602 0.4211 0.3437 -0.0520 0.0028  0.0259  128 VAL A C     
449  O  O     . VAL A 96  ? 0.3182 0.4731 0.3955 -0.0503 0.0070  0.0277  128 VAL A O     
450  C  CB    . VAL A 96  ? 0.3040 0.4418 0.3759 -0.0519 -0.0053 0.0259  128 VAL A CB    
451  C  CG1   . VAL A 96  ? 0.3305 0.4613 0.3984 -0.0457 -0.0103 0.0263  128 VAL A CG1   
452  C  CG2   . VAL A 96  ? 0.2461 0.3900 0.3220 -0.0611 -0.0061 0.0243  128 VAL A CG2   
453  N  N     . ARG A 97  ? 0.2836 0.4591 0.3763 -0.0578 0.0038  0.0254  129 ARG A N     
454  C  CA    . ARG A 97  ? 0.3357 0.5208 0.4320 -0.0619 0.0107  0.0279  129 ARG A CA    
455  C  C     . ARG A 97  ? 0.3344 0.5317 0.4331 -0.0536 0.0130  0.0263  129 ARG A C     
456  O  O     . ARG A 97  ? 0.3210 0.5210 0.4159 -0.0532 0.0188  0.0292  129 ARG A O     
457  C  CB    . ARG A 97  ? 0.3584 0.5592 0.4666 -0.0700 0.0113  0.0269  129 ARG A CB    
458  C  CG    . ARG A 97  ? 0.3572 0.5472 0.4649 -0.0811 0.0123  0.0278  129 ARG A CG    
459  C  CD    . ARG A 97  ? 0.2554 0.4636 0.3774 -0.0899 0.0130  0.0252  129 ARG A CD    
460  N  NE    . ARG A 97  ? 0.3651 0.5625 0.4892 -0.1019 0.0154  0.0248  129 ARG A NE    
461  C  CZ    . ARG A 97  ? 0.3119 0.5219 0.4486 -0.1117 0.0148  0.0200  129 ARG A CZ    
462  N  NH1   . ARG A 97  ? 0.3084 0.5438 0.4560 -0.1103 0.0114  0.0164  129 ARG A NH1   
463  N  NH2   . ARG A 97  ? 0.3836 0.5814 0.5231 -0.1230 0.0176  0.0182  129 ARG A NH2   
464  N  N     . GLN A 98  ? 0.3167 0.5224 0.4220 -0.0463 0.0089  0.0217  130 GLN A N     
465  C  CA    . GLN A 98  ? 0.3537 0.5693 0.4623 -0.0380 0.0111  0.0179  130 GLN A CA    
466  C  C     . GLN A 98  ? 0.4024 0.6034 0.5015 -0.0329 0.0115  0.0165  130 GLN A C     
467  O  O     . GLN A 98  ? 0.2971 0.5064 0.3965 -0.0280 0.0148  0.0127  130 GLN A O     
468  C  CB    . GLN A 98  ? 0.3283 0.5549 0.4485 -0.0309 0.0072  0.0134  130 GLN A CB    
469  C  CG    . GLN A 98  ? 0.3781 0.6265 0.5100 -0.0342 0.0075  0.0133  130 GLN A CG    
470  C  CD    . GLN A 98  ? 0.6145 0.8730 0.7576 -0.0262 0.0028  0.0103  130 GLN A CD    
471  O  OE1   . GLN A 98  ? 0.7156 0.9816 0.8639 -0.0288 -0.0014 0.0117  130 GLN A OE1   
472  N  NE2   . GLN A 98  ? 0.6930 0.9525 0.8405 -0.0161 0.0038  0.0060  130 GLN A NE2   
473  N  N     . GLN A 99  ? 0.3715 0.5529 0.4624 -0.0341 0.0084  0.0187  131 GLN A N     
474  C  CA    . GLN A 99  ? 0.2998 0.4687 0.3840 -0.0292 0.0082  0.0166  131 GLN A CA    
475  C  C     . GLN A 99  ? 0.3778 0.5368 0.4499 -0.0326 0.0111  0.0205  131 GLN A C     
476  O  O     . GLN A 99  ? 0.3156 0.4738 0.3835 -0.0285 0.0127  0.0178  131 GLN A O     
477  C  CB    . GLN A 99  ? 0.3102 0.4653 0.3947 -0.0262 0.0030  0.0164  131 GLN A CB    
478  C  CG    . GLN A 99  ? 0.3183 0.4816 0.4151 -0.0196 0.0006  0.0132  131 GLN A CG    
479  C  CD    . GLN A 99  ? 0.4037 0.5741 0.5074 -0.0130 0.0036  0.0061  131 GLN A CD    
480  O  OE1   . GLN A 99  ? 0.4106 0.5745 0.5096 -0.0117 0.0057  0.0026  131 GLN A OE1   
481  N  NE2   . GLN A 99  ? 0.3965 0.5819 0.5122 -0.0085 0.0040  0.0027  131 GLN A NE2   
482  N  N     . THR A 100 ? 0.2884 0.4403 0.3556 -0.0396 0.0121  0.0264  132 THR A N     
483  C  CA    . THR A 100 ? 0.2675 0.4080 0.3239 -0.0415 0.0150  0.0311  132 THR A CA    
484  C  C     . THR A 100 ? 0.2576 0.4020 0.3138 -0.0478 0.0204  0.0377  132 THR A C     
485  O  O     . THR A 100 ? 0.3237 0.4738 0.3876 -0.0535 0.0207  0.0383  132 THR A O     
486  C  CB    . THR A 100 ? 0.2563 0.3772 0.3061 -0.0431 0.0113  0.0323  132 THR A CB    
487  O  OG1   . THR A 100 ? 0.3752 0.4935 0.4284 -0.0495 0.0094  0.0332  132 THR A OG1   
488  C  CG2   . THR A 100 ? 0.3155 0.4316 0.3662 -0.0372 0.0069  0.0277  132 THR A CG2   
489  N  N     . PRO A 101 ? 0.3845 0.5267 0.4329 -0.0468 0.0252  0.0432  133 PRO A N     
490  C  CA    . PRO A 101 ? 0.3929 0.5355 0.4417 -0.0525 0.0315  0.0517  133 PRO A CA    
491  C  C     . PRO A 101 ? 0.3782 0.5012 0.4266 -0.0597 0.0309  0.0540  133 PRO A C     
492  O  O     . PRO A 101 ? 0.3661 0.4748 0.4092 -0.0584 0.0263  0.0509  133 PRO A O     
493  C  CB    . PRO A 101 ? 0.4305 0.5759 0.4700 -0.0472 0.0361  0.0576  133 PRO A CB    
494  C  CG    . PRO A 101 ? 0.4995 0.6532 0.5363 -0.0393 0.0322  0.0494  133 PRO A CG    
495  C  CD    . PRO A 101 ? 0.4170 0.5592 0.4573 -0.0399 0.0255  0.0421  133 PRO A CD    
496  N  N     . PRO A 102 ? 0.4442 0.5666 0.4988 -0.0675 0.0358  0.0590  134 PRO A N     
497  C  CA    . PRO A 102 ? 0.4285 0.5335 0.4851 -0.0753 0.0351  0.0582  134 PRO A CA    
498  C  C     . PRO A 102 ? 0.4325 0.5168 0.4791 -0.0731 0.0368  0.0623  134 PRO A C     
499  O  O     . PRO A 102 ? 0.3829 0.4646 0.4251 -0.0704 0.0431  0.0713  134 PRO A O     
500  C  CB    . PRO A 102 ? 0.4411 0.5516 0.5086 -0.0843 0.0418  0.0629  134 PRO A CB    
501  C  CG    . PRO A 102 ? 0.4447 0.5795 0.5172 -0.0813 0.0435  0.0637  134 PRO A CG    
502  C  CD    . PRO A 102 ? 0.4660 0.6054 0.5279 -0.0703 0.0421  0.0642  134 PRO A CD    
503  N  N     . GLY A 103 ? 0.4145 0.4858 0.4575 -0.0736 0.0313  0.0563  135 GLY A N     
504  C  CA    . GLY A 103 ? 0.3973 0.4487 0.4324 -0.0724 0.0328  0.0587  135 GLY A CA    
505  C  C     . GLY A 103 ? 0.4166 0.4659 0.4407 -0.0628 0.0318  0.0612  135 GLY A C     
506  O  O     . GLY A 103 ? 0.4213 0.4554 0.4390 -0.0609 0.0333  0.0637  135 GLY A O     
507  N  N     . LEU A 104 ? 0.3393 0.4039 0.3621 -0.0569 0.0295  0.0595  136 LEU A N     
508  C  CA    . LEU A 104 ? 0.3850 0.4511 0.3992 -0.0486 0.0293  0.0611  136 LEU A CA    
509  C  C     . LEU A 104 ? 0.4024 0.4657 0.4135 -0.0450 0.0228  0.0537  136 LEU A C     
510  O  O     . LEU A 104 ? 0.3797 0.4393 0.3840 -0.0399 0.0224  0.0542  136 LEU A O     
511  C  CB    . LEU A 104 ? 0.4365 0.5228 0.4515 -0.0441 0.0321  0.0633  136 LEU A CB    
512  C  CG    . LEU A 104 ? 0.4650 0.5572 0.4817 -0.0459 0.0399  0.0734  136 LEU A CG    
513  C  CD1   . LEU A 104 ? 0.4960 0.6106 0.5099 -0.0392 0.0423  0.0754  136 LEU A CD1   
514  C  CD2   . LEU A 104 ? 0.4822 0.5567 0.4940 -0.0462 0.0446  0.0824  136 LEU A CD2   
515  N  N     . CYS A 105 ? 0.3078 0.3740 0.3246 -0.0472 0.0179  0.0475  137 CYS A N     
516  C  CA    . CYS A 105 ? 0.2994 0.3643 0.3147 -0.0429 0.0129  0.0423  137 CYS A CA    
517  C  C     . CYS A 105 ? 0.2424 0.2947 0.2551 -0.0455 0.0092  0.0405  137 CYS A C     
518  O  O     . CYS A 105 ? 0.3258 0.3761 0.3415 -0.0511 0.0085  0.0398  137 CYS A O     
519  C  CB    . CYS A 105 ? 0.3191 0.3977 0.3428 -0.0409 0.0103  0.0375  137 CYS A CB    
520  S  SG    . CYS A 105 ? 0.3741 0.4707 0.4004 -0.0365 0.0142  0.0367  137 CYS A SG    
521  N  N     . PRO A 106 ? 0.2862 0.3320 0.2939 -0.0418 0.0069  0.0393  138 PRO A N     
522  C  CA    . PRO A 106 ? 0.3423 0.3780 0.3459 -0.0434 0.0039  0.0381  138 PRO A CA    
523  C  C     . PRO A 106 ? 0.3284 0.3691 0.3360 -0.0422 -0.0010 0.0356  138 PRO A C     
524  O  O     . PRO A 106 ? 0.3510 0.3989 0.3643 -0.0386 -0.0021 0.0347  138 PRO A O     
525  C  CB    . PRO A 106 ? 0.3042 0.3319 0.3003 -0.0394 0.0051  0.0395  138 PRO A CB    
526  C  CG    . PRO A 106 ? 0.3501 0.3868 0.3491 -0.0350 0.0058  0.0387  138 PRO A CG    
527  C  CD    . PRO A 106 ? 0.2977 0.3456 0.3026 -0.0363 0.0077  0.0389  138 PRO A CD    
528  N  N     . LEU A 107 ? 0.3064 0.3435 0.3112 -0.0449 -0.0038 0.0344  139 LEU A N     
529  C  CA    . LEU A 107 ? 0.3108 0.3522 0.3166 -0.0425 -0.0083 0.0341  139 LEU A CA    
530  C  C     . LEU A 107 ? 0.3579 0.3932 0.3599 -0.0374 -0.0081 0.0363  139 LEU A C     
531  O  O     . LEU A 107 ? 0.3852 0.4122 0.3810 -0.0369 -0.0056 0.0368  139 LEU A O     
532  C  CB    . LEU A 107 ? 0.3569 0.3984 0.3587 -0.0463 -0.0111 0.0316  139 LEU A CB    
533  C  CG    . LEU A 107 ? 0.4893 0.5441 0.4978 -0.0498 -0.0145 0.0288  139 LEU A CG    
534  C  CD1   . LEU A 107 ? 0.5781 0.6371 0.5815 -0.0507 -0.0188 0.0261  139 LEU A CD1   
535  C  CD2   . LEU A 107 ? 0.4097 0.4756 0.4268 -0.0452 -0.0162 0.0312  139 LEU A CD2   
536  N  N     . ALA A 108 ? 0.3139 0.3537 0.3208 -0.0334 -0.0104 0.0380  140 ALA A N     
537  C  CA    . ALA A 108 ? 0.2863 0.3205 0.2925 -0.0294 -0.0095 0.0405  140 ALA A CA    
538  C  C     . ALA A 108 ? 0.2504 0.2877 0.2583 -0.0261 -0.0124 0.0448  140 ALA A C     
539  O  O     . ALA A 108 ? 0.3391 0.3853 0.3524 -0.0249 -0.0151 0.0457  140 ALA A O     
540  C  CB    . ALA A 108 ? 0.3054 0.3405 0.3196 -0.0269 -0.0070 0.0386  140 ALA A CB    
541  N  N     . GLY A 109 ? 0.3231 0.3545 0.3266 -0.0243 -0.0115 0.0481  141 GLY A N     
542  C  CA    . GLY A 109 ? 0.3604 0.3948 0.3641 -0.0205 -0.0132 0.0544  141 GLY A CA    
543  C  C     . GLY A 109 ? 0.3672 0.3966 0.3619 -0.0203 -0.0119 0.0572  141 GLY A C     
544  O  O     . GLY A 109 ? 0.3814 0.4051 0.3697 -0.0229 -0.0100 0.0535  141 GLY A O     
545  N  N     . ASN A 110 ? 0.4156 0.4484 0.4101 -0.0164 -0.0125 0.0646  142 ASN A N     
546  C  CA    . ASN A 110 ? 0.4911 0.5222 0.4770 -0.0156 -0.0111 0.0685  142 ASN A CA    
547  C  C     . ASN A 110 ? 0.5482 0.5874 0.5220 -0.0172 -0.0144 0.0654  142 ASN A C     
548  O  O     . ASN A 110 ? 0.6038 0.6546 0.5769 -0.0158 -0.0182 0.0667  142 ASN A O     
549  C  CB    . ASN A 110 ? 0.5462 0.5785 0.5376 -0.0106 -0.0094 0.0792  142 ASN A CB    
550  C  CG    . ASN A 110 ? 0.6090 0.6305 0.6084 -0.0109 -0.0042 0.0811  142 ASN A CG    
551  O  OD1   . ASN A 110 ? 0.6343 0.6513 0.6469 -0.0090 -0.0020 0.0839  142 ASN A OD1   
552  N  ND2   . ASN A 110 ? 0.7023 0.7201 0.6949 -0.0134 -0.0019 0.0786  142 ASN A ND2   
553  N  N     . SER A 111 ? 0.6100 0.6442 0.5751 -0.0198 -0.0128 0.0606  143 SER A N     
554  C  CA    . SER A 111 ? 0.8602 0.8998 0.8151 -0.0221 -0.0152 0.0545  143 SER A CA    
555  C  C     . SER A 111 ? 0.9206 0.9651 0.8789 -0.0258 -0.0185 0.0482  143 SER A C     
556  O  O     . SER A 111 ? 0.9740 1.0303 0.9285 -0.0267 -0.0223 0.0450  143 SER A O     
557  C  CB    . SER A 111 ? 0.9304 0.9821 0.8775 -0.0185 -0.0169 0.0593  143 SER A CB    
558  O  OG    . SER A 111 ? 0.9592 1.0072 0.8986 -0.0176 -0.0136 0.0598  143 SER A OG    
559  N  N     . VAL A 112 ? 0.7978 0.8352 0.7636 -0.0281 -0.0170 0.0460  144 VAL A N     
560  C  CA    . VAL A 112 ? 0.5571 0.5995 0.5283 -0.0319 -0.0191 0.0412  144 VAL A CA    
561  C  C     . VAL A 112 ? 0.5673 0.6085 0.5335 -0.0375 -0.0195 0.0326  144 VAL A C     
562  O  O     . VAL A 112 ? 0.4897 0.5361 0.4609 -0.0419 -0.0211 0.0280  144 VAL A O     
563  C  CB    . VAL A 112 ? 0.5686 0.6048 0.5485 -0.0324 -0.0165 0.0415  144 VAL A CB    
564  C  CG1   . VAL A 112 ? 0.6349 0.6599 0.6113 -0.0352 -0.0126 0.0381  144 VAL A CG1   
565  C  CG2   . VAL A 112 ? 0.6168 0.6623 0.6050 -0.0344 -0.0187 0.0395  144 VAL A CG2   
566  N  N     . HIS A 113 ? 0.5239 0.5583 0.4814 -0.0377 -0.0176 0.0299  145 HIS A N     
567  C  CA    . HIS A 113 ? 0.6230 0.6543 0.5773 -0.0430 -0.0172 0.0206  145 HIS A CA    
568  C  C     . HIS A 113 ? 0.5558 0.6031 0.5086 -0.0453 -0.0222 0.0147  145 HIS A C     
569  O  O     . HIS A 113 ? 0.5742 0.6227 0.5305 -0.0517 -0.0228 0.0060  145 HIS A O     
570  C  CB    . HIS A 113 ? 0.6473 0.6678 0.5934 -0.0415 -0.0137 0.0186  145 HIS A CB    
571  C  CG    . HIS A 113 ? 0.7961 0.8222 0.7351 -0.0359 -0.0141 0.0237  145 HIS A CG    
572  N  ND1   . HIS A 113 ? 0.8617 0.8850 0.8026 -0.0316 -0.0123 0.0324  145 HIS A ND1   
573  C  CD2   . HIS A 113 ? 0.8785 0.9137 0.8090 -0.0342 -0.0158 0.0212  145 HIS A CD2   
574  C  CE1   . HIS A 113 ? 0.8788 0.9081 0.8134 -0.0278 -0.0123 0.0363  145 HIS A CE1   
575  N  NE2   . HIS A 113 ? 0.8750 0.9123 0.8023 -0.0288 -0.0145 0.0300  145 HIS A NE2   
576  N  N     . GLU A 114 ? 0.5800 0.6411 0.5284 -0.0403 -0.0256 0.0196  146 GLU A N     
577  C  CA    . GLU A 114 ? 0.6284 0.7097 0.5752 -0.0414 -0.0310 0.0146  146 GLU A CA    
578  C  C     . GLU A 114 ? 0.6055 0.6968 0.5631 -0.0440 -0.0341 0.0142  146 GLU A C     
579  O  O     . GLU A 114 ? 0.5297 0.6324 0.4901 -0.0496 -0.0372 0.0047  146 GLU A O     
580  C  CB    . GLU A 114 ? 0.7694 0.8646 0.7088 -0.0339 -0.0333 0.0228  146 GLU A CB    
581  C  CG    . GLU A 114 ? 0.9393 1.0342 0.8668 -0.0324 -0.0317 0.0196  146 GLU A CG    
582  C  CD    . GLU A 114 ? 1.0571 1.1599 0.9803 -0.0380 -0.0339 0.0042  146 GLU A CD    
583  O  OE1   . GLU A 114 ? 1.0749 1.1620 0.9974 -0.0422 -0.0302 -0.0044 146 GLU A OE1   
584  O  OE2   . GLU A 114 ? 1.1063 1.2317 1.0276 -0.0379 -0.0392 0.0004  146 GLU A OE2   
585  N  N     . ASP A 115 ? 0.5925 0.6807 0.5572 -0.0402 -0.0331 0.0235  147 ASP A N     
586  C  CA    . ASP A 115 ? 0.5559 0.6534 0.5315 -0.0420 -0.0353 0.0232  147 ASP A CA    
587  C  C     . ASP A 115 ? 0.4576 0.5473 0.4390 -0.0508 -0.0329 0.0144  147 ASP A C     
588  O  O     . ASP A 115 ? 0.5027 0.6048 0.4915 -0.0556 -0.0354 0.0090  147 ASP A O     
589  C  CB    . ASP A 115 ? 0.6703 0.7632 0.6528 -0.0360 -0.0336 0.0333  147 ASP A CB    
590  C  CG    . ASP A 115 ? 0.8217 0.9246 0.8027 -0.0274 -0.0358 0.0432  147 ASP A CG    
591  O  OD1   . ASP A 115 ? 0.8183 0.9358 0.7924 -0.0256 -0.0395 0.0430  147 ASP A OD1   
592  O  OD2   . ASP A 115 ? 0.8539 0.9505 0.8412 -0.0222 -0.0336 0.0512  147 ASP A OD2   
593  N  N     . LYS A 116 ? 0.4989 0.5689 0.4778 -0.0529 -0.0276 0.0136  148 LYS A N     
594  C  CA    . LYS A 116 ? 0.4741 0.5351 0.4586 -0.0607 -0.0241 0.0074  148 LYS A CA    
595  C  C     . LYS A 116 ? 0.5033 0.5684 0.4869 -0.0677 -0.0256 -0.0043 148 LYS A C     
596  O  O     . LYS A 116 ? 0.4836 0.5506 0.4760 -0.0755 -0.0247 -0.0107 148 LYS A O     
597  C  CB    . LYS A 116 ? 0.4498 0.4904 0.4313 -0.0595 -0.0180 0.0108  148 LYS A CB    
598  C  CG    . LYS A 116 ? 0.5082 0.5384 0.4958 -0.0663 -0.0133 0.0075  148 LYS A CG    
599  C  CD    . LYS A 116 ? 0.5617 0.5747 0.5458 -0.0634 -0.0075 0.0125  148 LYS A CD    
600  C  CE    . LYS A 116 ? 0.6987 0.7032 0.6900 -0.0685 -0.0020 0.0131  148 LYS A CE    
601  N  NZ    . LYS A 116 ? 0.6691 0.6641 0.6623 -0.0753 0.0006  0.0053  148 LYS A NZ    
602  N  N     . LYS A 117 ? 0.5253 0.5926 0.4990 -0.0654 -0.0273 -0.0079 149 LYS A N     
603  C  CA    . LYS A 117 ? 0.5886 0.6629 0.5615 -0.0718 -0.0292 -0.0214 149 LYS A CA    
604  C  C     . LYS A 117 ? 0.5344 0.6335 0.5143 -0.0753 -0.0352 -0.0266 149 LYS A C     
605  O  O     . LYS A 117 ? 0.5591 0.6625 0.5463 -0.0844 -0.0355 -0.0385 149 LYS A O     
606  C  CB    . LYS A 117 ? 0.6928 0.7696 0.6529 -0.0671 -0.0304 -0.0239 149 LYS A CB    
607  C  CG    . LYS A 117 ? 0.7476 0.8352 0.7060 -0.0729 -0.0329 -0.0399 149 LYS A CG    
608  C  CD    . LYS A 117 ? 0.8701 0.9435 0.8198 -0.0717 -0.0289 -0.0457 149 LYS A CD    
609  C  CE    . LYS A 117 ? 0.9727 1.0669 0.9131 -0.0703 -0.0334 -0.0556 149 LYS A CE    
610  N  NZ    . LYS A 117 ? 1.0082 1.0904 0.9392 -0.0673 -0.0294 -0.0600 149 LYS A NZ    
611  N  N     . PHE A 118 ? 0.5365 0.6522 0.5154 -0.0682 -0.0397 -0.0177 150 PHE A N     
612  C  CA    . PHE A 118 ? 0.4779 0.6197 0.4638 -0.0699 -0.0456 -0.0211 150 PHE A CA    
613  C  C     . PHE A 118 ? 0.4375 0.5775 0.4378 -0.0765 -0.0436 -0.0224 150 PHE A C     
614  O  O     . PHE A 118 ? 0.4053 0.5597 0.4143 -0.0845 -0.0459 -0.0326 150 PHE A O     
615  C  CB    . PHE A 118 ? 0.4520 0.6101 0.4344 -0.0590 -0.0499 -0.0089 150 PHE A CB    
616  C  CG    . PHE A 118 ? 0.4853 0.6726 0.4748 -0.0585 -0.0563 -0.0107 150 PHE A CG    
617  C  CD1   . PHE A 118 ? 0.3986 0.5902 0.4001 -0.0578 -0.0563 -0.0056 150 PHE A CD1   
618  C  CD2   . PHE A 118 ? 0.5602 0.7734 0.5444 -0.0581 -0.0624 -0.0177 150 PHE A CD2   
619  C  CE1   . PHE A 118 ? 0.4651 0.6854 0.4740 -0.0566 -0.0622 -0.0069 150 PHE A CE1   
620  C  CE2   . PHE A 118 ? 0.5782 0.8217 0.5692 -0.0570 -0.0686 -0.0191 150 PHE A CE2   
621  C  CZ    . PHE A 118 ? 0.5578 0.8045 0.5615 -0.0561 -0.0685 -0.0134 150 PHE A CZ    
622  N  N     . LEU A 119 ? 0.3875 0.5116 0.3909 -0.0736 -0.0390 -0.0127 151 LEU A N     
623  C  CA    . LEU A 119 ? 0.4177 0.5436 0.4340 -0.0780 -0.0369 -0.0118 151 LEU A CA    
624  C  C     . LEU A 119 ? 0.2774 0.3908 0.3004 -0.0893 -0.0318 -0.0201 151 LEU A C     
625  O  O     . LEU A 119 ? 0.3655 0.4882 0.4006 -0.0963 -0.0313 -0.0239 151 LEU A O     
626  C  CB    . LEU A 119 ? 0.4033 0.5182 0.4202 -0.0709 -0.0335 -0.0000 151 LEU A CB    
627  C  CG    . LEU A 119 ? 0.3666 0.4925 0.3821 -0.0603 -0.0374 0.0089  151 LEU A CG    
628  C  CD1   . LEU A 119 ? 0.3395 0.4502 0.3552 -0.0545 -0.0330 0.0176  151 LEU A CD1   
629  C  CD2   . LEU A 119 ? 0.3630 0.5132 0.3887 -0.0598 -0.0420 0.0082  151 LEU A CD2   
630  N  N     . ASP A 120 ? 0.3599 0.4522 0.3762 -0.0910 -0.0273 -0.0225 152 ASP A N     
631  C  CA    . ASP A 120 ? 0.4141 0.4923 0.4378 -0.1011 -0.0215 -0.0297 152 ASP A CA    
632  C  C     . ASP A 120 ? 0.4256 0.5194 0.4577 -0.1111 -0.0247 -0.0442 152 ASP A C     
633  O  O     . ASP A 120 ? 0.4331 0.5223 0.4777 -0.1212 -0.0204 -0.0496 152 ASP A O     
634  C  CB    . ASP A 120 ? 0.4280 0.4824 0.4428 -0.0994 -0.0167 -0.0301 152 ASP A CB    
635  C  CG    . ASP A 120 ? 0.5350 0.5727 0.5456 -0.0925 -0.0117 -0.0173 152 ASP A CG    
636  O  OD1   . ASP A 120 ? 0.5832 0.6258 0.5989 -0.0908 -0.0109 -0.0095 152 ASP A OD1   
637  O  OD2   . ASP A 120 ? 0.5693 0.5909 0.5716 -0.0887 -0.0086 -0.0158 152 ASP A OD2   
638  N  N     . LYS A 121 ? 0.4424 0.5559 0.4684 -0.1084 -0.0319 -0.0505 153 LYS A N     
639  C  CA    . LYS A 121 ? 0.4465 0.5796 0.4798 -0.1175 -0.0361 -0.0663 153 LYS A CA    
640  C  C     . LYS A 121 ? 0.3531 0.5150 0.3965 -0.1188 -0.0415 -0.0660 153 LYS A C     
641  O  O     . LYS A 121 ? 0.4802 0.6532 0.5372 -0.1298 -0.0416 -0.0771 153 LYS A O     
642  C  CB    . LYS A 121 ? 0.3953 0.5394 0.4161 -0.1137 -0.0412 -0.0744 153 LYS A CB    
643  C  CG    . LYS A 121 ? 0.4772 0.6462 0.5045 -0.1225 -0.0464 -0.0928 153 LYS A CG    
644  C  CD    . LYS A 121 ? 0.6294 0.8067 0.6433 -0.1191 -0.0500 -0.1023 153 LYS A CD    
645  C  CE    . LYS A 121 ? 0.6989 0.9097 0.7177 -0.1258 -0.0571 -0.1202 153 LYS A CE    
646  N  NZ    . LYS A 121 ? 0.7064 0.9138 0.7444 -0.1414 -0.0538 -0.1351 153 LYS A NZ    
647  N  N     . TYR A 122 ? 0.3998 0.5741 0.4382 -0.1077 -0.0456 -0.0538 154 TYR A N     
648  C  CA    . TYR A 122 ? 0.4148 0.6191 0.4622 -0.1067 -0.0514 -0.0533 154 TYR A CA    
649  C  C     . TYR A 122 ? 0.3687 0.5703 0.4260 -0.1052 -0.0480 -0.0432 154 TYR A C     
650  O  O     . TYR A 122 ? 0.3552 0.5807 0.4236 -0.1070 -0.0514 -0.0450 154 TYR A O     
651  C  CB    . TYR A 122 ? 0.5169 0.7425 0.5538 -0.0946 -0.0589 -0.0474 154 TYR A CB    
652  C  CG    . TYR A 122 ? 0.5672 0.8069 0.5957 -0.0964 -0.0636 -0.0593 154 TYR A CG    
653  C  CD1   . TYR A 122 ? 0.5775 0.8446 0.6141 -0.1048 -0.0687 -0.0746 154 TYR A CD1   
654  C  CD2   . TYR A 122 ? 0.5853 0.8127 0.5983 -0.0902 -0.0628 -0.0565 154 TYR A CD2   
655  C  CE1   . TYR A 122 ? 0.6357 0.9183 0.6645 -0.1065 -0.0731 -0.0875 154 TYR A CE1   
656  C  CE2   . TYR A 122 ? 0.5833 0.8255 0.5880 -0.0916 -0.0668 -0.0682 154 TYR A CE2   
657  C  CZ    . TYR A 122 ? 0.6633 0.9334 0.6757 -0.0996 -0.0721 -0.0841 154 TYR A CZ    
658  O  OH    . TYR A 122 ? 0.7283 1.0159 0.7322 -0.1008 -0.0763 -0.0976 154 TYR A OH    
659  N  N     . MET A 123 ? 0.3941 0.5701 0.4479 -0.1017 -0.0416 -0.0333 155 MET A N     
660  C  CA    . MET A 123 ? 0.4265 0.5998 0.4894 -0.1010 -0.0374 -0.0254 155 MET A CA    
661  C  C     . MET A 123 ? 0.3545 0.5010 0.4186 -0.1070 -0.0285 -0.0238 155 MET A C     
662  O  O     . MET A 123 ? 0.3202 0.4515 0.3794 -0.1007 -0.0244 -0.0141 155 MET A O     
663  C  CB    . MET A 123 ? 0.2848 0.4592 0.3424 -0.0876 -0.0391 -0.0131 155 MET A CB    
664  C  CG    . MET A 123 ? 0.3781 0.5800 0.4378 -0.0803 -0.0467 -0.0115 155 MET A CG    
665  S  SD    . MET A 123 ? 0.4324 0.6343 0.4931 -0.0660 -0.0466 0.0025  155 MET A SD    
666  C  CE    . MET A 123 ? 0.4046 0.6407 0.4692 -0.0584 -0.0553 0.0038  155 MET A CE    
667  N  N     . PRO A 124 ? 0.3607 0.5018 0.4323 -0.1191 -0.0251 -0.0332 156 PRO A N     
668  C  CA    . PRO A 124 ? 0.3771 0.4909 0.4492 -0.1236 -0.0160 -0.0300 156 PRO A CA    
669  C  C     . PRO A 124 ? 0.3569 0.4686 0.4367 -0.1237 -0.0100 -0.0204 156 PRO A C     
670  O  O     . PRO A 124 ? 0.3898 0.4815 0.4649 -0.1209 -0.0036 -0.0122 156 PRO A O     
671  C  CB    . PRO A 124 ? 0.4237 0.5346 0.5050 -0.1369 -0.0139 -0.0436 156 PRO A CB    
672  C  CG    . PRO A 124 ? 0.4406 0.5823 0.5323 -0.1420 -0.0204 -0.0525 156 PRO A CG    
673  C  CD    . PRO A 124 ? 0.3862 0.5464 0.4678 -0.1294 -0.0287 -0.0471 156 PRO A CD    
674  N  N     . GLN A 125 ? 0.3095 0.4435 0.4009 -0.1264 -0.0118 -0.0210 157 GLN A N     
675  C  CA    . GLN A 125 ? 0.3410 0.4760 0.4394 -0.1260 -0.0059 -0.0122 157 GLN A CA    
676  C  C     . GLN A 125 ? 0.3755 0.5073 0.4637 -0.1127 -0.0067 -0.0021 157 GLN A C     
677  O  O     . GLN A 125 ? 0.3396 0.4622 0.4269 -0.1104 -0.0004 0.0059  157 GLN A O     
678  C  CB    . GLN A 125 ? 0.3343 0.4963 0.4482 -0.1317 -0.0078 -0.0162 157 GLN A CB    
679  C  CG    . GLN A 125 ? 0.4895 0.6585 0.6160 -0.1461 -0.0077 -0.0284 157 GLN A CG    
680  C  CD    . GLN A 125 ? 0.6102 0.7520 0.7384 -0.1551 0.0008  -0.0296 157 GLN A CD    
681  O  OE1   . GLN A 125 ? 0.6221 0.7557 0.7492 -0.1608 -0.0006 -0.0398 157 GLN A OE1   
682  N  NE2   . GLN A 125 ? 0.5855 0.7142 0.7167 -0.1560 0.0099  -0.0191 157 GLN A NE2   
683  N  N     . PHE A 126 ? 0.3075 0.4476 0.3886 -0.1038 -0.0140 -0.0023 158 PHE A N     
684  C  CA    . PHE A 126 ? 0.3401 0.4745 0.4128 -0.0919 -0.0143 0.0058  158 PHE A CA    
685  C  C     . PHE A 126 ? 0.3385 0.4481 0.3998 -0.0898 -0.0100 0.0097  158 PHE A C     
686  O  O     . PHE A 126 ? 0.3330 0.4354 0.3912 -0.0845 -0.0061 0.0163  158 PHE A O     
687  C  CB    . PHE A 126 ? 0.3429 0.4892 0.4116 -0.0835 -0.0221 0.0055  158 PHE A CB    
688  C  CG    . PHE A 126 ? 0.3969 0.5338 0.4577 -0.0724 -0.0221 0.0128  158 PHE A CG    
689  C  CD1   . PHE A 126 ? 0.3935 0.5341 0.4594 -0.0668 -0.0197 0.0173  158 PHE A CD1   
690  C  CD2   . PHE A 126 ? 0.4914 0.6168 0.5407 -0.0679 -0.0242 0.0142  158 PHE A CD2   
691  C  CE1   . PHE A 126 ? 0.3900 0.5220 0.4507 -0.0576 -0.0195 0.0220  158 PHE A CE1   
692  C  CE2   . PHE A 126 ? 0.4927 0.6096 0.5369 -0.0588 -0.0237 0.0203  158 PHE A CE2   
693  C  CZ    . PHE A 126 ? 0.3610 0.4807 0.4115 -0.0540 -0.0213 0.0237  158 PHE A CZ    
694  N  N     . MET A 127 ? 0.3269 0.4248 0.3822 -0.0936 -0.0105 0.0049  159 MET A N     
695  C  CA    . MET A 127 ? 0.3310 0.4067 0.3758 -0.0907 -0.0067 0.0084  159 MET A CA    
696  C  C     . MET A 127 ? 0.3066 0.3693 0.3550 -0.0952 0.0018  0.0128  159 MET A C     
697  O  O     . MET A 127 ? 0.3314 0.3805 0.3723 -0.0899 0.0056  0.0191  159 MET A O     
698  C  CB    . MET A 127 ? 0.4220 0.4905 0.4601 -0.0929 -0.0093 0.0013  159 MET A CB    
699  C  CG    . MET A 127 ? 0.4163 0.4975 0.4482 -0.0867 -0.0170 -0.0004 159 MET A CG    
700  S  SD    . MET A 127 ? 0.4689 0.5469 0.4934 -0.0741 -0.0177 0.0101  159 MET A SD    
701  C  CE    . MET A 127 ? 0.4882 0.5418 0.5020 -0.0724 -0.0125 0.0124  159 MET A CE    
702  N  N     . LYS A 128 ? 0.3158 0.3834 0.3761 -0.1047 0.0051  0.0101  160 LYS A N     
703  C  CA    . LYS A 128 ? 0.3674 0.4233 0.4322 -0.1088 0.0142  0.0164  160 LYS A CA    
704  C  C     . LYS A 128 ? 0.3860 0.4476 0.4489 -0.1017 0.0173  0.0263  160 LYS A C     
705  O  O     . LYS A 128 ? 0.3626 0.4135 0.4235 -0.1006 0.0244  0.0342  160 LYS A O     
706  C  CB    . LYS A 128 ? 0.3778 0.4398 0.4581 -0.1213 0.0175  0.0116  160 LYS A CB    
707  C  CG    . LYS A 128 ? 0.4819 0.5282 0.5682 -0.1268 0.0281  0.0187  160 LYS A CG    
708  C  CD    . LYS A 128 ? 0.6389 0.6920 0.7430 -0.1404 0.0321  0.0139  160 LYS A CD    
709  C  CE    . LYS A 128 ? 0.7639 0.8035 0.8733 -0.1498 0.0324  0.0023  160 LYS A CE    
710  N  NZ    . LYS A 128 ? 0.8381 0.8676 0.9640 -0.1622 0.0424  0.0034  160 LYS A NZ    
711  N  N     . HIS A 129 ? 0.3361 0.4153 0.3997 -0.0961 0.0123  0.0258  161 HIS A N     
712  C  CA    . HIS A 129 ? 0.3318 0.4180 0.3937 -0.0888 0.0147  0.0325  161 HIS A CA    
713  C  C     . HIS A 129 ? 0.3641 0.4385 0.4134 -0.0799 0.0144  0.0361  161 HIS A C     
714  O  O     . HIS A 129 ? 0.3341 0.4117 0.3808 -0.0746 0.0178  0.0413  161 HIS A O     
715  C  CB    . HIS A 129 ? 0.3239 0.4313 0.3922 -0.0853 0.0098  0.0296  161 HIS A CB    
716  C  CG    . HIS A 129 ? 0.3671 0.4836 0.4352 -0.0781 0.0123  0.0339  161 HIS A CG    
717  N  ND1   . HIS A 129 ? 0.3864 0.5134 0.4610 -0.0808 0.0185  0.0379  161 HIS A ND1   
718  C  CD2   . HIS A 129 ? 0.4010 0.5188 0.4640 -0.0687 0.0099  0.0339  161 HIS A CD2   
719  C  CE1   . HIS A 129 ? 0.4242 0.5599 0.4966 -0.0728 0.0193  0.0394  161 HIS A CE1   
720  N  NE2   . HIS A 129 ? 0.3941 0.5237 0.4601 -0.0657 0.0142  0.0364  161 HIS A NE2   
721  N  N     . LEU A 130 ? 0.3088 0.3719 0.3506 -0.0782 0.0105  0.0328  162 LEU A N     
722  C  CA    . LEU A 130 ? 0.3547 0.4090 0.3860 -0.0701 0.0095  0.0352  162 LEU A CA    
723  C  C     . LEU A 130 ? 0.4047 0.4412 0.4293 -0.0706 0.0144  0.0388  162 LEU A C     
724  O  O     . LEU A 130 ? 0.3323 0.3599 0.3602 -0.0774 0.0179  0.0381  162 LEU A O     
725  C  CB    . LEU A 130 ? 0.3136 0.3685 0.3409 -0.0669 0.0027  0.0307  162 LEU A CB    
726  C  CG    . LEU A 130 ? 0.4986 0.5668 0.5294 -0.0612 -0.0020 0.0299  162 LEU A CG    
727  C  CD1   . LEU A 130 ? 0.4528 0.5373 0.4944 -0.0630 -0.0013 0.0294  162 LEU A CD1   
728  C  CD2   . LEU A 130 ? 0.4362 0.5067 0.4650 -0.0605 -0.0080 0.0267  162 LEU A CD2   
729  N  N     . HIS A 131 ? 0.3494 0.3810 0.3657 -0.0633 0.0150  0.0422  163 HIS A N     
730  C  CA    . HIS A 131 ? 0.4535 0.4694 0.4629 -0.0616 0.0188  0.0457  163 HIS A CA    
731  C  C     . HIS A 131 ? 0.4147 0.4197 0.4205 -0.0639 0.0157  0.0397  163 HIS A C     
732  O  O     . HIS A 131 ? 0.3700 0.3813 0.3762 -0.0649 0.0100  0.0340  163 HIS A O     
733  C  CB    . HIS A 131 ? 0.4998 0.5176 0.5020 -0.0531 0.0191  0.0494  163 HIS A CB    
734  C  CG    . HIS A 131 ? 0.5396 0.5472 0.5365 -0.0500 0.0247  0.0560  163 HIS A CG    
735  N  ND1   . HIS A 131 ? 0.4861 0.4804 0.4765 -0.0475 0.0247  0.0554  163 HIS A ND1   
736  C  CD2   . HIS A 131 ? 0.5829 0.5930 0.5801 -0.0480 0.0308  0.0643  163 HIS A CD2   
737  C  CE1   . HIS A 131 ? 0.5346 0.5230 0.5222 -0.0437 0.0304  0.0629  163 HIS A CE1   
738  N  NE2   . HIS A 131 ? 0.5686 0.5664 0.5599 -0.0438 0.0341  0.0690  163 HIS A NE2   
739  N  N     . TYR A 132 ? 0.3718 0.3611 0.3739 -0.0641 0.0199  0.0413  164 TYR A N     
740  C  CA    . TYR A 132 ? 0.4201 0.3999 0.4181 -0.0654 0.0175  0.0346  164 TYR A CA    
741  C  C     . TYR A 132 ? 0.4090 0.3883 0.3973 -0.0579 0.0144  0.0349  164 TYR A C     
742  O  O     . TYR A 132 ? 0.4238 0.4016 0.4080 -0.0581 0.0108  0.0292  164 TYR A O     
743  C  CB    . TYR A 132 ? 0.4717 0.4338 0.4715 -0.0689 0.0237  0.0347  164 TYR A CB    
744  C  CG    . TYR A 132 ? 0.4736 0.4251 0.4685 -0.0619 0.0295  0.0435  164 TYR A CG    
745  C  CD1   . TYR A 132 ? 0.5324 0.4767 0.5188 -0.0556 0.0288  0.0428  164 TYR A CD1   
746  C  CD2   . TYR A 132 ? 0.4381 0.3890 0.4372 -0.0612 0.0358  0.0532  164 TYR A CD2   
747  C  CE1   . TYR A 132 ? 0.5452 0.4823 0.5276 -0.0484 0.0337  0.0510  164 TYR A CE1   
748  C  CE2   . TYR A 132 ? 0.5088 0.4528 0.5031 -0.0537 0.0409  0.0623  164 TYR A CE2   
749  C  CZ    . TYR A 132 ? 0.5695 0.5069 0.5557 -0.0472 0.0396  0.0609  164 TYR A CZ    
750  O  OH    . TYR A 132 ? 0.5227 0.4557 0.5046 -0.0388 0.0444  0.0701  164 TYR A OH    
751  N  N     . ARG A 133 ? 0.3248 0.3072 0.3099 -0.0514 0.0158  0.0410  165 ARG A N     
752  C  CA    . ARG A 133 ? 0.3458 0.3297 0.3242 -0.0452 0.0131  0.0409  165 ARG A CA    
753  C  C     . ARG A 133 ? 0.3668 0.3623 0.3473 -0.0449 0.0075  0.0381  165 ARG A C     
754  O  O     . ARG A 133 ? 0.3061 0.3108 0.2931 -0.0474 0.0060  0.0374  165 ARG A O     
755  C  CB    . ARG A 133 ? 0.3843 0.3707 0.3601 -0.0390 0.0162  0.0469  165 ARG A CB    
756  C  CG    . ARG A 133 ? 0.3913 0.3663 0.3635 -0.0362 0.0216  0.0515  165 ARG A CG    
757  C  CD    . ARG A 133 ? 0.3722 0.3551 0.3426 -0.0299 0.0245  0.0583  165 ARG A CD    
758  N  NE    . ARG A 133 ? 0.4004 0.3732 0.3680 -0.0260 0.0302  0.0648  165 ARG A NE    
759  C  CZ    . ARG A 133 ? 0.5068 0.4858 0.4736 -0.0208 0.0344  0.0733  165 ARG A CZ    
760  N  NH1   . ARG A 133 ? 0.4310 0.4274 0.3992 -0.0196 0.0333  0.0747  165 ARG A NH1   
761  N  NH2   . ARG A 133 ? 0.5676 0.5364 0.5325 -0.0162 0.0399  0.0805  165 ARG A NH2   
762  N  N     . ILE A 134 ? 0.3330 0.3280 0.3086 -0.0414 0.0050  0.0370  166 ILE A N     
763  C  CA    . ILE A 134 ? 0.3712 0.3749 0.3491 -0.0400 0.0006  0.0362  166 ILE A CA    
764  C  C     . ILE A 134 ? 0.3985 0.4033 0.3753 -0.0349 0.0012  0.0384  166 ILE A C     
765  O  O     . ILE A 134 ? 0.4285 0.4285 0.4007 -0.0323 0.0038  0.0396  166 ILE A O     
766  C  CB    . ILE A 134 ? 0.3886 0.3928 0.3630 -0.0414 -0.0029 0.0333  166 ILE A CB    
767  C  CG1   . ILE A 134 ? 0.4203 0.4172 0.3863 -0.0388 -0.0017 0.0331  166 ILE A CG1   
768  C  CG2   . ILE A 134 ? 0.3781 0.3830 0.3548 -0.0474 -0.0037 0.0288  166 ILE A CG2   
769  C  CD1   . ILE A 134 ? 0.4914 0.4915 0.4525 -0.0395 -0.0049 0.0301  166 ILE A CD1   
770  N  N     . ILE A 135 ? 0.2865 0.2983 0.2690 -0.0333 -0.0010 0.0386  167 ILE A N     
771  C  CA    . ILE A 135 ? 0.2811 0.2936 0.2650 -0.0297 -0.0005 0.0394  167 ILE A CA    
772  C  C     . ILE A 135 ? 0.3604 0.3720 0.3432 -0.0288 -0.0028 0.0412  167 ILE A C     
773  O  O     . ILE A 135 ? 0.3572 0.3731 0.3462 -0.0280 -0.0048 0.0425  167 ILE A O     
774  C  CB    . ILE A 135 ? 0.3182 0.3379 0.3110 -0.0283 -0.0000 0.0377  167 ILE A CB    
775  C  CG1   . ILE A 135 ? 0.3535 0.3771 0.3453 -0.0283 0.0026  0.0369  167 ILE A CG1   
776  C  CG2   . ILE A 135 ? 0.3313 0.3512 0.3282 -0.0259 0.0007  0.0369  167 ILE A CG2   
777  C  CD1   . ILE A 135 ? 0.4424 0.4760 0.4417 -0.0264 0.0034  0.0336  167 ILE A CD1   
778  N  N     . ASP A 136 ? 0.3160 0.3229 0.2911 -0.0283 -0.0021 0.0420  168 ASP A N     
779  C  CA    . ASP A 136 ? 0.3153 0.3233 0.2873 -0.0272 -0.0038 0.0446  168 ASP A CA    
780  C  C     . ASP A 136 ? 0.3223 0.3301 0.2986 -0.0247 -0.0019 0.0478  168 ASP A C     
781  O  O     . ASP A 136 ? 0.3412 0.3465 0.3149 -0.0240 0.0007  0.0472  168 ASP A O     
782  C  CB    . ASP A 136 ? 0.3812 0.3859 0.3430 -0.0279 -0.0035 0.0427  168 ASP A CB    
783  C  CG    . ASP A 136 ? 0.5567 0.5657 0.5136 -0.0261 -0.0049 0.0456  168 ASP A CG    
784  O  OD1   . ASP A 136 ? 0.5932 0.6083 0.5544 -0.0248 -0.0069 0.0497  168 ASP A OD1   
785  O  OD2   . ASP A 136 ? 0.5469 0.5540 0.4958 -0.0253 -0.0036 0.0442  168 ASP A OD2   
786  N  N     . VAL A 137 ? 0.3076 0.3181 0.2920 -0.0234 -0.0027 0.0511  169 VAL A N     
787  C  CA    . VAL A 137 ? 0.3369 0.3456 0.3282 -0.0219 -0.0001 0.0542  169 VAL A CA    
788  C  C     . VAL A 137 ? 0.3365 0.3446 0.3206 -0.0211 0.0013  0.0585  169 VAL A C     
789  O  O     . VAL A 137 ? 0.2847 0.2912 0.2726 -0.0211 0.0045  0.0596  169 VAL A O     
790  C  CB    . VAL A 137 ? 0.3586 0.3682 0.3611 -0.0201 -0.0005 0.0579  169 VAL A CB    
791  C  CG1   . VAL A 137 ? 0.3050 0.3105 0.3176 -0.0194 0.0033  0.0608  169 VAL A CG1   
792  C  CG2   . VAL A 137 ? 0.3196 0.3317 0.3292 -0.0206 -0.0017 0.0526  169 VAL A CG2   
793  N  N     . SER A 138 ? 0.3479 0.3591 0.3220 -0.0205 -0.0008 0.0600  170 SER A N     
794  C  CA    . SER A 138 ? 0.4049 0.4179 0.3710 -0.0192 0.0007  0.0635  170 SER A CA    
795  C  C     . SER A 138 ? 0.3247 0.3344 0.2859 -0.0199 0.0033  0.0591  170 SER A C     
796  O  O     . SER A 138 ? 0.3610 0.3723 0.3200 -0.0188 0.0060  0.0620  170 SER A O     
797  C  CB    . SER A 138 ? 0.4505 0.4704 0.4067 -0.0185 -0.0026 0.0637  170 SER A CB    
798  O  OG    . SER A 138 ? 0.6728 0.6992 0.6331 -0.0162 -0.0048 0.0702  170 SER A OG    
799  N  N     . THR A 139 ? 0.2889 0.2951 0.2489 -0.0211 0.0029  0.0531  171 THR A N     
800  C  CA    . THR A 139 ? 0.3733 0.3771 0.3298 -0.0203 0.0055  0.0501  171 THR A CA    
801  C  C     . THR A 139 ? 0.3756 0.3816 0.3405 -0.0201 0.0082  0.0512  171 THR A C     
802  O  O     . THR A 139 ? 0.3281 0.3363 0.2912 -0.0190 0.0108  0.0519  171 THR A O     
803  C  CB    . THR A 139 ? 0.3520 0.3518 0.3070 -0.0210 0.0052  0.0457  171 THR A CB    
804  O  OG1   . THR A 139 ? 0.3419 0.3384 0.2893 -0.0219 0.0040  0.0431  171 THR A OG1   
805  C  CG2   . THR A 139 ? 0.3364 0.3358 0.2905 -0.0187 0.0081  0.0444  171 THR A CG2   
806  N  N     . VAL A 140 ? 0.3135 0.3203 0.2888 -0.0214 0.0078  0.0503  172 VAL A N     
807  C  CA    . VAL A 140 ? 0.2866 0.2963 0.2722 -0.0223 0.0103  0.0491  172 VAL A CA    
808  C  C     . VAL A 140 ? 0.2584 0.2679 0.2482 -0.0228 0.0126  0.0548  172 VAL A C     
809  O  O     . VAL A 140 ? 0.3452 0.3577 0.3408 -0.0239 0.0157  0.0543  172 VAL A O     
810  C  CB    . VAL A 140 ? 0.2872 0.2980 0.2836 -0.0235 0.0094  0.0453  172 VAL A CB    
811  C  CG1   . VAL A 140 ? 0.3172 0.3327 0.3250 -0.0250 0.0120  0.0408  172 VAL A CG1   
812  C  CG2   . VAL A 140 ? 0.2859 0.2981 0.2772 -0.0228 0.0075  0.0416  172 VAL A CG2   
813  N  N     . LYS A 141 ? 0.2622 0.2699 0.2496 -0.0219 0.0115  0.0609  173 LYS A N     
814  C  CA    . LYS A 141 ? 0.3376 0.3460 0.3280 -0.0215 0.0144  0.0690  173 LYS A CA    
815  C  C     . LYS A 141 ? 0.3798 0.3924 0.3611 -0.0207 0.0166  0.0702  173 LYS A C     
816  O  O     . LYS A 141 ? 0.3712 0.3859 0.3585 -0.0218 0.0207  0.0737  173 LYS A O     
817  C  CB    . LYS A 141 ? 0.3677 0.3767 0.3554 -0.0192 0.0122  0.0761  173 LYS A CB    
818  C  CG    . LYS A 141 ? 0.4778 0.4894 0.4664 -0.0175 0.0154  0.0870  173 LYS A CG    
819  C  CD    . LYS A 141 ? 0.6453 0.6624 0.6268 -0.0138 0.0123  0.0939  173 LYS A CD    
820  C  CE    . LYS A 141 ? 0.6804 0.7020 0.6624 -0.0111 0.0160  0.1070  173 LYS A CE    
821  N  NZ    . LYS A 141 ? 0.6641 0.6780 0.6638 -0.0111 0.0203  0.1145  173 LYS A NZ    
822  N  N     . GLU A 142 ? 0.3603 0.3743 0.3283 -0.0190 0.0144  0.0668  174 GLU A N     
823  C  CA    . GLU A 142 ? 0.4177 0.4359 0.3771 -0.0174 0.0166  0.0665  174 GLU A CA    
824  C  C     . GLU A 142 ? 0.4250 0.4449 0.3898 -0.0180 0.0193  0.0624  174 GLU A C     
825  O  O     . GLU A 142 ? 0.4613 0.4868 0.4269 -0.0177 0.0229  0.0646  174 GLU A O     
826  C  CB    . GLU A 142 ? 0.3892 0.4065 0.3353 -0.0155 0.0140  0.0617  174 GLU A CB    
827  C  CG    . GLU A 142 ? 0.5877 0.6094 0.5258 -0.0143 0.0119  0.0649  174 GLU A CG    
828  C  CD    . GLU A 142 ? 0.6286 0.6587 0.5637 -0.0125 0.0151  0.0720  174 GLU A CD    
829  O  OE1   . GLU A 142 ? 0.7459 0.7808 0.6823 -0.0117 0.0148  0.0801  174 GLU A OE1   
830  O  OE2   . GLU A 142 ? 0.6877 0.7206 0.6194 -0.0113 0.0183  0.0704  174 GLU A OE2   
831  N  N     . LEU A 143 ? 0.3381 0.3559 0.3068 -0.0186 0.0178  0.0567  175 LEU A N     
832  C  CA    . LEU A 143 ? 0.3534 0.3768 0.3274 -0.0185 0.0197  0.0525  175 LEU A CA    
833  C  C     . LEU A 143 ? 0.3857 0.4134 0.3738 -0.0221 0.0227  0.0536  175 LEU A C     
834  O  O     . LEU A 143 ? 0.4026 0.4381 0.3946 -0.0226 0.0255  0.0520  175 LEU A O     
835  C  CB    . LEU A 143 ? 0.3404 0.3633 0.3152 -0.0178 0.0175  0.0471  175 LEU A CB    
836  C  CG    . LEU A 143 ? 0.4004 0.4182 0.3636 -0.0146 0.0160  0.0461  175 LEU A CG    
837  C  CD1   . LEU A 143 ? 0.3787 0.3979 0.3439 -0.0136 0.0149  0.0430  175 LEU A CD1   
838  C  CD2   . LEU A 143 ? 0.3865 0.4060 0.3417 -0.0108 0.0182  0.0463  175 LEU A CD2   
839  N  N     . CYS A 144 ? 0.3266 0.3495 0.3239 -0.0248 0.0226  0.0561  176 CYS A N     
840  C  CA    . CYS A 144 ? 0.3643 0.3883 0.3774 -0.0288 0.0264  0.0572  176 CYS A CA    
841  C  C     . CYS A 144 ? 0.3390 0.3650 0.3513 -0.0292 0.0306  0.0656  176 CYS A C     
842  O  O     . CYS A 144 ? 0.3527 0.3837 0.3756 -0.0325 0.0349  0.0653  176 CYS A O     
843  C  CB    . CYS A 144 ? 0.3375 0.3538 0.3612 -0.0305 0.0259  0.0584  176 CYS A CB    
844  S  SG    . CYS A 144 ? 0.3806 0.3942 0.4274 -0.0359 0.0316  0.0589  176 CYS A SG    
845  N  N     . ARG A 145 ? 0.3356 0.3598 0.3358 -0.0260 0.0297  0.0728  177 ARG A N     
846  C  CA    . ARG A 145 ? 0.3810 0.4100 0.3781 -0.0253 0.0338  0.0815  177 ARG A CA    
847  C  C     . ARG A 145 ? 0.4120 0.4501 0.4046 -0.0247 0.0359  0.0776  177 ARG A C     
848  O  O     . ARG A 145 ? 0.4093 0.4536 0.4080 -0.0266 0.0410  0.0821  177 ARG A O     
849  C  CB    . ARG A 145 ? 0.4526 0.4818 0.4354 -0.0212 0.0313  0.0877  177 ARG A CB    
850  C  CG    . ARG A 145 ? 0.5998 0.6359 0.5796 -0.0199 0.0357  0.0987  177 ARG A CG    
851  C  CD    . ARG A 145 ? 0.7494 0.7897 0.7141 -0.0154 0.0325  0.1032  177 ARG A CD    
852  N  NE    . ARG A 145 ? 0.7376 0.7809 0.6875 -0.0130 0.0288  0.0937  177 ARG A NE    
853  C  CZ    . ARG A 145 ? 0.8736 0.9251 0.8140 -0.0109 0.0310  0.0919  177 ARG A CZ    
854  N  NH1   . ARG A 145 ? 0.9215 0.9808 0.8649 -0.0110 0.0366  0.0994  177 ARG A NH1   
855  N  NH2   . ARG A 145 ? 0.8987 0.9502 0.8277 -0.0086 0.0281  0.0825  177 ARG A NH2   
856  N  N     . ARG A 146 ? 0.3274 0.3666 0.3105 -0.0217 0.0327  0.0699  178 ARG A N     
857  C  CA    . ARG A 146 ? 0.3907 0.4388 0.3692 -0.0194 0.0347  0.0666  178 ARG A CA    
858  C  C     . ARG A 146 ? 0.4094 0.4649 0.4014 -0.0224 0.0365  0.0614  178 ARG A C     
859  O  O     . ARG A 146 ? 0.3887 0.4543 0.3854 -0.0234 0.0406  0.0622  178 ARG A O     
860  C  CB    . ARG A 146 ? 0.3909 0.4361 0.3555 -0.0143 0.0313  0.0613  178 ARG A CB    
861  C  CG    . ARG A 146 ? 0.4166 0.4591 0.3675 -0.0114 0.0302  0.0637  178 ARG A CG    
862  C  CD    . ARG A 146 ? 0.5033 0.5401 0.4438 -0.0076 0.0275  0.0571  178 ARG A CD    
863  N  NE    . ARG A 146 ? 0.5943 0.6320 0.5223 -0.0046 0.0276  0.0564  178 ARG A NE    
864  C  CZ    . ARG A 146 ? 0.5528 0.5886 0.4750 -0.0055 0.0249  0.0576  178 ARG A CZ    
865  N  NH1   . ARG A 146 ? 0.5896 0.6214 0.5177 -0.0088 0.0222  0.0608  178 ARG A NH1   
866  N  NH2   . ARG A 146 ? 0.4805 0.5201 0.3914 -0.0029 0.0249  0.0548  178 ARG A NH2   
867  N  N     . TRP A 147 ? 0.3496 0.4028 0.3484 -0.0240 0.0337  0.0553  179 TRP A N     
868  C  CA    . TRP A 147 ? 0.3018 0.3659 0.3115 -0.0260 0.0343  0.0479  179 TRP A CA    
869  C  C     . TRP A 147 ? 0.3352 0.4006 0.3644 -0.0333 0.0371  0.0461  179 TRP A C     
870  O  O     . TRP A 147 ? 0.3231 0.4008 0.3633 -0.0363 0.0389  0.0400  179 TRP A O     
871  C  CB    . TRP A 147 ? 0.3214 0.3859 0.3268 -0.0228 0.0300  0.0415  179 TRP A CB    
872  C  CG    . TRP A 147 ? 0.3855 0.4474 0.3748 -0.0159 0.0282  0.0427  179 TRP A CG    
873  C  CD1   . TRP A 147 ? 0.3588 0.4213 0.3385 -0.0120 0.0301  0.0459  179 TRP A CD1   
874  C  CD2   . TRP A 147 ? 0.2809 0.3384 0.2630 -0.0122 0.0250  0.0405  179 TRP A CD2   
875  N  NE1   . TRP A 147 ? 0.3686 0.4258 0.3367 -0.0062 0.0284  0.0450  179 TRP A NE1   
876  C  CE2   . TRP A 147 ? 0.3750 0.4287 0.3446 -0.0064 0.0254  0.0426  179 TRP A CE2   
877  C  CE3   . TRP A 147 ? 0.2458 0.3029 0.2315 -0.0131 0.0223  0.0371  179 TRP A CE3   
878  C  CZ2   . TRP A 147 ? 0.3656 0.4130 0.3274 -0.0021 0.0238  0.0422  179 TRP A CZ2   
879  C  CZ3   . TRP A 147 ? 0.3309 0.3838 0.3076 -0.0086 0.0205  0.0375  179 TRP A CZ3   
880  C  CH2   . TRP A 147 ? 0.3241 0.3713 0.2895 -0.0034 0.0215  0.0404  179 TRP A CH2   
881  N  N     . TYR A 148 ? 0.3566 0.4101 0.3912 -0.0361 0.0377  0.0508  180 TYR A N     
882  C  CA    . TYR A 148 ? 0.3627 0.4139 0.4179 -0.0428 0.0410  0.0487  180 TYR A CA    
883  C  C     . TYR A 148 ? 0.3663 0.4070 0.4254 -0.0443 0.0451  0.0609  180 TYR A C     
884  O  O     . TYR A 148 ? 0.3617 0.3911 0.4266 -0.0448 0.0448  0.0638  180 TYR A O     
885  C  CB    . TYR A 148 ? 0.3221 0.3694 0.3834 -0.0437 0.0375  0.0402  180 TYR A CB    
886  C  CG    . TYR A 148 ? 0.3272 0.3872 0.3845 -0.0415 0.0337  0.0296  180 TYR A CG    
887  C  CD1   . TYR A 148 ? 0.3191 0.3929 0.3904 -0.0457 0.0348  0.0191  180 TYR A CD1   
888  C  CD2   . TYR A 148 ? 0.3254 0.3848 0.3656 -0.0352 0.0294  0.0304  180 TYR A CD2   
889  C  CE1   . TYR A 148 ? 0.3227 0.4116 0.3895 -0.0426 0.0312  0.0106  180 TYR A CE1   
890  C  CE2   . TYR A 148 ? 0.2748 0.3463 0.3113 -0.0322 0.0267  0.0232  180 TYR A CE2   
891  C  CZ    . TYR A 148 ? 0.3272 0.4145 0.3762 -0.0353 0.0274  0.0137  180 TYR A CZ    
892  O  OH    . TYR A 148 ? 0.3228 0.4254 0.3673 -0.0312 0.0246  0.0076  180 TYR A OH    
893  N  N     . PRO A 149 ? 0.3948 0.4403 0.4511 -0.0444 0.0495  0.0691  181 PRO A N     
894  C  CA    . PRO A 149 ? 0.4093 0.4473 0.4673 -0.0444 0.0537  0.0830  181 PRO A CA    
895  C  C     . PRO A 149 ? 0.3850 0.4144 0.4662 -0.0507 0.0591  0.0856  181 PRO A C     
896  O  O     . PRO A 149 ? 0.5200 0.5383 0.6040 -0.0491 0.0604  0.0954  181 PRO A O     
897  C  CB    . PRO A 149 ? 0.4059 0.4552 0.4566 -0.0433 0.0577  0.0894  181 PRO A CB    
898  C  CG    . PRO A 149 ? 0.4381 0.4996 0.4943 -0.0459 0.0579  0.0782  181 PRO A CG    
899  C  CD    . PRO A 149 ? 0.3462 0.4062 0.3983 -0.0437 0.0512  0.0666  181 PRO A CD    
900  N  N     . GLU A 150 ? 0.4018 0.4365 0.5009 -0.0576 0.0624  0.0766  182 GLU A N     
901  C  CA    . GLU A 150 ? 0.4593 0.4844 0.5836 -0.0646 0.0681  0.0765  182 GLU A CA    
902  C  C     . GLU A 150 ? 0.4033 0.4152 0.5318 -0.0628 0.0646  0.0725  182 GLU A C     
903  O  O     . GLU A 150 ? 0.4579 0.4560 0.5971 -0.0629 0.0686  0.0817  182 GLU A O     
904  C  CB    . GLU A 150 ? 0.4940 0.5301 0.6365 -0.0727 0.0708  0.0629  182 GLU A CB    
905  C  CG    . GLU A 150 ? 0.7053 0.7588 0.8422 -0.0735 0.0728  0.0637  182 GLU A CG    
906  C  CD    . GLU A 150 ? 0.9447 1.0139 1.0971 -0.0803 0.0732  0.0477  182 GLU A CD    
907  O  OE1   . GLU A 150 ? 1.0299 1.1034 1.2022 -0.0885 0.0804  0.0479  182 GLU A OE1   
908  O  OE2   . GLU A 150 ? 1.0192 1.0980 1.1646 -0.0774 0.0666  0.0352  182 GLU A OE2   
909  N  N     . GLU A 151 ? 0.3565 0.3734 0.4772 -0.0605 0.0577  0.0598  183 GLU A N     
910  C  CA    . GLU A 151 ? 0.3711 0.3780 0.4937 -0.0580 0.0541  0.0560  183 GLU A CA    
911  C  C     . GLU A 151 ? 0.4847 0.4833 0.5918 -0.0509 0.0516  0.0694  183 GLU A C     
912  O  O     . GLU A 151 ? 0.4627 0.4504 0.5763 -0.0490 0.0515  0.0724  183 GLU A O     
913  C  CB    . GLU A 151 ? 0.3397 0.3566 0.4553 -0.0567 0.0476  0.0409  183 GLU A CB    
914  C  CG    . GLU A 151 ? 0.4133 0.4416 0.5452 -0.0632 0.0491  0.0253  183 GLU A CG    
915  C  CD    . GLU A 151 ? 0.4711 0.5163 0.5967 -0.0641 0.0491  0.0231  183 GLU A CD    
916  O  OE1   . GLU A 151 ? 0.4329 0.4785 0.5449 -0.0606 0.0498  0.0345  183 GLU A OE1   
917  O  OE2   . GLU A 151 ? 0.4010 0.4611 0.5356 -0.0677 0.0484  0.0095  183 GLU A OE2   
918  N  N     . TYR A 152 ? 0.4089 0.4141 0.4961 -0.0466 0.0496  0.0767  184 TYR A N     
919  C  CA    . TYR A 152 ? 0.3733 0.3747 0.4451 -0.0401 0.0465  0.0872  184 TYR A CA    
920  C  C     . TYR A 152 ? 0.4611 0.4538 0.5422 -0.0392 0.0517  0.1022  184 TYR A C     
921  O  O     . TYR A 152 ? 0.4462 0.4338 0.5233 -0.0343 0.0493  0.1090  184 TYR A O     
922  C  CB    . TYR A 152 ? 0.4848 0.4960 0.5355 -0.0365 0.0442  0.0901  184 TYR A CB    
923  C  CG    . TYR A 152 ? 0.4363 0.4468 0.4713 -0.0305 0.0410  0.0995  184 TYR A CG    
924  C  CD1   . TYR A 152 ? 0.4731 0.4821 0.4982 -0.0273 0.0346  0.0944  184 TYR A CD1   
925  C  CD2   . TYR A 152 ? 0.5176 0.5314 0.5481 -0.0282 0.0447  0.1132  184 TYR A CD2   
926  C  CE1   . TYR A 152 ? 0.5164 0.5274 0.5283 -0.0226 0.0314  0.1013  184 TYR A CE1   
927  C  CE2   . TYR A 152 ? 0.6045 0.6218 0.6205 -0.0225 0.0414  0.1206  184 TYR A CE2   
928  C  CZ    . TYR A 152 ? 0.6458 0.6618 0.6530 -0.0200 0.0345  0.1138  184 TYR A CZ    
929  O  OH    . TYR A 152 ? 0.7578 0.7797 0.7517 -0.0150 0.0308  0.1196  184 TYR A OH    
930  N  N     . GLU A 153 ? 0.4263 0.4184 0.5209 -0.0437 0.0593  0.1083  185 GLU A N     
931  C  CA    . GLU A 153 ? 0.5281 0.5116 0.6323 -0.0422 0.0655  0.1252  185 GLU A CA    
932  C  C     . GLU A 153 ? 0.5352 0.5037 0.6578 -0.0423 0.0669  0.1244  185 GLU A C     
933  O  O     . GLU A 153 ? 0.5348 0.4954 0.6630 -0.0383 0.0707  0.1397  185 GLU A O     
934  C  CB    . GLU A 153 ? 0.5565 0.5421 0.6734 -0.0480 0.0745  0.1321  185 GLU A CB    
935  C  CG    . GLU A 153 ? 0.8071 0.8088 0.9077 -0.0476 0.0742  0.1328  185 GLU A CG    
936  C  CD    . GLU A 153 ? 1.0180 1.0275 1.0934 -0.0391 0.0699  0.1423  185 GLU A CD    
937  O  OE1   . GLU A 153 ? 1.0840 1.0892 1.1574 -0.0341 0.0706  0.1557  185 GLU A OE1   
938  O  OE2   . GLU A 153 ? 1.0857 1.1066 1.1439 -0.0372 0.0659  0.1357  185 GLU A OE2   
939  N  N     . PHE A 154 ? 0.4365 0.4023 0.5685 -0.0458 0.0640  0.1074  186 PHE A N     
940  C  CA    . PHE A 154 ? 0.4328 0.3853 0.5827 -0.0456 0.0653  0.1038  186 PHE A CA    
941  C  C     . PHE A 154 ? 0.4629 0.4160 0.6003 -0.0389 0.0575  0.1004  186 PHE A C     
942  O  O     . PHE A 154 ? 0.4075 0.3509 0.5583 -0.0372 0.0581  0.0977  186 PHE A O     
943  C  CB    . PHE A 154 ? 0.3907 0.3418 0.5608 -0.0539 0.0676  0.0854  186 PHE A CB    
944  C  CG    . PHE A 154 ? 0.4029 0.3507 0.5929 -0.0619 0.0767  0.0876  186 PHE A CG    
945  C  CD1   . PHE A 154 ? 0.3570 0.2880 0.5708 -0.0639 0.0852  0.0959  186 PHE A CD1   
946  C  CD2   . PHE A 154 ? 0.4441 0.4058 0.6307 -0.0673 0.0772  0.0815  186 PHE A CD2   
947  C  CE1   . PHE A 154 ? 0.3693 0.2966 0.6036 -0.0723 0.0944  0.0980  186 PHE A CE1   
948  C  CE2   . PHE A 154 ? 0.4541 0.4146 0.6605 -0.0756 0.0858  0.0831  186 PHE A CE2   
949  C  CZ    . PHE A 154 ? 0.4926 0.4355 0.7233 -0.0786 0.0946  0.0912  186 PHE A CZ    
950  N  N     . ALA A 155 ? 0.4147 0.3789 0.5282 -0.0352 0.0507  0.1002  187 ALA A N     
951  C  CA    . ALA A 155 ? 0.3976 0.3641 0.5006 -0.0306 0.0435  0.0947  187 ALA A CA    
952  C  C     . ALA A 155 ? 0.4351 0.3965 0.5382 -0.0236 0.0430  0.1080  187 ALA A C     
953  O  O     . ALA A 155 ? 0.5071 0.4678 0.6090 -0.0206 0.0466  0.1238  187 ALA A O     
954  C  CB    . ALA A 155 ? 0.3602 0.3385 0.4398 -0.0292 0.0374  0.0911  187 ALA A CB    
955  N  N     . PRO A 156 ? 0.5135 0.4734 0.6183 -0.0204 0.0389  0.1025  188 PRO A N     
956  C  CA    . PRO A 156 ? 0.6727 0.6316 0.7760 -0.0128 0.0374  0.1148  188 PRO A CA    
957  C  C     . PRO A 156 ? 0.6244 0.5961 0.7045 -0.0089 0.0319  0.1218  188 PRO A C     
958  O  O     . PRO A 156 ? 0.6426 0.6223 0.7078 -0.0112 0.0271  0.1126  188 PRO A O     
959  C  CB    . PRO A 156 ? 0.6886 0.6457 0.7990 -0.0113 0.0340  0.1036  188 PRO A CB    
960  C  CG    . PRO A 156 ? 0.6256 0.5803 0.7459 -0.0183 0.0356  0.0868  188 PRO A CG    
961  C  CD    . PRO A 156 ? 0.5582 0.5192 0.6674 -0.0231 0.0359  0.0852  188 PRO A CD    
962  N  N     . LYS A 157 ? 0.7207 0.6950 0.7985 -0.0026 0.0330  0.1381  189 LYS A N     
963  C  CA    . LYS A 157 ? 0.8749 0.8640 0.9316 0.0014  0.0279  0.1443  189 LYS A CA    
964  C  C     . LYS A 157 ? 0.8933 0.8883 0.9501 0.0099  0.0253  0.1554  189 LYS A C     
965  O  O     . LYS A 157 ? 0.9133 0.9198 0.9583 0.0121  0.0183  0.1511  189 LYS A O     
966  C  CB    . LYS A 157 ? 0.9566 0.9509 1.0053 0.0008  0.0320  0.1543  189 LYS A CB    
967  C  CG    . LYS A 157 ? 0.9834 0.9751 1.0315 -0.0068 0.0345  0.1440  189 LYS A CG    
968  C  CD    . LYS A 157 ? 0.9848 0.9799 1.0314 -0.0074 0.0408  0.1557  189 LYS A CD    
969  C  CE    . LYS A 157 ? 0.9505 0.9403 1.0063 -0.0152 0.0454  0.1471  189 LYS A CE    
970  N  NZ    . LYS A 157 ? 0.8799 0.8752 0.9237 -0.0183 0.0401  0.1309  189 LYS A NZ    
971  N  N     . SER A 161 ? 0.9609 1.0134 1.0430 0.0669  0.0052  0.2036  193 SER A N     
972  C  CA    . SER A 161 ? 0.9694 1.0488 1.0429 0.0754  -0.0019 0.2105  193 SER A CA    
973  C  C     . SER A 161 ? 0.9901 1.0889 1.0438 0.0680  -0.0104 0.1960  193 SER A C     
974  O  O     . SER A 161 ? 0.9941 1.0845 1.0397 0.0575  -0.0101 0.1834  193 SER A O     
975  C  CB    . SER A 161 ? 0.9508 1.0314 1.0405 0.0828  -0.0031 0.2100  193 SER A CB    
976  O  OG    . SER A 161 ? 0.8867 0.9665 0.9770 0.0747  -0.0072 0.1893  193 SER A OG    
977  N  N     . HIS A 162 ? 0.9771 1.1023 1.0243 0.0736  -0.0176 0.1977  194 HIS A N     
978  C  CA    . HIS A 162 ? 0.9406 1.0854 0.9715 0.0665  -0.0255 0.1833  194 HIS A CA    
979  C  C     . HIS A 162 ? 0.7109 0.8599 0.7483 0.0622  -0.0302 0.1679  194 HIS A C     
980  O  O     . HIS A 162 ? 0.6278 0.7939 0.6549 0.0564  -0.0366 0.1561  194 HIS A O     
981  C  CB    . HIS A 162 ? 1.1174 1.2937 1.1355 0.0741  -0.0309 0.1935  194 HIS A CB    
982  C  CG    . HIS A 162 ? 1.2764 1.4527 1.2887 0.0804  -0.0258 0.2119  194 HIS A CG    
983  N  ND1   . HIS A 162 ? 1.3043 1.4589 1.3147 0.0743  -0.0190 0.2125  194 HIS A ND1   
984  C  CD2   . HIS A 162 ? 1.3170 1.5134 1.3255 0.0918  -0.0258 0.2298  194 HIS A CD2   
985  C  CE1   . HIS A 162 ? 1.3159 1.4772 1.3218 0.0818  -0.0150 0.2314  194 HIS A CE1   
986  N  NE2   . HIS A 162 ? 1.3220 1.5058 1.3271 0.0908  -0.0180 0.2377  194 HIS A NE2   
987  N  N     . ARG A 163 ? 0.5391 0.6733 0.5939 0.0647  -0.0267 0.1673  195 ARG A N     
988  C  CA    . ARG A 163 ? 0.5706 0.7093 0.6322 0.0609  -0.0301 0.1534  195 ARG A CA    
989  C  C     . ARG A 163 ? 0.5640 0.6868 0.6220 0.0480  -0.0287 0.1364  195 ARG A C     
990  O  O     . ARG A 163 ? 0.5055 0.6073 0.5641 0.0441  -0.0232 0.1360  195 ARG A O     
991  C  CB    . ARG A 163 ? 0.6266 0.7580 0.7085 0.0698  -0.0267 0.1589  195 ARG A CB    
992  C  CG    . ARG A 163 ? 0.8257 0.9776 0.9125 0.0839  -0.0292 0.1747  195 ARG A CG    
993  C  CD    . ARG A 163 ? 0.9786 1.1291 1.0848 0.0915  -0.0278 0.1747  195 ARG A CD    
994  N  NE    . ARG A 163 ? 1.0868 1.2613 1.1924 0.0894  -0.0348 0.1636  195 ARG A NE    
995  C  CZ    . ARG A 163 ? 1.1449 1.3153 1.2525 0.0795  -0.0355 0.1462  195 ARG A CZ    
996  N  NH1   . ARG A 163 ? 1.1254 1.2702 1.2346 0.0714  -0.0301 0.1374  195 ARG A NH1   
997  N  NH2   . ARG A 163 ? 1.1727 1.3664 1.2809 0.0776  -0.0413 0.1378  195 ARG A NH2   
998  N  N     . ALA A 164 ? 0.5425 0.6765 0.5976 0.0414  -0.0334 0.1231  196 ALA A N     
999  C  CA    . ALA A 164 ? 0.5066 0.6286 0.5559 0.0296  -0.0323 0.1087  196 ALA A CA    
1000 C  C     . ALA A 164 ? 0.4333 0.5345 0.4945 0.0280  -0.0266 0.1040  196 ALA A C     
1001 O  O     . ALA A 164 ? 0.4554 0.5416 0.5122 0.0212  -0.0234 0.0978  196 ALA A O     
1002 C  CB    . ALA A 164 ? 0.5167 0.6556 0.5624 0.0231  -0.0377 0.0971  196 ALA A CB    
1003 N  N     . LEU A 165 ? 0.4052 0.5069 0.4817 0.0347  -0.0252 0.1061  197 LEU A N     
1004 C  CA    . LEU A 165 ? 0.5129 0.5975 0.6015 0.0335  -0.0198 0.0996  197 LEU A CA    
1005 C  C     . LEU A 165 ? 0.5495 0.6134 0.6410 0.0339  -0.0138 0.1047  197 LEU A C     
1006 O  O     . LEU A 165 ? 0.5459 0.5962 0.6392 0.0279  -0.0103 0.0958  197 LEU A O     
1007 C  CB    . LEU A 165 ? 0.6229 0.7130 0.7283 0.0420  -0.0192 0.1011  197 LEU A CB    
1008 C  CG    . LEU A 165 ? 0.6677 0.7521 0.7838 0.0393  -0.0162 0.0883  197 LEU A CG    
1009 C  CD1   . LEU A 165 ? 0.5795 0.6685 0.6845 0.0283  -0.0182 0.0763  197 LEU A CD1   
1010 C  CD2   . LEU A 165 ? 0.7164 0.8133 0.8467 0.0478  -0.0171 0.0891  197 LEU A CD2   
1011 N  N     . ASP A 166 ? 0.5499 0.6130 0.6421 0.0409  -0.0126 0.1194  198 ASP A N     
1012 C  CA    . ASP A 166 ? 0.5541 0.5984 0.6499 0.0405  -0.0063 0.1255  198 ASP A CA    
1013 C  C     . ASP A 166 ? 0.4735 0.5141 0.5539 0.0312  -0.0065 0.1201  198 ASP A C     
1014 O  O     . ASP A 166 ? 0.4653 0.4903 0.5496 0.0267  -0.0015 0.1167  198 ASP A O     
1015 C  CB    . ASP A 166 ? 0.5931 0.6394 0.6924 0.0505  -0.0043 0.1447  198 ASP A CB    
1016 C  CG    . ASP A 166 ? 0.7564 0.8041 0.8732 0.0613  -0.0030 0.1515  198 ASP A CG    
1017 O  OD1   . ASP A 166 ? 0.8101 0.8512 0.9394 0.0605  -0.0015 0.1406  198 ASP A OD1   
1018 O  OD2   . ASP A 166 ? 0.8743 0.9309 0.9921 0.0713  -0.0033 0.1681  198 ASP A OD2   
1019 N  N     . ALA A 167 ? 0.4603 0.5159 0.5243 0.0282  -0.0121 0.1184  199 ALA A N     
1020 C  CA    . ALA A 167 ? 0.5146 0.5667 0.5644 0.0201  -0.0122 0.1121  199 ALA A CA    
1021 C  C     . ALA A 167 ? 0.4687 0.5117 0.5204 0.0125  -0.0110 0.0977  199 ALA A C     
1022 O  O     . ALA A 167 ? 0.4450 0.4775 0.4935 0.0076  -0.0079 0.0939  199 ALA A O     
1023 C  CB    . ALA A 167 ? 0.4642 0.5342 0.4981 0.0185  -0.0183 0.1112  199 ALA A CB    
1024 N  N     . ILE A 168 ? 0.4649 0.5140 0.5220 0.0119  -0.0132 0.0901  200 ILE A N     
1025 C  CA    . ILE A 168 ? 0.4230 0.4662 0.4823 0.0060  -0.0116 0.0778  200 ILE A CA    
1026 C  C     . ILE A 168 ? 0.4217 0.4504 0.4933 0.0067  -0.0060 0.0759  200 ILE A C     
1027 O  O     . ILE A 168 ? 0.4209 0.4429 0.4902 0.0014  -0.0037 0.0685  200 ILE A O     
1028 C  CB    . ILE A 168 ? 0.3941 0.4485 0.4582 0.0061  -0.0144 0.0715  200 ILE A CB    
1029 C  CG1   . ILE A 168 ? 0.4379 0.5066 0.4908 0.0029  -0.0196 0.0706  200 ILE A CG1   
1030 C  CG2   . ILE A 168 ? 0.3333 0.3834 0.4007 0.0014  -0.0118 0.0604  200 ILE A CG2   
1031 C  CD1   . ILE A 168 ? 0.4482 0.5295 0.5066 0.0017  -0.0219 0.0646  200 ILE A CD1   
1032 N  N     . SER A 169 ? 0.3531 0.3777 0.4391 0.0134  -0.0034 0.0820  201 SER A N     
1033 C  CA    . SER A 169 ? 0.3669 0.3770 0.4676 0.0135  0.0025  0.0789  201 SER A CA    
1034 C  C     . SER A 169 ? 0.3106 0.3108 0.4070 0.0094  0.0058  0.0819  201 SER A C     
1035 O  O     . SER A 169 ? 0.3912 0.3843 0.4921 0.0044  0.0090  0.0729  201 SER A O     
1036 C  CB    . SER A 169 ? 0.4416 0.4470 0.5594 0.0222  0.0054  0.0869  201 SER A CB    
1037 O  OG    . SER A 169 ? 0.5541 0.5668 0.6806 0.0256  0.0039  0.0802  201 SER A OG    
1038 N  N     . GLU A 170 ? 0.3746 0.3768 0.4623 0.0115  0.0051  0.0944  202 GLU A N     
1039 C  CA    . GLU A 170 ? 0.4254 0.4203 0.5085 0.0078  0.0085  0.0982  202 GLU A CA    
1040 C  C     . GLU A 170 ? 0.4171 0.4145 0.4874 0.0004  0.0068  0.0875  202 GLU A C     
1041 O  O     . GLU A 170 ? 0.3529 0.3434 0.4257 -0.0039 0.0104  0.0836  202 GLU A O     
1042 C  CB    . GLU A 170 ? 0.5410 0.5417 0.6153 0.0123  0.0078  0.1136  202 GLU A CB    
1043 C  CG    . GLU A 170 ? 0.7470 0.7398 0.8212 0.0102  0.0132  0.1209  202 GLU A CG    
1044 C  CD    . GLU A 170 ? 0.9725 0.9685 1.0316 0.0035  0.0118  0.1137  202 GLU A CD    
1045 O  OE1   . GLU A 170 ? 1.0213 1.0275 1.0658 0.0023  0.0063  0.1084  202 GLU A OE1   
1046 O  OE2   . GLU A 170 ? 1.0102 0.9985 1.0731 -0.0005 0.0166  0.1130  202 GLU A OE2   
1047 N  N     . SER A 171 ? 0.3740 0.3817 0.4316 -0.0010 0.0015  0.0829  203 SER A N     
1048 C  CA    . SER A 171 ? 0.3542 0.3631 0.4005 -0.0070 0.0004  0.0741  203 SER A CA    
1049 C  C     . SER A 171 ? 0.2959 0.3008 0.3505 -0.0101 0.0028  0.0631  203 SER A C     
1050 O  O     . SER A 171 ? 0.3372 0.3397 0.3884 -0.0139 0.0046  0.0584  203 SER A O     
1051 C  CB    . SER A 171 ? 0.4512 0.4702 0.4855 -0.0082 -0.0047 0.0714  203 SER A CB    
1052 O  OG    . SER A 171 ? 0.6261 0.6518 0.6515 -0.0057 -0.0073 0.0794  203 SER A OG    
1053 N  N     . ILE A 172 ? 0.2680 0.2746 0.3337 -0.0081 0.0027  0.0586  204 ILE A N     
1054 C  CA    . ILE A 172 ? 0.3006 0.3067 0.3744 -0.0105 0.0049  0.0470  204 ILE A CA    
1055 C  C     . ILE A 172 ? 0.3638 0.3609 0.4490 -0.0120 0.0098  0.0452  204 ILE A C     
1056 O  O     . ILE A 172 ? 0.3507 0.3493 0.4358 -0.0159 0.0112  0.0365  204 ILE A O     
1057 C  CB    . ILE A 172 ? 0.3431 0.3542 0.4272 -0.0072 0.0043  0.0423  204 ILE A CB    
1058 C  CG1   . ILE A 172 ? 0.3307 0.3527 0.4043 -0.0075 -0.0000 0.0425  204 ILE A CG1   
1059 C  CG2   . ILE A 172 ? 0.3676 0.3799 0.4613 -0.0090 0.0071  0.0294  204 ILE A CG2   
1060 C  CD1   . ILE A 172 ? 0.3374 0.3667 0.4208 -0.0039 -0.0007 0.0392  204 ILE A CD1   
1061 N  N     . LYS A 173 ? 0.3848 0.3733 0.4807 -0.0088 0.0127  0.0536  205 LYS A N     
1062 C  CA    . LYS A 173 ? 0.3264 0.3050 0.4358 -0.0113 0.0183  0.0522  205 LYS A CA    
1063 C  C     . LYS A 173 ? 0.3403 0.3193 0.4398 -0.0158 0.0191  0.0542  205 LYS A C     
1064 O  O     . LYS A 173 ? 0.3199 0.2969 0.4270 -0.0204 0.0224  0.0467  205 LYS A O     
1065 C  CB    . LYS A 173 ? 0.3763 0.3444 0.4997 -0.0064 0.0221  0.0636  205 LYS A CB    
1066 C  CG    . LYS A 173 ? 0.4869 0.4539 0.6233 -0.0008 0.0222  0.0613  205 LYS A CG    
1067 C  CD    . LYS A 173 ? 0.6911 0.6431 0.8508 0.0014  0.0291  0.0635  205 LYS A CD    
1068 C  CE    . LYS A 173 ? 0.8096 0.7604 0.9816 0.0090  0.0292  0.0640  205 LYS A CE    
1069 N  NZ    . LYS A 173 ? 0.8635 0.8213 1.0258 0.0165  0.0253  0.0797  205 LYS A NZ    
1070 N  N     . GLU A 174 ? 0.3635 0.3466 0.4463 -0.0147 0.0162  0.0630  206 GLU A N     
1071 C  CA    . GLU A 174 ? 0.3911 0.3756 0.4637 -0.0181 0.0170  0.0648  206 GLU A CA    
1072 C  C     . GLU A 174 ? 0.3528 0.3437 0.4188 -0.0219 0.0155  0.0529  206 GLU A C     
1073 O  O     . GLU A 174 ? 0.3407 0.3323 0.4090 -0.0254 0.0180  0.0488  206 GLU A O     
1074 C  CB    . GLU A 174 ? 0.4043 0.3933 0.4606 -0.0154 0.0141  0.0751  206 GLU A CB    
1075 C  CG    . GLU A 174 ? 0.4524 0.4427 0.4993 -0.0175 0.0159  0.0789  206 GLU A CG    
1076 C  CD    . GLU A 174 ? 0.4735 0.4702 0.5043 -0.0146 0.0128  0.0869  206 GLU A CD    
1077 O  OE1   . GLU A 174 ? 0.5303 0.5303 0.5602 -0.0106 0.0102  0.0926  206 GLU A OE1   
1078 O  OE2   . GLU A 174 ? 0.4467 0.4469 0.4661 -0.0160 0.0130  0.0867  206 GLU A OE2   
1079 N  N     . LEU A 175 ? 0.3726 0.3697 0.4311 -0.0210 0.0115  0.0479  207 LEU A N     
1080 C  CA    . LEU A 175 ? 0.3877 0.3917 0.4402 -0.0234 0.0105  0.0385  207 LEU A CA    
1081 C  C     . LEU A 175 ? 0.3307 0.3372 0.3972 -0.0254 0.0131  0.0279  207 LEU A C     
1082 O  O     . LEU A 175 ? 0.3140 0.3270 0.3783 -0.0277 0.0138  0.0216  207 LEU A O     
1083 C  CB    . LEU A 175 ? 0.3188 0.3285 0.3626 -0.0221 0.0068  0.0367  207 LEU A CB    
1084 C  CG    . LEU A 175 ? 0.3269 0.3439 0.3626 -0.0234 0.0063  0.0304  207 LEU A CG    
1085 C  CD1   . LEU A 175 ? 0.2750 0.2910 0.3006 -0.0243 0.0069  0.0331  207 LEU A CD1   
1086 C  CD2   . LEU A 175 ? 0.2880 0.3091 0.3166 -0.0228 0.0037  0.0306  207 LEU A CD2   
1087 N  N     . GLN A 176 ? 0.3250 0.3275 0.4067 -0.0244 0.0148  0.0251  208 GLN A N     
1088 C  CA    . GLN A 176 ? 0.3303 0.3353 0.4273 -0.0269 0.0176  0.0128  208 GLN A CA    
1089 C  C     . GLN A 176 ? 0.2823 0.2831 0.3879 -0.0310 0.0216  0.0123  208 GLN A C     
1090 O  O     . GLN A 176 ? 0.3518 0.3607 0.4629 -0.0345 0.0227  0.0012  208 GLN A O     
1091 C  CB    . GLN A 176 ? 0.4617 0.4616 0.5745 -0.0244 0.0192  0.0095  208 GLN A CB    
1092 C  CG    . GLN A 176 ? 0.5464 0.5497 0.6762 -0.0270 0.0222  -0.0061 208 GLN A CG    
1093 C  CD    . GLN A 176 ? 0.5691 0.5901 0.6911 -0.0280 0.0196  -0.0181 208 GLN A CD    
1094 O  OE1   . GLN A 176 ? 0.6683 0.6977 0.7935 -0.0316 0.0206  -0.0277 208 GLN A OE1   
1095 N  NE2   . GLN A 176 ? 0.5485 0.5769 0.6605 -0.0246 0.0164  -0.0170 208 GLN A NE2   
1096 N  N     . PHE A 177 ? 0.2997 0.2899 0.4070 -0.0306 0.0240  0.0245  209 PHE A N     
1097 C  CA    . PHE A 177 ? 0.3368 0.3237 0.4514 -0.0349 0.0284  0.0261  209 PHE A CA    
1098 C  C     . PHE A 177 ? 0.2937 0.2920 0.3952 -0.0371 0.0265  0.0228  209 PHE A C     
1099 O  O     . PHE A 177 ? 0.2980 0.3020 0.4079 -0.0415 0.0290  0.0148  209 PHE A O     
1100 C  CB    . PHE A 177 ? 0.2947 0.2711 0.4091 -0.0328 0.0310  0.0427  209 PHE A CB    
1101 C  CG    . PHE A 177 ? 0.3792 0.3532 0.5001 -0.0373 0.0362  0.0467  209 PHE A CG    
1102 C  CD1   . PHE A 177 ? 0.3776 0.3592 0.4833 -0.0381 0.0350  0.0505  209 PHE A CD1   
1103 C  CD2   . PHE A 177 ? 0.3640 0.3280 0.5073 -0.0407 0.0427  0.0467  209 PHE A CD2   
1104 C  CE1   . PHE A 177 ? 0.3955 0.3770 0.5077 -0.0422 0.0401  0.0543  209 PHE A CE1   
1105 C  CE2   . PHE A 177 ? 0.4131 0.3756 0.5638 -0.0456 0.0482  0.0508  209 PHE A CE2   
1106 C  CZ    . PHE A 177 ? 0.4266 0.3989 0.5612 -0.0463 0.0467  0.0548  209 PHE A CZ    
1107 N  N     . TYR A 178 ? 0.2859 0.2881 0.3678 -0.0338 0.0225  0.0285  210 TYR A N     
1108 C  CA    . TYR A 178 ? 0.3058 0.3175 0.3752 -0.0345 0.0211  0.0264  210 TYR A CA    
1109 C  C     . TYR A 178 ? 0.2699 0.2941 0.3421 -0.0356 0.0199  0.0132  210 TYR A C     
1110 O  O     . TYR A 178 ? 0.3079 0.3415 0.3816 -0.0378 0.0210  0.0080  210 TYR A O     
1111 C  CB    . TYR A 178 ? 0.2783 0.2896 0.3282 -0.0308 0.0175  0.0337  210 TYR A CB    
1112 C  CG    . TYR A 178 ? 0.3462 0.3504 0.3908 -0.0294 0.0183  0.0457  210 TYR A CG    
1113 C  CD1   . TYR A 178 ? 0.3545 0.3563 0.4056 -0.0313 0.0225  0.0509  210 TYR A CD1   
1114 C  CD2   . TYR A 178 ? 0.3607 0.3629 0.3943 -0.0263 0.0150  0.0516  210 TYR A CD2   
1115 C  CE1   . TYR A 178 ? 0.3963 0.3944 0.4416 -0.0293 0.0236  0.0627  210 TYR A CE1   
1116 C  CE2   . TYR A 178 ? 0.3586 0.3582 0.3865 -0.0245 0.0154  0.0618  210 TYR A CE2   
1117 C  CZ    . TYR A 178 ? 0.3732 0.3712 0.4063 -0.0256 0.0197  0.0678  210 TYR A CZ    
1118 O  OH    . TYR A 178 ? 0.4016 0.3997 0.4280 -0.0230 0.0203  0.0789  210 TYR A OH    
1119 N  N     . ARG A 179 ? 0.2926 0.3198 0.3657 -0.0338 0.0178  0.0077  211 ARG A N     
1120 C  CA    . ARG A 179 ? 0.2911 0.3334 0.3662 -0.0342 0.0168  -0.0046 211 ARG A CA    
1121 C  C     . ARG A 179 ? 0.3525 0.3999 0.4459 -0.0388 0.0198  -0.0160 211 ARG A C     
1122 O  O     . ARG A 179 ? 0.3168 0.3801 0.4108 -0.0401 0.0194  -0.0247 211 ARG A O     
1123 C  CB    . ARG A 179 ? 0.2940 0.3395 0.3683 -0.0315 0.0147  -0.0084 211 ARG A CB    
1124 C  CG    . ARG A 179 ? 0.3248 0.3893 0.4006 -0.0312 0.0139  -0.0208 211 ARG A CG    
1125 C  CD    . ARG A 179 ? 0.3688 0.4390 0.4430 -0.0283 0.0125  -0.0242 211 ARG A CD    
1126 N  NE    . ARG A 179 ? 0.3322 0.4238 0.4029 -0.0268 0.0116  -0.0332 211 ARG A NE    
1127 C  CZ    . ARG A 179 ? 0.3580 0.4610 0.4280 -0.0244 0.0109  -0.0385 211 ARG A CZ    
1128 N  NH1   . ARG A 179 ? 0.3680 0.4624 0.4415 -0.0234 0.0110  -0.0363 211 ARG A NH1   
1129 N  NH2   . ARG A 179 ? 0.3545 0.4797 0.4202 -0.0224 0.0103  -0.0456 211 ARG A NH2   
1130 N  N     . ASN A 180 ? 0.2895 0.3243 0.3992 -0.0413 0.0232  -0.0160 212 ASN A N     
1131 C  CA    . ASN A 180 ? 0.3323 0.3697 0.4626 -0.0468 0.0269  -0.0281 212 ASN A CA    
1132 C  C     . ASN A 180 ? 0.3478 0.3884 0.4808 -0.0512 0.0294  -0.0265 212 ASN A C     
1133 O  O     . ASN A 180 ? 0.3878 0.4400 0.5336 -0.0562 0.0310  -0.0395 212 ASN A O     
1134 C  CB    . ASN A 180 ? 0.3627 0.3826 0.5114 -0.0479 0.0309  -0.0270 212 ASN A CB    
1135 C  CG    . ASN A 180 ? 0.5071 0.5275 0.6587 -0.0441 0.0292  -0.0333 212 ASN A CG    
1136 O  OD1   . ASN A 180 ? 0.5912 0.6273 0.7349 -0.0423 0.0258  -0.0422 212 ASN A OD1   
1137 N  ND2   . ASN A 180 ? 0.5486 0.5527 0.7118 -0.0422 0.0320  -0.0281 212 ASN A ND2   
1138 N  N     . ASN A 181 ? 0.2564 0.2893 0.3781 -0.0497 0.0298  -0.0117 213 ASN A N     
1139 C  CA    . ASN A 181 ? 0.2765 0.3104 0.4041 -0.0542 0.0336  -0.0088 213 ASN A CA    
1140 C  C     . ASN A 181 ? 0.3646 0.4109 0.4755 -0.0520 0.0313  -0.0054 213 ASN A C     
1141 O  O     . ASN A 181 ? 0.3055 0.3591 0.4232 -0.0560 0.0341  -0.0072 213 ASN A O     
1142 C  CB    . ASN A 181 ? 0.3092 0.3248 0.4418 -0.0546 0.0379  0.0058  213 ASN A CB    
1143 C  CG    . ASN A 181 ? 0.3829 0.3854 0.5384 -0.0576 0.0425  0.0026  213 ASN A CG    
1144 O  OD1   . ASN A 181 ? 0.4675 0.4698 0.6430 -0.0643 0.0474  -0.0052 213 ASN A OD1   
1145 N  ND2   . ASN A 181 ? 0.3020 0.2937 0.4558 -0.0528 0.0412  0.0081  213 ASN A ND2   
1146 N  N     . ILE A 182 ? 0.3337 0.3826 0.4247 -0.0460 0.0269  -0.0005 214 ILE A N     
1147 C  CA    . ILE A 182 ? 0.3253 0.3834 0.4020 -0.0432 0.0257  0.0034  214 ILE A CA    
1148 C  C     . ILE A 182 ? 0.3306 0.4029 0.3964 -0.0387 0.0217  -0.0023 214 ILE A C     
1149 O  O     . ILE A 182 ? 0.3364 0.4175 0.3915 -0.0353 0.0208  0.0001  214 ILE A O     
1150 C  CB    . ILE A 182 ? 0.3388 0.3851 0.4011 -0.0398 0.0256  0.0174  214 ILE A CB    
1151 C  CG1   . ILE A 182 ? 0.3859 0.4254 0.4355 -0.0353 0.0218  0.0211  214 ILE A CG1   
1152 C  CG2   . ILE A 182 ? 0.2702 0.3047 0.3423 -0.0431 0.0300  0.0253  214 ILE A CG2   
1153 C  CD1   . ILE A 182 ? 0.3825 0.4144 0.4167 -0.0319 0.0210  0.0318  214 ILE A CD1   
1154 N  N     . PHE A 183 ? 0.3050 0.3801 0.3736 -0.0381 0.0197  -0.0091 215 PHE A N     
1155 C  CA    . PHE A 183 ? 0.2564 0.3468 0.3153 -0.0336 0.0166  -0.0134 215 PHE A CA    
1156 C  C     . PHE A 183 ? 0.2718 0.3837 0.3423 -0.0359 0.0165  -0.0278 215 PHE A C     
1157 O  O     . PHE A 183 ? 0.3206 0.4325 0.4088 -0.0418 0.0186  -0.0371 215 PHE A O     
1158 C  CB    . PHE A 183 ? 0.2569 0.3411 0.3099 -0.0308 0.0146  -0.0115 215 PHE A CB    
1159 C  CG    . PHE A 183 ? 0.2895 0.3603 0.3275 -0.0274 0.0135  0.0010  215 PHE A CG    
1160 C  CD1   . PHE A 183 ? 0.3173 0.3712 0.3561 -0.0289 0.0143  0.0083  215 PHE A CD1   
1161 C  CD2   . PHE A 183 ? 0.3433 0.4191 0.3672 -0.0226 0.0121  0.0052  215 PHE A CD2   
1162 C  CE1   . PHE A 183 ? 0.3008 0.3451 0.3263 -0.0263 0.0130  0.0175  215 PHE A CE1   
1163 C  CE2   . PHE A 183 ? 0.3428 0.4058 0.3549 -0.0205 0.0116  0.0146  215 PHE A CE2   
1164 C  CZ    . PHE A 183 ? 0.2726 0.3208 0.2855 -0.0227 0.0117  0.0197  215 PHE A CZ    
1165 N  N     . LYS A 184 ? 0.2628 0.3938 0.3238 -0.0310 0.0142  -0.0297 216 LYS A N     
1166 C  CA    . LYS A 184 ? 0.3248 0.4820 0.3946 -0.0321 0.0134  -0.0435 216 LYS A CA    
1167 C  C     . LYS A 184 ? 0.3953 0.5580 0.4769 -0.0352 0.0131  -0.0568 216 LYS A C     
1168 O  O     . LYS A 184 ? 0.3526 0.5104 0.4278 -0.0321 0.0120  -0.0545 216 LYS A O     
1169 C  CB    . LYS A 184 ? 0.3363 0.5135 0.3913 -0.0241 0.0110  -0.0401 216 LYS A CB    
1170 C  CG    . LYS A 184 ? 0.4773 0.6872 0.5395 -0.0239 0.0094  -0.0538 216 LYS A CG    
1171 C  CD    . LYS A 184 ? 0.4033 0.6331 0.4503 -0.0144 0.0075  -0.0470 216 LYS A CD    
1172 C  CE    . LYS A 184 ? 0.3716 0.6031 0.4063 -0.0081 0.0064  -0.0414 216 LYS A CE    
1173 N  NZ    . LYS A 184 ? 0.3611 0.6117 0.3821 0.0021  0.0054  -0.0329 216 LYS A NZ    
1174 N  N     . LYS A 185 ? 0.3676 0.5411 0.4675 -0.0416 0.0144  -0.0716 217 LYS A N     
1175 C  CA    . LYS A 185 ? 0.5436 0.7229 0.6576 -0.0450 0.0147  -0.0873 217 LYS A CA    
1176 C  C     . LYS A 185 ? 0.5931 0.8002 0.6983 -0.0393 0.0112  -0.0950 217 LYS A C     
1177 O  O     . LYS A 185 ? 0.6152 0.8507 0.7234 -0.0393 0.0096  -0.1061 217 LYS A O     
1178 C  CB    . LYS A 185 ? 0.6059 0.7905 0.7435 -0.0540 0.0175  -0.1027 217 LYS A CB    
1179 C  CG    . LYS A 185 ? 0.6820 0.8368 0.8346 -0.0603 0.0223  -0.0982 217 LYS A CG    
1180 C  CD    . LYS A 185 ? 0.7425 0.8796 0.8977 -0.0585 0.0230  -0.0976 217 LYS A CD    
1181 C  CE    . LYS A 185 ? 0.7811 0.8875 0.9458 -0.0616 0.0275  -0.0866 217 LYS A CE    
1182 N  NZ    . LYS A 185 ? 0.8117 0.9013 0.9686 -0.0562 0.0266  -0.0769 217 LYS A NZ    
1183 N  N     . SER B 6   ? 0.9816 1.1020 0.8961 0.0054  0.0582  0.0822  38  SER B N     
1184 C  CA    . SER B 6   ? 0.9903 1.1111 0.9014 0.0104  0.0581  0.0715  38  SER B CA    
1185 C  C     . SER B 6   ? 0.9274 1.0379 0.8258 0.0147  0.0533  0.0618  38  SER B C     
1186 O  O     . SER B 6   ? 0.8748 0.9709 0.7758 0.0138  0.0490  0.0571  38  SER B O     
1187 C  CB    . SER B 6   ? 0.9658 1.1049 0.8741 0.0143  0.0643  0.0723  38  SER B CB    
1188 O  OG    . SER B 6   ? 0.9479 1.0980 0.8461 0.0155  0.0666  0.0781  38  SER B OG    
1189 N  N     . MET B 7   ? 0.9107 1.0297 0.7961 0.0191  0.0545  0.0584  39  MET B N     
1190 C  CA    . MET B 7   ? 0.8742 0.9843 0.7490 0.0222  0.0505  0.0476  39  MET B CA    
1191 C  C     . MET B 7   ? 0.8268 0.9281 0.7002 0.0177  0.0450  0.0496  39  MET B C     
1192 O  O     . MET B 7   ? 0.7756 0.8643 0.6464 0.0176  0.0410  0.0411  39  MET B O     
1193 C  CB    . MET B 7   ? 0.9229 1.0472 0.7847 0.0275  0.0532  0.0418  39  MET B CB    
1194 C  CG    . MET B 7   ? 1.0648 1.2020 0.9278 0.0324  0.0595  0.0411  39  MET B CG    
1195 S  SD    . MET B 7   ? 1.2369 1.3658 1.0957 0.0407  0.0605  0.0250  39  MET B SD    
1196 C  CE    . MET B 7   ? 1.2380 1.3820 1.0805 0.0452  0.0620  0.0156  39  MET B CE    
1197 N  N     . ALA B 8   ? 0.7674 0.8755 0.6437 0.0141  0.0452  0.0612  40  ALA B N     
1198 C  CA    . ALA B 8   ? 0.7337 0.8349 0.6104 0.0107  0.0401  0.0643  40  ALA B CA    
1199 C  C     . ALA B 8   ? 0.6889 0.7729 0.5768 0.0068  0.0371  0.0631  40  ALA B C     
1200 O  O     . ALA B 8   ? 0.7922 0.8686 0.6802 0.0045  0.0324  0.0623  40  ALA B O     
1201 C  CB    . ALA B 8   ? 0.8423 0.9547 0.7208 0.0092  0.0421  0.0789  40  ALA B CB    
1202 N  N     . GLN B 9   ? 0.6054 0.6857 0.5027 0.0063  0.0396  0.0627  41  GLN B N     
1203 C  CA    . GLN B 9   ? 0.6906 0.7579 0.5976 0.0034  0.0369  0.0607  41  GLN B CA    
1204 C  C     . GLN B 9   ? 0.5562 0.6149 0.4602 0.0069  0.0358  0.0509  41  GLN B C     
1205 O  O     . GLN B 9   ? 0.5877 0.6389 0.4992 0.0059  0.0344  0.0496  41  GLN B O     
1206 C  CB    . GLN B 9   ? 0.6524 0.7235 0.5734 0.0002  0.0401  0.0666  41  GLN B CB    
1207 C  CG    . GLN B 9   ? 0.6898 0.7634 0.6181 -0.0042 0.0415  0.0772  41  GLN B CG    
1208 C  CD    . GLN B 9   ? 0.7089 0.7805 0.6544 -0.0093 0.0433  0.0796  41  GLN B CD    
1209 O  OE1   . GLN B 9   ? 0.5181 0.5891 0.4691 -0.0093 0.0429  0.0731  41  GLN B OE1   
1210 N  NE2   . GLN B 9   ? 0.7495 0.8206 0.7042 -0.0132 0.0455  0.0887  41  GLN B NE2   
1211 N  N     . ARG B 10  ? 0.5390 0.5991 0.4328 0.0115  0.0367  0.0440  42  ARG B N     
1212 C  CA    . ARG B 10  ? 0.5244 0.5732 0.4162 0.0151  0.0363  0.0352  42  ARG B CA    
1213 C  C     . ARG B 10  ? 0.5146 0.5499 0.4060 0.0117  0.0317  0.0319  42  ARG B C     
1214 O  O     . ARG B 10  ? 0.5429 0.5802 0.4320 0.0078  0.0286  0.0337  42  ARG B O     
1215 C  CB    . ARG B 10  ? 0.4921 0.5450 0.3745 0.0208  0.0391  0.0274  42  ARG B CB    
1216 C  CG    . ARG B 10  ? 0.4985 0.5648 0.3818 0.0254  0.0443  0.0294  42  ARG B CG    
1217 C  CD    . ARG B 10  ? 0.5587 0.6276 0.4330 0.0319  0.0472  0.0197  42  ARG B CD    
1218 N  NE    . ARG B 10  ? 0.5481 0.6299 0.4240 0.0375  0.0524  0.0208  42  ARG B NE    
1219 C  CZ    . ARG B 10  ? 0.6716 0.7555 0.5425 0.0448  0.0559  0.0124  42  ARG B CZ    
1220 N  NH1   . ARG B 10  ? 0.7077 0.7803 0.5724 0.0470  0.0551  0.0015  42  ARG B NH1   
1221 N  NH2   . ARG B 10  ? 0.7162 0.8141 0.5896 0.0500  0.0607  0.0142  42  ARG B NH2   
1222 N  N     . MET B 11  ? 0.4051 0.4280 0.2993 0.0135  0.0317  0.0278  43  MET B N     
1223 C  CA    . MET B 11  ? 0.4253 0.4352 0.3206 0.0100  0.0284  0.0247  43  MET B CA    
1224 C  C     . MET B 11  ? 0.4215 0.4203 0.3128 0.0131  0.0302  0.0154  43  MET B C     
1225 O  O     . MET B 11  ? 0.4050 0.4008 0.2965 0.0192  0.0341  0.0135  43  MET B O     
1226 C  CB    . MET B 11  ? 0.4344 0.4386 0.3385 0.0087  0.0275  0.0296  43  MET B CB    
1227 C  CG    . MET B 11  ? 0.4790 0.4928 0.3899 0.0058  0.0267  0.0368  43  MET B CG    
1228 S  SD    . MET B 11  ? 0.4734 0.4833 0.3936 0.0050  0.0255  0.0394  43  MET B SD    
1229 C  CE    . MET B 11  ? 0.5262 0.5492 0.4557 0.0019  0.0259  0.0444  43  MET B CE    
1230 N  N     . VAL B 12  ? 0.4408 0.4336 0.3297 0.0089  0.0275  0.0093  44  VAL B N     
1231 C  CA    . VAL B 12  ? 0.4856 0.4658 0.3731 0.0098  0.0293  -0.0012 44  VAL B CA    
1232 C  C     . VAL B 12  ? 0.4744 0.4394 0.3694 0.0067  0.0287  0.0006  44  VAL B C     
1233 O  O     . VAL B 12  ? 0.4448 0.4090 0.3419 0.0003  0.0250  0.0002  44  VAL B O     
1234 C  CB    . VAL B 12  ? 0.3968 0.3835 0.2776 0.0065  0.0269  -0.0110 44  VAL B CB    
1235 C  CG1   . VAL B 12  ? 0.4140 0.3865 0.2958 0.0065  0.0293  -0.0241 44  VAL B CG1   
1236 C  CG2   . VAL B 12  ? 0.4073 0.4124 0.2799 0.0101  0.0277  -0.0107 44  VAL B CG2   
1237 N  N     . TRP B 13  ? 0.3909 0.3457 0.2903 0.0117  0.0327  0.0037  45  TRP B N     
1238 C  CA    . TRP B 13  ? 0.3629 0.3043 0.2692 0.0100  0.0334  0.0073  45  TRP B CA    
1239 C  C     . TRP B 13  ? 0.4691 0.3937 0.3775 0.0083  0.0362  -0.0020 45  TRP B C     
1240 O  O     . TRP B 13  ? 0.4114 0.3296 0.3183 0.0134  0.0403  -0.0085 45  TRP B O     
1241 C  CB    . TRP B 13  ? 0.3715 0.3120 0.2814 0.0172  0.0367  0.0159  45  TRP B CB    
1242 C  CG    . TRP B 13  ? 0.4023 0.3589 0.3129 0.0172  0.0340  0.0233  45  TRP B CG    
1243 C  CD1   . TRP B 13  ? 0.3876 0.3584 0.2953 0.0190  0.0336  0.0239  45  TRP B CD1   
1244 C  CD2   . TRP B 13  ? 0.3622 0.3227 0.2778 0.0148  0.0318  0.0303  45  TRP B CD2   
1245 N  NE1   . TRP B 13  ? 0.3551 0.3369 0.2671 0.0172  0.0315  0.0304  45  TRP B NE1   
1246 C  CE2   . TRP B 13  ? 0.3888 0.3650 0.3054 0.0149  0.0301  0.0336  45  TRP B CE2   
1247 C  CE3   . TRP B 13  ? 0.3980 0.3510 0.3179 0.0124  0.0315  0.0336  45  TRP B CE3   
1248 C  CZ2   . TRP B 13  ? 0.3328 0.3168 0.2548 0.0126  0.0279  0.0385  45  TRP B CZ2   
1249 C  CZ3   . TRP B 13  ? 0.3740 0.3366 0.2979 0.0109  0.0292  0.0391  45  TRP B CZ3   
1250 C  CH2   . TRP B 13  ? 0.4128 0.3905 0.3378 0.0110  0.0273  0.0407  45  TRP B CH2   
1251 N  N     . VAL B 14  ? 0.4152 0.3330 0.3283 0.0011  0.0344  -0.0032 46  VAL B N     
1252 C  CA    . VAL B 14  ? 0.4147 0.3169 0.3322 -0.0027 0.0371  -0.0132 46  VAL B CA    
1253 C  C     . VAL B 14  ? 0.4847 0.3746 0.4110 -0.0067 0.0387  -0.0071 46  VAL B C     
1254 O  O     . VAL B 14  ? 0.4999 0.3981 0.4276 -0.0108 0.0349  -0.0005 46  VAL B O     
1255 C  CB    . VAL B 14  ? 0.4645 0.3756 0.3783 -0.0098 0.0327  -0.0255 46  VAL B CB    
1256 C  CG1   . VAL B 14  ? 0.5636 0.4608 0.4853 -0.0170 0.0344  -0.0357 46  VAL B CG1   
1257 C  CG2   . VAL B 14  ? 0.4632 0.3835 0.3687 -0.0050 0.0332  -0.0337 46  VAL B CG2   
1258 N  N     . ASP B 15  ? 0.4434 0.3136 0.3765 -0.0052 0.0451  -0.0089 47  ASP B N     
1259 C  CA    . ASP B 15  ? 0.4628 0.3205 0.4054 -0.0103 0.0478  -0.0042 47  ASP B CA    
1260 C  C     . ASP B 15  ? 0.4943 0.3345 0.4449 -0.0164 0.0518  -0.0167 47  ASP B C     
1261 O  O     . ASP B 15  ? 0.5122 0.3422 0.4630 -0.0124 0.0559  -0.0256 47  ASP B O     
1262 C  CB    . ASP B 15  ? 0.4644 0.3143 0.4104 -0.0023 0.0531  0.0106  47  ASP B CB    
1263 C  CG    . ASP B 15  ? 0.6690 0.5111 0.6235 -0.0077 0.0554  0.0181  47  ASP B CG    
1264 O  OD1   . ASP B 15  ? 0.6836 0.5381 0.6378 -0.0142 0.0503  0.0197  47  ASP B OD1   
1265 O  OD2   . ASP B 15  ? 0.7174 0.5411 0.6796 -0.0051 0.0630  0.0228  47  ASP B OD2   
1266 N  N     . LEU B 16  ? 0.4498 0.2870 0.4081 -0.0262 0.0510  -0.0181 48  LEU B N     
1267 C  CA    . LEU B 16  ? 0.4788 0.3011 0.4474 -0.0347 0.0546  -0.0309 48  LEU B CA    
1268 C  C     . LEU B 16  ? 0.5423 0.3470 0.5235 -0.0377 0.0613  -0.0211 48  LEU B C     
1269 O  O     . LEU B 16  ? 0.4990 0.3107 0.4801 -0.0372 0.0603  -0.0072 48  LEU B O     
1270 C  CB    . LEU B 16  ? 0.5381 0.3766 0.5063 -0.0456 0.0472  -0.0433 48  LEU B CB    
1271 C  CG    . LEU B 16  ? 0.6762 0.5258 0.6377 -0.0471 0.0431  -0.0608 48  LEU B CG    
1272 C  CD1   . LEU B 16  ? 0.6142 0.4742 0.5625 -0.0364 0.0414  -0.0570 48  LEU B CD1   
1273 C  CD2   . LEU B 16  ? 0.6027 0.4736 0.5629 -0.0560 0.0350  -0.0677 48  LEU B CD2   
1274 N  N     . GLU B 17  ? 0.5372 0.3194 0.5299 -0.0407 0.0689  -0.0287 49  GLU B N     
1275 C  CA    . GLU B 17  ? 0.6084 0.3730 0.6161 -0.0471 0.0759  -0.0229 49  GLU B CA    
1276 C  C     . GLU B 17  ? 0.6962 0.4566 0.7146 -0.0611 0.0756  -0.0424 49  GLU B C     
1277 O  O     . GLU B 17  ? 0.8301 0.5835 0.8500 -0.0620 0.0767  -0.0594 49  GLU B O     
1278 C  CB    . GLU B 17  ? 0.6109 0.3495 0.6261 -0.0383 0.0870  -0.0131 49  GLU B CB    
1279 C  CG    . GLU B 17  ? 0.6455 0.3905 0.6498 -0.0230 0.0872  0.0028  49  GLU B CG    
1280 C  CD    . GLU B 17  ? 0.6369 0.3951 0.6380 -0.0208 0.0855  0.0218  49  GLU B CD    
1281 O  OE1   . GLU B 17  ? 0.6907 0.4473 0.7001 -0.0298 0.0869  0.0255  49  GLU B OE1   
1282 O  OE2   . GLU B 17  ? 0.6280 0.3996 0.6188 -0.0103 0.0829  0.0322  49  GLU B OE2   
1283 N  N     . MET B 18  ? 0.6705 0.4375 0.6967 -0.0718 0.0739  -0.0409 50  MET B N     
1284 C  CA    . MET B 18  ? 0.5650 0.3333 0.6024 -0.0863 0.0726  -0.0592 50  MET B CA    
1285 C  C     . MET B 18  ? 0.6853 0.4336 0.7422 -0.0949 0.0819  -0.0540 50  MET B C     
1286 O  O     . MET B 18  ? 0.6032 0.3399 0.6630 -0.0892 0.0885  -0.0343 50  MET B O     
1287 C  CB    . MET B 18  ? 0.5741 0.3732 0.6042 -0.0922 0.0613  -0.0636 50  MET B CB    
1288 C  CG    . MET B 18  ? 0.5547 0.3748 0.5660 -0.0837 0.0525  -0.0649 50  MET B CG    
1289 S  SD    . MET B 18  ? 0.6463 0.4766 0.6452 -0.0720 0.0500  -0.0412 50  MET B SD    
1290 C  CE    . MET B 18  ? 0.7109 0.5589 0.7152 -0.0809 0.0451  -0.0356 50  MET B CE    
1291 N  N     . THR B 19  ? 0.6617 0.4078 0.7325 -0.1090 0.0825  -0.0719 51  THR B N     
1292 C  CA    . THR B 19  ? 0.7257 0.4557 0.8173 -0.1200 0.0911  -0.0686 51  THR B CA    
1293 C  C     . THR B 19  ? 0.7801 0.5307 0.8726 -0.1261 0.0868  -0.0579 51  THR B C     
1294 O  O     . THR B 19  ? 0.8022 0.5433 0.9117 -0.1356 0.0938  -0.0535 51  THR B O     
1295 C  CB    . THR B 19  ? 0.7673 0.4882 0.8757 -0.1340 0.0936  -0.0940 51  THR B CB    
1296 O  OG1   . THR B 19  ? 0.7723 0.5232 0.8729 -0.1399 0.0816  -0.1125 51  THR B OG1   
1297 C  CG2   . THR B 19  ? 0.7504 0.4447 0.8626 -0.1281 0.1012  -0.1036 51  THR B CG2   
1298 N  N     . GLY B 20  ? 0.6878 0.4655 0.7635 -0.1207 0.0762  -0.0536 52  GLY B N     
1299 C  CA    . GLY B 20  ? 0.7146 0.5127 0.7908 -0.1249 0.0719  -0.0441 52  GLY B CA    
1300 C  C     . GLY B 20  ? 0.6641 0.4921 0.7241 -0.1210 0.0592  -0.0477 52  GLY B C     
1301 O  O     . GLY B 20  ? 0.6895 0.5225 0.7372 -0.1147 0.0541  -0.0555 52  GLY B O     
1302 N  N     . LEU B 21  ? 0.7228 0.5705 0.7839 -0.1246 0.0548  -0.0412 53  LEU B N     
1303 C  CA    . LEU B 21  ? 0.7507 0.6261 0.7988 -0.1206 0.0436  -0.0420 53  LEU B CA    
1304 C  C     . LEU B 21  ? 0.8154 0.7108 0.8674 -0.1301 0.0361  -0.0602 53  LEU B C     
1305 O  O     . LEU B 21  ? 0.9126 0.8296 0.9530 -0.1256 0.0269  -0.0626 53  LEU B O     
1306 C  CB    . LEU B 21  ? 0.7702 0.6582 0.8172 -0.1178 0.0425  -0.0259 53  LEU B CB    
1307 C  CG    . LEU B 21  ? 0.8292 0.7122 0.8655 -0.1052 0.0449  -0.0082 53  LEU B CG    
1308 C  CD1   . LEU B 21  ? 0.8699 0.7531 0.8910 -0.0951 0.0407  -0.0102 53  LEU B CD1   
1309 C  CD2   . LEU B 21  ? 0.8309 0.6912 0.8752 -0.1044 0.0562  0.0029  53  LEU B CD2   
1310 N  N     . ASP B 22  ? 0.7422 0.6322 0.8109 -0.1430 0.0398  -0.0728 54  ASP B N     
1311 C  CA    . ASP B 22  ? 0.7617 0.6747 0.8356 -0.1527 0.0324  -0.0911 54  ASP B CA    
1312 C  C     . ASP B 22  ? 0.7590 0.6790 0.8211 -0.1486 0.0266  -0.1060 54  ASP B C     
1313 O  O     . ASP B 22  ? 0.7940 0.6967 0.8605 -0.1513 0.0315  -0.1184 54  ASP B O     
1314 C  CB    . ASP B 22  ? 0.8170 0.7212 0.9136 -0.1683 0.0388  -0.1024 54  ASP B CB    
1315 C  CG    . ASP B 22  ? 0.8773 0.8117 0.9820 -0.1790 0.0310  -0.1166 54  ASP B CG    
1316 O  OD1   . ASP B 22  ? 0.8758 0.8350 0.9686 -0.1750 0.0208  -0.1249 54  ASP B OD1   
1317 O  OD2   . ASP B 22  ? 0.9328 0.8676 1.0563 -0.1911 0.0354  -0.1186 54  ASP B OD2   
1318 N  N     . ILE B 23  ? 0.7302 0.6759 0.7778 -0.1417 0.0167  -0.1045 55  ILE B N     
1319 C  CA    . ILE B 23  ? 0.7422 0.6993 0.7771 -0.1370 0.0110  -0.1168 55  ILE B CA    
1320 C  C     . ILE B 23  ? 0.7009 0.6700 0.7453 -0.1485 0.0085  -0.1412 55  ILE B C     
1321 O  O     . ILE B 23  ? 0.7053 0.6763 0.7430 -0.1467 0.0072  -0.1554 55  ILE B O     
1322 C  CB    . ILE B 23  ? 0.7838 0.7666 0.8029 -0.1274 0.0018  -0.1072 55  ILE B CB    
1323 C  CG1   . ILE B 23  ? 0.7857 0.7794 0.7898 -0.1207 -0.0029 -0.1159 55  ILE B CG1   
1324 C  CG2   . ILE B 23  ? 0.7729 0.7834 0.7986 -0.1334 -0.0051 -0.1091 55  ILE B CG2   
1325 C  CD1   . ILE B 23  ? 0.7344 0.7034 0.7319 -0.1137 0.0037  -0.1140 55  ILE B CD1   
1326 N  N     . GLU B 24  ? 0.7396 0.7185 0.8002 -0.1606 0.0081  -0.1475 56  GLU B N     
1327 C  CA    . GLU B 24  ? 0.8238 0.8172 0.8956 -0.1728 0.0054  -0.1724 56  GLU B CA    
1328 C  C     . GLU B 24  ? 0.8395 0.8032 0.9267 -0.1818 0.0155  -0.1864 56  GLU B C     
1329 O  O     . GLU B 24  ? 0.8480 0.8206 0.9423 -0.1905 0.0138  -0.2105 56  GLU B O     
1330 C  CB    . GLU B 24  ? 0.8834 0.9005 0.9687 -0.1830 0.0013  -0.1744 56  GLU B CB    
1331 C  CG    . GLU B 24  ? 0.9339 0.9850 1.0066 -0.1749 -0.0095 -0.1653 56  GLU B CG    
1332 C  CD    . GLU B 24  ? 1.0459 1.1217 1.1027 -0.1684 -0.0183 -0.1761 56  GLU B CD    
1333 O  OE1   . GLU B 24  ? 1.0790 1.1620 1.1181 -0.1551 -0.0225 -0.1620 56  GLU B OE1   
1334 O  OE2   . GLU B 24  ? 1.1168 1.2056 1.1793 -0.1767 -0.0207 -0.1990 56  GLU B OE2   
1335 N  N     . LYS B 25  ? 0.8223 0.7520 0.9152 -0.1797 0.0260  -0.1722 57  LYS B N     
1336 C  CA    . LYS B 25  ? 0.8674 0.7663 0.9786 -0.1887 0.0370  -0.1830 57  LYS B CA    
1337 C  C     . LYS B 25  ? 0.8648 0.7307 0.9694 -0.1777 0.0454  -0.1737 57  LYS B C     
1338 O  O     . LYS B 25  ? 0.8428 0.6891 0.9556 -0.1809 0.0514  -0.1893 57  LYS B O     
1339 C  CB    . LYS B 25  ? 0.8863 0.7749 1.0190 -0.2002 0.0443  -0.1752 57  LYS B CB    
1340 C  CG    . LYS B 25  ? 1.0092 0.8681 1.1631 -0.2090 0.0557  -0.1838 57  LYS B CG    
1341 C  CD    . LYS B 25  ? 1.1083 0.9741 1.2811 -0.2198 0.0578  -0.1809 57  LYS B CD    
1342 C  CE    . LYS B 25  ? 1.1099 1.0149 1.2845 -0.2273 0.0466  -0.1985 57  LYS B CE    
1343 N  NZ    . LYS B 25  ? 1.0856 0.9977 1.2596 -0.2287 0.0429  -0.2232 57  LYS B NZ    
1344 N  N     . ASP B 26  ? 0.8386 0.6989 0.9295 -0.1647 0.0458  -0.1498 58  ASP B N     
1345 C  CA    . ASP B 26  ? 0.8358 0.6661 0.9225 -0.1541 0.0543  -0.1386 58  ASP B CA    
1346 C  C     . ASP B 26  ? 0.7557 0.5907 0.8252 -0.1437 0.0501  -0.1473 58  ASP B C     
1347 O  O     . ASP B 26  ? 0.7070 0.5707 0.7629 -0.1412 0.0399  -0.1540 58  ASP B O     
1348 C  CB    . ASP B 26  ? 0.8808 0.7065 0.9603 -0.1447 0.0564  -0.1107 58  ASP B CB    
1349 C  CG    . ASP B 26  ? 0.9061 0.7221 1.0032 -0.1536 0.0635  -0.1003 58  ASP B CG    
1350 O  OD1   . ASP B 26  ? 0.9038 0.6940 1.0185 -0.1605 0.0739  -0.1042 58  ASP B OD1   
1351 O  OD2   . ASP B 26  ? 0.8960 0.7301 0.9902 -0.1535 0.0593  -0.0882 58  ASP B OD2   
1352 N  N     . GLN B 27  ? 0.7405 0.5477 0.8112 -0.1370 0.0586  -0.1461 59  GLN B N     
1353 C  CA    . GLN B 27  ? 0.7982 0.6065 0.8551 -0.1272 0.0568  -0.1551 59  GLN B CA    
1354 C  C     . GLN B 27  ? 0.7399 0.5329 0.7861 -0.1118 0.0612  -0.1340 59  GLN B C     
1355 O  O     . GLN B 27  ? 0.8123 0.5902 0.8637 -0.1091 0.0670  -0.1144 59  GLN B O     
1356 C  CB    . GLN B 27  ? 0.8740 0.6646 0.9442 -0.1336 0.0631  -0.1793 59  GLN B CB    
1357 C  CG    . GLN B 27  ? 0.9725 0.7743 1.0587 -0.1508 0.0609  -0.2016 59  GLN B CG    
1358 C  CD    . GLN B 27  ? 1.0274 0.8688 1.1005 -0.1527 0.0482  -0.2176 59  GLN B CD    
1359 O  OE1   . GLN B 27  ? 1.0066 0.8598 1.0629 -0.1431 0.0440  -0.2229 59  GLN B OE1   
1360 N  NE2   . GLN B 27  ? 1.0785 0.9425 1.1594 -0.1645 0.0423  -0.2246 59  GLN B NE2   
1361 N  N     . ILE B 28  ? 0.6693 0.4688 0.7007 -0.1016 0.0584  -0.1384 60  ILE B N     
1362 C  CA    . ILE B 28  ? 0.6748 0.4638 0.6958 -0.0867 0.0619  -0.1213 60  ILE B CA    
1363 C  C     . ILE B 28  ? 0.7475 0.5040 0.7797 -0.0831 0.0733  -0.1255 60  ILE B C     
1364 O  O     . ILE B 28  ? 0.7831 0.5338 0.8202 -0.0862 0.0754  -0.1470 60  ILE B O     
1365 C  CB    . ILE B 28  ? 0.6547 0.4674 0.6556 -0.0777 0.0541  -0.1234 60  ILE B CB    
1366 C  CG1   . ILE B 28  ? 0.6112 0.4546 0.6027 -0.0809 0.0435  -0.1186 60  ILE B CG1   
1367 C  CG2   . ILE B 28  ? 0.6201 0.4240 0.6120 -0.0631 0.0577  -0.1068 60  ILE B CG2   
1368 C  CD1   . ILE B 28  ? 0.6247 0.4935 0.5988 -0.0746 0.0361  -0.1234 60  ILE B CD1   
1369 N  N     . ILE B 29  ? 0.7159 0.4520 0.7524 -0.0758 0.0809  -0.1052 61  ILE B N     
1370 C  CA    . ILE B 29  ? 0.7294 0.4333 0.7769 -0.0701 0.0926  -0.1053 61  ILE B CA    
1371 C  C     . ILE B 29  ? 0.7164 0.4180 0.7516 -0.0527 0.0944  -0.0924 61  ILE B C     
1372 O  O     . ILE B 29  ? 0.7324 0.4122 0.7738 -0.0457 0.1025  -0.0970 61  ILE B O     
1373 C  CB    . ILE B 29  ? 0.6929 0.3718 0.7593 -0.0754 0.1025  -0.0925 61  ILE B CB    
1374 C  CG1   . ILE B 29  ? 0.7651 0.4546 0.8246 -0.0710 0.1004  -0.0664 61  ILE B CG1   
1375 C  CG2   . ILE B 29  ? 0.7188 0.3949 0.8023 -0.0935 0.1032  -0.1100 61  ILE B CG2   
1376 C  CD1   . ILE B 29  ? 0.7837 0.4526 0.8602 -0.0756 0.1102  -0.0517 61  ILE B CD1   
1377 N  N     . GLU B 30  ? 0.7100 0.4332 0.7293 -0.0454 0.0874  -0.0772 62  GLU B N     
1378 C  CA    . GLU B 30  ? 0.7123 0.4374 0.7204 -0.0298 0.0884  -0.0669 62  GLU B CA    
1379 C  C     . GLU B 30  ? 0.6691 0.4259 0.6592 -0.0270 0.0777  -0.0639 62  GLU B C     
1380 O  O     . GLU B 30  ? 0.5902 0.3637 0.5770 -0.0338 0.0710  -0.0593 62  GLU B O     
1381 C  CB    . GLU B 30  ? 0.7690 0.4793 0.7817 -0.0206 0.0957  -0.0433 62  GLU B CB    
1382 C  CG    . GLU B 30  ? 0.7678 0.4755 0.7735 -0.0040 0.0990  -0.0353 62  GLU B CG    
1383 C  CD    . GLU B 30  ? 0.7648 0.4617 0.7746 0.0061  0.1057  -0.0115 62  GLU B CD    
1384 O  OE1   . GLU B 30  ? 0.7625 0.4652 0.7735 0.0018  0.1044  0.0020  62  GLU B OE1   
1385 O  OE2   . GLU B 30  ? 0.7786 0.4629 0.7902 0.0189  0.1124  -0.0062 62  GLU B OE2   
1386 N  N     . MET B 31  ? 0.5810 0.3456 0.5606 -0.0167 0.0768  -0.0662 63  MET B N     
1387 C  CA    . MET B 31  ? 0.5232 0.3162 0.4870 -0.0138 0.0680  -0.0629 63  MET B CA    
1388 C  C     . MET B 31  ? 0.5409 0.3369 0.4969 0.0004  0.0702  -0.0546 63  MET B C     
1389 O  O     . MET B 31  ? 0.5506 0.3336 0.5095 0.0073  0.0764  -0.0617 63  MET B O     
1390 C  CB    . MET B 31  ? 0.4806 0.2912 0.4381 -0.0207 0.0617  -0.0822 63  MET B CB    
1391 C  CG    . MET B 31  ? 0.5761 0.4156 0.5186 -0.0183 0.0532  -0.0770 63  MET B CG    
1392 S  SD    . MET B 31  ? 0.6344 0.4981 0.5695 -0.0266 0.0454  -0.0961 63  MET B SD    
1393 C  CE    . MET B 31  ? 0.5472 0.4386 0.4658 -0.0193 0.0392  -0.0842 63  MET B CE    
1394 N  N     . ALA B 32  ? 0.4765 0.2907 0.4238 0.0045  0.0654  -0.0404 64  ALA B N     
1395 C  CA    . ALA B 32  ? 0.5215 0.3441 0.4616 0.0168  0.0665  -0.0329 64  ALA B CA    
1396 C  C     . ALA B 32  ? 0.5086 0.3585 0.4373 0.0158  0.0585  -0.0300 64  ALA B C     
1397 O  O     . ALA B 32  ? 0.4687 0.3287 0.3961 0.0085  0.0530  -0.0255 64  ALA B O     
1398 C  CB    . ALA B 32  ? 0.5852 0.3989 0.5301 0.0254  0.0713  -0.0150 64  ALA B CB    
1399 N  N     . CYS B 33  ? 0.4261 0.2873 0.3474 0.0235  0.0587  -0.0320 65  CYS B N     
1400 C  CA    . CYS B 33  ? 0.4478 0.3339 0.3594 0.0228  0.0527  -0.0297 65  CYS B CA    
1401 C  C     . CYS B 33  ? 0.4376 0.3334 0.3459 0.0334  0.0548  -0.0214 65  CYS B C     
1402 O  O     . CYS B 33  ? 0.4463 0.3346 0.3560 0.0420  0.0604  -0.0248 65  CYS B O     
1403 C  CB    . CYS B 33  ? 0.4654 0.3623 0.3702 0.0186  0.0499  -0.0448 65  CYS B CB    
1404 S  SG    . CYS B 33  ? 0.5078 0.4348 0.4011 0.0184  0.0439  -0.0400 65  CYS B SG    
1405 N  N     . LEU B 34  ? 0.3844 0.2973 0.2895 0.0327  0.0506  -0.0113 66  LEU B N     
1406 C  CA    . LEU B 34  ? 0.4626 0.3901 0.3653 0.0405  0.0516  -0.0044 66  LEU B CA    
1407 C  C     . LEU B 34  ? 0.5807 0.5291 0.4771 0.0359  0.0469  -0.0036 66  LEU B C     
1408 O  O     . LEU B 34  ? 0.6177 0.5695 0.5127 0.0276  0.0423  -0.0043 66  LEU B O     
1409 C  CB    . LEU B 34  ? 0.4285 0.3559 0.3365 0.0447  0.0523  0.0088  66  LEU B CB    
1410 C  CG    . LEU B 34  ? 0.5725 0.4805 0.4873 0.0503  0.0575  0.0127  66  LEU B CG    
1411 C  CD1   . LEU B 34  ? 0.5608 0.4756 0.4790 0.0541  0.0571  0.0264  66  LEU B CD1   
1412 C  CD2   . LEU B 34  ? 0.5763 0.4758 0.4920 0.0604  0.0638  0.0077  66  LEU B CD2   
1413 N  N     . ILE B 35  ? 0.4203 0.3835 0.3141 0.0416  0.0484  -0.0012 67  ILE B N     
1414 C  CA    . ILE B 35  ? 0.3741 0.3572 0.2638 0.0380  0.0455  0.0018  67  ILE B CA    
1415 C  C     . ILE B 35  ? 0.4510 0.4457 0.3456 0.0412  0.0460  0.0118  67  ILE B C     
1416 O  O     . ILE B 35  ? 0.4354 0.4335 0.3318 0.0494  0.0498  0.0127  67  ILE B O     
1417 C  CB    . ILE B 35  ? 0.4295 0.4233 0.3116 0.0408  0.0476  -0.0061 67  ILE B CB    
1418 C  CG1   . ILE B 35  ? 0.4877 0.4725 0.3655 0.0377  0.0470  -0.0187 67  ILE B CG1   
1419 C  CG2   . ILE B 35  ? 0.4575 0.4718 0.3363 0.0372  0.0455  -0.0001 67  ILE B CG2   
1420 C  CD1   . ILE B 35  ? 0.4311 0.4183 0.3072 0.0283  0.0413  -0.0184 67  ILE B CD1   
1421 N  N     . THR B 36  ? 0.3994 0.4010 0.2970 0.0348  0.0422  0.0185  68  THR B N     
1422 C  CA    . THR B 36  ? 0.3602 0.3750 0.2638 0.0358  0.0423  0.0259  68  THR B CA    
1423 C  C     . THR B 36  ? 0.3784 0.4084 0.2820 0.0307  0.0413  0.0289  68  THR B C     
1424 O  O     . THR B 36  ? 0.3999 0.4299 0.2985 0.0261  0.0396  0.0274  68  THR B O     
1425 C  CB    . THR B 36  ? 0.3750 0.3853 0.2850 0.0330  0.0396  0.0311  68  THR B CB    
1426 O  OG1   . THR B 36  ? 0.4300 0.4394 0.3407 0.0244  0.0356  0.0323  68  THR B OG1   
1427 C  CG2   . THR B 36  ? 0.3230 0.3167 0.2332 0.0370  0.0410  0.0301  68  THR B CG2   
1428 N  N     . ASP B 37  ? 0.3744 0.4184 0.2842 0.0316  0.0427  0.0334  69  ASP B N     
1429 C  CA    . ASP B 37  ? 0.3685 0.4248 0.2818 0.0255  0.0425  0.0379  69  ASP B CA    
1430 C  C     . ASP B 37  ? 0.4064 0.4585 0.3266 0.0185  0.0387  0.0415  69  ASP B C     
1431 O  O     . ASP B 37  ? 0.3332 0.3747 0.2542 0.0185  0.0362  0.0403  69  ASP B O     
1432 C  CB    . ASP B 37  ? 0.3611 0.4349 0.2804 0.0281  0.0462  0.0400  69  ASP B CB    
1433 C  CG    . ASP B 37  ? 0.3985 0.4772 0.3263 0.0310  0.0457  0.0405  69  ASP B CG    
1434 O  OD1   . ASP B 37  ? 0.4352 0.5050 0.3651 0.0297  0.0426  0.0409  69  ASP B OD1   
1435 O  OD2   . ASP B 37  ? 0.4738 0.5676 0.4060 0.0350  0.0486  0.0407  69  ASP B OD2   
1436 N  N     . SER B 38  ? 0.3552 0.4155 0.2814 0.0128  0.0390  0.0461  70  SER B N     
1437 C  CA    . SER B 38  ? 0.3749 0.4309 0.3088 0.0065  0.0359  0.0487  70  SER B CA    
1438 C  C     . SER B 38  ? 0.3935 0.4528 0.3363 0.0069  0.0350  0.0471  70  SER B C     
1439 O  O     . SER B 38  ? 0.4471 0.5018 0.3952 0.0030  0.0322  0.0471  70  SER B O     
1440 C  CB    . SER B 38  ? 0.4711 0.5338 0.4113 0.0009  0.0376  0.0546  70  SER B CB    
1441 O  OG    . SER B 38  ? 0.6007 0.6770 0.5486 0.0005  0.0416  0.0559  70  SER B OG    
1442 N  N     . ASP B 39  ? 0.3557 0.4251 0.3002 0.0120  0.0373  0.0455  71  ASP B N     
1443 C  CA    . ASP B 39  ? 0.3590 0.4364 0.3110 0.0137  0.0362  0.0438  71  ASP B CA    
1444 C  C     . ASP B 39  ? 0.3546 0.4246 0.3000 0.0213  0.0354  0.0429  71  ASP B C     
1445 O  O     . ASP B 39  ? 0.3684 0.4484 0.3177 0.0257  0.0352  0.0427  71  ASP B O     
1446 C  CB    . ASP B 39  ? 0.4039 0.5008 0.3637 0.0148  0.0391  0.0431  71  ASP B CB    
1447 C  CG    . ASP B 39  ? 0.5189 0.6235 0.4902 0.0059  0.0404  0.0441  71  ASP B CG    
1448 O  OD1   . ASP B 39  ? 0.4732 0.5715 0.4504 -0.0003 0.0382  0.0439  71  ASP B OD1   
1449 O  OD2   . ASP B 39  ? 0.5423 0.6589 0.5178 0.0051  0.0442  0.0452  71  ASP B OD2   
1450 N  N     . LEU B 40  ? 0.3182 0.3719 0.2545 0.0228  0.0351  0.0426  72  LEU B N     
1451 C  CA    . LEU B 40  ? 0.3331 0.3750 0.2645 0.0286  0.0352  0.0425  72  LEU B CA    
1452 C  C     . LEU B 40  ? 0.3713 0.4168 0.3005 0.0387  0.0388  0.0425  72  LEU B C     
1453 O  O     . LEU B 40  ? 0.3659 0.4029 0.2934 0.0448  0.0399  0.0442  72  LEU B O     
1454 C  CB    . LEU B 40  ? 0.3996 0.4419 0.3355 0.0276  0.0328  0.0445  72  LEU B CB    
1455 C  CG    . LEU B 40  ? 0.3754 0.4151 0.3152 0.0188  0.0294  0.0441  72  LEU B CG    
1456 C  CD1   . LEU B 40  ? 0.3396 0.3816 0.2829 0.0191  0.0276  0.0453  72  LEU B CD1   
1457 C  CD2   . LEU B 40  ? 0.3622 0.3866 0.2960 0.0148  0.0284  0.0431  72  LEU B CD2   
1458 N  N     . ASN B 41  ? 0.3732 0.4312 0.3031 0.0409  0.0413  0.0414  73  ASN B N     
1459 C  CA    . ASN B 41  ? 0.3565 0.4179 0.2843 0.0513  0.0451  0.0408  73  ASN B CA    
1460 C  C     . ASN B 41  ? 0.3343 0.3782 0.2538 0.0540  0.0473  0.0368  73  ASN B C     
1461 O  O     . ASN B 41  ? 0.3413 0.3836 0.2564 0.0491  0.0472  0.0335  73  ASN B O     
1462 C  CB    . ASN B 41  ? 0.4326 0.5153 0.3649 0.0523  0.0472  0.0403  73  ASN B CB    
1463 C  CG    . ASN B 41  ? 0.5063 0.6076 0.4488 0.0483  0.0452  0.0420  73  ASN B CG    
1464 O  OD1   . ASN B 41  ? 0.5021 0.6090 0.4480 0.0523  0.0437  0.0436  73  ASN B OD1   
1465 N  ND2   . ASN B 41  ? 0.4597 0.5716 0.4078 0.0404  0.0456  0.0415  73  ASN B ND2   
1466 N  N     . ILE B 42  ? 0.3661 0.3977 0.2842 0.0620  0.0496  0.0370  74  ILE B N     
1467 C  CA    . ILE B 42  ? 0.3786 0.3919 0.2910 0.0641  0.0522  0.0312  74  ILE B CA    
1468 C  C     . ILE B 42  ? 0.3994 0.4218 0.3085 0.0690  0.0556  0.0261  74  ILE B C     
1469 O  O     . ILE B 42  ? 0.3945 0.4265 0.3064 0.0783  0.0589  0.0275  74  ILE B O     
1470 C  CB    . ILE B 42  ? 0.3840 0.3804 0.2981 0.0718  0.0551  0.0335  74  ILE B CB    
1471 C  CG1   . ILE B 42  ? 0.3756 0.3637 0.2922 0.0662  0.0521  0.0386  74  ILE B CG1   
1472 C  CG2   . ILE B 42  ? 0.4745 0.4520 0.3851 0.0740  0.0587  0.0252  74  ILE B CG2   
1473 C  CD1   . ILE B 42  ? 0.4629 0.4392 0.3826 0.0744  0.0555  0.0449  74  ILE B CD1   
1474 N  N     . LEU B 43  ? 0.4018 0.4236 0.3051 0.0632  0.0550  0.0202  75  LEU B N     
1475 C  CA    . LEU B 43  ? 0.4352 0.4672 0.3342 0.0675  0.0585  0.0148  75  LEU B CA    
1476 C  C     . LEU B 43  ? 0.5462 0.5626 0.4412 0.0738  0.0622  0.0055  75  LEU B C     
1477 O  O     . LEU B 43  ? 0.4583 0.4808 0.3527 0.0826  0.0667  0.0017  75  LEU B O     
1478 C  CB    . LEU B 43  ? 0.4017 0.4447 0.2958 0.0590  0.0564  0.0140  75  LEU B CB    
1479 C  CG    . LEU B 43  ? 0.4229 0.4787 0.3225 0.0516  0.0536  0.0224  75  LEU B CG    
1480 C  CD1   . LEU B 43  ? 0.4129 0.4782 0.3077 0.0450  0.0530  0.0232  75  LEU B CD1   
1481 C  CD2   . LEU B 43  ? 0.4986 0.5711 0.4058 0.0561  0.0559  0.0268  75  LEU B CD2   
1482 N  N     . ALA B 44  ? 0.4701 0.4669 0.3638 0.0695  0.0607  0.0011  76  ALA B N     
1483 C  CA    . ALA B 44  ? 0.4331 0.4141 0.3249 0.0739  0.0645  -0.0099 76  ALA B CA    
1484 C  C     . ALA B 44  ? 0.4254 0.3820 0.3218 0.0713  0.0644  -0.0103 76  ALA B C     
1485 O  O     . ALA B 44  ? 0.4897 0.4431 0.3867 0.0625  0.0599  -0.0065 76  ALA B O     
1486 C  CB    . ALA B 44  ? 0.4264 0.4146 0.3097 0.0692  0.0636  -0.0208 76  ALA B CB    
1487 N  N     . GLU B 45  ? 0.4495 0.3887 0.3501 0.0792  0.0699  -0.0147 77  GLU B N     
1488 C  CA    . GLU B 45  ? 0.4348 0.3485 0.3412 0.0768  0.0715  -0.0158 77  GLU B CA    
1489 C  C     . GLU B 45  ? 0.4772 0.3790 0.3820 0.0725  0.0730  -0.0326 77  GLU B C     
1490 O  O     . GLU B 45  ? 0.5453 0.4449 0.4497 0.0796  0.0777  -0.0426 77  GLU B O     
1491 C  CB    . GLU B 45  ? 0.5008 0.4012 0.4151 0.0886  0.0776  -0.0080 77  GLU B CB    
1492 C  CG    . GLU B 45  ? 0.6081 0.4810 0.5300 0.0864  0.0808  -0.0069 77  GLU B CG    
1493 C  CD    . GLU B 45  ? 0.6842 0.5510 0.6128 0.0960  0.0844  0.0088  77  GLU B CD    
1494 O  OE1   . GLU B 45  ? 0.7031 0.5899 0.6296 0.0989  0.0811  0.0199  77  GLU B OE1   
1495 O  OE2   . GLU B 45  ? 0.6845 0.5272 0.6210 0.1007  0.0909  0.0101  77  GLU B OE2   
1496 N  N     . GLY B 46  ? 0.5188 0.4147 0.4234 0.0610  0.0690  -0.0368 78  GLY B N     
1497 C  CA    . GLY B 46  ? 0.5484 0.4376 0.4516 0.0553  0.0692  -0.0541 78  GLY B CA    
1498 C  C     . GLY B 46  ? 0.5313 0.3916 0.4452 0.0553  0.0749  -0.0608 78  GLY B C     
1499 O  O     . GLY B 46  ? 0.5594 0.4039 0.4812 0.0624  0.0800  -0.0511 78  GLY B O     
1500 N  N     . PRO B 47  ? 0.5854 0.4392 0.5004 0.0473  0.0744  -0.0776 79  PRO B N     
1501 C  CA    . PRO B 47  ? 0.5639 0.3887 0.4914 0.0455  0.0805  -0.0859 79  PRO B CA    
1502 C  C     . PRO B 47  ? 0.4929 0.3025 0.4291 0.0407  0.0808  -0.0718 79  PRO B C     
1503 O  O     . PRO B 47  ? 0.4794 0.3017 0.4117 0.0340  0.0744  -0.0625 79  PRO B O     
1504 C  CB    . PRO B 47  ? 0.6327 0.4618 0.5585 0.0353  0.0776  -0.1075 79  PRO B CB    
1505 C  CG    . PRO B 47  ? 0.6258 0.4853 0.5370 0.0371  0.0725  -0.1117 79  PRO B CG    
1506 C  CD    . PRO B 47  ? 0.5515 0.4258 0.4567 0.0404  0.0688  -0.0905 79  PRO B CD    
1507 N  N     . ASN B 48  ? 0.5197 0.3020 0.4683 0.0449  0.0890  -0.0698 80  ASN B N     
1508 C  CA    . ASN B 48  ? 0.5511 0.3163 0.5097 0.0407  0.0913  -0.0570 80  ASN B CA    
1509 C  C     . ASN B 48  ? 0.5373 0.2747 0.5100 0.0347  0.0981  -0.0711 80  ASN B C     
1510 O  O     . ASN B 48  ? 0.6133 0.3284 0.5954 0.0432  0.1071  -0.0722 80  ASN B O     
1511 C  CB    . ASN B 48  ? 0.6087 0.3691 0.5697 0.0535  0.0959  -0.0362 80  ASN B CB    
1512 C  CG    . ASN B 48  ? 0.6498 0.3915 0.6215 0.0509  0.1001  -0.0226 80  ASN B CG    
1513 O  OD1   . ASN B 48  ? 0.5715 0.3146 0.5449 0.0388  0.0963  -0.0224 80  ASN B OD1   
1514 N  ND2   . ASN B 48  ? 0.6772 0.4026 0.6565 0.0628  0.1084  -0.0103 80  ASN B ND2   
1515 N  N     . LEU B 49  ? 0.5363 0.2754 0.5116 0.0201  0.0940  -0.0822 81  LEU B N     
1516 C  CA    . LEU B 49  ? 0.6655 0.3843 0.6536 0.0121  0.0990  -0.1019 81  LEU B CA    
1517 C  C     . LEU B 49  ? 0.6131 0.3162 0.6145 0.0003  0.1010  -0.0973 81  LEU B C     
1518 O  O     . LEU B 49  ? 0.5911 0.3083 0.5883 -0.0058 0.0949  -0.0860 81  LEU B O     
1519 C  CB    . LEU B 49  ? 0.6472 0.3862 0.6274 0.0046  0.0924  -0.1254 81  LEU B CB    
1520 C  CG    . LEU B 49  ? 0.6160 0.3747 0.5820 0.0148  0.0902  -0.1312 81  LEU B CG    
1521 C  CD1   . LEU B 49  ? 0.6238 0.4052 0.5816 0.0070  0.0837  -0.1530 81  LEU B CD1   
1522 C  CD2   . LEU B 49  ? 0.6165 0.3542 0.5897 0.0273  0.1002  -0.1352 81  LEU B CD2   
1523 N  N     . ILE B 50  ? 0.5963 0.2700 0.6152 -0.0027 0.1103  -0.1065 82  ILE B N     
1524 C  CA    . ILE B 50  ? 0.7509 0.4075 0.7858 -0.0157 0.1139  -0.1065 82  ILE B CA    
1525 C  C     . ILE B 50  ? 0.7584 0.4154 0.8006 -0.0291 0.1123  -0.1359 82  ILE B C     
1526 O  O     . ILE B 50  ? 0.7264 0.3711 0.7742 -0.0263 0.1175  -0.1543 82  ILE B O     
1527 C  CB    . ILE B 50  ? 0.7374 0.3588 0.7894 -0.0096 0.1270  -0.0930 82  ILE B CB    
1528 C  CG1   . ILE B 50  ? 0.7681 0.3947 0.8125 0.0030  0.1274  -0.0633 82  ILE B CG1   
1529 C  CG2   . ILE B 50  ? 0.7178 0.3197 0.7893 -0.0247 0.1322  -0.0969 82  ILE B CG2   
1530 C  CD1   . ILE B 50  ? 0.8277 0.4300 0.8799 0.0187  0.1386  -0.0510 82  ILE B CD1   
1531 N  N     . ILE B 51  ? 0.7336 0.4065 0.7761 -0.0434 0.1053  -0.1411 83  ILE B N     
1532 C  CA    . ILE B 51  ? 0.7258 0.4102 0.7715 -0.0561 0.1008  -0.1692 83  ILE B CA    
1533 C  C     . ILE B 51  ? 0.7883 0.4472 0.8584 -0.0696 0.1085  -0.1793 83  ILE B C     
1534 O  O     . ILE B 51  ? 0.7612 0.4116 0.8404 -0.0757 0.1109  -0.1637 83  ILE B O     
1535 C  CB    . ILE B 51  ? 0.7315 0.4534 0.7622 -0.0626 0.0875  -0.1694 83  ILE B CB    
1536 C  CG1   . ILE B 51  ? 0.8211 0.5693 0.8303 -0.0522 0.0805  -0.1708 83  ILE B CG1   
1537 C  CG2   . ILE B 51  ? 0.6850 0.4169 0.7249 -0.0789 0.0837  -0.1933 83  ILE B CG2   
1538 C  CD1   . ILE B 51  ? 0.8689 0.6172 0.8672 -0.0377 0.0814  -0.1463 83  ILE B CD1   
1539 N  N     . LYS B 52  ? 0.7969 0.4444 0.8781 -0.0747 0.1129  -0.2062 84  LYS B N     
1540 C  CA    . LYS B 52  ? 0.8345 0.4644 0.9391 -0.0870 0.1183  -0.2149 84  LYS B CA    
1541 C  C     . LYS B 52  ? 0.8707 0.5226 0.9786 -0.1037 0.1104  -0.2212 84  LYS B C     
1542 O  O     . LYS B 52  ? 0.8415 0.5238 0.9369 -0.1087 0.1004  -0.2360 84  LYS B O     
1543 C  CB    . LYS B 52  ? 0.8722 0.4992 0.9836 -0.0864 0.1200  -0.2391 84  LYS B CB    
1544 C  CG    . LYS B 52  ? 0.9513 0.5764 1.0826 -0.1012 0.1207  -0.2537 84  LYS B CG    
1545 C  CD    . LYS B 52  ? 0.9670 0.5606 1.1186 -0.1024 0.1313  -0.2351 84  LYS B CD    
1546 C  CE    . LYS B 52  ? 1.0331 0.6132 1.2053 -0.1097 0.1367  -0.2528 84  LYS B CE    
1547 N  NZ    . LYS B 52  ? 0.9954 0.5462 1.1874 -0.1112 0.1474  -0.2340 84  LYS B NZ    
1548 N  N     . GLN B 53  ? 0.8726 0.5115 0.9975 -0.1117 0.1149  -0.2090 85  GLN B N     
1549 C  CA    . GLN B 53  ? 0.8993 0.5571 1.0309 -0.1274 0.1089  -0.2136 85  GLN B CA    
1550 C  C     . GLN B 53  ? 1.0026 0.6429 1.1583 -0.1363 0.1161  -0.2153 85  GLN B C     
1551 O  O     . GLN B 53  ? 0.9937 0.6048 1.1598 -0.1294 0.1265  -0.2027 85  GLN B O     
1552 C  CB    . GLN B 53  ? 0.8919 0.5569 1.0163 -0.1282 0.1064  -0.1910 85  GLN B CB    
1553 C  CG    . GLN B 53  ? 0.8006 0.4914 0.8992 -0.1189 0.0967  -0.1856 85  GLN B CG    
1554 C  CD    . GLN B 53  ? 0.8986 0.6252 0.9870 -0.1255 0.0846  -0.2079 85  GLN B CD    
1555 O  OE1   . GLN B 53  ? 1.0097 0.7432 1.1114 -0.1403 0.0832  -0.2287 85  GLN B OE1   
1556 N  NE2   . GLN B 53  ? 0.8448 0.5959 0.9101 -0.1146 0.0760  -0.2033 85  GLN B NE2   
1557 N  N     . PRO B 54  ? 1.0324 0.6912 1.1976 -0.1510 0.1110  -0.2306 86  PRO B N     
1558 C  CA    . PRO B 54  ? 1.0816 0.7248 1.2707 -0.1605 0.1183  -0.2358 86  PRO B CA    
1559 C  C     . PRO B 54  ? 1.0591 0.6794 1.2597 -0.1600 0.1274  -0.2084 86  PRO B C     
1560 O  O     . PRO B 54  ? 1.0138 0.6384 1.2053 -0.1564 0.1260  -0.1870 86  PRO B O     
1561 C  CB    . PRO B 54  ? 1.0585 0.7331 1.2519 -0.1757 0.1093  -0.2549 86  PRO B CB    
1562 C  CG    . PRO B 54  ? 1.0590 0.7647 1.2304 -0.1720 0.0975  -0.2667 86  PRO B CG    
1563 C  CD    . PRO B 54  ? 1.0174 0.7142 1.1719 -0.1590 0.0984  -0.2455 86  PRO B CD    
1564 N  N     . ASP B 55  ? 1.0736 0.6705 1.2947 -0.1636 0.1372  -0.2093 87  ASP B N     
1565 C  CA    . ASP B 55  ? 1.1354 0.7107 1.3683 -0.1624 0.1469  -0.1832 87  ASP B CA    
1566 C  C     . ASP B 55  ? 1.1138 0.7063 1.3520 -0.1747 0.1436  -0.1755 87  ASP B C     
1567 O  O     . ASP B 55  ? 1.1362 0.7220 1.3745 -0.1713 0.1480  -0.1496 87  ASP B O     
1568 C  CB    . ASP B 55  ? 1.2352 0.7820 1.4897 -0.1639 0.1584  -0.1877 87  ASP B CB    
1569 C  CG    . ASP B 55  ? 1.3335 0.8574 1.5841 -0.1483 0.1645  -0.1847 87  ASP B CG    
1570 O  OD1   . ASP B 55  ? 1.3917 0.9152 1.6434 -0.1481 0.1633  -0.2086 87  ASP B OD1   
1571 O  OD2   . ASP B 55  ? 1.3620 0.8703 1.6083 -0.1357 0.1705  -0.1585 87  ASP B OD2   
1572 N  N     . GLU B 56  ? 1.1089 0.7256 1.3515 -0.1884 0.1359  -0.1974 88  GLU B N     
1573 C  CA    . GLU B 56  ? 1.1055 0.7401 1.3546 -0.2002 0.1327  -0.1914 88  GLU B CA    
1574 C  C     . GLU B 56  ? 1.0064 0.6586 1.2372 -0.1950 0.1260  -0.1735 88  GLU B C     
1575 O  O     . GLU B 56  ? 0.9810 0.6347 1.2156 -0.1975 0.1284  -0.1539 88  GLU B O     
1576 C  CB    . GLU B 56  ? 1.2033 0.8637 1.4599 -0.2144 0.1251  -0.2197 88  GLU B CB    
1577 C  CG    . GLU B 56  ? 1.2614 0.9454 1.5013 -0.2113 0.1143  -0.2413 88  GLU B CG    
1578 C  CD    . GLU B 56  ? 1.3619 1.0619 1.6127 -0.2221 0.1108  -0.2717 88  GLU B CD    
1579 O  OE1   . GLU B 56  ? 1.3913 1.0900 1.6377 -0.2175 0.1099  -0.2896 88  GLU B OE1   
1580 O  OE2   . GLU B 56  ? 1.3752 1.0904 1.6390 -0.2350 0.1089  -0.2778 88  GLU B OE2   
1581 N  N     . LEU B 57  ? 0.9747 0.6410 1.1858 -0.1876 0.1179  -0.1801 89  LEU B N     
1582 C  CA    . LEU B 57  ? 0.9167 0.5989 1.1109 -0.1827 0.1119  -0.1642 89  LEU B CA    
1583 C  C     . LEU B 57  ? 0.8520 0.5121 1.0425 -0.1709 0.1203  -0.1344 89  LEU B C     
1584 O  O     . LEU B 57  ? 0.8763 0.5453 1.0623 -0.1704 0.1193  -0.1155 89  LEU B O     
1585 C  CB    . LEU B 57  ? 0.9712 0.6717 1.1456 -0.1773 0.1023  -0.1782 89  LEU B CB    
1586 C  CG    . LEU B 57  ? 0.9857 0.7069 1.1430 -0.1744 0.0947  -0.1665 89  LEU B CG    
1587 C  CD1   . LEU B 57  ? 0.9989 0.7526 1.1594 -0.1869 0.0856  -0.1749 89  LEU B CD1   
1588 C  CD2   . LEU B 57  ? 1.0268 0.7548 1.1637 -0.1649 0.0893  -0.1744 89  LEU B CD2   
1589 N  N     . LEU B 58  ? 0.8077 0.4409 0.9999 -0.1604 0.1285  -0.1299 90  LEU B N     
1590 C  CA    . LEU B 58  ? 0.8720 0.4867 1.0606 -0.1475 0.1364  -0.1010 90  LEU B CA    
1591 C  C     . LEU B 58  ? 0.9398 0.5466 1.1436 -0.1527 0.1439  -0.0834 90  LEU B C     
1592 O  O     . LEU B 58  ? 0.9251 0.5337 1.1232 -0.1465 0.1462  -0.0586 90  LEU B O     
1593 C  CB    . LEU B 58  ? 0.9437 0.5338 1.1318 -0.1346 0.1433  -0.1013 90  LEU B CB    
1594 C  CG    . LEU B 58  ? 0.8572 0.4537 1.0290 -0.1269 0.1372  -0.1162 90  LEU B CG    
1595 C  CD1   . LEU B 58  ? 0.8333 0.4054 1.0086 -0.1155 0.1448  -0.1190 90  LEU B CD1   
1596 C  CD2   . LEU B 58  ? 0.7743 0.3831 0.9260 -0.1180 0.1325  -0.1002 90  LEU B CD2   
1597 N  N     . ASP B 59  ? 0.9948 0.5942 1.2181 -0.1641 0.1480  -0.0962 91  ASP B N     
1598 C  CA    . ASP B 59  ? 1.0775 0.6705 1.3163 -0.1705 0.1553  -0.0810 91  ASP B CA    
1599 C  C     . ASP B 59  ? 1.0740 0.6940 1.3115 -0.1809 0.1486  -0.0779 91  ASP B C     
1600 O  O     . ASP B 59  ? 1.1102 0.7291 1.3557 -0.1839 0.1540  -0.0603 91  ASP B O     
1601 C  CB    . ASP B 59  ? 1.1597 0.7362 1.4209 -0.1804 0.1621  -0.0967 91  ASP B CB    
1602 C  CG    . ASP B 59  ? 1.2799 0.8286 1.5448 -0.1701 0.1698  -0.0996 91  ASP B CG    
1603 O  OD1   . ASP B 59  ? 1.3216 0.8599 1.5748 -0.1544 0.1727  -0.0815 91  ASP B OD1   
1604 O  OD2   . ASP B 59  ? 1.3458 0.8842 1.6257 -0.1775 0.1728  -0.1203 91  ASP B OD2   
1605 N  N     . SER B 60  ? 1.0436 0.6890 1.2711 -0.1860 0.1372  -0.0944 92  SER B N     
1606 C  CA    . SER B 60  ? 1.0725 0.7462 1.2986 -0.1952 0.1300  -0.0931 92  SER B CA    
1607 C  C     . SER B 60  ? 0.9876 0.6754 1.1943 -0.1862 0.1249  -0.0766 92  SER B C     
1608 O  O     . SER B 60  ? 1.0266 0.7405 1.2297 -0.1925 0.1174  -0.0778 92  SER B O     
1609 C  CB    . SER B 60  ? 1.1702 0.8671 1.3992 -0.2071 0.1202  -0.1221 92  SER B CB    
1610 O  OG    . SER B 60  ? 1.2391 0.9517 1.4495 -0.2014 0.1107  -0.1318 92  SER B OG    
1611 N  N     . MET B 61  ? 0.9280 0.6003 1.1228 -0.1714 0.1287  -0.0615 93  MET B N     
1612 C  CA    . MET B 61  ? 0.9071 0.5925 1.0837 -0.1625 0.1243  -0.0467 93  MET B CA    
1613 C  C     . MET B 61  ? 0.9412 0.6361 1.1195 -0.1629 0.1272  -0.0236 93  MET B C     
1614 O  O     . MET B 61  ? 0.9817 0.6685 1.1740 -0.1673 0.1342  -0.0153 93  MET B O     
1615 C  CB    . MET B 61  ? 0.8577 0.5251 1.0218 -0.1460 0.1282  -0.0363 93  MET B CB    
1616 C  CG    . MET B 61  ? 0.8327 0.4978 0.9886 -0.1436 0.1233  -0.0577 93  MET B CG    
1617 S  SD    . MET B 61  ? 0.8540 0.5034 0.9932 -0.1233 0.1269  -0.0436 93  MET B SD    
1618 C  CE    . MET B 61  ? 0.8856 0.5065 1.0386 -0.1152 0.1397  -0.0273 93  MET B CE    
1619 N  N     . SER B 62  ? 0.8693 0.5823 1.0331 -0.1581 0.1220  -0.0137 94  SER B N     
1620 C  CA    . SER B 62  ? 0.9363 0.6617 1.0993 -0.1567 0.1241  0.0078  94  SER B CA    
1621 C  C     . SER B 62  ? 1.0757 0.7841 1.2363 -0.1434 0.1334  0.0319  94  SER B C     
1622 O  O     . SER B 62  ? 1.1178 0.8060 1.2754 -0.1337 0.1374  0.0334  94  SER B O     
1623 C  CB    . SER B 62  ? 0.8691 0.6185 1.0172 -0.1541 0.1164  0.0110  94  SER B CB    
1624 O  OG    . SER B 62  ? 0.8005 0.5485 0.9286 -0.1376 0.1126  0.0175  94  SER B OG    
1625 N  N     . ASP B 63  ? 1.1204 0.8394 1.2820 -0.1425 0.1367  0.0509  95  ASP B N     
1626 C  CA    . ASP B 63  ? 1.1417 0.8501 1.3005 -0.1299 0.1449  0.0745  95  ASP B CA    
1627 C  C     . ASP B 63  ? 1.0412 0.7503 1.1813 -0.1131 0.1430  0.0850  95  ASP B C     
1628 O  O     . ASP B 63  ? 1.0761 0.7684 1.2143 -0.1014 0.1486  0.0943  95  ASP B O     
1629 C  CB    . ASP B 63  ? 1.2472 0.9721 1.4087 -0.1324 0.1479  0.0912  95  ASP B CB    
1630 C  CG    . ASP B 63  ? 1.3383 1.0609 1.5196 -0.1482 0.1513  0.0834  95  ASP B CG    
1631 O  OD1   . ASP B 63  ? 1.3528 1.0836 1.5412 -0.1611 0.1453  0.0631  95  ASP B OD1   
1632 O  OD2   . ASP B 63  ? 1.3949 1.1090 1.5848 -0.1477 0.1601  0.0975  95  ASP B OD2   
1633 N  N     . TRP B 64  ? 0.9134 0.6427 1.0403 -0.1115 0.1353  0.0835  96  TRP B N     
1634 C  CA    . TRP B 64  ? 0.8862 0.6179 0.9955 -0.0965 0.1329  0.0915  96  TRP B CA    
1635 C  C     . TRP B 64  ? 0.8934 0.6033 1.0017 -0.0923 0.1335  0.0792  96  TRP B C     
1636 O  O     . TRP B 64  ? 0.8692 0.5687 0.9712 -0.0782 0.1371  0.0899  96  TRP B O     
1637 C  CB    . TRP B 64  ? 0.8453 0.6067 0.9401 -0.0961 0.1209  0.0861  96  TRP B CB    
1638 C  CG    . TRP B 64  ? 0.8904 0.6636 0.9651 -0.0798 0.1151  0.0938  96  TRP B CG    
1639 C  CD1   . TRP B 64  ? 0.8929 0.6847 0.9574 -0.0700 0.1145  0.1107  96  TRP B CD1   
1640 C  CD2   . TRP B 64  ? 0.9057 0.6753 0.9691 -0.0718 0.1093  0.0840  96  TRP B CD2   
1641 N  NE1   . TRP B 64  ? 0.9294 0.7289 0.9780 -0.0572 0.1085  0.1113  96  TRP B NE1   
1642 C  CE2   . TRP B 64  ? 0.9332 0.7191 0.9809 -0.0580 0.1055  0.0958  96  TRP B CE2   
1643 C  CE3   . TRP B 64  ? 0.9216 0.6775 0.9869 -0.0751 0.1072  0.0657  96  TRP B CE3   
1644 C  CZ2   . TRP B 64  ? 0.9225 0.7106 0.9575 -0.0481 0.1000  0.0908  96  TRP B CZ2   
1645 C  CZ3   . TRP B 64  ? 0.9216 0.6801 0.9730 -0.0644 0.1018  0.0613  96  TRP B CZ3   
1646 C  CH2   . TRP B 64  ? 0.9068 0.6809 0.9437 -0.0513 0.0984  0.0742  96  TRP B CH2   
1647 N  N     . CYS B 65  ? 0.8940 0.6007 1.0078 -0.1036 0.1289  0.0555  97  CYS B N     
1648 C  CA    . CYS B 65  ? 0.8575 0.5487 0.9685 -0.0994 0.1278  0.0406  97  CYS B CA    
1649 C  C     . CYS B 65  ? 0.9346 0.5977 1.0585 -0.0958 0.1383  0.0445  97  CYS B C     
1650 O  O     . CYS B 65  ? 0.9380 0.5876 1.0562 -0.0831 0.1413  0.0481  97  CYS B O     
1651 C  CB    . CYS B 65  ? 0.8402 0.5414 0.9533 -0.1119 0.1190  0.0134  97  CYS B CB    
1652 S  SG    . CYS B 65  ? 0.7995 0.5376 0.8893 -0.1071 0.1018  0.0060  97  CYS B SG    
1653 N  N     . LYS B 66  ? 0.9044 0.5617 1.0450 -0.1055 0.1430  0.0437  98  LYS B N     
1654 C  CA    . LYS B 66  ? 0.9430 0.5761 1.0959 -0.1016 0.1523  0.0476  98  LYS B CA    
1655 C  C     . LYS B 66  ? 0.9321 0.5612 1.0773 -0.0840 0.1580  0.0734  98  LYS B C     
1656 O  O     . LYS B 66  ? 0.8992 0.5117 1.0437 -0.0729 0.1623  0.0752  98  LYS B O     
1657 C  CB    . LYS B 66  ? 0.9413 0.5712 1.1134 -0.1155 0.1569  0.0451  98  LYS B CB    
1658 C  CG    . LYS B 66  ? 0.9610 0.5870 1.1456 -0.1306 0.1539  0.0168  98  LYS B CG    
1659 C  CD    . LYS B 66  ? 1.0134 0.6241 1.2194 -0.1398 0.1622  0.0148  98  LYS B CD    
1660 C  CE    . LYS B 66  ? 1.0067 0.6356 1.2218 -0.1549 0.1598  0.0128  98  LYS B CE    
1661 N  NZ    . LYS B 66  ? 1.1002 0.7204 1.3358 -0.1696 0.1625  -0.0065 98  LYS B NZ    
1662 N  N     . GLU B 67  ? 0.9797 0.6269 1.1183 -0.0807 0.1577  0.0928  99  GLU B N     
1663 C  CA    . GLU B 67  ? 1.0773 0.7268 1.2077 -0.0638 0.1621  0.1170  99  GLU B CA    
1664 C  C     . GLU B 67  ? 0.9925 0.6427 1.1077 -0.0491 0.1588  0.1180  99  GLU B C     
1665 O  O     . GLU B 67  ? 0.9981 0.6354 1.1136 -0.0364 0.1642  0.1262  99  GLU B O     
1666 C  CB    . GLU B 67  ? 1.1927 0.8676 1.3161 -0.0634 0.1602  0.1335  99  GLU B CB    
1667 C  CG    . GLU B 67  ? 1.3382 1.0194 1.4552 -0.0475 0.1653  0.1582  99  GLU B CG    
1668 C  CD    . GLU B 67  ? 1.4204 1.1316 1.5195 -0.0394 0.1587  0.1690  99  GLU B CD    
1669 O  OE1   . GLU B 67  ? 1.4436 1.1617 1.5311 -0.0236 0.1581  0.1796  99  GLU B OE1   
1670 O  OE2   . GLU B 67  ? 1.4279 1.1571 1.5250 -0.0487 0.1541  0.1660  99  GLU B OE2   
1671 N  N     . HIS B 68  ? 0.9021 0.5675 1.0045 -0.0505 0.1502  0.1097  100 HIS B N     
1672 C  CA    . HIS B 68  ? 0.9285 0.5983 1.0151 -0.0362 0.1468  0.1132  100 HIS B CA    
1673 C  C     . HIS B 68  ? 0.8531 0.5004 0.9430 -0.0332 0.1489  0.0981  100 HIS B C     
1674 O  O     . HIS B 68  ? 0.8336 0.4748 0.9187 -0.0183 0.1518  0.1063  100 HIS B O     
1675 C  CB    . HIS B 68  ? 0.9862 0.6786 1.0587 -0.0391 0.1375  0.1087  100 HIS B CB    
1676 C  CG    . HIS B 68  ? 1.0925 0.8097 1.1582 -0.0363 0.1357  0.1260  100 HIS B CG    
1677 N  ND1   . HIS B 68  ? 1.1329 0.8601 1.2063 -0.0482 0.1356  0.1267  100 HIS B ND1   
1678 C  CD2   . HIS B 68  ? 1.1234 0.8603 1.1751 -0.0228 0.1333  0.1416  100 HIS B CD2   
1679 C  CE1   . HIS B 68  ? 1.1267 0.8776 1.1909 -0.0419 0.1336  0.1419  100 HIS B CE1   
1680 N  NE2   . HIS B 68  ? 1.1206 0.8785 1.1717 -0.0267 0.1319  0.1505  100 HIS B NE2   
1681 N  N     . HIS B 69  ? 0.8127 0.4501 0.9109 -0.0470 0.1470  0.0749  101 HIS B N     
1682 C  CA    . HIS B 69  ? 0.7897 0.4075 0.8915 -0.0450 0.1489  0.0577  101 HIS B CA    
1683 C  C     . HIS B 69  ? 0.8777 0.4735 0.9944 -0.0408 0.1583  0.0619  101 HIS B C     
1684 O  O     . HIS B 69  ? 0.9828 0.5623 1.1026 -0.0360 0.1609  0.0501  101 HIS B O     
1685 C  CB    . HIS B 69  ? 0.6796 0.2979 0.7862 -0.0615 0.1436  0.0300  101 HIS B CB    
1686 C  CG    . HIS B 69  ? 0.7521 0.4034 0.8403 -0.0628 0.1294  0.0227  101 HIS B CG    
1687 N  ND1   . HIS B 69  ? 0.7436 0.4152 0.8131 -0.0497 0.1231  0.0357  101 HIS B ND1   
1688 C  CD2   . HIS B 69  ? 0.7862 0.4558 0.8723 -0.0752 0.1199  0.0040  101 HIS B CD2   
1689 C  CE1   . HIS B 69  ? 0.7216 0.4199 0.7792 -0.0542 0.1110  0.0256  101 HIS B CE1   
1690 N  NE2   . HIS B 69  ? 0.6940 0.3921 0.7607 -0.0689 0.1087  0.0073  101 HIS B NE2   
1691 N  N     . GLY B 70  ? 0.8676 0.4626 0.9937 -0.0421 0.1639  0.0779  102 GLY B N     
1692 C  CA    . GLY B 70  ? 0.7874 0.3618 0.9264 -0.0357 0.1738  0.0861  102 GLY B CA    
1693 C  C     . GLY B 70  ? 0.8436 0.4222 0.9732 -0.0159 0.1771  0.1094  102 GLY B C     
1694 O  O     . GLY B 70  ? 0.9504 0.5129 1.0841 -0.0052 0.1828  0.1108  102 GLY B O     
1695 N  N     . LYS B 71  ? 0.8731 0.4754 0.9903 -0.0105 0.1734  0.1269  103 LYS B N     
1696 C  CA    . LYS B 71  ? 0.9695 0.5816 1.0773 0.0083  0.1756  0.1484  103 LYS B CA    
1697 C  C     . LYS B 71  ? 0.9524 0.5657 1.0483 0.0208  0.1719  0.1431  103 LYS B C     
1698 O  O     . LYS B 71  ? 1.0226 0.6352 1.1163 0.0366  0.1758  0.1555  103 LYS B O     
1699 C  CB    . LYS B 71  ? 1.0259 0.6670 1.1227 0.0105  0.1715  0.1651  103 LYS B CB    
1700 C  CG    . LYS B 71  ? 1.1117 0.7747 1.1917 0.0098  0.1611  0.1592  103 LYS B CG    
1701 C  CD    . LYS B 71  ? 1.1465 0.8392 1.2166 0.0125  0.1574  0.1749  103 LYS B CD    
1702 C  CE    . LYS B 71  ? 1.1430 0.8583 1.1950 0.0188  0.1483  0.1735  103 LYS B CE    
1703 N  NZ    . LYS B 71  ? 1.1341 0.8383 1.1837 0.0119  0.1438  0.1536  103 LYS B NZ    
1704 N  N     . SER B 72  ? 0.8842 0.5003 0.9727 0.0141  0.1647  0.1251  104 SER B N     
1705 C  CA    . SER B 72  ? 0.8618 0.4790 0.9389 0.0252  0.1614  0.1189  104 SER B CA    
1706 C  C     . SER B 72  ? 0.9147 0.5064 1.0017 0.0260  0.1662  0.1023  104 SER B C     
1707 O  O     . SER B 72  ? 0.9225 0.5136 1.0011 0.0361  0.1645  0.0963  104 SER B O     
1708 C  CB    . SER B 72  ? 0.9187 0.5507 0.9826 0.0183  0.1523  0.1077  104 SER B CB    
1709 O  OG    . SER B 72  ? 0.9242 0.5439 0.9954 0.0024  0.1507  0.0839  104 SER B OG    
1710 N  N     . GLY B 73  ? 0.9085 0.4803 1.0130 0.0160  0.1721  0.0943  105 GLY B N     
1711 C  CA    . GLY B 73  ? 1.0429 0.5919 1.1578 0.0152  0.1762  0.0755  105 GLY B CA    
1712 C  C     . GLY B 73  ? 0.9778 0.5265 1.0891 0.0046  0.1699  0.0478  105 GLY B C     
1713 O  O     . GLY B 73  ? 0.9552 0.4897 1.0715 0.0061  0.1719  0.0302  105 GLY B O     
1714 N  N     . LEU B 74  ? 0.9051 0.4708 1.0079 -0.0059 0.1623  0.0428  106 LEU B N     
1715 C  CA    . LEU B 74  ? 0.8961 0.4650 0.9940 -0.0157 0.1559  0.0165  106 LEU B CA    
1716 C  C     . LEU B 74  ? 0.8903 0.4487 1.0048 -0.0322 0.1570  -0.0057 106 LEU B C     
1717 O  O     . LEU B 74  ? 0.8875 0.4426 1.0024 -0.0363 0.1547  -0.0303 106 LEU B O     
1718 C  CB    . LEU B 74  ? 0.8763 0.4775 0.9581 -0.0210 0.1440  0.0187  106 LEU B CB    
1719 C  CG    . LEU B 74  ? 0.8161 0.4380 0.8880 -0.0297 0.1322  -0.0062 106 LEU B CG    
1720 C  CD1   . LEU B 74  ? 0.8279 0.4489 0.8917 -0.0192 0.1310  -0.0184 106 LEU B CD1   
1721 C  CD2   . LEU B 74  ? 0.8140 0.4701 0.8698 -0.0318 0.1202  -0.0000 106 LEU B CD2   
1722 N  N     . THR B 75  ? 0.8810 0.4363 1.0089 -0.0418 0.1603  0.0020  107 THR B N     
1723 C  CA    . THR B 75  ? 0.8447 0.3919 0.9894 -0.0578 0.1613  -0.0186 107 THR B CA    
1724 C  C     . THR B 75  ? 0.8804 0.4053 1.0367 -0.0531 0.1681  -0.0303 107 THR B C     
1725 O  O     . THR B 75  ? 0.9319 0.4544 1.0944 -0.0624 0.1659  -0.0568 107 THR B O     
1726 C  CB    . THR B 75  ? 0.8288 0.3767 0.9860 -0.0672 0.1649  -0.0054 107 THR B CB    
1727 O  OG1   . THR B 75  ? 0.7480 0.3185 0.8947 -0.0715 0.1584  0.0041  107 THR B OG1   
1728 C  CG2   . THR B 75  ? 0.8428 0.3840 1.0181 -0.0841 0.1659  -0.0270 107 THR B CG2   
1729 N  N     . LYS B 76  ? 0.8934 0.4037 1.0524 -0.0384 0.1761  -0.0113 108 LYS B N     
1730 C  CA    . LYS B 76  ? 0.9507 0.4391 1.1208 -0.0325 0.1830  -0.0209 108 LYS B CA    
1731 C  C     . LYS B 76  ? 0.9289 0.4207 1.0879 -0.0262 0.1783  -0.0408 108 LYS B C     
1732 O  O     . LYS B 76  ? 0.9366 0.4174 1.1044 -0.0294 0.1801  -0.0628 108 LYS B O     
1733 C  CB    . LYS B 76  ? 0.9340 0.4097 1.1078 -0.0165 0.1920  0.0058  108 LYS B CB    
1734 C  CG    . LYS B 76  ? 1.0510 0.5031 1.2368 -0.0086 0.2000  -0.0017 108 LYS B CG    
1735 C  CD    . LYS B 76  ? 1.1087 0.5533 1.2946 0.0098  0.2076  0.0258  108 LYS B CD    
1736 C  CE    . LYS B 76  ? 1.1328 0.5706 1.3139 0.0258  0.2089  0.0203  108 LYS B CE    
1737 N  NZ    . LYS B 76  ? 1.0850 0.5430 1.2459 0.0304  0.1994  0.0116  108 LYS B NZ    
1738 N  N     . ALA B 77  ? 0.9228 0.4311 1.0625 -0.0173 0.1724  -0.0340 109 ALA B N     
1739 C  CA    . ALA B 77  ? 0.9385 0.4525 1.0664 -0.0112 0.1681  -0.0526 109 ALA B CA    
1740 C  C     . ALA B 77  ? 0.9186 0.4436 1.0461 -0.0276 0.1610  -0.0827 109 ALA B C     
1741 O  O     . ALA B 77  ? 0.9441 0.4683 1.0708 -0.0268 0.1598  -0.1056 109 ALA B O     
1742 C  CB    . ALA B 77  ? 0.8904 0.4203 0.9981 0.0014  0.1641  -0.0374 109 ALA B CB    
1743 N  N     . VAL B 78  ? 0.8392 0.3775 0.9666 -0.0420 0.1557  -0.0832 110 VAL B N     
1744 C  CA    . VAL B 78  ? 0.7840 0.3371 0.9118 -0.0579 0.1481  -0.1109 110 VAL B CA    
1745 C  C     . VAL B 78  ? 0.8223 0.3626 0.9690 -0.0665 0.1521  -0.1297 110 VAL B C     
1746 O  O     . VAL B 78  ? 0.9098 0.4586 1.0556 -0.0719 0.1478  -0.1567 110 VAL B O     
1747 C  CB    . VAL B 78  ? 0.7672 0.3380 0.8929 -0.0709 0.1421  -0.1049 110 VAL B CB    
1748 C  CG1   . VAL B 78  ? 0.8451 0.4339 0.9733 -0.0873 0.1341  -0.1329 110 VAL B CG1   
1749 C  CG2   . VAL B 78  ? 0.6514 0.2411 0.7561 -0.0622 0.1358  -0.0887 110 VAL B CG2   
1750 N  N     . LYS B 79  ? 0.9256 0.4466 1.0894 -0.0677 0.1606  -0.1158 111 LYS B N     
1751 C  CA    . LYS B 79  ? 1.0006 0.5050 1.1837 -0.0743 0.1663  -0.1321 111 LYS B CA    
1752 C  C     . LYS B 79  ? 0.9930 0.4853 1.1749 -0.0623 0.1697  -0.1441 111 LYS B C     
1753 O  O     . LYS B 79  ? 0.9680 0.4561 1.1597 -0.0687 0.1703  -0.1685 111 LYS B O     
1754 C  CB    . LYS B 79  ? 1.0793 0.5637 1.2802 -0.0757 0.1762  -0.1117 111 LYS B CB    
1755 C  CG    . LYS B 79  ? 1.1123 0.6081 1.3178 -0.0890 0.1739  -0.1023 111 LYS B CG    
1756 C  CD    . LYS B 79  ? 1.1933 0.6689 1.4176 -0.0904 0.1848  -0.0847 111 LYS B CD    
1757 C  CE    . LYS B 79  ? 1.2013 0.6898 1.4272 -0.0997 0.1832  -0.0693 111 LYS B CE    
1758 N  NZ    . LYS B 79  ? 1.1815 0.6877 1.4123 -0.1184 0.1759  -0.0915 111 LYS B NZ    
1759 N  N     . GLU B 80  ? 0.9944 0.4828 1.1644 -0.0445 0.1718  -0.1277 112 GLU B N     
1760 C  CA    . GLU B 80  ? 1.0948 0.5725 1.2633 -0.0310 0.1754  -0.1363 112 GLU B CA    
1761 C  C     . GLU B 80  ? 1.0365 0.5346 1.1886 -0.0297 0.1671  -0.1597 112 GLU B C     
1762 O  O     . GLU B 80  ? 0.9740 0.4668 1.1275 -0.0235 0.1691  -0.1766 112 GLU B O     
1763 C  CB    . GLU B 80  ? 1.2538 0.7220 1.4169 -0.0115 0.1811  -0.1077 112 GLU B CB    
1764 C  CG    . GLU B 80  ? 1.4365 0.8873 1.6050 0.0030  0.1880  -0.1109 112 GLU B CG    
1765 C  CD    . GLU B 80  ? 1.5832 1.0133 1.7636 0.0130  0.1980  -0.0843 112 GLU B CD    
1766 O  OE1   . GLU B 80  ? 1.6442 1.0622 1.8269 0.0282  0.2035  -0.0806 112 GLU B OE1   
1767 O  OE2   . GLU B 80  ? 1.6057 1.0334 1.7931 0.0061  0.2004  -0.0671 112 GLU B OE2   
1768 N  N     . SER B 81  ? 0.9833 0.5054 1.1201 -0.0351 0.1583  -0.1612 113 SER B N     
1769 C  CA    . SER B 81  ? 0.9230 0.4668 1.0416 -0.0315 0.1510  -0.1791 113 SER B CA    
1770 C  C     . SER B 81  ? 0.9795 0.5343 1.1019 -0.0421 0.1467  -0.2120 113 SER B C     
1771 O  O     . SER B 81  ? 0.9381 0.4925 1.0741 -0.0570 0.1458  -0.2224 113 SER B O     
1772 C  CB    . SER B 81  ? 0.8246 0.3911 0.9268 -0.0357 0.1431  -0.1719 113 SER B CB    
1773 O  OG    . SER B 81  ? 0.8903 0.4817 0.9762 -0.0364 0.1353  -0.1929 113 SER B OG    
1774 N  N     . THR B 82  ? 0.9989 0.5661 1.1088 -0.0337 0.1440  -0.2282 114 THR B N     
1775 C  CA    . THR B 82  ? 1.0497 0.6364 1.1572 -0.0418 0.1380  -0.2592 114 THR B CA    
1776 C  C     . THR B 82  ? 1.0491 0.6716 1.1339 -0.0425 0.1276  -0.2687 114 THR B C     
1777 O  O     . THR B 82  ? 1.0906 0.7355 1.1685 -0.0456 0.1219  -0.2926 114 THR B O     
1778 C  CB    . THR B 82  ? 1.0089 0.5831 1.1214 -0.0316 0.1437  -0.2727 114 THR B CB    
1779 O  OG1   . THR B 82  ? 0.9958 0.5689 1.0953 -0.0132 0.1464  -0.2610 114 THR B OG1   
1780 C  CG2   . THR B 82  ? 0.9815 0.5219 1.1182 -0.0331 0.1537  -0.2668 114 THR B CG2   
1781 N  N     . ILE B 83  ? 0.9622 0.5916 1.0348 -0.0395 0.1253  -0.2500 115 ILE B N     
1782 C  CA    . ILE B 83  ? 0.8860 0.5526 0.9354 -0.0385 0.1146  -0.2525 115 ILE B CA    
1783 C  C     . ILE B 83  ? 0.8652 0.5537 0.9142 -0.0554 0.1054  -0.2590 115 ILE B C     
1784 O  O     . ILE B 83  ? 0.7948 0.4765 0.8504 -0.0620 0.1051  -0.2417 115 ILE B O     
1785 C  CB    . ILE B 83  ? 0.8363 0.5112 0.8703 -0.0250 0.1121  -0.2208 115 ILE B CB    
1786 C  CG1   . ILE B 83  ? 0.8240 0.4825 0.8578 -0.0074 0.1205  -0.2155 115 ILE B CG1   
1787 C  CG2   . ILE B 83  ? 0.7661 0.4830 0.7771 -0.0250 0.0992  -0.2177 115 ILE B CG2   
1788 C  CD1   . ILE B 83  ? 0.8087 0.4771 0.8290 0.0058  0.1183  -0.1861 115 ILE B CD1   
1789 N  N     . THR B 84  ? 0.8287 0.5455 0.8699 -0.0617 0.0980  -0.2838 116 THR B N     
1790 C  CA    . THR B 84  ? 0.7405 0.4841 0.7796 -0.0760 0.0881  -0.2904 116 THR B CA    
1791 C  C     . THR B 84  ? 0.7127 0.4874 0.7297 -0.0707 0.0776  -0.2679 116 THR B C     
1792 O  O     . THR B 84  ? 0.7304 0.5097 0.7330 -0.0571 0.0773  -0.2516 116 THR B O     
1793 C  CB    . THR B 84  ? 0.8011 0.5709 0.8385 -0.0821 0.0820  -0.3189 116 THR B CB    
1794 O  OG1   . THR B 84  ? 0.8137 0.6123 0.8287 -0.0725 0.0767  -0.3256 116 THR B OG1   
1795 C  CG2   . THR B 84  ? 0.7410 0.4873 0.7966 -0.0821 0.0898  -0.3317 116 THR B CG2   
1796 N  N     . LEU B 85  ? 0.6912 0.4877 0.7072 -0.0820 0.0692  -0.2676 117 LEU B N     
1797 C  CA    . LEU B 85  ? 0.7175 0.5434 0.7145 -0.0778 0.0593  -0.2480 117 LEU B CA    
1798 C  C     . LEU B 85  ? 0.6536 0.5111 0.6299 -0.0695 0.0531  -0.2556 117 LEU B C     
1799 O  O     . LEU B 85  ? 0.6608 0.5321 0.6211 -0.0598 0.0494  -0.2362 117 LEU B O     
1800 C  CB    . LEU B 85  ? 0.7602 0.6037 0.7620 -0.0912 0.0520  -0.2487 117 LEU B CB    
1801 C  CG    . LEU B 85  ? 0.7191 0.5926 0.7044 -0.0881 0.0419  -0.2298 117 LEU B CG    
1802 C  CD1   . LEU B 85  ? 0.6573 0.5138 0.6417 -0.0813 0.0450  -0.2001 117 LEU B CD1   
1803 C  CD2   . LEU B 85  ? 0.7514 0.6479 0.7416 -0.1011 0.0342  -0.2380 117 LEU B CD2   
1804 N  N     . GLN B 86  ? 0.7309 0.6008 0.7077 -0.0734 0.0523  -0.2842 118 GLN B N     
1805 C  CA    . GLN B 86  ? 0.7815 0.6848 0.7384 -0.0658 0.0466  -0.2924 118 GLN B CA    
1806 C  C     . GLN B 86  ? 0.7336 0.6257 0.6823 -0.0506 0.0529  -0.2840 118 GLN B C     
1807 O  O     . GLN B 86  ? 0.7756 0.6911 0.7058 -0.0415 0.0487  -0.2722 118 GLN B O     
1808 C  CB    . GLN B 86  ? 0.9011 0.8221 0.8615 -0.0738 0.0446  -0.3270 118 GLN B CB    
1809 C  CG    . GLN B 86  ? 1.0583 0.9988 1.0256 -0.0886 0.0370  -0.3372 118 GLN B CG    
1810 C  CD    . GLN B 86  ? 1.2005 1.1085 1.1934 -0.0999 0.0428  -0.3373 118 GLN B CD    
1811 O  OE1   . GLN B 86  ? 1.2927 1.1667 1.3005 -0.0985 0.0525  -0.3404 118 GLN B OE1   
1812 N  NE2   . GLN B 86  ? 1.2149 1.1344 1.2134 -0.1105 0.0370  -0.3322 118 GLN B NE2   
1813 N  N     . GLN B 87  ? 0.6919 0.5484 0.6550 -0.0475 0.0634  -0.2893 119 GLN B N     
1814 C  CA    . GLN B 87  ? 0.7056 0.5510 0.6626 -0.0322 0.0698  -0.2802 119 GLN B CA    
1815 C  C     . GLN B 87  ? 0.6184 0.4625 0.5673 -0.0244 0.0684  -0.2470 119 GLN B C     
1816 O  O     . GLN B 87  ? 0.6889 0.5465 0.6239 -0.0129 0.0678  -0.2366 119 GLN B O     
1817 C  CB    . GLN B 87  ? 0.7225 0.5280 0.6990 -0.0302 0.0818  -0.2910 119 GLN B CB    
1818 C  CG    . GLN B 87  ? 0.8966 0.6803 0.8732 -0.0152 0.0894  -0.2700 119 GLN B CG    
1819 C  CD    . GLN B 87  ? 1.0671 0.8182 1.0596 -0.0094 0.1013  -0.2846 119 GLN B CD    
1820 O  OE1   . GLN B 87  ? 1.1787 0.9164 1.1862 -0.0186 0.1051  -0.3091 119 GLN B OE1   
1821 N  NE2   . GLN B 87  ? 1.1006 0.8394 1.0911 0.0059  0.1074  -0.2700 119 GLN B NE2   
1822 N  N     . ALA B 88  ? 0.6018 0.4313 0.5599 -0.0307 0.0680  -0.2307 120 ALA B N     
1823 C  CA    . ALA B 88  ? 0.5843 0.4150 0.5353 -0.0243 0.0661  -0.2011 120 ALA B CA    
1824 C  C     . ALA B 88  ? 0.6225 0.4899 0.5548 -0.0231 0.0563  -0.1932 120 ALA B C     
1825 O  O     . ALA B 88  ? 0.6067 0.4825 0.5285 -0.0134 0.0557  -0.1764 120 ALA B O     
1826 C  CB    . ALA B 88  ? 0.5586 0.3704 0.5229 -0.0323 0.0673  -0.1877 120 ALA B CB    
1827 N  N     . GLU B 89  ? 0.6388 0.5290 0.5677 -0.0327 0.0488  -0.2047 121 GLU B N     
1828 C  CA    . GLU B 89  ? 0.6378 0.5630 0.5496 -0.0307 0.0402  -0.1965 121 GLU B CA    
1829 C  C     . GLU B 89  ? 0.5190 0.4621 0.4167 -0.0206 0.0410  -0.2023 121 GLU B C     
1830 O  O     . GLU B 89  ? 0.5438 0.5052 0.4287 -0.0141 0.0380  -0.1865 121 GLU B O     
1831 C  CB    . GLU B 89  ? 0.6305 0.5786 0.5418 -0.0418 0.0322  -0.2084 121 GLU B CB    
1832 C  CG    . GLU B 89  ? 0.6223 0.6028 0.5185 -0.0397 0.0237  -0.1940 121 GLU B CG    
1833 C  CD    . GLU B 89  ? 0.7603 0.7691 0.6543 -0.0482 0.0155  -0.2068 121 GLU B CD    
1834 O  OE1   . GLU B 89  ? 0.8103 0.8166 0.7138 -0.0564 0.0162  -0.2297 121 GLU B OE1   
1835 O  OE2   . GLU B 89  ? 0.7549 0.7892 0.6385 -0.0465 0.0087  -0.1940 121 GLU B OE2   
1836 N  N     . TYR B 90  ? 0.5716 0.5100 0.4724 -0.0195 0.0456  -0.2254 122 TYR B N     
1837 C  CA    . TYR B 90  ? 0.7132 0.6681 0.6015 -0.0091 0.0476  -0.2318 122 TYR B CA    
1838 C  C     . TYR B 90  ? 0.7077 0.6509 0.5934 0.0026  0.0527  -0.2110 122 TYR B C     
1839 O  O     . TYR B 90  ? 0.6968 0.6625 0.5688 0.0097  0.0506  -0.2003 122 TYR B O     
1840 C  CB    . TYR B 90  ? 0.6284 0.5747 0.5238 -0.0097 0.0531  -0.2614 122 TYR B CB    
1841 C  CG    . TYR B 90  ? 0.6534 0.5954 0.5448 0.0034  0.0603  -0.2655 122 TYR B CG    
1842 C  CD1   . TYR B 90  ? 0.6307 0.6049 0.5043 0.0114  0.0581  -0.2642 122 TYR B CD1   
1843 C  CD2   . TYR B 90  ? 0.7447 0.6513 0.6510 0.0080  0.0700  -0.2702 122 TYR B CD2   
1844 C  CE1   . TYR B 90  ? 0.6147 0.5870 0.4852 0.0234  0.0649  -0.2682 122 TYR B CE1   
1845 C  CE2   . TYR B 90  ? 0.7828 0.6864 0.6862 0.0208  0.0768  -0.2741 122 TYR B CE2   
1846 C  CZ    . TYR B 90  ? 0.7068 0.6441 0.5923 0.0283  0.0740  -0.2737 122 TYR B CZ    
1847 O  OH    . TYR B 90  ? 0.7277 0.6640 0.6108 0.0411  0.0810  -0.2778 122 TYR B OH    
1848 N  N     . GLU B 91  ? 0.6298 0.5391 0.5293 0.0048  0.0595  -0.2044 123 GLU B N     
1849 C  CA    . GLU B 91  ? 0.6196 0.5193 0.5180 0.0165  0.0643  -0.1858 123 GLU B CA    
1850 C  C     . GLU B 91  ? 0.5678 0.4826 0.4579 0.0169  0.0586  -0.1611 123 GLU B C     
1851 O  O     . GLU B 91  ? 0.5860 0.5154 0.4669 0.0253  0.0588  -0.1502 123 GLU B O     
1852 C  CB    . GLU B 91  ? 0.6220 0.4838 0.5373 0.0188  0.0724  -0.1822 123 GLU B CB    
1853 C  CG    . GLU B 91  ? 0.7486 0.5910 0.6747 0.0195  0.0798  -0.2061 123 GLU B CG    
1854 C  CD    . GLU B 91  ? 0.9015 0.7084 0.8424 0.0273  0.0898  -0.1985 123 GLU B CD    
1855 O  OE1   . GLU B 91  ? 0.9531 0.7583 0.8911 0.0371  0.0914  -0.1772 123 GLU B OE1   
1856 O  OE2   . GLU B 91  ? 0.9793 0.7605 0.9353 0.0238  0.0963  -0.2138 123 GLU B OE2   
1857 N  N     . PHE B 92  ? 0.4941 0.4062 0.3884 0.0077  0.0537  -0.1528 124 PHE B N     
1858 C  CA    . PHE B 92  ? 0.4818 0.4057 0.3705 0.0079  0.0489  -0.1305 124 PHE B CA    
1859 C  C     . PHE B 92  ? 0.5617 0.5190 0.4356 0.0085  0.0430  -0.1288 124 PHE B C     
1860 O  O     . PHE B 92  ? 0.4708 0.4393 0.3385 0.0136  0.0421  -0.1126 124 PHE B O     
1861 C  CB    . PHE B 92  ? 0.5589 0.4729 0.4562 -0.0018 0.0455  -0.1236 124 PHE B CB    
1862 C  CG    . PHE B 92  ? 0.5548 0.4392 0.4650 -0.0004 0.0515  -0.1146 124 PHE B CG    
1863 C  CD1   . PHE B 92  ? 0.5149 0.3953 0.4244 0.0076  0.0537  -0.0956 124 PHE B CD1   
1864 C  CD2   . PHE B 92  ? 0.5863 0.4485 0.5098 -0.0070 0.0553  -0.1249 124 PHE B CD2   
1865 C  CE1   . PHE B 92  ? 0.6026 0.4591 0.5229 0.0101  0.0592  -0.0861 124 PHE B CE1   
1866 C  CE2   . PHE B 92  ? 0.6294 0.4651 0.5648 -0.0049 0.0617  -0.1143 124 PHE B CE2   
1867 C  CZ    . PHE B 92  ? 0.5739 0.4075 0.5068 0.0042  0.0634  -0.0944 124 PHE B CZ    
1868 N  N     . LEU B 93  ? 0.5320 0.5065 0.4007 0.0034  0.0392  -0.1454 125 LEU B N     
1869 C  CA    . LEU B 93  ? 0.5404 0.5484 0.3944 0.0050  0.0341  -0.1431 125 LEU B CA    
1870 C  C     . LEU B 93  ? 0.4641 0.4833 0.3093 0.0154  0.0386  -0.1425 125 LEU B C     
1871 O  O     . LEU B 93  ? 0.5845 0.6227 0.4209 0.0192  0.0371  -0.1278 125 LEU B O     
1872 C  CB    . LEU B 93  ? 0.6132 0.6396 0.4637 -0.0018 0.0293  -0.1626 125 LEU B CB    
1873 C  CG    . LEU B 93  ? 0.6245 0.6886 0.4598 -0.0006 0.0233  -0.1597 125 LEU B CG    
1874 C  CD1   . LEU B 93  ? 0.5792 0.6501 0.4132 -0.0025 0.0184  -0.1366 125 LEU B CD1   
1875 C  CD2   . LEU B 93  ? 0.6593 0.7423 0.4921 -0.0068 0.0188  -0.1822 125 LEU B CD2   
1876 N  N     . SER B 94  ? 0.5073 0.5146 0.3559 0.0201  0.0448  -0.1582 126 SER B N     
1877 C  CA    . SER B 94  ? 0.5586 0.5759 0.4002 0.0308  0.0498  -0.1578 126 SER B CA    
1878 C  C     . SER B 94  ? 0.5936 0.6042 0.4375 0.0366  0.0522  -0.1349 126 SER B C     
1879 O  O     . SER B 94  ? 0.5997 0.6309 0.4351 0.0419  0.0526  -0.1249 126 SER B O     
1880 C  CB    . SER B 94  ? 0.5789 0.5799 0.4269 0.0354  0.0567  -0.1786 126 SER B CB    
1881 O  OG    . SER B 94  ? 0.7281 0.7373 0.5710 0.0466  0.0622  -0.1773 126 SER B OG    
1882 N  N     . PHE B 95  ? 0.5120 0.4958 0.3677 0.0354  0.0539  -0.1263 127 PHE B N     
1883 C  CA    . PHE B 95  ? 0.5173 0.4967 0.3760 0.0409  0.0558  -0.1063 127 PHE B CA    
1884 C  C     . PHE B 95  ? 0.5496 0.5493 0.4019 0.0373  0.0503  -0.0897 127 PHE B C     
1885 O  O     . PHE B 95  ? 0.5684 0.5823 0.4167 0.0426  0.0518  -0.0791 127 PHE B O     
1886 C  CB    . PHE B 95  ? 0.5294 0.4794 0.4012 0.0398  0.0580  -0.1000 127 PHE B CB    
1887 C  CG    . PHE B 95  ? 0.4838 0.4323 0.3586 0.0447  0.0589  -0.0801 127 PHE B CG    
1888 C  CD1   . PHE B 95  ? 0.5808 0.5321 0.4557 0.0554  0.0640  -0.0762 127 PHE B CD1   
1889 C  CD2   . PHE B 95  ? 0.4564 0.4030 0.3342 0.0386  0.0545  -0.0664 127 PHE B CD2   
1890 C  CE1   . PHE B 95  ? 0.5022 0.4556 0.3806 0.0596  0.0643  -0.0593 127 PHE B CE1   
1891 C  CE2   . PHE B 95  ? 0.5162 0.4640 0.3971 0.0427  0.0550  -0.0502 127 PHE B CE2   
1892 C  CZ    . PHE B 95  ? 0.4467 0.3986 0.3279 0.0530  0.0598  -0.0468 127 PHE B CZ    
1893 N  N     . VAL B 96  ? 0.4825 0.4840 0.3351 0.0283  0.0443  -0.0875 128 VAL B N     
1894 C  CA    . VAL B 96  ? 0.5126 0.5301 0.3613 0.0254  0.0397  -0.0711 128 VAL B CA    
1895 C  C     . VAL B 96  ? 0.5037 0.5500 0.3402 0.0278  0.0388  -0.0712 128 VAL B C     
1896 O  O     . VAL B 96  ? 0.5441 0.6037 0.3781 0.0288  0.0383  -0.0561 128 VAL B O     
1897 C  CB    . VAL B 96  ? 0.5306 0.5432 0.3833 0.0163  0.0339  -0.0683 128 VAL B CB    
1898 C  CG1   . VAL B 96  ? 0.5673 0.5540 0.4319 0.0146  0.0355  -0.0638 128 VAL B CG1   
1899 C  CG2   . VAL B 96  ? 0.4451 0.4656 0.2941 0.0111  0.0305  -0.0851 128 VAL B CG2   
1900 N  N     . ARG B 97  ? 0.4776 0.5350 0.3070 0.0287  0.0391  -0.0881 129 ARG B N     
1901 C  CA    . ARG B 97  ? 0.4964 0.5839 0.3131 0.0321  0.0389  -0.0877 129 ARG B CA    
1902 C  C     . ARG B 97  ? 0.5602 0.6540 0.3750 0.0405  0.0452  -0.0818 129 ARG B C     
1903 O  O     . ARG B 97  ? 0.6035 0.7203 0.4110 0.0427  0.0458  -0.0714 129 ARG B O     
1904 C  CB    . ARG B 97  ? 0.5046 0.6050 0.3139 0.0313  0.0376  -0.1093 129 ARG B CB    
1905 C  CG    . ARG B 97  ? 0.5020 0.6145 0.3083 0.0238  0.0302  -0.1119 129 ARG B CG    
1906 C  CD    . ARG B 97  ? 0.5527 0.6807 0.3525 0.0229  0.0288  -0.1359 129 ARG B CD    
1907 N  NE    . ARG B 97  ? 0.6072 0.7497 0.4048 0.0158  0.0212  -0.1391 129 ARG B NE    
1908 C  CZ    . ARG B 97  ? 0.6256 0.7807 0.4206 0.0122  0.0182  -0.1613 129 ARG B CZ    
1909 N  NH1   . ARG B 97  ? 0.5492 0.7022 0.3438 0.0148  0.0226  -0.1830 129 ARG B NH1   
1910 N  NH2   . ARG B 97  ? 0.6652 0.8361 0.4589 0.0061  0.0109  -0.1626 129 ARG B NH2   
1911 N  N     . GLN B 98  ? 0.5176 0.5921 0.3398 0.0455  0.0503  -0.0875 130 GLN B N     
1912 C  CA    . GLN B 98  ? 0.6330 0.7142 0.4551 0.0538  0.0561  -0.0813 130 GLN B CA    
1913 C  C     . GLN B 98  ? 0.5827 0.6590 0.4123 0.0533  0.0561  -0.0614 130 GLN B C     
1914 O  O     . GLN B 98  ? 0.6500 0.7382 0.4797 0.0585  0.0601  -0.0537 130 GLN B O     
1915 C  CB    . GLN B 98  ? 0.7029 0.7682 0.5301 0.0612  0.0619  -0.0954 130 GLN B CB    
1916 C  CG    . GLN B 98  ? 0.9595 1.0423 0.7777 0.0668  0.0654  -0.1121 130 GLN B CG    
1917 C  CD    . GLN B 98  ? 1.0870 1.2005 0.8960 0.0709  0.0673  -0.1025 130 GLN B CD    
1918 O  OE1   . GLN B 98  ? 1.1013 1.2177 0.9139 0.0769  0.0718  -0.0933 130 GLN B OE1   
1919 N  NE2   . GLN B 98  ? 1.1081 1.2464 0.9054 0.0677  0.0642  -0.1044 130 GLN B NE2   
1920 N  N     . GLN B 99  ? 0.5365 0.5973 0.3731 0.0469  0.0520  -0.0538 131 GLN B N     
1921 C  CA    . GLN B 99  ? 0.5174 0.5736 0.3620 0.0463  0.0520  -0.0374 131 GLN B CA    
1922 C  C     . GLN B 99  ? 0.5675 0.6350 0.4115 0.0397  0.0478  -0.0237 131 GLN B C     
1923 O  O     . GLN B 99  ? 0.5767 0.6474 0.4267 0.0396  0.0488  -0.0111 131 GLN B O     
1924 C  CB    . GLN B 99  ? 0.5046 0.5347 0.3592 0.0454  0.0515  -0.0373 131 GLN B CB    
1925 C  CG    . GLN B 99  ? 0.5854 0.6011 0.4440 0.0535  0.0569  -0.0465 131 GLN B CG    
1926 C  CD    . GLN B 99  ? 0.5601 0.5869 0.4198 0.0625  0.0619  -0.0415 131 GLN B CD    
1927 O  OE1   . GLN B 99  ? 0.6437 0.6813 0.5061 0.0619  0.0613  -0.0286 131 GLN B OE1   
1928 N  NE2   . GLN B 99  ? 0.5957 0.6206 0.4542 0.0706  0.0670  -0.0527 131 GLN B NE2   
1929 N  N     . THR B 100 ? 0.5649 0.6390 0.4032 0.0345  0.0433  -0.0259 132 THR B N     
1930 C  CA    . THR B 100 ? 0.5608 0.6426 0.4000 0.0290  0.0396  -0.0123 132 THR B CA    
1931 C  C     . THR B 100 ? 0.5695 0.6744 0.3977 0.0287  0.0380  -0.0121 132 THR B C     
1932 O  O     . THR B 100 ? 0.5327 0.6449 0.3527 0.0301  0.0373  -0.0258 132 THR B O     
1933 C  CB    . THR B 100 ? 0.5826 0.6478 0.4284 0.0227  0.0345  -0.0116 132 THR B CB    
1934 O  OG1   . THR B 100 ? 0.6338 0.6943 0.4759 0.0207  0.0320  -0.0263 132 THR B OG1   
1935 C  CG2   . THR B 100 ? 0.5403 0.5863 0.3966 0.0233  0.0361  -0.0081 132 THR B CG2   
1936 N  N     . PRO B 101 ? 0.6364 0.7540 0.4649 0.0270  0.0378  0.0034  133 PRO B N     
1937 C  CA    . PRO B 101 ? 0.6897 0.8301 0.5078 0.0273  0.0361  0.0067  133 PRO B CA    
1938 C  C     . PRO B 101 ? 0.6455 0.7838 0.4622 0.0228  0.0293  0.0028  133 PRO B C     
1939 O  O     . PRO B 101 ? 0.6381 0.7580 0.4640 0.0184  0.0262  0.0044  133 PRO B O     
1940 C  CB    . PRO B 101 ? 0.6808 0.8301 0.5035 0.0266  0.0390  0.0267  133 PRO B CB    
1941 C  CG    . PRO B 101 ? 0.7144 0.8424 0.5512 0.0230  0.0388  0.0319  133 PRO B CG    
1942 C  CD    . PRO B 101 ? 0.6954 0.8081 0.5343 0.0251  0.0397  0.0183  133 PRO B CD    
1943 N  N     . PRO B 102 ? 0.6408 0.8000 0.4462 0.0242  0.0267  -0.0027 134 PRO B N     
1944 C  CA    . PRO B 102 ? 0.6233 0.7833 0.4277 0.0200  0.0199  -0.0097 134 PRO B CA    
1945 C  C     . PRO B 102 ? 0.6290 0.7871 0.4399 0.0168  0.0164  0.0069  134 PRO B C     
1946 O  O     . PRO B 102 ? 0.6519 0.8232 0.4612 0.0192  0.0181  0.0235  134 PRO B O     
1947 C  CB    . PRO B 102 ? 0.6425 0.8320 0.4323 0.0234  0.0184  -0.0181 134 PRO B CB    
1948 C  CG    . PRO B 102 ? 0.6654 0.8626 0.4493 0.0291  0.0250  -0.0223 134 PRO B CG    
1949 C  CD    . PRO B 102 ? 0.7066 0.8916 0.4994 0.0298  0.0300  -0.0055 134 PRO B CD    
1950 N  N     . GLY B 103 ? 0.5197 0.6608 0.3388 0.0117  0.0121  0.0026  135 GLY B N     
1951 C  CA    . GLY B 103 ? 0.4667 0.6075 0.2918 0.0089  0.0080  0.0144  135 GLY B CA    
1952 C  C     . GLY B 103 ? 0.6112 0.7386 0.4473 0.0081  0.0107  0.0307  135 GLY B C     
1953 O  O     . GLY B 103 ? 0.7327 0.8609 0.5741 0.0068  0.0081  0.0416  135 GLY B O     
1954 N  N     . LEU B 104 ? 0.5602 0.6761 0.4005 0.0090  0.0160  0.0320  136 LEU B N     
1955 C  CA    . LEU B 104 ? 0.5721 0.6789 0.4234 0.0080  0.0189  0.0460  136 LEU B CA    
1956 C  C     . LEU B 104 ? 0.6260 0.7106 0.4879 0.0049  0.0190  0.0420  136 LEU B C     
1957 O  O     . LEU B 104 ? 0.6458 0.7231 0.5180 0.0029  0.0199  0.0513  136 LEU B O     
1958 C  CB    . LEU B 104 ? 0.5623 0.6791 0.4116 0.0114  0.0253  0.0536  136 LEU B CB    
1959 C  CG    . LEU B 104 ? 0.6020 0.7430 0.4414 0.0151  0.0268  0.0619  136 LEU B CG    
1960 C  CD1   . LEU B 104 ? 0.6322 0.7817 0.4725 0.0175  0.0341  0.0707  136 LEU B CD1   
1961 C  CD2   . LEU B 104 ? 0.6197 0.7656 0.4622 0.0143  0.0238  0.0751  136 LEU B CD2   
1962 N  N     . CYS B 105 ? 0.5270 0.6012 0.3873 0.0048  0.0186  0.0286  137 CYS B N     
1963 C  CA    . CYS B 105 ? 0.5218 0.5776 0.3914 0.0034  0.0198  0.0272  137 CYS B CA    
1964 C  C     . CYS B 105 ? 0.4738 0.5173 0.3481 -0.0009 0.0155  0.0221  137 CYS B C     
1965 O  O     . CYS B 105 ? 0.4439 0.4900 0.3134 -0.0026 0.0125  0.0134  137 CYS B O     
1966 C  CB    . CYS B 105 ? 0.5618 0.6124 0.4290 0.0075  0.0239  0.0186  137 CYS B CB    
1967 S  SG    . CYS B 105 ? 0.6025 0.6689 0.4657 0.0127  0.0296  0.0240  137 CYS B SG    
1968 N  N     . PRO B 106 ? 0.4228 0.4547 0.3066 -0.0029 0.0154  0.0268  138 PRO B N     
1969 C  CA    . PRO B 106 ? 0.4247 0.4466 0.3136 -0.0071 0.0119  0.0235  138 PRO B CA    
1970 C  C     . PRO B 106 ? 0.5030 0.5098 0.3940 -0.0071 0.0138  0.0154  138 PRO B C     
1971 O  O     . PRO B 106 ? 0.4899 0.4911 0.3813 -0.0032 0.0178  0.0151  138 PRO B O     
1972 C  CB    . PRO B 106 ? 0.3944 0.4142 0.2927 -0.0087 0.0114  0.0335  138 PRO B CB    
1973 C  CG    . PRO B 106 ? 0.3907 0.4117 0.2911 -0.0056 0.0158  0.0377  138 PRO B CG    
1974 C  CD    . PRO B 106 ? 0.3828 0.4140 0.2741 -0.0021 0.0181  0.0358  138 PRO B CD    
1975 N  N     . LEU B 107 ? 0.4110 0.4118 0.3041 -0.0114 0.0112  0.0094  139 LEU B N     
1976 C  CA    . LEU B 107 ? 0.4431 0.4274 0.3411 -0.0125 0.0133  0.0045  139 LEU B CA    
1977 C  C     . LEU B 107 ? 0.4328 0.4108 0.3383 -0.0119 0.0144  0.0134  139 LEU B C     
1978 O  O     . LEU B 107 ? 0.4304 0.4147 0.3395 -0.0136 0.0119  0.0202  139 LEU B O     
1979 C  CB    . LEU B 107 ? 0.4255 0.4069 0.3261 -0.0187 0.0104  -0.0032 139 LEU B CB    
1980 C  CG    . LEU B 107 ? 0.6178 0.5939 0.5161 -0.0203 0.0118  -0.0171 139 LEU B CG    
1981 C  CD1   . LEU B 107 ? 0.6428 0.6131 0.5481 -0.0277 0.0099  -0.0234 139 LEU B CD1   
1982 C  CD2   . LEU B 107 ? 0.5096 0.4709 0.4086 -0.0153 0.0179  -0.0194 139 LEU B CD2   
1983 N  N     . ALA B 108 ? 0.3405 0.3070 0.2485 -0.0089 0.0184  0.0130  140 ALA B N     
1984 C  CA    . ALA B 108 ? 0.3900 0.3537 0.3040 -0.0073 0.0196  0.0208  140 ALA B CA    
1985 C  C     . ALA B 108 ? 0.3872 0.3363 0.3050 -0.0067 0.0228  0.0199  140 ALA B C     
1986 O  O     . ALA B 108 ? 0.4435 0.3824 0.3599 -0.0052 0.0259  0.0138  140 ALA B O     
1987 C  CB    . ALA B 108 ? 0.3920 0.3628 0.3051 -0.0015 0.0219  0.0255  140 ALA B CB    
1988 N  N     . GLY B 109 ? 0.3872 0.3357 0.3105 -0.0077 0.0226  0.0260  141 GLY B N     
1989 C  CA    . GLY B 109 ? 0.4097 0.3461 0.3374 -0.0070 0.0262  0.0281  141 GLY B CA    
1990 C  C     . GLY B 109 ? 0.4437 0.3836 0.3766 -0.0108 0.0244  0.0332  141 GLY B C     
1991 O  O     . GLY B 109 ? 0.4067 0.3576 0.3407 -0.0135 0.0204  0.0342  141 GLY B O     
1992 N  N     . ASN B 110 ? 0.4123 0.3427 0.3494 -0.0106 0.0282  0.0367  142 ASN B N     
1993 C  CA    . ASN B 110 ? 0.4969 0.4310 0.4392 -0.0140 0.0276  0.0415  142 ASN B CA    
1994 C  C     . ASN B 110 ? 0.5174 0.4477 0.4635 -0.0226 0.0256  0.0359  142 ASN B C     
1995 O  O     . ASN B 110 ? 0.4479 0.3656 0.3964 -0.0256 0.0286  0.0314  142 ASN B O     
1996 C  CB    . ASN B 110 ? 0.4758 0.4035 0.4207 -0.0093 0.0332  0.0497  142 ASN B CB    
1997 C  CG    . ASN B 110 ? 0.5453 0.4862 0.4882 -0.0020 0.0332  0.0565  142 ASN B CG    
1998 O  OD1   . ASN B 110 ? 0.5445 0.4843 0.4850 0.0056  0.0361  0.0598  142 ASN B OD1   
1999 N  ND2   . ASN B 110 ? 0.5470 0.5020 0.4918 -0.0040 0.0298  0.0578  142 ASN B ND2   
2000 N  N     . SER B 111 ? 0.4818 0.4236 0.4298 -0.0266 0.0210  0.0355  143 SER B N     
2001 C  CA    . SER B 111 ? 0.4981 0.4412 0.4502 -0.0343 0.0182  0.0301  143 SER B CA    
2002 C  C     . SER B 111 ? 0.5386 0.4771 0.4877 -0.0370 0.0172  0.0208  143 SER B C     
2003 O  O     . SER B 111 ? 0.5060 0.4382 0.4595 -0.0430 0.0182  0.0147  143 SER B O     
2004 C  CB    . SER B 111 ? 0.5438 0.4811 0.5033 -0.0384 0.0218  0.0330  143 SER B CB    
2005 O  OG    . SER B 111 ? 0.5284 0.4750 0.4903 -0.0364 0.0218  0.0402  143 SER B OG    
2006 N  N     . VAL B 112 ? 0.4876 0.4309 0.4296 -0.0329 0.0153  0.0191  144 VAL B N     
2007 C  CA    . VAL B 112 ? 0.5136 0.4539 0.4508 -0.0334 0.0153  0.0103  144 VAL B CA    
2008 C  C     . VAL B 112 ? 0.4749 0.4253 0.4123 -0.0395 0.0102  0.0028  144 VAL B C     
2009 O  O     . VAL B 112 ? 0.4036 0.3554 0.3370 -0.0407 0.0094  -0.0063 144 VAL B O     
2010 C  CB    . VAL B 112 ? 0.5324 0.4777 0.4619 -0.0266 0.0154  0.0120  144 VAL B CB    
2011 C  CG1   . VAL B 112 ? 0.4637 0.4247 0.3901 -0.0268 0.0104  0.0142  144 VAL B CG1   
2012 C  CG2   . VAL B 112 ? 0.5091 0.4474 0.4342 -0.0247 0.0181  0.0036  144 VAL B CG2   
2013 N  N     . HIS B 113 ? 0.4286 0.3879 0.3707 -0.0428 0.0067  0.0062  145 HIS B N     
2014 C  CA    . HIS B 113 ? 0.4882 0.4596 0.4314 -0.0480 0.0017  -0.0003 145 HIS B CA    
2015 C  C     . HIS B 113 ? 0.3175 0.2823 0.2664 -0.0553 0.0032  -0.0107 145 HIS B C     
2016 O  O     . HIS B 113 ? 0.4518 0.4261 0.3993 -0.0589 -0.0003 -0.0205 145 HIS B O     
2017 C  CB    . HIS B 113 ? 0.5396 0.5220 0.4880 -0.0490 -0.0019 0.0060  145 HIS B CB    
2018 C  CG    . HIS B 113 ? 0.4999 0.4755 0.4551 -0.0494 0.0014  0.0123  145 HIS B CG    
2019 N  ND1   . HIS B 113 ? 0.4953 0.4677 0.4587 -0.0554 0.0031  0.0103  145 HIS B ND1   
2020 C  CD2   . HIS B 113 ? 0.4966 0.4700 0.4518 -0.0445 0.0035  0.0204  145 HIS B CD2   
2021 C  CE1   . HIS B 113 ? 0.5218 0.4908 0.4889 -0.0536 0.0062  0.0179  145 HIS B CE1   
2022 N  NE2   . HIS B 113 ? 0.5041 0.4743 0.4660 -0.0470 0.0062  0.0233  145 HIS B NE2   
2023 N  N     . GLU B 114 ? 0.4817 0.4313 0.4376 -0.0575 0.0087  -0.0088 146 GLU B N     
2024 C  CA    . GLU B 114 ? 0.5083 0.4481 0.4718 -0.0651 0.0117  -0.0187 146 GLU B CA    
2025 C  C     . GLU B 114 ? 0.5055 0.4370 0.4645 -0.0637 0.0139  -0.0290 146 GLU B C     
2026 O  O     . GLU B 114 ? 0.5670 0.5011 0.5288 -0.0700 0.0126  -0.0427 146 GLU B O     
2027 C  CB    . GLU B 114 ? 0.5980 0.5225 0.5703 -0.0666 0.0183  -0.0113 146 GLU B CB    
2028 C  CG    . GLU B 114 ? 0.7550 0.6683 0.7388 -0.0759 0.0226  -0.0198 146 GLU B CG    
2029 C  CD    . GLU B 114 ? 0.8735 0.8011 0.8656 -0.0849 0.0186  -0.0240 146 GLU B CD    
2030 O  OE1   . GLU B 114 ? 0.8884 0.8325 0.8779 -0.0827 0.0135  -0.0179 146 GLU B OE1   
2031 O  OE2   . GLU B 114 ? 0.9287 0.8514 0.9312 -0.0941 0.0209  -0.0340 146 GLU B OE2   
2032 N  N     . ASP B 115 ? 0.4841 0.4067 0.4367 -0.0555 0.0174  -0.0236 147 ASP B N     
2033 C  CA    . ASP B 115 ? 0.5524 0.4692 0.4998 -0.0525 0.0194  -0.0332 147 ASP B CA    
2034 C  C     . ASP B 115 ? 0.5040 0.4406 0.4434 -0.0532 0.0131  -0.0421 147 ASP B C     
2035 O  O     . ASP B 115 ? 0.4930 0.4301 0.4314 -0.0557 0.0133  -0.0562 147 ASP B O     
2036 C  CB    . ASP B 115 ? 0.6278 0.5372 0.5694 -0.0425 0.0233  -0.0244 147 ASP B CB    
2037 C  CG    . ASP B 115 ? 0.7179 0.6123 0.6661 -0.0400 0.0291  -0.0133 147 ASP B CG    
2038 O  OD1   . ASP B 115 ? 0.7256 0.6268 0.6750 -0.0397 0.0274  -0.0029 147 ASP B OD1   
2039 O  OD2   . ASP B 115 ? 0.6842 0.5607 0.6364 -0.0378 0.0357  -0.0150 147 ASP B OD2   
2040 N  N     . LYS B 116 ? 0.4543 0.4082 0.3883 -0.0508 0.0077  -0.0340 148 LYS B N     
2041 C  CA    . LYS B 116 ? 0.4867 0.4614 0.4127 -0.0504 0.0019  -0.0394 148 LYS B CA    
2042 C  C     . LYS B 116 ? 0.4951 0.4806 0.4262 -0.0587 -0.0021 -0.0515 148 LYS B C     
2043 O  O     . LYS B 116 ? 0.5559 0.5550 0.4814 -0.0595 -0.0051 -0.0627 148 LYS B O     
2044 C  CB    . LYS B 116 ? 0.5279 0.5162 0.4497 -0.0457 -0.0019 -0.0262 148 LYS B CB    
2045 C  CG    . LYS B 116 ? 0.5815 0.5925 0.4955 -0.0443 -0.0074 -0.0282 148 LYS B CG    
2046 C  CD    . LYS B 116 ? 0.6711 0.6914 0.5822 -0.0388 -0.0093 -0.0138 148 LYS B CD    
2047 C  CE    . LYS B 116 ? 0.7491 0.7923 0.6524 -0.0362 -0.0140 -0.0133 148 LYS B CE    
2048 N  NZ    . LYS B 116 ? 0.7416 0.7993 0.6481 -0.0412 -0.0194 -0.0204 148 LYS B NZ    
2049 N  N     . LYS B 117 ? 0.4771 0.4593 0.4188 -0.0650 -0.0023 -0.0498 149 LYS B N     
2050 C  CA    . LYS B 117 ? 0.5377 0.5305 0.4867 -0.0740 -0.0056 -0.0623 149 LYS B CA    
2051 C  C     . LYS B 117 ? 0.5843 0.5667 0.5367 -0.0791 -0.0019 -0.0796 149 LYS B C     
2052 O  O     . LYS B 117 ? 0.5091 0.5076 0.4593 -0.0825 -0.0059 -0.0942 149 LYS B O     
2053 C  CB    . LYS B 117 ? 0.5230 0.5116 0.4843 -0.0799 -0.0047 -0.0567 149 LYS B CB    
2054 C  CG    . LYS B 117 ? 0.6719 0.6726 0.6432 -0.0903 -0.0078 -0.0692 149 LYS B CG    
2055 C  CD    . LYS B 117 ? 0.7938 0.7951 0.7764 -0.0948 -0.0074 -0.0612 149 LYS B CD    
2056 C  CE    . LYS B 117 ? 0.8510 0.8263 0.8411 -0.0962 0.0013  -0.0544 149 LYS B CE    
2057 N  NZ    . LYS B 117 ? 0.8751 0.8534 0.8745 -0.0993 0.0021  -0.0451 149 LYS B NZ    
2058 N  N     . PHE B 118 ? 0.4921 0.4484 0.4503 -0.0789 0.0059  -0.0782 150 PHE B N     
2059 C  CA    . PHE B 118 ? 0.4617 0.4041 0.4259 -0.0836 0.0107  -0.0945 150 PHE B CA    
2060 C  C     . PHE B 118 ? 0.4807 0.4309 0.4330 -0.0778 0.0095  -0.1047 150 PHE B C     
2061 O  O     . PHE B 118 ? 0.5030 0.4564 0.4580 -0.0830 0.0094  -0.1238 150 PHE B O     
2062 C  CB    . PHE B 118 ? 0.5784 0.4904 0.5513 -0.0826 0.0201  -0.0878 150 PHE B CB    
2063 C  CG    . PHE B 118 ? 0.6384 0.5406 0.6271 -0.0922 0.0234  -0.0866 150 PHE B CG    
2064 C  CD1   . PHE B 118 ? 0.6156 0.5211 0.6066 -0.0918 0.0226  -0.0706 150 PHE B CD1   
2065 C  CD2   . PHE B 118 ? 0.6603 0.5509 0.6627 -0.1020 0.0277  -0.1021 150 PHE B CD2   
2066 C  CE1   . PHE B 118 ? 0.6796 0.5782 0.6851 -0.1006 0.0262  -0.0689 150 PHE B CE1   
2067 C  CE2   . PHE B 118 ? 0.7173 0.5993 0.7356 -0.1116 0.0316  -0.1002 150 PHE B CE2   
2068 C  CZ    . PHE B 118 ? 0.7044 0.5911 0.7238 -0.1107 0.0309  -0.0830 150 PHE B CZ    
2069 N  N     . LEU B 119 ? 0.4904 0.4455 0.4303 -0.0676 0.0086  -0.0931 151 LEU B N     
2070 C  CA    . LEU B 119 ? 0.5195 0.4841 0.4477 -0.0616 0.0080  -0.1013 151 LEU B CA    
2071 C  C     . LEU B 119 ? 0.4775 0.4733 0.3978 -0.0634 0.0001  -0.1092 151 LEU B C     
2072 O  O     . LEU B 119 ? 0.4891 0.4956 0.4042 -0.0635 -0.0007 -0.1250 151 LEU B O     
2073 C  CB    . LEU B 119 ? 0.4860 0.4475 0.4049 -0.0509 0.0101  -0.0857 151 LEU B CB    
2074 C  CG    . LEU B 119 ? 0.4666 0.4016 0.3906 -0.0463 0.0181  -0.0793 151 LEU B CG    
2075 C  CD1   . LEU B 119 ? 0.4079 0.3460 0.3237 -0.0368 0.0186  -0.0635 151 LEU B CD1   
2076 C  CD2   . LEU B 119 ? 0.5133 0.4349 0.4396 -0.0456 0.0236  -0.0950 151 LEU B CD2   
2077 N  N     . ASP B 120 ? 0.4798 0.4920 0.3992 -0.0641 -0.0057 -0.0984 152 ASP B N     
2078 C  CA    . ASP B 120 ? 0.5245 0.5680 0.4376 -0.0652 -0.0134 -0.1042 152 ASP B CA    
2079 C  C     . ASP B 120 ? 0.5584 0.6092 0.4795 -0.0750 -0.0153 -0.1259 152 ASP B C     
2080 O  O     . ASP B 120 ? 0.6494 0.7249 0.5634 -0.0752 -0.0198 -0.1387 152 ASP B O     
2081 C  CB    . ASP B 120 ? 0.5591 0.6151 0.4735 -0.0642 -0.0184 -0.0884 152 ASP B CB    
2082 C  CG    . ASP B 120 ? 0.6629 0.7208 0.5681 -0.0546 -0.0181 -0.0699 152 ASP B CG    
2083 O  OD1   . ASP B 120 ? 0.7121 0.7741 0.6069 -0.0484 -0.0165 -0.0700 152 ASP B OD1   
2084 O  OD2   . ASP B 120 ? 0.7020 0.7579 0.6115 -0.0534 -0.0191 -0.0557 152 ASP B OD2   
2085 N  N     . LYS B 121 ? 0.4886 0.5197 0.4250 -0.0836 -0.0115 -0.1306 153 LYS B N     
2086 C  CA    . LYS B 121 ? 0.5010 0.5380 0.4478 -0.0945 -0.0125 -0.1526 153 LYS B CA    
2087 C  C     . LYS B 121 ? 0.6339 0.6599 0.5802 -0.0950 -0.0076 -0.1714 153 LYS B C     
2088 O  O     . LYS B 121 ? 0.6566 0.7023 0.6017 -0.0992 -0.0112 -0.1918 153 LYS B O     
2089 C  CB    . LYS B 121 ? 0.5835 0.6031 0.5484 -0.1043 -0.0091 -0.1514 153 LYS B CB    
2090 C  CG    . LYS B 121 ? 0.6293 0.6575 0.6075 -0.1172 -0.0104 -0.1746 153 LYS B CG    
2091 C  CD    . LYS B 121 ? 0.6195 0.6325 0.6169 -0.1278 -0.0064 -0.1725 153 LYS B CD    
2092 C  CE    . LYS B 121 ? 0.8171 0.8375 0.8297 -0.1418 -0.0068 -0.1975 153 LYS B CE    
2093 N  NZ    . LYS B 121 ? 0.8734 0.8733 0.9071 -0.1529 -0.0003 -0.1961 153 LYS B NZ    
2094 N  N     . TYR B 122 ? 0.6151 0.6111 0.5627 -0.0902 0.0005  -0.1656 154 TYR B N     
2095 C  CA    . TYR B 122 ? 0.5590 0.5381 0.5112 -0.0915 0.0069  -0.1840 154 TYR B CA    
2096 C  C     . TYR B 122 ? 0.5183 0.4998 0.4557 -0.0802 0.0087  -0.1845 154 TYR B C     
2097 O  O     . TYR B 122 ? 0.6028 0.5790 0.5420 -0.0808 0.0123  -0.2037 154 TYR B O     
2098 C  CB    . TYR B 122 ? 0.6351 0.5762 0.6034 -0.0950 0.0165  -0.1796 154 TYR B CB    
2099 C  CG    . TYR B 122 ? 0.6246 0.5614 0.6109 -0.1085 0.0168  -0.1859 154 TYR B CG    
2100 C  CD1   . TYR B 122 ? 0.7094 0.6513 0.7068 -0.1196 0.0167  -0.2113 154 TYR B CD1   
2101 C  CD2   . TYR B 122 ? 0.6553 0.5848 0.6481 -0.1106 0.0175  -0.1673 154 TYR B CD2   
2102 C  CE1   . TYR B 122 ? 0.7583 0.6975 0.7739 -0.1329 0.0174  -0.2174 154 TYR B CE1   
2103 C  CE2   . TYR B 122 ? 0.7425 0.6698 0.7524 -0.1231 0.0184  -0.1725 154 TYR B CE2   
2104 C  CZ    . TYR B 122 ? 0.7929 0.7249 0.8146 -0.1345 0.0184  -0.1972 154 TYR B CZ    
2105 O  OH    . TYR B 122 ? 0.7838 0.7146 0.8241 -0.1480 0.0197  -0.2027 154 TYR B OH    
2106 N  N     . MET B 123 ? 0.5466 0.5360 0.4709 -0.0703 0.0068  -0.1649 155 MET B N     
2107 C  CA    . MET B 123 ? 0.5911 0.5867 0.5016 -0.0597 0.0084  -0.1641 155 MET B CA    
2108 C  C     . MET B 123 ? 0.6012 0.6283 0.4966 -0.0543 0.0012  -0.1524 155 MET B C     
2109 O  O     . MET B 123 ? 0.5282 0.5538 0.4168 -0.0466 0.0020  -0.1334 155 MET B O     
2110 C  CB    . MET B 123 ? 0.6193 0.5872 0.5314 -0.0520 0.0160  -0.1501 155 MET B CB    
2111 C  CG    . MET B 123 ? 0.6811 0.6176 0.6071 -0.0546 0.0245  -0.1606 155 MET B CG    
2112 S  SD    . MET B 123 ? 0.6100 0.5215 0.5347 -0.0421 0.0331  -0.1464 155 MET B SD    
2113 C  CE    . MET B 123 ? 0.6091 0.4844 0.5530 -0.0466 0.0429  -0.1590 155 MET B CE    
2114 N  N     . PRO B 124 ? 0.5939 0.6508 0.4845 -0.0579 -0.0057 -0.1635 156 PRO B N     
2115 C  CA    . PRO B 124 ? 0.5116 0.5979 0.3898 -0.0527 -0.0123 -0.1493 156 PRO B CA    
2116 C  C     . PRO B 124 ? 0.4957 0.5947 0.3584 -0.0421 -0.0108 -0.1429 156 PRO B C     
2117 O  O     . PRO B 124 ? 0.5344 0.6444 0.3898 -0.0363 -0.0128 -0.1234 156 PRO B O     
2118 C  CB    . PRO B 124 ? 0.5337 0.6496 0.4121 -0.0592 -0.0196 -0.1650 156 PRO B CB    
2119 C  CG    . PRO B 124 ? 0.6214 0.7297 0.5063 -0.0653 -0.0164 -0.1917 156 PRO B CG    
2120 C  CD    . PRO B 124 ? 0.5764 0.6429 0.4737 -0.0669 -0.0077 -0.1892 156 PRO B CD    
2121 N  N     . GLN B 125 ? 0.5043 0.6021 0.3627 -0.0395 -0.0068 -0.1587 157 GLN B N     
2122 C  CA    . GLN B 125 ? 0.6263 0.7370 0.4705 -0.0294 -0.0046 -0.1523 157 GLN B CA    
2123 C  C     . GLN B 125 ? 0.6037 0.6918 0.4495 -0.0235 0.0009  -0.1322 157 GLN B C     
2124 O  O     . GLN B 125 ? 0.6231 0.7236 0.4599 -0.0169 0.0007  -0.1156 157 GLN B O     
2125 C  CB    . GLN B 125 ? 0.6952 0.8094 0.5358 -0.0280 -0.0010 -0.1757 157 GLN B CB    
2126 C  CG    . GLN B 125 ? 0.8817 1.0262 0.7179 -0.0326 -0.0069 -0.1972 157 GLN B CG    
2127 C  CD    . GLN B 125 ? 1.0043 1.1886 0.8254 -0.0278 -0.0135 -0.1861 157 GLN B CD    
2128 O  OE1   . GLN B 125 ? 1.0494 1.2527 0.8717 -0.0323 -0.0205 -0.1854 157 GLN B OE1   
2129 N  NE2   . GLN B 125 ? 1.0254 1.2233 0.8330 -0.0181 -0.0109 -0.1764 157 GLN B NE2   
2130 N  N     . PHE B 126 ? 0.5450 0.6008 0.4030 -0.0259 0.0060  -0.1333 158 PHE B N     
2131 C  CA    . PHE B 126 ? 0.5304 0.5664 0.3912 -0.0206 0.0107  -0.1151 158 PHE B CA    
2132 C  C     . PHE B 126 ? 0.5586 0.6026 0.4183 -0.0205 0.0066  -0.0941 158 PHE B C     
2133 O  O     . PHE B 126 ? 0.6005 0.6477 0.4554 -0.0143 0.0082  -0.0791 158 PHE B O     
2134 C  CB    . PHE B 126 ? 0.4984 0.5015 0.3733 -0.0240 0.0159  -0.1185 158 PHE B CB    
2135 C  CG    . PHE B 126 ? 0.5122 0.4973 0.3905 -0.0185 0.0201  -0.1004 158 PHE B CG    
2136 C  CD1   . PHE B 126 ? 0.5033 0.4797 0.3795 -0.0102 0.0262  -0.0996 158 PHE B CD1   
2137 C  CD2   . PHE B 126 ? 0.4716 0.4508 0.3557 -0.0214 0.0180  -0.0851 158 PHE B CD2   
2138 C  CE1   . PHE B 126 ? 0.4972 0.4607 0.3768 -0.0051 0.0295  -0.0837 158 PHE B CE1   
2139 C  CE2   . PHE B 126 ? 0.5229 0.4890 0.4100 -0.0164 0.0215  -0.0700 158 PHE B CE2   
2140 C  CZ    . PHE B 126 ? 0.5337 0.4927 0.4185 -0.0084 0.0271  -0.0693 158 PHE B CZ    
2141 N  N     . MET B 127 ? 0.5165 0.5643 0.3820 -0.0274 0.0015  -0.0935 159 MET B N     
2142 C  CA    . MET B 127 ? 0.4348 0.4899 0.3006 -0.0269 -0.0022 -0.0748 159 MET B CA    
2143 C  C     . MET B 127 ? 0.4905 0.5742 0.3442 -0.0218 -0.0058 -0.0674 159 MET B C     
2144 O  O     . MET B 127 ? 0.4954 0.5821 0.3483 -0.0183 -0.0060 -0.0495 159 MET B O     
2145 C  CB    . MET B 127 ? 0.5495 0.6030 0.4249 -0.0350 -0.0065 -0.0770 159 MET B CB    
2146 C  CG    . MET B 127 ? 0.6117 0.6367 0.5001 -0.0396 -0.0023 -0.0779 159 MET B CG    
2147 S  SD    . MET B 127 ? 0.5964 0.6026 0.4869 -0.0334 0.0026  -0.0584 159 MET B SD    
2148 C  CE    . MET B 127 ? 0.5996 0.6229 0.4886 -0.0324 -0.0030 -0.0416 159 MET B CE    
2149 N  N     . LYS B 128 ? 0.4709 0.5765 0.3159 -0.0213 -0.0081 -0.0808 160 LYS B N     
2150 C  CA    . LYS B 128 ? 0.5708 0.7061 0.4033 -0.0155 -0.0108 -0.0727 160 LYS B CA    
2151 C  C     . LYS B 128 ? 0.6238 0.7574 0.4499 -0.0080 -0.0051 -0.0615 160 LYS B C     
2152 O  O     . LYS B 128 ? 0.6055 0.7566 0.4248 -0.0031 -0.0056 -0.0465 160 LYS B O     
2153 C  CB    . LYS B 128 ? 0.6472 0.8089 0.4711 -0.0162 -0.0144 -0.0914 160 LYS B CB    
2154 C  CG    . LYS B 128 ? 0.7621 0.9594 0.5751 -0.0117 -0.0195 -0.0818 160 LYS B CG    
2155 C  CD    . LYS B 128 ? 0.8953 1.1221 0.7008 -0.0133 -0.0244 -0.1021 160 LYS B CD    
2156 C  CE    . LYS B 128 ? 0.9790 1.2031 0.7959 -0.0228 -0.0295 -0.1159 160 LYS B CE    
2157 N  NZ    . LYS B 128 ? 0.9802 1.2068 0.7987 -0.0284 -0.0293 -0.1449 160 LYS B NZ    
2158 N  N     . HIS B 129 ? 0.5838 0.6973 0.4127 -0.0068 0.0007  -0.0682 161 HIS B N     
2159 C  CA    . HIS B 129 ? 0.5695 0.6815 0.3945 0.0000  0.0062  -0.0573 161 HIS B CA    
2160 C  C     . HIS B 129 ? 0.5182 0.6182 0.3504 0.0003  0.0072  -0.0371 161 HIS B C     
2161 O  O     . HIS B 129 ? 0.5365 0.6413 0.3660 0.0051  0.0109  -0.0253 161 HIS B O     
2162 C  CB    . HIS B 129 ? 0.5922 0.6867 0.4194 0.0023  0.0121  -0.0697 161 HIS B CB    
2163 C  CG    . HIS B 129 ? 0.5804 0.6780 0.4032 0.0096  0.0177  -0.0612 161 HIS B CG    
2164 N  ND1   . HIS B 129 ? 0.5615 0.6832 0.3724 0.0149  0.0193  -0.0638 161 HIS B ND1   
2165 C  CD2   . HIS B 129 ? 0.5624 0.6448 0.3913 0.0124  0.0220  -0.0502 161 HIS B CD2   
2166 C  CE1   . HIS B 129 ? 0.6119 0.7320 0.4227 0.0202  0.0248  -0.0545 161 HIS B CE1   
2167 N  NE2   . HIS B 129 ? 0.5618 0.6586 0.3836 0.0188  0.0262  -0.0466 161 HIS B NE2   
2168 N  N     . LEU B 130 ? 0.4375 0.5236 0.2795 -0.0048 0.0044  -0.0335 162 LEU B N     
2169 C  CA    . LEU B 130 ? 0.5226 0.5954 0.3730 -0.0049 0.0058  -0.0178 162 LEU B CA    
2170 C  C     . LEU B 130 ? 0.6104 0.6954 0.4619 -0.0057 0.0018  -0.0043 162 LEU B C     
2171 O  O     . LEU B 130 ? 0.5626 0.6643 0.4099 -0.0067 -0.0029 -0.0068 162 LEU B O     
2172 C  CB    . LEU B 130 ? 0.5080 0.5566 0.3692 -0.0092 0.0064  -0.0220 162 LEU B CB    
2173 C  CG    . LEU B 130 ? 0.5954 0.6272 0.4583 -0.0076 0.0114  -0.0326 162 LEU B CG    
2174 C  CD1   . LEU B 130 ? 0.5758 0.5853 0.4498 -0.0114 0.0124  -0.0328 162 LEU B CD1   
2175 C  CD2   . LEU B 130 ? 0.5692 0.6014 0.4292 -0.0008 0.0164  -0.0260 162 LEU B CD2   
2176 N  N     . HIS B 131 ? 0.6197 0.6967 0.4779 -0.0048 0.0038  0.0098  163 HIS B N     
2177 C  CA    . HIS B 131 ? 0.6324 0.7147 0.4955 -0.0055 0.0010  0.0229  163 HIS B CA    
2178 C  C     . HIS B 131 ? 0.6706 0.7447 0.5414 -0.0106 -0.0033 0.0187  163 HIS B C     
2179 O  O     . HIS B 131 ? 0.6668 0.7273 0.5409 -0.0140 -0.0031 0.0081  163 HIS B O     
2180 C  CB    . HIS B 131 ? 0.7066 0.7806 0.5769 -0.0041 0.0051  0.0360  163 HIS B CB    
2181 C  CG    . HIS B 131 ? 0.7171 0.7980 0.5923 -0.0035 0.0041  0.0505  163 HIS B CG    
2182 N  ND1   . HIS B 131 ? 0.7198 0.7904 0.6061 -0.0061 0.0024  0.0553  163 HIS B ND1   
2183 C  CD2   . HIS B 131 ? 0.7585 0.8553 0.6297 0.0001  0.0051  0.0618  163 HIS B CD2   
2184 C  CE1   . HIS B 131 ? 0.7392 0.8174 0.6291 -0.0041 0.0025  0.0682  163 HIS B CE1   
2185 N  NE2   . HIS B 131 ? 0.7357 0.8293 0.6166 -0.0003 0.0043  0.0733  163 HIS B NE2   
2186 N  N     . TYR B 132 ? 0.6295 0.7120 0.5037 -0.0107 -0.0068 0.0277  164 TYR B N     
2187 C  CA    . TYR B 132 ? 0.5697 0.6479 0.4517 -0.0151 -0.0110 0.0245  164 TYR B CA    
2188 C  C     . TYR B 132 ? 0.5548 0.6144 0.4481 -0.0171 -0.0090 0.0297  164 TYR B C     
2189 O  O     . TYR B 132 ? 0.6171 0.6689 0.5168 -0.0214 -0.0107 0.0242  164 TYR B O     
2190 C  CB    . TYR B 132 ? 0.6372 0.7344 0.5185 -0.0132 -0.0157 0.0315  164 TYR B CB    
2191 C  CG    . TYR B 132 ? 0.7100 0.8105 0.5944 -0.0084 -0.0138 0.0491  164 TYR B CG    
2192 C  CD1   . TYR B 132 ? 0.7695 0.8594 0.6659 -0.0091 -0.0136 0.0572  164 TYR B CD1   
2193 C  CD2   . TYR B 132 ? 0.7885 0.9029 0.6648 -0.0032 -0.0116 0.0575  164 TYR B CD2   
2194 C  CE1   . TYR B 132 ? 0.8882 0.9789 0.7897 -0.0052 -0.0110 0.0723  164 TYR B CE1   
2195 C  CE2   . TYR B 132 ? 0.9124 1.0280 0.7935 0.0006  -0.0087 0.0744  164 TYR B CE2   
2196 C  CZ    . TYR B 132 ? 0.9842 1.0868 0.8786 -0.0006 -0.0083 0.0814  164 TYR B CZ    
2197 O  OH    . TYR B 132 ? 1.0732 1.1747 0.9747 0.0029  -0.0047 0.0972  164 TYR B OH    
2198 N  N     . ARG B 133 ? 0.5293 0.5834 0.4258 -0.0145 -0.0052 0.0395  165 ARG B N     
2199 C  CA    . ARG B 133 ? 0.5707 0.6103 0.4776 -0.0162 -0.0035 0.0427  165 ARG B CA    
2200 C  C     . ARG B 133 ? 0.5169 0.5430 0.4240 -0.0177 -0.0008 0.0345  165 ARG B C     
2201 O  O     . ARG B 133 ? 0.4662 0.4917 0.3663 -0.0163 0.0012  0.0283  165 ARG B O     
2202 C  CB    . ARG B 133 ? 0.7155 0.7547 0.6273 -0.0136 0.0000  0.0538  165 ARG B CB    
2203 C  CG    . ARG B 133 ? 0.8215 0.8692 0.7376 -0.0118 -0.0014 0.0646  165 ARG B CG    
2204 C  CD    . ARG B 133 ? 0.8994 0.9397 0.8270 -0.0117 0.0022  0.0728  165 ARG B CD    
2205 N  NE    . ARG B 133 ? 1.0065 1.0537 0.9384 -0.0089 0.0029  0.0849  165 ARG B NE    
2206 C  CZ    . ARG B 133 ? 1.0765 1.1254 1.0146 -0.0078 0.0001  0.0893  165 ARG B CZ    
2207 N  NH1   . ARG B 133 ? 1.0539 1.0997 0.9948 -0.0102 -0.0038 0.0817  165 ARG B NH1   
2208 N  NH2   . ARG B 133 ? 1.1122 1.1665 1.0548 -0.0041 0.0016  0.1020  165 ARG B NH2   
2209 N  N     . ILE B 134 ? 0.4069 0.4227 0.3223 -0.0199 -0.0005 0.0348  166 ILE B N     
2210 C  CA    . ILE B 134 ? 0.4004 0.4037 0.3169 -0.0204 0.0024  0.0298  166 ILE B CA    
2211 C  C     . ILE B 134 ? 0.4232 0.4224 0.3463 -0.0188 0.0049  0.0359  166 ILE B C     
2212 O  O     . ILE B 134 ? 0.4241 0.4273 0.3532 -0.0191 0.0040  0.0417  166 ILE B O     
2213 C  CB    . ILE B 134 ? 0.4643 0.4610 0.3843 -0.0248 0.0010  0.0237  166 ILE B CB    
2214 C  CG1   . ILE B 134 ? 0.4950 0.4935 0.4235 -0.0270 -0.0013 0.0284  166 ILE B CG1   
2215 C  CG2   . ILE B 134 ? 0.4428 0.4455 0.3578 -0.0273 -0.0017 0.0152  166 ILE B CG2   
2216 C  CD1   . ILE B 134 ? 0.5836 0.5753 0.5174 -0.0313 -0.0013 0.0243  166 ILE B CD1   
2217 N  N     . ILE B 135 ? 0.3787 0.3705 0.3013 -0.0168 0.0082  0.0338  167 ILE B N     
2218 C  CA    . ILE B 135 ? 0.3651 0.3556 0.2936 -0.0152 0.0102  0.0377  167 ILE B CA    
2219 C  C     . ILE B 135 ? 0.4067 0.3888 0.3377 -0.0159 0.0111  0.0357  167 ILE B C     
2220 O  O     . ILE B 135 ? 0.3597 0.3345 0.2876 -0.0134 0.0140  0.0334  167 ILE B O     
2221 C  CB    . ILE B 135 ? 0.4311 0.4243 0.3572 -0.0109 0.0136  0.0388  167 ILE B CB    
2222 C  CG1   . ILE B 135 ? 0.4185 0.4209 0.3435 -0.0108 0.0137  0.0423  167 ILE B CG1   
2223 C  CG2   . ILE B 135 ? 0.4068 0.4016 0.3393 -0.0092 0.0152  0.0411  167 ILE B CG2   
2224 C  CD1   . ILE B 135 ? 0.5227 0.5305 0.4477 -0.0076 0.0173  0.0440  167 ILE B CD1   
2225 N  N     . ASP B 136 ? 0.3113 0.2943 0.2483 -0.0188 0.0092  0.0372  168 ASP B N     
2226 C  CA    . ASP B 136 ? 0.3846 0.3613 0.3243 -0.0201 0.0103  0.0366  168 ASP B CA    
2227 C  C     . ASP B 136 ? 0.4093 0.3892 0.3526 -0.0168 0.0124  0.0404  168 ASP B C     
2228 O  O     . ASP B 136 ? 0.3700 0.3576 0.3186 -0.0175 0.0109  0.0418  168 ASP B O     
2229 C  CB    . ASP B 136 ? 0.3913 0.3703 0.3356 -0.0250 0.0072  0.0357  168 ASP B CB    
2230 C  CG    . ASP B 136 ? 0.4992 0.4722 0.4469 -0.0273 0.0091  0.0354  168 ASP B CG    
2231 O  OD1   . ASP B 136 ? 0.4675 0.4336 0.4139 -0.0246 0.0130  0.0371  168 ASP B OD1   
2232 O  OD2   . ASP B 136 ? 0.5931 0.5691 0.5454 -0.0315 0.0070  0.0344  168 ASP B OD2   
2233 N  N     . VAL B 137 ? 0.3405 0.3153 0.2812 -0.0129 0.0159  0.0416  169 VAL B N     
2234 C  CA    . VAL B 137 ? 0.3481 0.3294 0.2912 -0.0087 0.0177  0.0454  169 VAL B CA    
2235 C  C     . VAL B 137 ? 0.3810 0.3655 0.3289 -0.0110 0.0172  0.0473  169 VAL B C     
2236 O  O     . VAL B 137 ? 0.3211 0.3166 0.2722 -0.0091 0.0170  0.0486  169 VAL B O     
2237 C  CB    . VAL B 137 ? 0.3910 0.3664 0.3304 -0.0027 0.0219  0.0478  169 VAL B CB    
2238 C  CG1   . VAL B 137 ? 0.3422 0.3284 0.2834 0.0028  0.0234  0.0525  169 VAL B CG1   
2239 C  CG2   . VAL B 137 ? 0.3442 0.3180 0.2791 -0.0001 0.0226  0.0451  169 VAL B CG2   
2240 N  N     . SER B 138 ? 0.3031 0.2800 0.2521 -0.0154 0.0171  0.0465  170 SER B N     
2241 C  CA    . SER B 138 ? 0.3682 0.3492 0.3219 -0.0176 0.0173  0.0487  170 SER B CA    
2242 C  C     . SER B 138 ? 0.2849 0.2771 0.2437 -0.0197 0.0137  0.0465  170 SER B C     
2243 O  O     . SER B 138 ? 0.3574 0.3580 0.3201 -0.0194 0.0140  0.0477  170 SER B O     
2244 C  CB    . SER B 138 ? 0.4048 0.3759 0.3603 -0.0227 0.0184  0.0479  170 SER B CB    
2245 O  OG    . SER B 138 ? 0.5256 0.4850 0.4791 -0.0204 0.0233  0.0507  170 SER B OG    
2246 N  N     . THR B 139 ? 0.3061 0.2989 0.2652 -0.0214 0.0106  0.0435  171 THR B N     
2247 C  CA    . THR B 139 ? 0.3334 0.3348 0.2989 -0.0223 0.0081  0.0420  171 THR B CA    
2248 C  C     . THR B 139 ? 0.3822 0.3927 0.3505 -0.0190 0.0093  0.0415  171 THR B C     
2249 O  O     . THR B 139 ? 0.3064 0.3255 0.2808 -0.0192 0.0089  0.0396  171 THR B O     
2250 C  CB    . THR B 139 ? 0.3286 0.3284 0.2938 -0.0235 0.0058  0.0413  171 THR B CB    
2251 O  OG1   . THR B 139 ? 0.3435 0.3403 0.3075 -0.0267 0.0037  0.0406  171 THR B OG1   
2252 C  CG2   . THR B 139 ? 0.3076 0.3138 0.2810 -0.0235 0.0046  0.0408  171 THR B CG2   
2253 N  N     . VAL B 140 ? 0.3318 0.3423 0.2963 -0.0160 0.0108  0.0421  172 VAL B N     
2254 C  CA    . VAL B 140 ? 0.3063 0.3284 0.2739 -0.0130 0.0117  0.0406  172 VAL B CA    
2255 C  C     . VAL B 140 ? 0.2914 0.3209 0.2579 -0.0101 0.0132  0.0424  172 VAL B C     
2256 O  O     . VAL B 140 ? 0.3318 0.3753 0.3026 -0.0087 0.0130  0.0394  172 VAL B O     
2257 C  CB    . VAL B 140 ? 0.3489 0.3711 0.3128 -0.0101 0.0131  0.0413  172 VAL B CB    
2258 C  CG1   . VAL B 140 ? 0.3239 0.3610 0.2930 -0.0082 0.0134  0.0382  172 VAL B CG1   
2259 C  CG2   . VAL B 140 ? 0.3345 0.3496 0.2977 -0.0127 0.0122  0.0413  172 VAL B CG2   
2260 N  N     . LYS B 141 ? 0.3256 0.3468 0.2869 -0.0091 0.0152  0.0472  173 LYS B N     
2261 C  CA    . LYS B 141 ? 0.3087 0.3368 0.2689 -0.0058 0.0177  0.0515  173 LYS B CA    
2262 C  C     . LYS B 141 ? 0.3086 0.3458 0.2742 -0.0086 0.0165  0.0492  173 LYS B C     
2263 O  O     . LYS B 141 ? 0.3177 0.3705 0.2845 -0.0056 0.0172  0.0489  173 LYS B O     
2264 C  CB    . LYS B 141 ? 0.3013 0.3152 0.2571 -0.0051 0.0211  0.0576  173 LYS B CB    
2265 C  CG    . LYS B 141 ? 0.3718 0.3904 0.3275 -0.0028 0.0247  0.0644  173 LYS B CG    
2266 C  CD    . LYS B 141 ? 0.4290 0.4313 0.3855 -0.0068 0.0276  0.0680  173 LYS B CD    
2267 C  CE    . LYS B 141 ? 0.4641 0.4494 0.4173 -0.0052 0.0300  0.0692  173 LYS B CE    
2268 N  NZ    . LYS B 141 ? 0.5192 0.5057 0.4690 0.0035  0.0344  0.0771  173 LYS B NZ    
2269 N  N     . GLU B 142 ? 0.2755 0.3053 0.2445 -0.0139 0.0147  0.0470  174 GLU B N     
2270 C  CA    . GLU B 142 ? 0.3495 0.3881 0.3246 -0.0162 0.0137  0.0443  174 GLU B CA    
2271 C  C     . GLU B 142 ? 0.3311 0.3817 0.3124 -0.0153 0.0117  0.0374  174 GLU B C     
2272 O  O     . GLU B 142 ? 0.3597 0.4243 0.3446 -0.0141 0.0121  0.0343  174 GLU B O     
2273 C  CB    . GLU B 142 ? 0.3113 0.3409 0.2893 -0.0213 0.0119  0.0435  174 GLU B CB    
2274 C  CG    . GLU B 142 ? 0.4212 0.4415 0.3964 -0.0238 0.0143  0.0481  174 GLU B CG    
2275 C  CD    . GLU B 142 ? 0.5348 0.5631 0.5111 -0.0229 0.0178  0.0525  174 GLU B CD    
2276 O  OE1   . GLU B 142 ? 0.5420 0.5831 0.5232 -0.0230 0.0170  0.0500  174 GLU B OE1   
2277 O  OE2   . GLU B 142 ? 0.6191 0.6412 0.5920 -0.0218 0.0219  0.0588  174 GLU B OE2   
2278 N  N     . LEU B 143 ? 0.2875 0.3335 0.2708 -0.0162 0.0101  0.0344  175 LEU B N     
2279 C  CA    . LEU B 143 ? 0.2968 0.3521 0.2884 -0.0163 0.0092  0.0272  175 LEU B CA    
2280 C  C     . LEU B 143 ? 0.3510 0.4228 0.3418 -0.0127 0.0103  0.0243  175 LEU B C     
2281 O  O     . LEU B 143 ? 0.3138 0.3990 0.3117 -0.0127 0.0098  0.0167  175 LEU B O     
2282 C  CB    . LEU B 143 ? 0.3182 0.3648 0.3124 -0.0181 0.0084  0.0266  175 LEU B CB    
2283 C  CG    . LEU B 143 ? 0.3504 0.3854 0.3465 -0.0208 0.0069  0.0291  175 LEU B CG    
2284 C  CD1   . LEU B 143 ? 0.3104 0.3395 0.3090 -0.0218 0.0069  0.0300  175 LEU B CD1   
2285 C  CD2   . LEU B 143 ? 0.3329 0.3716 0.3380 -0.0218 0.0059  0.0255  175 LEU B CD2   
2286 N  N     . CYS B 144 ? 0.2993 0.3716 0.2819 -0.0090 0.0117  0.0297  176 CYS B N     
2287 C  CA    . CYS B 144 ? 0.2404 0.3315 0.2214 -0.0043 0.0125  0.0282  176 CYS B CA    
2288 C  C     . CYS B 144 ? 0.3023 0.4067 0.2815 -0.0017 0.0136  0.0298  176 CYS B C     
2289 O  O     . CYS B 144 ? 0.3291 0.4546 0.3110 0.0006  0.0132  0.0237  176 CYS B O     
2290 C  CB    . CYS B 144 ? 0.3048 0.3924 0.2778 0.0003  0.0141  0.0352  176 CYS B CB    
2291 S  SG    . CYS B 144 ? 0.3444 0.4579 0.3145 0.0081  0.0149  0.0357  176 CYS B SG    
2292 N  N     . ARG B 145 ? 0.3012 0.3952 0.2762 -0.0022 0.0154  0.0374  177 ARG B N     
2293 C  CA    . ARG B 145 ? 0.3981 0.5047 0.3719 -0.0003 0.0173  0.0403  177 ARG B CA    
2294 C  C     . ARG B 145 ? 0.3967 0.5158 0.3787 -0.0028 0.0154  0.0300  177 ARG B C     
2295 O  O     . ARG B 145 ? 0.2982 0.4383 0.2802 0.0004  0.0163  0.0275  177 ARG B O     
2296 C  CB    . ARG B 145 ? 0.3929 0.4837 0.3639 -0.0026 0.0198  0.0493  177 ARG B CB    
2297 C  CG    . ARG B 145 ? 0.5105 0.6121 0.4828 -0.0028 0.0221  0.0520  177 ARG B CG    
2298 C  CD    . ARG B 145 ? 0.5831 0.6688 0.5538 -0.0057 0.0254  0.0614  177 ARG B CD    
2299 N  NE    . ARG B 145 ? 0.7721 0.8642 0.7476 -0.0091 0.0266  0.0612  177 ARG B NE    
2300 C  CZ    . ARG B 145 ? 0.8077 0.8900 0.7889 -0.0153 0.0248  0.0577  177 ARG B CZ    
2301 N  NH1   . ARG B 145 ? 0.8048 0.8709 0.7868 -0.0186 0.0217  0.0543  177 ARG B NH1   
2302 N  NH2   . ARG B 145 ? 0.8380 0.9290 0.8241 -0.0178 0.0261  0.0576  177 ARG B NH2   
2303 N  N     . ARG B 146 ? 0.3029 0.4105 0.2924 -0.0076 0.0132  0.0240  178 ARG B N     
2304 C  CA    . ARG B 146 ? 0.3059 0.4229 0.3050 -0.0094 0.0121  0.0141  178 ARG B CA    
2305 C  C     . ARG B 146 ? 0.3592 0.4905 0.3648 -0.0086 0.0109  0.0026  178 ARG B C     
2306 O  O     . ARG B 146 ? 0.2978 0.4487 0.3070 -0.0069 0.0111  -0.0055 178 ARG B O     
2307 C  CB    . ARG B 146 ? 0.2859 0.3858 0.2915 -0.0137 0.0105  0.0133  178 ARG B CB    
2308 C  CG    . ARG B 146 ? 0.2396 0.3325 0.2425 -0.0154 0.0113  0.0204  178 ARG B CG    
2309 C  CD    . ARG B 146 ? 0.2728 0.3499 0.2800 -0.0188 0.0092  0.0211  178 ARG B CD    
2310 N  NE    . ARG B 146 ? 0.3397 0.4142 0.3467 -0.0210 0.0095  0.0255  178 ARG B NE    
2311 C  CZ    . ARG B 146 ? 0.3484 0.4152 0.3487 -0.0228 0.0107  0.0328  178 ARG B CZ    
2312 N  NH1   . ARG B 146 ? 0.2999 0.3598 0.2926 -0.0216 0.0119  0.0369  178 ARG B NH1   
2313 N  NH2   . ARG B 146 ? 0.2816 0.3477 0.2842 -0.0259 0.0111  0.0353  178 ARG B NH2   
2314 N  N     . TRP B 147 ? 0.2619 0.3851 0.2698 -0.0101 0.0100  0.0010  179 TRP B N     
2315 C  CA    . TRP B 147 ? 0.2645 0.3982 0.2823 -0.0115 0.0092  -0.0112 179 TRP B CA    
2316 C  C     . TRP B 147 ? 0.3596 0.5143 0.3732 -0.0078 0.0091  -0.0138 179 TRP B C     
2317 O  O     . TRP B 147 ? 0.2968 0.4684 0.3190 -0.0088 0.0085  -0.0265 179 TRP B O     
2318 C  CB    . TRP B 147 ? 0.2695 0.3849 0.2941 -0.0157 0.0089  -0.0114 179 TRP B CB    
2319 C  CG    . TRP B 147 ? 0.2744 0.3718 0.3040 -0.0184 0.0088  -0.0086 179 TRP B CG    
2320 C  CD1   . TRP B 147 ? 0.2396 0.3379 0.2722 -0.0181 0.0086  -0.0100 179 TRP B CD1   
2321 C  CD2   . TRP B 147 ? 0.2819 0.3606 0.3139 -0.0210 0.0087  -0.0035 179 TRP B CD2   
2322 N  NE1   . TRP B 147 ? 0.3230 0.4045 0.3602 -0.0200 0.0082  -0.0060 179 TRP B NE1   
2323 C  CE2   . TRP B 147 ? 0.3114 0.3810 0.3479 -0.0216 0.0082  -0.0016 179 TRP B CE2   
2324 C  CE3   . TRP B 147 ? 0.2875 0.3583 0.3184 -0.0223 0.0092  0.0002  179 TRP B CE3   
2325 C  CZ2   . TRP B 147 ? 0.3108 0.3646 0.3498 -0.0230 0.0079  0.0043  179 TRP B CZ2   
2326 C  CZ3   . TRP B 147 ? 0.2722 0.3269 0.3053 -0.0241 0.0094  0.0060  179 TRP B CZ3   
2327 C  CH2   . TRP B 147 ? 0.3159 0.3627 0.3528 -0.0243 0.0086  0.0083  179 TRP B CH2   
2328 N  N     . TYR B 148 ? 0.2788 0.4335 0.2803 -0.0035 0.0099  -0.0026 180 TYR B N     
2329 C  CA    . TYR B 148 ? 0.2852 0.4607 0.2821 0.0016  0.0098  -0.0029 180 TYR B CA    
2330 C  C     . TYR B 148 ? 0.3442 0.5268 0.3288 0.0084  0.0117  0.0095  180 TYR B C     
2331 O  O     . TYR B 148 ? 0.3317 0.5072 0.3084 0.0124  0.0131  0.0202  180 TYR B O     
2332 C  CB    . TYR B 148 ? 0.2912 0.4580 0.2885 0.0009  0.0095  -0.0009 180 TYR B CB    
2333 C  CG    . TYR B 148 ? 0.2816 0.4404 0.2919 -0.0061 0.0088  -0.0108 180 TYR B CG    
2334 C  CD1   . TYR B 148 ? 0.2036 0.3372 0.2165 -0.0106 0.0093  -0.0069 180 TYR B CD1   
2335 C  CD2   . TYR B 148 ? 0.2710 0.4488 0.2918 -0.0083 0.0079  -0.0240 180 TYR B CD2   
2336 C  CE1   . TYR B 148 ? 0.2489 0.3748 0.2742 -0.0162 0.0095  -0.0136 180 TYR B CE1   
2337 C  CE2   . TYR B 148 ? 0.3329 0.5016 0.3678 -0.0152 0.0084  -0.0323 180 TYR B CE2   
2338 C  CZ    . TYR B 148 ? 0.3042 0.4462 0.3411 -0.0188 0.0095  -0.0260 180 TYR B CZ    
2339 O  OH    . TYR B 148 ? 0.3042 0.4368 0.3554 -0.0250 0.0108  -0.0319 180 TYR B OH    
2340 N  N     . PRO B 149 ? 0.3174 0.5142 0.3008 0.0102  0.0125  0.0087  181 PRO B N     
2341 C  CA    . PRO B 149 ? 0.3535 0.5556 0.3261 0.0164  0.0155  0.0227  181 PRO B CA    
2342 C  C     . PRO B 149 ? 0.3689 0.5919 0.3343 0.0248  0.0161  0.0281  181 PRO B C     
2343 O  O     . PRO B 149 ? 0.3841 0.6002 0.3411 0.0302  0.0192  0.0431  181 PRO B O     
2344 C  CB    . PRO B 149 ? 0.3385 0.5562 0.3131 0.0161  0.0163  0.0182  181 PRO B CB    
2345 C  CG    . PRO B 149 ? 0.3830 0.6144 0.3681 0.0127  0.0132  -0.0005 181 PRO B CG    
2346 C  CD    . PRO B 149 ? 0.3279 0.5370 0.3203 0.0071  0.0114  -0.0049 181 PRO B CD    
2347 N  N     . GLU B 150 ? 0.3610 0.6099 0.3304 0.0262  0.0133  0.0160  182 GLU B N     
2348 C  CA    . GLU B 150 ? 0.3415 0.6141 0.3047 0.0348  0.0132  0.0205  182 GLU B CA    
2349 C  C     . GLU B 150 ? 0.3678 0.6212 0.3280 0.0368  0.0140  0.0300  182 GLU B C     
2350 O  O     . GLU B 150 ? 0.4037 0.6589 0.3552 0.0452  0.0167  0.0444  182 GLU B O     
2351 C  CB    . GLU B 150 ? 0.4247 0.7287 0.3953 0.0339  0.0095  0.0026  182 GLU B CB    
2352 C  CG    . GLU B 150 ? 0.6012 0.9342 0.5667 0.0428  0.0084  0.0055  182 GLU B CG    
2353 C  CD    . GLU B 150 ? 0.7675 1.1335 0.7420 0.0406  0.0045  -0.0148 182 GLU B CD    
2354 O  OE1   . GLU B 150 ? 0.8047 1.1814 0.7826 0.0416  0.0026  -0.0187 182 GLU B OE1   
2355 O  OE2   . GLU B 150 ? 0.8145 1.1966 0.7937 0.0377  0.0035  -0.0277 182 GLU B OE2   
2356 N  N     . GLU B 151 ? 0.3129 0.5476 0.2805 0.0296  0.0124  0.0225  183 GLU B N     
2357 C  CA    . GLU B 151 ? 0.3405 0.5570 0.3052 0.0312  0.0135  0.0303  183 GLU B CA    
2358 C  C     . GLU B 151 ? 0.3706 0.5596 0.3282 0.0326  0.0170  0.0448  183 GLU B C     
2359 O  O     . GLU B 151 ? 0.3737 0.5540 0.3256 0.0383  0.0193  0.0551  183 GLU B O     
2360 C  CB    . GLU B 151 ? 0.3615 0.5646 0.3358 0.0228  0.0116  0.0199  183 GLU B CB    
2361 C  CG    . GLU B 151 ? 0.3751 0.6034 0.3589 0.0207  0.0089  0.0056  183 GLU B CG    
2362 C  CD    . GLU B 151 ? 0.4256 0.6669 0.4184 0.0154  0.0072  -0.0087 183 GLU B CD    
2363 O  OE1   . GLU B 151 ? 0.4270 0.6613 0.4174 0.0146  0.0080  -0.0065 183 GLU B OE1   
2364 O  OE2   . GLU B 151 ? 0.4878 0.7467 0.4913 0.0116  0.0054  -0.0230 183 GLU B OE2   
2365 N  N     . TYR B 152 ? 0.3203 0.4957 0.2791 0.0272  0.0177  0.0450  184 TYR B N     
2366 C  CA    . TYR B 152 ? 0.3419 0.4921 0.2959 0.0267  0.0211  0.0567  184 TYR B CA    
2367 C  C     . TYR B 152 ? 0.4170 0.5744 0.3634 0.0357  0.0253  0.0710  184 TYR B C     
2368 O  O     . TYR B 152 ? 0.3726 0.5098 0.3154 0.0380  0.0290  0.0818  184 TYR B O     
2369 C  CB    . TYR B 152 ? 0.3285 0.4683 0.2867 0.0193  0.0207  0.0531  184 TYR B CB    
2370 C  CG    . TYR B 152 ? 0.3818 0.4966 0.3373 0.0169  0.0238  0.0627  184 TYR B CG    
2371 C  CD1   . TYR B 152 ? 0.3887 0.4799 0.3442 0.0135  0.0236  0.0631  184 TYR B CD1   
2372 C  CD2   . TYR B 152 ? 0.4650 0.5815 0.4186 0.0177  0.0273  0.0707  184 TYR B CD2   
2373 C  CE1   . TYR B 152 ? 0.3802 0.4504 0.3344 0.0106  0.0262  0.0695  184 TYR B CE1   
2374 C  CE2   . TYR B 152 ? 0.5120 0.6062 0.4654 0.0143  0.0304  0.0781  184 TYR B CE2   
2375 C  CZ    . TYR B 152 ? 0.5113 0.5825 0.4652 0.0106  0.0297  0.0766  184 TYR B CZ    
2376 O  OH    . TYR B 152 ? 0.5241 0.5746 0.4788 0.0064  0.0327  0.0817  184 TYR B OH    
2377 N  N     . GLU B 153 ? 0.3189 0.5054 0.2631 0.0411  0.0254  0.0715  185 GLU B N     
2378 C  CA    . GLU B 153 ? 0.4110 0.6066 0.3479 0.0507  0.0300  0.0874  185 GLU B CA    
2379 C  C     . GLU B 153 ? 0.4540 0.6489 0.3868 0.0597  0.0316  0.0961  185 GLU B C     
2380 O  O     . GLU B 153 ? 0.4255 0.6119 0.3537 0.0667  0.0369  0.1120  185 GLU B O     
2381 C  CB    . GLU B 153 ? 0.4002 0.6322 0.3347 0.0555  0.0293  0.0854  185 GLU B CB    
2382 C  CG    . GLU B 153 ? 0.5149 0.7557 0.4422 0.0642  0.0352  0.1038  185 GLU B CG    
2383 C  CD    . GLU B 153 ? 0.6024 0.8184 0.5311 0.0582  0.0399  0.1120  185 GLU B CD    
2384 O  OE1   . GLU B 153 ? 0.6039 0.8123 0.5383 0.0487  0.0375  0.1010  185 GLU B OE1   
2385 O  OE2   . GLU B 153 ? 0.6199 0.8244 0.5454 0.0632  0.0462  0.1294  185 GLU B OE2   
2386 N  N     . PHE B 154 ? 0.3890 0.5924 0.3245 0.0597  0.0276  0.0862  186 PHE B N     
2387 C  CA    . PHE B 154 ? 0.4076 0.6136 0.3403 0.0686  0.0287  0.0930  186 PHE B CA    
2388 C  C     . PHE B 154 ? 0.4668 0.6401 0.4012 0.0649  0.0299  0.0933  186 PHE B C     
2389 O  O     . PHE B 154 ? 0.4875 0.6612 0.4205 0.0719  0.0309  0.0973  186 PHE B O     
2390 C  CB    . PHE B 154 ? 0.4102 0.6495 0.3456 0.0713  0.0240  0.0820  186 PHE B CB    
2391 C  CG    . PHE B 154 ? 0.5430 0.8196 0.4763 0.0759  0.0224  0.0798  186 PHE B CG    
2392 C  CD1   . PHE B 154 ? 0.6155 0.9105 0.5409 0.0885  0.0256  0.0953  186 PHE B CD1   
2393 C  CD2   . PHE B 154 ? 0.4834 0.7772 0.4230 0.0681  0.0181  0.0625  186 PHE B CD2   
2394 C  CE1   . PHE B 154 ? 0.5561 0.8887 0.4789 0.0932  0.0241  0.0931  186 PHE B CE1   
2395 C  CE2   . PHE B 154 ? 0.4991 0.8293 0.4365 0.0724  0.0166  0.0585  186 PHE B CE2   
2396 C  CZ    . PHE B 154 ? 0.5220 0.8734 0.4501 0.0850  0.0194  0.0739  186 PHE B CZ    
2397 N  N     . ALA B 155 ? 0.3957 0.5433 0.3330 0.0547  0.0298  0.0888  187 ALA B N     
2398 C  CA    . ALA B 155 ? 0.4455 0.5651 0.3837 0.0511  0.0306  0.0879  187 ALA B CA    
2399 C  C     . ALA B 155 ? 0.5908 0.6914 0.5251 0.0580  0.0366  0.1017  187 ALA B C     
2400 O  O     . ALA B 155 ? 0.6874 0.7882 0.6196 0.0619  0.0406  0.1126  187 ALA B O     
2401 C  CB    . ALA B 155 ? 0.4253 0.5259 0.3673 0.0393  0.0288  0.0801  187 ALA B CB    
2402 N  N     . PRO B 156 ? 0.6960 0.7800 0.6300 0.0598  0.0379  0.1016  188 PRO B N     
2403 C  CA    . PRO B 156 ? 0.8502 0.9125 0.7824 0.0659  0.0442  0.1127  188 PRO B CA    
2404 C  C     . PRO B 156 ? 0.8853 0.9204 0.8196 0.0572  0.0468  0.1132  188 PRO B C     
2405 O  O     . PRO B 156 ? 0.8730 0.9022 0.8093 0.0468  0.0430  0.1030  188 PRO B O     
2406 C  CB    . PRO B 156 ? 0.8158 0.8712 0.7480 0.0689  0.0439  0.1082  188 PRO B CB    
2407 C  CG    . PRO B 156 ? 0.6794 0.7408 0.6139 0.0593  0.0381  0.0943  188 PRO B CG    
2408 C  CD    . PRO B 156 ? 0.6171 0.7029 0.5532 0.0567  0.0343  0.0910  188 PRO B CD    
2409 N  N     . SER B 161 ? 1.1753 0.9581 1.1681 0.0552  0.1165  0.1528  193 SER B N     
2410 C  CA    . SER B 161 ? 1.1968 0.9501 1.1987 0.0493  0.1206  0.1390  193 SER B CA    
2411 C  C     . SER B 161 ? 1.0955 0.8543 1.0941 0.0353  0.1113  0.1166  193 SER B C     
2412 O  O     . SER B 161 ? 1.0652 0.8432 1.0530 0.0372  0.1027  0.1083  193 SER B O     
2413 C  CB    . SER B 161 ? 1.2543 0.9977 1.2557 0.0634  0.1244  0.1395  193 SER B CB    
2414 O  OG    . SER B 161 ? 1.2281 0.9961 1.2168 0.0689  0.1153  0.1327  193 SER B OG    
2415 N  N     . HIS B 162 ? 0.9545 0.6974 0.9631 0.0214  0.1135  0.1073  194 HIS B N     
2416 C  CA    . HIS B 162 ? 0.8716 0.6211 0.8779 0.0083  0.1050  0.0869  194 HIS B CA    
2417 C  C     . HIS B 162 ? 0.7702 0.5042 0.7782 0.0084  0.1057  0.0697  194 HIS B C     
2418 O  O     . HIS B 162 ? 0.6863 0.4027 0.7044 -0.0016 0.1086  0.0564  194 HIS B O     
2419 C  CB    . HIS B 162 ? 0.9733 0.7180 0.9898 -0.0066 0.1063  0.0840  194 HIS B CB    
2420 C  CG    . HIS B 162 ? 1.0375 0.8062 1.0487 -0.0094 0.1012  0.0930  194 HIS B CG    
2421 N  ND1   . HIS B 162 ? 1.0364 0.8284 1.0383 -0.0139 0.0904  0.0838  194 HIS B ND1   
2422 C  CD2   . HIS B 162 ? 1.0575 0.8311 1.0719 -0.0078 0.1060  0.1103  194 HIS B CD2   
2423 C  CE1   . HIS B 162 ? 1.0139 0.8231 1.0140 -0.0150 0.0886  0.0937  194 HIS B CE1   
2424 N  NE2   . HIS B 162 ? 1.0335 0.8333 1.0405 -0.0114 0.0978  0.1096  194 HIS B NE2   
2425 N  N     . ARG B 163 ? 0.6287 0.3716 0.6270 0.0199  0.1030  0.0695  195 ARG B N     
2426 C  CA    . ARG B 163 ? 0.6284 0.3629 0.6255 0.0218  0.1027  0.0534  195 ARG B CA    
2427 C  C     . ARG B 163 ? 0.5199 0.2806 0.5029 0.0218  0.0921  0.0447  195 ARG B C     
2428 O  O     . ARG B 163 ? 0.5783 0.3604 0.5528 0.0265  0.0872  0.0546  195 ARG B O     
2429 C  CB    . ARG B 163 ? 0.5497 0.2686 0.5502 0.0370  0.1113  0.0614  195 ARG B CB    
2430 C  CG    . ARG B 163 ? 0.7333 0.4237 0.7493 0.0383  0.1233  0.0722  195 ARG B CG    
2431 C  CD    . ARG B 163 ? 0.8797 0.5426 0.9089 0.0289  0.1288  0.0541  195 ARG B CD    
2432 N  NE    . ARG B 163 ? 1.1359 0.7971 1.1610 0.0336  0.1272  0.0370  195 ARG B NE    
2433 C  CZ    . ARG B 163 ? 1.2722 0.9223 1.2988 0.0483  0.1334  0.0409  195 ARG B CZ    
2434 N  NH1   . ARG B 163 ? 1.2961 0.9358 1.3282 0.0604  0.1417  0.0623  195 ARG B NH1   
2435 N  NH2   . ARG B 163 ? 1.3055 0.9567 1.3280 0.0517  0.1317  0.0238  195 ARG B NH2   
2436 N  N     . ALA B 164 ? 0.5105 0.2699 0.4917 0.0165  0.0890  0.0260  196 ALA B N     
2437 C  CA    . ALA B 164 ? 0.4791 0.2628 0.4484 0.0133  0.0792  0.0175  196 ALA B CA    
2438 C  C     . ALA B 164 ? 0.4607 0.2607 0.4202 0.0254  0.0770  0.0247  196 ALA B C     
2439 O  O     . ALA B 164 ? 0.5115 0.3335 0.4635 0.0247  0.0702  0.0291  196 ALA B O     
2440 C  CB    . ALA B 164 ? 0.4777 0.2579 0.4469 0.0063  0.0773  -0.0035 196 ALA B CB    
2441 N  N     . LEU B 165 ? 0.4981 0.2881 0.4590 0.0366  0.0829  0.0254  197 LEU B N     
2442 C  CA    . LEU B 165 ? 0.4838 0.2913 0.4366 0.0478  0.0809  0.0305  197 LEU B CA    
2443 C  C     . LEU B 165 ? 0.4631 0.2854 0.4139 0.0534  0.0795  0.0481  197 LEU B C     
2444 O  O     . LEU B 165 ? 0.4958 0.3414 0.4393 0.0546  0.0735  0.0502  197 LEU B O     
2445 C  CB    . LEU B 165 ? 0.5212 0.3144 0.4774 0.0594  0.0883  0.0280  197 LEU B CB    
2446 C  CG    . LEU B 165 ? 0.5233 0.3353 0.4722 0.0710  0.0867  0.0304  197 LEU B CG    
2447 C  CD1   . LEU B 165 ? 0.4771 0.3106 0.4163 0.0643  0.0788  0.0199  197 LEU B CD1   
2448 C  CD2   . LEU B 165 ? 0.4873 0.2837 0.4409 0.0823  0.0946  0.0261  197 LEU B CD2   
2449 N  N     . ASP B 166 ? 0.5008 0.3105 0.4587 0.0567  0.0854  0.0607  198 ASP B N     
2450 C  CA    . ASP B 166 ? 0.5168 0.3429 0.4725 0.0621  0.0842  0.0771  198 ASP B CA    
2451 C  C     . ASP B 166 ? 0.4661 0.3109 0.4172 0.0515  0.0761  0.0752  198 ASP B C     
2452 O  O     . ASP B 166 ? 0.5515 0.4196 0.4972 0.0548  0.0713  0.0803  198 ASP B O     
2453 C  CB    . ASP B 166 ? 0.5261 0.3349 0.4904 0.0663  0.0927  0.0913  198 ASP B CB    
2454 C  CG    . ASP B 166 ? 0.7440 0.5300 0.7152 0.0768  0.1019  0.0932  198 ASP B CG    
2455 O  OD1   . ASP B 166 ? 0.7024 0.4979 0.6700 0.0896  0.1025  0.0967  198 ASP B OD1   
2456 O  OD2   . ASP B 166 ? 0.7880 0.5471 0.7694 0.0722  0.1088  0.0908  198 ASP B OD2   
2457 N  N     . ALA B 167 ? 0.4850 0.3207 0.4393 0.0388  0.0745  0.0670  199 ALA B N     
2458 C  CA    . ALA B 167 ? 0.5067 0.3588 0.4580 0.0294  0.0673  0.0654  199 ALA B CA    
2459 C  C     . ALA B 167 ? 0.4464 0.3179 0.3897 0.0285  0.0599  0.0578  199 ALA B C     
2460 O  O     . ALA B 167 ? 0.4335 0.3240 0.3737 0.0276  0.0550  0.0617  199 ALA B O     
2461 C  CB    . ALA B 167 ? 0.5226 0.3622 0.4799 0.0166  0.0673  0.0573  199 ALA B CB    
2462 N  N     . ILE B 168 ? 0.4005 0.2680 0.3411 0.0287  0.0595  0.0469  200 ILE B N     
2463 C  CA    . ILE B 168 ? 0.4462 0.3322 0.3798 0.0274  0.0532  0.0411  200 ILE B CA    
2464 C  C     . ILE B 168 ? 0.3965 0.2984 0.3271 0.0372  0.0531  0.0485  200 ILE B C     
2465 O  O     . ILE B 168 ? 0.4654 0.3859 0.3930 0.0353  0.0480  0.0488  200 ILE B O     
2466 C  CB    . ILE B 168 ? 0.5209 0.4012 0.4517 0.0247  0.0529  0.0274  200 ILE B CB    
2467 C  CG1   . ILE B 168 ? 0.5450 0.4442 0.4691 0.0205  0.0463  0.0227  200 ILE B CG1   
2468 C  CG2   . ILE B 168 ? 0.4601 0.3321 0.3908 0.0349  0.0586  0.0256  200 ILE B CG2   
2469 C  CD1   . ILE B 168 ? 0.5604 0.4666 0.4854 0.0109  0.0409  0.0232  200 ILE B CD1   
2470 N  N     . SER B 169 ? 0.4742 0.3697 0.4067 0.0479  0.0588  0.0547  201 SER B N     
2471 C  CA    . SER B 169 ? 0.4918 0.4057 0.4225 0.0577  0.0585  0.0622  201 SER B CA    
2472 C  C     . SER B 169 ? 0.4338 0.3638 0.3651 0.0561  0.0551  0.0705  201 SER B C     
2473 O  O     . SER B 169 ? 0.4452 0.3968 0.3747 0.0567  0.0509  0.0706  201 SER B O     
2474 C  CB    . SER B 169 ? 0.5429 0.4468 0.4765 0.0705  0.0656  0.0688  201 SER B CB    
2475 O  OG    . SER B 169 ? 0.6973 0.6205 0.6305 0.0803  0.0654  0.0793  201 SER B OG    
2476 N  N     . GLU B 170 ? 0.4197 0.3402 0.3543 0.0537  0.0573  0.0769  202 GLU B N     
2477 C  CA    . GLU B 170 ? 0.4171 0.3541 0.3520 0.0522  0.0545  0.0838  202 GLU B CA    
2478 C  C     . GLU B 170 ? 0.3525 0.3002 0.2862 0.0415  0.0476  0.0758  202 GLU B C     
2479 O  O     . GLU B 170 ? 0.3678 0.3350 0.3014 0.0412  0.0441  0.0777  202 GLU B O     
2480 C  CB    . GLU B 170 ? 0.5140 0.4384 0.4528 0.0519  0.0592  0.0929  202 GLU B CB    
2481 C  CG    . GLU B 170 ? 0.8639 0.7796 0.8049 0.0642  0.0667  0.1045  202 GLU B CG    
2482 C  CD    . GLU B 170 ? 1.1223 1.0225 1.0688 0.0630  0.0729  0.1145  202 GLU B CD    
2483 O  OE1   . GLU B 170 ? 1.1930 1.1011 1.1397 0.0723  0.0767  0.1289  202 GLU B OE1   
2484 O  OE2   . GLU B 170 ? 1.1853 1.0668 1.1361 0.0528  0.0741  0.1081  202 GLU B OE2   
2485 N  N     . SER B 171 ? 0.3878 0.3240 0.3212 0.0330  0.0459  0.0667  203 SER B N     
2486 C  CA    . SER B 171 ? 0.3837 0.3301 0.3164 0.0242  0.0398  0.0604  203 SER B CA    
2487 C  C     . SER B 171 ? 0.4617 0.4252 0.3922 0.0267  0.0368  0.0580  203 SER B C     
2488 O  O     . SER B 171 ? 0.3509 0.3290 0.2832 0.0235  0.0330  0.0577  203 SER B O     
2489 C  CB    . SER B 171 ? 0.4691 0.4025 0.4013 0.0163  0.0386  0.0518  203 SER B CB    
2490 O  OG    . SER B 171 ? 0.6064 0.5246 0.5426 0.0125  0.0416  0.0528  203 SER B OG    
2491 N  N     . ILE B 172 ? 0.4271 0.3889 0.3551 0.0323  0.0390  0.0558  204 ILE B N     
2492 C  CA    . ILE B 172 ? 0.3931 0.3720 0.3204 0.0345  0.0372  0.0540  204 ILE B CA    
2493 C  C     . ILE B 172 ? 0.3634 0.3606 0.2937 0.0393  0.0365  0.0596  204 ILE B C     
2494 O  O     . ILE B 172 ? 0.3767 0.3900 0.3097 0.0359  0.0332  0.0573  204 ILE B O     
2495 C  CB    . ILE B 172 ? 0.4364 0.4114 0.3608 0.0409  0.0406  0.0512  204 ILE B CB    
2496 C  CG1   . ILE B 172 ? 0.3861 0.3491 0.3069 0.0353  0.0402  0.0431  204 ILE B CG1   
2497 C  CG2   . ILE B 172 ? 0.3893 0.3844 0.3145 0.0442  0.0397  0.0509  204 ILE B CG2   
2498 C  CD1   . ILE B 172 ? 0.4036 0.3629 0.3213 0.0415  0.0439  0.0385  204 ILE B CD1   
2499 N  N     . LYS B 173 ? 0.3583 0.3540 0.2888 0.0474  0.0399  0.0669  205 LYS B N     
2500 C  CA    . LYS B 173 ? 0.3692 0.3865 0.3017 0.0530  0.0389  0.0721  205 LYS B CA    
2501 C  C     . LYS B 173 ? 0.4168 0.4434 0.3518 0.0457  0.0351  0.0710  205 LYS B C     
2502 O  O     . LYS B 173 ? 0.3609 0.4090 0.2988 0.0456  0.0323  0.0689  205 LYS B O     
2503 C  CB    . LYS B 173 ? 0.4940 0.5086 0.4257 0.0644  0.0438  0.0823  205 LYS B CB    
2504 C  CG    . LYS B 173 ? 0.7295 0.7664 0.6621 0.0699  0.0428  0.0894  205 LYS B CG    
2505 C  CD    . LYS B 173 ? 0.9003 0.9663 0.8349 0.0725  0.0393  0.0853  205 LYS B CD    
2506 C  CE    . LYS B 173 ? 0.9322 1.0229 0.8669 0.0807  0.0389  0.0924  205 LYS B CE    
2507 N  NZ    . LYS B 173 ? 0.8875 0.9681 0.8194 0.0914  0.0444  0.1059  205 LYS B NZ    
2508 N  N     . GLU B 174 ? 0.4026 0.4145 0.3375 0.0395  0.0352  0.0714  206 GLU B N     
2509 C  CA    . GLU B 174 ? 0.4309 0.4516 0.3686 0.0331  0.0319  0.0699  206 GLU B CA    
2510 C  C     . GLU B 174 ? 0.3631 0.3925 0.3041 0.0260  0.0275  0.0614  206 GLU B C     
2511 O  O     . GLU B 174 ? 0.3578 0.4043 0.3028 0.0245  0.0250  0.0588  206 GLU B O     
2512 C  CB    . GLU B 174 ? 0.3716 0.3749 0.3094 0.0276  0.0331  0.0714  206 GLU B CB    
2513 C  CG    . GLU B 174 ? 0.4246 0.4378 0.3653 0.0232  0.0310  0.0718  206 GLU B CG    
2514 C  CD    . GLU B 174 ? 0.4851 0.4830 0.4273 0.0159  0.0313  0.0712  206 GLU B CD    
2515 O  OE1   . GLU B 174 ? 0.4685 0.4479 0.4097 0.0148  0.0340  0.0715  206 GLU B OE1   
2516 O  OE2   . GLU B 174 ? 0.4293 0.4346 0.3745 0.0111  0.0291  0.0695  206 GLU B OE2   
2517 N  N     . LEU B 175 ? 0.3494 0.3678 0.2892 0.0220  0.0270  0.0572  207 LEU B N     
2518 C  CA    . LEU B 175 ? 0.2958 0.3215 0.2394 0.0160  0.0240  0.0515  207 LEU B CA    
2519 C  C     . LEU B 175 ? 0.3409 0.3854 0.2881 0.0193  0.0239  0.0499  207 LEU B C     
2520 O  O     . LEU B 175 ? 0.3281 0.3839 0.2820 0.0146  0.0217  0.0456  207 LEU B O     
2521 C  CB    . LEU B 175 ? 0.3568 0.3699 0.2971 0.0124  0.0240  0.0488  207 LEU B CB    
2522 C  CG    . LEU B 175 ? 0.3453 0.3642 0.2898 0.0064  0.0216  0.0455  207 LEU B CG    
2523 C  CD1   . LEU B 175 ? 0.3479 0.3694 0.2984 0.0011  0.0189  0.0443  207 LEU B CD1   
2524 C  CD2   . LEU B 175 ? 0.2614 0.2709 0.2012 0.0039  0.0217  0.0442  207 LEU B CD2   
2525 N  N     . GLN B 176 ? 0.3349 0.3834 0.2792 0.0273  0.0264  0.0528  208 GLN B N     
2526 C  CA    . GLN B 176 ? 0.3315 0.4011 0.2801 0.0306  0.0262  0.0509  208 GLN B CA    
2527 C  C     . GLN B 176 ? 0.3567 0.4457 0.3099 0.0315  0.0242  0.0500  208 GLN B C     
2528 O  O     . GLN B 176 ? 0.3081 0.4147 0.2687 0.0281  0.0224  0.0440  208 GLN B O     
2529 C  CB    . GLN B 176 ? 0.3586 0.4295 0.3033 0.0405  0.0295  0.0548  208 GLN B CB    
2530 C  CG    . GLN B 176 ? 0.4840 0.5783 0.4337 0.0438  0.0294  0.0523  208 GLN B CG    
2531 C  CD    . GLN B 176 ? 0.5491 0.6457 0.5034 0.0362  0.0290  0.0467  208 GLN B CD    
2532 O  OE1   . GLN B 176 ? 0.6211 0.7063 0.5715 0.0361  0.0310  0.0468  208 GLN B OE1   
2533 N  NE2   . GLN B 176 ? 0.4895 0.6015 0.4528 0.0299  0.0268  0.0416  208 GLN B NE2   
2534 N  N     . PHE B 177 ? 0.3381 0.4253 0.2876 0.0357  0.0249  0.0555  209 PHE B N     
2535 C  CA    . PHE B 177 ? 0.3595 0.4672 0.3120 0.0368  0.0229  0.0544  209 PHE B CA    
2536 C  C     . PHE B 177 ? 0.3680 0.4779 0.3273 0.0268  0.0199  0.0460  209 PHE B C     
2537 O  O     . PHE B 177 ? 0.3156 0.4464 0.2817 0.0251  0.0178  0.0392  209 PHE B O     
2538 C  CB    . PHE B 177 ? 0.3485 0.4517 0.2954 0.0426  0.0251  0.0635  209 PHE B CB    
2539 C  CG    . PHE B 177 ? 0.3531 0.4784 0.3017 0.0436  0.0233  0.0626  209 PHE B CG    
2540 C  CD1   . PHE B 177 ? 0.3799 0.5026 0.3312 0.0362  0.0216  0.0583  209 PHE B CD1   
2541 C  CD2   . PHE B 177 ? 0.4012 0.5524 0.3487 0.0528  0.0233  0.0656  209 PHE B CD2   
2542 C  CE1   . PHE B 177 ? 0.3891 0.5339 0.3418 0.0375  0.0201  0.0562  209 PHE B CE1   
2543 C  CE2   . PHE B 177 ? 0.3924 0.5674 0.3407 0.0541  0.0215  0.0638  209 PHE B CE2   
2544 C  CZ    . PHE B 177 ? 0.3914 0.5629 0.3422 0.0463  0.0201  0.0587  209 PHE B CZ    
2545 N  N     . TYR B 178 ? 0.2895 0.3787 0.2480 0.0204  0.0197  0.0459  210 TYR B N     
2546 C  CA    . TYR B 178 ? 0.3690 0.4586 0.3347 0.0121  0.0173  0.0390  210 TYR B CA    
2547 C  C     . TYR B 178 ? 0.3277 0.4254 0.3020 0.0076  0.0165  0.0321  210 TYR B C     
2548 O  O     . TYR B 178 ? 0.3024 0.4128 0.2858 0.0036  0.0151  0.0246  210 TYR B O     
2549 C  CB    . TYR B 178 ? 0.3118 0.3794 0.2751 0.0072  0.0172  0.0411  210 TYR B CB    
2550 C  CG    . TYR B 178 ? 0.3151 0.3760 0.2735 0.0091  0.0182  0.0464  210 TYR B CG    
2551 C  CD1   . TYR B 178 ? 0.2721 0.3481 0.2308 0.0125  0.0183  0.0476  210 TYR B CD1   
2552 C  CD2   . TYR B 178 ? 0.2805 0.3218 0.2345 0.0073  0.0192  0.0500  210 TYR B CD2   
2553 C  CE1   . TYR B 178 ? 0.2784 0.3488 0.2333 0.0141  0.0201  0.0539  210 TYR B CE1   
2554 C  CE2   . TYR B 178 ? 0.2786 0.3135 0.2301 0.0079  0.0209  0.0549  210 TYR B CE2   
2555 C  CZ    . TYR B 178 ? 0.2877 0.3367 0.2398 0.0114  0.0216  0.0577  210 TYR B CZ    
2556 O  OH    . TYR B 178 ? 0.3805 0.4236 0.3307 0.0118  0.0242  0.0640  210 TYR B OH    
2557 N  N     . ARG B 179 ? 0.2574 0.3486 0.2298 0.0081  0.0181  0.0340  211 ARG B N     
2558 C  CA    . ARG B 179 ? 0.3399 0.4391 0.3214 0.0034  0.0184  0.0288  211 ARG B CA    
2559 C  C     . ARG B 179 ? 0.3912 0.5161 0.3797 0.0055  0.0178  0.0231  211 ARG B C     
2560 O  O     . ARG B 179 ? 0.3562 0.4912 0.3567 -0.0007 0.0173  0.0152  211 ARG B O     
2561 C  CB    . ARG B 179 ? 0.3571 0.4478 0.3345 0.0045  0.0206  0.0325  211 ARG B CB    
2562 C  CG    . ARG B 179 ? 0.3359 0.4338 0.3237 -0.0014 0.0219  0.0287  211 ARG B CG    
2563 C  CD    . ARG B 179 ? 0.3787 0.4731 0.3622 0.0004  0.0247  0.0325  211 ARG B CD    
2564 N  NE    . ARG B 179 ? 0.3537 0.4540 0.3484 -0.0063 0.0267  0.0303  211 ARG B NE    
2565 C  CZ    . ARG B 179 ? 0.3836 0.4839 0.3771 -0.0064 0.0297  0.0335  211 ARG B CZ    
2566 N  NH1   . ARG B 179 ? 0.3764 0.4714 0.3579 -0.0000 0.0308  0.0373  211 ARG B NH1   
2567 N  NH2   . ARG B 179 ? 0.4671 0.5728 0.4724 -0.0131 0.0323  0.0327  211 ARG B NH2   
2568 N  N     . ASN B 180 ? 0.3180 0.4542 0.3000 0.0142  0.0180  0.0268  212 ASN B N     
2569 C  CA    . ASN B 180 ? 0.3137 0.4787 0.3017 0.0172  0.0170  0.0214  212 ASN B CA    
2570 C  C     . ASN B 180 ? 0.3713 0.5516 0.3652 0.0144  0.0144  0.0138  212 ASN B C     
2571 O  O     . ASN B 180 ? 0.3938 0.5981 0.3972 0.0124  0.0130  0.0044  212 ASN B O     
2572 C  CB    . ASN B 180 ? 0.3543 0.5285 0.3335 0.0291  0.0180  0.0292  212 ASN B CB    
2573 C  CG    . ASN B 180 ? 0.4044 0.5703 0.3804 0.0326  0.0207  0.0336  212 ASN B CG    
2574 O  OD1   . ASN B 180 ? 0.4405 0.5998 0.4214 0.0261  0.0216  0.0303  212 ASN B OD1   
2575 N  ND2   . ASN B 180 ? 0.4396 0.6061 0.4078 0.0436  0.0225  0.0416  212 ASN B ND2   
2576 N  N     . ASN B 181 ? 0.3575 0.5263 0.3465 0.0141  0.0138  0.0167  213 ASN B N     
2577 C  CA    . ASN B 181 ? 0.3326 0.5196 0.3245 0.0142  0.0118  0.0106  213 ASN B CA    
2578 C  C     . ASN B 181 ? 0.3969 0.5757 0.3972 0.0055  0.0109  0.0025  213 ASN B C     
2579 O  O     . ASN B 181 ? 0.3122 0.5103 0.3190 0.0040  0.0092  -0.0073 213 ASN B O     
2580 C  CB    . ASN B 181 ? 0.3614 0.5494 0.3413 0.0229  0.0125  0.0208  213 ASN B CB    
2581 C  CG    . ASN B 181 ? 0.4100 0.6154 0.3840 0.0335  0.0133  0.0275  213 ASN B CG    
2582 O  OD1   . ASN B 181 ? 0.4307 0.6659 0.4061 0.0380  0.0116  0.0237  213 ASN B OD1   
2583 N  ND2   . ASN B 181 ? 0.3714 0.5597 0.3390 0.0382  0.0159  0.0371  213 ASN B ND2   
2584 N  N     . ILE B 182 ? 0.3340 0.4866 0.3343 0.0004  0.0118  0.0058  214 ILE B N     
2585 C  CA    . ILE B 182 ? 0.3345 0.4797 0.3428 -0.0060 0.0111  -0.0004 214 ILE B CA    
2586 C  C     . ILE B 182 ? 0.3212 0.4521 0.3398 -0.0135 0.0123  -0.0033 214 ILE B C     
2587 O  O     . ILE B 182 ? 0.3233 0.4475 0.3512 -0.0186 0.0122  -0.0085 214 ILE B O     
2588 C  CB    . ILE B 182 ? 0.2559 0.3858 0.2556 -0.0044 0.0111  0.0071  214 ILE B CB    
2589 C  CG1   . ILE B 182 ? 0.3292 0.4345 0.3227 -0.0054 0.0122  0.0160  214 ILE B CG1   
2590 C  CG2   . ILE B 182 ? 0.2711 0.4139 0.2611 0.0031  0.0112  0.0124  214 ILE B CG2   
2591 C  CD1   . ILE B 182 ? 0.3565 0.4470 0.3451 -0.0062 0.0120  0.0209  214 ILE B CD1   
2592 N  N     . PHE B 183 ? 0.3049 0.4314 0.3225 -0.0136 0.0138  0.0008  215 PHE B N     
2593 C  CA    . PHE B 183 ? 0.2895 0.4045 0.3169 -0.0202 0.0157  0.0000  215 PHE B CA    
2594 C  C     . PHE B 183 ? 0.3276 0.4596 0.3699 -0.0249 0.0169  -0.0101 215 PHE B C     
2595 O  O     . PHE B 183 ? 0.3327 0.4864 0.3750 -0.0218 0.0159  -0.0148 215 PHE B O     
2596 C  CB    . PHE B 183 ? 0.3147 0.4159 0.3328 -0.0183 0.0173  0.0102  215 PHE B CB    
2597 C  CG    . PHE B 183 ? 0.2975 0.3788 0.3062 -0.0174 0.0167  0.0177  215 PHE B CG    
2598 C  CD1   . PHE B 183 ? 0.3238 0.4016 0.3202 -0.0121 0.0155  0.0222  215 PHE B CD1   
2599 C  CD2   . PHE B 183 ? 0.3541 0.4213 0.3672 -0.0218 0.0175  0.0205  215 PHE B CD2   
2600 C  CE1   . PHE B 183 ? 0.3206 0.3820 0.3102 -0.0123 0.0148  0.0275  215 PHE B CE1   
2601 C  CE2   . PHE B 183 ? 0.3221 0.3748 0.3269 -0.0209 0.0163  0.0265  215 PHE B CE2   
2602 C  CZ    . PHE B 183 ? 0.3093 0.3594 0.3027 -0.0167 0.0148  0.0290  215 PHE B CZ    
2603 N  N     . LYS B 184 ? 0.3013 0.4239 0.3576 -0.0323 0.0192  -0.0132 216 LYS B N     
2604 C  CA    . LYS B 184 ? 0.3188 0.4554 0.3933 -0.0388 0.0210  -0.0243 216 LYS B CA    
2605 C  C     . LYS B 184 ? 0.3070 0.4570 0.3810 -0.0379 0.0224  -0.0228 216 LYS B C     
2606 O  O     . LYS B 184 ? 0.3413 0.4811 0.4069 -0.0358 0.0241  -0.0122 216 LYS B O     
2607 C  CB    . LYS B 184 ? 0.3614 0.4805 0.4514 -0.0465 0.0247  -0.0248 216 LYS B CB    
2608 C  CG    . LYS B 184 ? 0.5068 0.6372 0.6195 -0.0548 0.0274  -0.0381 216 LYS B CG    
2609 C  CD    . LYS B 184 ? 0.5016 0.6110 0.6305 -0.0615 0.0321  -0.0364 216 LYS B CD    
2610 C  CE    . LYS B 184 ? 0.4752 0.5697 0.6000 -0.0618 0.0358  -0.0210 216 LYS B CE    
2611 N  NZ    . LYS B 184 ? 0.4756 0.5508 0.6169 -0.0675 0.0411  -0.0170 216 LYS B NZ    
2612 N  N     . LYS B 185 ? 0.3154 0.4908 0.3988 -0.0395 0.0215  -0.0344 217 LYS B N     
2613 C  CA    . LYS B 185 ? 0.4915 0.6840 0.5773 -0.0390 0.0228  -0.0347 217 LYS B CA    
2614 C  C     . LYS B 185 ? 0.5383 0.7247 0.6419 -0.0489 0.0278  -0.0366 217 LYS B C     
2615 O  O     . LYS B 185 ? 0.5689 0.7489 0.6893 -0.0571 0.0298  -0.0444 217 LYS B O     
2616 C  CB    . LYS B 185 ? 0.5787 0.8046 0.6688 -0.0369 0.0197  -0.0468 217 LYS B CB    
2617 C  CG    . LYS B 185 ? 0.6558 0.8915 0.7279 -0.0257 0.0157  -0.0422 217 LYS B CG    
2618 C  CD    . LYS B 185 ? 0.7753 1.0114 0.8327 -0.0165 0.0161  -0.0297 217 LYS B CD    
2619 C  CE    . LYS B 185 ? 0.8435 1.0910 0.8858 -0.0051 0.0131  -0.0245 217 LYS B CE    
2620 N  NZ    . LYS B 185 ? 0.8804 1.1264 0.9101 0.0046  0.0142  -0.0125 217 LYS B NZ    
2621 N  N     . LYS B 186 ? 0.5652 0.7535 0.6659 -0.0478 0.0304  -0.0290 218 LYS B N     
2622 C  CA    . LYS B 186 ? 0.7325 0.9162 0.8493 -0.0567 0.0361  -0.0282 218 LYS B CA    
2623 C  C     . LYS B 186 ? 0.7451 0.9573 0.8780 -0.0617 0.0372  -0.0397 218 LYS B C     
2624 O  O     . LYS B 186 ? 0.7490 0.9723 0.9001 -0.0693 0.0372  -0.0541 218 LYS B O     
2625 C  CB    . LYS B 186 ? 0.8117 0.9810 0.9161 -0.0530 0.0390  -0.0127 218 LYS B CB    
2626 C  CG    . LYS B 186 ? 0.8361 0.9816 0.9232 -0.0474 0.0372  -0.0021 218 LYS B CG    
2627 C  CD    . LYS B 186 ? 0.8086 0.9405 0.8880 -0.0463 0.0409  0.0110  218 LYS B CD    
2628 C  CE    . LYS B 186 ? 0.7508 0.8595 0.8310 -0.0491 0.0423  0.0182  218 LYS B CE    
2629 N  NZ    . LYS B 186 ? 0.7477 0.8479 0.8242 -0.0495 0.0469  0.0305  218 LYS B NZ    
2630 P  P     . U   C 1   ? 0.5685 0.4995 0.5305 -0.0220 0.0378  0.0628  11  U   C P     
2631 O  OP1   . U   C 1   ? 0.5270 0.4745 0.4871 -0.0230 0.0312  0.0587  11  U   C OP1   
2632 O  OP2   . U   C 1   ? 0.5537 0.4817 0.5219 -0.0240 0.0433  0.0708  11  U   C OP2   
2633 O  "O5'" . U   C 1   ? 0.6152 0.5324 0.5787 -0.0281 0.0372  0.0527  11  U   C "O5'" 
2634 C  "C5'" . U   C 1   ? 0.6751 0.5741 0.6443 -0.0311 0.0432  0.0522  11  U   C "C5'" 
2635 C  "C4'" . U   C 1   ? 0.8060 0.6995 0.7780 -0.0396 0.0405  0.0393  11  U   C "C4'" 
2636 O  "O4'" . U   C 1   ? 0.8374 0.7432 0.8137 -0.0473 0.0361  0.0363  11  U   C "O4'" 
2637 C  "C3'" . U   C 1   ? 0.8972 0.7707 0.8773 -0.0444 0.0469  0.0352  11  U   C "C3'" 
2638 O  "O3'" . U   C 1   ? 0.8128 0.6729 0.7899 -0.0384 0.0503  0.0326  11  U   C "O3'" 
2639 C  "C2'" . U   C 1   ? 0.9078 0.7865 0.8924 -0.0551 0.0422  0.0224  11  U   C "C2'" 
2640 O  "O2'" . U   C 1   ? 0.8779 0.7600 0.8556 -0.0543 0.0375  0.0113  11  U   C "O2'" 
2641 C  "C1'" . U   C 1   ? 0.8366 0.7354 0.8200 -0.0565 0.0365  0.0267  11  U   C "C1'" 
2642 N  N1    . U   C 1   ? 0.7044 0.6043 0.6980 -0.0633 0.0396  0.0309  11  U   C N1    
2643 C  C2    . U   C 1   ? 0.6887 0.5987 0.6880 -0.0723 0.0351  0.0223  11  U   C C2    
2644 O  O2    . U   C 1   ? 0.7593 0.6775 0.7547 -0.0739 0.0288  0.0126  11  U   C O2    
2645 N  N3    . U   C 1   ? 0.7384 0.6508 0.7480 -0.0787 0.0384  0.0263  11  U   C N3    
2646 C  C4    . U   C 1   ? 0.7416 0.6473 0.7557 -0.0769 0.0459  0.0387  11  U   C C4    
2647 O  O4    . U   C 1   ? 0.8008 0.7111 0.8245 -0.0836 0.0487  0.0415  11  U   C O4    
2648 C  C5    . U   C 1   ? 0.7180 0.6139 0.7249 -0.0668 0.0500  0.0477  11  U   C C5    
2649 C  C6    . U   C 1   ? 0.6596 0.5531 0.6571 -0.0605 0.0466  0.0431  11  U   C C6    
2650 P  P     . U   C 2   ? 0.6974 0.5365 0.6806 -0.0331 0.0605  0.0414  12  U   C P     
2651 O  OP1   . U   C 2   ? 0.6630 0.4948 0.6403 -0.0242 0.0620  0.0386  12  U   C OP1   
2652 O  OP2   . U   C 2   ? 0.7066 0.5521 0.6910 -0.0293 0.0635  0.0574  12  U   C OP2   
2653 O  "O5'" . U   C 2   ? 0.6598 0.4814 0.6559 -0.0441 0.0653  0.0327  12  U   C "O5'" 
2654 C  "C5'" . U   C 2   ? 0.6802 0.5015 0.6776 -0.0518 0.0613  0.0148  12  U   C "C5'" 
2655 C  "C4'" . U   C 2   ? 0.7240 0.5328 0.7362 -0.0639 0.0657  0.0071  12  U   C "C4'" 
2656 O  "O4'" . U   C 2   ? 0.7662 0.5895 0.7827 -0.0717 0.0626  0.0105  12  U   C "O4'" 
2657 C  "C3'" . U   C 2   ? 0.6732 0.4564 0.6975 -0.0630 0.0774  0.0153  12  U   C "C3'" 
2658 O  "O3'" . U   C 2   ? 0.6722 0.4357 0.6986 -0.0589 0.0824  0.0075  12  U   C "O3'" 
2659 C  "C2'" . U   C 2   ? 0.6876 0.4682 0.7268 -0.0774 0.0798  0.0105  12  U   C "C2'" 
2660 O  "O2'" . U   C 2   ? 0.7117 0.4861 0.7582 -0.0869 0.0787  -0.0103 12  U   C "O2'" 
2661 C  "C1'" . U   C 2   ? 0.8211 0.6298 0.8534 -0.0802 0.0704  0.0122  12  U   C "C1'" 
2662 N  N1    . U   C 2   ? 0.9427 0.7573 0.9773 -0.0785 0.0737  0.0300  12  U   C N1    
2663 C  C2    . U   C 2   ? 0.9959 0.8222 1.0189 -0.0672 0.0718  0.0437  12  U   C C2    
2664 O  O2    . U   C 2   ? 1.0407 0.8726 1.0518 -0.0583 0.0675  0.0432  12  U   C O2    
2665 N  N3    . U   C 2   ? 1.0476 0.8808 1.0740 -0.0668 0.0754  0.0581  12  U   C N3    
2666 C  C4    . U   C 2   ? 1.0571 0.8868 1.0970 -0.0763 0.0810  0.0616  12  U   C C4    
2667 O  O4    . U   C 2   ? 1.1169 0.9561 1.1573 -0.0740 0.0841  0.0756  12  U   C O4    
2668 C  C5    . U   C 2   ? 1.0042 0.8208 1.0568 -0.0884 0.0830  0.0473  12  U   C C5    
2669 C  C6    . U   C 2   ? 0.9681 0.7781 1.0176 -0.0889 0.0792  0.0319  12  U   C C6    
2670 C  C1    . CIT D .   ? 0.7875 0.9210 0.9059 -0.1322 0.0168  0.0107  301 CIT A C1    
2671 O  O1    . CIT D .   ? 0.6332 0.7898 0.7618 -0.1353 0.0123  0.0048  301 CIT A O1    
2672 O  O2    . CIT D .   ? 0.7529 0.8682 0.8695 -0.1380 0.0184  0.0068  301 CIT A O2    
2673 C  C2    . CIT D .   ? 0.8649 0.9944 0.9739 -0.1214 0.0200  0.0213  301 CIT A C2    
2674 C  C3    . CIT D .   ? 0.9807 1.1123 1.0975 -0.1259 0.0298  0.0298  301 CIT A C3    
2675 O  O7    . CIT D .   ? 1.0475 1.1932 1.1814 -0.1378 0.0315  0.0248  301 CIT A O7    
2676 C  C4    . CIT D .   ? 0.9217 1.0683 1.0360 -0.1165 0.0311  0.0362  301 CIT A C4    
2677 C  C5    . CIT D .   ? 0.8352 0.9737 0.9344 -0.1040 0.0273  0.0381  301 CIT A C5    
2678 O  O3    . CIT D .   ? 0.8847 1.0372 0.9827 -0.0957 0.0245  0.0377  301 CIT A O3    
2679 O  O4    . CIT D .   ? 0.8136 0.9317 0.9024 -0.1019 0.0274  0.0396  301 CIT A O4    
2680 C  C6    . CIT D .   ? 1.0708 1.1774 1.1828 -0.1281 0.0378  0.0371  301 CIT A C6    
2681 O  O5    . CIT D .   ? 1.1154 1.2208 1.2337 -0.1323 0.0470  0.0458  301 CIT A O5    
2682 O  O6    . CIT D .   ? 1.0936 1.1812 1.1955 -0.1252 0.0357  0.0352  301 CIT A O6    
2683 MG MG    . MG  E .   ? 0.8186 0.6210 0.8021 -0.0091 0.0767  0.0534  301 MG  B MG    
2684 MG MG    . MG  F .   ? 0.6070 0.4815 0.5628 -0.0119 0.0487  0.0440  302 MG  B MG    
2685 O  O     . HOH G .   ? 0.4930 0.8775 0.6644 -0.0568 -0.0541 -0.0022 401 HOH A O     
2686 O  O     . HOH G .   ? 0.3415 0.4838 0.3845 -0.0127 0.0129  -0.0088 402 HOH A O     
2687 O  O     . HOH G .   ? 0.6227 0.6195 0.6527 -0.0175 0.0257  0.1057  403 HOH A O     
2688 O  O     . HOH G .   ? 0.3488 0.6331 0.4885 -0.1215 -0.0393 -0.0343 404 HOH A O     
2689 O  O     . HOH G .   ? 0.6056 0.6998 0.7308 -0.0664 0.0470  0.0036  405 HOH A O     
2690 O  O     . HOH G .   ? 0.7413 0.7535 0.7944 -0.1010 0.0338  0.0403  406 HOH A O     
2691 O  O     . HOH G .   ? 0.3556 0.4433 0.3922 -0.0565 0.0160  0.0427  407 HOH A O     
2692 O  O     . HOH G .   ? 0.4187 0.5556 0.4568 -0.0133 0.0100  -0.0245 408 HOH A O     
2693 O  O     . HOH G .   ? 0.4967 0.5976 0.6030 -0.0429 0.0185  -0.0520 409 HOH A O     
2694 O  O     . HOH G .   ? 0.4232 0.6631 0.4561 -0.0056 0.0300  0.0017  410 HOH A O     
2695 O  O     . HOH G .   ? 0.5349 0.7076 0.6475 -0.0009 0.0100  -0.0150 411 HOH A O     
2696 O  O     . HOH G .   ? 0.7694 1.0405 0.8787 -0.0350 0.0068  -0.1288 412 HOH A O     
2697 O  O     . HOH G .   ? 0.6263 0.9920 0.7436 0.0340  -0.0773 0.0679  413 HOH A O     
2698 O  O     . HOH G .   ? 0.4035 0.5895 0.4228 -0.0249 0.0402  0.0555  414 HOH A O     
2699 O  O     . HOH G .   ? 0.3948 0.6529 0.5357 -0.0236 -0.0263 0.0205  415 HOH A O     
2700 O  O     . HOH G .   ? 0.4058 0.4949 0.5291 -0.0544 0.0265  -0.0418 416 HOH A O     
2701 O  O     . HOH G .   ? 0.4119 0.4738 0.5077 -0.0247 0.0134  -0.0316 417 HOH A O     
2702 O  O     . HOH G .   ? 0.3325 0.3542 0.3319 -0.0562 -0.0002 0.0307  418 HOH A O     
2703 O  O     . HOH G .   ? 0.4882 0.4818 0.6532 -0.0716 0.0860  0.1038  419 HOH A O     
2704 O  O     . HOH G .   ? 0.4662 0.5260 0.4617 -0.0298 0.0180  0.0485  420 HOH A O     
2705 O  O     . HOH G .   ? 0.4900 0.5566 0.5902 -0.0596 0.0542  0.0430  421 HOH A O     
2706 O  O     . HOH G .   ? 0.6075 0.9727 0.6191 0.0194  0.0308  -0.0439 422 HOH A O     
2707 O  O     . HOH G .   ? 0.5129 0.5591 0.5764 -0.1238 0.0044  -0.0160 423 HOH A O     
2708 O  O     . HOH G .   ? 0.5640 0.7018 0.6722 0.0218  -0.0267 0.0612  424 HOH A O     
2709 O  O     . HOH G .   ? 0.4909 0.5089 0.5107 -0.0809 0.0071  0.0213  425 HOH A O     
2710 O  O     . HOH G .   ? 0.6271 0.7690 0.7904 0.0302  -0.0018 0.0079  426 HOH A O     
2711 O  O     . HOH G .   ? 0.5594 0.6034 0.5688 -0.0289 0.0506  0.1067  427 HOH A O     
2712 O  O     . HOH G .   ? 0.5255 0.5928 0.5220 -0.1008 -0.0245 -0.0584 428 HOH A O     
2713 O  O     . HOH G .   ? 0.6032 0.7174 0.6431 -0.0620 0.0547  0.0872  429 HOH A O     
2714 O  O     . HOH G .   ? 0.4156 0.6868 0.4279 0.0053  0.0286  -0.0076 430 HOH A O     
2715 O  O     . HOH G .   ? 0.3682 0.5307 0.4299 -0.0098 0.0148  -0.0168 431 HOH A O     
2716 O  O     . HOH G .   ? 0.7005 0.7666 0.7715 -0.1012 0.0382  0.0517  432 HOH A O     
2717 O  O     . HOH G .   ? 0.4442 0.4750 0.5994 0.0044  0.0154  -0.0136 433 HOH A O     
2718 O  O     . HOH G .   ? 0.6522 0.7148 0.6467 -0.0185 -0.0233 0.0588  434 HOH A O     
2719 O  O     . HOH G .   ? 0.5501 0.6020 0.5421 -0.0330 0.0326  0.0707  435 HOH A O     
2720 O  O     . HOH G .   ? 0.5277 0.7439 0.6633 -0.0066 -0.0002 0.0059  436 HOH A O     
2721 O  O     . HOH G .   ? 0.5345 0.9929 0.6263 -0.0744 -0.1019 -0.0519 437 HOH A O     
2722 O  O     . HOH G .   ? 0.4568 0.5768 0.4828 -0.0199 0.0259  0.0152  438 HOH A O     
2723 O  O     . HOH G .   ? 0.5329 0.5697 0.5573 0.0073  -0.0071 0.1079  439 HOH A O     
2724 O  O     . HOH G .   ? 0.6762 0.8417 0.7291 -0.0144 0.0098  -0.0510 440 HOH A O     
2725 O  O     . HOH G .   ? 0.4825 0.6682 0.5994 -0.0506 0.0184  -0.0744 441 HOH A O     
2726 O  O     . HOH G .   ? 0.6308 0.8145 0.6225 0.0021  0.0164  0.0099  442 HOH A O     
2727 O  O     . HOH G .   ? 0.8570 0.9486 0.8930 0.0662  0.0002  0.2186  443 HOH A O     
2728 O  O     . HOH G .   ? 0.7237 0.7682 0.8600 -0.0184 0.0181  -0.0418 444 HOH A O     
2729 O  O     . HOH G .   ? 0.4935 0.5343 0.6693 -0.0733 0.0468  -0.0230 445 HOH A O     
2730 O  O     . HOH G .   ? 0.4344 0.7087 0.5898 -0.0869 0.0035  0.0144  446 HOH A O     
2731 O  O     . HOH G .   ? 0.3893 0.9010 0.5516 -0.0331 -0.0960 -0.0063 447 HOH A O     
2732 O  O     . HOH G .   ? 0.6463 0.6919 0.8349 -0.0864 0.0642  0.0073  448 HOH A O     
2733 O  O     . HOH G .   ? 0.5880 0.7345 0.6545 -0.0105 0.0121  -0.0410 449 HOH A O     
2734 O  O     . HOH G .   ? 0.3997 0.5784 0.4839 -0.0683 0.0303  0.0446  450 HOH A O     
2735 O  O     . HOH G .   ? 0.5034 0.7976 0.5301 0.0046  0.0341  -0.0119 451 HOH A O     
2736 O  O     . HOH G .   ? 0.7368 0.7912 0.6378 -0.0038 0.0204  0.0652  452 HOH A O     
2737 O  O     . HOH G .   ? 0.6435 0.9670 0.6870 -0.0013 0.0011  -0.0665 453 HOH A O     
2738 O  O     . HOH G .   ? 0.5304 0.4572 0.7113 0.0000  0.0000  0.0778  454 HOH A O     
2739 O  O     . HOH G .   ? 0.7835 0.7731 0.8131 -0.0886 0.0265  0.0340  455 HOH A O     
2740 O  O     . HOH G .   ? 0.6329 0.6889 0.6105 -0.0182 0.0488  0.1236  456 HOH A O     
2741 O  O     . HOH G .   ? 0.7127 0.8088 0.7399 -0.0309 0.0466  0.0509  457 HOH A O     
2742 O  O     . HOH G .   ? 0.8268 0.9519 0.9316 -0.0384 0.0153  -0.0680 458 HOH A O     
2743 O  O     . HOH G .   ? 0.8027 0.7152 0.7844 -0.0162 0.0689  0.1115  459 HOH A O     
2744 O  O     . HOH H .   ? 0.7993 0.5508 0.9288 -0.1507 0.0991  -0.0363 401 HOH B O     
2745 O  O     . HOH H .   ? 0.6895 0.3979 0.6928 0.0826  0.1289  0.1039  402 HOH B O     
2746 O  O     . HOH H .   ? 0.5121 0.3998 0.4667 -0.0309 0.0361  0.0180  403 HOH B O     
2747 O  O     . HOH H .   ? 0.5034 0.4773 0.4653 -0.0360 0.0106  0.0375  404 HOH B O     
2748 O  O     . HOH H .   ? 0.6852 0.5628 0.6397 0.0287  0.0675  0.0938  405 HOH B O     
2749 O  O     . HOH H .   ? 0.6868 0.5418 0.6571 -0.0434 0.0447  -0.0018 406 HOH B O     
2750 O  O     . HOH H .   ? 0.7425 0.4109 0.7961 -0.0168 0.1289  0.0653  407 HOH B O     
2751 O  O     . HOH H .   ? 0.7590 0.8914 0.6676 0.0035  0.0614  0.1033  408 HOH B O     
2752 O  O     . HOH H .   ? 0.6537 0.6526 0.5127 0.0756  0.0725  -0.0847 409 HOH B O     
2753 O  O     . HOH H .   ? 0.5431 0.6261 0.3857 0.0095  0.0199  -0.0002 410 HOH B O     
2754 O  O     . HOH H .   ? 0.5758 0.5916 0.5256 0.0112  0.0381  0.0900  411 HOH B O     
2755 O  O     . HOH H .   ? 0.5684 0.2969 0.5537 0.0394  0.1023  0.0114  412 HOH B O     
2756 O  O     . HOH H .   ? 1.0711 0.6246 1.2683 -0.1216 0.1483  -0.1861 413 HOH B O     
2757 O  O     . HOH H .   ? 0.5196 0.5535 0.4474 0.0641  0.0449  0.0516  414 HOH B O     
2758 O  O     . HOH H .   ? 0.5313 0.6089 0.5042 -0.0092 0.0393  0.0542  415 HOH B O     
2759 O  O     . HOH H .   ? 0.4129 0.3129 0.3589 0.0180  0.0531  0.0728  416 HOH B O     
2760 O  O     . HOH H .   ? 0.3426 0.5983 0.3406 0.0113  0.0073  -0.0229 417 HOH B O     
2761 O  O     . HOH H .   ? 0.6015 0.5104 0.4881 0.0477  0.0735  -0.1520 418 HOH B O     
2762 O  O     . HOH H .   ? 0.7544 0.9603 0.6945 0.0378  0.0415  0.1011  419 HOH B O     
2763 O  O     . HOH H .   ? 0.5670 0.7261 0.6199 -0.0196 0.0089  -0.0483 420 HOH B O     
2764 O  O     . HOH H .   ? 0.6737 0.6881 0.6177 -0.0586 -0.0128 -0.0189 421 HOH B O     
2765 O  O     . HOH H .   ? 0.4476 0.5462 0.4144 0.0172  0.0301  0.0391  422 HOH B O     
2766 O  O     . HOH H .   ? 0.4069 0.4535 0.3337 0.0777  0.0510  0.0483  423 HOH B O     
2767 O  O     . HOH H .   ? 0.5924 0.4924 0.5298 -0.0147 0.0342  0.0179  424 HOH B O     
2768 O  O     . HOH H .   ? 0.8758 0.8876 0.8225 -0.0969 0.0061  -0.2561 425 HOH B O     
2769 O  O     . HOH H .   ? 0.7239 0.8883 0.5183 0.0124  0.0117  -0.0931 426 HOH B O     
2770 O  O     . HOH H .   ? 0.5670 0.6757 0.5743 -0.0166 0.0406  0.0418  427 HOH B O     
2771 O  O     . HOH H .   ? 0.6664 0.7504 0.6085 0.0322  0.0367  0.0969  428 HOH B O     
2772 O  O     . HOH H .   ? 0.7323 0.7838 0.6928 0.0002  0.0395  0.0924  429 HOH B O     
2773 O  O     . HOH H .   ? 0.6711 0.7757 0.6235 0.0430  0.0362  0.0449  430 HOH B O     
2774 O  O     . HOH H .   ? 0.5975 0.7952 0.6250 -0.0068 0.0117  -0.0162 431 HOH B O     
2775 O  O     . HOH H .   ? 0.5716 0.4106 0.5003 0.0538  0.0752  -0.0222 432 HOH B O     
2776 O  O     . HOH H .   ? 0.5709 0.7344 0.6001 -0.0126 0.0192  -0.0011 433 HOH B O     
2777 O  O     . HOH H .   ? 0.5902 0.6751 0.5127 0.0131  0.0468  0.0520  434 HOH B O     
2778 O  O     . HOH H .   ? 0.8133 0.7033 0.7531 -0.0002 0.0432  0.0346  435 HOH B O     
2779 O  O     . HOH H .   ? 0.5843 0.6295 0.5284 0.0239  0.0333  0.0849  436 HOH B O     
2780 O  O     . HOH H .   ? 0.3758 0.5002 0.4451 -0.0282 0.0114  -0.0450 437 HOH B O     
2781 O  O     . HOH H .   ? 0.5089 0.6990 0.4598 0.0286  0.0273  0.0659  438 HOH B O     
2782 O  O     . HOH H .   ? 0.6605 0.7135 0.6141 -0.0901 -0.0212 -0.0990 439 HOH B O     
2783 O  O     . HOH H .   ? 0.6742 0.8392 0.6084 0.0465  0.0536  0.1366  440 HOH B O     
2784 O  O     . HOH H .   ? 0.6222 0.7287 0.8061 -0.0836 0.0455  -0.0496 441 HOH B O     
2785 O  O     . HOH H .   ? 0.8210 0.8856 0.6926 0.0746  0.0685  -0.0138 442 HOH B O     
2786 O  O     . HOH H .   ? 0.9902 0.8304 1.0131 -0.0312 0.1049  0.1396  443 HOH B O     
2787 O  O     . HOH H .   ? 0.7246 0.8334 0.6757 0.0145  0.0490  0.0489  444 HOH B O     
2788 O  O     . HOH H .   ? 0.7787 0.8627 0.6657 0.0009  0.0206  0.0800  445 HOH B O     
2789 O  O     . HOH H .   ? 0.6751 0.7721 0.6139 0.0775  0.0482  0.0497  446 HOH B O     
2790 O  O     . HOH H .   ? 0.6411 0.5844 0.5919 0.0034  0.0435  0.0801  447 HOH B O     
2791 O  O     . HOH H .   ? 0.5413 0.7056 0.5073 0.0116  0.0240  0.0498  448 HOH B O     
2792 O  O     . HOH H .   ? 0.6625 0.9411 0.6592 0.0247  0.0059  -0.0085 449 HOH B O     
2793 O  O     . HOH H .   ? 0.6104 0.6464 0.5886 -0.0233 0.0310  0.0718  450 HOH B O     
2794 O  O     . HOH H .   ? 0.4376 0.4051 0.3638 0.0716  0.0536  0.0639  451 HOH B O     
2795 O  O     . HOH H .   ? 0.6266 0.7682 0.5925 0.0059  0.0309  0.0673  452 HOH B O     
2796 O  O     . HOH H .   ? 0.5819 0.5220 0.5098 0.0888  0.0649  0.0632  453 HOH B O     
2797 O  O     . HOH H .   ? 1.0414 0.8595 1.0561 -0.0068 0.1122  0.1532  454 HOH B O     
2798 O  O     . HOH H .   ? 0.8033 0.6266 0.7798 0.0109  0.0808  0.0880  455 HOH B O     
2799 O  O     . HOH H .   ? 1.0301 0.6571 1.1070 0.0827  0.1789  0.1799  456 HOH B O     
2800 O  O     . HOH H .   ? 0.8885 0.4428 0.9709 0.0512  0.1693  0.0496  457 HOH B O     
2801 O  O     . HOH H .   ? 0.8378 0.9866 0.8314 0.0116  0.0296  0.0282  458 HOH B O     
2802 O  O     . HOH H .   ? 0.5818 0.6308 0.5165 0.0609  0.0386  0.0639  459 HOH B O     
2803 O  O     . HOH H .   ? 0.5065 0.5239 0.4351 0.0736  0.0475  0.0646  460 HOH B O     
2804 O  O     . HOH H .   ? 0.5853 0.6798 0.5253 0.0740  0.0369  0.0716  461 HOH B O     
2805 O  O     . HOH H .   ? 0.8977 1.1686 0.6687 0.0158  -0.0113 -0.0405 462 HOH B O     
2806 O  O     . HOH I .   ? 0.7576 0.6650 0.7289 -0.0135 0.0580  0.0904  101 HOH C O     
2807 O  O     . HOH I .   ? 0.8313 0.6954 0.8027 -0.0067 0.0651  0.0804  102 HOH C O     
2808 O  O     . HOH I .   ? 0.6206 0.5180 0.5758 -0.0030 0.0498  0.0677  103 HOH C O     
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   33  33  MET MET A . n 
A 1 2   ALA 2   34  34  ALA ALA A . n 
A 1 3   ALA 3   35  35  ALA ALA A . n 
A 1 4   GLY 4   36  36  GLY GLY A . n 
A 1 5   GLU 5   37  37  GLU GLU A . n 
A 1 6   SER 6   38  38  SER SER A . n 
A 1 7   MET 7   39  39  MET MET A . n 
A 1 8   ALA 8   40  40  ALA ALA A . n 
A 1 9   GLN 9   41  41  GLN GLN A . n 
A 1 10  ARG 10  42  42  ARG ARG A . n 
A 1 11  MET 11  43  43  MET MET A . n 
A 1 12  VAL 12  44  44  VAL VAL A . n 
A 1 13  TRP 13  45  45  TRP TRP A . n 
A 1 14  VAL 14  46  46  VAL VAL A . n 
A 1 15  ASP 15  47  47  ASP ASP A . n 
A 1 16  LEU 16  48  48  LEU LEU A . n 
A 1 17  GLU 17  49  49  GLU GLU A . n 
A 1 18  MET 18  50  50  MET MET A . n 
A 1 19  THR 19  51  ?   ?   ?   A . n 
A 1 20  GLY 20  52  ?   ?   ?   A . n 
A 1 21  LEU 21  53  ?   ?   ?   A . n 
A 1 22  ASP 22  54  ?   ?   ?   A . n 
A 1 23  ILE 23  55  ?   ?   ?   A . n 
A 1 24  GLU 24  56  ?   ?   ?   A . n 
A 1 25  LYS 25  57  ?   ?   ?   A . n 
A 1 26  ASP 26  58  ?   ?   ?   A . n 
A 1 27  GLN 27  59  ?   ?   ?   A . n 
A 1 28  ILE 28  60  60  ILE ILE A . n 
A 1 29  ILE 29  61  61  ILE ILE A . n 
A 1 30  GLU 30  62  62  GLU GLU A . n 
A 1 31  MET 31  63  63  MET MET A . n 
A 1 32  ALA 32  64  64  ALA ALA A . n 
A 1 33  CYS 33  65  65  CYS CYS A . n 
A 1 34  LEU 34  66  66  LEU LEU A . n 
A 1 35  ILE 35  67  67  ILE ILE A . n 
A 1 36  THR 36  68  68  THR THR A . n 
A 1 37  ASP 37  69  69  ASP ASP A . n 
A 1 38  SER 38  70  70  SER SER A . n 
A 1 39  ASP 39  71  71  ASP ASP A . n 
A 1 40  LEU 40  72  72  LEU LEU A . n 
A 1 41  ASN 41  73  73  ASN ASN A . n 
A 1 42  ILE 42  74  74  ILE ILE A . n 
A 1 43  LEU 43  75  75  LEU LEU A . n 
A 1 44  ALA 44  76  76  ALA ALA A . n 
A 1 45  GLU 45  77  77  GLU GLU A . n 
A 1 46  GLY 46  78  78  GLY GLY A . n 
A 1 47  PRO 47  79  79  PRO PRO A . n 
A 1 48  ASN 48  80  80  ASN ASN A . n 
A 1 49  LEU 49  81  81  LEU LEU A . n 
A 1 50  ILE 50  82  82  ILE ILE A . n 
A 1 51  ILE 51  83  83  ILE ILE A . n 
A 1 52  LYS 52  84  84  LYS LYS A . n 
A 1 53  GLN 53  85  ?   ?   ?   A . n 
A 1 54  PRO 54  86  ?   ?   ?   A . n 
A 1 55  ASP 55  87  ?   ?   ?   A . n 
A 1 56  GLU 56  88  ?   ?   ?   A . n 
A 1 57  LEU 57  89  ?   ?   ?   A . n 
A 1 58  LEU 58  90  ?   ?   ?   A . n 
A 1 59  ASP 59  91  ?   ?   ?   A . n 
A 1 60  SER 60  92  ?   ?   ?   A . n 
A 1 61  MET 61  93  ?   ?   ?   A . n 
A 1 62  SER 62  94  ?   ?   ?   A . n 
A 1 63  ASP 63  95  ?   ?   ?   A . n 
A 1 64  TRP 64  96  ?   ?   ?   A . n 
A 1 65  CYS 65  97  ?   ?   ?   A . n 
A 1 66  LYS 66  98  ?   ?   ?   A . n 
A 1 67  GLU 67  99  ?   ?   ?   A . n 
A 1 68  HIS 68  100 ?   ?   ?   A . n 
A 1 69  HIS 69  101 ?   ?   ?   A . n 
A 1 70  GLY 70  102 ?   ?   ?   A . n 
A 1 71  LYS 71  103 ?   ?   ?   A . n 
A 1 72  SER 72  104 ?   ?   ?   A . n 
A 1 73  GLY 73  105 ?   ?   ?   A . n 
A 1 74  LEU 74  106 ?   ?   ?   A . n 
A 1 75  THR 75  107 ?   ?   ?   A . n 
A 1 76  LYS 76  108 ?   ?   ?   A . n 
A 1 77  ALA 77  109 ?   ?   ?   A . n 
A 1 78  VAL 78  110 ?   ?   ?   A . n 
A 1 79  LYS 79  111 ?   ?   ?   A . n 
A 1 80  GLU 80  112 ?   ?   ?   A . n 
A 1 81  SER 81  113 ?   ?   ?   A . n 
A 1 82  THR 82  114 114 THR THR A . n 
A 1 83  ILE 83  115 115 ILE ILE A . n 
A 1 84  THR 84  116 116 THR THR A . n 
A 1 85  LEU 85  117 117 LEU LEU A . n 
A 1 86  GLN 86  118 118 GLN GLN A . n 
A 1 87  GLN 87  119 119 GLN GLN A . n 
A 1 88  ALA 88  120 120 ALA ALA A . n 
A 1 89  GLU 89  121 121 GLU GLU A . n 
A 1 90  TYR 90  122 122 TYR TYR A . n 
A 1 91  GLU 91  123 123 GLU GLU A . n 
A 1 92  PHE 92  124 124 PHE PHE A . n 
A 1 93  LEU 93  125 125 LEU LEU A . n 
A 1 94  SER 94  126 126 SER SER A . n 
A 1 95  PHE 95  127 127 PHE PHE A . n 
A 1 96  VAL 96  128 128 VAL VAL A . n 
A 1 97  ARG 97  129 129 ARG ARG A . n 
A 1 98  GLN 98  130 130 GLN GLN A . n 
A 1 99  GLN 99  131 131 GLN GLN A . n 
A 1 100 THR 100 132 132 THR THR A . n 
A 1 101 PRO 101 133 133 PRO PRO A . n 
A 1 102 PRO 102 134 134 PRO PRO A . n 
A 1 103 GLY 103 135 135 GLY GLY A . n 
A 1 104 LEU 104 136 136 LEU LEU A . n 
A 1 105 CYS 105 137 137 CYS CYS A . n 
A 1 106 PRO 106 138 138 PRO PRO A . n 
A 1 107 LEU 107 139 139 LEU LEU A . n 
A 1 108 ALA 108 140 140 ALA ALA A . n 
A 1 109 GLY 109 141 141 GLY GLY A . n 
A 1 110 ASN 110 142 142 ASN ASN A . n 
A 1 111 SER 111 143 143 SER SER A . n 
A 1 112 VAL 112 144 144 VAL VAL A . n 
A 1 113 HIS 113 145 145 HIS HIS A . n 
A 1 114 GLU 114 146 146 GLU GLU A . n 
A 1 115 ASP 115 147 147 ASP ASP A . n 
A 1 116 LYS 116 148 148 LYS LYS A . n 
A 1 117 LYS 117 149 149 LYS LYS A . n 
A 1 118 PHE 118 150 150 PHE PHE A . n 
A 1 119 LEU 119 151 151 LEU LEU A . n 
A 1 120 ASP 120 152 152 ASP ASP A . n 
A 1 121 LYS 121 153 153 LYS LYS A . n 
A 1 122 TYR 122 154 154 TYR TYR A . n 
A 1 123 MET 123 155 155 MET MET A . n 
A 1 124 PRO 124 156 156 PRO PRO A . n 
A 1 125 GLN 125 157 157 GLN GLN A . n 
A 1 126 PHE 126 158 158 PHE PHE A . n 
A 1 127 MET 127 159 159 MET MET A . n 
A 1 128 LYS 128 160 160 LYS LYS A . n 
A 1 129 HIS 129 161 161 HIS HIS A . n 
A 1 130 LEU 130 162 162 LEU LEU A . n 
A 1 131 HIS 131 163 163 HIS HIS A . n 
A 1 132 TYR 132 164 164 TYR TYR A . n 
A 1 133 ARG 133 165 165 ARG ARG A . n 
A 1 134 ILE 134 166 166 ILE ILE A . n 
A 1 135 ILE 135 167 167 ILE ILE A . n 
A 1 136 ASP 136 168 168 ASP ASP A . n 
A 1 137 VAL 137 169 169 VAL VAL A . n 
A 1 138 SER 138 170 170 SER SER A . n 
A 1 139 THR 139 171 171 THR THR A . n 
A 1 140 VAL 140 172 172 VAL VAL A . n 
A 1 141 LYS 141 173 173 LYS LYS A . n 
A 1 142 GLU 142 174 174 GLU GLU A . n 
A 1 143 LEU 143 175 175 LEU LEU A . n 
A 1 144 CYS 144 176 176 CYS CYS A . n 
A 1 145 ARG 145 177 177 ARG ARG A . n 
A 1 146 ARG 146 178 178 ARG ARG A . n 
A 1 147 TRP 147 179 179 TRP TRP A . n 
A 1 148 TYR 148 180 180 TYR TYR A . n 
A 1 149 PRO 149 181 181 PRO PRO A . n 
A 1 150 GLU 150 182 182 GLU GLU A . n 
A 1 151 GLU 151 183 183 GLU GLU A . n 
A 1 152 TYR 152 184 184 TYR TYR A . n 
A 1 153 GLU 153 185 185 GLU GLU A . n 
A 1 154 PHE 154 186 186 PHE PHE A . n 
A 1 155 ALA 155 187 187 ALA ALA A . n 
A 1 156 PRO 156 188 188 PRO PRO A . n 
A 1 157 LYS 157 189 189 LYS LYS A . n 
A 1 158 LYS 158 190 ?   ?   ?   A . n 
A 1 159 ALA 159 191 ?   ?   ?   A . n 
A 1 160 ALA 160 192 ?   ?   ?   A . n 
A 1 161 SER 161 193 193 SER SER A . n 
A 1 162 HIS 162 194 194 HIS HIS A . n 
A 1 163 ARG 163 195 195 ARG ARG A . n 
A 1 164 ALA 164 196 196 ALA ALA A . n 
A 1 165 LEU 165 197 197 LEU LEU A . n 
A 1 166 ASP 166 198 198 ASP ASP A . n 
A 1 167 ALA 167 199 199 ALA ALA A . n 
A 1 168 ILE 168 200 200 ILE ILE A . n 
A 1 169 SER 169 201 201 SER SER A . n 
A 1 170 GLU 170 202 202 GLU GLU A . n 
A 1 171 SER 171 203 203 SER SER A . n 
A 1 172 ILE 172 204 204 ILE ILE A . n 
A 1 173 LYS 173 205 205 LYS LYS A . n 
A 1 174 GLU 174 206 206 GLU GLU A . n 
A 1 175 LEU 175 207 207 LEU LEU A . n 
A 1 176 GLN 176 208 208 GLN GLN A . n 
A 1 177 PHE 177 209 209 PHE PHE A . n 
A 1 178 TYR 178 210 210 TYR TYR A . n 
A 1 179 ARG 179 211 211 ARG ARG A . n 
A 1 180 ASN 180 212 212 ASN ASN A . n 
A 1 181 ASN 181 213 213 ASN ASN A . n 
A 1 182 ILE 182 214 214 ILE ILE A . n 
A 1 183 PHE 183 215 215 PHE PHE A . n 
A 1 184 LYS 184 216 216 LYS LYS A . n 
A 1 185 LYS 185 217 217 LYS LYS A . n 
A 1 186 LYS 186 218 ?   ?   ?   A . n 
B 1 1   MET 1   33  ?   ?   ?   B . n 
B 1 2   ALA 2   34  ?   ?   ?   B . n 
B 1 3   ALA 3   35  ?   ?   ?   B . n 
B 1 4   GLY 4   36  ?   ?   ?   B . n 
B 1 5   GLU 5   37  ?   ?   ?   B . n 
B 1 6   SER 6   38  38  SER SER B . n 
B 1 7   MET 7   39  39  MET MET B . n 
B 1 8   ALA 8   40  40  ALA ALA B . n 
B 1 9   GLN 9   41  41  GLN GLN B . n 
B 1 10  ARG 10  42  42  ARG ARG B . n 
B 1 11  MET 11  43  43  MET MET B . n 
B 1 12  VAL 12  44  44  VAL VAL B . n 
B 1 13  TRP 13  45  45  TRP TRP B . n 
B 1 14  VAL 14  46  46  VAL VAL B . n 
B 1 15  ASP 15  47  47  ASP ASP B . n 
B 1 16  LEU 16  48  48  LEU LEU B . n 
B 1 17  GLU 17  49  49  GLU GLU B . n 
B 1 18  MET 18  50  50  MET MET B . n 
B 1 19  THR 19  51  51  THR THR B . n 
B 1 20  GLY 20  52  52  GLY GLY B . n 
B 1 21  LEU 21  53  53  LEU LEU B . n 
B 1 22  ASP 22  54  54  ASP ASP B . n 
B 1 23  ILE 23  55  55  ILE ILE B . n 
B 1 24  GLU 24  56  56  GLU GLU B . n 
B 1 25  LYS 25  57  57  LYS LYS B . n 
B 1 26  ASP 26  58  58  ASP ASP B . n 
B 1 27  GLN 27  59  59  GLN GLN B . n 
B 1 28  ILE 28  60  60  ILE ILE B . n 
B 1 29  ILE 29  61  61  ILE ILE B . n 
B 1 30  GLU 30  62  62  GLU GLU B . n 
B 1 31  MET 31  63  63  MET MET B . n 
B 1 32  ALA 32  64  64  ALA ALA B . n 
B 1 33  CYS 33  65  65  CYS CYS B . n 
B 1 34  LEU 34  66  66  LEU LEU B . n 
B 1 35  ILE 35  67  67  ILE ILE B . n 
B 1 36  THR 36  68  68  THR THR B . n 
B 1 37  ASP 37  69  69  ASP ASP B . n 
B 1 38  SER 38  70  70  SER SER B . n 
B 1 39  ASP 39  71  71  ASP ASP B . n 
B 1 40  LEU 40  72  72  LEU LEU B . n 
B 1 41  ASN 41  73  73  ASN ASN B . n 
B 1 42  ILE 42  74  74  ILE ILE B . n 
B 1 43  LEU 43  75  75  LEU LEU B . n 
B 1 44  ALA 44  76  76  ALA ALA B . n 
B 1 45  GLU 45  77  77  GLU GLU B . n 
B 1 46  GLY 46  78  78  GLY GLY B . n 
B 1 47  PRO 47  79  79  PRO PRO B . n 
B 1 48  ASN 48  80  80  ASN ASN B . n 
B 1 49  LEU 49  81  81  LEU LEU B . n 
B 1 50  ILE 50  82  82  ILE ILE B . n 
B 1 51  ILE 51  83  83  ILE ILE B . n 
B 1 52  LYS 52  84  84  LYS LYS B . n 
B 1 53  GLN 53  85  85  GLN GLN B . n 
B 1 54  PRO 54  86  86  PRO PRO B . n 
B 1 55  ASP 55  87  87  ASP ASP B . n 
B 1 56  GLU 56  88  88  GLU GLU B . n 
B 1 57  LEU 57  89  89  LEU LEU B . n 
B 1 58  LEU 58  90  90  LEU LEU B . n 
B 1 59  ASP 59  91  91  ASP ASP B . n 
B 1 60  SER 60  92  92  SER SER B . n 
B 1 61  MET 61  93  93  MET MET B . n 
B 1 62  SER 62  94  94  SER SER B . n 
B 1 63  ASP 63  95  95  ASP ASP B . n 
B 1 64  TRP 64  96  96  TRP TRP B . n 
B 1 65  CYS 65  97  97  CYS CYS B . n 
B 1 66  LYS 66  98  98  LYS LYS B . n 
B 1 67  GLU 67  99  99  GLU GLU B . n 
B 1 68  HIS 68  100 100 HIS HIS B . n 
B 1 69  HIS 69  101 101 HIS HIS B . n 
B 1 70  GLY 70  102 102 GLY GLY B . n 
B 1 71  LYS 71  103 103 LYS LYS B . n 
B 1 72  SER 72  104 104 SER SER B . n 
B 1 73  GLY 73  105 105 GLY GLY B . n 
B 1 74  LEU 74  106 106 LEU LEU B . n 
B 1 75  THR 75  107 107 THR THR B . n 
B 1 76  LYS 76  108 108 LYS LYS B . n 
B 1 77  ALA 77  109 109 ALA ALA B . n 
B 1 78  VAL 78  110 110 VAL VAL B . n 
B 1 79  LYS 79  111 111 LYS LYS B . n 
B 1 80  GLU 80  112 112 GLU GLU B . n 
B 1 81  SER 81  113 113 SER SER B . n 
B 1 82  THR 82  114 114 THR THR B . n 
B 1 83  ILE 83  115 115 ILE ILE B . n 
B 1 84  THR 84  116 116 THR THR B . n 
B 1 85  LEU 85  117 117 LEU LEU B . n 
B 1 86  GLN 86  118 118 GLN GLN B . n 
B 1 87  GLN 87  119 119 GLN GLN B . n 
B 1 88  ALA 88  120 120 ALA ALA B . n 
B 1 89  GLU 89  121 121 GLU GLU B . n 
B 1 90  TYR 90  122 122 TYR TYR B . n 
B 1 91  GLU 91  123 123 GLU GLU B . n 
B 1 92  PHE 92  124 124 PHE PHE B . n 
B 1 93  LEU 93  125 125 LEU LEU B . n 
B 1 94  SER 94  126 126 SER SER B . n 
B 1 95  PHE 95  127 127 PHE PHE B . n 
B 1 96  VAL 96  128 128 VAL VAL B . n 
B 1 97  ARG 97  129 129 ARG ARG B . n 
B 1 98  GLN 98  130 130 GLN GLN B . n 
B 1 99  GLN 99  131 131 GLN GLN B . n 
B 1 100 THR 100 132 132 THR THR B . n 
B 1 101 PRO 101 133 133 PRO PRO B . n 
B 1 102 PRO 102 134 134 PRO PRO B . n 
B 1 103 GLY 103 135 135 GLY GLY B . n 
B 1 104 LEU 104 136 136 LEU LEU B . n 
B 1 105 CYS 105 137 137 CYS CYS B . n 
B 1 106 PRO 106 138 138 PRO PRO B . n 
B 1 107 LEU 107 139 139 LEU LEU B . n 
B 1 108 ALA 108 140 140 ALA ALA B . n 
B 1 109 GLY 109 141 141 GLY GLY B . n 
B 1 110 ASN 110 142 142 ASN ASN B . n 
B 1 111 SER 111 143 143 SER SER B . n 
B 1 112 VAL 112 144 144 VAL VAL B . n 
B 1 113 HIS 113 145 145 HIS HIS B . n 
B 1 114 GLU 114 146 146 GLU GLU B . n 
B 1 115 ASP 115 147 147 ASP ASP B . n 
B 1 116 LYS 116 148 148 LYS LYS B . n 
B 1 117 LYS 117 149 149 LYS LYS B . n 
B 1 118 PHE 118 150 150 PHE PHE B . n 
B 1 119 LEU 119 151 151 LEU LEU B . n 
B 1 120 ASP 120 152 152 ASP ASP B . n 
B 1 121 LYS 121 153 153 LYS LYS B . n 
B 1 122 TYR 122 154 154 TYR TYR B . n 
B 1 123 MET 123 155 155 MET MET B . n 
B 1 124 PRO 124 156 156 PRO PRO B . n 
B 1 125 GLN 125 157 157 GLN GLN B . n 
B 1 126 PHE 126 158 158 PHE PHE B . n 
B 1 127 MET 127 159 159 MET MET B . n 
B 1 128 LYS 128 160 160 LYS LYS B . n 
B 1 129 HIS 129 161 161 HIS HIS B . n 
B 1 130 LEU 130 162 162 LEU LEU B . n 
B 1 131 HIS 131 163 163 HIS HIS B . n 
B 1 132 TYR 132 164 164 TYR TYR B . n 
B 1 133 ARG 133 165 165 ARG ARG B . n 
B 1 134 ILE 134 166 166 ILE ILE B . n 
B 1 135 ILE 135 167 167 ILE ILE B . n 
B 1 136 ASP 136 168 168 ASP ASP B . n 
B 1 137 VAL 137 169 169 VAL VAL B . n 
B 1 138 SER 138 170 170 SER SER B . n 
B 1 139 THR 139 171 171 THR THR B . n 
B 1 140 VAL 140 172 172 VAL VAL B . n 
B 1 141 LYS 141 173 173 LYS LYS B . n 
B 1 142 GLU 142 174 174 GLU GLU B . n 
B 1 143 LEU 143 175 175 LEU LEU B . n 
B 1 144 CYS 144 176 176 CYS CYS B . n 
B 1 145 ARG 145 177 177 ARG ARG B . n 
B 1 146 ARG 146 178 178 ARG ARG B . n 
B 1 147 TRP 147 179 179 TRP TRP B . n 
B 1 148 TYR 148 180 180 TYR TYR B . n 
B 1 149 PRO 149 181 181 PRO PRO B . n 
B 1 150 GLU 150 182 182 GLU GLU B . n 
B 1 151 GLU 151 183 183 GLU GLU B . n 
B 1 152 TYR 152 184 184 TYR TYR B . n 
B 1 153 GLU 153 185 185 GLU GLU B . n 
B 1 154 PHE 154 186 186 PHE PHE B . n 
B 1 155 ALA 155 187 187 ALA ALA B . n 
B 1 156 PRO 156 188 188 PRO PRO B . n 
B 1 157 LYS 157 189 ?   ?   ?   B . n 
B 1 158 LYS 158 190 ?   ?   ?   B . n 
B 1 159 ALA 159 191 ?   ?   ?   B . n 
B 1 160 ALA 160 192 ?   ?   ?   B . n 
B 1 161 SER 161 193 193 SER SER B . n 
B 1 162 HIS 162 194 194 HIS HIS B . n 
B 1 163 ARG 163 195 195 ARG ARG B . n 
B 1 164 ALA 164 196 196 ALA ALA B . n 
B 1 165 LEU 165 197 197 LEU LEU B . n 
B 1 166 ASP 166 198 198 ASP ASP B . n 
B 1 167 ALA 167 199 199 ALA ALA B . n 
B 1 168 ILE 168 200 200 ILE ILE B . n 
B 1 169 SER 169 201 201 SER SER B . n 
B 1 170 GLU 170 202 202 GLU GLU B . n 
B 1 171 SER 171 203 203 SER SER B . n 
B 1 172 ILE 172 204 204 ILE ILE B . n 
B 1 173 LYS 173 205 205 LYS LYS B . n 
B 1 174 GLU 174 206 206 GLU GLU B . n 
B 1 175 LEU 175 207 207 LEU LEU B . n 
B 1 176 GLN 176 208 208 GLN GLN B . n 
B 1 177 PHE 177 209 209 PHE PHE B . n 
B 1 178 TYR 178 210 210 TYR TYR B . n 
B 1 179 ARG 179 211 211 ARG ARG B . n 
B 1 180 ASN 180 212 212 ASN ASN B . n 
B 1 181 ASN 181 213 213 ASN ASN B . n 
B 1 182 ILE 182 214 214 ILE ILE B . n 
B 1 183 PHE 183 215 215 PHE PHE B . n 
B 1 184 LYS 184 216 216 LYS LYS B . n 
B 1 185 LYS 185 217 217 LYS LYS B . n 
B 1 186 LYS 186 218 218 LYS LYS B . n 
C 2 1   U   1   11  11  U   U   C . n 
C 2 2   U   2   12  12  U   U   C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 3 CIT 1  301 1   CIT CIT A . 
E 4 MG  1  301 1   MG  MG  B . 
F 4 MG  1  302 2   MG  MG  B . 
G 5 HOH 1  401 38  HOH HOH A . 
G 5 HOH 2  402 5   HOH HOH A . 
G 5 HOH 3  403 12  HOH HOH A . 
G 5 HOH 4  404 71  HOH HOH A . 
G 5 HOH 5  405 125 HOH HOH A . 
G 5 HOH 6  406 107 HOH HOH A . 
G 5 HOH 7  407 1   HOH HOH A . 
G 5 HOH 8  408 27  HOH HOH A . 
G 5 HOH 9  409 106 HOH HOH A . 
G 5 HOH 10 410 85  HOH HOH A . 
G 5 HOH 11 411 33  HOH HOH A . 
G 5 HOH 12 412 74  HOH HOH A . 
G 5 HOH 13 413 94  HOH HOH A . 
G 5 HOH 14 414 72  HOH HOH A . 
G 5 HOH 15 415 32  HOH HOH A . 
G 5 HOH 16 416 15  HOH HOH A . 
G 5 HOH 17 417 6   HOH HOH A . 
G 5 HOH 18 418 2   HOH HOH A . 
G 5 HOH 19 419 37  HOH HOH A . 
G 5 HOH 20 420 14  HOH HOH A . 
G 5 HOH 21 421 131 HOH HOH A . 
G 5 HOH 22 422 53  HOH HOH A . 
G 5 HOH 23 423 34  HOH HOH A . 
G 5 HOH 24 424 124 HOH HOH A . 
G 5 HOH 25 425 16  HOH HOH A . 
G 5 HOH 26 426 103 HOH HOH A . 
G 5 HOH 27 427 55  HOH HOH A . 
G 5 HOH 28 428 28  HOH HOH A . 
G 5 HOH 29 429 40  HOH HOH A . 
G 5 HOH 30 430 25  HOH HOH A . 
G 5 HOH 31 431 10  HOH HOH A . 
G 5 HOH 32 432 65  HOH HOH A . 
G 5 HOH 33 433 50  HOH HOH A . 
G 5 HOH 34 434 81  HOH HOH A . 
G 5 HOH 35 435 41  HOH HOH A . 
G 5 HOH 36 436 48  HOH HOH A . 
G 5 HOH 37 437 104 HOH HOH A . 
G 5 HOH 38 438 102 HOH HOH A . 
G 5 HOH 39 439 20  HOH HOH A . 
G 5 HOH 40 440 60  HOH HOH A . 
G 5 HOH 41 441 76  HOH HOH A . 
G 5 HOH 42 442 46  HOH HOH A . 
G 5 HOH 43 443 80  HOH HOH A . 
G 5 HOH 44 444 93  HOH HOH A . 
G 5 HOH 45 445 69  HOH HOH A . 
G 5 HOH 46 446 26  HOH HOH A . 
G 5 HOH 47 447 108 HOH HOH A . 
G 5 HOH 48 448 110 HOH HOH A . 
G 5 HOH 49 449 62  HOH HOH A . 
G 5 HOH 50 450 9   HOH HOH A . 
G 5 HOH 51 451 90  HOH HOH A . 
G 5 HOH 52 452 24  HOH HOH A . 
G 5 HOH 53 453 49  HOH HOH A . 
G 5 HOH 54 454 105 HOH HOH A . 
G 5 HOH 55 455 113 HOH HOH A . 
G 5 HOH 56 456 59  HOH HOH A . 
G 5 HOH 57 457 111 HOH HOH A . 
G 5 HOH 58 458 129 HOH HOH A . 
G 5 HOH 59 459 98  HOH HOH A . 
H 5 HOH 1  401 29  HOH HOH B . 
H 5 HOH 2  402 39  HOH HOH B . 
H 5 HOH 3  403 127 HOH HOH B . 
H 5 HOH 4  404 19  HOH HOH B . 
H 5 HOH 5  405 117 HOH HOH B . 
H 5 HOH 6  406 126 HOH HOH B . 
H 5 HOH 7  407 13  HOH HOH B . 
H 5 HOH 8  408 70  HOH HOH B . 
H 5 HOH 9  409 52  HOH HOH B . 
H 5 HOH 10 410 17  HOH HOH B . 
H 5 HOH 11 411 122 HOH HOH B . 
H 5 HOH 12 412 8   HOH HOH B . 
H 5 HOH 13 413 128 HOH HOH B . 
H 5 HOH 14 414 63  HOH HOH B . 
H 5 HOH 15 415 22  HOH HOH B . 
H 5 HOH 16 416 121 HOH HOH B . 
H 5 HOH 17 417 3   HOH HOH B . 
H 5 HOH 18 418 43  HOH HOH B . 
H 5 HOH 19 419 97  HOH HOH B . 
H 5 HOH 20 420 130 HOH HOH B . 
H 5 HOH 21 421 64  HOH HOH B . 
H 5 HOH 22 422 18  HOH HOH B . 
H 5 HOH 23 423 11  HOH HOH B . 
H 5 HOH 24 424 77  HOH HOH B . 
H 5 HOH 25 425 73  HOH HOH B . 
H 5 HOH 26 426 31  HOH HOH B . 
H 5 HOH 27 427 100 HOH HOH B . 
H 5 HOH 28 428 78  HOH HOH B . 
H 5 HOH 29 429 30  HOH HOH B . 
H 5 HOH 30 430 57  HOH HOH B . 
H 5 HOH 31 431 35  HOH HOH B . 
H 5 HOH 32 432 4   HOH HOH B . 
H 5 HOH 33 433 109 HOH HOH B . 
H 5 HOH 34 434 61  HOH HOH B . 
H 5 HOH 35 435 79  HOH HOH B . 
H 5 HOH 36 436 36  HOH HOH B . 
H 5 HOH 37 437 7   HOH HOH B . 
H 5 HOH 38 438 47  HOH HOH B . 
H 5 HOH 39 439 84  HOH HOH B . 
H 5 HOH 40 440 45  HOH HOH B . 
H 5 HOH 41 441 54  HOH HOH B . 
H 5 HOH 42 442 86  HOH HOH B . 
H 5 HOH 43 443 89  HOH HOH B . 
H 5 HOH 44 444 58  HOH HOH B . 
H 5 HOH 45 445 68  HOH HOH B . 
H 5 HOH 46 446 42  HOH HOH B . 
H 5 HOH 47 447 123 HOH HOH B . 
H 5 HOH 48 448 44  HOH HOH B . 
H 5 HOH 49 449 51  HOH HOH B . 
H 5 HOH 50 450 83  HOH HOH B . 
H 5 HOH 51 451 23  HOH HOH B . 
H 5 HOH 52 452 132 HOH HOH B . 
H 5 HOH 53 453 56  HOH HOH B . 
H 5 HOH 54 454 99  HOH HOH B . 
H 5 HOH 55 455 120 HOH HOH B . 
H 5 HOH 56 456 87  HOH HOH B . 
H 5 HOH 57 457 91  HOH HOH B . 
H 5 HOH 58 458 67  HOH HOH B . 
H 5 HOH 59 459 114 HOH HOH B . 
H 5 HOH 60 460 115 HOH HOH B . 
H 5 HOH 61 461 112 HOH HOH B . 
H 5 HOH 62 462 95  HOH HOH B . 
I 5 HOH 1  101 92  HOH HOH C . 
I 5 HOH 2  102 118 HOH HOH C . 
I 5 HOH 3  103 119 HOH HOH C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4860  ? 
1 MORE         -38   ? 
1 'SSA (A^2)'  14450 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     454 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   G 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 OD1 ? B ASP 15 ? B ASP 47 ? 1_555 MG ? F MG . ? B MG 302 ? 1_555 O   ? I HOH . ? C HOH 103 ? 1_555 163.3 ? 
2 OE2 ? B GLU 17 ? B GLU 49 ? 1_555 MG ? E MG . ? B MG 301 ? 1_555 OP1 ? C U   2 ? C U   12  ? 1_555 109.9 ? 
3 OE2 ? B GLU 17 ? B GLU 49 ? 1_555 MG ? E MG . ? B MG 301 ? 1_555 O   ? H HOH . ? B HOH 455 ? 1_555 133.2 ? 
4 OP1 ? C U   2  ? C U   12 ? 1_555 MG ? E MG . ? B MG 301 ? 1_555 O   ? H HOH . ? B HOH 455 ? 1_555 115.2 ? 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2019-08-28 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         30.1829 
_pdbx_refine_tls.origin_y         150.6185 
_pdbx_refine_tls.origin_z         -0.0866 
_pdbx_refine_tls.T[1][1]          0.2505 
_pdbx_refine_tls.T[2][2]          0.2225 
_pdbx_refine_tls.T[3][3]          0.2004 
_pdbx_refine_tls.T[1][2]          -0.0360 
_pdbx_refine_tls.T[1][3]          0.0058 
_pdbx_refine_tls.T[2][3]          0.0277 
_pdbx_refine_tls.L[1][1]          2.3456 
_pdbx_refine_tls.L[2][2]          0.5207 
_pdbx_refine_tls.L[3][3]          1.2479 
_pdbx_refine_tls.L[1][2]          -0.3306 
_pdbx_refine_tls.L[1][3]          -0.5040 
_pdbx_refine_tls.L[2][3]          0.1412 
_pdbx_refine_tls.S[1][1]          0.0586 
_pdbx_refine_tls.S[2][2]          0.0184 
_pdbx_refine_tls.S[3][3]          -0.0530 
_pdbx_refine_tls.S[1][2]          -0.1442 
_pdbx_refine_tls.S[1][3]          0.2032 
_pdbx_refine_tls.S[2][3]          -0.1085 
_pdbx_refine_tls.S[2][1]          0.0960 
_pdbx_refine_tls.S[3][1]          -0.2208 
_pdbx_refine_tls.S[3][2]          0.0775 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    ? 
_pdbx_refine_tls_group.beg_auth_seq_id     ? 
_pdbx_refine_tls_group.end_auth_asym_id    ? 
_pdbx_refine_tls_group.end_auth_seq_id     ? 
_pdbx_refine_tls_group.selection_details   all 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.13_2998 1 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .         2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? .         3 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALEPACK   ? ? ? .         4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .         5 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A THR 51  ? A THR 19  
2  1 Y 1 A GLY 52  ? A GLY 20  
3  1 Y 1 A LEU 53  ? A LEU 21  
4  1 Y 1 A ASP 54  ? A ASP 22  
5  1 Y 1 A ILE 55  ? A ILE 23  
6  1 Y 1 A GLU 56  ? A GLU 24  
7  1 Y 1 A LYS 57  ? A LYS 25  
8  1 Y 1 A ASP 58  ? A ASP 26  
9  1 Y 1 A GLN 59  ? A GLN 27  
10 1 Y 1 A GLN 85  ? A GLN 53  
11 1 Y 1 A PRO 86  ? A PRO 54  
12 1 Y 1 A ASP 87  ? A ASP 55  
13 1 Y 1 A GLU 88  ? A GLU 56  
14 1 Y 1 A LEU 89  ? A LEU 57  
15 1 Y 1 A LEU 90  ? A LEU 58  
16 1 Y 1 A ASP 91  ? A ASP 59  
17 1 Y 1 A SER 92  ? A SER 60  
18 1 Y 1 A MET 93  ? A MET 61  
19 1 Y 1 A SER 94  ? A SER 62  
20 1 Y 1 A ASP 95  ? A ASP 63  
21 1 Y 1 A TRP 96  ? A TRP 64  
22 1 Y 1 A CYS 97  ? A CYS 65  
23 1 Y 1 A LYS 98  ? A LYS 66  
24 1 Y 1 A GLU 99  ? A GLU 67  
25 1 Y 1 A HIS 100 ? A HIS 68  
26 1 Y 1 A HIS 101 ? A HIS 69  
27 1 Y 1 A GLY 102 ? A GLY 70  
28 1 Y 1 A LYS 103 ? A LYS 71  
29 1 Y 1 A SER 104 ? A SER 72  
30 1 Y 1 A GLY 105 ? A GLY 73  
31 1 Y 1 A LEU 106 ? A LEU 74  
32 1 Y 1 A THR 107 ? A THR 75  
33 1 Y 1 A LYS 108 ? A LYS 76  
34 1 Y 1 A ALA 109 ? A ALA 77  
35 1 Y 1 A VAL 110 ? A VAL 78  
36 1 Y 1 A LYS 111 ? A LYS 79  
37 1 Y 1 A GLU 112 ? A GLU 80  
38 1 Y 1 A SER 113 ? A SER 81  
39 1 Y 1 A LYS 190 ? A LYS 158 
40 1 Y 1 A ALA 191 ? A ALA 159 
41 1 Y 1 A ALA 192 ? A ALA 160 
42 1 Y 1 A LYS 218 ? A LYS 186 
43 1 Y 1 B MET 33  ? B MET 1   
44 1 Y 1 B ALA 34  ? B ALA 2   
45 1 Y 1 B ALA 35  ? B ALA 3   
46 1 Y 1 B GLY 36  ? B GLY 4   
47 1 Y 1 B GLU 37  ? B GLU 5   
48 1 Y 1 B LYS 189 ? B LYS 157 
49 1 Y 1 B LYS 190 ? B LYS 158 
50 1 Y 1 B ALA 191 ? B ALA 159 
51 1 Y 1 B ALA 192 ? B ALA 160 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'CITRIC ACID'   CIT 
4 'MAGNESIUM ION' MG  
5 water           HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'light scattering' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#