data_6KZ1
# 
_entry.id   6KZ1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.341 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6KZ1         
WWPDB D_1300013891 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6KZ1 
_pdbx_database_status.recvd_initial_deposition_date   2019-09-22 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Lin, L.'   1 ? 
'Wang, M.'  2 ? 
'Shi, Y.'   3 ? 
'Zhu, J.'   4 ? 
'Zhang, R.' 5 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Cell Rep' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2211-1247 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            34 
_citation.language                  ? 
_citation.page_first                108770 
_citation.page_last                 108770 
_citation.title                     'Phase separation-mediated condensation of Whirlin-Myo15-Eps8 stereocilia tip complex.' 
_citation.year                      2021 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.celrep.2021.108770 
_citation.pdbx_database_id_PubMed   33626355 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Lin, L.'   1 ? 
primary 'Shi, Y.'   2 ? 
primary 'Wang, M.'  3 ? 
primary 'Wang, C.'  4 ? 
primary 'Lu, Q.'    5 ? 
primary 'Zhu, J.'   6 ? 
primary 'Zhang, R.' 7 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6KZ1 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     51.974 
_cell.length_a_esd                 ? 
_cell.length_b                     51.974 
_cell.length_b_esd                 ? 
_cell.length_c                     70.445 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6KZ1 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Whirlin      12430.313 1  ? ? ? ? 
2 polymer syn 'Myosin XVa' 1611.920  1  ? ? ? ? 
3 water   nat water        18.015    53 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Autosomal recessive deafness type 31 protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MHHHHHHSSGLEVLFQGPGSTLVRVKKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGHVILEVNGLTLRG
KEHREAARIIAEAFKTKDRDYIDFLVTEFNVML
;
;MHHHHHHSSGLEVLFQGPGSTLVRVKKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGHVILEVNGLTLRG
KEHREAARIIAEAFKTKDRDYIDFLVTEFNVML
;
A ? 
2 'polypeptide(L)' no no EKRLTLPPSEITLL EKRLTLPPSEITLL B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  LEU n 
1 12  GLU n 
1 13  VAL n 
1 14  LEU n 
1 15  PHE n 
1 16  GLN n 
1 17  GLY n 
1 18  PRO n 
1 19  GLY n 
1 20  SER n 
1 21  THR n 
1 22  LEU n 
1 23  VAL n 
1 24  ARG n 
1 25  VAL n 
1 26  LYS n 
1 27  LYS n 
1 28  SER n 
1 29  ALA n 
1 30  ALA n 
1 31  THR n 
1 32  LEU n 
1 33  GLY n 
1 34  ILE n 
1 35  ALA n 
1 36  ILE n 
1 37  GLU n 
1 38  GLY n 
1 39  GLY n 
1 40  ALA n 
1 41  ASN n 
1 42  THR n 
1 43  ARG n 
1 44  GLN n 
1 45  PRO n 
1 46  LEU n 
1 47  PRO n 
1 48  ARG n 
1 49  ILE n 
1 50  VAL n 
1 51  THR n 
1 52  ILE n 
1 53  GLN n 
1 54  ARG n 
1 55  GLY n 
1 56  GLY n 
1 57  SER n 
1 58  ALA n 
1 59  HIS n 
1 60  ASN n 
1 61  CYS n 
1 62  GLY n 
1 63  GLN n 
1 64  LEU n 
1 65  LYS n 
1 66  VAL n 
1 67  GLY n 
1 68  HIS n 
1 69  VAL n 
1 70  ILE n 
1 71  LEU n 
1 72  GLU n 
1 73  VAL n 
1 74  ASN n 
1 75  GLY n 
1 76  LEU n 
1 77  THR n 
1 78  LEU n 
1 79  ARG n 
1 80  GLY n 
1 81  LYS n 
1 82  GLU n 
1 83  HIS n 
1 84  ARG n 
1 85  GLU n 
1 86  ALA n 
1 87  ALA n 
1 88  ARG n 
1 89  ILE n 
1 90  ILE n 
1 91  ALA n 
1 92  GLU n 
1 93  ALA n 
1 94  PHE n 
1 95  LYS n 
1 96  THR n 
1 97  LYS n 
1 98  ASP n 
1 99  ARG n 
1 100 ASP n 
1 101 TYR n 
1 102 ILE n 
1 103 ASP n 
1 104 PHE n 
1 105 LEU n 
1 106 VAL n 
1 107 THR n 
1 108 GLU n 
1 109 PHE n 
1 110 ASN n 
1 111 VAL n 
1 112 MET n 
1 113 LEU n 
2 1   GLU n 
2 2   LYS n 
2 3   ARG n 
2 4   LEU n 
2 5   THR n 
2 6   LEU n 
2 7   PRO n 
2 8   PRO n 
2 9   SER n 
2 10  GLU n 
2 11  ILE n 
2 12  THR n 
2 13  LEU n 
2 14  LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   113 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'WHRN, DFNB31, KIAA1526' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       14 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP WHRN_HUMAN Q9P202 ? 1 
;STLVRVKKSAATLGIAIEGGANTRQPLPRIVTIQRGGSAHNCGQLKVGHVILEVNGLTLRGKEHREAARIIAEAFKTKDR
DYIDFLVTEFNVML
;
814 
2 PDB 6KZ1       6KZ1   ? 2 ?                                                                                                 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6KZ1 A 20 ? 113 ? Q9P202 814  ? 907  ? 814  907  
2 2 6KZ1 B 1  ? 14  ? 6KZ1   3498 ? 3511 ? 3498 3511 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6KZ1 MET A 1  ? UNP Q9P202 ? ? 'initiating methionine' 795 1  
1 6KZ1 HIS A 2  ? UNP Q9P202 ? ? 'expression tag'        796 2  
1 6KZ1 HIS A 3  ? UNP Q9P202 ? ? 'expression tag'        797 3  
1 6KZ1 HIS A 4  ? UNP Q9P202 ? ? 'expression tag'        798 4  
1 6KZ1 HIS A 5  ? UNP Q9P202 ? ? 'expression tag'        799 5  
1 6KZ1 HIS A 6  ? UNP Q9P202 ? ? 'expression tag'        800 6  
1 6KZ1 HIS A 7  ? UNP Q9P202 ? ? 'expression tag'        801 7  
1 6KZ1 SER A 8  ? UNP Q9P202 ? ? 'expression tag'        802 8  
1 6KZ1 SER A 9  ? UNP Q9P202 ? ? 'expression tag'        803 9  
1 6KZ1 GLY A 10 ? UNP Q9P202 ? ? 'expression tag'        804 10 
1 6KZ1 LEU A 11 ? UNP Q9P202 ? ? 'expression tag'        805 11 
1 6KZ1 GLU A 12 ? UNP Q9P202 ? ? 'expression tag'        806 12 
1 6KZ1 VAL A 13 ? UNP Q9P202 ? ? 'expression tag'        807 13 
1 6KZ1 LEU A 14 ? UNP Q9P202 ? ? 'expression tag'        808 14 
1 6KZ1 PHE A 15 ? UNP Q9P202 ? ? 'expression tag'        809 15 
1 6KZ1 GLN A 16 ? UNP Q9P202 ? ? 'expression tag'        810 16 
1 6KZ1 GLY A 17 ? UNP Q9P202 ? ? 'expression tag'        811 17 
1 6KZ1 PRO A 18 ? UNP Q9P202 ? ? 'expression tag'        812 18 
1 6KZ1 GLY A 19 ? UNP Q9P202 ? ? 'expression tag'        813 19 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6KZ1 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            1.96 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         37.12 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'Potassium phosphate dibasic, HEPES pH7.5, Sodium phosphate monobasi' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-04-12 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL41XU' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.00000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL41XU 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6KZ1 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.690 
_reflns.d_resolution_low                 45.011 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       23647 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.800 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  10.261 
_reflns.pdbx_Rmerge_I_obs                0.055 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            22.540 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.130 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.057 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         242635 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.999 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
1.690 1.800  ? 3.120  ? 37386 3859 ? 3810 98.700  ? ? ? ? 0.685 ? ? ? ? ? ? ? ? 9.813  ? ? ? ? 0.722 ? ? 1 1 0.928 ? 
1.800 1.920  ? 6.220  ? 36695 3557 ? 3556 100.000 ? ? ? ? 0.390 ? ? ? ? ? ? ? ? 10.319 ? ? ? ? 0.411 ? ? 2 1 0.982 ? 
1.920 2.070  ? 12.290 ? 36632 3373 ? 3373 100.000 ? ? ? ? 0.201 ? ? ? ? ? ? ? ? 10.860 ? ? ? ? 0.211 ? ? 3 1 0.995 ? 
2.070 2.270  ? 19.860 ? 32692 3079 ? 3079 100.000 ? ? ? ? 0.121 ? ? ? ? ? ? ? ? 10.618 ? ? ? ? 0.127 ? ? 4 1 0.997 ? 
2.270 2.540  ? 25.580 ? 26819 2775 ? 2775 100.000 ? ? ? ? 0.084 ? ? ? ? ? ? ? ? 9.665  ? ? ? ? 0.089 ? ? 5 1 0.998 ? 
2.540 2.930  ? 34.060 ? 24765 2485 ? 2485 100.000 ? ? ? ? 0.062 ? ? ? ? ? ? ? ? 9.966  ? ? ? ? 0.066 ? ? 6 1 0.999 ? 
2.930 3.580  ? 48.660 ? 21927 2057 ? 2057 100.000 ? ? ? ? 0.047 ? ? ? ? ? ? ? ? 10.660 ? ? ? ? 0.049 ? ? 7 1 0.999 ? 
3.580 5.050  ? 55.110 ? 16368 1620 ? 1620 100.000 ? ? ? ? 0.038 ? ? ? ? ? ? ? ? 10.104 ? ? ? ? 0.040 ? ? 8 1 0.999 ? 
5.050 45.011 ? 57.710 ? 9351  892  ? 892  100.000 ? ? ? ? 0.035 ? ? ? ? ? ? ? ? 10.483 ? ? ? ? 0.037 ? ? 9 1 0.999 ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                86.410 
_refine.B_iso_mean                               34.8300 
_refine.B_iso_min                                17.830 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6KZ1 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.6940 
_refine.ls_d_res_low                             45.0110 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     12670 
_refine.ls_number_reflns_R_free                  637 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.7200 
_refine.ls_percent_reflns_R_free                 5.0300 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1798 
_refine.ls_R_factor_R_free                       0.2008 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1787 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.390 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1UFX 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 21.6000 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.1600 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       1.6940 
_refine_hist.d_res_low                        45.0110 
_refine_hist.number_atoms_solvent             53 
_refine_hist.number_atoms_total               864 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       109 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          42.96 
_refine_hist.pdbx_number_atoms_protein        811 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.012  ? 819  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.424  ? 1108 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.060  ? 137  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.007  ? 141  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 13.155 ? 301  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.6940 1.8247  . . 126 2333 99.0000  . . . 0.2410 0.0000 0.2211 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8247 2.0083  . . 128 2371 100.0000 . . . 0.2313 0.0000 0.1872 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0083 2.2989  . . 129 2379 100.0000 . . . 0.1873 0.0000 0.1727 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2989 2.8964  . . 123 2423 100.0000 . . . 0.2412 0.0000 0.2085 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8964 45.0110 . . 131 2527 100.0000 . . . 0.1825 0.0000 0.1645 . . . . . . . . . . 
# 
_struct.entry_id                     6KZ1 
_struct.title                        'Complex structure of Whirlin and Myosin XVa' 
_struct.pdbx_descriptor              'Ras-related protein Rab-35, Iporin' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6KZ1 
_struct_keywords.text            'Whirlin, Myosin XVa, complex structure, MOTOR PROTEIN' 
_struct_keywords.pdbx_keywords   'MOTOR PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 GLY A 56 ? GLY A 62 ? GLY A 850 GLY A 856 1 ? 7  
HELX_P HELX_P2 AA2 GLU A 82 ? THR A 96 ? GLU A 876 THR A 890 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 SER A 20  ? LYS A 26  ? SER A 814  LYS A 820  
AA1 2 TYR A 101 ? THR A 107 ? TYR A 895  THR A 901  
AA1 3 VAL A 69  ? VAL A 73  ? VAL A 863  VAL A 867  
AA1 4 LEU A 76  ? THR A 77  ? LEU A 870  THR A 871  
AA2 1 ARG A 48  ? ILE A 52  ? ARG A 842  ILE A 846  
AA2 2 ILE A 34  ? GLU A 37  ? ILE A 828  GLU A 831  
AA2 3 ILE B 11  ? LEU B 14  ? ILE B 3508 LEU B 3511 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 23  ? N VAL A 817 O PHE A 104 ? O PHE A 898  
AA1 2 3 O LEU A 105 ? O LEU A 899 N LEU A 71  ? N LEU A 865  
AA1 3 4 N VAL A 73  ? N VAL A 867 O LEU A 76  ? O LEU A 870  
AA2 1 2 O VAL A 50  ? O VAL A 844 N ALA A 35  ? N ALA A 829  
AA2 2 3 N ILE A 34  ? N ILE A 828 O LEU B 14  ? O LEU B 3511 
# 
_atom_sites.entry_id                    6KZ1 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.019240 
_atom_sites.fract_transf_matrix[1][2]   0.011108 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.022217 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014195 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1   N N   . GLY A 1 17  ? -3.690  15.670 13.963  1.00 73.13 ? 811  GLY A N   1 
ATOM   2   C CA  . GLY A 1 17  ? -3.221  16.343 15.146  1.00 68.45 ? 811  GLY A CA  1 
ATOM   3   C C   . GLY A 1 17  ? -4.077  17.508 15.440  1.00 57.58 ? 811  GLY A C   1 
ATOM   4   O O   . GLY A 1 17  ? -4.909  17.891 14.613  1.00 48.56 ? 811  GLY A O   1 
ATOM   5   N N   . PRO A 1 18  ? -3.856  18.090 16.699  1.00 44.24 ? 812  PRO A N   1 
ATOM   6   C CA  . PRO A 1 18  ? -4.793  19.158 16.998  1.00 34.79 ? 812  PRO A CA  1 
ATOM   7   C C   . PRO A 1 18  ? -4.793  20.223 15.954  1.00 36.95 ? 812  PRO A C   1 
ATOM   8   O O   . PRO A 1 18  ? -3.752  20.596 15.500  1.00 35.37 ? 812  PRO A O   1 
ATOM   9   C CB  . PRO A 1 18  ? -4.278  19.757 18.292  1.00 39.42 ? 812  PRO A CB  1 
ATOM   10  C CG  . PRO A 1 18  ? -3.603  18.701 18.968  1.00 42.70 ? 812  PRO A CG  1 
ATOM   11  C CD  . PRO A 1 18  ? -2.889  18.000 17.895  1.00 42.65 ? 812  PRO A CD  1 
ATOM   12  N N   . GLY A 1 19  ? -5.969  20.686 15.597  1.00 36.94 ? 813  GLY A N   1 
ATOM   13  C CA  . GLY A 1 19  ? -6.096  21.805 14.724  1.00 36.63 ? 813  GLY A CA  1 
ATOM   14  C C   . GLY A 1 19  ? -6.334  21.458 13.268  1.00 32.58 ? 813  GLY A C   1 
ATOM   15  O O   . GLY A 1 19  ? -6.489  22.336 12.493  1.00 35.53 ? 813  GLY A O   1 
ATOM   16  N N   . SER A 1 20  ? -6.341  20.192 12.922  1.00 26.28 ? 814  SER A N   1 
ATOM   17  C CA  . SER A 1 20  ? -6.579  19.803 11.551  1.00 24.35 ? 814  SER A CA  1 
ATOM   18  C C   . SER A 1 20  ? -7.966  19.226 11.304  1.00 26.47 ? 814  SER A C   1 
ATOM   19  O O   . SER A 1 20  ? -8.555  18.649 12.181  1.00 26.11 ? 814  SER A O   1 
ATOM   20  C CB  . SER A 1 20  ? -5.489  18.893 11.075  1.00 34.03 ? 814  SER A CB  1 
ATOM   21  O OG  . SER A 1 20  ? -5.766  17.551 11.305  1.00 39.96 ? 814  SER A OG  1 
ATOM   22  N N   . THR A 1 21  ? -8.469  19.461 10.099  1.00 24.04 ? 815  THR A N   1 
ATOM   23  C CA  . THR A 1 21  ? -9.810  19.003 9.717   1.00 26.63 ? 815  THR A CA  1 
ATOM   24  C C   . THR A 1 21  ? -9.700  18.392 8.351   1.00 28.99 ? 815  THR A C   1 
ATOM   25  O O   . THR A 1 21  ? -9.065  18.960 7.474   1.00 25.80 ? 815  THR A O   1 
ATOM   26  C CB  . THR A 1 21  ? -10.841 20.154 9.657   1.00 29.30 ? 815  THR A CB  1 
ATOM   27  O OG1 . THR A 1 21  ? -10.897 20.843 10.918  1.00 32.82 ? 815  THR A OG1 1 
ATOM   28  C CG2 . THR A 1 21  ? -12.237 19.612 9.316   1.00 30.22 ? 815  THR A CG2 1 
ATOM   29  N N   . LEU A 1 22  ? -10.326 17.236 8.146   1.00 27.47 ? 816  LEU A N   1 
ATOM   30  C CA  . LEU A 1 22  ? -10.377 16.668 6.815   1.00 28.77 ? 816  LEU A CA  1 
ATOM   31  C C   . LEU A 1 22  ? -11.641 17.150 6.131   1.00 27.30 ? 816  LEU A C   1 
ATOM   32  O O   . LEU A 1 22  ? -12.725 16.915 6.618   1.00 29.45 ? 816  LEU A O   1 
ATOM   33  C CB  . LEU A 1 22  ? -10.348 15.143 6.892   1.00 33.02 ? 816  LEU A CB  1 
ATOM   34  C CG  . LEU A 1 22  ? -10.156 14.385 5.589   1.00 35.89 ? 816  LEU A CG  1 
ATOM   35  C CD1 . LEU A 1 22  ? -8.847  14.758 4.863   1.00 33.80 ? 816  LEU A CD1 1 
ATOM   36  C CD2 . LEU A 1 22  ? -10.180 12.884 5.855   1.00 42.72 ? 816  LEU A CD2 1 
ATOM   37  N N   . VAL A 1 23  ? -11.466 17.852 5.008   1.00 23.23 ? 817  VAL A N   1 
ATOM   38  C CA  . VAL A 1 23  ? -12.572 18.405 4.211   1.00 23.85 ? 817  VAL A CA  1 
ATOM   39  C C   . VAL A 1 23  ? -12.709 17.716 2.851   1.00 25.90 ? 817  VAL A C   1 
ATOM   40  O O   . VAL A 1 23  ? -11.771 17.692 2.052   1.00 25.07 ? 817  VAL A O   1 
ATOM   41  C CB  . VAL A 1 23  ? -12.354 19.923 3.973   1.00 22.14 ? 817  VAL A CB  1 
ATOM   42  C CG1 . VAL A 1 23  ? -13.428 20.494 3.078   1.00 27.97 ? 817  VAL A CG1 1 
ATOM   43  C CG2 . VAL A 1 23  ? -12.319 20.638 5.341   1.00 26.54 ? 817  VAL A CG2 1 
ATOM   44  N N   . ARG A 1 24  ? -13.867 17.125 2.608   1.00 22.65 ? 818  ARG A N   1 
ATOM   45  C CA  . ARG A 1 24  ? -14.097 16.483 1.315   1.00 20.38 ? 818  ARG A CA  1 
ATOM   46  C C   . ARG A 1 24  ? -14.877 17.430 0.420   1.00 25.04 ? 818  ARG A C   1 
ATOM   47  O O   . ARG A 1 24  ? -16.043 17.745 0.687   1.00 26.11 ? 818  ARG A O   1 
ATOM   48  C CB  . ARG A 1 24  ? -14.824 15.150 1.520   1.00 23.22 ? 818  ARG A CB  1 
ATOM   49  C CG  . ARG A 1 24  ? -15.147 14.454 0.223   1.00 23.26 ? 818  ARG A CG  1 
ATOM   50  C CD  . ARG A 1 24  ? -15.587 13.025 0.498   1.00 23.96 ? 818  ARG A CD  1 
ATOM   51  N NE  . ARG A 1 24  ? -14.404 12.275 0.923   1.00 24.76 ? 818  ARG A NE  1 
ATOM   52  C CZ  . ARG A 1 24  ? -14.401 10.971 1.137   1.00 25.99 ? 818  ARG A CZ  1 
ATOM   53  N NH1 . ARG A 1 24  ? -15.536 10.276 1.001   1.00 27.20 ? 818  ARG A NH1 1 
ATOM   54  N NH2 . ARG A 1 24  ? -13.268 10.371 1.490   1.00 28.78 ? 818  ARG A NH2 1 
ATOM   55  N N   . VAL A 1 25  ? -14.240 17.875 -0.668  1.00 22.20 ? 819  VAL A N   1 
ATOM   56  C CA  . VAL A 1 25  ? -14.834 18.855 -1.546  1.00 20.98 ? 819  VAL A CA  1 
ATOM   57  C C   . VAL A 1 25  ? -15.365 18.162 -2.803  1.00 24.91 ? 819  VAL A C   1 
ATOM   58  O O   . VAL A 1 25  ? -14.591 17.570 -3.553  1.00 23.32 ? 819  VAL A O   1 
ATOM   59  C CB  . VAL A 1 25  ? -13.798 19.958 -1.938  1.00 20.43 ? 819  VAL A CB  1 
ATOM   60  C CG1 . VAL A 1 25  ? -14.425 20.994 -2.939  1.00 26.06 ? 819  VAL A CG1 1 
ATOM   61  C CG2 . VAL A 1 25  ? -13.247 20.659 -0.708  1.00 23.63 ? 819  VAL A CG2 1 
ATOM   62  N N   . LYS A 1 26  ? -16.683 18.199 -3.019  1.00 20.97 ? 820  LYS A N   1 
ATOM   63  C CA  . LYS A 1 26  ? -17.264 17.657 -4.239  1.00 24.46 ? 820  LYS A CA  1 
ATOM   64  C C   . LYS A 1 26  ? -16.841 18.475 -5.456  1.00 26.78 ? 820  LYS A C   1 
ATOM   65  O O   . LYS A 1 26  ? -16.758 19.712 -5.384  1.00 25.65 ? 820  LYS A O   1 
ATOM   66  C CB  . LYS A 1 26  ? -18.793 17.635 -4.134  1.00 27.86 ? 820  LYS A CB  1 
ATOM   67  C CG  . LYS A 1 26  ? -19.466 16.972 -5.335  1.00 35.84 ? 820  LYS A CG  1 
ATOM   68  C CD  . LYS A 1 26  ? -20.866 17.481 -5.566  1.00 43.80 ? 820  LYS A CD  1 
ATOM   69  C CE  . LYS A 1 26  ? -21.581 16.601 -6.600  1.00 47.26 ? 820  LYS A CE  1 
ATOM   70  N NZ  . LYS A 1 26  ? -20.639 16.009 -7.609  1.00 49.12 ? 820  LYS A NZ  1 
ATOM   71  N N   . LYS A 1 27  ? -16.552 17.790 -6.559  1.00 24.81 ? 821  LYS A N   1 
ATOM   72  C CA  . LYS A 1 27  ? -16.191 18.470 -7.799  1.00 25.34 ? 821  LYS A CA  1 
ATOM   73  C C   . LYS A 1 27  ? -17.460 18.977 -8.491  1.00 30.57 ? 821  LYS A C   1 
ATOM   74  O O   . LYS A 1 27  ? -17.880 18.435 -9.521  1.00 38.18 ? 821  LYS A O   1 
ATOM   75  C CB  . LYS A 1 27  ? -15.420 17.521 -8.707  1.00 30.18 ? 821  LYS A CB  1 
ATOM   76  C CG  . LYS A 1 27  ? -14.135 16.998 -8.111  1.00 33.75 ? 821  LYS A CG  1 
ATOM   77  C CD  . LYS A 1 27  ? -13.581 15.905 -9.025  1.00 31.82 ? 821  LYS A CD  1 
ATOM   78  C CE  . LYS A 1 27  ? -12.342 15.279 -8.418  1.00 31.83 ? 821  LYS A CE  1 
ATOM   79  N NZ  . LYS A 1 27  ? -11.718 14.365 -9.437  1.00 29.74 ? 821  LYS A NZ  1 
ATOM   80  N N   . SER A 1 28  ? -18.094 19.990 -7.897  1.00 29.88 ? 822  SER A N   1 
ATOM   81  C CA  . SER A 1 28  ? -19.421 20.431 -8.317  1.00 29.94 ? 822  SER A CA  1 
ATOM   82  C C   . SER A 1 28  ? -19.380 21.382 -9.501  1.00 33.10 ? 822  SER A C   1 
ATOM   83  O O   . SER A 1 28  ? -20.396 21.567 -10.181 1.00 37.54 ? 822  SER A O   1 
ATOM   84  C CB  . SER A 1 28  ? -20.149 21.108 -7.157  1.00 32.88 ? 822  SER A CB  1 
ATOM   85  O OG  . SER A 1 28  ? -19.391 22.209 -6.662  1.00 34.22 ? 822  SER A OG  1 
ATOM   86  N N   . ALA A 1 29  ? -18.220 21.976 -9.741  1.00 32.75 ? 823  ALA A N   1 
ATOM   87  C CA  . ALA A 1 29  ? -18.030 22.972 -10.788 1.00 36.66 ? 823  ALA A CA  1 
ATOM   88  C C   . ALA A 1 29  ? -16.867 22.560 -11.664 1.00 38.71 ? 823  ALA A C   1 
ATOM   89  O O   . ALA A 1 29  ? -16.205 21.580 -11.372 1.00 39.81 ? 823  ALA A O   1 
ATOM   90  C CB  . ALA A 1 29  ? -17.781 24.345 -10.178 1.00 39.33 ? 823  ALA A CB  1 
ATOM   91  N N   . ALA A 1 30  ? -16.602 23.308 -12.729 1.00 39.46 ? 824  ALA A N   1 
ATOM   92  C CA  . ALA A 1 30  ? -15.518 22.950 -13.638 1.00 40.58 ? 824  ALA A CA  1 
ATOM   93  C C   . ALA A 1 30  ? -14.115 23.255 -13.106 1.00 41.12 ? 824  ALA A C   1 
ATOM   94  O O   . ALA A 1 30  ? -13.122 22.768 -13.653 1.00 39.06 ? 824  ALA A O   1 
ATOM   95  C CB  . ALA A 1 30  ? -15.732 23.649 -15.004 1.00 42.66 ? 824  ALA A CB  1 
ATOM   96  N N   . THR A 1 31  ? -14.008 24.062 -12.043 1.00 35.41 ? 825  THR A N   1 
ATOM   97  C CA  . THR A 1 31  ? -12.717 24.316 -11.421 1.00 33.10 ? 825  THR A CA  1 
ATOM   98  C C   . THR A 1 31  ? -12.901 24.255 -9.927  1.00 27.11 ? 825  THR A C   1 
ATOM   99  O O   . THR A 1 31  ? -14.024 24.204 -9.444  1.00 30.70 ? 825  THR A O   1 
ATOM   100 C CB  . THR A 1 31  ? -12.115 25.688 -11.769 1.00 37.78 ? 825  THR A CB  1 
ATOM   101 O OG1 . THR A 1 31  ? -12.927 26.723 -11.203 1.00 42.34 ? 825  THR A OG1 1 
ATOM   102 C CG2 . THR A 1 31  ? -12.029 25.876 -13.294 1.00 37.42 ? 825  THR A CG2 1 
ATOM   103 N N   . LEU A 1 32  ? -11.790 24.238 -9.224  1.00 27.27 ? 826  LEU A N   1 
ATOM   104 C CA  . LEU A 1 32  ? -11.817 24.250 -7.787  1.00 25.90 ? 826  LEU A CA  1 
ATOM   105 C C   . LEU A 1 32  ? -12.191 25.641 -7.317  1.00 29.08 ? 826  LEU A C   1 
ATOM   106 O O   . LEU A 1 32  ? -12.931 25.808 -6.347  1.00 33.81 ? 826  LEU A O   1 
ATOM   107 C CB  . LEU A 1 32  ? -10.456 23.828 -7.269  1.00 33.90 ? 826  LEU A CB  1 
ATOM   108 C CG  . LEU A 1 32  ? -10.248 23.398 -5.843  1.00 38.48 ? 826  LEU A CG  1 
ATOM   109 C CD1 . LEU A 1 32  ? -11.314 22.413 -5.381  1.00 30.34 ? 826  LEU A CD1 1 
ATOM   110 C CD2 . LEU A 1 32  ? -8.858  22.779 -5.784  1.00 39.17 ? 826  LEU A CD2 1 
ATOM   111 N N   . GLY A 1 33  ? -11.663 26.643 -8.024  1.00 31.40 ? 827  GLY A N   1 
ATOM   112 C CA  . GLY A 1 33  ? -11.977 28.032 -7.761  1.00 30.60 ? 827  GLY A CA  1 
ATOM   113 C C   . GLY A 1 33  ? -11.267 28.523 -6.513  1.00 33.75 ? 827  GLY A C   1 
ATOM   114 O O   . GLY A 1 33  ? -11.848 29.244 -5.706  1.00 36.00 ? 827  GLY A O   1 
ATOM   115 N N   . ILE A 1 34  ? -10.020 28.108 -6.327  1.00 28.64 ? 828  ILE A N   1 
ATOM   116 C CA  . ILE A 1 34  ? -9.200  28.702 -5.282  1.00 30.28 ? 828  ILE A CA  1 
ATOM   117 C C   . ILE A 1 34  ? -7.878  29.153 -5.861  1.00 32.70 ? 828  ILE A C   1 
ATOM   118 O O   . ILE A 1 34  ? -7.467  28.672 -6.932  1.00 30.74 ? 828  ILE A O   1 
ATOM   119 C CB  . ILE A 1 34  ? -8.919  27.735 -4.128  1.00 30.09 ? 828  ILE A CB  1 
ATOM   120 C CG1 . ILE A 1 34  ? -8.045  26.582 -4.608  1.00 28.65 ? 828  ILE A CG1 1 
ATOM   121 C CG2 . ILE A 1 34  ? -10.224 27.227 -3.574  1.00 27.68 ? 828  ILE A CG2 1 
ATOM   122 C CD1 . ILE A 1 34  ? -7.717  25.547 -3.519  1.00 31.69 ? 828  ILE A CD1 1 
ATOM   123 N N   . ALA A 1 35  ? -7.271  30.128 -5.198  1.00 27.23 ? 829  ALA A N   1 
ATOM   124 C CA  . ALA A 1 35  ? -5.873  30.483 -5.414  1.00 24.09 ? 829  ALA A CA  1 
ATOM   125 C C   . ALA A 1 35  ? -5.089  30.038 -4.194  1.00 28.00 ? 829  ALA A C   1 
ATOM   126 O O   . ALA A 1 35  ? -5.538  30.249 -3.047  1.00 26.97 ? 829  ALA A O   1 
ATOM   127 C CB  . ALA A 1 35  ? -5.700  31.968 -5.624  1.00 27.78 ? 829  ALA A CB  1 
ATOM   128 N N   . ILE A 1 36  ? -3.908  29.465 -4.408  1.00 22.99 ? 830  ILE A N   1 
ATOM   129 C CA  . ILE A 1 36  ? -3.052  29.083 -3.266  1.00 20.89 ? 830  ILE A CA  1 
ATOM   130 C C   . ILE A 1 36  ? -1.664  29.702 -3.399  1.00 24.98 ? 830  ILE A C   1 
ATOM   131 O O   . ILE A 1 36  ? -1.193  29.936 -4.534  1.00 26.88 ? 830  ILE A O   1 
ATOM   132 C CB  . ILE A 1 36  ? -2.887  27.573 -3.141  1.00 20.85 ? 830  ILE A CB  1 
ATOM   133 C CG1 . ILE A 1 36  ? -2.286  27.010 -4.435  1.00 28.54 ? 830  ILE A CG1 1 
ATOM   134 C CG2 . ILE A 1 36  ? -4.262  26.899 -2.878  1.00 25.43 ? 830  ILE A CG2 1 
ATOM   135 C CD1 . ILE A 1 36  ? -1.690  25.643 -4.266  1.00 32.59 ? 830  ILE A CD1 1 
ATOM   136 N N   . GLU A 1 37  ? -1.030  29.957 -2.259  1.00 20.80 ? 831  GLU A N   1 
ATOM   137 C CA  . GLU A 1 37  ? 0.293   30.546 -2.187  1.00 20.99 ? 831  GLU A CA  1 
ATOM   138 C C   . GLU A 1 37  ? 1.149   29.697 -1.293  1.00 24.49 ? 831  GLU A C   1 
ATOM   139 O O   . GLU A 1 37  ? 0.687   29.266 -0.250  1.00 27.83 ? 831  GLU A O   1 
ATOM   140 C CB  . GLU A 1 37  ? 0.232   31.971 -1.624  1.00 28.61 ? 831  GLU A CB  1 
ATOM   141 C CG  . GLU A 1 37  ? 1.555   32.707 -1.636  1.00 36.56 ? 831  GLU A CG  1 
ATOM   142 C CD  . GLU A 1 37  ? 1.420   34.159 -1.193  1.00 50.80 ? 831  GLU A CD  1 
ATOM   143 O OE1 . GLU A 1 37  ? 0.371   34.498 -0.604  1.00 55.84 ? 831  GLU A OE1 1 
ATOM   144 O OE2 . GLU A 1 37  ? 2.357   34.960 -1.441  1.00 56.57 ? 831  GLU A OE2 1 
ATOM   145 N N   . GLY A 1 38  ? 2.416   29.518 -1.646  1.00 25.89 ? 832  GLY A N   1 
ATOM   146 C CA  . GLY A 1 38  ? 3.332   28.886 -0.714  1.00 27.90 ? 832  GLY A CA  1 
ATOM   147 C C   . GLY A 1 38  ? 3.759   27.494 -1.111  1.00 27.59 ? 832  GLY A C   1 
ATOM   148 O O   . GLY A 1 38  ? 3.337   26.964 -2.149  1.00 28.45 ? 832  GLY A O   1 
ATOM   149 N N   . GLY A 1 39  ? 4.588   26.889 -0.271  1.00 21.14 ? 833  GLY A N   1 
ATOM   150 C CA  . GLY A 1 39  ? 5.212   25.629 -0.612  1.00 23.62 ? 833  GLY A CA  1 
ATOM   151 C C   . GLY A 1 39  ? 6.617   25.663 -0.070  1.00 23.22 ? 833  GLY A C   1 
ATOM   152 O O   . GLY A 1 39  ? 7.030   26.658 0.525   1.00 25.17 ? 833  GLY A O   1 
ATOM   153 N N   . ALA A 1 40  ? 7.340   24.576 -0.284  1.00 25.30 ? 834  ALA A N   1 
ATOM   154 C CA  . ALA A 1 40  ? 8.603   24.345 0.398   1.00 30.14 ? 834  ALA A CA  1 
ATOM   155 C C   . ALA A 1 40  ? 9.615   25.447 0.101   1.00 35.39 ? 834  ALA A C   1 
ATOM   156 O O   . ALA A 1 40  ? 9.684   25.963 -1.012  1.00 34.41 ? 834  ALA A O   1 
ATOM   157 C CB  . ALA A 1 40  ? 9.164   22.988 0.029   1.00 33.69 ? 834  ALA A CB  1 
ATOM   158 N N   . ASN A 1 41  ? 10.366  25.817 1.137   1.00 38.25 ? 835  ASN A N   1 
ATOM   159 C CA  . ASN A 1 41  ? 11.395  26.854 1.065   1.00 50.13 ? 835  ASN A CA  1 
ATOM   160 C C   . ASN A 1 41  ? 10.883  28.219 0.671   1.00 48.71 ? 835  ASN A C   1 
ATOM   161 O O   . ASN A 1 41  ? 11.524  28.960 -0.079  1.00 50.65 ? 835  ASN A O   1 
ATOM   162 C CB  . ASN A 1 41  ? 12.471  26.404 0.117   1.00 60.39 ? 835  ASN A CB  1 
ATOM   163 C CG  . ASN A 1 41  ? 12.718  24.948 0.250   1.00 68.90 ? 835  ASN A CG  1 
ATOM   164 O OD1 . ASN A 1 41  ? 12.505  24.175 -0.687  1.00 69.89 ? 835  ASN A OD1 1 
ATOM   165 N ND2 . ASN A 1 41  ? 13.140  24.535 1.442   1.00 73.67 ? 835  ASN A ND2 1 
ATOM   166 N N   . THR A 1 42  ? 9.715   28.540 1.205   1.00 43.00 ? 836  THR A N   1 
ATOM   167 C CA  . THR A 1 42  ? 9.173   29.875 1.138   1.00 39.95 ? 836  THR A CA  1 
ATOM   168 C C   . THR A 1 42  ? 8.748   30.208 2.559   1.00 36.67 ? 836  THR A C   1 
ATOM   169 O O   . THR A 1 42  ? 8.714   29.325 3.428   1.00 35.70 ? 836  THR A O   1 
ATOM   170 C CB  . THR A 1 42  ? 7.982   29.980 0.159   1.00 42.07 ? 836  THR A CB  1 
ATOM   171 O OG1 . THR A 1 42  ? 6.842   29.315 0.716   1.00 37.80 ? 836  THR A OG1 1 
ATOM   172 C CG2 . THR A 1 42  ? 8.315   29.345 -1.199  1.00 46.00 ? 836  THR A CG2 1 
ATOM   173 N N   . ARG A 1 43  ? 8.438   31.472 2.804   1.00 35.82 ? 837  ARG A N   1 
ATOM   174 C CA  . ARG A 1 43  ? 7.983   31.911 4.115   1.00 38.25 ? 837  ARG A CA  1 
ATOM   175 C C   . ARG A 1 43  ? 6.668   31.241 4.506   1.00 37.21 ? 837  ARG A C   1 
ATOM   176 O O   . ARG A 1 43  ? 6.288   31.256 5.678   1.00 40.97 ? 837  ARG A O   1 
ATOM   177 C CB  . ARG A 1 43  ? 7.824   33.427 4.128   1.00 43.67 ? 837  ARG A CB  1 
ATOM   178 N N   . GLN A 1 44  ? 5.982   30.653 3.517   1.00 34.81 ? 838  GLN A N   1 
ATOM   179 C CA  . GLN A 1 44  ? 4.729   29.917 3.731   1.00 30.17 ? 838  GLN A CA  1 
ATOM   180 C C   . GLN A 1 44  ? 4.948   28.481 3.256   1.00 30.85 ? 838  GLN A C   1 
ATOM   181 O O   . GLN A 1 44  ? 4.725   28.163 2.059   1.00 31.42 ? 838  GLN A O   1 
ATOM   182 C CB  . GLN A 1 44  ? 3.575   30.614 2.982   1.00 29.79 ? 838  GLN A CB  1 
ATOM   183 C CG  . GLN A 1 44  ? 2.209   29.931 3.030   1.00 30.31 ? 838  GLN A CG  1 
ATOM   184 C CD  . GLN A 1 44  ? 1.547   30.051 4.400   1.00 35.51 ? 838  GLN A CD  1 
ATOM   185 O OE1 . GLN A 1 44  ? 1.367   31.147 4.914   1.00 43.40 ? 838  GLN A OE1 1 
ATOM   186 N NE2 . GLN A 1 44  ? 1.182   28.922 4.979   1.00 32.04 ? 838  GLN A NE2 1 
ATOM   187 N N   . PRO A 1 45  ? 5.477   27.614 4.146   1.00 23.97 ? 839  PRO A N   1 
ATOM   188 C CA  . PRO A 1 45  ? 6.040   26.341 3.687   1.00 26.33 ? 839  PRO A CA  1 
ATOM   189 C C   . PRO A 1 45  ? 5.016   25.302 3.266   1.00 28.03 ? 839  PRO A C   1 
ATOM   190 O O   . PRO A 1 45  ? 5.337   24.386 2.515   1.00 28.37 ? 839  PRO A O   1 
ATOM   191 C CB  . PRO A 1 45  ? 6.843   25.854 4.891   1.00 28.23 ? 839  PRO A CB  1 
ATOM   192 C CG  . PRO A 1 45  ? 6.267   26.544 6.071   1.00 29.55 ? 839  PRO A CG  1 
ATOM   193 C CD  . PRO A 1 45  ? 5.721   27.861 5.584   1.00 28.59 ? 839  PRO A CD  1 
ATOM   194 N N   . LEU A 1 46  ? 3.787   25.464 3.735   1.00 29.40 ? 840  LEU A N   1 
ATOM   195 C CA  . LEU A 1 46  ? 2.664   24.672 3.229   1.00 27.41 ? 840  LEU A CA  1 
ATOM   196 C C   . LEU A 1 46  ? 1.695   25.637 2.584   1.00 27.25 ? 840  LEU A C   1 
ATOM   197 O O   . LEU A 1 46  ? 1.556   26.756 3.072   1.00 28.13 ? 840  LEU A O   1 
ATOM   198 C CB  . LEU A 1 46  ? 1.978   23.908 4.357   1.00 28.13 ? 840  LEU A CB  1 
ATOM   199 C CG  . LEU A 1 46  ? 2.757   22.699 4.885   1.00 31.18 ? 840  LEU A CG  1 
ATOM   200 C CD1 . LEU A 1 46  ? 2.219   22.347 6.212   1.00 38.07 ? 840  LEU A CD1 1 
ATOM   201 C CD2 . LEU A 1 46  ? 2.620   21.541 3.907   1.00 34.61 ? 840  LEU A CD2 1 
ATOM   202 N N   . PRO A 1 47  ? 1.021   25.221 1.490   1.00 23.74 ? 841  PRO A N   1 
ATOM   203 C CA  . PRO A 1 47  ? 0.185   26.171 0.767   1.00 21.11 ? 841  PRO A CA  1 
ATOM   204 C C   . PRO A 1 47  ? -1.007  26.732 1.528   1.00 20.99 ? 841  PRO A C   1 
ATOM   205 O O   . PRO A 1 47  ? -1.751  26.010 2.186   1.00 23.03 ? 841  PRO A O   1 
ATOM   206 C CB  . PRO A 1 47  ? -0.323  25.356 -0.434  1.00 22.63 ? 841  PRO A CB  1 
ATOM   207 C CG  . PRO A 1 47  ? 0.682   24.277 -0.591  1.00 26.95 ? 841  PRO A CG  1 
ATOM   208 C CD  . PRO A 1 47  ? 1.107   23.926 0.794   1.00 27.06 ? 841  PRO A CD  1 
ATOM   209 N N   . ARG A 1 48  ? -1.222  28.024 1.373   1.00 21.75 ? 842  ARG A N   1 
ATOM   210 C CA  . ARG A 1 48  ? -2.337  28.698 2.009   1.00 19.36 ? 842  ARG A CA  1 
ATOM   211 C C   . ARG A 1 48  ? -3.382  29.086 1.008   1.00 23.49 ? 842  ARG A C   1 
ATOM   212 O O   . ARG A 1 48  ? -3.015  29.501 -0.105  1.00 24.56 ? 842  ARG A O   1 
ATOM   213 C CB  . ARG A 1 48  ? -1.832  29.950 2.722   1.00 26.84 ? 842  ARG A CB  1 
ATOM   214 C CG  . ARG A 1 48  ? -2.881  30.797 3.357   1.00 36.21 ? 842  ARG A CG  1 
ATOM   215 C CD  . ARG A 1 48  ? -2.228  32.112 3.842   1.00 44.04 ? 842  ARG A CD  1 
ATOM   216 N NE  . ARG A 1 48  ? -2.980  33.259 3.336   1.00 53.33 ? 842  ARG A NE  1 
ATOM   217 C CZ  . ARG A 1 48  ? -3.880  33.906 4.059   1.00 54.89 ? 842  ARG A CZ  1 
ATOM   218 N NH1 . ARG A 1 48  ? -4.075  33.532 5.315   1.00 56.50 ? 842  ARG A NH1 1 
ATOM   219 N NH2 . ARG A 1 48  ? -4.557  34.932 3.553   1.00 52.51 ? 842  ARG A NH2 1 
ATOM   220 N N   . ILE A 1 49  ? -4.673  28.936 1.355   1.00 18.69 ? 843  ILE A N   1 
ATOM   221 C CA  . ILE A 1 49  ? -5.697  29.411 0.428   1.00 19.98 ? 843  ILE A CA  1 
ATOM   222 C C   . ILE A 1 49  ? -5.780  30.931 0.490   1.00 24.00 ? 843  ILE A C   1 
ATOM   223 O O   . ILE A 1 49  ? -6.025  31.509 1.551   1.00 24.08 ? 843  ILE A O   1 
ATOM   224 C CB  . ILE A 1 49  ? -7.071  28.800 0.725   1.00 19.73 ? 843  ILE A CB  1 
ATOM   225 C CG1 . ILE A 1 49  ? -6.951  27.288 0.585   1.00 21.16 ? 843  ILE A CG1 1 
ATOM   226 C CG2 . ILE A 1 49  ? -8.121  29.381 -0.228  1.00 24.44 ? 843  ILE A CG2 1 
ATOM   227 C CD1 . ILE A 1 49  ? -8.273  26.518 0.927   1.00 23.14 ? 843  ILE A CD1 1 
ATOM   228 N N   . VAL A 1 50  ? -5.537  31.590 -0.639  1.00 21.94 ? 844  VAL A N   1 
ATOM   229 C CA  . VAL A 1 50  ? -5.574  33.063 -0.598  1.00 25.31 ? 844  VAL A CA  1 
ATOM   230 C C   . VAL A 1 50  ? -6.878  33.672 -1.142  1.00 29.38 ? 844  VAL A C   1 
ATOM   231 O O   . VAL A 1 50  ? -7.213  34.810 -0.769  1.00 29.55 ? 844  VAL A O   1 
ATOM   232 C CB  . VAL A 1 50  ? -4.380  33.670 -1.330  1.00 35.12 ? 844  VAL A CB  1 
ATOM   233 C CG1 . VAL A 1 50  ? -3.072  33.298 -0.611  1.00 38.04 ? 844  VAL A CG1 1 
ATOM   234 C CG2 . VAL A 1 50  ? -4.325  33.216 -2.696  1.00 34.39 ? 844  VAL A CG2 1 
ATOM   235 N N   . THR A 1 51  ? -7.602  32.940 -1.997  1.00 26.16 ? 845  THR A N   1 
ATOM   236 C CA  . THR A 1 51  ? -8.899  33.385 -2.529  1.00 25.54 ? 845  THR A CA  1 
ATOM   237 C C   . THR A 1 51  ? -9.829  32.200 -2.724  1.00 27.39 ? 845  THR A C   1 
ATOM   238 O O   . THR A 1 51  ? -9.357  31.102 -3.042  1.00 27.42 ? 845  THR A O   1 
ATOM   239 C CB  . THR A 1 51  ? -8.739  34.105 -3.915  1.00 35.19 ? 845  THR A CB  1 
ATOM   240 O OG1 . THR A 1 51  ? -7.691  35.073 -3.833  1.00 40.10 ? 845  THR A OG1 1 
ATOM   241 C CG2 . THR A 1 51  ? -10.026 34.806 -4.346  1.00 37.97 ? 845  THR A CG2 1 
ATOM   242 N N   . ILE A 1 52  ? -11.144 32.427 -2.560  1.00 26.56 ? 846  ILE A N   1 
ATOM   243 C CA  . ILE A 1 52  ? -12.164 31.433 -2.915  1.00 26.54 ? 846  ILE A CA  1 
ATOM   244 C C   . ILE A 1 52  ? -13.148 32.131 -3.848  1.00 32.40 ? 846  ILE A C   1 
ATOM   245 O O   . ILE A 1 52  ? -13.853 33.060 -3.450  1.00 34.10 ? 846  ILE A O   1 
ATOM   246 C CB  . ILE A 1 52  ? -12.884 30.860 -1.685  1.00 26.51 ? 846  ILE A CB  1 
ATOM   247 C CG1 . ILE A 1 52  ? -11.923 29.988 -0.872  1.00 27.00 ? 846  ILE A CG1 1 
ATOM   248 C CG2 . ILE A 1 52  ? -14.064 29.964 -2.087  1.00 27.39 ? 846  ILE A CG2 1 
ATOM   249 C CD1 . ILE A 1 52  ? -12.548 29.463 0.367   1.00 31.36 ? 846  ILE A CD1 1 
ATOM   250 N N   . GLN A 1 53  ? -13.157 31.714 -5.106  1.00 29.16 ? 847  GLN A N   1 
ATOM   251 C CA  . GLN A 1 53  ? -14.038 32.345 -6.087  1.00 32.58 ? 847  GLN A CA  1 
ATOM   252 C C   . GLN A 1 53  ? -15.475 31.835 -6.060  1.00 33.34 ? 847  GLN A C   1 
ATOM   253 O O   . GLN A 1 53  ? -15.726 30.617 -5.996  1.00 33.91 ? 847  GLN A O   1 
ATOM   254 C CB  . GLN A 1 53  ? -13.454 32.139 -7.476  1.00 38.81 ? 847  GLN A CB  1 
ATOM   255 C CG  . GLN A 1 53  ? -12.046 32.685 -7.638  1.00 49.27 ? 847  GLN A CG  1 
ATOM   256 C CD  . GLN A 1 53  ? -11.467 32.378 -9.011  1.00 60.39 ? 847  GLN A CD  1 
ATOM   257 O OE1 . GLN A 1 53  ? -11.866 31.415 -9.662  1.00 63.17 ? 847  GLN A OE1 1 
ATOM   258 N NE2 . GLN A 1 53  ? -10.531 33.205 -9.459  1.00 62.77 ? 847  GLN A NE2 1 
ATOM   259 N N   . ARG A 1 54  ? -16.427 32.764 -6.166  1.00 35.20 ? 848  ARG A N   1 
ATOM   260 C CA  . ARG A 1 54  ? -17.838 32.388 -6.244  1.00 40.10 ? 848  ARG A CA  1 
ATOM   261 C C   . ARG A 1 54  ? -18.019 31.533 -7.483  1.00 42.45 ? 848  ARG A C   1 
ATOM   262 O O   . ARG A 1 54  ? -17.383 31.793 -8.499  1.00 40.07 ? 848  ARG A O   1 
ATOM   263 C CB  . ARG A 1 54  ? -18.740 33.624 -6.299  1.00 45.09 ? 848  ARG A CB  1 
ATOM   264 N N   . GLY A 1 55  ? -18.838 30.489 -7.388  1.00 43.74 ? 849  GLY A N   1 
ATOM   265 C CA  . GLY A 1 55  ? -19.100 29.650 -8.541  1.00 45.90 ? 849  GLY A CA  1 
ATOM   266 C C   . GLY A 1 55  ? -18.178 28.458 -8.703  1.00 44.68 ? 849  GLY A C   1 
ATOM   267 O O   . GLY A 1 55  ? -18.438 27.573 -9.507  1.00 44.63 ? 849  GLY A O   1 
ATOM   268 N N   . GLY A 1 56  ? -17.088 28.424 -7.948  1.00 36.20 ? 850  GLY A N   1 
ATOM   269 C CA  . GLY A 1 56  ? -16.176 27.298 -8.042  1.00 33.33 ? 850  GLY A CA  1 
ATOM   270 C C   . GLY A 1 56  ? -16.572 26.198 -7.082  1.00 31.48 ? 850  GLY A C   1 
ATOM   271 O O   . GLY A 1 56  ? -17.456 26.398 -6.249  1.00 32.90 ? 850  GLY A O   1 
ATOM   272 N N   . SER A 1 57  ? -15.904 25.047 -7.184  1.00 26.39 ? 851  SER A N   1 
ATOM   273 C CA  . SER A 1 57  ? -16.255 23.903 -6.347  1.00 25.56 ? 851  SER A CA  1 
ATOM   274 C C   . SER A 1 57  ? -16.055 24.217 -4.877  1.00 28.00 ? 851  SER A C   1 
ATOM   275 O O   . SER A 1 57  ? -16.819 23.766 -4.039  1.00 29.54 ? 851  SER A O   1 
ATOM   276 C CB  . SER A 1 57  ? -15.433 22.683 -6.727  1.00 25.26 ? 851  SER A CB  1 
ATOM   277 O OG  . SER A 1 57  ? -15.731 22.277 -8.065  1.00 25.06 ? 851  SER A OG  1 
ATOM   278 N N   . ALA A 1 58  ? -14.997 24.952 -4.559  1.00 22.71 ? 852  ALA A N   1 
ATOM   279 C CA  . ALA A 1 58  ? -14.715 25.212 -3.157  1.00 21.34 ? 852  ALA A CA  1 
ATOM   280 C C   . ALA A 1 58  ? -15.780 26.107 -2.527  1.00 25.54 ? 852  ALA A C   1 
ATOM   281 O O   . ALA A 1 58  ? -16.200 25.889 -1.357  1.00 28.08 ? 852  ALA A O   1 
ATOM   282 C CB  . ALA A 1 58  ? -13.344 25.838 -3.008  1.00 22.61 ? 852  ALA A CB  1 
ATOM   283 N N   . HIS A 1 59  ? -16.210 27.130 -3.264  1.00 26.61 ? 853  HIS A N   1 
ATOM   284 C CA  . HIS A 1 59  ? -17.250 28.013 -2.758  1.00 30.01 ? 853  HIS A CA  1 
ATOM   285 C C   . HIS A 1 59  ? -18.529 27.206 -2.504  1.00 33.58 ? 853  HIS A C   1 
ATOM   286 O O   . HIS A 1 59  ? -19.248 27.456 -1.541  1.00 36.00 ? 853  HIS A O   1 
ATOM   287 C CB  . HIS A 1 59  ? -17.532 29.163 -3.727  1.00 34.53 ? 853  HIS A CB  1 
ATOM   288 C CG  . HIS A 1 59  ? -18.484 30.190 -3.183  1.00 45.35 ? 853  HIS A CG  1 
ATOM   289 N ND1 . HIS A 1 59  ? -18.060 31.340 -2.549  1.00 50.15 ? 853  HIS A ND1 1 
ATOM   290 C CD2 . HIS A 1 59  ? -19.838 30.229 -3.161  1.00 50.64 ? 853  HIS A CD2 1 
ATOM   291 C CE1 . HIS A 1 59  ? -19.110 32.045 -2.165  1.00 51.89 ? 853  HIS A CE1 1 
ATOM   292 N NE2 . HIS A 1 59  ? -20.201 31.392 -2.522  1.00 54.17 ? 853  HIS A NE2 1 
ATOM   293 N N   . ASN A 1 60  ? -18.814 26.248 -3.380  1.00 35.20 ? 854  ASN A N   1 
ATOM   294 C CA  . ASN A 1 60  ? -20.057 25.479 -3.268  1.00 36.79 ? 854  ASN A CA  1 
ATOM   295 C C   . ASN A 1 60  ? -20.068 24.603 -2.017  1.00 35.94 ? 854  ASN A C   1 
ATOM   296 O O   . ASN A 1 60  ? -21.104 24.338 -1.403  1.00 39.55 ? 854  ASN A O   1 
ATOM   297 C CB  . ASN A 1 60  ? -20.257 24.612 -4.511  1.00 39.16 ? 854  ASN A CB  1 
ATOM   298 C CG  . ASN A 1 60  ? -20.556 25.430 -5.759  1.00 43.74 ? 854  ASN A CG  1 
ATOM   299 O OD1 . ASN A 1 60  ? -20.976 26.589 -5.674  1.00 48.99 ? 854  ASN A OD1 1 
ATOM   300 N ND2 . ASN A 1 60  ? -20.365 24.820 -6.924  1.00 43.93 ? 854  ASN A ND2 1 
ATOM   301 N N   . CYS A 1 61  ? -18.894 24.134 -1.665  1.00 35.58 ? 855  CYS A N   1 
ATOM   302 C CA  . CYS A 1 61  ? -18.735 23.212 -0.565  1.00 37.23 ? 855  CYS A CA  1 
ATOM   303 C C   . CYS A 1 61  ? -18.999 23.905 0.774   1.00 41.58 ? 855  CYS A C   1 
ATOM   304 O O   . CYS A 1 61  ? -19.618 23.331 1.669   1.00 45.76 ? 855  CYS A O   1 
ATOM   305 C CB  . CYS A 1 61  ? -17.333 22.627 -0.648  1.00 38.16 ? 855  CYS A CB  1 
ATOM   306 S SG  . CYS A 1 61  ? -16.699 21.894 0.822   1.00 51.47 ? 855  CYS A SG  1 
ATOM   307 N N   . GLY A 1 62  ? -18.524 25.127 0.909   1.00 38.31 ? 856  GLY A N   1 
ATOM   308 C CA  . GLY A 1 62  ? -18.700 25.869 2.129   1.00 40.60 ? 856  GLY A CA  1 
ATOM   309 C C   . GLY A 1 62  ? -17.778 25.543 3.283   1.00 41.40 ? 856  GLY A C   1 
ATOM   310 O O   . GLY A 1 62  ? -17.881 26.158 4.305   1.00 43.16 ? 856  GLY A O   1 
ATOM   311 N N   . GLN A 1 63  ? -16.897 24.580 3.124   1.00 38.38 ? 857  GLN A N   1 
ATOM   312 C CA  . GLN A 1 63  ? -16.059 24.164 4.216   1.00 38.95 ? 857  GLN A CA  1 
ATOM   313 C C   . GLN A 1 63  ? -14.647 24.653 4.115   1.00 31.35 ? 857  GLN A C   1 
ATOM   314 O O   . GLN A 1 63  ? -13.938 24.517 5.052   1.00 34.47 ? 857  GLN A O   1 
ATOM   315 C CB  . GLN A 1 63  ? -15.973 22.651 4.301   1.00 50.06 ? 857  GLN A CB  1 
ATOM   316 C CG  . GLN A 1 63  ? -17.244 21.923 4.708   1.00 64.00 ? 857  GLN A CG  1 
ATOM   317 C CD  . GLN A 1 63  ? -17.215 20.482 4.250   1.00 74.70 ? 857  GLN A CD  1 
ATOM   318 O OE1 . GLN A 1 63  ? -17.697 20.155 3.196   1.00 79.93 ? 857  GLN A OE1 1 
ATOM   319 N NE2 . GLN A 1 63  ? -16.610 19.633 5.038   1.00 81.20 ? 857  GLN A NE2 1 
ATOM   320 N N   . LEU A 1 64  ? -14.249 25.170 2.974   1.00 28.67 ? 858  LEU A N   1 
ATOM   321 C CA  . LEU A 1 64  ? -12.918 25.705 2.817   1.00 27.95 ? 858  LEU A CA  1 
ATOM   322 C C   . LEU A 1 64  ? -12.992 27.200 2.961   1.00 29.19 ? 858  LEU A C   1 
ATOM   323 O O   . LEU A 1 64  ? -13.930 27.780 2.544   1.00 30.43 ? 858  LEU A O   1 
ATOM   324 C CB  . LEU A 1 64  ? -12.347 25.341 1.470   1.00 24.81 ? 858  LEU A CB  1 
ATOM   325 C CG  . LEU A 1 64  ? -11.811 23.956 1.179   1.00 24.48 ? 858  LEU A CG  1 
ATOM   326 C CD1 . LEU A 1 64  ? -11.180 23.929 -0.175  1.00 26.58 ? 858  LEU A CD1 1 
ATOM   327 C CD2 . LEU A 1 64  ? -10.826 23.473 2.202   1.00 23.55 ? 858  LEU A CD2 1 
ATOM   328 N N   . LYS A 1 65  ? -11.984 27.797 3.570   1.00 26.85 ? 859  LYS A N   1 
ATOM   329 C CA  . LYS A 1 65  ? -11.955 29.223 3.822   1.00 26.35 ? 859  LYS A CA  1 
ATOM   330 C C   . LYS A 1 65  ? -10.623 29.859 3.463   1.00 24.70 ? 859  LYS A C   1 
ATOM   331 O O   . LYS A 1 65  ? -9.589  29.205 3.499   1.00 24.29 ? 859  LYS A O   1 
ATOM   332 C CB  . LYS A 1 65  ? -12.243 29.502 5.302   1.00 29.84 ? 859  LYS A CB  1 
ATOM   333 C CG  . LYS A 1 65  ? -13.619 28.979 5.748   1.00 36.95 ? 859  LYS A CG  1 
ATOM   334 C CD  . LYS A 1 65  ? -14.027 29.512 7.112   1.00 48.33 ? 859  LYS A CD  1 
ATOM   335 C CE  . LYS A 1 65  ? -15.372 28.927 7.527   1.00 57.70 ? 859  LYS A CE  1 
ATOM   336 N NZ  . LYS A 1 65  ? -15.347 27.443 7.467   1.00 62.18 ? 859  LYS A NZ  1 
ATOM   337 N N   . VAL A 1 66  ? -10.661 31.165 3.190   1.00 23.72 ? 860  VAL A N   1 
ATOM   338 C CA  . VAL A 1 66  ? -9.442  31.914 2.955   1.00 23.24 ? 860  VAL A CA  1 
ATOM   339 C C   . VAL A 1 66  ? -8.628  31.898 4.218   1.00 24.85 ? 860  VAL A C   1 
ATOM   340 O O   . VAL A 1 66  ? -9.154  32.162 5.289   1.00 26.72 ? 860  VAL A O   1 
ATOM   341 C CB  . VAL A 1 66  ? -9.736  33.352 2.537   1.00 24.88 ? 860  VAL A CB  1 
ATOM   342 C CG1 . VAL A 1 66  ? -8.453  34.141 2.515   1.00 29.89 ? 860  VAL A CG1 1 
ATOM   343 C CG2 . VAL A 1 66  ? -10.383 33.335 1.137   1.00 24.40 ? 860  VAL A CG2 1 
ATOM   344 N N   . GLY A 1 67  ? -7.353  31.558 4.111   1.00 23.55 ? 861  GLY A N   1 
ATOM   345 C CA  . GLY A 1 67  ? -6.534  31.364 5.290   1.00 23.98 ? 861  GLY A CA  1 
ATOM   346 C C   . GLY A 1 67  ? -6.272  29.919 5.698   1.00 22.66 ? 861  GLY A C   1 
ATOM   347 O O   . GLY A 1 67  ? -5.332  29.657 6.447   1.00 25.35 ? 861  GLY A O   1 
ATOM   348 N N   . HIS A 1 68  ? -7.070  28.982 5.192   1.00 21.42 ? 862  HIS A N   1 
ATOM   349 C CA  . HIS A 1 68  ? -6.767  27.573 5.459   1.00 20.27 ? 862  HIS A CA  1 
ATOM   350 C C   . HIS A 1 68  ? -5.407  27.214 4.903   1.00 23.56 ? 862  HIS A C   1 
ATOM   351 O O   . HIS A 1 68  ? -5.069  27.597 3.783   1.00 24.27 ? 862  HIS A O   1 
ATOM   352 C CB  . HIS A 1 68  ? -7.807  26.651 4.826   1.00 24.94 ? 862  HIS A CB  1 
ATOM   353 C CG  . HIS A 1 68  ? -8.918  26.278 5.741   1.00 23.62 ? 862  HIS A CG  1 
ATOM   354 N ND1 . HIS A 1 68  ? -10.216 26.111 5.298   1.00 25.78 ? 862  HIS A ND1 1 
ATOM   355 C CD2 . HIS A 1 68  ? -8.935  26.003 7.070   1.00 24.58 ? 862  HIS A CD2 1 
ATOM   356 C CE1 . HIS A 1 68  ? -10.980 25.766 6.315   1.00 27.68 ? 862  HIS A CE1 1 
ATOM   357 N NE2 . HIS A 1 68  ? -10.230 25.695 7.405   1.00 25.44 ? 862  HIS A NE2 1 
ATOM   358 N N   . VAL A 1 69  ? -4.654  26.433 5.655   1.00 20.41 ? 863  VAL A N   1 
ATOM   359 C CA  . VAL A 1 69  ? -3.398  25.913 5.167   1.00 21.70 ? 863  VAL A CA  1 
ATOM   360 C C   . VAL A 1 69  ? -3.607  24.442 4.825   1.00 21.57 ? 863  VAL A C   1 
ATOM   361 O O   . VAL A 1 69  ? -4.176  23.688 5.605   1.00 21.32 ? 863  VAL A O   1 
ATOM   362 C CB  . VAL A 1 69  ? -2.286  26.090 6.185   1.00 23.26 ? 863  VAL A CB  1 
ATOM   363 C CG1 . VAL A 1 69  ? -1.036  25.327 5.752   1.00 24.35 ? 863  VAL A CG1 1 
ATOM   364 C CG2 . VAL A 1 69  ? -1.952  27.575 6.357   1.00 23.14 ? 863  VAL A CG2 1 
ATOM   365 N N   . ILE A 1 70  ? -3.234  24.065 3.600   1.00 18.45 ? 864  ILE A N   1 
ATOM   366 C CA  . ILE A 1 70  ? -3.449  22.700 3.118   1.00 19.04 ? 864  ILE A CA  1 
ATOM   367 C C   . ILE A 1 70  ? -2.272  21.799 3.474   1.00 25.19 ? 864  ILE A C   1 
ATOM   368 O O   . ILE A 1 70  ? -1.135  22.019 3.026   1.00 23.59 ? 864  ILE A O   1 
ATOM   369 C CB  . ILE A 1 70  ? -3.667  22.696 1.574   1.00 17.83 ? 864  ILE A CB  1 
ATOM   370 C CG1 . ILE A 1 70  ? -4.830  23.615 1.220   1.00 18.42 ? 864  ILE A CG1 1 
ATOM   371 C CG2 . ILE A 1 70  ? -3.940  21.278 1.136   1.00 19.55 ? 864  ILE A CG2 1 
ATOM   372 C CD1 . ILE A 1 70  ? -4.988  23.808 -0.333  1.00 20.00 ? 864  ILE A CD1 1 
ATOM   373 N N   . LEU A 1 71  ? -2.529  20.811 4.338   1.00 22.49 ? 865  LEU A N   1 
ATOM   374 C CA  . LEU A 1 71  ? -1.498  19.893 4.823   1.00 22.55 ? 865  LEU A CA  1 
ATOM   375 C C   . LEU A 1 71  ? -1.334  18.640 3.935   1.00 24.29 ? 865  LEU A C   1 
ATOM   376 O O   . LEU A 1 71  ? -0.210  18.156 3.711   1.00 24.99 ? 865  LEU A O   1 
ATOM   377 C CB  . LEU A 1 71  ? -1.826  19.454 6.255   1.00 23.04 ? 865  LEU A CB  1 
ATOM   378 C CG  . LEU A 1 71  ? -2.121  20.642 7.178   1.00 22.64 ? 865  LEU A CG  1 
ATOM   379 C CD1 . LEU A 1 71  ? -2.595  20.113 8.559   1.00 27.86 ? 865  LEU A CD1 1 
ATOM   380 C CD2 . LEU A 1 71  ? -0.902  21.523 7.307   1.00 28.20 ? 865  LEU A CD2 1 
ATOM   381 N N   . GLU A 1 72  ? -2.453  18.101 3.472   1.00 23.68 ? 866  GLU A N   1 
ATOM   382 C CA  . GLU A 1 72  ? -2.469  16.873 2.666   1.00 24.02 ? 866  GLU A CA  1 
ATOM   383 C C   . GLU A 1 72  ? -3.544  16.931 1.613   1.00 22.66 ? 866  GLU A C   1 
ATOM   384 O O   . GLU A 1 72  ? -4.587  17.543 1.831   1.00 24.64 ? 866  GLU A O   1 
ATOM   385 C CB  . GLU A 1 72  ? -2.724  15.638 3.543   1.00 26.68 ? 866  GLU A CB  1 
ATOM   386 C CG  . GLU A 1 72  ? -1.725  15.454 4.687   1.00 31.87 ? 866  GLU A CG  1 
ATOM   387 C CD  . GLU A 1 72  ? -1.987  14.198 5.504   1.00 40.17 ? 866  GLU A CD  1 
ATOM   388 O OE1 . GLU A 1 72  ? -2.979  13.490 5.219   1.00 35.78 ? 866  GLU A OE1 1 
ATOM   389 O OE2 . GLU A 1 72  ? -1.197  13.921 6.436   1.00 44.04 ? 866  GLU A OE2 1 
ATOM   390 N N   . VAL A 1 73  ? -3.321  16.257 0.478   1.00 21.83 ? 867  VAL A N   1 
ATOM   391 C CA  . VAL A 1 73  ? -4.310  16.188 -0.589  1.00 22.14 ? 867  VAL A CA  1 
ATOM   392 C C   . VAL A 1 73  ? -4.522  14.710 -0.859  1.00 26.00 ? 867  VAL A C   1 
ATOM   393 O O   . VAL A 1 73  ? -3.570  14.027 -1.239  1.00 26.14 ? 867  VAL A O   1 
ATOM   394 C CB  . VAL A 1 73  ? -3.842  16.899 -1.895  1.00 22.36 ? 867  VAL A CB  1 
ATOM   395 C CG1 . VAL A 1 73  ? -4.825  16.665 -3.012  1.00 23.68 ? 867  VAL A CG1 1 
ATOM   396 C CG2 . VAL A 1 73  ? -3.642  18.410 -1.626  1.00 23.65 ? 867  VAL A CG2 1 
ATOM   397 N N   . ASN A 1 74  ? -5.750  14.218 -0.664  1.00 23.56 ? 868  ASN A N   1 
ATOM   398 C CA  . ASN A 1 74  ? -6.034  12.793 -0.829  1.00 23.01 ? 868  ASN A CA  1 
ATOM   399 C C   . ASN A 1 74  ? -5.051  11.909 -0.058  1.00 28.97 ? 868  ASN A C   1 
ATOM   400 O O   . ASN A 1 74  ? -4.732  10.783 -0.461  1.00 31.67 ? 868  ASN A O   1 
ATOM   401 C CB  . ASN A 1 74  ? -6.063  12.436 -2.331  1.00 28.15 ? 868  ASN A CB  1 
ATOM   402 C CG  . ASN A 1 74  ? -7.283  13.019 -3.040  1.00 30.58 ? 868  ASN A CG  1 
ATOM   403 O OD1 . ASN A 1 74  ? -8.276  13.308 -2.401  1.00 27.40 ? 868  ASN A OD1 1 
ATOM   404 N ND2 . ASN A 1 74  ? -7.216  13.178 -4.363  1.00 27.90 ? 868  ASN A ND2 1 
ATOM   405 N N   . GLY A 1 75  ? -4.617  12.409 1.092   1.00 29.18 ? 869  GLY A N   1 
ATOM   406 C CA  . GLY A 1 75  ? -3.737  11.635 1.946   1.00 32.79 ? 869  GLY A CA  1 
ATOM   407 C C   . GLY A 1 75  ? -2.261  11.802 1.636   1.00 35.47 ? 869  GLY A C   1 
ATOM   408 O O   . GLY A 1 75  ? -1.412  11.263 2.360   1.00 35.13 ? 869  GLY A O   1 
ATOM   409 N N   . LEU A 1 76  ? -1.944  12.525 0.561   1.00 32.29 ? 870  LEU A N   1 
ATOM   410 C CA  . LEU A 1 76  ? -0.542  12.809 0.217   1.00 36.25 ? 870  LEU A CA  1 
ATOM   411 C C   . LEU A 1 76  ? -0.051  14.100 0.889   1.00 31.76 ? 870  LEU A C   1 
ATOM   412 O O   . LEU A 1 76  ? -0.642  15.152 0.696   1.00 29.05 ? 870  LEU A O   1 
ATOM   413 C CB  . LEU A 1 76  ? -0.369  12.919 -1.305  1.00 39.02 ? 870  LEU A CB  1 
ATOM   414 C CG  . LEU A 1 76  ? 1.047   13.244 -1.794  1.00 47.66 ? 870  LEU A CG  1 
ATOM   415 C CD1 . LEU A 1 76  ? 2.045   12.245 -1.224  1.00 52.33 ? 870  LEU A CD1 1 
ATOM   416 C CD2 . LEU A 1 76  ? 1.139   13.261 -3.314  1.00 48.72 ? 870  LEU A CD2 1 
ATOM   417 N N   . THR A 1 77  ? 1.035   14.028 1.666   1.00 30.18 ? 871  THR A N   1 
ATOM   418 C CA  . THR A 1 77  ? 1.514   15.238 2.331   1.00 28.70 ? 871  THR A CA  1 
ATOM   419 C C   . THR A 1 77  ? 2.068   16.246 1.321   1.00 30.62 ? 871  THR A C   1 
ATOM   420 O O   . THR A 1 77  ? 2.682   15.888 0.315   1.00 32.73 ? 871  THR A O   1 
ATOM   421 C CB  . THR A 1 77  ? 2.601   14.939 3.385   1.00 32.88 ? 871  THR A CB  1 
ATOM   422 O OG1 . THR A 1 77  ? 2.920   16.148 4.092   1.00 33.29 ? 871  THR A OG1 1 
ATOM   423 C CG2 . THR A 1 77  ? 3.860   14.383 2.730   1.00 36.28 ? 871  THR A CG2 1 
ATOM   424 N N   . LEU A 1 78  ? 1.817   17.522 1.588   1.00 26.11 ? 872  LEU A N   1 
ATOM   425 C CA  . LEU A 1 78  ? 2.414   18.571 0.786   1.00 26.09 ? 872  LEU A CA  1 
ATOM   426 C C   . LEU A 1 78  ? 3.709   19.091 1.413   1.00 29.40 ? 872  LEU A C   1 
ATOM   427 O O   . LEU A 1 78  ? 4.331   19.978 0.834   1.00 28.67 ? 872  LEU A O   1 
ATOM   428 C CB  . LEU A 1 78  ? 1.435   19.734 0.600   1.00 25.26 ? 872  LEU A CB  1 
ATOM   429 C CG  . LEU A 1 78  ? 0.169   19.348 -0.151  1.00 24.02 ? 872  LEU A CG  1 
ATOM   430 C CD1 . LEU A 1 78  ? -0.672  20.552 -0.482  1.00 22.04 ? 872  LEU A CD1 1 
ATOM   431 C CD2 . LEU A 1 78  ? 0.479   18.555 -1.440  1.00 24.10 ? 872  LEU A CD2 1 
ATOM   432 N N   . ARG A 1 79  ? 4.096   18.572 2.593   1.00 27.05 ? 873  ARG A N   1 
ATOM   433 C CA  . ARG A 1 79  ? 5.344   19.016 3.222   1.00 29.09 ? 873  ARG A CA  1 
ATOM   434 C C   . ARG A 1 79  ? 6.493   18.600 2.318   1.00 32.21 ? 873  ARG A C   1 
ATOM   435 O O   . ARG A 1 79  ? 6.569   17.449 1.892   1.00 32.04 ? 873  ARG A O   1 
ATOM   436 C CB  . ARG A 1 79  ? 5.508   18.439 4.642   1.00 29.72 ? 873  ARG A CB  1 
ATOM   437 C CG  . ARG A 1 79  ? 6.807   18.857 5.321   1.00 38.11 ? 873  ARG A CG  1 
ATOM   438 C CD  . ARG A 1 79  ? 6.716   18.677 6.833   1.00 45.17 ? 873  ARG A CD  1 
ATOM   439 N NE  . ARG A 1 79  ? 5.806   19.652 7.444   1.00 48.49 ? 873  ARG A NE  1 
ATOM   440 C CZ  . ARG A 1 79  ? 6.120   20.924 7.687   1.00 49.69 ? 873  ARG A CZ  1 
ATOM   441 N NH1 . ARG A 1 79  ? 7.323   21.392 7.362   1.00 51.15 ? 873  ARG A NH1 1 
ATOM   442 N NH2 . ARG A 1 79  ? 5.235   21.729 8.257   1.00 45.83 ? 873  ARG A NH2 1 
ATOM   443 N N   . GLY A 1 80  ? 7.373   19.541 1.991   1.00 30.82 ? 874  GLY A N   1 
ATOM   444 C CA  . GLY A 1 80  ? 8.514   19.209 1.168   1.00 31.72 ? 874  GLY A CA  1 
ATOM   445 C C   . GLY A 1 80  ? 8.248   19.426 -0.305  1.00 31.57 ? 874  GLY A C   1 
ATOM   446 O O   . GLY A 1 80  ? 9.181   19.383 -1.101  1.00 36.26 ? 874  GLY A O   1 
ATOM   447 N N   . LYS A 1 81  ? 6.991   19.668 -0.684  1.00 26.41 ? 875  LYS A N   1 
ATOM   448 C CA  . LYS A 1 81  ? 6.665   19.910 -2.091  1.00 28.45 ? 875  LYS A CA  1 
ATOM   449 C C   . LYS A 1 81  ? 6.820   21.381 -2.404  1.00 32.46 ? 875  LYS A C   1 
ATOM   450 O O   . LYS A 1 81  ? 6.257   22.226 -1.714  1.00 28.54 ? 875  LYS A O   1 
ATOM   451 C CB  . LYS A 1 81  ? 5.232   19.465 -2.422  1.00 28.16 ? 875  LYS A CB  1 
ATOM   452 C CG  . LYS A 1 81  ? 4.939   17.997 -2.115  1.00 35.49 ? 875  LYS A CG  1 
ATOM   453 C CD  . LYS A 1 81  ? 5.974   17.087 -2.734  1.00 48.94 ? 875  LYS A CD  1 
ATOM   454 C CE  . LYS A 1 81  ? 5.670   15.637 -2.416  1.00 58.32 ? 875  LYS A CE  1 
ATOM   455 N NZ  . LYS A 1 81  ? 4.380   15.245 -3.032  1.00 61.29 ? 875  LYS A NZ  1 
ATOM   456 N N   . GLU A 1 82  ? 7.568   21.685 -3.456  1.00 31.42 ? 876  GLU A N   1 
ATOM   457 C CA  . GLU A 1 82  ? 7.704   23.056 -3.918  1.00 29.49 ? 876  GLU A CA  1 
ATOM   458 C C   . GLU A 1 82  ? 6.349   23.557 -4.414  1.00 29.32 ? 876  GLU A C   1 
ATOM   459 O O   . GLU A 1 82  ? 5.458   22.760 -4.679  1.00 29.63 ? 876  GLU A O   1 
ATOM   460 C CB  . GLU A 1 82  ? 8.783   23.110 -5.029  1.00 41.89 ? 876  GLU A CB  1 
ATOM   461 C CG  . GLU A 1 82  ? 9.176   24.488 -5.544  1.00 59.28 ? 876  GLU A CG  1 
ATOM   462 C CD  . GLU A 1 82  ? 8.329   24.955 -6.711  1.00 75.99 ? 876  GLU A CD  1 
ATOM   463 O OE1 . GLU A 1 82  ? 7.801   24.084 -7.428  1.00 85.48 ? 876  GLU A OE1 1 
ATOM   464 O OE2 . GLU A 1 82  ? 8.200   26.184 -6.913  1.00 79.78 ? 876  GLU A OE2 1 
ATOM   465 N N   . HIS A 1 83  ? 6.151   24.872 -4.469  1.00 27.35 ? 877  HIS A N   1 
ATOM   466 C CA  . HIS A 1 83  ? 4.847   25.397 -4.861  1.00 27.13 ? 877  HIS A CA  1 
ATOM   467 C C   . HIS A 1 83  ? 4.310   24.770 -6.158  1.00 25.73 ? 877  HIS A C   1 
ATOM   468 O O   . HIS A 1 83  ? 3.153   24.354 -6.191  1.00 26.18 ? 877  HIS A O   1 
ATOM   469 C CB  . HIS A 1 83  ? 4.900   26.905 -5.039  1.00 30.18 ? 877  HIS A CB  1 
ATOM   470 C CG  . HIS A 1 83  ? 3.616   27.488 -5.519  1.00 27.23 ? 877  HIS A CG  1 
ATOM   471 N ND1 . HIS A 1 83  ? 2.559   27.754 -4.670  1.00 25.50 ? 877  HIS A ND1 1 
ATOM   472 C CD2 . HIS A 1 83  ? 3.210   27.862 -6.756  1.00 30.25 ? 877  HIS A CD2 1 
ATOM   473 C CE1 . HIS A 1 83  ? 1.562   28.268 -5.369  1.00 26.66 ? 877  HIS A CE1 1 
ATOM   474 N NE2 . HIS A 1 83  ? 1.918   28.316 -6.641  1.00 27.96 ? 877  HIS A NE2 1 
ATOM   475 N N   . ARG A 1 84  ? 5.131   24.686 -7.212  1.00 26.79 ? 878  ARG A N   1 
ATOM   476 C CA  . ARG A 1 84  ? 4.619   24.168 -8.470  1.00 25.66 ? 878  ARG A CA  1 
ATOM   477 C C   . ARG A 1 84  ? 4.192   22.709 -8.371  1.00 31.33 ? 878  ARG A C   1 
ATOM   478 O O   . ARG A 1 84  ? 3.251   22.277 -9.069  1.00 35.91 ? 878  ARG A O   1 
ATOM   479 C CB  . ARG A 1 84  ? 5.673   24.356 -9.580  1.00 31.43 ? 878  ARG A CB  1 
ATOM   480 C CG  . ARG A 1 84  ? 5.940   25.817 -9.822  1.00 36.25 ? 878  ARG A CG  1 
ATOM   481 C CD  . ARG A 1 84  ? 7.172   26.067 -10.739 1.00 50.89 ? 878  ARG A CD  1 
ATOM   482 N NE  . ARG A 1 84  ? 8.431   25.756 -10.057 1.00 53.21 ? 878  ARG A NE  1 
ATOM   483 C CZ  . ARG A 1 84  ? 9.624   26.194 -10.452 1.00 55.29 ? 878  ARG A CZ  1 
ATOM   484 N NH1 . ARG A 1 84  ? 9.714   26.970 -11.506 1.00 54.85 ? 878  ARG A NH1 1 
ATOM   485 N NH2 . ARG A 1 84  ? 10.725  25.873 -9.779  1.00 58.09 ? 878  ARG A NH2 1 
ATOM   486 N N   . GLU A 1 85  ? 4.864   21.946 -7.511  1.00 30.37 ? 879  GLU A N   1 
ATOM   487 C CA  . GLU A 1 85  ? 4.544   20.541 -7.359  1.00 35.53 ? 879  GLU A CA  1 
ATOM   488 C C   . GLU A 1 85  ? 3.274   20.388 -6.556  1.00 30.22 ? 879  GLU A C   1 
ATOM   489 O O   . GLU A 1 85  ? 2.431   19.573 -6.896  1.00 30.58 ? 879  GLU A O   1 
ATOM   490 C CB  . GLU A 1 85  ? 5.686   19.754 -6.700  1.00 41.73 ? 879  GLU A CB  1 
ATOM   491 C CG  . GLU A 1 85  ? 5.335   18.299 -6.307  1.00 56.25 ? 879  GLU A CG  1 
ATOM   492 C CD  . GLU A 1 85  ? 4.988   17.361 -7.479  1.00 77.30 ? 879  GLU A CD  1 
ATOM   493 O OE1 . GLU A 1 85  ? 4.460   17.811 -8.522  1.00 86.41 ? 879  GLU A OE1 1 
ATOM   494 O OE2 . GLU A 1 85  ? 5.240   16.145 -7.338  1.00 80.17 ? 879  GLU A OE2 1 
ATOM   495 N N   . ALA A 1 86  ? 3.136   21.167 -5.483  1.00 26.01 ? 880  ALA A N   1 
ATOM   496 C CA  . ALA A 1 86  ? 1.890   21.147 -4.725  1.00 23.66 ? 880  ALA A CA  1 
ATOM   497 C C   . ALA A 1 86  ? 0.690   21.525 -5.595  1.00 26.58 ? 880  ALA A C   1 
ATOM   498 O O   . ALA A 1 86  ? -0.380  20.894 -5.527  1.00 24.37 ? 880  ALA A O   1 
ATOM   499 C CB  . ALA A 1 86  ? 1.984   22.088 -3.519  1.00 26.83 ? 880  ALA A CB  1 
ATOM   500 N N   . ALA A 1 87  ? 0.842   22.559 -6.413  1.00 26.31 ? 881  ALA A N   1 
ATOM   501 C CA  . ALA A 1 87  ? -0.283  22.966 -7.238  1.00 28.66 ? 881  ALA A CA  1 
ATOM   502 C C   . ALA A 1 87  ? -0.632  21.873 -8.238  1.00 29.68 ? 881  ALA A C   1 
ATOM   503 O O   . ALA A 1 87  ? -1.815  21.601 -8.514  1.00 28.91 ? 881  ALA A O   1 
ATOM   504 C CB  . ALA A 1 87  ? 0.035   24.272 -7.935  1.00 30.19 ? 881  ALA A CB  1 
ATOM   505 N N   . ARG A 1 88  ? 0.388   21.213 -8.767  1.00 29.25 ? 882  ARG A N   1 
ATOM   506 C CA  . ARG A 1 88  ? 0.135   20.175 -9.752  1.00 32.14 ? 882  ARG A CA  1 
ATOM   507 C C   . ARG A 1 88  ? -0.560  18.984 -9.120  1.00 29.63 ? 882  ARG A C   1 
ATOM   508 O O   . ARG A 1 88  ? -1.406  18.353 -9.742  1.00 28.43 ? 882  ARG A O   1 
ATOM   509 C CB  . ARG A 1 88  ? 1.438   19.733 -10.426 1.00 36.28 ? 882  ARG A CB  1 
ATOM   510 C CG  . ARG A 1 88  ? 1.215   18.754 -11.562 1.00 45.33 ? 882  ARG A CG  1 
ATOM   511 C CD  . ARG A 1 88  ? 2.143   17.544 -11.452 1.00 58.63 ? 882  ARG A CD  1 
ATOM   512 N NE  . ARG A 1 88  ? 1.671   16.593 -10.443 1.00 68.94 ? 882  ARG A NE  1 
ATOM   513 C CZ  . ARG A 1 88  ? 2.412   15.627 -9.907  1.00 76.53 ? 882  ARG A CZ  1 
ATOM   514 N NH1 . ARG A 1 88  ? 3.678   15.474 -10.269 1.00 81.55 ? 882  ARG A NH1 1 
ATOM   515 N NH2 . ARG A 1 88  ? 1.885   14.812 -9.004  1.00 77.29 ? 882  ARG A NH2 1 
ATOM   516 N N   . ILE A 1 89  ? -0.244  18.704 -7.849  1.00 26.28 ? 883  ILE A N   1 
ATOM   517 C CA  . ILE A 1 89  ? -0.895  17.594 -7.176  1.00 26.04 ? 883  ILE A CA  1 
ATOM   518 C C   . ILE A 1 89  ? -2.365  17.877 -7.043  1.00 29.16 ? 883  ILE A C   1 
ATOM   519 O O   . ILE A 1 89  ? -3.193  16.997 -7.232  1.00 29.96 ? 883  ILE A O   1 
ATOM   520 C CB  . ILE A 1 89  ? -0.259  17.362 -5.784  1.00 28.35 ? 883  ILE A CB  1 
ATOM   521 C CG1 . ILE A 1 89  ? 1.118   16.742 -5.960  1.00 35.20 ? 883  ILE A CG1 1 
ATOM   522 C CG2 . ILE A 1 89  ? -1.179  16.531 -4.866  1.00 31.93 ? 883  ILE A CG2 1 
ATOM   523 C CD1 . ILE A 1 89  ? 2.040   16.895 -4.799  1.00 37.15 ? 883  ILE A CD1 1 
ATOM   524 N N   . ILE A 1 90  ? -2.690  19.118 -6.697  1.00 25.46 ? 884  ILE A N   1 
ATOM   525 C CA  . ILE A 1 90  ? -4.083  19.488 -6.486  1.00 22.27 ? 884  ILE A CA  1 
ATOM   526 C C   . ILE A 1 90  ? -4.839  19.502 -7.803  1.00 24.88 ? 884  ILE A C   1 
ATOM   527 O O   . ILE A 1 90  ? -5.958  18.987 -7.928  1.00 26.09 ? 884  ILE A O   1 
ATOM   528 C CB  . ILE A 1 90  ? -4.178  20.865 -5.796  1.00 23.17 ? 884  ILE A CB  1 
ATOM   529 C CG1 . ILE A 1 90  ? -3.655  20.775 -4.354  1.00 21.67 ? 884  ILE A CG1 1 
ATOM   530 C CG2 . ILE A 1 90  ? -5.606  21.338 -5.774  1.00 24.81 ? 884  ILE A CG2 1 
ATOM   531 C CD1 . ILE A 1 90  ? -3.400  22.135 -3.701  1.00 25.06 ? 884  ILE A CD1 1 
ATOM   532 N N   . ALA A 1 91  ? -4.216  20.061 -8.832  1.00 26.13 ? 885  ALA A N   1 
ATOM   533 C CA  . ALA A 1 91  ? -4.827  20.048 -10.166 1.00 24.43 ? 885  ALA A CA  1 
ATOM   534 C C   . ALA A 1 91  ? -5.109  18.639 -10.675 1.00 27.20 ? 885  ALA A C   1 
ATOM   535 O O   . ALA A 1 91  ? -6.174  18.367 -11.217 1.00 30.67 ? 885  ALA A O   1 
ATOM   536 C CB  . ALA A 1 91  ? -3.919  20.779 -11.141 1.00 34.11 ? 885  ALA A CB  1 
ATOM   537 N N   . GLU A 1 92  ? -4.170  17.730 -10.459 1.00 28.72 ? 886  GLU A N   1 
ATOM   538 C CA  . GLU A 1 92  ? -4.340  16.363 -10.924 1.00 34.66 ? 886  GLU A CA  1 
ATOM   539 C C   . GLU A 1 92  ? -5.411  15.653 -10.117 1.00 33.58 ? 886  GLU A C   1 
ATOM   540 O O   . GLU A 1 92  ? -6.167  14.848 -10.658 1.00 34.20 ? 886  GLU A O   1 
ATOM   541 C CB  . GLU A 1 92  ? -3.016  15.604 -10.870 1.00 44.96 ? 886  GLU A CB  1 
ATOM   542 C CG  . GLU A 1 92  ? -1.943  16.140 -11.849 1.00 56.94 ? 886  GLU A CG  1 
ATOM   543 C CD  . GLU A 1 92  ? -2.486  16.491 -13.249 1.00 70.97 ? 886  GLU A CD  1 
ATOM   544 O OE1 . GLU A 1 92  ? -3.060  15.601 -13.914 1.00 75.75 ? 886  GLU A OE1 1 
ATOM   545 O OE2 . GLU A 1 92  ? -2.317  17.652 -13.697 1.00 74.74 ? 886  GLU A OE2 1 
ATOM   546 N N   . ALA A 1 93  ? -5.474  15.958 -8.823  1.00 29.62 ? 887  ALA A N   1 
ATOM   547 C CA  . ALA A 1 93  ? -6.541  15.452 -7.977  1.00 25.43 ? 887  ALA A CA  1 
ATOM   548 C C   . ALA A 1 93  ? -7.919  15.955 -8.437  1.00 26.74 ? 887  ALA A C   1 
ATOM   549 O O   . ALA A 1 93  ? -8.909  15.238 -8.292  1.00 26.36 ? 887  ALA A O   1 
ATOM   550 C CB  . ALA A 1 93  ? -6.280  15.839 -6.506  1.00 25.51 ? 887  ALA A CB  1 
ATOM   551 N N   . PHE A 1 94  ? -8.006  17.171 -8.979  1.00 26.09 ? 888  PHE A N   1 
ATOM   552 C CA  . PHE A 1 94  ? -9.309  17.675 -9.453  1.00 24.81 ? 888  PHE A CA  1 
ATOM   553 C C   . PHE A 1 94  ? -9.701  17.022 -10.783 1.00 28.28 ? 888  PHE A C   1 
ATOM   554 O O   . PHE A 1 94  ? -10.882 16.685 -11.015 1.00 28.71 ? 888  PHE A O   1 
ATOM   555 C CB  . PHE A 1 94  ? -9.289  19.213 -9.604  1.00 24.60 ? 888  PHE A CB  1 
ATOM   556 C CG  . PHE A 1 94  ? -10.658 19.799 -9.896  1.00 27.10 ? 888  PHE A CG  1 
ATOM   557 C CD1 . PHE A 1 94  ? -11.567 19.988 -8.860  1.00 34.00 ? 888  PHE A CD1 1 
ATOM   558 C CD2 . PHE A 1 94  ? -11.041 20.108 -11.195 1.00 34.48 ? 888  PHE A CD2 1 
ATOM   559 C CE1 . PHE A 1 94  ? -12.834 20.486 -9.109  1.00 31.13 ? 888  PHE A CE1 1 
ATOM   560 C CE2 . PHE A 1 94  ? -12.305 20.614 -11.451 1.00 38.67 ? 888  PHE A CE2 1 
ATOM   561 C CZ  . PHE A 1 94  ? -13.195 20.809 -10.393 1.00 36.27 ? 888  PHE A CZ  1 
ATOM   562 N N   . LYS A 1 95  ? -8.702  16.817 -11.635 1.00 30.28 ? 889  LYS A N   1 
ATOM   563 C CA  . LYS A 1 95  ? -8.919  16.334 -13.000 1.00 30.54 ? 889  LYS A CA  1 
ATOM   564 C C   . LYS A 1 95  ? -9.269  14.863 -13.028 1.00 31.52 ? 889  LYS A C   1 
ATOM   565 O O   . LYS A 1 95  ? -9.915  14.392 -13.986 1.00 37.78 ? 889  LYS A O   1 
ATOM   566 C CB  . LYS A 1 95  ? -7.673  16.543 -13.849 1.00 33.51 ? 889  LYS A CB  1 
ATOM   567 C CG  . LYS A 1 95  ? -7.329  17.975 -14.215 1.00 44.67 ? 889  LYS A CG  1 
ATOM   568 C CD  . LYS A 1 95  ? -5.897  18.008 -14.777 1.00 56.69 ? 889  LYS A CD  1 
ATOM   569 C CE  . LYS A 1 95  ? -5.430  19.396 -15.219 1.00 63.94 ? 889  LYS A CE  1 
ATOM   570 N NZ  . LYS A 1 95  ? -5.749  19.691 -16.652 1.00 68.25 ? 889  LYS A NZ  1 
ATOM   571 N N   . THR A 1 96  ? -8.797  14.100 -12.042 1.00 28.48 ? 890  THR A N   1 
ATOM   572 C CA  . THR A 1 96  ? -8.941  12.643 -12.161 1.00 31.55 ? 890  THR A CA  1 
ATOM   573 C C   . THR A 1 96  ? -10.394 12.180 -12.193 1.00 30.07 ? 890  THR A C   1 
ATOM   574 O O   . THR A 1 96  ? -11.258 12.753 -11.548 1.00 30.01 ? 890  THR A O   1 
ATOM   575 C CB  . THR A 1 96  ? -8.237  11.872 -11.031 1.00 33.22 ? 890  THR A CB  1 
ATOM   576 O OG1 . THR A 1 96  ? -8.301  10.468 -11.320 1.00 36.01 ? 890  THR A OG1 1 
ATOM   577 C CG2 . THR A 1 96  ? -8.886  12.127 -9.693  1.00 34.90 ? 890  THR A CG2 1 
ATOM   578 N N   . LYS A 1 97  ? -10.652 11.113 -12.918 1.00 33.29 ? 891  LYS A N   1 
ATOM   579 C CA  . LYS A 1 97  ? -11.978 10.571 -13.003 1.00 33.82 ? 891  LYS A CA  1 
ATOM   580 C C   . LYS A 1 97  ? -12.187 9.428  -12.036 1.00 33.46 ? 891  LYS A C   1 
ATOM   581 O O   . LYS A 1 97  ? -13.229 8.866  -11.986 1.00 35.16 ? 891  LYS A O   1 
ATOM   582 C CB  . LYS A 1 97  ? -12.293 10.152 -14.430 1.00 44.88 ? 891  LYS A CB  1 
ATOM   583 C CG  . LYS A 1 97  ? -12.675 11.302 -15.343 1.00 55.72 ? 891  LYS A CG  1 
ATOM   584 C CD  . LYS A 1 97  ? -12.987 10.806 -16.732 1.00 69.19 ? 891  LYS A CD  1 
ATOM   585 C CE  . LYS A 1 97  ? -12.957 11.928 -17.745 1.00 80.15 ? 891  LYS A CE  1 
ATOM   586 N NZ  . LYS A 1 97  ? -13.085 11.396 -19.139 1.00 83.41 ? 891  LYS A NZ  1 
ATOM   587 N N   . ASP A 1 98  ? -11.195 9.142  -11.224 1.00 34.50 ? 892  ASP A N   1 
ATOM   588 C CA  . ASP A 1 98  ? -11.280 8.059  -10.239 1.00 36.69 ? 892  ASP A CA  1 
ATOM   589 C C   . ASP A 1 98  ? -12.345 8.293  -9.164  1.00 34.29 ? 892  ASP A C   1 
ATOM   590 O O   . ASP A 1 98  ? -12.890 7.340  -8.608  1.00 37.76 ? 892  ASP A O   1 
ATOM   591 C CB  . ASP A 1 98  ? -9.927  7.860  -9.550  1.00 44.36 ? 892  ASP A CB  1 
ATOM   592 C CG  . ASP A 1 98  ? -8.875  7.289  -10.483 1.00 55.10 ? 892  ASP A CG  1 
ATOM   593 O OD1 . ASP A 1 98  ? -9.223  6.953  -11.636 1.00 56.44 ? 892  ASP A OD1 1 
ATOM   594 O OD2 . ASP A 1 98  ? -7.707  7.151  -10.056 1.00 56.97 ? 892  ASP A OD2 1 
ATOM   595 N N   . ARG A 1 99  ? -12.626 9.559  -8.882  1.00 32.10 ? 893  ARG A N   1 
ATOM   596 C CA  . ARG A 1 99  ? -13.585 9.916  -7.857  1.00 27.93 ? 893  ARG A CA  1 
ATOM   597 C C   . ARG A 1 99  ? -14.147 11.305 -8.128  1.00 26.09 ? 893  ARG A C   1 
ATOM   598 O O   . ARG A 1 99  ? -13.611 12.046 -8.941  1.00 27.99 ? 893  ARG A O   1 
ATOM   599 C CB  . ARG A 1 99  ? -12.940 9.864  -6.461  1.00 29.91 ? 893  ARG A CB  1 
ATOM   600 C CG  . ARG A 1 99  ? -11.847 10.896 -6.224  1.00 30.74 ? 893  ARG A CG  1 
ATOM   601 C CD  . ARG A 1 99  ? -10.975 10.488 -5.024  1.00 29.68 ? 893  ARG A CD  1 
ATOM   602 N NE  . ARG A 1 99  ? -10.135 9.315  -5.317  1.00 32.40 ? 893  ARG A NE  1 
ATOM   603 C CZ  . ARG A 1 99  ? -8.952  9.373  -5.937  1.00 35.98 ? 893  ARG A CZ  1 
ATOM   604 N NH1 . ARG A 1 99  ? -8.459  10.539 -6.338  1.00 35.40 ? 893  ARG A NH1 1 
ATOM   605 N NH2 . ARG A 1 99  ? -8.254  8.261  -6.154  1.00 39.47 ? 893  ARG A NH2 1 
ATOM   606 N N   . ASP A 1 100 ? -15.225 11.665 -7.425  1.00 26.39 ? 894  ASP A N   1 
ATOM   607 C CA  . ASP A 1 100 ? -15.877 12.933 -7.732  1.00 25.68 ? 894  ASP A CA  1 
ATOM   608 C C   . ASP A 1 100 ? -15.658 13.978 -6.644  1.00 25.46 ? 894  ASP A C   1 
ATOM   609 O O   . ASP A 1 100 ? -16.426 14.944 -6.535  1.00 24.56 ? 894  ASP A O   1 
ATOM   610 C CB  . ASP A 1 100 ? -17.380 12.724 -7.953  1.00 28.98 ? 894  ASP A CB  1 
ATOM   611 C CG  . ASP A 1 100 ? -18.173 12.454 -6.666  1.00 42.98 ? 894  ASP A CG  1 
ATOM   612 O OD1 . ASP A 1 100 ? -17.617 12.102 -5.591  1.00 41.44 ? 894  ASP A OD1 1 
ATOM   613 O OD2 . ASP A 1 100 ? -19.415 12.595 -6.745  1.00 47.18 ? 894  ASP A OD2 1 
ATOM   614 N N   . TYR A 1 101 ? -14.580 13.807 -5.876  1.00 23.37 ? 895  TYR A N   1 
ATOM   615 C CA  . TYR A 1 101 ? -14.250 14.751 -4.805  1.00 21.38 ? 895  TYR A CA  1 
ATOM   616 C C   . TYR A 1 101 ? -12.745 14.848 -4.673  1.00 21.87 ? 895  TYR A C   1 
ATOM   617 O O   . TYR A 1 101 ? -12.034 14.033 -5.266  1.00 21.72 ? 895  TYR A O   1 
ATOM   618 C CB  . TYR A 1 101 ? -14.830 14.293 -3.455  1.00 22.29 ? 895  TYR A CB  1 
ATOM   619 C CG  . TYR A 1 101 ? -14.310 12.936 -3.034  1.00 23.36 ? 895  TYR A CG  1 
ATOM   620 C CD1 . TYR A 1 101 ? -14.962 11.768 -3.434  1.00 24.46 ? 895  TYR A CD1 1 
ATOM   621 C CD2 . TYR A 1 101 ? -13.160 12.821 -2.250  1.00 25.69 ? 895  TYR A CD2 1 
ATOM   622 C CE1 . TYR A 1 101 ? -14.477 10.510 -3.050  1.00 29.20 ? 895  TYR A CE1 1 
ATOM   623 C CE2 . TYR A 1 101 ? -12.668 11.566 -1.876  1.00 26.74 ? 895  TYR A CE2 1 
ATOM   624 C CZ  . TYR A 1 101 ? -13.333 10.429 -2.280  1.00 27.99 ? 895  TYR A CZ  1 
ATOM   625 O OH  . TYR A 1 101 ? -12.853 9.193  -1.930  1.00 31.49 ? 895  TYR A OH  1 
ATOM   626 N N   . ILE A 1 102 ? -12.286 15.836 -3.911  1.00 21.89 ? 896  ILE A N   1 
ATOM   627 C CA  . ILE A 1 102 ? -10.899 15.881 -3.429  1.00 21.85 ? 896  ILE A CA  1 
ATOM   628 C C   . ILE A 1 102 ? -10.920 16.004 -1.921  1.00 23.77 ? 896  ILE A C   1 
ATOM   629 O O   . ILE A 1 102 ? -11.658 16.820 -1.398  1.00 24.30 ? 896  ILE A O   1 
ATOM   630 C CB  . ILE A 1 102 ? -10.114 17.079 -3.985  1.00 24.53 ? 896  ILE A CB  1 
ATOM   631 C CG1 . ILE A 1 102 ? -10.181 17.158 -5.497  1.00 28.08 ? 896  ILE A CG1 1 
ATOM   632 C CG2 . ILE A 1 102 ? -8.655  17.067 -3.439  1.00 28.01 ? 896  ILE A CG2 1 
ATOM   633 C CD1 . ILE A 1 102 ? -9.460  18.419 -6.004  1.00 29.75 ? 896  ILE A CD1 1 
ATOM   634 N N   . ASP A 1 103 ? -10.106 15.207 -1.239  1.00 22.05 ? 897  ASP A N   1 
ATOM   635 C CA  . ASP A 1 103 ? -9.953  15.317 0.213   1.00 22.79 ? 897  ASP A CA  1 
ATOM   636 C C   . ASP A 1 103 ? -8.815  16.261 0.551   1.00 27.19 ? 897  ASP A C   1 
ATOM   637 O O   . ASP A 1 103 ? -7.693  16.023 0.129   1.00 29.81 ? 897  ASP A O   1 
ATOM   638 C CB  . ASP A 1 103 ? -9.662  13.943 0.843   1.00 25.83 ? 897  ASP A CB  1 
ATOM   639 C CG  . ASP A 1 103 ? -10.906 13.108 1.035   1.00 29.24 ? 897  ASP A CG  1 
ATOM   640 O OD1 . ASP A 1 103 ? -12.014 13.677 0.972   1.00 32.06 ? 897  ASP A OD1 1 
ATOM   641 O OD2 . ASP A 1 103 ? -10.764 11.876 1.262   1.00 30.40 ? 897  ASP A OD2 1 
ATOM   642 N N   . PHE A 1 104 ? -9.081  17.317 1.324   1.00 24.53 ? 898  PHE A N   1 
ATOM   643 C CA  . PHE A 1 104 ? -8.008  18.216 1.769   1.00 19.40 ? 898  PHE A CA  1 
ATOM   644 C C   . PHE A 1 104 ? -7.872  18.125 3.257   1.00 23.17 ? 898  PHE A C   1 
ATOM   645 O O   . PHE A 1 104 ? -8.866  18.312 3.945   1.00 24.33 ? 898  PHE A O   1 
ATOM   646 C CB  . PHE A 1 104 ? -8.311  19.676 1.457   1.00 19.86 ? 898  PHE A CB  1 
ATOM   647 C CG  . PHE A 1 104 ? -8.359  19.998 -0.037  1.00 20.92 ? 898  PHE A CG  1 
ATOM   648 C CD1 . PHE A 1 104 ? -7.180  20.258 -0.718  1.00 24.61 ? 898  PHE A CD1 1 
ATOM   649 C CD2 . PHE A 1 104 ? -9.559  20.089 -0.722  1.00 24.96 ? 898  PHE A CD2 1 
ATOM   650 C CE1 . PHE A 1 104 ? -7.193  20.588 -2.093  1.00 23.35 ? 898  PHE A CE1 1 
ATOM   651 C CE2 . PHE A 1 104 ? -9.586  20.419 -2.081  1.00 23.91 ? 898  PHE A CE2 1 
ATOM   652 C CZ  . PHE A 1 104 ? -8.408  20.671 -2.760  1.00 25.46 ? 898  PHE A CZ  1 
ATOM   653 N N   . LEU A 1 105 ? -6.679  17.873 3.778   1.00 20.20 ? 899  LEU A N   1 
ATOM   654 C CA  . LEU A 1 105 ? -6.505  18.022 5.225   1.00 20.55 ? 899  LEU A CA  1 
ATOM   655 C C   . LEU A 1 105 ? -6.042  19.438 5.432   1.00 23.29 ? 899  LEU A C   1 
ATOM   656 O O   . LEU A 1 105 ? -5.011  19.843 4.874   1.00 23.39 ? 899  LEU A O   1 
ATOM   657 C CB  . LEU A 1 105 ? -5.486  17.040 5.793   1.00 22.20 ? 899  LEU A CB  1 
ATOM   658 C CG  . LEU A 1 105 ? -5.313  17.035 7.308   1.00 24.23 ? 899  LEU A CG  1 
ATOM   659 C CD1 . LEU A 1 105 ? -6.591  16.426 7.883   1.00 26.42 ? 899  LEU A CD1 1 
ATOM   660 C CD2 . LEU A 1 105 ? -4.093  16.209 7.692   1.00 27.32 ? 899  LEU A CD2 1 
ATOM   661 N N   . VAL A 1 106 ? -6.787  20.217 6.204   1.00 22.23 ? 900  VAL A N   1 
ATOM   662 C CA  . VAL A 1 106 ? -6.444  21.630 6.347   1.00 19.69 ? 900  VAL A CA  1 
ATOM   663 C C   . VAL A 1 106 ? -6.305  22.006 7.809   1.00 21.30 ? 900  VAL A C   1 
ATOM   664 O O   . VAL A 1 106 ? -6.764  21.285 8.706   1.00 23.83 ? 900  VAL A O   1 
ATOM   665 C CB  . VAL A 1 106 ? -7.490  22.531 5.699   1.00 20.88 ? 900  VAL A CB  1 
ATOM   666 C CG1 . VAL A 1 106 ? -7.616  22.215 4.185   1.00 21.81 ? 900  VAL A CG1 1 
ATOM   667 C CG2 . VAL A 1 106 ? -8.835  22.328 6.406   1.00 21.93 ? 900  VAL A CG2 1 
ATOM   668 N N   . THR A 1 107 ? -5.674  23.142 8.054   1.00 19.79 ? 901  THR A N   1 
ATOM   669 C CA  . THR A 1 107 ? -5.582  23.639 9.456   1.00 20.51 ? 901  THR A CA  1 
ATOM   670 C C   . THR A 1 107 ? -5.914  25.138 9.439   1.00 19.53 ? 901  THR A C   1 
ATOM   671 O O   . THR A 1 107 ? -5.693  25.838 8.428   1.00 22.47 ? 901  THR A O   1 
ATOM   672 C CB  . THR A 1 107 ? -4.222  23.421 10.085  1.00 22.41 ? 901  THR A CB  1 
ATOM   673 O OG1 . THR A 1 107 ? -4.265  23.888 11.457  1.00 24.81 ? 901  THR A OG1 1 
ATOM   674 C CG2 . THR A 1 107 ? -3.126  24.189 9.347   1.00 24.52 ? 901  THR A CG2 1 
ATOM   675 N N   . GLU A 1 108 ? -6.458  25.630 10.550  1.00 28.33 ? 902  GLU A N   1 
ATOM   676 C CA  . GLU A 1 108 ? -6.714  27.049 10.670  1.00 27.89 ? 902  GLU A CA  1 
ATOM   677 C C   . GLU A 1 108 ? -5.523  27.734 11.309  1.00 36.43 ? 902  GLU A C   1 
ATOM   678 O O   . GLU A 1 108 ? -5.475  28.959 11.371  1.00 37.59 ? 902  GLU A O   1 
ATOM   679 C CB  . GLU A 1 108 ? -7.982  27.316 11.497  1.00 34.67 ? 902  GLU A CB  1 
ATOM   680 C CG  . GLU A 1 108 ? -9.277  26.829 10.839  1.00 41.93 ? 902  GLU A CG  1 
ATOM   681 C CD  . GLU A 1 108 ? -10.515 27.137 11.677  1.00 49.88 ? 902  GLU A CD  1 
ATOM   682 O OE1 . GLU A 1 108 ? -10.403 27.908 12.659  1.00 57.21 ? 902  GLU A OE1 1 
ATOM   683 O OE2 . GLU A 1 108 ? -11.602 26.609 11.358  1.00 50.69 ? 902  GLU A OE2 1 
ATOM   684 N N   . PHE A 1 109 ? -4.574  26.943 11.800  1.00 30.31 ? 903  PHE A N   1 
ATOM   685 C CA  . PHE A 1 109 ? -3.354  27.509 12.401  1.00 29.43 ? 903  PHE A CA  1 
ATOM   686 C C   . PHE A 1 109 ? -2.471  28.130 11.321  1.00 27.27 ? 903  PHE A C   1 
ATOM   687 O O   . PHE A 1 109 ? -2.532  27.755 10.147  1.00 27.32 ? 903  PHE A O   1 
ATOM   688 C CB  . PHE A 1 109 ? -2.535  26.455 13.133  1.00 28.84 ? 903  PHE A CB  1 
ATOM   689 C CG  . PHE A 1 109 ? -3.275  25.737 14.246  1.00 35.41 ? 903  PHE A CG  1 
ATOM   690 C CD1 . PHE A 1 109 ? -4.523  26.164 14.687  1.00 32.48 ? 903  PHE A CD1 1 
ATOM   691 C CD2 . PHE A 1 109 ? -2.684  24.642 14.866  1.00 41.35 ? 903  PHE A CD2 1 
ATOM   692 C CE1 . PHE A 1 109 ? -5.189  25.481 15.724  1.00 39.66 ? 903  PHE A CE1 1 
ATOM   693 C CE2 . PHE A 1 109 ? -3.340  23.965 15.889  1.00 39.80 ? 903  PHE A CE2 1 
ATOM   694 C CZ  . PHE A 1 109 ? -4.591  24.392 16.307  1.00 40.18 ? 903  PHE A CZ  1 
ATOM   695 N N   . ASN A 1 110 ? -1.634  29.082 11.727  1.00 27.00 ? 904  ASN A N   1 
ATOM   696 C CA  . ASN A 1 110 ? -0.576  29.523 10.837  1.00 27.56 ? 904  ASN A CA  1 
ATOM   697 C C   . ASN A 1 110 ? 0.471   28.440 10.785  1.00 27.40 ? 904  ASN A C   1 
ATOM   698 O O   . ASN A 1 110 ? 0.692   27.716 11.770  1.00 30.01 ? 904  ASN A O   1 
ATOM   699 C CB  . ASN A 1 110 ? 0.037   30.834 11.309  1.00 31.43 ? 904  ASN A CB  1 
ATOM   700 C CG  . ASN A 1 110 ? -1.005  31.856 11.664  1.00 47.02 ? 904  ASN A CG  1 
ATOM   701 O OD1 . ASN A 1 110 ? -1.642  32.441 10.796  1.00 51.68 ? 904  ASN A OD1 1 
ATOM   702 N ND2 . ASN A 1 110 ? -1.183  32.083 12.963  1.00 50.03 ? 904  ASN A ND2 1 
ATOM   703 N N   . VAL A 1 111 ? 1.122   28.302 9.644   1.00 25.91 ? 905  VAL A N   1 
ATOM   704 C CA  . VAL A 1 111 ? 2.202   27.340 9.577   1.00 27.89 ? 905  VAL A CA  1 
ATOM   705 C C   . VAL A 1 111 ? 3.420   28.140 9.148   1.00 31.67 ? 905  VAL A C   1 
ATOM   706 O O   . VAL A 1 111 ? 3.426   28.738 8.064   1.00 31.23 ? 905  VAL A O   1 
ATOM   707 C CB  . VAL A 1 111 ? 1.899   26.180 8.615   1.00 31.36 ? 905  VAL A CB  1 
ATOM   708 C CG1 . VAL A 1 111 ? 3.072   25.188 8.632   1.00 30.72 ? 905  VAL A CG1 1 
ATOM   709 C CG2 . VAL A 1 111 ? 0.602   25.485 9.062   1.00 28.69 ? 905  VAL A CG2 1 
ATOM   710 N N   . MET A 1 112 ? 4.441   28.175 9.997   1.00 26.84 ? 906  MET A N   1 
ATOM   711 C CA  . MET A 1 112 ? 5.605   29.017 9.681   1.00 30.66 ? 906  MET A CA  1 
ATOM   712 C C   . MET A 1 112 ? 6.898   28.255 9.454   1.00 35.22 ? 906  MET A C   1 
ATOM   713 O O   . MET A 1 112 ? 7.899   28.838 9.042   1.00 40.83 ? 906  MET A O   1 
ATOM   714 C CB  . MET A 1 112 ? 5.847   30.029 10.781  1.00 31.91 ? 906  MET A CB  1 
ATOM   715 C CG  . MET A 1 112 ? 4.855   31.152 10.825  1.00 36.16 ? 906  MET A CG  1 
ATOM   716 S SD  . MET A 1 112 ? 5.435   32.355 12.023  1.00 43.85 ? 906  MET A SD  1 
ATOM   717 C CE  . MET A 1 112 ? 6.930   32.923 11.211  1.00 66.37 ? 906  MET A CE  1 
ATOM   718 N N   . LEU A 1 113 ? 6.889   26.978 9.772   1.00 31.18 ? 907  LEU A N   1 
ATOM   719 C CA  . LEU A 1 113 ? 8.071   26.139 9.487   1.00 34.68 ? 907  LEU A CA  1 
ATOM   720 C C   . LEU A 1 113 ? 7.534   24.834 8.903   1.00 40.34 ? 907  LEU A C   1 
ATOM   721 O O   . LEU A 1 113 ? 6.494   24.402 9.325   1.00 42.25 ? 907  LEU A O   1 
ATOM   722 C CB  . LEU A 1 113 ? 8.861   25.870 10.769  1.00 36.85 ? 907  LEU A CB  1 
ATOM   723 C CG  . LEU A 1 113 ? 9.724   27.004 11.304  1.00 38.30 ? 907  LEU A CG  1 
ATOM   724 C CD1 . LEU A 1 113 ? 10.374  26.574 12.604  1.00 36.30 ? 907  LEU A CD1 1 
ATOM   725 C CD2 . LEU A 1 113 ? 10.789  27.408 10.310  1.00 40.43 ? 907  LEU A CD2 1 
ATOM   726 O OXT . LEU A 1 113 ? 8.188   24.297 8.020   1.00 30.00 ? 907  LEU A OXT 1 
ATOM   727 N N   . ARG B 2 3   ? 13.710  42.969 -19.440 1.00 62.50 ? 3500 ARG B N   1 
ATOM   728 C CA  . ARG B 2 3   ? 13.045  43.324 -18.191 1.00 60.90 ? 3500 ARG B CA  1 
ATOM   729 C C   . ARG B 2 3   ? 11.522  43.257 -18.330 1.00 56.14 ? 3500 ARG B C   1 
ATOM   730 O O   . ARG B 2 3   ? 10.787  43.694 -17.443 1.00 55.20 ? 3500 ARG B O   1 
ATOM   731 C CB  . ARG B 2 3   ? 13.470  44.721 -17.733 1.00 61.60 ? 3500 ARG B CB  1 
ATOM   732 N N   . LEU B 2 4   ? 11.052  42.726 -19.457 1.00 50.64 ? 3501 LEU B N   1 
ATOM   733 C CA  . LEU B 2 4   ? 9.622   42.479 -19.642 1.00 41.25 ? 3501 LEU B CA  1 
ATOM   734 C C   . LEU B 2 4   ? 9.307   41.004 -19.389 1.00 34.72 ? 3501 LEU B C   1 
ATOM   735 O O   . LEU B 2 4   ? 8.628   40.352 -20.194 1.00 32.87 ? 3501 LEU B O   1 
ATOM   736 C CB  . LEU B 2 4   ? 9.170   42.880 -21.046 1.00 39.30 ? 3501 LEU B CB  1 
ATOM   737 C CG  . LEU B 2 4   ? 9.151   44.382 -21.362 1.00 39.21 ? 3501 LEU B CG  1 
ATOM   738 C CD1 . LEU B 2 4   ? 8.472   44.659 -22.707 1.00 37.08 ? 3501 LEU B CD1 1 
ATOM   739 C CD2 . LEU B 2 4   ? 8.486   45.175 -20.240 1.00 38.98 ? 3501 LEU B CD2 1 
ATOM   740 N N   . THR B 2 5   ? 9.836   40.481 -18.283 1.00 31.90 ? 3502 THR B N   1 
ATOM   741 C CA  . THR B 2 5   ? 9.662   39.076 -17.934 1.00 31.49 ? 3502 THR B CA  1 
ATOM   742 C C   . THR B 2 5   ? 9.233   38.948 -16.474 1.00 29.41 ? 3502 THR B C   1 
ATOM   743 O O   . THR B 2 5   ? 9.845   39.554 -15.603 1.00 36.40 ? 3502 THR B O   1 
ATOM   744 C CB  . THR B 2 5   ? 10.969  38.272 -18.155 1.00 35.32 ? 3502 THR B CB  1 
ATOM   745 O OG1 . THR B 2 5   ? 12.038  38.852 -17.390 1.00 37.63 ? 3502 THR B OG1 1 
ATOM   746 C CG2 . THR B 2 5   ? 11.362  38.282 -19.614 1.00 36.56 ? 3502 THR B CG2 1 
ATOM   747 N N   . LEU B 2 6   ? 8.193   38.162 -16.197 1.00 27.58 ? 3503 LEU B N   1 
ATOM   748 C CA  . LEU B 2 6   ? 7.808   37.897 -14.796 1.00 26.28 ? 3503 LEU B CA  1 
ATOM   749 C C   . LEU B 2 6   ? 8.671   36.805 -14.169 1.00 30.37 ? 3503 LEU B C   1 
ATOM   750 O O   . LEU B 2 6   ? 9.109   35.878 -14.850 1.00 27.41 ? 3503 LEU B O   1 
ATOM   751 C CB  . LEU B 2 6   ? 6.357   37.431 -14.722 1.00 26.84 ? 3503 LEU B CB  1 
ATOM   752 C CG  . LEU B 2 6   ? 5.204   38.282 -15.250 1.00 31.21 ? 3503 LEU B CG  1 
ATOM   753 C CD1 . LEU B 2 6   ? 3.924   37.524 -15.043 1.00 31.78 ? 3503 LEU B CD1 1 
ATOM   754 C CD2 . LEU B 2 6   ? 5.172   39.612 -14.535 1.00 36.74 ? 3503 LEU B CD2 1 
ATOM   755 N N   . PRO B 2 7   ? 8.860   36.856 -12.851 1.00 30.38 ? 3504 PRO B N   1 
ATOM   756 C CA  . PRO B 2 7   ? 9.463   35.726 -12.136 1.00 27.72 ? 3504 PRO B CA  1 
ATOM   757 C C   . PRO B 2 7   ? 8.521   34.538 -12.164 1.00 28.57 ? 3504 PRO B C   1 
ATOM   758 O O   . PRO B 2 7   ? 7.336   34.705 -12.472 1.00 27.87 ? 3504 PRO B O   1 
ATOM   759 C CB  . PRO B 2 7   ? 9.630   36.258 -10.711 1.00 34.05 ? 3504 PRO B CB  1 
ATOM   760 C CG  . PRO B 2 7   ? 8.537   37.277 -10.582 1.00 33.39 ? 3504 PRO B CG  1 
ATOM   761 C CD  . PRO B 2 7   ? 8.394   37.919 -11.940 1.00 32.94 ? 3504 PRO B CD  1 
ATOM   762 N N   . PRO B 2 8   ? 9.025   33.337 -11.852 1.00 32.95 ? 3505 PRO B N   1 
ATOM   763 C CA  . PRO B 2 8   ? 8.130   32.215 -11.535 1.00 33.55 ? 3505 PRO B CA  1 
ATOM   764 C C   . PRO B 2 8   ? 7.069   32.651 -10.511 1.00 32.76 ? 3505 PRO B C   1 
ATOM   765 O O   . PRO B 2 8   ? 7.430   33.330 -9.547  1.00 35.70 ? 3505 PRO B O   1 
ATOM   766 C CB  . PRO B 2 8   ? 9.065   31.166 -10.926 1.00 37.51 ? 3505 PRO B CB  1 
ATOM   767 C CG  . PRO B 2 8   ? 10.433  31.537 -11.390 1.00 38.56 ? 3505 PRO B CG  1 
ATOM   768 C CD  . PRO B 2 8   ? 10.449  33.003 -11.657 1.00 39.36 ? 3505 PRO B CD  1 
ATOM   769 N N   . SER B 2 9   ? 5.792   32.346 -10.717 1.00 30.88 ? 3506 SER B N   1 
ATOM   770 C CA  . SER B 2 9   ? 4.837   32.857 -9.733  1.00 34.10 ? 3506 SER B CA  1 
ATOM   771 C C   . SER B 2 9   ? 4.774   31.934 -8.533  1.00 34.73 ? 3506 SER B C   1 
ATOM   772 O O   . SER B 2 9   ? 4.995   30.728 -8.656  1.00 34.55 ? 3506 SER B O   1 
ATOM   773 C CB  . SER B 2 9   ? 3.429   33.043 -10.289 1.00 37.87 ? 3506 SER B CB  1 
ATOM   774 O OG  . SER B 2 9   ? 2.617   33.637 -9.265  1.00 39.95 ? 3506 SER B OG  1 
ATOM   775 N N   . GLU B 2 10  ? 4.495   32.519 -7.376  1.00 35.59 ? 3507 GLU B N   1 
ATOM   776 C CA  . GLU B 2 10  ? 4.403   31.773 -6.148  1.00 30.87 ? 3507 GLU B CA  1 
ATOM   777 C C   . GLU B 2 10  ? 2.938   31.618 -5.757  1.00 28.50 ? 3507 GLU B C   1 
ATOM   778 O O   . GLU B 2 10  ? 2.611   31.149 -4.663  1.00 30.20 ? 3507 GLU B O   1 
ATOM   779 C CB  . GLU B 2 10  ? 5.200   32.470 -5.018  1.00 40.81 ? 3507 GLU B CB  1 
ATOM   780 N N   . ILE B 2 11  ? 2.060   32.010 -6.688  1.00 25.16 ? 3508 ILE B N   1 
ATOM   781 C CA  . ILE B 2 11  ? 0.616   31.886 -6.473  1.00 25.42 ? 3508 ILE B CA  1 
ATOM   782 C C   . ILE B 2 11  ? -0.021  31.249 -7.679  1.00 25.44 ? 3508 ILE B C   1 
ATOM   783 O O   . ILE B 2 11  ? 0.283   31.641 -8.809  1.00 24.01 ? 3508 ILE B O   1 
ATOM   784 C CB  . ILE B 2 11  ? -0.044  33.234 -6.232  1.00 28.75 ? 3508 ILE B CB  1 
ATOM   785 C CG1 . ILE B 2 11  ? 0.585   33.906 -5.012  1.00 33.52 ? 3508 ILE B CG1 1 
ATOM   786 C CG2 . ILE B 2 11  ? -1.540  33.068 -6.056  1.00 32.34 ? 3508 ILE B CG2 1 
ATOM   787 C CD1 . ILE B 2 11  ? 0.099   35.330 -4.807  1.00 40.97 ? 3508 ILE B CD1 1 
ATOM   788 N N   . THR B 2 12  ? -0.907  30.285 -7.444  1.00 24.02 ? 3509 THR B N   1 
ATOM   789 C CA  . THR B 2 12  ? -1.555  29.570 -8.560  1.00 24.67 ? 3509 THR B CA  1 
ATOM   790 C C   . THR B 2 12  ? -3.067  29.539 -8.402  1.00 26.28 ? 3509 THR B C   1 
ATOM   791 O O   . THR B 2 12  ? -3.580  29.313 -7.301  1.00 26.98 ? 3509 THR B O   1 
ATOM   792 C CB  . THR B 2 12  ? -1.035  28.118 -8.657  1.00 26.19 ? 3509 THR B CB  1 
ATOM   793 O OG1 . THR B 2 12  ? 0.368   28.146 -8.919  1.00 27.86 ? 3509 THR B OG1 1 
ATOM   794 C CG2 . THR B 2 12  ? -1.760  27.334 -9.744  1.00 25.89 ? 3509 THR B CG2 1 
ATOM   795 N N   . LEU B 2 13  ? -3.781  29.812 -9.496  1.00 23.40 ? 3510 LEU B N   1 
ATOM   796 C CA  . LEU B 2 13  ? -5.257  29.737 -9.559  1.00 24.04 ? 3510 LEU B CA  1 
ATOM   797 C C   . LEU B 2 13  ? -5.656  28.321 -9.986  1.00 29.32 ? 3510 LEU B C   1 
ATOM   798 O O   . LEU B 2 13  ? -5.167  27.850 -10.983 1.00 27.86 ? 3510 LEU B O   1 
ATOM   799 C CB  . LEU B 2 13  ? -5.770  30.766 -10.565 1.00 30.00 ? 3510 LEU B CB  1 
ATOM   800 C CG  . LEU B 2 13  ? -5.703  32.206 -10.085 1.00 30.00 ? 3510 LEU B CG  1 
ATOM   801 C CD1 . LEU B 2 13  ? -5.729  33.186 -11.244 1.00 30.00 ? 3510 LEU B CD1 1 
ATOM   802 C CD2 . LEU B 2 13  ? -6.855  32.483 -9.153  1.00 30.00 ? 3510 LEU B CD2 1 
ATOM   803 N N   . LEU B 2 14  ? -6.497  27.683 -9.183  1.00 30.56 ? 3511 LEU B N   1 
ATOM   804 C CA  . LEU B 2 14  ? -7.000  26.320 -9.447  1.00 31.41 ? 3511 LEU B CA  1 
ATOM   805 C C   . LEU B 2 14  ? -8.535  26.354 -9.542  1.00 36.32 ? 3511 LEU B C   1 
ATOM   806 O O   . LEU B 2 14  ? -9.161  27.348 -9.340  1.00 35.03 ? 3511 LEU B O   1 
ATOM   807 C CB  . LEU B 2 14  ? -6.525  25.382 -8.329  1.00 30.57 ? 3511 LEU B CB  1 
ATOM   808 C CG  . LEU B 2 14  ? -5.015  25.247 -8.153  1.00 32.31 ? 3511 LEU B CG  1 
ATOM   809 C CD1 . LEU B 2 14  ? -4.657  24.800 -6.754  1.00 32.62 ? 3511 LEU B CD1 1 
ATOM   810 C CD2 . LEU B 2 14  ? -4.432  24.293 -9.155  1.00 33.93 ? 3511 LEU B CD2 1 
ATOM   811 O OXT . LEU B 2 14  ? -9.077  25.304 -9.844  1.00 30.00 ? 3511 LEU B OXT 1 
HETATM 812 O O   . HOH C 3 .   ? -7.631  23.836 12.534  1.00 35.66 ? 1001 HOH A O   1 
HETATM 813 O O   . HOH C 3 .   ? -14.472 27.263 9.595   1.00 59.30 ? 1002 HOH A O   1 
HETATM 814 O O   . HOH C 3 .   ? -16.015 17.387 4.628   1.00 33.81 ? 1003 HOH A O   1 
HETATM 815 O O   . HOH C 3 .   ? -5.239  30.937 10.067  1.00 43.54 ? 1004 HOH A O   1 
HETATM 816 O O   . HOH C 3 .   ? -9.506  22.799 10.835  1.00 48.21 ? 1005 HOH A O   1 
HETATM 817 O O   . HOH C 3 .   ? -11.503 24.748 9.774   1.00 38.33 ? 1006 HOH A O   1 
HETATM 818 O O   . HOH C 3 .   ? -5.522  13.405 4.893   1.00 36.30 ? 1007 HOH A O   1 
HETATM 819 O O   . HOH C 3 .   ? -4.119  29.945 8.721   1.00 31.19 ? 1008 HOH A O   1 
HETATM 820 O O   . HOH C 3 .   ? -5.251  35.773 1.189   1.00 42.09 ? 1009 HOH A O   1 
HETATM 821 O O   . HOH C 3 .   ? -8.350  10.903 0.996   1.00 45.42 ? 1010 HOH A O   1 
HETATM 822 O O   . HOH C 3 .   ? -15.176 18.338 6.863   1.00 43.94 ? 1011 HOH A O   1 
HETATM 823 O O   . HOH C 3 .   ? -0.560  33.828 1.806   1.00 55.60 ? 1012 HOH A O   1 
HETATM 824 O O   . HOH C 3 .   ? 3.953   22.385 -0.260  1.00 33.26 ? 1013 HOH A O   1 
HETATM 825 O O   . HOH C 3 .   ? -18.401 21.584 -4.117  1.00 33.33 ? 1014 HOH A O   1 
HETATM 826 O O   . HOH C 3 .   ? -16.544 9.652  -5.937  1.00 28.51 ? 1015 HOH A O   1 
HETATM 827 O O   . HOH C 3 .   ? 8.134   31.264 7.873   1.00 51.60 ? 1016 HOH A O   1 
HETATM 828 O O   . HOH C 3 .   ? -14.632 28.207 -5.380  1.00 29.02 ? 1017 HOH A O   1 
HETATM 829 O O   . HOH C 3 .   ? 9.574   17.530 -3.055  1.00 50.08 ? 1018 HOH A O   1 
HETATM 830 O O   . HOH C 3 .   ? 7.627   15.591 0.205   1.00 47.60 ? 1019 HOH A O   1 
HETATM 831 O O   . HOH C 3 .   ? -18.977 15.695 -9.750  1.00 53.27 ? 1020 HOH A O   1 
HETATM 832 O O   . HOH C 3 .   ? -2.856  14.295 -6.999  1.00 34.99 ? 1021 HOH A O   1 
HETATM 833 O O   . HOH C 3 .   ? -9.540  13.401 -6.244  1.00 28.43 ? 1022 HOH A O   1 
HETATM 834 O O   . HOH C 3 .   ? 11.624  20.133 0.000   0.50 52.24 ? 1023 HOH A O   1 
HETATM 835 O O   . HOH C 3 .   ? -2.000  31.642 8.146   1.00 40.70 ? 1024 HOH A O   1 
HETATM 836 O O   . HOH C 3 .   ? 7.122   22.269 2.901   1.00 36.84 ? 1025 HOH A O   1 
HETATM 837 O O   . HOH C 3 .   ? 7.987   26.587 -3.190  1.00 31.83 ? 1026 HOH A O   1 
HETATM 838 O O   . HOH C 3 .   ? 12.838  27.350 -10.958 1.00 39.29 ? 1027 HOH A O   1 
HETATM 839 O O   . HOH C 3 .   ? -5.978  14.467 2.524   1.00 31.85 ? 1028 HOH A O   1 
HETATM 840 O O   . HOH C 3 .   ? 1.609   17.881 5.956   1.00 46.73 ? 1029 HOH A O   1 
HETATM 841 O O   . HOH C 3 .   ? -18.397 19.286 -0.998  1.00 40.55 ? 1030 HOH A O   1 
HETATM 842 O O   . HOH C 3 .   ? -10.451 8.994  -0.355  1.00 40.47 ? 1031 HOH A O   1 
HETATM 843 O O   . HOH C 3 .   ? 4.620   15.200 6.224   1.00 55.62 ? 1032 HOH A O   1 
HETATM 844 O O   . HOH C 3 .   ? -3.203  21.536 12.760  1.00 39.25 ? 1033 HOH A O   1 
HETATM 845 O O   . HOH C 3 .   ? -11.007 6.596  -4.684  1.00 52.62 ? 1034 HOH A O   1 
HETATM 846 O O   . HOH C 3 .   ? 3.527   31.555 7.198   1.00 48.91 ? 1035 HOH A O   1 
HETATM 847 O O   . HOH C 3 .   ? 0.170   30.143 7.526   1.00 35.71 ? 1036 HOH A O   1 
HETATM 848 O O   . HOH C 3 .   ? 8.689   19.475 -5.089  1.00 38.25 ? 1037 HOH A O   1 
HETATM 849 O O   . HOH C 3 .   ? 1.970   23.891 -11.218 1.00 49.09 ? 1038 HOH A O   1 
HETATM 850 O O   . HOH C 3 .   ? -15.533 7.376  1.711   1.00 30.28 ? 1039 HOH A O   1 
HETATM 851 O O   . HOH C 3 .   ? -8.829  10.312 -15.203 1.00 45.51 ? 1040 HOH A O   1 
HETATM 852 O O   . HOH C 3 .   ? 9.854   20.142 6.184   1.00 51.47 ? 1041 HOH A O   1 
HETATM 853 O O   . HOH C 3 .   ? -4.525  12.258 -5.598  1.00 43.79 ? 1042 HOH A O   1 
HETATM 854 O O   . HOH C 3 .   ? -13.824 6.654  -0.282  1.00 52.98 ? 1043 HOH A O   1 
HETATM 855 O O   . HOH C 3 .   ? -4.512  13.020 12.410  1.00 55.13 ? 1044 HOH A O   1 
HETATM 856 O O   . HOH C 3 .   ? -18.200 16.800 2.955   1.00 52.83 ? 1045 HOH A O   1 
HETATM 857 O O   . HOH C 3 .   ? 9.671   23.286 3.872   1.00 45.37 ? 1046 HOH A O   1 
HETATM 858 O O   . HOH C 3 .   ? -8.432  36.205 -11.091 1.00 45.29 ? 1047 HOH A O   1 
HETATM 859 O O   . HOH D 3 .   ? 4.376   34.894 -6.530  1.00 52.83 ? 3601 HOH B O   1 
HETATM 860 O O   . HOH D 3 .   ? 4.708   30.297 -3.276  1.00 39.26 ? 3602 HOH B O   1 
HETATM 861 O O   . HOH D 3 .   ? 5.493   33.907 -14.403 1.00 40.57 ? 3603 HOH B O   1 
HETATM 862 O O   . HOH D 3 .   ? 4.943   36.008 -11.699 1.00 33.52 ? 3604 HOH B O   1 
HETATM 863 O O   . HOH D 3 .   ? 2.910   36.392 -8.269  1.00 50.81 ? 3605 HOH B O   1 
HETATM 864 O O   . HOH D 3 .   ? 6.929   29.871 -4.637  1.00 54.03 ? 3606 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1   N N   . GLY A 17  ? 0.9363 1.0170 0.8253 -0.0826 -0.0533 0.0467  811  GLY A N   
2   C CA  . GLY A 17  ? 0.8726 0.9660 0.7622 -0.0814 -0.0501 0.0381  811  GLY A CA  
3   C C   . GLY A 17  ? 0.7283 0.8328 0.6265 -0.0835 -0.0427 0.0321  811  GLY A C   
4   O O   . GLY A 17  ? 0.6122 0.7140 0.5190 -0.0846 -0.0406 0.0336  811  GLY A O   
5   N N   . PRO A 18  ? 0.5558 0.6731 0.4520 -0.0840 -0.0389 0.0250  812  PRO A N   
6   C CA  . PRO A 18  ? 0.4289 0.5598 0.3333 -0.0852 -0.0325 0.0167  812  PRO A CA  
7   C C   . PRO A 18  ? 0.4505 0.5823 0.3712 -0.0793 -0.0332 0.0086  812  PRO A C   
8   O O   . PRO A 18  ? 0.4315 0.5569 0.3556 -0.0741 -0.0379 0.0068  812  PRO A O   
9   C CB  . PRO A 18  ? 0.4872 0.6287 0.3819 -0.0864 -0.0306 0.0121  812  PRO A CB  
10  C CG  . PRO A 18  ? 0.5368 0.6696 0.4162 -0.0877 -0.0353 0.0198  812  PRO A CG  
11  C CD  . PRO A 18  ? 0.5391 0.6580 0.4235 -0.0832 -0.0418 0.0246  812  PRO A CD  
12  N N   . GLY A 19  ? 0.4445 0.5843 0.3746 -0.0804 -0.0286 0.0033  813  GLY A N   
13  C CA  . GLY A 19  ? 0.4356 0.5768 0.3793 -0.0751 -0.0295 -0.0056 813  GLY A CA  
14  C C   . GLY A 19  ? 0.3847 0.5151 0.3382 -0.0737 -0.0314 -0.0032 813  GLY A C   
15  O O   . GLY A 19  ? 0.4193 0.5477 0.3829 -0.0695 -0.0330 -0.0099 813  GLY A O   
16  N N   . SER A 20  ? 0.3087 0.4312 0.2586 -0.0773 -0.0316 0.0062  814  SER A N   
17  C CA  . SER A 20  ? 0.2846 0.3965 0.2442 -0.0759 -0.0335 0.0082  814  SER A CA  
18  C C   . SER A 20  ? 0.3081 0.4256 0.2721 -0.0801 -0.0288 0.0091  814  SER A C   
19  O O   . SER A 20  ? 0.3030 0.4291 0.2600 -0.0855 -0.0244 0.0113  814  SER A O   
20  C CB  . SER A 20  ? 0.4134 0.5109 0.3688 -0.0759 -0.0378 0.0171  814  SER A CB  
21  O OG  . SER A 20  ? 0.4919 0.5883 0.4380 -0.0811 -0.0364 0.0262  814  SER A OG  
22  N N   . THR A 21  ? 0.2753 0.3875 0.2506 -0.0780 -0.0300 0.0066  815  THR A N   
23  C CA  . THR A 21  ? 0.3043 0.4213 0.2863 -0.0812 -0.0262 0.0063  815  THR A CA  
24  C C   . THR A 21  ? 0.3374 0.4398 0.3244 -0.0806 -0.0292 0.0120  815  THR A C   
25  O O   . THR A 21  ? 0.2991 0.3909 0.2903 -0.0763 -0.0338 0.0102  815  THR A O   
26  C CB  . THR A 21  ? 0.3307 0.4587 0.3239 -0.0784 -0.0248 -0.0058 815  THR A CB  
27  O OG1 . THR A 21  ? 0.3719 0.5139 0.3613 -0.0786 -0.0220 -0.0122 815  THR A OG1 
28  C CG2 . THR A 21  ? 0.3377 0.4720 0.3386 -0.0819 -0.0208 -0.0068 815  THR A CG2 
29  N N   . LEU A 22  ? 0.3187 0.4201 0.3047 -0.0854 -0.0265 0.0188  816  LEU A N   
30  C CA  . LEU A 22  ? 0.3375 0.4261 0.3294 -0.0851 -0.0289 0.0236  816  LEU A CA  
31  C C   . LEU A 22  ? 0.3133 0.4064 0.3176 -0.0840 -0.0277 0.0166  816  LEU A C   
32  O O   . LEU A 22  ? 0.3357 0.4410 0.3423 -0.0874 -0.0228 0.0140  816  LEU A O   
33  C CB  . LEU A 22  ? 0.3955 0.4792 0.3797 -0.0907 -0.0272 0.0348  816  LEU A CB  
34  C CG  . LEU A 22  ? 0.4353 0.5045 0.4238 -0.0907 -0.0300 0.0415  816  LEU A CG  
35  C CD1 . LEU A 22  ? 0.4131 0.4689 0.4023 -0.0863 -0.0357 0.0420  816  LEU A CD1 
36  C CD2 . LEU A 22  ? 0.5260 0.5916 0.5056 -0.0964 -0.0282 0.0522  816  LEU A CD2 
37  N N   . VAL A 23  ? 0.2627 0.3454 0.2746 -0.0793 -0.0324 0.0129  817  VAL A N   
38  C CA  . VAL A 23  ? 0.2663 0.3500 0.2899 -0.0770 -0.0333 0.0057  817  VAL A CA  
39  C C   . VAL A 23  ? 0.2957 0.3651 0.3235 -0.0777 -0.0356 0.0115  817  VAL A C   
40  O O   . VAL A 23  ? 0.2911 0.3451 0.3164 -0.0765 -0.0396 0.0154  817  VAL A O   
41  C CB  . VAL A 23  ? 0.2441 0.3253 0.2719 -0.0708 -0.0379 -0.0045 817  VAL A CB  
42  C CG1 . VAL A 23  ? 0.3148 0.3941 0.3539 -0.0678 -0.0406 -0.0118 817  VAL A CG1 
43  C CG2 . VAL A 23  ? 0.2957 0.3924 0.3204 -0.0700 -0.0353 -0.0109 817  VAL A CG2 
44  N N   . ARG A 24  ? 0.2506 0.3255 0.2846 -0.0803 -0.0327 0.0117  818  ARG A N   
45  C CA  . ARG A 24  ? 0.2247 0.2866 0.2632 -0.0811 -0.0348 0.0168  818  ARG A CA  
46  C C   . ARG A 24  ? 0.2812 0.3397 0.3304 -0.0765 -0.0390 0.0077  818  ARG A C   
47  O O   . ARG A 24  ? 0.2878 0.3589 0.3454 -0.0757 -0.0373 -0.0001 818  ARG A O   
48  C CB  . ARG A 24  ? 0.2587 0.3269 0.2967 -0.0871 -0.0295 0.0235  818  ARG A CB  
49  C CG  . ARG A 24  ? 0.2616 0.3177 0.3047 -0.0880 -0.0312 0.0287  818  ARG A CG  
50  C CD  . ARG A 24  ? 0.2702 0.3303 0.3097 -0.0946 -0.0260 0.0371  818  ARG A CD  
51  N NE  . ARG A 24  ? 0.2867 0.3399 0.3141 -0.0970 -0.0261 0.0468  818  ARG A NE  
52  C CZ  . ARG A 24  ? 0.3051 0.3567 0.3258 -0.1025 -0.0231 0.0562  818  ARG A CZ  
53  N NH1 . ARG A 24  ? 0.3172 0.3746 0.3417 -0.1067 -0.0189 0.0573  818  ARG A NH1 
54  N NH2 . ARG A 24  ? 0.3464 0.3905 0.3565 -0.1036 -0.0248 0.0641  818  ARG A NH2 
55  N N   . VAL A 25  ? 0.2514 0.2920 0.3001 -0.0736 -0.0448 0.0082  819  VAL A N   
56  C CA  . VAL A 25  ? 0.2360 0.2693 0.2920 -0.0690 -0.0503 -0.0002 819  VAL A CA  
57  C C   . VAL A 25  ? 0.2880 0.3097 0.3487 -0.0704 -0.0522 0.0041  819  VAL A C   
58  O O   . VAL A 25  ? 0.2745 0.2814 0.3301 -0.0727 -0.0533 0.0122  819  VAL A O   
59  C CB  . VAL A 25  ? 0.2357 0.2548 0.2859 -0.0655 -0.0560 -0.0037 819  VAL A CB  
60  C CG1 . VAL A 25  ? 0.3090 0.3166 0.3645 -0.0608 -0.0630 -0.0123 819  VAL A CG1 
61  C CG2 . VAL A 25  ? 0.2739 0.3043 0.3196 -0.0639 -0.0543 -0.0081 819  VAL A CG2 
62  N N   . LYS A 26  ? 0.2323 0.2613 0.3032 -0.0692 -0.0523 -0.0016 820  LYS A N   
63  C CA  . LYS A 26  ? 0.2785 0.2964 0.3546 -0.0699 -0.0548 0.0014  820  LYS A CA  
64  C C   . LYS A 26  ? 0.3160 0.3118 0.3898 -0.0665 -0.0629 -0.0009 820  LYS A C   
65  O O   . LYS A 26  ? 0.3028 0.2956 0.3760 -0.0619 -0.0677 -0.0096 820  LYS A O   
66  C CB  . LYS A 26  ? 0.3126 0.3448 0.4012 -0.0688 -0.0536 -0.0062 820  LYS A CB  
67  C CG  . LYS A 26  ? 0.4149 0.4373 0.5094 -0.0698 -0.0558 -0.0030 820  LYS A CG  
68  C CD  . LYS A 26  ? 0.5086 0.5391 0.6166 -0.0659 -0.0588 -0.0143 820  LYS A CD  
69  C CE  . LYS A 26  ? 0.5526 0.5765 0.6666 -0.0679 -0.0594 -0.0102 820  LYS A CE  
70  N NZ  . LYS A 26  ? 0.5866 0.5885 0.6913 -0.0706 -0.0614 0.0014  820  LYS A NZ  
71  N N   . LYS A 27  ? 0.2375 0.4334 0.2716 -0.0277 0.0116  -0.0623 821  LYS A N   
72  C CA  . LYS A 27  ? 0.2716 0.4215 0.2698 -0.0491 -0.0100 -0.0408 821  LYS A CA  
73  C C   . LYS A 27  ? 0.3416 0.4723 0.3475 -0.0451 -0.0459 -0.0381 821  LYS A C   
74  O O   . LYS A 27  ? 0.4497 0.5708 0.4302 -0.0594 -0.0488 -0.0271 821  LYS A O   
75  C CB  . LYS A 27  ? 0.3494 0.4948 0.3025 -0.0752 0.0144  -0.0255 821  LYS A CB  
76  C CG  . LYS A 27  ? 0.3970 0.5262 0.3592 -0.0663 0.0307  -0.0246 821  LYS A CG  
77  C CD  . LYS A 27  ? 0.3851 0.4875 0.3365 -0.0698 0.0311  -0.0165 821  LYS A CD  
78  C CE  . LYS A 27  ? 0.3839 0.4836 0.3418 -0.0698 0.0336  -0.0234 821  LYS A CE  
79  N NZ  . LYS A 27  ? 0.3649 0.4557 0.3094 -0.0835 0.0332  -0.0230 821  LYS A NZ  
80  N N   . SER A 28  ? 0.3219 0.4486 0.3648 -0.0250 -0.0732 -0.0494 822  SER A N   
81  C CA  . SER A 28  ? 0.3203 0.4360 0.3814 -0.0157 -0.1066 -0.0519 822  SER A CA  
82  C C   . SER A 28  ? 0.3858 0.4507 0.4210 -0.0332 -0.1414 -0.0308 822  SER A C   
83  O O   . SER A 28  ? 0.4459 0.4964 0.4841 -0.0329 -0.1679 -0.0270 822  SER A O   
84  C CB  . SER A 28  ? 0.3336 0.4678 0.4480 0.0139  -0.1209 -0.0746 822  SER A CB  
85  O OG  . SER A 28  ? 0.3539 0.4696 0.4769 0.0176  -0.1314 -0.0747 822  SER A OG  
86  N N   . ALA A 29  ? 0.3987 0.4371 0.4088 -0.0489 -0.1419 -0.0168 823  ALA A N   
87  C CA  . ALA A 29  ? 0.4729 0.4623 0.4575 -0.0672 -0.1752 0.0045  823  ALA A CA  
88  C C   . ALA A 29  ? 0.5223 0.4952 0.4534 -0.0981 -0.1560 0.0257  823  ALA A C   
89  O O   . ALA A 29  ? 0.5314 0.5307 0.4503 -0.1027 -0.1184 0.0220  823  ALA A O   
90  C CB  . ALA A 29  ? 0.5044 0.4745 0.5153 -0.0551 -0.2008 0.0004  823  ALA A CB  
91  N N   . ALA A 30  ? 0.5564 0.4865 0.4564 -0.1199 -0.1821 0.0476  824  ALA A N   
92  C CA  . ALA A 30  ? 0.5931 0.5079 0.4408 -0.1513 -0.1651 0.0679  824  ALA A CA  
93  C C   . ALA A 30  ? 0.6030 0.5171 0.4422 -0.1571 -0.1463 0.0699  824  ALA A C   
94  O O   . ALA A 30  ? 0.5908 0.5023 0.3910 -0.1805 -0.1236 0.0820  824  ALA A O   
95  C CB  . ALA A 30  ? 0.6429 0.5126 0.4653 -0.1695 -0.1905 0.0908  824  ALA A CB  
96  N N   . THR A 31  ? 0.5174 0.4344 0.3934 -0.1362 -0.1555 0.0574  825  THR A N   
97  C CA  . THR A 31  ? 0.4888 0.4082 0.3608 -0.1391 -0.1367 0.0573  825  THR A CA  
98  C C   . THR A 31  ? 0.3855 0.3392 0.3052 -0.1086 -0.1236 0.0321  825  THR A C   
99  O O   . THR A 31  ? 0.4135 0.3842 0.3687 -0.0864 -0.1342 0.0162  825  THR A O   
100 C CB  . THR A 31  ? 0.5659 0.4428 0.4267 -0.1509 -0.1670 0.0734  825  THR A CB  
101 O OG1 . THR A 31  ? 0.6131 0.4796 0.5161 -0.1279 -0.2017 0.0630  825  THR A OG1 
102 C CG2 . THR A 31  ? 0.5893 0.4297 0.4029 -0.1825 -0.1855 0.0998  825  THR A CG2 
103 N N   . LEU A 32  ? 0.3840 0.3486 0.3034 -0.1086 -0.1002 0.0287  826  LEU A N   
104 C CA  . LEU A 32  ? 0.3422 0.3379 0.3039 -0.0820 -0.0875 0.0061  826  LEU A CA  
105 C C   . LEU A 32  ? 0.3785 0.3539 0.3725 -0.0656 -0.1239 0.0003  826  LEU A C   
106 O O   . LEU A 32  ? 0.4163 0.4142 0.4540 -0.0391 -0.1294 -0.0210 826  LEU A O   
107 C CB  . LEU A 32  ? 0.4431 0.4533 0.3916 -0.0896 -0.0528 0.0064  826  LEU A CB  
108 C CG  . LEU A 32  ? 0.4768 0.5269 0.4586 -0.0682 -0.0266 -0.0150 826  LEU A CG  
109 C CD1 . LEU A 32  ? 0.3527 0.4412 0.3589 -0.0512 -0.0135 -0.0323 826  LEU A CD1 
110 C CD2 . LEU A 32  ? 0.4916 0.5498 0.4469 -0.0846 0.0082  -0.0080 826  LEU A CD2 
111 N N   . GLY A 33  ? 0.4293 0.3623 0.4015 -0.0824 -0.1493 0.0192  827  GLY A N   
112 C CA  . GLY A 33  ? 0.4189 0.3257 0.4181 -0.0703 -0.1883 0.0170  827  GLY A CA  
113 C C   . GLY A 33  ? 0.4455 0.3652 0.4716 -0.0544 -0.1785 0.0030  827  GLY A C   
114 O O   . GLY A 33  ? 0.4583 0.3825 0.5270 -0.0305 -0.1981 -0.0140 827  GLY A O   
115 N N   . ILE A 34  ? 0.3859 0.3134 0.3888 -0.0672 -0.1476 0.0089  828  ILE A N   
116 C CA  . ILE A 34  ? 0.3986 0.3310 0.4210 -0.0565 -0.1415 -0.0001 828  ILE A CA  
117 C C   . ILE A 34  ? 0.4519 0.3539 0.4366 -0.0821 -0.1401 0.0220  828  ILE A C   
118 O O   . ILE A 34  ? 0.4457 0.3346 0.3874 -0.1083 -0.1314 0.0412  828  ILE A O   
119 C CB  . ILE A 34  ? 0.3742 0.3543 0.4148 -0.0420 -0.1012 -0.0196 828  ILE A CB  
120 C CG1 . ILE A 34  ? 0.3651 0.3569 0.3664 -0.0639 -0.0640 -0.0080 828  ILE A CG1 
121 C CG2 . ILE A 34  ? 0.3210 0.3337 0.3971 -0.0185 -0.1010 -0.0409 828  ILE A CG2 
122 C CD1 . ILE A 34  ? 0.3828 0.4208 0.4002 -0.0518 -0.0239 -0.0253 828  ILE A CD1 
123 N N   . ALA A 35  ? 0.3813 0.2709 0.3823 -0.0749 -0.1512 0.0191  829  ALA A N   
124 C CA  . ALA A 35  ? 0.3579 0.2278 0.3295 -0.0954 -0.1428 0.0356  829  ALA A CA  
125 C C   . ALA A 35  ? 0.3908 0.2942 0.3788 -0.0833 -0.1084 0.0201  829  ALA A C   
126 O O   . ALA A 35  ? 0.3564 0.2817 0.3867 -0.0565 -0.1097 -0.0020 829  ALA A O   
127 C CB  . ALA A 35  ? 0.4174 0.2449 0.3932 -0.0984 -0.1829 0.0463  829  ALA A CB  
128 N N   . ILE A 36  ? 0.3366 0.2442 0.2927 -0.1029 -0.0785 0.0309  830  ILE A N   
129 C CA  . ILE A 36  ? 0.2956 0.2323 0.2660 -0.0933 -0.0467 0.0181  830  ILE A CA  
130 C C   . ILE A 36  ? 0.3628 0.2760 0.3105 -0.1111 -0.0445 0.0333  830  ILE A C   
131 O O   . ILE A 36  ? 0.4093 0.2930 0.3189 -0.1371 -0.0534 0.0555  830  ILE A O   
132 C CB  . ILE A 36  ? 0.2859 0.2603 0.2462 -0.0964 -0.0050 0.0121  830  ILE A CB  
133 C CG1 . ILE A 36  ? 0.4036 0.3643 0.3164 -0.1240 0.0063  0.0323  830  ILE A CG1 
134 C CG2 . ILE A 36  ? 0.3262 0.3283 0.3119 -0.0773 -0.0048 -0.0046 830  ILE A CG2 
135 C CD1 . ILE A 36  ? 0.4408 0.4345 0.3629 -0.0982 0.0331  0.0172  830  ILE A CD1 
136 N N   . GLU A 37  ? 0.2975 0.2248 0.2679 -0.0977 -0.0328 0.0214  831  GLU A N   
137 C CA  . GLU A 37  ? 0.3112 0.2203 0.2661 -0.1111 -0.0292 0.0329  831  GLU A CA  
138 C C   . GLU A 37  ? 0.3423 0.2859 0.3022 -0.1072 0.0113  0.0225  831  GLU A C   
139 O O   . GLU A 37  ? 0.3628 0.3394 0.3552 -0.0846 0.0241  0.0017  831  GLU A O   
140 C CB  . GLU A 37  ? 0.4064 0.2922 0.3883 -0.0972 -0.0627 0.0288  831  GLU A CB  
141 C CG  . GLU A 37  ? 0.5206 0.3828 0.4856 -0.1123 -0.0641 0.0427  831  GLU A CG  
142 C CD  . GLU A 37  ? 0.7012 0.5365 0.6923 -0.0995 -0.1013 0.0399  831  GLU A CD  
143 O OE1 . GLU A 37  ? 0.7498 0.5932 0.7786 -0.0748 -0.1199 0.0219  831  GLU A OE1 
144 O OE2 . GLU A 37  ? 0.7851 0.6044 0.7599 -0.1069 -0.1073 0.0527  831  GLU A OE2 
145 N N   . GLY A 38  ? 0.2783 0.3069 0.3985 -0.0419 0.0359  -0.0167 832  GLY A N   
146 C CA  . GLY A 38  ? 0.3074 0.3497 0.4030 -0.0376 0.0237  -0.0257 832  GLY A CA  
147 C C   . GLY A 38  ? 0.3120 0.3545 0.3820 -0.0258 0.0109  -0.0129 832  GLY A C   
148 O O   . GLY A 38  ? 0.3263 0.3579 0.3968 -0.0206 0.0112  0.0038  832  GLY A O   
149 N N   . GLY A 39  ? 0.2338 0.2885 0.2808 -0.0217 -0.0004 -0.0208 833  GLY A N   
150 C CA  . GLY A 39  ? 0.2716 0.3299 0.2959 -0.0106 -0.0137 -0.0107 833  GLY A CA  
151 C C   . GLY A 39  ? 0.2600 0.3404 0.2817 -0.0095 -0.0238 -0.0240 833  GLY A C   
152 O O   . GLY A 39  ? 0.2757 0.3672 0.3135 -0.0172 -0.0199 -0.0401 833  GLY A O   
153 N N   . ALA A 40  ? 0.2910 0.3774 0.2927 0.0002  -0.0366 -0.0171 834  ALA A N   
154 C CA  . ALA A 40  ? 0.3496 0.4553 0.3404 0.0028  -0.0480 -0.0289 834  ALA A CA  
155 C C   . ALA A 40  ? 0.3992 0.5230 0.4224 -0.0028 -0.0460 -0.0406 834  ALA A C   
156 O O   . ALA A 40  ? 0.3778 0.5015 0.4281 -0.0042 -0.0409 -0.0344 834  ALA A O   
157 C CB  . ALA A 40  ? 0.4019 0.5099 0.3682 0.0145  -0.0616 -0.0175 834  ALA A CB  
158 N N   . ASN A 41  ? 0.4315 0.5703 0.4514 -0.0063 -0.0498 -0.0578 835  ASN A N   
159 C CA  . ASN A 41  ? 0.5665 0.7238 0.6143 -0.0118 -0.0487 -0.0712 835  ASN A CA  
160 C C   . ASN A 41  ? 0.5380 0.6918 0.6210 -0.0219 -0.0343 -0.0755 835  ASN A C   
161 O O   . ASN A 41  ? 0.5495 0.7134 0.6615 -0.0247 -0.0319 -0.0778 835  ASN A O   
162 C CB  . ASN A 41  ? 0.6907 0.8598 0.7442 -0.0047 -0.0581 -0.0644 835  ASN A CB  
163 C CG  . ASN A 41  ? 0.8103 0.9780 0.8294 0.0062  -0.0711 -0.0554 835  ASN A CG  
164 O OD1 . ASN A 41  ? 0.8276 0.9870 0.8409 0.0134  -0.0741 -0.0389 835  ASN A OD1 
165 N ND2 . ASN A 41  ? 0.8763 1.0517 0.8710 0.0075  -0.0789 -0.0660 835  ASN A ND2 
166 N N   . THR A 42  ? 0.4716 0.6109 0.5513 -0.0275 -0.0248 -0.0768 836  THR A N   
167 C CA  . THR A 42  ? 0.4240 0.5600 0.5338 -0.0380 -0.0109 -0.0840 836  THR A CA  
168 C C   . THR A 42  ? 0.3871 0.5219 0.4842 -0.0441 -0.0075 -0.0982 836  THR A C   
169 O O   . THR A 42  ? 0.3860 0.5194 0.4508 -0.0396 -0.0152 -0.0993 836  THR A O   
170 C CB  . THR A 42  ? 0.4533 0.5697 0.5754 -0.0390 -0.0006 -0.0687 836  THR A CB  
171 O OG1 . THR A 42  ? 0.4137 0.5127 0.5097 -0.0373 0.0012  -0.0625 836  THR A OG1 
172 C CG2 . THR A 42  ? 0.5018 0.6172 0.6286 -0.0310 -0.0057 -0.0522 836  THR A CG2 
173 N N   . ARG A 43  ? 0.3678 0.5033 0.4899 -0.0544 0.0037  -0.1091 837  ARG A N   
174 C CA  . ARG A 43  ? 0.4021 0.5361 0.5153 -0.0611 0.0083  -0.1230 837  ARG A CA  
175 C C   . ARG A 43  ? 0.4039 0.5174 0.4925 -0.0594 0.0116  -0.1142 837  ARG A C   
176 O O   . ARG A 43  ? 0.4579 0.5691 0.5298 -0.0626 0.0127  -0.1237 837  ARG A O   
177 C CB  . ARG A 43  ? 0.4581 0.5953 0.6058 -0.0724 0.0207  -0.1346 837  ARG A CB  
178 N N   . GLN A 44  ? 0.3791 0.4779 0.4656 -0.0543 0.0132  -0.0960 838  GLN A N   
179 C CA  . GLN A 44  ? 0.3348 0.4134 0.3979 -0.0517 0.0159  -0.0853 838  GLN A CA  
180 C C   . GLN A 44  ? 0.3534 0.4286 0.3903 -0.0399 0.0042  -0.0701 838  GLN A C   
181 O O   . GLN A 44  ? 0.3603 0.4279 0.4055 -0.0355 0.0050  -0.0546 838  GLN A O   
182 C CB  . GLN A 44  ? 0.3278 0.3901 0.4141 -0.0573 0.0300  -0.0773 838  GLN A CB  
183 C CG  . GLN A 44  ? 0.3484 0.3886 0.4145 -0.0549 0.0341  -0.0648 838  GLN A CG  
184 C CD  . GLN A 44  ? 0.4220 0.4569 0.4705 -0.0598 0.0376  -0.0756 838  GLN A CD  
185 O OE1 . GLN A 44  ? 0.5150 0.5527 0.5814 -0.0692 0.0464  -0.0887 838  GLN A OE1 
186 N NE2 . GLN A 44  ? 0.3924 0.4195 0.4057 -0.0536 0.0308  -0.0700 838  GLN A NE2 
187 N N   . PRO A 45  ? 0.2742 0.3563 0.2804 -0.0345 -0.0072 -0.0746 839  PRO A N   
188 C CA  . PRO A 45  ? 0.3105 0.3949 0.2951 -0.0233 -0.0201 -0.0628 839  PRO A CA  
189 C C   . PRO A 45  ? 0.3456 0.4103 0.3091 -0.0168 -0.0204 -0.0446 839  PRO A C   
190 O O   . PRO A 45  ? 0.3535 0.4174 0.3069 -0.0079 -0.0286 -0.0317 839  PRO A O   
191 C CB  . PRO A 45  ? 0.3386 0.4361 0.2979 -0.0209 -0.0310 -0.0750 839  PRO A CB  
192 C CG  . PRO A 45  ? 0.3569 0.4517 0.3143 -0.0295 -0.0235 -0.0889 839  PRO A CG  
193 C CD  . PRO A 45  ? 0.3342 0.4247 0.3272 -0.0389 -0.0090 -0.0920 839  PRO A CD  
194 N N   . LEU A 46  ? 0.3704 0.4191 0.3277 -0.0212 -0.0115 -0.0438 840  LEU A N   
195 C CA  . LEU A 46  ? 0.3569 0.3850 0.2996 -0.0164 -0.0092 -0.0262 840  LEU A CA  
196 C C   . LEU A 46  ? 0.3495 0.3654 0.3206 -0.0238 0.0057  -0.0225 840  LEU A C   
197 O O   . LEU A 46  ? 0.3532 0.3725 0.3432 -0.0332 0.0145  -0.0357 840  LEU A O   
198 C CB  . LEU A 46  ? 0.3808 0.3993 0.2885 -0.0146 -0.0119 -0.0271 840  LEU A CB  
199 C CG  . LEU A 46  ? 0.4277 0.4545 0.3025 -0.0056 -0.0273 -0.0267 840  LEU A CG  
200 C CD1 . LEU A 46  ? 0.5261 0.5474 0.3729 -0.0070 -0.0282 -0.0337 840  LEU A CD1 
201 C CD2 . LEU A 46  ? 0.4788 0.4966 0.3397 0.0047  -0.0339 -0.0069 840  LEU A CD2 
202 N N   . PRO A 47  ? 0.3087 0.3102 0.2831 -0.0197 0.0086  -0.0047 841  PRO A N   
203 C CA  . PRO A 47  ? 0.2690 0.2599 0.2731 -0.0266 0.0225  -0.0008 841  PRO A CA  
204 C C   . PRO A 47  ? 0.2721 0.2499 0.2756 -0.0344 0.0338  -0.0064 841  PRO A C   
205 O O   . PRO A 47  ? 0.3110 0.2773 0.2868 -0.0319 0.0325  -0.0028 841  PRO A O   
206 C CB  . PRO A 47  ? 0.2942 0.2714 0.2942 -0.0190 0.0214  0.0203  841  PRO A CB  
207 C CG  . PRO A 47  ? 0.3522 0.3397 0.3322 -0.0091 0.0066  0.0252  841  PRO A CG  
208 C CD  . PRO A 47  ? 0.3592 0.3554 0.3134 -0.0087 -0.0009 0.0122  841  PRO A CD  
209 N N   . ARG A 48  ? 0.2913 0.2819 0.2534 -0.0355 0.0093  -0.0416 842  ARG A N   
210 C CA  . ARG A 48  ? 0.2615 0.2332 0.2410 -0.0290 0.0009  -0.0351 842  ARG A CA  
211 C C   . ARG A 48  ? 0.3201 0.2779 0.2945 -0.0375 -0.0096 -0.0196 842  ARG A C   
212 O O   . ARG A 48  ? 0.3370 0.2974 0.2985 -0.0524 -0.0116 -0.0111 842  ARG A O   
213 C CB  . ARG A 48  ? 0.3526 0.3203 0.3469 -0.0311 0.0002  -0.0345 842  ARG A CB  
214 C CG  . ARG A 48  ? 0.4716 0.4199 0.4842 -0.0258 -0.0085 -0.0272 842  ARG A CG  
215 C CD  . ARG A 48  ? 0.5678 0.5134 0.5921 -0.0312 -0.0090 -0.0255 842  ARG A CD  
216 N NE  . ARG A 48  ? 0.6895 0.6182 0.7185 -0.0403 -0.0197 -0.0098 842  ARG A NE  
217 C CZ  . ARG A 48  ? 0.7090 0.6213 0.7552 -0.0335 -0.0264 -0.0053 842  ARG A CZ  
218 N NH1 . ARG A 48  ? 0.7250 0.6365 0.7853 -0.0180 -0.0232 -0.0156 842  ARG A NH1 
219 N NH2 . ARG A 48  ? 0.6828 0.5799 0.7324 -0.0420 -0.0360 0.0092  842  ARG A NH2 
220 N N   . ILE A 49  ? 0.2610 0.2044 0.2446 -0.0284 -0.0161 -0.0158 843  ILE A N   
221 C CA  . ILE A 49  ? 0.2832 0.2126 0.2632 -0.0366 -0.0268 -0.0004 843  ILE A CA  
222 C C   . ILE A 49  ? 0.3347 0.2517 0.3256 -0.0444 -0.0338 0.0102  843  ILE A C   
223 O O   . ILE A 49  ? 0.3324 0.2409 0.3415 -0.0363 -0.0353 0.0081  843  ILE A O   
224 C CB  . ILE A 49  ? 0.2819 0.1996 0.2681 -0.0251 -0.0319 0.0009  843  ILE A CB  
225 C CG1 . ILE A 49  ? 0.2999 0.2302 0.2740 -0.0183 -0.0248 -0.0093 843  ILE A CG1 
226 C CG2 . ILE A 49  ? 0.3475 0.2504 0.3306 -0.0340 -0.0434 0.0173  843  ILE A CG2 
227 C CD1 . ILE A 49  ? 0.3265 0.2467 0.3062 -0.0057 -0.0286 -0.0099 843  ILE A CD1 
228 N N   . VAL A 50  ? 0.3125 0.2288 0.2924 -0.0603 -0.0377 0.0212  844  VAL A N   
229 C CA  . VAL A 50  ? 0.3557 0.2603 0.3457 -0.0681 -0.0440 0.0314  844  VAL A CA  
230 C C   . VAL A 50  ? 0.4126 0.2983 0.4055 -0.0719 -0.0560 0.0468  844  VAL A C   
231 O O   . VAL A 50  ? 0.4145 0.2872 0.4209 -0.0734 -0.0620 0.0540  844  VAL A O   
232 C CB  . VAL A 50  ? 0.4802 0.3947 0.4594 -0.0834 -0.0406 0.0340  844  VAL A CB  
233 C CG1 . VAL A 50  ? 0.5112 0.4428 0.4912 -0.0792 -0.0292 0.0189  844  VAL A CG1 
234 C CG2 . VAL A 50  ? 0.4759 0.3961 0.4345 -0.0944 -0.0414 0.0402  844  VAL A CG2 
235 N N   . THR A 51  ? 0.3762 0.2606 0.3570 -0.0733 -0.0596 0.0517  845  THR A N   
236 C CA  . THR A 51  ? 0.3735 0.2406 0.3564 -0.0760 -0.0710 0.0657  845  THR A CA  
237 C C   . THR A 51  ? 0.3990 0.2653 0.3765 -0.0677 -0.0724 0.0638  845  THR A C   
238 O O   . THR A 51  ? 0.3991 0.2795 0.3634 -0.0665 -0.0654 0.0556  845  THR A O   
239 C CB  . THR A 51  ? 0.5010 0.3663 0.4699 -0.0940 -0.0762 0.0796  845  THR A CB  
240 O OG1 . THR A 51  ? 0.5611 0.4303 0.5321 -0.1027 -0.0732 0.0801  845  THR A OG1 
241 C CG2 . THR A 51  ? 0.5410 0.3872 0.5146 -0.0969 -0.0884 0.0948  845  THR A CG2 
242 N N   . ILE A 52  ? 0.3906 0.2405 0.3779 -0.0623 -0.0813 0.0714  846  ILE A N   
243 C CA  . ILE A 52  ? 0.3933 0.2402 0.3750 -0.0564 -0.0844 0.0722  846  ILE A CA  
244 C C   . ILE A 52  ? 0.4732 0.3057 0.4522 -0.0654 -0.0960 0.0889  846  ILE A C   
245 O O   . ILE A 52  ? 0.4913 0.3191 0.4853 -0.0610 -0.0997 0.0915  846  ILE A O   
246 C CB  . ILE A 52  ? 0.3896 0.2309 0.3869 -0.0386 -0.0834 0.0635  846  ILE A CB  
247 C CG1 . ILE A 52  ? 0.3904 0.2475 0.3878 -0.0296 -0.0715 0.0466  846  ILE A CG1 
248 C CG2 . ILE A 52  ? 0.4040 0.2401 0.3967 -0.0333 -0.0879 0.0661  846  ILE A CG2 
249 C CD1 . ILE A 52  ? 0.4423 0.2942 0.4550 -0.0122 -0.0700 0.0377  846  ILE A CD1 
250 N N   . GLN A 53  ? 0.3689 0.3415 0.3976 0.0248  -0.0901 -0.0429 847  GLN A N   
251 C CA  . GLN A 53  ? 0.4106 0.3813 0.4458 0.0293  -0.0986 -0.0455 847  GLN A CA  
252 C C   . GLN A 53  ? 0.4110 0.3885 0.4673 0.0297  -0.1012 -0.0494 847  GLN A C   
253 O O   . GLN A 53  ? 0.4151 0.3963 0.4772 0.0273  -0.1009 -0.0503 847  GLN A O   
254 C CB  . GLN A 53  ? 0.4965 0.4597 0.5181 0.0314  -0.1067 -0.0441 847  GLN A CB  
255 C CG  . GLN A 53  ? 0.6384 0.5946 0.6391 0.0311  -0.1047 -0.0407 847  GLN A CG  
256 C CD  . GLN A 53  ? 0.7862 0.7350 0.7734 0.0322  -0.1121 -0.0400 847  GLN A CD  
257 O OE1 . GLN A 53  ? 0.8196 0.7690 0.8114 0.0318  -0.1166 -0.0414 847  GLN A OE1 
258 N NE2 . GLN A 53  ? 0.8244 0.7660 0.7944 0.0330  -0.1130 -0.0380 847  GLN A NE2 
259 N N   . ARG A 54  ? 0.4301 0.4092 0.4983 0.0329  -0.1043 -0.0520 848  ARG A N   
260 C CA  . ARG A 54  ? 0.4828 0.4686 0.5722 0.0338  -0.1077 -0.0561 848  ARG A CA  
261 C C   . ARG A 54  ? 0.5140 0.4974 0.6015 0.0349  -0.1169 -0.0561 848  ARG A C   
262 O O   . ARG A 54  ? 0.4912 0.4670 0.5641 0.0368  -0.1231 -0.0538 848  ARG A O   
263 C CB  . ARG A 54  ? 0.5414 0.5284 0.6436 0.0377  -0.1106 -0.0586 848  ARG A CB  
264 N N   . GLY A 55  ? 0.5237 0.5133 0.6248 0.0332  -0.1174 -0.0587 849  GLY A N   
265 C CA  . GLY A 55  ? 0.5520 0.5397 0.6523 0.0337  -0.1258 -0.0591 849  GLY A CA  
266 C C   . GLY A 55  ? 0.5417 0.5266 0.6292 0.0305  -0.1237 -0.0570 849  GLY A C   
267 O O   . GLY A 55  ? 0.5411 0.5254 0.6293 0.0299  -0.1290 -0.0579 849  GLY A O   
268 N N   . GLY A 56  ? 0.4388 0.4219 0.5148 0.0281  -0.1159 -0.0543 850  GLY A N   
269 C CA  . GLY A 56  ? 0.4069 0.3874 0.4722 0.0252  -0.1136 -0.0522 850  GLY A CA  
270 C C   . GLY A 56  ? 0.3774 0.3647 0.4539 0.0212  -0.1076 -0.0533 850  GLY A C   
271 O O   . GLY A 56  ? 0.3885 0.3823 0.4793 0.0203  -0.1040 -0.0557 850  GLY A O   
272 N N   . SER A 57  ? 0.3159 0.3012 0.3857 0.0186  -0.1061 -0.0518 851  SER A N   
273 C CA  . SER A 57  ? 0.3003 0.2911 0.3798 0.0145  -0.1010 -0.0525 851  SER A CA  
274 C C   . SER A 57  ? 0.3293 0.3239 0.4108 0.0114  -0.0921 -0.0511 851  SER A C   
275 O O   . SER A 57  ? 0.3426 0.3433 0.4365 0.0082  -0.0881 -0.0530 851  SER A O   
276 C CB  . SER A 57  ? 0.3006 0.2875 0.3717 0.0126  -0.1010 -0.0506 851  SER A CB  
277 O OG  . SER A 57  ? 0.2994 0.2831 0.3695 0.0145  -0.1088 -0.0526 851  SER A OG  
278 N N   . ALA A 58  ? 0.2679 0.2587 0.3364 0.0116  -0.0887 -0.0477 852  ALA A N   
279 C CA  . ALA A 58  ? 0.2494 0.2433 0.3181 0.0077  -0.0801 -0.0459 852  ALA A CA  
280 C C   . ALA A 58  ? 0.2964 0.2958 0.3780 0.0077  -0.0776 -0.0494 852  ALA A C   
281 O O   . ALA A 58  ? 0.3241 0.3289 0.4139 0.0031  -0.0708 -0.0503 852  ALA A O   
282 C CB  . ALA A 58  ? 0.2729 0.2616 0.3246 0.0078  -0.0774 -0.0415 852  ALA A CB  
283 N N   . HIS A 59  ? 0.3099 0.3078 0.3934 0.0125  -0.0828 -0.0513 853  HIS A N   
284 C CA  . HIS A 59  ? 0.3467 0.3496 0.4441 0.0132  -0.0809 -0.0550 853  HIS A CA  
285 C C   . HIS A 59  ? 0.3832 0.3934 0.4995 0.0112  -0.0808 -0.0594 853  HIS A C   
286 O O   . HIS A 59  ? 0.4078 0.4239 0.5362 0.0085  -0.0750 -0.0624 853  HIS A O   
287 C CB  . HIS A 59  ? 0.4051 0.4045 0.5024 0.0192  -0.0880 -0.0561 853  HIS A CB  
288 C CG  . HIS A 59  ? 0.5358 0.5398 0.6476 0.0203  -0.0856 -0.0597 853  HIS A CG  
289 N ND1 . HIS A 59  ? 0.5988 0.6012 0.7054 0.0203  -0.0802 -0.0588 853  HIS A ND1 
290 C CD2 . HIS A 59  ? 0.5940 0.6043 0.7260 0.0214  -0.0875 -0.0645 853  HIS A CD2 
291 C CE1 . HIS A 59  ? 0.6136 0.6209 0.7370 0.0213  -0.0787 -0.0631 853  HIS A CE1 
292 N NE2 . HIS A 59  ? 0.6355 0.6478 0.7749 0.0221  -0.0831 -0.0666 853  HIS A NE2 
293 N N   . ASN A 60  ? 0.4030 0.4127 0.5215 0.0123  -0.0871 -0.0601 854  ASN A N   
294 C CA  . ASN A 60  ? 0.4150 0.4315 0.5512 0.0106  -0.0879 -0.0644 854  ASN A CA  
295 C C   . ASN A 60  ? 0.4016 0.4224 0.5413 0.0040  -0.0794 -0.0645 854  ASN A C   
296 O O   . ASN A 60  ? 0.4400 0.4676 0.5951 0.0012  -0.0763 -0.0686 854  ASN A O   
297 C CB  . ASN A 60  ? 0.4460 0.4603 0.5817 0.0127  -0.0964 -0.0648 854  ASN A CB  
298 C CG  . ASN A 60  ? 0.5052 0.5162 0.6405 0.0184  -0.1059 -0.0656 854  ASN A CG  
299 O OD1 . ASN A 60  ? 0.5694 0.5815 0.7106 0.0212  -0.1067 -0.0669 854  ASN A OD1 
300 N ND2 . ASN A 60  ? 0.5113 0.5179 0.6399 0.0197  -0.1131 -0.0648 854  ASN A ND2 
301 N N   . CYS A 61  ? 0.4034 0.4200 0.5286 0.0013  -0.0758 -0.0598 855  CYS A N   
302 C CA  . CYS A 61  ? 0.4232 0.4423 0.5490 -0.0053 -0.0688 -0.0586 855  CYS A CA  
303 C C   . CYS A 61  ? 0.4753 0.4987 0.6059 -0.0097 -0.0603 -0.0598 855  CYS A C   
304 O O   . CYS A 61  ? 0.5235 0.5519 0.6632 -0.0153 -0.0551 -0.0620 855  CYS A O   
305 C CB  . CYS A 61  ? 0.4427 0.4555 0.5518 -0.0064 -0.0684 -0.0528 855  CYS A CB  
306 S SG  . CYS A 61  ? 0.6124 0.6261 0.7169 -0.0143 -0.0597 -0.0490 855  CYS A SG  
307 N N   . GLY A 62  ? 0.4368 0.4580 0.5608 -0.0076 -0.0585 -0.0586 856  GLY A N   
308 C CA  . GLY A 62  ? 0.4633 0.4881 0.5912 -0.0119 -0.0501 -0.0601 856  GLY A CA  
309 C C   . GLY A 62  ? 0.4776 0.5012 0.5942 -0.0190 -0.0423 -0.0557 856  GLY A C   
310 O O   . GLY A 62  ? 0.4990 0.5248 0.6160 -0.0231 -0.0349 -0.0563 856  GLY A O   
311 N N   . GLN A 63  ? 0.4436 0.4638 0.5508 -0.0206 -0.0439 -0.0512 857  GLN A N   
312 C CA  . GLN A 63  ? 0.4551 0.4736 0.5513 -0.0272 -0.0380 -0.0459 857  GLN A CA  
313 C C   . GLN A 63  ? 0.3665 0.3793 0.4454 -0.0256 -0.0379 -0.0403 857  GLN A C   
314 O O   . GLN A 63  ? 0.4091 0.4212 0.4795 -0.0313 -0.0324 -0.0361 857  GLN A O   
315 C CB  . GLN A 63  ? 0.5960 0.6137 0.6924 -0.0299 -0.0400 -0.0438 857  GLN A CB  
316 C CG  . GLN A 63  ? 0.7676 0.7899 0.8741 -0.0369 -0.0358 -0.0460 857  GLN A CG  
317 C CD  . GLN A 63  ? 0.8994 0.9230 1.0158 -0.0348 -0.0412 -0.0491 857  GLN A CD  
318 O OE1 . GLN A 63  ? 0.9592 0.9881 1.0896 -0.0352 -0.0408 -0.0549 857  GLN A OE1 
319 N NE2 . GLN A 63  ? 0.9856 1.0044 1.0954 -0.0316 -0.0467 -0.0459 857  GLN A NE2 
320 N N   . LEU A 64  ? 0.3359 0.3446 0.4090 -0.0184 -0.0441 -0.0399 858  LEU A N   
321 C CA  . LEU A 64  ? 0.3341 0.3374 0.3905 -0.0168 -0.0440 -0.0349 858  LEU A CA  
322 C C   . LEU A 64  ? 0.3504 0.3537 0.4049 -0.0150 -0.0415 -0.0365 858  LEU A C   
323 O O   . LEU A 64  ? 0.3618 0.3673 0.4270 -0.0116 -0.0437 -0.0414 858  LEU A O   
324 C CB  . LEU A 64  ? 0.2986 0.2965 0.3478 -0.0109 -0.0517 -0.0335 858  LEU A CB  
325 C CG  . LEU A 64  ? 0.2954 0.2916 0.3432 -0.0122 -0.0541 -0.0311 858  LEU A CG  
326 C CD1 . LEU A 64  ? 0.3264 0.3170 0.3667 -0.0064 -0.0609 -0.0307 858  LEU A CD1 
327 C CD2 . LEU A 64  ? 0.2867 0.2820 0.3261 -0.0177 -0.0489 -0.0254 858  LEU A CD2 
328 N N   . LYS A 65  ? 0.3259 0.3269 0.3675 -0.0176 -0.0369 -0.0325 859  LYS A N   
329 C CA  . LYS A 65  ? 0.3208 0.3213 0.3591 -0.0165 -0.0336 -0.0336 859  LYS A CA  
330 C C   . LYS A 65  ? 0.3078 0.3024 0.3284 -0.0142 -0.0345 -0.0291 859  LYS A C   
331 O O   . LYS A 65  ? 0.3067 0.2989 0.3172 -0.0159 -0.0348 -0.0244 859  LYS A O   
332 C CB  . LYS A 65  ? 0.3625 0.3672 0.4040 -0.0243 -0.0242 -0.0342 859  LYS A CB  
333 C CG  . LYS A 65  ? 0.4444 0.4554 0.5040 -0.0274 -0.0222 -0.0395 859  LYS A CG  
334 C CD  . LYS A 65  ? 0.5859 0.6009 0.6494 -0.0349 -0.0126 -0.0415 859  LYS A CD  
335 C CE  . LYS A 65  ? 0.6966 0.7177 0.7780 -0.0383 -0.0104 -0.0472 859  LYS A CE  
336 N NZ  . LYS A 65  ? 0.7529 0.7744 0.8353 -0.0407 -0.0134 -0.0451 859  LYS A NZ  
337 N N   . VAL A 66  ? 0.2971 0.2897 0.3146 -0.0107 -0.0345 -0.0307 860  VAL A N   
338 C CA  . VAL A 66  ? 0.2985 0.2857 0.2988 -0.0092 -0.0344 -0.0269 860  VAL A CA  
339 C C   . VAL A 66  ? 0.3213 0.3098 0.3130 -0.0164 -0.0266 -0.0227 860  VAL A C   
340 O O   . VAL A 66  ? 0.3417 0.3342 0.3393 -0.0217 -0.0199 -0.0242 860  VAL A O   
341 C CB  . VAL A 66  ? 0.3204 0.3051 0.3198 -0.0047 -0.0353 -0.0296 860  VAL A CB  
342 C CG1 . VAL A 66  ? 0.3917 0.3713 0.3728 -0.0046 -0.0336 -0.0256 860  VAL A CG1 
343 C CG2 . VAL A 66  ? 0.3131 0.2954 0.3187 0.0024  -0.0447 -0.0327 860  VAL A CG2 
344 N N   . GLY A 67  ? 0.3105 0.2957 0.2886 -0.0170 -0.0273 -0.0175 861  GLY A N   
345 C CA  . GLY A 67  ? 0.3181 0.3046 0.2883 -0.0243 -0.0210 -0.0127 861  GLY A CA  
346 C C   . GLY A 67  ? 0.3000 0.2883 0.2728 -0.0285 -0.0214 -0.0093 861  GLY A C   
347 O O   . GLY A 67  ? 0.3369 0.3251 0.3011 -0.0335 -0.0182 -0.0041 861  GLY A O   
348 N N   . HIS A 68  ? 0.2798 0.2696 0.2644 -0.0264 -0.0256 -0.0121 862  HIS A N   
349 C CA  . HIS A 68  ? 0.2643 0.2548 0.2510 -0.0298 -0.0267 -0.0088 862  HIS A CA  
350 C C   . HIS A 68  ? 0.3113 0.2974 0.2866 -0.0274 -0.0300 -0.0040 862  HIS A C   
351 O O   . HIS A 68  ? 0.3232 0.3056 0.2935 -0.0211 -0.0345 -0.0053 862  HIS A O   
352 C CB  . HIS A 68  ? 0.3184 0.3105 0.3188 -0.0271 -0.0312 -0.0129 862  HIS A CB  
353 C CG  . HIS A 68  ? 0.2959 0.2932 0.3085 -0.0327 -0.0272 -0.0156 862  HIS A CG  
354 N ND1 . HIS A 68  ? 0.3176 0.3177 0.3442 -0.0302 -0.0295 -0.0215 862  HIS A ND1 
355 C CD2 . HIS A 68  ? 0.3071 0.3071 0.3198 -0.0412 -0.0209 -0.0133 862  HIS A CD2 
356 C CE1 . HIS A 68  ? 0.3373 0.3419 0.3724 -0.0367 -0.0245 -0.0231 862  HIS A CE1 
357 N NE2 . HIS A 68  ? 0.3119 0.3162 0.3384 -0.0437 -0.0192 -0.0183 862  HIS A NE2 
358 N N   . VAL A 69  ? 0.2724 0.2589 0.2442 -0.0326 -0.0280 0.0014  863  VAL A N   
359 C CA  . VAL A 69  ? 0.2926 0.2756 0.2564 -0.0305 -0.0311 0.0057  863  VAL A CA  
360 C C   . VAL A 69  ? 0.2880 0.2708 0.2609 -0.0301 -0.0350 0.0059  863  VAL A C   
361 O O   . VAL A 69  ? 0.2813 0.2669 0.2620 -0.0352 -0.0332 0.0066  863  VAL A O   
362 C CB  . VAL A 69  ? 0.3156 0.2988 0.2694 -0.0362 -0.0270 0.0121  863  VAL A CB  
363 C CG1 . VAL A 69  ? 0.3320 0.3123 0.2808 -0.0345 -0.0304 0.0167  863  VAL A CG1 
364 C CG2 . VAL A 69  ? 0.3177 0.3003 0.2610 -0.0360 -0.0234 0.0118  863  VAL A CG2 
365 N N   . ILE A 70  ? 0.2499 0.2293 0.2218 -0.0241 -0.0402 0.0046  864  ILE A N   
366 C CA  . ILE A 70  ? 0.2548 0.2334 0.2353 -0.0231 -0.0440 0.0040  864  ILE A CA  
367 C C   . ILE A 70  ? 0.3342 0.3112 0.3117 -0.0256 -0.0439 0.0099  864  ILE A C   
368 O O   . ILE A 70  ? 0.3177 0.2918 0.2867 -0.0231 -0.0449 0.0121  864  ILE A O   
369 C CB  . ILE A 70  ? 0.2404 0.2156 0.2216 -0.0161 -0.0496 -0.0009 864  ILE A CB  
370 C CG1 . ILE A 70  ? 0.2461 0.2229 0.2311 -0.0135 -0.0504 -0.0063 864  ILE A CG1 
371 C CG2 . ILE A 70  ? 0.2594 0.2340 0.2497 -0.0157 -0.0527 -0.0018 864  ILE A CG2 
372 C CD1 . ILE A 70  ? 0.2679 0.2409 0.2512 -0.0070 -0.0565 -0.0106 864  ILE A CD1 
373 N N   . LEU A 71  ? 0.2970 0.2759 0.2816 -0.0308 -0.0427 0.0127  865  LEU A N   
374 C CA  . LEU A 71  ? 0.2986 0.2760 0.2821 -0.0338 -0.0429 0.0190  865  LEU A CA  
375 C C   . LEU A 71  ? 0.3193 0.2938 0.3098 -0.0302 -0.0473 0.0181  865  LEU A C   
376 O O   . LEU A 71  ? 0.3298 0.3017 0.3179 -0.0290 -0.0487 0.0216  865  LEU A O   
377 C CB  . LEU A 71  ? 0.3028 0.2830 0.2895 -0.0421 -0.0396 0.0231  865  LEU A CB  
378 C CG  . LEU A 71  ? 0.2987 0.2819 0.2795 -0.0467 -0.0345 0.0232  865  LEU A CG  
379 C CD1 . LEU A 71  ? 0.3628 0.3485 0.3472 -0.0559 -0.0311 0.0264  865  LEU A CD1 
380 C CD2 . LEU A 71  ? 0.3737 0.3558 0.3421 -0.0463 -0.0330 0.0272  865  LEU A CD2 
381 N N   . GLU A 72  ? 0.3084 0.2834 0.3080 -0.0289 -0.0492 0.0132  866  GLU A N   
382 C CA  . GLU A 72  ? 0.3111 0.2835 0.3181 -0.0262 -0.0528 0.0117  866  GLU A CA  
383 C C   . GLU A 72  ? 0.2923 0.2646 0.3042 -0.0220 -0.0556 0.0045  866  GLU A C   
384 O O   . GLU A 72  ? 0.3154 0.2910 0.3300 -0.0228 -0.0545 0.0012  866  GLU A O   
385 C CB  . GLU A 72  ? 0.3419 0.3148 0.3571 -0.0317 -0.0523 0.0151  866  GLU A CB  
386 C CG  . GLU A 72  ? 0.4090 0.3819 0.4201 -0.0369 -0.0503 0.0231  866  GLU A CG  
387 C CD  . GLU A 72  ? 0.5115 0.4841 0.5305 -0.0425 -0.0505 0.0267  866  GLU A CD  
388 O OE1 . GLU A 72  ? 0.4531 0.4258 0.4805 -0.0424 -0.0516 0.0228  866  GLU A OE1 
389 O OE2 . GLU A 72  ? 0.5616 0.5337 0.5780 -0.0472 -0.0497 0.0338  866  GLU A OE2 
390 N N   . VAL A 73  ? 0.2823 0.2511 0.2963 -0.0180 -0.0591 0.0020  867  VAL A N   
391 C CA  . VAL A 73  ? 0.2847 0.2531 0.3033 -0.0145 -0.0624 -0.0045 867  VAL A CA  
392 C C   . VAL A 73  ? 0.3311 0.2979 0.3588 -0.0152 -0.0640 -0.0052 867  VAL A C   
393 O O   . VAL A 73  ? 0.3345 0.2976 0.3612 -0.0141 -0.0648 -0.0033 867  VAL A O   
394 C CB  . VAL A 73  ? 0.2915 0.2563 0.3018 -0.0091 -0.0652 -0.0078 867  VAL A CB  
395 C CG1 . VAL A 73  ? 0.3068 0.2708 0.3219 -0.0063 -0.0692 -0.0139 867  VAL A CG1 
396 C CG2 . VAL A 73  ? 0.3106 0.2766 0.3115 -0.0083 -0.0635 -0.0071 867  VAL A CG2 
397 N N   . ASN A 74  ? 0.3077 0.2126 0.3749 -0.0124 -0.0591 -0.0164 868  ASN A N   
398 C CA  . ASN A 74  ? 0.2973 0.1852 0.3918 -0.0015 -0.0600 -0.0259 868  ASN A CA  
399 C C   . ASN A 74  ? 0.3631 0.2502 0.4873 0.0097  -0.0668 -0.0180 868  ASN A C   
400 O O   . ASN A 74  ? 0.3883 0.2740 0.5411 0.0214  -0.0662 -0.0297 868  ASN A O   
401 C CB  . ASN A 74  ? 0.3550 0.2557 0.4590 0.0038  -0.0513 -0.0512 868  ASN A CB  
402 C CG  . ASN A 74  ? 0.3968 0.2907 0.4744 -0.0059 -0.0453 -0.0597 868  ASN A CG  
403 O OD1 . ASN A 74  ? 0.3699 0.2429 0.4282 -0.0143 -0.0481 -0.0485 868  ASN A OD1 
404 N ND2 . ASN A 74  ? 0.3573 0.2686 0.4340 -0.0046 -0.0370 -0.0796 868  ASN A ND2 
405 N N   . GLY A 75  ? 0.3683 0.2549 0.4853 0.0060  -0.0735 0.0024  869  GLY A N   
406 C CA  . GLY A 75  ? 0.4063 0.2905 0.5491 0.0158  -0.0807 0.0120  869  GLY A CA  
407 C C   . GLY A 75  ? 0.4250 0.3397 0.5831 0.0223  -0.0798 0.0078  869  GLY A C   
408 O O   . GLY A 75  ? 0.4135 0.3292 0.5922 0.0304  -0.0859 0.0164  869  GLY A O   
409 N N   . LEU A 76  ? 0.3797 0.3190 0.5283 0.0191  -0.0723 -0.0057 870  LEU A N   
410 C CA  . LEU A 76  ? 0.4155 0.3856 0.5764 0.0242  -0.0708 -0.0100 870  LEU A CA  
411 C C   . LEU A 76  ? 0.3613 0.3454 0.5001 0.0146  -0.0733 0.0063  870  LEU A C   
412 O O   . LEU A 76  ? 0.3360 0.3224 0.4454 0.0028  -0.0698 0.0084  870  LEU A O   
413 C CB  . LEU A 76  ? 0.4428 0.4337 0.6059 0.0262  -0.0611 -0.0332 870  LEU A CB  
414 C CG  . LEU A 76  ? 0.5375 0.5612 0.7124 0.0310  -0.0585 -0.0398 870  LEU A CG  
415 C CD1 . LEU A 76  ? 0.5852 0.6101 0.7931 0.0438  -0.0646 -0.0360 870  LEU A CD1 
416 C CD2 . LEU A 76  ? 0.5438 0.5857 0.7216 0.0335  -0.0488 -0.0633 870  LEU A CD2 
417 N N   . THR A 77  ? 0.3334 0.3272 0.4863 0.0197  -0.0792 0.0175  871  THR A N   
418 C CA  . THR A 77  ? 0.3169 0.3240 0.4496 0.0107  -0.0818 0.0331  871  THR A CA  
419 C C   . THR A 77  ? 0.3352 0.3728 0.4555 0.0059  -0.0739 0.0219  871  THR A C   
420 O O   . THR A 77  ? 0.3503 0.4057 0.4875 0.0133  -0.0685 0.0044  871  THR A O   
421 C CB  . THR A 77  ? 0.3621 0.3739 0.5134 0.0175  -0.0900 0.0474  871  THR A CB  
422 O OG1 . THR A 77  ? 0.3713 0.3932 0.5004 0.0077  -0.0927 0.0636  871  THR A OG1 
423 C CG2 . THR A 77  ? 0.3876 0.4229 0.5678 0.0295  -0.0878 0.0339  871  THR A CG2 
424 N N   . LEU A 78  ? 0.2864 0.3293 0.3763 -0.0068 -0.0731 0.0320  872  LEU A N   
425 C CA  . LEU A 78  ? 0.2809 0.3528 0.3576 -0.0120 -0.0662 0.0242  872  LEU A CA  
426 C C   . LEU A 78  ? 0.3141 0.4071 0.3961 -0.0111 -0.0701 0.0353  872  LEU A C   
427 O O   . LEU A 78  ? 0.2995 0.4180 0.3719 -0.0152 -0.0648 0.0300  872  LEU A O   
428 C CB  . LEU A 78  ? 0.2840 0.3520 0.3237 -0.0266 -0.0621 0.0273  872  LEU A CB  
429 C CG  . LEU A 78  ? 0.2768 0.3270 0.3090 -0.0282 -0.0573 0.0146  872  LEU A CG  
430 C CD1 . LEU A 78  ? 0.2635 0.3142 0.2596 -0.0421 -0.0523 0.0156  872  LEU A CD1 
431 C CD2 . LEU A 78  ? 0.2665 0.3281 0.3210 -0.0180 -0.0506 -0.0091 872  LEU A CD2 
432 N N   . ARG A 79  ? 0.2830 0.3655 0.3794 -0.0061 -0.0792 0.0507  873  ARG A N   
433 C CA  . ARG A 79  ? 0.3000 0.4023 0.4028 -0.0046 -0.0833 0.0612  873  ARG A CA  
434 C C   . ARG A 79  ? 0.3225 0.4506 0.4506 0.0057  -0.0789 0.0445  873  ARG A C   
435 O O   . ARG A 79  ? 0.3137 0.4363 0.4673 0.0168  -0.0785 0.0328  873  ARG A O   
436 C CB  . ARG A 79  ? 0.3098 0.3946 0.4247 -0.0002 -0.0940 0.0802  873  ARG A CB  
437 C CG  . ARG A 79  ? 0.4068 0.5119 0.5294 0.0018  -0.0987 0.0911  873  ARG A CG  
438 C CD  . ARG A 79  ? 0.5026 0.5886 0.6253 0.0015  -0.1092 0.1135  873  ARG A CD  
439 N NE  . ARG A 79  ? 0.5599 0.6331 0.6495 -0.0124 -0.1106 0.1280  873  ARG A NE  
440 C CZ  . ARG A 79  ? 0.5797 0.6636 0.6446 -0.0227 -0.1027 0.1293  873  ARG A CZ  
441 N NH1 . ARG A 79  ? 0.5858 0.6996 0.6581 -0.0204 -0.1027 0.1276  873  ARG A NH1 
442 N NH2 . ARG A 79  ? 0.5460 0.6112 0.5841 -0.0341 -0.0917 0.1263  873  ARG A NH2 
443 N N   . GLY A 80  ? 0.2980 0.4543 0.4188 0.0020  -0.0753 0.0429  874  GLY A N   
444 C CA  . GLY A 80  ? 0.2931 0.4748 0.4372 0.0114  -0.0712 0.0277  874  GLY A CA  
445 C C   . GLY A 80  ? 0.2893 0.4833 0.4270 0.0099  -0.0606 0.0065  874  GLY A C   
446 O O   . GLY A 80  ? 0.3357 0.5540 0.4878 0.0156  -0.0558 -0.0067 874  GLY A O   
447 N N   . LYS A 81  ? 0.2365 0.4145 0.3527 0.0022  -0.0568 0.0031  875  LYS A N   
448 C CA  . LYS A 81  ? 0.2614 0.4502 0.3695 0.0003  -0.0467 -0.0169 875  LYS A CA  
449 C C   . LYS A 81  ? 0.3152 0.5236 0.3946 -0.0115 -0.0413 -0.0150 875  LYS A C   
450 O O   . LYS A 81  ? 0.2772 0.4766 0.3306 -0.0224 -0.0438 -0.0002 875  LYS A O   
451 C CB  . LYS A 81  ? 0.2695 0.4323 0.3681 -0.0020 -0.0447 -0.0228 875  LYS A CB  
452 C CG  . LYS A 81  ? 0.3608 0.5014 0.4862 0.0090  -0.0497 -0.0247 875  LYS A CG  
453 C CD  . LYS A 81  ? 0.5146 0.6711 0.6736 0.0227  -0.0481 -0.0391 875  LYS A CD  
454 C CE  . LYS A 81  ? 0.6322 0.7662 0.8174 0.0335  -0.0530 -0.0408 875  LYS A CE  
455 N NZ  . LYS A 81  ? 0.6790 0.7932 0.8563 0.0316  -0.0490 -0.0512 875  LYS A NZ  
456 N N   . GLU A 82  ? 0.2917 0.5266 0.3757 -0.0092 -0.0338 -0.0303 876  GLU A N   
457 C CA  . GLU A 82  ? 0.2697 0.5240 0.3268 -0.0200 -0.0274 -0.0311 876  GLU A CA  
458 C C   . GLU A 82  ? 0.2819 0.5218 0.3102 -0.0298 -0.0224 -0.0350 876  GLU A C   
459 O O   . GLU A 82  ? 0.2908 0.5107 0.3242 -0.0265 -0.0223 -0.0420 876  GLU A O   
460 C CB  . GLU A 82  ? 0.4119 0.6966 0.4833 -0.0140 -0.0200 -0.0487 876  GLU A CB  
461 C CG  . GLU A 82  ? 0.6319 0.9408 0.6797 -0.0237 -0.0130 -0.0505 876  GLU A CG  
462 C CD  . GLU A 82  ? 0.8505 1.1599 0.8770 -0.0297 -0.0037 -0.0651 876  GLU A CD  
463 O OE1 . GLU A 82  ? 0.9701 1.2695 1.0082 -0.0233 -0.0009 -0.0794 876  GLU A OE1 
464 O OE2 . GLU A 82  ? 0.9043 1.2241 0.9028 -0.0407 0.0010  -0.0622 876  GLU A OE2 
465 N N   . HIS A 83  ? 0.3229 0.4065 0.3097 -0.0297 0.0663  -0.0288 877  HIS A N   
466 C CA  . HIS A 83  ? 0.3318 0.4011 0.2981 -0.0382 0.0450  -0.0127 877  HIS A CA  
467 C C   . HIS A 83  ? 0.3196 0.3931 0.2647 -0.0608 0.0481  -0.0253 877  HIS A C   
468 O O   . HIS A 83  ? 0.3278 0.3904 0.2766 -0.0568 0.0399  -0.0220 877  HIS A O   
469 C CB  . HIS A 83  ? 0.3814 0.4463 0.3191 -0.0504 0.0268  0.0077  877  HIS A CB  
470 C CG  . HIS A 83  ? 0.3564 0.4074 0.2707 -0.0610 0.0049  0.0239  877  HIS A CG  
471 N ND1 . HIS A 83  ? 0.3358 0.3694 0.2636 -0.0426 -0.0117 0.0416  877  HIS A ND1 
472 C CD2 . HIS A 83  ? 0.4064 0.4583 0.2847 -0.0880 -0.0033 0.0251  877  HIS A CD2 
473 C CE1 . HIS A 83  ? 0.3626 0.3870 0.2636 -0.0579 -0.0293 0.0528  877  HIS A CE1 
474 N NE2 . HIS A 83  ? 0.3854 0.4205 0.2563 -0.0853 -0.0245 0.0429  877  HIS A NE2 
475 N N   . ARG A 84  ? 0.3351 0.4240 0.2587 -0.0840 0.0598  -0.0397 878  ARG A N   
476 C CA  . ARG A 84  ? 0.3269 0.4195 0.2285 -0.1063 0.0617  -0.0507 878  ARG A CA  
477 C C   . ARG A 84  ? 0.3900 0.4835 0.3170 -0.0953 0.0750  -0.0678 878  ARG A C   
478 O O   . ARG A 84  ? 0.4533 0.5422 0.3691 -0.1055 0.0702  -0.0706 878  ARG A O   
479 C CB  . ARG A 84  ? 0.4032 0.5130 0.2779 -0.1328 0.0730  -0.0635 878  ARG A CB  
480 C CG  . ARG A 84  ? 0.4748 0.5825 0.3202 -0.1466 0.0580  -0.0460 878  ARG A CG  
481 C CD  . ARG A 84  ? 0.6621 0.7874 0.4843 -0.1700 0.0706  -0.0583 878  ARG A CD  
482 N NE  . ARG A 84  ? 0.6794 0.8164 0.5260 -0.1567 0.0886  -0.0694 878  ARG A NE  
483 C CZ  . ARG A 84  ? 0.7048 0.8512 0.5450 -0.1665 0.0934  -0.0742 878  ARG A CZ  
484 N NH1 . ARG A 84  ? 0.7086 0.8548 0.5207 -0.1893 0.0828  -0.0690 878  ARG A NH1 
485 N NH2 . ARG A 84  ? 0.7290 0.8812 0.5969 -0.1502 0.1052  -0.0825 878  ARG A NH2 
486 N N   . GLU A 85  ? 0.3646 0.4637 0.3255 -0.0745 0.0915  -0.0792 879  GLU A N   
487 C CA  . GLU A 85  ? 0.4210 0.5213 0.4076 -0.0629 0.1053  -0.0961 879  GLU A CA  
488 C C   . GLU A 85  ? 0.3538 0.4357 0.3587 -0.0428 0.0918  -0.0829 879  GLU A C   
489 O O   . GLU A 85  ? 0.3584 0.4364 0.3670 -0.0437 0.0927  -0.0900 879  GLU A O   
490 C CB  . GLU A 85  ? 0.4857 0.5973 0.5026 -0.0469 0.1271  -0.1127 879  GLU A CB  
491 C CG  . GLU A 85  ? 0.6644 0.7640 0.7090 -0.0285 0.1265  -0.1165 879  GLU A CG  
492 C CD  . GLU A 85  ? 0.9324 1.0379 0.9668 -0.0463 0.1334  -0.1324 879  GLU A CD  
493 O OE1 . GLU A 85  ? 1.0548 1.1689 1.0594 -0.0709 0.1357  -0.1388 879  GLU A OE1 
494 O OE2 . GLU A 85  ? 0.9647 1.0650 1.0164 -0.0366 0.1344  -0.1359 879  GLU A OE2 
495 N N   . ALA A 86  ? 0.3003 0.3712 0.3170 -0.0245 0.0793  -0.0639 880  ALA A N   
496 C CA  . ALA A 86  ? 0.2714 0.3240 0.3034 -0.0062 0.0645  -0.0494 880  ALA A CA  
497 C C   . ALA A 86  ? 0.3210 0.3643 0.3246 -0.0240 0.0467  -0.0396 880  ALA A C   
498 O O   . ALA A 86  ? 0.2929 0.3267 0.3064 -0.0171 0.0424  -0.0399 880  ALA A O   
499 C CB  . ALA A 86  ? 0.3107 0.3534 0.3554 0.0135  0.0525  -0.0291 880  ALA A CB  
500 N N   . ALA A 87  ? 0.3285 0.3743 0.2968 -0.0469 0.0361  -0.0308 881  ALA A N   
501 C CA  . ALA A 87  ? 0.3706 0.4073 0.3111 -0.0639 0.0186  -0.0210 881  ALA A CA  
502 C C   . ALA A 87  ? 0.3833 0.4265 0.3178 -0.0779 0.0294  -0.0403 881  ALA A C   
503 O O   . ALA A 87  ? 0.3782 0.4114 0.3089 -0.0797 0.0194  -0.0367 881  ALA A O   
504 C CB  . ALA A 87  ? 0.4016 0.4404 0.3050 -0.0861 0.0062  -0.0088 881  ALA A CB  
505 N N   . ARG A 88  ? 0.3721 0.4323 0.3070 -0.0874 0.0501  -0.0612 882  ARG A N   
506 C CA  . ARG A 88  ? 0.4083 0.4759 0.3369 -0.1016 0.0613  -0.0803 882  ARG A CA  
507 C C   . ARG A 88  ? 0.3676 0.4288 0.3292 -0.0806 0.0679  -0.0882 882  ARG A C   
508 O O   . ARG A 88  ? 0.3552 0.4136 0.3114 -0.0882 0.0667  -0.0946 882  ARG A O   
509 C CB  . ARG A 88  ? 0.4561 0.5437 0.3787 -0.1158 0.0826  -0.1012 882  ARG A CB  
510 C CG  . ARG A 88  ? 0.5714 0.6675 0.4834 -0.1335 0.0935  -0.1207 882  ARG A CG  
511 C CD  . ARG A 88  ? 0.7268 0.8376 0.6631 -0.1266 0.1195  -0.1451 882  ARG A CD  
512 N NE  . ARG A 88  ? 0.8472 0.9506 0.8215 -0.0995 0.1251  -0.1489 882  ARG A NE  
513 C CZ  . ARG A 88  ? 0.9311 1.0404 0.9361 -0.0836 0.1408  -0.1615 882  ARG A CZ  
514 N NH1 . ARG A 88  ? 0.9919 1.1097 0.9968 -0.0902 0.1458  -0.1660 882  ARG A NH1 
515 N NH2 . ARG A 88  ? 0.9343 1.0312 0.9711 -0.0590 0.1376  -0.1571 882  ARG A NH2 
516 N N   . ILE A 89  ? 0.3149 0.3729 0.3108 -0.0534 0.0740  -0.0870 883  ILE A N   
517 C CA  . ILE A 89  ? 0.3034 0.3546 0.3316 -0.0322 0.0801  -0.0939 883  ILE A CA  
518 C C   . ILE A 89  ? 0.3501 0.3834 0.3744 -0.0282 0.0596  -0.0775 883  ILE A C   
519 O O   . ILE A 89  ? 0.3589 0.3878 0.3917 -0.0257 0.0617  -0.0850 883  ILE A O   
520 C CB  . ILE A 89  ? 0.3208 0.3709 0.3854 -0.0034 0.0891  -0.0937 883  ILE A CB  
521 C CG1 . ILE A 89  ? 0.3986 0.4672 0.4716 -0.0063 0.1128  -0.1148 883  ILE A CG1 
522 C CG2 . ILE A 89  ? 0.3596 0.3970 0.4568 0.0217  0.0886  -0.0929 883  ILE A CG2 
523 C CD1 . ILE A 89  ? 0.4207 0.4829 0.5078 0.0133  0.1060  -0.0997 883  ILE A CD1 
524 N N   . ILE A 90  ? 0.3110 0.3338 0.3225 -0.0271 0.0397  -0.0548 884  ILE A N   
525 C CA  . ILE A 90  ? 0.2776 0.2827 0.2859 -0.0220 0.0188  -0.0375 884  ILE A CA  
526 C C   . ILE A 90  ? 0.3212 0.3261 0.2979 -0.0476 0.0109  -0.0396 884  ILE A C   
527 O O   . ILE A 90  ? 0.3383 0.3341 0.3191 -0.0452 0.0048  -0.0395 884  ILE A O   
528 C CB  . ILE A 90  ? 0.2946 0.2891 0.2964 -0.0151 -0.0006 -0.0125 884  ILE A CB  
529 C CG1 . ILE A 90  ? 0.2649 0.2566 0.3019 0.0140  0.0055  -0.0090 884  ILE A CG1 
530 C CG2 . ILE A 90  ? 0.3243 0.3015 0.3169 -0.0144 -0.0231 0.0052  884  ILE A CG2 
531 C CD1 . ILE A 90  ? 0.3122 0.2974 0.3427 0.0196  -0.0096 0.0128  884  ILE A CD1 
532 N N   . ALA A 91  ? 0.3442 0.3597 0.2890 -0.0730 0.0116  -0.0426 885  ALA A N   
533 C CA  . ALA A 91  ? 0.3327 0.3495 0.2459 -0.0989 0.0056  -0.0463 885  ALA A CA  
534 C C   . ALA A 91  ? 0.3621 0.3848 0.2864 -0.1012 0.0210  -0.0678 885  ALA A C   
535 O O   . ALA A 91  ? 0.4117 0.4273 0.3265 -0.1086 0.0125  -0.0671 885  ALA A O   
536 C CB  . ALA A 91  ? 0.4625 0.4916 0.3422 -0.1248 0.0075  -0.0485 885  ALA A CB  
537 N N   . GLU A 92  ? 0.3701 0.4054 0.3156 -0.0939 0.0434  -0.0867 886  GLU A N   
538 C CA  . GLU A 92  ? 0.4392 0.4813 0.3963 -0.0957 0.0594  -0.1082 886  GLU A CA  
539 C C   . GLU A 92  ? 0.4205 0.4490 0.4062 -0.0732 0.0558  -0.1055 886  GLU A C   
540 O O   . GLU A 92  ? 0.4290 0.4560 0.4146 -0.0784 0.0579  -0.1148 886  GLU A O   
541 C CB  . GLU A 92  ? 0.5588 0.6179 0.5316 -0.0932 0.0843  -0.1290 886  GLU A CB  
542 C CG  . GLU A 92  ? 0.7153 0.7897 0.6584 -0.1185 0.0906  -0.1355 886  GLU A CG  
543 C CD  . GLU A 92  ? 0.9057 0.9811 0.8098 -0.1480 0.0809  -0.1348 886  GLU A CD  
544 O OE1 . GLU A 92  ? 0.9662 1.0432 0.8688 -0.1556 0.0862  -0.1474 886  GLU A OE1 
545 O OE2 . GLU A 92  ? 0.9635 1.0383 0.8381 -0.1639 0.0683  -0.1220 886  GLU A OE2 
546 N N   . ALA A 93  ? 0.3655 0.3841 0.3758 -0.0483 0.0502  -0.0926 887  ALA A N   
547 C CA  . ALA A 93  ? 0.3087 0.3125 0.3450 -0.0262 0.0441  -0.0868 887  ALA A CA  
548 C C   . ALA A 93  ? 0.3366 0.3267 0.3526 -0.0355 0.0222  -0.0722 887  ALA A C   
549 O O   . ALA A 93  ? 0.3301 0.3116 0.3600 -0.0269 0.0202  -0.0746 887  ALA A O   
550 C CB  . ALA A 93  ? 0.3033 0.2991 0.3670 0.0013  0.0411  -0.0741 887  ALA A CB  
551 N N   . PHE A 94  ? 0.3400 0.3277 0.3238 -0.0528 0.0056  -0.0573 888  PHE A N   
552 C CA  . PHE A 94  ? 0.3349 0.3097 0.2981 -0.0625 -0.0156 -0.0435 888  PHE A CA  
553 C C   . PHE A 94  ? 0.3835 0.3648 0.3264 -0.0852 -0.0109 -0.0583 888  PHE A C   
554 O O   . PHE A 94  ? 0.3924 0.3641 0.3344 -0.0857 -0.0199 -0.0563 888  PHE A O   
555 C CB  . PHE A 94  ? 0.3435 0.3130 0.2780 -0.0737 -0.0355 -0.0222 888  PHE A CB  
556 C CG  . PHE A 94  ? 0.3862 0.3406 0.3029 -0.0799 -0.0589 -0.0058 888  PHE A CG  
557 C CD1 . PHE A 94  ? 0.4723 0.4103 0.4091 -0.0580 -0.0724 0.0097  888  PHE A CD1 
558 C CD2 . PHE A 94  ? 0.4909 0.4474 0.3719 -0.1069 -0.0668 -0.0066 888  PHE A CD2 
559 C CE1 . PHE A 94  ? 0.4456 0.3698 0.3673 -0.0630 -0.0936 0.0241  888  PHE A CE1 
560 C CE2 . PHE A 94  ? 0.5537 0.4963 0.4193 -0.1120 -0.0882 0.0079  888  PHE A CE2 
561 C CZ  . PHE A 94  ? 0.5218 0.4483 0.4081 -0.0898 -0.1016 0.0234  888  PHE A CZ  
562 N N   . LYS A 95  ? 0.4083 0.4061 0.3360 -0.1035 0.0038  -0.0737 889  LYS A N   
563 C CA  . LYS A 95  ? 0.4169 0.4226 0.3209 -0.1281 0.0083  -0.0875 889  LYS A CA  
564 C C   . LYS A 95  ? 0.4206 0.4291 0.3480 -0.1202 0.0235  -0.1066 889  LYS A C   
565 O O   . LYS A 95  ? 0.5045 0.5139 0.4170 -0.1357 0.0228  -0.1147 889  LYS A O   
566 C CB  . LYS A 95  ? 0.4560 0.4790 0.3383 -0.1492 0.0205  -0.0988 889  LYS A CB  
567 C CG  . LYS A 95  ? 0.6083 0.6307 0.4584 -0.1651 0.0061  -0.0827 889  LYS A CG  
568 C CD  . LYS A 95  ? 0.7583 0.7991 0.5966 -0.1799 0.0227  -0.0963 889  LYS A CD  
569 C CE  . LYS A 95  ? 0.8608 0.9027 0.6659 -0.1974 0.0105  -0.0823 889  LYS A CE  
570 N NZ  . LYS A 95  ? 0.9274 0.9724 0.6933 -0.2275 0.0039  -0.0844 889  LYS A NZ  
571 N N   . THR A 96  ? 0.3066 0.3053 0.4704 -0.0140 -0.0096 -0.0616 890  THR A N   
572 C CA  . THR A 96  ? 0.3520 0.3242 0.5224 -0.0128 -0.0006 -0.0570 890  THR A CA  
573 C C   . THR A 96  ? 0.3378 0.2963 0.5083 -0.0256 0.0136  -0.0588 890  THR A C   
574 O O   . THR A 96  ? 0.3408 0.3018 0.4976 -0.0326 0.0169  -0.0561 890  THR A O   
575 C CB  . THR A 96  ? 0.3846 0.3370 0.5405 -0.0007 -0.0029 -0.0395 890  THR A CB  
576 O OG1 . THR A 96  ? 0.4252 0.3524 0.5906 0.0006  0.0061  -0.0365 890  THR A OG1 
577 C CG2 . THR A 96  ? 0.4164 0.3614 0.5484 -0.0026 -0.0001 -0.0271 890  THR A CG2 
578 N N   . LYS A 97  ? 0.3779 0.3222 0.5649 -0.0289 0.0223  -0.0644 891  LYS A N   
579 C CA  . LYS A 97  ? 0.3885 0.3188 0.5777 -0.0410 0.0365  -0.0669 891  LYS A CA  
580 C C   . LYS A 97  ? 0.3983 0.2971 0.5760 -0.0381 0.0451  -0.0511 891  LYS A C   
581 O O   . LYS A 97  ? 0.4244 0.3082 0.6032 -0.0476 0.0578  -0.0515 891  LYS A O   
582 C CB  . LYS A 97  ? 0.5194 0.4524 0.7337 -0.0475 0.0424  -0.0829 891  LYS A CB  
583 C CG  . LYS A 97  ? 0.6433 0.6056 0.8680 -0.0552 0.0393  -0.0994 891  LYS A CG  
584 C CD  . LYS A 97  ? 0.8164 0.7872 1.0255 -0.0642 0.0446  -0.0983 891  LYS A CD  
585 C CE  . LYS A 97  ? 0.9517 0.9371 1.1565 -0.0648 0.0509  -0.1030 891  LYS A CE  
586 N NZ  . LYS A 97  ? 0.9992 0.9795 1.1906 -0.0727 0.0591  -0.0997 891  LYS A NZ  
587 N N   . ASP A 98  ? 0.4183 0.3077 0.5847 -0.0247 0.0384  -0.0371 892  ASP A N   
588 C CA  . ASP A 98  ? 0.4600 0.3194 0.6147 -0.0198 0.0461  -0.0207 892  ASP A CA  
589 C C   . ASP A 98  ? 0.4389 0.2904 0.5738 -0.0267 0.0533  -0.0116 892  ASP A C   
590 O O   . ASP A 98  ? 0.4931 0.3188 0.6228 -0.0282 0.0647  -0.0019 892  ASP A O   
591 C CB  . ASP A 98  ? 0.5619 0.4172 0.7065 -0.0029 0.0358  -0.0074 892  ASP A CB  
592 C CG  . ASP A 98  ? 0.6914 0.5468 0.8552 0.0051  0.0311  -0.0133 892  ASP A CG  
593 O OD1 . ASP A 98  ? 0.7012 0.5575 0.8858 -0.0025 0.0368  -0.0271 892  ASP A OD1 
594 O OD2 . ASP A 98  ? 0.7173 0.5720 0.8754 0.0191  0.0219  -0.0043 892  ASP A OD2 
595 N N   . ARG A 99  ? 0.4072 0.2809 0.5316 -0.0307 0.0469  -0.0147 893  ARG A N   
596 C CA  . ARG A 99  ? 0.3623 0.2317 0.4672 -0.0369 0.0524  -0.0067 893  ARG A CA  
597 C C   . ARG A 99  ? 0.3303 0.2271 0.4338 -0.0459 0.0480  -0.0180 893  ARG A C   
598 O O   . ARG A 99  ? 0.3432 0.2625 0.4577 -0.0449 0.0391  -0.0294 893  ARG A O   
599 C CB  . ARG A 99  ? 0.3981 0.2588 0.4796 -0.0245 0.0469  0.0122  893  ARG A CB  
600 C CG  . ARG A 99  ? 0.4030 0.2875 0.4773 -0.0148 0.0304  0.0123  893  ARG A CG  
601 C CD  . ARG A 99  ? 0.3996 0.2727 0.4553 0.0001  0.0251  0.0306  893  ARG A CD  
602 N NE  . ARG A 99  ? 0.4367 0.2920 0.5022 0.0103  0.0258  0.0358  893  ARG A NE  
603 C CZ  . ARG A 99  ? 0.4743 0.3409 0.5517 0.0194  0.0154  0.0306  893  ARG A CZ  
604 N NH1 . ARG A 99  ? 0.4563 0.3513 0.5374 0.0193  0.0036  0.0202  893  ARG A NH1 
605 N NH2 . ARG A 99  ? 0.5217 0.3706 0.6074 0.0285  0.0171  0.0360  893  ARG A NH2 
606 N N   . ASP A 100 ? 0.3394 0.2342 0.4290 -0.0544 0.0546  -0.0143 894  ASP A N   
607 C CA  . ASP A 100 ? 0.3222 0.2419 0.4116 -0.0639 0.0520  -0.0255 894  ASP A CA  
608 C C   . ASP A 100 ? 0.3226 0.2548 0.3901 -0.0596 0.0435  -0.0173 894  ASP A C   
609 O O   . ASP A 100 ? 0.3081 0.2551 0.3698 -0.0681 0.0441  -0.0226 894  ASP A O   
610 C CB  . ASP A 100 ? 0.3649 0.2781 0.4582 -0.0787 0.0659  -0.0314 894  ASP A CB  
611 C CG  . ASP A 100 ? 0.5550 0.4504 0.6277 -0.0815 0.0742  -0.0175 894  ASP A CG  
612 O OD1 . ASP A 100 ? 0.5457 0.4274 0.6016 -0.0716 0.0718  -0.0015 894  ASP A OD1 
613 O OD2 . ASP A 100 ? 0.6078 0.5035 0.6812 -0.0940 0.0838  -0.0229 894  ASP A OD2 
614 N N   . TYR A 101 ? 0.2783 0.3044 0.3054 -0.0651 0.0132  -0.0188 895  TYR A N   
615 C CA  . TYR A 101 ? 0.2585 0.2808 0.2729 -0.0626 0.0093  -0.0145 895  TYR A CA  
616 C C   . TYR A 101 ? 0.2636 0.2808 0.2867 -0.0603 0.0037  -0.0162 895  TYR A C   
617 O O   . TYR A 101 ? 0.2569 0.2728 0.2956 -0.0609 0.0024  -0.0197 895  TYR A O   
618 C CB  . TYR A 101 ? 0.2755 0.2913 0.2800 -0.0633 0.0062  -0.0059 895  TYR A CB  
619 C CG  . TYR A 101 ? 0.2877 0.2961 0.3037 -0.0645 0.0016  -0.0031 895  TYR A CG  
620 C CD1 . TYR A 101 ? 0.2987 0.3079 0.3225 -0.0674 0.0041  -0.0031 895  TYR A CD1 
621 C CD2 . TYR A 101 ? 0.3187 0.3194 0.3381 -0.0626 -0.0053 -0.0006 895  TYR A CD2 
622 C CE1 . TYR A 101 ? 0.3575 0.3597 0.3921 -0.0684 -0.0001 -0.0005 895  TYR A CE1 
623 C CE2 . TYR A 101 ? 0.3305 0.3245 0.3609 -0.0636 -0.0095 0.0020  895  TYR A CE2 
624 C CZ  . TYR A 101 ? 0.3436 0.3384 0.3814 -0.0664 -0.0068 0.0020  895  TYR A CZ  
625 O OH  . TYR A 101 ? 0.3865 0.3746 0.4353 -0.0674 -0.0108 0.0045  895  TYR A OH  
626 N N   . ILE A 102 ? 0.2680 0.2826 0.2812 -0.0578 0.0004  -0.0138 896  ILE A N   
627 C CA  . ILE A 102 ? 0.2677 0.2759 0.2867 -0.0557 -0.0062 -0.0134 896  ILE A CA  
628 C C   . ILE A 102 ? 0.2983 0.2993 0.3054 -0.0548 -0.0113 -0.0056 896  ILE A C   
629 O O   . ILE A 102 ? 0.3097 0.3123 0.3015 -0.0542 -0.0097 -0.0026 896  ILE A O   
630 C CB  . ILE A 102 ? 0.3004 0.3123 0.3194 -0.0532 -0.0059 -0.0187 896  ILE A CB  
631 C CG1 . ILE A 102 ? 0.3393 0.3594 0.3680 -0.0539 -0.0002 -0.0266 896  ILE A CG1 
632 C CG2 . ILE A 102 ? 0.3446 0.3495 0.3701 -0.0511 -0.0130 -0.0179 896  ILE A CG2 
633 C CD1 . ILE A 102 ? 0.3596 0.3836 0.3872 -0.0513 0.0003  -0.0314 896  ILE A CD1 
634 N N   . ASP A 103 ? 0.2768 0.2700 0.2911 -0.0545 -0.0173 -0.0023 897  ASP A N   
635 C CA  . ASP A 103 ? 0.2920 0.2779 0.2961 -0.0534 -0.0229 0.0051  897  ASP A CA  
636 C C   . ASP A 103 ? 0.3492 0.3326 0.3513 -0.0505 -0.0273 0.0041  897  ASP A C   
637 O O   . ASP A 103 ? 0.3785 0.3604 0.3936 -0.0497 -0.0301 0.0006  897  ASP A O   
638 C CB  . ASP A 103 ? 0.3300 0.3085 0.3428 -0.0546 -0.0274 0.0096  897  ASP A CB  
639 C CG  . ASP A 103 ? 0.3742 0.3532 0.3837 -0.0573 -0.0244 0.0134  897  ASP A CG  
640 O OD1 . ASP A 103 ? 0.4122 0.3961 0.4098 -0.0580 -0.0197 0.0141  897  ASP A OD1 
641 O OD2 . ASP A 103 ? 0.3873 0.3616 0.4062 -0.0587 -0.0268 0.0159  897  ASP A OD2 
642 N N   . PHE A 104 ? 0.3210 0.3040 0.3071 -0.0490 -0.0281 0.0073  898  PHE A N   
643 C CA  . PHE A 104 ? 0.2580 0.2380 0.2413 -0.0463 -0.0327 0.0070  898  PHE A CA  
644 C C   . PHE A 104 ? 0.3114 0.2835 0.2853 -0.0456 -0.0386 0.0146  898  PHE A C   
645 O O   . PHE A 104 ? 0.3307 0.3026 0.2910 -0.0461 -0.0372 0.0194  898  PHE A O   
646 C CB  . PHE A 104 ? 0.2657 0.2514 0.2374 -0.0448 -0.0291 0.0040  898  PHE A CB  
647 C CG  . PHE A 104 ? 0.2737 0.2677 0.2535 -0.0451 -0.0233 -0.0039 898  PHE A CG  
648 C CD1 . PHE A 104 ? 0.3163 0.3112 0.3075 -0.0437 -0.0250 -0.0094 898  PHE A CD1 
649 C CD2 . PHE A 104 ? 0.3238 0.3249 0.2995 -0.0467 -0.0164 -0.0058 898  PHE A CD2 
650 C CE1 . PHE A 104 ? 0.2953 0.2980 0.2939 -0.0438 -0.0197 -0.0167 898  PHE A CE1 
651 C CE2 . PHE A 104 ? 0.3056 0.3145 0.2884 -0.0469 -0.0111 -0.0131 898  PHE A CE2 
652 C CZ  . PHE A 104 ? 0.3212 0.3309 0.3154 -0.0454 -0.0128 -0.0185 898  PHE A CZ  
653 N N   . LEU A 105 ? 0.2736 0.2396 0.2543 -0.0443 -0.0451 0.0160  899  LEU A N   
654 C CA  . LEU A 105 ? 0.2840 0.2430 0.2540 -0.0432 -0.0508 0.0231  899  LEU A CA  
655 C C   . LEU A 105 ? 0.3217 0.2815 0.2819 -0.0408 -0.0520 0.0216  899  LEU A C   
656 O O   . LEU A 105 ? 0.3198 0.2806 0.2883 -0.0394 -0.0535 0.0168  899  LEU A O   
657 C CB  . LEU A 105 ? 0.3036 0.2551 0.2847 -0.0431 -0.0575 0.0260  899  LEU A CB  
658 C CG  . LEU A 105 ? 0.3352 0.2793 0.3062 -0.0422 -0.0635 0.0337  899  LEU A CG  
659 C CD1 . LEU A 105 ? 0.3660 0.3094 0.3287 -0.0441 -0.0614 0.0393  899  LEU A CD1 
660 C CD2 . LEU A 105 ? 0.3722 0.3098 0.3561 -0.0417 -0.0702 0.0353  899  LEU A CD2 
661 N N   . VAL A 106 ? 0.3141 0.2738 0.2568 -0.0402 -0.0512 0.0255  900  VAL A N   
662 C CA  . VAL A 106 ? 0.2849 0.2459 0.2175 -0.0380 -0.0517 0.0237  900  VAL A CA  
663 C C   . VAL A 106 ? 0.3118 0.2663 0.2312 -0.0368 -0.0571 0.0304  900  VAL A C   
664 O O   . VAL A 106 ? 0.3467 0.2968 0.2619 -0.0377 -0.0593 0.0366  900  VAL A O   
665 C CB  . VAL A 106 ? 0.3006 0.2693 0.2234 -0.0382 -0.0445 0.0207  900  VAL A CB  
666 C CG1 . VAL A 106 ? 0.3056 0.2814 0.2415 -0.0394 -0.0390 0.0137  900  VAL A CG1 
667 C CG2 . VAL A 106 ? 0.3185 0.2869 0.2280 -0.0395 -0.0421 0.0265  900  VAL A CG2 
668 N N   . THR A 107 ? 0.2950 0.2489 0.2078 -0.0346 -0.0594 0.0290  901  THR A N   
669 C CA  . THR A 107 ? 0.3109 0.2588 0.2095 -0.0333 -0.0643 0.0352  901  THR A CA  
670 C C   . THR A 107 ? 0.3022 0.2537 0.1863 -0.0318 -0.0615 0.0333  901  THR A C   
671 O O   . THR A 107 ? 0.3362 0.2932 0.2242 -0.0311 -0.0580 0.0269  901  THR A O   
672 C CB  . THR A 107 ? 0.3350 0.2763 0.2403 -0.0321 -0.0721 0.0368  901  THR A CB  
673 O OG1 . THR A 107 ? 0.3722 0.3080 0.2626 -0.0310 -0.0765 0.0429  901  THR A OG1 
674 C CG2 . THR A 107 ? 0.3585 0.3020 0.2713 -0.0305 -0.0730 0.0305  901  THR A CG2 
675 N N   . GLU A 108 ? 0.3580 0.4759 0.2427 -0.0477 0.0186  -0.0208 902  GLU A N   
676 C CA  . GLU A 108 ? 0.3585 0.4792 0.2221 -0.0408 0.0372  -0.0210 902  GLU A CA  
677 C C   . GLU A 108 ? 0.4778 0.5763 0.3299 -0.0417 0.0331  -0.0213 902  GLU A C   
678 O O   . GLU A 108 ? 0.4980 0.5962 0.3342 -0.0352 0.0470  -0.0226 902  GLU A O   
679 C CB  . GLU A 108 ? 0.4518 0.5754 0.2900 -0.0470 0.0484  -0.0118 902  GLU A CB  
680 C CG  . GLU A 108 ? 0.5329 0.6804 0.3800 -0.0448 0.0557  -0.0115 902  GLU A CG  
681 C CD  . GLU A 108 ? 0.6412 0.7914 0.4626 -0.0509 0.0671  -0.0025 902  GLU A CD  
682 O OE1 . GLU A 108 ? 0.7473 0.8829 0.5434 -0.0550 0.0722  0.0026  902  GLU A OE1 
683 O OE2 . GLU A 108 ? 0.6442 0.8111 0.4706 -0.0518 0.0711  -0.0006 902  GLU A OE2 
684 N N   . PHE A 109 ? 0.4041 0.4838 0.2638 -0.0500 0.0142  -0.0201 903  PHE A N   
685 C CA  . PHE A 109 ? 0.4034 0.4611 0.2539 -0.0514 0.0086  -0.0206 903  PHE A CA  
686 C C   . PHE A 109 ? 0.3684 0.4323 0.2352 -0.0380 0.0120  -0.0314 903  PHE A C   
687 O O   . PHE A 109 ? 0.3553 0.4365 0.2462 -0.0301 0.0120  -0.0387 903  PHE A O   
688 C CB  . PHE A 109 ? 0.4008 0.4374 0.2574 -0.0633 -0.0133 -0.0169 903  PHE A CB  
689 C CG  . PHE A 109 ? 0.4919 0.5199 0.3335 -0.0776 -0.0192 -0.0062 903  PHE A CG  
690 C CD1 . PHE A 109 ? 0.4591 0.4955 0.2796 -0.0797 -0.0050 0.0001  903  PHE A CD1 
691 C CD2 . PHE A 109 ? 0.5705 0.5815 0.4190 -0.0890 -0.0394 -0.0025 903  PHE A CD2 
692 C CE1 . PHE A 109 ? 0.5573 0.5855 0.3642 -0.0932 -0.0108 0.0100  903  PHE A CE1 
693 C CE2 . PHE A 109 ? 0.5582 0.5609 0.3931 -0.1023 -0.0454 0.0073  903  PHE A CE2 
694 C CZ  . PHE A 109 ? 0.5670 0.5785 0.3812 -0.1043 -0.0309 0.0134  903  PHE A CZ  
695 N N   . ASN A 110 ? 0.3743 0.4238 0.2279 -0.0357 0.0148  -0.0324 904  ASN A N   
696 C CA  . ASN A 110 ? 0.3755 0.4263 0.2455 -0.0251 0.0140  -0.0424 904  ASN A CA  
697 C C   . ASN A 110 ? 0.3703 0.4090 0.2618 -0.0302 -0.0074 -0.0448 904  ASN A C   
698 O O   . ASN A 110 ? 0.4112 0.4324 0.2967 -0.0427 -0.0211 -0.0380 904  ASN A O   
699 C CB  . ASN A 110 ? 0.4354 0.4737 0.2850 -0.0214 0.0228  -0.0427 904  ASN A CB  
700 C CG  . ASN A 110 ? 0.6390 0.6848 0.4629 -0.0192 0.0424  -0.0382 904  ASN A CG  
701 O OD1 . ASN A 110 ? 0.6901 0.7562 0.5171 -0.0087 0.0574  -0.0427 904  ASN A OD1 
702 N ND2 . ASN A 110 ? 0.6912 0.7204 0.4892 -0.0292 0.0424  -0.0291 904  ASN A ND2 
703 N N   . VAL A 111 ? 0.3400 0.3878 0.2568 -0.0209 -0.0106 -0.0545 905  VAL A N   
704 C CA  . VAL A 111 ? 0.3621 0.3979 0.2996 -0.0252 -0.0309 -0.0574 905  VAL A CA  
705 C C   . VAL A 111 ? 0.4104 0.4396 0.3532 -0.0165 -0.0302 -0.0653 905  VAL A C   
706 O O   . VAL A 111 ? 0.3959 0.4414 0.3493 -0.0040 -0.0195 -0.0734 905  VAL A O   
707 C CB  . VAL A 111 ? 0.3911 0.4431 0.3574 -0.0236 -0.0387 -0.0617 905  VAL A CB  
708 C CG1 . VAL A 111 ? 0.3809 0.4186 0.3676 -0.0287 -0.0604 -0.0643 905  VAL A CG1 
709 C CG2 . VAL A 111 ? 0.3574 0.4167 0.3161 -0.0320 -0.0376 -0.0536 905  VAL A CG2 
710 N N   . MET A 112 ? 0.3597 0.3653 0.2949 -0.0230 -0.0413 -0.0628 906  MET A N   
711 C CA  . MET A 112 ? 0.4097 0.4078 0.3474 -0.0151 -0.0400 -0.0698 906  MET A CA  
712 C C   . MET A 112 ? 0.4638 0.4502 0.4241 -0.0167 -0.0591 -0.0748 906  MET A C   
713 O O   . MET A 112 ? 0.5342 0.5162 0.5009 -0.0095 -0.0592 -0.0816 906  MET A O   
714 C CB  . MET A 112 ? 0.4415 0.4218 0.3493 -0.0187 -0.0339 -0.0641 906  MET A CB  
715 C CG  . MET A 112 ? 0.4987 0.4905 0.3846 -0.0133 -0.0125 -0.0618 906  MET A CG  
716 S SD  . MET A 112 ? 0.6144 0.5833 0.4685 -0.0166 -0.0072 -0.0568 906  MET A SD  
717 C CE  . MET A 112 ? 0.8955 0.8602 0.7661 -0.0059 -0.0104 -0.0678 906  MET A CE  
718 N N   . LEU A 113 ? 0.4108 0.3915 0.3824 -0.0264 -0.0753 -0.0712 907  LEU A N   
719 C CA  . LEU A 113 ? 0.4505 0.4214 0.4457 -0.0283 -0.0942 -0.0760 907  LEU A CA  
720 C C   . LEU A 113 ? 0.5101 0.4935 0.5291 -0.0307 -0.1038 -0.0772 907  LEU A C   
721 O O   . LEU A 113 ? 0.5347 0.5241 0.5466 -0.0370 -0.1021 -0.0706 907  LEU A O   
722 C CB  . LEU A 113 ? 0.4915 0.4343 0.4742 -0.0403 -0.1087 -0.0694 907  LEU A CB  
723 C CG  . LEU A 113 ? 0.5215 0.4480 0.4858 -0.0383 -0.1042 -0.0695 907  LEU A CG  
724 C CD1 . LEU A 113 ? 0.5089 0.4076 0.4629 -0.0511 -0.1204 -0.0628 907  LEU A CD1 
725 C CD2 . LEU A 113 ? 0.5406 0.4729 0.5228 -0.0259 -0.1021 -0.0807 907  LEU A CD2 
727 N N   . ARG B 3   ? 0.7949 0.7630 0.8167 -0.0586 0.0040  0.0442  3500 ARG B N   
728 C CA  . ARG B 3   ? 0.7586 0.7608 0.7945 -0.0620 -0.0056 0.0360  3500 ARG B CA  
729 C C   . ARG B 3   ? 0.7068 0.6922 0.7341 -0.0651 -0.0143 0.0245  3500 ARG B C   
730 O O   . ARG B 3   ? 0.6840 0.6924 0.7210 -0.0689 -0.0240 0.0148  3500 ARG B O   
731 C CB  . ARG B 3   ? 0.7551 0.7810 0.8046 -0.0669 -0.0145 0.0268  3500 ARG B CB  
732 N N   . LEU B 4   ? 0.6567 0.6017 0.6655 -0.0637 -0.0107 0.0255  3501 LEU B N   
733 C CA  . LEU B 4   ? 0.5472 0.4740 0.5463 -0.0660 -0.0173 0.0164  3501 LEU B CA  
734 C C   . LEU B 4   ? 0.4667 0.3918 0.4606 -0.0610 -0.0086 0.0272  3501 LEU B C   
735 O O   . LEU B 4   ? 0.4596 0.3519 0.4374 -0.0599 -0.0061 0.0276  3501 LEU B O   
736 C CB  . LEU B 4   ? 0.5431 0.4257 0.5246 -0.0683 -0.0201 0.0093  3501 LEU B CB  
737 C CG  . LEU B 4   ? 0.5419 0.4216 0.5263 -0.0742 -0.0310 -0.0043 3501 LEU B CG  
738 C CD1 . LEU B 4   ? 0.5360 0.3709 0.5021 -0.0766 -0.0345 -0.0119 3501 LEU B CD1 
739 C CD2 . LEU B 4   ? 0.5233 0.4354 0.5225 -0.0790 -0.0435 -0.0166 3501 LEU B CD2 
740 N N   . THR B 5   ? 0.4146 0.3750 0.4223 -0.0580 -0.0039 0.0360  3502 THR B N   
741 C CA  . THR B 5   ? 0.4097 0.3725 0.4142 -0.0531 0.0049  0.0473  3502 THR B CA  
742 C C   . THR B 5   ? 0.3647 0.3679 0.3848 -0.0542 -0.0002 0.0451  3502 THR B C   
743 O O   . THR B 5   ? 0.4364 0.4738 0.4730 -0.0556 -0.0029 0.0446  3502 THR B O   
744 C CB  . THR B 5   ? 0.4585 0.4210 0.4626 -0.0466 0.0196  0.0649  3502 THR B CB  
745 O OG1 . THR B 5   ? 0.4704 0.4676 0.4916 -0.0466 0.0201  0.0682  3502 THR B OG1 
746 C CG2 . THR B 5   ? 0.4933 0.4147 0.4811 -0.0452 0.0254  0.0677  3502 THR B CG2 
747 N N   . LEU B 6   ? 0.3445 0.3441 0.3594 -0.0538 -0.0014 0.0439  3503 LEU B N   
748 C CA  . LEU B 6   ? 0.3105 0.3484 0.3396 -0.0545 -0.0051 0.0432  3503 LEU B CA  
749 C C   . LEU B 6   ? 0.3534 0.4117 0.3890 -0.0485 0.0069  0.0600  3503 LEU B C   
750 O O   . LEU B 6   ? 0.3269 0.3631 0.3516 -0.0433 0.0182  0.0719  3503 LEU B O   
751 C CB  . LEU B 6   ? 0.3241 0.3507 0.3451 -0.0564 -0.0108 0.0358  3503 LEU B CB  
752 C CG  . LEU B 6   ? 0.3888 0.3948 0.4022 -0.0622 -0.0230 0.0189  3503 LEU B CG  
753 C CD1 . LEU B 6   ? 0.4008 0.3997 0.4070 -0.0626 -0.0258 0.0154  3503 LEU B CD1 
754 C CD2 . LEU B 6   ? 0.4444 0.4784 0.4733 -0.0677 -0.0348 0.0066  3503 LEU B CD2 
755 N N   . PRO B 7   ? 0.3337 0.4339 0.3868 -0.0491 0.0046  0.0612  3504 PRO B N   
756 C CA  . PRO B 7   ? 0.2909 0.4119 0.3502 -0.0436 0.0150  0.0763  3504 PRO B CA  
757 C C   . PRO B 7   ? 0.3102 0.4168 0.3586 -0.0413 0.0180  0.0794  3504 PRO B C   
758 O O   . PRO B 7   ? 0.3102 0.3990 0.3499 -0.0448 0.0102  0.0683  3504 PRO B O   
759 C CB  . PRO B 7   ? 0.3483 0.5167 0.4286 -0.0464 0.0086  0.0730  3504 PRO B CB  
760 C CG  . PRO B 7   ? 0.3394 0.5082 0.4211 -0.0533 -0.0059 0.0548  3504 PRO B CG  
761 C CD  . PRO B 7   ? 0.3516 0.4811 0.4189 -0.0551 -0.0083 0.0478  3504 PRO B CD  
762 N N   . PRO B 8   ? 0.3631 0.4769 0.4119 -0.0355 0.0292  0.0944  3505 PRO B N   
763 C CA  . PRO B 8   ? 0.3739 0.4844 0.4164 -0.0337 0.0312  0.0973  3505 PRO B CA  
764 C C   . PRO B 8   ? 0.3523 0.4880 0.4043 -0.0391 0.0188  0.0848  3505 PRO B C   
765 O O   . PRO B 8   ? 0.3719 0.5435 0.4412 -0.0416 0.0137  0.0816  3505 PRO B O   
766 C CB  . PRO B 8   ? 0.4150 0.5457 0.4644 -0.0276 0.0432  0.1146  3505 PRO B CB  
767 C CG  . PRO B 8   ? 0.4277 0.5571 0.4802 -0.0250 0.0501  0.1223  3505 PRO B CG  
768 C CD  . PRO B 8   ? 0.4365 0.5657 0.4931 -0.0306 0.0400  0.1091  3505 PRO B CD  
769 N N   . SER B 9   ? 0.3379 0.4559 0.3795 -0.0411 0.0137  0.0771  3506 SER B N   
770 C CA  . SER B 9   ? 0.3668 0.5103 0.4185 -0.0465 0.0016  0.0646  3506 SER B CA  
771 C C   . SER B 9   ? 0.3612 0.5359 0.4224 -0.0442 0.0049  0.0725  3506 SER B C   
772 O O   . SER B 9   ? 0.3642 0.5302 0.4185 -0.0390 0.0154  0.0853  3506 SER B O   
773 C CB  . SER B 9   ? 0.4277 0.5446 0.4666 -0.0504 -0.0071 0.0514  3506 SER B CB  
774 O OG  . SER B 9   ? 0.4406 0.5858 0.4914 -0.0557 -0.0190 0.0393  3506 SER B OG  
775 N N   . GLU B 10  ? 0.3546 0.5656 0.4319 -0.0484 -0.0039 0.0648  3507 GLU B N   
776 C CA  . GLU B 10  ? 0.2804 0.5242 0.3683 -0.0471 -0.0022 0.0708  3507 GLU B CA  
777 C C   . GLU B 10  ? 0.2515 0.4954 0.3361 -0.0509 -0.0111 0.0601  3507 GLU B C   
778 O O   . GLU B 10  ? 0.2605 0.5329 0.3542 -0.0513 -0.0124 0.0615  3507 GLU B O   
779 C CB  . GLU B 10  ? 0.3844 0.6725 0.4939 -0.0490 -0.0051 0.0711  3507 GLU B CB  
780 N N   . ILE B 11  ? 0.2246 0.4357 0.2955 -0.0537 -0.0170 0.0493  3508 ILE B N   
781 C CA  . ILE B 11  ? 0.2313 0.4377 0.2970 -0.0573 -0.0255 0.0384  3508 ILE B CA  
782 C C   . ILE B 11  ? 0.2537 0.4152 0.2977 -0.0555 -0.0218 0.0391  3508 ILE B C   
783 O O   . ILE B 11  ? 0.2490 0.3804 0.2828 -0.0550 -0.0200 0.0382  3508 ILE B O   
784 C CB  . ILE B 11  ? 0.2677 0.4838 0.3407 -0.0642 -0.0398 0.0206  3508 ILE B CB  
785 C CG1 . ILE B 11  ? 0.3059 0.5672 0.4006 -0.0664 -0.0437 0.0195  3508 ILE B CG1 
786 C CG2 . ILE B 11  ? 0.3173 0.5271 0.3842 -0.0678 -0.0483 0.0097  3508 ILE B CG2 
787 C CD1 . ILE B 11  ? 0.3942 0.6656 0.4970 -0.0731 -0.0573 0.0024  3508 ILE B CD1 
788 N N   . THR B 12  ? 0.2395 0.3966 0.2764 -0.0546 -0.0209 0.0405  3509 THR B N   
789 C CA  . THR B 12  ? 0.2691 0.3835 0.2847 -0.0528 -0.0169 0.0419  3509 THR B CA  
790 C C   . THR B 12  ? 0.2935 0.4019 0.3033 -0.0570 -0.0264 0.0297  3509 THR B C   
791 O O   . THR B 12  ? 0.2896 0.4267 0.3089 -0.0587 -0.0307 0.0273  3509 THR B O   
792 C CB  . THR B 12  ? 0.2932 0.4003 0.3017 -0.0461 -0.0028 0.0593  3509 THR B CB  
793 O OG1 . THR B 12  ? 0.3122 0.4216 0.3249 -0.0420 0.0063  0.0706  3509 THR B OG1 
794 C CG2 . THR B 12  ? 0.3110 0.3753 0.2975 -0.0444 0.0012  0.0606  3509 THR B CG2 
795 N N   . LEU B 13  ? 0.2746 0.3458 0.2686 -0.0588 -0.0298 0.0220  3510 LEU B N   
796 C CA  . LEU B 13  ? 0.2889 0.3494 0.2751 -0.0626 -0.0382 0.0108  3510 LEU B CA  
797 C C   . LEU B 13  ? 0.3694 0.4056 0.3392 -0.0585 -0.0293 0.0204  3510 LEU B C   
798 O O   . LEU B 13  ? 0.3657 0.3708 0.3221 -0.0547 -0.0201 0.0289  3510 LEU B O   
803 N N   . LEU B 14  ? 0.3803 0.4298 0.3509 -0.0596 -0.0321 0.0185  3511 LEU B N   
804 C CA  . LEU B 14  ? 0.4021 0.4329 0.3585 -0.0560 -0.0241 0.0274  3511 LEU B CA  
805 C C   . LEU B 14  ? 0.4731 0.4879 0.4188 -0.0600 -0.0325 0.0158  3511 LEU B C   
806 O O   . LEU B 14  ? 0.4521 0.4752 0.4035 -0.0654 -0.0447 0.0011  3511 LEU B O   
807 C CB  . LEU B 14  ? 0.3769 0.4406 0.3440 -0.0526 -0.0178 0.0389  3511 LEU B CB  
808 C CG  . LEU B 14  ? 0.3911 0.4692 0.3672 -0.0477 -0.0075 0.0530  3511 LEU B CG  
809 C CD1 . LEU B 14  ? 0.3763 0.4955 0.3677 -0.0463 -0.0053 0.0602  3511 LEU B CD1 
810 C CD2 . LEU B 14  ? 0.4285 0.4724 0.3883 -0.0420 0.0054  0.0660  3511 LEU B CD2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   795  ?    ?   ?   A . n 
A 1 2   HIS 2   796  ?    ?   ?   A . n 
A 1 3   HIS 3   797  ?    ?   ?   A . n 
A 1 4   HIS 4   798  ?    ?   ?   A . n 
A 1 5   HIS 5   799  ?    ?   ?   A . n 
A 1 6   HIS 6   800  ?    ?   ?   A . n 
A 1 7   HIS 7   801  ?    ?   ?   A . n 
A 1 8   SER 8   802  ?    ?   ?   A . n 
A 1 9   SER 9   803  ?    ?   ?   A . n 
A 1 10  GLY 10  804  ?    ?   ?   A . n 
A 1 11  LEU 11  805  ?    ?   ?   A . n 
A 1 12  GLU 12  806  ?    ?   ?   A . n 
A 1 13  VAL 13  807  ?    ?   ?   A . n 
A 1 14  LEU 14  808  ?    ?   ?   A . n 
A 1 15  PHE 15  809  ?    ?   ?   A . n 
A 1 16  GLN 16  810  ?    ?   ?   A . n 
A 1 17  GLY 17  811  811  GLY GLY A . n 
A 1 18  PRO 18  812  812  PRO PRO A . n 
A 1 19  GLY 19  813  813  GLY GLY A . n 
A 1 20  SER 20  814  814  SER SER A . n 
A 1 21  THR 21  815  815  THR THR A . n 
A 1 22  LEU 22  816  816  LEU LEU A . n 
A 1 23  VAL 23  817  817  VAL VAL A . n 
A 1 24  ARG 24  818  818  ARG ARG A . n 
A 1 25  VAL 25  819  819  VAL VAL A . n 
A 1 26  LYS 26  820  820  LYS LYS A . n 
A 1 27  LYS 27  821  821  LYS LYS A . n 
A 1 28  SER 28  822  822  SER SER A . n 
A 1 29  ALA 29  823  823  ALA ALA A . n 
A 1 30  ALA 30  824  824  ALA ALA A . n 
A 1 31  THR 31  825  825  THR THR A . n 
A 1 32  LEU 32  826  826  LEU LEU A . n 
A 1 33  GLY 33  827  827  GLY GLY A . n 
A 1 34  ILE 34  828  828  ILE ILE A . n 
A 1 35  ALA 35  829  829  ALA ALA A . n 
A 1 36  ILE 36  830  830  ILE ILE A . n 
A 1 37  GLU 37  831  831  GLU GLU A . n 
A 1 38  GLY 38  832  832  GLY GLY A . n 
A 1 39  GLY 39  833  833  GLY GLY A . n 
A 1 40  ALA 40  834  834  ALA ALA A . n 
A 1 41  ASN 41  835  835  ASN ASN A . n 
A 1 42  THR 42  836  836  THR THR A . n 
A 1 43  ARG 43  837  837  ARG ARG A . n 
A 1 44  GLN 44  838  838  GLN GLN A . n 
A 1 45  PRO 45  839  839  PRO PRO A . n 
A 1 46  LEU 46  840  840  LEU LEU A . n 
A 1 47  PRO 47  841  841  PRO PRO A . n 
A 1 48  ARG 48  842  842  ARG ARG A . n 
A 1 49  ILE 49  843  843  ILE ILE A . n 
A 1 50  VAL 50  844  844  VAL VAL A . n 
A 1 51  THR 51  845  845  THR THR A . n 
A 1 52  ILE 52  846  846  ILE ILE A . n 
A 1 53  GLN 53  847  847  GLN GLN A . n 
A 1 54  ARG 54  848  848  ARG ARG A . n 
A 1 55  GLY 55  849  849  GLY GLY A . n 
A 1 56  GLY 56  850  850  GLY GLY A . n 
A 1 57  SER 57  851  851  SER SER A . n 
A 1 58  ALA 58  852  852  ALA ALA A . n 
A 1 59  HIS 59  853  853  HIS HIS A . n 
A 1 60  ASN 60  854  854  ASN ASN A . n 
A 1 61  CYS 61  855  855  CYS CYS A . n 
A 1 62  GLY 62  856  856  GLY GLY A . n 
A 1 63  GLN 63  857  857  GLN GLN A . n 
A 1 64  LEU 64  858  858  LEU LEU A . n 
A 1 65  LYS 65  859  859  LYS LYS A . n 
A 1 66  VAL 66  860  860  VAL VAL A . n 
A 1 67  GLY 67  861  861  GLY GLY A . n 
A 1 68  HIS 68  862  862  HIS HIS A . n 
A 1 69  VAL 69  863  863  VAL VAL A . n 
A 1 70  ILE 70  864  864  ILE ILE A . n 
A 1 71  LEU 71  865  865  LEU LEU A . n 
A 1 72  GLU 72  866  866  GLU GLU A . n 
A 1 73  VAL 73  867  867  VAL VAL A . n 
A 1 74  ASN 74  868  868  ASN ASN A . n 
A 1 75  GLY 75  869  869  GLY GLY A . n 
A 1 76  LEU 76  870  870  LEU LEU A . n 
A 1 77  THR 77  871  871  THR THR A . n 
A 1 78  LEU 78  872  872  LEU LEU A . n 
A 1 79  ARG 79  873  873  ARG ARG A . n 
A 1 80  GLY 80  874  874  GLY GLY A . n 
A 1 81  LYS 81  875  875  LYS LYS A . n 
A 1 82  GLU 82  876  876  GLU GLU A . n 
A 1 83  HIS 83  877  877  HIS HIS A . n 
A 1 84  ARG 84  878  878  ARG ARG A . n 
A 1 85  GLU 85  879  879  GLU GLU A . n 
A 1 86  ALA 86  880  880  ALA ALA A . n 
A 1 87  ALA 87  881  881  ALA ALA A . n 
A 1 88  ARG 88  882  882  ARG ARG A . n 
A 1 89  ILE 89  883  883  ILE ILE A . n 
A 1 90  ILE 90  884  884  ILE ILE A . n 
A 1 91  ALA 91  885  885  ALA ALA A . n 
A 1 92  GLU 92  886  886  GLU GLU A . n 
A 1 93  ALA 93  887  887  ALA ALA A . n 
A 1 94  PHE 94  888  888  PHE PHE A . n 
A 1 95  LYS 95  889  889  LYS LYS A . n 
A 1 96  THR 96  890  890  THR THR A . n 
A 1 97  LYS 97  891  891  LYS LYS A . n 
A 1 98  ASP 98  892  892  ASP ASP A . n 
A 1 99  ARG 99  893  893  ARG ARG A . n 
A 1 100 ASP 100 894  894  ASP ASP A . n 
A 1 101 TYR 101 895  895  TYR TYR A . n 
A 1 102 ILE 102 896  896  ILE ILE A . n 
A 1 103 ASP 103 897  897  ASP ASP A . n 
A 1 104 PHE 104 898  898  PHE PHE A . n 
A 1 105 LEU 105 899  899  LEU LEU A . n 
A 1 106 VAL 106 900  900  VAL VAL A . n 
A 1 107 THR 107 901  901  THR THR A . n 
A 1 108 GLU 108 902  902  GLU GLU A . n 
A 1 109 PHE 109 903  903  PHE PHE A . n 
A 1 110 ASN 110 904  904  ASN ASN A . n 
A 1 111 VAL 111 905  905  VAL VAL A . n 
A 1 112 MET 112 906  906  MET MET A . n 
A 1 113 LEU 113 907  907  LEU LEU A . n 
B 2 1   GLU 1   3498 ?    ?   ?   B . n 
B 2 2   LYS 2   3499 ?    ?   ?   B . n 
B 2 3   ARG 3   3500 3500 ARG ARG B . n 
B 2 4   LEU 4   3501 3501 LEU LEU B . n 
B 2 5   THR 5   3502 3502 THR THR B . n 
B 2 6   LEU 6   3503 3503 LEU LEU B . n 
B 2 7   PRO 7   3504 3504 PRO PRO B . n 
B 2 8   PRO 8   3505 3505 PRO PRO B . n 
B 2 9   SER 9   3506 3506 SER SER B . n 
B 2 10  GLU 10  3507 3507 GLU GLU B . n 
B 2 11  ILE 11  3508 3508 ILE ILE B . n 
B 2 12  THR 12  3509 3509 THR THR B . n 
B 2 13  LEU 13  3510 3510 LEU LEU B . n 
B 2 14  LEU 14  3511 3511 LEU LEU B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1  1001 11 HOH HOH A . 
C 3 HOH 2  1002 43 HOH HOH A . 
C 3 HOH 3  1003 9  HOH HOH A . 
C 3 HOH 4  1004 33 HOH HOH A . 
C 3 HOH 5  1005 31 HOH HOH A . 
C 3 HOH 6  1006 17 HOH HOH A . 
C 3 HOH 7  1007 14 HOH HOH A . 
C 3 HOH 8  1008 10 HOH HOH A . 
C 3 HOH 9  1009 23 HOH HOH A . 
C 3 HOH 10 1010 29 HOH HOH A . 
C 3 HOH 11 1011 49 HOH HOH A . 
C 3 HOH 12 1012 44 HOH HOH A . 
C 3 HOH 13 1013 12 HOH HOH A . 
C 3 HOH 14 1014 4  HOH HOH A . 
C 3 HOH 15 1015 1  HOH HOH A . 
C 3 HOH 16 1016 42 HOH HOH A . 
C 3 HOH 17 1017 2  HOH HOH A . 
C 3 HOH 18 1018 41 HOH HOH A . 
C 3 HOH 19 1019 28 HOH HOH A . 
C 3 HOH 20 1020 32 HOH HOH A . 
C 3 HOH 21 1021 8  HOH HOH A . 
C 3 HOH 22 1022 3  HOH HOH A . 
C 3 HOH 23 1023 27 HOH HOH A . 
C 3 HOH 24 1024 25 HOH HOH A . 
C 3 HOH 25 1025 16 HOH HOH A . 
C 3 HOH 26 1026 5  HOH HOH A . 
C 3 HOH 27 1027 22 HOH HOH A . 
C 3 HOH 28 1028 7  HOH HOH A . 
C 3 HOH 29 1029 34 HOH HOH A . 
C 3 HOH 30 1030 13 HOH HOH A . 
C 3 HOH 31 1031 20 HOH HOH A . 
C 3 HOH 32 1032 54 HOH HOH A . 
C 3 HOH 33 1033 24 HOH HOH A . 
C 3 HOH 34 1034 48 HOH HOH A . 
C 3 HOH 35 1035 38 HOH HOH A . 
C 3 HOH 36 1036 18 HOH HOH A . 
C 3 HOH 37 1037 21 HOH HOH A . 
C 3 HOH 38 1038 35 HOH HOH A . 
C 3 HOH 39 1039 6  HOH HOH A . 
C 3 HOH 40 1040 50 HOH HOH A . 
C 3 HOH 41 1041 45 HOH HOH A . 
C 3 HOH 42 1042 37 HOH HOH A . 
C 3 HOH 43 1043 47 HOH HOH A . 
C 3 HOH 44 1044 51 HOH HOH A . 
C 3 HOH 45 1045 52 HOH HOH A . 
C 3 HOH 46 1046 36 HOH HOH A . 
C 3 HOH 47 1047 40 HOH HOH A . 
D 3 HOH 1  3601 26 HOH HOH B . 
D 3 HOH 2  3602 30 HOH HOH B . 
D 3 HOH 3  3603 19 HOH HOH B . 
D 3 HOH 4  3604 15 HOH HOH B . 
D 3 HOH 5  3605 53 HOH HOH B . 
D 3 HOH 6  3606 46 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C 
1 2 B,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1160 ? 
1 MORE         -11  ? 
1 'SSA (A^2)'  6130 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z            1.0000000000  0.0000000000  0.0000000000 0.0000000000  0.0000000000 
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000  
2 'crystal symmetry operation' 2_665 -y+1,x-y+1,z+1/3 -0.5000000000 -0.8660254038 0.0000000000 25.9870000000 0.8660254038 
-0.5000000000 0.0000000000 45.0108043363 0.0000000000 0.0000000000 1.0000000000 23.4816666667 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     1023 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   C 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2020-09-23 
2 'Structure model' 1 1 2021-04-07 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                 
2  2 'Structure model' '_citation.journal_abbrev'          
3  2 'Structure model' '_citation.journal_id_CSD'          
4  2 'Structure model' '_citation.journal_id_ISSN'         
5  2 'Structure model' '_citation.journal_volume'          
6  2 'Structure model' '_citation.page_first'              
7  2 'Structure model' '_citation.page_last'               
8  2 'Structure model' '_citation.pdbx_database_id_DOI'    
9  2 'Structure model' '_citation.pdbx_database_id_PubMed' 
10 2 'Structure model' '_citation.title'                   
11 2 'Structure model' '_citation.year'                    
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1  'X-RAY DIFFRACTION' ? refined -11.0327 17.7546 5.8321   0.2229 ? -0.0805 ? -0.0310 ? 0.3102 ? 0.0143  ? 0.2280 ? 0.1649 ? 
0.3406  ? 0.2524  ? 0.7061 ? 0.6649  ? 0.6175 ? 0.0002  ? -0.4190 ? 0.0421  ? 0.1469  ? -0.0907 ? 0.1514  ? 0.0667  ? -0.2076 ? 
-0.0882 ? 
2  'X-RAY DIFFRACTION' ? refined -10.2166 25.4206 -6.9816  0.2807 ? -0.0834 ? -0.0868 ? 0.2588 ? 0.0092  ? 0.2452 ? 1.2502 ? 
0.6632  ? 0.7318  ? 0.6541 ? 0.2688  ? 0.4729 ? -0.8307 ? 0.1941  ? 0.9039  ? -0.8200 ? 0.2023  ? 0.5284  ? -0.6746 ? -0.1388 ? 
-0.0111 ? 
3  'X-RAY DIFFRACTION' ? refined 5.6943   27.2116 1.9601   0.2459 ? -0.0266 ? -0.0086 ? 0.3238 ? -0.0512 ? 0.2731 ? 0.0381 ? 
0.0281  ? 0.0360  ? 0.0394 ? 0.0164  ? 0.0152 ? 0.1848  ? -0.4660 ? 0.5580  ? 0.3891  ? 0.0653  ? -0.0814 ? 0.1040  ? 0.4163  ? 
-0.0003 ? 
4  'X-RAY DIFFRACTION' ? refined -6.9589  31.5890 -0.2822  0.2828 ? -0.0514 ? -0.0458 ? 0.1824 ? 0.0267  ? 0.2738 ? 0.0778 ? 
-0.0498 ? -0.0899 ? 0.0803 ? 0.0523  ? 0.1125 ? -0.2696 ? 0.3998  ? 0.3992  ? -0.3609 ? 0.2942  ? 0.1342  ? -0.2166 ? 0.3255  ? 
-0.0009 ? 
5  'X-RAY DIFFRACTION' ? refined -11.6679 25.4097 0.3936   0.2423 ? -0.0064 ? -0.0569 ? 0.2354 ? -0.0324 ? 0.2833 ? 0.3484 ? 
0.5138  ? -0.0317 ? 0.5660 ? 0.1217  ? 0.2629 ? 0.0951  ? -0.0369 ? -0.0638 ? -0.0408 ? -0.1506 ? 0.3093  ? -0.0143 ? -0.0957 ? 
-0.0002 ? 
6  'X-RAY DIFFRACTION' ? refined 2.7907   17.5046 -0.0431  0.2348 ? 0.0002  ? -0.0631 ? 0.3116 ? 0.0063  ? 0.3399 ? 0.0813 ? 
-0.0683 ? -0.0671 ? 0.1153 ? 0.1136  ? 0.1030 ? 0.0624  ? 0.2648  ? -0.8802 ? 0.0360  ? -0.0135 ? -0.3744 ? 0.2773  ? 0.4995  ? 
-0.0028 ? 
7  'X-RAY DIFFRACTION' ? refined -1.3837  19.9200 -8.8304  0.3012 ? -0.0780 ? 0.0462  ? 0.3479 ? -0.0664 ? 0.2528 ? 0.0095 ? 
-0.0061 ? 0.0118  ? 0.1242 ? 0.1353  ? 0.0624 ? -0.6384 ? 0.8327  ? -0.3513 ? -0.6622 ? 0.5429  ? -0.0475 ? -0.1177 ? 0.3108  ? 
0.0007  ? 
8  'X-RAY DIFFRACTION' ? refined -12.2994 10.6831 -9.6896  0.3162 ? -0.0326 ? 0.0370  ? 0.2195 ? -0.0285 ? 0.4497 ? 0.8049 ? 
-0.2626 ? -0.4058 ? 0.2550 ? 0.2169  ? 0.4541 ? -0.1923 ? -0.2540 ? -0.6761 ? 0.4779  ? 0.0185  ? -0.0215 ? 0.5584  ? 0.1024  ? 
-0.0010 ? 
9  'X-RAY DIFFRACTION' ? refined -9.0312  17.6479 1.6248   0.2583 ? -0.0483 ? -0.0290 ? 0.2404 ? 0.0084  ? 0.2399 ? 0.1186 ? 
-0.0130 ? -0.0279 ? 0.0473 ? -0.0641 ? 0.0705 ? 0.0088  ? -0.0696 ? -0.2983 ? 0.2097  ? 0.0369  ? -0.2026 ? 0.0677  ? -0.0788 ? 
0.0011  ? 
10 'X-RAY DIFFRACTION' ? refined 0.3348   27.8859 11.2051  0.3667 ? -0.0370 ? -0.0142 ? 0.4003 ? -0.0409 ? 0.2572 ? 0.0240 ? 
0.0730  ? 0.0353  ? 0.0745 ? 0.0177  ? 0.0535 ? 0.3902  ? -0.0671 ? -0.3898 ? 0.4837  ? -0.1029 ? -0.1924 ? 0.0290  ? -0.3226 ? 
-0.0024 ? 
11 'X-RAY DIFFRACTION' ? refined 3.9122   34.3247 -11.9894 0.2741 ? -0.0526 ? -0.0094 ? 0.3496 ? 0.0439  ? 0.3012 ? 0.0454 ? 
0.1098  ? -0.0124 ? 0.0254 ? -0.0105 ? 0.1221 ? -0.1268 ? -0.5177 ? 0.0040  ? -0.3547 ? -0.1690 ? -0.1387 ? 0.1491  ? 0.2148  ? 
0.0011  ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1  'X-RAY DIFFRACTION' 1  ? ? A 811 ? ? A 820 ? 
;chain 'A' and (resid 811 through 820 )
;
2  'X-RAY DIFFRACTION' 2  ? ? A 821 ? ? A 831 ? 
;chain 'A' and (resid 821 through 831 )
;
3  'X-RAY DIFFRACTION' 3  ? ? A 832 ? ? A 841 ? 
;chain 'A' and (resid 832 through 841 )
;
4  'X-RAY DIFFRACTION' 4  ? ? A 842 ? ? A 846 ? 
;chain 'A' and (resid 842 through 846 )
;
5  'X-RAY DIFFRACTION' 5  ? ? A 847 ? ? A 867 ? 
;chain 'A' and (resid 847 through 867 )
;
6  'X-RAY DIFFRACTION' 6  ? ? A 868 ? ? A 876 ? 
;chain 'A' and (resid 868 through 876 )
;
7  'X-RAY DIFFRACTION' 7  ? ? A 877 ? ? A 889 ? 
;chain 'A' and (resid 877 through 889 )
;
8  'X-RAY DIFFRACTION' 8  ? ? A 890 ? ? A 894 ? 
;chain 'A' and (resid 890 through 894 )
;
9  'X-RAY DIFFRACTION' 9  ? ? A 895 ? ? A 901 ? 
;chain 'A' and (resid 895 through 901 )
;
10 'X-RAY DIFFRACTION' 10 ? ? A 902 ? ? A 907 ? 
;chain 'A' and (resid 902 through 907 )
;
11 'X-RAY DIFFRACTION' 11 ? ? B 0   ? ? B 0   ? 
;chain 'B' and (resid 3500 through 3511 )
;
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .          1 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.8.4_1496 2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.25       3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .          4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .          5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A GLY 813  ? ? O A HOH 1001 ? ? 1.89 
2 1 O A HOH 1004 ? ? O A HOH 1008 ? ? 2.01 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    NH1 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    ARG 
_pdbx_validate_symm_contact.auth_seq_id_1     842 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    OD2 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    ASP 
_pdbx_validate_symm_contact.auth_seq_id_2     894 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   4_565 
_pdbx_validate_symm_contact.dist              2.16 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    LEU 
_pdbx_validate_torsion.auth_asym_id    B 
_pdbx_validate_torsion.auth_seq_id     3501 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -99.97 
_pdbx_validate_torsion.psi             47.14 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 837  ? CG  ? A ARG 43 CG  
2  1 Y 1 A ARG 837  ? CD  ? A ARG 43 CD  
3  1 Y 1 A ARG 837  ? NE  ? A ARG 43 NE  
4  1 Y 1 A ARG 837  ? CZ  ? A ARG 43 CZ  
5  1 Y 1 A ARG 837  ? NH1 ? A ARG 43 NH1 
6  1 Y 1 A ARG 837  ? NH2 ? A ARG 43 NH2 
7  1 Y 1 A ARG 848  ? CG  ? A ARG 54 CG  
8  1 Y 1 A ARG 848  ? CD  ? A ARG 54 CD  
9  1 Y 1 A ARG 848  ? NE  ? A ARG 54 NE  
10 1 Y 1 A ARG 848  ? CZ  ? A ARG 54 CZ  
11 1 Y 1 A ARG 848  ? NH1 ? A ARG 54 NH1 
12 1 Y 1 A ARG 848  ? NH2 ? A ARG 54 NH2 
13 1 Y 1 B ARG 3500 ? CG  ? B ARG 3  CG  
14 1 Y 1 B ARG 3500 ? CD  ? B ARG 3  CD  
15 1 Y 1 B ARG 3500 ? NE  ? B ARG 3  NE  
16 1 Y 1 B ARG 3500 ? CZ  ? B ARG 3  CZ  
17 1 Y 1 B ARG 3500 ? NH1 ? B ARG 3  NH1 
18 1 Y 1 B ARG 3500 ? NH2 ? B ARG 3  NH2 
19 1 Y 1 B GLU 3507 ? CG  ? B GLU 10 CG  
20 1 Y 1 B GLU 3507 ? CD  ? B GLU 10 CD  
21 1 Y 1 B GLU 3507 ? OE1 ? B GLU 10 OE1 
22 1 Y 1 B GLU 3507 ? OE2 ? B GLU 10 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 795  ? A MET 1  
2  1 Y 1 A HIS 796  ? A HIS 2  
3  1 Y 1 A HIS 797  ? A HIS 3  
4  1 Y 1 A HIS 798  ? A HIS 4  
5  1 Y 1 A HIS 799  ? A HIS 5  
6  1 Y 1 A HIS 800  ? A HIS 6  
7  1 Y 1 A HIS 801  ? A HIS 7  
8  1 Y 1 A SER 802  ? A SER 8  
9  1 Y 1 A SER 803  ? A SER 9  
10 1 Y 1 A GLY 804  ? A GLY 10 
11 1 Y 1 A LEU 805  ? A LEU 11 
12 1 Y 1 A GLU 806  ? A GLU 12 
13 1 Y 1 A VAL 807  ? A VAL 13 
14 1 Y 1 A LEU 808  ? A LEU 14 
15 1 Y 1 A PHE 809  ? A PHE 15 
16 1 Y 1 A GLN 810  ? A GLN 16 
17 1 Y 1 B GLU 3498 ? B GLU 1  
18 1 Y 1 B LYS 3499 ? B LYS 2  
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#