data_6MZL
# 
_entry.id   6MZL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6MZL         
WWPDB D_1000237915 
EMDB  EMD-9305     
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB .                             EMD-9298 'other EM volume'      
EMDB 'Human TFIID canonical state' EMD-9305 'associated EM volume' 
EMDB .                             EMD-9300 'other EM volume'      
EMDB .                             EMD-9301 'other EM volume'      
EMDB .                             EMD-9299 'other EM volume'      
EMDB .                             EMD-9302 'other EM volume'      
EMDB .                             EMD-9306 'other EM volume'      
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6MZL 
_pdbx_database_status.recvd_initial_deposition_date   2018-11-05 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Patel, A.B.'  1  ? 
'Louder, R.K.' 2  ? 
'Greber, B.J.' 3  ? 
'Grunberg, S.' 4  ? 
'Luo, J.'      5  ? 
'Fang, J.'     6  ? 
'Liu, Y.'      7  ? 
'Ranish, J.'   8  ? 
'Hahn, S.'     9  ? 
'Nogales, E.'  10 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Science 
_citation.journal_id_ASTM           SCIEAS 
_citation.journal_id_CSD            0038 
_citation.journal_id_ISSN           1095-9203 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            362 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Structure of human TFIID and mechanism of TBP loading onto promoter DNA.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/science.aau8872 
_citation.pdbx_database_id_PubMed   30442764 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Patel, A.B.'  1  ? 
primary 'Louder, R.K.' 2  ? 
primary 'Greber, B.J.' 3  ? 
primary 'Grunberg, S.' 4  ? 
primary 'Luo, J.'      5  ? 
primary 'Fang, J.'     6  ? 
primary 'Liu, Y.'      7  ? 
primary 'Ranish, J.'   8  ? 
primary 'Hahn, S.'     9  ? 
primary 'Nogales, E.'  10 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer man 'Transcription initiation factor TFIID subunit 1'       212956.172 1 2.3.1.48,2.7.11.1 ? ? ? 
2  polymer nat 'Transcription initiation factor TFIID subunit 2'       137159.984 1 ?                 ? ? ? 
3  polymer nat 'Transcription initiation factor TFIID subunit 3'       103769.320 1 ?                 ? ? ? 
4  polymer nat 'Transcription initiation factor TFIID subunit 4'       110221.883 2 ?                 ? ? ? 
5  polymer nat 'Transcription initiation factor TFIID subunit 5,TAF5'  85785.164  2 ?                 ? ? ? 
6  polymer nat 'Transcription initiation factor TFIID subunit 6'       72749.297  1 ?                 ? ? ? 
7  polymer nat 'Transcription initiation factor TFIID subunit 6'       72365.836  1 ?                 ? ? ? 
8  polymer nat 'Transcription initiation factor TFIID subunit 7'       40325.117  1 ?                 ? ? ? 
9  polymer nat 'Transcription initiation factor TFIID subunit 8,TAF8'  32975.344  1 ?                 ? ? ? 
10 polymer nat 'Transcription initiation factor TFIID subunit 9, TAF9' 28830.689  2 ?                 ? ? ? 
11 polymer nat 'Transcription initiation factor TFIID subunit 10'      21731.248  2 ?                 ? ? ? 
12 polymer nat 'Transcription initiation factor TFIID subunit 11'      23340.094  1 ?                 ? ? ? 
13 polymer nat 'Transcription initiation factor TFIID subunit 12'      17948.467  2 ?                 ? ? ? 
14 polymer nat 'Transcription initiation factor TFIID subunit 13'      14307.068  1 ?                 ? ? ? 
15 polymer nat 'TATA-box-binding protein'                              37729.938  1 ?                 ? ? ? 
16 polymer nat 'poly(UNK)'                                             8188.084   1 ?                 ? ? ? 
17 polymer nat 'poly(UNK)'                                             20272.906  1 ?                 ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  'Cell cycle gene 1 protein,TBP-associated factor 250 kDa,p250,Transcription initiation factor TFIID 250 kDa subunit,TAFII250' 
2  '150 kDa cofactor of initiator function,RNA polymerase II TBP-associated factor subunit B' 
4  'RNA polymerase II TBP-associated factor subunit C,TBP-associated factor 4' 
5  'Transcription initiation factor TFIID 100 kDa subunit,TAFII100,Transcription initiation factor TFIID 100 kDa subunit,TAFII100' 
6  'RNA polymerase II TBP-associated factor subunit E' 
7  'RNA polymerase II TBP-associated factor subunit E,Transcription initiation factor TFIID 70 kDa subunit' 
8  'RNA polymerase II TBP-associated factor subunit F,Transcription initiation factor TFIID 55 kDa subunit,TAFII55' 
9  
;Protein taube nuss,TBP-associated factor 43 kDa,TBP-associated factor 8,Transcription initiation factor TFIID 43 kDa subunit,hTAFII43,Protein taube nuss,TBP-associated factor 43 kDa
;
10 
;RNA polymerase II TBP-associated factor subunit G,STAF31/32,Transcription initiation factor TFIID 31 kDa subunit,TAFII31,Transcription initiation factor TFIID 32 kDa subunit,TAFII32
;
11 'STAF28,Transcription initiation factor TFIID 30 kDa subunit,TAFII30' 
12 'TFIID subunit p30-beta,Transcription initiation factor TFIID 28 kDa subunit,TAFII28' 
13 'Transcription initiation factor TFIID 20/15 kDa subunits,TAFII20/TAFII15' 
14 'Transcription initiation factor TFIID 18 kDa subunit,TAFII18' 
15 'TATA sequence-binding protein,TATA-binding factor,TATA-box factor,Transcription initiation factor TFIID TBP subunit' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no 
;MGPGCDLLLRTAATITAAAIMSDTDSDEDSAGGGPFSLAGFLFGNINGAGQLEGESVLDDECKKHLAGLGALGLGSLITE
LTANEELTGTDGALVNDEGWVRSTEDAVDYSDINEVAEDESRRYQQTMGSLQPLCHSDYDEDDYDADCEDIDCKLMPPPP
PPPGPMKKDKDQDSITGEKVDFSSSSDSESEMGPQEATQAESEDGKLTLPLAGIMQHDATKLLPSVTELFPEFRPGKVLR
FLRLFGPGKNVPSVWRSARRKRKKKHRELIQEEQIQEVECSVESEVSQKSLWNYDYAPPPPPEQCLSDDEITMMAPVESK
FSQSTGDIDKVTDTKPRVAEWRYGPARLWYDMLGVPEDGSGFDYGFKLRKTEHEPVIKSRMIEEFRKLEENNGTDLLADE
NFLMVTQLHWEDDIIWDGEDVKHKGTKPQRASLAGWLPSSMTRNAMAYNVQQGFAATLDDDKPWYSIFPIDNEDLVYGRW
EDNIIWDAQAMPRLLEPPVLTLDPNDENLILEIPDEKEEATSNSPSKESKKESSLKKSRILLGKTGVIKEEPQQNMSQPE
VKDPWNLSNDEYYYPKQQGLRGTFGGNIIQHSIPAVELRQPFFPTHMGPIKLRQFHRPPLKKYSFGALSQPGPHSVQPLL
KHIKKKAKMREQERQASGGGEMFFMRTPQDLTGKDGDLILAEYSEENGPLMMQVGMATKIKNYYKRKPGKDPGAPDCKYG
ETVYCHTSPFLGSLHPGQLLQAFENNLFRAPIYLHKMPETDFLIIRTRQGYYIRELVDIFVVGQQCPLFEVPGPNSKRAN
THIRDFLQVFIYRLFWKSKDRPRRIRMEDIKKAFPSHSESSIRKRLKLCADFKRTGMDSNWWVLKSDFRLPTEEEIRAMV
SPEQCCAYYSMIAAEQRLKDAGYGEKSFFAPEEENEEDFQMKIDDEVRTAPWNTTRAFIAAMKGKCLLEVTGVADPTGCG
EGFSYVKIPNKPTQQKDDKEPQPVKKTVTGTDADLRRLSLKNAKQLLRKFGVPEEEIKKLSRWEVIDVVRTMSTEQARSG
EGPMSKFARGSRFSVAEHQERYKEECQRIFDLQNKVLSSTEVLSTDTDSSSAEDSDFEEMGKNIENMLQNKKTSSQLSRE
REEQERKELQRMLLAAGSAASGNNHRDDDTASVTSLNSSATGRCLKIYRTFRDEEGKEYVRCETVRKPAVIDAYVRIRTT
KDEEFIRKFALFDEQHREEMRKERRRIQEQLRRLKRNQEKEKLKGPPEKKPKKMKERPDLKLKCGACGAIGHMRTNKFCP
LYYQTNAPPSNPVAMTEEQEEELEKTVIHNDNEELIKVEGTKIVLGKQLIESADEVRRKSLVLKFPKQQLPPKKKRRVGT
TVHCDYLNRPHKSIHRRRTDPMVTLSSILESIINDMRDLPNTYPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRLYP
SREEFREHLELIVKNSATYNGPKHSLTQISQSMLDLCDEKLKEKEDKLARLEKAINPLLDDDDQVAFSFILDNIVTQKMM
AVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVC
YQTLTEYDEHLTQLEKDICTAKEAALEEAELESLDPMTPGPYTPQPPDLYDTNTSLSMSRDASVFQDESNMSVLDIPSAT
PEKQVTQEGEDGDGDLADEEEGTVQQPQASVLYEDLLMSEGEDDEEDAGSDEEGDNPFSAIQLSESGSDSDVGSGGIRPK
QPRMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSG
PSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE
;
;MGPGCDLLLRTAATITAAAIMSDTDSDEDSAGGGPFSLAGFLFGNINGAGQLEGESVLDDECKKHLAGLGALGLGSLITE
LTANEELTGTDGALVNDEGWVRSTEDAVDYSDINEVAEDESRRYQQTMGSLQPLCHSDYDEDDYDADCEDIDCKLMPPPP
PPPGPMKKDKDQDSITGEKVDFSSSSDSESEMGPQEATQAESEDGKLTLPLAGIMQHDATKLLPSVTELFPEFRPGKVLR
FLRLFGPGKNVPSVWRSARRKRKKKHRELIQEEQIQEVECSVESEVSQKSLWNYDYAPPPPPEQCLSDDEITMMAPVESK
FSQSTGDIDKVTDTKPRVAEWRYGPARLWYDMLGVPEDGSGFDYGFKLRKTEHEPVIKSRMIEEFRKLEENNGTDLLADE
NFLMVTQLHWEDDIIWDGEDVKHKGTKPQRASLAGWLPSSMTRNAMAYNVQQGFAATLDDDKPWYSIFPIDNEDLVYGRW
EDNIIWDAQAMPRLLEPPVLTLDPNDENLILEIPDEKEEATSNSPSKESKKESSLKKSRILLGKTGVIKEEPQQNMSQPE
VKDPWNLSNDEYYYPKQQGLRGTFGGNIIQHSIPAVELRQPFFPTHMGPIKLRQFHRPPLKKYSFGALSQPGPHSVQPLL
KHIKKKAKMREQERQASGGGEMFFMRTPQDLTGKDGDLILAEYSEENGPLMMQVGMATKIKNYYKRKPGKDPGAPDCKYG
ETVYCHTSPFLGSLHPGQLLQAFENNLFRAPIYLHKMPETDFLIIRTRQGYYIRELVDIFVVGQQCPLFEVPGPNSKRAN
THIRDFLQVFIYRLFWKSKDRPRRIRMEDIKKAFPSHSESSIRKRLKLCADFKRTGMDSNWWVLKSDFRLPTEEEIRAMV
SPEQCCAYYSMIAAEQRLKDAGYGEKSFFAPEEENEEDFQMKIDDEVRTAPWNTTRAFIAAMKGKCLLEVTGVADPTGCG
EGFSYVKIPNKPTQQKDDKEPQPVKKTVTGTDADLRRLSLKNAKQLLRKFGVPEEEIKKLSRWEVIDVVRTMSTEQARSG
EGPMSKFARGSRFSVAEHQERYKEECQRIFDLQNKVLSSTEVLSTDTDSSSAEDSDFEEMGKNIENMLQNKKTSSQLSRE
REEQERKELQRMLLAAGSAASGNNHRDDDTASVTSLNSSATGRCLKIYRTFRDEEGKEYVRCETVRKPAVIDAYVRIRTT
KDEEFIRKFALFDEQHREEMRKERRRIQEQLRRLKRNQEKEKLKGPPEKKPKKMKERPDLKLKCGACGAIGHMRTNKFCP
LYYQTNAPPSNPVAMTEEQEEELEKTVIHNDNEELIKVEGTKIVLGKQLIESADEVRRKSLVLKFPKQQLPPKKKRRVGT
TVHCDYLNRPHKSIHRRRTDPMVTLSSILESIINDMRDLPNTYPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRLYP
SREEFREHLELIVKNSATYNGPKHSLTQISQSMLDLCDEKLKEKEDKLARLEKAINPLLDDDDQVAFSFILDNIVTQKMM
AVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVC
YQTLTEYDEHLTQLEKDICTAKEAALEEAELESLDPMTPGPYTPQPPDLYDTNTSLSMSRDASVFQDESNMSVLDIPSAT
PEKQVTQEGEDGDGDLADEEEGTVQQPQASVLYEDLLMSEGEDDEEDAGSDEEGDNPFSAIQLSESGSDSDVGSGGIRPK
QPRMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSG
PSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE
;
A   ? 
2  'polypeptide(L)' no no 
;MPLTGVEPARMNRKKGDKGFESPRPYKLTHQVVCINNINFQRKSVVGFVELTIFPTVANLNRIKLNSKQCRIYRVRINDL
EAAFIYNDPTLEVCHSESKQRNLNYFSNAYAAAVSAVDPDAGNGELCIKVPSELWKHVDELKVLKIHINFSLDQPKGGLH
FVVPSVEGSMAERGAHVFSCGYQNSTRFWFPCVDSYSELCTWKLEFTVDAAMVAVSNGDLVETVYTHDMRKKTFHYMLTI
PTAASNISLAIGPFEILVDPYMHEVTHFCLPQLLPLLKHTTSYLHEVFEFYEEILTCRYPYSCFKTVFIDEAYVEVAAYA
SMSIFSTNLLHSAMIIDETPLTRRCLAQSLAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGVNEYRHWIKEELD
KIVAYELKTGGVLLHPIFGGGKEKDNPASHLHFSIKHPHTLSWEYYSMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLA
STASSQKFQSHMWSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQDYTSPGTQKY
VGPLKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSVLRKV
EFEQADFMWQYQLRYERDVVAQQESILALEKFPTPASRLALTDILEQEQCFYRVRMSACFCLAKIANSMVSTWTGPPAMK
SLFTRMFCCKSCPNIVKTNNFMSFQSYFLQKTMPVAMALLRDVHNLCPKEVLTFILDLIKYNDNRKNKFSDNYYRAEMID
ALANSVTPAVSVNNEVRTLDNLNPDVRLILEEITRFLNMEKLLPSYRHTITVSCLRAIRVLQKNGHVPSDPALFKSYAEY
GHFVDIRIAALEAVVDYTKVDRSYEELQWLLNMIQNDPVPYVRHKILNMLTKNPPFTKNMESPLCNEALVDQLWKLMNSG
TSHDWRLRCGAVDLYFTLFGLSRPSCLPLPELGLVLNLKEKKAVLNPTIIPESVAGNQEAANNPSSHPQLVGFQNPFSSS
QDEEEIDMDTVHDSQAFISHHLNMLERPSTPGLSKYRPASSRSALIPQHSAGCDSTPTTKPQWSLELARKGTGKEQAPLE
MSMHPAASAPLSVFTKESTASKHSDHHHHHHHEHKKKKKKHKHKHKHKHKHDSKEKDKEPFTFSSPASGRSIRSPSLSD
;
;MPLTGVEPARMNRKKGDKGFESPRPYKLTHQVVCINNINFQRKSVVGFVELTIFPTVANLNRIKLNSKQCRIYRVRINDL
EAAFIYNDPTLEVCHSESKQRNLNYFSNAYAAAVSAVDPDAGNGELCIKVPSELWKHVDELKVLKIHINFSLDQPKGGLH
FVVPSVEGSMAERGAHVFSCGYQNSTRFWFPCVDSYSELCTWKLEFTVDAAMVAVSNGDLVETVYTHDMRKKTFHYMLTI
PTAASNISLAIGPFEILVDPYMHEVTHFCLPQLLPLLKHTTSYLHEVFEFYEEILTCRYPYSCFKTVFIDEAYVEVAAYA
SMSIFSTNLLHSAMIIDETPLTRRCLAQSLAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGVNEYRHWIKEELD
KIVAYELKTGGVLLHPIFGGGKEKDNPASHLHFSIKHPHTLSWEYYSMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLA
STASSQKFQSHMWSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQDYTSPGTQKY
VGPLKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSVLRKV
EFEQADFMWQYQLRYERDVVAQQESILALEKFPTPASRLALTDILEQEQCFYRVRMSACFCLAKIANSMVSTWTGPPAMK
SLFTRMFCCKSCPNIVKTNNFMSFQSYFLQKTMPVAMALLRDVHNLCPKEVLTFILDLIKYNDNRKNKFSDNYYRAEMID
ALANSVTPAVSVNNEVRTLDNLNPDVRLILEEITRFLNMEKLLPSYRHTITVSCLRAIRVLQKNGHVPSDPALFKSYAEY
GHFVDIRIAALEAVVDYTKVDRSYEELQWLLNMIQNDPVPYVRHKILNMLTKNPPFTKNMESPLCNEALVDQLWKLMNSG
TSHDWRLRCGAVDLYFTLFGLSRPSCLPLPELGLVLNLKEKKAVLNPTIIPESVAGNQEAANNPSSHPQLVGFQNPFSSS
QDEEEIDMDTVHDSQAFISHHLNMLERPSTPGLSKYRPASSRSALIPQHSAGCDSTPTTKPQWSLELARKGTGKEQAPLE
MSMHPAASAPLSVFTKESTASKHSDHHHHHHHEHKKKKKKHKHKHKHKHKHDSKEKDKEPFTFSSPASGRSIRSPSLSD
;
B   ? 
3  'polypeptide(L)' no no 
;MCESYSRSLLRVSVAQICQALGWDSVQLSACHLLTDVLQRYLQQLGRGCHRYSELYGRTDPILDDVGEAFQLMGVSLHEL
EDYIHNIEPVTFPHQIPSFPVSKNNVLQFPQPGSKDAEERKEYIPDYLPPIVSSQEEEEEEQVPTDGGTSAEAMQVPLEE
DDELEEEEIINDENFLGKRPLDSPEAEELPAMKRPRLLSTKGDTLDVVLLEAREPLSSINTQKIPPMLSPVHVQDSTDLA
PPSPEPPMLAPVAKSQMPTAKPLETKSFTPKTKTKTSSPGQKTKSPKTAQSPAMVGSPIRSPKTVSKEKKSPGRSKSPKS
PKSPKVTTHIPQTPVRPETPNRTPSATLSEKISKETIQVKQIQTPPDAGKLNSENQPKKAVVADKTIEASIDAVIARACA
EREPDPFEFSSGSESEGDIFTSPKRISGPECTTPKASTSANNFTKSGSTPLPLSGGTSSSDNSWTMDASIDEVVRKAKLG
TPSNMPPNFPYISSPSVSPPTPEPLHKVYEEKTKLPSSVEVKKKLKKELKTKMKKKEKQRDREREKDKNKDKSKEKDKVK
EKEKDKETGRETKYPWKEFLKEEEADPYKFKIKEFEDVDPKVKLKDGLVRKEKEKHKDKKKDREKGKKDKDKREKEKVKD
KGREDKMKAPAPPLVLPPKELALPLFSPATASRVPAMLPSLLPVLPEKLFEEKEKVKEKEKKKDKKEKKKKKEKEKEKKE
KEREKEKREREKREKEKEKHKHEKIKVEPVALAPSPVIPRLTLRVGAGQDKIVISKVVPAPEAKPAPSQNRPKTPPPAPA
PAPGPMLVSPAPVPLPLLAQAAAGPALLPSPGPAASGASAKAPVRSVVTETVSTYVIRDEWGNQIWICPGCNKPDDGSPM
IGCDDCDDWYHWPCVGIMTAPPEEMQWFCPKCANKKKDKKHKKRKHRAH
;
;MCESYSRSLLRVSVAQICQALGWDSVQLSACHLLTDVLQRYLQQLGRGCHRYSELYGRTDPILDDVGEAFQLMGVSLHEL
EDYIHNIEPVTFPHQIPSFPVSKNNVLQFPQPGSKDAEERKEYIPDYLPPIVSSQEEEEEEQVPTDGGTSAEAMQVPLEE
DDELEEEEIINDENFLGKRPLDSPEAEELPAMKRPRLLSTKGDTLDVVLLEAREPLSSINTQKIPPMLSPVHVQDSTDLA
PPSPEPPMLAPVAKSQMPTAKPLETKSFTPKTKTKTSSPGQKTKSPKTAQSPAMVGSPIRSPKTVSKEKKSPGRSKSPKS
PKSPKVTTHIPQTPVRPETPNRTPSATLSEKISKETIQVKQIQTPPDAGKLNSENQPKKAVVADKTIEASIDAVIARACA
EREPDPFEFSSGSESEGDIFTSPKRISGPECTTPKASTSANNFTKSGSTPLPLSGGTSSSDNSWTMDASIDEVVRKAKLG
TPSNMPPNFPYISSPSVSPPTPEPLHKVYEEKTKLPSSVEVKKKLKKELKTKMKKKEKQRDREREKDKNKDKSKEKDKVK
EKEKDKETGRETKYPWKEFLKEEEADPYKFKIKEFEDVDPKVKLKDGLVRKEKEKHKDKKKDREKGKKDKDKREKEKVKD
KGREDKMKAPAPPLVLPPKELALPLFSPATASRVPAMLPSLLPVLPEKLFEEKEKVKEKEKKKDKKEKKKKKEKEKEKKE
KEREKEKREREKREKEKEKHKHEKIKVEPVALAPSPVIPRLTLRVGAGQDKIVISKVVPAPEAKPAPSQNRPKTPPPAPA
PAPGPMLVSPAPVPLPLLAQAAAGPALLPSPGPAASGASAKAPVRSVVTETVSTYVIRDEWGNQIWICPGCNKPDDGSPM
IGCDDCDDWYHWPCVGIMTAPPEEMQWFCPKCANKKKDKKHKKRKHRAH
;
C   ? 
4  'polypeptide(L)' no no 
;MAAGSDLLDEVFFNSEVDEKVVSDLVGSLESQLAASAAHHHHLAPRTPEVRAAAAGALGNHVVSGSPAGAAGAGPAAPAE
GAPGAAPEPPPAGRARPGGGGPQRPGPPSPRRPLVPAGPAPPAAKLRPPPEGSAGSCAPVPAAAAVAAGPEPAPAGPAKP
AGPAALAARAGPGPGPGPGPGPGPGPGKPAGPGAAQTLNGSAALLNSHHAAAPAVSLVNNGPAALLPLPKPAAPGTVIQT
PPFVGAAAPPAPAAPSPPAAPAPAAPAAAPPPPPPAPATLARPPGHPAGPPTAAPAVPPPAAAQNGGSAGAAPAPAPAAG
GPAGVSGQPGPGAAAAAPAPGVKAESPKRVVQAAPPAAQTLAASGPASTAASMVIGPTMQGALPSPAAVPPPAPGTPTGL
PKGAAGAVTQSLSRTPTATTSGIRATLTPTVLAPRLPQPPQNPTNIQNFQLPPGMVLVRSENGQLLMIPQQALAQMQAQA
HAQPQTTMAPRPATPTSAPPVQISTVQAPGTPIIARQVTPTTIIKQVSQAQTTVQPSATLQRSPGVQPQLVLGGAAQTAS
LGTATAVQTGTPQRTVPGATTTSSAATETMENVKKCKNFLSTLIKLASSGKQSTETAANVKELVQNLLDGKIEAEDFTSR
LYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQPPPPTSQATTALTAVVLSSSVQRTAGKTAATVTSALQPP
VLSLTQPTQVGVGKQGQPTPLVIQQPPKPGALIRPPQVTLTQTPMVALRQPHNRIMLTTPQQIQLNPLQPVPVVKPAVLP
GTKALSAVSAQAAAAQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDETFLLQAPLQR
RILEIGKKHGITELHPDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDE
QEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDCPGPGSGAEGSGPGSVVPG
SSGVGTPRQFTRQRITRVNLRDLIFCLENERETSHSLLLYKAFLK
;
;MAAGSDLLDEVFFNSEVDEKVVSDLVGSLESQLAASAAHHHHLAPRTPEVRAAAAGALGNHVVSGSPAGAAGAGPAAPAE
GAPGAAPEPPPAGRARPGGGGPQRPGPPSPRRPLVPAGPAPPAAKLRPPPEGSAGSCAPVPAAAAVAAGPEPAPAGPAKP
AGPAALAARAGPGPGPGPGPGPGPGPGKPAGPGAAQTLNGSAALLNSHHAAAPAVSLVNNGPAALLPLPKPAAPGTVIQT
PPFVGAAAPPAPAAPSPPAAPAPAAPAAAPPPPPPAPATLARPPGHPAGPPTAAPAVPPPAAAQNGGSAGAAPAPAPAAG
GPAGVSGQPGPGAAAAAPAPGVKAESPKRVVQAAPPAAQTLAASGPASTAASMVIGPTMQGALPSPAAVPPPAPGTPTGL
PKGAAGAVTQSLSRTPTATTSGIRATLTPTVLAPRLPQPPQNPTNIQNFQLPPGMVLVRSENGQLLMIPQQALAQMQAQA
HAQPQTTMAPRPATPTSAPPVQISTVQAPGTPIIARQVTPTTIIKQVSQAQTTVQPSATLQRSPGVQPQLVLGGAAQTAS
LGTATAVQTGTPQRTVPGATTTSSAATETMENVKKCKNFLSTLIKLASSGKQSTETAANVKELVQNLLDGKIEAEDFTSR
LYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQPPPPTSQATTALTAVVLSSSVQRTAGKTAATVTSALQPP
VLSLTQPTQVGVGKQGQPTPLVIQQPPKPGALIRPPQVTLTQTPMVALRQPHNRIMLTTPQQIQLNPLQPVPVVKPAVLP
GTKALSAVSAQAAAAQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDETFLLQAPLQR
RILEIGKKHGITELHPDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDE
QEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDCPGPGSGAEGSGPGSVVPG
SSGVGTPRQFTRQRITRVNLRDLIFCLENERETSHSLLLYKAFLK
;
D,E ? 
5  'polypeptide(L)' no no 
;MAALAEEQTEVAVKLEPEGPPTLLPPQAGDGAGEGSGGTTNNGPNGGGGNVAASSSTGGDGGTPKPTVAVSAAAPAGAAP
VPAAAPDAGAPHDRQTLLAVLQFLRQSKLREAEEALRREAGLLEEAVAGSGAPGEVDSAGAEVTSALLSRVTASAPGPAA
PDPPGTGASGATVVSGSASGPAAPGKVGSVAVEDQPDVSAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLF
YPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLDFRTSKFVLRISRDSYQLLKRH
LQEKQNNQIWNIVQEHLYIDIFDGMPRSKQQIDAMVGSLAGEAKREANKSKVFFGLLKEPEIEVPLDDEDEEGENEEGKP
KKKKPKKDSIGSKSKKQDPNAPPQNRIPLPELKDSDKLDKIMNMKETTKRVRLGPDCLPSICFYTFLNAYQGLTAVDVTD
DSSLIAGGFADSTVRV(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)KILYGHSGPVYGASFSPDRN
YLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFH
PNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCS
LRFSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKSTPVVHLHFTRRNLVLAAGA
YSPQ
;
;MAALAEEQTEVAVKLEPEGPPTLLPPQAGDGAGEGSGGTTNNGPNGGGGNVAASSSTGGDGGTPKPTVAVSAAAPAGAAP
VPAAAPDAGAPHDRQTLLAVLQFLRQSKLREAEEALRREAGLLEEAVAGSGAPGEVDSAGAEVTSALLSRVTASAPGPAA
PDPPGTGASGATVVSGSASGPAAPGKVGSVAVEDQPDVSAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLF
YPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLDFRTSKFVLRISRDSYQLLKRH
LQEKQNNQIWNIVQEHLYIDIFDGMPRSKQQIDAMVGSLAGEAKREANKSKVFFGLLKEPEIEVPLDDEDEEGENEEGKP
KKKKPKKDSIGSKSKKQDPNAPPQNRIPLPELKDSDKLDKIMNMKETTKRVRLGPDCLPSICFYTFLNAYQGLTAVDVTD
DSSLIAGGFADSTVRVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKILYGHSGPVYGASFSPDRNYLLS
SSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSN
YVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFS
RDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKSTPVVHLHFTRRNLVLAAGAYSPQ
;
F,G ? 
6  'polypeptide(L)' no no 
;MAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNV
EPLYGFHAQEFIPFRFASGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAE
ATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRA
EALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLR
PDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRITKTFTKSWVDEKTPWTTRYGSIAGLAELGHDVIKTLILPRLQQEG
ERIRSVLDGPVLSNIDRIGADHVQSLLLKHCAPVLAKLRPPPDNQDAYRAEFGSLGPLLCSQVVKARAQAALQAQQVNRT
TLTITQPRPTLTLSQAPQPGPRTPGLLKVPGSIALPVQTLVSARAAAPPQPSPPPTKFIVMSSSSSAPSTQQVLSLSTSA
PGSGSTTTSPVTTTVPSVQPIVKLVSTATTAPPSTAPSGPGSVQKYIVVSLPPTGEGKGGPTSHPSPVPPPASSPSPLSG
SALCGGKQEAGDSPPPAPGTPKANGSQPNSGSPQPAP
;
;MAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNV
EPLYGFHAQEFIPFRFASGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAE
ATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRA
EALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLR
PDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRITKTFTKSWVDEKTPWTTRYGSIAGLAELGHDVIKTLILPRLQQEG
ERIRSVLDGPVLSNIDRIGADHVQSLLLKHCAPVLAKLRPPPDNQDAYRAEFGSLGPLLCSQVVKARAQAALQAQQVNRT
TLTITQPRPTLTLSQAPQPGPRTPGLLKVPGSIALPVQTLVSARAAAPPQPSPPPTKFIVMSSSSSAPSTQQVLSLSTSA
PGSGSTTTSPVTTTVPSVQPIVKLVSTATTAPPSTAPSGPGSVQKYIVVSLPPTGEGKGGPTSHPSPVPPPASSPSPLSG
SALCGGKQEAGDSPPPAPGTPKANGSQPNSGSPQPAP
;
H   ? 
7  'polypeptide(L)' no no 
;MAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNV
EPLYGFHAQEFIPFRFASGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAE
ATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPL(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)SVEQQLYYKEITEACVGSCEAKRAEALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNL
ALLIYLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRIT
KTFTKSWVDEKTPWTTRYGSIAGLAELGHDVIKTLILPRLQQEGERIRSVLDGPVLSNIDRIGADHVQSLLLKHCAPVLA
KLRPPPDNQDAYRAEFGSLGPLLCSQVVKARAQAALQAQQVNRTTLTITQPRPTLTLSQAPQPGPRTPGLLKVPGSIALP
VQTLVSARAAAPPQPSPPPTKFIVMSSSSSAPSTQQVLSLSTSAPGSGSTTTSPVTTTVPSVQPIVKLVSTATTAPPSTA
PSGPGSVQKYIVVSLPPTGEGKGGPTSHPSPVPPPASSPSPLSGSALCGGKQEAGDSPPPAPGTPKANGSQPNSGSPQPA
P
;
;MAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNV
EPLYGFHAQEFIPFRFASGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAE
ATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLXXXXXXXXXXSVEQQLYYKEITEACVGSCEAKRA
EALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLR
PDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRITKTFTKSWVDEKTPWTTRYGSIAGLAELGHDVIKTLILPRLQQEG
ERIRSVLDGPVLSNIDRIGADHVQSLLLKHCAPVLAKLRPPPDNQDAYRAEFGSLGPLLCSQVVKARAQAALQAQQVNRT
TLTITQPRPTLTLSQAPQPGPRTPGLLKVPGSIALPVQTLVSARAAAPPQPSPPPTKFIVMSSSSSAPSTQQVLSLSTSA
PGSGSTTTSPVTTTVPSVQPIVKLVSTATTAPPSTAPSGPGSVQKYIVVSLPPTGEGKGGPTSHPSPVPPPASSPSPLSG
SALCGGKQEAGDSPPPAPGTPKANGSQPNSGSPQPAP
;
I   ? 
8  'polypeptide(L)' no no 
;MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTI
DKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESP
DVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQD
EEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQA
VLDELKQKEDREKEQLSSLQEELESLLEK
;
;MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTI
DKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESP
DVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQD
EEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQA
VLDELKQKEDREKEQLSSLQEELESLLEK
;
J   ? 
9  'polypeptide(L)' no no 
;MADAAATAGAGGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYC
EHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVIT(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)YQVLREKAASQRRDVERALTRFMAK
TGETQSLFKDDVSTFPLIAARPFTIPYLTALLPSELEMQQMEETDSSEQDEQTDTENLALHISMEDSGAEKENTSVLQQN
PSLSGSRNGEENIIDNPYLRPVKKPKIRRKKSLS
;
;MADAAATAGAGGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYC
EHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXYQVLREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYLTALLPSELEMQQMEET
DSSEQDEQTDTENLALHISMEDSGAEKENTSVLQQNPSLSGSRNGEENIIDNPYLRPVKKPKIRRKKSLS
;
K   ? 
10 'polypeptide(L)' no no 
;MESGKTASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQCRAD
QSFTSPPPRDFLLDIARQRNQTPLPLIKP(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)PDRYCLTAPNYRLKSL
QKKASTSAGRITVPRLSVGSVTSRPSTPTLGTPTPQTMSVSTKVGTPMSLTGQRFTVQMPTSQSPAVKASIPATSAVQNV
LINPSLIGSKNILITTNMMSSQNTANESSNALKRKREDDDDDDDDDDDYDNL
;
;MESGKTASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQCRAD
QSFTSPPPRDFLLDIARQRNQTPLPLIKPXXXXXXXPDRYCLTAPNYRLKSLQKKASTSAGRITVPRLSVGSVTSRPSTP
TLGTPTPQTMSVSTKVGTPMSLTGQRFTVQMPTSQSPAVKASIPATSAVQNVLINPSLIGSKNILITTNMMSSQNTANES
SNALKRKREDDDDDDDDDDDYDNL
;
L,M ? 
11 'polypeptide(L)' no no 
;MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAGGTGPLAARAGEPAERRGAAPV
SAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQ
KFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT
;
;MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAGGTGPLAARAGEPAERRGAAPV
SAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQ
KFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT
;
N,O ? 
12 'polypeptide(L)' no no 
;MDDAHESPSDKGGETGESDETAAVPGDPGATDTDGIPEETDGDADVDLKEAAAEEGELESQDVSDLTTVEREDSSLLNPA
AKKLKIDTKEKKEKKQKVDEDEIQKMQILVSSFSEEQLNRYEMYRRSAFPKAAIKRLIQSITGTSVSQNVVIAMSGISKV
FVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIFF
;
;MDDAHESPSDKGGETGESDETAAVPGDPGATDTDGIPEETDGDADVDLKEAAAEEGELESQDVSDLTTVEREDSSLLNPA
AKKLKIDTKEKKEKKQKVDEDEIQKMQILVSSFSEEQLNRYEMYRRSAFPKAAIKRLIQSITGTSVSQNVVIAMSGISKV
FVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIFF
;
P   ? 
13 'polypeptide(L)' no no 
;MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDV
EEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTK
K
;
;MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDV
EEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTK
K
;
Q,R ? 
14 'polypeptide(L)' no no 
;MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGR
VQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS
;
;MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGR
VQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS
;
S   ? 
15 'polypeptide(L)' no no 
;MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQQQQQQQQQQQQQQQQQQQQ
QQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSG
IVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARV
VQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAE
IYEAFENIYPILKGFRKTT
;
;MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQQQQQQQQQQQQQQQQQQQQ
QQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSG
IVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARV
VQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAE
IYEAFENIYPILKGFRKTT
;
T   ? 
16 'polypeptide(L)' no no 
;(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
;
;XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXX
;
Y   ? 
17 'polypeptide(L)' no no 
;(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
;
;XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
;
Z   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    MET n 
1  2    GLY n 
1  3    PRO n 
1  4    GLY n 
1  5    CYS n 
1  6    ASP n 
1  7    LEU n 
1  8    LEU n 
1  9    LEU n 
1  10   ARG n 
1  11   THR n 
1  12   ALA n 
1  13   ALA n 
1  14   THR n 
1  15   ILE n 
1  16   THR n 
1  17   ALA n 
1  18   ALA n 
1  19   ALA n 
1  20   ILE n 
1  21   MET n 
1  22   SER n 
1  23   ASP n 
1  24   THR n 
1  25   ASP n 
1  26   SER n 
1  27   ASP n 
1  28   GLU n 
1  29   ASP n 
1  30   SER n 
1  31   ALA n 
1  32   GLY n 
1  33   GLY n 
1  34   GLY n 
1  35   PRO n 
1  36   PHE n 
1  37   SER n 
1  38   LEU n 
1  39   ALA n 
1  40   GLY n 
1  41   PHE n 
1  42   LEU n 
1  43   PHE n 
1  44   GLY n 
1  45   ASN n 
1  46   ILE n 
1  47   ASN n 
1  48   GLY n 
1  49   ALA n 
1  50   GLY n 
1  51   GLN n 
1  52   LEU n 
1  53   GLU n 
1  54   GLY n 
1  55   GLU n 
1  56   SER n 
1  57   VAL n 
1  58   LEU n 
1  59   ASP n 
1  60   ASP n 
1  61   GLU n 
1  62   CYS n 
1  63   LYS n 
1  64   LYS n 
1  65   HIS n 
1  66   LEU n 
1  67   ALA n 
1  68   GLY n 
1  69   LEU n 
1  70   GLY n 
1  71   ALA n 
1  72   LEU n 
1  73   GLY n 
1  74   LEU n 
1  75   GLY n 
1  76   SER n 
1  77   LEU n 
1  78   ILE n 
1  79   THR n 
1  80   GLU n 
1  81   LEU n 
1  82   THR n 
1  83   ALA n 
1  84   ASN n 
1  85   GLU n 
1  86   GLU n 
1  87   LEU n 
1  88   THR n 
1  89   GLY n 
1  90   THR n 
1  91   ASP n 
1  92   GLY n 
1  93   ALA n 
1  94   LEU n 
1  95   VAL n 
1  96   ASN n 
1  97   ASP n 
1  98   GLU n 
1  99   GLY n 
1  100  TRP n 
1  101  VAL n 
1  102  ARG n 
1  103  SER n 
1  104  THR n 
1  105  GLU n 
1  106  ASP n 
1  107  ALA n 
1  108  VAL n 
1  109  ASP n 
1  110  TYR n 
1  111  SER n 
1  112  ASP n 
1  113  ILE n 
1  114  ASN n 
1  115  GLU n 
1  116  VAL n 
1  117  ALA n 
1  118  GLU n 
1  119  ASP n 
1  120  GLU n 
1  121  SER n 
1  122  ARG n 
1  123  ARG n 
1  124  TYR n 
1  125  GLN n 
1  126  GLN n 
1  127  THR n 
1  128  MET n 
1  129  GLY n 
1  130  SER n 
1  131  LEU n 
1  132  GLN n 
1  133  PRO n 
1  134  LEU n 
1  135  CYS n 
1  136  HIS n 
1  137  SER n 
1  138  ASP n 
1  139  TYR n 
1  140  ASP n 
1  141  GLU n 
1  142  ASP n 
1  143  ASP n 
1  144  TYR n 
1  145  ASP n 
1  146  ALA n 
1  147  ASP n 
1  148  CYS n 
1  149  GLU n 
1  150  ASP n 
1  151  ILE n 
1  152  ASP n 
1  153  CYS n 
1  154  LYS n 
1  155  LEU n 
1  156  MET n 
1  157  PRO n 
1  158  PRO n 
1  159  PRO n 
1  160  PRO n 
1  161  PRO n 
1  162  PRO n 
1  163  PRO n 
1  164  GLY n 
1  165  PRO n 
1  166  MET n 
1  167  LYS n 
1  168  LYS n 
1  169  ASP n 
1  170  LYS n 
1  171  ASP n 
1  172  GLN n 
1  173  ASP n 
1  174  SER n 
1  175  ILE n 
1  176  THR n 
1  177  GLY n 
1  178  GLU n 
1  179  LYS n 
1  180  VAL n 
1  181  ASP n 
1  182  PHE n 
1  183  SER n 
1  184  SER n 
1  185  SER n 
1  186  SER n 
1  187  ASP n 
1  188  SER n 
1  189  GLU n 
1  190  SER n 
1  191  GLU n 
1  192  MET n 
1  193  GLY n 
1  194  PRO n 
1  195  GLN n 
1  196  GLU n 
1  197  ALA n 
1  198  THR n 
1  199  GLN n 
1  200  ALA n 
1  201  GLU n 
1  202  SER n 
1  203  GLU n 
1  204  ASP n 
1  205  GLY n 
1  206  LYS n 
1  207  LEU n 
1  208  THR n 
1  209  LEU n 
1  210  PRO n 
1  211  LEU n 
1  212  ALA n 
1  213  GLY n 
1  214  ILE n 
1  215  MET n 
1  216  GLN n 
1  217  HIS n 
1  218  ASP n 
1  219  ALA n 
1  220  THR n 
1  221  LYS n 
1  222  LEU n 
1  223  LEU n 
1  224  PRO n 
1  225  SER n 
1  226  VAL n 
1  227  THR n 
1  228  GLU n 
1  229  LEU n 
1  230  PHE n 
1  231  PRO n 
1  232  GLU n 
1  233  PHE n 
1  234  ARG n 
1  235  PRO n 
1  236  GLY n 
1  237  LYS n 
1  238  VAL n 
1  239  LEU n 
1  240  ARG n 
1  241  PHE n 
1  242  LEU n 
1  243  ARG n 
1  244  LEU n 
1  245  PHE n 
1  246  GLY n 
1  247  PRO n 
1  248  GLY n 
1  249  LYS n 
1  250  ASN n 
1  251  VAL n 
1  252  PRO n 
1  253  SER n 
1  254  VAL n 
1  255  TRP n 
1  256  ARG n 
1  257  SER n 
1  258  ALA n 
1  259  ARG n 
1  260  ARG n 
1  261  LYS n 
1  262  ARG n 
1  263  LYS n 
1  264  LYS n 
1  265  LYS n 
1  266  HIS n 
1  267  ARG n 
1  268  GLU n 
1  269  LEU n 
1  270  ILE n 
1  271  GLN n 
1  272  GLU n 
1  273  GLU n 
1  274  GLN n 
1  275  ILE n 
1  276  GLN n 
1  277  GLU n 
1  278  VAL n 
1  279  GLU n 
1  280  CYS n 
1  281  SER n 
1  282  VAL n 
1  283  GLU n 
1  284  SER n 
1  285  GLU n 
1  286  VAL n 
1  287  SER n 
1  288  GLN n 
1  289  LYS n 
1  290  SER n 
1  291  LEU n 
1  292  TRP n 
1  293  ASN n 
1  294  TYR n 
1  295  ASP n 
1  296  TYR n 
1  297  ALA n 
1  298  PRO n 
1  299  PRO n 
1  300  PRO n 
1  301  PRO n 
1  302  PRO n 
1  303  GLU n 
1  304  GLN n 
1  305  CYS n 
1  306  LEU n 
1  307  SER n 
1  308  ASP n 
1  309  ASP n 
1  310  GLU n 
1  311  ILE n 
1  312  THR n 
1  313  MET n 
1  314  MET n 
1  315  ALA n 
1  316  PRO n 
1  317  VAL n 
1  318  GLU n 
1  319  SER n 
1  320  LYS n 
1  321  PHE n 
1  322  SER n 
1  323  GLN n 
1  324  SER n 
1  325  THR n 
1  326  GLY n 
1  327  ASP n 
1  328  ILE n 
1  329  ASP n 
1  330  LYS n 
1  331  VAL n 
1  332  THR n 
1  333  ASP n 
1  334  THR n 
1  335  LYS n 
1  336  PRO n 
1  337  ARG n 
1  338  VAL n 
1  339  ALA n 
1  340  GLU n 
1  341  TRP n 
1  342  ARG n 
1  343  TYR n 
1  344  GLY n 
1  345  PRO n 
1  346  ALA n 
1  347  ARG n 
1  348  LEU n 
1  349  TRP n 
1  350  TYR n 
1  351  ASP n 
1  352  MET n 
1  353  LEU n 
1  354  GLY n 
1  355  VAL n 
1  356  PRO n 
1  357  GLU n 
1  358  ASP n 
1  359  GLY n 
1  360  SER n 
1  361  GLY n 
1  362  PHE n 
1  363  ASP n 
1  364  TYR n 
1  365  GLY n 
1  366  PHE n 
1  367  LYS n 
1  368  LEU n 
1  369  ARG n 
1  370  LYS n 
1  371  THR n 
1  372  GLU n 
1  373  HIS n 
1  374  GLU n 
1  375  PRO n 
1  376  VAL n 
1  377  ILE n 
1  378  LYS n 
1  379  SER n 
1  380  ARG n 
1  381  MET n 
1  382  ILE n 
1  383  GLU n 
1  384  GLU n 
1  385  PHE n 
1  386  ARG n 
1  387  LYS n 
1  388  LEU n 
1  389  GLU n 
1  390  GLU n 
1  391  ASN n 
1  392  ASN n 
1  393  GLY n 
1  394  THR n 
1  395  ASP n 
1  396  LEU n 
1  397  LEU n 
1  398  ALA n 
1  399  ASP n 
1  400  GLU n 
1  401  ASN n 
1  402  PHE n 
1  403  LEU n 
1  404  MET n 
1  405  VAL n 
1  406  THR n 
1  407  GLN n 
1  408  LEU n 
1  409  HIS n 
1  410  TRP n 
1  411  GLU n 
1  412  ASP n 
1  413  ASP n 
1  414  ILE n 
1  415  ILE n 
1  416  TRP n 
1  417  ASP n 
1  418  GLY n 
1  419  GLU n 
1  420  ASP n 
1  421  VAL n 
1  422  LYS n 
1  423  HIS n 
1  424  LYS n 
1  425  GLY n 
1  426  THR n 
1  427  LYS n 
1  428  PRO n 
1  429  GLN n 
1  430  ARG n 
1  431  ALA n 
1  432  SER n 
1  433  LEU n 
1  434  ALA n 
1  435  GLY n 
1  436  TRP n 
1  437  LEU n 
1  438  PRO n 
1  439  SER n 
1  440  SER n 
1  441  MET n 
1  442  THR n 
1  443  ARG n 
1  444  ASN n 
1  445  ALA n 
1  446  MET n 
1  447  ALA n 
1  448  TYR n 
1  449  ASN n 
1  450  VAL n 
1  451  GLN n 
1  452  GLN n 
1  453  GLY n 
1  454  PHE n 
1  455  ALA n 
1  456  ALA n 
1  457  THR n 
1  458  LEU n 
1  459  ASP n 
1  460  ASP n 
1  461  ASP n 
1  462  LYS n 
1  463  PRO n 
1  464  TRP n 
1  465  TYR n 
1  466  SER n 
1  467  ILE n 
1  468  PHE n 
1  469  PRO n 
1  470  ILE n 
1  471  ASP n 
1  472  ASN n 
1  473  GLU n 
1  474  ASP n 
1  475  LEU n 
1  476  VAL n 
1  477  TYR n 
1  478  GLY n 
1  479  ARG n 
1  480  TRP n 
1  481  GLU n 
1  482  ASP n 
1  483  ASN n 
1  484  ILE n 
1  485  ILE n 
1  486  TRP n 
1  487  ASP n 
1  488  ALA n 
1  489  GLN n 
1  490  ALA n 
1  491  MET n 
1  492  PRO n 
1  493  ARG n 
1  494  LEU n 
1  495  LEU n 
1  496  GLU n 
1  497  PRO n 
1  498  PRO n 
1  499  VAL n 
1  500  LEU n 
1  501  THR n 
1  502  LEU n 
1  503  ASP n 
1  504  PRO n 
1  505  ASN n 
1  506  ASP n 
1  507  GLU n 
1  508  ASN n 
1  509  LEU n 
1  510  ILE n 
1  511  LEU n 
1  512  GLU n 
1  513  ILE n 
1  514  PRO n 
1  515  ASP n 
1  516  GLU n 
1  517  LYS n 
1  518  GLU n 
1  519  GLU n 
1  520  ALA n 
1  521  THR n 
1  522  SER n 
1  523  ASN n 
1  524  SER n 
1  525  PRO n 
1  526  SER n 
1  527  LYS n 
1  528  GLU n 
1  529  SER n 
1  530  LYS n 
1  531  LYS n 
1  532  GLU n 
1  533  SER n 
1  534  SER n 
1  535  LEU n 
1  536  LYS n 
1  537  LYS n 
1  538  SER n 
1  539  ARG n 
1  540  ILE n 
1  541  LEU n 
1  542  LEU n 
1  543  GLY n 
1  544  LYS n 
1  545  THR n 
1  546  GLY n 
1  547  VAL n 
1  548  ILE n 
1  549  LYS n 
1  550  GLU n 
1  551  GLU n 
1  552  PRO n 
1  553  GLN n 
1  554  GLN n 
1  555  ASN n 
1  556  MET n 
1  557  SER n 
1  558  GLN n 
1  559  PRO n 
1  560  GLU n 
1  561  VAL n 
1  562  LYS n 
1  563  ASP n 
1  564  PRO n 
1  565  TRP n 
1  566  ASN n 
1  567  LEU n 
1  568  SER n 
1  569  ASN n 
1  570  ASP n 
1  571  GLU n 
1  572  TYR n 
1  573  TYR n 
1  574  TYR n 
1  575  PRO n 
1  576  LYS n 
1  577  GLN n 
1  578  GLN n 
1  579  GLY n 
1  580  LEU n 
1  581  ARG n 
1  582  GLY n 
1  583  THR n 
1  584  PHE n 
1  585  GLY n 
1  586  GLY n 
1  587  ASN n 
1  588  ILE n 
1  589  ILE n 
1  590  GLN n 
1  591  HIS n 
1  592  SER n 
1  593  ILE n 
1  594  PRO n 
1  595  ALA n 
1  596  VAL n 
1  597  GLU n 
1  598  LEU n 
1  599  ARG n 
1  600  GLN n 
1  601  PRO n 
1  602  PHE n 
1  603  PHE n 
1  604  PRO n 
1  605  THR n 
1  606  HIS n 
1  607  MET n 
1  608  GLY n 
1  609  PRO n 
1  610  ILE n 
1  611  LYS n 
1  612  LEU n 
1  613  ARG n 
1  614  GLN n 
1  615  PHE n 
1  616  HIS n 
1  617  ARG n 
1  618  PRO n 
1  619  PRO n 
1  620  LEU n 
1  621  LYS n 
1  622  LYS n 
1  623  TYR n 
1  624  SER n 
1  625  PHE n 
1  626  GLY n 
1  627  ALA n 
1  628  LEU n 
1  629  SER n 
1  630  GLN n 
1  631  PRO n 
1  632  GLY n 
1  633  PRO n 
1  634  HIS n 
1  635  SER n 
1  636  VAL n 
1  637  GLN n 
1  638  PRO n 
1  639  LEU n 
1  640  LEU n 
1  641  LYS n 
1  642  HIS n 
1  643  ILE n 
1  644  LYS n 
1  645  LYS n 
1  646  LYS n 
1  647  ALA n 
1  648  LYS n 
1  649  MET n 
1  650  ARG n 
1  651  GLU n 
1  652  GLN n 
1  653  GLU n 
1  654  ARG n 
1  655  GLN n 
1  656  ALA n 
1  657  SER n 
1  658  GLY n 
1  659  GLY n 
1  660  GLY n 
1  661  GLU n 
1  662  MET n 
1  663  PHE n 
1  664  PHE n 
1  665  MET n 
1  666  ARG n 
1  667  THR n 
1  668  PRO n 
1  669  GLN n 
1  670  ASP n 
1  671  LEU n 
1  672  THR n 
1  673  GLY n 
1  674  LYS n 
1  675  ASP n 
1  676  GLY n 
1  677  ASP n 
1  678  LEU n 
1  679  ILE n 
1  680  LEU n 
1  681  ALA n 
1  682  GLU n 
1  683  TYR n 
1  684  SER n 
1  685  GLU n 
1  686  GLU n 
1  687  ASN n 
1  688  GLY n 
1  689  PRO n 
1  690  LEU n 
1  691  MET n 
1  692  MET n 
1  693  GLN n 
1  694  VAL n 
1  695  GLY n 
1  696  MET n 
1  697  ALA n 
1  698  THR n 
1  699  LYS n 
1  700  ILE n 
1  701  LYS n 
1  702  ASN n 
1  703  TYR n 
1  704  TYR n 
1  705  LYS n 
1  706  ARG n 
1  707  LYS n 
1  708  PRO n 
1  709  GLY n 
1  710  LYS n 
1  711  ASP n 
1  712  PRO n 
1  713  GLY n 
1  714  ALA n 
1  715  PRO n 
1  716  ASP n 
1  717  CYS n 
1  718  LYS n 
1  719  TYR n 
1  720  GLY n 
1  721  GLU n 
1  722  THR n 
1  723  VAL n 
1  724  TYR n 
1  725  CYS n 
1  726  HIS n 
1  727  THR n 
1  728  SER n 
1  729  PRO n 
1  730  PHE n 
1  731  LEU n 
1  732  GLY n 
1  733  SER n 
1  734  LEU n 
1  735  HIS n 
1  736  PRO n 
1  737  GLY n 
1  738  GLN n 
1  739  LEU n 
1  740  LEU n 
1  741  GLN n 
1  742  ALA n 
1  743  PHE n 
1  744  GLU n 
1  745  ASN n 
1  746  ASN n 
1  747  LEU n 
1  748  PHE n 
1  749  ARG n 
1  750  ALA n 
1  751  PRO n 
1  752  ILE n 
1  753  TYR n 
1  754  LEU n 
1  755  HIS n 
1  756  LYS n 
1  757  MET n 
1  758  PRO n 
1  759  GLU n 
1  760  THR n 
1  761  ASP n 
1  762  PHE n 
1  763  LEU n 
1  764  ILE n 
1  765  ILE n 
1  766  ARG n 
1  767  THR n 
1  768  ARG n 
1  769  GLN n 
1  770  GLY n 
1  771  TYR n 
1  772  TYR n 
1  773  ILE n 
1  774  ARG n 
1  775  GLU n 
1  776  LEU n 
1  777  VAL n 
1  778  ASP n 
1  779  ILE n 
1  780  PHE n 
1  781  VAL n 
1  782  VAL n 
1  783  GLY n 
1  784  GLN n 
1  785  GLN n 
1  786  CYS n 
1  787  PRO n 
1  788  LEU n 
1  789  PHE n 
1  790  GLU n 
1  791  VAL n 
1  792  PRO n 
1  793  GLY n 
1  794  PRO n 
1  795  ASN n 
1  796  SER n 
1  797  LYS n 
1  798  ARG n 
1  799  ALA n 
1  800  ASN n 
1  801  THR n 
1  802  HIS n 
1  803  ILE n 
1  804  ARG n 
1  805  ASP n 
1  806  PHE n 
1  807  LEU n 
1  808  GLN n 
1  809  VAL n 
1  810  PHE n 
1  811  ILE n 
1  812  TYR n 
1  813  ARG n 
1  814  LEU n 
1  815  PHE n 
1  816  TRP n 
1  817  LYS n 
1  818  SER n 
1  819  LYS n 
1  820  ASP n 
1  821  ARG n 
1  822  PRO n 
1  823  ARG n 
1  824  ARG n 
1  825  ILE n 
1  826  ARG n 
1  827  MET n 
1  828  GLU n 
1  829  ASP n 
1  830  ILE n 
1  831  LYS n 
1  832  LYS n 
1  833  ALA n 
1  834  PHE n 
1  835  PRO n 
1  836  SER n 
1  837  HIS n 
1  838  SER n 
1  839  GLU n 
1  840  SER n 
1  841  SER n 
1  842  ILE n 
1  843  ARG n 
1  844  LYS n 
1  845  ARG n 
1  846  LEU n 
1  847  LYS n 
1  848  LEU n 
1  849  CYS n 
1  850  ALA n 
1  851  ASP n 
1  852  PHE n 
1  853  LYS n 
1  854  ARG n 
1  855  THR n 
1  856  GLY n 
1  857  MET n 
1  858  ASP n 
1  859  SER n 
1  860  ASN n 
1  861  TRP n 
1  862  TRP n 
1  863  VAL n 
1  864  LEU n 
1  865  LYS n 
1  866  SER n 
1  867  ASP n 
1  868  PHE n 
1  869  ARG n 
1  870  LEU n 
1  871  PRO n 
1  872  THR n 
1  873  GLU n 
1  874  GLU n 
1  875  GLU n 
1  876  ILE n 
1  877  ARG n 
1  878  ALA n 
1  879  MET n 
1  880  VAL n 
1  881  SER n 
1  882  PRO n 
1  883  GLU n 
1  884  GLN n 
1  885  CYS n 
1  886  CYS n 
1  887  ALA n 
1  888  TYR n 
1  889  TYR n 
1  890  SER n 
1  891  MET n 
1  892  ILE n 
1  893  ALA n 
1  894  ALA n 
1  895  GLU n 
1  896  GLN n 
1  897  ARG n 
1  898  LEU n 
1  899  LYS n 
1  900  ASP n 
1  901  ALA n 
1  902  GLY n 
1  903  TYR n 
1  904  GLY n 
1  905  GLU n 
1  906  LYS n 
1  907  SER n 
1  908  PHE n 
1  909  PHE n 
1  910  ALA n 
1  911  PRO n 
1  912  GLU n 
1  913  GLU n 
1  914  GLU n 
1  915  ASN n 
1  916  GLU n 
1  917  GLU n 
1  918  ASP n 
1  919  PHE n 
1  920  GLN n 
1  921  MET n 
1  922  LYS n 
1  923  ILE n 
1  924  ASP n 
1  925  ASP n 
1  926  GLU n 
1  927  VAL n 
1  928  ARG n 
1  929  THR n 
1  930  ALA n 
1  931  PRO n 
1  932  TRP n 
1  933  ASN n 
1  934  THR n 
1  935  THR n 
1  936  ARG n 
1  937  ALA n 
1  938  PHE n 
1  939  ILE n 
1  940  ALA n 
1  941  ALA n 
1  942  MET n 
1  943  LYS n 
1  944  GLY n 
1  945  LYS n 
1  946  CYS n 
1  947  LEU n 
1  948  LEU n 
1  949  GLU n 
1  950  VAL n 
1  951  THR n 
1  952  GLY n 
1  953  VAL n 
1  954  ALA n 
1  955  ASP n 
1  956  PRO n 
1  957  THR n 
1  958  GLY n 
1  959  CYS n 
1  960  GLY n 
1  961  GLU n 
1  962  GLY n 
1  963  PHE n 
1  964  SER n 
1  965  TYR n 
1  966  VAL n 
1  967  LYS n 
1  968  ILE n 
1  969  PRO n 
1  970  ASN n 
1  971  LYS n 
1  972  PRO n 
1  973  THR n 
1  974  GLN n 
1  975  GLN n 
1  976  LYS n 
1  977  ASP n 
1  978  ASP n 
1  979  LYS n 
1  980  GLU n 
1  981  PRO n 
1  982  GLN n 
1  983  PRO n 
1  984  VAL n 
1  985  LYS n 
1  986  LYS n 
1  987  THR n 
1  988  VAL n 
1  989  THR n 
1  990  GLY n 
1  991  THR n 
1  992  ASP n 
1  993  ALA n 
1  994  ASP n 
1  995  LEU n 
1  996  ARG n 
1  997  ARG n 
1  998  LEU n 
1  999  SER n 
1  1000 LEU n 
1  1001 LYS n 
1  1002 ASN n 
1  1003 ALA n 
1  1004 LYS n 
1  1005 GLN n 
1  1006 LEU n 
1  1007 LEU n 
1  1008 ARG n 
1  1009 LYS n 
1  1010 PHE n 
1  1011 GLY n 
1  1012 VAL n 
1  1013 PRO n 
1  1014 GLU n 
1  1015 GLU n 
1  1016 GLU n 
1  1017 ILE n 
1  1018 LYS n 
1  1019 LYS n 
1  1020 LEU n 
1  1021 SER n 
1  1022 ARG n 
1  1023 TRP n 
1  1024 GLU n 
1  1025 VAL n 
1  1026 ILE n 
1  1027 ASP n 
1  1028 VAL n 
1  1029 VAL n 
1  1030 ARG n 
1  1031 THR n 
1  1032 MET n 
1  1033 SER n 
1  1034 THR n 
1  1035 GLU n 
1  1036 GLN n 
1  1037 ALA n 
1  1038 ARG n 
1  1039 SER n 
1  1040 GLY n 
1  1041 GLU n 
1  1042 GLY n 
1  1043 PRO n 
1  1044 MET n 
1  1045 SER n 
1  1046 LYS n 
1  1047 PHE n 
1  1048 ALA n 
1  1049 ARG n 
1  1050 GLY n 
1  1051 SER n 
1  1052 ARG n 
1  1053 PHE n 
1  1054 SER n 
1  1055 VAL n 
1  1056 ALA n 
1  1057 GLU n 
1  1058 HIS n 
1  1059 GLN n 
1  1060 GLU n 
1  1061 ARG n 
1  1062 TYR n 
1  1063 LYS n 
1  1064 GLU n 
1  1065 GLU n 
1  1066 CYS n 
1  1067 GLN n 
1  1068 ARG n 
1  1069 ILE n 
1  1070 PHE n 
1  1071 ASP n 
1  1072 LEU n 
1  1073 GLN n 
1  1074 ASN n 
1  1075 LYS n 
1  1076 VAL n 
1  1077 LEU n 
1  1078 SER n 
1  1079 SER n 
1  1080 THR n 
1  1081 GLU n 
1  1082 VAL n 
1  1083 LEU n 
1  1084 SER n 
1  1085 THR n 
1  1086 ASP n 
1  1087 THR n 
1  1088 ASP n 
1  1089 SER n 
1  1090 SER n 
1  1091 SER n 
1  1092 ALA n 
1  1093 GLU n 
1  1094 ASP n 
1  1095 SER n 
1  1096 ASP n 
1  1097 PHE n 
1  1098 GLU n 
1  1099 GLU n 
1  1100 MET n 
1  1101 GLY n 
1  1102 LYS n 
1  1103 ASN n 
1  1104 ILE n 
1  1105 GLU n 
1  1106 ASN n 
1  1107 MET n 
1  1108 LEU n 
1  1109 GLN n 
1  1110 ASN n 
1  1111 LYS n 
1  1112 LYS n 
1  1113 THR n 
1  1114 SER n 
1  1115 SER n 
1  1116 GLN n 
1  1117 LEU n 
1  1118 SER n 
1  1119 ARG n 
1  1120 GLU n 
1  1121 ARG n 
1  1122 GLU n 
1  1123 GLU n 
1  1124 GLN n 
1  1125 GLU n 
1  1126 ARG n 
1  1127 LYS n 
1  1128 GLU n 
1  1129 LEU n 
1  1130 GLN n 
1  1131 ARG n 
1  1132 MET n 
1  1133 LEU n 
1  1134 LEU n 
1  1135 ALA n 
1  1136 ALA n 
1  1137 GLY n 
1  1138 SER n 
1  1139 ALA n 
1  1140 ALA n 
1  1141 SER n 
1  1142 GLY n 
1  1143 ASN n 
1  1144 ASN n 
1  1145 HIS n 
1  1146 ARG n 
1  1147 ASP n 
1  1148 ASP n 
1  1149 ASP n 
1  1150 THR n 
1  1151 ALA n 
1  1152 SER n 
1  1153 VAL n 
1  1154 THR n 
1  1155 SER n 
1  1156 LEU n 
1  1157 ASN n 
1  1158 SER n 
1  1159 SER n 
1  1160 ALA n 
1  1161 THR n 
1  1162 GLY n 
1  1163 ARG n 
1  1164 CYS n 
1  1165 LEU n 
1  1166 LYS n 
1  1167 ILE n 
1  1168 TYR n 
1  1169 ARG n 
1  1170 THR n 
1  1171 PHE n 
1  1172 ARG n 
1  1173 ASP n 
1  1174 GLU n 
1  1175 GLU n 
1  1176 GLY n 
1  1177 LYS n 
1  1178 GLU n 
1  1179 TYR n 
1  1180 VAL n 
1  1181 ARG n 
1  1182 CYS n 
1  1183 GLU n 
1  1184 THR n 
1  1185 VAL n 
1  1186 ARG n 
1  1187 LYS n 
1  1188 PRO n 
1  1189 ALA n 
1  1190 VAL n 
1  1191 ILE n 
1  1192 ASP n 
1  1193 ALA n 
1  1194 TYR n 
1  1195 VAL n 
1  1196 ARG n 
1  1197 ILE n 
1  1198 ARG n 
1  1199 THR n 
1  1200 THR n 
1  1201 LYS n 
1  1202 ASP n 
1  1203 GLU n 
1  1204 GLU n 
1  1205 PHE n 
1  1206 ILE n 
1  1207 ARG n 
1  1208 LYS n 
1  1209 PHE n 
1  1210 ALA n 
1  1211 LEU n 
1  1212 PHE n 
1  1213 ASP n 
1  1214 GLU n 
1  1215 GLN n 
1  1216 HIS n 
1  1217 ARG n 
1  1218 GLU n 
1  1219 GLU n 
1  1220 MET n 
1  1221 ARG n 
1  1222 LYS n 
1  1223 GLU n 
1  1224 ARG n 
1  1225 ARG n 
1  1226 ARG n 
1  1227 ILE n 
1  1228 GLN n 
1  1229 GLU n 
1  1230 GLN n 
1  1231 LEU n 
1  1232 ARG n 
1  1233 ARG n 
1  1234 LEU n 
1  1235 LYS n 
1  1236 ARG n 
1  1237 ASN n 
1  1238 GLN n 
1  1239 GLU n 
1  1240 LYS n 
1  1241 GLU n 
1  1242 LYS n 
1  1243 LEU n 
1  1244 LYS n 
1  1245 GLY n 
1  1246 PRO n 
1  1247 PRO n 
1  1248 GLU n 
1  1249 LYS n 
1  1250 LYS n 
1  1251 PRO n 
1  1252 LYS n 
1  1253 LYS n 
1  1254 MET n 
1  1255 LYS n 
1  1256 GLU n 
1  1257 ARG n 
1  1258 PRO n 
1  1259 ASP n 
1  1260 LEU n 
1  1261 LYS n 
1  1262 LEU n 
1  1263 LYS n 
1  1264 CYS n 
1  1265 GLY n 
1  1266 ALA n 
1  1267 CYS n 
1  1268 GLY n 
1  1269 ALA n 
1  1270 ILE n 
1  1271 GLY n 
1  1272 HIS n 
1  1273 MET n 
1  1274 ARG n 
1  1275 THR n 
1  1276 ASN n 
1  1277 LYS n 
1  1278 PHE n 
1  1279 CYS n 
1  1280 PRO n 
1  1281 LEU n 
1  1282 TYR n 
1  1283 TYR n 
1  1284 GLN n 
1  1285 THR n 
1  1286 ASN n 
1  1287 ALA n 
1  1288 PRO n 
1  1289 PRO n 
1  1290 SER n 
1  1291 ASN n 
1  1292 PRO n 
1  1293 VAL n 
1  1294 ALA n 
1  1295 MET n 
1  1296 THR n 
1  1297 GLU n 
1  1298 GLU n 
1  1299 GLN n 
1  1300 GLU n 
1  1301 GLU n 
1  1302 GLU n 
1  1303 LEU n 
1  1304 GLU n 
1  1305 LYS n 
1  1306 THR n 
1  1307 VAL n 
1  1308 ILE n 
1  1309 HIS n 
1  1310 ASN n 
1  1311 ASP n 
1  1312 ASN n 
1  1313 GLU n 
1  1314 GLU n 
1  1315 LEU n 
1  1316 ILE n 
1  1317 LYS n 
1  1318 VAL n 
1  1319 GLU n 
1  1320 GLY n 
1  1321 THR n 
1  1322 LYS n 
1  1323 ILE n 
1  1324 VAL n 
1  1325 LEU n 
1  1326 GLY n 
1  1327 LYS n 
1  1328 GLN n 
1  1329 LEU n 
1  1330 ILE n 
1  1331 GLU n 
1  1332 SER n 
1  1333 ALA n 
1  1334 ASP n 
1  1335 GLU n 
1  1336 VAL n 
1  1337 ARG n 
1  1338 ARG n 
1  1339 LYS n 
1  1340 SER n 
1  1341 LEU n 
1  1342 VAL n 
1  1343 LEU n 
1  1344 LYS n 
1  1345 PHE n 
1  1346 PRO n 
1  1347 LYS n 
1  1348 GLN n 
1  1349 GLN n 
1  1350 LEU n 
1  1351 PRO n 
1  1352 PRO n 
1  1353 LYS n 
1  1354 LYS n 
1  1355 LYS n 
1  1356 ARG n 
1  1357 ARG n 
1  1358 VAL n 
1  1359 GLY n 
1  1360 THR n 
1  1361 THR n 
1  1362 VAL n 
1  1363 HIS n 
1  1364 CYS n 
1  1365 ASP n 
1  1366 TYR n 
1  1367 LEU n 
1  1368 ASN n 
1  1369 ARG n 
1  1370 PRO n 
1  1371 HIS n 
1  1372 LYS n 
1  1373 SER n 
1  1374 ILE n 
1  1375 HIS n 
1  1376 ARG n 
1  1377 ARG n 
1  1378 ARG n 
1  1379 THR n 
1  1380 ASP n 
1  1381 PRO n 
1  1382 MET n 
1  1383 VAL n 
1  1384 THR n 
1  1385 LEU n 
1  1386 SER n 
1  1387 SER n 
1  1388 ILE n 
1  1389 LEU n 
1  1390 GLU n 
1  1391 SER n 
1  1392 ILE n 
1  1393 ILE n 
1  1394 ASN n 
1  1395 ASP n 
1  1396 MET n 
1  1397 ARG n 
1  1398 ASP n 
1  1399 LEU n 
1  1400 PRO n 
1  1401 ASN n 
1  1402 THR n 
1  1403 TYR n 
1  1404 PRO n 
1  1405 PHE n 
1  1406 HIS n 
1  1407 THR n 
1  1408 PRO n 
1  1409 VAL n 
1  1410 ASN n 
1  1411 ALA n 
1  1412 LYS n 
1  1413 VAL n 
1  1414 VAL n 
1  1415 LYS n 
1  1416 ASP n 
1  1417 TYR n 
1  1418 TYR n 
1  1419 LYS n 
1  1420 ILE n 
1  1421 ILE n 
1  1422 THR n 
1  1423 ARG n 
1  1424 PRO n 
1  1425 MET n 
1  1426 ASP n 
1  1427 LEU n 
1  1428 GLN n 
1  1429 THR n 
1  1430 LEU n 
1  1431 ARG n 
1  1432 GLU n 
1  1433 ASN n 
1  1434 VAL n 
1  1435 ARG n 
1  1436 LYS n 
1  1437 ARG n 
1  1438 LEU n 
1  1439 TYR n 
1  1440 PRO n 
1  1441 SER n 
1  1442 ARG n 
1  1443 GLU n 
1  1444 GLU n 
1  1445 PHE n 
1  1446 ARG n 
1  1447 GLU n 
1  1448 HIS n 
1  1449 LEU n 
1  1450 GLU n 
1  1451 LEU n 
1  1452 ILE n 
1  1453 VAL n 
1  1454 LYS n 
1  1455 ASN n 
1  1456 SER n 
1  1457 ALA n 
1  1458 THR n 
1  1459 TYR n 
1  1460 ASN n 
1  1461 GLY n 
1  1462 PRO n 
1  1463 LYS n 
1  1464 HIS n 
1  1465 SER n 
1  1466 LEU n 
1  1467 THR n 
1  1468 GLN n 
1  1469 ILE n 
1  1470 SER n 
1  1471 GLN n 
1  1472 SER n 
1  1473 MET n 
1  1474 LEU n 
1  1475 ASP n 
1  1476 LEU n 
1  1477 CYS n 
1  1478 ASP n 
1  1479 GLU n 
1  1480 LYS n 
1  1481 LEU n 
1  1482 LYS n 
1  1483 GLU n 
1  1484 LYS n 
1  1485 GLU n 
1  1486 ASP n 
1  1487 LYS n 
1  1488 LEU n 
1  1489 ALA n 
1  1490 ARG n 
1  1491 LEU n 
1  1492 GLU n 
1  1493 LYS n 
1  1494 ALA n 
1  1495 ILE n 
1  1496 ASN n 
1  1497 PRO n 
1  1498 LEU n 
1  1499 LEU n 
1  1500 ASP n 
1  1501 ASP n 
1  1502 ASP n 
1  1503 ASP n 
1  1504 GLN n 
1  1505 VAL n 
1  1506 ALA n 
1  1507 PHE n 
1  1508 SER n 
1  1509 PHE n 
1  1510 ILE n 
1  1511 LEU n 
1  1512 ASP n 
1  1513 ASN n 
1  1514 ILE n 
1  1515 VAL n 
1  1516 THR n 
1  1517 GLN n 
1  1518 LYS n 
1  1519 MET n 
1  1520 MET n 
1  1521 ALA n 
1  1522 VAL n 
1  1523 PRO n 
1  1524 ASP n 
1  1525 SER n 
1  1526 TRP n 
1  1527 PRO n 
1  1528 PHE n 
1  1529 HIS n 
1  1530 HIS n 
1  1531 PRO n 
1  1532 VAL n 
1  1533 ASN n 
1  1534 LYS n 
1  1535 LYS n 
1  1536 PHE n 
1  1537 VAL n 
1  1538 PRO n 
1  1539 ASP n 
1  1540 TYR n 
1  1541 TYR n 
1  1542 LYS n 
1  1543 VAL n 
1  1544 ILE n 
1  1545 VAL n 
1  1546 ASN n 
1  1547 PRO n 
1  1548 MET n 
1  1549 ASP n 
1  1550 LEU n 
1  1551 GLU n 
1  1552 THR n 
1  1553 ILE n 
1  1554 ARG n 
1  1555 LYS n 
1  1556 ASN n 
1  1557 ILE n 
1  1558 SER n 
1  1559 LYS n 
1  1560 HIS n 
1  1561 LYS n 
1  1562 TYR n 
1  1563 GLN n 
1  1564 SER n 
1  1565 ARG n 
1  1566 GLU n 
1  1567 SER n 
1  1568 PHE n 
1  1569 LEU n 
1  1570 ASP n 
1  1571 ASP n 
1  1572 VAL n 
1  1573 ASN n 
1  1574 LEU n 
1  1575 ILE n 
1  1576 LEU n 
1  1577 ALA n 
1  1578 ASN n 
1  1579 SER n 
1  1580 VAL n 
1  1581 LYS n 
1  1582 TYR n 
1  1583 ASN n 
1  1584 GLY n 
1  1585 PRO n 
1  1586 GLU n 
1  1587 SER n 
1  1588 GLN n 
1  1589 TYR n 
1  1590 THR n 
1  1591 LYS n 
1  1592 THR n 
1  1593 ALA n 
1  1594 GLN n 
1  1595 GLU n 
1  1596 ILE n 
1  1597 VAL n 
1  1598 ASN n 
1  1599 VAL n 
1  1600 CYS n 
1  1601 TYR n 
1  1602 GLN n 
1  1603 THR n 
1  1604 LEU n 
1  1605 THR n 
1  1606 GLU n 
1  1607 TYR n 
1  1608 ASP n 
1  1609 GLU n 
1  1610 HIS n 
1  1611 LEU n 
1  1612 THR n 
1  1613 GLN n 
1  1614 LEU n 
1  1615 GLU n 
1  1616 LYS n 
1  1617 ASP n 
1  1618 ILE n 
1  1619 CYS n 
1  1620 THR n 
1  1621 ALA n 
1  1622 LYS n 
1  1623 GLU n 
1  1624 ALA n 
1  1625 ALA n 
1  1626 LEU n 
1  1627 GLU n 
1  1628 GLU n 
1  1629 ALA n 
1  1630 GLU n 
1  1631 LEU n 
1  1632 GLU n 
1  1633 SER n 
1  1634 LEU n 
1  1635 ASP n 
1  1636 PRO n 
1  1637 MET n 
1  1638 THR n 
1  1639 PRO n 
1  1640 GLY n 
1  1641 PRO n 
1  1642 TYR n 
1  1643 THR n 
1  1644 PRO n 
1  1645 GLN n 
1  1646 PRO n 
1  1647 PRO n 
1  1648 ASP n 
1  1649 LEU n 
1  1650 TYR n 
1  1651 ASP n 
1  1652 THR n 
1  1653 ASN n 
1  1654 THR n 
1  1655 SER n 
1  1656 LEU n 
1  1657 SER n 
1  1658 MET n 
1  1659 SER n 
1  1660 ARG n 
1  1661 ASP n 
1  1662 ALA n 
1  1663 SER n 
1  1664 VAL n 
1  1665 PHE n 
1  1666 GLN n 
1  1667 ASP n 
1  1668 GLU n 
1  1669 SER n 
1  1670 ASN n 
1  1671 MET n 
1  1672 SER n 
1  1673 VAL n 
1  1674 LEU n 
1  1675 ASP n 
1  1676 ILE n 
1  1677 PRO n 
1  1678 SER n 
1  1679 ALA n 
1  1680 THR n 
1  1681 PRO n 
1  1682 GLU n 
1  1683 LYS n 
1  1684 GLN n 
1  1685 VAL n 
1  1686 THR n 
1  1687 GLN n 
1  1688 GLU n 
1  1689 GLY n 
1  1690 GLU n 
1  1691 ASP n 
1  1692 GLY n 
1  1693 ASP n 
1  1694 GLY n 
1  1695 ASP n 
1  1696 LEU n 
1  1697 ALA n 
1  1698 ASP n 
1  1699 GLU n 
1  1700 GLU n 
1  1701 GLU n 
1  1702 GLY n 
1  1703 THR n 
1  1704 VAL n 
1  1705 GLN n 
1  1706 GLN n 
1  1707 PRO n 
1  1708 GLN n 
1  1709 ALA n 
1  1710 SER n 
1  1711 VAL n 
1  1712 LEU n 
1  1713 TYR n 
1  1714 GLU n 
1  1715 ASP n 
1  1716 LEU n 
1  1717 LEU n 
1  1718 MET n 
1  1719 SER n 
1  1720 GLU n 
1  1721 GLY n 
1  1722 GLU n 
1  1723 ASP n 
1  1724 ASP n 
1  1725 GLU n 
1  1726 GLU n 
1  1727 ASP n 
1  1728 ALA n 
1  1729 GLY n 
1  1730 SER n 
1  1731 ASP n 
1  1732 GLU n 
1  1733 GLU n 
1  1734 GLY n 
1  1735 ASP n 
1  1736 ASN n 
1  1737 PRO n 
1  1738 PHE n 
1  1739 SER n 
1  1740 ALA n 
1  1741 ILE n 
1  1742 GLN n 
1  1743 LEU n 
1  1744 SER n 
1  1745 GLU n 
1  1746 SER n 
1  1747 GLY n 
1  1748 SER n 
1  1749 ASP n 
1  1750 SER n 
1  1751 ASP n 
1  1752 VAL n 
1  1753 GLY n 
1  1754 SER n 
1  1755 GLY n 
1  1756 GLY n 
1  1757 ILE n 
1  1758 ARG n 
1  1759 PRO n 
1  1760 LYS n 
1  1761 GLN n 
1  1762 PRO n 
1  1763 ARG n 
1  1764 MET n 
1  1765 LEU n 
1  1766 GLN n 
1  1767 GLU n 
1  1768 ASN n 
1  1769 THR n 
1  1770 ARG n 
1  1771 MET n 
1  1772 ASP n 
1  1773 MET n 
1  1774 GLU n 
1  1775 ASN n 
1  1776 GLU n 
1  1777 GLU n 
1  1778 SER n 
1  1779 MET n 
1  1780 MET n 
1  1781 SER n 
1  1782 TYR n 
1  1783 GLU n 
1  1784 GLY n 
1  1785 ASP n 
1  1786 GLY n 
1  1787 GLY n 
1  1788 GLU n 
1  1789 ALA n 
1  1790 SER n 
1  1791 HIS n 
1  1792 GLY n 
1  1793 LEU n 
1  1794 GLU n 
1  1795 ASP n 
1  1796 SER n 
1  1797 ASN n 
1  1798 ILE n 
1  1799 SER n 
1  1800 TYR n 
1  1801 GLY n 
1  1802 SER n 
1  1803 TYR n 
1  1804 GLU n 
1  1805 GLU n 
1  1806 PRO n 
1  1807 ASP n 
1  1808 PRO n 
1  1809 LYS n 
1  1810 SER n 
1  1811 ASN n 
1  1812 THR n 
1  1813 GLN n 
1  1814 ASP n 
1  1815 THR n 
1  1816 SER n 
1  1817 PHE n 
1  1818 SER n 
1  1819 SER n 
1  1820 ILE n 
1  1821 GLY n 
1  1822 GLY n 
1  1823 TYR n 
1  1824 GLU n 
1  1825 VAL n 
1  1826 SER n 
1  1827 GLU n 
1  1828 GLU n 
1  1829 GLU n 
1  1830 GLU n 
1  1831 ASP n 
1  1832 GLU n 
1  1833 GLU n 
1  1834 GLU n 
1  1835 GLU n 
1  1836 GLU n 
1  1837 GLN n 
1  1838 ARG n 
1  1839 SER n 
1  1840 GLY n 
1  1841 PRO n 
1  1842 SER n 
1  1843 VAL n 
1  1844 LEU n 
1  1845 SER n 
1  1846 GLN n 
1  1847 VAL n 
1  1848 HIS n 
1  1849 LEU n 
1  1850 SER n 
1  1851 GLU n 
1  1852 ASP n 
1  1853 GLU n 
1  1854 GLU n 
1  1855 ASP n 
1  1856 SER n 
1  1857 GLU n 
1  1858 ASP n 
1  1859 PHE n 
1  1860 HIS n 
1  1861 SER n 
1  1862 ILE n 
1  1863 ALA n 
1  1864 GLY n 
1  1865 ASP n 
1  1866 SER n 
1  1867 ASP n 
1  1868 LEU n 
1  1869 ASP n 
1  1870 SER n 
1  1871 ASP n 
1  1872 GLU n 
2  1    MET n 
2  2    PRO n 
2  3    LEU n 
2  4    THR n 
2  5    GLY n 
2  6    VAL n 
2  7    GLU n 
2  8    PRO n 
2  9    ALA n 
2  10   ARG n 
2  11   MET n 
2  12   ASN n 
2  13   ARG n 
2  14   LYS n 
2  15   LYS n 
2  16   GLY n 
2  17   ASP n 
2  18   LYS n 
2  19   GLY n 
2  20   PHE n 
2  21   GLU n 
2  22   SER n 
2  23   PRO n 
2  24   ARG n 
2  25   PRO n 
2  26   TYR n 
2  27   LYS n 
2  28   LEU n 
2  29   THR n 
2  30   HIS n 
2  31   GLN n 
2  32   VAL n 
2  33   VAL n 
2  34   CYS n 
2  35   ILE n 
2  36   ASN n 
2  37   ASN n 
2  38   ILE n 
2  39   ASN n 
2  40   PHE n 
2  41   GLN n 
2  42   ARG n 
2  43   LYS n 
2  44   SER n 
2  45   VAL n 
2  46   VAL n 
2  47   GLY n 
2  48   PHE n 
2  49   VAL n 
2  50   GLU n 
2  51   LEU n 
2  52   THR n 
2  53   ILE n 
2  54   PHE n 
2  55   PRO n 
2  56   THR n 
2  57   VAL n 
2  58   ALA n 
2  59   ASN n 
2  60   LEU n 
2  61   ASN n 
2  62   ARG n 
2  63   ILE n 
2  64   LYS n 
2  65   LEU n 
2  66   ASN n 
2  67   SER n 
2  68   LYS n 
2  69   GLN n 
2  70   CYS n 
2  71   ARG n 
2  72   ILE n 
2  73   TYR n 
2  74   ARG n 
2  75   VAL n 
2  76   ARG n 
2  77   ILE n 
2  78   ASN n 
2  79   ASP n 
2  80   LEU n 
2  81   GLU n 
2  82   ALA n 
2  83   ALA n 
2  84   PHE n 
2  85   ILE n 
2  86   TYR n 
2  87   ASN n 
2  88   ASP n 
2  89   PRO n 
2  90   THR n 
2  91   LEU n 
2  92   GLU n 
2  93   VAL n 
2  94   CYS n 
2  95   HIS n 
2  96   SER n 
2  97   GLU n 
2  98   SER n 
2  99   LYS n 
2  100  GLN n 
2  101  ARG n 
2  102  ASN n 
2  103  LEU n 
2  104  ASN n 
2  105  TYR n 
2  106  PHE n 
2  107  SER n 
2  108  ASN n 
2  109  ALA n 
2  110  TYR n 
2  111  ALA n 
2  112  ALA n 
2  113  ALA n 
2  114  VAL n 
2  115  SER n 
2  116  ALA n 
2  117  VAL n 
2  118  ASP n 
2  119  PRO n 
2  120  ASP n 
2  121  ALA n 
2  122  GLY n 
2  123  ASN n 
2  124  GLY n 
2  125  GLU n 
2  126  LEU n 
2  127  CYS n 
2  128  ILE n 
2  129  LYS n 
2  130  VAL n 
2  131  PRO n 
2  132  SER n 
2  133  GLU n 
2  134  LEU n 
2  135  TRP n 
2  136  LYS n 
2  137  HIS n 
2  138  VAL n 
2  139  ASP n 
2  140  GLU n 
2  141  LEU n 
2  142  LYS n 
2  143  VAL n 
2  144  LEU n 
2  145  LYS n 
2  146  ILE n 
2  147  HIS n 
2  148  ILE n 
2  149  ASN n 
2  150  PHE n 
2  151  SER n 
2  152  LEU n 
2  153  ASP n 
2  154  GLN n 
2  155  PRO n 
2  156  LYS n 
2  157  GLY n 
2  158  GLY n 
2  159  LEU n 
2  160  HIS n 
2  161  PHE n 
2  162  VAL n 
2  163  VAL n 
2  164  PRO n 
2  165  SER n 
2  166  VAL n 
2  167  GLU n 
2  168  GLY n 
2  169  SER n 
2  170  MET n 
2  171  ALA n 
2  172  GLU n 
2  173  ARG n 
2  174  GLY n 
2  175  ALA n 
2  176  HIS n 
2  177  VAL n 
2  178  PHE n 
2  179  SER n 
2  180  CYS n 
2  181  GLY n 
2  182  TYR n 
2  183  GLN n 
2  184  ASN n 
2  185  SER n 
2  186  THR n 
2  187  ARG n 
2  188  PHE n 
2  189  TRP n 
2  190  PHE n 
2  191  PRO n 
2  192  CYS n 
2  193  VAL n 
2  194  ASP n 
2  195  SER n 
2  196  TYR n 
2  197  SER n 
2  198  GLU n 
2  199  LEU n 
2  200  CYS n 
2  201  THR n 
2  202  TRP n 
2  203  LYS n 
2  204  LEU n 
2  205  GLU n 
2  206  PHE n 
2  207  THR n 
2  208  VAL n 
2  209  ASP n 
2  210  ALA n 
2  211  ALA n 
2  212  MET n 
2  213  VAL n 
2  214  ALA n 
2  215  VAL n 
2  216  SER n 
2  217  ASN n 
2  218  GLY n 
2  219  ASP n 
2  220  LEU n 
2  221  VAL n 
2  222  GLU n 
2  223  THR n 
2  224  VAL n 
2  225  TYR n 
2  226  THR n 
2  227  HIS n 
2  228  ASP n 
2  229  MET n 
2  230  ARG n 
2  231  LYS n 
2  232  LYS n 
2  233  THR n 
2  234  PHE n 
2  235  HIS n 
2  236  TYR n 
2  237  MET n 
2  238  LEU n 
2  239  THR n 
2  240  ILE n 
2  241  PRO n 
2  242  THR n 
2  243  ALA n 
2  244  ALA n 
2  245  SER n 
2  246  ASN n 
2  247  ILE n 
2  248  SER n 
2  249  LEU n 
2  250  ALA n 
2  251  ILE n 
2  252  GLY n 
2  253  PRO n 
2  254  PHE n 
2  255  GLU n 
2  256  ILE n 
2  257  LEU n 
2  258  VAL n 
2  259  ASP n 
2  260  PRO n 
2  261  TYR n 
2  262  MET n 
2  263  HIS n 
2  264  GLU n 
2  265  VAL n 
2  266  THR n 
2  267  HIS n 
2  268  PHE n 
2  269  CYS n 
2  270  LEU n 
2  271  PRO n 
2  272  GLN n 
2  273  LEU n 
2  274  LEU n 
2  275  PRO n 
2  276  LEU n 
2  277  LEU n 
2  278  LYS n 
2  279  HIS n 
2  280  THR n 
2  281  THR n 
2  282  SER n 
2  283  TYR n 
2  284  LEU n 
2  285  HIS n 
2  286  GLU n 
2  287  VAL n 
2  288  PHE n 
2  289  GLU n 
2  290  PHE n 
2  291  TYR n 
2  292  GLU n 
2  293  GLU n 
2  294  ILE n 
2  295  LEU n 
2  296  THR n 
2  297  CYS n 
2  298  ARG n 
2  299  TYR n 
2  300  PRO n 
2  301  TYR n 
2  302  SER n 
2  303  CYS n 
2  304  PHE n 
2  305  LYS n 
2  306  THR n 
2  307  VAL n 
2  308  PHE n 
2  309  ILE n 
2  310  ASP n 
2  311  GLU n 
2  312  ALA n 
2  313  TYR n 
2  314  VAL n 
2  315  GLU n 
2  316  VAL n 
2  317  ALA n 
2  318  ALA n 
2  319  TYR n 
2  320  ALA n 
2  321  SER n 
2  322  MET n 
2  323  SER n 
2  324  ILE n 
2  325  PHE n 
2  326  SER n 
2  327  THR n 
2  328  ASN n 
2  329  LEU n 
2  330  LEU n 
2  331  HIS n 
2  332  SER n 
2  333  ALA n 
2  334  MET n 
2  335  ILE n 
2  336  ILE n 
2  337  ASP n 
2  338  GLU n 
2  339  THR n 
2  340  PRO n 
2  341  LEU n 
2  342  THR n 
2  343  ARG n 
2  344  ARG n 
2  345  CYS n 
2  346  LEU n 
2  347  ALA n 
2  348  GLN n 
2  349  SER n 
2  350  LEU n 
2  351  ALA n 
2  352  GLN n 
2  353  GLN n 
2  354  PHE n 
2  355  PHE n 
2  356  GLY n 
2  357  CYS n 
2  358  PHE n 
2  359  ILE n 
2  360  SER n 
2  361  ARG n 
2  362  MET n 
2  363  SER n 
2  364  TRP n 
2  365  SER n 
2  366  ASP n 
2  367  GLU n 
2  368  TRP n 
2  369  VAL n 
2  370  LEU n 
2  371  LYS n 
2  372  GLY n 
2  373  ILE n 
2  374  SER n 
2  375  GLY n 
2  376  TYR n 
2  377  ILE n 
2  378  TYR n 
2  379  GLY n 
2  380  LEU n 
2  381  TRP n 
2  382  MET n 
2  383  LYS n 
2  384  LYS n 
2  385  THR n 
2  386  PHE n 
2  387  GLY n 
2  388  VAL n 
2  389  ASN n 
2  390  GLU n 
2  391  TYR n 
2  392  ARG n 
2  393  HIS n 
2  394  TRP n 
2  395  ILE n 
2  396  LYS n 
2  397  GLU n 
2  398  GLU n 
2  399  LEU n 
2  400  ASP n 
2  401  LYS n 
2  402  ILE n 
2  403  VAL n 
2  404  ALA n 
2  405  TYR n 
2  406  GLU n 
2  407  LEU n 
2  408  LYS n 
2  409  THR n 
2  410  GLY n 
2  411  GLY n 
2  412  VAL n 
2  413  LEU n 
2  414  LEU n 
2  415  HIS n 
2  416  PRO n 
2  417  ILE n 
2  418  PHE n 
2  419  GLY n 
2  420  GLY n 
2  421  GLY n 
2  422  LYS n 
2  423  GLU n 
2  424  LYS n 
2  425  ASP n 
2  426  ASN n 
2  427  PRO n 
2  428  ALA n 
2  429  SER n 
2  430  HIS n 
2  431  LEU n 
2  432  HIS n 
2  433  PHE n 
2  434  SER n 
2  435  ILE n 
2  436  LYS n 
2  437  HIS n 
2  438  PRO n 
2  439  HIS n 
2  440  THR n 
2  441  LEU n 
2  442  SER n 
2  443  TRP n 
2  444  GLU n 
2  445  TYR n 
2  446  TYR n 
2  447  SER n 
2  448  MET n 
2  449  PHE n 
2  450  GLN n 
2  451  CYS n 
2  452  LYS n 
2  453  ALA n 
2  454  HIS n 
2  455  LEU n 
2  456  VAL n 
2  457  MET n 
2  458  ARG n 
2  459  LEU n 
2  460  ILE n 
2  461  GLU n 
2  462  ASN n 
2  463  ARG n 
2  464  ILE n 
2  465  SER n 
2  466  MET n 
2  467  GLU n 
2  468  PHE n 
2  469  MET n 
2  470  LEU n 
2  471  GLN n 
2  472  VAL n 
2  473  PHE n 
2  474  ASN n 
2  475  LYS n 
2  476  LEU n 
2  477  LEU n 
2  478  SER n 
2  479  LEU n 
2  480  ALA n 
2  481  SER n 
2  482  THR n 
2  483  ALA n 
2  484  SER n 
2  485  SER n 
2  486  GLN n 
2  487  LYS n 
2  488  PHE n 
2  489  GLN n 
2  490  SER n 
2  491  HIS n 
2  492  MET n 
2  493  TRP n 
2  494  SER n 
2  495  GLN n 
2  496  MET n 
2  497  LEU n 
2  498  VAL n 
2  499  SER n 
2  500  THR n 
2  501  SER n 
2  502  GLY n 
2  503  PHE n 
2  504  LEU n 
2  505  LYS n 
2  506  SER n 
2  507  ILE n 
2  508  SER n 
2  509  ASN n 
2  510  VAL n 
2  511  SER n 
2  512  GLY n 
2  513  LYS n 
2  514  ASP n 
2  515  ILE n 
2  516  GLN n 
2  517  PRO n 
2  518  LEU n 
2  519  ILE n 
2  520  LYS n 
2  521  GLN n 
2  522  TRP n 
2  523  VAL n 
2  524  ASP n 
2  525  GLN n 
2  526  SER n 
2  527  GLY n 
2  528  VAL n 
2  529  VAL n 
2  530  LYS n 
2  531  PHE n 
2  532  TYR n 
2  533  GLY n 
2  534  SER n 
2  535  PHE n 
2  536  ALA n 
2  537  PHE n 
2  538  ASN n 
2  539  ARG n 
2  540  LYS n 
2  541  ARG n 
2  542  ASN n 
2  543  VAL n 
2  544  LEU n 
2  545  GLU n 
2  546  LEU n 
2  547  GLU n 
2  548  ILE n 
2  549  LYS n 
2  550  GLN n 
2  551  ASP n 
2  552  TYR n 
2  553  THR n 
2  554  SER n 
2  555  PRO n 
2  556  GLY n 
2  557  THR n 
2  558  GLN n 
2  559  LYS n 
2  560  TYR n 
2  561  VAL n 
2  562  GLY n 
2  563  PRO n 
2  564  LEU n 
2  565  LYS n 
2  566  VAL n 
2  567  THR n 
2  568  VAL n 
2  569  GLN n 
2  570  GLU n 
2  571  LEU n 
2  572  ASP n 
2  573  GLY n 
2  574  SER n 
2  575  PHE n 
2  576  ASN n 
2  577  HIS n 
2  578  THR n 
2  579  LEU n 
2  580  GLN n 
2  581  ILE n 
2  582  GLU n 
2  583  GLU n 
2  584  ASN n 
2  585  SER n 
2  586  LEU n 
2  587  LYS n 
2  588  HIS n 
2  589  ASP n 
2  590  ILE n 
2  591  PRO n 
2  592  CYS n 
2  593  HIS n 
2  594  SER n 
2  595  LYS n 
2  596  SER n 
2  597  ARG n 
2  598  ARG n 
2  599  ASN n 
2  600  LYS n 
2  601  LYS n 
2  602  LYS n 
2  603  LYS n 
2  604  ILE n 
2  605  PRO n 
2  606  LEU n 
2  607  MET n 
2  608  ASN n 
2  609  GLY n 
2  610  GLU n 
2  611  GLU n 
2  612  VAL n 
2  613  ASP n 
2  614  MET n 
2  615  ASP n 
2  616  LEU n 
2  617  SER n 
2  618  ALA n 
2  619  MET n 
2  620  ASP n 
2  621  ALA n 
2  622  ASP n 
2  623  SER n 
2  624  PRO n 
2  625  LEU n 
2  626  LEU n 
2  627  TRP n 
2  628  ILE n 
2  629  ARG n 
2  630  ILE n 
2  631  ASP n 
2  632  PRO n 
2  633  ASP n 
2  634  MET n 
2  635  SER n 
2  636  VAL n 
2  637  LEU n 
2  638  ARG n 
2  639  LYS n 
2  640  VAL n 
2  641  GLU n 
2  642  PHE n 
2  643  GLU n 
2  644  GLN n 
2  645  ALA n 
2  646  ASP n 
2  647  PHE n 
2  648  MET n 
2  649  TRP n 
2  650  GLN n 
2  651  TYR n 
2  652  GLN n 
2  653  LEU n 
2  654  ARG n 
2  655  TYR n 
2  656  GLU n 
2  657  ARG n 
2  658  ASP n 
2  659  VAL n 
2  660  VAL n 
2  661  ALA n 
2  662  GLN n 
2  663  GLN n 
2  664  GLU n 
2  665  SER n 
2  666  ILE n 
2  667  LEU n 
2  668  ALA n 
2  669  LEU n 
2  670  GLU n 
2  671  LYS n 
2  672  PHE n 
2  673  PRO n 
2  674  THR n 
2  675  PRO n 
2  676  ALA n 
2  677  SER n 
2  678  ARG n 
2  679  LEU n 
2  680  ALA n 
2  681  LEU n 
2  682  THR n 
2  683  ASP n 
2  684  ILE n 
2  685  LEU n 
2  686  GLU n 
2  687  GLN n 
2  688  GLU n 
2  689  GLN n 
2  690  CYS n 
2  691  PHE n 
2  692  TYR n 
2  693  ARG n 
2  694  VAL n 
2  695  ARG n 
2  696  MET n 
2  697  SER n 
2  698  ALA n 
2  699  CYS n 
2  700  PHE n 
2  701  CYS n 
2  702  LEU n 
2  703  ALA n 
2  704  LYS n 
2  705  ILE n 
2  706  ALA n 
2  707  ASN n 
2  708  SER n 
2  709  MET n 
2  710  VAL n 
2  711  SER n 
2  712  THR n 
2  713  TRP n 
2  714  THR n 
2  715  GLY n 
2  716  PRO n 
2  717  PRO n 
2  718  ALA n 
2  719  MET n 
2  720  LYS n 
2  721  SER n 
2  722  LEU n 
2  723  PHE n 
2  724  THR n 
2  725  ARG n 
2  726  MET n 
2  727  PHE n 
2  728  CYS n 
2  729  CYS n 
2  730  LYS n 
2  731  SER n 
2  732  CYS n 
2  733  PRO n 
2  734  ASN n 
2  735  ILE n 
2  736  VAL n 
2  737  LYS n 
2  738  THR n 
2  739  ASN n 
2  740  ASN n 
2  741  PHE n 
2  742  MET n 
2  743  SER n 
2  744  PHE n 
2  745  GLN n 
2  746  SER n 
2  747  TYR n 
2  748  PHE n 
2  749  LEU n 
2  750  GLN n 
2  751  LYS n 
2  752  THR n 
2  753  MET n 
2  754  PRO n 
2  755  VAL n 
2  756  ALA n 
2  757  MET n 
2  758  ALA n 
2  759  LEU n 
2  760  LEU n 
2  761  ARG n 
2  762  ASP n 
2  763  VAL n 
2  764  HIS n 
2  765  ASN n 
2  766  LEU n 
2  767  CYS n 
2  768  PRO n 
2  769  LYS n 
2  770  GLU n 
2  771  VAL n 
2  772  LEU n 
2  773  THR n 
2  774  PHE n 
2  775  ILE n 
2  776  LEU n 
2  777  ASP n 
2  778  LEU n 
2  779  ILE n 
2  780  LYS n 
2  781  TYR n 
2  782  ASN n 
2  783  ASP n 
2  784  ASN n 
2  785  ARG n 
2  786  LYS n 
2  787  ASN n 
2  788  LYS n 
2  789  PHE n 
2  790  SER n 
2  791  ASP n 
2  792  ASN n 
2  793  TYR n 
2  794  TYR n 
2  795  ARG n 
2  796  ALA n 
2  797  GLU n 
2  798  MET n 
2  799  ILE n 
2  800  ASP n 
2  801  ALA n 
2  802  LEU n 
2  803  ALA n 
2  804  ASN n 
2  805  SER n 
2  806  VAL n 
2  807  THR n 
2  808  PRO n 
2  809  ALA n 
2  810  VAL n 
2  811  SER n 
2  812  VAL n 
2  813  ASN n 
2  814  ASN n 
2  815  GLU n 
2  816  VAL n 
2  817  ARG n 
2  818  THR n 
2  819  LEU n 
2  820  ASP n 
2  821  ASN n 
2  822  LEU n 
2  823  ASN n 
2  824  PRO n 
2  825  ASP n 
2  826  VAL n 
2  827  ARG n 
2  828  LEU n 
2  829  ILE n 
2  830  LEU n 
2  831  GLU n 
2  832  GLU n 
2  833  ILE n 
2  834  THR n 
2  835  ARG n 
2  836  PHE n 
2  837  LEU n 
2  838  ASN n 
2  839  MET n 
2  840  GLU n 
2  841  LYS n 
2  842  LEU n 
2  843  LEU n 
2  844  PRO n 
2  845  SER n 
2  846  TYR n 
2  847  ARG n 
2  848  HIS n 
2  849  THR n 
2  850  ILE n 
2  851  THR n 
2  852  VAL n 
2  853  SER n 
2  854  CYS n 
2  855  LEU n 
2  856  ARG n 
2  857  ALA n 
2  858  ILE n 
2  859  ARG n 
2  860  VAL n 
2  861  LEU n 
2  862  GLN n 
2  863  LYS n 
2  864  ASN n 
2  865  GLY n 
2  866  HIS n 
2  867  VAL n 
2  868  PRO n 
2  869  SER n 
2  870  ASP n 
2  871  PRO n 
2  872  ALA n 
2  873  LEU n 
2  874  PHE n 
2  875  LYS n 
2  876  SER n 
2  877  TYR n 
2  878  ALA n 
2  879  GLU n 
2  880  TYR n 
2  881  GLY n 
2  882  HIS n 
2  883  PHE n 
2  884  VAL n 
2  885  ASP n 
2  886  ILE n 
2  887  ARG n 
2  888  ILE n 
2  889  ALA n 
2  890  ALA n 
2  891  LEU n 
2  892  GLU n 
2  893  ALA n 
2  894  VAL n 
2  895  VAL n 
2  896  ASP n 
2  897  TYR n 
2  898  THR n 
2  899  LYS n 
2  900  VAL n 
2  901  ASP n 
2  902  ARG n 
2  903  SER n 
2  904  TYR n 
2  905  GLU n 
2  906  GLU n 
2  907  LEU n 
2  908  GLN n 
2  909  TRP n 
2  910  LEU n 
2  911  LEU n 
2  912  ASN n 
2  913  MET n 
2  914  ILE n 
2  915  GLN n 
2  916  ASN n 
2  917  ASP n 
2  918  PRO n 
2  919  VAL n 
2  920  PRO n 
2  921  TYR n 
2  922  VAL n 
2  923  ARG n 
2  924  HIS n 
2  925  LYS n 
2  926  ILE n 
2  927  LEU n 
2  928  ASN n 
2  929  MET n 
2  930  LEU n 
2  931  THR n 
2  932  LYS n 
2  933  ASN n 
2  934  PRO n 
2  935  PRO n 
2  936  PHE n 
2  937  THR n 
2  938  LYS n 
2  939  ASN n 
2  940  MET n 
2  941  GLU n 
2  942  SER n 
2  943  PRO n 
2  944  LEU n 
2  945  CYS n 
2  946  ASN n 
2  947  GLU n 
2  948  ALA n 
2  949  LEU n 
2  950  VAL n 
2  951  ASP n 
2  952  GLN n 
2  953  LEU n 
2  954  TRP n 
2  955  LYS n 
2  956  LEU n 
2  957  MET n 
2  958  ASN n 
2  959  SER n 
2  960  GLY n 
2  961  THR n 
2  962  SER n 
2  963  HIS n 
2  964  ASP n 
2  965  TRP n 
2  966  ARG n 
2  967  LEU n 
2  968  ARG n 
2  969  CYS n 
2  970  GLY n 
2  971  ALA n 
2  972  VAL n 
2  973  ASP n 
2  974  LEU n 
2  975  TYR n 
2  976  PHE n 
2  977  THR n 
2  978  LEU n 
2  979  PHE n 
2  980  GLY n 
2  981  LEU n 
2  982  SER n 
2  983  ARG n 
2  984  PRO n 
2  985  SER n 
2  986  CYS n 
2  987  LEU n 
2  988  PRO n 
2  989  LEU n 
2  990  PRO n 
2  991  GLU n 
2  992  LEU n 
2  993  GLY n 
2  994  LEU n 
2  995  VAL n 
2  996  LEU n 
2  997  ASN n 
2  998  LEU n 
2  999  LYS n 
2  1000 GLU n 
2  1001 LYS n 
2  1002 LYS n 
2  1003 ALA n 
2  1004 VAL n 
2  1005 LEU n 
2  1006 ASN n 
2  1007 PRO n 
2  1008 THR n 
2  1009 ILE n 
2  1010 ILE n 
2  1011 PRO n 
2  1012 GLU n 
2  1013 SER n 
2  1014 VAL n 
2  1015 ALA n 
2  1016 GLY n 
2  1017 ASN n 
2  1018 GLN n 
2  1019 GLU n 
2  1020 ALA n 
2  1021 ALA n 
2  1022 ASN n 
2  1023 ASN n 
2  1024 PRO n 
2  1025 SER n 
2  1026 SER n 
2  1027 HIS n 
2  1028 PRO n 
2  1029 GLN n 
2  1030 LEU n 
2  1031 VAL n 
2  1032 GLY n 
2  1033 PHE n 
2  1034 GLN n 
2  1035 ASN n 
2  1036 PRO n 
2  1037 PHE n 
2  1038 SER n 
2  1039 SER n 
2  1040 SER n 
2  1041 GLN n 
2  1042 ASP n 
2  1043 GLU n 
2  1044 GLU n 
2  1045 GLU n 
2  1046 ILE n 
2  1047 ASP n 
2  1048 MET n 
2  1049 ASP n 
2  1050 THR n 
2  1051 VAL n 
2  1052 HIS n 
2  1053 ASP n 
2  1054 SER n 
2  1055 GLN n 
2  1056 ALA n 
2  1057 PHE n 
2  1058 ILE n 
2  1059 SER n 
2  1060 HIS n 
2  1061 HIS n 
2  1062 LEU n 
2  1063 ASN n 
2  1064 MET n 
2  1065 LEU n 
2  1066 GLU n 
2  1067 ARG n 
2  1068 PRO n 
2  1069 SER n 
2  1070 THR n 
2  1071 PRO n 
2  1072 GLY n 
2  1073 LEU n 
2  1074 SER n 
2  1075 LYS n 
2  1076 TYR n 
2  1077 ARG n 
2  1078 PRO n 
2  1079 ALA n 
2  1080 SER n 
2  1081 SER n 
2  1082 ARG n 
2  1083 SER n 
2  1084 ALA n 
2  1085 LEU n 
2  1086 ILE n 
2  1087 PRO n 
2  1088 GLN n 
2  1089 HIS n 
2  1090 SER n 
2  1091 ALA n 
2  1092 GLY n 
2  1093 CYS n 
2  1094 ASP n 
2  1095 SER n 
2  1096 THR n 
2  1097 PRO n 
2  1098 THR n 
2  1099 THR n 
2  1100 LYS n 
2  1101 PRO n 
2  1102 GLN n 
2  1103 TRP n 
2  1104 SER n 
2  1105 LEU n 
2  1106 GLU n 
2  1107 LEU n 
2  1108 ALA n 
2  1109 ARG n 
2  1110 LYS n 
2  1111 GLY n 
2  1112 THR n 
2  1113 GLY n 
2  1114 LYS n 
2  1115 GLU n 
2  1116 GLN n 
2  1117 ALA n 
2  1118 PRO n 
2  1119 LEU n 
2  1120 GLU n 
2  1121 MET n 
2  1122 SER n 
2  1123 MET n 
2  1124 HIS n 
2  1125 PRO n 
2  1126 ALA n 
2  1127 ALA n 
2  1128 SER n 
2  1129 ALA n 
2  1130 PRO n 
2  1131 LEU n 
2  1132 SER n 
2  1133 VAL n 
2  1134 PHE n 
2  1135 THR n 
2  1136 LYS n 
2  1137 GLU n 
2  1138 SER n 
2  1139 THR n 
2  1140 ALA n 
2  1141 SER n 
2  1142 LYS n 
2  1143 HIS n 
2  1144 SER n 
2  1145 ASP n 
2  1146 HIS n 
2  1147 HIS n 
2  1148 HIS n 
2  1149 HIS n 
2  1150 HIS n 
2  1151 HIS n 
2  1152 HIS n 
2  1153 GLU n 
2  1154 HIS n 
2  1155 LYS n 
2  1156 LYS n 
2  1157 LYS n 
2  1158 LYS n 
2  1159 LYS n 
2  1160 LYS n 
2  1161 HIS n 
2  1162 LYS n 
2  1163 HIS n 
2  1164 LYS n 
2  1165 HIS n 
2  1166 LYS n 
2  1167 HIS n 
2  1168 LYS n 
2  1169 HIS n 
2  1170 LYS n 
2  1171 HIS n 
2  1172 ASP n 
2  1173 SER n 
2  1174 LYS n 
2  1175 GLU n 
2  1176 LYS n 
2  1177 ASP n 
2  1178 LYS n 
2  1179 GLU n 
2  1180 PRO n 
2  1181 PHE n 
2  1182 THR n 
2  1183 PHE n 
2  1184 SER n 
2  1185 SER n 
2  1186 PRO n 
2  1187 ALA n 
2  1188 SER n 
2  1189 GLY n 
2  1190 ARG n 
2  1191 SER n 
2  1192 ILE n 
2  1193 ARG n 
2  1194 SER n 
2  1195 PRO n 
2  1196 SER n 
2  1197 LEU n 
2  1198 SER n 
2  1199 ASP n 
3  1    MET n 
3  2    CYS n 
3  3    GLU n 
3  4    SER n 
3  5    TYR n 
3  6    SER n 
3  7    ARG n 
3  8    SER n 
3  9    LEU n 
3  10   LEU n 
3  11   ARG n 
3  12   VAL n 
3  13   SER n 
3  14   VAL n 
3  15   ALA n 
3  16   GLN n 
3  17   ILE n 
3  18   CYS n 
3  19   GLN n 
3  20   ALA n 
3  21   LEU n 
3  22   GLY n 
3  23   TRP n 
3  24   ASP n 
3  25   SER n 
3  26   VAL n 
3  27   GLN n 
3  28   LEU n 
3  29   SER n 
3  30   ALA n 
3  31   CYS n 
3  32   HIS n 
3  33   LEU n 
3  34   LEU n 
3  35   THR n 
3  36   ASP n 
3  37   VAL n 
3  38   LEU n 
3  39   GLN n 
3  40   ARG n 
3  41   TYR n 
3  42   LEU n 
3  43   GLN n 
3  44   GLN n 
3  45   LEU n 
3  46   GLY n 
3  47   ARG n 
3  48   GLY n 
3  49   CYS n 
3  50   HIS n 
3  51   ARG n 
3  52   TYR n 
3  53   SER n 
3  54   GLU n 
3  55   LEU n 
3  56   TYR n 
3  57   GLY n 
3  58   ARG n 
3  59   THR n 
3  60   ASP n 
3  61   PRO n 
3  62   ILE n 
3  63   LEU n 
3  64   ASP n 
3  65   ASP n 
3  66   VAL n 
3  67   GLY n 
3  68   GLU n 
3  69   ALA n 
3  70   PHE n 
3  71   GLN n 
3  72   LEU n 
3  73   MET n 
3  74   GLY n 
3  75   VAL n 
3  76   SER n 
3  77   LEU n 
3  78   HIS n 
3  79   GLU n 
3  80   LEU n 
3  81   GLU n 
3  82   ASP n 
3  83   TYR n 
3  84   ILE n 
3  85   HIS n 
3  86   ASN n 
3  87   ILE n 
3  88   GLU n 
3  89   PRO n 
3  90   VAL n 
3  91   THR n 
3  92   PHE n 
3  93   PRO n 
3  94   HIS n 
3  95   GLN n 
3  96   ILE n 
3  97   PRO n 
3  98   SER n 
3  99   PHE n 
3  100  PRO n 
3  101  VAL n 
3  102  SER n 
3  103  LYS n 
3  104  ASN n 
3  105  ASN n 
3  106  VAL n 
3  107  LEU n 
3  108  GLN n 
3  109  PHE n 
3  110  PRO n 
3  111  GLN n 
3  112  PRO n 
3  113  GLY n 
3  114  SER n 
3  115  LYS n 
3  116  ASP n 
3  117  ALA n 
3  118  GLU n 
3  119  GLU n 
3  120  ARG n 
3  121  LYS n 
3  122  GLU n 
3  123  TYR n 
3  124  ILE n 
3  125  PRO n 
3  126  ASP n 
3  127  TYR n 
3  128  LEU n 
3  129  PRO n 
3  130  PRO n 
3  131  ILE n 
3  132  VAL n 
3  133  SER n 
3  134  SER n 
3  135  GLN n 
3  136  GLU n 
3  137  GLU n 
3  138  GLU n 
3  139  GLU n 
3  140  GLU n 
3  141  GLU n 
3  142  GLN n 
3  143  VAL n 
3  144  PRO n 
3  145  THR n 
3  146  ASP n 
3  147  GLY n 
3  148  GLY n 
3  149  THR n 
3  150  SER n 
3  151  ALA n 
3  152  GLU n 
3  153  ALA n 
3  154  MET n 
3  155  GLN n 
3  156  VAL n 
3  157  PRO n 
3  158  LEU n 
3  159  GLU n 
3  160  GLU n 
3  161  ASP n 
3  162  ASP n 
3  163  GLU n 
3  164  LEU n 
3  165  GLU n 
3  166  GLU n 
3  167  GLU n 
3  168  GLU n 
3  169  ILE n 
3  170  ILE n 
3  171  ASN n 
3  172  ASP n 
3  173  GLU n 
3  174  ASN n 
3  175  PHE n 
3  176  LEU n 
3  177  GLY n 
3  178  LYS n 
3  179  ARG n 
3  180  PRO n 
3  181  LEU n 
3  182  ASP n 
3  183  SER n 
3  184  PRO n 
3  185  GLU n 
3  186  ALA n 
3  187  GLU n 
3  188  GLU n 
3  189  LEU n 
3  190  PRO n 
3  191  ALA n 
3  192  MET n 
3  193  LYS n 
3  194  ARG n 
3  195  PRO n 
3  196  ARG n 
3  197  LEU n 
3  198  LEU n 
3  199  SER n 
3  200  THR n 
3  201  LYS n 
3  202  GLY n 
3  203  ASP n 
3  204  THR n 
3  205  LEU n 
3  206  ASP n 
3  207  VAL n 
3  208  VAL n 
3  209  LEU n 
3  210  LEU n 
3  211  GLU n 
3  212  ALA n 
3  213  ARG n 
3  214  GLU n 
3  215  PRO n 
3  216  LEU n 
3  217  SER n 
3  218  SER n 
3  219  ILE n 
3  220  ASN n 
3  221  THR n 
3  222  GLN n 
3  223  LYS n 
3  224  ILE n 
3  225  PRO n 
3  226  PRO n 
3  227  MET n 
3  228  LEU n 
3  229  SER n 
3  230  PRO n 
3  231  VAL n 
3  232  HIS n 
3  233  VAL n 
3  234  GLN n 
3  235  ASP n 
3  236  SER n 
3  237  THR n 
3  238  ASP n 
3  239  LEU n 
3  240  ALA n 
3  241  PRO n 
3  242  PRO n 
3  243  SER n 
3  244  PRO n 
3  245  GLU n 
3  246  PRO n 
3  247  PRO n 
3  248  MET n 
3  249  LEU n 
3  250  ALA n 
3  251  PRO n 
3  252  VAL n 
3  253  ALA n 
3  254  LYS n 
3  255  SER n 
3  256  GLN n 
3  257  MET n 
3  258  PRO n 
3  259  THR n 
3  260  ALA n 
3  261  LYS n 
3  262  PRO n 
3  263  LEU n 
3  264  GLU n 
3  265  THR n 
3  266  LYS n 
3  267  SER n 
3  268  PHE n 
3  269  THR n 
3  270  PRO n 
3  271  LYS n 
3  272  THR n 
3  273  LYS n 
3  274  THR n 
3  275  LYS n 
3  276  THR n 
3  277  SER n 
3  278  SER n 
3  279  PRO n 
3  280  GLY n 
3  281  GLN n 
3  282  LYS n 
3  283  THR n 
3  284  LYS n 
3  285  SER n 
3  286  PRO n 
3  287  LYS n 
3  288  THR n 
3  289  ALA n 
3  290  GLN n 
3  291  SER n 
3  292  PRO n 
3  293  ALA n 
3  294  MET n 
3  295  VAL n 
3  296  GLY n 
3  297  SER n 
3  298  PRO n 
3  299  ILE n 
3  300  ARG n 
3  301  SER n 
3  302  PRO n 
3  303  LYS n 
3  304  THR n 
3  305  VAL n 
3  306  SER n 
3  307  LYS n 
3  308  GLU n 
3  309  LYS n 
3  310  LYS n 
3  311  SER n 
3  312  PRO n 
3  313  GLY n 
3  314  ARG n 
3  315  SER n 
3  316  LYS n 
3  317  SER n 
3  318  PRO n 
3  319  LYS n 
3  320  SER n 
3  321  PRO n 
3  322  LYS n 
3  323  SER n 
3  324  PRO n 
3  325  LYS n 
3  326  VAL n 
3  327  THR n 
3  328  THR n 
3  329  HIS n 
3  330  ILE n 
3  331  PRO n 
3  332  GLN n 
3  333  THR n 
3  334  PRO n 
3  335  VAL n 
3  336  ARG n 
3  337  PRO n 
3  338  GLU n 
3  339  THR n 
3  340  PRO n 
3  341  ASN n 
3  342  ARG n 
3  343  THR n 
3  344  PRO n 
3  345  SER n 
3  346  ALA n 
3  347  THR n 
3  348  LEU n 
3  349  SER n 
3  350  GLU n 
3  351  LYS n 
3  352  ILE n 
3  353  SER n 
3  354  LYS n 
3  355  GLU n 
3  356  THR n 
3  357  ILE n 
3  358  GLN n 
3  359  VAL n 
3  360  LYS n 
3  361  GLN n 
3  362  ILE n 
3  363  GLN n 
3  364  THR n 
3  365  PRO n 
3  366  PRO n 
3  367  ASP n 
3  368  ALA n 
3  369  GLY n 
3  370  LYS n 
3  371  LEU n 
3  372  ASN n 
3  373  SER n 
3  374  GLU n 
3  375  ASN n 
3  376  GLN n 
3  377  PRO n 
3  378  LYS n 
3  379  LYS n 
3  380  ALA n 
3  381  VAL n 
3  382  VAL n 
3  383  ALA n 
3  384  ASP n 
3  385  LYS n 
3  386  THR n 
3  387  ILE n 
3  388  GLU n 
3  389  ALA n 
3  390  SER n 
3  391  ILE n 
3  392  ASP n 
3  393  ALA n 
3  394  VAL n 
3  395  ILE n 
3  396  ALA n 
3  397  ARG n 
3  398  ALA n 
3  399  CYS n 
3  400  ALA n 
3  401  GLU n 
3  402  ARG n 
3  403  GLU n 
3  404  PRO n 
3  405  ASP n 
3  406  PRO n 
3  407  PHE n 
3  408  GLU n 
3  409  PHE n 
3  410  SER n 
3  411  SER n 
3  412  GLY n 
3  413  SER n 
3  414  GLU n 
3  415  SER n 
3  416  GLU n 
3  417  GLY n 
3  418  ASP n 
3  419  ILE n 
3  420  PHE n 
3  421  THR n 
3  422  SER n 
3  423  PRO n 
3  424  LYS n 
3  425  ARG n 
3  426  ILE n 
3  427  SER n 
3  428  GLY n 
3  429  PRO n 
3  430  GLU n 
3  431  CYS n 
3  432  THR n 
3  433  THR n 
3  434  PRO n 
3  435  LYS n 
3  436  ALA n 
3  437  SER n 
3  438  THR n 
3  439  SER n 
3  440  ALA n 
3  441  ASN n 
3  442  ASN n 
3  443  PHE n 
3  444  THR n 
3  445  LYS n 
3  446  SER n 
3  447  GLY n 
3  448  SER n 
3  449  THR n 
3  450  PRO n 
3  451  LEU n 
3  452  PRO n 
3  453  LEU n 
3  454  SER n 
3  455  GLY n 
3  456  GLY n 
3  457  THR n 
3  458  SER n 
3  459  SER n 
3  460  SER n 
3  461  ASP n 
3  462  ASN n 
3  463  SER n 
3  464  TRP n 
3  465  THR n 
3  466  MET n 
3  467  ASP n 
3  468  ALA n 
3  469  SER n 
3  470  ILE n 
3  471  ASP n 
3  472  GLU n 
3  473  VAL n 
3  474  VAL n 
3  475  ARG n 
3  476  LYS n 
3  477  ALA n 
3  478  LYS n 
3  479  LEU n 
3  480  GLY n 
3  481  THR n 
3  482  PRO n 
3  483  SER n 
3  484  ASN n 
3  485  MET n 
3  486  PRO n 
3  487  PRO n 
3  488  ASN n 
3  489  PHE n 
3  490  PRO n 
3  491  TYR n 
3  492  ILE n 
3  493  SER n 
3  494  SER n 
3  495  PRO n 
3  496  SER n 
3  497  VAL n 
3  498  SER n 
3  499  PRO n 
3  500  PRO n 
3  501  THR n 
3  502  PRO n 
3  503  GLU n 
3  504  PRO n 
3  505  LEU n 
3  506  HIS n 
3  507  LYS n 
3  508  VAL n 
3  509  TYR n 
3  510  GLU n 
3  511  GLU n 
3  512  LYS n 
3  513  THR n 
3  514  LYS n 
3  515  LEU n 
3  516  PRO n 
3  517  SER n 
3  518  SER n 
3  519  VAL n 
3  520  GLU n 
3  521  VAL n 
3  522  LYS n 
3  523  LYS n 
3  524  LYS n 
3  525  LEU n 
3  526  LYS n 
3  527  LYS n 
3  528  GLU n 
3  529  LEU n 
3  530  LYS n 
3  531  THR n 
3  532  LYS n 
3  533  MET n 
3  534  LYS n 
3  535  LYS n 
3  536  LYS n 
3  537  GLU n 
3  538  LYS n 
3  539  GLN n 
3  540  ARG n 
3  541  ASP n 
3  542  ARG n 
3  543  GLU n 
3  544  ARG n 
3  545  GLU n 
3  546  LYS n 
3  547  ASP n 
3  548  LYS n 
3  549  ASN n 
3  550  LYS n 
3  551  ASP n 
3  552  LYS n 
3  553  SER n 
3  554  LYS n 
3  555  GLU n 
3  556  LYS n 
3  557  ASP n 
3  558  LYS n 
3  559  VAL n 
3  560  LYS n 
3  561  GLU n 
3  562  LYS n 
3  563  GLU n 
3  564  LYS n 
3  565  ASP n 
3  566  LYS n 
3  567  GLU n 
3  568  THR n 
3  569  GLY n 
3  570  ARG n 
3  571  GLU n 
3  572  THR n 
3  573  LYS n 
3  574  TYR n 
3  575  PRO n 
3  576  TRP n 
3  577  LYS n 
3  578  GLU n 
3  579  PHE n 
3  580  LEU n 
3  581  LYS n 
3  582  GLU n 
3  583  GLU n 
3  584  GLU n 
3  585  ALA n 
3  586  ASP n 
3  587  PRO n 
3  588  TYR n 
3  589  LYS n 
3  590  PHE n 
3  591  LYS n 
3  592  ILE n 
3  593  LYS n 
3  594  GLU n 
3  595  PHE n 
3  596  GLU n 
3  597  ASP n 
3  598  VAL n 
3  599  ASP n 
3  600  PRO n 
3  601  LYS n 
3  602  VAL n 
3  603  LYS n 
3  604  LEU n 
3  605  LYS n 
3  606  ASP n 
3  607  GLY n 
3  608  LEU n 
3  609  VAL n 
3  610  ARG n 
3  611  LYS n 
3  612  GLU n 
3  613  LYS n 
3  614  GLU n 
3  615  LYS n 
3  616  HIS n 
3  617  LYS n 
3  618  ASP n 
3  619  LYS n 
3  620  LYS n 
3  621  LYS n 
3  622  ASP n 
3  623  ARG n 
3  624  GLU n 
3  625  LYS n 
3  626  GLY n 
3  627  LYS n 
3  628  LYS n 
3  629  ASP n 
3  630  LYS n 
3  631  ASP n 
3  632  LYS n 
3  633  ARG n 
3  634  GLU n 
3  635  LYS n 
3  636  GLU n 
3  637  LYS n 
3  638  VAL n 
3  639  LYS n 
3  640  ASP n 
3  641  LYS n 
3  642  GLY n 
3  643  ARG n 
3  644  GLU n 
3  645  ASP n 
3  646  LYS n 
3  647  MET n 
3  648  LYS n 
3  649  ALA n 
3  650  PRO n 
3  651  ALA n 
3  652  PRO n 
3  653  PRO n 
3  654  LEU n 
3  655  VAL n 
3  656  LEU n 
3  657  PRO n 
3  658  PRO n 
3  659  LYS n 
3  660  GLU n 
3  661  LEU n 
3  662  ALA n 
3  663  LEU n 
3  664  PRO n 
3  665  LEU n 
3  666  PHE n 
3  667  SER n 
3  668  PRO n 
3  669  ALA n 
3  670  THR n 
3  671  ALA n 
3  672  SER n 
3  673  ARG n 
3  674  VAL n 
3  675  PRO n 
3  676  ALA n 
3  677  MET n 
3  678  LEU n 
3  679  PRO n 
3  680  SER n 
3  681  LEU n 
3  682  LEU n 
3  683  PRO n 
3  684  VAL n 
3  685  LEU n 
3  686  PRO n 
3  687  GLU n 
3  688  LYS n 
3  689  LEU n 
3  690  PHE n 
3  691  GLU n 
3  692  GLU n 
3  693  LYS n 
3  694  GLU n 
3  695  LYS n 
3  696  VAL n 
3  697  LYS n 
3  698  GLU n 
3  699  LYS n 
3  700  GLU n 
3  701  LYS n 
3  702  LYS n 
3  703  LYS n 
3  704  ASP n 
3  705  LYS n 
3  706  LYS n 
3  707  GLU n 
3  708  LYS n 
3  709  LYS n 
3  710  LYS n 
3  711  LYS n 
3  712  LYS n 
3  713  GLU n 
3  714  LYS n 
3  715  GLU n 
3  716  LYS n 
3  717  GLU n 
3  718  LYS n 
3  719  LYS n 
3  720  GLU n 
3  721  LYS n 
3  722  GLU n 
3  723  ARG n 
3  724  GLU n 
3  725  LYS n 
3  726  GLU n 
3  727  LYS n 
3  728  ARG n 
3  729  GLU n 
3  730  ARG n 
3  731  GLU n 
3  732  LYS n 
3  733  ARG n 
3  734  GLU n 
3  735  LYS n 
3  736  GLU n 
3  737  LYS n 
3  738  GLU n 
3  739  LYS n 
3  740  HIS n 
3  741  LYS n 
3  742  HIS n 
3  743  GLU n 
3  744  LYS n 
3  745  ILE n 
3  746  LYS n 
3  747  VAL n 
3  748  GLU n 
3  749  PRO n 
3  750  VAL n 
3  751  ALA n 
3  752  LEU n 
3  753  ALA n 
3  754  PRO n 
3  755  SER n 
3  756  PRO n 
3  757  VAL n 
3  758  ILE n 
3  759  PRO n 
3  760  ARG n 
3  761  LEU n 
3  762  THR n 
3  763  LEU n 
3  764  ARG n 
3  765  VAL n 
3  766  GLY n 
3  767  ALA n 
3  768  GLY n 
3  769  GLN n 
3  770  ASP n 
3  771  LYS n 
3  772  ILE n 
3  773  VAL n 
3  774  ILE n 
3  775  SER n 
3  776  LYS n 
3  777  VAL n 
3  778  VAL n 
3  779  PRO n 
3  780  ALA n 
3  781  PRO n 
3  782  GLU n 
3  783  ALA n 
3  784  LYS n 
3  785  PRO n 
3  786  ALA n 
3  787  PRO n 
3  788  SER n 
3  789  GLN n 
3  790  ASN n 
3  791  ARG n 
3  792  PRO n 
3  793  LYS n 
3  794  THR n 
3  795  PRO n 
3  796  PRO n 
3  797  PRO n 
3  798  ALA n 
3  799  PRO n 
3  800  ALA n 
3  801  PRO n 
3  802  ALA n 
3  803  PRO n 
3  804  GLY n 
3  805  PRO n 
3  806  MET n 
3  807  LEU n 
3  808  VAL n 
3  809  SER n 
3  810  PRO n 
3  811  ALA n 
3  812  PRO n 
3  813  VAL n 
3  814  PRO n 
3  815  LEU n 
3  816  PRO n 
3  817  LEU n 
3  818  LEU n 
3  819  ALA n 
3  820  GLN n 
3  821  ALA n 
3  822  ALA n 
3  823  ALA n 
3  824  GLY n 
3  825  PRO n 
3  826  ALA n 
3  827  LEU n 
3  828  LEU n 
3  829  PRO n 
3  830  SER n 
3  831  PRO n 
3  832  GLY n 
3  833  PRO n 
3  834  ALA n 
3  835  ALA n 
3  836  SER n 
3  837  GLY n 
3  838  ALA n 
3  839  SER n 
3  840  ALA n 
3  841  LYS n 
3  842  ALA n 
3  843  PRO n 
3  844  VAL n 
3  845  ARG n 
3  846  SER n 
3  847  VAL n 
3  848  VAL n 
3  849  THR n 
3  850  GLU n 
3  851  THR n 
3  852  VAL n 
3  853  SER n 
3  854  THR n 
3  855  TYR n 
3  856  VAL n 
3  857  ILE n 
3  858  ARG n 
3  859  ASP n 
3  860  GLU n 
3  861  TRP n 
3  862  GLY n 
3  863  ASN n 
3  864  GLN n 
3  865  ILE n 
3  866  TRP n 
3  867  ILE n 
3  868  CYS n 
3  869  PRO n 
3  870  GLY n 
3  871  CYS n 
3  872  ASN n 
3  873  LYS n 
3  874  PRO n 
3  875  ASP n 
3  876  ASP n 
3  877  GLY n 
3  878  SER n 
3  879  PRO n 
3  880  MET n 
3  881  ILE n 
3  882  GLY n 
3  883  CYS n 
3  884  ASP n 
3  885  ASP n 
3  886  CYS n 
3  887  ASP n 
3  888  ASP n 
3  889  TRP n 
3  890  TYR n 
3  891  HIS n 
3  892  TRP n 
3  893  PRO n 
3  894  CYS n 
3  895  VAL n 
3  896  GLY n 
3  897  ILE n 
3  898  MET n 
3  899  THR n 
3  900  ALA n 
3  901  PRO n 
3  902  PRO n 
3  903  GLU n 
3  904  GLU n 
3  905  MET n 
3  906  GLN n 
3  907  TRP n 
3  908  PHE n 
3  909  CYS n 
3  910  PRO n 
3  911  LYS n 
3  912  CYS n 
3  913  ALA n 
3  914  ASN n 
3  915  LYS n 
3  916  LYS n 
3  917  LYS n 
3  918  ASP n 
3  919  LYS n 
3  920  LYS n 
3  921  HIS n 
3  922  LYS n 
3  923  LYS n 
3  924  ARG n 
3  925  LYS n 
3  926  HIS n 
3  927  ARG n 
3  928  ALA n 
3  929  HIS n 
4  1    MET n 
4  2    ALA n 
4  3    ALA n 
4  4    GLY n 
4  5    SER n 
4  6    ASP n 
4  7    LEU n 
4  8    LEU n 
4  9    ASP n 
4  10   GLU n 
4  11   VAL n 
4  12   PHE n 
4  13   PHE n 
4  14   ASN n 
4  15   SER n 
4  16   GLU n 
4  17   VAL n 
4  18   ASP n 
4  19   GLU n 
4  20   LYS n 
4  21   VAL n 
4  22   VAL n 
4  23   SER n 
4  24   ASP n 
4  25   LEU n 
4  26   VAL n 
4  27   GLY n 
4  28   SER n 
4  29   LEU n 
4  30   GLU n 
4  31   SER n 
4  32   GLN n 
4  33   LEU n 
4  34   ALA n 
4  35   ALA n 
4  36   SER n 
4  37   ALA n 
4  38   ALA n 
4  39   HIS n 
4  40   HIS n 
4  41   HIS n 
4  42   HIS n 
4  43   LEU n 
4  44   ALA n 
4  45   PRO n 
4  46   ARG n 
4  47   THR n 
4  48   PRO n 
4  49   GLU n 
4  50   VAL n 
4  51   ARG n 
4  52   ALA n 
4  53   ALA n 
4  54   ALA n 
4  55   ALA n 
4  56   GLY n 
4  57   ALA n 
4  58   LEU n 
4  59   GLY n 
4  60   ASN n 
4  61   HIS n 
4  62   VAL n 
4  63   VAL n 
4  64   SER n 
4  65   GLY n 
4  66   SER n 
4  67   PRO n 
4  68   ALA n 
4  69   GLY n 
4  70   ALA n 
4  71   ALA n 
4  72   GLY n 
4  73   ALA n 
4  74   GLY n 
4  75   PRO n 
4  76   ALA n 
4  77   ALA n 
4  78   PRO n 
4  79   ALA n 
4  80   GLU n 
4  81   GLY n 
4  82   ALA n 
4  83   PRO n 
4  84   GLY n 
4  85   ALA n 
4  86   ALA n 
4  87   PRO n 
4  88   GLU n 
4  89   PRO n 
4  90   PRO n 
4  91   PRO n 
4  92   ALA n 
4  93   GLY n 
4  94   ARG n 
4  95   ALA n 
4  96   ARG n 
4  97   PRO n 
4  98   GLY n 
4  99   GLY n 
4  100  GLY n 
4  101  GLY n 
4  102  PRO n 
4  103  GLN n 
4  104  ARG n 
4  105  PRO n 
4  106  GLY n 
4  107  PRO n 
4  108  PRO n 
4  109  SER n 
4  110  PRO n 
4  111  ARG n 
4  112  ARG n 
4  113  PRO n 
4  114  LEU n 
4  115  VAL n 
4  116  PRO n 
4  117  ALA n 
4  118  GLY n 
4  119  PRO n 
4  120  ALA n 
4  121  PRO n 
4  122  PRO n 
4  123  ALA n 
4  124  ALA n 
4  125  LYS n 
4  126  LEU n 
4  127  ARG n 
4  128  PRO n 
4  129  PRO n 
4  130  PRO n 
4  131  GLU n 
4  132  GLY n 
4  133  SER n 
4  134  ALA n 
4  135  GLY n 
4  136  SER n 
4  137  CYS n 
4  138  ALA n 
4  139  PRO n 
4  140  VAL n 
4  141  PRO n 
4  142  ALA n 
4  143  ALA n 
4  144  ALA n 
4  145  ALA n 
4  146  VAL n 
4  147  ALA n 
4  148  ALA n 
4  149  GLY n 
4  150  PRO n 
4  151  GLU n 
4  152  PRO n 
4  153  ALA n 
4  154  PRO n 
4  155  ALA n 
4  156  GLY n 
4  157  PRO n 
4  158  ALA n 
4  159  LYS n 
4  160  PRO n 
4  161  ALA n 
4  162  GLY n 
4  163  PRO n 
4  164  ALA n 
4  165  ALA n 
4  166  LEU n 
4  167  ALA n 
4  168  ALA n 
4  169  ARG n 
4  170  ALA n 
4  171  GLY n 
4  172  PRO n 
4  173  GLY n 
4  174  PRO n 
4  175  GLY n 
4  176  PRO n 
4  177  GLY n 
4  178  PRO n 
4  179  GLY n 
4  180  PRO n 
4  181  GLY n 
4  182  PRO n 
4  183  GLY n 
4  184  PRO n 
4  185  GLY n 
4  186  PRO n 
4  187  GLY n 
4  188  LYS n 
4  189  PRO n 
4  190  ALA n 
4  191  GLY n 
4  192  PRO n 
4  193  GLY n 
4  194  ALA n 
4  195  ALA n 
4  196  GLN n 
4  197  THR n 
4  198  LEU n 
4  199  ASN n 
4  200  GLY n 
4  201  SER n 
4  202  ALA n 
4  203  ALA n 
4  204  LEU n 
4  205  LEU n 
4  206  ASN n 
4  207  SER n 
4  208  HIS n 
4  209  HIS n 
4  210  ALA n 
4  211  ALA n 
4  212  ALA n 
4  213  PRO n 
4  214  ALA n 
4  215  VAL n 
4  216  SER n 
4  217  LEU n 
4  218  VAL n 
4  219  ASN n 
4  220  ASN n 
4  221  GLY n 
4  222  PRO n 
4  223  ALA n 
4  224  ALA n 
4  225  LEU n 
4  226  LEU n 
4  227  PRO n 
4  228  LEU n 
4  229  PRO n 
4  230  LYS n 
4  231  PRO n 
4  232  ALA n 
4  233  ALA n 
4  234  PRO n 
4  235  GLY n 
4  236  THR n 
4  237  VAL n 
4  238  ILE n 
4  239  GLN n 
4  240  THR n 
4  241  PRO n 
4  242  PRO n 
4  243  PHE n 
4  244  VAL n 
4  245  GLY n 
4  246  ALA n 
4  247  ALA n 
4  248  ALA n 
4  249  PRO n 
4  250  PRO n 
4  251  ALA n 
4  252  PRO n 
4  253  ALA n 
4  254  ALA n 
4  255  PRO n 
4  256  SER n 
4  257  PRO n 
4  258  PRO n 
4  259  ALA n 
4  260  ALA n 
4  261  PRO n 
4  262  ALA n 
4  263  PRO n 
4  264  ALA n 
4  265  ALA n 
4  266  PRO n 
4  267  ALA n 
4  268  ALA n 
4  269  ALA n 
4  270  PRO n 
4  271  PRO n 
4  272  PRO n 
4  273  PRO n 
4  274  PRO n 
4  275  PRO n 
4  276  ALA n 
4  277  PRO n 
4  278  ALA n 
4  279  THR n 
4  280  LEU n 
4  281  ALA n 
4  282  ARG n 
4  283  PRO n 
4  284  PRO n 
4  285  GLY n 
4  286  HIS n 
4  287  PRO n 
4  288  ALA n 
4  289  GLY n 
4  290  PRO n 
4  291  PRO n 
4  292  THR n 
4  293  ALA n 
4  294  ALA n 
4  295  PRO n 
4  296  ALA n 
4  297  VAL n 
4  298  PRO n 
4  299  PRO n 
4  300  PRO n 
4  301  ALA n 
4  302  ALA n 
4  303  ALA n 
4  304  GLN n 
4  305  ASN n 
4  306  GLY n 
4  307  GLY n 
4  308  SER n 
4  309  ALA n 
4  310  GLY n 
4  311  ALA n 
4  312  ALA n 
4  313  PRO n 
4  314  ALA n 
4  315  PRO n 
4  316  ALA n 
4  317  PRO n 
4  318  ALA n 
4  319  ALA n 
4  320  GLY n 
4  321  GLY n 
4  322  PRO n 
4  323  ALA n 
4  324  GLY n 
4  325  VAL n 
4  326  SER n 
4  327  GLY n 
4  328  GLN n 
4  329  PRO n 
4  330  GLY n 
4  331  PRO n 
4  332  GLY n 
4  333  ALA n 
4  334  ALA n 
4  335  ALA n 
4  336  ALA n 
4  337  ALA n 
4  338  PRO n 
4  339  ALA n 
4  340  PRO n 
4  341  GLY n 
4  342  VAL n 
4  343  LYS n 
4  344  ALA n 
4  345  GLU n 
4  346  SER n 
4  347  PRO n 
4  348  LYS n 
4  349  ARG n 
4  350  VAL n 
4  351  VAL n 
4  352  GLN n 
4  353  ALA n 
4  354  ALA n 
4  355  PRO n 
4  356  PRO n 
4  357  ALA n 
4  358  ALA n 
4  359  GLN n 
4  360  THR n 
4  361  LEU n 
4  362  ALA n 
4  363  ALA n 
4  364  SER n 
4  365  GLY n 
4  366  PRO n 
4  367  ALA n 
4  368  SER n 
4  369  THR n 
4  370  ALA n 
4  371  ALA n 
4  372  SER n 
4  373  MET n 
4  374  VAL n 
4  375  ILE n 
4  376  GLY n 
4  377  PRO n 
4  378  THR n 
4  379  MET n 
4  380  GLN n 
4  381  GLY n 
4  382  ALA n 
4  383  LEU n 
4  384  PRO n 
4  385  SER n 
4  386  PRO n 
4  387  ALA n 
4  388  ALA n 
4  389  VAL n 
4  390  PRO n 
4  391  PRO n 
4  392  PRO n 
4  393  ALA n 
4  394  PRO n 
4  395  GLY n 
4  396  THR n 
4  397  PRO n 
4  398  THR n 
4  399  GLY n 
4  400  LEU n 
4  401  PRO n 
4  402  LYS n 
4  403  GLY n 
4  404  ALA n 
4  405  ALA n 
4  406  GLY n 
4  407  ALA n 
4  408  VAL n 
4  409  THR n 
4  410  GLN n 
4  411  SER n 
4  412  LEU n 
4  413  SER n 
4  414  ARG n 
4  415  THR n 
4  416  PRO n 
4  417  THR n 
4  418  ALA n 
4  419  THR n 
4  420  THR n 
4  421  SER n 
4  422  GLY n 
4  423  ILE n 
4  424  ARG n 
4  425  ALA n 
4  426  THR n 
4  427  LEU n 
4  428  THR n 
4  429  PRO n 
4  430  THR n 
4  431  VAL n 
4  432  LEU n 
4  433  ALA n 
4  434  PRO n 
4  435  ARG n 
4  436  LEU n 
4  437  PRO n 
4  438  GLN n 
4  439  PRO n 
4  440  PRO n 
4  441  GLN n 
4  442  ASN n 
4  443  PRO n 
4  444  THR n 
4  445  ASN n 
4  446  ILE n 
4  447  GLN n 
4  448  ASN n 
4  449  PHE n 
4  450  GLN n 
4  451  LEU n 
4  452  PRO n 
4  453  PRO n 
4  454  GLY n 
4  455  MET n 
4  456  VAL n 
4  457  LEU n 
4  458  VAL n 
4  459  ARG n 
4  460  SER n 
4  461  GLU n 
4  462  ASN n 
4  463  GLY n 
4  464  GLN n 
4  465  LEU n 
4  466  LEU n 
4  467  MET n 
4  468  ILE n 
4  469  PRO n 
4  470  GLN n 
4  471  GLN n 
4  472  ALA n 
4  473  LEU n 
4  474  ALA n 
4  475  GLN n 
4  476  MET n 
4  477  GLN n 
4  478  ALA n 
4  479  GLN n 
4  480  ALA n 
4  481  HIS n 
4  482  ALA n 
4  483  GLN n 
4  484  PRO n 
4  485  GLN n 
4  486  THR n 
4  487  THR n 
4  488  MET n 
4  489  ALA n 
4  490  PRO n 
4  491  ARG n 
4  492  PRO n 
4  493  ALA n 
4  494  THR n 
4  495  PRO n 
4  496  THR n 
4  497  SER n 
4  498  ALA n 
4  499  PRO n 
4  500  PRO n 
4  501  VAL n 
4  502  GLN n 
4  503  ILE n 
4  504  SER n 
4  505  THR n 
4  506  VAL n 
4  507  GLN n 
4  508  ALA n 
4  509  PRO n 
4  510  GLY n 
4  511  THR n 
4  512  PRO n 
4  513  ILE n 
4  514  ILE n 
4  515  ALA n 
4  516  ARG n 
4  517  GLN n 
4  518  VAL n 
4  519  THR n 
4  520  PRO n 
4  521  THR n 
4  522  THR n 
4  523  ILE n 
4  524  ILE n 
4  525  LYS n 
4  526  GLN n 
4  527  VAL n 
4  528  SER n 
4  529  GLN n 
4  530  ALA n 
4  531  GLN n 
4  532  THR n 
4  533  THR n 
4  534  VAL n 
4  535  GLN n 
4  536  PRO n 
4  537  SER n 
4  538  ALA n 
4  539  THR n 
4  540  LEU n 
4  541  GLN n 
4  542  ARG n 
4  543  SER n 
4  544  PRO n 
4  545  GLY n 
4  546  VAL n 
4  547  GLN n 
4  548  PRO n 
4  549  GLN n 
4  550  LEU n 
4  551  VAL n 
4  552  LEU n 
4  553  GLY n 
4  554  GLY n 
4  555  ALA n 
4  556  ALA n 
4  557  GLN n 
4  558  THR n 
4  559  ALA n 
4  560  SER n 
4  561  LEU n 
4  562  GLY n 
4  563  THR n 
4  564  ALA n 
4  565  THR n 
4  566  ALA n 
4  567  VAL n 
4  568  GLN n 
4  569  THR n 
4  570  GLY n 
4  571  THR n 
4  572  PRO n 
4  573  GLN n 
4  574  ARG n 
4  575  THR n 
4  576  VAL n 
4  577  PRO n 
4  578  GLY n 
4  579  ALA n 
4  580  THR n 
4  581  THR n 
4  582  THR n 
4  583  SER n 
4  584  SER n 
4  585  ALA n 
4  586  ALA n 
4  587  THR n 
4  588  GLU n 
4  589  THR n 
4  590  MET n 
4  591  GLU n 
4  592  ASN n 
4  593  VAL n 
4  594  LYS n 
4  595  LYS n 
4  596  CYS n 
4  597  LYS n 
4  598  ASN n 
4  599  PHE n 
4  600  LEU n 
4  601  SER n 
4  602  THR n 
4  603  LEU n 
4  604  ILE n 
4  605  LYS n 
4  606  LEU n 
4  607  ALA n 
4  608  SER n 
4  609  SER n 
4  610  GLY n 
4  611  LYS n 
4  612  GLN n 
4  613  SER n 
4  614  THR n 
4  615  GLU n 
4  616  THR n 
4  617  ALA n 
4  618  ALA n 
4  619  ASN n 
4  620  VAL n 
4  621  LYS n 
4  622  GLU n 
4  623  LEU n 
4  624  VAL n 
4  625  GLN n 
4  626  ASN n 
4  627  LEU n 
4  628  LEU n 
4  629  ASP n 
4  630  GLY n 
4  631  LYS n 
4  632  ILE n 
4  633  GLU n 
4  634  ALA n 
4  635  GLU n 
4  636  ASP n 
4  637  PHE n 
4  638  THR n 
4  639  SER n 
4  640  ARG n 
4  641  LEU n 
4  642  TYR n 
4  643  ARG n 
4  644  GLU n 
4  645  LEU n 
4  646  ASN n 
4  647  SER n 
4  648  SER n 
4  649  PRO n 
4  650  GLN n 
4  651  PRO n 
4  652  TYR n 
4  653  LEU n 
4  654  VAL n 
4  655  PRO n 
4  656  PHE n 
4  657  LEU n 
4  658  LYS n 
4  659  ARG n 
4  660  SER n 
4  661  LEU n 
4  662  PRO n 
4  663  ALA n 
4  664  LEU n 
4  665  ARG n 
4  666  GLN n 
4  667  LEU n 
4  668  THR n 
4  669  PRO n 
4  670  ASP n 
4  671  SER n 
4  672  ALA n 
4  673  ALA n 
4  674  PHE n 
4  675  ILE n 
4  676  GLN n 
4  677  GLN n 
4  678  SER n 
4  679  GLN n 
4  680  GLN n 
4  681  GLN n 
4  682  PRO n 
4  683  PRO n 
4  684  PRO n 
4  685  PRO n 
4  686  THR n 
4  687  SER n 
4  688  GLN n 
4  689  ALA n 
4  690  THR n 
4  691  THR n 
4  692  ALA n 
4  693  LEU n 
4  694  THR n 
4  695  ALA n 
4  696  VAL n 
4  697  VAL n 
4  698  LEU n 
4  699  SER n 
4  700  SER n 
4  701  SER n 
4  702  VAL n 
4  703  GLN n 
4  704  ARG n 
4  705  THR n 
4  706  ALA n 
4  707  GLY n 
4  708  LYS n 
4  709  THR n 
4  710  ALA n 
4  711  ALA n 
4  712  THR n 
4  713  VAL n 
4  714  THR n 
4  715  SER n 
4  716  ALA n 
4  717  LEU n 
4  718  GLN n 
4  719  PRO n 
4  720  PRO n 
4  721  VAL n 
4  722  LEU n 
4  723  SER n 
4  724  LEU n 
4  725  THR n 
4  726  GLN n 
4  727  PRO n 
4  728  THR n 
4  729  GLN n 
4  730  VAL n 
4  731  GLY n 
4  732  VAL n 
4  733  GLY n 
4  734  LYS n 
4  735  GLN n 
4  736  GLY n 
4  737  GLN n 
4  738  PRO n 
4  739  THR n 
4  740  PRO n 
4  741  LEU n 
4  742  VAL n 
4  743  ILE n 
4  744  GLN n 
4  745  GLN n 
4  746  PRO n 
4  747  PRO n 
4  748  LYS n 
4  749  PRO n 
4  750  GLY n 
4  751  ALA n 
4  752  LEU n 
4  753  ILE n 
4  754  ARG n 
4  755  PRO n 
4  756  PRO n 
4  757  GLN n 
4  758  VAL n 
4  759  THR n 
4  760  LEU n 
4  761  THR n 
4  762  GLN n 
4  763  THR n 
4  764  PRO n 
4  765  MET n 
4  766  VAL n 
4  767  ALA n 
4  768  LEU n 
4  769  ARG n 
4  770  GLN n 
4  771  PRO n 
4  772  HIS n 
4  773  ASN n 
4  774  ARG n 
4  775  ILE n 
4  776  MET n 
4  777  LEU n 
4  778  THR n 
4  779  THR n 
4  780  PRO n 
4  781  GLN n 
4  782  GLN n 
4  783  ILE n 
4  784  GLN n 
4  785  LEU n 
4  786  ASN n 
4  787  PRO n 
4  788  LEU n 
4  789  GLN n 
4  790  PRO n 
4  791  VAL n 
4  792  PRO n 
4  793  VAL n 
4  794  VAL n 
4  795  LYS n 
4  796  PRO n 
4  797  ALA n 
4  798  VAL n 
4  799  LEU n 
4  800  PRO n 
4  801  GLY n 
4  802  THR n 
4  803  LYS n 
4  804  ALA n 
4  805  LEU n 
4  806  SER n 
4  807  ALA n 
4  808  VAL n 
4  809  SER n 
4  810  ALA n 
4  811  GLN n 
4  812  ALA n 
4  813  ALA n 
4  814  ALA n 
4  815  ALA n 
4  816  GLN n 
4  817  LYS n 
4  818  ASN n 
4  819  LYS n 
4  820  LEU n 
4  821  LYS n 
4  822  GLU n 
4  823  PRO n 
4  824  GLY n 
4  825  GLY n 
4  826  GLY n 
4  827  SER n 
4  828  PHE n 
4  829  ARG n 
4  830  ASP n 
4  831  ASP n 
4  832  ASP n 
4  833  ASP n 
4  834  ILE n 
4  835  ASN n 
4  836  ASP n 
4  837  VAL n 
4  838  ALA n 
4  839  SER n 
4  840  MET n 
4  841  ALA n 
4  842  GLY n 
4  843  VAL n 
4  844  ASN n 
4  845  LEU n 
4  846  SER n 
4  847  GLU n 
4  848  GLU n 
4  849  SER n 
4  850  ALA n 
4  851  ARG n 
4  852  ILE n 
4  853  LEU n 
4  854  ALA n 
4  855  THR n 
4  856  ASN n 
4  857  SER n 
4  858  GLU n 
4  859  LEU n 
4  860  VAL n 
4  861  GLY n 
4  862  THR n 
4  863  LEU n 
4  864  THR n 
4  865  ARG n 
4  866  SER n 
4  867  CYS n 
4  868  LYS n 
4  869  ASP n 
4  870  GLU n 
4  871  THR n 
4  872  PHE n 
4  873  LEU n 
4  874  LEU n 
4  875  GLN n 
4  876  ALA n 
4  877  PRO n 
4  878  LEU n 
4  879  GLN n 
4  880  ARG n 
4  881  ARG n 
4  882  ILE n 
4  883  LEU n 
4  884  GLU n 
4  885  ILE n 
4  886  GLY n 
4  887  LYS n 
4  888  LYS n 
4  889  HIS n 
4  890  GLY n 
4  891  ILE n 
4  892  THR n 
4  893  GLU n 
4  894  LEU n 
4  895  HIS n 
4  896  PRO n 
4  897  ASP n 
4  898  VAL n 
4  899  VAL n 
4  900  SER n 
4  901  TYR n 
4  902  VAL n 
4  903  SER n 
4  904  HIS n 
4  905  ALA n 
4  906  THR n 
4  907  GLN n 
4  908  GLN n 
4  909  ARG n 
4  910  LEU n 
4  911  GLN n 
4  912  ASN n 
4  913  LEU n 
4  914  VAL n 
4  915  GLU n 
4  916  LYS n 
4  917  ILE n 
4  918  SER n 
4  919  GLU n 
4  920  THR n 
4  921  ALA n 
4  922  GLN n 
4  923  GLN n 
4  924  LYS n 
4  925  ASN n 
4  926  PHE n 
4  927  SER n 
4  928  TYR n 
4  929  LYS n 
4  930  ASP n 
4  931  ASP n 
4  932  ASP n 
4  933  ARG n 
4  934  TYR n 
4  935  GLU n 
4  936  GLN n 
4  937  ALA n 
4  938  SER n 
4  939  ASP n 
4  940  VAL n 
4  941  ARG n 
4  942  ALA n 
4  943  GLN n 
4  944  LEU n 
4  945  LYS n 
4  946  PHE n 
4  947  PHE n 
4  948  GLU n 
4  949  GLN n 
4  950  LEU n 
4  951  ASP n 
4  952  GLN n 
4  953  ILE n 
4  954  GLU n 
4  955  LYS n 
4  956  GLN n 
4  957  ARG n 
4  958  LYS n 
4  959  ASP n 
4  960  GLU n 
4  961  GLN n 
4  962  GLU n 
4  963  ARG n 
4  964  GLU n 
4  965  ILE n 
4  966  LEU n 
4  967  MET n 
4  968  ARG n 
4  969  ALA n 
4  970  ALA n 
4  971  LYS n 
4  972  SER n 
4  973  ARG n 
4  974  SER n 
4  975  ARG n 
4  976  GLN n 
4  977  GLU n 
4  978  ASP n 
4  979  PRO n 
4  980  GLU n 
4  981  GLN n 
4  982  LEU n 
4  983  ARG n 
4  984  LEU n 
4  985  LYS n 
4  986  GLN n 
4  987  LYS n 
4  988  ALA n 
4  989  LYS n 
4  990  GLU n 
4  991  MET n 
4  992  GLN n 
4  993  GLN n 
4  994  GLN n 
4  995  GLU n 
4  996  LEU n 
4  997  ALA n 
4  998  GLN n 
4  999  MET n 
4  1000 ARG n 
4  1001 GLN n 
4  1002 ARG n 
4  1003 ASP n 
4  1004 ALA n 
4  1005 ASN n 
4  1006 LEU n 
4  1007 THR n 
4  1008 ALA n 
4  1009 LEU n 
4  1010 ALA n 
4  1011 ALA n 
4  1012 ILE n 
4  1013 GLY n 
4  1014 PRO n 
4  1015 ARG n 
4  1016 LYS n 
4  1017 LYS n 
4  1018 ARG n 
4  1019 LYS n 
4  1020 VAL n 
4  1021 ASP n 
4  1022 CYS n 
4  1023 PRO n 
4  1024 GLY n 
4  1025 PRO n 
4  1026 GLY n 
4  1027 SER n 
4  1028 GLY n 
4  1029 ALA n 
4  1030 GLU n 
4  1031 GLY n 
4  1032 SER n 
4  1033 GLY n 
4  1034 PRO n 
4  1035 GLY n 
4  1036 SER n 
4  1037 VAL n 
4  1038 VAL n 
4  1039 PRO n 
4  1040 GLY n 
4  1041 SER n 
4  1042 SER n 
4  1043 GLY n 
4  1044 VAL n 
4  1045 GLY n 
4  1046 THR n 
4  1047 PRO n 
4  1048 ARG n 
4  1049 GLN n 
4  1050 PHE n 
4  1051 THR n 
4  1052 ARG n 
4  1053 GLN n 
4  1054 ARG n 
4  1055 ILE n 
4  1056 THR n 
4  1057 ARG n 
4  1058 VAL n 
4  1059 ASN n 
4  1060 LEU n 
4  1061 ARG n 
4  1062 ASP n 
4  1063 LEU n 
4  1064 ILE n 
4  1065 PHE n 
4  1066 CYS n 
4  1067 LEU n 
4  1068 GLU n 
4  1069 ASN n 
4  1070 GLU n 
4  1071 ARG n 
4  1072 GLU n 
4  1073 THR n 
4  1074 SER n 
4  1075 HIS n 
4  1076 SER n 
4  1077 LEU n 
4  1078 LEU n 
4  1079 LEU n 
4  1080 TYR n 
4  1081 LYS n 
4  1082 ALA n 
4  1083 PHE n 
4  1084 LEU n 
4  1085 LYS n 
5  1    MET n 
5  2    ALA n 
5  3    ALA n 
5  4    LEU n 
5  5    ALA n 
5  6    GLU n 
5  7    GLU n 
5  8    GLN n 
5  9    THR n 
5  10   GLU n 
5  11   VAL n 
5  12   ALA n 
5  13   VAL n 
5  14   LYS n 
5  15   LEU n 
5  16   GLU n 
5  17   PRO n 
5  18   GLU n 
5  19   GLY n 
5  20   PRO n 
5  21   PRO n 
5  22   THR n 
5  23   LEU n 
5  24   LEU n 
5  25   PRO n 
5  26   PRO n 
5  27   GLN n 
5  28   ALA n 
5  29   GLY n 
5  30   ASP n 
5  31   GLY n 
5  32   ALA n 
5  33   GLY n 
5  34   GLU n 
5  35   GLY n 
5  36   SER n 
5  37   GLY n 
5  38   GLY n 
5  39   THR n 
5  40   THR n 
5  41   ASN n 
5  42   ASN n 
5  43   GLY n 
5  44   PRO n 
5  45   ASN n 
5  46   GLY n 
5  47   GLY n 
5  48   GLY n 
5  49   GLY n 
5  50   ASN n 
5  51   VAL n 
5  52   ALA n 
5  53   ALA n 
5  54   SER n 
5  55   SER n 
5  56   SER n 
5  57   THR n 
5  58   GLY n 
5  59   GLY n 
5  60   ASP n 
5  61   GLY n 
5  62   GLY n 
5  63   THR n 
5  64   PRO n 
5  65   LYS n 
5  66   PRO n 
5  67   THR n 
5  68   VAL n 
5  69   ALA n 
5  70   VAL n 
5  71   SER n 
5  72   ALA n 
5  73   ALA n 
5  74   ALA n 
5  75   PRO n 
5  76   ALA n 
5  77   GLY n 
5  78   ALA n 
5  79   ALA n 
5  80   PRO n 
5  81   VAL n 
5  82   PRO n 
5  83   ALA n 
5  84   ALA n 
5  85   ALA n 
5  86   PRO n 
5  87   ASP n 
5  88   ALA n 
5  89   GLY n 
5  90   ALA n 
5  91   PRO n 
5  92   HIS n 
5  93   ASP n 
5  94   ARG n 
5  95   GLN n 
5  96   THR n 
5  97   LEU n 
5  98   LEU n 
5  99   ALA n 
5  100  VAL n 
5  101  LEU n 
5  102  GLN n 
5  103  PHE n 
5  104  LEU n 
5  105  ARG n 
5  106  GLN n 
5  107  SER n 
5  108  LYS n 
5  109  LEU n 
5  110  ARG n 
5  111  GLU n 
5  112  ALA n 
5  113  GLU n 
5  114  GLU n 
5  115  ALA n 
5  116  LEU n 
5  117  ARG n 
5  118  ARG n 
5  119  GLU n 
5  120  ALA n 
5  121  GLY n 
5  122  LEU n 
5  123  LEU n 
5  124  GLU n 
5  125  GLU n 
5  126  ALA n 
5  127  VAL n 
5  128  ALA n 
5  129  GLY n 
5  130  SER n 
5  131  GLY n 
5  132  ALA n 
5  133  PRO n 
5  134  GLY n 
5  135  GLU n 
5  136  VAL n 
5  137  ASP n 
5  138  SER n 
5  139  ALA n 
5  140  GLY n 
5  141  ALA n 
5  142  GLU n 
5  143  VAL n 
5  144  THR n 
5  145  SER n 
5  146  ALA n 
5  147  LEU n 
5  148  LEU n 
5  149  SER n 
5  150  ARG n 
5  151  VAL n 
5  152  THR n 
5  153  ALA n 
5  154  SER n 
5  155  ALA n 
5  156  PRO n 
5  157  GLY n 
5  158  PRO n 
5  159  ALA n 
5  160  ALA n 
5  161  PRO n 
5  162  ASP n 
5  163  PRO n 
5  164  PRO n 
5  165  GLY n 
5  166  THR n 
5  167  GLY n 
5  168  ALA n 
5  169  SER n 
5  170  GLY n 
5  171  ALA n 
5  172  THR n 
5  173  VAL n 
5  174  VAL n 
5  175  SER n 
5  176  GLY n 
5  177  SER n 
5  178  ALA n 
5  179  SER n 
5  180  GLY n 
5  181  PRO n 
5  182  ALA n 
5  183  ALA n 
5  184  PRO n 
5  185  GLY n 
5  186  LYS n 
5  187  VAL n 
5  188  GLY n 
5  189  SER n 
5  190  VAL n 
5  191  ALA n 
5  192  VAL n 
5  193  GLU n 
5  194  ASP n 
5  195  GLN n 
5  196  PRO n 
5  197  ASP n 
5  198  VAL n 
5  199  SER n 
5  200  ALA n 
5  201  VAL n 
5  202  LEU n 
5  203  SER n 
5  204  ALA n 
5  205  TYR n 
5  206  ASN n 
5  207  GLN n 
5  208  GLN n 
5  209  GLY n 
5  210  ASP n 
5  211  PRO n 
5  212  THR n 
5  213  MET n 
5  214  TYR n 
5  215  GLU n 
5  216  GLU n 
5  217  TYR n 
5  218  TYR n 
5  219  SER n 
5  220  GLY n 
5  221  LEU n 
5  222  LYS n 
5  223  HIS n 
5  224  PHE n 
5  225  ILE n 
5  226  GLU n 
5  227  CYS n 
5  228  SER n 
5  229  LEU n 
5  230  ASP n 
5  231  CYS n 
5  232  HIS n 
5  233  ARG n 
5  234  ALA n 
5  235  GLU n 
5  236  LEU n 
5  237  SER n 
5  238  GLN n 
5  239  LEU n 
5  240  PHE n 
5  241  TYR n 
5  242  PRO n 
5  243  LEU n 
5  244  PHE n 
5  245  VAL n 
5  246  HIS n 
5  247  MET n 
5  248  TYR n 
5  249  LEU n 
5  250  GLU n 
5  251  LEU n 
5  252  VAL n 
5  253  TYR n 
5  254  ASN n 
5  255  GLN n 
5  256  HIS n 
5  257  GLU n 
5  258  ASN n 
5  259  GLU n 
5  260  ALA n 
5  261  LYS n 
5  262  SER n 
5  263  PHE n 
5  264  PHE n 
5  265  GLU n 
5  266  LYS n 
5  267  PHE n 
5  268  HIS n 
5  269  GLY n 
5  270  ASP n 
5  271  GLN n 
5  272  GLU n 
5  273  CYS n 
5  274  TYR n 
5  275  TYR n 
5  276  GLN n 
5  277  ASP n 
5  278  ASP n 
5  279  LEU n 
5  280  ARG n 
5  281  VAL n 
5  282  LEU n 
5  283  SER n 
5  284  SER n 
5  285  LEU n 
5  286  THR n 
5  287  LYS n 
5  288  LYS n 
5  289  GLU n 
5  290  HIS n 
5  291  MET n 
5  292  LYS n 
5  293  GLY n 
5  294  ASN n 
5  295  GLU n 
5  296  THR n 
5  297  MET n 
5  298  LEU n 
5  299  ASP n 
5  300  PHE n 
5  301  ARG n 
5  302  THR n 
5  303  SER n 
5  304  LYS n 
5  305  PHE n 
5  306  VAL n 
5  307  LEU n 
5  308  ARG n 
5  309  ILE n 
5  310  SER n 
5  311  ARG n 
5  312  ASP n 
5  313  SER n 
5  314  TYR n 
5  315  GLN n 
5  316  LEU n 
5  317  LEU n 
5  318  LYS n 
5  319  ARG n 
5  320  HIS n 
5  321  LEU n 
5  322  GLN n 
5  323  GLU n 
5  324  LYS n 
5  325  GLN n 
5  326  ASN n 
5  327  ASN n 
5  328  GLN n 
5  329  ILE n 
5  330  TRP n 
5  331  ASN n 
5  332  ILE n 
5  333  VAL n 
5  334  GLN n 
5  335  GLU n 
5  336  HIS n 
5  337  LEU n 
5  338  TYR n 
5  339  ILE n 
5  340  ASP n 
5  341  ILE n 
5  342  PHE n 
5  343  ASP n 
5  344  GLY n 
5  345  MET n 
5  346  PRO n 
5  347  ARG n 
5  348  SER n 
5  349  LYS n 
5  350  GLN n 
5  351  GLN n 
5  352  ILE n 
5  353  ASP n 
5  354  ALA n 
5  355  MET n 
5  356  VAL n 
5  357  GLY n 
5  358  SER n 
5  359  LEU n 
5  360  ALA n 
5  361  GLY n 
5  362  GLU n 
5  363  ALA n 
5  364  LYS n 
5  365  ARG n 
5  366  GLU n 
5  367  ALA n 
5  368  ASN n 
5  369  LYS n 
5  370  SER n 
5  371  LYS n 
5  372  VAL n 
5  373  PHE n 
5  374  PHE n 
5  375  GLY n 
5  376  LEU n 
5  377  LEU n 
5  378  LYS n 
5  379  GLU n 
5  380  PRO n 
5  381  GLU n 
5  382  ILE n 
5  383  GLU n 
5  384  VAL n 
5  385  PRO n 
5  386  LEU n 
5  387  ASP n 
5  388  ASP n 
5  389  GLU n 
5  390  ASP n 
5  391  GLU n 
5  392  GLU n 
5  393  GLY n 
5  394  GLU n 
5  395  ASN n 
5  396  GLU n 
5  397  GLU n 
5  398  GLY n 
5  399  LYS n 
5  400  PRO n 
5  401  LYS n 
5  402  LYS n 
5  403  LYS n 
5  404  LYS n 
5  405  PRO n 
5  406  LYS n 
5  407  LYS n 
5  408  ASP n 
5  409  SER n 
5  410  ILE n 
5  411  GLY n 
5  412  SER n 
5  413  LYS n 
5  414  SER n 
5  415  LYS n 
5  416  LYS n 
5  417  GLN n 
5  418  ASP n 
5  419  PRO n 
5  420  ASN n 
5  421  ALA n 
5  422  PRO n 
5  423  PRO n 
5  424  GLN n 
5  425  ASN n 
5  426  ARG n 
5  427  ILE n 
5  428  PRO n 
5  429  LEU n 
5  430  PRO n 
5  431  GLU n 
5  432  LEU n 
5  433  LYS n 
5  434  ASP n 
5  435  SER n 
5  436  ASP n 
5  437  LYS n 
5  438  LEU n 
5  439  ASP n 
5  440  LYS n 
5  441  ILE n 
5  442  MET n 
5  443  ASN n 
5  444  MET n 
5  445  LYS n 
5  446  GLU n 
5  447  THR n 
5  448  THR n 
5  449  LYS n 
5  450  ARG n 
5  451  VAL n 
5  452  ARG n 
5  453  LEU n 
5  454  GLY n 
5  455  PRO n 
5  456  ASP n 
5  457  CYS n 
5  458  LEU n 
5  459  PRO n 
5  460  SER n 
5  461  ILE n 
5  462  CYS n 
5  463  PHE n 
5  464  TYR n 
5  465  THR n 
5  466  PHE n 
5  467  LEU n 
5  468  ASN n 
5  469  ALA n 
5  470  TYR n 
5  471  GLN n 
5  472  GLY n 
5  473  LEU n 
5  474  THR n 
5  475  ALA n 
5  476  VAL n 
5  477  ASP n 
5  478  VAL n 
5  479  THR n 
5  480  ASP n 
5  481  ASP n 
5  482  SER n 
5  483  SER n 
5  484  LEU n 
5  485  ILE n 
5  486  ALA n 
5  487  GLY n 
5  488  GLY n 
5  489  PHE n 
5  490  ALA n 
5  491  ASP n 
5  492  SER n 
5  493  THR n 
5  494  VAL n 
5  495  ARG n 
5  496  VAL n 
5  497  UNK n 
5  498  UNK n 
5  499  UNK n 
5  500  UNK n 
5  501  UNK n 
5  502  UNK n 
5  503  UNK n 
5  504  UNK n 
5  505  UNK n 
5  506  UNK n 
5  507  UNK n 
5  508  UNK n 
5  509  UNK n 
5  510  UNK n 
5  511  UNK n 
5  512  UNK n 
5  513  UNK n 
5  514  UNK n 
5  515  UNK n 
5  516  UNK n 
5  517  UNK n 
5  518  UNK n 
5  519  UNK n 
5  520  UNK n 
5  521  UNK n 
5  522  UNK n 
5  523  UNK n 
5  524  UNK n 
5  525  UNK n 
5  526  UNK n 
5  527  UNK n 
5  528  UNK n 
5  529  UNK n 
5  530  UNK n 
5  531  UNK n 
5  532  UNK n 
5  533  UNK n 
5  534  UNK n 
5  535  UNK n 
5  536  UNK n 
5  537  LYS n 
5  538  ILE n 
5  539  LEU n 
5  540  TYR n 
5  541  GLY n 
5  542  HIS n 
5  543  SER n 
5  544  GLY n 
5  545  PRO n 
5  546  VAL n 
5  547  TYR n 
5  548  GLY n 
5  549  ALA n 
5  550  SER n 
5  551  PHE n 
5  552  SER n 
5  553  PRO n 
5  554  ASP n 
5  555  ARG n 
5  556  ASN n 
5  557  TYR n 
5  558  LEU n 
5  559  LEU n 
5  560  SER n 
5  561  SER n 
5  562  SER n 
5  563  GLU n 
5  564  ASP n 
5  565  GLY n 
5  566  THR n 
5  567  VAL n 
5  568  ARG n 
5  569  LEU n 
5  570  TRP n 
5  571  SER n 
5  572  LEU n 
5  573  GLN n 
5  574  THR n 
5  575  PHE n 
5  576  THR n 
5  577  CYS n 
5  578  LEU n 
5  579  VAL n 
5  580  GLY n 
5  581  TYR n 
5  582  LYS n 
5  583  GLY n 
5  584  HIS n 
5  585  ASN n 
5  586  TYR n 
5  587  PRO n 
5  588  VAL n 
5  589  TRP n 
5  590  ASP n 
5  591  THR n 
5  592  GLN n 
5  593  PHE n 
5  594  SER n 
5  595  PRO n 
5  596  TYR n 
5  597  GLY n 
5  598  TYR n 
5  599  TYR n 
5  600  PHE n 
5  601  VAL n 
5  602  SER n 
5  603  GLY n 
5  604  GLY n 
5  605  HIS n 
5  606  ASP n 
5  607  ARG n 
5  608  VAL n 
5  609  ALA n 
5  610  ARG n 
5  611  LEU n 
5  612  TRP n 
5  613  ALA n 
5  614  THR n 
5  615  ASP n 
5  616  HIS n 
5  617  TYR n 
5  618  GLN n 
5  619  PRO n 
5  620  LEU n 
5  621  ARG n 
5  622  ILE n 
5  623  PHE n 
5  624  ALA n 
5  625  GLY n 
5  626  HIS n 
5  627  LEU n 
5  628  ALA n 
5  629  ASP n 
5  630  VAL n 
5  631  ASN n 
5  632  CYS n 
5  633  THR n 
5  634  ARG n 
5  635  PHE n 
5  636  HIS n 
5  637  PRO n 
5  638  ASN n 
5  639  SER n 
5  640  ASN n 
5  641  TYR n 
5  642  VAL n 
5  643  ALA n 
5  644  THR n 
5  645  GLY n 
5  646  SER n 
5  647  ALA n 
5  648  ASP n 
5  649  ARG n 
5  650  THR n 
5  651  VAL n 
5  652  ARG n 
5  653  LEU n 
5  654  TRP n 
5  655  ASP n 
5  656  VAL n 
5  657  LEU n 
5  658  ASN n 
5  659  GLY n 
5  660  ASN n 
5  661  CYS n 
5  662  VAL n 
5  663  ARG n 
5  664  ILE n 
5  665  PHE n 
5  666  THR n 
5  667  GLY n 
5  668  HIS n 
5  669  LYS n 
5  670  GLY n 
5  671  PRO n 
5  672  ILE n 
5  673  HIS n 
5  674  SER n 
5  675  LEU n 
5  676  THR n 
5  677  PHE n 
5  678  SER n 
5  679  PRO n 
5  680  ASN n 
5  681  GLY n 
5  682  ARG n 
5  683  PHE n 
5  684  LEU n 
5  685  ALA n 
5  686  THR n 
5  687  GLY n 
5  688  ALA n 
5  689  THR n 
5  690  ASP n 
5  691  GLY n 
5  692  ARG n 
5  693  VAL n 
5  694  LEU n 
5  695  LEU n 
5  696  TRP n 
5  697  ASP n 
5  698  ILE n 
5  699  GLY n 
5  700  HIS n 
5  701  GLY n 
5  702  LEU n 
5  703  MET n 
5  704  VAL n 
5  705  GLY n 
5  706  GLU n 
5  707  LEU n 
5  708  LYS n 
5  709  GLY n 
5  710  HIS n 
5  711  THR n 
5  712  ASP n 
5  713  THR n 
5  714  VAL n 
5  715  CYS n 
5  716  SER n 
5  717  LEU n 
5  718  ARG n 
5  719  PHE n 
5  720  SER n 
5  721  ARG n 
5  722  ASP n 
5  723  GLY n 
5  724  GLU n 
5  725  ILE n 
5  726  LEU n 
5  727  ALA n 
5  728  SER n 
5  729  GLY n 
5  730  SER n 
5  731  MET n 
5  732  ASP n 
5  733  ASN n 
5  734  THR n 
5  735  VAL n 
5  736  ARG n 
5  737  LEU n 
5  738  TRP n 
5  739  ASP n 
5  740  ALA n 
5  741  ILE n 
5  742  LYS n 
5  743  ALA n 
5  744  PHE n 
5  745  GLU n 
5  746  ASP n 
5  747  LEU n 
5  748  GLU n 
5  749  THR n 
5  750  ASP n 
5  751  ASP n 
5  752  PHE n 
5  753  THR n 
5  754  THR n 
5  755  ALA n 
5  756  THR n 
5  757  GLY n 
5  758  HIS n 
5  759  ILE n 
5  760  ASN n 
5  761  LEU n 
5  762  PRO n 
5  763  GLU n 
5  764  ASN n 
5  765  SER n 
5  766  GLN n 
5  767  GLU n 
5  768  LEU n 
5  769  LEU n 
5  770  LEU n 
5  771  GLY n 
5  772  THR n 
5  773  TYR n 
5  774  MET n 
5  775  THR n 
5  776  LYS n 
5  777  SER n 
5  778  THR n 
5  779  PRO n 
5  780  VAL n 
5  781  VAL n 
5  782  HIS n 
5  783  LEU n 
5  784  HIS n 
5  785  PHE n 
5  786  THR n 
5  787  ARG n 
5  788  ARG n 
5  789  ASN n 
5  790  LEU n 
5  791  VAL n 
5  792  LEU n 
5  793  ALA n 
5  794  ALA n 
5  795  GLY n 
5  796  ALA n 
5  797  TYR n 
5  798  SER n 
5  799  PRO n 
5  800  GLN n 
6  1    MET n 
6  2    ALA n 
6  3    GLU n 
6  4    GLU n 
6  5    LYS n 
6  6    LYS n 
6  7    LEU n 
6  8    LYS n 
6  9    LEU n 
6  10   SER n 
6  11   ASN n 
6  12   THR n 
6  13   VAL n 
6  14   LEU n 
6  15   PRO n 
6  16   SER n 
6  17   GLU n 
6  18   SER n 
6  19   MET n 
6  20   LYS n 
6  21   VAL n 
6  22   VAL n 
6  23   ALA n 
6  24   GLU n 
6  25   SER n 
6  26   MET n 
6  27   GLY n 
6  28   ILE n 
6  29   ALA n 
6  30   GLN n 
6  31   ILE n 
6  32   GLN n 
6  33   GLU n 
6  34   GLU n 
6  35   THR n 
6  36   CYS n 
6  37   GLN n 
6  38   LEU n 
6  39   LEU n 
6  40   THR n 
6  41   ASP n 
6  42   GLU n 
6  43   VAL n 
6  44   SER n 
6  45   TYR n 
6  46   ARG n 
6  47   ILE n 
6  48   LYS n 
6  49   GLU n 
6  50   ILE n 
6  51   ALA n 
6  52   GLN n 
6  53   ASP n 
6  54   ALA n 
6  55   LEU n 
6  56   LYS n 
6  57   PHE n 
6  58   MET n 
6  59   HIS n 
6  60   MET n 
6  61   GLY n 
6  62   LYS n 
6  63   ARG n 
6  64   GLN n 
6  65   LYS n 
6  66   LEU n 
6  67   THR n 
6  68   THR n 
6  69   SER n 
6  70   ASP n 
6  71   ILE n 
6  72   ASP n 
6  73   TYR n 
6  74   ALA n 
6  75   LEU n 
6  76   LYS n 
6  77   LEU n 
6  78   LYS n 
6  79   ASN n 
6  80   VAL n 
6  81   GLU n 
6  82   PRO n 
6  83   LEU n 
6  84   TYR n 
6  85   GLY n 
6  86   PHE n 
6  87   HIS n 
6  88   ALA n 
6  89   GLN n 
6  90   GLU n 
6  91   PHE n 
6  92   ILE n 
6  93   PRO n 
6  94   PHE n 
6  95   ARG n 
6  96   PHE n 
6  97   ALA n 
6  98   SER n 
6  99   GLY n 
6  100  GLY n 
6  101  GLY n 
6  102  ARG n 
6  103  GLU n 
6  104  LEU n 
6  105  TYR n 
6  106  PHE n 
6  107  TYR n 
6  108  GLU n 
6  109  GLU n 
6  110  LYS n 
6  111  GLU n 
6  112  VAL n 
6  113  ASP n 
6  114  LEU n 
6  115  SER n 
6  116  ASP n 
6  117  ILE n 
6  118  ILE n 
6  119  ASN n 
6  120  THR n 
6  121  PRO n 
6  122  LEU n 
6  123  PRO n 
6  124  ARG n 
6  125  VAL n 
6  126  PRO n 
6  127  LEU n 
6  128  ASP n 
6  129  VAL n 
6  130  CYS n 
6  131  LEU n 
6  132  LYS n 
6  133  ALA n 
6  134  HIS n 
6  135  TRP n 
6  136  LEU n 
6  137  SER n 
6  138  ILE n 
6  139  GLU n 
6  140  GLY n 
6  141  CYS n 
6  142  GLN n 
6  143  PRO n 
6  144  ALA n 
6  145  ILE n 
6  146  PRO n 
6  147  GLU n 
6  148  ASN n 
6  149  PRO n 
6  150  PRO n 
6  151  PRO n 
6  152  ALA n 
6  153  PRO n 
6  154  LYS n 
6  155  GLU n 
6  156  GLN n 
6  157  GLN n 
6  158  LYS n 
6  159  ALA n 
6  160  GLU n 
6  161  ALA n 
6  162  THR n 
6  163  GLU n 
6  164  PRO n 
6  165  LEU n 
6  166  LYS n 
6  167  SER n 
6  168  ALA n 
6  169  LYS n 
6  170  PRO n 
6  171  GLY n 
6  172  GLN n 
6  173  GLU n 
6  174  GLU n 
6  175  ASP n 
6  176  GLY n 
6  177  PRO n 
6  178  LEU n 
6  179  LYS n 
6  180  GLY n 
6  181  LYS n 
6  182  GLY n 
6  183  GLN n 
6  184  GLY n 
6  185  ALA n 
6  186  THR n 
6  187  THR n 
6  188  ALA n 
6  189  ASP n 
6  190  GLY n 
6  191  LYS n 
6  192  GLY n 
6  193  LYS n 
6  194  GLU n 
6  195  LYS n 
6  196  LYS n 
6  197  ALA n 
6  198  PRO n 
6  199  PRO n 
6  200  LEU n 
6  201  LEU n 
6  202  GLU n 
6  203  GLY n 
6  204  ALA n 
6  205  PRO n 
6  206  LEU n 
6  207  ARG n 
6  208  LEU n 
6  209  LYS n 
6  210  PRO n 
6  211  ARG n 
6  212  SER n 
6  213  ILE n 
6  214  HIS n 
6  215  GLU n 
6  216  LEU n 
6  217  SER n 
6  218  VAL n 
6  219  GLU n 
6  220  GLN n 
6  221  GLN n 
6  222  LEU n 
6  223  TYR n 
6  224  TYR n 
6  225  LYS n 
6  226  GLU n 
6  227  ILE n 
6  228  THR n 
6  229  GLU n 
6  230  ALA n 
6  231  CYS n 
6  232  VAL n 
6  233  GLY n 
6  234  SER n 
6  235  CYS n 
6  236  GLU n 
6  237  ALA n 
6  238  LYS n 
6  239  ARG n 
6  240  ALA n 
6  241  GLU n 
6  242  ALA n 
6  243  LEU n 
6  244  GLN n 
6  245  SER n 
6  246  ILE n 
6  247  ALA n 
6  248  THR n 
6  249  ASP n 
6  250  PRO n 
6  251  GLY n 
6  252  LEU n 
6  253  TYR n 
6  254  GLN n 
6  255  MET n 
6  256  LEU n 
6  257  PRO n 
6  258  ARG n 
6  259  PHE n 
6  260  SER n 
6  261  THR n 
6  262  PHE n 
6  263  ILE n 
6  264  SER n 
6  265  GLU n 
6  266  GLY n 
6  267  VAL n 
6  268  ARG n 
6  269  VAL n 
6  270  ASN n 
6  271  VAL n 
6  272  VAL n 
6  273  GLN n 
6  274  ASN n 
6  275  ASN n 
6  276  LEU n 
6  277  ALA n 
6  278  LEU n 
6  279  LEU n 
6  280  ILE n 
6  281  TYR n 
6  282  LEU n 
6  283  MET n 
6  284  ARG n 
6  285  MET n 
6  286  VAL n 
6  287  LYS n 
6  288  ALA n 
6  289  LEU n 
6  290  MET n 
6  291  ASP n 
6  292  ASN n 
6  293  PRO n 
6  294  THR n 
6  295  LEU n 
6  296  TYR n 
6  297  LEU n 
6  298  GLU n 
6  299  LYS n 
6  300  TYR n 
6  301  VAL n 
6  302  HIS n 
6  303  GLU n 
6  304  LEU n 
6  305  ILE n 
6  306  PRO n 
6  307  ALA n 
6  308  VAL n 
6  309  MET n 
6  310  THR n 
6  311  CYS n 
6  312  ILE n 
6  313  VAL n 
6  314  SER n 
6  315  ARG n 
6  316  GLN n 
6  317  LEU n 
6  318  CYS n 
6  319  LEU n 
6  320  ARG n 
6  321  PRO n 
6  322  ASP n 
6  323  VAL n 
6  324  ASP n 
6  325  ASN n 
6  326  HIS n 
6  327  TRP n 
6  328  ALA n 
6  329  LEU n 
6  330  ARG n 
6  331  ASP n 
6  332  PHE n 
6  333  ALA n 
6  334  ALA n 
6  335  ARG n 
6  336  LEU n 
6  337  VAL n 
6  338  ALA n 
6  339  GLN n 
6  340  ILE n 
6  341  CYS n 
6  342  LYS n 
6  343  HIS n 
6  344  PHE n 
6  345  SER n 
6  346  THR n 
6  347  THR n 
6  348  THR n 
6  349  ASN n 
6  350  ASN n 
6  351  ILE n 
6  352  GLN n 
6  353  SER n 
6  354  ARG n 
6  355  ILE n 
6  356  THR n 
6  357  LYS n 
6  358  THR n 
6  359  PHE n 
6  360  THR n 
6  361  LYS n 
6  362  SER n 
6  363  TRP n 
6  364  VAL n 
6  365  ASP n 
6  366  GLU n 
6  367  LYS n 
6  368  THR n 
6  369  PRO n 
6  370  TRP n 
6  371  THR n 
6  372  THR n 
6  373  ARG n 
6  374  TYR n 
6  375  GLY n 
6  376  SER n 
6  377  ILE n 
6  378  ALA n 
6  379  GLY n 
6  380  LEU n 
6  381  ALA n 
6  382  GLU n 
6  383  LEU n 
6  384  GLY n 
6  385  HIS n 
6  386  ASP n 
6  387  VAL n 
6  388  ILE n 
6  389  LYS n 
6  390  THR n 
6  391  LEU n 
6  392  ILE n 
6  393  LEU n 
6  394  PRO n 
6  395  ARG n 
6  396  LEU n 
6  397  GLN n 
6  398  GLN n 
6  399  GLU n 
6  400  GLY n 
6  401  GLU n 
6  402  ARG n 
6  403  ILE n 
6  404  ARG n 
6  405  SER n 
6  406  VAL n 
6  407  LEU n 
6  408  ASP n 
6  409  GLY n 
6  410  PRO n 
6  411  VAL n 
6  412  LEU n 
6  413  SER n 
6  414  ASN n 
6  415  ILE n 
6  416  ASP n 
6  417  ARG n 
6  418  ILE n 
6  419  GLY n 
6  420  ALA n 
6  421  ASP n 
6  422  HIS n 
6  423  VAL n 
6  424  GLN n 
6  425  SER n 
6  426  LEU n 
6  427  LEU n 
6  428  LEU n 
6  429  LYS n 
6  430  HIS n 
6  431  CYS n 
6  432  ALA n 
6  433  PRO n 
6  434  VAL n 
6  435  LEU n 
6  436  ALA n 
6  437  LYS n 
6  438  LEU n 
6  439  ARG n 
6  440  PRO n 
6  441  PRO n 
6  442  PRO n 
6  443  ASP n 
6  444  ASN n 
6  445  GLN n 
6  446  ASP n 
6  447  ALA n 
6  448  TYR n 
6  449  ARG n 
6  450  ALA n 
6  451  GLU n 
6  452  PHE n 
6  453  GLY n 
6  454  SER n 
6  455  LEU n 
6  456  GLY n 
6  457  PRO n 
6  458  LEU n 
6  459  LEU n 
6  460  CYS n 
6  461  SER n 
6  462  GLN n 
6  463  VAL n 
6  464  VAL n 
6  465  LYS n 
6  466  ALA n 
6  467  ARG n 
6  468  ALA n 
6  469  GLN n 
6  470  ALA n 
6  471  ALA n 
6  472  LEU n 
6  473  GLN n 
6  474  ALA n 
6  475  GLN n 
6  476  GLN n 
6  477  VAL n 
6  478  ASN n 
6  479  ARG n 
6  480  THR n 
6  481  THR n 
6  482  LEU n 
6  483  THR n 
6  484  ILE n 
6  485  THR n 
6  486  GLN n 
6  487  PRO n 
6  488  ARG n 
6  489  PRO n 
6  490  THR n 
6  491  LEU n 
6  492  THR n 
6  493  LEU n 
6  494  SER n 
6  495  GLN n 
6  496  ALA n 
6  497  PRO n 
6  498  GLN n 
6  499  PRO n 
6  500  GLY n 
6  501  PRO n 
6  502  ARG n 
6  503  THR n 
6  504  PRO n 
6  505  GLY n 
6  506  LEU n 
6  507  LEU n 
6  508  LYS n 
6  509  VAL n 
6  510  PRO n 
6  511  GLY n 
6  512  SER n 
6  513  ILE n 
6  514  ALA n 
6  515  LEU n 
6  516  PRO n 
6  517  VAL n 
6  518  GLN n 
6  519  THR n 
6  520  LEU n 
6  521  VAL n 
6  522  SER n 
6  523  ALA n 
6  524  ARG n 
6  525  ALA n 
6  526  ALA n 
6  527  ALA n 
6  528  PRO n 
6  529  PRO n 
6  530  GLN n 
6  531  PRO n 
6  532  SER n 
6  533  PRO n 
6  534  PRO n 
6  535  PRO n 
6  536  THR n 
6  537  LYS n 
6  538  PHE n 
6  539  ILE n 
6  540  VAL n 
6  541  MET n 
6  542  SER n 
6  543  SER n 
6  544  SER n 
6  545  SER n 
6  546  SER n 
6  547  ALA n 
6  548  PRO n 
6  549  SER n 
6  550  THR n 
6  551  GLN n 
6  552  GLN n 
6  553  VAL n 
6  554  LEU n 
6  555  SER n 
6  556  LEU n 
6  557  SER n 
6  558  THR n 
6  559  SER n 
6  560  ALA n 
6  561  PRO n 
6  562  GLY n 
6  563  SER n 
6  564  GLY n 
6  565  SER n 
6  566  THR n 
6  567  THR n 
6  568  THR n 
6  569  SER n 
6  570  PRO n 
6  571  VAL n 
6  572  THR n 
6  573  THR n 
6  574  THR n 
6  575  VAL n 
6  576  PRO n 
6  577  SER n 
6  578  VAL n 
6  579  GLN n 
6  580  PRO n 
6  581  ILE n 
6  582  VAL n 
6  583  LYS n 
6  584  LEU n 
6  585  VAL n 
6  586  SER n 
6  587  THR n 
6  588  ALA n 
6  589  THR n 
6  590  THR n 
6  591  ALA n 
6  592  PRO n 
6  593  PRO n 
6  594  SER n 
6  595  THR n 
6  596  ALA n 
6  597  PRO n 
6  598  SER n 
6  599  GLY n 
6  600  PRO n 
6  601  GLY n 
6  602  SER n 
6  603  VAL n 
6  604  GLN n 
6  605  LYS n 
6  606  TYR n 
6  607  ILE n 
6  608  VAL n 
6  609  VAL n 
6  610  SER n 
6  611  LEU n 
6  612  PRO n 
6  613  PRO n 
6  614  THR n 
6  615  GLY n 
6  616  GLU n 
6  617  GLY n 
6  618  LYS n 
6  619  GLY n 
6  620  GLY n 
6  621  PRO n 
6  622  THR n 
6  623  SER n 
6  624  HIS n 
6  625  PRO n 
6  626  SER n 
6  627  PRO n 
6  628  VAL n 
6  629  PRO n 
6  630  PRO n 
6  631  PRO n 
6  632  ALA n 
6  633  SER n 
6  634  SER n 
6  635  PRO n 
6  636  SER n 
6  637  PRO n 
6  638  LEU n 
6  639  SER n 
6  640  GLY n 
6  641  SER n 
6  642  ALA n 
6  643  LEU n 
6  644  CYS n 
6  645  GLY n 
6  646  GLY n 
6  647  LYS n 
6  648  GLN n 
6  649  GLU n 
6  650  ALA n 
6  651  GLY n 
6  652  ASP n 
6  653  SER n 
6  654  PRO n 
6  655  PRO n 
6  656  PRO n 
6  657  ALA n 
6  658  PRO n 
6  659  GLY n 
6  660  THR n 
6  661  PRO n 
6  662  LYS n 
6  663  ALA n 
6  664  ASN n 
6  665  GLY n 
6  666  SER n 
6  667  GLN n 
6  668  PRO n 
6  669  ASN n 
6  670  SER n 
6  671  GLY n 
6  672  SER n 
6  673  PRO n 
6  674  GLN n 
6  675  PRO n 
6  676  ALA n 
6  677  PRO n 
7  1    MET n 
7  2    ALA n 
7  3    GLU n 
7  4    GLU n 
7  5    LYS n 
7  6    LYS n 
7  7    LEU n 
7  8    LYS n 
7  9    LEU n 
7  10   SER n 
7  11   ASN n 
7  12   THR n 
7  13   VAL n 
7  14   LEU n 
7  15   PRO n 
7  16   SER n 
7  17   GLU n 
7  18   SER n 
7  19   MET n 
7  20   LYS n 
7  21   VAL n 
7  22   VAL n 
7  23   ALA n 
7  24   GLU n 
7  25   SER n 
7  26   MET n 
7  27   GLY n 
7  28   ILE n 
7  29   ALA n 
7  30   GLN n 
7  31   ILE n 
7  32   GLN n 
7  33   GLU n 
7  34   GLU n 
7  35   THR n 
7  36   CYS n 
7  37   GLN n 
7  38   LEU n 
7  39   LEU n 
7  40   THR n 
7  41   ASP n 
7  42   GLU n 
7  43   VAL n 
7  44   SER n 
7  45   TYR n 
7  46   ARG n 
7  47   ILE n 
7  48   LYS n 
7  49   GLU n 
7  50   ILE n 
7  51   ALA n 
7  52   GLN n 
7  53   ASP n 
7  54   ALA n 
7  55   LEU n 
7  56   LYS n 
7  57   PHE n 
7  58   MET n 
7  59   HIS n 
7  60   MET n 
7  61   GLY n 
7  62   LYS n 
7  63   ARG n 
7  64   GLN n 
7  65   LYS n 
7  66   LEU n 
7  67   THR n 
7  68   THR n 
7  69   SER n 
7  70   ASP n 
7  71   ILE n 
7  72   ASP n 
7  73   TYR n 
7  74   ALA n 
7  75   LEU n 
7  76   LYS n 
7  77   LEU n 
7  78   LYS n 
7  79   ASN n 
7  80   VAL n 
7  81   GLU n 
7  82   PRO n 
7  83   LEU n 
7  84   TYR n 
7  85   GLY n 
7  86   PHE n 
7  87   HIS n 
7  88   ALA n 
7  89   GLN n 
7  90   GLU n 
7  91   PHE n 
7  92   ILE n 
7  93   PRO n 
7  94   PHE n 
7  95   ARG n 
7  96   PHE n 
7  97   ALA n 
7  98   SER n 
7  99   GLY n 
7  100  GLY n 
7  101  GLY n 
7  102  ARG n 
7  103  GLU n 
7  104  LEU n 
7  105  TYR n 
7  106  PHE n 
7  107  TYR n 
7  108  GLU n 
7  109  GLU n 
7  110  LYS n 
7  111  GLU n 
7  112  VAL n 
7  113  ASP n 
7  114  LEU n 
7  115  SER n 
7  116  ASP n 
7  117  ILE n 
7  118  ILE n 
7  119  ASN n 
7  120  THR n 
7  121  PRO n 
7  122  LEU n 
7  123  PRO n 
7  124  ARG n 
7  125  VAL n 
7  126  PRO n 
7  127  LEU n 
7  128  ASP n 
7  129  VAL n 
7  130  CYS n 
7  131  LEU n 
7  132  LYS n 
7  133  ALA n 
7  134  HIS n 
7  135  TRP n 
7  136  LEU n 
7  137  SER n 
7  138  ILE n 
7  139  GLU n 
7  140  GLY n 
7  141  CYS n 
7  142  GLN n 
7  143  PRO n 
7  144  ALA n 
7  145  ILE n 
7  146  PRO n 
7  147  GLU n 
7  148  ASN n 
7  149  PRO n 
7  150  PRO n 
7  151  PRO n 
7  152  ALA n 
7  153  PRO n 
7  154  LYS n 
7  155  GLU n 
7  156  GLN n 
7  157  GLN n 
7  158  LYS n 
7  159  ALA n 
7  160  GLU n 
7  161  ALA n 
7  162  THR n 
7  163  GLU n 
7  164  PRO n 
7  165  LEU n 
7  166  LYS n 
7  167  SER n 
7  168  ALA n 
7  169  LYS n 
7  170  PRO n 
7  171  GLY n 
7  172  GLN n 
7  173  GLU n 
7  174  GLU n 
7  175  ASP n 
7  176  GLY n 
7  177  PRO n 
7  178  LEU n 
7  179  LYS n 
7  180  GLY n 
7  181  LYS n 
7  182  GLY n 
7  183  GLN n 
7  184  GLY n 
7  185  ALA n 
7  186  THR n 
7  187  THR n 
7  188  ALA n 
7  189  ASP n 
7  190  GLY n 
7  191  LYS n 
7  192  GLY n 
7  193  LYS n 
7  194  GLU n 
7  195  LYS n 
7  196  LYS n 
7  197  ALA n 
7  198  PRO n 
7  199  PRO n 
7  200  LEU n 
7  201  LEU n 
7  202  GLU n 
7  203  GLY n 
7  204  ALA n 
7  205  PRO n 
7  206  LEU n 
7  207  UNK n 
7  208  UNK n 
7  209  UNK n 
7  210  UNK n 
7  211  UNK n 
7  212  UNK n 
7  213  UNK n 
7  214  UNK n 
7  215  UNK n 
7  216  UNK n 
7  217  SER n 
7  218  VAL n 
7  219  GLU n 
7  220  GLN n 
7  221  GLN n 
7  222  LEU n 
7  223  TYR n 
7  224  TYR n 
7  225  LYS n 
7  226  GLU n 
7  227  ILE n 
7  228  THR n 
7  229  GLU n 
7  230  ALA n 
7  231  CYS n 
7  232  VAL n 
7  233  GLY n 
7  234  SER n 
7  235  CYS n 
7  236  GLU n 
7  237  ALA n 
7  238  LYS n 
7  239  ARG n 
7  240  ALA n 
7  241  GLU n 
7  242  ALA n 
7  243  LEU n 
7  244  GLN n 
7  245  SER n 
7  246  ILE n 
7  247  ALA n 
7  248  THR n 
7  249  ASP n 
7  250  PRO n 
7  251  GLY n 
7  252  LEU n 
7  253  TYR n 
7  254  GLN n 
7  255  MET n 
7  256  LEU n 
7  257  PRO n 
7  258  ARG n 
7  259  PHE n 
7  260  SER n 
7  261  THR n 
7  262  PHE n 
7  263  ILE n 
7  264  SER n 
7  265  GLU n 
7  266  GLY n 
7  267  VAL n 
7  268  ARG n 
7  269  VAL n 
7  270  ASN n 
7  271  VAL n 
7  272  VAL n 
7  273  GLN n 
7  274  ASN n 
7  275  ASN n 
7  276  LEU n 
7  277  ALA n 
7  278  LEU n 
7  279  LEU n 
7  280  ILE n 
7  281  TYR n 
7  282  LEU n 
7  283  MET n 
7  284  ARG n 
7  285  MET n 
7  286  VAL n 
7  287  LYS n 
7  288  ALA n 
7  289  LEU n 
7  290  MET n 
7  291  ASP n 
7  292  ASN n 
7  293  PRO n 
7  294  THR n 
7  295  LEU n 
7  296  TYR n 
7  297  LEU n 
7  298  GLU n 
7  299  LYS n 
7  300  TYR n 
7  301  VAL n 
7  302  HIS n 
7  303  GLU n 
7  304  LEU n 
7  305  ILE n 
7  306  PRO n 
7  307  ALA n 
7  308  VAL n 
7  309  MET n 
7  310  THR n 
7  311  CYS n 
7  312  ILE n 
7  313  VAL n 
7  314  SER n 
7  315  ARG n 
7  316  GLN n 
7  317  LEU n 
7  318  CYS n 
7  319  LEU n 
7  320  ARG n 
7  321  PRO n 
7  322  ASP n 
7  323  VAL n 
7  324  ASP n 
7  325  ASN n 
7  326  HIS n 
7  327  TRP n 
7  328  ALA n 
7  329  LEU n 
7  330  ARG n 
7  331  ASP n 
7  332  PHE n 
7  333  ALA n 
7  334  ALA n 
7  335  ARG n 
7  336  LEU n 
7  337  VAL n 
7  338  ALA n 
7  339  GLN n 
7  340  ILE n 
7  341  CYS n 
7  342  LYS n 
7  343  HIS n 
7  344  PHE n 
7  345  SER n 
7  346  THR n 
7  347  THR n 
7  348  THR n 
7  349  ASN n 
7  350  ASN n 
7  351  ILE n 
7  352  GLN n 
7  353  SER n 
7  354  ARG n 
7  355  ILE n 
7  356  THR n 
7  357  LYS n 
7  358  THR n 
7  359  PHE n 
7  360  THR n 
7  361  LYS n 
7  362  SER n 
7  363  TRP n 
7  364  VAL n 
7  365  ASP n 
7  366  GLU n 
7  367  LYS n 
7  368  THR n 
7  369  PRO n 
7  370  TRP n 
7  371  THR n 
7  372  THR n 
7  373  ARG n 
7  374  TYR n 
7  375  GLY n 
7  376  SER n 
7  377  ILE n 
7  378  ALA n 
7  379  GLY n 
7  380  LEU n 
7  381  ALA n 
7  382  GLU n 
7  383  LEU n 
7  384  GLY n 
7  385  HIS n 
7  386  ASP n 
7  387  VAL n 
7  388  ILE n 
7  389  LYS n 
7  390  THR n 
7  391  LEU n 
7  392  ILE n 
7  393  LEU n 
7  394  PRO n 
7  395  ARG n 
7  396  LEU n 
7  397  GLN n 
7  398  GLN n 
7  399  GLU n 
7  400  GLY n 
7  401  GLU n 
7  402  ARG n 
7  403  ILE n 
7  404  ARG n 
7  405  SER n 
7  406  VAL n 
7  407  LEU n 
7  408  ASP n 
7  409  GLY n 
7  410  PRO n 
7  411  VAL n 
7  412  LEU n 
7  413  SER n 
7  414  ASN n 
7  415  ILE n 
7  416  ASP n 
7  417  ARG n 
7  418  ILE n 
7  419  GLY n 
7  420  ALA n 
7  421  ASP n 
7  422  HIS n 
7  423  VAL n 
7  424  GLN n 
7  425  SER n 
7  426  LEU n 
7  427  LEU n 
7  428  LEU n 
7  429  LYS n 
7  430  HIS n 
7  431  CYS n 
7  432  ALA n 
7  433  PRO n 
7  434  VAL n 
7  435  LEU n 
7  436  ALA n 
7  437  LYS n 
7  438  LEU n 
7  439  ARG n 
7  440  PRO n 
7  441  PRO n 
7  442  PRO n 
7  443  ASP n 
7  444  ASN n 
7  445  GLN n 
7  446  ASP n 
7  447  ALA n 
7  448  TYR n 
7  449  ARG n 
7  450  ALA n 
7  451  GLU n 
7  452  PHE n 
7  453  GLY n 
7  454  SER n 
7  455  LEU n 
7  456  GLY n 
7  457  PRO n 
7  458  LEU n 
7  459  LEU n 
7  460  CYS n 
7  461  SER n 
7  462  GLN n 
7  463  VAL n 
7  464  VAL n 
7  465  LYS n 
7  466  ALA n 
7  467  ARG n 
7  468  ALA n 
7  469  GLN n 
7  470  ALA n 
7  471  ALA n 
7  472  LEU n 
7  473  GLN n 
7  474  ALA n 
7  475  GLN n 
7  476  GLN n 
7  477  VAL n 
7  478  ASN n 
7  479  ARG n 
7  480  THR n 
7  481  THR n 
7  482  LEU n 
7  483  THR n 
7  484  ILE n 
7  485  THR n 
7  486  GLN n 
7  487  PRO n 
7  488  ARG n 
7  489  PRO n 
7  490  THR n 
7  491  LEU n 
7  492  THR n 
7  493  LEU n 
7  494  SER n 
7  495  GLN n 
7  496  ALA n 
7  497  PRO n 
7  498  GLN n 
7  499  PRO n 
7  500  GLY n 
7  501  PRO n 
7  502  ARG n 
7  503  THR n 
7  504  PRO n 
7  505  GLY n 
7  506  LEU n 
7  507  LEU n 
7  508  LYS n 
7  509  VAL n 
7  510  PRO n 
7  511  GLY n 
7  512  SER n 
7  513  ILE n 
7  514  ALA n 
7  515  LEU n 
7  516  PRO n 
7  517  VAL n 
7  518  GLN n 
7  519  THR n 
7  520  LEU n 
7  521  VAL n 
7  522  SER n 
7  523  ALA n 
7  524  ARG n 
7  525  ALA n 
7  526  ALA n 
7  527  ALA n 
7  528  PRO n 
7  529  PRO n 
7  530  GLN n 
7  531  PRO n 
7  532  SER n 
7  533  PRO n 
7  534  PRO n 
7  535  PRO n 
7  536  THR n 
7  537  LYS n 
7  538  PHE n 
7  539  ILE n 
7  540  VAL n 
7  541  MET n 
7  542  SER n 
7  543  SER n 
7  544  SER n 
7  545  SER n 
7  546  SER n 
7  547  ALA n 
7  548  PRO n 
7  549  SER n 
7  550  THR n 
7  551  GLN n 
7  552  GLN n 
7  553  VAL n 
7  554  LEU n 
7  555  SER n 
7  556  LEU n 
7  557  SER n 
7  558  THR n 
7  559  SER n 
7  560  ALA n 
7  561  PRO n 
7  562  GLY n 
7  563  SER n 
7  564  GLY n 
7  565  SER n 
7  566  THR n 
7  567  THR n 
7  568  THR n 
7  569  SER n 
7  570  PRO n 
7  571  VAL n 
7  572  THR n 
7  573  THR n 
7  574  THR n 
7  575  VAL n 
7  576  PRO n 
7  577  SER n 
7  578  VAL n 
7  579  GLN n 
7  580  PRO n 
7  581  ILE n 
7  582  VAL n 
7  583  LYS n 
7  584  LEU n 
7  585  VAL n 
7  586  SER n 
7  587  THR n 
7  588  ALA n 
7  589  THR n 
7  590  THR n 
7  591  ALA n 
7  592  PRO n 
7  593  PRO n 
7  594  SER n 
7  595  THR n 
7  596  ALA n 
7  597  PRO n 
7  598  SER n 
7  599  GLY n 
7  600  PRO n 
7  601  GLY n 
7  602  SER n 
7  603  VAL n 
7  604  GLN n 
7  605  LYS n 
7  606  TYR n 
7  607  ILE n 
7  608  VAL n 
7  609  VAL n 
7  610  SER n 
7  611  LEU n 
7  612  PRO n 
7  613  PRO n 
7  614  THR n 
7  615  GLY n 
7  616  GLU n 
7  617  GLY n 
7  618  LYS n 
7  619  GLY n 
7  620  GLY n 
7  621  PRO n 
7  622  THR n 
7  623  SER n 
7  624  HIS n 
7  625  PRO n 
7  626  SER n 
7  627  PRO n 
7  628  VAL n 
7  629  PRO n 
7  630  PRO n 
7  631  PRO n 
7  632  ALA n 
7  633  SER n 
7  634  SER n 
7  635  PRO n 
7  636  SER n 
7  637  PRO n 
7  638  LEU n 
7  639  SER n 
7  640  GLY n 
7  641  SER n 
7  642  ALA n 
7  643  LEU n 
7  644  CYS n 
7  645  GLY n 
7  646  GLY n 
7  647  LYS n 
7  648  GLN n 
7  649  GLU n 
7  650  ALA n 
7  651  GLY n 
7  652  ASP n 
7  653  SER n 
7  654  PRO n 
7  655  PRO n 
7  656  PRO n 
7  657  ALA n 
7  658  PRO n 
7  659  GLY n 
7  660  THR n 
7  661  PRO n 
7  662  LYS n 
7  663  ALA n 
7  664  ASN n 
7  665  GLY n 
7  666  SER n 
7  667  GLN n 
7  668  PRO n 
7  669  ASN n 
7  670  SER n 
7  671  GLY n 
7  672  SER n 
7  673  PRO n 
7  674  GLN n 
7  675  PRO n 
7  676  ALA n 
7  677  PRO n 
8  1    MET n 
8  2    SER n 
8  3    LYS n 
8  4    SER n 
8  5    LYS n 
8  6    ASP n 
8  7    ASP n 
8  8    ALA n 
8  9    PRO n 
8  10   HIS n 
8  11   GLU n 
8  12   LEU n 
8  13   GLU n 
8  14   SER n 
8  15   GLN n 
8  16   PHE n 
8  17   ILE n 
8  18   LEU n 
8  19   ARG n 
8  20   LEU n 
8  21   PRO n 
8  22   PRO n 
8  23   GLU n 
8  24   TYR n 
8  25   ALA n 
8  26   SER n 
8  27   THR n 
8  28   VAL n 
8  29   ARG n 
8  30   ARG n 
8  31   ALA n 
8  32   VAL n 
8  33   GLN n 
8  34   SER n 
8  35   GLY n 
8  36   HIS n 
8  37   VAL n 
8  38   ASN n 
8  39   LEU n 
8  40   LYS n 
8  41   ASP n 
8  42   ARG n 
8  43   LEU n 
8  44   THR n 
8  45   ILE n 
8  46   GLU n 
8  47   LEU n 
8  48   HIS n 
8  49   PRO n 
8  50   ASP n 
8  51   GLY n 
8  52   ARG n 
8  53   HIS n 
8  54   GLY n 
8  55   ILE n 
8  56   VAL n 
8  57   ARG n 
8  58   VAL n 
8  59   ASP n 
8  60   ARG n 
8  61   VAL n 
8  62   PRO n 
8  63   LEU n 
8  64   ALA n 
8  65   SER n 
8  66   LYS n 
8  67   LEU n 
8  68   VAL n 
8  69   ASP n 
8  70   LEU n 
8  71   PRO n 
8  72   CYS n 
8  73   VAL n 
8  74   MET n 
8  75   GLU n 
8  76   SER n 
8  77   LEU n 
8  78   LYS n 
8  79   THR n 
8  80   ILE n 
8  81   ASP n 
8  82   LYS n 
8  83   LYS n 
8  84   THR n 
8  85   PHE n 
8  86   TYR n 
8  87   LYS n 
8  88   THR n 
8  89   ALA n 
8  90   ASP n 
8  91   ILE n 
8  92   CYS n 
8  93   GLN n 
8  94   MET n 
8  95   LEU n 
8  96   VAL n 
8  97   SER n 
8  98   THR n 
8  99   VAL n 
8  100  ASP n 
8  101  GLY n 
8  102  ASP n 
8  103  LEU n 
8  104  TYR n 
8  105  PRO n 
8  106  PRO n 
8  107  VAL n 
8  108  GLU n 
8  109  GLU n 
8  110  PRO n 
8  111  VAL n 
8  112  ALA n 
8  113  SER n 
8  114  THR n 
8  115  ASP n 
8  116  PRO n 
8  117  LYS n 
8  118  ALA n 
8  119  SER n 
8  120  LYS n 
8  121  LYS n 
8  122  LYS n 
8  123  ASP n 
8  124  LYS n 
8  125  ASP n 
8  126  LYS n 
8  127  GLU n 
8  128  LYS n 
8  129  LYS n 
8  130  PHE n 
8  131  ILE n 
8  132  TRP n 
8  133  ASN n 
8  134  HIS n 
8  135  GLY n 
8  136  ILE n 
8  137  THR n 
8  138  LEU n 
8  139  PRO n 
8  140  LEU n 
8  141  LYS n 
8  142  ASN n 
8  143  VAL n 
8  144  ARG n 
8  145  LYS n 
8  146  ARG n 
8  147  ARG n 
8  148  PHE n 
8  149  ARG n 
8  150  LYS n 
8  151  THR n 
8  152  ALA n 
8  153  LYS n 
8  154  LYS n 
8  155  LYS n 
8  156  TYR n 
8  157  ILE n 
8  158  GLU n 
8  159  SER n 
8  160  PRO n 
8  161  ASP n 
8  162  VAL n 
8  163  GLU n 
8  164  LYS n 
8  165  GLU n 
8  166  VAL n 
8  167  LYS n 
8  168  ARG n 
8  169  LEU n 
8  170  LEU n 
8  171  SER n 
8  172  THR n 
8  173  ASP n 
8  174  ALA n 
8  175  GLU n 
8  176  ALA n 
8  177  VAL n 
8  178  SER n 
8  179  THR n 
8  180  ARG n 
8  181  TRP n 
8  182  GLU n 
8  183  ILE n 
8  184  ILE n 
8  185  ALA n 
8  186  GLU n 
8  187  ASP n 
8  188  GLU n 
8  189  THR n 
8  190  LYS n 
8  191  GLU n 
8  192  ALA n 
8  193  GLU n 
8  194  ASN n 
8  195  GLN n 
8  196  GLY n 
8  197  LEU n 
8  198  ASP n 
8  199  ILE n 
8  200  SER n 
8  201  SER n 
8  202  PRO n 
8  203  GLY n 
8  204  MET n 
8  205  SER n 
8  206  GLY n 
8  207  HIS n 
8  208  ARG n 
8  209  GLN n 
8  210  GLY n 
8  211  HIS n 
8  212  ASP n 
8  213  SER n 
8  214  LEU n 
8  215  GLU n 
8  216  HIS n 
8  217  ASP n 
8  218  GLU n 
8  219  LEU n 
8  220  ARG n 
8  221  GLU n 
8  222  ILE n 
8  223  PHE n 
8  224  ASN n 
8  225  ASP n 
8  226  LEU n 
8  227  SER n 
8  228  SER n 
8  229  SER n 
8  230  SER n 
8  231  GLU n 
8  232  ASP n 
8  233  GLU n 
8  234  ASP n 
8  235  GLU n 
8  236  THR n 
8  237  GLN n 
8  238  HIS n 
8  239  GLN n 
8  240  ASP n 
8  241  GLU n 
8  242  GLU n 
8  243  ASP n 
8  244  ILE n 
8  245  ASN n 
8  246  ILE n 
8  247  ILE n 
8  248  ASP n 
8  249  THR n 
8  250  GLU n 
8  251  GLU n 
8  252  ASP n 
8  253  LEU n 
8  254  GLU n 
8  255  ARG n 
8  256  GLN n 
8  257  LEU n 
8  258  GLN n 
8  259  ASP n 
8  260  LYS n 
8  261  LEU n 
8  262  ASN n 
8  263  GLU n 
8  264  SER n 
8  265  ASP n 
8  266  GLU n 
8  267  GLN n 
8  268  HIS n 
8  269  GLN n 
8  270  GLU n 
8  271  ASN n 
8  272  GLU n 
8  273  GLY n 
8  274  THR n 
8  275  ASN n 
8  276  GLN n 
8  277  LEU n 
8  278  VAL n 
8  279  MET n 
8  280  GLY n 
8  281  ILE n 
8  282  GLN n 
8  283  LYS n 
8  284  GLN n 
8  285  ILE n 
8  286  ASP n 
8  287  ASN n 
8  288  MET n 
8  289  LYS n 
8  290  GLY n 
8  291  LYS n 
8  292  LEU n 
8  293  GLN n 
8  294  GLU n 
8  295  THR n 
8  296  GLN n 
8  297  ASP n 
8  298  ARG n 
8  299  ALA n 
8  300  LYS n 
8  301  ARG n 
8  302  GLN n 
8  303  GLU n 
8  304  ASP n 
8  305  LEU n 
8  306  ILE n 
8  307  MET n 
8  308  LYS n 
8  309  VAL n 
8  310  GLU n 
8  311  ASN n 
8  312  LEU n 
8  313  ALA n 
8  314  LEU n 
8  315  LYS n 
8  316  ASN n 
8  317  ARG n 
8  318  PHE n 
8  319  GLN n 
8  320  ALA n 
8  321  VAL n 
8  322  LEU n 
8  323  ASP n 
8  324  GLU n 
8  325  LEU n 
8  326  LYS n 
8  327  GLN n 
8  328  LYS n 
8  329  GLU n 
8  330  ASP n 
8  331  ARG n 
8  332  GLU n 
8  333  LYS n 
8  334  GLU n 
8  335  GLN n 
8  336  LEU n 
8  337  SER n 
8  338  SER n 
8  339  LEU n 
8  340  GLN n 
8  341  GLU n 
8  342  GLU n 
8  343  LEU n 
8  344  GLU n 
8  345  SER n 
8  346  LEU n 
8  347  LEU n 
8  348  GLU n 
8  349  LYS n 
9  1    MET n 
9  2    ALA n 
9  3    ASP n 
9  4    ALA n 
9  5    ALA n 
9  6    ALA n 
9  7    THR n 
9  8    ALA n 
9  9    GLY n 
9  10   ALA n 
9  11   GLY n 
9  12   GLY n 
9  13   SER n 
9  14   GLY n 
9  15   THR n 
9  16   ARG n 
9  17   SER n 
9  18   GLY n 
9  19   SER n 
9  20   LYS n 
9  21   GLN n 
9  22   SER n 
9  23   THR n 
9  24   ASN n 
9  25   PRO n 
9  26   ALA n 
9  27   ASP n 
9  28   ASN n 
9  29   TYR n 
9  30   HIS n 
9  31   LEU n 
9  32   ALA n 
9  33   ARG n 
9  34   ARG n 
9  35   ARG n 
9  36   THR n 
9  37   LEU n 
9  38   GLN n 
9  39   VAL n 
9  40   VAL n 
9  41   VAL n 
9  42   SER n 
9  43   SER n 
9  44   LEU n 
9  45   LEU n 
9  46   THR n 
9  47   GLU n 
9  48   ALA n 
9  49   GLY n 
9  50   PHE n 
9  51   GLU n 
9  52   SER n 
9  53   ALA n 
9  54   GLU n 
9  55   LYS n 
9  56   ALA n 
9  57   SER n 
9  58   VAL n 
9  59   GLU n 
9  60   THR n 
9  61   LEU n 
9  62   THR n 
9  63   GLU n 
9  64   MET n 
9  65   LEU n 
9  66   GLN n 
9  67   SER n 
9  68   TYR n 
9  69   ILE n 
9  70   SER n 
9  71   GLU n 
9  72   ILE n 
9  73   GLY n 
9  74   ARG n 
9  75   SER n 
9  76   ALA n 
9  77   LYS n 
9  78   SER n 
9  79   TYR n 
9  80   CYS n 
9  81   GLU n 
9  82   HIS n 
9  83   THR n 
9  84   ALA n 
9  85   ARG n 
9  86   THR n 
9  87   GLN n 
9  88   PRO n 
9  89   THR n 
9  90   LEU n 
9  91   SER n 
9  92   ASP n 
9  93   ILE n 
9  94   VAL n 
9  95   VAL n 
9  96   THR n 
9  97   LEU n 
9  98   VAL n 
9  99   GLU n 
9  100  MET n 
9  101  GLY n 
9  102  PHE n 
9  103  ASN n 
9  104  VAL n 
9  105  ASP n 
9  106  THR n 
9  107  LEU n 
9  108  PRO n 
9  109  ALA n 
9  110  TYR n 
9  111  ALA n 
9  112  LYS n 
9  113  ARG n 
9  114  SER n 
9  115  GLN n 
9  116  ARG n 
9  117  MET n 
9  118  VAL n 
9  119  ILE n 
9  120  THR n 
9  121  UNK n 
9  122  UNK n 
9  123  UNK n 
9  124  UNK n 
9  125  UNK n 
9  126  UNK n 
9  127  UNK n 
9  128  UNK n 
9  129  UNK n 
9  130  UNK n 
9  131  UNK n 
9  132  UNK n 
9  133  UNK n 
9  134  UNK n 
9  135  UNK n 
9  136  UNK n 
9  137  UNK n 
9  138  UNK n 
9  139  UNK n 
9  140  UNK n 
9  141  UNK n 
9  142  UNK n 
9  143  UNK n 
9  144  UNK n 
9  145  UNK n 
9  146  UNK n 
9  147  UNK n 
9  148  UNK n 
9  149  UNK n 
9  150  UNK n 
9  151  UNK n 
9  152  UNK n 
9  153  UNK n 
9  154  UNK n 
9  155  UNK n 
9  156  UNK n 
9  157  UNK n 
9  158  UNK n 
9  159  UNK n 
9  160  UNK n 
9  161  UNK n 
9  162  UNK n 
9  163  UNK n 
9  164  UNK n 
9  165  UNK n 
9  166  UNK n 
9  167  UNK n 
9  168  UNK n 
9  169  UNK n 
9  170  UNK n 
9  171  UNK n 
9  172  TYR n 
9  173  GLN n 
9  174  VAL n 
9  175  LEU n 
9  176  ARG n 
9  177  GLU n 
9  178  LYS n 
9  179  ALA n 
9  180  ALA n 
9  181  SER n 
9  182  GLN n 
9  183  ARG n 
9  184  ARG n 
9  185  ASP n 
9  186  VAL n 
9  187  GLU n 
9  188  ARG n 
9  189  ALA n 
9  190  LEU n 
9  191  THR n 
9  192  ARG n 
9  193  PHE n 
9  194  MET n 
9  195  ALA n 
9  196  LYS n 
9  197  THR n 
9  198  GLY n 
9  199  GLU n 
9  200  THR n 
9  201  GLN n 
9  202  SER n 
9  203  LEU n 
9  204  PHE n 
9  205  LYS n 
9  206  ASP n 
9  207  ASP n 
9  208  VAL n 
9  209  SER n 
9  210  THR n 
9  211  PHE n 
9  212  PRO n 
9  213  LEU n 
9  214  ILE n 
9  215  ALA n 
9  216  ALA n 
9  217  ARG n 
9  218  PRO n 
9  219  PHE n 
9  220  THR n 
9  221  ILE n 
9  222  PRO n 
9  223  TYR n 
9  224  LEU n 
9  225  THR n 
9  226  ALA n 
9  227  LEU n 
9  228  LEU n 
9  229  PRO n 
9  230  SER n 
9  231  GLU n 
9  232  LEU n 
9  233  GLU n 
9  234  MET n 
9  235  GLN n 
9  236  GLN n 
9  237  MET n 
9  238  GLU n 
9  239  GLU n 
9  240  THR n 
9  241  ASP n 
9  242  SER n 
9  243  SER n 
9  244  GLU n 
9  245  GLN n 
9  246  ASP n 
9  247  GLU n 
9  248  GLN n 
9  249  THR n 
9  250  ASP n 
9  251  THR n 
9  252  GLU n 
9  253  ASN n 
9  254  LEU n 
9  255  ALA n 
9  256  LEU n 
9  257  HIS n 
9  258  ILE n 
9  259  SER n 
9  260  MET n 
9  261  GLU n 
9  262  ASP n 
9  263  SER n 
9  264  GLY n 
9  265  ALA n 
9  266  GLU n 
9  267  LYS n 
9  268  GLU n 
9  269  ASN n 
9  270  THR n 
9  271  SER n 
9  272  VAL n 
9  273  LEU n 
9  274  GLN n 
9  275  GLN n 
9  276  ASN n 
9  277  PRO n 
9  278  SER n 
9  279  LEU n 
9  280  SER n 
9  281  GLY n 
9  282  SER n 
9  283  ARG n 
9  284  ASN n 
9  285  GLY n 
9  286  GLU n 
9  287  GLU n 
9  288  ASN n 
9  289  ILE n 
9  290  ILE n 
9  291  ASP n 
9  292  ASN n 
9  293  PRO n 
9  294  TYR n 
9  295  LEU n 
9  296  ARG n 
9  297  PRO n 
9  298  VAL n 
9  299  LYS n 
9  300  LYS n 
9  301  PRO n 
9  302  LYS n 
9  303  ILE n 
9  304  ARG n 
9  305  ARG n 
9  306  LYS n 
9  307  LYS n 
9  308  SER n 
9  309  LEU n 
9  310  SER n 
10 1    MET n 
10 2    GLU n 
10 3    SER n 
10 4    GLY n 
10 5    LYS n 
10 6    THR n 
10 7    ALA n 
10 8    SER n 
10 9    PRO n 
10 10   LYS n 
10 11   SER n 
10 12   MET n 
10 13   PRO n 
10 14   LYS n 
10 15   ASP n 
10 16   ALA n 
10 17   GLN n 
10 18   MET n 
10 19   MET n 
10 20   ALA n 
10 21   GLN n 
10 22   ILE n 
10 23   LEU n 
10 24   LYS n 
10 25   ASP n 
10 26   MET n 
10 27   GLY n 
10 28   ILE n 
10 29   THR n 
10 30   GLU n 
10 31   TYR n 
10 32   GLU n 
10 33   PRO n 
10 34   ARG n 
10 35   VAL n 
10 36   ILE n 
10 37   ASN n 
10 38   GLN n 
10 39   MET n 
10 40   LEU n 
10 41   GLU n 
10 42   PHE n 
10 43   ALA n 
10 44   PHE n 
10 45   ARG n 
10 46   TYR n 
10 47   VAL n 
10 48   THR n 
10 49   THR n 
10 50   ILE n 
10 51   LEU n 
10 52   ASP n 
10 53   ASP n 
10 54   ALA n 
10 55   LYS n 
10 56   ILE n 
10 57   TYR n 
10 58   SER n 
10 59   SER n 
10 60   HIS n 
10 61   ALA n 
10 62   LYS n 
10 63   LYS n 
10 64   ALA n 
10 65   THR n 
10 66   VAL n 
10 67   ASP n 
10 68   ALA n 
10 69   ASP n 
10 70   ASP n 
10 71   VAL n 
10 72   ARG n 
10 73   LEU n 
10 74   ALA n 
10 75   ILE n 
10 76   GLN n 
10 77   CYS n 
10 78   ARG n 
10 79   ALA n 
10 80   ASP n 
10 81   GLN n 
10 82   SER n 
10 83   PHE n 
10 84   THR n 
10 85   SER n 
10 86   PRO n 
10 87   PRO n 
10 88   PRO n 
10 89   ARG n 
10 90   ASP n 
10 91   PHE n 
10 92   LEU n 
10 93   LEU n 
10 94   ASP n 
10 95   ILE n 
10 96   ALA n 
10 97   ARG n 
10 98   GLN n 
10 99   ARG n 
10 100  ASN n 
10 101  GLN n 
10 102  THR n 
10 103  PRO n 
10 104  LEU n 
10 105  PRO n 
10 106  LEU n 
10 107  ILE n 
10 108  LYS n 
10 109  PRO n 
10 110  UNK n 
10 111  UNK n 
10 112  UNK n 
10 113  UNK n 
10 114  UNK n 
10 115  UNK n 
10 116  UNK n 
10 117  PRO n 
10 118  ASP n 
10 119  ARG n 
10 120  TYR n 
10 121  CYS n 
10 122  LEU n 
10 123  THR n 
10 124  ALA n 
10 125  PRO n 
10 126  ASN n 
10 127  TYR n 
10 128  ARG n 
10 129  LEU n 
10 130  LYS n 
10 131  SER n 
10 132  LEU n 
10 133  GLN n 
10 134  LYS n 
10 135  LYS n 
10 136  ALA n 
10 137  SER n 
10 138  THR n 
10 139  SER n 
10 140  ALA n 
10 141  GLY n 
10 142  ARG n 
10 143  ILE n 
10 144  THR n 
10 145  VAL n 
10 146  PRO n 
10 147  ARG n 
10 148  LEU n 
10 149  SER n 
10 150  VAL n 
10 151  GLY n 
10 152  SER n 
10 153  VAL n 
10 154  THR n 
10 155  SER n 
10 156  ARG n 
10 157  PRO n 
10 158  SER n 
10 159  THR n 
10 160  PRO n 
10 161  THR n 
10 162  LEU n 
10 163  GLY n 
10 164  THR n 
10 165  PRO n 
10 166  THR n 
10 167  PRO n 
10 168  GLN n 
10 169  THR n 
10 170  MET n 
10 171  SER n 
10 172  VAL n 
10 173  SER n 
10 174  THR n 
10 175  LYS n 
10 176  VAL n 
10 177  GLY n 
10 178  THR n 
10 179  PRO n 
10 180  MET n 
10 181  SER n 
10 182  LEU n 
10 183  THR n 
10 184  GLY n 
10 185  GLN n 
10 186  ARG n 
10 187  PHE n 
10 188  THR n 
10 189  VAL n 
10 190  GLN n 
10 191  MET n 
10 192  PRO n 
10 193  THR n 
10 194  SER n 
10 195  GLN n 
10 196  SER n 
10 197  PRO n 
10 198  ALA n 
10 199  VAL n 
10 200  LYS n 
10 201  ALA n 
10 202  SER n 
10 203  ILE n 
10 204  PRO n 
10 205  ALA n 
10 206  THR n 
10 207  SER n 
10 208  ALA n 
10 209  VAL n 
10 210  GLN n 
10 211  ASN n 
10 212  VAL n 
10 213  LEU n 
10 214  ILE n 
10 215  ASN n 
10 216  PRO n 
10 217  SER n 
10 218  LEU n 
10 219  ILE n 
10 220  GLY n 
10 221  SER n 
10 222  LYS n 
10 223  ASN n 
10 224  ILE n 
10 225  LEU n 
10 226  ILE n 
10 227  THR n 
10 228  THR n 
10 229  ASN n 
10 230  MET n 
10 231  MET n 
10 232  SER n 
10 233  SER n 
10 234  GLN n 
10 235  ASN n 
10 236  THR n 
10 237  ALA n 
10 238  ASN n 
10 239  GLU n 
10 240  SER n 
10 241  SER n 
10 242  ASN n 
10 243  ALA n 
10 244  LEU n 
10 245  LYS n 
10 246  ARG n 
10 247  LYS n 
10 248  ARG n 
10 249  GLU n 
10 250  ASP n 
10 251  ASP n 
10 252  ASP n 
10 253  ASP n 
10 254  ASP n 
10 255  ASP n 
10 256  ASP n 
10 257  ASP n 
10 258  ASP n 
10 259  ASP n 
10 260  ASP n 
10 261  TYR n 
10 262  ASP n 
10 263  ASN n 
10 264  LEU n 
11 1    MET n 
11 2    SER n 
11 3    CYS n 
11 4    SER n 
11 5    GLY n 
11 6    SER n 
11 7    GLY n 
11 8    ALA n 
11 9    ASP n 
11 10   PRO n 
11 11   GLU n 
11 12   ALA n 
11 13   ALA n 
11 14   PRO n 
11 15   ALA n 
11 16   SER n 
11 17   ALA n 
11 18   ALA n 
11 19   SER n 
11 20   ALA n 
11 21   PRO n 
11 22   GLY n 
11 23   PRO n 
11 24   ALA n 
11 25   PRO n 
11 26   PRO n 
11 27   VAL n 
11 28   SER n 
11 29   ALA n 
11 30   PRO n 
11 31   ALA n 
11 32   ALA n 
11 33   LEU n 
11 34   PRO n 
11 35   SER n 
11 36   SER n 
11 37   THR n 
11 38   ALA n 
11 39   ALA n 
11 40   GLU n 
11 41   ASN n 
11 42   LYS n 
11 43   ALA n 
11 44   SER n 
11 45   PRO n 
11 46   ALA n 
11 47   GLY n 
11 48   THR n 
11 49   ALA n 
11 50   GLY n 
11 51   GLY n 
11 52   PRO n 
11 53   GLY n 
11 54   ALA n 
11 55   GLY n 
11 56   ALA n 
11 57   ALA n 
11 58   ALA n 
11 59   GLY n 
11 60   GLY n 
11 61   THR n 
11 62   GLY n 
11 63   PRO n 
11 64   LEU n 
11 65   ALA n 
11 66   ALA n 
11 67   ARG n 
11 68   ALA n 
11 69   GLY n 
11 70   GLU n 
11 71   PRO n 
11 72   ALA n 
11 73   GLU n 
11 74   ARG n 
11 75   ARG n 
11 76   GLY n 
11 77   ALA n 
11 78   ALA n 
11 79   PRO n 
11 80   VAL n 
11 81   SER n 
11 82   ALA n 
11 83   GLY n 
11 84   GLY n 
11 85   ALA n 
11 86   ALA n 
11 87   PRO n 
11 88   PRO n 
11 89   GLU n 
11 90   GLY n 
11 91   ALA n 
11 92   ILE n 
11 93   SER n 
11 94   ASN n 
11 95   GLY n 
11 96   VAL n 
11 97   TYR n 
11 98   VAL n 
11 99   LEU n 
11 100  PRO n 
11 101  SER n 
11 102  ALA n 
11 103  ALA n 
11 104  ASN n 
11 105  GLY n 
11 106  ASP n 
11 107  VAL n 
11 108  LYS n 
11 109  PRO n 
11 110  VAL n 
11 111  VAL n 
11 112  SER n 
11 113  SER n 
11 114  THR n 
11 115  PRO n 
11 116  LEU n 
11 117  VAL n 
11 118  ASP n 
11 119  PHE n 
11 120  LEU n 
11 121  MET n 
11 122  GLN n 
11 123  LEU n 
11 124  GLU n 
11 125  ASP n 
11 126  TYR n 
11 127  THR n 
11 128  PRO n 
11 129  THR n 
11 130  ILE n 
11 131  PRO n 
11 132  ASP n 
11 133  ALA n 
11 134  VAL n 
11 135  THR n 
11 136  GLY n 
11 137  TYR n 
11 138  TYR n 
11 139  LEU n 
11 140  ASN n 
11 141  ARG n 
11 142  ALA n 
11 143  GLY n 
11 144  PHE n 
11 145  GLU n 
11 146  ALA n 
11 147  SER n 
11 148  ASP n 
11 149  PRO n 
11 150  ARG n 
11 151  ILE n 
11 152  ILE n 
11 153  ARG n 
11 154  LEU n 
11 155  ILE n 
11 156  SER n 
11 157  LEU n 
11 158  ALA n 
11 159  ALA n 
11 160  GLN n 
11 161  LYS n 
11 162  PHE n 
11 163  ILE n 
11 164  SER n 
11 165  ASP n 
11 166  ILE n 
11 167  ALA n 
11 168  ASN n 
11 169  ASP n 
11 170  ALA n 
11 171  LEU n 
11 172  GLN n 
11 173  HIS n 
11 174  CYS n 
11 175  LYS n 
11 176  MET n 
11 177  LYS n 
11 178  GLY n 
11 179  THR n 
11 180  ALA n 
11 181  SER n 
11 182  GLY n 
11 183  SER n 
11 184  SER n 
11 185  ARG n 
11 186  SER n 
11 187  LYS n 
11 188  SER n 
11 189  LYS n 
11 190  ASP n 
11 191  ARG n 
11 192  LYS n 
11 193  TYR n 
11 194  THR n 
11 195  LEU n 
11 196  THR n 
11 197  MET n 
11 198  GLU n 
11 199  ASP n 
11 200  LEU n 
11 201  THR n 
11 202  PRO n 
11 203  ALA n 
11 204  LEU n 
11 205  SER n 
11 206  GLU n 
11 207  TYR n 
11 208  GLY n 
11 209  ILE n 
11 210  ASN n 
11 211  VAL n 
11 212  LYS n 
11 213  LYS n 
11 214  PRO n 
11 215  HIS n 
11 216  TYR n 
11 217  PHE n 
11 218  THR n 
12 1    MET n 
12 2    ASP n 
12 3    ASP n 
12 4    ALA n 
12 5    HIS n 
12 6    GLU n 
12 7    SER n 
12 8    PRO n 
12 9    SER n 
12 10   ASP n 
12 11   LYS n 
12 12   GLY n 
12 13   GLY n 
12 14   GLU n 
12 15   THR n 
12 16   GLY n 
12 17   GLU n 
12 18   SER n 
12 19   ASP n 
12 20   GLU n 
12 21   THR n 
12 22   ALA n 
12 23   ALA n 
12 24   VAL n 
12 25   PRO n 
12 26   GLY n 
12 27   ASP n 
12 28   PRO n 
12 29   GLY n 
12 30   ALA n 
12 31   THR n 
12 32   ASP n 
12 33   THR n 
12 34   ASP n 
12 35   GLY n 
12 36   ILE n 
12 37   PRO n 
12 38   GLU n 
12 39   GLU n 
12 40   THR n 
12 41   ASP n 
12 42   GLY n 
12 43   ASP n 
12 44   ALA n 
12 45   ASP n 
12 46   VAL n 
12 47   ASP n 
12 48   LEU n 
12 49   LYS n 
12 50   GLU n 
12 51   ALA n 
12 52   ALA n 
12 53   ALA n 
12 54   GLU n 
12 55   GLU n 
12 56   GLY n 
12 57   GLU n 
12 58   LEU n 
12 59   GLU n 
12 60   SER n 
12 61   GLN n 
12 62   ASP n 
12 63   VAL n 
12 64   SER n 
12 65   ASP n 
12 66   LEU n 
12 67   THR n 
12 68   THR n 
12 69   VAL n 
12 70   GLU n 
12 71   ARG n 
12 72   GLU n 
12 73   ASP n 
12 74   SER n 
12 75   SER n 
12 76   LEU n 
12 77   LEU n 
12 78   ASN n 
12 79   PRO n 
12 80   ALA n 
12 81   ALA n 
12 82   LYS n 
12 83   LYS n 
12 84   LEU n 
12 85   LYS n 
12 86   ILE n 
12 87   ASP n 
12 88   THR n 
12 89   LYS n 
12 90   GLU n 
12 91   LYS n 
12 92   LYS n 
12 93   GLU n 
12 94   LYS n 
12 95   LYS n 
12 96   GLN n 
12 97   LYS n 
12 98   VAL n 
12 99   ASP n 
12 100  GLU n 
12 101  ASP n 
12 102  GLU n 
12 103  ILE n 
12 104  GLN n 
12 105  LYS n 
12 106  MET n 
12 107  GLN n 
12 108  ILE n 
12 109  LEU n 
12 110  VAL n 
12 111  SER n 
12 112  SER n 
12 113  PHE n 
12 114  SER n 
12 115  GLU n 
12 116  GLU n 
12 117  GLN n 
12 118  LEU n 
12 119  ASN n 
12 120  ARG n 
12 121  TYR n 
12 122  GLU n 
12 123  MET n 
12 124  TYR n 
12 125  ARG n 
12 126  ARG n 
12 127  SER n 
12 128  ALA n 
12 129  PHE n 
12 130  PRO n 
12 131  LYS n 
12 132  ALA n 
12 133  ALA n 
12 134  ILE n 
12 135  LYS n 
12 136  ARG n 
12 137  LEU n 
12 138  ILE n 
12 139  GLN n 
12 140  SER n 
12 141  ILE n 
12 142  THR n 
12 143  GLY n 
12 144  THR n 
12 145  SER n 
12 146  VAL n 
12 147  SER n 
12 148  GLN n 
12 149  ASN n 
12 150  VAL n 
12 151  VAL n 
12 152  ILE n 
12 153  ALA n 
12 154  MET n 
12 155  SER n 
12 156  GLY n 
12 157  ILE n 
12 158  SER n 
12 159  LYS n 
12 160  VAL n 
12 161  PHE n 
12 162  VAL n 
12 163  GLY n 
12 164  GLU n 
12 165  VAL n 
12 166  VAL n 
12 167  GLU n 
12 168  GLU n 
12 169  ALA n 
12 170  LEU n 
12 171  ASP n 
12 172  VAL n 
12 173  CYS n 
12 174  GLU n 
12 175  LYS n 
12 176  TRP n 
12 177  GLY n 
12 178  GLU n 
12 179  MET n 
12 180  PRO n 
12 181  PRO n 
12 182  LEU n 
12 183  GLN n 
12 184  PRO n 
12 185  LYS n 
12 186  HIS n 
12 187  MET n 
12 188  ARG n 
12 189  GLU n 
12 190  ALA n 
12 191  VAL n 
12 192  ARG n 
12 193  ARG n 
12 194  LEU n 
12 195  LYS n 
12 196  SER n 
12 197  LYS n 
12 198  GLY n 
12 199  GLN n 
12 200  ILE n 
12 201  PRO n 
12 202  ASN n 
12 203  SER n 
12 204  LYS n 
12 205  HIS n 
12 206  LYS n 
12 207  LYS n 
12 208  ILE n 
12 209  ILE n 
12 210  PHE n 
12 211  PHE n 
13 1    MET n 
13 2    ASN n 
13 3    GLN n 
13 4    PHE n 
13 5    GLY n 
13 6    PRO n 
13 7    SER n 
13 8    ALA n 
13 9    LEU n 
13 10   ILE n 
13 11   ASN n 
13 12   LEU n 
13 13   SER n 
13 14   ASN n 
13 15   PHE n 
13 16   SER n 
13 17   SER n 
13 18   ILE n 
13 19   LYS n 
13 20   PRO n 
13 21   GLU n 
13 22   PRO n 
13 23   ALA n 
13 24   SER n 
13 25   THR n 
13 26   PRO n 
13 27   PRO n 
13 28   GLN n 
13 29   GLY n 
13 30   SER n 
13 31   MET n 
13 32   ALA n 
13 33   ASN n 
13 34   SER n 
13 35   THR n 
13 36   ALA n 
13 37   VAL n 
13 38   VAL n 
13 39   LYS n 
13 40   ILE n 
13 41   PRO n 
13 42   GLY n 
13 43   THR n 
13 44   PRO n 
13 45   GLY n 
13 46   ALA n 
13 47   GLY n 
13 48   GLY n 
13 49   ARG n 
13 50   LEU n 
13 51   SER n 
13 52   PRO n 
13 53   GLU n 
13 54   ASN n 
13 55   ASN n 
13 56   GLN n 
13 57   VAL n 
13 58   LEU n 
13 59   THR n 
13 60   LYS n 
13 61   LYS n 
13 62   LYS n 
13 63   LEU n 
13 64   GLN n 
13 65   ASP n 
13 66   LEU n 
13 67   VAL n 
13 68   ARG n 
13 69   GLU n 
13 70   VAL n 
13 71   ASP n 
13 72   PRO n 
13 73   ASN n 
13 74   GLU n 
13 75   GLN n 
13 76   LEU n 
13 77   ASP n 
13 78   GLU n 
13 79   ASP n 
13 80   VAL n 
13 81   GLU n 
13 82   GLU n 
13 83   MET n 
13 84   LEU n 
13 85   LEU n 
13 86   GLN n 
13 87   ILE n 
13 88   ALA n 
13 89   ASP n 
13 90   ASP n 
13 91   PHE n 
13 92   ILE n 
13 93   GLU n 
13 94   SER n 
13 95   VAL n 
13 96   VAL n 
13 97   THR n 
13 98   ALA n 
13 99   ALA n 
13 100  CYS n 
13 101  GLN n 
13 102  LEU n 
13 103  ALA n 
13 104  ARG n 
13 105  HIS n 
13 106  ARG n 
13 107  LYS n 
13 108  SER n 
13 109  SER n 
13 110  THR n 
13 111  LEU n 
13 112  GLU n 
13 113  VAL n 
13 114  LYS n 
13 115  ASP n 
13 116  VAL n 
13 117  GLN n 
13 118  LEU n 
13 119  HIS n 
13 120  LEU n 
13 121  GLU n 
13 122  ARG n 
13 123  GLN n 
13 124  TRP n 
13 125  ASN n 
13 126  MET n 
13 127  TRP n 
13 128  ILE n 
13 129  PRO n 
13 130  GLY n 
13 131  PHE n 
13 132  GLY n 
13 133  SER n 
13 134  GLU n 
13 135  GLU n 
13 136  ILE n 
13 137  ARG n 
13 138  PRO n 
13 139  TYR n 
13 140  LYS n 
13 141  LYS n 
13 142  ALA n 
13 143  CYS n 
13 144  THR n 
13 145  THR n 
13 146  GLU n 
13 147  ALA n 
13 148  HIS n 
13 149  LYS n 
13 150  GLN n 
13 151  ARG n 
13 152  MET n 
13 153  ALA n 
13 154  LEU n 
13 155  ILE n 
13 156  ARG n 
13 157  LYS n 
13 158  THR n 
13 159  THR n 
13 160  LYS n 
13 161  LYS n 
14 1    MET n 
14 2    ALA n 
14 3    ASP n 
14 4    GLU n 
14 5    GLU n 
14 6    GLU n 
14 7    ASP n 
14 8    PRO n 
14 9    THR n 
14 10   PHE n 
14 11   GLU n 
14 12   GLU n 
14 13   GLU n 
14 14   ASN n 
14 15   GLU n 
14 16   GLU n 
14 17   ILE n 
14 18   GLY n 
14 19   GLY n 
14 20   GLY n 
14 21   ALA n 
14 22   GLU n 
14 23   GLY n 
14 24   GLY n 
14 25   GLN n 
14 26   GLY n 
14 27   LYS n 
14 28   ARG n 
14 29   LYS n 
14 30   ARG n 
14 31   LEU n 
14 32   PHE n 
14 33   SER n 
14 34   LYS n 
14 35   GLU n 
14 36   LEU n 
14 37   ARG n 
14 38   CYS n 
14 39   MET n 
14 40   MET n 
14 41   TYR n 
14 42   GLY n 
14 43   PHE n 
14 44   GLY n 
14 45   ASP n 
14 46   ASP n 
14 47   GLN n 
14 48   ASN n 
14 49   PRO n 
14 50   TYR n 
14 51   THR n 
14 52   GLU n 
14 53   SER n 
14 54   VAL n 
14 55   ASP n 
14 56   ILE n 
14 57   LEU n 
14 58   GLU n 
14 59   ASP n 
14 60   LEU n 
14 61   VAL n 
14 62   ILE n 
14 63   GLU n 
14 64   PHE n 
14 65   ILE n 
14 66   THR n 
14 67   GLU n 
14 68   MET n 
14 69   THR n 
14 70   HIS n 
14 71   LYS n 
14 72   ALA n 
14 73   MET n 
14 74   SER n 
14 75   ILE n 
14 76   GLY n 
14 77   ARG n 
14 78   GLN n 
14 79   GLY n 
14 80   ARG n 
14 81   VAL n 
14 82   GLN n 
14 83   VAL n 
14 84   GLU n 
14 85   ASP n 
14 86   ILE n 
14 87   VAL n 
14 88   PHE n 
14 89   LEU n 
14 90   ILE n 
14 91   ARG n 
14 92   LYS n 
14 93   ASP n 
14 94   PRO n 
14 95   ARG n 
14 96   LYS n 
14 97   PHE n 
14 98   ALA n 
14 99   ARG n 
14 100  VAL n 
14 101  LYS n 
14 102  ASP n 
14 103  LEU n 
14 104  LEU n 
14 105  THR n 
14 106  MET n 
14 107  ASN n 
14 108  GLU n 
14 109  GLU n 
14 110  LEU n 
14 111  LYS n 
14 112  ARG n 
14 113  ALA n 
14 114  ARG n 
14 115  LYS n 
14 116  ALA n 
14 117  PHE n 
14 118  ASP n 
14 119  GLU n 
14 120  ALA n 
14 121  ASN n 
14 122  TYR n 
14 123  GLY n 
14 124  SER n 
15 1    MET n 
15 2    ASP n 
15 3    GLN n 
15 4    ASN n 
15 5    ASN n 
15 6    SER n 
15 7    LEU n 
15 8    PRO n 
15 9    PRO n 
15 10   TYR n 
15 11   ALA n 
15 12   GLN n 
15 13   GLY n 
15 14   LEU n 
15 15   ALA n 
15 16   SER n 
15 17   PRO n 
15 18   GLN n 
15 19   GLY n 
15 20   ALA n 
15 21   MET n 
15 22   THR n 
15 23   PRO n 
15 24   GLY n 
15 25   ILE n 
15 26   PRO n 
15 27   ILE n 
15 28   PHE n 
15 29   SER n 
15 30   PRO n 
15 31   MET n 
15 32   MET n 
15 33   PRO n 
15 34   TYR n 
15 35   GLY n 
15 36   THR n 
15 37   GLY n 
15 38   LEU n 
15 39   THR n 
15 40   PRO n 
15 41   GLN n 
15 42   PRO n 
15 43   ILE n 
15 44   GLN n 
15 45   ASN n 
15 46   THR n 
15 47   ASN n 
15 48   SER n 
15 49   LEU n 
15 50   SER n 
15 51   ILE n 
15 52   LEU n 
15 53   GLU n 
15 54   GLU n 
15 55   GLN n 
15 56   GLN n 
15 57   ARG n 
15 58   GLN n 
15 59   GLN n 
15 60   GLN n 
15 61   GLN n 
15 62   GLN n 
15 63   GLN n 
15 64   GLN n 
15 65   GLN n 
15 66   GLN n 
15 67   GLN n 
15 68   GLN n 
15 69   GLN n 
15 70   GLN n 
15 71   GLN n 
15 72   GLN n 
15 73   GLN n 
15 74   GLN n 
15 75   GLN n 
15 76   GLN n 
15 77   GLN n 
15 78   GLN n 
15 79   GLN n 
15 80   GLN n 
15 81   GLN n 
15 82   GLN n 
15 83   GLN n 
15 84   GLN n 
15 85   GLN n 
15 86   GLN n 
15 87   GLN n 
15 88   GLN n 
15 89   GLN n 
15 90   GLN n 
15 91   GLN n 
15 92   GLN n 
15 93   GLN n 
15 94   GLN n 
15 95   GLN n 
15 96   ALA n 
15 97   VAL n 
15 98   ALA n 
15 99   ALA n 
15 100  ALA n 
15 101  ALA n 
15 102  VAL n 
15 103  GLN n 
15 104  GLN n 
15 105  SER n 
15 106  THR n 
15 107  SER n 
15 108  GLN n 
15 109  GLN n 
15 110  ALA n 
15 111  THR n 
15 112  GLN n 
15 113  GLY n 
15 114  THR n 
15 115  SER n 
15 116  GLY n 
15 117  GLN n 
15 118  ALA n 
15 119  PRO n 
15 120  GLN n 
15 121  LEU n 
15 122  PHE n 
15 123  HIS n 
15 124  SER n 
15 125  GLN n 
15 126  THR n 
15 127  LEU n 
15 128  THR n 
15 129  THR n 
15 130  ALA n 
15 131  PRO n 
15 132  LEU n 
15 133  PRO n 
15 134  GLY n 
15 135  THR n 
15 136  THR n 
15 137  PRO n 
15 138  LEU n 
15 139  TYR n 
15 140  PRO n 
15 141  SER n 
15 142  PRO n 
15 143  MET n 
15 144  THR n 
15 145  PRO n 
15 146  MET n 
15 147  THR n 
15 148  PRO n 
15 149  ILE n 
15 150  THR n 
15 151  PRO n 
15 152  ALA n 
15 153  THR n 
15 154  PRO n 
15 155  ALA n 
15 156  SER n 
15 157  GLU n 
15 158  SER n 
15 159  SER n 
15 160  GLY n 
15 161  ILE n 
15 162  VAL n 
15 163  PRO n 
15 164  GLN n 
15 165  LEU n 
15 166  GLN n 
15 167  ASN n 
15 168  ILE n 
15 169  VAL n 
15 170  SER n 
15 171  THR n 
15 172  VAL n 
15 173  ASN n 
15 174  LEU n 
15 175  GLY n 
15 176  CYS n 
15 177  LYS n 
15 178  LEU n 
15 179  ASP n 
15 180  LEU n 
15 181  LYS n 
15 182  THR n 
15 183  ILE n 
15 184  ALA n 
15 185  LEU n 
15 186  ARG n 
15 187  ALA n 
15 188  ARG n 
15 189  ASN n 
15 190  ALA n 
15 191  GLU n 
15 192  TYR n 
15 193  ASN n 
15 194  PRO n 
15 195  LYS n 
15 196  ARG n 
15 197  PHE n 
15 198  ALA n 
15 199  ALA n 
15 200  VAL n 
15 201  ILE n 
15 202  MET n 
15 203  ARG n 
15 204  ILE n 
15 205  ARG n 
15 206  GLU n 
15 207  PRO n 
15 208  ARG n 
15 209  THR n 
15 210  THR n 
15 211  ALA n 
15 212  LEU n 
15 213  ILE n 
15 214  PHE n 
15 215  SER n 
15 216  SER n 
15 217  GLY n 
15 218  LYS n 
15 219  MET n 
15 220  VAL n 
15 221  CYS n 
15 222  THR n 
15 223  GLY n 
15 224  ALA n 
15 225  LYS n 
15 226  SER n 
15 227  GLU n 
15 228  GLU n 
15 229  GLN n 
15 230  SER n 
15 231  ARG n 
15 232  LEU n 
15 233  ALA n 
15 234  ALA n 
15 235  ARG n 
15 236  LYS n 
15 237  TYR n 
15 238  ALA n 
15 239  ARG n 
15 240  VAL n 
15 241  VAL n 
15 242  GLN n 
15 243  LYS n 
15 244  LEU n 
15 245  GLY n 
15 246  PHE n 
15 247  PRO n 
15 248  ALA n 
15 249  LYS n 
15 250  PHE n 
15 251  LEU n 
15 252  ASP n 
15 253  PHE n 
15 254  LYS n 
15 255  ILE n 
15 256  GLN n 
15 257  ASN n 
15 258  MET n 
15 259  VAL n 
15 260  GLY n 
15 261  SER n 
15 262  CYS n 
15 263  ASP n 
15 264  VAL n 
15 265  LYS n 
15 266  PHE n 
15 267  PRO n 
15 268  ILE n 
15 269  ARG n 
15 270  LEU n 
15 271  GLU n 
15 272  GLY n 
15 273  LEU n 
15 274  VAL n 
15 275  LEU n 
15 276  THR n 
15 277  HIS n 
15 278  GLN n 
15 279  GLN n 
15 280  PHE n 
15 281  SER n 
15 282  SER n 
15 283  TYR n 
15 284  GLU n 
15 285  PRO n 
15 286  GLU n 
15 287  LEU n 
15 288  PHE n 
15 289  PRO n 
15 290  GLY n 
15 291  LEU n 
15 292  ILE n 
15 293  TYR n 
15 294  ARG n 
15 295  MET n 
15 296  ILE n 
15 297  LYS n 
15 298  PRO n 
15 299  ARG n 
15 300  ILE n 
15 301  VAL n 
15 302  LEU n 
15 303  LEU n 
15 304  ILE n 
15 305  PHE n 
15 306  VAL n 
15 307  SER n 
15 308  GLY n 
15 309  LYS n 
15 310  VAL n 
15 311  VAL n 
15 312  LEU n 
15 313  THR n 
15 314  GLY n 
15 315  ALA n 
15 316  LYS n 
15 317  VAL n 
15 318  ARG n 
15 319  ALA n 
15 320  GLU n 
15 321  ILE n 
15 322  TYR n 
15 323  GLU n 
15 324  ALA n 
15 325  PHE n 
15 326  GLU n 
15 327  ASN n 
15 328  ILE n 
15 329  TYR n 
15 330  PRO n 
15 331  ILE n 
15 332  LEU n 
15 333  LYS n 
15 334  GLY n 
15 335  PHE n 
15 336  ARG n 
15 337  LYS n 
15 338  THR n 
15 339  THR n 
16 1    UNK n 
16 2    UNK n 
16 3    UNK n 
16 4    UNK n 
16 5    UNK n 
16 6    UNK n 
16 7    UNK n 
16 8    UNK n 
16 9    UNK n 
16 10   UNK n 
16 11   UNK n 
16 12   UNK n 
16 13   UNK n 
16 14   UNK n 
16 15   UNK n 
16 16   UNK n 
16 17   UNK n 
16 18   UNK n 
16 19   UNK n 
16 20   UNK n 
16 21   UNK n 
16 22   UNK n 
16 23   UNK n 
16 24   UNK n 
16 25   UNK n 
16 26   UNK n 
16 27   UNK n 
16 28   UNK n 
16 29   UNK n 
16 30   UNK n 
16 31   UNK n 
16 32   UNK n 
16 33   UNK n 
16 34   UNK n 
16 35   UNK n 
16 36   UNK n 
16 37   UNK n 
16 38   UNK n 
16 39   UNK n 
16 40   UNK n 
16 41   UNK n 
16 42   UNK n 
16 43   UNK n 
16 44   UNK n 
16 45   UNK n 
16 46   UNK n 
16 47   UNK n 
16 48   UNK n 
16 49   UNK n 
16 50   UNK n 
16 51   UNK n 
16 52   UNK n 
16 53   UNK n 
16 54   UNK n 
16 55   UNK n 
16 56   UNK n 
16 57   UNK n 
16 58   UNK n 
16 59   UNK n 
16 60   UNK n 
16 61   UNK n 
16 62   UNK n 
16 63   UNK n 
16 64   UNK n 
16 65   UNK n 
16 66   UNK n 
16 67   UNK n 
16 68   UNK n 
16 69   UNK n 
16 70   UNK n 
16 71   UNK n 
16 72   UNK n 
16 73   UNK n 
16 74   UNK n 
16 75   UNK n 
16 76   UNK n 
16 77   UNK n 
16 78   UNK n 
16 79   UNK n 
16 80   UNK n 
16 81   UNK n 
16 82   UNK n 
16 83   UNK n 
16 84   UNK n 
16 85   UNK n 
16 86   UNK n 
16 87   UNK n 
16 88   UNK n 
16 89   UNK n 
16 90   UNK n 
16 91   UNK n 
16 92   UNK n 
16 93   UNK n 
16 94   UNK n 
16 95   UNK n 
16 96   UNK n 
17 1    UNK n 
17 2    UNK n 
17 3    UNK n 
17 4    UNK n 
17 5    UNK n 
17 6    UNK n 
17 7    UNK n 
17 8    UNK n 
17 9    UNK n 
17 10   UNK n 
17 11   UNK n 
17 12   UNK n 
17 13   UNK n 
17 14   UNK n 
17 15   UNK n 
17 16   UNK n 
17 17   UNK n 
17 18   UNK n 
17 19   UNK n 
17 20   UNK n 
17 21   UNK n 
17 22   UNK n 
17 23   UNK n 
17 24   UNK n 
17 25   UNK n 
17 26   UNK n 
17 27   UNK n 
17 28   UNK n 
17 29   UNK n 
17 30   UNK n 
17 31   UNK n 
17 32   UNK n 
17 33   UNK n 
17 34   UNK n 
17 35   UNK n 
17 36   UNK n 
17 37   UNK n 
17 38   UNK n 
17 39   UNK n 
17 40   UNK n 
17 41   UNK n 
17 42   UNK n 
17 43   UNK n 
17 44   UNK n 
17 45   UNK n 
17 46   UNK n 
17 47   UNK n 
17 48   UNK n 
17 49   UNK n 
17 50   UNK n 
17 51   UNK n 
17 52   UNK n 
17 53   UNK n 
17 54   UNK n 
17 55   UNK n 
17 56   UNK n 
17 57   UNK n 
17 58   UNK n 
17 59   UNK n 
17 60   UNK n 
17 61   UNK n 
17 62   UNK n 
17 63   UNK n 
17 64   UNK n 
17 65   UNK n 
17 66   UNK n 
17 67   UNK n 
17 68   UNK n 
17 69   UNK n 
17 70   UNK n 
17 71   UNK n 
17 72   UNK n 
17 73   UNK n 
17 74   UNK n 
17 75   UNK n 
17 76   UNK n 
17 77   UNK n 
17 78   UNK n 
17 79   UNK n 
17 80   UNK n 
17 81   UNK n 
17 82   UNK n 
17 83   UNK n 
17 84   UNK n 
17 85   UNK n 
17 86   UNK n 
17 87   UNK n 
17 88   UNK n 
17 89   UNK n 
17 90   UNK n 
17 91   UNK n 
17 92   UNK n 
17 93   UNK n 
17 94   UNK n 
17 95   UNK n 
17 96   UNK n 
17 97   UNK n 
17 98   UNK n 
17 99   UNK n 
17 100  UNK n 
17 101  UNK n 
17 102  UNK n 
17 103  UNK n 
17 104  UNK n 
17 105  UNK n 
17 106  UNK n 
17 107  UNK n 
17 108  UNK n 
17 109  UNK n 
17 110  UNK n 
17 111  UNK n 
17 112  UNK n 
17 113  UNK n 
17 114  UNK n 
17 115  UNK n 
17 116  UNK n 
17 117  UNK n 
17 118  UNK n 
17 119  UNK n 
17 120  UNK n 
17 121  UNK n 
17 122  UNK n 
17 123  UNK n 
17 124  UNK n 
17 125  UNK n 
17 126  UNK n 
17 127  UNK n 
17 128  UNK n 
17 129  UNK n 
17 130  UNK n 
17 131  UNK n 
17 132  UNK n 
17 133  UNK n 
17 134  UNK n 
17 135  UNK n 
17 136  UNK n 
17 137  UNK n 
17 138  UNK n 
17 139  UNK n 
17 140  UNK n 
17 141  UNK n 
17 142  UNK n 
17 143  UNK n 
17 144  UNK n 
17 145  UNK n 
17 146  UNK n 
17 147  UNK n 
17 148  UNK n 
17 149  UNK n 
17 150  UNK n 
17 151  UNK n 
17 152  UNK n 
17 153  UNK n 
17 154  UNK n 
17 155  UNK n 
17 156  UNK n 
17 157  UNK n 
17 158  UNK n 
17 159  UNK n 
17 160  UNK n 
17 161  UNK n 
17 162  UNK n 
17 163  UNK n 
17 164  UNK n 
17 165  UNK n 
17 166  UNK n 
17 167  UNK n 
17 168  UNK n 
17 169  UNK n 
17 170  UNK n 
17 171  UNK n 
17 172  UNK n 
17 173  UNK n 
17 174  UNK n 
17 175  UNK n 
17 176  UNK n 
17 177  UNK n 
17 178  UNK n 
17 179  UNK n 
17 180  UNK n 
17 181  UNK n 
17 182  UNK n 
17 183  UNK n 
17 184  UNK n 
17 185  UNK n 
17 186  UNK n 
17 187  UNK n 
17 188  UNK n 
17 189  UNK n 
17 190  UNK n 
17 191  UNK n 
17 192  UNK n 
17 193  UNK n 
17 194  UNK n 
17 195  UNK n 
17 196  UNK n 
17 197  UNK n 
17 198  UNK n 
17 199  UNK n 
17 200  UNK n 
17 201  UNK n 
17 202  UNK n 
17 203  UNK n 
17 204  UNK n 
17 205  UNK n 
17 206  UNK n 
17 207  UNK n 
17 208  UNK n 
17 209  UNK n 
17 210  UNK n 
17 211  UNK n 
17 212  UNK n 
17 213  UNK n 
17 214  UNK n 
17 215  UNK n 
17 216  UNK n 
17 217  UNK n 
17 218  UNK n 
17 219  UNK n 
17 220  UNK n 
17 221  UNK n 
17 222  UNK n 
17 223  UNK n 
17 224  UNK n 
17 225  UNK n 
17 226  UNK n 
17 227  UNK n 
17 228  UNK n 
17 229  UNK n 
17 230  UNK n 
17 231  UNK n 
17 232  UNK n 
17 233  UNK n 
17 234  UNK n 
17 235  UNK n 
17 236  UNK n 
17 237  UNK n 
17 238  UNK n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   1872 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'TAF1, BA2R, CCG1, CCGS, TAF2A' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
2  1 sample 1   1199 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample 1   929  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample 1   1085 Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample 1   496  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  2 sample 497 536  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  3 sample 537 800  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample 1   677  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample 1   206  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  2 sample 207 216  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  3 sample 217 677  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample 1   349  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample 1   120  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  2 sample 121 170  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  3 sample 171 310  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample 1   108  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 2 sample 109 116  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 3 sample 117 264  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample 1   218  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample 1   211  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample 1   161  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample 1   124  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
15 1 sample 1   339  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
16 1 sample 1   96   Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
17 1 sample 1   238  Human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  UNP TAF1_HUMAN  P21675 ?        1  
;MGPGCDLLLRTAATITAAAIMSDTDSDEDSAGGGPFSLAGFLFGNINGAGQLEGESVLDDECKKHLAGLGALGLGSLITE
LTANEELTGTDGALVNDEGWVRSTEDAVDYSDINEVAEDESRRYQQTMGSLQPLCHSDYDEDDYDADCEDIDCKLMPPPP
PPPGPMKKDKDQDSITGEKVDFSSSSDSESEMGPQEATQAESEDGKLTLPLAGIMQHDATKLLPSVTELFPEFRPGKVLR
FLRLFGPGKNVPSVWRSARRKRKKKHRELIQEEQIQEVECSVESEVSQKSLWNYDYAPPPPPEQCLSDDEITMMAPVESK
FSQSTGDIDKVTDTKPRVAEWRYGPARLWYDMLGVPEDGSGFDYGFKLRKTEHEPVIKSRMIEEFRKLEENNGTDLLADE
NFLMVTQLHWEDDIIWDGEDVKHKGTKPQRASLAGWLPSSMTRNAMAYNVQQGFAATLDDDKPWYSIFPIDNEDLVYGRW
EDNIIWDAQAMPRLLEPPVLTLDPNDENLILEIPDEKEEATSNSPSKESKKESSLKKSRILLGKTGVIKEEPQQNMSQPE
VKDPWNLSNDEYYYPKQQGLRGTFGGNIIQHSIPAVELRQPFFPTHMGPIKLRQFHRPPLKKYSFGALSQPGPHSVQPLL
KHIKKKAKMREQERQASGGGEMFFMRTPQDLTGKDGDLILAEYSEENGPLMMQVGMATKIKNYYKRKPGKDPGAPDCKYG
ETVYCHTSPFLGSLHPGQLLQAFENNLFRAPIYLHKMPETDFLIIRTRQGYYIRELVDIFVVGQQCPLFEVPGPNSKRAN
THIRDFLQVFIYRLFWKSKDRPRRIRMEDIKKAFPSHSESSIRKRLKLCADFKRTGMDSNWWVLKSDFRLPTEEEIRAMV
SPEQCCAYYSMIAAEQRLKDAGYGEKSFFAPEEENEEDFQMKIDDEVRTAPWNTTRAFIAAMKGKCLLEVTGVADPTGCG
EGFSYVKIPNKPTQQKDDKEPQPVKKTVTGTDADLRRLSLKNAKQLLRKFGVPEEEIKKLSRWEVIDVVRTMSTEQARSG
EGPMSKFARGSRFSVAEHQERYKEECQRIFDLQNKVLSSTEVLSTDTDSSSAEDSDFEEMGKNIENMLQNKKTSSQLSRE
REEQERKELQRMLLAAGSAASGNNHRDDDTASVTSLNSSATGRCLKIYRTFRDEEGKEYVRCETVRKPAVIDAYVRIRTT
KDEEFIRKFALFDEQHREEMRKERRRIQEQLRRLKRNQEKEKLKGPPEKKPKKMKERPDLKLKCGACGAIGHMRTNKFCP
LYYQTNAPPSNPVAMTEEQEEELEKTVIHNDNEELIKVEGTKIVLGKQLIESADEVRRKSLVLKFPKQQLPPKKKRRVGT
TVHCDYLNRPHKSIHRRRTDPMVTLSSILESIINDMRDLPNTYPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRLYP
SREEFREHLELIVKNSATYNGPKHSLTQISQSMLDLCDEKLKEKEDKLARLEKAINPLLDDDDQVAFSFILDNIVTQKMM
AVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNISKHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVC
YQTLTEYDEHLTQLEKDICTAKEAALEEAELESLDPMTPGPYTPQPPDLYDTNTSLSMSRDASVFQDESNMSVLDIPSAT
PEKQVTQEGEDGDGDLADEEEGTVQQPQASVLYEDLLMSEGEDDEEDAGSDEEGDNPFSAIQLSESGSDSDVGSGGIRPK
QPRMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSG
PSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE
;
1   
2  UNP TAF2_HUMAN  Q6P1X5 ?        2  
;MPLTGVEPARMNRKKGDKGFESPRPYKLTHQVVCINNINFQRKSVVGFVELTIFPTVANLNRIKLNSKQCRIYRVRINDL
EAAFIYNDPTLEVCHSESKQRNLNYFSNAYAAAVSAVDPDAGNGELCIKVPSELWKHVDELKVLKIHINFSLDQPKGGLH
FVVPSVEGSMAERGAHVFSCGYQNSTRFWFPCVDSYSELCTWKLEFTVDAAMVAVSNGDLVETVYTHDMRKKTFHYMLTI
PTAASNISLAIGPFEILVDPYMHEVTHFCLPQLLPLLKHTTSYLHEVFEFYEEILTCRYPYSCFKTVFIDEAYVEVAAYA
SMSIFSTNLLHSAMIIDETPLTRRCLAQSLAQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGVNEYRHWIKEELD
KIVAYELKTGGVLLHPIFGGGKEKDNPASHLHFSIKHPHTLSWEYYSMFQCKAHLVMRLIENRISMEFMLQVFNKLLSLA
STASSQKFQSHMWSQMLVSTSGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQDYTSPGTQKY
VGPLKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNKKKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSVLRKV
EFEQADFMWQYQLRYERDVVAQQESILALEKFPTPASRLALTDILEQEQCFYRVRMSACFCLAKIANSMVSTWTGPPAMK
SLFTRMFCCKSCPNIVKTNNFMSFQSYFLQKTMPVAMALLRDVHNLCPKEVLTFILDLIKYNDNRKNKFSDNYYRAEMID
ALANSVTPAVSVNNEVRTLDNLNPDVRLILEEITRFLNMEKLLPSYRHTITVSCLRAIRVLQKNGHVPSDPALFKSYAEY
GHFVDIRIAALEAVVDYTKVDRSYEELQWLLNMIQNDPVPYVRHKILNMLTKNPPFTKNMESPLCNEALVDQLWKLMNSG
TSHDWRLRCGAVDLYFTLFGLSRPSCLPLPELGLVLNLKEKKAVLNPTIIPESVAGNQEAANNPSSHPQLVGFQNPFSSS
QDEEEIDMDTVHDSQAFISHHLNMLERPSTPGLSKYRPASSRSALIPQHSAGCDSTPTTKPQWSLELARKGTGKEQAPLE
MSMHPAASAPLSVFTKESTASKHSDHHHHHHHEHKKKKKKHKHKHKHKHKHDSKEKDKEPFTFSSPASGRSIRSPSLSD
;
1   
3  UNP TAF3_HUMAN  Q5VWG9 ?        3  
;MCESYSRSLLRVSVAQICQALGWDSVQLSACHLLTDVLQRYLQQLGRGCHRYSELYGRTDPILDDVGEAFQLMGVSLHEL
EDYIHNIEPVTFPHQIPSFPVSKNNVLQFPQPGSKDAEERKEYIPDYLPPIVSSQEEEEEEQVPTDGGTSAEAMQVPLEE
DDELEEEEIINDENFLGKRPLDSPEAEELPAMKRPRLLSTKGDTLDVVLLEAREPLSSINTQKIPPMLSPVHVQDSTDLA
PPSPEPPMLAPVAKSQMPTAKPLETKSFTPKTKTKTSSPGQKTKSPKTAQSPAMVGSPIRSPKTVSKEKKSPGRSKSPKS
PKSPKVTTHIPQTPVRPETPNRTPSATLSEKISKETIQVKQIQTPPDAGKLNSENQPKKAVVADKTIEASIDAVIARACA
EREPDPFEFSSGSESEGDIFTSPKRISGPECTTPKASTSANNFTKSGSTPLPLSGGTSSSDNSWTMDASIDEVVRKAKLG
TPSNMPPNFPYISSPSVSPPTPEPLHKVYEEKTKLPSSVEVKKKLKKELKTKMKKKEKQRDREREKDKNKDKSKEKDKVK
EKEKDKETGRETKYPWKEFLKEEEADPYKFKIKEFEDVDPKVKLKDGLVRKEKEKHKDKKKDREKGKKDKDKREKEKVKD
KGREDKMKAPAPPLVLPPKELALPLFSPATASRVPAMLPSLLPVLPEKLFEEKEKVKEKEKKKDKKEKKKKKEKEKEKKE
KEREKEKREREKREKEKEKHKHEKIKVEPVALAPSPVIPRLTLRVGAGQDKIVISKVVPAPEAKPAPSQNRPKTPPPAPA
PAPGPMLVSPAPVPLPLLAQAAAGPALLPSPGPAASGASAKAPVRSVVTETVSTYVIRDEWGNQIWICPGCNKPDDGSPM
IGCDDCDDWYHWPCVGIMTAPPEEMQWFCPKCANKKKDKKHKKRKHRAH
;
1   
4  UNP TAF4_HUMAN  O00268 ?        4  
;MAAGSDLLDEVFFNSEVDEKVVSDLVGSLESQLAASAAHHHHLAPRTPEVRAAAAGALGNHVVSGSPAGAAGAGPAAPAE
GAPGAAPEPPPAGRARPGGGGPQRPGPPSPRRPLVPAGPAPPAAKLRPPPEGSAGSCAPVPAAAAVAAGPEPAPAGPAKP
AGPAALAARAGPGPGPGPGPGPGPGPGKPAGPGAAQTLNGSAALLNSHHAAAPAVSLVNNGPAALLPLPKPAAPGTVIQT
PPFVGAAAPPAPAAPSPPAAPAPAAPAAAPPPPPPAPATLARPPGHPAGPPTAAPAVPPPAAAQNGGSAGAAPAPAPAAG
GPAGVSGQPGPGAAAAAPAPGVKAESPKRVVQAAPPAAQTLAASGPASTAASMVIGPTMQGALPSPAAVPPPAPGTPTGL
PKGAAGAVTQSLSRTPTATTSGIRATLTPTVLAPRLPQPPQNPTNIQNFQLPPGMVLVRSENGQLLMIPQQALAQMQAQA
HAQPQTTMAPRPATPTSAPPVQISTVQAPGTPIIARQVTPTTIIKQVSQAQTTVQPSATLQRSPGVQPQLVLGGAAQTAS
LGTATAVQTGTPQRTVPGATTTSSAATETMENVKKCKNFLSTLIKLASSGKQSTETAANVKELVQNLLDGKIEAEDFTSR
LYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQPPPPTSQATTALTAVVLSSSVQRTAGKTAATVTSALQPP
VLSLTQPTQVGVGKQGQPTPLVIQQPPKPGALIRPPQVTLTQTPMVALRQPHNRIMLTTPQQIQLNPLQPVPVVKPAVLP
GTKALSAVSAQAAAAQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKDETFLLQAPLQR
RILEIGKKHGITELHPDVVSYVSHATQQRLQNLVEKISETAQQKNFSYKDDDRYEQASDVRAQLKFFEQLDQIEKQRKDE
QEREILMRAAKSRSRQEDPEQLRLKQKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDCPGPGSGAEGSGPGSVVPG
SSGVGTPRQFTRQRITRVNLRDLIFCLENERETSHSLLLYKAFLK
;
1   
5  UNP TAF5_HUMAN  Q15542 ?        5  
;MAALAEEQTEVAVKLEPEGPPTLLPPQAGDGAGEGSGGTTNNGPNGGGGNVAASSSTGGDGGTPKPTVAVSAAAPAGAAP
VPAAAPDAGAPHDRQTLLAVLQFLRQSKLREAEEALRREAGLLEEAVAGSGAPGEVDSAGAEVTSALLSRVTASAPGPAA
PDPPGTGASGATVVSGSASGPAAPGKVGSVAVEDQPDVSAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLF
YPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLDFRTSKFVLRISRDSYQLLKRH
LQEKQNNQIWNIVQEHLYIDIFDGMPRSKQQIDAMVGSLAGEAKREANKSKVFFGLLKEPEIEVPLDDEDEEGENEEGKP
KKKKPKKDSIGSKSKKQDPNAPPQNRIPLPELKDSDKLDKIMNMKETTKRVRLGPDCLPSICFYTFLNAYQGLTAVDVTD
DSSLIAGGFADSTVRV
;
1   
6  PDB 6MZL        6MZL   ?        5  ? 497 
7  UNP TAF5_HUMAN  Q15542 ?        5  
;KILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPYGYYFVSGGHDRVARLWATDH
YQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLW
DIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLLGTYMTK
STPVVHLHFTRRNLVLAAGAYSPQ
;
537 
8  UNP TAF6_HUMAN  P49848 ?        6  
;MAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNV
EPLYGFHAQEFIPFRFASGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAE
ATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRA
EALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLR
PDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRITKTFTKSWVDEKTPWTTRYGSIAGLAELGHDVIKTLILPRLQQEG
ERIRSVLDGPVLSNIDRIGADHVQSLLLKHCAPVLAKLRPPPDNQDAYRAEFGSLGPLLCSQVVKARAQAALQAQQVNRT
TLTITQPRPTLTLSQAPQPGPRTPGLLKVPGSIALPVQTLVSARAAAPPQPSPPPTKFIVMSSSSSAPSTQQVLSLSTSA
PGSGSTTTSPVTTTVPSVQPIVKLVSTATTAPPSTAPSGPGSVQKYIVVSLPPTGEGKGGPTSHPSPVPPPASSPSPLSG
SALCGGKQEAGDSPPPAPGTPKANGSQPNSGSPQPAP
;
1   
9  UNP TAF6_HUMAN  P49848 P49848-3 7  
;MAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEIAQDALKFMHMGKRQKLTTSDIDYALKLKNV
EPLYGFHAQEFIPFRFASGGGRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPPPAPKEQQKAE
ATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPLLEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRA
EALQSIATDPGLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKYVHELIPAVMTCIVSRQLCLR
PDVDNHWALRDFAARLVAQICKHFSTTTNNIQSRITKTFTKSWVDEKTPWTTRYGSIAGLAELGHDVIKTLILPRLQQEG
ERIRSVLDGPVLSNIDRIGADHVQSLLLKHCAPVLAKLRPPPDNQDAYRAEFGSLGPLLCSQVVKARAQAALQAQQVNRT
TLTITQPRPTLTLSQAPQPGPRTPGLLKVPGSIALPVQTLVSARAAAPPQPSPPPTKFIVMSSSSSAPSTQQVLSLSTSA
PGSGSTTTSPVTTTVPSVQPIVKLVSTATTAPPSTAPSGPGSVQKYIVVSLPPTGEGKGGPTSHPSPVPPPASSPSPLSG
SALCGGKQEAGDSPPPAPGTPKANGSQPNSGSPQPAP
;
38  
10 PDB 6MZL        6MZL   ?        7  ? 207 
11 PDB 6MZL        6MZL   ?        7  ? 217 
12 UNP TAF7_HUMAN  Q15545 ?        8  
;MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDRVPLASKLVDLPCVMESLKTI
DKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASKKKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESP
DVEKEVKRLLSTDAEAVSTRWEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQD
EEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAKRQEDLIMKVENLALKNRFQA
VLDELKQKEDREKEQLSSLQEELESLLEK
;
1   
13 UNP TAF8_HUMAN  Q7Z7C8 ?        9  
;MADAAATAGAGGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVETLTEMLQSYISEIGRSAKSYC
EHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYI
KTPTYREPVSDYQVLREKAASQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYLTALLPSELEMQQMEET
DSSEQDEQTDTENLALHISMEDSGAEKENTSVLQQNPSLSGSRNGEENIIDNPYLRPVKKPKIRRKKSLS
;
1   
14 PDB 6MZL        6MZL   ?        9  ? 121 
15 PDB 6MZL        6MZL   ?        9  ? 171 
16 UNP TAF9_HUMAN  Q16594 ?        10 
;MESGKTASPKSMPKDAQMMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKATVDADDVRLAIQCRAD
QSFTSPPPRDFLLDIARQRNQTPLPLIKPYSGPRLPPDRYCLTAPNYRLKSLQKKASTSAGRITVPRLSVGSVTSRPSTP
TLGTPTPQTMSVSTKVGTPMSLTGQRFTVQMPTSQSPAVKASIPATSAVQNVLINPSLIGSKNILITTNMMSSQNTANES
SNALKRKREDDDDDDDDDDDYDNL
;
1   
17 PDB 6MZL        6MZL   ?        10 ? 109 
18 PDB 6MZL        6MZL   ?        10 ? 117 
19 UNP TAF10_HUMAN Q12962 ?        11 
;MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAGGPGAGAAAGGTGPLAARAGEPAERRGAAPV
SAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQ
KFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT
;
1   
20 UNP TAF11_HUMAN Q15544 ?        12 
;MDDAHESPSDKGGETGESDETAAVPGDPGATDTDGIPEETDGDADVDLKEAAAEEGELESQDVSDLTTVEREDSSLLNPA
AKKLKIDTKEKKEKKQKVDEDEIQKMQILVSSFSEEQLNRYEMYRRSAFPKAAIKRLIQSITGTSVSQNVVIAMSGISKV
FVGEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIPNSKHKKIIFF
;
1   
21 UNP TAF12_HUMAN Q16514 ?        13 
;MNQFGPSALINLSNFSSIKPEPASTPPQGSMANSTAVVKIPGTPGAGGRLSPENNQVLTKKKLQDLVREVDPNEQLDEDV
EEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLHLERQWNMWIPGFGSEEIRPYKKACTTEAHKQRMALIRKTTK
K
;
1   
22 UNP TAF13_HUMAN Q15543 ?        14 
;MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGR
VQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS
;
1   
23 UNP TBP_HUMAN   P20226 ?        15 
;MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTNSLSILEEQQRQQQQQQQQQQQQQQQQQQQQQQQ
QQQQQQQQQQQQQQQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPSPMTPMTPITPATPASESSG
IVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARV
VQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAE
IYEAFENIYPILKGFRKTT
;
1   
24 PDB 6MZL        6MZL   ?        16 ? 1   
25 PDB 6MZL        6MZL   ?        17 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  6MZL A 1   ? 1872 ? P21675 1   ? 1872 ? 1   1872 
2  2  6MZL B 1   ? 1199 ? Q6P1X5 1   ? 1199 ? 1   1199 
3  3  6MZL C 1   ? 929  ? Q5VWG9 1   ? 929  ? 28  956  
4  4  6MZL D 1   ? 1085 ? O00268 1   ? 1085 ? 1   1085 
5  4  6MZL E 1   ? 1085 ? O00268 1   ? 1085 ? 1   1085 
6  5  6MZL F 1   ? 496  ? Q15542 1   ? 496  ? 1   496  
7  6  6MZL F 497 ? 536  ? 6MZL   497 ? 536  ? 497 536  
8  7  6MZL F 537 ? 800  ? Q15542 537 ? 800  ? 537 800  
9  5  6MZL G 1   ? 496  ? Q15542 1   ? 496  ? 1   496  
10 6  6MZL G 497 ? 536  ? 6MZL   497 ? 536  ? 497 536  
11 7  6MZL G 537 ? 800  ? Q15542 537 ? 800  ? 537 800  
12 8  6MZL H 1   ? 677  ? P49848 1   ? 677  ? 1   677  
13 9  6MZL I 1   ? 677  ? P49848 38  ? 714  ? 1   677  
14 10 6MZL I 207 ? 216  ? 6MZL   207 ? 216  ? 207 216  
15 11 6MZL I 217 ? 677  ? 6MZL   217 ? 677  ? 217 677  
16 12 6MZL J 1   ? 349  ? Q15545 1   ? 349  ? 1   349  
17 13 6MZL K 1   ? 310  ? Q7Z7C8 1   ? 310  ? 1   310  
18 14 6MZL K 121 ? 170  ? 6MZL   121 ? 170  ? 121 170  
19 15 6MZL K 171 ? 310  ? 6MZL   171 ? 310  ? 171 310  
20 16 6MZL L 1   ? 264  ? Q16594 1   ? 264  ? 1   264  
21 17 6MZL L 109 ? 116  ? 6MZL   109 ? 116  ? 109 116  
22 18 6MZL L 117 ? 264  ? 6MZL   117 ? 264  ? 117 264  
23 16 6MZL M 1   ? 264  ? Q16594 1   ? 264  ? 1   264  
24 17 6MZL M 109 ? 116  ? 6MZL   109 ? 116  ? 109 116  
25 18 6MZL M 117 ? 264  ? 6MZL   117 ? 264  ? 117 264  
26 19 6MZL N 1   ? 218  ? Q12962 1   ? 218  ? 1   218  
27 19 6MZL O 1   ? 218  ? Q12962 1   ? 218  ? 1   218  
28 20 6MZL P 1   ? 211  ? Q15544 1   ? 211  ? 1   211  
29 21 6MZL Q 1   ? 161  ? Q16514 1   ? 161  ? 1   161  
30 21 6MZL R 1   ? 161  ? Q16514 1   ? 161  ? 1   161  
31 22 6MZL S 1   ? 124  ? Q15543 1   ? 124  ? 1   124  
32 23 6MZL T 1   ? 339  ? P20226 1   ? 339  ? 1   339  
33 24 6MZL Y 1   ? 96   ? 6MZL   2   ? 328  ? 2   328  
34 25 6MZL Z 1   ? 238  ? 6MZL   2   ? 592  ? 2   592  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
UNK 'L-peptide linking' . UNKNOWN         ? 'C4 H9 N O2'     103.120 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6MZL 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6MZL 
_struct.title                        'Human TFIID canonical state' 
_struct.pdbx_descriptor              
;TAF1, Transcription initiation factor TFIID subunit 2, Transcription initiation factor TFIID subunit 3, Transcription initiation factor TFIID subunit 4, Transcription initiation factor TFIID subunit 5,TAF5,Transcription initiation factor TFIID subunit 5, Transcription initiation factor TFIID subunit 6, Transcription initiation factor TFIID subunit 7, Transcription initiation factor TFIID subunit 8,TAF8,TAF8, Transcription initiation factor TFIID subunit 9,TAF9,TAF9, Transcription initiation factor TFIID subunit 10, Transcription initiation factor TFIID subunit 11, Transcription initiation factor TFIID subunit 12, Transcription initiation factor TFIID subunit 13, TATA-box-binding protein, Unk
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6MZL 
_struct_keywords.text            'Transcription, DNA, Nuclear' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 4  ? 
F N N 5  ? 
G N N 5  ? 
H N N 6  ? 
I N N 7  ? 
J N N 8  ? 
K N N 9  ? 
L N N 10 ? 
M N N 10 ? 
N N N 11 ? 
O N N 11 ? 
P N N 12 ? 
Q N N 13 ? 
R N N 13 ? 
S N N 14 ? 
T N N 15 ? 
U N N 16 ? 
V N N 17 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 LEU A 38   ? GLY A 44   ? LEU A 38   GLY A 44   1 ? 7  
HELX_P HELX_P2   AA2 ASP A 59   ? GLY A 70   ? ASP A 59   GLY A 70   1 ? 12 
HELX_P HELX_P3   AA3 LEU A 74   ? THR A 82   ? LEU A 74   THR A 82   1 ? 9  
HELX_P HELX_P4   AA4 SER A 592  ? GLU A 597  ? SER A 592  GLU A 597  1 ? 6  
HELX_P HELX_P5   AA5 GLY A 608  ? GLN A 614  ? GLY A 608  GLN A 614  1 ? 7  
HELX_P HELX_P6   AA6 GLY A 626  ? GLN A 630  ? GLY A 626  GLN A 630  5 ? 5  
HELX_P HELX_P7   AA7 LEU A 639  ? ALA A 656  ? LEU A 639  ALA A 656  1 ? 18 
HELX_P HELX_P8   AA8 PRO A 668  ? THR A 672  ? PRO A 668  THR A 672  5 ? 5  
HELX_P HELX_P9   AA9 SER A 796  ? SER A 818  ? SER A 796  SER A 818  1 ? 23 
HELX_P HELX_P10  AB1 MET A 827  ? PHE A 834  ? MET A 827  PHE A 834  1 ? 8  
HELX_P HELX_P11  AB2 SER A 838  ? LYS A 847  ? SER A 838  LYS A 847  1 ? 10 
HELX_P HELX_P12  AB3 THR A 872  ? VAL A 880  ? THR A 872  VAL A 880  1 ? 9  
HELX_P HELX_P13  AB4 SER A 881  ? ALA A 901  ? SER A 881  ALA A 901  1 ? 21 
HELX_P HELX_P14  AB5 GLY A 904  ? PHE A 908  ? GLY A 904  PHE A 908  5 ? 5  
HELX_P HELX_P15  AB6 ASP A 924  ? THR A 929  ? ASP A 924  THR A 929  1 ? 6  
HELX_P HELX_P16  AB7 ALA A 930  ? LYS A 943  ? ALA A 930  LYS A 943  1 ? 14 
HELX_P HELX_P17  AB8 VAL A 1055 ? SER A 1079 ? VAL A 1055 SER A 1079 1 ? 25 
HELX_P HELX_P18  AB9 ASN B 102  ? ASP B 118  ? ASN B 102  ASP B 118  1 ? 17 
HELX_P HELX_P19  AC1 PRO B 131  ? LEU B 141  ? PRO B 131  LEU B 141  1 ? 11 
HELX_P HELX_P20  AC2 SER B 185  ? PHE B 190  ? SER B 185  PHE B 190  1 ? 6  
HELX_P HELX_P21  AC3 LEU B 273  ? THR B 281  ? LEU B 273  THR B 281  1 ? 9  
HELX_P HELX_P22  AC4 TYR B 283  ? THR B 296  ? TYR B 283  THR B 296  1 ? 14 
HELX_P HELX_P23  AC5 ASP B 337  ? PHE B 358  ? ASP B 337  PHE B 358  1 ? 22 
HELX_P HELX_P24  AC6 SER B 363  ? GLU B 367  ? SER B 363  GLU B 367  5 ? 5  
HELX_P HELX_P25  AC7 TRP B 368  ? LYS B 384  ? TRP B 368  LYS B 384  1 ? 17 
HELX_P HELX_P26  AC8 GLY B 387  ? THR B 409  ? GLY B 387  THR B 409  1 ? 23 
HELX_P HELX_P27  AC9 SER B 442  ? ILE B 464  ? SER B 442  ILE B 464  1 ? 23 
HELX_P HELX_P28  AD1 SER B 465  ? SER B 484  ? SER B 465  SER B 484  1 ? 20 
HELX_P HELX_P29  AD2 TRP B 493  ? LEU B 497  ? TRP B 493  LEU B 497  5 ? 5  
HELX_P HELX_P30  AD3 SER B 499  ? SER B 511  ? SER B 499  SER B 511  1 ? 13 
HELX_P HELX_P31  AD4 ASP B 514  ? VAL B 523  ? ASP B 514  VAL B 523  1 ? 10 
HELX_P HELX_P32  AD5 ALA B 645  ? LEU B 653  ? ALA B 645  LEU B 653  1 ? 9  
HELX_P HELX_P33  AD6 ASP B 658  ? PHE B 672  ? ASP B 658  PHE B 672  1 ? 15 
HELX_P HELX_P34  AD7 PRO B 675  ? GLN B 687  ? PRO B 675  GLN B 687  1 ? 13 
HELX_P HELX_P35  AD8 TYR B 692  ? SER B 708  ? TYR B 692  SER B 708  1 ? 17 
HELX_P HELX_P36  AD9 MET B 719  ? MET B 726  ? MET B 719  MET B 726  1 ? 8  
HELX_P HELX_P37  AE1 SER B 743  ? LEU B 759  ? SER B 743  LEU B 759  1 ? 17 
HELX_P HELX_P38  AE2 PRO B 768  ? TYR B 781  ? PRO B 768  TYR B 781  1 ? 14 
HELX_P HELX_P39  AE3 ASN B 792  ? ASN B 804  ? ASN B 792  ASN B 804  1 ? 13 
HELX_P HELX_P40  AE4 PRO B 824  ? LEU B 843  ? PRO B 824  LEU B 843  1 ? 20 
HELX_P HELX_P41  AE5 HIS B 848  ? LYS B 863  ? HIS B 848  LYS B 863  1 ? 16 
HELX_P HELX_P42  AE6 PRO B 871  ? SER B 876  ? PRO B 871  SER B 876  1 ? 6  
HELX_P HELX_P43  AE7 PHE B 883  ? ASP B 901  ? PHE B 883  ASP B 901  1 ? 19 
HELX_P HELX_P44  AE8 SER B 903  ? ASN B 916  ? SER B 903  ASN B 916  1 ? 14 
HELX_P HELX_P45  AE9 VAL B 919  ? ASN B 933  ? VAL B 919  ASN B 933  1 ? 15 
HELX_P HELX_P46  AF1 ALA B 948  ? SER B 959  ? ALA B 948  SER B 959  1 ? 12 
HELX_P HELX_P47  AF2 ASP B 964  ? LEU B 978  ? ASP B 964  LEU B 978  1 ? 15 
HELX_P HELX_P48  AF3 GLU C 3    ? GLY C 22   ? GLU C 30   GLY C 49   1 ? 20 
HELX_P HELX_P49  AF4 GLN C 27   ? GLU C 54   ? GLN C 54   GLU C 81   1 ? 28 
HELX_P HELX_P50  AF5 ILE C 62   ? MET C 73   ? ILE C 89   MET C 100  1 ? 12 
HELX_P HELX_P51  AF6 HIS C 78   ? GLU C 88   ? HIS C 105  GLU C 115  1 ? 11 
HELX_P HELX_P52  AF7 LEU D 874  ? HIS D 889  ? LEU D 874  HIS D 889  1 ? 16 
HELX_P HELX_P53  AF8 HIS D 895  ? ASN D 925  ? HIS D 895  ASN D 925  1 ? 31 
HELX_P HELX_P54  AF9 VAL D 940  ? LYS D 971  ? VAL D 940  LYS D 971  1 ? 32 
HELX_P HELX_P55  AG1 LEU E 874  ? HIS E 889  ? LEU E 874  HIS E 889  1 ? 16 
HELX_P HELX_P56  AG2 HIS E 895  ? ASN E 925  ? HIS E 895  ASN E 925  1 ? 31 
HELX_P HELX_P57  AG3 VAL E 940  ? LYS E 971  ? VAL E 940  LYS E 971  1 ? 32 
HELX_P HELX_P58  AG4 PRO F 211  ? CYS F 227  ? PRO F 211  CYS F 227  1 ? 17 
HELX_P HELX_P59  AG5 LEU F 229  ? ASN F 254  ? LEU F 229  ASN F 254  1 ? 26 
HELX_P HELX_P60  AG6 HIS F 256  ? HIS F 268  ? HIS F 256  HIS F 268  1 ? 13 
HELX_P HELX_P61  AG7 TYR F 275  ? SER F 284  ? TYR F 275  SER F 284  1 ? 10 
HELX_P HELX_P62  AG8 LYS F 287  ? ASN F 294  ? LYS F 287  ASN F 294  1 ? 8  
HELX_P HELX_P63  AG9 GLU F 295  ? PHE F 300  ? GLU F 295  PHE F 300  1 ? 6  
HELX_P HELX_P64  AH1 SER F 310  ? GLN F 322  ? SER F 310  GLN F 322  1 ? 13 
HELX_P HELX_P65  AH2 ASN F 327  ? LEU F 337  ? ASN F 327  LEU F 337  1 ? 11 
HELX_P HELX_P66  AH3 UNK F 510  ? UNK F 518  ? UNK F 510  UNK F 518  1 ? 9  
HELX_P HELX_P67  AH4 PRO G 211  ? CYS G 227  ? PRO G 211  CYS G 227  1 ? 17 
HELX_P HELX_P68  AH5 LEU G 229  ? SER G 237  ? LEU G 229  SER G 237  1 ? 9  
HELX_P HELX_P69  AH6 LEU G 239  ? GLN G 255  ? LEU G 239  GLN G 255  1 ? 17 
HELX_P HELX_P70  AH7 HIS G 256  ? HIS G 268  ? HIS G 256  HIS G 268  1 ? 13 
HELX_P HELX_P71  AH8 TYR G 275  ? SER G 284  ? TYR G 275  SER G 284  1 ? 10 
HELX_P HELX_P72  AH9 LYS G 287  ? ASN G 294  ? LYS G 287  ASN G 294  1 ? 8  
HELX_P HELX_P73  AI1 GLU G 295  ? PHE G 300  ? GLU G 295  PHE G 300  1 ? 6  
HELX_P HELX_P74  AI2 SER G 310  ? GLN G 322  ? SER G 310  GLN G 322  1 ? 13 
HELX_P HELX_P75  AI3 ASN G 327  ? LEU G 337  ? ASN G 327  LEU G 337  1 ? 11 
HELX_P HELX_P76  AI4 UNK G 505  ? UNK G 510  ? UNK G 505  UNK G 510  1 ? 6  
HELX_P HELX_P77  AI5 UNK G 510  ? UNK G 520  ? UNK G 510  UNK G 520  1 ? 11 
HELX_P HELX_P78  AI6 UNK G 525  ? UNK G 529  ? UNK G 525  UNK G 529  5 ? 5  
HELX_P HELX_P79  AI7 PRO H 15   ? MET H 26   ? PRO H 15   MET H 26   1 ? 12 
HELX_P HELX_P80  AI8 GLN H 32   ? HIS H 59   ? GLN H 32   HIS H 59   1 ? 28 
HELX_P HELX_P81  AI9 THR H 67   ? LEU H 75   ? THR H 67   LEU H 75   1 ? 9  
HELX_P HELX_P82  AJ1 VAL H 218  ? GLY H 233  ? VAL H 218  GLY H 233  1 ? 16 
HELX_P HELX_P83  AJ2 CYS H 235  ? THR H 248  ? CYS H 235  THR H 248  1 ? 14 
HELX_P HELX_P84  AJ3 MET H 255  ? ASN H 274  ? MET H 255  ASN H 274  1 ? 20 
HELX_P HELX_P85  AJ4 ASN H 275  ? ASP H 291  ? ASN H 275  ASP H 291  1 ? 17 
HELX_P HELX_P86  AJ5 LEU H 297  ? LYS H 299  ? LEU H 297  LYS H 299  5 ? 3  
HELX_P HELX_P87  AJ6 TYR H 300  ? CYS H 311  ? TYR H 300  CYS H 311  1 ? 12 
HELX_P HELX_P88  AJ7 ASP H 322  ? SER H 345  ? ASP H 322  SER H 345  1 ? 24 
HELX_P HELX_P89  AJ8 ASN H 350  ? ASP H 365  ? ASN H 350  ASP H 365  1 ? 16 
HELX_P HELX_P90  AJ9 PRO H 369  ? GLY H 384  ? PRO H 369  GLY H 384  1 ? 16 
HELX_P HELX_P91  AK1 GLY H 384  ? ILE H 392  ? GLY H 384  ILE H 392  1 ? 9  
HELX_P HELX_P92  AK2 ARG H 395  ? LEU H 407  ? ARG H 395  LEU H 407  1 ? 13 
HELX_P HELX_P93  AK3 SER H 413  ? ARG H 439  ? SER H 413  ARG H 439  1 ? 27 
HELX_P HELX_P94  AK4 ASP H 443  ? GLU H 451  ? ASP H 443  GLU H 451  1 ? 9  
HELX_P HELX_P95  AK5 PRO H 457  ? LEU H 472  ? PRO H 457  LEU H 472  1 ? 16 
HELX_P HELX_P96  AK6 PRO I 15   ? MET I 26   ? PRO I 15   MET I 26   1 ? 12 
HELX_P HELX_P97  AK7 GLN I 32   ? HIS I 59   ? GLN I 32   HIS I 59   1 ? 28 
HELX_P HELX_P98  AK8 THR I 67   ? LEU I 75   ? THR I 67   LEU I 75   1 ? 9  
HELX_P HELX_P99  AK9 SER I 217  ? GLY I 233  ? SER I 217  GLY I 233  1 ? 17 
HELX_P HELX_P100 AL1 CYS I 235  ? THR I 248  ? CYS I 235  THR I 248  1 ? 14 
HELX_P HELX_P101 AL2 PRO I 257  ? ASN I 274  ? PRO I 257  ASN I 274  1 ? 18 
HELX_P HELX_P102 AL3 ASN I 275  ? ASP I 291  ? ASN I 275  ASP I 291  1 ? 17 
HELX_P HELX_P103 AL4 LEU I 297  ? GLU I 303  ? LEU I 297  GLU I 303  5 ? 7  
HELX_P HELX_P104 AL5 LEU I 304  ? SER I 314  ? LEU I 304  SER I 314  1 ? 11 
HELX_P HELX_P105 AL6 LEU I 319  ? ASP I 322  ? LEU I 319  ASP I 322  5 ? 4  
HELX_P HELX_P106 AL7 VAL I 323  ? LYS I 342  ? VAL I 323  LYS I 342  1 ? 20 
HELX_P HELX_P107 AL8 ASN I 349  ? ASP I 365  ? ASN I 349  ASP I 365  1 ? 17 
HELX_P HELX_P108 AL9 PRO I 369  ? LEU I 383  ? PRO I 369  LEU I 383  1 ? 15 
HELX_P HELX_P109 AM1 GLY I 384  ? LEU I 407  ? GLY I 384  LEU I 407  1 ? 24 
HELX_P HELX_P110 AM2 SER I 413  ? ARG I 439  ? SER I 413  ARG I 439  1 ? 27 
HELX_P HELX_P111 AM3 ASP I 443  ? ALA I 450  ? ASP I 443  ALA I 450  1 ? 8  
HELX_P HELX_P112 AM4 PRO I 457  ? GLN I 473  ? PRO I 457  GLN I 473  1 ? 17 
HELX_P HELX_P113 AM5 PRO J 21   ? GLY J 35   ? PRO J 21   GLY J 35   1 ? 15 
HELX_P HELX_P114 AM6 ASN J 38   ? ARG J 42   ? ASN J 38   ARG J 42   1 ? 5  
HELX_P HELX_P115 AM7 ASN J 142  ? ARG J 147  ? ASN J 142  ARG J 147  1 ? 6  
HELX_P HELX_P116 AM8 HIS K 30   ? GLY K 49   ? HIS K 30   GLY K 49   1 ? 20 
HELX_P HELX_P117 AM9 GLU K 54   ? CYS K 80   ? GLU K 54   CYS K 80   1 ? 27 
HELX_P HELX_P118 AN1 THR K 89   ? MET K 100  ? THR K 89   MET K 100  1 ? 12 
HELX_P HELX_P119 AN2 ASP K 105  ? VAL K 118  ? ASP K 105  VAL K 118  1 ? 14 
HELX_P HELX_P120 AN3 UNK K 171  ? GLY K 198  ? UNK K 171  GLY K 198  1 ? 28 
HELX_P HELX_P121 AN4 PRO K 222  ? LEU K 227  ? PRO K 222  LEU K 227  1 ? 6  
HELX_P HELX_P122 AN5 LYS L 14   ? GLY L 27   ? LYS L 14   GLY L 27   1 ? 14 
HELX_P HELX_P123 AN6 GLU L 32   ? HIS L 60   ? GLU L 32   HIS L 60   1 ? 29 
HELX_P HELX_P124 AN7 ASP L 67   ? PHE L 83   ? ASP L 67   PHE L 83   1 ? 17 
HELX_P HELX_P125 AN8 PRO L 87   ? GLN L 101  ? PRO L 87   GLN L 101  1 ? 15 
HELX_P HELX_P126 AN9 LYS M 14   ? MET M 26   ? LYS M 14   MET M 26   1 ? 13 
HELX_P HELX_P127 AO1 GLU M 32   ? ALA M 61   ? GLU M 32   ALA M 61   1 ? 30 
HELX_P HELX_P128 AO2 ASP M 67   ? SER M 82   ? ASP M 67   SER M 82   1 ? 16 
HELX_P HELX_P129 AO3 PRO M 87   ? GLN M 101  ? PRO M 87   GLN M 101  1 ? 15 
HELX_P HELX_P130 AO4 THR N 114  ? LEU N 123  ? THR N 114  LEU N 123  1 ? 10 
HELX_P HELX_P131 AO5 PRO N 131  ? ALA N 142  ? PRO N 131  ALA N 142  1 ? 12 
HELX_P HELX_P132 AO6 ASP N 148  ? HIS N 173  ? ASP N 148  HIS N 173  1 ? 26 
HELX_P HELX_P133 AO7 THR N 196  ? LEU N 204  ? THR N 196  LEU N 204  1 ? 9  
HELX_P HELX_P134 AO8 THR O 114  ? GLN O 122  ? THR O 114  GLN O 122  1 ? 9  
HELX_P HELX_P135 AO9 LEU O 123  ? ASP O 125  ? LEU O 123  ASP O 125  5 ? 3  
HELX_P HELX_P136 AP1 PRO O 131  ? ALA O 142  ? PRO O 131  ALA O 142  1 ? 12 
HELX_P HELX_P137 AP2 ASP O 148  ? LYS O 175  ? ASP O 148  LYS O 175  1 ? 28 
HELX_P HELX_P138 AP3 THR O 196  ? LEU O 204  ? THR O 196  LEU O 204  1 ? 9  
HELX_P HELX_P139 AP4 SER P 114  ? ARG P 126  ? SER P 114  ARG P 126  1 ? 13 
HELX_P HELX_P140 AP5 PRO P 130  ? SER P 140  ? PRO P 130  SER P 140  1 ? 11 
HELX_P HELX_P141 AP6 SER P 147  ? TRP P 176  ? SER P 147  TRP P 176  1 ? 30 
HELX_P HELX_P142 AP7 GLN P 183  ? LYS P 197  ? GLN P 183  LYS P 197  1 ? 15 
HELX_P HELX_P143 AP8 THR Q 59   ? ASP Q 71   ? THR Q 59   ASP Q 71   1 ? 13 
HELX_P HELX_P144 AP9 GLU Q 78   ? ARG Q 106  ? GLU Q 78   ARG Q 106  1 ? 29 
HELX_P HELX_P145 AQ1 GLU Q 112  ? TRP Q 124  ? GLU Q 112  TRP Q 124  1 ? 13 
HELX_P HELX_P146 AQ2 THR R 59   ? ASP R 71   ? THR R 59   ASP R 71   1 ? 13 
HELX_P HELX_P147 AQ3 ASP R 77   ? ARG R 106  ? ASP R 77   ARG R 106  1 ? 30 
HELX_P HELX_P148 AQ4 GLU R 112  ? TRP R 124  ? GLU R 112  TRP R 124  1 ? 13 
HELX_P HELX_P149 AQ5 LEU S 36   ? TYR S 41   ? LEU S 36   TYR S 41   1 ? 6  
HELX_P HELX_P150 AQ6 GLY S 42   ? GLY S 44   ? GLY S 42   GLY S 44   5 ? 3  
HELX_P HELX_P151 AQ7 TYR S 50   ? SER S 74   ? TYR S 50   SER S 74   1 ? 25 
HELX_P HELX_P152 AQ8 ASP T 179  ? ALA T 187  ? ASP T 179  ALA T 187  1 ? 9  
HELX_P HELX_P153 AQ9 SER T 226  ? LEU T 244  ? SER T 226  LEU T 244  1 ? 19 
HELX_P HELX_P154 AR1 ARG T 269  ? HIS T 277  ? ARG T 269  HIS T 277  1 ? 9  
HELX_P HELX_P155 AR2 VAL T 317  ? PHE T 335  ? VAL T 317  PHE T 335  1 ? 19 
HELX_P HELX_P156 AR3 UNK U 3    ? UNK U 17   ? UNK Y 4    UNK Y 18   1 ? 15 
HELX_P HELX_P157 AR4 UNK U 53   ? UNK U 59   ? UNK Y 120  UNK Y 126  1 ? 7  
HELX_P HELX_P158 AR5 UNK U 68   ? UNK U 73   ? UNK Y 135  UNK Y 140  1 ? 6  
HELX_P HELX_P159 AR6 UNK U 78   ? UNK U 87   ? UNK Y 310  UNK Y 319  1 ? 10 
HELX_P HELX_P160 AR7 UNK V 3    ? UNK V 19   ? UNK Z 4    UNK Z 20   1 ? 17 
HELX_P HELX_P161 AR8 UNK V 53   ? UNK V 57   ? UNK Z 82   UNK Z 86   1 ? 5  
HELX_P HELX_P162 AR9 UNK V 60   ? UNK V 66   ? UNK Z 89   UNK Z 95   1 ? 7  
HELX_P HELX_P163 AS1 UNK V 68   ? UNK V 77   ? UNK Z 120  UNK Z 129  1 ? 10 
HELX_P HELX_P164 AS2 UNK V 83   ? UNK V 89   ? UNK Z 135  UNK Z 141  1 ? 7  
HELX_P HELX_P165 AS3 UNK V 106  ? UNK V 108  ? UNK Z 209  UNK Z 211  5 ? 3  
HELX_P HELX_P166 AS4 UNK V 109  ? UNK V 114  ? UNK Z 212  UNK Z 217  1 ? 6  
HELX_P HELX_P167 AS5 UNK V 122  ? UNK V 131  ? UNK Z 310  UNK Z 319  1 ? 10 
HELX_P HELX_P168 AS6 UNK V 154  ? UNK V 160  ? UNK Z 371  UNK Z 377  1 ? 7  
HELX_P HELX_P169 AS7 UNK V 171  ? UNK V 178  ? UNK Z 402  UNK Z 409  1 ? 8  
HELX_P HELX_P170 AS8 UNK V 179  ? UNK V 181  ? UNK Z 410  UNK Z 412  5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_conn.id                            covale1 
_struct_conn.conn_type_id                  covale 
_struct_conn.pdbx_leaving_atom_flag        none 
_struct_conn.pdbx_PDB_id                   ? 
_struct_conn.ptnr1_label_asym_id           C 
_struct_conn.ptnr1_label_comp_id           TYR 
_struct_conn.ptnr1_label_seq_id            5 
_struct_conn.ptnr1_label_atom_id           CZ 
_struct_conn.pdbx_ptnr1_label_alt_id       ? 
_struct_conn.pdbx_ptnr1_PDB_ins_code       ? 
_struct_conn.pdbx_ptnr1_standard_comp_id   ? 
_struct_conn.ptnr1_symmetry                1_555 
_struct_conn.ptnr2_label_asym_id           U 
_struct_conn.ptnr2_label_comp_id           UNK 
_struct_conn.ptnr2_label_seq_id            91 
_struct_conn.ptnr2_label_atom_id           CB 
_struct_conn.pdbx_ptnr2_label_alt_id       ? 
_struct_conn.pdbx_ptnr2_PDB_ins_code       ? 
_struct_conn.ptnr1_auth_asym_id            C 
_struct_conn.ptnr1_auth_comp_id            TYR 
_struct_conn.ptnr1_auth_seq_id             32 
_struct_conn.ptnr2_auth_asym_id            Y 
_struct_conn.ptnr2_auth_comp_id            UNK 
_struct_conn.ptnr2_auth_seq_id             323 
_struct_conn.ptnr2_symmetry                1_555 
_struct_conn.pdbx_ptnr3_label_atom_id      ? 
_struct_conn.pdbx_ptnr3_label_seq_id       ? 
_struct_conn.pdbx_ptnr3_label_comp_id      ? 
_struct_conn.pdbx_ptnr3_label_asym_id      ? 
_struct_conn.pdbx_ptnr3_label_alt_id       ? 
_struct_conn.pdbx_ptnr3_PDB_ins_code       ? 
_struct_conn.details                       ? 
_struct_conn.pdbx_dist_value               1.496 
_struct_conn.pdbx_value_order              ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLN 600 A . ? GLN 600 A PRO 601 A ? PRO 601 A 1 -4.05  
2 SER 657 A . ? SER 657 A GLY 658 A ? GLY 658 A 1 -1.00  
3 ARG 821 A . ? ARG 821 A PRO 822 A ? PRO 822 A 1 1.46   
4 ASN 823 B . ? ASN 823 B PRO 824 B ? PRO 824 B 1 -23.49 
5 GLY 456 H . ? GLY 456 H PRO 457 H ? PRO 457 H 1 -7.51  
6 GLY 456 I . ? GLY 456 I PRO 457 I ? PRO 457 I 1 -4.88  
7 PRO 180 P . ? PRO 180 P PRO 181 P ? PRO 181 P 1 9.86   
8 GLU 206 T . ? GLU 206 T PRO 207 T ? PRO 207 T 1 -3.89  
9 LYS 297 T . ? LYS 297 T PRO 298 T ? PRO 298 T 1 -7.14  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 13 ? 
AA2 ? 5  ? 
AA3 ? 7  ? 
AA4 ? 3  ? 
AA5 ? 2  ? 
AA6 ? 7  ? 
AA7 ? 2  ? 
AA8 ? 2  ? 
AA9 ? 2  ? 
AB1 ? 5  ? 
AB2 ? 2  ? 
AB3 ? 2  ? 
AB4 ? 3  ? 
AB5 ? 2  ? 
AB6 ? 2  ? 
AB7 ? 4  ? 
AB8 ? 4  ? 
AB9 ? 3  ? 
AC1 ? 4  ? 
AC2 ? 4  ? 
AC3 ? 4  ? 
AC4 ? 3  ? 
AC5 ? 4  ? 
AC6 ? 4  ? 
AC7 ? 3  ? 
AC8 ? 4  ? 
AC9 ? 4  ? 
AD1 ? 4  ? 
AD2 ? 3  ? 
AD3 ? 2  ? 
AD4 ? 10 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? anti-parallel 
AA1 3  4  ? parallel      
AA1 4  5  ? anti-parallel 
AA1 5  6  ? anti-parallel 
AA1 6  7  ? anti-parallel 
AA1 7  8  ? anti-parallel 
AA1 8  9  ? anti-parallel 
AA1 9  10 ? anti-parallel 
AA1 10 11 ? anti-parallel 
AA1 11 12 ? anti-parallel 
AA1 12 13 ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA3 1  2  ? anti-parallel 
AA3 2  3  ? parallel      
AA3 3  4  ? anti-parallel 
AA3 4  5  ? anti-parallel 
AA3 5  6  ? parallel      
AA3 6  7  ? anti-parallel 
AA4 1  2  ? anti-parallel 
AA4 2  3  ? anti-parallel 
AA5 1  2  ? anti-parallel 
AA6 1  2  ? anti-parallel 
AA6 2  3  ? anti-parallel 
AA6 3  4  ? anti-parallel 
AA6 4  5  ? parallel      
AA6 5  6  ? anti-parallel 
AA6 6  7  ? anti-parallel 
AA7 1  2  ? anti-parallel 
AA8 1  2  ? anti-parallel 
AA9 1  2  ? anti-parallel 
AB1 1  2  ? anti-parallel 
AB1 2  3  ? parallel      
AB1 3  4  ? parallel      
AB1 4  5  ? anti-parallel 
AB2 1  2  ? parallel      
AB3 1  2  ? anti-parallel 
AB4 1  2  ? anti-parallel 
AB4 2  3  ? anti-parallel 
AB5 1  2  ? parallel      
AB6 1  2  ? parallel      
AB7 1  2  ? anti-parallel 
AB7 2  3  ? anti-parallel 
AB7 3  4  ? anti-parallel 
AB8 1  2  ? anti-parallel 
AB8 2  3  ? anti-parallel 
AB8 3  4  ? anti-parallel 
AB9 1  2  ? anti-parallel 
AB9 2  3  ? anti-parallel 
AC1 1  2  ? anti-parallel 
AC1 2  3  ? anti-parallel 
AC1 3  4  ? anti-parallel 
AC2 1  2  ? anti-parallel 
AC2 2  3  ? anti-parallel 
AC2 3  4  ? anti-parallel 
AC3 1  2  ? anti-parallel 
AC3 2  3  ? anti-parallel 
AC3 3  4  ? anti-parallel 
AC4 1  2  ? anti-parallel 
AC4 2  3  ? anti-parallel 
AC5 1  2  ? anti-parallel 
AC5 2  3  ? anti-parallel 
AC5 3  4  ? anti-parallel 
AC6 1  2  ? anti-parallel 
AC6 2  3  ? anti-parallel 
AC6 3  4  ? anti-parallel 
AC7 1  2  ? anti-parallel 
AC7 2  3  ? anti-parallel 
AC8 1  2  ? anti-parallel 
AC8 2  3  ? anti-parallel 
AC8 3  4  ? anti-parallel 
AC9 1  2  ? anti-parallel 
AC9 2  3  ? anti-parallel 
AC9 3  4  ? anti-parallel 
AD1 1  2  ? anti-parallel 
AD1 2  3  ? anti-parallel 
AD1 3  4  ? anti-parallel 
AD2 1  2  ? anti-parallel 
AD2 2  3  ? anti-parallel 
AD3 1  2  ? parallel      
AD4 1  2  ? anti-parallel 
AD4 2  3  ? anti-parallel 
AD4 3  4  ? anti-parallel 
AD4 4  5  ? anti-parallel 
AD4 5  6  ? anti-parallel 
AD4 6  7  ? anti-parallel 
AD4 7  8  ? anti-parallel 
AD4 8  9  ? anti-parallel 
AD4 9  10 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  SER J 14  ? ARG J 19  ? SER J 14  ARG J 19  
AA1 2  ASP A 761 ? ARG A 766 ? ASP A 761 ARG A 766 
AA1 3  TYR A 771 ? ARG A 774 ? TYR A 771 ARG A 774 
AA1 4  HIS A 634 ? GLN A 637 ? HIS A 634 GLN A 637 
AA1 5  LEU J 43  ? LEU J 47  ? LEU J 43  LEU J 47  
AA1 6  HIS J 53  ? VAL J 58  ? HIS J 53  VAL J 58  
AA1 7  VAL J 61  ? THR J 79  ? VAL J 61  THR J 79  
AA1 8  THR J 84  ? THR J 98  ? THR J 84  THR J 98  
AA1 9  ALA A 697 ? TYR A 704 ? ALA A 697 TYR A 704 
AA1 10 LEU A 739 ? GLU A 744 ? LEU A 739 GLU A 744 
AA1 11 PHE A 748 ? LYS A 756 ? PHE A 748 LYS A 756 
AA1 12 ASP A 778 ? VAL A 782 ? ASP A 778 VAL A 782 
AA1 13 ASP A 677 ? TYR A 683 ? ASP A 677 TYR A 683 
AA2 1  CYS A 786 ? PRO A 787 ? CYS A 786 PRO A 787 
AA2 2  PHE A 748 ? LYS A 756 ? PHE A 748 LYS A 756 
AA2 3  LEU A 739 ? GLU A 744 ? LEU A 739 GLU A 744 
AA2 4  ALA A 697 ? TYR A 704 ? ALA A 697 TYR A 704 
AA2 5  GLU A 721 ? TYR A 724 ? GLU A 721 TYR A 724 
AA3 1  LEU J 43  ? LEU J 47  ? LEU J 43  LEU J 47  
AA3 2  HIS A 634 ? GLN A 637 ? HIS A 634 GLN A 637 
AA3 3  TYR A 771 ? ARG A 774 ? TYR A 771 ARG A 774 
AA3 4  ASP A 761 ? ARG A 766 ? ASP A 761 ARG A 766 
AA3 5  SER J 14  ? ARG J 19  ? SER J 14  ARG J 19  
AA3 6  THR J 84  ? THR J 98  ? THR J 84  THR J 98  
AA3 7  VAL J 61  ? THR J 79  ? VAL J 61  THR J 79  
AA4 1  ARG A 824 ? ARG A 826 ? ARG A 824 ARG A 826 
AA4 2  TRP A 861 ? LEU A 864 ? TRP A 861 LEU A 864 
AA4 3  ALA A 850 ? LYS A 853 ? ALA A 850 LYS A 853 
AA5 1  LEU A 947 ? LEU A 948 ? LEU A 947 LEU A 948 
AA5 2  LYS A 967 ? ILE A 968 ? LYS A 967 ILE A 968 
AA6 1  CYS B 70  ? ARG B 76  ? CYS B 70  ARG B 76  
AA6 2  LEU B 144 ? LEU B 152 ? LEU B 144 LEU B 152 
AA6 3  VAL B 45  ? PHE B 54  ? VAL B 45  PHE B 54  
AA6 4  LYS B 27  ? ASN B 36  ? LYS B 27  ASN B 36  
AA6 5  CYS B 200 ? VAL B 208 ? CYS B 200 VAL B 208 
AA6 6  LYS B 232 ? THR B 242 ? LYS B 232 THR B 242 
AA6 7  ASP B 219 ? GLU B 222 ? ASP B 219 GLU B 222 
AA7 1  ARG B 62  ? LEU B 65  ? ARG B 62  LEU B 65  
AA7 2  LEU B 126 ? LYS B 129 ? LEU B 126 LYS B 129 
AA8 1  HIS B 160 ? VAL B 162 ? HIS B 160 VAL B 162 
AA8 2  HIS B 176 ? PHE B 178 ? HIS B 176 PHE B 178 
AA9 1  ALA B 214 ? VAL B 215 ? ALA B 214 VAL B 215 
AA9 2  ALA B 250 ? ILE B 251 ? ALA B 250 ILE B 251 
AB1 1  PHE B 254 ? LEU B 257 ? PHE B 254 LEU B 257 
AB1 2  VAL B 265 ? CYS B 269 ? VAL B 265 CYS B 269 
AB1 3  PHE B 304 ? ILE B 309 ? PHE B 304 ILE B 309 
AB1 4  MET B 322 ? SER B 326 ? MET B 322 SER B 326 
AB1 5  ALA B 318 ? TYR B 319 ? ALA B 318 TYR B 319 
AB2 1  VAL B 529 ? PHE B 531 ? VAL B 529 PHE B 531 
AB2 2  ARG B 638 ? VAL B 640 ? ARG B 638 VAL B 640 
AB3 1  GLU B 547 ? GLN B 550 ? GLU B 547 GLN B 550 
AB3 2  LEU B 586 ? ASP B 589 ? LEU B 586 ASP B 589 
AB4 1  PHE B 575 ? LEU B 579 ? PHE B 575 LEU B 579 
AB4 2  LYS B 565 ? GLU B 570 ? LYS B 565 GLU B 570 
AB4 3  LEU B 625 ? TRP B 627 ? LEU B 625 TRP B 627 
AB5 1  SER C 25  ? VAL C 26  ? SER C 52  VAL C 53  
AB5 2  THR N 194 ? LEU N 195 ? THR N 194 LEU N 195 
AB6 1  LEU F 307 ? ILE F 309 ? LEU F 307 ILE F 309 
AB6 2  ILE F 339 ? ILE F 341 ? ILE F 339 ILE F 341 
AB7 1  THR F 474 ? ALA F 475 ? THR F 474 ALA F 475 
AB7 2  SER F 482 ? ALA F 486 ? SER F 482 ALA F 486 
AB7 3  SER F 492 ? VAL F 496 ? SER F 492 VAL F 496 
AB7 4  ILE F 538 ? LEU F 539 ? ILE F 538 LEU F 539 
AB8 1  GLY F 548 ? SER F 550 ? GLY F 548 SER F 550 
AB8 2  LEU F 558 ? SER F 561 ? LEU F 558 SER F 561 
AB8 3  VAL F 567 ? TRP F 570 ? VAL F 567 TRP F 570 
AB8 4  CYS F 577 ? TYR F 581 ? CYS F 577 TYR F 581 
AB9 1  ASP F 590 ? PHE F 593 ? ASP F 590 PHE F 593 
AB9 2  PHE F 600 ? GLY F 603 ? PHE F 600 GLY F 603 
AB9 3  ALA F 609 ? TRP F 612 ? ALA F 609 TRP F 612 
AC1 1  VAL F 630 ? PHE F 635 ? VAL F 630 PHE F 635 
AC1 2  VAL F 642 ? SER F 646 ? VAL F 642 SER F 646 
AC1 3  VAL F 651 ? TRP F 654 ? VAL F 651 TRP F 654 
AC1 4  CYS F 661 ? PHE F 665 ? CYS F 661 PHE F 665 
AC2 1  ILE F 672 ? PHE F 677 ? ILE F 672 PHE F 677 
AC2 2  PHE F 683 ? ALA F 688 ? PHE F 683 ALA F 688 
AC2 3  ARG F 692 ? ASP F 697 ? ARG F 692 ASP F 697 
AC2 4  MET F 703 ? LYS F 708 ? MET F 703 LYS F 708 
AC3 1  VAL F 714 ? PHE F 719 ? VAL F 714 PHE F 719 
AC3 2  ILE F 725 ? SER F 730 ? ILE F 725 SER F 730 
AC3 3  THR F 734 ? ASP F 739 ? THR F 734 ASP F 739 
AC3 4  HIS F 758 ? ASN F 760 ? HIS F 758 ASN F 760 
AC4 1  GLN F 766 ? LEU F 769 ? GLN F 766 LEU F 769 
AC4 2  THR F 778 ? HIS F 782 ? THR F 778 HIS F 782 
AC4 3  LEU F 790 ? LEU F 792 ? LEU F 790 LEU F 792 
AC5 1  THR G 474 ? ASP G 477 ? THR G 474 ASP G 477 
AC5 2  SER G 482 ? ALA G 486 ? SER G 482 ALA G 486 
AC5 3  SER G 492 ? VAL G 496 ? SER G 492 VAL G 496 
AC5 4  LYS G 537 ? LEU G 539 ? LYS G 537 LEU G 539 
AC6 1  GLY G 548 ? PHE G 551 ? GLY G 548 PHE G 551 
AC6 2  LEU G 558 ? SER G 561 ? LEU G 558 SER G 561 
AC6 3  VAL G 567 ? TRP G 570 ? VAL G 567 TRP G 570 
AC6 4  CYS G 577 ? TYR G 581 ? CYS G 577 TYR G 581 
AC7 1  ASP G 590 ? PHE G 593 ? ASP G 590 PHE G 593 
AC7 2  PHE G 600 ? GLY G 603 ? PHE G 600 GLY G 603 
AC7 3  ALA G 609 ? TRP G 612 ? ALA G 609 TRP G 612 
AC8 1  VAL G 630 ? PHE G 635 ? VAL G 630 PHE G 635 
AC8 2  VAL G 642 ? SER G 646 ? VAL G 642 SER G 646 
AC8 3  VAL G 651 ? TRP G 654 ? VAL G 651 TRP G 654 
AC8 4  CYS G 661 ? PHE G 665 ? CYS G 661 PHE G 665 
AC9 1  ILE G 672 ? PHE G 677 ? ILE G 672 PHE G 677 
AC9 2  PHE G 683 ? ALA G 688 ? PHE G 683 ALA G 688 
AC9 3  ARG G 692 ? ASP G 697 ? ARG G 692 ASP G 697 
AC9 4  MET G 703 ? LEU G 707 ? MET G 703 LEU G 707 
AD1 1  VAL G 714 ? PHE G 719 ? VAL G 714 PHE G 719 
AD1 2  ILE G 725 ? SER G 730 ? ILE G 725 SER G 730 
AD1 3  THR G 734 ? ASP G 739 ? THR G 734 ASP G 739 
AD1 4  HIS G 758 ? ASN G 760 ? HIS G 758 ASN G 760 
AD2 1  GLN G 766 ? LEU G 769 ? GLN G 766 LEU G 769 
AD2 2  THR G 778 ? HIS G 782 ? THR G 778 HIS G 782 
AD2 3  LEU G 790 ? LEU G 792 ? LEU G 790 LEU G 792 
AD3 1  LYS I 65  ? LEU I 66  ? LYS I 65  LEU I 66  
AD3 2  GLU M 30  ? TYR M 31  ? GLU M 30  TYR M 31  
AD4 1  ALA T 190 ? ASN T 193 ? ALA T 190 ASN T 193 
AD4 2  PHE T 197 ? ILE T 204 ? PHE T 197 ILE T 204 
AD4 3  THR T 209 ? ILE T 213 ? THR T 209 ILE T 213 
AD4 4  LYS T 218 ? ALA T 224 ? LYS T 218 ALA T 224 
AD4 5  GLN T 164 ? ASN T 173 ? GLN T 164 ASN T 173 
AD4 6  LEU T 251 ? ASP T 263 ? LEU T 251 ASP T 263 
AD4 7  LYS T 309 ? THR T 313 ? LYS T 309 THR T 313 
AD4 8  ILE T 300 ? ILE T 304 ? ILE T 300 ILE T 304 
AD4 9  PHE T 288 ? MET T 295 ? PHE T 288 MET T 295 
AD4 10 SER T 281 ? GLU T 284 ? SER T 281 GLU T 284 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  O SER J 14  ? O SER J 14  N ARG A 766 ? N ARG A 766 
AA1 2  3  N ILE A 765 ? N ILE A 765 O TYR A 772 ? O TYR A 772 
AA1 3  4  O TYR A 771 ? O TYR A 771 N GLN A 637 ? N GLN A 637 
AA1 4  5  N HIS A 634 ? N HIS A 634 O ILE J 45  ? O ILE J 45  
AA1 5  6  N GLU J 46  ? N GLU J 46  O ILE J 55  ? O ILE J 55  
AA1 6  7  N GLY J 54  ? N GLY J 54  O SER J 65  ? O SER J 65  
AA1 7  8  N LYS J 78  ? N LYS J 78  O TYR J 86  ? O TYR J 86  
AA1 8  9  O PHE J 85  ? O PHE J 85  N THR A 698 ? N THR A 698 
AA1 9  10 N LYS A 699 ? N LYS A 699 O GLU A 744 ? O GLU A 744 
AA1 10 11 N PHE A 743 ? N PHE A 743 O ALA A 750 ? O ALA A 750 
AA1 11 12 N HIS A 755 ? N HIS A 755 O ILE A 779 ? O ILE A 779 
AA1 12 13 O PHE A 780 ? O PHE A 780 N GLU A 682 ? N GLU A 682 
AA2 1  2  O CYS A 786 ? O CYS A 786 N ARG A 749 ? N ARG A 749 
AA2 2  3  O ALA A 750 ? O ALA A 750 N PHE A 743 ? N PHE A 743 
AA2 3  4  O GLU A 744 ? O GLU A 744 N LYS A 699 ? N LYS A 699 
AA2 4  5  N ASN A 702 ? N ASN A 702 O GLU A 721 ? O GLU A 721 
AA3 1  2  O ILE J 45  ? O ILE J 45  N HIS A 634 ? N HIS A 634 
AA3 2  3  N GLN A 637 ? N GLN A 637 O TYR A 771 ? O TYR A 771 
AA3 3  4  O TYR A 772 ? O TYR A 772 N ILE A 765 ? N ILE A 765 
AA3 4  5  N ARG A 766 ? N ARG A 766 O SER J 14  ? O SER J 14  
AA3 5  6  N ARG J 19  ? N ARG J 19  O LEU J 95  ? O LEU J 95  
AA3 6  7  O TYR J 86  ? O TYR J 86  N LYS J 78  ? N LYS J 78  
AA4 1  2  N ILE A 825 ? N ILE A 825 O TRP A 862 ? O TRP A 862 
AA4 2  3  O VAL A 863 ? O VAL A 863 N ASP A 851 ? N ASP A 851 
AA5 1  2  N LEU A 947 ? N LEU A 947 O ILE A 968 ? O ILE A 968 
AA6 1  2  N ARG B 76  ? N ARG B 76  O HIS B 147 ? O HIS B 147 
AA6 2  3  O ILE B 148 ? O ILE B 148 N VAL B 49  ? N VAL B 49  
AA6 3  4  O VAL B 46  ? O VAL B 46  N ASN B 36  ? N ASN B 36  
AA6 4  5  N VAL B 33  ? N VAL B 33  O GLU B 205 ? O GLU B 205 
AA6 5  6  N CYS B 200 ? N CYS B 200 O THR B 242 ? O THR B 242 
AA6 6  7  N MET B 237 ? N MET B 237 O ASP B 219 ? O ASP B 219 
AA7 1  2  O ILE B 63  ? O ILE B 63  N ILE B 128 ? N ILE B 128 
AA8 1  2  N HIS B 160 ? N HIS B 160 O PHE B 178 ? O PHE B 178 
AA9 1  2  N VAL B 215 ? N VAL B 215 O ALA B 250 ? O ALA B 250 
AB1 1  2  N ILE B 256 ? N ILE B 256 O HIS B 267 ? O HIS B 267 
AB1 2  3  N THR B 266 ? N THR B 266 O PHE B 304 ? O PHE B 304 
AB1 3  4  N VAL B 307 ? N VAL B 307 O PHE B 325 ? O PHE B 325 
AB1 4  5  O MET B 322 ? O MET B 322 N TYR B 319 ? N TYR B 319 
AB2 1  2  N PHE B 531 ? N PHE B 531 O LYS B 639 ? O LYS B 639 
AB3 1  2  N ILE B 548 ? N ILE B 548 O HIS B 588 ? O HIS B 588 
AB4 1  2  O ASN B 576 ? O ASN B 576 N VAL B 568 ? N VAL B 568 
AB4 2  3  N GLN B 569 ? N GLN B 569 O TRP B 627 ? O TRP B 627 
AB5 1  2  N SER C 25  ? N SER C 52  O LEU N 195 ? O LEU N 195 
AB6 1  2  N LEU F 307 ? N LEU F 307 O ASP F 340 ? O ASP F 340 
AB7 1  2  N THR F 474 ? N THR F 474 O ALA F 486 ? O ALA F 486 
AB7 2  3  N SER F 483 ? N SER F 483 O ARG F 495 ? O ARG F 495 
AB7 3  4  N SER F 492 ? N SER F 492 O LEU F 539 ? O LEU F 539 
AB8 1  2  N GLY F 548 ? N GLY F 548 O SER F 561 ? O SER F 561 
AB8 2  3  N SER F 560 ? N SER F 560 O ARG F 568 ? O ARG F 568 
AB8 3  4  N LEU F 569 ? N LEU F 569 O VAL F 579 ? O VAL F 579 
AB9 1  2  N ASP F 590 ? N ASP F 590 O GLY F 603 ? O GLY F 603 
AB9 2  3  N SER F 602 ? N SER F 602 O ARG F 610 ? O ARG F 610 
AC1 1  2  N CYS F 632 ? N CYS F 632 O GLY F 645 ? O GLY F 645 
AC1 2  3  N THR F 644 ? N THR F 644 O ARG F 652 ? O ARG F 652 
AC1 3  4  N VAL F 651 ? N VAL F 651 O PHE F 665 ? O PHE F 665 
AC2 1  2  N THR F 676 ? N THR F 676 O ALA F 685 ? O ALA F 685 
AC2 2  3  N THR F 686 ? N THR F 686 O LEU F 694 ? O LEU F 694 
AC2 3  4  N LEU F 695 ? N LEU F 695 O GLY F 705 ? O GLY F 705 
AC3 1  2  N ARG F 718 ? N ARG F 718 O ALA F 727 ? O ALA F 727 
AC3 2  3  N LEU F 726 ? N LEU F 726 O TRP F 738 ? O TRP F 738 
AC3 3  4  N VAL F 735 ? N VAL F 735 O ILE F 759 ? O ILE F 759 
AC4 1  2  N LEU F 768 ? N LEU F 768 O VAL F 781 ? O VAL F 781 
AC4 2  3  N THR F 778 ? N THR F 778 O LEU F 792 ? O LEU F 792 
AC5 1  2  N THR G 474 ? N THR G 474 O ALA G 486 ? O ALA G 486 
AC5 2  3  N SER G 483 ? N SER G 483 O ARG G 495 ? O ARG G 495 
AC5 3  4  N VAL G 494 ? N VAL G 494 O LYS G 537 ? O LYS G 537 
AC6 1  2  N GLY G 548 ? N GLY G 548 O SER G 561 ? O SER G 561 
AC6 2  3  N SER G 560 ? N SER G 560 O ARG G 568 ? O ARG G 568 
AC6 3  4  N VAL G 567 ? N VAL G 567 O TYR G 581 ? O TYR G 581 
AC7 1  2  N GLN G 592 ? N GLN G 592 O VAL G 601 ? O VAL G 601 
AC7 2  3  N SER G 602 ? N SER G 602 O ARG G 610 ? O ARG G 610 
AC8 1  2  N ARG G 634 ? N ARG G 634 O ALA G 643 ? O ALA G 643 
AC8 2  3  N VAL G 642 ? N VAL G 642 O TRP G 654 ? O TRP G 654 
AC8 3  4  N LEU G 653 ? N LEU G 653 O ARG G 663 ? O ARG G 663 
AC9 1  2  N THR G 676 ? N THR G 676 O ALA G 685 ? O ALA G 685 
AC9 2  3  N LEU G 684 ? N LEU G 684 O TRP G 696 ? O TRP G 696 
AC9 3  4  N VAL G 693 ? N VAL G 693 O LEU G 707 ? O LEU G 707 
AD1 1  2  N ARG G 718 ? N ARG G 718 O ALA G 727 ? O ALA G 727 
AD1 2  3  N LEU G 726 ? N LEU G 726 O TRP G 738 ? O TRP G 738 
AD1 3  4  N VAL G 735 ? N VAL G 735 O ILE G 759 ? O ILE G 759 
AD2 1  2  N LEU G 768 ? N LEU G 768 O VAL G 781 ? O VAL G 781 
AD2 2  3  N THR G 778 ? N THR G 778 O LEU G 792 ? O LEU G 792 
AD3 1  2  N LEU I 66  ? N LEU I 66  O GLU M 30  ? O GLU M 30  
AD4 1  2  N ASN T 193 ? N ASN T 193 O PHE T 197 ? O PHE T 197 
AD4 2  3  N MET T 202 ? N MET T 202 O ALA T 211 ? O ALA T 211 
AD4 3  4  N THR T 210 ? N THR T 210 O THR T 222 ? O THR T 222 
AD4 4  5  O MET T 219 ? O MET T 219 N VAL T 172 ? N VAL T 172 
AD4 5  6  N VAL T 169 ? N VAL T 169 O GLN T 256 ? O GLN T 256 
AD4 6  7  N GLY T 260 ? N GLY T 260 O LEU T 312 ? O LEU T 312 
AD4 7  8  O THR T 313 ? O THR T 313 N VAL T 301 ? N VAL T 301 
AD4 8  9  O ILE T 300 ? O ILE T 300 N MET T 295 ? N MET T 295 
AD4 9  10 O PHE T 288 ? O PHE T 288 N GLU T 284 ? N GLU T 284 
# 
_atom_sites.entry_id                    6MZL 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N   . PHE A 1  36   ? 167.614 119.942 139.070 1.00 370.00 ? 36   PHE A N   1 
ATOM 2     C CA  . PHE A 1  36   ? 166.710 121.046 138.779 1.00 370.00 ? 36   PHE A CA  1 
ATOM 3     C C   . PHE A 1  36   ? 165.291 120.623 139.137 1.00 370.00 ? 36   PHE A C   1 
ATOM 4     O O   . PHE A 1  36   ? 164.906 119.483 138.889 1.00 370.00 ? 36   PHE A O   1 
ATOM 5     C CB  . PHE A 1  36   ? 166.796 121.447 137.308 1.00 370.00 ? 36   PHE A CB  1 
ATOM 6     C CG  . PHE A 1  36   ? 168.177 121.846 136.865 1.00 370.00 ? 36   PHE A CG  1 
ATOM 7     C CD1 . PHE A 1  36   ? 168.695 123.093 137.187 1.00 370.00 ? 36   PHE A CD1 1 
ATOM 8     C CD2 . PHE A 1  36   ? 168.951 120.976 136.107 1.00 370.00 ? 36   PHE A CD2 1 
ATOM 9     C CE1 . PHE A 1  36   ? 169.968 123.458 136.769 1.00 370.00 ? 36   PHE A CE1 1 
ATOM 10    C CE2 . PHE A 1  36   ? 170.221 121.336 135.688 1.00 370.00 ? 36   PHE A CE2 1 
ATOM 11    C CZ  . PHE A 1  36   ? 170.729 122.578 136.019 1.00 370.00 ? 36   PHE A CZ  1 
ATOM 12    N N   . SER A 1  37   ? 164.501 121.554 139.670 1.00 370.00 ? 37   SER A N   1 
ATOM 13    C CA  . SER A 1  37   ? 163.259 121.231 140.376 1.00 370.00 ? 37   SER A CA  1 
ATOM 14    C C   . SER A 1  37   ? 162.145 120.994 139.360 1.00 370.00 ? 37   SER A C   1 
ATOM 15    O O   . SER A 1  37   ? 161.383 121.898 139.015 1.00 370.00 ? 37   SER A O   1 
ATOM 16    C CB  . SER A 1  37   ? 162.898 122.347 141.350 1.00 370.00 ? 37   SER A CB  1 
ATOM 17    O OG  . SER A 1  37   ? 163.872 122.470 142.371 1.00 370.00 ? 37   SER A OG  1 
ATOM 18    N N   . LEU A 1  38   ? 162.047 119.750 138.898 1.00 370.00 ? 38   LEU A N   1 
ATOM 19    C CA  . LEU A 1  38   ? 161.026 119.319 137.951 1.00 370.00 ? 38   LEU A CA  1 
ATOM 20    C C   . LEU A 1  38   ? 159.796 118.682 138.602 1.00 370.00 ? 38   LEU A C   1 
ATOM 21    O O   . LEU A 1  38   ? 159.286 117.700 138.052 1.00 370.00 ? 38   LEU A O   1 
ATOM 22    C CB  . LEU A 1  38   ? 161.613 118.346 136.926 1.00 370.00 ? 38   LEU A CB  1 
ATOM 23    C CG  . LEU A 1  38   ? 162.491 118.922 135.816 1.00 370.00 ? 38   LEU A CG  1 
ATOM 24    C CD1 . LEU A 1  38   ? 162.794 117.842 134.790 1.00 370.00 ? 38   LEU A CD1 1 
ATOM 25    C CD2 . LEU A 1  38   ? 161.828 120.117 135.165 1.00 370.00 ? 38   LEU A CD2 1 
ATOM 26    N N   . ALA A 1  39   ? 159.353 119.162 139.771 1.00 370.00 ? 39   ALA A N   1 
ATOM 27    C CA  . ALA A 1  39   ? 158.131 118.639 140.387 1.00 370.00 ? 39   ALA A CA  1 
ATOM 28    C C   . ALA A 1  39   ? 156.898 118.883 139.520 1.00 370.00 ? 39   ALA A C   1 
ATOM 29    O O   . ALA A 1  39   ? 155.967 118.073 139.508 1.00 370.00 ? 39   ALA A O   1 
ATOM 30    C CB  . ALA A 1  39   ? 157.934 119.258 141.770 1.00 370.00 ? 39   ALA A CB  1 
ATOM 31    N N   . GLY A 1  40   ? 156.858 120.009 138.811 1.00 370.00 ? 40   GLY A N   1 
ATOM 32    C CA  . GLY A 1  40   ? 155.732 120.267 137.929 1.00 370.00 ? 40   GLY A CA  1 
ATOM 33    C C   . GLY A 1  40   ? 155.806 119.488 136.628 1.00 370.00 ? 40   GLY A C   1 
ATOM 34    O O   . GLY A 1  40   ? 154.805 119.365 135.913 1.00 370.00 ? 40   GLY A O   1 
ATOM 35    N N   . PHE A 1  41   ? 157.003 118.994 136.283 1.00 370.00 ? 41   PHE A N   1 
ATOM 36    C CA  . PHE A 1  41   ? 157.226 118.320 135.005 1.00 370.00 ? 41   PHE A CA  1 
ATOM 37    C C   . PHE A 1  41   ? 156.440 117.019 134.939 1.00 370.00 ? 41   PHE A C   1 
ATOM 38    O O   . PHE A 1  41   ? 155.854 116.681 133.910 1.00 370.00 ? 41   PHE A O   1 
ATOM 39    C CB  . PHE A 1  41   ? 158.717 118.053 134.836 1.00 370.00 ? 41   PHE A CB  1 
ATOM 40    C CG  . PHE A 1  41   ? 159.162 117.813 133.426 1.00 370.00 ? 41   PHE A CG  1 
ATOM 41    C CD1 . PHE A 1  41   ? 159.557 118.876 132.628 1.00 370.00 ? 41   PHE A CD1 1 
ATOM 42    C CD2 . PHE A 1  41   ? 159.207 116.532 132.894 1.00 370.00 ? 41   PHE A CD2 1 
ATOM 43    C CE1 . PHE A 1  41   ? 159.984 118.658 131.321 1.00 370.00 ? 41   PHE A CE1 1 
ATOM 44    C CE2 . PHE A 1  41   ? 159.622 116.326 131.606 1.00 370.00 ? 41   PHE A CE2 1 
ATOM 45    C CZ  . PHE A 1  41   ? 160.012 117.380 130.813 1.00 370.00 ? 41   PHE A CZ  1 
ATOM 46    N N   . LEU A 1  42   ? 156.412 116.269 136.034 1.00 370.00 ? 42   LEU A N   1 
ATOM 47    C CA  . LEU A 1  42   ? 155.478 115.156 136.081 1.00 370.00 ? 42   LEU A CA  1 
ATOM 48    C C   . LEU A 1  42   ? 154.037 115.643 136.078 1.00 370.00 ? 42   LEU A C   1 
ATOM 49    O O   . LEU A 1  42   ? 153.203 115.065 135.383 1.00 370.00 ? 42   LEU A O   1 
ATOM 50    C CB  . LEU A 1  42   ? 155.764 114.264 137.290 1.00 370.00 ? 42   LEU A CB  1 
ATOM 51    C CG  . LEU A 1  42   ? 155.800 114.756 138.736 1.00 370.00 ? 42   LEU A CG  1 
ATOM 52    C CD1 . LEU A 1  42   ? 155.376 113.652 139.664 1.00 370.00 ? 42   LEU A CD1 1 
ATOM 53    C CD2 . LEU A 1  42   ? 157.232 115.119 139.075 1.00 370.00 ? 42   LEU A CD2 1 
ATOM 54    N N   . PHE A 1  43   ? 153.752 116.768 136.738 1.00 370.00 ? 43   PHE A N   1 
ATOM 55    C CA  . PHE A 1  43   ? 152.364 117.173 136.934 1.00 370.00 ? 43   PHE A CA  1 
ATOM 56    C C   . PHE A 1  43   ? 151.721 117.746 135.666 1.00 370.00 ? 43   PHE A C   1 
ATOM 57    O O   . PHE A 1  43   ? 150.495 117.865 135.608 1.00 370.00 ? 43   PHE A O   1 
ATOM 58    C CB  . PHE A 1  43   ? 152.260 118.170 138.093 1.00 370.00 ? 43   PHE A CB  1 
ATOM 59    C CG  . PHE A 1  43   ? 150.871 118.294 138.649 1.00 370.00 ? 43   PHE A CG  1 
ATOM 60    C CD1 . PHE A 1  43   ? 150.346 117.280 139.434 1.00 370.00 ? 43   PHE A CD1 1 
ATOM 61    C CD2 . PHE A 1  43   ? 150.093 119.404 138.382 1.00 370.00 ? 43   PHE A CD2 1 
ATOM 62    C CE1 . PHE A 1  43   ? 149.072 117.368 139.952 1.00 370.00 ? 43   PHE A CE1 1 
ATOM 63    C CE2 . PHE A 1  43   ? 148.810 119.506 138.895 1.00 370.00 ? 43   PHE A CE2 1 
ATOM 64    C CZ  . PHE A 1  43   ? 148.296 118.483 139.682 1.00 370.00 ? 43   PHE A CZ  1 
ATOM 65    N N   . GLY A 1  44   ? 152.499 118.065 134.636 1.00 370.00 ? 44   GLY A N   1 
ATOM 66    C CA  . GLY A 1  44   ? 151.894 118.562 133.412 1.00 370.00 ? 44   GLY A CA  1 
ATOM 67    C C   . GLY A 1  44   ? 152.253 119.959 132.961 1.00 370.00 ? 44   GLY A C   1 
ATOM 68    O O   . GLY A 1  44   ? 151.822 120.943 133.572 1.00 370.00 ? 44   GLY A O   1 
ATOM 69    N N   . ASN A 1  45   ? 153.043 120.031 131.881 1.00 370.00 ? 45   ASN A N   1 
ATOM 70    C CA  . ASN A 1  45   ? 153.386 121.264 131.172 1.00 370.00 ? 45   ASN A CA  1 
ATOM 71    C C   . ASN A 1  45   ? 154.022 122.364 132.019 1.00 370.00 ? 45   ASN A C   1 
ATOM 72    O O   . ASN A 1  45   ? 153.395 123.399 132.255 1.00 370.00 ? 45   ASN A O   1 
ATOM 73    C CB  . ASN A 1  45   ? 152.142 121.823 130.462 1.00 370.00 ? 45   ASN A CB  1 
ATOM 74    C CG  . ASN A 1  45   ? 151.868 121.148 129.131 1.00 370.00 ? 45   ASN A CG  1 
ATOM 75    O OD1 . ASN A 1  45   ? 152.778 120.963 128.326 1.00 370.00 ? 45   ASN A OD1 1 
ATOM 76    N ND2 . ASN A 1  45   ? 150.612 120.781 128.891 1.00 370.00 ? 45   ASN A ND2 1 
ATOM 77    N N   . ILE A 1  46   ? 155.246 122.152 132.505 1.00 370.00 ? 46   ILE A N   1 
ATOM 78    C CA  . ILE A 1  46   ? 156.057 123.252 133.009 1.00 370.00 ? 46   ILE A CA  1 
ATOM 79    C C   . ILE A 1  46   ? 157.275 123.407 132.110 1.00 370.00 ? 46   ILE A C   1 
ATOM 80    O O   . ILE A 1  46   ? 157.561 122.572 131.252 1.00 370.00 ? 46   ILE A O   1 
ATOM 81    C CB  . ILE A 1  46   ? 156.518 123.083 134.471 1.00 370.00 ? 46   ILE A CB  1 
ATOM 82    C CG1 . ILE A 1  46   ? 157.550 121.959 134.578 1.00 370.00 ? 46   ILE A CG1 1 
ATOM 83    C CG2 . ILE A 1  46   ? 155.329 122.879 135.390 1.00 370.00 ? 46   ILE A CG2 1 
ATOM 84    C CD1 . ILE A 1  46   ? 158.359 122.000 135.855 1.00 370.00 ? 46   ILE A CD1 1 
ATOM 85    N N   . ASN A 1  47   ? 157.982 124.518 132.312 1.00 370.00 ? 47   ASN A N   1 
ATOM 86    C CA  . ASN A 1  47   ? 159.117 124.843 131.459 1.00 370.00 ? 47   ASN A CA  1 
ATOM 87    C C   . ASN A 1  47   ? 160.412 124.235 131.979 1.00 370.00 ? 47   ASN A C   1 
ATOM 88    O O   . ASN A 1  47   ? 161.381 124.103 131.223 1.00 370.00 ? 47   ASN A O   1 
ATOM 89    C CB  . ASN A 1  47   ? 159.249 126.358 131.339 1.00 370.00 ? 47   ASN A CB  1 
ATOM 90    C CG  . ASN A 1  47   ? 157.940 127.027 130.958 1.00 370.00 ? 47   ASN A CG  1 
ATOM 91    O OD1 . ASN A 1  47   ? 157.443 127.889 131.681 1.00 370.00 ? 47   ASN A OD1 1 
ATOM 92    N ND2 . ASN A 1  47   ? 157.351 126.598 129.848 1.00 370.00 ? 47   ASN A ND2 1 
ATOM 93    N N   . GLY A 1  48   ? 160.457 123.874 133.256 1.00 370.00 ? 48   GLY A N   1 
ATOM 94    C CA  . GLY A 1  48   ? 161.719 123.566 133.898 1.00 370.00 ? 48   GLY A CA  1 
ATOM 95    C C   . GLY A 1  48   ? 162.099 124.647 134.886 1.00 370.00 ? 48   GLY A C   1 
ATOM 96    O O   . GLY A 1  48   ? 162.755 124.378 135.898 1.00 370.00 ? 48   GLY A O   1 
ATOM 97    N N   . ALA A 1  49   ? 161.705 125.888 134.585 1.00 370.00 ? 49   ALA A N   1 
ATOM 98    C CA  . ALA A 1  49   ? 161.869 126.969 135.549 1.00 370.00 ? 49   ALA A CA  1 
ATOM 99    C C   . ALA A 1  49   ? 160.897 126.830 136.714 1.00 370.00 ? 49   ALA A C   1 
ATOM 100   O O   . ALA A 1  49   ? 161.217 127.224 137.842 1.00 370.00 ? 49   ALA A O   1 
ATOM 101   C CB  . ALA A 1  49   ? 161.687 128.319 134.858 1.00 370.00 ? 49   ALA A CB  1 
ATOM 102   N N   . GLY A 1  50   ? 159.714 126.272 136.468 1.00 370.00 ? 50   GLY A N   1 
ATOM 103   C CA  . GLY A 1  50   ? 158.749 126.076 137.531 1.00 370.00 ? 50   GLY A CA  1 
ATOM 104   C C   . GLY A 1  50   ? 157.409 126.748 137.313 1.00 370.00 ? 50   GLY A C   1 
ATOM 105   O O   . GLY A 1  50   ? 156.629 126.886 138.258 1.00 370.00 ? 50   GLY A O   1 
ATOM 106   N N   . GLN A 1  51   ? 157.127 127.178 136.086 1.00 370.00 ? 51   GLN A N   1 
ATOM 107   C CA  . GLN A 1  51   ? 155.863 127.827 135.755 1.00 370.00 ? 51   GLN A CA  1 
ATOM 108   C C   . GLN A 1  51   ? 154.934 126.833 135.070 1.00 370.00 ? 51   GLN A C   1 
ATOM 109   O O   . GLN A 1  51   ? 155.290 126.263 134.034 1.00 370.00 ? 51   GLN A O   1 
ATOM 110   C CB  . GLN A 1  51   ? 156.094 129.039 134.851 1.00 370.00 ? 51   GLN A CB  1 
ATOM 111   C CG  . GLN A 1  51   ? 156.916 130.142 135.487 1.00 370.00 ? 51   GLN A CG  1 
ATOM 112   C CD  . GLN A 1  51   ? 156.211 130.776 136.665 1.00 370.00 ? 51   GLN A CD  1 
ATOM 113   O OE1 . GLN A 1  51   ? 154.997 130.974 136.640 1.00 370.00 ? 51   GLN A OE1 1 
ATOM 114   N NE2 . GLN A 1  51   ? 156.966 131.095 137.707 1.00 370.00 ? 51   GLN A NE2 1 
ATOM 115   N N   . LEU A 1  52   ? 153.730 126.671 135.614 1.00 370.00 ? 52   LEU A N   1 
ATOM 116   C CA  . LEU A 1  52   ? 152.806 125.633 135.173 1.00 370.00 ? 52   LEU A CA  1 
ATOM 117   C C   . LEU A 1  52   ? 151.922 126.127 134.036 1.00 370.00 ? 52   LEU A C   1 
ATOM 118   O O   . LEU A 1  52   ? 151.454 127.270 134.039 1.00 370.00 ? 52   LEU A O   1 
ATOM 119   C CB  . LEU A 1  52   ? 151.941 125.135 136.342 1.00 370.00 ? 52   LEU A CB  1 
ATOM 120   C CG  . LEU A 1  52   ? 150.959 123.966 136.143 1.00 370.00 ? 52   LEU A CG  1 
ATOM 121   C CD1 . LEU A 1  52   ? 150.969 123.054 137.353 1.00 370.00 ? 52   LEU A CD1 1 
ATOM 122   C CD2 . LEU A 1  52   ? 149.527 124.453 135.904 1.00 370.00 ? 52   LEU A CD2 1 
ATOM 123   N N   . GLU A 1  53   ? 151.712 125.248 133.061 1.00 370.00 ? 53   GLU A N   1 
ATOM 124   C CA  . GLU A 1  53   ? 150.767 125.436 131.973 1.00 370.00 ? 53   GLU A CA  1 
ATOM 125   C C   . GLU A 1  53   ? 149.795 124.264 131.975 1.00 370.00 ? 53   GLU A C   1 
ATOM 126   O O   . GLU A 1  53   ? 150.063 123.224 132.583 1.00 370.00 ? 53   GLU A O   1 
ATOM 127   C CB  . GLU A 1  53   ? 151.486 125.519 130.626 1.00 370.00 ? 53   GLU A CB  1 
ATOM 128   C CG  . GLU A 1  53   ? 152.418 126.705 130.486 1.00 370.00 ? 53   GLU A CG  1 
ATOM 129   C CD  . GLU A 1  53   ? 153.182 126.674 129.181 1.00 370.00 ? 53   GLU A CD  1 
ATOM 130   O OE1 . GLU A 1  53   ? 153.075 125.661 128.457 1.00 370.00 ? 53   GLU A OE1 1 
ATOM 131   O OE2 . GLU A 1  53   ? 153.891 127.656 128.881 1.00 370.00 ? 53   GLU A OE2 1 
ATOM 132   N N   . GLY A 1  54   ? 148.651 124.440 131.320 1.00 370.00 ? 54   GLY A N   1 
ATOM 133   C CA  . GLY A 1  54   ? 147.692 123.353 131.248 1.00 370.00 ? 54   GLY A CA  1 
ATOM 134   C C   . GLY A 1  54   ? 146.646 123.458 130.155 1.00 370.00 ? 54   GLY A C   1 
ATOM 135   O O   . GLY A 1  54   ? 146.082 124.533 129.934 1.00 370.00 ? 54   GLY A O   1 
ATOM 136   N N   . GLU A 1  55   ? 146.382 122.348 129.456 1.00 370.00 ? 55   GLU A N   1 
ATOM 137   C CA  . GLU A 1  55   ? 145.208 122.288 128.589 1.00 370.00 ? 55   GLU A CA  1 
ATOM 138   C C   . GLU A 1  55   ? 143.930 122.287 129.419 1.00 370.00 ? 55   GLU A C   1 
ATOM 139   O O   . GLU A 1  55   ? 143.007 123.068 129.165 1.00 370.00 ? 55   GLU A O   1 
ATOM 140   C CB  . GLU A 1  55   ? 145.275 121.055 127.685 1.00 370.00 ? 55   GLU A CB  1 
ATOM 141   C CG  . GLU A 1  55   ? 144.117 120.949 126.696 1.00 370.00 ? 55   GLU A CG  1 
ATOM 142   C CD  . GLU A 1  55   ? 144.254 119.767 125.753 1.00 370.00 ? 55   GLU A CD  1 
ATOM 143   O OE1 . GLU A 1  55   ? 145.245 119.017 125.876 1.00 370.00 ? 55   GLU A OE1 1 
ATOM 144   O OE2 . GLU A 1  55   ? 143.370 119.590 124.886 1.00 370.00 ? 55   GLU A OE2 1 
ATOM 145   N N   . SER A 1  56   ? 143.863 121.414 130.418 1.00 370.00 ? 56   SER A N   1 
ATOM 146   C CA  . SER A 1  56   ? 142.896 121.554 131.491 1.00 370.00 ? 56   SER A CA  1 
ATOM 147   C C   . SER A 1  56   ? 143.473 122.475 132.562 1.00 370.00 ? 56   SER A C   1 
ATOM 148   O O   . SER A 1  56   ? 144.662 122.795 132.566 1.00 370.00 ? 56   SER A O   1 
ATOM 149   C CB  . SER A 1  56   ? 142.535 120.191 132.078 1.00 370.00 ? 56   SER A CB  1 
ATOM 150   O OG  . SER A 1  56   ? 141.887 119.382 131.111 1.00 370.00 ? 56   SER A OG  1 
ATOM 151   N N   . VAL A 1  57   ? 142.619 122.897 133.490 1.00 370.00 ? 57   VAL A N   1 
ATOM 152   C CA  . VAL A 1  57   ? 143.012 123.847 134.524 1.00 370.00 ? 57   VAL A CA  1 
ATOM 153   C C   . VAL A 1  57   ? 142.891 123.158 135.873 1.00 370.00 ? 57   VAL A C   1 
ATOM 154   O O   . VAL A 1  57   ? 141.786 122.799 136.299 1.00 370.00 ? 57   VAL A O   1 
ATOM 155   C CB  . VAL A 1  57   ? 142.161 125.126 134.488 1.00 370.00 ? 57   VAL A CB  1 
ATOM 156   C CG1 . VAL A 1  57   ? 142.545 126.042 135.640 1.00 370.00 ? 57   VAL A CG1 1 
ATOM 157   C CG2 . VAL A 1  57   ? 142.324 125.842 133.156 1.00 370.00 ? 57   VAL A CG2 1 
ATOM 158   N N   . LEU A 1  58   ? 144.026 122.969 136.537 1.00 370.00 ? 58   LEU A N   1 
ATOM 159   C CA  . LEU A 1  58   ? 144.043 122.499 137.910 1.00 370.00 ? 58   LEU A CA  1 
ATOM 160   C C   . LEU A 1  58   ? 143.902 123.681 138.866 1.00 370.00 ? 58   LEU A C   1 
ATOM 161   O O   . LEU A 1  58   ? 143.988 124.848 138.473 1.00 370.00 ? 58   LEU A O   1 
ATOM 162   C CB  . LEU A 1  58   ? 145.329 121.722 138.203 1.00 370.00 ? 58   LEU A CB  1 
ATOM 163   C CG  . LEU A 1  58   ? 145.418 120.214 137.914 1.00 370.00 ? 58   LEU A CG  1 
ATOM 164   C CD1 . LEU A 1  58   ? 144.407 119.441 138.750 1.00 370.00 ? 58   LEU A CD1 1 
ATOM 165   C CD2 . LEU A 1  58   ? 145.296 119.859 136.433 1.00 370.00 ? 58   LEU A CD2 1 
ATOM 166   N N   . ASP A 1  59   ? 143.671 123.366 140.138 1.00 370.00 ? 59   ASP A N   1 
ATOM 167   C CA  . ASP A 1  59   ? 143.552 124.399 141.154 1.00 370.00 ? 59   ASP A CA  1 
ATOM 168   C C   . ASP A 1  59   ? 144.936 124.983 141.466 1.00 370.00 ? 59   ASP A C   1 
ATOM 169   O O   . ASP A 1  59   ? 145.971 124.377 141.187 1.00 370.00 ? 59   ASP A O   1 
ATOM 170   C CB  . ASP A 1  59   ? 142.891 123.822 142.409 1.00 370.00 ? 59   ASP A CB  1 
ATOM 171   C CG  . ASP A 1  59   ? 142.391 124.897 143.356 1.00 370.00 ? 59   ASP A CG  1 
ATOM 172   O OD1 . ASP A 1  59   ? 141.366 125.534 143.038 1.00 370.00 ? 59   ASP A OD1 1 
ATOM 173   O OD2 . ASP A 1  59   ? 143.018 125.107 144.413 1.00 370.00 ? 59   ASP A OD2 1 
ATOM 174   N N   . ASP A 1  60   ? 144.944 126.189 142.045 1.00 370.00 ? 60   ASP A N   1 
ATOM 175   C CA  . ASP A 1  60   ? 146.207 126.841 142.386 1.00 370.00 ? 60   ASP A CA  1 
ATOM 176   C C   . ASP A 1  60   ? 146.908 126.187 143.571 1.00 370.00 ? 60   ASP A C   1 
ATOM 177   O O   . ASP A 1  60   ? 148.109 126.430 143.767 1.00 370.00 ? 60   ASP A O   1 
ATOM 178   C CB  . ASP A 1  60   ? 145.995 128.340 142.644 1.00 370.00 ? 60   ASP A CB  1 
ATOM 179   C CG  . ASP A 1  60   ? 144.991 128.626 143.755 1.00 370.00 ? 60   ASP A CG  1 
ATOM 180   O OD1 . ASP A 1  60   ? 144.342 127.691 144.266 1.00 370.00 ? 60   ASP A OD1 1 
ATOM 181   O OD2 . ASP A 1  60   ? 144.853 129.813 144.119 1.00 370.00 ? 60   ASP A OD2 1 
ATOM 182   N N   . GLU A 1  61   ? 146.180 125.396 144.375 1.00 370.00 ? 61   GLU A N   1 
ATOM 183   C CA  . GLU A 1  61   ? 146.819 124.592 145.415 1.00 370.00 ? 61   GLU A CA  1 
ATOM 184   C C   . GLU A 1  61   ? 147.821 123.623 144.805 1.00 370.00 ? 61   GLU A C   1 
ATOM 185   O O   . GLU A 1  61   ? 148.884 123.385 145.381 1.00 370.00 ? 61   GLU A O   1 
ATOM 186   C CB  . GLU A 1  61   ? 145.778 123.851 146.274 1.00 370.00 ? 61   GLU A CB  1 
ATOM 187   C CG  . GLU A 1  61   ? 144.943 122.746 145.609 1.00 370.00 ? 61   GLU A CG  1 
ATOM 188   C CD  . GLU A 1  61   ? 143.973 122.083 146.583 1.00 370.00 ? 61   GLU A CD  1 
ATOM 189   O OE1 . GLU A 1  61   ? 143.958 122.477 147.768 1.00 370.00 ? 61   GLU A OE1 1 
ATOM 190   O OE2 . GLU A 1  61   ? 143.228 121.170 146.167 1.00 370.00 ? 61   GLU A OE2 1 
ATOM 191   N N   . CYS A 1  62   ? 147.525 123.118 143.599 1.00 370.00 ? 62   CYS A N   1 
ATOM 192   C CA  . CYS A 1  62   ? 148.448 122.243 142.887 1.00 370.00 ? 62   CYS A CA  1 
ATOM 193   C C   . CYS A 1  62   ? 149.763 122.950 142.580 1.00 370.00 ? 62   CYS A C   1 
ATOM 194   O O   . CYS A 1  62   ? 150.823 122.419 142.890 1.00 370.00 ? 62   CYS A O   1 
ATOM 195   C CB  . CYS A 1  62   ? 147.800 121.731 141.601 1.00 370.00 ? 62   CYS A CB  1 
ATOM 196   S SG  . CYS A 1  62   ? 146.343 120.695 141.872 1.00 370.00 ? 62   CYS A SG  1 
ATOM 197   N N   . LYS A 1  63   ? 149.713 124.192 142.089 1.00 370.00 ? 63   LYS A N   1 
ATOM 198   C CA  . LYS A 1  63   ? 150.933 124.897 141.689 1.00 370.00 ? 63   LYS A CA  1 
ATOM 199   C C   . LYS A 1  63   ? 151.732 125.398 142.900 1.00 370.00 ? 63   LYS A C   1 
ATOM 200   O O   . LYS A 1  63   ? 152.954 125.180 142.994 1.00 370.00 ? 63   LYS A O   1 
ATOM 201   C CB  . LYS A 1  63   ? 150.546 126.041 140.748 1.00 370.00 ? 63   LYS A CB  1 
ATOM 202   C CG  . LYS A 1  63   ? 151.673 126.700 139.973 1.00 370.00 ? 63   LYS A CG  1 
ATOM 203   C CD  . LYS A 1  63   ? 152.089 128.025 140.576 1.00 370.00 ? 63   LYS A CD  1 
ATOM 204   C CE  . LYS A 1  63   ? 153.078 128.737 139.670 1.00 370.00 ? 63   LYS A CE  1 
ATOM 205   N NZ  . LYS A 1  63   ? 153.516 130.039 140.235 1.00 370.00 ? 63   LYS A NZ  1 
ATOM 206   N N   . LYS A 1  64   ? 151.049 126.066 143.842 1.00 370.00 ? 64   LYS A N   1 
ATOM 207   C CA  . LYS A 1  64   ? 151.701 126.550 145.063 1.00 370.00 ? 64   LYS A CA  1 
ATOM 208   C C   . LYS A 1  64   ? 152.253 125.405 145.898 1.00 370.00 ? 64   LYS A C   1 
ATOM 209   O O   . LYS A 1  64   ? 153.450 125.357 146.228 1.00 370.00 ? 64   LYS A O   1 
ATOM 210   C CB  . LYS A 1  64   ? 150.694 127.312 145.920 1.00 370.00 ? 64   LYS A CB  1 
ATOM 211   C CG  . LYS A 1  64   ? 151.271 127.813 147.231 1.00 370.00 ? 64   LYS A CG  1 
ATOM 212   C CD  . LYS A 1  64   ? 150.181 127.949 148.285 1.00 370.00 ? 64   LYS A CD  1 
ATOM 213   C CE  . LYS A 1  64   ? 149.224 129.075 148.009 1.00 370.00 ? 64   LYS A CE  1 
ATOM 214   N NZ  . LYS A 1  64   ? 148.212 129.194 149.090 1.00 370.00 ? 64   LYS A NZ  1 
ATOM 215   N N   . HIS A 1  65   ? 151.394 124.452 146.232 1.00 370.00 ? 65   HIS A N   1 
ATOM 216   C CA  . HIS A 1  65   ? 151.816 123.328 147.036 1.00 370.00 ? 65   HIS A CA  1 
ATOM 217   C C   . HIS A 1  65   ? 152.682 122.359 146.237 1.00 370.00 ? 65   HIS A C   1 
ATOM 218   O O   . HIS A 1  65   ? 153.305 121.492 146.825 1.00 370.00 ? 65   HIS A O   1 
ATOM 219   C CB  . HIS A 1  65   ? 150.577 122.669 147.632 1.00 370.00 ? 65   HIS A CB  1 
ATOM 220   C CG  . HIS A 1  65   ? 149.928 123.482 148.713 1.00 370.00 ? 65   HIS A CG  1 
ATOM 221   N ND1 . HIS A 1  65   ? 149.096 124.544 148.450 1.00 370.00 ? 65   HIS A ND1 1 
ATOM 222   C CD2 . HIS A 1  65   ? 149.969 123.371 150.062 1.00 370.00 ? 65   HIS A CD2 1 
ATOM 223   C CE1 . HIS A 1  65   ? 148.666 125.062 149.589 1.00 370.00 ? 65   HIS A CE1 1 
ATOM 224   N NE2 . HIS A 1  65   ? 149.181 124.368 150.585 1.00 370.00 ? 65   HIS A NE2 1 
ATOM 225   N N   . LEU A 1  66   ? 152.733 122.487 144.903 1.00 370.00 ? 66   LEU A N   1 
ATOM 226   C CA  . LEU A 1  66   ? 153.725 121.799 144.071 1.00 370.00 ? 66   LEU A CA  1 
ATOM 227   C C   . LEU A 1  66   ? 155.133 122.325 144.321 1.00 370.00 ? 66   LEU A C   1 
ATOM 228   O O   . LEU A 1  66   ? 156.100 121.550 144.477 1.00 370.00 ? 66   LEU A O   1 
ATOM 229   C CB  . LEU A 1  66   ? 153.336 121.994 142.604 1.00 370.00 ? 66   LEU A CB  1 
ATOM 230   C CG  . LEU A 1  66   ? 154.083 121.494 141.376 1.00 370.00 ? 66   LEU A CG  1 
ATOM 231   C CD1 . LEU A 1  66   ? 154.018 120.000 141.312 1.00 370.00 ? 66   LEU A CD1 1 
ATOM 232   C CD2 . LEU A 1  66   ? 153.446 122.122 140.150 1.00 370.00 ? 66   LEU A CD2 1 
ATOM 233   N N   . ALA A 1  67   ? 155.263 123.661 144.331 1.00 370.00 ? 67   ALA A N   1 
ATOM 234   C CA  . ALA A 1  67   ? 156.496 124.296 144.799 1.00 370.00 ? 67   ALA A CA  1 
ATOM 235   C C   . ALA A 1  67   ? 156.823 123.873 146.229 1.00 370.00 ? 67   ALA A C   1 
ATOM 236   O O   . ALA A 1  67   ? 157.998 123.796 146.612 1.00 370.00 ? 67   ALA A O   1 
ATOM 237   C CB  . ALA A 1  67   ? 156.378 125.817 144.700 1.00 370.00 ? 67   ALA A CB  1 
ATOM 238   N N   . GLY A 1  68   ? 155.792 123.597 147.034 1.00 370.00 ? 68   GLY A N   1 
ATOM 239   C CA  . GLY A 1  68   ? 156.017 122.878 148.283 1.00 370.00 ? 68   GLY A CA  1 
ATOM 240   C C   . GLY A 1  68   ? 156.367 121.402 148.119 1.00 370.00 ? 68   GLY A C   1 
ATOM 241   O O   . GLY A 1  68   ? 157.162 120.865 148.898 1.00 370.00 ? 68   GLY A O   1 
ATOM 242   N N   . LEU A 1  69   ? 155.790 120.730 147.109 1.00 370.00 ? 69   LEU A N   1 
ATOM 243   C CA  . LEU A 1  69   ? 155.934 119.284 146.907 1.00 370.00 ? 69   LEU A CA  1 
ATOM 244   C C   . LEU A 1  69   ? 157.338 118.886 146.511 1.00 370.00 ? 69   LEU A C   1 
ATOM 245   O O   . LEU A 1  69   ? 157.656 117.692 146.543 1.00 370.00 ? 69   LEU A O   1 
ATOM 246   C CB  . LEU A 1  69   ? 155.012 118.733 145.804 1.00 370.00 ? 69   LEU A CB  1 
ATOM 247   C CG  . LEU A 1  69   ? 153.501 118.479 145.827 1.00 370.00 ? 69   LEU A CG  1 
ATOM 248   C CD1 . LEU A 1  69   ? 153.017 117.985 144.459 1.00 370.00 ? 69   LEU A CD1 1 
ATOM 249   C CD2 . LEU A 1  69   ? 153.087 117.533 146.937 1.00 370.00 ? 69   LEU A CD2 1 
ATOM 250   N N   . GLY A 1  70   ? 158.151 119.851 146.073 1.00 370.00 ? 70   GLY A N   1 
ATOM 251   C CA  . GLY A 1  70   ? 159.539 119.555 145.721 1.00 370.00 ? 70   GLY A CA  1 
ATOM 252   C C   . GLY A 1  70   ? 160.377 118.896 146.815 1.00 370.00 ? 70   GLY A C   1 
ATOM 253   O O   . GLY A 1  70   ? 161.398 118.269 146.518 1.00 370.00 ? 70   GLY A O   1 
ATOM 254   N N   . ALA A 1  71   ? 159.974 119.028 148.086 1.00 370.00 ? 71   ALA A N   1 
ATOM 255   C CA  . ALA A 1  71   ? 160.754 118.449 149.180 1.00 370.00 ? 71   ALA A CA  1 
ATOM 256   C C   . ALA A 1  71   ? 160.272 117.053 149.585 1.00 370.00 ? 71   ALA A C   1 
ATOM 257   O O   . ALA A 1  71   ? 161.094 116.161 149.828 1.00 370.00 ? 71   ALA A O   1 
ATOM 258   C CB  . ALA A 1  71   ? 160.731 119.382 150.390 1.00 370.00 ? 71   ALA A CB  1 
ATOM 259   N N   . LEU A 1  72   ? 158.948 116.840 149.665 1.00 370.00 ? 72   LEU A N   1 
ATOM 260   C CA  . LEU A 1  72   ? 158.394 115.808 150.552 1.00 370.00 ? 72   LEU A CA  1 
ATOM 261   C C   . LEU A 1  72   ? 158.598 114.377 150.048 1.00 370.00 ? 72   LEU A C   1 
ATOM 262   O O   . LEU A 1  72   ? 158.224 113.430 150.747 1.00 370.00 ? 72   LEU A O   1 
ATOM 263   C CB  . LEU A 1  72   ? 156.903 116.065 150.822 1.00 370.00 ? 72   LEU A CB  1 
ATOM 264   C CG  . LEU A 1  72   ? 155.767 116.036 149.790 1.00 370.00 ? 72   LEU A CG  1 
ATOM 265   C CD1 . LEU A 1  72   ? 155.148 114.649 149.592 1.00 370.00 ? 72   LEU A CD1 1 
ATOM 266   C CD2 . LEU A 1  72   ? 154.700 117.015 150.231 1.00 370.00 ? 72   LEU A CD2 1 
ATOM 267   N N   . GLY A 1  73   ? 159.155 114.184 148.857 1.00 370.00 ? 73   GLY A N   1 
ATOM 268   C CA  . GLY A 1  73   ? 159.304 112.835 148.344 1.00 370.00 ? 73   GLY A CA  1 
ATOM 269   C C   . GLY A 1  73   ? 159.141 112.759 146.844 1.00 370.00 ? 73   GLY A C   1 
ATOM 270   O O   . GLY A 1  73   ? 159.443 111.736 146.221 1.00 370.00 ? 73   GLY A O   1 
ATOM 271   N N   . LEU A 1  74   ? 158.645 113.852 146.258 1.00 370.00 ? 74   LEU A N   1 
ATOM 272   C CA  . LEU A 1  74   ? 158.599 113.990 144.807 1.00 370.00 ? 74   LEU A CA  1 
ATOM 273   C C   . LEU A 1  74   ? 159.991 114.134 144.197 1.00 370.00 ? 74   LEU A C   1 
ATOM 274   O O   . LEU A 1  74   ? 160.140 113.960 142.982 1.00 370.00 ? 74   LEU A O   1 
ATOM 275   C CB  . LEU A 1  74   ? 157.738 115.195 144.409 1.00 370.00 ? 74   LEU A CB  1 
ATOM 276   C CG  . LEU A 1  74   ? 156.201 115.110 144.352 1.00 370.00 ? 74   LEU A CG  1 
ATOM 277   C CD1 . LEU A 1  74   ? 155.742 114.028 143.393 1.00 370.00 ? 74   LEU A CD1 1 
ATOM 278   C CD2 . LEU A 1  74   ? 155.542 114.930 145.714 1.00 370.00 ? 74   LEU A CD2 1 
ATOM 279   N N   . GLY A 1  75   ? 160.999 114.468 145.017 1.00 370.00 ? 75   GLY A N   1 
ATOM 280   C CA  . GLY A 1  75   ? 162.357 114.665 144.523 1.00 370.00 ? 75   GLY A CA  1 
ATOM 281   C C   . GLY A 1  75   ? 162.978 113.434 143.886 1.00 370.00 ? 75   GLY A C   1 
ATOM 282   O O   . GLY A 1  75   ? 163.855 113.551 143.027 1.00 370.00 ? 75   GLY A O   1 
ATOM 283   N N   . SER A 1  76   ? 162.546 112.239 144.305 1.00 370.00 ? 76   SER A N   1 
ATOM 284   C CA  . SER A 1  76   ? 163.012 111.009 143.664 1.00 370.00 ? 76   SER A CA  1 
ATOM 285   C C   . SER A 1  76   ? 162.547 110.935 142.213 1.00 370.00 ? 76   SER A C   1 
ATOM 286   O O   . SER A 1  76   ? 163.327 110.619 141.305 1.00 370.00 ? 76   SER A O   1 
ATOM 287   C CB  . SER A 1  76   ? 162.521 109.793 144.449 1.00 370.00 ? 76   SER A CB  1 
ATOM 288   O OG  . SER A 1  76   ? 161.108 109.684 144.384 1.00 370.00 ? 76   SER A OG  1 
ATOM 289   N N   . LEU A 1  77   ? 161.279 111.262 141.973 1.00 370.00 ? 77   LEU A N   1 
ATOM 290   C CA  . LEU A 1  77   ? 160.777 111.333 140.608 1.00 370.00 ? 77   LEU A CA  1 
ATOM 291   C C   . LEU A 1  77   ? 161.345 112.533 139.856 1.00 370.00 ? 77   LEU A C   1 
ATOM 292   O O   . LEU A 1  77   ? 161.432 112.491 138.626 1.00 370.00 ? 77   LEU A O   1 
ATOM 293   C CB  . LEU A 1  77   ? 159.245 111.374 140.615 1.00 370.00 ? 77   LEU A CB  1 
ATOM 294   C CG  . LEU A 1  77   ? 158.447 110.063 140.727 1.00 370.00 ? 77   LEU A CG  1 
ATOM 295   C CD1 . LEU A 1  77   ? 158.556 109.377 142.084 1.00 370.00 ? 77   LEU A CD1 1 
ATOM 296   C CD2 . LEU A 1  77   ? 156.988 110.335 140.438 1.00 370.00 ? 77   LEU A CD2 1 
ATOM 297   N N   . ILE A 1  78   ? 161.754 113.585 140.570 1.00 370.00 ? 78   ILE A N   1 
ATOM 298   C CA  . ILE A 1  78   ? 162.446 114.709 139.938 1.00 370.00 ? 78   ILE A CA  1 
ATOM 299   C C   . ILE A 1  78   ? 163.811 114.270 139.415 1.00 370.00 ? 78   ILE A C   1 
ATOM 300   O O   . ILE A 1  78   ? 164.186 114.572 138.274 1.00 370.00 ? 78   ILE A O   1 
ATOM 301   C CB  . ILE A 1  78   ? 162.557 115.889 140.923 1.00 370.00 ? 78   ILE A CB  1 
ATOM 302   C CG1 . ILE A 1  78   ? 161.182 116.500 141.183 1.00 370.00 ? 78   ILE A CG1 1 
ATOM 303   C CG2 . ILE A 1  78   ? 163.499 116.952 140.410 1.00 370.00 ? 78   ILE A CG2 1 
ATOM 304   C CD1 . ILE A 1  78   ? 161.176 117.494 142.318 1.00 370.00 ? 78   ILE A CD1 1 
ATOM 305   N N   . THR A 1  79   ? 164.571 113.537 140.240 1.00 370.00 ? 79   THR A N   1 
ATOM 306   C CA  . THR A 1  79   ? 165.848 112.974 139.804 1.00 370.00 ? 79   THR A CA  1 
ATOM 307   C C   . THR A 1  79   ? 165.675 111.924 138.715 1.00 370.00 ? 79   THR A C   1 
ATOM 308   O O   . THR A 1  79   ? 166.588 111.735 137.905 1.00 370.00 ? 79   THR A O   1 
ATOM 309   C CB  . THR A 1  79   ? 166.603 112.348 140.979 1.00 370.00 ? 79   THR A CB  1 
ATOM 310   O OG1 . THR A 1  79   ? 165.797 111.326 141.587 1.00 370.00 ? 79   THR A OG1 1 
ATOM 311   C CG2 . THR A 1  79   ? 166.977 113.398 142.012 1.00 370.00 ? 79   THR A CG2 1 
ATOM 312   N N   . GLU A 1  80   ? 164.534 111.228 138.693 1.00 370.00 ? 80   GLU A N   1 
ATOM 313   C CA  . GLU A 1  80   ? 164.176 110.429 137.523 1.00 370.00 ? 80   GLU A CA  1 
ATOM 314   C C   . GLU A 1  80   ? 164.014 111.300 136.282 1.00 370.00 ? 80   GLU A C   1 
ATOM 315   O O   . GLU A 1  80   ? 164.514 110.959 135.203 1.00 370.00 ? 80   GLU A O   1 
ATOM 316   C CB  . GLU A 1  80   ? 162.888 109.649 137.791 1.00 370.00 ? 80   GLU A CB  1 
ATOM 317   C CG  . GLU A 1  80   ? 163.040 108.462 138.717 1.00 370.00 ? 80   GLU A CG  1 
ATOM 318   C CD  . GLU A 1  80   ? 163.757 107.309 138.051 1.00 370.00 ? 80   GLU A CD  1 
ATOM 319   O OE1 . GLU A 1  80   ? 163.598 107.145 136.823 1.00 370.00 ? 80   GLU A OE1 1 
ATOM 320   O OE2 . GLU A 1  80   ? 164.473 106.567 138.753 1.00 370.00 ? 80   GLU A OE2 1 
ATOM 321   N N   . LEU A 1  81   ? 163.325 112.435 136.421 1.00 370.00 ? 81   LEU A N   1 
ATOM 322   C CA  . LEU A 1  81   ? 162.962 113.243 135.260 1.00 370.00 ? 81   LEU A CA  1 
ATOM 323   C C   . LEU A 1  81   ? 164.131 114.065 134.720 1.00 370.00 ? 81   LEU A C   1 
ATOM 324   O O   . LEU A 1  81   ? 164.124 114.436 133.540 1.00 370.00 ? 81   LEU A O   1 
ATOM 325   C CB  . LEU A 1  81   ? 161.763 114.125 135.606 1.00 370.00 ? 81   LEU A CB  1 
ATOM 326   C CG  . LEU A 1  81   ? 160.381 113.588 135.206 1.00 370.00 ? 81   LEU A CG  1 
ATOM 327   C CD1 . LEU A 1  81   ? 160.068 112.189 135.692 1.00 370.00 ? 81   LEU A CD1 1 
ATOM 328   C CD2 . LEU A 1  81   ? 159.359 114.509 135.807 1.00 370.00 ? 81   LEU A CD2 1 
ATOM 329   N N   . THR A 1  82   ? 165.128 114.378 135.547 1.00 370.00 ? 82   THR A N   1 
ATOM 330   C CA  . THR A 1  82   ? 166.355 114.981 135.021 1.00 370.00 ? 82   THR A CA  1 
ATOM 331   C C   . THR A 1  82   ? 167.479 113.957 134.998 1.00 370.00 ? 82   THR A C   1 
ATOM 332   O O   . THR A 1  82   ? 168.046 113.620 136.042 1.00 370.00 ? 82   THR A O   1 
ATOM 333   C CB  . THR A 1  82   ? 166.820 116.197 135.837 1.00 370.00 ? 82   THR A CB  1 
ATOM 334   O OG1 . THR A 1  82   ? 165.772 117.167 135.899 1.00 370.00 ? 82   THR A OG1 1 
ATOM 335   C CG2 . THR A 1  82   ? 168.033 116.843 135.175 1.00 370.00 ? 82   THR A CG2 1 
ATOM 336   N N   . ASN A 1  96   ? 158.867 139.972 131.924 1.00 370.00 ? 96   ASN A N   1 
ATOM 337   C CA  . ASN A 1  96   ? 160.152 140.653 132.030 1.00 370.00 ? 96   ASN A CA  1 
ATOM 338   C C   . ASN A 1  96   ? 160.607 141.175 130.670 1.00 370.00 ? 96   ASN A C   1 
ATOM 339   O O   . ASN A 1  96   ? 160.706 140.414 129.706 1.00 370.00 ? 96   ASN A O   1 
ATOM 340   C CB  . ASN A 1  96   ? 161.207 139.716 132.621 1.00 370.00 ? 96   ASN A CB  1 
ATOM 341   C CG  . ASN A 1  96   ? 160.962 139.413 134.086 1.00 370.00 ? 96   ASN A CG  1 
ATOM 342   O OD1 . ASN A 1  96   ? 160.607 140.300 134.864 1.00 370.00 ? 96   ASN A OD1 1 
ATOM 343   N ND2 . ASN A 1  96   ? 161.149 138.157 134.473 1.00 370.00 ? 96   ASN A ND2 1 
ATOM 344   N N   . ASP A 1  97   ? 160.866 142.483 130.601 1.00 370.00 ? 97   ASP A N   1 
ATOM 345   C CA  . ASP A 1  97   ? 161.307 143.094 129.350 1.00 370.00 ? 97   ASP A CA  1 
ATOM 346   C C   . ASP A 1  97   ? 162.731 142.675 129.002 1.00 370.00 ? 97   ASP A C   1 
ATOM 347   O O   . ASP A 1  97   ? 163.039 142.383 127.841 1.00 370.00 ? 97   ASP A O   1 
ATOM 348   C CB  . ASP A 1  97   ? 161.193 144.616 129.438 1.00 370.00 ? 97   ASP A CB  1 
ATOM 349   C CG  . ASP A 1  97   ? 159.754 145.091 129.458 1.00 370.00 ? 97   ASP A CG  1 
ATOM 350   O OD1 . ASP A 1  97   ? 158.892 144.400 128.875 1.00 370.00 ? 97   ASP A OD1 1 
ATOM 351   O OD2 . ASP A 1  97   ? 159.483 146.155 130.053 1.00 370.00 ? 97   ASP A OD2 1 
ATOM 352   N N   . GLU A 1  98   ? 163.621 142.651 129.998 1.00 370.00 ? 98   GLU A N   1 
ATOM 353   C CA  . GLU A 1  98   ? 164.988 142.210 129.753 1.00 370.00 ? 98   GLU A CA  1 
ATOM 354   C C   . GLU A 1  98   ? 165.109 140.701 129.592 1.00 370.00 ? 98   GLU A C   1 
ATOM 355   O O   . GLU A 1  98   ? 166.158 140.232 129.139 1.00 370.00 ? 98   GLU A O   1 
ATOM 356   C CB  . GLU A 1  98   ? 165.917 142.676 130.877 1.00 370.00 ? 98   GLU A CB  1 
ATOM 357   C CG  . GLU A 1  98   ? 166.150 144.176 130.913 1.00 370.00 ? 98   GLU A CG  1 
ATOM 358   C CD  . GLU A 1  98   ? 167.092 144.592 132.026 1.00 370.00 ? 98   GLU A CD  1 
ATOM 359   O OE1 . GLU A 1  98   ? 167.457 143.731 132.855 1.00 370.00 ? 98   GLU A OE1 1 
ATOM 360   O OE2 . GLU A 1  98   ? 167.477 145.780 132.066 1.00 370.00 ? 98   GLU A OE2 1 
ATOM 361   N N   . GLY A 1  99   ? 164.082 139.932 129.947 1.00 370.00 ? 99   GLY A N   1 
ATOM 362   C CA  . GLY A 1  99   ? 164.162 138.500 129.755 1.00 370.00 ? 99   GLY A CA  1 
ATOM 363   C C   . GLY A 1  99   ? 163.501 138.031 128.477 1.00 370.00 ? 99   GLY A C   1 
ATOM 364   O O   . GLY A 1  99   ? 162.295 137.766 128.443 1.00 370.00 ? 99   GLY A O   1 
ATOM 365   N N   . TRP A 1  100  ? 164.307 137.897 127.427 1.00 370.00 ? 100  TRP A N   1 
ATOM 366   C CA  . TRP A 1  100  ? 163.899 137.325 126.151 1.00 370.00 ? 100  TRP A CA  1 
ATOM 367   C C   . TRP A 1  100  ? 165.124 136.679 125.529 1.00 370.00 ? 100  TRP A C   1 
ATOM 368   O O   . TRP A 1  100  ? 166.215 137.254 125.551 1.00 370.00 ? 100  TRP A O   1 
ATOM 369   C CB  . TRP A 1  100  ? 163.310 138.368 125.192 1.00 370.00 ? 100  TRP A CB  1 
ATOM 370   C CG  . TRP A 1  100  ? 161.956 138.878 125.576 1.00 370.00 ? 100  TRP A CG  1 
ATOM 371   C CD1 . TRP A 1  100  ? 161.672 140.027 126.251 1.00 370.00 ? 100  TRP A CD1 1 
ATOM 372   C CD2 . TRP A 1  100  ? 160.696 138.251 125.303 1.00 370.00 ? 100  TRP A CD2 1 
ATOM 373   N NE1 . TRP A 1  100  ? 160.315 140.157 126.417 1.00 370.00 ? 100  TRP A NE1 1 
ATOM 374   C CE2 . TRP A 1  100  ? 159.693 139.080 125.843 1.00 370.00 ? 100  TRP A CE2 1 
ATOM 375   C CE3 . TRP A 1  100  ? 160.320 137.071 124.654 1.00 370.00 ? 100  TRP A CE3 1 
ATOM 376   C CZ2 . TRP A 1  100  ? 158.337 138.766 125.756 1.00 370.00 ? 100  TRP A CZ2 1 
ATOM 377   C CZ3 . TRP A 1  100  ? 158.973 136.761 124.567 1.00 370.00 ? 100  TRP A CZ3 1 
ATOM 378   C CH2 . TRP A 1  100  ? 157.998 137.605 125.115 1.00 370.00 ? 100  TRP A CH2 1 
ATOM 379   N N   . VAL A 1  101  ? 164.937 135.487 124.976 1.00 370.00 ? 101  VAL A N   1 
ATOM 380   C CA  . VAL A 1  101  ? 166.053 134.712 124.451 1.00 370.00 ? 101  VAL A CA  1 
ATOM 381   C C   . VAL A 1  101  ? 166.385 135.195 123.046 1.00 370.00 ? 101  VAL A C   1 
ATOM 382   O O   . VAL A 1  101  ? 165.509 135.260 122.174 1.00 370.00 ? 101  VAL A O   1 
ATOM 383   C CB  . VAL A 1  101  ? 165.723 133.213 124.478 1.00 370.00 ? 101  VAL A CB  1 
ATOM 384   C CG1 . VAL A 1  101  ? 166.835 132.401 123.832 1.00 370.00 ? 101  VAL A CG1 1 
ATOM 385   C CG2 . VAL A 1  101  ? 165.511 132.779 125.913 1.00 370.00 ? 101  VAL A CG2 1 
ATOM 386   N N   . ARG A 1  102  ? 167.653 135.538 122.831 1.00 370.00 ? 102  ARG A N   1 
ATOM 387   C CA  . ARG A 1  102  ? 168.092 136.108 121.565 1.00 370.00 ? 102  ARG A CA  1 
ATOM 388   C C   . ARG A 1  102  ? 168.072 135.060 120.460 1.00 370.00 ? 102  ARG A C   1 
ATOM 389   O O   . ARG A 1  102  ? 168.340 133.878 120.693 1.00 370.00 ? 102  ARG A O   1 
ATOM 390   C CB  . ARG A 1  102  ? 169.498 136.687 121.712 1.00 370.00 ? 102  ARG A CB  1 
ATOM 391   C CG  . ARG A 1  102  ? 169.571 137.884 122.646 1.00 370.00 ? 102  ARG A CG  1 
ATOM 392   C CD  . ARG A 1  102  ? 170.993 138.402 122.762 1.00 370.00 ? 102  ARG A CD  1 
ATOM 393   N NE  . ARG A 1  102  ? 171.095 139.525 123.690 1.00 370.00 ? 102  ARG A NE  1 
ATOM 394   C CZ  . ARG A 1  102  ? 172.237 140.121 124.013 1.00 370.00 ? 102  ARG A CZ  1 
ATOM 395   N NH1 . ARG A 1  102  ? 173.379 139.705 123.482 1.00 370.00 ? 102  ARG A NH1 1 
ATOM 396   N NH2 . ARG A 1  102  ? 172.241 141.136 124.867 1.00 370.00 ? 102  ARG A NH2 1 
ATOM 397   N N   . SER A 1  103  ? 167.735 135.501 119.250 1.00 370.00 ? 103  SER A N   1 
ATOM 398   C CA  . SER A 1  103  ? 167.632 134.627 118.094 1.00 370.00 ? 103  SER A CA  1 
ATOM 399   C C   . SER A 1  103  ? 168.232 135.312 116.874 1.00 370.00 ? 103  SER A C   1 
ATOM 400   O O   . SER A 1  103  ? 168.388 136.536 116.843 1.00 370.00 ? 103  SER A O   1 
ATOM 401   C CB  . SER A 1  103  ? 166.174 134.242 117.804 1.00 370.00 ? 103  SER A CB  1 
ATOM 402   O OG  . SER A 1  103  ? 165.419 135.371 117.397 1.00 370.00 ? 103  SER A OG  1 
ATOM 403   N N   . THR A 1  104  ? 168.581 134.505 115.876 1.00 370.00 ? 104  THR A N   1 
ATOM 404   C CA  . THR A 1  104  ? 169.014 135.034 114.591 1.00 370.00 ? 104  THR A CA  1 
ATOM 405   C C   . THR A 1  104  ? 167.850 135.707 113.868 1.00 370.00 ? 104  THR A C   1 
ATOM 406   O O   . THR A 1  104  ? 166.678 135.464 114.170 1.00 370.00 ? 104  THR A O   1 
ATOM 407   C CB  . THR A 1  104  ? 169.598 133.924 113.719 1.00 370.00 ? 104  THR A CB  1 
ATOM 408   O OG1 . THR A 1  104  ? 168.605 132.915 113.493 1.00 370.00 ? 104  THR A OG1 1 
ATOM 409   C CG2 . THR A 1  104  ? 170.809 133.300 114.394 1.00 370.00 ? 104  THR A CG2 1 
ATOM 410   N N   . GLU A 1  105  ? 168.196 136.585 112.920 1.00 370.00 ? 105  GLU A N   1 
ATOM 411   C CA  . GLU A 1  105  ? 167.196 137.372 112.201 1.00 370.00 ? 105  GLU A CA  1 
ATOM 412   C C   . GLU A 1  105  ? 166.278 136.504 111.346 1.00 370.00 ? 105  GLU A C   1 
ATOM 413   O O   . GLU A 1  105  ? 165.086 136.800 111.208 1.00 370.00 ? 105  GLU A O   1 
ATOM 414   C CB  . GLU A 1  105  ? 167.893 138.426 111.342 1.00 370.00 ? 105  GLU A CB  1 
ATOM 415   C CG  . GLU A 1  105  ? 168.599 139.481 112.168 1.00 370.00 ? 105  GLU A CG  1 
ATOM 416   C CD  . GLU A 1  105  ? 169.308 140.514 111.323 1.00 370.00 ? 105  GLU A CD  1 
ATOM 417   O OE1 . GLU A 1  105  ? 169.353 140.346 110.087 1.00 370.00 ? 105  GLU A OE1 1 
ATOM 418   O OE2 . GLU A 1  105  ? 169.828 141.491 111.898 1.00 370.00 ? 105  GLU A OE2 1 
ATOM 419   N N   . ASP A 1  106  ? 166.810 135.426 110.767 1.00 370.00 ? 106  ASP A N   1 
ATOM 420   C CA  . ASP A 1  106  ? 166.038 134.540 109.904 1.00 370.00 ? 106  ASP A CA  1 
ATOM 421   C C   . ASP A 1  106  ? 165.576 133.275 110.623 1.00 370.00 ? 106  ASP A C   1 
ATOM 422   O O   . ASP A 1  106  ? 165.606 132.185 110.042 1.00 370.00 ? 106  ASP A O   1 
ATOM 423   C CB  . ASP A 1  106  ? 166.848 134.184 108.657 1.00 370.00 ? 106  ASP A CB  1 
ATOM 424   C CG  . ASP A 1  106  ? 167.010 135.361 107.723 1.00 370.00 ? 106  ASP A CG  1 
ATOM 425   O OD1 . ASP A 1  106  ? 166.114 136.233 107.717 1.00 370.00 ? 106  ASP A OD1 1 
ATOM 426   O OD2 . ASP A 1  106  ? 168.023 135.417 106.996 1.00 370.00 ? 106  ASP A OD2 1 
ATOM 427   N N   . ALA A 1  107  ? 165.154 133.402 111.879 1.00 370.00 ? 107  ALA A N   1 
ATOM 428   C CA  . ALA A 1  107  ? 164.716 132.250 112.656 1.00 370.00 ? 107  ALA A CA  1 
ATOM 429   C C   . ALA A 1  107  ? 163.337 131.770 112.212 1.00 370.00 ? 107  ALA A C   1 
ATOM 430   O O   . ALA A 1  107  ? 162.448 132.570 111.905 1.00 370.00 ? 107  ALA A O   1 
ATOM 431   C CB  . ALA A 1  107  ? 164.709 132.597 114.143 1.00 370.00 ? 107  ALA A CB  1 
ATOM 432   N N   . VAL A 1  108  ? 163.176 130.442 112.153 1.00 370.00 ? 108  VAL A N   1 
ATOM 433   C CA  . VAL A 1  108  ? 161.966 129.779 111.671 1.00 370.00 ? 108  VAL A CA  1 
ATOM 434   C C   . VAL A 1  108  ? 161.097 129.342 112.855 1.00 370.00 ? 108  VAL A C   1 
ATOM 435   O O   . VAL A 1  108  ? 161.621 128.926 113.900 1.00 370.00 ? 108  VAL A O   1 
ATOM 436   C CB  . VAL A 1  108  ? 162.377 128.587 110.780 1.00 370.00 ? 108  VAL A CB  1 
ATOM 437   C CG1 . VAL A 1  108  ? 161.186 127.737 110.309 1.00 370.00 ? 108  VAL A CG1 1 
ATOM 438   C CG2 . VAL A 1  108  ? 163.185 129.088 109.576 1.00 370.00 ? 108  VAL A CG2 1 
ATOM 439   N N   . ASP A 1  109  ? 159.763 129.449 112.706 1.00 370.00 ? 109  ASP A N   1 
ATOM 440   C CA  . ASP A 1  109  ? 158.809 128.796 113.601 1.00 370.00 ? 109  ASP A CA  1 
ATOM 441   C C   . ASP A 1  109  ? 158.839 127.298 113.319 1.00 370.00 ? 109  ASP A C   1 
ATOM 442   O O   . ASP A 1  109  ? 158.383 126.845 112.260 1.00 370.00 ? 109  ASP A O   1 
ATOM 443   C CB  . ASP A 1  109  ? 157.396 129.339 113.388 1.00 370.00 ? 109  ASP A CB  1 
ATOM 444   C CG  . ASP A 1  109  ? 157.154 130.705 114.039 1.00 370.00 ? 109  ASP A CG  1 
ATOM 445   O OD1 . ASP A 1  109  ? 157.666 130.955 115.160 1.00 370.00 ? 109  ASP A OD1 1 
ATOM 446   O OD2 . ASP A 1  109  ? 156.468 131.521 113.411 1.00 370.00 ? 109  ASP A OD2 1 
ATOM 447   N N   . TYR A 1  110  ? 159.391 126.537 114.257 1.00 370.00 ? 110  TYR A N   1 
ATOM 448   C CA  . TYR A 1  110  ? 159.362 125.081 114.223 1.00 370.00 ? 110  TYR A CA  1 
ATOM 449   C C   . TYR A 1  110  ? 158.222 124.498 115.054 1.00 370.00 ? 110  TYR A C   1 
ATOM 450   O O   . TYR A 1  110  ? 158.166 123.278 115.247 1.00 370.00 ? 110  TYR A O   1 
ATOM 451   C CB  . TYR A 1  110  ? 160.705 124.511 114.701 1.00 370.00 ? 110  TYR A CB  1 
ATOM 452   C CG  . TYR A 1  110  ? 161.843 124.789 113.745 1.00 370.00 ? 110  TYR A CG  1 
ATOM 453   C CD1 . TYR A 1  110  ? 162.021 124.005 112.612 1.00 370.00 ? 110  TYR A CD1 1 
ATOM 454   C CD2 . TYR A 1  110  ? 162.729 125.837 113.964 1.00 370.00 ? 110  TYR A CD2 1 
ATOM 455   C CE1 . TYR A 1  110  ? 163.047 124.245 111.726 1.00 370.00 ? 110  TYR A CE1 1 
ATOM 456   C CE2 . TYR A 1  110  ? 163.774 126.091 113.073 1.00 370.00 ? 110  TYR A CE2 1 
ATOM 457   C CZ  . TYR A 1  110  ? 163.921 125.287 111.955 1.00 370.00 ? 110  TYR A CZ  1 
ATOM 458   O OH  . TYR A 1  110  ? 164.940 125.518 111.060 1.00 370.00 ? 110  TYR A OH  1 
ATOM 459   N N   . SER A 1  111  ? 157.331 125.345 115.572 1.00 370.00 ? 111  SER A N   1 
ATOM 460   C CA  . SER A 1  111  ? 156.194 124.854 116.339 1.00 370.00 ? 111  SER A CA  1 
ATOM 461   C C   . SER A 1  111  ? 155.159 124.164 115.467 1.00 370.00 ? 111  SER A C   1 
ATOM 462   O O   . SER A 1  111  ? 154.418 123.311 115.964 1.00 370.00 ? 111  SER A O   1 
ATOM 463   C CB  . SER A 1  111  ? 155.534 126.005 117.105 1.00 370.00 ? 111  SER A CB  1 
ATOM 464   O OG  . SER A 1  111  ? 154.963 126.954 116.223 1.00 370.00 ? 111  SER A OG  1 
ATOM 465   N N   . ASP A 1  112  ? 155.094 124.503 114.182 1.00 370.00 ? 112  ASP A N   1 
ATOM 466   C CA  . ASP A 1  112  ? 154.018 124.041 113.319 1.00 370.00 ? 112  ASP A CA  1 
ATOM 467   C C   . ASP A 1  112  ? 154.452 122.961 112.335 1.00 370.00 ? 112  ASP A C   1 
ATOM 468   O O   . ASP A 1  112  ? 153.828 122.831 111.277 1.00 370.00 ? 112  ASP A O   1 
ATOM 469   C CB  . ASP A 1  112  ? 153.417 125.224 112.557 1.00 370.00 ? 112  ASP A CB  1 
ATOM 470   C CG  . ASP A 1  112  ? 152.672 126.182 113.464 1.00 370.00 ? 112  ASP A CG  1 
ATOM 471   O OD1 . ASP A 1  112  ? 152.150 125.731 114.509 1.00 370.00 ? 112  ASP A OD1 1 
ATOM 472   O OD2 . ASP A 1  112  ? 152.605 127.382 113.132 1.00 370.00 ? 112  ASP A OD2 1 
ATOM 473   N N   . ILE A 1  113  ? 155.536 122.232 112.629 1.00 370.00 ? 113  ILE A N   1 
ATOM 474   C CA  . ILE A 1  113  ? 156.004 121.147 111.768 1.00 370.00 ? 113  ILE A CA  1 
ATOM 475   C C   . ILE A 1  113  ? 154.939 120.062 111.645 1.00 370.00 ? 113  ILE A C   1 
ATOM 476   O O   . ILE A 1  113  ? 154.391 119.588 112.645 1.00 370.00 ? 113  ILE A O   1 
ATOM 477   C CB  . ILE A 1  113  ? 157.336 120.584 112.301 1.00 370.00 ? 113  ILE A CB  1 
ATOM 478   C CG1 . ILE A 1  113  ? 158.417 121.665 112.278 1.00 370.00 ? 113  ILE A CG1 1 
ATOM 479   C CG2 . ILE A 1  113  ? 157.800 119.399 111.485 1.00 370.00 ? 113  ILE A CG2 1 
ATOM 480   C CD1 . ILE A 1  113  ? 159.695 121.251 112.964 1.00 370.00 ? 113  ILE A CD1 1 
ATOM 481   N N   . ASN A 1  114  ? 154.654 119.661 110.405 1.00 370.00 ? 114  ASN A N   1 
ATOM 482   C CA  . ASN A 1  114  ? 153.643 118.657 110.119 1.00 370.00 ? 114  ASN A CA  1 
ATOM 483   C C   . ASN A 1  114  ? 154.214 117.358 109.565 1.00 370.00 ? 114  ASN A C   1 
ATOM 484   O O   . ASN A 1  114  ? 153.446 116.420 109.324 1.00 370.00 ? 114  ASN A O   1 
ATOM 485   C CB  . ASN A 1  114  ? 152.609 119.211 109.127 1.00 370.00 ? 114  ASN A CB  1 
ATOM 486   C CG  . ASN A 1  114  ? 151.729 120.281 109.737 1.00 370.00 ? 114  ASN A CG  1 
ATOM 487   O OD1 . ASN A 1  114  ? 151.547 120.336 110.953 1.00 370.00 ? 114  ASN A OD1 1 
ATOM 488   N ND2 . ASN A 1  114  ? 151.190 121.152 108.892 1.00 370.00 ? 114  ASN A ND2 1 
ATOM 489   N N   . GLU A 1  115  ? 155.524 117.271 109.364 1.00 370.00 ? 115  GLU A N   1 
ATOM 490   C CA  . GLU A 1  115  ? 156.160 116.084 108.804 1.00 370.00 ? 115  GLU A CA  1 
ATOM 491   C C   . GLU A 1  115  ? 156.259 114.955 109.822 1.00 370.00 ? 115  GLU A C   1 
ATOM 492   O O   . GLU A 1  115  ? 155.886 115.112 110.984 1.00 370.00 ? 115  GLU A O   1 
ATOM 493   C CB  . GLU A 1  115  ? 157.558 116.415 108.302 1.00 370.00 ? 115  GLU A CB  1 
ATOM 494   C CG  . GLU A 1  115  ? 157.591 117.332 107.066 1.00 370.00 ? 115  GLU A CG  1 
ATOM 495   C CD  . GLU A 1  115  ? 159.001 117.597 106.599 1.00 370.00 ? 115  GLU A CD  1 
ATOM 496   O OE1 . GLU A 1  115  ? 159.946 117.191 107.303 1.00 370.00 ? 115  GLU A OE1 1 
ATOM 497   O OE2 . GLU A 1  115  ? 159.149 118.211 105.521 1.00 370.00 ? 115  GLU A OE2 1 
ATOM 498   N N   . VAL A 1  116  ? 156.628 113.766 109.338 1.00 370.00 ? 116  VAL A N   1 
ATOM 499   C CA  . VAL A 1  116  ? 156.913 112.626 110.202 1.00 370.00 ? 116  VAL A CA  1 
ATOM 500   C C   . VAL A 1  116  ? 158.376 112.246 110.039 1.00 370.00 ? 116  VAL A C   1 
ATOM 501   O O   . VAL A 1  116  ? 158.845 112.018 108.919 1.00 370.00 ? 116  VAL A O   1 
ATOM 502   C CB  . VAL A 1  116  ? 155.998 111.421 109.893 1.00 370.00 ? 116  VAL A CB  1 
ATOM 503   C CG1 . VAL A 1  116  ? 156.350 110.230 110.764 1.00 370.00 ? 116  VAL A CG1 1 
ATOM 504   C CG2 . VAL A 1  116  ? 154.544 111.826 110.053 1.00 370.00 ? 116  VAL A CG2 1 
ATOM 505   N N   . ALA A 1  117  ? 159.094 112.203 111.160 1.00 370.00 ? 117  ALA A N   1 
ATOM 506   C CA  . ALA A 1  117  ? 160.452 111.681 111.170 1.00 370.00 ? 117  ALA A CA  1 
ATOM 507   C C   . ALA A 1  117  ? 160.441 110.170 111.378 1.00 370.00 ? 117  ALA A C   1 
ATOM 508   O O   . ALA A 1  117  ? 159.497 109.607 111.940 1.00 370.00 ? 117  ALA A O   1 
ATOM 509   C CB  . ALA A 1  117  ? 161.290 112.350 112.257 1.00 370.00 ? 117  ALA A CB  1 
ATOM 510   N N   . GLU A 1  118  ? 161.527 109.521 110.954 1.00 370.00 ? 118  GLU A N   1 
ATOM 511   C CA  . GLU A 1  118  ? 161.628 108.063 110.982 1.00 370.00 ? 118  GLU A CA  1 
ATOM 512   C C   . GLU A 1  118  ? 161.660 107.501 112.400 1.00 370.00 ? 118  GLU A C   1 
ATOM 513   O O   . GLU A 1  118  ? 162.069 108.173 113.351 1.00 370.00 ? 118  GLU A O   1 
ATOM 514   C CB  . GLU A 1  118  ? 162.882 107.612 110.238 1.00 370.00 ? 118  GLU A CB  1 
ATOM 515   C CG  . GLU A 1  118  ? 162.865 107.880 108.741 1.00 370.00 ? 118  GLU A CG  1 
ATOM 516   C CD  . GLU A 1  118  ? 164.160 107.438 108.079 1.00 370.00 ? 118  GLU A CD  1 
ATOM 517   O OE1 . GLU A 1  118  ? 165.100 107.033 108.804 1.00 370.00 ? 118  GLU A OE1 1 
ATOM 518   O OE2 . GLU A 1  118  ? 164.245 107.505 106.839 1.00 370.00 ? 118  GLU A OE2 1 
ATOM 519   N N   . ASP A 1  119  ? 161.227 106.249 112.526 1.00 370.00 ? 119  ASP A N   1 
ATOM 520   C CA  . ASP A 1  119  ? 161.225 105.542 113.797 1.00 370.00 ? 119  ASP A CA  1 
ATOM 521   C C   . ASP A 1  119  ? 162.636 105.112 114.182 1.00 370.00 ? 119  ASP A C   1 
ATOM 522   O O   . ASP A 1  119  ? 163.118 104.064 113.745 1.00 370.00 ? 119  ASP A O   1 
ATOM 523   C CB  . ASP A 1  119  ? 160.308 104.322 113.726 1.00 370.00 ? 119  ASP A CB  1 
ATOM 524   C CG  . ASP A 1  119  ? 158.849 104.696 113.543 1.00 370.00 ? 119  ASP A CG  1 
ATOM 525   O OD1 . ASP A 1  119  ? 158.450 105.799 113.966 1.00 370.00 ? 119  ASP A OD1 1 
ATOM 526   O OD2 . ASP A 1  119  ? 158.093 103.873 112.979 1.00 370.00 ? 119  ASP A OD2 1 
ATOM 527   N N   . ILE A 1  588  ? 224.912 161.394 185.725 1.00 370.00 ? 588  ILE A N   1 
ATOM 528   C CA  . ILE A 1  588  ? 226.146 160.620 185.699 1.00 370.00 ? 588  ILE A CA  1 
ATOM 529   C C   . ILE A 1  588  ? 226.131 159.670 184.509 1.00 370.00 ? 588  ILE A C   1 
ATOM 530   O O   . ILE A 1  588  ? 225.336 158.733 184.459 1.00 370.00 ? 588  ILE A O   1 
ATOM 531   C CB  . ILE A 1  588  ? 226.348 159.850 187.014 1.00 370.00 ? 588  ILE A CB  1 
ATOM 532   C CG1 . ILE A 1  588  ? 226.374 160.817 188.202 1.00 370.00 ? 588  ILE A CG1 1 
ATOM 533   C CG2 . ILE A 1  588  ? 227.626 159.021 186.957 1.00 370.00 ? 588  ILE A CG2 1 
ATOM 534   C CD1 . ILE A 1  588  ? 227.490 161.839 188.145 1.00 370.00 ? 588  ILE A CD1 1 
ATOM 535   N N   . ILE A 1  589  ? 227.019 159.916 183.551 1.00 370.00 ? 589  ILE A N   1 
ATOM 536   C CA  . ILE A 1  589  ? 227.093 159.132 182.324 1.00 370.00 ? 589  ILE A CA  1 
ATOM 537   C C   . ILE A 1  589  ? 228.255 158.160 182.439 1.00 370.00 ? 589  ILE A C   1 
ATOM 538   O O   . ILE A 1  589  ? 229.397 158.569 182.685 1.00 370.00 ? 589  ILE A O   1 
ATOM 539   C CB  . ILE A 1  589  ? 227.254 160.041 181.093 1.00 370.00 ? 589  ILE A CB  1 
ATOM 540   C CG1 . ILE A 1  589  ? 226.074 161.009 180.988 1.00 370.00 ? 589  ILE A CG1 1 
ATOM 541   C CG2 . ILE A 1  589  ? 227.388 159.209 179.825 1.00 370.00 ? 589  ILE A CG2 1 
ATOM 542   C CD1 . ILE A 1  589  ? 224.735 160.326 180.827 1.00 370.00 ? 589  ILE A CD1 1 
ATOM 543   N N   . GLN A 1  590  ? 227.966 156.873 182.263 1.00 370.00 ? 590  GLN A N   1 
ATOM 544   C CA  . GLN A 1  590  ? 228.978 155.824 182.274 1.00 370.00 ? 590  GLN A CA  1 
ATOM 545   C C   . GLN A 1  590  ? 229.054 155.236 180.873 1.00 370.00 ? 590  GLN A C   1 
ATOM 546   O O   . GLN A 1  590  ? 228.155 154.498 180.454 1.00 370.00 ? 590  GLN A O   1 
ATOM 547   C CB  . GLN A 1  590  ? 228.652 154.748 183.307 1.00 370.00 ? 590  GLN A CB  1 
ATOM 548   C CG  . GLN A 1  590  ? 229.710 153.663 183.413 1.00 370.00 ? 590  GLN A CG  1 
ATOM 549   C CD  . GLN A 1  590  ? 229.398 152.644 184.489 1.00 370.00 ? 590  GLN A CD  1 
ATOM 550   O OE1 . GLN A 1  590  ? 228.364 152.719 185.151 1.00 370.00 ? 590  GLN A OE1 1 
ATOM 551   N NE2 . GLN A 1  590  ? 230.296 151.682 184.669 1.00 370.00 ? 590  GLN A NE2 1 
ATOM 552   N N   . HIS A 1  591  ? 230.122 155.566 180.153 1.00 370.00 ? 591  HIS A N   1 
ATOM 553   C CA  . HIS A 1  591  ? 230.317 155.068 178.804 1.00 370.00 ? 591  HIS A CA  1 
ATOM 554   C C   . HIS A 1  591  ? 230.751 153.606 178.842 1.00 370.00 ? 591  HIS A C   1 
ATOM 555   O O   . HIS A 1  591  ? 231.057 153.046 179.900 1.00 370.00 ? 591  HIS A O   1 
ATOM 556   C CB  . HIS A 1  591  ? 231.362 155.908 178.073 1.00 370.00 ? 591  HIS A CB  1 
ATOM 557   C CG  . HIS A 1  591  ? 231.036 157.366 178.012 1.00 370.00 ? 591  HIS A CG  1 
ATOM 558   N ND1 . HIS A 1  591  ? 230.115 157.889 177.131 1.00 370.00 ? 591  HIS A ND1 1 
ATOM 559   C CD2 . HIS A 1  591  ? 231.504 158.413 178.732 1.00 370.00 ? 591  HIS A CD2 1 
ATOM 560   C CE1 . HIS A 1  591  ? 230.035 159.196 177.306 1.00 370.00 ? 591  HIS A CE1 1 
ATOM 561   N NE2 . HIS A 1  591  ? 230.867 159.539 178.273 1.00 370.00 ? 591  HIS A NE2 1 
ATOM 562   N N   . SER A 1  592  ? 230.768 152.980 177.668 1.00 370.00 ? 592  SER A N   1 
ATOM 563   C CA  . SER A 1  592  ? 231.246 151.610 177.566 1.00 370.00 ? 592  SER A CA  1 
ATOM 564   C C   . SER A 1  592  ? 232.754 151.550 177.799 1.00 370.00 ? 592  SER A C   1 
ATOM 565   O O   . SER A 1  592  ? 233.471 152.544 177.661 1.00 370.00 ? 592  SER A O   1 
ATOM 566   C CB  . SER A 1  592  ? 230.901 151.016 176.202 1.00 370.00 ? 592  SER A CB  1 
ATOM 567   O OG  . SER A 1  592  ? 231.611 151.662 175.161 1.00 370.00 ? 592  SER A OG  1 
ATOM 568   N N   . ILE A 1  593  ? 233.222 150.355 178.174 1.00 370.00 ? 593  ILE A N   1 
ATOM 569   C CA  . ILE A 1  593  ? 234.650 150.168 178.464 1.00 370.00 ? 593  ILE A CA  1 
ATOM 570   C C   . ILE A 1  593  ? 235.552 150.391 177.251 1.00 370.00 ? 593  ILE A C   1 
ATOM 571   O O   . ILE A 1  593  ? 236.593 151.044 177.411 1.00 370.00 ? 593  ILE A O   1 
ATOM 572   C CB  . ILE A 1  593  ? 234.872 148.823 179.168 1.00 370.00 ? 593  ILE A CB  1 
ATOM 573   C CG1 . ILE A 1  593  ? 234.100 148.798 180.490 1.00 370.00 ? 593  ILE A CG1 1 
ATOM 574   C CG2 . ILE A 1  593  ? 236.352 148.541 179.430 1.00 370.00 ? 593  ILE A CG2 1 
ATOM 575   C CD1 . ILE A 1  593  ? 234.542 149.855 181.477 1.00 370.00 ? 593  ILE A CD1 1 
ATOM 576   N N   . PRO A 1  594  ? 235.233 149.928 176.022 1.00 370.00 ? 594  PRO A N   1 
ATOM 577   C CA  . PRO A 1  594  ? 236.055 150.375 174.877 1.00 370.00 ? 594  PRO A CA  1 
ATOM 578   C C   . PRO A 1  594  ? 235.965 151.866 174.579 1.00 370.00 ? 594  PRO A C   1 
ATOM 579   O O   . PRO A 1  594  ? 236.888 152.416 173.965 1.00 370.00 ? 594  PRO A O   1 
ATOM 580   C CB  . PRO A 1  594  ? 235.519 149.537 173.709 1.00 370.00 ? 594  PRO A CB  1 
ATOM 581   C CG  . PRO A 1  594  ? 234.968 148.350 174.331 1.00 370.00 ? 594  PRO A CG  1 
ATOM 582   C CD  . PRO A 1  594  ? 234.359 148.809 175.601 1.00 370.00 ? 594  PRO A CD  1 
ATOM 583   N N   . ALA A 1  595  ? 234.889 152.539 174.990 1.00 370.00 ? 595  ALA A N   1 
ATOM 584   C CA  . ALA A 1  595  ? 234.837 153.989 174.838 1.00 370.00 ? 595  ALA A CA  1 
ATOM 585   C C   . ALA A 1  595  ? 235.728 154.686 175.861 1.00 370.00 ? 595  ALA A C   1 
ATOM 586   O O   . ALA A 1  595  ? 236.467 155.612 175.515 1.00 370.00 ? 595  ALA A O   1 
ATOM 587   C CB  . ALA A 1  595  ? 233.394 154.482 174.952 1.00 370.00 ? 595  ALA A CB  1 
ATOM 588   N N   . VAL A 1  596  ? 235.664 154.261 177.128 1.00 370.00 ? 596  VAL A N   1 
ATOM 589   C CA  . VAL A 1  596  ? 236.471 154.896 178.171 1.00 370.00 ? 596  VAL A CA  1 
ATOM 590   C C   . VAL A 1  596  ? 237.960 154.581 177.980 1.00 370.00 ? 596  VAL A C   1 
ATOM 591   O O   . VAL A 1  596  ? 238.822 155.420 178.271 1.00 370.00 ? 596  VAL A O   1 
ATOM 592   C CB  . VAL A 1  596  ? 235.944 154.484 179.568 1.00 370.00 ? 596  VAL A CB  1 
ATOM 593   C CG1 . VAL A 1  596  ? 236.716 155.157 180.679 1.00 370.00 ? 596  VAL A CG1 1 
ATOM 594   C CG2 . VAL A 1  596  ? 234.481 154.856 179.716 1.00 370.00 ? 596  VAL A CG2 1 
ATOM 595   N N   . GLU A 1  597  ? 238.286 153.414 177.422 1.00 370.00 ? 597  GLU A N   1 
ATOM 596   C CA  . GLU A 1  597  ? 239.679 153.029 177.198 1.00 370.00 ? 597  GLU A CA  1 
ATOM 597   C C   . GLU A 1  597  ? 240.297 153.624 175.935 1.00 370.00 ? 597  GLU A C   1 
ATOM 598   O O   . GLU A 1  597  ? 241.395 153.195 175.564 1.00 370.00 ? 597  GLU A O   1 
ATOM 599   C CB  . GLU A 1  597  ? 239.822 151.501 177.141 1.00 370.00 ? 597  GLU A CB  1 
ATOM 600   C CG  . GLU A 1  597  ? 239.657 150.799 178.475 1.00 370.00 ? 597  GLU A CG  1 
ATOM 601   C CD  . GLU A 1  597  ? 239.790 149.294 178.366 1.00 370.00 ? 597  GLU A CD  1 
ATOM 602   O OE1 . GLU A 1  597  ? 239.894 148.781 177.232 1.00 370.00 ? 597  GLU A OE1 1 
ATOM 603   O OE2 . GLU A 1  597  ? 239.786 148.623 179.418 1.00 370.00 ? 597  GLU A OE2 1 
ATOM 604   N N   . LEU A 1  598  ? 239.618 154.575 175.271 1.00 370.00 ? 598  LEU A N   1 
ATOM 605   C CA  . LEU A 1  598  ? 240.132 155.309 174.097 1.00 370.00 ? 598  LEU A CA  1 
ATOM 606   C C   . LEU A 1  598  ? 240.511 154.372 172.948 1.00 370.00 ? 598  LEU A C   1 
ATOM 607   O O   . LEU A 1  598  ? 241.476 154.607 172.218 1.00 370.00 ? 598  LEU A O   1 
ATOM 608   C CB  . LEU A 1  598  ? 241.324 156.202 174.477 1.00 370.00 ? 598  LEU A CB  1 
ATOM 609   C CG  . LEU A 1  598  ? 241.151 157.625 175.028 1.00 370.00 ? 598  LEU A CG  1 
ATOM 610   C CD1 . LEU A 1  598  ? 240.535 158.551 174.001 1.00 370.00 ? 598  LEU A CD1 1 
ATOM 611   C CD2 . LEU A 1  598  ? 240.386 157.672 176.351 1.00 370.00 ? 598  LEU A CD2 1 
ATOM 612   N N   . ARG A 1  599  ? 239.742 153.299 172.785 1.00 370.00 ? 599  ARG A N   1 
ATOM 613   C CA  . ARG A 1  599  ? 240.121 152.244 171.856 1.00 370.00 ? 599  ARG A CA  1 
ATOM 614   C C   . ARG A 1  599  ? 239.793 152.616 170.415 1.00 370.00 ? 599  ARG A C   1 
ATOM 615   O O   . ARG A 1  599  ? 238.861 153.375 170.136 1.00 370.00 ? 599  ARG A O   1 
ATOM 616   C CB  . ARG A 1  599  ? 239.423 150.936 172.222 1.00 370.00 ? 599  ARG A CB  1 
ATOM 617   C CG  . ARG A 1  599  ? 239.807 150.391 173.585 1.00 370.00 ? 599  ARG A CG  1 
ATOM 618   C CD  . ARG A 1  599  ? 241.243 149.894 173.601 1.00 370.00 ? 599  ARG A CD  1 
ATOM 619   N NE  . ARG A 1  599  ? 241.596 149.308 174.891 1.00 370.00 ? 599  ARG A NE  1 
ATOM 620   C CZ  . ARG A 1  599  ? 242.810 148.869 175.209 1.00 370.00 ? 599  ARG A CZ  1 
ATOM 621   N NH1 . ARG A 1  599  ? 243.800 148.951 174.331 1.00 370.00 ? 599  ARG A NH1 1 
ATOM 622   N NH2 . ARG A 1  599  ? 243.035 148.352 176.408 1.00 370.00 ? 599  ARG A NH2 1 
ATOM 623   N N   . GLN A 1  600  ? 240.583 152.063 169.490 1.00 370.00 ? 600  GLN A N   1 
ATOM 624   C CA  . GLN A 1  600  ? 240.470 152.076 168.040 1.00 370.00 ? 600  GLN A CA  1 
ATOM 625   C C   . GLN A 1  600  ? 239.680 150.856 167.568 1.00 370.00 ? 600  GLN A C   1 
ATOM 626   O O   . GLN A 1  600  ? 239.735 149.795 168.199 1.00 370.00 ? 600  GLN A O   1 
ATOM 627   C CB  . GLN A 1  600  ? 241.859 152.069 167.396 1.00 370.00 ? 600  GLN A CB  1 
ATOM 628   C CG  . GLN A 1  600  ? 242.697 153.317 167.658 1.00 370.00 ? 600  GLN A CG  1 
ATOM 629   C CD  . GLN A 1  600  ? 243.512 153.228 168.937 1.00 370.00 ? 600  GLN A CD  1 
ATOM 630   O OE1 . GLN A 1  600  ? 243.727 152.142 169.475 1.00 370.00 ? 600  GLN A OE1 1 
ATOM 631   N NE2 . GLN A 1  600  ? 243.973 154.372 169.427 1.00 370.00 ? 600  GLN A NE2 1 
ATOM 632   N N   . PRO A 1  601  ? 238.918 150.951 166.463 1.00 370.00 ? 601  PRO A N   1 
ATOM 633   C CA  . PRO A 1  601  ? 238.634 152.117 165.616 1.00 370.00 ? 601  PRO A CA  1 
ATOM 634   C C   . PRO A 1  601  ? 237.438 152.926 166.100 1.00 370.00 ? 601  PRO A C   1 
ATOM 635   O O   . PRO A 1  601  ? 236.897 153.716 165.324 1.00 370.00 ? 601  PRO A O   1 
ATOM 636   C CB  . PRO A 1  601  ? 238.335 151.491 164.255 1.00 370.00 ? 601  PRO A CB  1 
ATOM 637   C CG  . PRO A 1  601  ? 237.732 150.182 164.596 1.00 370.00 ? 601  PRO A CG  1 
ATOM 638   C CD  . PRO A 1  601  ? 238.429 149.705 165.844 1.00 370.00 ? 601  PRO A CD  1 
ATOM 639   N N   . PHE A 1  602  ? 237.015 152.699 167.349 1.00 370.00 ? 602  PHE A N   1 
ATOM 640   C CA  . PHE A 1  602  ? 235.915 153.475 167.917 1.00 370.00 ? 602  PHE A CA  1 
ATOM 641   C C   . PHE A 1  602  ? 236.289 154.944 168.055 1.00 370.00 ? 602  PHE A C   1 
ATOM 642   O O   . PHE A 1  602  ? 235.465 155.824 167.780 1.00 370.00 ? 602  PHE A O   1 
ATOM 643   C CB  . PHE A 1  602  ? 235.515 152.909 169.281 1.00 370.00 ? 602  PHE A CB  1 
ATOM 644   C CG  . PHE A 1  602  ? 234.848 151.561 169.217 1.00 370.00 ? 602  PHE A CG  1 
ATOM 645   C CD1 . PHE A 1  602  ? 234.301 151.085 168.033 1.00 370.00 ? 602  PHE A CD1 1 
ATOM 646   C CD2 . PHE A 1  602  ? 234.776 150.768 170.351 1.00 370.00 ? 602  PHE A CD2 1 
ATOM 647   C CE1 . PHE A 1  602  ? 233.693 149.844 167.982 1.00 370.00 ? 602  PHE A CE1 1 
ATOM 648   C CE2 . PHE A 1  602  ? 234.171 149.526 170.308 1.00 370.00 ? 602  PHE A CE2 1 
ATOM 649   C CZ  . PHE A 1  602  ? 233.628 149.064 169.123 1.00 370.00 ? 602  PHE A CZ  1 
ATOM 650   N N   . PHE A 1  603  ? 237.529 155.222 168.458 1.00 370.00 ? 603  PHE A N   1 
ATOM 651   C CA  . PHE A 1  603  ? 238.095 156.571 168.498 1.00 370.00 ? 603  PHE A CA  1 
ATOM 652   C C   . PHE A 1  603  ? 239.258 156.591 167.517 1.00 370.00 ? 603  PHE A C   1 
ATOM 653   O O   . PHE A 1  603  ? 240.368 156.144 167.851 1.00 370.00 ? 603  PHE A O   1 
ATOM 654   C CB  . PHE A 1  603  ? 238.563 156.959 169.899 1.00 370.00 ? 603  PHE A CB  1 
ATOM 655   C CG  . PHE A 1  603  ? 237.451 157.244 170.868 1.00 370.00 ? 603  PHE A CG  1 
ATOM 656   C CD1 . PHE A 1  603  ? 236.142 157.408 170.447 1.00 370.00 ? 603  PHE A CD1 1 
ATOM 657   C CD2 . PHE A 1  603  ? 237.732 157.373 172.213 1.00 370.00 ? 603  PHE A CD2 1 
ATOM 658   C CE1 . PHE A 1  603  ? 235.138 157.675 171.360 1.00 370.00 ? 603  PHE A CE1 1 
ATOM 659   C CE2 . PHE A 1  603  ? 236.741 157.654 173.124 1.00 370.00 ? 603  PHE A CE2 1 
ATOM 660   C CZ  . PHE A 1  603  ? 235.441 157.794 172.700 1.00 370.00 ? 603  PHE A CZ  1 
ATOM 661   N N   . PRO A 1  604  ? 239.039 157.060 166.286 1.00 370.00 ? 604  PRO A N   1 
ATOM 662   C CA  . PRO A 1  604  ? 240.127 157.094 165.301 1.00 370.00 ? 604  PRO A CA  1 
ATOM 663   C C   . PRO A 1  604  ? 241.214 158.083 165.691 1.00 370.00 ? 604  PRO A C   1 
ATOM 664   O O   . PRO A 1  604  ? 240.950 159.148 166.252 1.00 370.00 ? 604  PRO A O   1 
ATOM 665   C CB  . PRO A 1  604  ? 239.420 157.520 164.010 1.00 370.00 ? 604  PRO A CB  1 
ATOM 666   C CG  . PRO A 1  604  ? 238.236 158.296 164.476 1.00 370.00 ? 604  PRO A CG  1 
ATOM 667   C CD  . PRO A 1  604  ? 237.795 157.649 165.761 1.00 370.00 ? 604  PRO A CD  1 
ATOM 668   N N   . THR A 1  605  ? 242.456 157.709 165.388 1.00 370.00 ? 605  THR A N   1 
ATOM 669   C CA  . THR A 1  605  ? 243.603 158.539 165.721 1.00 370.00 ? 605  THR A CA  1 
ATOM 670   C C   . THR A 1  605  ? 243.822 159.654 164.711 1.00 370.00 ? 605  THR A C   1 
ATOM 671   O O   . THR A 1  605  ? 244.173 160.773 165.098 1.00 370.00 ? 605  THR A O   1 
ATOM 672   C CB  . THR A 1  605  ? 244.865 157.678 165.803 1.00 370.00 ? 605  THR A CB  1 
ATOM 673   O OG1 . THR A 1  605  ? 245.124 157.094 164.520 1.00 370.00 ? 605  THR A OG1 1 
ATOM 674   C CG2 . THR A 1  605  ? 244.695 156.572 166.835 1.00 370.00 ? 605  THR A CG2 1 
ATOM 675   N N   . HIS A 1  606  ? 243.593 159.382 163.430 1.00 370.00 ? 606  HIS A N   1 
ATOM 676   C CA  . HIS A 1  606  ? 243.758 160.393 162.400 1.00 370.00 ? 606  HIS A CA  1 
ATOM 677   C C   . HIS A 1  606  ? 242.711 160.167 161.324 1.00 370.00 ? 606  HIS A C   1 
ATOM 678   O O   . HIS A 1  606  ? 242.381 159.025 160.994 1.00 370.00 ? 606  HIS A O   1 
ATOM 679   C CB  . HIS A 1  606  ? 245.165 160.362 161.792 1.00 370.00 ? 606  HIS A CB  1 
ATOM 680   C CG  . HIS A 1  606  ? 245.428 161.466 160.816 1.00 370.00 ? 606  HIS A CG  1 
ATOM 681   N ND1 . HIS A 1  606  ? 245.133 161.359 159.474 1.00 370.00 ? 606  HIS A ND1 1 
ATOM 682   C CD2 . HIS A 1  606  ? 245.956 162.701 160.988 1.00 370.00 ? 606  HIS A CD2 1 
ATOM 683   C CE1 . HIS A 1  606  ? 245.470 162.480 158.861 1.00 370.00 ? 606  HIS A CE1 1 
ATOM 684   N NE2 . HIS A 1  606  ? 245.971 163.311 159.756 1.00 370.00 ? 606  HIS A NE2 1 
ATOM 685   N N   . MET A 1  607  ? 242.194 161.268 160.785 1.00 370.00 ? 607  MET A N   1 
ATOM 686   C CA  . MET A 1  607  ? 241.170 161.240 159.752 1.00 370.00 ? 607  MET A CA  1 
ATOM 687   C C   . MET A 1  607  ? 241.614 162.151 158.620 1.00 370.00 ? 607  MET A C   1 
ATOM 688   O O   . MET A 1  607  ? 241.926 163.323 158.850 1.00 370.00 ? 607  MET A O   1 
ATOM 689   C CB  . MET A 1  607  ? 239.812 161.687 160.300 1.00 370.00 ? 607  MET A CB  1 
ATOM 690   C CG  . MET A 1  607  ? 239.208 160.737 161.318 1.00 370.00 ? 607  MET A CG  1 
ATOM 691   S SD  . MET A 1  607  ? 237.569 161.252 161.861 1.00 370.00 ? 607  MET A SD  1 
ATOM 692   C CE  . MET A 1  607  ? 237.974 162.648 162.909 1.00 370.00 ? 607  MET A CE  1 
ATOM 693   N N   . GLY A 1  608  ? 241.639 161.615 157.406 1.00 370.00 ? 608  GLY A N   1 
ATOM 694   C CA  . GLY A 1  608  ? 242.021 162.384 156.246 1.00 370.00 ? 608  GLY A CA  1 
ATOM 695   C C   . GLY A 1  608  ? 240.931 163.338 155.813 1.00 370.00 ? 608  GLY A C   1 
ATOM 696   O O   . GLY A 1  608  ? 239.847 163.417 156.412 1.00 370.00 ? 608  GLY A O   1 
ATOM 697   N N   . PRO A 1  609  ? 241.234 164.122 154.768 1.00 370.00 ? 609  PRO A N   1 
ATOM 698   C CA  . PRO A 1  609  ? 240.207 165.006 154.177 1.00 370.00 ? 609  PRO A CA  1 
ATOM 699   C C   . PRO A 1  609  ? 238.962 164.277 153.687 1.00 370.00 ? 609  PRO A C   1 
ATOM 700   O O   . PRO A 1  609  ? 237.850 164.808 153.799 1.00 370.00 ? 609  PRO A O   1 
ATOM 701   C CB  . PRO A 1  609  ? 240.968 165.685 153.028 1.00 370.00 ? 609  PRO A CB  1 
ATOM 702   C CG  . PRO A 1  609  ? 242.405 165.620 153.431 1.00 370.00 ? 609  PRO A CG  1 
ATOM 703   C CD  . PRO A 1  609  ? 242.553 164.310 154.140 1.00 370.00 ? 609  PRO A CD  1 
ATOM 704   N N   . ILE A 1  610  ? 239.133 163.081 153.118 1.00 370.00 ? 610  ILE A N   1 
ATOM 705   C CA  . ILE A 1  610  ? 237.998 162.243 152.734 1.00 370.00 ? 610  ILE A CA  1 
ATOM 706   C C   . ILE A 1  610  ? 237.209 161.815 153.969 1.00 370.00 ? 610  ILE A C   1 
ATOM 707   O O   . ILE A 1  610  ? 235.972 161.847 153.983 1.00 370.00 ? 610  ILE A O   1 
ATOM 708   C CB  . ILE A 1  610  ? 238.490 161.030 151.924 1.00 370.00 ? 610  ILE A CB  1 
ATOM 709   C CG1 . ILE A 1  610  ? 239.205 161.500 150.656 1.00 370.00 ? 610  ILE A CG1 1 
ATOM 710   C CG2 . ILE A 1  610  ? 237.339 160.102 151.563 1.00 370.00 ? 610  ILE A CG2 1 
ATOM 711   C CD1 . ILE A 1  610  ? 239.958 160.403 149.938 1.00 370.00 ? 610  ILE A CD1 1 
ATOM 712   N N   . LYS A 1  611  ? 237.920 161.405 155.026 1.00 370.00 ? 611  LYS A N   1 
ATOM 713   C CA  . LYS A 1  611  ? 237.268 160.948 156.252 1.00 370.00 ? 611  LYS A CA  1 
ATOM 714   C C   . LYS A 1  611  ? 236.564 162.081 156.992 1.00 370.00 ? 611  LYS A C   1 
ATOM 715   O O   . LYS A 1  611  ? 235.548 161.846 157.657 1.00 370.00 ? 611  LYS A O   1 
ATOM 716   C CB  . LYS A 1  611  ? 238.292 160.277 157.168 1.00 370.00 ? 611  LYS A CB  1 
ATOM 717   C CG  . LYS A 1  611  ? 238.927 159.024 156.585 1.00 370.00 ? 611  LYS A CG  1 
ATOM 718   C CD  . LYS A 1  611  ? 237.916 157.895 156.472 1.00 370.00 ? 611  LYS A CD  1 
ATOM 719   C CE  . LYS A 1  611  ? 238.564 156.619 155.961 1.00 370.00 ? 611  LYS A CE  1 
ATOM 720   N NZ  . LYS A 1  611  ? 237.575 155.517 155.809 1.00 370.00 ? 611  LYS A NZ  1 
ATOM 721   N N   . LEU A 1  612  ? 237.091 163.306 156.906 1.00 370.00 ? 612  LEU A N   1 
ATOM 722   C CA  . LEU A 1  612  ? 236.436 164.436 157.559 1.00 370.00 ? 612  LEU A CA  1 
ATOM 723   C C   . LEU A 1  612  ? 235.160 164.840 156.831 1.00 370.00 ? 612  LEU A C   1 
ATOM 724   O O   . LEU A 1  612  ? 234.199 165.294 157.462 1.00 370.00 ? 612  LEU A O   1 
ATOM 725   C CB  . LEU A 1  612  ? 237.398 165.617 157.665 1.00 370.00 ? 612  LEU A CB  1 
ATOM 726   C CG  . LEU A 1  612  ? 238.538 165.415 158.663 1.00 370.00 ? 612  LEU A CG  1 
ATOM 727   C CD1 . LEU A 1  612  ? 239.530 166.562 158.591 1.00 370.00 ? 612  LEU A CD1 1 
ATOM 728   C CD2 . LEU A 1  612  ? 237.990 165.250 160.073 1.00 370.00 ? 612  LEU A CD2 1 
ATOM 729   N N   . ARG A 1  613  ? 235.141 164.711 155.502 1.00 370.00 ? 613  ARG A N   1 
ATOM 730   C CA  . ARG A 1  613  ? 233.902 164.930 154.760 1.00 370.00 ? 613  ARG A CA  1 
ATOM 731   C C   . ARG A 1  613  ? 232.898 163.820 155.041 1.00 370.00 ? 613  ARG A C   1 
ATOM 732   O O   . ARG A 1  613  ? 231.685 164.059 155.084 1.00 370.00 ? 613  ARG A O   1 
ATOM 733   C CB  . ARG A 1  613  ? 234.197 165.024 153.262 1.00 370.00 ? 613  ARG A CB  1 
ATOM 734   C CG  . ARG A 1  613  ? 235.030 166.232 152.862 1.00 370.00 ? 613  ARG A CG  1 
ATOM 735   C CD  . ARG A 1  613  ? 235.295 166.243 151.364 1.00 370.00 ? 613  ARG A CD  1 
ATOM 736   N NE  . ARG A 1  613  ? 236.149 167.356 150.957 1.00 370.00 ? 613  ARG A NE  1 
ATOM 737   C CZ  . ARG A 1  613  ? 237.474 167.286 150.883 1.00 370.00 ? 613  ARG A CZ  1 
ATOM 738   N NH1 . ARG A 1  613  ? 238.096 166.156 151.190 1.00 370.00 ? 613  ARG A NH1 1 
ATOM 739   N NH2 . ARG A 1  613  ? 238.180 168.341 150.501 1.00 370.00 ? 613  ARG A NH2 1 
ATOM 740   N N   . GLN A 1  614  ? 233.390 162.596 155.238 1.00 370.00 ? 614  GLN A N   1 
ATOM 741   C CA  . GLN A 1  614  ? 232.573 161.430 155.537 1.00 370.00 ? 614  GLN A CA  1 
ATOM 742   C C   . GLN A 1  614  ? 232.431 161.182 157.036 1.00 370.00 ? 614  GLN A C   1 
ATOM 743   O O   . GLN A 1  614  ? 232.141 160.050 157.442 1.00 370.00 ? 614  GLN A O   1 
ATOM 744   C CB  . GLN A 1  614  ? 233.167 160.198 154.851 1.00 370.00 ? 614  GLN A CB  1 
ATOM 745   C CG  . GLN A 1  614  ? 233.097 160.246 153.334 1.00 370.00 ? 614  GLN A CG  1 
ATOM 746   C CD  . GLN A 1  614  ? 233.848 159.104 152.680 1.00 370.00 ? 614  GLN A CD  1 
ATOM 747   O OE1 . GLN A 1  614  ? 234.519 158.322 153.353 1.00 370.00 ? 614  GLN A OE1 1 
ATOM 748   N NE2 . GLN A 1  614  ? 233.740 159.003 151.360 1.00 370.00 ? 614  GLN A NE2 1 
ATOM 749   N N   . PHE A 1  615  ? 232.656 162.208 157.857 1.00 370.00 ? 615  PHE A N   1 
ATOM 750   C CA  . PHE A 1  615  ? 232.569 162.093 159.309 1.00 370.00 ? 615  PHE A CA  1 
ATOM 751   C C   . PHE A 1  615  ? 231.129 161.835 159.748 1.00 370.00 ? 615  PHE A C   1 
ATOM 752   O O   . PHE A 1  615  ? 230.232 162.632 159.458 1.00 370.00 ? 615  PHE A O   1 
ATOM 753   C CB  . PHE A 1  615  ? 233.126 163.371 159.936 1.00 370.00 ? 615  PHE A CB  1 
ATOM 754   C CG  . PHE A 1  615  ? 233.127 163.380 161.432 1.00 370.00 ? 615  PHE A CG  1 
ATOM 755   C CD1 . PHE A 1  615  ? 233.929 162.502 162.145 1.00 370.00 ? 615  PHE A CD1 1 
ATOM 756   C CD2 . PHE A 1  615  ? 232.387 164.326 162.126 1.00 370.00 ? 615  PHE A CD2 1 
ATOM 757   C CE1 . PHE A 1  615  ? 233.943 162.523 163.529 1.00 370.00 ? 615  PHE A CE1 1 
ATOM 758   C CE2 . PHE A 1  615  ? 232.410 164.369 163.506 1.00 370.00 ? 615  PHE A CE2 1 
ATOM 759   C CZ  . PHE A 1  615  ? 233.182 163.460 164.209 1.00 370.00 ? 615  PHE A CZ  1 
ATOM 760   N N   . HIS A 1  616  ? 230.925 160.696 160.422 1.00 370.00 ? 616  HIS A N   1 
ATOM 761   C CA  . HIS A 1  616  ? 229.643 160.103 160.813 1.00 370.00 ? 616  HIS A CA  1 
ATOM 762   C C   . HIS A 1  616  ? 228.740 159.759 159.634 1.00 370.00 ? 616  HIS A C   1 
ATOM 763   O O   . HIS A 1  616  ? 227.535 159.543 159.825 1.00 370.00 ? 616  HIS A O   1 
ATOM 764   C CB  . HIS A 1  616  ? 228.873 160.962 161.823 1.00 370.00 ? 616  HIS A CB  1 
ATOM 765   C CG  . HIS A 1  616  ? 229.487 160.965 163.184 1.00 370.00 ? 616  HIS A CG  1 
ATOM 766   N ND1 . HIS A 1  616  ? 229.471 159.859 164.004 1.00 370.00 ? 616  HIS A ND1 1 
ATOM 767   C CD2 . HIS A 1  616  ? 230.115 161.940 163.879 1.00 370.00 ? 616  HIS A CD2 1 
ATOM 768   C CE1 . HIS A 1  616  ? 230.089 160.143 165.134 1.00 370.00 ? 616  HIS A CE1 1 
ATOM 769   N NE2 . HIS A 1  616  ? 230.488 161.401 165.085 1.00 370.00 ? 616  HIS A NE2 1 
ATOM 770   N N   . ARG A 1  617  ? 229.282 159.682 158.422 1.00 370.00 ? 617  ARG A N   1 
ATOM 771   C CA  . ARG A 1  617  ? 228.582 159.112 157.272 1.00 370.00 ? 617  ARG A CA  1 
ATOM 772   C C   . ARG A 1  617  ? 229.503 158.116 156.569 1.00 370.00 ? 617  ARG A C   1 
ATOM 773   O O   . ARG A 1  617  ? 230.060 158.414 155.505 1.00 370.00 ? 617  ARG A O   1 
ATOM 774   C CB  . ARG A 1  617  ? 228.112 160.211 156.316 1.00 370.00 ? 617  ARG A CB  1 
ATOM 775   C CG  . ARG A 1  617  ? 226.954 161.046 156.854 1.00 370.00 ? 617  ARG A CG  1 
ATOM 776   C CD  . ARG A 1  617  ? 226.511 162.104 155.859 1.00 370.00 ? 617  ARG A CD  1 
ATOM 777   N NE  . ARG A 1  617  ? 225.369 162.865 156.352 1.00 370.00 ? 617  ARG A NE  1 
ATOM 778   C CZ  . ARG A 1  617  ? 225.472 163.966 157.088 1.00 370.00 ? 617  ARG A CZ  1 
ATOM 779   N NH1 . ARG A 1  617  ? 226.669 164.430 157.420 1.00 370.00 ? 617  ARG A NH1 1 
ATOM 780   N NH2 . ARG A 1  617  ? 224.381 164.600 157.495 1.00 370.00 ? 617  ARG A NH2 1 
ATOM 781   N N   . PRO A 1  618  ? 229.697 156.926 157.146 1.00 370.00 ? 618  PRO A N   1 
ATOM 782   C CA  . PRO A 1  618  ? 230.641 155.965 156.561 1.00 370.00 ? 618  PRO A CA  1 
ATOM 783   C C   . PRO A 1  618  ? 230.080 155.326 155.303 1.00 370.00 ? 618  PRO A C   1 
ATOM 784   O O   . PRO A 1  618  ? 228.969 154.773 155.307 1.00 370.00 ? 618  PRO A O   1 
ATOM 785   C CB  . PRO A 1  618  ? 230.837 154.932 157.681 1.00 370.00 ? 618  PRO A CB  1 
ATOM 786   C CG  . PRO A 1  618  ? 229.581 154.985 158.464 1.00 370.00 ? 618  PRO A CG  1 
ATOM 787   C CD  . PRO A 1  618  ? 229.107 156.410 158.399 1.00 370.00 ? 618  PRO A CD  1 
ATOM 788   N N   . PRO A 1  619  ? 230.814 155.389 154.197 1.00 370.00 ? 619  PRO A N   1 
ATOM 789   C CA  . PRO A 1  619  ? 230.327 154.784 152.958 1.00 370.00 ? 619  PRO A CA  1 
ATOM 790   C C   . PRO A 1  619  ? 230.534 153.281 152.957 1.00 370.00 ? 619  PRO A C   1 
ATOM 791   O O   . PRO A 1  619  ? 231.472 152.753 153.559 1.00 370.00 ? 619  PRO A O   1 
ATOM 792   C CB  . PRO A 1  619  ? 231.182 155.459 151.880 1.00 370.00 ? 619  PRO A CB  1 
ATOM 793   C CG  . PRO A 1  619  ? 232.455 155.769 152.576 1.00 370.00 ? 619  PRO A CG  1 
ATOM 794   C CD  . PRO A 1  619  ? 232.090 156.099 154.000 1.00 370.00 ? 619  PRO A CD  1 
ATOM 795   N N   . LEU A 1  620  ? 229.612 152.592 152.293 1.00 370.00 ? 620  LEU A N   1 
ATOM 796   C CA  . LEU A 1  620  ? 229.680 151.141 152.190 1.00 370.00 ? 620  LEU A CA  1 
ATOM 797   C C   . LEU A 1  620  ? 230.866 150.723 151.330 1.00 370.00 ? 620  LEU A C   1 
ATOM 798   O O   . LEU A 1  620  ? 230.921 151.037 150.138 1.00 370.00 ? 620  LEU A O   1 
ATOM 799   C CB  . LEU A 1  620  ? 228.372 150.605 151.612 1.00 370.00 ? 620  LEU A CB  1 
ATOM 800   C CG  . LEU A 1  620  ? 228.222 149.090 151.658 1.00 370.00 ? 620  LEU A CG  1 
ATOM 801   C CD1 . LEU A 1  620  ? 228.227 148.622 153.105 1.00 370.00 ? 620  LEU A CD1 1 
ATOM 802   C CD2 . LEU A 1  620  ? 226.946 148.677 150.955 1.00 370.00 ? 620  LEU A CD2 1 
ATOM 803   N N   . LYS A 1  621  ? 231.813 150.013 151.942 1.00 370.00 ? 621  LYS A N   1 
ATOM 804   C CA  . LYS A 1  621  ? 233.101 149.715 151.331 1.00 370.00 ? 621  LYS A CA  1 
ATOM 805   C C   . LYS A 1  621  ? 233.280 148.210 151.181 1.00 370.00 ? 621  LYS A C   1 
ATOM 806   O O   . LYS A 1  621  ? 232.923 147.439 152.079 1.00 370.00 ? 621  LYS A O   1 
ATOM 807   C CB  . LYS A 1  621  ? 234.243 150.309 152.168 1.00 370.00 ? 621  LYS A CB  1 
ATOM 808   C CG  . LYS A 1  621  ? 235.622 150.190 151.541 1.00 370.00 ? 621  LYS A CG  1 
ATOM 809   C CD  . LYS A 1  621  ? 236.658 150.944 152.354 1.00 370.00 ? 621  LYS A CD  1 
ATOM 810   C CE  . LYS A 1  621  ? 238.054 150.711 151.808 1.00 370.00 ? 621  LYS A CE  1 
ATOM 811   N NZ  . LYS A 1  621  ? 238.206 151.282 150.443 1.00 370.00 ? 621  LYS A NZ  1 
ATOM 812   N N   . LYS A 1  622  ? 233.827 147.801 150.039 1.00 370.00 ? 622  LYS A N   1 
ATOM 813   C CA  . LYS A 1  622  ? 234.058 146.390 149.756 1.00 370.00 ? 622  LYS A CA  1 
ATOM 814   C C   . LYS A 1  622  ? 235.183 145.828 150.621 1.00 370.00 ? 622  LYS A C   1 
ATOM 815   O O   . LYS A 1  622  ? 236.139 146.531 150.960 1.00 370.00 ? 622  LYS A O   1 
ATOM 816   C CB  . LYS A 1  622  ? 234.398 146.210 148.279 1.00 370.00 ? 622  LYS A CB  1 
ATOM 817   C CG  . LYS A 1  622  ? 233.259 146.542 147.334 1.00 370.00 ? 622  LYS A CG  1 
ATOM 818   C CD  . LYS A 1  622  ? 233.655 146.276 145.894 1.00 370.00 ? 622  LYS A CD  1 
ATOM 819   C CE  . LYS A 1  622  ? 234.611 147.344 145.384 1.00 370.00 ? 622  LYS A CE  1 
ATOM 820   N NZ  . LYS A 1  622  ? 234.890 147.173 143.933 1.00 370.00 ? 622  LYS A NZ  1 
ATOM 821   N N   . TYR A 1  623  ? 235.061 144.552 150.980 1.00 370.00 ? 623  TYR A N   1 
ATOM 822   C CA  . TYR A 1  623  ? 236.129 143.848 151.679 1.00 370.00 ? 623  TYR A CA  1 
ATOM 823   C C   . TYR A 1  623  ? 237.133 143.271 150.689 1.00 370.00 ? 623  TYR A C   1 
ATOM 824   O O   . TYR A 1  623  ? 236.796 142.982 149.537 1.00 370.00 ? 623  TYR A O   1 
ATOM 825   C CB  . TYR A 1  623  ? 235.565 142.723 152.549 1.00 370.00 ? 623  TYR A CB  1 
ATOM 826   C CG  . TYR A 1  623  ? 234.795 143.182 153.765 1.00 370.00 ? 623  TYR A CG  1 
ATOM 827   C CD1 . TYR A 1  623  ? 235.460 143.635 154.895 1.00 370.00 ? 623  TYR A CD1 1 
ATOM 828   C CD2 . TYR A 1  623  ? 233.408 143.137 153.795 1.00 370.00 ? 623  TYR A CD2 1 
ATOM 829   C CE1 . TYR A 1  623  ? 234.764 144.048 156.019 1.00 370.00 ? 623  TYR A CE1 1 
ATOM 830   C CE2 . TYR A 1  623  ? 232.703 143.545 154.918 1.00 370.00 ? 623  TYR A CE2 1 
ATOM 831   C CZ  . TYR A 1  623  ? 233.390 144.002 156.022 1.00 370.00 ? 623  TYR A CZ  1 
ATOM 832   O OH  . TYR A 1  623  ? 232.703 144.413 157.142 1.00 370.00 ? 623  TYR A OH  1 
ATOM 833   N N   . SER A 1  624  ? 238.379 143.112 151.143 1.00 370.00 ? 624  SER A N   1 
ATOM 834   C CA  . SER A 1  624  ? 239.400 142.438 150.350 1.00 370.00 ? 624  SER A CA  1 
ATOM 835   C C   . SER A 1  624  ? 239.468 140.941 150.617 1.00 370.00 ? 624  SER A C   1 
ATOM 836   O O   . SER A 1  624  ? 240.014 140.203 149.790 1.00 370.00 ? 624  SER A O   1 
ATOM 837   C CB  . SER A 1  624  ? 240.778 143.056 150.608 1.00 370.00 ? 624  SER A CB  1 
ATOM 838   O OG  . SER A 1  624  ? 240.834 144.395 150.151 1.00 370.00 ? 624  SER A OG  1 
ATOM 839   N N   . PHE A 1  625  ? 238.931 140.479 151.744 1.00 370.00 ? 625  PHE A N   1 
ATOM 840   C CA  . PHE A 1  625  ? 238.897 139.061 152.068 1.00 370.00 ? 625  PHE A CA  1 
ATOM 841   C C   . PHE A 1  625  ? 237.656 138.801 152.910 1.00 370.00 ? 625  PHE A C   1 
ATOM 842   O O   . PHE A 1  625  ? 236.950 139.728 153.314 1.00 370.00 ? 625  PHE A O   1 
ATOM 843   C CB  . PHE A 1  625  ? 240.186 138.604 152.775 1.00 370.00 ? 625  PHE A CB  1 
ATOM 844   C CG  . PHE A 1  625  ? 240.437 139.268 154.107 1.00 370.00 ? 625  PHE A CG  1 
ATOM 845   C CD1 . PHE A 1  625  ? 241.108 140.480 154.173 1.00 370.00 ? 625  PHE A CD1 1 
ATOM 846   C CD2 . PHE A 1  625  ? 240.051 138.656 155.293 1.00 370.00 ? 625  PHE A CD2 1 
ATOM 847   C CE1 . PHE A 1  625  ? 241.353 141.090 155.390 1.00 370.00 ? 625  PHE A CE1 1 
ATOM 848   C CE2 . PHE A 1  625  ? 240.297 139.261 156.515 1.00 370.00 ? 625  PHE A CE2 1 
ATOM 849   C CZ  . PHE A 1  625  ? 240.953 140.477 156.562 1.00 370.00 ? 625  PHE A CZ  1 
ATOM 850   N N   . GLY A 1  626  ? 237.389 137.524 153.165 1.00 370.00 ? 626  GLY A N   1 
ATOM 851   C CA  . GLY A 1  626  ? 236.194 137.128 153.876 1.00 370.00 ? 626  GLY A CA  1 
ATOM 852   C C   . GLY A 1  626  ? 235.097 136.619 152.955 1.00 370.00 ? 626  GLY A C   1 
ATOM 853   O O   . GLY A 1  626  ? 235.248 136.524 151.735 1.00 370.00 ? 626  GLY A O   1 
ATOM 854   N N   . ALA A 1  627  ? 233.978 136.243 153.584 1.00 370.00 ? 627  ALA A N   1 
ATOM 855   C CA  . ALA A 1  627  ? 232.834 135.699 152.855 1.00 370.00 ? 627  ALA A CA  1 
ATOM 856   C C   . ALA A 1  627  ? 232.208 136.726 151.919 1.00 370.00 ? 627  ALA A C   1 
ATOM 857   O O   . ALA A 1  627  ? 231.889 136.414 150.767 1.00 370.00 ? 627  ALA A O   1 
ATOM 858   C CB  . ALA A 1  627  ? 231.792 135.172 153.842 1.00 370.00 ? 627  ALA A CB  1 
ATOM 859   N N   . LEU A 1  628  ? 232.025 137.958 152.394 1.00 370.00 ? 628  LEU A N   1 
ATOM 860   C CA  . LEU A 1  628  ? 231.384 139.014 151.615 1.00 370.00 ? 628  LEU A CA  1 
ATOM 861   C C   . LEU A 1  628  ? 232.336 139.752 150.685 1.00 370.00 ? 628  LEU A C   1 
ATOM 862   O O   . LEU A 1  628  ? 231.929 140.747 150.076 1.00 370.00 ? 628  LEU A O   1 
ATOM 863   C CB  . LEU A 1  628  ? 230.689 140.013 152.546 1.00 370.00 ? 628  LEU A CB  1 
ATOM 864   C CG  . LEU A 1  628  ? 229.195 139.800 152.803 1.00 370.00 ? 628  LEU A CG  1 
ATOM 865   C CD1 . LEU A 1  628  ? 228.901 138.494 153.499 1.00 370.00 ? 628  LEU A CD1 1 
ATOM 866   C CD2 . LEU A 1  628  ? 228.663 140.961 153.626 1.00 370.00 ? 628  LEU A CD2 1 
ATOM 867   N N   . SER A 1  629  ? 233.584 139.302 150.561 1.00 370.00 ? 629  SER A N   1 
ATOM 868   C CA  . SER A 1  629  ? 234.453 139.802 149.506 1.00 370.00 ? 629  SER A CA  1 
ATOM 869   C C   . SER A 1  629  ? 234.218 139.094 148.179 1.00 370.00 ? 629  SER A C   1 
ATOM 870   O O   . SER A 1  629  ? 234.737 139.545 147.152 1.00 370.00 ? 629  SER A O   1 
ATOM 871   C CB  . SER A 1  629  ? 235.919 139.655 149.913 1.00 370.00 ? 629  SER A CB  1 
ATOM 872   O OG  . SER A 1  629  ? 236.281 138.290 150.037 1.00 370.00 ? 629  SER A OG  1 
ATOM 873   N N   . GLN A 1  630  ? 233.443 137.993 148.178 1.00 370.00 ? 630  GLN A N   1 
ATOM 874   C CA  . GLN A 1  630  ? 233.074 137.156 147.049 1.00 370.00 ? 630  GLN A CA  1 
ATOM 875   C C   . GLN A 1  630  ? 231.839 137.714 146.345 1.00 370.00 ? 630  GLN A C   1 
ATOM 876   O O   . GLN A 1  630  ? 230.959 138.294 146.989 1.00 370.00 ? 630  GLN A O   1 
ATOM 877   C CB  . GLN A 1  630  ? 232.791 135.732 147.520 1.00 370.00 ? 630  GLN A CB  1 
ATOM 878   C CG  . GLN A 1  630  ? 233.969 135.048 148.195 1.00 370.00 ? 630  GLN A CG  1 
ATOM 879   C CD  . GLN A 1  630  ? 235.121 134.792 147.247 1.00 370.00 ? 630  GLN A CD  1 
ATOM 880   O OE1 . GLN A 1  630  ? 234.919 134.449 146.083 1.00 370.00 ? 630  GLN A OE1 1 
ATOM 881   N NE2 . GLN A 1  630  ? 236.342 134.955 147.745 1.00 370.00 ? 630  GLN A NE2 1 
ATOM 882   N N   . PRO A 1  631  ? 231.743 137.555 145.029 1.00 370.00 ? 631  PRO A N   1 
ATOM 883   C CA  . PRO A 1  631  ? 230.551 138.010 144.308 1.00 370.00 ? 631  PRO A CA  1 
ATOM 884   C C   . PRO A 1  631  ? 229.367 137.075 144.537 1.00 370.00 ? 631  PRO A C   1 
ATOM 885   O O   . PRO A 1  631  ? 229.490 135.981 145.087 1.00 370.00 ? 631  PRO A O   1 
ATOM 886   C CB  . PRO A 1  631  ? 230.988 137.984 142.838 1.00 370.00 ? 631  PRO A CB  1 
ATOM 887   C CG  . PRO A 1  631  ? 232.477 138.020 142.876 1.00 370.00 ? 631  PRO A CG  1 
ATOM 888   C CD  . PRO A 1  631  ? 232.853 137.254 144.109 1.00 370.00 ? 631  PRO A CD  1 
ATOM 889   N N   . GLY A 1  632  ? 228.201 137.537 144.089 1.00 370.00 ? 632  GLY A N   1 
ATOM 890   C CA  . GLY A 1  632  ? 226.986 136.761 144.161 1.00 370.00 ? 632  GLY A CA  1 
ATOM 891   C C   . GLY A 1  632  ? 226.134 137.102 145.367 1.00 370.00 ? 632  GLY A C   1 
ATOM 892   O O   . GLY A 1  632  ? 226.480 137.969 146.175 1.00 370.00 ? 632  GLY A O   1 
ATOM 893   N N   . PRO A 1  633  ? 224.989 136.432 145.501 1.00 370.00 ? 633  PRO A N   1 
ATOM 894   C CA  . PRO A 1  633  ? 224.118 136.683 146.654 1.00 370.00 ? 633  PRO A CA  1 
ATOM 895   C C   . PRO A 1  633  ? 224.685 136.089 147.934 1.00 370.00 ? 633  PRO A C   1 
ATOM 896   O O   . PRO A 1  633  ? 225.408 135.090 147.919 1.00 370.00 ? 633  PRO A O   1 
ATOM 897   C CB  . PRO A 1  633  ? 222.803 135.999 146.261 1.00 370.00 ? 633  PRO A CB  1 
ATOM 898   C CG  . PRO A 1  633  ? 223.217 134.923 145.317 1.00 370.00 ? 633  PRO A CG  1 
ATOM 899   C CD  . PRO A 1  633  ? 224.386 135.479 144.552 1.00 370.00 ? 633  PRO A CD  1 
ATOM 900   N N   . HIS A 1  634  ? 224.344 136.724 149.052 1.00 370.00 ? 634  HIS A N   1 
ATOM 901   C CA  . HIS A 1  634  ? 224.804 136.307 150.368 1.00 370.00 ? 634  HIS A CA  1 
ATOM 902   C C   . HIS A 1  634  ? 223.619 136.212 151.318 1.00 370.00 ? 634  HIS A C   1 
ATOM 903   O O   . HIS A 1  634  ? 222.675 137.004 151.228 1.00 370.00 ? 634  HIS A O   1 
ATOM 904   C CB  . HIS A 1  634  ? 225.858 137.272 150.916 1.00 370.00 ? 634  HIS A CB  1 
ATOM 905   C CG  . HIS A 1  634  ? 227.130 137.280 150.127 1.00 370.00 ? 634  HIS A CG  1 
ATOM 906   N ND1 . HIS A 1  634  ? 228.060 136.268 150.208 1.00 370.00 ? 634  HIS A ND1 1 
ATOM 907   C CD2 . HIS A 1  634  ? 227.619 138.170 149.231 1.00 370.00 ? 634  HIS A CD2 1 
ATOM 908   C CE1 . HIS A 1  634  ? 229.071 136.535 149.402 1.00 370.00 ? 634  HIS A CE1 1 
ATOM 909   N NE2 . HIS A 1  634  ? 228.829 137.684 148.797 1.00 370.00 ? 634  HIS A NE2 1 
ATOM 910   N N   . SER A 1  635  ? 223.669 135.220 152.208 1.00 370.00 ? 635  SER A N   1 
ATOM 911   C CA  . SER A 1  635  ? 222.564 134.941 153.119 1.00 370.00 ? 635  SER A CA  1 
ATOM 912   C C   . SER A 1  635  ? 222.382 136.053 154.146 1.00 370.00 ? 635  SER A C   1 
ATOM 913   O O   . SER A 1  635  ? 223.353 136.596 154.680 1.00 370.00 ? 635  SER A O   1 
ATOM 914   C CB  . SER A 1  635  ? 222.803 133.608 153.830 1.00 370.00 ? 635  SER A CB  1 
ATOM 915   O OG  . SER A 1  635  ? 222.818 132.531 152.909 1.00 370.00 ? 635  SER A OG  1 
ATOM 916   N N   . VAL A 1  636  ? 221.123 136.386 154.423 1.00 370.00 ? 636  VAL A N   1 
ATOM 917   C CA  . VAL A 1  636  ? 220.761 137.387 155.422 1.00 370.00 ? 636  VAL A CA  1 
ATOM 918   C C   . VAL A 1  636  ? 220.074 136.668 156.579 1.00 370.00 ? 636  VAL A C   1 
ATOM 919   O O   . VAL A 1  636  ? 218.929 136.221 156.447 1.00 370.00 ? 636  VAL A O   1 
ATOM 920   C CB  . VAL A 1  636  ? 219.850 138.467 154.819 1.00 370.00 ? 636  VAL A CB  1 
ATOM 921   C CG1 . VAL A 1  636  ? 219.529 139.535 155.850 1.00 370.00 ? 636  VAL A CG1 1 
ATOM 922   C CG2 . VAL A 1  636  ? 220.484 139.068 153.569 1.00 370.00 ? 636  VAL A CG2 1 
ATOM 923   N N   . GLN A 1  637  ? 220.749 136.594 157.727 1.00 370.00 ? 637  GLN A N   1 
ATOM 924   C CA  . GLN A 1  637  ? 220.370 135.636 158.763 1.00 370.00 ? 637  GLN A CA  1 
ATOM 925   C C   . GLN A 1  637  ? 219.519 136.276 159.861 1.00 370.00 ? 637  GLN A C   1 
ATOM 926   O O   . GLN A 1  637  ? 219.710 137.452 160.188 1.00 370.00 ? 637  GLN A O   1 
ATOM 927   C CB  . GLN A 1  637  ? 221.625 135.015 159.380 1.00 370.00 ? 637  GLN A CB  1 
ATOM 928   C CG  . GLN A 1  637  ? 222.403 134.156 158.395 1.00 370.00 ? 637  GLN A CG  1 
ATOM 929   C CD  . GLN A 1  637  ? 223.669 133.568 158.985 1.00 370.00 ? 637  GLN A CD  1 
ATOM 930   O OE1 . GLN A 1  637  ? 224.011 133.824 160.139 1.00 370.00 ? 637  GLN A OE1 1 
ATOM 931   N NE2 . GLN A 1  637  ? 224.378 132.778 158.187 1.00 370.00 ? 637  GLN A NE2 1 
ATOM 932   N N   . PRO A 1  638  ? 218.576 135.527 160.438 1.00 370.00 ? 638  PRO A N   1 
ATOM 933   C CA  . PRO A 1  638  ? 217.753 136.067 161.527 1.00 370.00 ? 638  PRO A CA  1 
ATOM 934   C C   . PRO A 1  638  ? 218.490 136.103 162.858 1.00 370.00 ? 638  PRO A C   1 
ATOM 935   O O   . PRO A 1  638  ? 219.493 135.416 163.065 1.00 370.00 ? 638  PRO A O   1 
ATOM 936   C CB  . PRO A 1  638  ? 216.571 135.091 161.587 1.00 370.00 ? 638  PRO A CB  1 
ATOM 937   C CG  . PRO A 1  638  ? 217.133 133.808 161.088 1.00 370.00 ? 638  PRO A CG  1 
ATOM 938   C CD  . PRO A 1  638  ? 218.126 134.183 160.025 1.00 370.00 ? 638  PRO A CD  1 
ATOM 939   N N   . LEU A 1  639  ? 217.973 136.932 163.772 1.00 370.00 ? 639  LEU A N   1 
ATOM 940   C CA  . LEU A 1  639  ? 218.608 137.171 165.063 1.00 370.00 ? 639  LEU A CA  1 
ATOM 941   C C   . LEU A 1  639  ? 217.755 136.806 166.269 1.00 370.00 ? 639  LEU A C   1 
ATOM 942   O O   . LEU A 1  639  ? 218.234 136.969 167.397 1.00 370.00 ? 639  LEU A O   1 
ATOM 943   C CB  . LEU A 1  639  ? 219.016 138.645 165.209 1.00 370.00 ? 639  LEU A CB  1 
ATOM 944   C CG  . LEU A 1  639  ? 220.398 139.131 164.771 1.00 370.00 ? 639  LEU A CG  1 
ATOM 945   C CD1 . LEU A 1  639  ? 221.477 138.436 165.580 1.00 370.00 ? 639  LEU A CD1 1 
ATOM 946   C CD2 . LEU A 1  639  ? 220.620 138.924 163.300 1.00 370.00 ? 639  LEU A CD2 1 
ATOM 947   N N   . LEU A 1  640  ? 216.521 136.327 166.062 1.00 370.00 ? 640  LEU A N   1 
ATOM 948   C CA  . LEU A 1  640  ? 215.521 136.229 167.129 1.00 370.00 ? 640  LEU A CA  1 
ATOM 949   C C   . LEU A 1  640  ? 215.951 135.288 168.252 1.00 370.00 ? 640  LEU A C   1 
ATOM 950   O O   . LEU A 1  640  ? 215.720 135.568 169.434 1.00 370.00 ? 640  LEU A O   1 
ATOM 951   C CB  . LEU A 1  640  ? 214.183 135.783 166.538 1.00 370.00 ? 640  LEU A CB  1 
ATOM 952   C CG  . LEU A 1  640  ? 213.012 135.744 167.519 1.00 370.00 ? 640  LEU A CG  1 
ATOM 953   C CD1 . LEU A 1  640  ? 212.747 137.132 168.084 1.00 370.00 ? 640  LEU A CD1 1 
ATOM 954   C CD2 . LEU A 1  640  ? 211.770 135.193 166.847 1.00 370.00 ? 640  LEU A CD2 1 
ATOM 955   N N   . LYS A 1  641  ? 216.568 134.160 167.897 1.00 370.00 ? 641  LYS A N   1 
ATOM 956   C CA  . LYS A 1  641  ? 217.100 133.255 168.913 1.00 370.00 ? 641  LYS A CA  1 
ATOM 957   C C   . LYS A 1  641  ? 218.285 133.874 169.647 1.00 370.00 ? 641  LYS A C   1 
ATOM 958   O O   . LYS A 1  641  ? 218.468 133.646 170.850 1.00 370.00 ? 641  LYS A O   1 
ATOM 959   C CB  . LYS A 1  641  ? 217.493 131.924 168.273 1.00 370.00 ? 641  LYS A CB  1 
ATOM 960   C CG  . LYS A 1  641  ? 216.318 131.130 167.725 1.00 370.00 ? 641  LYS A CG  1 
ATOM 961   C CD  . LYS A 1  641  ? 216.766 129.780 167.189 1.00 370.00 ? 641  LYS A CD  1 
ATOM 962   C CE  . LYS A 1  641  ? 215.610 129.031 166.548 1.00 370.00 ? 641  LYS A CE  1 
ATOM 963   N NZ  . LYS A 1  641  ? 214.571 128.646 167.542 1.00 370.00 ? 641  LYS A NZ  1 
ATOM 964   N N   . HIS A 1  642  ? 219.111 134.648 168.936 1.00 370.00 ? 642  HIS A N   1 
ATOM 965   C CA  . HIS A 1  642  ? 220.293 135.249 169.550 1.00 370.00 ? 642  HIS A CA  1 
ATOM 966   C C   . HIS A 1  642  ? 219.920 136.377 170.509 1.00 370.00 ? 642  HIS A C   1 
ATOM 967   O O   . HIS A 1  642  ? 220.587 136.573 171.532 1.00 370.00 ? 642  HIS A O   1 
ATOM 968   C CB  . HIS A 1  642  ? 221.243 135.758 168.464 1.00 370.00 ? 642  HIS A CB  1 
ATOM 969   C CG  . HIS A 1  642  ? 222.511 136.348 168.998 1.00 370.00 ? 642  HIS A CG  1 
ATOM 970   N ND1 . HIS A 1  642  ? 223.527 135.578 169.522 1.00 370.00 ? 642  HIS A ND1 1 
ATOM 971   C CD2 . HIS A 1  642  ? 222.927 137.633 169.090 1.00 370.00 ? 642  HIS A CD2 1 
ATOM 972   C CE1 . HIS A 1  642  ? 224.515 136.364 169.913 1.00 370.00 ? 642  HIS A CE1 1 
ATOM 973   N NE2 . HIS A 1  642  ? 224.176 137.616 169.662 1.00 370.00 ? 642  HIS A NE2 1 
ATOM 974   N N   . ILE A 1  643  ? 218.877 137.145 170.175 1.00 370.00 ? 643  ILE A N   1 
ATOM 975   C CA  . ILE A 1  643  ? 218.426 138.247 171.029 1.00 370.00 ? 643  ILE A CA  1 
ATOM 976   C C   . ILE A 1  643  ? 217.881 137.713 172.348 1.00 370.00 ? 643  ILE A C   1 
ATOM 977   O O   . ILE A 1  643  ? 218.207 138.223 173.429 1.00 370.00 ? 643  ILE A O   1 
ATOM 978   C CB  . ILE A 1  643  ? 217.371 139.091 170.289 1.00 370.00 ? 643  ILE A CB  1 
ATOM 979   C CG1 . ILE A 1  643  ? 217.971 139.738 169.043 1.00 370.00 ? 643  ILE A CG1 1 
ATOM 980   C CG2 . ILE A 1  643  ? 216.789 140.165 171.201 1.00 370.00 ? 643  ILE A CG2 1 
ATOM 981   C CD1 . ILE A 1  643  ? 216.931 140.191 168.047 1.00 370.00 ? 643  ILE A CD1 1 
ATOM 982   N N   . LYS A 1  644  ? 217.035 136.682 172.271 1.00 370.00 ? 644  LYS A N   1 
ATOM 983   C CA  . LYS A 1  644  ? 216.420 136.101 173.464 1.00 370.00 ? 644  LYS A CA  1 
ATOM 984   C C   . LYS A 1  644  ? 217.459 135.438 174.361 1.00 370.00 ? 644  LYS A C   1 
ATOM 985   O O   . LYS A 1  644  ? 217.352 135.487 175.591 1.00 370.00 ? 644  LYS A O   1 
ATOM 986   C CB  . LYS A 1  644  ? 215.340 135.099 173.057 1.00 370.00 ? 644  LYS A CB  1 
ATOM 987   C CG  . LYS A 1  644  ? 214.129 135.728 172.387 1.00 370.00 ? 644  LYS A CG  1 
ATOM 988   C CD  . LYS A 1  644  ? 213.084 134.679 172.038 1.00 370.00 ? 644  LYS A CD  1 
ATOM 989   C CE  . LYS A 1  644  ? 211.877 135.305 171.357 1.00 370.00 ? 644  LYS A CE  1 
ATOM 990   N NZ  . LYS A 1  644  ? 210.847 134.286 171.019 1.00 370.00 ? 644  LYS A NZ  1 
ATOM 991   N N   . LYS A 1  645  ? 218.456 134.784 173.756 1.00 370.00 ? 645  LYS A N   1 
ATOM 992   C CA  . LYS A 1  645  ? 219.503 134.116 174.528 1.00 370.00 ? 645  LYS A CA  1 
ATOM 993   C C   . LYS A 1  645  ? 220.376 135.117 175.279 1.00 370.00 ? 645  LYS A C   1 
ATOM 994   O O   . LYS A 1  645  ? 220.726 134.898 176.445 1.00 370.00 ? 645  LYS A O   1 
ATOM 995   C CB  . LYS A 1  645  ? 220.352 133.243 173.602 1.00 370.00 ? 645  LYS A CB  1 
ATOM 996   C CG  . LYS A 1  645  ? 221.443 132.464 174.314 1.00 370.00 ? 645  LYS A CG  1 
ATOM 997   C CD  . LYS A 1  645  ? 220.852 131.497 175.326 1.00 370.00 ? 645  LYS A CD  1 
ATOM 998   C CE  . LYS A 1  645  ? 220.107 130.364 174.641 1.00 370.00 ? 645  LYS A CE  1 
ATOM 999   N NZ  . LYS A 1  645  ? 219.567 129.384 175.623 1.00 370.00 ? 645  LYS A NZ  1 
ATOM 1000  N N   . LYS A 1  646  ? 220.749 136.218 174.617 1.00 370.00 ? 646  LYS A N   1 
ATOM 1001  C CA  . LYS A 1  646  ? 221.601 137.222 175.251 1.00 370.00 ? 646  LYS A CA  1 
ATOM 1002  C C   . LYS A 1  646  ? 220.855 137.976 176.348 1.00 370.00 ? 646  LYS A C   1 
ATOM 1003  O O   . LYS A 1  646  ? 221.429 138.279 177.401 1.00 370.00 ? 646  LYS A O   1 
ATOM 1004  C CB  . LYS A 1  646  ? 222.133 138.194 174.198 1.00 370.00 ? 646  LYS A CB  1 
ATOM 1005  C CG  . LYS A 1  646  ? 223.092 139.237 174.743 1.00 370.00 ? 646  LYS A CG  1 
ATOM 1006  C CD  . LYS A 1  646  ? 224.379 138.607 175.245 1.00 370.00 ? 646  LYS A CD  1 
ATOM 1007  C CE  . LYS A 1  646  ? 225.224 138.094 174.093 1.00 370.00 ? 646  LYS A CE  1 
ATOM 1008  N NZ  . LYS A 1  646  ? 226.526 137.552 174.560 1.00 370.00 ? 646  LYS A NZ  1 
ATOM 1009  N N   . ALA A 1  647  ? 219.579 138.295 176.110 1.00 370.00 ? 647  ALA A N   1 
ATOM 1010  C CA  . ALA A 1  647  ? 218.764 138.965 177.122 1.00 370.00 ? 647  ALA A CA  1 
ATOM 1011  C C   . ALA A 1  647  ? 218.529 138.064 178.329 1.00 370.00 ? 647  ALA A C   1 
ATOM 1012  O O   . ALA A 1  647  ? 218.447 138.541 179.467 1.00 370.00 ? 647  ALA A O   1 
ATOM 1013  C CB  . ALA A 1  647  ? 217.436 139.415 176.512 1.00 370.00 ? 647  ALA A CB  1 
ATOM 1014  N N   . LYS A 1  648  ? 218.383 136.757 178.091 1.00 370.00 ? 648  LYS A N   1 
ATOM 1015  C CA  . LYS A 1  648  ? 218.263 135.795 179.184 1.00 370.00 ? 648  LYS A CA  1 
ATOM 1016  C C   . LYS A 1  648  ? 219.543 135.729 180.011 1.00 370.00 ? 648  LYS A C   1 
ATOM 1017  O O   . LYS A 1  648  ? 219.497 135.761 181.246 1.00 370.00 ? 648  LYS A O   1 
ATOM 1018  C CB  . LYS A 1  648  ? 217.912 134.415 178.629 1.00 370.00 ? 648  LYS A CB  1 
ATOM 1019  C CG  . LYS A 1  648  ? 217.610 133.365 179.682 1.00 370.00 ? 648  LYS A CG  1 
ATOM 1020  C CD  . LYS A 1  648  ? 217.272 132.037 179.031 1.00 370.00 ? 648  LYS A CD  1 
ATOM 1021  C CE  . LYS A 1  648  ? 215.925 132.096 178.330 1.00 370.00 ? 648  LYS A CE  1 
ATOM 1022  N NZ  . LYS A 1  648  ? 214.805 132.243 179.298 1.00 370.00 ? 648  LYS A NZ  1 
ATOM 1023  N N   . MET A 1  649  ? 220.694 135.615 179.338 1.00 370.00 ? 649  MET A N   1 
ATOM 1024  C CA  . MET A 1  649  ? 221.982 135.473 180.018 1.00 370.00 ? 649  MET A CA  1 
ATOM 1025  C C   . MET A 1  649  ? 222.341 136.716 180.830 1.00 370.00 ? 649  MET A C   1 
ATOM 1026  O O   . MET A 1  649  ? 222.854 136.612 181.951 1.00 370.00 ? 649  MET A O   1 
ATOM 1027  C CB  . MET A 1  649  ? 223.079 135.169 178.995 1.00 370.00 ? 649  MET A CB  1 
ATOM 1028  C CG  . MET A 1  649  ? 224.448 134.918 179.612 1.00 370.00 ? 649  MET A CG  1 
ATOM 1029  S SD  . MET A 1  649  ? 225.739 134.579 178.402 1.00 370.00 ? 649  MET A SD  1 
ATOM 1030  C CE  . MET A 1  649  ? 226.004 136.210 177.714 1.00 370.00 ? 649  MET A CE  1 
ATOM 1031  N N   . ARG A 1  650  ? 222.099 137.902 180.263 1.00 370.00 ? 650  ARG A N   1 
ATOM 1032  C CA  . ARG A 1  650  ? 222.350 139.148 180.984 1.00 370.00 ? 650  ARG A CA  1 
ATOM 1033  C C   . ARG A 1  650  ? 221.417 139.297 182.182 1.00 370.00 ? 650  ARG A C   1 
ATOM 1034  O O   . ARG A 1  650  ? 221.805 139.855 183.215 1.00 370.00 ? 650  ARG A O   1 
ATOM 1035  C CB  . ARG A 1  650  ? 222.216 140.339 180.035 1.00 370.00 ? 650  ARG A CB  1 
ATOM 1036  C CG  . ARG A 1  650  ? 223.342 140.430 179.011 1.00 370.00 ? 650  ARG A CG  1 
ATOM 1037  C CD  . ARG A 1  650  ? 223.138 141.567 178.017 1.00 370.00 ? 650  ARG A CD  1 
ATOM 1038  N NE  . ARG A 1  650  ? 224.223 141.619 177.040 1.00 370.00 ? 650  ARG A NE  1 
ATOM 1039  C CZ  . ARG A 1  650  ? 224.268 142.453 176.007 1.00 370.00 ? 650  ARG A CZ  1 
ATOM 1040  N NH1 . ARG A 1  650  ? 223.284 143.316 175.800 1.00 370.00 ? 650  ARG A NH1 1 
ATOM 1041  N NH2 . ARG A 1  650  ? 225.300 142.422 175.176 1.00 370.00 ? 650  ARG A NH2 1 
ATOM 1042  N N   . GLU A 1  651  ? 220.176 138.817 182.057 1.00 370.00 ? 651  GLU A N   1 
ATOM 1043  C CA  . GLU A 1  651  ? 219.271 138.807 183.202 1.00 370.00 ? 651  GLU A CA  1 
ATOM 1044  C C   . GLU A 1  651  ? 219.717 137.792 184.251 1.00 370.00 ? 651  GLU A C   1 
ATOM 1045  O O   . GLU A 1  651  ? 219.583 138.040 185.457 1.00 370.00 ? 651  GLU A O   1 
ATOM 1046  C CB  . GLU A 1  651  ? 217.840 138.519 182.737 1.00 370.00 ? 651  GLU A CB  1 
ATOM 1047  C CG  . GLU A 1  651  ? 216.783 138.574 183.836 1.00 370.00 ? 651  GLU A CG  1 
ATOM 1048  C CD  . GLU A 1  651  ? 216.567 139.973 184.388 1.00 370.00 ? 651  GLU A CD  1 
ATOM 1049  O OE1 . GLU A 1  651  ? 216.773 140.956 183.642 1.00 370.00 ? 651  GLU A OE1 1 
ATOM 1050  O OE2 . GLU A 1  651  ? 216.194 140.090 185.574 1.00 370.00 ? 651  GLU A OE2 1 
ATOM 1051  N N   . GLN A 1  652  ? 220.260 136.650 183.815 1.00 370.00 ? 652  GLN A N   1 
ATOM 1052  C CA  . GLN A 1  652  ? 220.764 135.658 184.762 1.00 370.00 ? 652  GLN A CA  1 
ATOM 1053  C C   . GLN A 1  652  ? 222.027 136.143 185.463 1.00 370.00 ? 652  GLN A C   1 
ATOM 1054  O O   . GLN A 1  652  ? 222.247 135.830 186.639 1.00 370.00 ? 652  GLN A O   1 
ATOM 1055  C CB  . GLN A 1  652  ? 221.023 134.326 184.055 1.00 370.00 ? 652  GLN A CB  1 
ATOM 1056  C CG  . GLN A 1  652  ? 219.764 133.568 183.664 1.00 370.00 ? 652  GLN A CG  1 
ATOM 1057  C CD  . GLN A 1  652  ? 220.064 132.267 182.945 1.00 370.00 ? 652  GLN A CD  1 
ATOM 1058  O OE1 . GLN A 1  652  ? 221.221 131.952 182.666 1.00 370.00 ? 652  GLN A OE1 1 
ATOM 1059  N NE2 . GLN A 1  652  ? 219.021 131.504 182.644 1.00 370.00 ? 652  GLN A NE2 1 
ATOM 1060  N N   . GLU A 1  653  ? 222.875 136.894 184.754 1.00 370.00 ? 653  GLU A N   1 
ATOM 1061  C CA  . GLU A 1  653  ? 224.034 137.512 185.392 1.00 370.00 ? 653  GLU A CA  1 
ATOM 1062  C C   . GLU A 1  653  ? 223.612 138.591 186.385 1.00 370.00 ? 653  GLU A C   1 
ATOM 1063  O O   . GLU A 1  653  ? 224.287 138.806 187.399 1.00 370.00 ? 653  GLU A O   1 
ATOM 1064  C CB  . GLU A 1  653  ? 224.969 138.086 184.325 1.00 370.00 ? 653  GLU A CB  1 
ATOM 1065  C CG  . GLU A 1  653  ? 226.294 138.620 184.853 1.00 370.00 ? 653  GLU A CG  1 
ATOM 1066  C CD  . GLU A 1  653  ? 227.201 139.129 183.753 1.00 370.00 ? 653  GLU A CD  1 
ATOM 1067  O OE1 . GLU A 1  653  ? 226.795 139.084 182.573 1.00 370.00 ? 653  GLU A OE1 1 
ATOM 1068  O OE2 . GLU A 1  653  ? 228.323 139.576 184.071 1.00 370.00 ? 653  GLU A OE2 1 
ATOM 1069  N N   . ARG A 1  654  ? 222.494 139.270 186.113 1.00 370.00 ? 654  ARG A N   1 
ATOM 1070  C CA  . ARG A 1  654  ? 221.957 140.250 187.054 1.00 370.00 ? 654  ARG A CA  1 
ATOM 1071  C C   . ARG A 1  654  ? 221.448 139.573 188.321 1.00 370.00 ? 654  ARG A C   1 
ATOM 1072  O O   . ARG A 1  654  ? 221.719 140.030 189.437 1.00 370.00 ? 654  ARG A O   1 
ATOM 1073  C CB  . ARG A 1  654  ? 220.835 141.045 186.387 1.00 370.00 ? 654  ARG A CB  1 
ATOM 1074  C CG  . ARG A 1  654  ? 220.263 142.169 187.233 1.00 370.00 ? 654  ARG A CG  1 
ATOM 1075  C CD  . ARG A 1  654  ? 219.156 142.892 186.483 1.00 370.00 ? 654  ARG A CD  1 
ATOM 1076  N NE  . ARG A 1  654  ? 219.660 143.585 185.301 1.00 370.00 ? 654  ARG A NE  1 
ATOM 1077  C CZ  . ARG A 1  654  ? 218.888 144.130 184.367 1.00 370.00 ? 654  ARG A CZ  1 
ATOM 1078  N NH1 . ARG A 1  654  ? 217.567 144.063 184.471 1.00 370.00 ? 654  ARG A NH1 1 
ATOM 1079  N NH2 . ARG A 1  654  ? 219.437 144.740 183.326 1.00 370.00 ? 654  ARG A NH2 1 
ATOM 1080  N N   . GLN A 1  655  ? 220.704 138.476 188.164 1.00 370.00 ? 655  GLN A N   1 
ATOM 1081  C CA  . GLN A 1  655  ? 220.089 137.815 189.308 1.00 370.00 ? 655  GLN A CA  1 
ATOM 1082  C C   . GLN A 1  655  ? 221.075 136.982 190.116 1.00 370.00 ? 655  GLN A C   1 
ATOM 1083  O O   . GLN A 1  655  ? 220.769 136.629 191.259 1.00 370.00 ? 655  GLN A O   1 
ATOM 1084  C CB  . GLN A 1  655  ? 218.931 136.931 188.844 1.00 370.00 ? 655  GLN A CB  1 
ATOM 1085  C CG  . GLN A 1  655  ? 217.767 137.701 188.261 1.00 370.00 ? 655  GLN A CG  1 
ATOM 1086  C CD  . GLN A 1  655  ? 217.076 138.568 189.293 1.00 370.00 ? 655  GLN A CD  1 
ATOM 1087  O OE1 . GLN A 1  655  ? 216.909 138.169 190.446 1.00 370.00 ? 655  GLN A OE1 1 
ATOM 1088  N NE2 . GLN A 1  655  ? 216.673 139.764 188.884 1.00 370.00 ? 655  GLN A NE2 1 
ATOM 1089  N N   . ALA A 1  656  ? 222.237 136.649 189.559 1.00 370.00 ? 656  ALA A N   1 
ATOM 1090  C CA  . ALA A 1  656  ? 223.218 135.852 190.281 1.00 370.00 ? 656  ALA A CA  1 
ATOM 1091  C C   . ALA A 1  656  ? 224.160 136.694 191.134 1.00 370.00 ? 656  ALA A C   1 
ATOM 1092  O O   . ALA A 1  656  ? 225.001 136.130 191.841 1.00 370.00 ? 656  ALA A O   1 
ATOM 1093  C CB  . ALA A 1  656  ? 224.033 134.999 189.306 1.00 370.00 ? 656  ALA A CB  1 
ATOM 1094  N N   . SER A 1  657  ? 224.047 138.021 191.090 1.00 370.00 ? 657  SER A N   1 
ATOM 1095  C CA  . SER A 1  657  ? 224.866 138.841 191.982 1.00 370.00 ? 657  SER A CA  1 
ATOM 1096  C C   . SER A 1  657  ? 224.279 140.091 192.666 1.00 370.00 ? 657  SER A C   1 
ATOM 1097  O O   . SER A 1  657  ? 225.044 141.045 192.829 1.00 370.00 ? 657  SER A O   1 
ATOM 1098  C CB  . SER A 1  657  ? 226.111 139.292 191.208 1.00 370.00 ? 657  SER A CB  1 
ATOM 1099  O OG  . SER A 1  657  ? 226.917 138.190 190.838 1.00 370.00 ? 657  SER A OG  1 
ATOM 1100  N N   . GLY A 1  658  ? 223.003 140.190 193.088 1.00 370.00 ? 658  GLY A N   1 
ATOM 1101  C CA  . GLY A 1  658  ? 221.888 139.255 193.020 1.00 370.00 ? 658  GLY A CA  1 
ATOM 1102  C C   . GLY A 1  658  ? 220.641 139.986 192.565 1.00 370.00 ? 658  GLY A C   1 
ATOM 1103  O O   . GLY A 1  658  ? 219.519 139.577 192.860 1.00 370.00 ? 658  GLY A O   1 
ATOM 1104  N N   . GLY A 1  659  ? 220.851 141.071 191.838 1.00 370.00 ? 659  GLY A N   1 
ATOM 1105  C CA  . GLY A 1  659  ? 219.763 141.936 191.432 1.00 370.00 ? 659  GLY A CA  1 
ATOM 1106  C C   . GLY A 1  659  ? 220.238 143.369 191.325 1.00 370.00 ? 659  GLY A C   1 
ATOM 1107  O O   . GLY A 1  659  ? 221.409 143.680 191.543 1.00 370.00 ? 659  GLY A O   1 
ATOM 1108  N N   . GLY A 1  660  ? 219.295 144.238 190.970 1.00 370.00 ? 660  GLY A N   1 
ATOM 1109  C CA  . GLY A 1  660  ? 219.571 145.662 190.925 1.00 370.00 ? 660  GLY A CA  1 
ATOM 1110  C C   . GLY A 1  660  ? 220.051 146.154 189.576 1.00 370.00 ? 660  GLY A C   1 
ATOM 1111  O O   . GLY A 1  660  ? 219.530 145.744 188.534 1.00 370.00 ? 660  GLY A O   1 
ATOM 1112  N N   . GLU A 1  661  ? 221.047 147.034 189.582 1.00 370.00 ? 661  GLU A N   1 
ATOM 1113  C CA  . GLU A 1  661  ? 221.581 147.628 188.367 1.00 370.00 ? 661  GLU A CA  1 
ATOM 1114  C C   . GLU A 1  661  ? 222.954 147.044 188.067 1.00 370.00 ? 661  GLU A C   1 
ATOM 1115  O O   . GLU A 1  661  ? 223.841 147.038 188.927 1.00 370.00 ? 661  GLU A O   1 
ATOM 1116  C CB  . GLU A 1  661  ? 221.674 149.150 188.499 1.00 370.00 ? 661  GLU A CB  1 
ATOM 1117  C CG  . GLU A 1  661  ? 222.159 149.854 187.246 1.00 370.00 ? 661  GLU A CG  1 
ATOM 1118  C CD  . GLU A 1  661  ? 222.186 151.360 187.401 1.00 370.00 ? 661  GLU A CD  1 
ATOM 1119  O OE1 . GLU A 1  661  ? 221.845 151.854 188.495 1.00 370.00 ? 661  GLU A OE1 1 
ATOM 1120  O OE2 . GLU A 1  661  ? 222.552 152.054 186.431 1.00 370.00 ? 661  GLU A OE2 1 
ATOM 1121  N N   . MET A 1  662  ? 223.124 146.563 186.839 1.00 370.00 ? 662  MET A N   1 
ATOM 1122  C CA  . MET A 1  662  ? 224.352 145.920 186.406 1.00 370.00 ? 662  MET A CA  1 
ATOM 1123  C C   . MET A 1  662  ? 224.846 146.576 185.122 1.00 370.00 ? 662  MET A C   1 
ATOM 1124  O O   . MET A 1  662  ? 224.052 146.984 184.269 1.00 370.00 ? 662  MET A O   1 
ATOM 1125  C CB  . MET A 1  662  ? 224.125 144.410 186.203 1.00 370.00 ? 662  MET A CB  1 
ATOM 1126  C CG  . MET A 1  662  ? 225.370 143.589 185.889 1.00 370.00 ? 662  MET A CG  1 
ATOM 1127  S SD  . MET A 1  662  ? 226.587 143.541 187.218 1.00 370.00 ? 662  MET A SD  1 
ATOM 1128  C CE  . MET A 1  662  ? 228.078 143.234 186.271 1.00 370.00 ? 662  MET A CE  1 
ATOM 1129  N N   . PHE A 1  663  ? 226.166 146.670 184.991 1.00 370.00 ? 663  PHE A N   1 
ATOM 1130  C CA  . PHE A 1  663  ? 226.815 147.276 183.838 1.00 370.00 ? 663  PHE A CA  1 
ATOM 1131  C C   . PHE A 1  663  ? 227.297 146.169 182.911 1.00 370.00 ? 663  PHE A C   1 
ATOM 1132  O O   . PHE A 1  663  ? 228.064 145.296 183.328 1.00 370.00 ? 663  PHE A O   1 
ATOM 1133  C CB  . PHE A 1  663  ? 227.979 148.163 184.286 1.00 370.00 ? 663  PHE A CB  1 
ATOM 1134  C CG  . PHE A 1  663  ? 228.684 148.862 183.161 1.00 370.00 ? 663  PHE A CG  1 
ATOM 1135  C CD1 . PHE A 1  663  ? 228.107 149.958 182.535 1.00 370.00 ? 663  PHE A CD1 1 
ATOM 1136  C CD2 . PHE A 1  663  ? 229.933 148.434 182.741 1.00 370.00 ? 663  PHE A CD2 1 
ATOM 1137  C CE1 . PHE A 1  663  ? 228.763 150.607 181.503 1.00 370.00 ? 663  PHE A CE1 1 
ATOM 1138  C CE2 . PHE A 1  663  ? 230.593 149.077 181.710 1.00 370.00 ? 663  PHE A CE2 1 
ATOM 1139  C CZ  . PHE A 1  663  ? 230.006 150.165 181.090 1.00 370.00 ? 663  PHE A CZ  1 
ATOM 1140  N N   . PHE A 1  664  ? 226.846 146.210 181.656 1.00 370.00 ? 664  PHE A N   1 
ATOM 1141  C CA  . PHE A 1  664  ? 227.066 145.115 180.720 1.00 370.00 ? 664  PHE A CA  1 
ATOM 1142  C C   . PHE A 1  664  ? 228.005 145.458 179.573 1.00 370.00 ? 664  PHE A C   1 
ATOM 1143  O O   . PHE A 1  664  ? 228.441 144.546 178.863 1.00 370.00 ? 664  PHE A O   1 
ATOM 1144  C CB  . PHE A 1  664  ? 225.726 144.644 180.135 1.00 370.00 ? 664  PHE A CB  1 
ATOM 1145  C CG  . PHE A 1  664  ? 224.784 144.074 181.155 1.00 370.00 ? 664  PHE A CG  1 
ATOM 1146  C CD1 . PHE A 1  664  ? 224.931 142.772 181.607 1.00 370.00 ? 664  PHE A CD1 1 
ATOM 1147  C CD2 . PHE A 1  664  ? 223.744 144.843 181.659 1.00 370.00 ? 664  PHE A CD2 1 
ATOM 1148  C CE1 . PHE A 1  664  ? 224.062 142.245 182.547 1.00 370.00 ? 664  PHE A CE1 1 
ATOM 1149  C CE2 . PHE A 1  664  ? 222.870 144.323 182.598 1.00 370.00 ? 664  PHE A CE2 1 
ATOM 1150  C CZ  . PHE A 1  664  ? 223.028 143.021 183.041 1.00 370.00 ? 664  PHE A CZ  1 
ATOM 1151  N N   . MET A 1  665  ? 228.320 146.735 179.361 1.00 370.00 ? 665  MET A N   1 
ATOM 1152  C CA  . MET A 1  665  ? 229.086 147.161 178.189 1.00 370.00 ? 665  MET A CA  1 
ATOM 1153  C C   . MET A 1  665  ? 230.580 147.162 178.520 1.00 370.00 ? 665  MET A C   1 
ATOM 1154  O O   . MET A 1  665  ? 231.225 148.201 178.673 1.00 370.00 ? 665  MET A O   1 
ATOM 1155  C CB  . MET A 1  665  ? 228.608 148.530 177.723 1.00 370.00 ? 665  MET A CB  1 
ATOM 1156  C CG  . MET A 1  665  ? 227.150 148.576 177.271 1.00 370.00 ? 665  MET A CG  1 
ATOM 1157  S SD  . MET A 1  665  ? 226.763 147.565 175.827 1.00 370.00 ? 665  MET A SD  1 
ATOM 1158  C CE  . MET A 1  665  ? 225.871 146.195 176.565 1.00 370.00 ? 665  MET A CE  1 
ATOM 1159  N N   . ARG A 1  666  ? 231.131 145.950 178.625 1.00 370.00 ? 666  ARG A N   1 
ATOM 1160  C CA  . ARG A 1  666  ? 232.517 145.775 179.040 1.00 370.00 ? 666  ARG A CA  1 
ATOM 1161  C C   . ARG A 1  666  ? 233.464 145.387 177.909 1.00 370.00 ? 666  ARG A C   1 
ATOM 1162  O O   . ARG A 1  666  ? 234.675 145.596 178.042 1.00 370.00 ? 666  ARG A O   1 
ATOM 1163  C CB  . ARG A 1  666  ? 232.604 144.723 180.155 1.00 370.00 ? 666  ARG A CB  1 
ATOM 1164  C CG  . ARG A 1  666  ? 232.216 143.315 179.730 1.00 370.00 ? 666  ARG A CG  1 
ATOM 1165  C CD  . ARG A 1  666  ? 232.340 142.332 180.881 1.00 370.00 ? 666  ARG A CD  1 
ATOM 1166  N NE  . ARG A 1  666  ? 231.360 142.591 181.929 1.00 370.00 ? 666  ARG A NE  1 
ATOM 1167  C CZ  . ARG A 1  666  ? 230.137 142.071 181.945 1.00 370.00 ? 666  ARG A CZ  1 
ATOM 1168  N NH1 . ARG A 1  666  ? 229.747 141.262 180.969 1.00 370.00 ? 666  ARG A NH1 1 
ATOM 1169  N NH2 . ARG A 1  666  ? 229.303 142.356 182.936 1.00 370.00 ? 666  ARG A NH2 1 
ATOM 1170  N N   . THR A 1  667  ? 232.958 144.842 176.811 1.00 370.00 ? 667  THR A N   1 
ATOM 1171  C CA  . THR A 1  667  ? 233.761 144.345 175.705 1.00 370.00 ? 667  THR A CA  1 
ATOM 1172  C C   . THR A 1  667  ? 233.296 145.012 174.419 1.00 370.00 ? 667  THR A C   1 
ATOM 1173  O O   . THR A 1  667  ? 232.199 145.580 174.374 1.00 370.00 ? 667  THR A O   1 
ATOM 1174  C CB  . THR A 1  667  ? 233.645 142.813 175.580 1.00 370.00 ? 667  THR A CB  1 
ATOM 1175  O OG1 . THR A 1  667  ? 232.281 142.443 175.356 1.00 370.00 ? 667  THR A OG1 1 
ATOM 1176  C CG2 . THR A 1  667  ? 234.178 142.111 176.824 1.00 370.00 ? 667  THR A CG2 1 
ATOM 1177  N N   . PRO A 1  668  ? 234.127 145.010 173.365 1.00 370.00 ? 668  PRO A N   1 
ATOM 1178  C CA  . PRO A 1  668  ? 233.620 145.449 172.051 1.00 370.00 ? 668  PRO A CA  1 
ATOM 1179  C C   . PRO A 1  668  ? 232.511 144.568 171.497 1.00 370.00 ? 668  PRO A C   1 
ATOM 1180  O O   . PRO A 1  668  ? 231.681 145.052 170.716 1.00 370.00 ? 668  PRO A O   1 
ATOM 1181  C CB  . PRO A 1  668  ? 234.871 145.411 171.161 1.00 370.00 ? 668  PRO A CB  1 
ATOM 1182  C CG  . PRO A 1  668  ? 236.005 145.579 172.102 1.00 370.00 ? 668  PRO A CG  1 
ATOM 1183  C CD  . PRO A 1  668  ? 235.596 144.854 173.346 1.00 370.00 ? 668  PRO A CD  1 
ATOM 1184  N N   . GLN A 1  669  ? 232.486 143.282 171.866 1.00 370.00 ? 669  GLN A N   1 
ATOM 1185  C CA  . GLN A 1  669  ? 231.414 142.391 171.432 1.00 370.00 ? 669  GLN A CA  1 
ATOM 1186  C C   . GLN A 1  669  ? 230.073 142.771 172.052 1.00 370.00 ? 669  GLN A C   1 
ATOM 1187  O O   . GLN A 1  669  ? 229.022 142.510 171.457 1.00 370.00 ? 669  GLN A O   1 
ATOM 1188  C CB  . GLN A 1  669  ? 231.761 140.938 171.773 1.00 370.00 ? 669  GLN A CB  1 
ATOM 1189  C CG  . GLN A 1  669  ? 232.924 140.348 170.975 1.00 370.00 ? 669  GLN A CG  1 
ATOM 1190  C CD  . GLN A 1  669  ? 234.282 140.677 171.569 1.00 370.00 ? 669  GLN A CD  1 
ATOM 1191  O OE1 . GLN A 1  669  ? 234.383 141.070 172.732 1.00 370.00 ? 669  GLN A OE1 1 
ATOM 1192  N NE2 . GLN A 1  669  ? 235.331 140.522 170.771 1.00 370.00 ? 669  GLN A NE2 1 
ATOM 1193  N N   . ASP A 1  670  ? 230.083 143.371 173.245 1.00 370.00 ? 670  ASP A N   1 
ATOM 1194  C CA  . ASP A 1  670  ? 228.845 143.807 173.884 1.00 370.00 ? 670  ASP A CA  1 
ATOM 1195  C C   . ASP A 1  670  ? 228.234 145.039 173.229 1.00 370.00 ? 670  ASP A C   1 
ATOM 1196  O O   . ASP A 1  670  ? 227.050 145.307 173.452 1.00 370.00 ? 670  ASP A O   1 
ATOM 1197  C CB  . ASP A 1  670  ? 229.091 144.081 175.368 1.00 370.00 ? 670  ASP A CB  1 
ATOM 1198  C CG  . ASP A 1  670  ? 229.297 142.812 176.167 1.00 370.00 ? 670  ASP A CG  1 
ATOM 1199  O OD1 . ASP A 1  670  ? 228.700 141.778 175.801 1.00 370.00 ? 670  ASP A OD1 1 
ATOM 1200  O OD2 . ASP A 1  670  ? 230.069 142.842 177.147 1.00 370.00 ? 670  ASP A OD2 1 
ATOM 1201  N N   . LEU A 1  671  ? 228.997 145.784 172.435 1.00 370.00 ? 671  LEU A N   1 
ATOM 1202  C CA  . LEU A 1  671  ? 228.504 146.986 171.773 1.00 370.00 ? 671  LEU A CA  1 
ATOM 1203  C C   . LEU A 1  671  ? 227.849 146.715 170.428 1.00 370.00 ? 671  LEU A C   1 
ATOM 1204  O O   . LEU A 1  671  ? 227.483 147.671 169.736 1.00 370.00 ? 671  LEU A O   1 
ATOM 1205  C CB  . LEU A 1  671  ? 229.640 147.993 171.583 1.00 370.00 ? 671  LEU A CB  1 
ATOM 1206  C CG  . LEU A 1  671  ? 230.095 148.673 172.867 1.00 370.00 ? 671  LEU A CG  1 
ATOM 1207  C CD1 . LEU A 1  671  ? 231.307 149.536 172.598 1.00 370.00 ? 671  LEU A CD1 1 
ATOM 1208  C CD2 . LEU A 1  671  ? 228.948 149.499 173.422 1.00 370.00 ? 671  LEU A CD2 1 
ATOM 1209  N N   . THR A 1  672  ? 227.720 145.452 170.027 1.00 370.00 ? 672  THR A N   1 
ATOM 1210  C CA  . THR A 1  672  ? 227.134 145.142 168.732 1.00 370.00 ? 672  THR A CA  1 
ATOM 1211  C C   . THR A 1  672  ? 225.628 145.398 168.735 1.00 370.00 ? 672  THR A C   1 
ATOM 1212  O O   . THR A 1  672  ? 224.981 145.455 169.785 1.00 370.00 ? 672  THR A O   1 
ATOM 1213  C CB  . THR A 1  672  ? 227.431 143.692 168.338 1.00 370.00 ? 672  THR A CB  1 
ATOM 1214  O OG1 . THR A 1  672  ? 227.093 143.501 166.959 1.00 370.00 ? 672  THR A OG1 1 
ATOM 1215  C CG2 . THR A 1  672  ? 226.634 142.709 169.186 1.00 370.00 ? 672  THR A CG2 1 
ATOM 1216  N N   . GLY A 1  673  ? 225.081 145.596 167.537 1.00 370.00 ? 673  GLY A N   1 
ATOM 1217  C CA  . GLY A 1  673  ? 223.654 145.728 167.321 1.00 370.00 ? 673  GLY A CA  1 
ATOM 1218  C C   . GLY A 1  673  ? 222.898 144.426 167.197 1.00 370.00 ? 673  GLY A C   1 
ATOM 1219  O O   . GLY A 1  673  ? 221.686 144.439 166.966 1.00 370.00 ? 673  GLY A O   1 
ATOM 1220  N N   . LYS A 1  674  ? 223.593 143.295 167.338 1.00 370.00 ? 674  LYS A N   1 
ATOM 1221  C CA  . LYS A 1  674  ? 222.992 141.979 167.156 1.00 370.00 ? 674  LYS A CA  1 
ATOM 1222  C C   . LYS A 1  674  ? 222.069 141.588 168.305 1.00 370.00 ? 674  LYS A C   1 
ATOM 1223  O O   . LYS A 1  674  ? 221.263 140.665 168.148 1.00 370.00 ? 674  LYS A O   1 
ATOM 1224  C CB  . LYS A 1  674  ? 224.100 140.936 167.007 1.00 370.00 ? 674  LYS A CB  1 
ATOM 1225  C CG  . LYS A 1  674  ? 225.024 141.198 165.831 1.00 370.00 ? 674  LYS A CG  1 
ATOM 1226  C CD  . LYS A 1  674  ? 226.183 140.218 165.803 1.00 370.00 ? 674  LYS A CD  1 
ATOM 1227  C CE  . LYS A 1  674  ? 227.195 140.596 164.733 1.00 370.00 ? 674  LYS A CE  1 
ATOM 1228  N NZ  . LYS A 1  674  ? 228.345 139.648 164.671 1.00 370.00 ? 674  LYS A NZ  1 
ATOM 1229  N N   . ASP A 1  675  ? 222.155 142.277 169.443 1.00 370.00 ? 675  ASP A N   1 
ATOM 1230  C CA  . ASP A 1  675  ? 221.464 141.881 170.661 1.00 370.00 ? 675  ASP A CA  1 
ATOM 1231  C C   . ASP A 1  675  ? 220.912 143.117 171.363 1.00 370.00 ? 675  ASP A C   1 
ATOM 1232  O O   . ASP A 1  675  ? 221.281 144.253 171.050 1.00 370.00 ? 675  ASP A O   1 
ATOM 1233  C CB  . ASP A 1  675  ? 222.410 141.088 171.572 1.00 370.00 ? 675  ASP A CB  1 
ATOM 1234  C CG  . ASP A 1  675  ? 223.725 141.814 171.831 1.00 370.00 ? 675  ASP A CG  1 
ATOM 1235  O OD1 . ASP A 1  675  ? 223.959 142.886 171.234 1.00 370.00 ? 675  ASP A OD1 1 
ATOM 1236  O OD2 . ASP A 1  675  ? 224.538 141.306 172.628 1.00 370.00 ? 675  ASP A OD2 1 
ATOM 1237  N N   . GLY A 1  676  ? 220.030 142.887 172.334 1.00 370.00 ? 676  GLY A N   1 
ATOM 1238  C CA  . GLY A 1  676  ? 219.453 143.959 173.116 1.00 370.00 ? 676  GLY A CA  1 
ATOM 1239  C C   . GLY A 1  676  ? 218.372 144.721 172.369 1.00 370.00 ? 676  GLY A C   1 
ATOM 1240  O O   . GLY A 1  676  ? 218.148 144.547 171.171 1.00 370.00 ? 676  GLY A O   1 
ATOM 1241  N N   . ASP A 1  677  ? 217.677 145.582 173.107 1.00 370.00 ? 677  ASP A N   1 
ATOM 1242  C CA  . ASP A 1  677  ? 216.677 146.450 172.501 1.00 370.00 ? 677  ASP A CA  1 
ATOM 1243  C C   . ASP A 1  677  ? 217.360 147.656 171.861 1.00 370.00 ? 677  ASP A C   1 
ATOM 1244  O O   . ASP A 1  677  ? 218.302 148.222 172.423 1.00 370.00 ? 677  ASP A O   1 
ATOM 1245  C CB  . ASP A 1  677  ? 215.657 146.897 173.549 1.00 370.00 ? 677  ASP A CB  1 
ATOM 1246  C CG  . ASP A 1  677  ? 214.829 145.742 174.087 1.00 370.00 ? 677  ASP A CG  1 
ATOM 1247  O OD1 . ASP A 1  677  ? 214.624 144.758 173.344 1.00 370.00 ? 677  ASP A OD1 1 
ATOM 1248  O OD2 . ASP A 1  677  ? 214.391 145.818 175.255 1.00 370.00 ? 677  ASP A OD2 1 
ATOM 1249  N N   . LEU A 1  678  ? 216.902 148.030 170.666 1.00 370.00 ? 678  LEU A N   1 
ATOM 1250  C CA  . LEU A 1  678  ? 217.524 149.089 169.880 1.00 370.00 ? 678  LEU A CA  1 
ATOM 1251  C C   . LEU A 1  678  ? 216.524 150.148 169.431 1.00 370.00 ? 678  LEU A C   1 
ATOM 1252  O O   . LEU A 1  678  ? 215.333 149.865 169.268 1.00 370.00 ? 678  LEU A O   1 
ATOM 1253  C CB  . LEU A 1  678  ? 218.238 148.538 168.637 1.00 370.00 ? 678  LEU A CB  1 
ATOM 1254  C CG  . LEU A 1  678  ? 219.710 148.119 168.711 1.00 370.00 ? 678  LEU A CG  1 
ATOM 1255  C CD1 . LEU A 1  678  ? 219.893 146.873 169.531 1.00 370.00 ? 678  LEU A CD1 1 
ATOM 1256  C CD2 . LEU A 1  678  ? 220.286 147.897 167.320 1.00 370.00 ? 678  LEU A CD2 1 
ATOM 1257  N N   . ILE A 1  679  ? 217.029 151.370 169.233 1.00 370.00 ? 679  ILE A N   1 
ATOM 1258  C CA  . ILE A 1  679  ? 216.309 152.445 168.564 1.00 370.00 ? 679  ILE A CA  1 
ATOM 1259  C C   . ILE A 1  679  ? 217.120 152.886 167.351 1.00 370.00 ? 679  ILE A C   1 
ATOM 1260  O O   . ILE A 1  679  ? 218.289 152.528 167.185 1.00 370.00 ? 679  ILE A O   1 
ATOM 1261  C CB  . ILE A 1  679  ? 216.064 153.667 169.470 1.00 370.00 ? 679  ILE A CB  1 
ATOM 1262  C CG1 . ILE A 1  679  ? 217.391 154.380 169.739 1.00 370.00 ? 679  ILE A CG1 1 
ATOM 1263  C CG2 . ILE A 1  679  ? 215.424 153.246 170.782 1.00 370.00 ? 679  ILE A CG2 1 
ATOM 1264  C CD1 . ILE A 1  679  ? 217.230 155.818 170.159 1.00 370.00 ? 679  ILE A CD1 1 
ATOM 1265  N N   . LEU A 1  680  ? 216.471 153.668 166.493 1.00 370.00 ? 680  LEU A N   1 
ATOM 1266  C CA  . LEU A 1  680  ? 217.141 154.559 165.558 1.00 370.00 ? 680  LEU A CA  1 
ATOM 1267  C C   . LEU A 1  680  ? 216.924 156.007 165.979 1.00 370.00 ? 680  LEU A C   1 
ATOM 1268  O O   . LEU A 1  680  ? 215.856 156.373 166.473 1.00 370.00 ? 680  LEU A O   1 
ATOM 1269  C CB  . LEU A 1  680  ? 216.642 154.367 164.123 1.00 370.00 ? 680  LEU A CB  1 
ATOM 1270  C CG  . LEU A 1  680  ? 217.461 153.451 163.209 1.00 370.00 ? 680  LEU A CG  1 
ATOM 1271  C CD1 . LEU A 1  680  ? 218.840 154.022 163.036 1.00 370.00 ? 680  LEU A CD1 1 
ATOM 1272  C CD2 . LEU A 1  680  ? 217.570 152.030 163.707 1.00 370.00 ? 680  LEU A CD2 1 
ATOM 1273  N N   . ALA A 1  681  ? 217.946 156.834 165.773 1.00 370.00 ? 681  ALA A N   1 
ATOM 1274  C CA  . ALA A 1  681  ? 217.863 158.260 166.065 1.00 370.00 ? 681  ALA A CA  1 
ATOM 1275  C C   . ALA A 1  681  ? 218.322 159.035 164.842 1.00 370.00 ? 681  ALA A C   1 
ATOM 1276  O O   . ALA A 1  681  ? 219.490 158.944 164.449 1.00 370.00 ? 681  ALA A O   1 
ATOM 1277  C CB  . ALA A 1  681  ? 218.709 158.624 167.288 1.00 370.00 ? 681  ALA A CB  1 
ATOM 1278  N N   . GLU A 1  682  ? 217.415 159.808 164.255 1.00 370.00 ? 682  GLU A N   1 
ATOM 1279  C CA  . GLU A 1  682  ? 217.698 160.581 163.053 1.00 370.00 ? 682  GLU A CA  1 
ATOM 1280  C C   . GLU A 1  682  ? 217.858 162.043 163.441 1.00 370.00 ? 682  GLU A C   1 
ATOM 1281  O O   . GLU A 1  682  ? 216.902 162.675 163.903 1.00 370.00 ? 682  GLU A O   1 
ATOM 1282  C CB  . GLU A 1  682  ? 216.586 160.406 162.019 1.00 370.00 ? 682  GLU A CB  1 
ATOM 1283  C CG  . GLU A 1  682  ? 216.837 161.112 160.702 1.00 370.00 ? 682  GLU A CG  1 
ATOM 1284  C CD  . GLU A 1  682  ? 215.743 160.848 159.687 1.00 370.00 ? 682  GLU A CD  1 
ATOM 1285  O OE1 . GLU A 1  682  ? 214.779 160.123 160.018 1.00 370.00 ? 682  GLU A OE1 1 
ATOM 1286  O OE2 . GLU A 1  682  ? 215.848 161.371 158.558 1.00 370.00 ? 682  GLU A OE2 1 
ATOM 1287  N N   . TYR A 1  683  ? 219.064 162.573 163.253 1.00 370.00 ? 683  TYR A N   1 
ATOM 1288  C CA  . TYR A 1  683  ? 219.367 163.946 163.634 1.00 370.00 ? 683  TYR A CA  1 
ATOM 1289  C C   . TYR A 1  683  ? 218.861 164.892 162.551 1.00 370.00 ? 683  TYR A C   1 
ATOM 1290  O O   . TYR A 1  683  ? 219.192 164.727 161.371 1.00 370.00 ? 683  TYR A O   1 
ATOM 1291  C CB  . TYR A 1  683  ? 220.870 164.129 163.861 1.00 370.00 ? 683  TYR A CB  1 
ATOM 1292  C CG  . TYR A 1  683  ? 221.414 163.461 165.115 1.00 370.00 ? 683  TYR A CG  1 
ATOM 1293  C CD1 . TYR A 1  683  ? 220.559 162.965 166.093 1.00 370.00 ? 683  TYR A CD1 1 
ATOM 1294  C CD2 . TYR A 1  683  ? 222.784 163.355 165.333 1.00 370.00 ? 683  TYR A CD2 1 
ATOM 1295  C CE1 . TYR A 1  683  ? 221.047 162.362 167.240 1.00 370.00 ? 683  TYR A CE1 1 
ATOM 1296  C CE2 . TYR A 1  683  ? 223.283 162.757 166.482 1.00 370.00 ? 683  TYR A CE2 1 
ATOM 1297  C CZ  . TYR A 1  683  ? 222.410 162.263 167.429 1.00 370.00 ? 683  TYR A CZ  1 
ATOM 1298  O OH  . TYR A 1  683  ? 222.904 161.667 168.568 1.00 370.00 ? 683  TYR A OH  1 
ATOM 1299  N N   . SER A 1  684  ? 218.041 165.869 162.951 1.00 370.00 ? 684  SER A N   1 
ATOM 1300  C CA  . SER A 1  684  ? 217.542 166.864 162.003 1.00 370.00 ? 684  SER A CA  1 
ATOM 1301  C C   . SER A 1  684  ? 218.648 167.802 161.538 1.00 370.00 ? 684  SER A C   1 
ATOM 1302  O O   . SER A 1  684  ? 218.546 168.390 160.454 1.00 370.00 ? 684  SER A O   1 
ATOM 1303  C CB  . SER A 1  684  ? 216.404 167.665 162.630 1.00 370.00 ? 684  SER A CB  1 
ATOM 1304  O OG  . SER A 1  684  ? 216.873 168.437 163.722 1.00 370.00 ? 684  SER A OG  1 
ATOM 1305  N N   . GLU A 1  685  ? 219.694 167.964 162.341 1.00 370.00 ? 685  GLU A N   1 
ATOM 1306  C CA  . GLU A 1  685  ? 220.854 168.747 161.940 1.00 370.00 ? 685  GLU A CA  1 
ATOM 1307  C C   . GLU A 1  685  ? 221.734 167.939 160.999 1.00 370.00 ? 685  GLU A C   1 
ATOM 1308  O O   . GLU A 1  685  ? 222.001 166.758 161.243 1.00 370.00 ? 685  GLU A O   1 
ATOM 1309  C CB  . GLU A 1  685  ? 221.653 169.184 163.165 1.00 370.00 ? 685  GLU A CB  1 
ATOM 1310  C CG  . GLU A 1  685  ? 221.007 170.312 163.935 1.00 370.00 ? 685  GLU A CG  1 
ATOM 1311  C CD  . GLU A 1  685  ? 221.765 170.663 165.192 1.00 370.00 ? 685  GLU A CD  1 
ATOM 1312  O OE1 . GLU A 1  685  ? 222.647 169.877 165.598 1.00 370.00 ? 685  GLU A OE1 1 
ATOM 1313  O OE2 . GLU A 1  685  ? 221.497 171.738 165.759 1.00 370.00 ? 685  GLU A OE2 1 
ATOM 1314  N N   . GLU A 1  686  ? 222.151 168.578 159.901 1.00 370.00 ? 686  GLU A N   1 
ATOM 1315  C CA  . GLU A 1  686  ? 223.053 167.938 158.949 1.00 370.00 ? 686  GLU A CA  1 
ATOM 1316  C C   . GLU A 1  686  ? 224.408 167.641 159.581 1.00 370.00 ? 686  GLU A C   1 
ATOM 1317  O O   . GLU A 1  686  ? 224.928 166.526 159.462 1.00 370.00 ? 686  GLU A O   1 
ATOM 1318  C CB  . GLU A 1  686  ? 223.212 168.826 157.714 1.00 370.00 ? 686  GLU A CB  1 
ATOM 1319  C CG  . GLU A 1  686  ? 224.054 168.227 156.602 1.00 370.00 ? 686  GLU A CG  1 
ATOM 1320  C CD  . GLU A 1  686  ? 224.125 169.119 155.375 1.00 370.00 ? 686  GLU A CD  1 
ATOM 1321  O OE1 . GLU A 1  686  ? 223.539 170.224 155.398 1.00 370.00 ? 686  GLU A OE1 1 
ATOM 1322  O OE2 . GLU A 1  686  ? 224.767 168.713 154.384 1.00 370.00 ? 686  GLU A OE2 1 
ATOM 1323  N N   . ASN A 1  687  ? 224.989 168.632 160.273 1.00 370.00 ? 687  ASN A N   1 
ATOM 1324  C CA  . ASN A 1  687  ? 226.286 168.504 160.942 1.00 370.00 ? 687  ASN A CA  1 
ATOM 1325  C C   . ASN A 1  687  ? 226.164 169.180 162.309 1.00 370.00 ? 687  ASN A C   1 
ATOM 1326  O O   . ASN A 1  687  ? 226.319 170.397 162.436 1.00 370.00 ? 687  ASN A O   1 
ATOM 1327  C CB  . ASN A 1  687  ? 227.412 169.110 160.109 1.00 370.00 ? 687  ASN A CB  1 
ATOM 1328  C CG  . ASN A 1  687  ? 227.749 168.276 158.892 1.00 370.00 ? 687  ASN A CG  1 
ATOM 1329  O OD1 . ASN A 1  687  ? 227.825 167.049 158.969 1.00 370.00 ? 687  ASN A OD1 1 
ATOM 1330  N ND2 . ASN A 1  687  ? 227.954 168.936 157.759 1.00 370.00 ? 687  ASN A ND2 1 
ATOM 1331  N N   . GLY A 1  688  ? 225.860 168.377 163.328 1.00 370.00 ? 688  GLY A N   1 
ATOM 1332  C CA  . GLY A 1  688  ? 225.716 168.859 164.681 1.00 370.00 ? 688  GLY A CA  1 
ATOM 1333  C C   . GLY A 1  688  ? 227.006 169.394 165.273 1.00 370.00 ? 688  GLY A C   1 
ATOM 1334  O O   . GLY A 1  688  ? 228.108 169.026 164.852 1.00 370.00 ? 688  GLY A O   1 
ATOM 1335  N N   . PRO A 1  689  ? 226.888 170.298 166.252 1.00 370.00 ? 689  PRO A N   1 
ATOM 1336  C CA  . PRO A 1  689  ? 228.094 170.829 166.908 1.00 370.00 ? 689  PRO A CA  1 
ATOM 1337  C C   . PRO A 1  689  ? 228.815 169.809 167.770 1.00 370.00 ? 689  PRO A C   1 
ATOM 1338  O O   . PRO A 1  689  ? 230.032 169.923 167.957 1.00 370.00 ? 689  PRO A O   1 
ATOM 1339  C CB  . PRO A 1  689  ? 227.550 171.991 167.748 1.00 370.00 ? 689  PRO A CB  1 
ATOM 1340  C CG  . PRO A 1  689  ? 226.135 171.618 168.023 1.00 370.00 ? 689  PRO A CG  1 
ATOM 1341  C CD  . PRO A 1  689  ? 225.655 170.890 166.796 1.00 370.00 ? 689  PRO A CD  1 
ATOM 1342  N N   . LEU A 1  690  ? 228.098 168.830 168.319 1.00 370.00 ? 690  LEU A N   1 
ATOM 1343  C CA  . LEU A 1  690  ? 228.706 167.720 169.037 1.00 370.00 ? 690  LEU A CA  1 
ATOM 1344  C C   . LEU A 1  690  ? 227.995 166.428 168.666 1.00 370.00 ? 690  LEU A C   1 
ATOM 1345  O O   . LEU A 1  690  ? 226.769 166.395 168.526 1.00 370.00 ? 690  LEU A O   1 
ATOM 1346  C CB  . LEU A 1  690  ? 228.684 167.923 170.559 1.00 370.00 ? 690  LEU A CB  1 
ATOM 1347  C CG  . LEU A 1  690  ? 229.712 168.923 171.099 1.00 370.00 ? 690  LEU A CG  1 
ATOM 1348  C CD1 . LEU A 1  690  ? 229.540 169.157 172.582 1.00 370.00 ? 690  LEU A CD1 1 
ATOM 1349  C CD2 . LEU A 1  690  ? 231.127 168.444 170.796 1.00 370.00 ? 690  LEU A CD2 1 
ATOM 1350  N N   . MET A 1  691  ? 228.786 165.372 168.502 1.00 370.00 ? 691  MET A N   1 
ATOM 1351  C CA  . MET A 1  691  ? 228.312 164.076 168.046 1.00 370.00 ? 691  MET A CA  1 
ATOM 1352  C C   . MET A 1  691  ? 228.931 162.999 168.922 1.00 370.00 ? 691  MET A C   1 
ATOM 1353  O O   . MET A 1  691  ? 230.100 163.092 169.303 1.00 370.00 ? 691  MET A O   1 
ATOM 1354  C CB  . MET A 1  691  ? 228.694 163.832 166.577 1.00 370.00 ? 691  MET A CB  1 
ATOM 1355  C CG  . MET A 1  691  ? 228.027 164.743 165.551 1.00 370.00 ? 691  MET A CG  1 
ATOM 1356  S SD  . MET A 1  691  ? 226.263 164.453 165.331 1.00 370.00 ? 691  MET A SD  1 
ATOM 1357  C CE  . MET A 1  691  ? 226.291 162.889 164.454 1.00 370.00 ? 691  MET A CE  1 
ATOM 1358  N N   . MET A 1  692  ? 228.137 161.985 169.255 1.00 370.00 ? 692  MET A N   1 
ATOM 1359  C CA  . MET A 1  692  ? 228.668 160.835 169.969 1.00 370.00 ? 692  MET A CA  1 
ATOM 1360  C C   . MET A 1  692  ? 229.304 159.852 168.996 1.00 370.00 ? 692  MET A C   1 
ATOM 1361  O O   . MET A 1  692  ? 228.828 159.660 167.877 1.00 370.00 ? 692  MET A O   1 
ATOM 1362  C CB  . MET A 1  692  ? 227.567 160.125 170.754 1.00 370.00 ? 692  MET A CB  1 
ATOM 1363  C CG  . MET A 1  692  ? 226.986 160.919 171.900 1.00 370.00 ? 692  MET A CG  1 
ATOM 1364  S SD  . MET A 1  692  ? 225.765 159.937 172.787 1.00 370.00 ? 692  MET A SD  1 
ATOM 1365  C CE  . MET A 1  692  ? 224.410 159.942 171.614 1.00 370.00 ? 692  MET A CE  1 
ATOM 1366  N N   . GLN A 1  693  ? 230.369 159.201 169.446 1.00 370.00 ? 693  GLN A N   1 
ATOM 1367  C CA  . GLN A 1  693  ? 230.991 158.136 168.678 1.00 370.00 ? 693  GLN A CA  1 
ATOM 1368  C C   . GLN A 1  693  ? 230.321 156.806 169.001 1.00 370.00 ? 693  GLN A C   1 
ATOM 1369  O O   . GLN A 1  693  ? 229.458 156.716 169.877 1.00 370.00 ? 693  GLN A O   1 
ATOM 1370  C CB  . GLN A 1  693  ? 232.486 158.038 168.976 1.00 370.00 ? 693  GLN A CB  1 
ATOM 1371  C CG  . GLN A 1  693  ? 233.313 159.246 168.565 1.00 370.00 ? 693  GLN A CG  1 
ATOM 1372  C CD  . GLN A 1  693  ? 233.275 159.508 167.074 1.00 370.00 ? 693  GLN A CD  1 
ATOM 1373  O OE1 . GLN A 1  693  ? 232.771 160.538 166.629 1.00 370.00 ? 693  GLN A OE1 1 
ATOM 1374  N NE2 . GLN A 1  693  ? 233.796 158.569 166.295 1.00 370.00 ? 693  GLN A NE2 1 
ATOM 1375  N N   . VAL A 1  694  ? 230.714 155.775 168.249 1.00 370.00 ? 694  VAL A N   1 
ATOM 1376  C CA  . VAL A 1  694  ? 230.302 154.415 168.571 1.00 370.00 ? 694  VAL A CA  1 
ATOM 1377  C C   . VAL A 1  694  ? 230.863 154.025 169.930 1.00 370.00 ? 694  VAL A C   1 
ATOM 1378  O O   . VAL A 1  694  ? 232.076 154.093 170.165 1.00 370.00 ? 694  VAL A O   1 
ATOM 1379  C CB  . VAL A 1  694  ? 230.767 153.445 167.475 1.00 370.00 ? 694  VAL A CB  1 
ATOM 1380  C CG1 . VAL A 1  694  ? 230.458 152.009 167.870 1.00 370.00 ? 694  VAL A CG1 1 
ATOM 1381  C CG2 . VAL A 1  694  ? 230.113 153.795 166.149 1.00 370.00 ? 694  VAL A CG2 1 
ATOM 1382  N N   . GLY A 1  695  ? 229.976 153.617 170.835 1.00 370.00 ? 695  GLY A N   1 
ATOM 1383  C CA  . GLY A 1  695  ? 230.363 153.185 172.159 1.00 370.00 ? 695  GLY A CA  1 
ATOM 1384  C C   . GLY A 1  695  ? 230.030 154.146 173.283 1.00 370.00 ? 695  GLY A C   1 
ATOM 1385  O O   . GLY A 1  695  ? 230.061 153.733 174.448 1.00 370.00 ? 695  GLY A O   1 
ATOM 1386  N N   . MET A 1  696  ? 229.708 155.399 172.980 1.00 370.00 ? 696  MET A N   1 
ATOM 1387  C CA  . MET A 1  696  ? 229.406 156.353 174.036 1.00 370.00 ? 696  MET A CA  1 
ATOM 1388  C C   . MET A 1  696  ? 227.965 156.193 174.517 1.00 370.00 ? 696  MET A C   1 
ATOM 1389  O O   . MET A 1  696  ? 227.139 155.530 173.884 1.00 370.00 ? 696  MET A O   1 
ATOM 1390  C CB  . MET A 1  696  ? 229.654 157.781 173.559 1.00 370.00 ? 696  MET A CB  1 
ATOM 1391  C CG  . MET A 1  696  ? 231.119 158.069 173.302 1.00 370.00 ? 696  MET A CG  1 
ATOM 1392  S SD  . MET A 1  696  ? 231.427 159.735 172.699 1.00 370.00 ? 696  MET A SD  1 
ATOM 1393  C CE  . MET A 1  696  ? 231.120 160.702 174.174 1.00 370.00 ? 696  MET A CE  1 
ATOM 1394  N N   . ALA A 1  697  ? 227.674 156.807 175.663 1.00 370.00 ? 697  ALA A N   1 
ATOM 1395  C CA  . ALA A 1  697  ? 226.402 156.639 176.351 1.00 370.00 ? 697  ALA A CA  1 
ATOM 1396  C C   . ALA A 1  697  ? 225.625 157.948 176.408 1.00 370.00 ? 697  ALA A C   1 
ATOM 1397  O O   . ALA A 1  697  ? 226.206 159.035 176.464 1.00 370.00 ? 697  ALA A O   1 
ATOM 1398  C CB  . ALA A 1  697  ? 226.611 156.114 177.775 1.00 370.00 ? 697  ALA A CB  1 
ATOM 1399  N N   . THR A 1  698  ? 224.297 157.825 176.406 1.00 370.00 ? 698  THR A N   1 
ATOM 1400  C CA  . THR A 1  698  ? 223.400 158.959 176.577 1.00 370.00 ? 698  THR A CA  1 
ATOM 1401  C C   . THR A 1  698  ? 222.138 158.500 177.295 1.00 370.00 ? 698  THR A C   1 
ATOM 1402  O O   . THR A 1  698  ? 221.806 157.311 177.307 1.00 370.00 ? 698  THR A O   1 
ATOM 1403  C CB  . THR A 1  698  ? 223.033 159.621 175.237 1.00 370.00 ? 698  THR A CB  1 
ATOM 1404  O OG1 . THR A 1  698  ? 222.284 160.817 175.482 1.00 370.00 ? 698  THR A OG1 1 
ATOM 1405  C CG2 . THR A 1  698  ? 222.211 158.680 174.366 1.00 370.00 ? 698  THR A CG2 1 
ATOM 1406  N N   . LYS A 1  699  ? 221.458 159.451 177.923 1.00 370.00 ? 699  LYS A N   1 
ATOM 1407  C CA  . LYS A 1  699  ? 220.215 159.189 178.629 1.00 370.00 ? 699  LYS A CA  1 
ATOM 1408  C C   . LYS A 1  699  ? 219.036 159.864 177.940 1.00 370.00 ? 699  LYS A C   1 
ATOM 1409  O O   . LYS A 1  699  ? 219.195 160.777 177.126 1.00 370.00 ? 699  LYS A O   1 
ATOM 1410  C CB  . LYS A 1  699  ? 220.300 159.672 180.078 1.00 370.00 ? 699  LYS A CB  1 
ATOM 1411  C CG  . LYS A 1  699  ? 221.259 158.881 180.943 1.00 370.00 ? 699  LYS A CG  1 
ATOM 1412  C CD  . LYS A 1  699  ? 221.247 159.397 182.374 1.00 370.00 ? 699  LYS A CD  1 
ATOM 1413  C CE  . LYS A 1  699  ? 222.234 158.643 183.246 1.00 370.00 ? 699  LYS A CE  1 
ATOM 1414  N NZ  . LYS A 1  699  ? 221.819 157.231 183.466 1.00 370.00 ? 699  LYS A NZ  1 
ATOM 1415  N N   . ILE A 1  700  ? 217.841 159.395 178.281 1.00 370.00 ? 700  ILE A N   1 
ATOM 1416  C CA  . ILE A 1  700  ? 216.598 160.093 177.981 1.00 370.00 ? 700  ILE A CA  1 
ATOM 1417  C C   . ILE A 1  700  ? 215.982 160.524 179.302 1.00 370.00 ? 700  ILE A C   1 
ATOM 1418  O O   . ILE A 1  700  ? 215.735 159.691 180.182 1.00 370.00 ? 700  ILE A O   1 
ATOM 1419  C CB  . ILE A 1  700  ? 215.616 159.220 177.184 1.00 370.00 ? 700  ILE A CB  1 
ATOM 1420  C CG1 . ILE A 1  700  ? 216.202 158.831 175.830 1.00 370.00 ? 700  ILE A CG1 1 
ATOM 1421  C CG2 . ILE A 1  700  ? 214.289 159.947 176.994 1.00 370.00 ? 700  ILE A CG2 1 
ATOM 1422  C CD1 . ILE A 1  700  ? 215.336 157.857 175.086 1.00 370.00 ? 700  ILE A CD1 1 
ATOM 1423  N N   . LYS A 1  701  ? 215.740 161.821 179.449 1.00 370.00 ? 701  LYS A N   1 
ATOM 1424  C CA  . LYS A 1  701  ? 214.954 162.335 180.557 1.00 370.00 ? 701  LYS A CA  1 
ATOM 1425  C C   . LYS A 1  701  ? 213.639 162.882 180.022 1.00 370.00 ? 701  LYS A C   1 
ATOM 1426  O O   . LYS A 1  701  ? 213.621 163.634 179.043 1.00 370.00 ? 701  LYS A O   1 
ATOM 1427  C CB  . LYS A 1  701  ? 215.716 163.413 181.327 1.00 370.00 ? 701  LYS A CB  1 
ATOM 1428  C CG  . LYS A 1  701  ? 217.033 162.924 181.892 1.00 370.00 ? 701  LYS A CG  1 
ATOM 1429  C CD  . LYS A 1  701  ? 216.824 161.822 182.911 1.00 370.00 ? 701  LYS A CD  1 
ATOM 1430  C CE  . LYS A 1  701  ? 218.144 161.399 183.517 1.00 370.00 ? 701  LYS A CE  1 
ATOM 1431  N NZ  . LYS A 1  701  ? 218.722 162.493 184.345 1.00 370.00 ? 701  LYS A NZ  1 
ATOM 1432  N N   . ASN A 1  702  ? 212.544 162.512 180.677 1.00 370.00 ? 702  ASN A N   1 
ATOM 1433  C CA  . ASN A 1  702  ? 211.193 162.841 180.229 1.00 370.00 ? 702  ASN A CA  1 
ATOM 1434  C C   . ASN A 1  702  ? 210.761 164.084 181.002 1.00 370.00 ? 702  ASN A C   1 
ATOM 1435  O O   . ASN A 1  702  ? 210.174 163.991 182.080 1.00 370.00 ? 702  ASN A O   1 
ATOM 1436  C CB  . ASN A 1  702  ? 210.234 161.670 180.462 1.00 370.00 ? 702  ASN A CB  1 
ATOM 1437  C CG  . ASN A 1  702  ? 210.556 160.471 179.595 1.00 370.00 ? 702  ASN A CG  1 
ATOM 1438  O OD1 . ASN A 1  702  ? 210.914 160.613 178.430 1.00 370.00 ? 702  ASN A OD1 1 
ATOM 1439  N ND2 . ASN A 1  702  ? 210.413 159.277 180.158 1.00 370.00 ? 702  ASN A ND2 1 
ATOM 1440  N N   . TYR A 1  703  ? 211.069 165.254 180.443 1.00 370.00 ? 703  TYR A N   1 
ATOM 1441  C CA  . TYR A 1  703  ? 210.800 166.511 181.128 1.00 370.00 ? 703  TYR A CA  1 
ATOM 1442  C C   . TYR A 1  703  ? 209.310 166.825 181.084 1.00 370.00 ? 703  TYR A C   1 
ATOM 1443  O O   . TYR A 1  703  ? 208.710 166.898 180.006 1.00 370.00 ? 703  TYR A O   1 
ATOM 1444  C CB  . TYR A 1  703  ? 211.613 167.641 180.500 1.00 370.00 ? 703  TYR A CB  1 
ATOM 1445  C CG  . TYR A 1  703  ? 213.100 167.509 180.736 1.00 370.00 ? 703  TYR A CG  1 
ATOM 1446  C CD1 . TYR A 1  703  ? 213.671 167.915 181.938 1.00 370.00 ? 703  TYR A CD1 1 
ATOM 1447  C CD2 . TYR A 1  703  ? 213.932 166.964 179.765 1.00 370.00 ? 703  TYR A CD2 1 
ATOM 1448  C CE1 . TYR A 1  703  ? 215.032 167.789 182.163 1.00 370.00 ? 703  TYR A CE1 1 
ATOM 1449  C CE2 . TYR A 1  703  ? 215.291 166.835 179.980 1.00 370.00 ? 703  TYR A CE2 1 
ATOM 1450  C CZ  . TYR A 1  703  ? 215.836 167.249 181.179 1.00 370.00 ? 703  TYR A CZ  1 
ATOM 1451  O OH  . TYR A 1  703  ? 217.190 167.121 181.393 1.00 370.00 ? 703  TYR A OH  1 
ATOM 1452  N N   . TYR A 1  704  ? 208.716 167.004 182.260 1.00 370.00 ? 704  TYR A N   1 
ATOM 1453  C CA  . TYR A 1  704  ? 207.296 167.276 182.406 1.00 370.00 ? 704  TYR A CA  1 
ATOM 1454  C C   . TYR A 1  704  ? 207.108 168.443 183.362 1.00 370.00 ? 704  TYR A C   1 
ATOM 1455  O O   . TYR A 1  704  ? 207.775 168.521 184.398 1.00 370.00 ? 704  TYR A O   1 
ATOM 1456  C CB  . TYR A 1  704  ? 206.551 166.036 182.925 1.00 370.00 ? 704  TYR A CB  1 
ATOM 1457  C CG  . TYR A 1  704  ? 205.053 166.201 183.061 1.00 370.00 ? 704  TYR A CG  1 
ATOM 1458  C CD1 . TYR A 1  704  ? 204.223 166.154 181.945 1.00 370.00 ? 704  TYR A CD1 1 
ATOM 1459  C CD2 . TYR A 1  704  ? 204.468 166.392 184.308 1.00 370.00 ? 704  TYR A CD2 1 
ATOM 1460  C CE1 . TYR A 1  704  ? 202.850 166.299 182.068 1.00 370.00 ? 704  TYR A CE1 1 
ATOM 1461  C CE2 . TYR A 1  704  ? 203.099 166.539 184.441 1.00 370.00 ? 704  TYR A CE2 1 
ATOM 1462  C CZ  . TYR A 1  704  ? 202.296 166.493 183.319 1.00 370.00 ? 704  TYR A CZ  1 
ATOM 1463  O OH  . TYR A 1  704  ? 200.934 166.639 183.451 1.00 370.00 ? 704  TYR A OH  1 
ATOM 1464  N N   . LYS A 1  705  ? 206.201 169.350 183.013 1.00 370.00 ? 705  LYS A N   1 
ATOM 1465  C CA  . LYS A 1  705  ? 205.814 170.445 183.891 1.00 370.00 ? 705  LYS A CA  1 
ATOM 1466  C C   . LYS A 1  705  ? 204.442 170.122 184.465 1.00 370.00 ? 705  LYS A C   1 
ATOM 1467  O O   . LYS A 1  705  ? 203.523 169.763 183.720 1.00 370.00 ? 705  LYS A O   1 
ATOM 1468  C CB  . LYS A 1  705  ? 205.796 171.783 183.155 1.00 370.00 ? 705  LYS A CB  1 
ATOM 1469  C CG  . LYS A 1  705  ? 205.510 172.963 184.072 1.00 370.00 ? 705  LYS A CG  1 
ATOM 1470  C CD  . LYS A 1  705  ? 205.594 174.281 183.333 1.00 370.00 ? 705  LYS A CD  1 
ATOM 1471  C CE  . LYS A 1  705  ? 205.380 175.451 184.274 1.00 370.00 ? 705  LYS A CE  1 
ATOM 1472  N NZ  . LYS A 1  705  ? 203.987 175.480 184.797 1.00 370.00 ? 705  LYS A NZ  1 
ATOM 1473  N N   . ARG A 1  706  ? 204.322 170.218 185.787 1.00 370.00 ? 706  ARG A N   1 
ATOM 1474  C CA  . ARG A 1  706  ? 203.101 169.814 186.469 1.00 370.00 ? 706  ARG A CA  1 
ATOM 1475  C C   . ARG A 1  706  ? 201.947 170.763 186.174 1.00 370.00 ? 706  ARG A C   1 
ATOM 1476  O O   . ARG A 1  706  ? 202.131 171.976 186.038 1.00 370.00 ? 706  ARG A O   1 
ATOM 1477  C CB  . ARG A 1  706  ? 203.339 169.742 187.977 1.00 370.00 ? 706  ARG A CB  1 
ATOM 1478  C CG  . ARG A 1  706  ? 204.260 168.615 188.397 1.00 370.00 ? 706  ARG A CG  1 
ATOM 1479  C CD  . ARG A 1  706  ? 204.364 168.524 189.907 1.00 370.00 ? 706  ARG A CD  1 
ATOM 1480  N NE  . ARG A 1  706  ? 205.264 167.455 190.326 1.00 370.00 ? 706  ARG A NE  1 
ATOM 1481  C CZ  . ARG A 1  706  ? 204.884 166.195 190.518 1.00 370.00 ? 706  ARG A CZ  1 
ATOM 1482  N NH1 . ARG A 1  706  ? 205.767 165.283 190.899 1.00 370.00 ? 706  ARG A NH1 1 
ATOM 1483  N NH2 . ARG A 1  706  ? 203.618 165.847 190.325 1.00 370.00 ? 706  ARG A NH2 1 
ATOM 1484  N N   . LYS A 1  707  ? 200.746 170.193 186.075 1.00 370.00 ? 707  LYS A N   1 
ATOM 1485  C CA  . LYS A 1  707  ? 199.535 170.982 185.967 1.00 370.00 ? 707  LYS A CA  1 
ATOM 1486  C C   . LYS A 1  707  ? 199.268 171.701 187.289 1.00 370.00 ? 707  LYS A C   1 
ATOM 1487  O O   . LYS A 1  707  ? 199.678 171.229 188.353 1.00 370.00 ? 707  LYS A O   1 
ATOM 1488  C CB  . LYS A 1  707  ? 198.356 170.079 185.601 1.00 370.00 ? 707  LYS A CB  1 
ATOM 1489  C CG  . LYS A 1  707  ? 198.431 169.498 184.199 1.00 370.00 ? 707  LYS A CG  1 
ATOM 1490  C CD  . LYS A 1  707  ? 197.208 168.650 183.885 1.00 370.00 ? 707  LYS A CD  1 
ATOM 1491  C CE  . LYS A 1  707  ? 197.293 168.044 182.492 1.00 370.00 ? 707  LYS A CE  1 
ATOM 1492  N NZ  . LYS A 1  707  ? 196.100 167.210 182.174 1.00 370.00 ? 707  LYS A NZ  1 
ATOM 1493  N N   . PRO A 1  708  ? 198.595 172.855 187.253 1.00 370.00 ? 708  PRO A N   1 
ATOM 1494  C CA  . PRO A 1  708  ? 198.300 173.560 188.507 1.00 370.00 ? 708  PRO A CA  1 
ATOM 1495  C C   . PRO A 1  708  ? 197.218 172.857 189.313 1.00 370.00 ? 708  PRO A C   1 
ATOM 1496  O O   . PRO A 1  708  ? 196.235 172.351 188.768 1.00 370.00 ? 708  PRO A O   1 
ATOM 1497  C CB  . PRO A 1  708  ? 197.840 174.946 188.038 1.00 370.00 ? 708  PRO A CB  1 
ATOM 1498  C CG  . PRO A 1  708  ? 197.344 174.732 186.656 1.00 370.00 ? 708  PRO A CG  1 
ATOM 1499  C CD  . PRO A 1  708  ? 198.218 173.660 186.074 1.00 370.00 ? 708  PRO A CD  1 
ATOM 1500  N N   . GLY A 1  709  ? 197.413 172.835 190.622 1.00 370.00 ? 709  GLY A N   1 
ATOM 1501  C CA  . GLY A 1  709  ? 196.474 172.192 191.543 1.00 370.00 ? 709  GLY A CA  1 
ATOM 1502  C C   . GLY A 1  709  ? 196.828 170.723 191.785 1.00 370.00 ? 709  GLY A C   1 
ATOM 1503  O O   . GLY A 1  709  ? 197.880 170.423 192.340 1.00 370.00 ? 709  GLY A O   1 
ATOM 1504  N N   . LYS A 1  710  ? 195.937 169.825 191.363 1.00 370.00 ? 710  LYS A N   1 
ATOM 1505  C CA  . LYS A 1  710  ? 196.062 168.394 191.645 1.00 370.00 ? 710  LYS A CA  1 
ATOM 1506  C C   . LYS A 1  710  ? 196.530 167.671 190.383 1.00 370.00 ? 710  LYS A C   1 
ATOM 1507  O O   . LYS A 1  710  ? 195.738 167.237 189.547 1.00 370.00 ? 710  LYS A O   1 
ATOM 1508  C CB  . LYS A 1  710  ? 194.738 167.840 192.166 1.00 370.00 ? 710  LYS A CB  1 
ATOM 1509  C CG  . LYS A 1  710  ? 194.803 166.398 192.647 1.00 370.00 ? 710  LYS A CG  1 
ATOM 1510  C CD  . LYS A 1  710  ? 193.456 165.932 193.179 1.00 370.00 ? 710  LYS A CD  1 
ATOM 1511  C CE  . LYS A 1  710  ? 193.129 166.594 194.509 1.00 370.00 ? 710  LYS A CE  1 
ATOM 1512  N NZ  . LYS A 1  710  ? 194.061 166.154 195.584 1.00 370.00 ? 710  LYS A NZ  1 
ATOM 1513  N N   . ASP A 1  711  ? 197.847 167.560 190.246 1.00 370.00 ? 711  ASP A N   1 
ATOM 1514  C CA  . ASP A 1  711  ? 198.435 166.803 189.145 1.00 370.00 ? 711  ASP A CA  1 
ATOM 1515  C C   . ASP A 1  711  ? 198.458 165.321 189.501 1.00 370.00 ? 711  ASP A C   1 
ATOM 1516  O O   . ASP A 1  711  ? 199.039 164.953 190.527 1.00 370.00 ? 711  ASP A O   1 
ATOM 1517  C CB  . ASP A 1  711  ? 199.854 167.289 188.863 1.00 370.00 ? 711  ASP A CB  1 
ATOM 1518  C CG  . ASP A 1  711  ? 200.417 166.753 187.553 1.00 370.00 ? 711  ASP A CG  1 
ATOM 1519  O OD1 . ASP A 1  711  ? 199.684 166.096 186.789 1.00 370.00 ? 711  ASP A OD1 1 
ATOM 1520  O OD2 . ASP A 1  711  ? 201.616 166.968 187.292 1.00 370.00 ? 711  ASP A OD2 1 
ATOM 1521  N N   . PRO A 1  712  ? 197.856 164.442 188.690 1.00 370.00 ? 712  PRO A N   1 
ATOM 1522  C CA  . PRO A 1  712  ? 198.000 162.998 188.936 1.00 370.00 ? 712  PRO A CA  1 
ATOM 1523  C C   . PRO A 1  712  ? 199.334 162.424 188.488 1.00 370.00 ? 712  PRO A C   1 
ATOM 1524  O O   . PRO A 1  712  ? 199.589 161.236 188.733 1.00 370.00 ? 712  PRO A O   1 
ATOM 1525  C CB  . PRO A 1  712  ? 196.846 162.391 188.128 1.00 370.00 ? 712  PRO A CB  1 
ATOM 1526  C CG  . PRO A 1  712  ? 196.595 163.371 187.043 1.00 370.00 ? 712  PRO A CG  1 
ATOM 1527  C CD  . PRO A 1  712  ? 196.856 164.723 187.645 1.00 370.00 ? 712  PRO A CD  1 
ATOM 1528  N N   . GLY A 1  713  ? 200.181 163.212 187.841 1.00 370.00 ? 713  GLY A N   1 
ATOM 1529  C CA  . GLY A 1  713  ? 201.496 162.768 187.428 1.00 370.00 ? 713  GLY A CA  1 
ATOM 1530  C C   . GLY A 1  713  ? 201.673 162.816 185.921 1.00 370.00 ? 713  GLY A C   1 
ATOM 1531  O O   . GLY A 1  713  ? 200.737 163.032 185.153 1.00 370.00 ? 713  GLY A O   1 
ATOM 1532  N N   . ALA A 1  714  ? 202.923 162.609 185.520 1.00 370.00 ? 714  ALA A N   1 
ATOM 1533  C CA  . ALA A 1  714  ? 203.279 162.624 184.112 1.00 370.00 ? 714  ALA A CA  1 
ATOM 1534  C C   . ALA A 1  714  ? 202.778 161.358 183.416 1.00 370.00 ? 714  ALA A C   1 
ATOM 1535  O O   . ALA A 1  714  ? 202.648 160.304 184.045 1.00 370.00 ? 714  ALA A O   1 
ATOM 1536  C CB  . ALA A 1  714  ? 204.793 162.737 183.952 1.00 370.00 ? 714  ALA A CB  1 
ATOM 1537  N N   . PRO A 1  715  ? 202.462 161.445 182.120 1.00 370.00 ? 715  PRO A N   1 
ATOM 1538  C CA  . PRO A 1  715  ? 202.143 160.232 181.358 1.00 370.00 ? 715  PRO A CA  1 
ATOM 1539  C C   . PRO A 1  715  ? 203.365 159.336 181.205 1.00 370.00 ? 715  PRO A C   1 
ATOM 1540  O O   . PRO A 1  715  ? 204.508 159.798 181.216 1.00 370.00 ? 715  PRO A O   1 
ATOM 1541  C CB  . PRO A 1  715  ? 201.675 160.776 180.003 1.00 370.00 ? 715  PRO A CB  1 
ATOM 1542  C CG  . PRO A 1  715  ? 201.224 162.172 180.292 1.00 370.00 ? 715  PRO A CG  1 
ATOM 1543  C CD  . PRO A 1  715  ? 202.153 162.668 181.359 1.00 370.00 ? 715  PRO A CD  1 
ATOM 1544  N N   . ASP A 1  716  ? 203.108 158.040 181.062 1.00 370.00 ? 716  ASP A N   1 
ATOM 1545  C CA  . ASP A 1  716  ? 204.180 157.062 180.960 1.00 370.00 ? 716  ASP A CA  1 
ATOM 1546  C C   . ASP A 1  716  ? 204.651 156.920 179.517 1.00 370.00 ? 716  ASP A C   1 
ATOM 1547  O O   . ASP A 1  716  ? 203.866 157.015 178.569 1.00 370.00 ? 716  ASP A O   1 
ATOM 1548  C CB  . ASP A 1  716  ? 203.723 155.705 181.497 1.00 370.00 ? 716  ASP A CB  1 
ATOM 1549  C CG  . ASP A 1  716  ? 203.540 155.707 183.003 1.00 370.00 ? 716  ASP A CG  1 
ATOM 1550  O OD1 . ASP A 1  716  ? 204.244 156.482 183.684 1.00 370.00 ? 716  ASP A OD1 1 
ATOM 1551  O OD2 . ASP A 1  716  ? 202.697 154.935 183.507 1.00 370.00 ? 716  ASP A OD2 1 
ATOM 1552  N N   . CYS A 1  717  ? 205.952 156.689 179.360 1.00 370.00 ? 717  CYS A N   1 
ATOM 1553  C CA  . CYS A 1  717  ? 206.571 156.505 178.058 1.00 370.00 ? 717  CYS A CA  1 
ATOM 1554  C C   . CYS A 1  717  ? 207.273 155.156 178.005 1.00 370.00 ? 717  CYS A C   1 
ATOM 1555  O O   . CYS A 1  717  ? 207.569 154.543 179.035 1.00 370.00 ? 717  CYS A O   1 
ATOM 1556  C CB  . CYS A 1  717  ? 207.570 157.627 177.752 1.00 370.00 ? 717  CYS A CB  1 
ATOM 1557  S SG  . CYS A 1  717  ? 206.814 159.254 177.590 1.00 370.00 ? 717  CYS A SG  1 
ATOM 1558  N N   . LYS A 1  718  ? 207.525 154.690 176.779 1.00 370.00 ? 718  LYS A N   1 
ATOM 1559  C CA  . LYS A 1  718  ? 208.243 153.434 176.599 1.00 370.00 ? 718  LYS A CA  1 
ATOM 1560  C C   . LYS A 1  718  ? 209.709 153.567 176.995 1.00 370.00 ? 718  LYS A C   1 
ATOM 1561  O O   . LYS A 1  718  ? 210.297 152.617 177.526 1.00 370.00 ? 718  LYS A O   1 
ATOM 1562  C CB  . LYS A 1  718  ? 208.112 152.964 175.149 1.00 370.00 ? 718  LYS A CB  1 
ATOM 1563  C CG  . LYS A 1  718  ? 208.688 151.583 174.871 1.00 370.00 ? 718  LYS A CG  1 
ATOM 1564  C CD  . LYS A 1  718  ? 208.426 151.153 173.438 1.00 370.00 ? 718  LYS A CD  1 
ATOM 1565  C CE  . LYS A 1  718  ? 209.003 149.774 173.165 1.00 370.00 ? 718  LYS A CE  1 
ATOM 1566  N NZ  . LYS A 1  718  ? 208.738 149.330 171.770 1.00 370.00 ? 718  LYS A NZ  1 
ATOM 1567  N N   . TYR A 1  719  ? 210.303 154.737 176.775 1.00 370.00 ? 719  TYR A N   1 
ATOM 1568  C CA  . TYR A 1  719  ? 211.715 154.961 177.044 1.00 370.00 ? 719  TYR A CA  1 
ATOM 1569  C C   . TYR A 1  719  ? 211.892 156.168 177.957 1.00 370.00 ? 719  TYR A C   1 
ATOM 1570  O O   . TYR A 1  719  ? 211.068 157.087 177.966 1.00 370.00 ? 719  TYR A O   1 
ATOM 1571  C CB  . TYR A 1  719  ? 212.493 155.191 175.743 1.00 370.00 ? 719  TYR A CB  1 
ATOM 1572  C CG  . TYR A 1  719  ? 212.391 154.055 174.755 1.00 370.00 ? 719  TYR A CG  1 
ATOM 1573  C CD1 . TYR A 1  719  ? 213.131 152.890 174.922 1.00 370.00 ? 719  TYR A CD1 1 
ATOM 1574  C CD2 . TYR A 1  719  ? 211.558 154.152 173.645 1.00 370.00 ? 719  TYR A CD2 1 
ATOM 1575  C CE1 . TYR A 1  719  ? 213.039 151.850 174.015 1.00 370.00 ? 719  TYR A CE1 1 
ATOM 1576  C CE2 . TYR A 1  719  ? 211.460 153.119 172.731 1.00 370.00 ? 719  TYR A CE2 1 
ATOM 1577  C CZ  . TYR A 1  719  ? 212.203 151.971 172.923 1.00 370.00 ? 719  TYR A CZ  1 
ATOM 1578  O OH  . TYR A 1  719  ? 212.112 150.938 172.020 1.00 370.00 ? 719  TYR A OH  1 
ATOM 1579  N N   . GLY A 1  720  ? 212.983 156.158 178.721 1.00 370.00 ? 720  GLY A N   1 
ATOM 1580  C CA  . GLY A 1  720  ? 213.399 157.312 179.488 1.00 370.00 ? 720  GLY A CA  1 
ATOM 1581  C C   . GLY A 1  720  ? 212.883 157.333 180.916 1.00 370.00 ? 720  GLY A C   1 
ATOM 1582  O O   . GLY A 1  720  ? 211.997 156.573 181.316 1.00 370.00 ? 720  GLY A O   1 
ATOM 1583  N N   . GLU A 1  721  ? 213.466 158.242 181.696 1.00 370.00 ? 721  GLU A N   1 
ATOM 1584  C CA  . GLU A 1  721  ? 213.120 158.452 183.097 1.00 370.00 ? 721  GLU A CA  1 
ATOM 1585  C C   . GLU A 1  721  ? 212.447 159.809 183.250 1.00 370.00 ? 721  GLU A C   1 
ATOM 1586  O O   . GLU A 1  721  ? 212.924 160.807 182.700 1.00 370.00 ? 721  GLU A O   1 
ATOM 1587  C CB  . GLU A 1  721  ? 214.368 158.372 183.983 1.00 370.00 ? 721  GLU A CB  1 
ATOM 1588  C CG  . GLU A 1  721  ? 214.097 158.507 185.477 1.00 370.00 ? 721  GLU A CG  1 
ATOM 1589  C CD  . GLU A 1  721  ? 215.357 158.371 186.314 1.00 370.00 ? 721  GLU A CD  1 
ATOM 1590  O OE1 . GLU A 1  721  ? 216.447 158.199 185.729 1.00 370.00 ? 721  GLU A OE1 1 
ATOM 1591  O OE2 . GLU A 1  721  ? 215.257 158.433 187.559 1.00 370.00 ? 721  GLU A OE2 1 
ATOM 1592  N N   . THR A 1  722  ? 211.340 159.838 183.991 1.00 370.00 ? 722  THR A N   1 
ATOM 1593  C CA  . THR A 1  722  ? 210.574 161.067 184.167 1.00 370.00 ? 722  THR A CA  1 
ATOM 1594  C C   . THR A 1  722  ? 211.317 162.043 185.075 1.00 370.00 ? 722  THR A C   1 
ATOM 1595  O O   . THR A 1  722  ? 211.751 161.682 186.173 1.00 370.00 ? 722  THR A O   1 
ATOM 1596  C CB  . THR A 1  722  ? 209.198 160.743 184.751 1.00 370.00 ? 722  THR A CB  1 
ATOM 1597  O OG1 . THR A 1  722  ? 208.511 159.834 183.883 1.00 370.00 ? 722  THR A OG1 1 
ATOM 1598  C CG2 . THR A 1  722  ? 208.361 162.008 184.909 1.00 370.00 ? 722  THR A CG2 1 
ATOM 1599  N N   . VAL A 1  723  ? 211.459 163.286 184.613 1.00 370.00 ? 723  VAL A N   1 
ATOM 1600  C CA  . VAL A 1  723  ? 212.040 164.369 185.399 1.00 370.00 ? 723  VAL A CA  1 
ATOM 1601  C C   . VAL A 1  723  ? 211.011 165.485 185.498 1.00 370.00 ? 723  VAL A C   1 
ATOM 1602  O O   . VAL A 1  723  ? 210.609 166.060 184.479 1.00 370.00 ? 723  VAL A O   1 
ATOM 1603  C CB  . VAL A 1  723  ? 213.349 164.889 184.786 1.00 370.00 ? 723  VAL A CB  1 
ATOM 1604  C CG1 . VAL A 1  723  ? 213.819 166.135 185.520 1.00 370.00 ? 723  VAL A CG1 1 
ATOM 1605  C CG2 . VAL A 1  723  ? 214.413 163.821 184.853 1.00 370.00 ? 723  VAL A CG2 1 
ATOM 1606  N N   . TYR A 1  724  ? 210.590 165.791 186.722 1.00 370.00 ? 724  TYR A N   1 
ATOM 1607  C CA  . TYR A 1  724  ? 209.693 166.909 186.983 1.00 370.00 ? 724  TYR A CA  1 
ATOM 1608  C C   . TYR A 1  724  ? 210.532 168.170 187.157 1.00 370.00 ? 724  TYR A C   1 
ATOM 1609  O O   . TYR A 1  724  ? 211.371 168.241 188.062 1.00 370.00 ? 724  TYR A O   1 
ATOM 1610  C CB  . TYR A 1  724  ? 208.846 166.647 188.227 1.00 370.00 ? 724  TYR A CB  1 
ATOM 1611  C CG  . TYR A 1  724  ? 207.900 165.477 188.083 1.00 370.00 ? 724  TYR A CG  1 
ATOM 1612  C CD1 . TYR A 1  724  ? 206.681 165.618 187.427 1.00 370.00 ? 724  TYR A CD1 1 
ATOM 1613  C CD2 . TYR A 1  724  ? 208.229 164.228 188.598 1.00 370.00 ? 724  TYR A CD2 1 
ATOM 1614  C CE1 . TYR A 1  724  ? 205.814 164.546 187.292 1.00 370.00 ? 724  TYR A CE1 1 
ATOM 1615  C CE2 . TYR A 1  724  ? 207.370 163.151 188.468 1.00 370.00 ? 724  TYR A CE2 1 
ATOM 1616  C CZ  . TYR A 1  724  ? 206.164 163.316 187.815 1.00 370.00 ? 724  TYR A CZ  1 
ATOM 1617  O OH  . TYR A 1  724  ? 205.305 162.250 187.682 1.00 370.00 ? 724  TYR A OH  1 
ATOM 1618  N N   . CYS A 1  725  ? 210.308 169.159 186.296 1.00 370.00 ? 725  CYS A N   1 
ATOM 1619  C CA  . CYS A 1  725  ? 211.121 170.366 186.279 1.00 370.00 ? 725  CYS A CA  1 
ATOM 1620  C C   . CYS A 1  725  ? 210.235 171.589 186.455 1.00 370.00 ? 725  CYS A C   1 
ATOM 1621  O O   . CYS A 1  725  ? 209.159 171.677 185.854 1.00 370.00 ? 725  CYS A O   1 
ATOM 1622  C CB  . CYS A 1  725  ? 211.938 170.463 184.980 1.00 370.00 ? 725  CYS A CB  1 
ATOM 1623  S SG  . CYS A 1  725  ? 210.982 170.541 183.442 1.00 370.00 ? 725  CYS A SG  1 
ATOM 1624  N N   . HIS A 1  726  ? 210.673 172.511 187.312 1.00 370.00 ? 726  HIS A N   1 
ATOM 1625  C CA  . HIS A 1  726  ? 210.014 173.802 187.458 1.00 370.00 ? 726  HIS A CA  1 
ATOM 1626  C C   . HIS A 1  726  ? 210.663 174.873 186.596 1.00 370.00 ? 726  HIS A C   1 
ATOM 1627  O O   . HIS A 1  726  ? 209.977 175.791 186.135 1.00 370.00 ? 726  HIS A O   1 
ATOM 1628  C CB  . HIS A 1  726  ? 210.030 174.244 188.924 1.00 370.00 ? 726  HIS A CB  1 
ATOM 1629  C CG  . HIS A 1  726  ? 209.298 173.317 189.843 1.00 370.00 ? 726  HIS A CG  1 
ATOM 1630  N ND1 . HIS A 1  726  ? 207.922 173.259 189.906 1.00 370.00 ? 726  HIS A ND1 1 
ATOM 1631  C CD2 . HIS A 1  726  ? 209.752 172.407 190.739 1.00 370.00 ? 726  HIS A CD2 1 
ATOM 1632  C CE1 . HIS A 1  726  ? 207.561 172.356 190.800 1.00 370.00 ? 726  HIS A CE1 1 
ATOM 1633  N NE2 . HIS A 1  726  ? 208.653 171.824 191.320 1.00 370.00 ? 726  HIS A NE2 1 
ATOM 1634  N N   . THR A 1  727  ? 211.970 174.772 186.375 1.00 370.00 ? 727  THR A N   1 
ATOM 1635  C CA  . THR A 1  727  ? 212.696 175.642 185.467 1.00 370.00 ? 727  THR A CA  1 
ATOM 1636  C C   . THR A 1  727  ? 213.040 174.847 184.212 1.00 370.00 ? 727  THR A C   1 
ATOM 1637  O O   . THR A 1  727  ? 213.457 173.688 184.291 1.00 370.00 ? 727  THR A O   1 
ATOM 1638  C CB  . THR A 1  727  ? 213.968 176.187 186.136 1.00 370.00 ? 727  THR A CB  1 
ATOM 1639  O OG1 . THR A 1  727  ? 213.614 176.855 187.353 1.00 370.00 ? 727  THR A OG1 1 
ATOM 1640  C CG2 . THR A 1  727  ? 214.699 177.179 185.232 1.00 370.00 ? 727  THR A CG2 1 
ATOM 1641  N N   . SER A 1  728  ? 212.849 175.471 183.054 1.00 370.00 ? 728  SER A N   1 
ATOM 1642  C CA  . SER A 1  728  ? 212.984 174.756 181.791 1.00 370.00 ? 728  SER A CA  1 
ATOM 1643  C C   . SER A 1  728  ? 214.457 174.561 181.450 1.00 370.00 ? 728  SER A C   1 
ATOM 1644  O O   . SER A 1  728  ? 215.238 175.515 181.526 1.00 370.00 ? 728  SER A O   1 
ATOM 1645  C CB  . SER A 1  728  ? 212.284 175.517 180.670 1.00 370.00 ? 728  SER A CB  1 
ATOM 1646  O OG  . SER A 1  728  ? 212.429 174.856 179.425 1.00 370.00 ? 728  SER A OG  1 
ATOM 1647  N N   . PRO A 1  729  ? 214.875 173.346 181.079 1.00 370.00 ? 729  PRO A N   1 
ATOM 1648  C CA  . PRO A 1  729  ? 216.265 173.132 180.659 1.00 370.00 ? 729  PRO A CA  1 
ATOM 1649  C C   . PRO A 1  729  ? 216.557 173.569 179.233 1.00 370.00 ? 729  PRO A C   1 
ATOM 1650  O O   . PRO A 1  729  ? 217.710 173.466 178.798 1.00 370.00 ? 729  PRO A O   1 
ATOM 1651  C CB  . PRO A 1  729  ? 216.433 171.613 180.808 1.00 370.00 ? 729  PRO A CB  1 
ATOM 1652  C CG  . PRO A 1  729  ? 215.068 171.074 180.583 1.00 370.00 ? 729  PRO A CG  1 
ATOM 1653  C CD  . PRO A 1  729  ? 214.122 172.083 181.170 1.00 370.00 ? 729  PRO A CD  1 
ATOM 1654  N N   . PHE A 1  730  ? 215.560 174.053 178.503 1.00 370.00 ? 730  PHE A N   1 
ATOM 1655  C CA  . PHE A 1  730  ? 215.704 174.501 177.127 1.00 370.00 ? 730  PHE A CA  1 
ATOM 1656  C C   . PHE A 1  730  ? 215.574 176.019 177.068 1.00 370.00 ? 730  PHE A C   1 
ATOM 1657  O O   . PHE A 1  730  ? 215.443 176.698 178.090 1.00 370.00 ? 730  PHE A O   1 
ATOM 1658  C CB  . PHE A 1  730  ? 214.666 173.818 176.236 1.00 370.00 ? 730  PHE A CB  1 
ATOM 1659  C CG  . PHE A 1  730  ? 214.859 172.337 176.117 1.00 370.00 ? 730  PHE A CG  1 
ATOM 1660  C CD1 . PHE A 1  730  ? 215.775 171.816 175.218 1.00 370.00 ? 730  PHE A CD1 1 
ATOM 1661  C CD2 . PHE A 1  730  ? 214.138 171.465 176.919 1.00 370.00 ? 730  PHE A CD2 1 
ATOM 1662  C CE1 . PHE A 1  730  ? 215.959 170.451 175.109 1.00 370.00 ? 730  PHE A CE1 1 
ATOM 1663  C CE2 . PHE A 1  730  ? 214.320 170.098 176.818 1.00 370.00 ? 730  PHE A CE2 1 
ATOM 1664  C CZ  . PHE A 1  730  ? 215.232 169.593 175.912 1.00 370.00 ? 730  PHE A CZ  1 
ATOM 1665  N N   . LEU A 1  731  ? 215.609 176.554 175.844 1.00 370.00 ? 731  LEU A N   1 
ATOM 1666  C CA  . LEU A 1  731  ? 215.519 177.999 175.674 1.00 370.00 ? 731  LEU A CA  1 
ATOM 1667  C C   . LEU A 1  731  ? 214.099 178.504 175.877 1.00 370.00 ? 731  LEU A C   1 
ATOM 1668  O O   . LEU A 1  731  ? 213.906 179.641 176.323 1.00 370.00 ? 731  LEU A O   1 
ATOM 1669  C CB  . LEU A 1  731  ? 216.016 178.421 174.288 1.00 370.00 ? 731  LEU A CB  1 
ATOM 1670  C CG  . LEU A 1  731  ? 217.520 178.431 173.995 1.00 370.00 ? 731  LEU A CG  1 
ATOM 1671  C CD1 . LEU A 1  731  ? 218.035 177.049 173.605 1.00 370.00 ? 731  LEU A CD1 1 
ATOM 1672  C CD2 . LEU A 1  731  ? 217.863 179.471 172.944 1.00 370.00 ? 731  LEU A CD2 1 
ATOM 1673  N N   . GLY A 1  732  ? 213.098 177.679 175.567 1.00 370.00 ? 732  GLY A N   1 
ATOM 1674  C CA  . GLY A 1  732  ? 211.715 178.002 175.823 1.00 370.00 ? 732  GLY A CA  1 
ATOM 1675  C C   . GLY A 1  732  ? 211.194 177.232 177.028 1.00 370.00 ? 732  GLY A C   1 
ATOM 1676  O O   . GLY A 1  732  ? 211.774 176.243 177.473 1.00 370.00 ? 732  GLY A O   1 
ATOM 1677  N N   . SER A 1  733  ? 210.068 177.707 177.548 1.00 370.00 ? 733  SER A N   1 
ATOM 1678  C CA  . SER A 1  733  ? 209.482 177.150 178.757 1.00 370.00 ? 733  SER A CA  1 
ATOM 1679  C C   . SER A 1  733  ? 208.411 176.124 178.410 1.00 370.00 ? 733  SER A C   1 
ATOM 1680  O O   . SER A 1  733  ? 207.663 176.279 177.441 1.00 370.00 ? 733  SER A O   1 
ATOM 1681  C CB  . SER A 1  733  ? 208.881 178.254 179.629 1.00 370.00 ? 733  SER A CB  1 
ATOM 1682  O OG  . SER A 1  733  ? 209.885 179.140 180.093 1.00 370.00 ? 733  SER A OG  1 
ATOM 1683  N N   . LEU A 1  734  ? 208.359 175.065 179.212 1.00 370.00 ? 734  LEU A N   1 
ATOM 1684  C CA  . LEU A 1  734  ? 207.321 174.056 179.063 1.00 370.00 ? 734  LEU A CA  1 
ATOM 1685  C C   . LEU A 1  734  ? 205.970 174.624 179.480 1.00 370.00 ? 734  LEU A C   1 
ATOM 1686  O O   . LEU A 1  734  ? 205.886 175.525 180.318 1.00 370.00 ? 734  LEU A O   1 
ATOM 1687  C CB  . LEU A 1  734  ? 207.645 172.811 179.895 1.00 370.00 ? 734  LEU A CB  1 
ATOM 1688  C CG  . LEU A 1  734  ? 208.610 171.743 179.359 1.00 370.00 ? 734  LEU A CG  1 
ATOM 1689  C CD1 . LEU A 1  734  ? 210.070 172.178 179.414 1.00 370.00 ? 734  LEU A CD1 1 
ATOM 1690  C CD2 . LEU A 1  734  ? 208.419 170.431 180.110 1.00 370.00 ? 734  LEU A CD2 1 
ATOM 1691  N N   . HIS A 1  735  ? 204.920 174.115 178.867 1.00 370.00 ? 735  HIS A N   1 
ATOM 1692  C CA  . HIS A 1  735  ? 203.558 174.417 179.265 1.00 370.00 ? 735  HIS A CA  1 
ATOM 1693  C C   . HIS A 1  735  ? 203.124 173.469 180.375 1.00 370.00 ? 735  HIS A C   1 
ATOM 1694  O O   . HIS A 1  735  ? 203.709 172.395 180.543 1.00 370.00 ? 735  HIS A O   1 
ATOM 1695  C CB  . HIS A 1  735  ? 202.629 174.301 178.056 1.00 370.00 ? 735  HIS A CB  1 
ATOM 1696  C CG  . HIS A 1  735  ? 202.872 175.345 177.012 1.00 370.00 ? 735  HIS A CG  1 
ATOM 1697  N ND1 . HIS A 1  735  ? 203.789 175.184 175.996 1.00 370.00 ? 735  HIS A ND1 1 
ATOM 1698  C CD2 . HIS A 1  735  ? 202.323 176.570 176.831 1.00 370.00 ? 735  HIS A CD2 1 
ATOM 1699  C CE1 . HIS A 1  735  ? 203.793 176.262 175.233 1.00 370.00 ? 735  HIS A CE1 1 
ATOM 1700  N NE2 . HIS A 1  735  ? 202.912 177.118 175.718 1.00 370.00 ? 735  HIS A NE2 1 
ATOM 1701  N N   . PRO A 1  736  ? 202.137 173.855 181.189 1.00 370.00 ? 736  PRO A N   1 
ATOM 1702  C CA  . PRO A 1  736  ? 201.608 172.918 182.191 1.00 370.00 ? 736  PRO A CA  1 
ATOM 1703  C C   . PRO A 1  736  ? 200.919 171.728 181.536 1.00 370.00 ? 736  PRO A C   1 
ATOM 1704  O O   . PRO A 1  736  ? 200.040 171.884 180.686 1.00 370.00 ? 736  PRO A O   1 
ATOM 1705  C CB  . PRO A 1  736  ? 200.622 173.777 182.992 1.00 370.00 ? 736  PRO A CB  1 
ATOM 1706  C CG  . PRO A 1  736  ? 201.123 175.169 182.822 1.00 370.00 ? 736  PRO A CG  1 
ATOM 1707  C CD  . PRO A 1  736  ? 201.649 175.227 181.420 1.00 370.00 ? 736  PRO A CD  1 
ATOM 1708  N N   . GLY A 1  737  ? 201.339 170.528 181.934 1.00 370.00 ? 737  GLY A N   1 
ATOM 1709  C CA  . GLY A 1  737  ? 200.849 169.305 181.337 1.00 370.00 ? 737  GLY A CA  1 
ATOM 1710  C C   . GLY A 1  737  ? 201.592 168.849 180.101 1.00 370.00 ? 737  GLY A C   1 
ATOM 1711  O O   . GLY A 1  737  ? 201.184 167.854 179.487 1.00 370.00 ? 737  GLY A O   1 
ATOM 1712  N N   . GLN A 1  738  ? 202.664 169.536 179.713 1.00 370.00 ? 738  GLN A N   1 
ATOM 1713  C CA  . GLN A 1  738  ? 203.425 169.189 178.521 1.00 370.00 ? 738  GLN A CA  1 
ATOM 1714  C C   . GLN A 1  738  ? 204.560 168.236 178.873 1.00 370.00 ? 738  GLN A C   1 
ATOM 1715  O O   . GLN A 1  738  ? 205.352 168.509 179.781 1.00 370.00 ? 738  GLN A O   1 
ATOM 1716  C CB  . GLN A 1  738  ? 203.985 170.446 177.855 1.00 370.00 ? 738  GLN A CB  1 
ATOM 1717  C CG  . GLN A 1  738  ? 204.726 170.178 176.556 1.00 370.00 ? 738  GLN A CG  1 
ATOM 1718  C CD  . GLN A 1  738  ? 205.241 171.446 175.908 1.00 370.00 ? 738  GLN A CD  1 
ATOM 1719  O OE1 . GLN A 1  738  ? 205.076 172.541 176.446 1.00 370.00 ? 738  GLN A OE1 1 
ATOM 1720  N NE2 . GLN A 1  738  ? 205.870 171.305 174.747 1.00 370.00 ? 738  GLN A NE2 1 
ATOM 1721  N N   . LEU A 1  739  ? 204.637 167.124 178.148 1.00 370.00 ? 739  LEU A N   1 
ATOM 1722  C CA  . LEU A 1  739  ? 205.727 166.166 178.278 1.00 370.00 ? 739  LEU A CA  1 
ATOM 1723  C C   . LEU A 1  739  ? 206.665 166.345 177.091 1.00 370.00 ? 739  LEU A C   1 
ATOM 1724  O O   . LEU A 1  739  ? 206.214 166.399 175.943 1.00 370.00 ? 739  LEU A O   1 
ATOM 1725  C CB  . LEU A 1  739  ? 205.182 164.734 178.347 1.00 370.00 ? 739  LEU A CB  1 
ATOM 1726  C CG  . LEU A 1  739  ? 206.043 163.517 178.730 1.00 370.00 ? 739  LEU A CG  1 
ATOM 1727  C CD1 . LEU A 1  739  ? 206.860 162.928 177.573 1.00 370.00 ? 739  LEU A CD1 1 
ATOM 1728  C CD2 . LEU A 1  739  ? 206.954 163.860 179.901 1.00 370.00 ? 739  LEU A CD2 1 
ATOM 1729  N N   . LEU A 1  740  ? 207.964 166.440 177.370 1.00 370.00 ? 740  LEU A N   1 
ATOM 1730  C CA  . LEU A 1  740  ? 208.970 166.648 176.334 1.00 370.00 ? 740  LEU A CA  1 
ATOM 1731  C C   . LEU A 1  740  ? 210.131 165.696 176.566 1.00 370.00 ? 740  LEU A C   1 
ATOM 1732  O O   . LEU A 1  740  ? 210.821 165.790 177.587 1.00 370.00 ? 740  LEU A O   1 
ATOM 1733  C CB  . LEU A 1  740  ? 209.458 168.100 176.325 1.00 370.00 ? 740  LEU A CB  1 
ATOM 1734  C CG  . LEU A 1  740  ? 210.486 168.492 175.263 1.00 370.00 ? 740  LEU A CG  1 
ATOM 1735  C CD1 . LEU A 1  740  ? 209.906 168.302 173.876 1.00 370.00 ? 740  LEU A CD1 1 
ATOM 1736  C CD2 . LEU A 1  740  ? 210.923 169.933 175.474 1.00 370.00 ? 740  LEU A CD2 1 
ATOM 1737  N N   . GLN A 1  741  ? 210.344 164.788 175.619 1.00 370.00 ? 741  GLN A N   1 
ATOM 1738  C CA  . GLN A 1  741  ? 211.454 163.852 175.682 1.00 370.00 ? 741  GLN A CA  1 
ATOM 1739  C C   . GLN A 1  741  ? 212.716 164.496 175.119 1.00 370.00 ? 741  GLN A C   1 
ATOM 1740  O O   . GLN A 1  741  ? 212.653 165.363 174.243 1.00 370.00 ? 741  GLN A O   1 
ATOM 1741  C CB  . GLN A 1  741  ? 211.115 162.582 174.903 1.00 370.00 ? 741  GLN A CB  1 
ATOM 1742  C CG  . GLN A 1  741  ? 209.964 161.780 175.486 1.00 370.00 ? 741  GLN A CG  1 
ATOM 1743  C CD  . GLN A 1  741  ? 209.603 160.578 174.634 1.00 370.00 ? 741  GLN A CD  1 
ATOM 1744  O OE1 . GLN A 1  741  ? 210.170 160.369 173.562 1.00 370.00 ? 741  GLN A OE1 1 
ATOM 1745  N NE2 . GLN A 1  741  ? 208.649 159.784 175.106 1.00 370.00 ? 741  GLN A NE2 1 
ATOM 1746  N N   . ALA A 1  742  ? 213.870 164.053 175.619 1.00 370.00 ? 742  ALA A N   1 
ATOM 1747  C CA  . ALA A 1  742  ? 215.130 164.688 175.258 1.00 370.00 ? 742  ALA A CA  1 
ATOM 1748  C C   . ALA A 1  742  ? 216.298 163.745 175.504 1.00 370.00 ? 742  ALA A C   1 
ATOM 1749  O O   . ALA A 1  742  ? 216.294 162.972 176.463 1.00 370.00 ? 742  ALA A O   1 
ATOM 1750  C CB  . ALA A 1  742  ? 215.344 165.983 176.051 1.00 370.00 ? 742  ALA A CB  1 
ATOM 1751  N N   . PHE A 1  743  ? 217.311 163.841 174.640 1.00 370.00 ? 743  PHE A N   1 
ATOM 1752  C CA  . PHE A 1  743  ? 218.598 163.196 174.881 1.00 370.00 ? 743  PHE A CA  1 
ATOM 1753  C C   . PHE A 1  743  ? 219.427 164.004 175.871 1.00 370.00 ? 743  PHE A C   1 
ATOM 1754  O O   . PHE A 1  743  ? 219.452 165.236 175.823 1.00 370.00 ? 743  PHE A O   1 
ATOM 1755  C CB  . PHE A 1  743  ? 219.387 163.036 173.577 1.00 370.00 ? 743  PHE A CB  1 
ATOM 1756  C CG  . PHE A 1  743  ? 218.981 161.847 172.750 1.00 370.00 ? 743  PHE A CG  1 
ATOM 1757  C CD1 . PHE A 1  743  ? 218.266 160.799 173.311 1.00 370.00 ? 743  PHE A CD1 1 
ATOM 1758  C CD2 . PHE A 1  743  ? 219.334 161.775 171.407 1.00 370.00 ? 743  PHE A CD2 1 
ATOM 1759  C CE1 . PHE A 1  743  ? 217.907 159.701 172.551 1.00 370.00 ? 743  PHE A CE1 1 
ATOM 1760  C CE2 . PHE A 1  743  ? 218.971 160.683 170.637 1.00 370.00 ? 743  PHE A CE2 1 
ATOM 1761  C CZ  . PHE A 1  743  ? 218.255 159.645 171.209 1.00 370.00 ? 743  PHE A CZ  1 
ATOM 1762  N N   . GLU A 1  744  ? 220.119 163.299 176.768 1.00 370.00 ? 744  GLU A N   1 
ATOM 1763  C CA  . GLU A 1  744  ? 220.920 163.937 177.809 1.00 370.00 ? 744  GLU A CA  1 
ATOM 1764  C C   . GLU A 1  744  ? 222.241 163.194 177.942 1.00 370.00 ? 744  GLU A C   1 
ATOM 1765  O O   . GLU A 1  744  ? 222.250 161.982 178.179 1.00 370.00 ? 744  GLU A O   1 
ATOM 1766  C CB  . GLU A 1  744  ? 220.193 163.950 179.162 1.00 370.00 ? 744  GLU A CB  1 
ATOM 1767  C CG  . GLU A 1  744  ? 218.870 164.709 179.209 1.00 370.00 ? 744  GLU A CG  1 
ATOM 1768  C CD  . GLU A 1  744  ? 219.009 166.193 178.964 1.00 370.00 ? 744  GLU A CD  1 
ATOM 1769  O OE1 . GLU A 1  744  ? 220.049 166.778 179.341 1.00 370.00 ? 744  GLU A OE1 1 
ATOM 1770  O OE2 . GLU A 1  744  ? 218.060 166.770 178.393 1.00 370.00 ? 744  GLU A OE2 1 
ATOM 1771  N N   . ASN A 1  745  ? 223.345 163.919 177.797 1.00 370.00 ? 745  ASN A N   1 
ATOM 1772  C CA  . ASN A 1  745  ? 224.680 163.406 178.087 1.00 370.00 ? 745  ASN A CA  1 
ATOM 1773  C C   . ASN A 1  745  ? 225.566 164.591 178.455 1.00 370.00 ? 745  ASN A C   1 
ATOM 1774  O O   . ASN A 1  745  ? 225.080 165.708 178.662 1.00 370.00 ? 745  ASN A O   1 
ATOM 1775  C CB  . ASN A 1  745  ? 225.233 162.576 176.917 1.00 370.00 ? 745  ASN A CB  1 
ATOM 1776  C CG  . ASN A 1  745  ? 225.233 163.324 175.587 1.00 370.00 ? 745  ASN A CG  1 
ATOM 1777  O OD1 . ASN A 1  745  ? 224.877 164.498 175.502 1.00 370.00 ? 745  ASN A OD1 1 
ATOM 1778  N ND2 . ASN A 1  745  ? 225.636 162.625 174.533 1.00 370.00 ? 745  ASN A ND2 1 
ATOM 1779  N N   . ASN A 1  746  ? 226.873 164.353 178.531 1.00 370.00 ? 746  ASN A N   1 
ATOM 1780  C CA  . ASN A 1  746  ? 227.795 165.433 178.849 1.00 370.00 ? 746  ASN A CA  1 
ATOM 1781  C C   . ASN A 1  746  ? 228.114 166.313 177.648 1.00 370.00 ? 746  ASN A C   1 
ATOM 1782  O O   . ASN A 1  746  ? 228.765 167.348 177.818 1.00 370.00 ? 746  ASN A O   1 
ATOM 1783  C CB  . ASN A 1  746  ? 229.093 164.869 179.433 1.00 370.00 ? 746  ASN A CB  1 
ATOM 1784  C CG  . ASN A 1  746  ? 228.919 164.342 180.845 1.00 370.00 ? 746  ASN A CG  1 
ATOM 1785  O OD1 . ASN A 1  746  ? 228.248 164.961 181.671 1.00 370.00 ? 746  ASN A OD1 1 
ATOM 1786  N ND2 . ASN A 1  746  ? 229.532 163.199 181.131 1.00 370.00 ? 746  ASN A ND2 1 
ATOM 1787  N N   . LEU A 1  747  ? 227.680 165.932 176.447 1.00 370.00 ? 747  LEU A N   1 
ATOM 1788  C CA  . LEU A 1  747  ? 227.957 166.734 175.262 1.00 370.00 ? 747  LEU A CA  1 
ATOM 1789  C C   . LEU A 1  747  ? 226.860 167.752 174.966 1.00 370.00 ? 747  LEU A C   1 
ATOM 1790  O O   . LEU A 1  747  ? 227.151 168.944 174.816 1.00 370.00 ? 747  LEU A O   1 
ATOM 1791  C CB  . LEU A 1  747  ? 228.151 165.826 174.045 1.00 370.00 ? 747  LEU A CB  1 
ATOM 1792  C CG  . LEU A 1  747  ? 229.381 164.921 174.028 1.00 370.00 ? 747  LEU A CG  1 
ATOM 1793  C CD1 . LEU A 1  747  ? 229.310 163.978 172.842 1.00 370.00 ? 747  LEU A CD1 1 
ATOM 1794  C CD2 . LEU A 1  747  ? 230.648 165.754 173.968 1.00 370.00 ? 747  LEU A CD2 1 
ATOM 1795  N N   . PHE A 1  748  ? 225.600 167.326 174.916 1.00 370.00 ? 748  PHE A N   1 
ATOM 1796  C CA  . PHE A 1  748  ? 224.558 168.195 174.386 1.00 370.00 ? 748  PHE A CA  1 
ATOM 1797  C C   . PHE A 1  748  ? 223.209 167.828 174.986 1.00 370.00 ? 748  PHE A C   1 
ATOM 1798  O O   . PHE A 1  748  ? 223.036 166.765 175.586 1.00 370.00 ? 748  PHE A O   1 
ATOM 1799  C CB  . PHE A 1  748  ? 224.500 168.128 172.849 1.00 370.00 ? 748  PHE A CB  1 
ATOM 1800  C CG  . PHE A 1  748  ? 224.131 166.767 172.293 1.00 370.00 ? 748  PHE A CG  1 
ATOM 1801  C CD1 . PHE A 1  748  ? 225.113 165.815 172.062 1.00 370.00 ? 748  PHE A CD1 1 
ATOM 1802  C CD2 . PHE A 1  748  ? 222.816 166.456 171.956 1.00 370.00 ? 748  PHE A CD2 1 
ATOM 1803  C CE1 . PHE A 1  748  ? 224.793 164.572 171.544 1.00 370.00 ? 748  PHE A CE1 1 
ATOM 1804  C CE2 . PHE A 1  748  ? 222.488 165.212 171.436 1.00 370.00 ? 748  PHE A CE2 1 
ATOM 1805  C CZ  . PHE A 1  748  ? 223.480 164.271 171.228 1.00 370.00 ? 748  PHE A CZ  1 
ATOM 1806  N N   . ARG A 1  749  ? 222.257 168.738 174.806 1.00 370.00 ? 749  ARG A N   1 
ATOM 1807  C CA  . ARG A 1  749  ? 220.861 168.530 175.154 1.00 370.00 ? 749  ARG A CA  1 
ATOM 1808  C C   . ARG A 1  749  ? 220.000 168.785 173.927 1.00 370.00 ? 749  ARG A C   1 
ATOM 1809  O O   . ARG A 1  749  ? 220.142 169.814 173.266 1.00 370.00 ? 749  ARG A O   1 
ATOM 1810  C CB  . ARG A 1  749  ? 220.449 169.456 176.297 1.00 370.00 ? 749  ARG A CB  1 
ATOM 1811  C CG  . ARG A 1  749  ? 218.994 169.353 176.675 1.00 370.00 ? 749  ARG A CG  1 
ATOM 1812  C CD  . ARG A 1  749  ? 218.681 170.149 177.934 1.00 370.00 ? 749  ARG A CD  1 
ATOM 1813  N NE  . ARG A 1  749  ? 219.307 169.556 179.113 1.00 370.00 ? 749  ARG A NE  1 
ATOM 1814  C CZ  . ARG A 1  749  ? 220.290 170.119 179.805 1.00 370.00 ? 749  ARG A CZ  1 
ATOM 1815  N NH1 . ARG A 1  749  ? 220.772 171.300 179.442 1.00 370.00 ? 749  ARG A NH1 1 
ATOM 1816  N NH2 . ARG A 1  749  ? 220.797 169.494 180.860 1.00 370.00 ? 749  ARG A NH2 1 
ATOM 1817  N N   . ALA A 1  750  ? 219.099 167.852 173.622 1.00 370.00 ? 750  ALA A N   1 
ATOM 1818  C CA  . ALA A 1  750  ? 218.322 168.001 172.406 1.00 370.00 ? 750  ALA A CA  1 
ATOM 1819  C C   . ALA A 1  750  ? 217.005 167.256 172.535 1.00 370.00 ? 750  ALA A C   1 
ATOM 1820  O O   . ALA A 1  750  ? 217.004 166.090 172.956 1.00 370.00 ? 750  ALA A O   1 
ATOM 1821  C CB  . ALA A 1  750  ? 219.091 167.488 171.185 1.00 370.00 ? 750  ALA A CB  1 
ATOM 1822  N N   . PRO A 1  751  ? 215.886 167.883 172.177 1.00 370.00 ? 751  PRO A N   1 
ATOM 1823  C CA  . PRO A 1  751  ? 214.591 167.207 172.301 1.00 370.00 ? 751  PRO A CA  1 
ATOM 1824  C C   . PRO A 1  751  ? 214.416 166.117 171.255 1.00 370.00 ? 751  PRO A C   1 
ATOM 1825  O O   . PRO A 1  751  ? 214.809 166.263 170.095 1.00 370.00 ? 751  PRO A O   1 
ATOM 1826  C CB  . PRO A 1  751  ? 213.580 168.340 172.096 1.00 370.00 ? 751  PRO A CB  1 
ATOM 1827  C CG  . PRO A 1  751  ? 214.304 169.335 171.264 1.00 370.00 ? 751  PRO A CG  1 
ATOM 1828  C CD  . PRO A 1  751  ? 215.747 169.264 171.682 1.00 370.00 ? 751  PRO A CD  1 
ATOM 1829  N N   . ILE A 1  752  ? 213.807 165.008 171.684 1.00 370.00 ? 752  ILE A N   1 
ATOM 1830  C CA  . ILE A 1  752  ? 213.611 163.848 170.826 1.00 370.00 ? 752  ILE A CA  1 
ATOM 1831  C C   . ILE A 1  752  ? 212.125 163.514 170.776 1.00 370.00 ? 752  ILE A C   1 
ATOM 1832  O O   . ILE A 1  752  ? 211.376 163.737 171.730 1.00 370.00 ? 752  ILE A O   1 
ATOM 1833  C CB  . ILE A 1  752  ? 214.430 162.617 171.285 1.00 370.00 ? 752  ILE A CB  1 
ATOM 1834  C CG1 . ILE A 1  752  ? 213.996 162.145 172.670 1.00 370.00 ? 752  ILE A CG1 1 
ATOM 1835  C CG2 . ILE A 1  752  ? 215.907 162.943 171.327 1.00 370.00 ? 752  ILE A CG2 1 
ATOM 1836  C CD1 . ILE A 1  752  ? 214.513 160.801 173.027 1.00 370.00 ? 752  ILE A CD1 1 
ATOM 1837  N N   . TYR A 1  753  ? 211.712 162.948 169.642 1.00 370.00 ? 753  TYR A N   1 
ATOM 1838  C CA  . TYR A 1  753  ? 210.301 162.796 169.301 1.00 370.00 ? 753  TYR A CA  1 
ATOM 1839  C C   . TYR A 1  753  ? 210.071 161.392 168.771 1.00 370.00 ? 753  TYR A C   1 
ATOM 1840  O O   . TYR A 1  753  ? 210.573 161.048 167.697 1.00 370.00 ? 753  TYR A O   1 
ATOM 1841  C CB  . TYR A 1  753  ? 209.891 163.839 168.257 1.00 370.00 ? 753  TYR A CB  1 
ATOM 1842  C CG  . TYR A 1  753  ? 209.795 165.240 168.810 1.00 370.00 ? 753  TYR A CG  1 
ATOM 1843  C CD1 . TYR A 1  753  ? 209.379 165.468 170.116 1.00 370.00 ? 753  TYR A CD1 1 
ATOM 1844  C CD2 . TYR A 1  753  ? 210.204 166.328 168.058 1.00 370.00 ? 753  TYR A CD2 1 
ATOM 1845  C CE1 . TYR A 1  753  ? 209.318 166.744 170.636 1.00 370.00 ? 753  TYR A CE1 1 
ATOM 1846  C CE2 . TYR A 1  753  ? 210.149 167.612 168.568 1.00 370.00 ? 753  TYR A CE2 1 
ATOM 1847  C CZ  . TYR A 1  753  ? 209.707 167.811 169.859 1.00 370.00 ? 753  TYR A CZ  1 
ATOM 1848  O OH  . TYR A 1  753  ? 209.654 169.081 170.375 1.00 370.00 ? 753  TYR A OH  1 
ATOM 1849  N N   . LEU A 1  754  ? 209.296 160.599 169.505 1.00 370.00 ? 754  LEU A N   1 
ATOM 1850  C CA  . LEU A 1  754  ? 209.068 159.214 169.119 1.00 370.00 ? 754  LEU A CA  1 
ATOM 1851  C C   . LEU A 1  754  ? 208.135 159.135 167.919 1.00 370.00 ? 754  LEU A C   1 
ATOM 1852  O O   . LEU A 1  754  ? 207.009 159.643 167.954 1.00 370.00 ? 754  LEU A O   1 
ATOM 1853  C CB  . LEU A 1  754  ? 208.490 158.421 170.290 1.00 370.00 ? 754  LEU A CB  1 
ATOM 1854  C CG  . LEU A 1  754  ? 208.238 156.938 170.005 1.00 370.00 ? 754  LEU A CG  1 
ATOM 1855  C CD1 . LEU A 1  754  ? 209.532 156.215 169.656 1.00 370.00 ? 754  LEU A CD1 1 
ATOM 1856  C CD2 . LEU A 1  754  ? 207.559 156.278 171.191 1.00 370.00 ? 754  LEU A CD2 1 
ATOM 1857  N N   . HIS A 1  755  ? 208.613 158.495 166.858 1.00 370.00 ? 755  HIS A N   1 
ATOM 1858  C CA  . HIS A 1  755  ? 207.844 158.244 165.650 1.00 370.00 ? 755  HIS A CA  1 
ATOM 1859  C C   . HIS A 1  755  ? 207.875 156.752 165.348 1.00 370.00 ? 755  HIS A C   1 
ATOM 1860  O O   . HIS A 1  755  ? 208.546 155.970 166.026 1.00 370.00 ? 755  HIS A O   1 
ATOM 1861  C CB  . HIS A 1  755  ? 208.385 159.054 164.464 1.00 370.00 ? 755  HIS A CB  1 
ATOM 1862  C CG  . HIS A 1  755  ? 208.156 160.529 164.584 1.00 370.00 ? 755  HIS A CG  1 
ATOM 1863  N ND1 . HIS A 1  755  ? 206.938 161.116 164.315 1.00 370.00 ? 755  HIS A ND1 1 
ATOM 1864  C CD2 . HIS A 1  755  ? 208.982 161.534 164.957 1.00 370.00 ? 755  HIS A CD2 1 
ATOM 1865  C CE1 . HIS A 1  755  ? 207.028 162.420 164.504 1.00 370.00 ? 755  HIS A CE1 1 
ATOM 1866  N NE2 . HIS A 1  755  ? 208.259 162.700 164.894 1.00 370.00 ? 755  HIS A NE2 1 
ATOM 1867  N N   . LYS A 1  756  ? 207.137 156.358 164.317 1.00 370.00 ? 756  LYS A N   1 
ATOM 1868  C CA  . LYS A 1  756  ? 207.063 154.966 163.903 1.00 370.00 ? 756  LYS A CA  1 
ATOM 1869  C C   . LYS A 1  756  ? 207.962 154.745 162.696 1.00 370.00 ? 756  LYS A C   1 
ATOM 1870  O O   . LYS A 1  756  ? 207.970 155.557 161.764 1.00 370.00 ? 756  LYS A O   1 
ATOM 1871  C CB  . LYS A 1  756  ? 205.624 154.563 163.579 1.00 370.00 ? 756  LYS A CB  1 
ATOM 1872  C CG  . LYS A 1  756  ? 204.710 154.533 164.792 1.00 370.00 ? 756  LYS A CG  1 
ATOM 1873  C CD  . LYS A 1  756  ? 203.307 154.094 164.415 1.00 370.00 ? 756  LYS A CD  1 
ATOM 1874  C CE  . LYS A 1  756  ? 202.430 153.932 165.646 1.00 370.00 ? 756  LYS A CE  1 
ATOM 1875  N NZ  . LYS A 1  756  ? 202.167 155.231 166.324 1.00 370.00 ? 756  LYS A NZ  1 
ATOM 1876  N N   . MET A 1  757  ? 208.740 153.669 162.737 1.00 370.00 ? 757  MET A N   1 
ATOM 1877  C CA  . MET A 1  757  ? 209.534 153.281 161.584 1.00 370.00 ? 757  MET A CA  1 
ATOM 1878  C C   . MET A 1  757  ? 208.591 152.822 160.474 1.00 370.00 ? 757  MET A C   1 
ATOM 1879  O O   . MET A 1  757  ? 207.574 152.178 160.763 1.00 370.00 ? 757  MET A O   1 
ATOM 1880  C CB  . MET A 1  757  ? 210.505 152.160 161.965 1.00 370.00 ? 757  MET A CB  1 
ATOM 1881  C CG  . MET A 1  757  ? 211.680 151.965 161.030 1.00 370.00 ? 757  MET A CG  1 
ATOM 1882  S SD  . MET A 1  757  ? 212.838 153.340 161.158 1.00 370.00 ? 757  MET A SD  1 
ATOM 1883  C CE  . MET A 1  757  ? 213.698 153.232 159.597 1.00 370.00 ? 757  MET A CE  1 
ATOM 1884  N N   . PRO A 1  758  ? 208.848 153.195 159.216 1.00 370.00 ? 758  PRO A N   1 
ATOM 1885  C CA  . PRO A 1  758  ? 207.971 152.760 158.119 1.00 370.00 ? 758  PRO A CA  1 
ATOM 1886  C C   . PRO A 1  758  ? 207.983 151.248 157.935 1.00 370.00 ? 758  PRO A C   1 
ATOM 1887  O O   . PRO A 1  758  ? 208.968 150.571 158.236 1.00 370.00 ? 758  PRO A O   1 
ATOM 1888  C CB  . PRO A 1  758  ? 208.551 153.479 156.896 1.00 370.00 ? 758  PRO A CB  1 
ATOM 1889  C CG  . PRO A 1  758  ? 209.241 154.669 157.459 1.00 370.00 ? 758  PRO A CG  1 
ATOM 1890  C CD  . PRO A 1  758  ? 209.815 154.213 158.768 1.00 370.00 ? 758  PRO A CD  1 
ATOM 1891  N N   . GLU A 1  759  ? 206.856 150.723 157.440 1.00 370.00 ? 759  GLU A N   1 
ATOM 1892  C CA  . GLU A 1  759  ? 206.666 149.282 157.301 1.00 370.00 ? 759  GLU A CA  1 
ATOM 1893  C C   . GLU A 1  759  ? 207.574 148.657 156.248 1.00 370.00 ? 759  GLU A C   1 
ATOM 1894  O O   . GLU A 1  759  ? 207.723 147.430 156.232 1.00 370.00 ? 759  GLU A O   1 
ATOM 1895  C CB  . GLU A 1  759  ? 205.204 148.980 156.963 1.00 370.00 ? 759  GLU A CB  1 
ATOM 1896  C CG  . GLU A 1  759  ? 204.210 149.378 158.050 1.00 370.00 ? 759  GLU A CG  1 
ATOM 1897  C CD  . GLU A 1  759  ? 204.334 148.540 159.309 1.00 370.00 ? 759  GLU A CD  1 
ATOM 1898  O OE1 . GLU A 1  759  ? 204.667 147.342 159.202 1.00 370.00 ? 759  GLU A OE1 1 
ATOM 1899  O OE2 . GLU A 1  759  ? 204.095 149.084 160.408 1.00 370.00 ? 759  GLU A OE2 1 
ATOM 1900  N N   . THR A 1  760  ? 208.181 149.460 155.378 1.00 370.00 ? 760  THR A N   1 
ATOM 1901  C CA  . THR A 1  760  ? 209.086 148.965 154.356 1.00 370.00 ? 760  THR A CA  1 
ATOM 1902  C C   . THR A 1  760  ? 210.543 148.945 154.793 1.00 370.00 ? 760  THR A C   1 
ATOM 1903  O O   . THR A 1  760  ? 211.375 148.367 154.084 1.00 370.00 ? 760  THR A O   1 
ATOM 1904  C CB  . THR A 1  760  ? 208.954 149.811 153.088 1.00 370.00 ? 760  THR A CB  1 
ATOM 1905  O OG1 . THR A 1  760  ? 209.319 151.167 153.373 1.00 370.00 ? 760  THR A OG1 1 
ATOM 1906  C CG2 . THR A 1  760  ? 207.524 149.775 152.589 1.00 370.00 ? 760  THR A CG2 1 
ATOM 1907  N N   . ASP A 1  761  ? 210.876 149.535 155.935 1.00 370.00 ? 761  ASP A N   1 
ATOM 1908  C CA  . ASP A 1  761  ? 212.263 149.779 156.300 1.00 370.00 ? 761  ASP A CA  1 
ATOM 1909  C C   . ASP A 1  761  ? 212.720 148.822 157.393 1.00 370.00 ? 761  ASP A C   1 
ATOM 1910  O O   . ASP A 1  761  ? 212.048 148.664 158.417 1.00 370.00 ? 761  ASP A O   1 
ATOM 1911  C CB  . ASP A 1  761  ? 212.452 151.228 156.754 1.00 370.00 ? 761  ASP A CB  1 
ATOM 1912  C CG  . ASP A 1  761  ? 212.294 152.218 155.617 1.00 370.00 ? 761  ASP A CG  1 
ATOM 1913  O OD1 . ASP A 1  761  ? 212.565 151.839 154.460 1.00 370.00 ? 761  ASP A OD1 1 
ATOM 1914  O OD2 . ASP A 1  761  ? 211.904 153.375 155.877 1.00 370.00 ? 761  ASP A OD2 1 
ATOM 1915  N N   . PHE A 1  762  ? 213.888 148.215 157.177 1.00 370.00 ? 762  PHE A N   1 
ATOM 1916  C CA  . PHE A 1  762  ? 214.487 147.259 158.098 1.00 370.00 ? 762  PHE A CA  1 
ATOM 1917  C C   . PHE A 1  762  ? 215.918 147.684 158.397 1.00 370.00 ? 762  PHE A C   1 
ATOM 1918  O O   . PHE A 1  762  ? 216.523 148.462 157.657 1.00 370.00 ? 762  PHE A O   1 
ATOM 1919  C CB  . PHE A 1  762  ? 214.492 145.835 157.519 1.00 370.00 ? 762  PHE A CB  1 
ATOM 1920  C CG  . PHE A 1  762  ? 213.144 145.170 157.496 1.00 370.00 ? 762  PHE A CG  1 
ATOM 1921  C CD1 . PHE A 1  762  ? 212.159 145.528 158.404 1.00 370.00 ? 762  PHE A CD1 1 
ATOM 1922  C CD2 . PHE A 1  762  ? 212.851 144.208 156.539 1.00 370.00 ? 762  PHE A CD2 1 
ATOM 1923  C CE1 . PHE A 1  762  ? 210.917 144.925 158.378 1.00 370.00 ? 762  PHE A CE1 1 
ATOM 1924  C CE2 . PHE A 1  762  ? 211.609 143.602 156.503 1.00 370.00 ? 762  PHE A CE2 1 
ATOM 1925  C CZ  . PHE A 1  762  ? 210.642 143.963 157.424 1.00 370.00 ? 762  PHE A CZ  1 
ATOM 1926  N N   . LEU A 1  763  ? 216.455 147.158 159.495 1.00 370.00 ? 763  LEU A N   1 
ATOM 1927  C CA  . LEU A 1  763  ? 217.845 147.379 159.876 1.00 370.00 ? 763  LEU A CA  1 
ATOM 1928  C C   . LEU A 1  763  ? 218.697 146.209 159.406 1.00 370.00 ? 763  LEU A C   1 
ATOM 1929  O O   . LEU A 1  763  ? 218.449 145.061 159.788 1.00 370.00 ? 763  LEU A O   1 
ATOM 1930  C CB  . LEU A 1  763  ? 217.983 147.552 161.390 1.00 370.00 ? 763  LEU A CB  1 
ATOM 1931  C CG  . LEU A 1  763  ? 219.416 147.742 161.899 1.00 370.00 ? 763  LEU A CG  1 
ATOM 1932  C CD1 . LEU A 1  763  ? 220.047 148.975 161.289 1.00 370.00 ? 763  LEU A CD1 1 
ATOM 1933  C CD2 . LEU A 1  763  ? 219.457 147.824 163.415 1.00 370.00 ? 763  LEU A CD2 1 
ATOM 1934  N N   . ILE A 1  764  ? 219.703 146.504 158.587 1.00 370.00 ? 764  ILE A N   1 
ATOM 1935  C CA  . ILE A 1  764  ? 220.634 145.502 158.081 1.00 370.00 ? 764  ILE A CA  1 
ATOM 1936  C C   . ILE A 1  764  ? 221.973 145.696 158.772 1.00 370.00 ? 764  ILE A C   1 
ATOM 1937  O O   . ILE A 1  764  ? 222.572 146.774 158.687 1.00 370.00 ? 764  ILE A O   1 
ATOM 1938  C CB  . ILE A 1  764  ? 220.790 145.592 156.553 1.00 370.00 ? 764  ILE A CB  1 
ATOM 1939  C CG1 . ILE A 1  764  ? 219.444 145.371 155.871 1.00 370.00 ? 764  ILE A CG1 1 
ATOM 1940  C CG2 . ILE A 1  764  ? 221.806 144.574 156.053 1.00 370.00 ? 764  ILE A CG2 1 
ATOM 1941  C CD1 . ILE A 1  764  ? 218.838 144.008 156.116 1.00 370.00 ? 764  ILE A CD1 1 
ATOM 1942  N N   . ILE A 1  765  ? 222.444 144.658 159.448 1.00 370.00 ? 765  ILE A N   1 
ATOM 1943  C CA  . ILE A 1  765  ? 223.765 144.656 160.061 1.00 370.00 ? 765  ILE A CA  1 
ATOM 1944  C C   . ILE A 1  765  ? 224.696 143.898 159.130 1.00 370.00 ? 765  ILE A C   1 
ATOM 1945  O O   . ILE A 1  765  ? 224.438 142.734 158.799 1.00 370.00 ? 765  ILE A O   1 
ATOM 1946  C CB  . ILE A 1  765  ? 223.729 144.015 161.458 1.00 370.00 ? 765  ILE A CB  1 
ATOM 1947  C CG1 . ILE A 1  765  ? 222.785 144.793 162.377 1.00 370.00 ? 765  ILE A CG1 1 
ATOM 1948  C CG2 . ILE A 1  765  ? 225.131 143.937 162.052 1.00 370.00 ? 765  ILE A CG2 1 
ATOM 1949  C CD1 . ILE A 1  765  ? 222.449 144.068 163.662 1.00 370.00 ? 765  ILE A CD1 1 
ATOM 1950  N N   . ARG A 1  766  ? 225.774 144.548 158.701 1.00 370.00 ? 766  ARG A N   1 
ATOM 1951  C CA  . ARG A 1  766  ? 226.678 143.971 157.717 1.00 370.00 ? 766  ARG A CA  1 
ATOM 1952  C C   . ARG A 1  766  ? 228.073 143.866 158.311 1.00 370.00 ? 766  ARG A C   1 
ATOM 1953  O O   . ARG A 1  766  ? 228.653 144.870 158.739 1.00 370.00 ? 766  ARG A O   1 
ATOM 1954  C CB  . ARG A 1  766  ? 226.682 144.795 156.419 1.00 370.00 ? 766  ARG A CB  1 
ATOM 1955  C CG  . ARG A 1  766  ? 227.571 144.236 155.315 1.00 370.00 ? 766  ARG A CG  1 
ATOM 1956  C CD  . ARG A 1  766  ? 228.820 145.062 155.063 1.00 370.00 ? 766  ARG A CD  1 
ATOM 1957  N NE  . ARG A 1  766  ? 229.653 144.453 154.027 1.00 370.00 ? 766  ARG A NE  1 
ATOM 1958  C CZ  . ARG A 1  766  ? 229.468 144.601 152.715 1.00 370.00 ? 766  ARG A CZ  1 
ATOM 1959  N NH1 . ARG A 1  766  ? 228.460 145.328 152.248 1.00 370.00 ? 766  ARG A NH1 1 
ATOM 1960  N NH2 . ARG A 1  766  ? 230.285 144.000 151.862 1.00 370.00 ? 766  ARG A NH2 1 
ATOM 1961  N N   . THR A 1  767  ? 228.592 142.643 158.345 1.00 370.00 ? 767  THR A N   1 
ATOM 1962  C CA  . THR A 1  767  ? 229.934 142.336 158.810 1.00 370.00 ? 767  THR A CA  1 
ATOM 1963  C C   . THR A 1  767  ? 230.668 141.591 157.704 1.00 370.00 ? 767  THR A C   1 
ATOM 1964  O O   . THR A 1  767  ? 230.127 141.357 156.620 1.00 370.00 ? 767  THR A O   1 
ATOM 1965  C CB  . THR A 1  767  ? 229.921 141.489 160.093 1.00 370.00 ? 767  THR A CB  1 
ATOM 1966  O OG1 . THR A 1  767  ? 229.253 140.247 159.840 1.00 370.00 ? 767  THR A OG1 1 
ATOM 1967  C CG2 . THR A 1  767  ? 229.220 142.225 161.234 1.00 370.00 ? 767  THR A CG2 1 
ATOM 1968  N N   . ARG A 1  768  ? 231.931 141.252 157.980 1.00 370.00 ? 768  ARG A N   1 
ATOM 1969  C CA  . ARG A 1  768  ? 232.714 140.439 157.055 1.00 370.00 ? 768  ARG A CA  1 
ATOM 1970  C C   . ARG A 1  768  ? 232.131 139.039 156.896 1.00 370.00 ? 768  ARG A C   1 
ATOM 1971  O O   . ARG A 1  768  ? 232.222 138.442 155.817 1.00 370.00 ? 768  ARG A O   1 
ATOM 1972  C CB  . ARG A 1  768  ? 234.165 140.359 157.537 1.00 370.00 ? 768  ARG A CB  1 
ATOM 1973  C CG  . ARG A 1  768  ? 235.137 139.734 156.546 1.00 370.00 ? 768  ARG A CG  1 
ATOM 1974  C CD  . ARG A 1  768  ? 236.538 139.650 157.127 1.00 370.00 ? 768  ARG A CD  1 
ATOM 1975  N NE  . ARG A 1  768  ? 237.105 140.968 157.399 1.00 370.00 ? 768  ARG A NE  1 
ATOM 1976  C CZ  . ARG A 1  768  ? 237.765 141.699 156.507 1.00 370.00 ? 768  ARG A CZ  1 
ATOM 1977  N NH1 . ARG A 1  768  ? 237.950 141.242 155.275 1.00 370.00 ? 768  ARG A NH1 1 
ATOM 1978  N NH2 . ARG A 1  768  ? 238.246 142.888 156.848 1.00 370.00 ? 768  ARG A NH2 1 
ATOM 1979  N N   . GLN A 1  769  ? 231.513 138.510 157.952 1.00 370.00 ? 769  GLN A N   1 
ATOM 1980  C CA  . GLN A 1  769  ? 231.054 137.128 157.966 1.00 370.00 ? 769  GLN A CA  1 
ATOM 1981  C C   . GLN A 1  769  ? 229.663 136.937 157.376 1.00 370.00 ? 769  GLN A C   1 
ATOM 1982  O O   . GLN A 1  769  ? 229.350 135.827 156.933 1.00 370.00 ? 769  GLN A O   1 
ATOM 1983  C CB  . GLN A 1  769  ? 231.074 136.575 159.397 1.00 370.00 ? 769  GLN A CB  1 
ATOM 1984  C CG  . GLN A 1  769  ? 232.471 136.321 159.962 1.00 370.00 ? 769  GLN A CG  1 
ATOM 1985  C CD  . GLN A 1  769  ? 233.121 137.565 160.545 1.00 370.00 ? 769  GLN A CD  1 
ATOM 1986  O OE1 . GLN A 1  769  ? 232.450 138.556 160.831 1.00 370.00 ? 769  GLN A OE1 1 
ATOM 1987  N NE2 . GLN A 1  769  ? 234.436 137.514 160.724 1.00 370.00 ? 769  GLN A NE2 1 
ATOM 1988  N N   . GLY A 1  770  ? 228.828 137.966 157.351 1.00 370.00 ? 770  GLY A N   1 
ATOM 1989  C CA  . GLY A 1  770  ? 227.497 137.785 156.805 1.00 370.00 ? 770  GLY A CA  1 
ATOM 1990  C C   . GLY A 1  770  ? 226.628 139.006 157.000 1.00 370.00 ? 770  GLY A C   1 
ATOM 1991  O O   . GLY A 1  770  ? 227.007 139.980 157.657 1.00 370.00 ? 770  GLY A O   1 
ATOM 1992  N N   . TYR A 1  771  ? 225.442 138.928 156.400 1.00 370.00 ? 771  TYR A N   1 
ATOM 1993  C CA  . TYR A 1  771  ? 224.403 139.934 156.558 1.00 370.00 ? 771  TYR A CA  1 
ATOM 1994  C C   . TYR A 1  771  ? 223.433 139.509 157.649 1.00 370.00 ? 771  TYR A C   1 
ATOM 1995  O O   . TYR A 1  771  ? 223.019 138.350 157.722 1.00 370.00 ? 771  TYR A O   1 
ATOM 1996  C CB  . TYR A 1  771  ? 223.611 140.151 155.265 1.00 370.00 ? 771  TYR A CB  1 
ATOM 1997  C CG  . TYR A 1  771  ? 224.336 140.852 154.140 1.00 370.00 ? 771  TYR A CG  1 
ATOM 1998  C CD1 . TYR A 1  771  ? 224.509 142.231 154.150 1.00 370.00 ? 771  TYR A CD1 1 
ATOM 1999  C CD2 . TYR A 1  771  ? 224.803 140.139 153.043 1.00 370.00 ? 771  TYR A CD2 1 
ATOM 2000  C CE1 . TYR A 1  771  ? 225.153 142.878 153.109 1.00 370.00 ? 771  TYR A CE1 1 
ATOM 2001  C CE2 . TYR A 1  771  ? 225.449 140.777 151.998 1.00 370.00 ? 771  TYR A CE2 1 
ATOM 2002  C CZ  . TYR A 1  771  ? 225.626 142.146 152.041 1.00 370.00 ? 771  TYR A CZ  1 
ATOM 2003  O OH  . TYR A 1  771  ? 226.269 142.786 151.005 1.00 370.00 ? 771  TYR A OH  1 
ATOM 2004  N N   . TYR A 1  772  ? 223.029 140.483 158.456 1.00 370.00 ? 772  TYR A N   1 
ATOM 2005  C CA  . TYR A 1  772  ? 222.138 140.277 159.585 1.00 370.00 ? 772  TYR A CA  1 
ATOM 2006  C C   . TYR A 1  772  ? 220.984 141.263 159.493 1.00 370.00 ? 772  TYR A C   1 
ATOM 2007  O O   . TYR A 1  772  ? 221.150 142.385 159.011 1.00 370.00 ? 772  TYR A O   1 
ATOM 2008  C CB  . TYR A 1  772  ? 222.897 140.452 160.909 1.00 370.00 ? 772  TYR A CB  1 
ATOM 2009  C CG  . TYR A 1  772  ? 223.734 139.259 161.313 1.00 370.00 ? 772  TYR A CG  1 
ATOM 2010  C CD1 . TYR A 1  772  ? 223.456 137.993 160.816 1.00 370.00 ? 772  TYR A CD1 1 
ATOM 2011  C CD2 . TYR A 1  772  ? 224.807 139.398 162.183 1.00 370.00 ? 772  TYR A CD2 1 
ATOM 2012  C CE1 . TYR A 1  772  ? 224.214 136.893 161.177 1.00 370.00 ? 772  TYR A CE1 1 
ATOM 2013  C CE2 . TYR A 1  772  ? 225.574 138.300 162.552 1.00 370.00 ? 772  TYR A CE2 1 
ATOM 2014  C CZ  . TYR A 1  772  ? 225.272 137.053 162.045 1.00 370.00 ? 772  TYR A CZ  1 
ATOM 2015  O OH  . TYR A 1  772  ? 226.029 135.959 162.406 1.00 370.00 ? 772  TYR A OH  1 
ATOM 2016  N N   . ILE A 1  773  ? 219.808 140.841 159.951 1.00 370.00 ? 773  ILE A N   1 
ATOM 2017  C CA  . ILE A 1  773  ? 218.602 141.653 159.861 1.00 370.00 ? 773  ILE A CA  1 
ATOM 2018  C C   . ILE A 1  773  ? 217.854 141.582 161.187 1.00 370.00 ? 773  ILE A C   1 
ATOM 2019  O O   . ILE A 1  773  ? 217.825 140.535 161.844 1.00 370.00 ? 773  ILE A O   1 
ATOM 2020  C CB  . ILE A 1  773  ? 217.712 141.213 158.669 1.00 370.00 ? 773  ILE A CB  1 
ATOM 2021  C CG1 . ILE A 1  773  ? 216.543 142.179 158.456 1.00 370.00 ? 773  ILE A CG1 1 
ATOM 2022  C CG2 . ILE A 1  773  ? 217.235 139.762 158.795 1.00 370.00 ? 773  ILE A CG2 1 
ATOM 2023  C CD1 . ILE A 1  773  ? 215.806 141.959 157.162 1.00 370.00 ? 773  ILE A CD1 1 
ATOM 2024  N N   . ARG A 1  774  ? 217.318 142.725 161.620 1.00 370.00 ? 774  ARG A N   1 
ATOM 2025  C CA  . ARG A 1  774  ? 216.458 142.817 162.793 1.00 370.00 ? 774  ARG A CA  1 
ATOM 2026  C C   . ARG A 1  774  ? 215.299 143.764 162.528 1.00 370.00 ? 774  ARG A C   1 
ATOM 2027  O O   . ARG A 1  774  ? 215.454 144.773 161.833 1.00 370.00 ? 774  ARG A O   1 
ATOM 2028  C CB  . ARG A 1  774  ? 217.233 143.291 164.024 1.00 370.00 ? 774  ARG A CB  1 
ATOM 2029  C CG  . ARG A 1  774  ? 218.123 142.222 164.623 1.00 370.00 ? 774  ARG A CG  1 
ATOM 2030  C CD  . ARG A 1  774  ? 218.908 142.709 165.807 1.00 370.00 ? 774  ARG A CD  1 
ATOM 2031  N NE  . ARG A 1  774  ? 218.014 143.154 166.869 1.00 370.00 ? 774  ARG A NE  1 
ATOM 2032  C CZ  . ARG A 1  774  ? 218.411 143.654 168.033 1.00 370.00 ? 774  ARG A CZ  1 
ATOM 2033  N NH1 . ARG A 1  774  ? 219.705 143.757 168.305 1.00 370.00 ? 774  ARG A NH1 1 
ATOM 2034  N NH2 . ARG A 1  774  ? 217.511 144.039 168.933 1.00 370.00 ? 774  ARG A NH2 1 
ATOM 2035  N N   . GLU A 1  775  ? 214.140 143.429 163.088 1.00 370.00 ? 775  GLU A N   1 
ATOM 2036  C CA  . GLU A 1  775  ? 212.986 144.315 163.044 1.00 370.00 ? 775  GLU A CA  1 
ATOM 2037  C C   . GLU A 1  775  ? 213.164 145.445 164.050 1.00 370.00 ? 775  GLU A C   1 
ATOM 2038  O O   . GLU A 1  775  ? 213.675 145.237 165.153 1.00 370.00 ? 775  GLU A O   1 
ATOM 2039  C CB  . GLU A 1  775  ? 211.717 143.528 163.364 1.00 370.00 ? 775  GLU A CB  1 
ATOM 2040  C CG  . GLU A 1  775  ? 210.414 144.296 163.232 1.00 370.00 ? 775  GLU A CG  1 
ATOM 2041  C CD  . GLU A 1  775  ? 209.245 143.491 163.746 1.00 370.00 ? 775  GLU A CD  1 
ATOM 2042  O OE1 . GLU A 1  775  ? 209.497 142.394 164.287 1.00 370.00 ? 775  GLU A OE1 1 
ATOM 2043  O OE2 . GLU A 1  775  ? 208.089 143.945 163.612 1.00 370.00 ? 775  GLU A OE2 1 
ATOM 2044  N N   . LEU A 1  776  ? 212.747 146.651 163.665 1.00 370.00 ? 776  LEU A N   1 
ATOM 2045  C CA  . LEU A 1  776  ? 212.816 147.809 164.552 1.00 370.00 ? 776  LEU A CA  1 
ATOM 2046  C C   . LEU A 1  776  ? 211.695 148.772 164.193 1.00 370.00 ? 776  LEU A C   1 
ATOM 2047  O O   . LEU A 1  776  ? 211.531 149.122 163.021 1.00 370.00 ? 776  LEU A O   1 
ATOM 2048  C CB  . LEU A 1  776  ? 214.185 148.490 164.457 1.00 370.00 ? 776  LEU A CB  1 
ATOM 2049  C CG  . LEU A 1  776  ? 214.516 149.580 165.478 1.00 370.00 ? 776  LEU A CG  1 
ATOM 2050  C CD1 . LEU A 1  776  ? 215.976 149.468 165.851 1.00 370.00 ? 776  LEU A CD1 1 
ATOM 2051  C CD2 . LEU A 1  776  ? 214.232 150.978 164.931 1.00 370.00 ? 776  LEU A CD2 1 
ATOM 2052  N N   . VAL A 1  777  ? 210.942 149.214 165.200 1.00 370.00 ? 777  VAL A N   1 
ATOM 2053  C CA  . VAL A 1  777  ? 209.782 150.059 164.973 1.00 370.00 ? 777  VAL A CA  1 
ATOM 2054  C C   . VAL A 1  777  ? 209.960 151.487 165.493 1.00 370.00 ? 777  VAL A C   1 
ATOM 2055  O O   . VAL A 1  777  ? 209.284 152.397 164.998 1.00 370.00 ? 777  VAL A O   1 
ATOM 2056  C CB  . VAL A 1  777  ? 208.518 149.410 165.574 1.00 370.00 ? 777  VAL A CB  1 
ATOM 2057  C CG1 . VAL A 1  777  ? 208.233 148.088 164.883 1.00 370.00 ? 777  VAL A CG1 1 
ATOM 2058  C CG2 . VAL A 1  777  ? 208.679 149.197 167.073 1.00 370.00 ? 777  VAL A CG2 1 
ATOM 2059  N N   . ASP A 1  778  ? 210.843 151.719 166.463 1.00 370.00 ? 778  ASP A N   1 
ATOM 2060  C CA  . ASP A 1  778  ? 210.920 152.999 167.162 1.00 370.00 ? 778  ASP A CA  1 
ATOM 2061  C C   . ASP A 1  778  ? 212.067 153.845 166.619 1.00 370.00 ? 778  ASP A C   1 
ATOM 2062  O O   . ASP A 1  778  ? 213.237 153.478 166.765 1.00 370.00 ? 778  ASP A O   1 
ATOM 2063  C CB  . ASP A 1  778  ? 211.089 152.775 168.664 1.00 370.00 ? 778  ASP A CB  1 
ATOM 2064  C CG  . ASP A 1  778  ? 209.851 152.188 169.302 1.00 370.00 ? 778  ASP A CG  1 
ATOM 2065  O OD1 . ASP A 1  778  ? 208.744 152.444 168.784 1.00 370.00 ? 778  ASP A OD1 1 
ATOM 2066  O OD2 . ASP A 1  778  ? 209.980 151.467 170.314 1.00 370.00 ? 778  ASP A OD2 1 
ATOM 2067  N N   . ILE A 1  779  ? 211.734 154.993 166.034 1.00 370.00 ? 779  ILE A N   1 
ATOM 2068  C CA  . ILE A 1  779  ? 212.727 155.929 165.517 1.00 370.00 ? 779  ILE A CA  1 
ATOM 2069  C C   . ILE A 1  779  ? 212.420 157.322 166.063 1.00 370.00 ? 779  ILE A C   1 
ATOM 2070  O O   . ILE A 1  779  ? 211.254 157.729 166.135 1.00 370.00 ? 779  ILE A O   1 
ATOM 2071  C CB  . ILE A 1  779  ? 212.794 155.909 163.970 1.00 370.00 ? 779  ILE A CB  1 
ATOM 2072  C CG1 . ILE A 1  779  ? 213.914 156.823 163.459 1.00 370.00 ? 779  ILE A CG1 1 
ATOM 2073  C CG2 . ILE A 1  779  ? 211.441 156.207 163.315 1.00 370.00 ? 779  ILE A CG2 1 
ATOM 2074  C CD1 . ILE A 1  779  ? 214.269 156.628 162.004 1.00 370.00 ? 779  ILE A CD1 1 
ATOM 2075  N N   . PHE A 1  780  ? 213.460 158.015 166.525 1.00 370.00 ? 780  PHE A N   1 
ATOM 2076  C CA  . PHE A 1  780  ? 213.333 159.343 167.109 1.00 370.00 ? 780  PHE A CA  1 
ATOM 2077  C C   . PHE A 1  780  ? 213.819 160.420 166.148 1.00 370.00 ? 780  PHE A C   1 
ATOM 2078  O O   . PHE A 1  780  ? 214.865 160.272 165.507 1.00 370.00 ? 780  PHE A O   1 
ATOM 2079  C CB  . PHE A 1  780  ? 214.125 159.442 168.415 1.00 370.00 ? 780  PHE A CB  1 
ATOM 2080  C CG  . PHE A 1  780  ? 213.519 158.679 169.558 1.00 370.00 ? 780  PHE A CG  1 
ATOM 2081  C CD1 . PHE A 1  780  ? 212.523 159.249 170.338 1.00 370.00 ? 780  PHE A CD1 1 
ATOM 2082  C CD2 . PHE A 1  780  ? 213.945 157.394 169.852 1.00 370.00 ? 780  PHE A CD2 1 
ATOM 2083  C CE1 . PHE A 1  780  ? 211.965 158.549 171.397 1.00 370.00 ? 780  PHE A CE1 1 
ATOM 2084  C CE2 . PHE A 1  780  ? 213.392 156.688 170.907 1.00 370.00 ? 780  PHE A CE2 1 
ATOM 2085  C CZ  . PHE A 1  780  ? 212.401 157.267 171.680 1.00 370.00 ? 780  PHE A CZ  1 
ATOM 2086  N N   . VAL A 1  781  ? 213.057 161.505 166.055 1.00 370.00 ? 781  VAL A N   1 
ATOM 2087  C CA  . VAL A 1  781  ? 213.544 162.725 165.420 1.00 370.00 ? 781  VAL A CA  1 
ATOM 2088  C C   . VAL A 1  781  ? 214.141 163.623 166.493 1.00 370.00 ? 781  VAL A C   1 
ATOM 2089  O O   . VAL A 1  781  ? 213.471 163.971 167.473 1.00 370.00 ? 781  VAL A O   1 
ATOM 2090  C CB  . VAL A 1  781  ? 212.414 163.437 164.661 1.00 370.00 ? 781  VAL A CB  1 
ATOM 2091  C CG1 . VAL A 1  781  ? 212.885 164.793 164.177 1.00 370.00 ? 781  VAL A CG1 1 
ATOM 2092  C CG2 . VAL A 1  781  ? 211.983 162.606 163.484 1.00 370.00 ? 781  VAL A CG2 1 
ATOM 2093  N N   . VAL A 1  782  ? 215.403 163.998 166.314 1.00 370.00 ? 782  VAL A N   1 
ATOM 2094  C CA  . VAL A 1  782  ? 216.143 164.770 167.302 1.00 370.00 ? 782  VAL A CA  1 
ATOM 2095  C C   . VAL A 1  782  ? 216.282 166.198 166.797 1.00 370.00 ? 782  VAL A C   1 
ATOM 2096  O O   . VAL A 1  782  ? 216.744 166.425 165.673 1.00 370.00 ? 782  VAL A O   1 
ATOM 2097  C CB  . VAL A 1  782  ? 217.522 164.142 167.572 1.00 370.00 ? 782  VAL A CB  1 
ATOM 2098  C CG1 . VAL A 1  782  ? 218.267 164.918 168.639 1.00 370.00 ? 782  VAL A CG1 1 
ATOM 2099  C CG2 . VAL A 1  782  ? 217.392 162.664 167.941 1.00 370.00 ? 782  VAL A CG2 1 
ATOM 2100  N N   . GLY A 1  783  ? 215.894 167.161 167.628 1.00 370.00 ? 783  GLY A N   1 
ATOM 2101  C CA  . GLY A 1  783  ? 215.905 168.553 167.245 1.00 370.00 ? 783  GLY A CA  1 
ATOM 2102  C C   . GLY A 1  783  ? 217.284 169.175 167.339 1.00 370.00 ? 783  GLY A C   1 
ATOM 2103  O O   . GLY A 1  783  ? 218.316 168.502 167.368 1.00 370.00 ? 783  GLY A O   1 
ATOM 2104  N N   . GLN A 1  784  ? 217.282 170.505 167.350 1.00 370.00 ? 784  GLN A N   1 
ATOM 2105  C CA  . GLN A 1  784  ? 218.507 171.275 167.512 1.00 370.00 ? 784  GLN A CA  1 
ATOM 2106  C C   . GLN A 1  784  ? 219.120 171.041 168.887 1.00 370.00 ? 784  GLN A C   1 
ATOM 2107  O O   . GLN A 1  784  ? 218.420 171.007 169.903 1.00 370.00 ? 784  GLN A O   1 
ATOM 2108  C CB  . GLN A 1  784  ? 218.208 172.760 167.313 1.00 370.00 ? 784  GLN A CB  1 
ATOM 2109  C CG  . GLN A 1  784  ? 219.415 173.659 167.407 1.00 370.00 ? 784  GLN A CG  1 
ATOM 2110  C CD  . GLN A 1  784  ? 219.079 175.098 167.128 1.00 370.00 ? 784  GLN A CD  1 
ATOM 2111  O OE1 . GLN A 1  784  ? 217.916 175.452 166.943 1.00 370.00 ? 784  GLN A OE1 1 
ATOM 2112  N NE2 . GLN A 1  784  ? 220.103 175.941 167.073 1.00 370.00 ? 784  GLN A NE2 1 
ATOM 2113  N N   . GLN A 1  785  ? 220.439 170.885 168.912 1.00 370.00 ? 785  GLN A N   1 
ATOM 2114  C CA  . GLN A 1  785  ? 221.150 170.601 170.146 1.00 370.00 ? 785  GLN A CA  1 
ATOM 2115  C C   . GLN A 1  785  ? 221.315 171.863 170.983 1.00 370.00 ? 785  GLN A C   1 
ATOM 2116  O O   . GLN A 1  785  ? 221.470 172.967 170.453 1.00 370.00 ? 785  GLN A O   1 
ATOM 2117  C CB  . GLN A 1  785  ? 222.521 169.999 169.842 1.00 370.00 ? 785  GLN A CB  1 
ATOM 2118  C CG  . GLN A 1  785  ? 222.465 168.652 169.149 1.00 370.00 ? 785  GLN A CG  1 
ATOM 2119  C CD  . GLN A 1  785  ? 223.843 168.062 168.910 1.00 370.00 ? 785  GLN A CD  1 
ATOM 2120  O OE1 . GLN A 1  785  ? 224.859 168.693 169.195 1.00 370.00 ? 785  GLN A OE1 1 
ATOM 2121  N NE2 . GLN A 1  785  ? 223.881 166.841 168.394 1.00 370.00 ? 785  GLN A NE2 1 
ATOM 2122  N N   . CYS A 1  786  ? 221.254 171.689 172.303 1.00 370.00 ? 786  CYS A N   1 
ATOM 2123  C CA  . CYS A 1  786  ? 221.689 172.691 173.264 1.00 370.00 ? 786  CYS A CA  1 
ATOM 2124  C C   . CYS A 1  786  ? 223.036 172.228 173.798 1.00 370.00 ? 786  CYS A C   1 
ATOM 2125  O O   . CYS A 1  786  ? 223.080 171.368 174.691 1.00 370.00 ? 786  CYS A O   1 
ATOM 2126  C CB  . CYS A 1  786  ? 220.673 172.840 174.400 1.00 370.00 ? 786  CYS A CB  1 
ATOM 2127  S SG  . CYS A 1  786  ? 219.053 173.453 173.876 1.00 370.00 ? 786  CYS A SG  1 
ATOM 2128  N N   . PRO A 1  787  ? 224.152 172.735 173.271 1.00 370.00 ? 787  PRO A N   1 
ATOM 2129  C CA  . PRO A 1  787  ? 225.466 172.170 173.612 1.00 370.00 ? 787  PRO A CA  1 
ATOM 2130  C C   . PRO A 1  787  ? 225.882 172.508 175.036 1.00 370.00 ? 787  PRO A C   1 
ATOM 2131  O O   . PRO A 1  787  ? 225.712 173.636 175.502 1.00 370.00 ? 787  PRO A O   1 
ATOM 2132  C CB  . PRO A 1  787  ? 226.406 172.817 172.589 1.00 370.00 ? 787  PRO A CB  1 
ATOM 2133  C CG  . PRO A 1  787  ? 225.516 173.265 171.474 1.00 370.00 ? 787  PRO A CG  1 
ATOM 2134  C CD  . PRO A 1  787  ? 224.236 173.667 172.136 1.00 370.00 ? 787  PRO A CD  1 
ATOM 2135  N N   . LEU A 1  788  ? 226.436 171.511 175.724 1.00 370.00 ? 788  LEU A N   1 
ATOM 2136  C CA  . LEU A 1  788  ? 226.897 171.670 177.093 1.00 370.00 ? 788  LEU A CA  1 
ATOM 2137  C C   . LEU A 1  788  ? 228.412 171.629 177.219 1.00 370.00 ? 788  LEU A C   1 
ATOM 2138  O O   . LEU A 1  788  ? 228.932 171.911 178.304 1.00 370.00 ? 788  LEU A O   1 
ATOM 2139  C CB  . LEU A 1  788  ? 226.288 170.577 177.984 1.00 370.00 ? 788  LEU A CB  1 
ATOM 2140  C CG  . LEU A 1  788  ? 224.764 170.577 178.129 1.00 370.00 ? 788  LEU A CG  1 
ATOM 2141  C CD1 . LEU A 1  788  ? 224.290 169.359 178.912 1.00 370.00 ? 788  LEU A CD1 1 
ATOM 2142  C CD2 . LEU A 1  788  ? 224.285 171.863 178.784 1.00 370.00 ? 788  LEU A CD2 1 
ATOM 2143  N N   . PHE A 1  789  ? 229.128 171.289 176.150 1.00 370.00 ? 789  PHE A N   1 
ATOM 2144  C CA  . PHE A 1  789  ? 230.579 171.174 176.165 1.00 370.00 ? 789  PHE A CA  1 
ATOM 2145  C C   . PHE A 1  789  ? 231.145 172.046 175.052 1.00 370.00 ? 789  PHE A C   1 
ATOM 2146  O O   . PHE A 1  789  ? 230.598 172.079 173.945 1.00 370.00 ? 789  PHE A O   1 
ATOM 2147  C CB  . PHE A 1  789  ? 231.016 169.717 175.988 1.00 370.00 ? 789  PHE A CB  1 
ATOM 2148  C CG  . PHE A 1  789  ? 232.474 169.486 176.254 1.00 370.00 ? 789  PHE A CG  1 
ATOM 2149  C CD1 . PHE A 1  789  ? 232.945 169.439 177.560 1.00 370.00 ? 789  PHE A CD1 1 
ATOM 2150  C CD2 . PHE A 1  789  ? 233.376 169.324 175.214 1.00 370.00 ? 789  PHE A CD2 1 
ATOM 2151  C CE1 . PHE A 1  789  ? 234.287 169.230 177.822 1.00 370.00 ? 789  PHE A CE1 1 
ATOM 2152  C CE2 . PHE A 1  789  ? 234.723 169.114 175.472 1.00 370.00 ? 789  PHE A CE2 1 
ATOM 2153  C CZ  . PHE A 1  789  ? 235.175 169.068 176.780 1.00 370.00 ? 789  PHE A CZ  1 
ATOM 2154  N N   . GLU A 1  790  ? 232.235 172.751 175.349 1.00 370.00 ? 790  GLU A N   1 
ATOM 2155  C CA  . GLU A 1  790  ? 232.763 173.771 174.451 1.00 370.00 ? 790  GLU A CA  1 
ATOM 2156  C C   . GLU A 1  790  ? 233.594 173.149 173.332 1.00 370.00 ? 790  GLU A C   1 
ATOM 2157  O O   . GLU A 1  790  ? 234.474 172.321 173.583 1.00 370.00 ? 790  GLU A O   1 
ATOM 2158  C CB  . GLU A 1  790  ? 233.606 174.775 175.239 1.00 370.00 ? 790  GLU A CB  1 
ATOM 2159  C CG  . GLU A 1  790  ? 234.126 175.944 174.416 1.00 370.00 ? 790  GLU A CG  1 
ATOM 2160  C CD  . GLU A 1  790  ? 234.894 176.954 175.250 1.00 370.00 ? 790  GLU A CD  1 
ATOM 2161  O OE1 . GLU A 1  790  ? 235.036 176.736 176.472 1.00 370.00 ? 790  GLU A OE1 1 
ATOM 2162  O OE2 . GLU A 1  790  ? 235.357 177.967 174.683 1.00 370.00 ? 790  GLU A OE2 1 
ATOM 2163  N N   . VAL A 1  791  ? 233.305 173.550 172.101 1.00 370.00 ? 791  VAL A N   1 
ATOM 2164  C CA  . VAL A 1  791  ? 234.100 173.126 170.946 1.00 370.00 ? 791  VAL A CA  1 
ATOM 2165  C C   . VAL A 1  791  ? 235.246 174.116 170.749 1.00 370.00 ? 791  VAL A C   1 
ATOM 2166  O O   . VAL A 1  791  ? 234.999 175.331 170.690 1.00 370.00 ? 791  VAL A O   1 
ATOM 2167  C CB  . VAL A 1  791  ? 233.223 173.042 169.698 1.00 370.00 ? 791  VAL A CB  1 
ATOM 2168  C CG1 . VAL A 1  791  ? 234.051 172.675 168.481 1.00 370.00 ? 791  VAL A CG1 1 
ATOM 2169  C CG2 . VAL A 1  791  ? 232.095 172.038 169.906 1.00 370.00 ? 791  VAL A CG2 1 
ATOM 2170  N N   . PRO A 1  792  ? 236.493 173.656 170.657 1.00 370.00 ? 792  PRO A N   1 
ATOM 2171  C CA  . PRO A 1  792  ? 237.612 174.590 170.497 1.00 370.00 ? 792  PRO A CA  1 
ATOM 2172  C C   . PRO A 1  792  ? 237.702 175.151 169.087 1.00 370.00 ? 792  PRO A C   1 
ATOM 2173  O O   . PRO A 1  792  ? 237.104 174.642 168.135 1.00 370.00 ? 792  PRO A O   1 
ATOM 2174  C CB  . PRO A 1  792  ? 238.839 173.734 170.819 1.00 370.00 ? 792  PRO A CB  1 
ATOM 2175  C CG  . PRO A 1  792  ? 238.423 172.353 170.473 1.00 370.00 ? 792  PRO A CG  1 
ATOM 2176  C CD  . PRO A 1  792  ? 236.960 172.267 170.816 1.00 370.00 ? 792  PRO A CD  1 
ATOM 2177  N N   . GLY A 1  793  ? 238.471 176.231 168.971 1.00 370.00 ? 793  GLY A N   1 
ATOM 2178  C CA  . GLY A 1  793  ? 238.823 176.798 167.692 1.00 370.00 ? 793  GLY A CA  1 
ATOM 2179  C C   . GLY A 1  793  ? 240.073 176.153 167.125 1.00 370.00 ? 793  GLY A C   1 
ATOM 2180  O O   . GLY A 1  793  ? 240.834 175.492 167.840 1.00 370.00 ? 793  GLY A O   1 
ATOM 2181  N N   . PRO A 1  794  ? 240.285 176.300 165.814 1.00 370.00 ? 794  PRO A N   1 
ATOM 2182  C CA  . PRO A 1  794  ? 241.485 175.731 165.182 1.00 370.00 ? 794  PRO A CA  1 
ATOM 2183  C C   . PRO A 1  794  ? 242.764 176.398 165.669 1.00 370.00 ? 794  PRO A C   1 
ATOM 2184  O O   . PRO A 1  794  ? 242.851 177.625 165.757 1.00 370.00 ? 794  PRO A O   1 
ATOM 2185  C CB  . PRO A 1  794  ? 241.247 175.978 163.689 1.00 370.00 ? 794  PRO A CB  1 
ATOM 2186  C CG  . PRO A 1  794  ? 239.761 176.089 163.564 1.00 370.00 ? 794  PRO A CG  1 
ATOM 2187  C CD  . PRO A 1  794  ? 239.315 176.780 164.816 1.00 370.00 ? 794  PRO A CD  1 
ATOM 2188  N N   . ASN A 1  795  ? 243.755 175.556 165.997 1.00 370.00 ? 795  ASN A N   1 
ATOM 2189  C CA  . ASN A 1  795  ? 245.072 175.941 166.526 1.00 370.00 ? 795  ASN A CA  1 
ATOM 2190  C C   . ASN A 1  795  ? 244.978 176.760 167.815 1.00 370.00 ? 795  ASN A C   1 
ATOM 2191  O O   . ASN A 1  795  ? 245.866 177.568 168.109 1.00 370.00 ? 795  ASN A O   1 
ATOM 2192  C CB  . ASN A 1  795  ? 245.912 176.686 165.478 1.00 370.00 ? 795  ASN A CB  1 
ATOM 2193  C CG  . ASN A 1  795  ? 246.413 175.772 164.373 1.00 370.00 ? 795  ASN A CG  1 
ATOM 2194  O OD1 . ASN A 1  795  ? 246.839 174.644 164.629 1.00 370.00 ? 795  ASN A OD1 1 
ATOM 2195  N ND2 . ASN A 1  795  ? 246.371 176.258 163.138 1.00 370.00 ? 795  ASN A ND2 1 
ATOM 2196  N N   . SER A 1  796  ? 243.918 176.568 168.596 1.00 370.00 ? 796  SER A N   1 
ATOM 2197  C CA  . SER A 1  796  ? 243.837 177.181 169.911 1.00 370.00 ? 796  SER A CA  1 
ATOM 2198  C C   . SER A 1  796  ? 244.716 176.421 170.903 1.00 370.00 ? 796  SER A C   1 
ATOM 2199  O O   . SER A 1  796  ? 245.227 175.334 170.618 1.00 370.00 ? 796  SER A O   1 
ATOM 2200  C CB  . SER A 1  796  ? 242.390 177.222 170.404 1.00 370.00 ? 796  SER A CB  1 
ATOM 2201  O OG  . SER A 1  796  ? 241.888 175.921 170.644 1.00 370.00 ? 796  SER A OG  1 
ATOM 2202  N N   . LYS A 1  797  ? 244.899 177.023 172.082 1.00 370.00 ? 797  LYS A N   1 
ATOM 2203  C CA  . LYS A 1  797  ? 245.720 176.403 173.118 1.00 370.00 ? 797  LYS A CA  1 
ATOM 2204  C C   . LYS A 1  797  ? 245.055 175.159 173.698 1.00 370.00 ? 797  LYS A C   1 
ATOM 2205  O O   . LYS A 1  797  ? 245.738 174.192 174.053 1.00 370.00 ? 797  LYS A O   1 
ATOM 2206  C CB  . LYS A 1  797  ? 246.020 177.416 174.223 1.00 370.00 ? 797  LYS A CB  1 
ATOM 2207  C CG  . LYS A 1  797  ? 246.818 178.613 173.745 1.00 370.00 ? 797  LYS A CG  1 
ATOM 2208  C CD  . LYS A 1  797  ? 248.206 178.189 173.299 1.00 370.00 ? 797  LYS A CD  1 
ATOM 2209  C CE  . LYS A 1  797  ? 249.057 179.390 172.936 1.00 370.00 ? 797  LYS A CE  1 
ATOM 2210  N NZ  . LYS A 1  797  ? 248.559 180.045 171.695 1.00 370.00 ? 797  LYS A NZ  1 
ATOM 2211  N N   . ARG A 1  798  ? 243.725 175.177 173.823 1.00 370.00 ? 798  ARG A N   1 
ATOM 2212  C CA  . ARG A 1  798  ? 242.993 173.998 174.282 1.00 370.00 ? 798  ARG A CA  1 
ATOM 2213  C C   . ARG A 1  798  ? 243.052 172.876 173.248 1.00 370.00 ? 798  ARG A C   1 
ATOM 2214  O O   . ARG A 1  798  ? 243.189 171.699 173.602 1.00 370.00 ? 798  ARG A O   1 
ATOM 2215  C CB  . ARG A 1  798  ? 241.548 174.388 174.615 1.00 370.00 ? 798  ARG A CB  1 
ATOM 2216  C CG  . ARG A 1  798  ? 240.666 173.296 175.231 1.00 370.00 ? 798  ARG A CG  1 
ATOM 2217  C CD  . ARG A 1  798  ? 239.710 172.703 174.204 1.00 370.00 ? 798  ARG A CD  1 
ATOM 2218  N NE  . ARG A 1  798  ? 238.775 171.740 174.773 1.00 370.00 ? 798  ARG A NE  1 
ATOM 2219  C CZ  . ARG A 1  798  ? 239.037 170.448 174.927 1.00 370.00 ? 798  ARG A CZ  1 
ATOM 2220  N NH1 . ARG A 1  798  ? 240.212 169.958 174.556 1.00 370.00 ? 798  ARG A NH1 1 
ATOM 2221  N NH2 . ARG A 1  798  ? 238.126 169.645 175.452 1.00 370.00 ? 798  ARG A NH2 1 
ATOM 2222  N N   . ALA A 1  799  ? 242.910 173.223 171.964 1.00 370.00 ? 799  ALA A N   1 
ATOM 2223  C CA  . ALA A 1  799  ? 242.988 172.228 170.896 1.00 370.00 ? 799  ALA A CA  1 
ATOM 2224  C C   . ALA A 1  799  ? 244.381 171.614 170.803 1.00 370.00 ? 799  ALA A C   1 
ATOM 2225  O O   . ALA A 1  799  ? 244.523 170.402 170.603 1.00 370.00 ? 799  ALA A O   1 
ATOM 2226  C CB  . ALA A 1  799  ? 242.587 172.855 169.560 1.00 370.00 ? 799  ALA A CB  1 
ATOM 2227  N N   . ASN A 1  800  ? 245.423 172.439 170.936 1.00 370.00 ? 800  ASN A N   1 
ATOM 2228  C CA  . ASN A 1  800  ? 246.791 171.933 170.849 1.00 370.00 ? 800  ASN A CA  1 
ATOM 2229  C C   . ASN A 1  800  ? 247.170 171.105 172.072 1.00 370.00 ? 800  ASN A C   1 
ATOM 2230  O O   . ASN A 1  800  ? 248.018 170.211 171.972 1.00 370.00 ? 800  ASN A O   1 
ATOM 2231  C CB  . ASN A 1  800  ? 247.773 173.090 170.663 1.00 370.00 ? 800  ASN A CB  1 
ATOM 2232  C CG  . ASN A 1  800  ? 247.683 173.716 169.284 1.00 370.00 ? 800  ASN A CG  1 
ATOM 2233  O OD1 . ASN A 1  800  ? 247.559 173.017 168.277 1.00 370.00 ? 800  ASN A OD1 1 
ATOM 2234  N ND2 . ASN A 1  800  ? 247.751 175.041 169.231 1.00 370.00 ? 800  ASN A ND2 1 
ATOM 2235  N N   . THR A 1  801  ? 246.577 171.404 173.231 1.00 370.00 ? 801  THR A N   1 
ATOM 2236  C CA  . THR A 1  801  ? 246.789 170.578 174.418 1.00 370.00 ? 801  THR A CA  1 
ATOM 2237  C C   . THR A 1  801  ? 246.118 169.217 174.259 1.00 370.00 ? 801  THR A C   1 
ATOM 2238  O O   . THR A 1  801  ? 246.652 168.194 174.710 1.00 370.00 ? 801  THR A O   1 
ATOM 2239  C CB  . THR A 1  801  ? 246.259 171.310 175.657 1.00 370.00 ? 801  THR A CB  1 
ATOM 2240  O OG1 . THR A 1  801  ? 246.876 172.600 175.750 1.00 370.00 ? 801  THR A OG1 1 
ATOM 2241  C CG2 . THR A 1  801  ? 246.556 170.536 176.942 1.00 370.00 ? 801  THR A CG2 1 
ATOM 2242  N N   . HIS A 1  802  ? 244.956 169.188 173.599 1.00 370.00 ? 802  HIS A N   1 
ATOM 2243  C CA  . HIS A 1  802  ? 244.212 167.945 173.411 1.00 370.00 ? 802  HIS A CA  1 
ATOM 2244  C C   . HIS A 1  802  ? 244.946 166.978 172.489 1.00 370.00 ? 802  HIS A C   1 
ATOM 2245  O O   . HIS A 1  802  ? 244.935 165.765 172.720 1.00 370.00 ? 802  HIS A O   1 
ATOM 2246  C CB  . HIS A 1  802  ? 242.817 168.245 172.866 1.00 370.00 ? 802  HIS A CB  1 
ATOM 2247  C CG  . HIS A 1  802  ? 241.973 167.024 172.678 1.00 370.00 ? 802  HIS A CG  1 
ATOM 2248  N ND1 . HIS A 1  802  ? 241.961 166.301 171.505 1.00 370.00 ? 802  HIS A ND1 1 
ATOM 2249  C CD2 . HIS A 1  802  ? 241.132 166.383 173.523 1.00 370.00 ? 802  HIS A CD2 1 
ATOM 2250  C CE1 . HIS A 1  802  ? 241.138 165.275 171.630 1.00 370.00 ? 802  HIS A CE1 1 
ATOM 2251  N NE2 . HIS A 1  802  ? 240.624 165.301 172.846 1.00 370.00 ? 802  HIS A NE2 1 
ATOM 2252  N N   . ILE A 1  803  ? 245.556 167.498 171.418 1.00 370.00 ? 803  ILE A N   1 
ATOM 2253  C CA  . ILE A 1  803  ? 246.295 166.650 170.485 1.00 370.00 ? 803  ILE A CA  1 
ATOM 2254  C C   . ILE A 1  803  ? 247.532 166.069 171.162 1.00 370.00 ? 803  ILE A C   1 
ATOM 2255  O O   . ILE A 1  803  ? 247.887 164.902 170.950 1.00 370.00 ? 803  ILE A O   1 
ATOM 2256  C CB  . ILE A 1  803  ? 246.666 167.455 169.224 1.00 370.00 ? 803  ILE A CB  1 
ATOM 2257  C CG1 . ILE A 1  803  ? 245.421 168.016 168.544 1.00 370.00 ? 803  ILE A CG1 1 
ATOM 2258  C CG2 . ILE A 1  803  ? 247.377 166.585 168.220 1.00 370.00 ? 803  ILE A CG2 1 
ATOM 2259  C CD1 . ILE A 1  803  ? 245.743 169.032 167.463 1.00 370.00 ? 803  ILE A CD1 1 
ATOM 2260  N N   . ARG A 1  804  ? 248.198 166.876 171.990 1.00 370.00 ? 804  ARG A N   1 
ATOM 2261  C CA  . ARG A 1  804  ? 249.369 166.427 172.737 1.00 370.00 ? 804  ARG A CA  1 
ATOM 2262  C C   . ARG A 1  804  ? 249.006 165.344 173.749 1.00 370.00 ? 804  ARG A C   1 
ATOM 2263  O O   . ARG A 1  804  ? 249.714 164.338 173.881 1.00 370.00 ? 804  ARG A O   1 
ATOM 2264  C CB  . ARG A 1  804  ? 250.024 167.627 173.426 1.00 370.00 ? 804  ARG A CB  1 
ATOM 2265  C CG  . ARG A 1  804  ? 251.235 167.289 174.269 1.00 370.00 ? 804  ARG A CG  1 
ATOM 2266  C CD  . ARG A 1  804  ? 251.848 168.544 174.871 1.00 370.00 ? 804  ARG A CD  1 
ATOM 2267  N NE  . ARG A 1  804  ? 250.916 169.246 175.749 1.00 370.00 ? 804  ARG A NE  1 
ATOM 2268  C CZ  . ARG A 1  804  ? 250.725 168.953 177.033 1.00 370.00 ? 804  ARG A CZ  1 
ATOM 2269  N NH1 . ARG A 1  804  ? 251.408 167.971 177.604 1.00 370.00 ? 804  ARG A NH1 1 
ATOM 2270  N NH2 . ARG A 1  804  ? 249.853 169.649 177.748 1.00 370.00 ? 804  ARG A NH2 1 
ATOM 2271  N N   . ASP A 1  805  ? 247.914 165.552 174.492 1.00 370.00 ? 805  ASP A N   1 
ATOM 2272  C CA  . ASP A 1  805  ? 247.494 164.581 175.501 1.00 370.00 ? 805  ASP A CA  1 
ATOM 2273  C C   . ASP A 1  805  ? 247.006 163.282 174.868 1.00 370.00 ? 805  ASP A C   1 
ATOM 2274  O O   . ASP A 1  805  ? 247.262 162.197 175.400 1.00 370.00 ? 805  ASP A O   1 
ATOM 2275  C CB  . ASP A 1  805  ? 246.402 165.180 176.385 1.00 370.00 ? 805  ASP A CB  1 
ATOM 2276  C CG  . ASP A 1  805  ? 246.924 166.266 177.298 1.00 370.00 ? 805  ASP A CG  1 
ATOM 2277  O OD1 . ASP A 1  805  ? 248.110 166.201 177.685 1.00 370.00 ? 805  ASP A OD1 1 
ATOM 2278  O OD2 . ASP A 1  805  ? 246.145 167.184 177.629 1.00 370.00 ? 805  ASP A OD2 1 
ATOM 2279  N N   . PHE A 1  806  ? 246.283 163.378 173.748 1.00 370.00 ? 806  PHE A N   1 
ATOM 2280  C CA  . PHE A 1  806  ? 245.809 162.181 173.056 1.00 370.00 ? 806  PHE A CA  1 
ATOM 2281  C C   . PHE A 1  806  ? 246.971 161.382 172.473 1.00 370.00 ? 806  PHE A C   1 
ATOM 2282  O O   . PHE A 1  806  ? 246.920 160.147 172.421 1.00 370.00 ? 806  PHE A O   1 
ATOM 2283  C CB  . PHE A 1  806  ? 244.811 162.569 171.966 1.00 370.00 ? 806  PHE A CB  1 
ATOM 2284  C CG  . PHE A 1  806  ? 244.251 161.401 171.212 1.00 370.00 ? 806  PHE A CG  1 
ATOM 2285  C CD1 . PHE A 1  806  ? 243.290 160.582 171.786 1.00 370.00 ? 806  PHE A CD1 1 
ATOM 2286  C CD2 . PHE A 1  806  ? 244.685 161.122 169.925 1.00 370.00 ? 806  PHE A CD2 1 
ATOM 2287  C CE1 . PHE A 1  806  ? 242.773 159.501 171.088 1.00 370.00 ? 806  PHE A CE1 1 
ATOM 2288  C CE2 . PHE A 1  806  ? 244.174 160.044 169.223 1.00 370.00 ? 806  PHE A CE2 1 
ATOM 2289  C CZ  . PHE A 1  806  ? 243.216 159.234 169.805 1.00 370.00 ? 806  PHE A CZ  1 
ATOM 2290  N N   . LEU A 1  807  ? 248.013 162.076 172.003 1.00 370.00 ? 807  LEU A N   1 
ATOM 2291  C CA  . LEU A 1  807  ? 249.262 161.412 171.639 1.00 370.00 ? 807  LEU A CA  1 
ATOM 2292  C C   . LEU A 1  807  ? 249.918 160.755 172.848 1.00 370.00 ? 807  LEU A C   1 
ATOM 2293  O O   . LEU A 1  807  ? 250.497 159.670 172.730 1.00 370.00 ? 807  LEU A O   1 
ATOM 2294  C CB  . LEU A 1  807  ? 250.209 162.418 170.978 1.00 370.00 ? 807  LEU A CB  1 
ATOM 2295  C CG  . LEU A 1  807  ? 251.677 162.098 170.673 1.00 370.00 ? 807  LEU A CG  1 
ATOM 2296  C CD1 . LEU A 1  807  ? 251.872 160.837 169.856 1.00 370.00 ? 807  LEU A CD1 1 
ATOM 2297  C CD2 . LEU A 1  807  ? 252.271 163.285 169.924 1.00 370.00 ? 807  LEU A CD2 1 
ATOM 2298  N N   . GLN A 1  808  ? 249.841 161.396 174.016 1.00 370.00 ? 808  GLN A N   1 
ATOM 2299  C CA  . GLN A 1  808  ? 250.443 160.827 175.218 1.00 370.00 ? 808  GLN A CA  1 
ATOM 2300  C C   . GLN A 1  808  ? 249.659 159.609 175.707 1.00 370.00 ? 808  GLN A C   1 
ATOM 2301  O O   . GLN A 1  808  ? 250.240 158.668 176.263 1.00 370.00 ? 808  GLN A O   1 
ATOM 2302  C CB  . GLN A 1  808  ? 250.533 161.896 176.310 1.00 370.00 ? 808  GLN A CB  1 
ATOM 2303  C CG  . GLN A 1  808  ? 251.415 161.503 177.481 1.00 370.00 ? 808  GLN A CG  1 
ATOM 2304  C CD  . GLN A 1  808  ? 252.883 161.456 177.092 1.00 370.00 ? 808  GLN A CD  1 
ATOM 2305  O OE1 . GLN A 1  808  ? 253.382 162.353 176.422 1.00 370.00 ? 808  GLN A OE1 1 
ATOM 2306  N NE2 . GLN A 1  808  ? 253.571 160.396 177.488 1.00 370.00 ? 808  GLN A NE2 1 
ATOM 2307  N N   . VAL A 1  809  ? 248.335 159.624 175.523 1.00 370.00 ? 809  VAL A N   1 
ATOM 2308  C CA  . VAL A 1  809  ? 247.497 158.467 175.848 1.00 370.00 ? 809  VAL A CA  1 
ATOM 2309  C C   . VAL A 1  809  ? 247.820 157.294 174.926 1.00 370.00 ? 809  VAL A C   1 
ATOM 2310  O O   . VAL A 1  809  ? 247.967 156.149 175.377 1.00 370.00 ? 809  VAL A O   1 
ATOM 2311  C CB  . VAL A 1  809  ? 246.006 158.857 175.772 1.00 370.00 ? 809  VAL A CB  1 
ATOM 2312  C CG1 . VAL A 1  809  ? 245.105 157.630 175.797 1.00 370.00 ? 809  VAL A CG1 1 
ATOM 2313  C CG2 . VAL A 1  809  ? 245.642 159.776 176.929 1.00 370.00 ? 809  VAL A CG2 1 
ATOM 2314  N N   . PHE A 1  810  ? 247.942 157.569 173.623 1.00 370.00 ? 810  PHE A N   1 
ATOM 2315  C CA  . PHE A 1  810  ? 248.169 156.512 172.638 1.00 370.00 ? 810  PHE A CA  1 
ATOM 2316  C C   . PHE A 1  810  ? 249.546 155.874 172.796 1.00 370.00 ? 810  PHE A C   1 
ATOM 2317  O O   . PHE A 1  810  ? 249.703 154.669 172.571 1.00 370.00 ? 810  PHE A O   1 
ATOM 2318  C CB  . PHE A 1  810  ? 247.981 157.068 171.225 1.00 370.00 ? 810  PHE A CB  1 
ATOM 2319  C CG  . PHE A 1  810  ? 248.151 156.041 170.140 1.00 370.00 ? 810  PHE A CG  1 
ATOM 2320  C CD1 . PHE A 1  810  ? 247.191 155.058 169.941 1.00 370.00 ? 810  PHE A CD1 1 
ATOM 2321  C CD2 . PHE A 1  810  ? 249.262 156.066 169.311 1.00 370.00 ? 810  PHE A CD2 1 
ATOM 2322  C CE1 . PHE A 1  810  ? 247.344 154.107 168.943 1.00 370.00 ? 810  PHE A CE1 1 
ATOM 2323  C CE2 . PHE A 1  810  ? 249.421 155.120 168.309 1.00 370.00 ? 810  PHE A CE2 1 
ATOM 2324  C CZ  . PHE A 1  810  ? 248.461 154.140 168.126 1.00 370.00 ? 810  PHE A CZ  1 
ATOM 2325  N N   . ILE A 1  811  ? 250.554 156.668 173.176 1.00 370.00 ? 811  ILE A N   1 
ATOM 2326  C CA  . ILE A 1  811  ? 251.898 156.137 173.423 1.00 370.00 ? 811  ILE A CA  1 
ATOM 2327  C C   . ILE A 1  811  ? 251.898 155.187 174.619 1.00 370.00 ? 811  ILE A C   1 
ATOM 2328  O O   . ILE A 1  811  ? 252.470 154.091 174.557 1.00 370.00 ? 811  ILE A O   1 
ATOM 2329  C CB  . ILE A 1  811  ? 252.906 157.290 173.608 1.00 370.00 ? 811  ILE A CB  1 
ATOM 2330  C CG1 . ILE A 1  811  ? 253.226 157.953 172.267 1.00 370.00 ? 811  ILE A CG1 1 
ATOM 2331  C CG2 . ILE A 1  811  ? 254.189 156.829 174.284 1.00 370.00 ? 811  ILE A CG2 1 
ATOM 2332  C CD1 . ILE A 1  811  ? 254.073 159.202 172.400 1.00 370.00 ? 811  ILE A CD1 1 
ATOM 2333  N N   . TYR A 1  812  ? 251.259 155.603 175.722 1.00 370.00 ? 812  TYR A N   1 
ATOM 2334  C CA  . TYR A 1  812  ? 251.198 154.801 176.946 1.00 370.00 ? 812  TYR A CA  1 
ATOM 2335  C C   . TYR A 1  812  ? 250.531 153.448 176.722 1.00 370.00 ? 812  TYR A C   1 
ATOM 2336  O O   . TYR A 1  812  ? 251.008 152.418 177.211 1.00 370.00 ? 812  TYR A O   1 
ATOM 2337  C CB  . TYR A 1  812  ? 250.457 155.575 178.037 1.00 370.00 ? 812  TYR A CB  1 
ATOM 2338  C CG  . TYR A 1  812  ? 251.266 156.653 178.721 1.00 370.00 ? 812  TYR A CG  1 
ATOM 2339  C CD1 . TYR A 1  812  ? 252.656 156.662 178.651 1.00 370.00 ? 812  TYR A CD1 1 
ATOM 2340  C CD2 . TYR A 1  812  ? 250.638 157.654 179.451 1.00 370.00 ? 812  TYR A CD2 1 
ATOM 2341  C CE1 . TYR A 1  812  ? 253.397 157.644 179.292 1.00 370.00 ? 812  TYR A CE1 1 
ATOM 2342  C CE2 . TYR A 1  812  ? 251.368 158.638 180.089 1.00 370.00 ? 812  TYR A CE2 1 
ATOM 2343  C CZ  . TYR A 1  812  ? 252.744 158.628 180.008 1.00 370.00 ? 812  TYR A CZ  1 
ATOM 2344  O OH  . TYR A 1  812  ? 253.467 159.611 180.642 1.00 370.00 ? 812  TYR A OH  1 
ATOM 2345  N N   . ARG A 1  813  ? 249.430 153.432 175.968 1.00 370.00 ? 813  ARG A N   1 
ATOM 2346  C CA  . ARG A 1  813  ? 248.727 152.180 175.708 1.00 370.00 ? 813  ARG A CA  1 
ATOM 2347  C C   . ARG A 1  813  ? 249.490 151.281 174.740 1.00 370.00 ? 813  ARG A C   1 
ATOM 2348  O O   . ARG A 1  813  ? 249.240 150.071 174.697 1.00 370.00 ? 813  ARG A O   1 
ATOM 2349  C CB  . ARG A 1  813  ? 247.321 152.470 175.188 1.00 370.00 ? 813  ARG A CB  1 
ATOM 2350  C CG  . ARG A 1  813  ? 246.438 153.115 176.233 1.00 370.00 ? 813  ARG A CG  1 
ATOM 2351  C CD  . ARG A 1  813  ? 245.024 153.330 175.739 1.00 370.00 ? 813  ARG A CD  1 
ATOM 2352  N NE  . ARG A 1  813  ? 244.224 153.997 176.758 1.00 370.00 ? 813  ARG A NE  1 
ATOM 2353  C CZ  . ARG A 1  813  ? 243.585 153.356 177.729 1.00 370.00 ? 813  ARG A CZ  1 
ATOM 2354  N NH1 . ARG A 1  813  ? 243.647 152.034 177.797 1.00 370.00 ? 813  ARG A NH1 1 
ATOM 2355  N NH2 . ARG A 1  813  ? 242.874 154.028 178.624 1.00 370.00 ? 813  ARG A NH2 1 
ATOM 2356  N N   . LEU A 1  814  ? 250.400 151.849 173.943 1.00 370.00 ? 814  LEU A N   1 
ATOM 2357  C CA  . LEU A 1  814  ? 251.302 151.019 173.147 1.00 370.00 ? 814  LEU A CA  1 
ATOM 2358  C C   . LEU A 1  814  ? 252.311 150.292 174.030 1.00 370.00 ? 814  LEU A C   1 
ATOM 2359  O O   . LEU A 1  814  ? 252.684 149.149 173.744 1.00 370.00 ? 814  LEU A O   1 
ATOM 2360  C CB  . LEU A 1  814  ? 252.019 151.861 172.090 1.00 370.00 ? 814  LEU A CB  1 
ATOM 2361  C CG  . LEU A 1  814  ? 251.221 152.322 170.871 1.00 370.00 ? 814  LEU A CG  1 
ATOM 2362  C CD1 . LEU A 1  814  ? 252.056 153.263 170.019 1.00 370.00 ? 814  LEU A CD1 1 
ATOM 2363  C CD2 . LEU A 1  814  ? 250.755 151.126 170.060 1.00 370.00 ? 814  LEU A CD2 1 
ATOM 2364  N N   . PHE A 1  815  ? 252.805 150.963 175.080 1.00 370.00 ? 815  PHE A N   1 
ATOM 2365  C CA  . PHE A 1  815  ? 253.664 150.296 176.058 1.00 370.00 ? 815  PHE A CA  1 
ATOM 2366  C C   . PHE A 1  815  ? 252.923 149.194 176.807 1.00 370.00 ? 815  PHE A C   1 
ATOM 2367  O O   . PHE A 1  815  ? 253.490 148.127 177.068 1.00 370.00 ? 815  PHE A O   1 
ATOM 2368  C CB  . PHE A 1  815  ? 254.247 151.309 177.044 1.00 370.00 ? 815  PHE A CB  1 
ATOM 2369  C CG  . PHE A 1  815  ? 255.392 152.111 176.491 1.00 370.00 ? 815  PHE A CG  1 
ATOM 2370  C CD1 . PHE A 1  815  ? 256.665 151.559 176.424 1.00 370.00 ? 815  PHE A CD1 1 
ATOM 2371  C CD2 . PHE A 1  815  ? 255.207 153.415 176.061 1.00 370.00 ? 815  PHE A CD2 1 
ATOM 2372  C CE1 . PHE A 1  815  ? 257.731 152.288 175.922 1.00 370.00 ? 815  PHE A CE1 1 
ATOM 2373  C CE2 . PHE A 1  815  ? 256.268 154.151 175.557 1.00 370.00 ? 815  PHE A CE2 1 
ATOM 2374  C CZ  . PHE A 1  815  ? 257.532 153.588 175.488 1.00 370.00 ? 815  PHE A CZ  1 
ATOM 2375  N N   . TRP A 1  816  ? 251.654 149.432 177.163 1.00 370.00 ? 816  TRP A N   1 
ATOM 2376  C CA  . TRP A 1  816  ? 250.858 148.390 177.812 1.00 370.00 ? 816  TRP A CA  1 
ATOM 2377  C C   . TRP A 1  816  ? 250.570 147.222 176.875 1.00 370.00 ? 816  TRP A C   1 
ATOM 2378  O O   . TRP A 1  816  ? 250.364 146.095 177.337 1.00 370.00 ? 816  TRP A O   1 
ATOM 2379  C CB  . TRP A 1  816  ? 249.541 148.961 178.348 1.00 370.00 ? 816  TRP A CB  1 
ATOM 2380  C CG  . TRP A 1  816  ? 249.666 149.794 179.595 1.00 370.00 ? 816  TRP A CG  1 
ATOM 2381  C CD1 . TRP A 1  816  ? 249.625 151.157 179.686 1.00 370.00 ? 816  TRP A CD1 1 
ATOM 2382  C CD2 . TRP A 1  816  ? 249.855 149.312 180.932 1.00 370.00 ? 816  TRP A CD2 1 
ATOM 2383  N NE1 . TRP A 1  816  ? 249.769 151.548 180.994 1.00 370.00 ? 816  TRP A NE1 1 
ATOM 2384  C CE2 . TRP A 1  816  ? 249.914 150.435 181.779 1.00 370.00 ? 816  TRP A CE2 1 
ATOM 2385  C CE3 . TRP A 1  816  ? 249.977 148.038 181.495 1.00 370.00 ? 816  TRP A CE3 1 
ATOM 2386  C CZ2 . TRP A 1  816  ? 250.094 150.324 183.157 1.00 370.00 ? 816  TRP A CZ2 1 
ATOM 2387  C CZ3 . TRP A 1  816  ? 250.155 147.930 182.867 1.00 370.00 ? 816  TRP A CZ3 1 
ATOM 2388  C CH2 . TRP A 1  816  ? 250.210 149.065 183.679 1.00 370.00 ? 816  TRP A CH2 1 
ATOM 2389  N N   . LYS A 1  817  ? 250.551 147.466 175.563 1.00 370.00 ? 817  LYS A N   1 
ATOM 2390  C CA  . LYS A 1  817  ? 250.331 146.387 174.607 1.00 370.00 ? 817  LYS A CA  1 
ATOM 2391  C C   . LYS A 1  817  ? 251.602 145.575 174.369 1.00 370.00 ? 817  LYS A C   1 
ATOM 2392  O O   . LYS A 1  817  ? 251.519 144.386 174.037 1.00 370.00 ? 817  LYS A O   1 
ATOM 2393  C CB  . LYS A 1  817  ? 249.803 146.969 173.290 1.00 370.00 ? 817  LYS A CB  1 
ATOM 2394  C CG  . LYS A 1  817  ? 249.296 145.946 172.282 1.00 370.00 ? 817  LYS A CG  1 
ATOM 2395  C CD  . LYS A 1  817  ? 248.840 146.612 170.996 1.00 370.00 ? 817  LYS A CD  1 
ATOM 2396  C CE  . LYS A 1  817  ? 247.516 147.330 171.190 1.00 370.00 ? 817  LYS A CE  1 
ATOM 2397  N NZ  . LYS A 1  817  ? 246.992 147.883 169.912 1.00 370.00 ? 817  LYS A NZ  1 
ATOM 2398  N N   . SER A 1  818  ? 252.770 146.194 174.551 1.00 370.00 ? 818  SER A N   1 
ATOM 2399  C CA  . SER A 1  818  ? 254.044 145.516 174.331 1.00 370.00 ? 818  SER A CA  1 
ATOM 2400  C C   . SER A 1  818  ? 254.273 144.417 175.364 1.00 370.00 ? 818  SER A C   1 
ATOM 2401  O O   . SER A 1  818  ? 254.077 144.622 176.565 1.00 370.00 ? 818  SER A O   1 
ATOM 2402  C CB  . SER A 1  818  ? 255.190 146.528 174.381 1.00 370.00 ? 818  SER A CB  1 
ATOM 2403  O OG  . SER A 1  818  ? 256.446 145.889 174.227 1.00 370.00 ? 818  SER A OG  1 
ATOM 2404  N N   . LYS A 1  819  ? 254.689 143.245 174.884 1.00 370.00 ? 819  LYS A N   1 
ATOM 2405  C CA  . LYS A 1  819  ? 254.925 142.087 175.736 1.00 370.00 ? 819  LYS A CA  1 
ATOM 2406  C C   . LYS A 1  819  ? 256.394 141.871 176.067 1.00 370.00 ? 819  LYS A C   1 
ATOM 2407  O O   . LYS A 1  819  ? 256.707 140.979 176.862 1.00 370.00 ? 819  LYS A O   1 
ATOM 2408  C CB  . LYS A 1  819  ? 254.366 140.821 175.073 1.00 370.00 ? 819  LYS A CB  1 
ATOM 2409  C CG  . LYS A 1  819  ? 252.854 140.813 174.917 1.00 370.00 ? 819  LYS A CG  1 
ATOM 2410  C CD  . LYS A 1  819  ? 252.373 139.530 174.257 1.00 370.00 ? 819  LYS A CD  1 
ATOM 2411  C CE  . LYS A 1  819  ? 250.856 139.482 174.182 1.00 370.00 ? 819  LYS A CE  1 
ATOM 2412  N NZ  . LYS A 1  819  ? 250.310 140.516 173.260 1.00 370.00 ? 819  LYS A NZ  1 
ATOM 2413  N N   . ASP A 1  820  ? 257.296 142.646 175.470 1.00 370.00 ? 820  ASP A N   1 
ATOM 2414  C CA  . ASP A 1  820  ? 258.716 142.513 175.760 1.00 370.00 ? 820  ASP A CA  1 
ATOM 2415  C C   . ASP A 1  820  ? 259.036 143.049 177.150 1.00 370.00 ? 820  ASP A C   1 
ATOM 2416  O O   . ASP A 1  820  ? 258.380 143.963 177.656 1.00 370.00 ? 820  ASP A O   1 
ATOM 2417  C CB  . ASP A 1  820  ? 259.545 143.253 174.710 1.00 370.00 ? 820  ASP A CB  1 
ATOM 2418  C CG  . ASP A 1  820  ? 259.488 142.592 173.348 1.00 370.00 ? 820  ASP A CG  1 
ATOM 2419  O OD1 . ASP A 1  820  ? 259.321 141.355 173.293 1.00 370.00 ? 820  ASP A OD1 1 
ATOM 2420  O OD2 . ASP A 1  820  ? 259.610 143.308 172.333 1.00 370.00 ? 820  ASP A OD2 1 
ATOM 2421  N N   . ARG A 1  821  ? 260.051 142.462 177.771 1.00 370.00 ? 821  ARG A N   1 
ATOM 2422  C CA  . ARG A 1  821  ? 260.530 142.900 179.082 1.00 370.00 ? 821  ARG A CA  1 
ATOM 2423  C C   . ARG A 1  821  ? 262.008 143.240 178.955 1.00 370.00 ? 821  ARG A C   1 
ATOM 2424  O O   . ARG A 1  821  ? 262.835 142.322 178.782 1.00 370.00 ? 821  ARG A O   1 
ATOM 2425  C CB  . ARG A 1  821  ? 260.295 141.831 180.145 1.00 370.00 ? 821  ARG A CB  1 
ATOM 2426  C CG  . ARG A 1  821  ? 258.826 141.546 180.403 1.00 370.00 ? 821  ARG A CG  1 
ATOM 2427  C CD  . ARG A 1  821  ? 258.144 142.740 181.050 1.00 370.00 ? 821  ARG A CD  1 
ATOM 2428  N NE  . ARG A 1  821  ? 256.755 142.454 181.396 1.00 370.00 ? 821  ARG A NE  1 
ATOM 2429  C CZ  . ARG A 1  821  ? 255.722 142.678 180.589 1.00 370.00 ? 821  ARG A CZ  1 
ATOM 2430  N NH1 . ARG A 1  821  ? 255.919 143.190 179.382 1.00 370.00 ? 821  ARG A NH1 1 
ATOM 2431  N NH2 . ARG A 1  821  ? 254.492 142.388 180.987 1.00 370.00 ? 821  ARG A NH2 1 
ATOM 2432  N N   . PRO A 1  822  ? 262.398 144.528 179.026 1.00 370.00 ? 822  PRO A N   1 
ATOM 2433  C CA  . PRO A 1  822  ? 261.613 145.754 179.245 1.00 370.00 ? 822  PRO A CA  1 
ATOM 2434  C C   . PRO A 1  822  ? 260.757 146.178 178.048 1.00 370.00 ? 822  PRO A C   1 
ATOM 2435  O O   . PRO A 1  822  ? 261.069 145.806 176.916 1.00 370.00 ? 822  PRO A O   1 
ATOM 2436  C CB  . PRO A 1  822  ? 262.686 146.807 179.529 1.00 370.00 ? 822  PRO A CB  1 
ATOM 2437  C CG  . PRO A 1  822  ? 263.878 146.320 178.799 1.00 370.00 ? 822  PRO A CG  1 
ATOM 2438  C CD  . PRO A 1  822  ? 263.836 144.823 178.892 1.00 370.00 ? 822  PRO A CD  1 
ATOM 2439  N N   . ARG A 1  823  ? 259.680 146.913 178.327 1.00 370.00 ? 823  ARG A N   1 
ATOM 2440  C CA  . ARG A 1  823  ? 258.704 147.282 177.309 1.00 370.00 ? 823  ARG A CA  1 
ATOM 2441  C C   . ARG A 1  823  ? 259.317 148.209 176.264 1.00 370.00 ? 823  ARG A C   1 
ATOM 2442  O O   . ARG A 1  823  ? 260.148 149.068 176.570 1.00 370.00 ? 823  ARG A O   1 
ATOM 2443  C CB  . ARG A 1  823  ? 257.495 147.941 177.973 1.00 370.00 ? 823  ARG A CB  1 
ATOM 2444  C CG  . ARG A 1  823  ? 256.706 146.988 178.862 1.00 370.00 ? 823  ARG A CG  1 
ATOM 2445  C CD  . ARG A 1  823  ? 255.551 147.685 179.560 1.00 370.00 ? 823  ARG A CD  1 
ATOM 2446  N NE  . ARG A 1  823  ? 254.806 146.775 180.426 1.00 370.00 ? 823  ARG A NE  1 
ATOM 2447  C CZ  . ARG A 1  823  ? 253.778 146.038 180.019 1.00 370.00 ? 823  ARG A CZ  1 
ATOM 2448  N NH1 . ARG A 1  823  ? 253.373 146.105 178.759 1.00 370.00 ? 823  ARG A NH1 1 
ATOM 2449  N NH2 . ARG A 1  823  ? 253.154 145.234 180.870 1.00 370.00 ? 823  ARG A NH2 1 
ATOM 2450  N N   . ARG A 1  824  ? 258.895 148.027 175.013 1.00 370.00 ? 824  ARG A N   1 
ATOM 2451  C CA  . ARG A 1  824  ? 259.488 148.755 173.900 1.00 370.00 ? 824  ARG A CA  1 
ATOM 2452  C C   . ARG A 1  824  ? 258.473 148.916 172.775 1.00 370.00 ? 824  ARG A C   1 
ATOM 2453  O O   . ARG A 1  824  ? 257.609 148.060 172.568 1.00 370.00 ? 824  ARG A O   1 
ATOM 2454  C CB  . ARG A 1  824  ? 260.759 148.056 173.390 1.00 370.00 ? 824  ARG A CB  1 
ATOM 2455  C CG  . ARG A 1  824  ? 260.544 146.646 172.857 1.00 370.00 ? 824  ARG A CG  1 
ATOM 2456  C CD  . ARG A 1  824  ? 261.840 146.045 172.338 1.00 370.00 ? 824  ARG A CD  1 
ATOM 2457  N NE  . ARG A 1  824  ? 261.637 144.716 171.769 1.00 370.00 ? 824  ARG A NE  1 
ATOM 2458  C CZ  . ARG A 1  824  ? 262.598 143.992 171.203 1.00 370.00 ? 824  ARG A CZ  1 
ATOM 2459  N NH1 . ARG A 1  824  ? 263.832 144.471 171.127 1.00 370.00 ? 824  ARG A NH1 1 
ATOM 2460  N NH2 . ARG A 1  824  ? 262.325 142.792 170.711 1.00 370.00 ? 824  ARG A NH2 1 
ATOM 2461  N N   . ILE A 1  825  ? 258.576 150.043 172.062 1.00 370.00 ? 825  ILE A N   1 
ATOM 2462  C CA  . ILE A 1  825  ? 257.708 150.368 170.936 1.00 370.00 ? 825  ILE A CA  1 
ATOM 2463  C C   . ILE A 1  825  ? 258.557 150.914 169.793 1.00 370.00 ? 825  ILE A C   1 
ATOM 2464  O O   . ILE A 1  825  ? 259.745 151.197 169.952 1.00 370.00 ? 825  ILE A O   1 
ATOM 2465  C CB  . ILE A 1  825  ? 256.581 151.364 171.323 1.00 370.00 ? 825  ILE A CB  1 
ATOM 2466  C CG1 . ILE A 1  825  ? 257.125 152.620 172.025 1.00 370.00 ? 825  ILE A CG1 1 
ATOM 2467  C CG2 . ILE A 1  825  ? 255.519 150.686 172.180 1.00 370.00 ? 825  ILE A CG2 1 
ATOM 2468  C CD1 . ILE A 1  825  ? 257.339 153.846 171.130 1.00 370.00 ? 825  ILE A CD1 1 
ATOM 2469  N N   . ARG A 1  826  ? 257.926 151.064 168.630 1.00 370.00 ? 826  ARG A N   1 
ATOM 2470  C CA  . ARG A 1  826  ? 258.577 151.586 167.434 1.00 370.00 ? 826  ARG A CA  1 
ATOM 2471  C C   . ARG A 1  826  ? 258.002 152.946 167.056 1.00 370.00 ? 826  ARG A C   1 
ATOM 2472  O O   . ARG A 1  826  ? 256.806 153.194 167.244 1.00 370.00 ? 826  ARG A O   1 
ATOM 2473  C CB  . ARG A 1  826  ? 258.438 150.614 166.259 1.00 370.00 ? 826  ARG A CB  1 
ATOM 2474  C CG  . ARG A 1  826  ? 259.308 149.382 166.389 1.00 370.00 ? 826  ARG A CG  1 
ATOM 2475  C CD  . ARG A 1  826  ? 259.106 148.409 165.245 1.00 370.00 ? 826  ARG A CD  1 
ATOM 2476  N NE  . ARG A 1  826  ? 257.815 147.732 165.318 1.00 370.00 ? 826  ARG A NE  1 
ATOM 2477  C CZ  . ARG A 1  826  ? 257.352 146.911 164.384 1.00 370.00 ? 826  ARG A CZ  1 
ATOM 2478  N NH1 . ARG A 1  826  ? 258.075 146.664 163.300 1.00 370.00 ? 826  ARG A NH1 1 
ATOM 2479  N NH2 . ARG A 1  826  ? 256.167 146.334 164.530 1.00 370.00 ? 826  ARG A NH2 1 
ATOM 2480  N N   . MET A 1  827  ? 258.877 153.828 166.557 1.00 370.00 ? 827  MET A N   1 
ATOM 2481  C CA  . MET A 1  827  ? 258.455 155.102 165.974 1.00 370.00 ? 827  MET A CA  1 
ATOM 2482  C C   . MET A 1  827  ? 257.489 154.909 164.805 1.00 370.00 ? 827  MET A C   1 
ATOM 2483  O O   . MET A 1  827  ? 256.578 155.724 164.607 1.00 370.00 ? 827  MET A O   1 
ATOM 2484  C CB  . MET A 1  827  ? 259.692 155.894 165.533 1.00 370.00 ? 827  MET A CB  1 
ATOM 2485  C CG  . MET A 1  827  ? 259.408 157.257 164.909 1.00 370.00 ? 827  MET A CG  1 
ATOM 2486  S SD  . MET A 1  827  ? 258.573 158.410 166.009 1.00 370.00 ? 827  MET A SD  1 
ATOM 2487  C CE  . MET A 1  827  ? 259.906 158.870 167.109 1.00 370.00 ? 827  MET A CE  1 
ATOM 2488  N N   . GLU A 1  828  ? 257.685 153.842 164.018 1.00 370.00 ? 828  GLU A N   1 
ATOM 2489  C CA  . GLU A 1  828  ? 256.858 153.582 162.837 1.00 370.00 ? 828  GLU A CA  1 
ATOM 2490  C C   . GLU A 1  828  ? 255.389 153.356 163.193 1.00 370.00 ? 828  GLU A C   1 
ATOM 2491  O O   . GLU A 1  828  ? 254.492 153.738 162.432 1.00 370.00 ? 828  GLU A O   1 
ATOM 2492  C CB  . GLU A 1  828  ? 257.416 152.377 162.076 1.00 370.00 ? 828  GLU A CB  1 
ATOM 2493  C CG  . GLU A 1  828  ? 256.726 152.075 160.751 1.00 370.00 ? 828  GLU A CG  1 
ATOM 2494  C CD  . GLU A 1  828  ? 257.340 150.891 160.031 1.00 370.00 ? 828  GLU A CD  1 
ATOM 2495  O OE1 . GLU A 1  828  ? 258.292 150.296 160.577 1.00 370.00 ? 828  GLU A OE1 1 
ATOM 2496  O OE2 . GLU A 1  828  ? 256.871 150.555 158.923 1.00 370.00 ? 828  GLU A OE2 1 
ATOM 2497  N N   . ASP A 1  829  ? 255.123 152.749 164.355 1.00 370.00 ? 829  ASP A N   1 
ATOM 2498  C CA  . ASP A 1  829  ? 253.742 152.494 164.758 1.00 370.00 ? 829  ASP A CA  1 
ATOM 2499  C C   . ASP A 1  829  ? 253.012 153.777 165.132 1.00 370.00 ? 829  ASP A C   1 
ATOM 2500  O O   . ASP A 1  829  ? 251.801 153.887 164.910 1.00 370.00 ? 829  ASP A O   1 
ATOM 2501  C CB  . ASP A 1  829  ? 253.706 151.508 165.925 1.00 370.00 ? 829  ASP A CB  1 
ATOM 2502  C CG  . ASP A 1  829  ? 254.097 150.104 165.514 1.00 370.00 ? 829  ASP A CG  1 
ATOM 2503  O OD1 . ASP A 1  829  ? 253.857 149.737 164.344 1.00 370.00 ? 829  ASP A OD1 1 
ATOM 2504  O OD2 . ASP A 1  829  ? 254.643 149.366 166.361 1.00 370.00 ? 829  ASP A OD2 1 
ATOM 2505  N N   . ILE A 1  830  ? 253.726 154.752 165.697 1.00 370.00 ? 830  ILE A N   1 
ATOM 2506  C CA  . ILE A 1  830  ? 253.105 156.025 166.046 1.00 370.00 ? 830  ILE A CA  1 
ATOM 2507  C C   . ILE A 1  830  ? 252.869 156.863 164.794 1.00 370.00 ? 830  ILE A C   1 
ATOM 2508  O O   . ILE A 1  830  ? 251.817 157.500 164.643 1.00 370.00 ? 830  ILE A O   1 
ATOM 2509  C CB  . ILE A 1  830  ? 253.977 156.765 167.078 1.00 370.00 ? 830  ILE A CB  1 
ATOM 2510  C CG1 . ILE A 1  830  ? 254.141 155.917 168.339 1.00 370.00 ? 830  ILE A CG1 1 
ATOM 2511  C CG2 . ILE A 1  830  ? 253.371 158.110 167.447 1.00 370.00 ? 830  ILE A CG2 1 
ATOM 2512  C CD1 . ILE A 1  830  ? 255.171 156.458 169.304 1.00 370.00 ? 830  ILE A CD1 1 
ATOM 2513  N N   . LYS A 1  831  ? 253.843 156.871 163.877 1.00 370.00 ? 831  LYS A N   1 
ATOM 2514  C CA  . LYS A 1  831  ? 253.735 157.659 162.650 1.00 370.00 ? 831  LYS A CA  1 
ATOM 2515  C C   . LYS A 1  831  ? 252.645 157.117 161.729 1.00 370.00 ? 831  LYS A C   1 
ATOM 2516  O O   . LYS A 1  831  ? 251.997 157.883 161.004 1.00 370.00 ? 831  LYS A O   1 
ATOM 2517  C CB  . LYS A 1  831  ? 255.091 157.686 161.939 1.00 370.00 ? 831  LYS A CB  1 
ATOM 2518  C CG  . LYS A 1  831  ? 255.160 158.566 160.695 1.00 370.00 ? 831  LYS A CG  1 
ATOM 2519  C CD  . LYS A 1  831  ? 255.061 160.041 161.056 1.00 370.00 ? 831  LYS A CD  1 
ATOM 2520  C CE  . LYS A 1  831  ? 255.282 160.929 159.840 1.00 370.00 ? 831  LYS A CE  1 
ATOM 2521  N NZ  . LYS A 1  831  ? 254.192 160.788 158.836 1.00 370.00 ? 831  LYS A NZ  1 
ATOM 2522  N N   . LYS A 1  832  ? 252.433 155.795 161.740 1.00 370.00 ? 832  LYS A N   1 
ATOM 2523  C CA  . LYS A 1  832  ? 251.352 155.205 160.951 1.00 370.00 ? 832  LYS A CA  1 
ATOM 2524  C C   . LYS A 1  832  ? 249.985 155.640 161.471 1.00 370.00 ? 832  LYS A C   1 
ATOM 2525  O O   . LYS A 1  832  ? 249.055 155.862 160.686 1.00 370.00 ? 832  LYS A O   1 
ATOM 2526  C CB  . LYS A 1  832  ? 251.471 153.679 160.956 1.00 370.00 ? 832  LYS A CB  1 
ATOM 2527  C CG  . LYS A 1  832  ? 250.458 152.959 160.071 1.00 370.00 ? 832  LYS A CG  1 
ATOM 2528  C CD  . LYS A 1  832  ? 250.692 151.455 160.050 1.00 370.00 ? 832  LYS A CD  1 
ATOM 2529  C CE  . LYS A 1  832  ? 249.935 150.757 161.171 1.00 370.00 ? 832  LYS A CE  1 
ATOM 2530  N NZ  . LYS A 1  832  ? 250.689 150.753 162.456 1.00 370.00 ? 832  LYS A NZ  1 
ATOM 2531  N N   . ALA A 1  833  ? 249.848 155.785 162.791 1.00 370.00 ? 833  ALA A N   1 
ATOM 2532  C CA  . ALA A 1  833  ? 248.595 156.266 163.360 1.00 370.00 ? 833  ALA A CA  1 
ATOM 2533  C C   . ALA A 1  833  ? 248.483 157.784 163.294 1.00 370.00 ? 833  ALA A C   1 
ATOM 2534  O O   . ALA A 1  833  ? 247.369 158.316 163.220 1.00 370.00 ? 833  ALA A O   1 
ATOM 2535  C CB  . ALA A 1  833  ? 248.457 155.786 164.806 1.00 370.00 ? 833  ALA A CB  1 
ATOM 2536  N N   . PHE A 1  834  ? 249.615 158.489 163.302 1.00 370.00 ? 834  PHE A N   1 
ATOM 2537  C CA  . PHE A 1  834  ? 249.669 159.951 163.273 1.00 370.00 ? 834  PHE A CA  1 
ATOM 2538  C C   . PHE A 1  834  ? 250.502 160.450 162.094 1.00 370.00 ? 834  PHE A C   1 
ATOM 2539  O O   . PHE A 1  834  ? 251.629 160.926 162.278 1.00 370.00 ? 834  PHE A O   1 
ATOM 2540  C CB  . PHE A 1  834  ? 250.238 160.477 164.587 1.00 370.00 ? 834  PHE A CB  1 
ATOM 2541  C CG  . PHE A 1  834  ? 249.270 160.440 165.725 1.00 370.00 ? 834  PHE A CG  1 
ATOM 2542  C CD1 . PHE A 1  834  ? 247.904 160.506 165.498 1.00 370.00 ? 834  PHE A CD1 1 
ATOM 2543  C CD2 . PHE A 1  834  ? 249.725 160.299 167.021 1.00 370.00 ? 834  PHE A CD2 1 
ATOM 2544  C CE1 . PHE A 1  834  ? 247.017 160.465 166.549 1.00 370.00 ? 834  PHE A CE1 1 
ATOM 2545  C CE2 . PHE A 1  834  ? 248.838 160.248 168.075 1.00 370.00 ? 834  PHE A CE2 1 
ATOM 2546  C CZ  . PHE A 1  834  ? 247.484 160.330 167.839 1.00 370.00 ? 834  PHE A CZ  1 
ATOM 2547  N N   . PRO A 1  835  ? 249.984 160.351 160.864 1.00 370.00 ? 835  PRO A N   1 
ATOM 2548  C CA  . PRO A 1  835  ? 250.772 160.796 159.701 1.00 370.00 ? 835  PRO A CA  1 
ATOM 2549  C C   . PRO A 1  835  ? 250.908 162.307 159.581 1.00 370.00 ? 835  PRO A C   1 
ATOM 2550  O O   . PRO A 1  835  ? 251.771 162.770 158.826 1.00 370.00 ? 835  PRO A O   1 
ATOM 2551  C CB  . PRO A 1  835  ? 249.993 160.219 158.513 1.00 370.00 ? 835  PRO A CB  1 
ATOM 2552  C CG  . PRO A 1  835  ? 248.588 160.197 158.992 1.00 370.00 ? 835  PRO A CG  1 
ATOM 2553  C CD  . PRO A 1  835  ? 248.640 159.894 160.466 1.00 370.00 ? 835  PRO A CD  1 
ATOM 2554  N N   . SER A 1  836  ? 250.097 163.085 160.296 1.00 370.00 ? 836  SER A N   1 
ATOM 2555  C CA  . SER A 1  836  ? 250.147 164.539 160.221 1.00 370.00 ? 836  SER A CA  1 
ATOM 2556  C C   . SER A 1  836  ? 251.090 165.149 161.246 1.00 370.00 ? 836  SER A C   1 
ATOM 2557  O O   . SER A 1  836  ? 251.254 166.373 161.268 1.00 370.00 ? 836  SER A O   1 
ATOM 2558  C CB  . SER A 1  836  ? 248.743 165.127 160.398 1.00 370.00 ? 836  SER A CB  1 
ATOM 2559  O OG  . SER A 1  836  ? 248.237 164.861 161.695 1.00 370.00 ? 836  SER A OG  1 
ATOM 2560  N N   . HIS A 1  837  ? 251.710 164.331 162.091 1.00 370.00 ? 837  HIS A N   1 
ATOM 2561  C CA  . HIS A 1  837  ? 252.720 164.804 163.023 1.00 370.00 ? 837  HIS A CA  1 
ATOM 2562  C C   . HIS A 1  837  ? 254.115 164.625 162.444 1.00 370.00 ? 837  HIS A C   1 
ATOM 2563  O O   . HIS A 1  837  ? 254.407 163.622 161.786 1.00 370.00 ? 837  HIS A O   1 
ATOM 2564  C CB  . HIS A 1  837  ? 252.627 164.063 164.356 1.00 370.00 ? 837  HIS A CB  1 
ATOM 2565  C CG  . HIS A 1  837  ? 251.450 164.462 165.185 1.00 370.00 ? 837  HIS A CG  1 
ATOM 2566  N ND1 . HIS A 1  837  ? 250.228 163.829 165.107 1.00 370.00 ? 837  HIS A ND1 1 
ATOM 2567  C CD2 . HIS A 1  837  ? 251.308 165.442 166.108 1.00 370.00 ? 837  HIS A CD2 1 
ATOM 2568  C CE1 . HIS A 1  837  ? 249.387 164.396 165.953 1.00 370.00 ? 837  HIS A CE1 1 
ATOM 2569  N NE2 . HIS A 1  837  ? 250.017 165.378 166.570 1.00 370.00 ? 837  HIS A NE2 1 
ATOM 2570  N N   . SER A 1  838  ? 254.973 165.607 162.694 1.00 370.00 ? 838  SER A N   1 
ATOM 2571  C CA  . SER A 1  838  ? 256.392 165.431 162.444 1.00 370.00 ? 838  SER A CA  1 
ATOM 2572  C C   . SER A 1  838  ? 256.986 164.502 163.497 1.00 370.00 ? 838  SER A C   1 
ATOM 2573  O O   . SER A 1  838  ? 256.432 164.328 164.586 1.00 370.00 ? 838  SER A O   1 
ATOM 2574  C CB  . SER A 1  838  ? 257.114 166.778 162.458 1.00 370.00 ? 838  SER A CB  1 
ATOM 2575  O OG  . SER A 1  838  ? 257.097 167.353 163.752 1.00 370.00 ? 838  SER A OG  1 
ATOM 2576  N N   . GLU A 1  839  ? 258.112 163.875 163.146 1.00 370.00 ? 839  GLU A N   1 
ATOM 2577  C CA  . GLU A 1  839  ? 258.805 162.996 164.084 1.00 370.00 ? 839  GLU A CA  1 
ATOM 2578  C C   . GLU A 1  839  ? 259.370 163.769 165.277 1.00 370.00 ? 839  GLU A C   1 
ATOM 2579  O O   . GLU A 1  839  ? 259.495 163.210 166.373 1.00 370.00 ? 839  GLU A O   1 
ATOM 2580  C CB  . GLU A 1  839  ? 259.910 162.231 163.350 1.00 370.00 ? 839  GLU A CB  1 
ATOM 2581  C CG  . GLU A 1  839  ? 260.580 161.121 164.150 1.00 370.00 ? 839  GLU A CG  1 
ATOM 2582  C CD  . GLU A 1  839  ? 261.653 160.404 163.356 1.00 370.00 ? 839  GLU A CD  1 
ATOM 2583  O OE1 . GLU A 1  839  ? 261.869 160.775 162.183 1.00 370.00 ? 839  GLU A OE1 1 
ATOM 2584  O OE2 . GLU A 1  839  ? 262.286 159.479 163.905 1.00 370.00 ? 839  GLU A OE2 1 
ATOM 2585  N N   . SER A 1  840  ? 259.702 165.052 165.087 1.00 370.00 ? 840  SER A N   1 
ATOM 2586  C CA  . SER A 1  840  ? 260.239 165.861 166.180 1.00 370.00 ? 840  SER A CA  1 
ATOM 2587  C C   . SER A 1  840  ? 259.192 166.116 167.261 1.00 370.00 ? 840  SER A C   1 
ATOM 2588  O O   . SER A 1  840  ? 259.527 166.180 168.450 1.00 370.00 ? 840  SER A O   1 
ATOM 2589  C CB  . SER A 1  840  ? 260.779 167.187 165.640 1.00 370.00 ? 840  SER A CB  1 
ATOM 2590  O OG  . SER A 1  840  ? 261.289 167.995 166.687 1.00 370.00 ? 840  SER A OG  1 
ATOM 2591  N N   . SER A 1  841  ? 257.923 166.263 166.870 1.00 370.00 ? 841  SER A N   1 
ATOM 2592  C CA  . SER A 1  841  ? 256.858 166.417 167.857 1.00 370.00 ? 841  SER A CA  1 
ATOM 2593  C C   . SER A 1  841  ? 256.604 165.117 168.609 1.00 370.00 ? 841  SER A C   1 
ATOM 2594  O O   . SER A 1  841  ? 256.177 165.144 169.769 1.00 370.00 ? 841  SER A O   1 
ATOM 2595  C CB  . SER A 1  841  ? 255.575 166.893 167.176 1.00 370.00 ? 841  SER A CB  1 
ATOM 2596  O OG  . SER A 1  841  ? 255.077 165.912 166.282 1.00 370.00 ? 841  SER A OG  1 
ATOM 2597  N N   . ILE A 1  842  ? 256.852 163.977 167.962 1.00 370.00 ? 842  ILE A N   1 
ATOM 2598  C CA  . ILE A 1  842  ? 256.768 162.689 168.641 1.00 370.00 ? 842  ILE A CA  1 
ATOM 2599  C C   . ILE A 1  842  ? 257.998 162.477 169.522 1.00 370.00 ? 842  ILE A C   1 
ATOM 2600  O O   . ILE A 1  842  ? 257.924 161.830 170.576 1.00 370.00 ? 842  ILE A O   1 
ATOM 2601  C CB  . ILE A 1  842  ? 256.587 161.566 167.601 1.00 370.00 ? 842  ILE A CB  1 
ATOM 2602  C CG1 . ILE A 1  842  ? 255.375 161.862 166.717 1.00 370.00 ? 842  ILE A CG1 1 
ATOM 2603  C CG2 . ILE A 1  842  ? 256.348 160.225 168.272 1.00 370.00 ? 842  ILE A CG2 1 
ATOM 2604  C CD1 . ILE A 1  842  ? 255.271 160.961 165.503 1.00 370.00 ? 842  ILE A CD1 1 
ATOM 2605  N N   . ARG A 1  843  ? 259.147 163.030 169.108 1.00 370.00 ? 843  ARG A N   1 
ATOM 2606  C CA  . ARG A 1  843  ? 260.354 162.992 169.936 1.00 370.00 ? 843  ARG A CA  1 
ATOM 2607  C C   . ARG A 1  843  ? 260.188 163.753 171.248 1.00 370.00 ? 843  ARG A C   1 
ATOM 2608  O O   . ARG A 1  843  ? 260.883 163.451 172.225 1.00 370.00 ? 843  ARG A O   1 
ATOM 2609  C CB  . ARG A 1  843  ? 261.552 163.553 169.162 1.00 370.00 ? 843  ARG A CB  1 
ATOM 2610  C CG  . ARG A 1  843  ? 262.189 162.592 168.168 1.00 370.00 ? 843  ARG A CG  1 
ATOM 2611  C CD  . ARG A 1  843  ? 263.510 163.144 167.621 1.00 370.00 ? 843  ARG A CD  1 
ATOM 2612  N NE  . ARG A 1  843  ? 263.366 164.220 166.646 1.00 370.00 ? 843  ARG A NE  1 
ATOM 2613  C CZ  . ARG A 1  843  ? 263.354 164.025 165.330 1.00 370.00 ? 843  ARG A CZ  1 
ATOM 2614  N NH1 . ARG A 1  843  ? 263.485 162.803 164.839 1.00 370.00 ? 843  ARG A NH1 1 
ATOM 2615  N NH2 . ARG A 1  843  ? 263.229 165.050 164.502 1.00 370.00 ? 843  ARG A NH2 1 
ATOM 2616  N N   . LYS A 1  844  ? 259.296 164.745 171.288 1.00 370.00 ? 844  LYS A N   1 
ATOM 2617  C CA  . LYS A 1  844  ? 259.044 165.476 172.527 1.00 370.00 ? 844  LYS A CA  1 
ATOM 2618  C C   . LYS A 1  844  ? 258.320 164.605 173.548 1.00 370.00 ? 844  LYS A C   1 
ATOM 2619  O O   . LYS A 1  844  ? 258.639 164.627 174.742 1.00 370.00 ? 844  LYS A O   1 
ATOM 2620  C CB  . LYS A 1  844  ? 258.245 166.743 172.227 1.00 370.00 ? 844  LYS A CB  1 
ATOM 2621  C CG  . LYS A 1  844  ? 259.019 167.746 171.395 1.00 370.00 ? 844  LYS A CG  1 
ATOM 2622  C CD  . LYS A 1  844  ? 258.218 169.002 171.105 1.00 370.00 ? 844  LYS A CD  1 
ATOM 2623  C CE  . LYS A 1  844  ? 259.025 169.953 170.235 1.00 370.00 ? 844  LYS A CE  1 
ATOM 2624  N NZ  . LYS A 1  844  ? 258.270 171.191 169.902 1.00 370.00 ? 844  LYS A NZ  1 
ATOM 2625  N N   . ARG A 1  845  ? 257.329 163.837 173.094 1.00 370.00 ? 845  ARG A N   1 
ATOM 2626  C CA  . ARG A 1  845  ? 256.521 163.027 173.999 1.00 370.00 ? 845  ARG A CA  1 
ATOM 2627  C C   . ARG A 1  845  ? 257.238 161.766 174.467 1.00 370.00 ? 845  ARG A C   1 
ATOM 2628  O O   . ARG A 1  845  ? 256.816 161.162 175.460 1.00 370.00 ? 845  ARG A O   1 
ATOM 2629  C CB  . ARG A 1  845  ? 255.207 162.664 173.313 1.00 370.00 ? 845  ARG A CB  1 
ATOM 2630  C CG  . ARG A 1  845  ? 254.350 163.861 172.905 1.00 370.00 ? 845  ARG A CG  1 
ATOM 2631  C CD  . ARG A 1  845  ? 253.752 164.597 174.090 1.00 370.00 ? 845  ARG A CD  1 
ATOM 2632  N NE  . ARG A 1  845  ? 254.590 165.689 174.575 1.00 370.00 ? 845  ARG A NE  1 
ATOM 2633  C CZ  . ARG A 1  845  ? 254.427 166.282 175.753 1.00 370.00 ? 845  ARG A CZ  1 
ATOM 2634  N NH1 . ARG A 1  845  ? 253.460 165.885 176.568 1.00 370.00 ? 845  ARG A NH1 1 
ATOM 2635  N NH2 . ARG A 1  845  ? 255.232 167.270 176.114 1.00 370.00 ? 845  ARG A NH2 1 
ATOM 2636  N N   . LEU A 1  846  ? 258.298 161.349 173.773 1.00 370.00 ? 846  LEU A N   1 
ATOM 2637  C CA  . LEU A 1  846  ? 258.989 160.102 174.073 1.00 370.00 ? 846  LEU A CA  1 
ATOM 2638  C C   . LEU A 1  846  ? 260.266 160.282 174.880 1.00 370.00 ? 846  LEU A C   1 
ATOM 2639  O O   . LEU A 1  846  ? 260.824 159.286 175.354 1.00 370.00 ? 846  LEU A O   1 
ATOM 2640  C CB  . LEU A 1  846  ? 259.319 159.359 172.771 1.00 370.00 ? 846  LEU A CB  1 
ATOM 2641  C CG  . LEU A 1  846  ? 258.127 158.744 172.039 1.00 370.00 ? 846  LEU A CG  1 
ATOM 2642  C CD1 . LEU A 1  846  ? 258.510 158.257 170.656 1.00 370.00 ? 846  LEU A CD1 1 
ATOM 2643  C CD2 . LEU A 1  846  ? 257.579 157.597 172.866 1.00 370.00 ? 846  LEU A CD2 1 
ATOM 2644  N N   . LYS A 1  847  ? 260.749 161.517 175.040 1.00 370.00 ? 847  LYS A N   1 
ATOM 2645  C CA  . LYS A 1  847  ? 262.038 161.726 175.690 1.00 370.00 ? 847  LYS A CA  1 
ATOM 2646  C C   . LYS A 1  847  ? 261.961 161.548 177.203 1.00 370.00 ? 847  LYS A C   1 
ATOM 2647  O O   . LYS A 1  847  ? 262.957 161.166 177.828 1.00 370.00 ? 847  LYS A O   1 
ATOM 2648  C CB  . LYS A 1  847  ? 262.588 163.110 175.327 1.00 370.00 ? 847  LYS A CB  1 
ATOM 2649  C CG  . LYS A 1  847  ? 261.750 164.287 175.807 1.00 370.00 ? 847  LYS A CG  1 
ATOM 2650  C CD  . LYS A 1  847  ? 262.336 165.610 175.348 1.00 370.00 ? 847  LYS A CD  1 
ATOM 2651  C CE  . LYS A 1  847  ? 263.630 165.922 176.080 1.00 370.00 ? 847  LYS A CE  1 
ATOM 2652  N NZ  . LYS A 1  847  ? 263.396 166.169 177.529 1.00 370.00 ? 847  LYS A NZ  1 
ATOM 2653  N N   . LEU A 1  848  ? 260.799 161.798 177.812 1.00 370.00 ? 848  LEU A N   1 
ATOM 2654  C CA  . LEU A 1  848  ? 260.700 161.712 179.265 1.00 370.00 ? 848  LEU A CA  1 
ATOM 2655  C C   . LEU A 1  848  ? 260.469 160.288 179.755 1.00 370.00 ? 848  LEU A C   1 
ATOM 2656  O O   . LEU A 1  848  ? 260.800 159.972 180.902 1.00 370.00 ? 848  LEU A O   1 
ATOM 2657  C CB  . LEU A 1  848  ? 259.579 162.621 179.774 1.00 370.00 ? 848  LEU A CB  1 
ATOM 2658  C CG  . LEU A 1  848  ? 259.798 164.129 179.629 1.00 370.00 ? 848  LEU A CG  1 
ATOM 2659  C CD1 . LEU A 1  848  ? 258.564 164.905 180.070 1.00 370.00 ? 848  LEU A CD1 1 
ATOM 2660  C CD2 . LEU A 1  848  ? 261.023 164.573 180.414 1.00 370.00 ? 848  LEU A CD2 1 
ATOM 2661  N N   . CYS A 1  849  ? 259.906 159.420 178.917 1.00 370.00 ? 849  CYS A N   1 
ATOM 2662  C CA  . CYS A 1  849  ? 259.498 158.094 179.353 1.00 370.00 ? 849  CYS A CA  1 
ATOM 2663  C C   . CYS A 1  849  ? 260.290 156.960 178.722 1.00 370.00 ? 849  CYS A C   1 
ATOM 2664  O O   . CYS A 1  849  ? 260.178 155.822 179.189 1.00 370.00 ? 849  CYS A O   1 
ATOM 2665  C CB  . CYS A 1  849  ? 258.005 157.881 179.061 1.00 370.00 ? 849  CYS A CB  1 
ATOM 2666  S SG  . CYS A 1  849  ? 257.577 157.919 177.303 1.00 370.00 ? 849  CYS A SG  1 
ATOM 2667  N N   . ALA A 1  850  ? 261.090 157.224 177.692 1.00 370.00 ? 850  ALA A N   1 
ATOM 2668  C CA  . ALA A 1  850  ? 261.723 156.132 176.970 1.00 370.00 ? 850  ALA A CA  1 
ATOM 2669  C C   . ALA A 1  850  ? 263.158 156.493 176.619 1.00 370.00 ? 850  ALA A C   1 
ATOM 2670  O O   . ALA A 1  850  ? 263.540 157.666 176.600 1.00 370.00 ? 850  ALA A O   1 
ATOM 2671  C CB  . ALA A 1  850  ? 260.944 155.776 175.698 1.00 370.00 ? 850  ALA A CB  1 
ATOM 2672  N N   . ASP A 1  851  ? 263.949 155.457 176.342 1.00 370.00 ? 851  ASP A N   1 
ATOM 2673  C CA  . ASP A 1  851  ? 265.338 155.590 175.923 1.00 370.00 ? 851  ASP A CA  1 
ATOM 2674  C C   . ASP A 1  851  ? 265.530 154.919 174.571 1.00 370.00 ? 851  ASP A C   1 
ATOM 2675  O O   . ASP A 1  851  ? 265.088 153.784 174.366 1.00 370.00 ? 851  ASP A O   1 
ATOM 2676  C CB  . ASP A 1  851  ? 266.296 154.981 176.948 1.00 370.00 ? 851  ASP A CB  1 
ATOM 2677  C CG  . ASP A 1  851  ? 266.410 155.813 178.203 1.00 370.00 ? 851  ASP A CG  1 
ATOM 2678  O OD1 . ASP A 1  851  ? 266.277 157.052 178.109 1.00 370.00 ? 851  ASP A OD1 1 
ATOM 2679  O OD2 . ASP A 1  851  ? 266.622 155.222 179.282 1.00 370.00 ? 851  ASP A OD2 1 
ATOM 2680  N N   . PHE A 1  852  ? 266.195 155.624 173.663 1.00 370.00 ? 852  PHE A N   1 
ATOM 2681  C CA  . PHE A 1  852  ? 266.385 155.142 172.301 1.00 370.00 ? 852  PHE A CA  1 
ATOM 2682  C C   . PHE A 1  852  ? 267.560 154.173 172.229 1.00 370.00 ? 852  PHE A C   1 
ATOM 2683  O O   . PHE A 1  852  ? 268.685 154.523 172.605 1.00 370.00 ? 852  PHE A O   1 
ATOM 2684  C CB  . PHE A 1  852  ? 266.588 156.333 171.367 1.00 370.00 ? 852  PHE A CB  1 
ATOM 2685  C CG  . PHE A 1  852  ? 266.977 155.953 169.969 1.00 370.00 ? 852  PHE A CG  1 
ATOM 2686  C CD1 . PHE A 1  852  ? 266.084 155.301 169.138 1.00 370.00 ? 852  PHE A CD1 1 
ATOM 2687  C CD2 . PHE A 1  852  ? 268.226 156.291 169.472 1.00 370.00 ? 852  PHE A CD2 1 
ATOM 2688  C CE1 . PHE A 1  852  ? 266.444 154.964 167.842 1.00 370.00 ? 852  PHE A CE1 1 
ATOM 2689  C CE2 . PHE A 1  852  ? 268.591 155.958 168.182 1.00 370.00 ? 852  PHE A CE2 1 
ATOM 2690  C CZ  . PHE A 1  852  ? 267.701 155.295 167.366 1.00 370.00 ? 852  PHE A CZ  1 
ATOM 2691  N N   . LYS A 1  853  ? 267.293 152.952 171.752 1.00 370.00 ? 853  LYS A N   1 
ATOM 2692  C CA  . LYS A 1  853  ? 268.304 151.923 171.518 1.00 370.00 ? 853  LYS A CA  1 
ATOM 2693  C C   . LYS A 1  853  ? 268.362 151.680 170.016 1.00 370.00 ? 853  LYS A C   1 
ATOM 2694  O O   . LYS A 1  853  ? 267.414 151.141 169.434 1.00 370.00 ? 853  LYS A O   1 
ATOM 2695  C CB  . LYS A 1  853  ? 267.971 150.621 172.250 1.00 370.00 ? 853  LYS A CB  1 
ATOM 2696  C CG  . LYS A 1  853  ? 267.800 150.696 173.766 1.00 370.00 ? 853  LYS A CG  1 
ATOM 2697  C CD  . LYS A 1  853  ? 269.114 150.847 174.533 1.00 370.00 ? 853  LYS A CD  1 
ATOM 2698  C CE  . LYS A 1  853  ? 269.375 152.273 175.020 1.00 370.00 ? 853  LYS A CE  1 
ATOM 2699  N NZ  . LYS A 1  853  ? 270.540 152.314 175.954 1.00 370.00 ? 853  LYS A NZ  1 
ATOM 2700  N N   . ARG A 1  854  ? 269.469 152.064 169.391 1.00 370.00 ? 854  ARG A N   1 
ATOM 2701  C CA  . ARG A 1  854  ? 269.606 151.927 167.949 1.00 370.00 ? 854  ARG A CA  1 
ATOM 2702  C C   . ARG A 1  854  ? 270.130 150.541 167.596 1.00 370.00 ? 854  ARG A C   1 
ATOM 2703  O O   . ARG A 1  854  ? 270.956 149.966 168.314 1.00 370.00 ? 854  ARG A O   1 
ATOM 2704  C CB  . ARG A 1  854  ? 270.518 153.017 167.383 1.00 370.00 ? 854  ARG A CB  1 
ATOM 2705  C CG  . ARG A 1  854  ? 271.955 152.989 167.867 1.00 370.00 ? 854  ARG A CG  1 
ATOM 2706  C CD  . ARG A 1  854  ? 272.669 154.219 167.389 1.00 370.00 ? 854  ARG A CD  1 
ATOM 2707  N NE  . ARG A 1  854  ? 272.723 154.288 165.934 1.00 370.00 ? 854  ARG A NE  1 
ATOM 2708  C CZ  . ARG A 1  854  ? 272.915 155.416 165.267 1.00 370.00 ? 854  ARG A CZ  1 
ATOM 2709  N NH1 . ARG A 1  854  ? 273.053 156.551 165.940 1.00 370.00 ? 854  ARG A NH1 1 
ATOM 2710  N NH2 . ARG A 1  854  ? 272.958 155.421 163.940 1.00 370.00 ? 854  ARG A NH2 1 
ATOM 2711  N N   . THR A 1  855  ? 269.603 149.997 166.504 1.00 370.00 ? 855  THR A N   1 
ATOM 2712  C CA  . THR A 1  855  ? 269.882 148.647 166.047 1.00 370.00 ? 855  THR A CA  1 
ATOM 2713  C C   . THR A 1  855  ? 270.197 148.718 164.556 1.00 370.00 ? 855  THR A C   1 
ATOM 2714  O O   . THR A 1  855  ? 269.681 149.579 163.840 1.00 370.00 ? 855  THR A O   1 
ATOM 2715  C CB  . THR A 1  855  ? 268.672 147.735 166.337 1.00 370.00 ? 855  THR A CB  1 
ATOM 2716  O OG1 . THR A 1  855  ? 268.269 147.923 167.700 1.00 370.00 ? 855  THR A OG1 1 
ATOM 2717  C CG2 . THR A 1  855  ? 268.995 146.251 166.135 1.00 370.00 ? 855  THR A CG2 1 
ATOM 2718  N N   . GLY A 1  856  ? 271.040 147.800 164.081 1.00 370.00 ? 856  GLY A N   1 
ATOM 2719  C CA  . GLY A 1  856  ? 271.520 147.852 162.715 1.00 370.00 ? 856  GLY A CA  1 
ATOM 2720  C C   . GLY A 1  856  ? 270.545 147.438 161.629 1.00 370.00 ? 856  GLY A C   1 
ATOM 2721  O O   . GLY A 1  856  ? 270.812 146.508 160.865 1.00 370.00 ? 856  GLY A O   1 
ATOM 2722  N N   . MET A 1  857  ? 269.466 148.210 161.496 1.00 370.00 ? 857  MET A N   1 
ATOM 2723  C CA  . MET A 1  857  ? 268.319 147.995 160.616 1.00 370.00 ? 857  MET A CA  1 
ATOM 2724  C C   . MET A 1  857  ? 267.522 149.289 160.613 1.00 370.00 ? 857  MET A C   1 
ATOM 2725  O O   . MET A 1  857  ? 267.617 150.071 161.565 1.00 370.00 ? 857  MET A O   1 
ATOM 2726  C CB  . MET A 1  857  ? 267.421 146.833 161.067 1.00 370.00 ? 857  MET A CB  1 
ATOM 2727  C CG  . MET A 1  857  ? 267.828 145.444 160.603 1.00 370.00 ? 857  MET A CG  1 
ATOM 2728  S SD  . MET A 1  857  ? 266.754 144.145 161.228 1.00 370.00 ? 857  MET A SD  1 
ATOM 2729  C CE  . MET A 1  857  ? 267.518 142.698 160.496 1.00 370.00 ? 857  MET A CE  1 
ATOM 2730  N N   . ASP A 1  858  ? 266.768 149.551 159.545 1.00 370.00 ? 858  ASP A N   1 
ATOM 2731  C CA  . ASP A 1  858  ? 265.887 150.719 159.490 1.00 370.00 ? 858  ASP A CA  1 
ATOM 2732  C C   . ASP A 1  858  ? 264.547 150.413 160.173 1.00 370.00 ? 858  ASP A C   1 
ATOM 2733  O O   . ASP A 1  858  ? 263.468 150.552 159.597 1.00 370.00 ? 858  ASP A O   1 
ATOM 2734  C CB  . ASP A 1  858  ? 265.707 151.153 158.039 1.00 370.00 ? 858  ASP A CB  1 
ATOM 2735  C CG  . ASP A 1  858  ? 265.107 152.549 157.896 1.00 370.00 ? 858  ASP A CG  1 
ATOM 2736  O OD1 . ASP A 1  858  ? 264.795 153.206 158.915 1.00 370.00 ? 858  ASP A OD1 1 
ATOM 2737  O OD2 . ASP A 1  858  ? 264.947 152.992 156.740 1.00 370.00 ? 858  ASP A OD2 1 
ATOM 2738  N N   . SER A 1  859  ? 264.646 150.025 161.446 1.00 370.00 ? 859  SER A N   1 
ATOM 2739  C CA  . SER A 1  859  ? 263.503 149.721 162.304 1.00 370.00 ? 859  SER A CA  1 
ATOM 2740  C C   . SER A 1  859  ? 264.026 149.658 163.731 1.00 370.00 ? 859  SER A C   1 
ATOM 2741  O O   . SER A 1  859  ? 264.634 148.654 164.114 1.00 370.00 ? 859  SER A O   1 
ATOM 2742  C CB  . SER A 1  859  ? 262.856 148.389 161.905 1.00 370.00 ? 859  SER A CB  1 
ATOM 2743  O OG  . SER A 1  859  ? 261.760 148.082 162.744 1.00 370.00 ? 859  SER A OG  1 
ATOM 2744  N N   . ASN A 1  860  ? 263.785 150.704 164.523 1.00 370.00 ? 860  ASN A N   1 
ATOM 2745  C CA  . ASN A 1  860  ? 264.429 150.847 165.823 1.00 370.00 ? 860  ASN A CA  1 
ATOM 2746  C C   . ASN A 1  860  ? 263.390 151.008 166.927 1.00 370.00 ? 860  ASN A C   1 
ATOM 2747  O O   . ASN A 1  860  ? 262.226 151.330 166.675 1.00 370.00 ? 860  ASN A O   1 
ATOM 2748  C CB  . ASN A 1  860  ? 265.407 152.034 165.833 1.00 370.00 ? 860  ASN A CB  1 
ATOM 2749  C CG  . ASN A 1  860  ? 266.653 151.773 165.000 1.00 370.00 ? 860  ASN A CG  1 
ATOM 2750  O OD1 . ASN A 1  860  ? 267.238 150.691 165.056 1.00 370.00 ? 860  ASN A OD1 1 
ATOM 2751  N ND2 . ASN A 1  860  ? 267.059 152.767 164.216 1.00 370.00 ? 860  ASN A ND2 1 
ATOM 2752  N N   . TRP A 1  861  ? 263.830 150.785 168.168 1.00 370.00 ? 861  TRP A N   1 
ATOM 2753  C CA  . TRP A 1  861  ? 262.936 150.648 169.309 1.00 370.00 ? 861  TRP A CA  1 
ATOM 2754  C C   . TRP A 1  861  ? 263.130 151.781 170.312 1.00 370.00 ? 861  TRP A C   1 
ATOM 2755  O O   . TRP A 1  861  ? 264.245 152.265 170.523 1.00 370.00 ? 861  TRP A O   1 
ATOM 2756  C CB  . TRP A 1  861  ? 263.162 149.303 170.018 1.00 370.00 ? 861  TRP A CB  1 
ATOM 2757  C CG  . TRP A 1  861  ? 262.845 148.107 169.165 1.00 370.00 ? 861  TRP A CG  1 
ATOM 2758  C CD1 . TRP A 1  861  ? 263.728 147.378 168.421 1.00 370.00 ? 861  TRP A CD1 1 
ATOM 2759  C CD2 . TRP A 1  861  ? 261.561 147.497 168.975 1.00 370.00 ? 861  TRP A CD2 1 
ATOM 2760  N NE1 . TRP A 1  861  ? 263.074 146.357 167.775 1.00 370.00 ? 861  TRP A NE1 1 
ATOM 2761  C CE2 . TRP A 1  861  ? 261.744 146.407 168.099 1.00 370.00 ? 861  TRP A CE2 1 
ATOM 2762  C CE3 . TRP A 1  861  ? 260.276 147.767 169.457 1.00 370.00 ? 861  TRP A CE3 1 
ATOM 2763  C CZ2 . TRP A 1  861  ? 260.691 145.588 167.694 1.00 370.00 ? 861  TRP A CZ2 1 
ATOM 2764  C CZ3 . TRP A 1  861  ? 259.230 146.947 169.055 1.00 370.00 ? 861  TRP A CZ3 1 
ATOM 2765  C CH2 . TRP A 1  861  ? 259.445 145.875 168.181 1.00 370.00 ? 861  TRP A CH2 1 
ATOM 2766  N N   . TRP A 1  862  ? 262.026 152.188 170.939 1.00 370.00 ? 862  TRP A N   1 
ATOM 2767  C CA  . TRP A 1  862  ? 262.044 153.069 172.103 1.00 370.00 ? 862  TRP A CA  1 
ATOM 2768  C C   . TRP A 1  862  ? 261.805 152.216 173.342 1.00 370.00 ? 862  TRP A C   1 
ATOM 2769  O O   . TRP A 1  862  ? 260.677 151.781 173.582 1.00 370.00 ? 862  TRP A O   1 
ATOM 2770  C CB  . TRP A 1  862  ? 260.960 154.144 172.003 1.00 370.00 ? 862  TRP A CB  1 
ATOM 2771  C CG  . TRP A 1  862  ? 261.227 155.246 171.030 1.00 370.00 ? 862  TRP A CG  1 
ATOM 2772  C CD1 . TRP A 1  862  ? 260.918 155.259 169.704 1.00 370.00 ? 862  TRP A CD1 1 
ATOM 2773  C CD2 . TRP A 1  862  ? 261.785 156.534 171.324 1.00 370.00 ? 862  TRP A CD2 1 
ATOM 2774  N NE1 . TRP A 1  862  ? 261.293 156.456 169.141 1.00 370.00 ? 862  TRP A NE1 1 
ATOM 2775  C CE2 . TRP A 1  862  ? 261.829 157.253 170.117 1.00 370.00 ? 862  TRP A CE2 1 
ATOM 2776  C CE3 . TRP A 1  862  ? 262.276 157.138 172.488 1.00 370.00 ? 862  TRP A CE3 1 
ATOM 2777  C CZ2 . TRP A 1  862  ? 262.322 158.554 170.042 1.00 370.00 ? 862  TRP A CZ2 1 
ATOM 2778  C CZ3 . TRP A 1  862  ? 262.780 158.426 172.407 1.00 370.00 ? 862  TRP A CZ3 1 
ATOM 2779  C CH2 . TRP A 1  862  ? 262.799 159.119 171.194 1.00 370.00 ? 862  TRP A CH2 1 
ATOM 2780  N N   . VAL A 1  863  ? 262.845 152.013 174.147 1.00 370.00 ? 863  VAL A N   1 
ATOM 2781  C CA  . VAL A 1  863  ? 262.764 151.137 175.312 1.00 370.00 ? 863  VAL A CA  1 
ATOM 2782  C C   . VAL A 1  863  ? 262.363 151.974 176.518 1.00 370.00 ? 863  VAL A C   1 
ATOM 2783  O O   . VAL A 1  863  ? 262.939 153.043 176.759 1.00 370.00 ? 863  VAL A O   1 
ATOM 2784  C CB  . VAL A 1  863  ? 264.093 150.397 175.551 1.00 370.00 ? 863  VAL A CB  1 
ATOM 2785  C CG1 . VAL A 1  863  ? 264.056 149.591 176.850 1.00 370.00 ? 863  VAL A CG1 1 
ATOM 2786  C CG2 . VAL A 1  863  ? 264.373 149.472 174.386 1.00 370.00 ? 863  VAL A CG2 1 
ATOM 2787  N N   . LEU A 1  864  ? 261.346 151.500 177.245 1.00 370.00 ? 864  LEU A N   1 
ATOM 2788  C CA  . LEU A 1  864  ? 260.812 152.203 178.408 1.00 370.00 ? 864  LEU A CA  1 
ATOM 2789  C C   . LEU A 1  864  ? 261.869 152.327 179.497 1.00 370.00 ? 864  LEU A C   1 
ATOM 2790  O O   . LEU A 1  864  ? 262.624 151.384 179.753 1.00 370.00 ? 864  LEU A O   1 
ATOM 2791  C CB  . LEU A 1  864  ? 259.584 151.461 178.947 1.00 370.00 ? 864  LEU A CB  1 
ATOM 2792  C CG  . LEU A 1  864  ? 258.770 152.066 180.101 1.00 370.00 ? 864  LEU A CG  1 
ATOM 2793  C CD1 . LEU A 1  864  ? 258.044 153.327 179.663 1.00 370.00 ? 864  LEU A CD1 1 
ATOM 2794  C CD2 . LEU A 1  864  ? 257.787 151.056 180.689 1.00 370.00 ? 864  LEU A CD2 1 
ATOM 2795  N N   . LYS A 1  865  ? 261.954 153.518 180.093 1.00 370.00 ? 865  LYS A N   1 
ATOM 2796  C CA  . LYS A 1  865  ? 262.894 153.772 181.178 1.00 370.00 ? 865  LYS A CA  1 
ATOM 2797  C C   . LYS A 1  865  ? 262.584 152.896 182.386 1.00 370.00 ? 865  LYS A C   1 
ATOM 2798  O O   . LYS A 1  865  ? 261.420 152.712 182.752 1.00 370.00 ? 865  LYS A O   1 
ATOM 2799  C CB  . LYS A 1  865  ? 262.850 155.248 181.577 1.00 370.00 ? 865  LYS A CB  1 
ATOM 2800  C CG  . LYS A 1  865  ? 263.442 156.196 180.547 1.00 370.00 ? 865  LYS A CG  1 
ATOM 2801  C CD  . LYS A 1  865  ? 263.375 157.636 181.034 1.00 370.00 ? 865  LYS A CD  1 
ATOM 2802  C CE  . LYS A 1  865  ? 263.921 158.613 180.001 1.00 370.00 ? 865  LYS A CE  1 
ATOM 2803  N NZ  . LYS A 1  865  ? 265.395 158.486 179.829 1.00 370.00 ? 865  LYS A NZ  1 
ATOM 2804  N N   . SER A 1  866  ? 263.640 152.338 182.989 1.00 370.00 ? 866  SER A N   1 
ATOM 2805  C CA  . SER A 1  866  ? 263.477 151.453 184.138 1.00 370.00 ? 866  SER A CA  1 
ATOM 2806  C C   . SER A 1  866  ? 262.982 152.186 185.376 1.00 370.00 ? 866  SER A C   1 
ATOM 2807  O O   . SER A 1  866  ? 262.302 151.578 186.211 1.00 370.00 ? 866  SER A O   1 
ATOM 2808  C CB  . SER A 1  866  ? 264.800 150.751 184.451 1.00 370.00 ? 866  SER A CB  1 
ATOM 2809  O OG  . SER A 1  866  ? 265.779 151.677 184.890 1.00 370.00 ? 866  SER A OG  1 
ATOM 2810  N N   . ASP A 1  867  ? 263.294 153.474 185.512 1.00 370.00 ? 867  ASP A N   1 
ATOM 2811  C CA  . ASP A 1  867  ? 262.869 154.265 186.657 1.00 370.00 ? 867  ASP A CA  1 
ATOM 2812  C C   . ASP A 1  867  ? 261.578 155.030 186.399 1.00 370.00 ? 867  ASP A C   1 
ATOM 2813  O O   . ASP A 1  867  ? 261.123 155.776 187.271 1.00 370.00 ? 867  ASP A O   1 
ATOM 2814  C CB  . ASP A 1  867  ? 263.986 155.228 187.078 1.00 370.00 ? 867  ASP A CB  1 
ATOM 2815  C CG  . ASP A 1  867  ? 264.451 156.139 185.946 1.00 370.00 ? 867  ASP A CG  1 
ATOM 2816  O OD1 . ASP A 1  867  ? 264.009 155.969 184.788 1.00 370.00 ? 867  ASP A OD1 1 
ATOM 2817  O OD2 . ASP A 1  867  ? 265.270 157.038 186.223 1.00 370.00 ? 867  ASP A OD2 1 
ATOM 2818  N N   . PHE A 1  868  ? 260.976 154.852 185.227 1.00 370.00 ? 868  PHE A N   1 
ATOM 2819  C CA  . PHE A 1  868  ? 259.700 155.469 184.893 1.00 370.00 ? 868  PHE A CA  1 
ATOM 2820  C C   . PHE A 1  868  ? 258.584 154.481 185.200 1.00 370.00 ? 868  PHE A C   1 
ATOM 2821  O O   . PHE A 1  868  ? 258.549 153.383 184.631 1.00 370.00 ? 868  PHE A O   1 
ATOM 2822  C CB  . PHE A 1  868  ? 259.652 155.879 183.420 1.00 370.00 ? 868  PHE A CB  1 
ATOM 2823  C CG  . PHE A 1  868  ? 258.367 156.551 183.019 1.00 370.00 ? 868  PHE A CG  1 
ATOM 2824  C CD1 . PHE A 1  868  ? 258.126 157.870 183.371 1.00 370.00 ? 868  PHE A CD1 1 
ATOM 2825  C CD2 . PHE A 1  868  ? 257.400 155.867 182.292 1.00 370.00 ? 868  PHE A CD2 1 
ATOM 2826  C CE1 . PHE A 1  868  ? 256.947 158.499 183.009 1.00 370.00 ? 868  PHE A CE1 1 
ATOM 2827  C CE2 . PHE A 1  868  ? 256.215 156.488 181.928 1.00 370.00 ? 868  PHE A CE2 1 
ATOM 2828  C CZ  . PHE A 1  868  ? 255.990 157.807 182.286 1.00 370.00 ? 868  PHE A CZ  1 
ATOM 2829  N N   . ARG A 1  869  ? 257.667 154.877 186.076 1.00 370.00 ? 869  ARG A N   1 
ATOM 2830  C CA  . ARG A 1  869  ? 256.485 154.076 186.357 1.00 370.00 ? 869  ARG A CA  1 
ATOM 2831  C C   . ARG A 1  869  ? 255.440 154.389 185.295 1.00 370.00 ? 869  ARG A C   1 
ATOM 2832  O O   . ARG A 1  869  ? 255.018 155.543 185.156 1.00 370.00 ? 869  ARG A O   1 
ATOM 2833  C CB  . ARG A 1  869  ? 255.945 154.369 187.757 1.00 370.00 ? 869  ARG A CB  1 
ATOM 2834  C CG  . ARG A 1  869  ? 254.741 153.517 188.143 1.00 370.00 ? 869  ARG A CG  1 
ATOM 2835  C CD  . ARG A 1  869  ? 254.256 153.830 189.552 1.00 370.00 ? 869  ARG A CD  1 
ATOM 2836  N NE  . ARG A 1  869  ? 253.748 155.193 189.680 1.00 370.00 ? 869  ARG A NE  1 
ATOM 2837  C CZ  . ARG A 1  869  ? 252.496 155.555 189.411 1.00 370.00 ? 869  ARG A CZ  1 
ATOM 2838  N NH1 . ARG A 1  869  ? 251.612 154.654 189.009 1.00 370.00 ? 869  ARG A NH1 1 
ATOM 2839  N NH2 . ARG A 1  869  ? 252.125 156.821 189.558 1.00 370.00 ? 869  ARG A NH2 1 
ATOM 2840  N N   . LEU A 1  870  ? 255.048 153.376 184.534 1.00 370.00 ? 870  LEU A N   1 
ATOM 2841  C CA  . LEU A 1  870  ? 254.049 153.573 183.492 1.00 370.00 ? 870  LEU A CA  1 
ATOM 2842  C C   . LEU A 1  870  ? 252.687 153.767 184.146 1.00 370.00 ? 870  LEU A C   1 
ATOM 2843  O O   . LEU A 1  870  ? 252.324 152.990 185.037 1.00 370.00 ? 870  LEU A O   1 
ATOM 2844  C CB  . LEU A 1  870  ? 254.037 152.379 182.536 1.00 370.00 ? 870  LEU A CB  1 
ATOM 2845  C CG  . LEU A 1  870  ? 253.153 152.399 181.288 1.00 370.00 ? 870  LEU A CG  1 
ATOM 2846  C CD1 . LEU A 1  870  ? 253.555 153.502 180.314 1.00 370.00 ? 870  LEU A CD1 1 
ATOM 2847  C CD2 . LEU A 1  870  ? 253.221 151.038 180.612 1.00 370.00 ? 870  LEU A CD2 1 
ATOM 2848  N N   . PRO A 1  871  ? 251.937 154.810 183.777 1.00 370.00 ? 871  PRO A N   1 
ATOM 2849  C CA  . PRO A 1  871  ? 250.678 155.101 184.473 1.00 370.00 ? 871  PRO A CA  1 
ATOM 2850  C C   . PRO A 1  871  ? 249.620 154.034 184.237 1.00 370.00 ? 871  PRO A C   1 
ATOM 2851  O O   . PRO A 1  871  ? 249.477 153.496 183.138 1.00 370.00 ? 871  PRO A O   1 
ATOM 2852  C CB  . PRO A 1  871  ? 250.245 156.447 183.880 1.00 370.00 ? 871  PRO A CB  1 
ATOM 2853  C CG  . PRO A 1  871  ? 251.501 157.058 183.378 1.00 370.00 ? 871  PRO A CG  1 
ATOM 2854  C CD  . PRO A 1  871  ? 252.332 155.913 182.883 1.00 370.00 ? 871  PRO A CD  1 
ATOM 2855  N N   . THR A 1  872  ? 248.860 153.752 185.292 1.00 370.00 ? 872  THR A N   1 
ATOM 2856  C CA  . THR A 1  872  ? 247.833 152.724 185.272 1.00 370.00 ? 872  THR A CA  1 
ATOM 2857  C C   . THR A 1  872  ? 246.658 153.142 184.383 1.00 370.00 ? 872  THR A C   1 
ATOM 2858  O O   . THR A 1  872  ? 246.583 154.274 183.895 1.00 370.00 ? 872  THR A O   1 
ATOM 2859  C CB  . THR A 1  872  ? 247.355 152.440 186.692 1.00 370.00 ? 872  THR A CB  1 
ATOM 2860  O OG1 . THR A 1  872  ? 246.800 153.638 187.248 1.00 370.00 ? 872  THR A OG1 1 
ATOM 2861  C CG2 . THR A 1  872  ? 248.522 151.974 187.565 1.00 370.00 ? 872  THR A CG2 1 
ATOM 2862  N N   . GLU A 1  873  ? 245.734 152.193 184.186 1.00 370.00 ? 873  GLU A N   1 
ATOM 2863  C CA  . GLU A 1  873  ? 244.630 152.341 183.235 1.00 370.00 ? 873  GLU A CA  1 
ATOM 2864  C C   . GLU A 1  873  ? 243.717 153.520 183.561 1.00 370.00 ? 873  GLU A C   1 
ATOM 2865  O O   . GLU A 1  873  ? 243.437 154.360 182.700 1.00 370.00 ? 873  GLU A O   1 
ATOM 2866  C CB  . GLU A 1  873  ? 243.821 151.044 183.185 1.00 370.00 ? 873  GLU A CB  1 
ATOM 2867  C CG  . GLU A 1  873  ? 242.612 151.121 182.275 1.00 370.00 ? 873  GLU A CG  1 
ATOM 2868  C CD  . GLU A 1  873  ? 242.978 151.313 180.820 1.00 370.00 ? 873  GLU A CD  1 
ATOM 2869  O OE1 . GLU A 1  873  ? 244.037 150.801 180.386 1.00 370.00 ? 873  GLU A OE1 1 
ATOM 2870  O OE2 . GLU A 1  873  ? 242.213 152.003 180.117 1.00 370.00 ? 873  GLU A OE2 1 
ATOM 2871  N N   . GLU A 1  874  ? 243.242 153.594 184.805 1.00 370.00 ? 874  GLU A N   1 
ATOM 2872  C CA  . GLU A 1  874  ? 242.325 154.663 185.190 1.00 370.00 ? 874  GLU A CA  1 
ATOM 2873  C C   . GLU A 1  874  ? 243.024 156.017 185.279 1.00 370.00 ? 874  GLU A C   1 
ATOM 2874  O O   . GLU A 1  874  ? 242.368 157.061 185.193 1.00 370.00 ? 874  GLU A O   1 
ATOM 2875  C CB  . GLU A 1  874  ? 241.621 154.300 186.497 1.00 370.00 ? 874  GLU A CB  1 
ATOM 2876  C CG  . GLU A 1  874  ? 240.452 153.328 186.294 1.00 370.00 ? 874  GLU A CG  1 
ATOM 2877  C CD  . GLU A 1  874  ? 240.877 151.881 186.126 1.00 370.00 ? 874  GLU A CD  1 
ATOM 2878  O OE1 . GLU A 1  874  ? 242.077 151.573 186.270 1.00 370.00 ? 874  GLU A OE1 1 
ATOM 2879  O OE2 . GLU A 1  874  ? 240.006 151.045 185.813 1.00 370.00 ? 874  GLU A OE2 1 
ATOM 2880  N N   . GLU A 1  875  ? 244.348 156.026 185.466 1.00 370.00 ? 875  GLU A N   1 
ATOM 2881  C CA  . GLU A 1  875  ? 245.095 157.278 185.361 1.00 370.00 ? 875  GLU A CA  1 
ATOM 2882  C C   . GLU A 1  875  ? 245.173 157.759 183.916 1.00 370.00 ? 875  GLU A C   1 
ATOM 2883  O O   . GLU A 1  875  ? 245.166 158.968 183.655 1.00 370.00 ? 875  GLU A O   1 
ATOM 2884  C CB  . GLU A 1  875  ? 246.499 157.107 185.941 1.00 370.00 ? 875  GLU A CB  1 
ATOM 2885  C CG  . GLU A 1  875  ? 246.536 156.949 187.446 1.00 370.00 ? 875  GLU A CG  1 
ATOM 2886  C CD  . GLU A 1  875  ? 247.945 156.782 187.972 1.00 370.00 ? 875  GLU A CD  1 
ATOM 2887  O OE1 . GLU A 1  875  ? 248.870 156.599 187.154 1.00 370.00 ? 875  GLU A OE1 1 
ATOM 2888  O OE2 . GLU A 1  875  ? 248.132 156.856 189.204 1.00 370.00 ? 875  GLU A OE2 1 
ATOM 2889  N N   . ILE A 1  876  ? 245.275 156.826 182.969 1.00 370.00 ? 876  ILE A N   1 
ATOM 2890  C CA  . ILE A 1  876  ? 245.204 157.172 181.552 1.00 370.00 ? 876  ILE A CA  1 
ATOM 2891  C C   . ILE A 1  876  ? 243.802 157.664 181.200 1.00 370.00 ? 876  ILE A C   1 
ATOM 2892  O O   . ILE A 1  876  ? 243.633 158.577 180.380 1.00 370.00 ? 876  ILE A O   1 
ATOM 2893  C CB  . ILE A 1  876  ? 245.638 155.958 180.704 1.00 370.00 ? 876  ILE A CB  1 
ATOM 2894  C CG1 . ILE A 1  876  ? 247.108 155.621 180.964 1.00 370.00 ? 876  ILE A CG1 1 
ATOM 2895  C CG2 . ILE A 1  876  ? 245.452 156.198 179.222 1.00 370.00 ? 876  ILE A CG2 1 
ATOM 2896  C CD1 . ILE A 1  876  ? 247.544 154.311 180.335 1.00 370.00 ? 876  ILE A CD1 1 
ATOM 2897  N N   . ARG A 1  877  ? 242.781 157.077 181.838 1.00 370.00 ? 877  ARG A N   1 
ATOM 2898  C CA  . ARG A 1  877  ? 241.393 157.481 181.619 1.00 370.00 ? 877  ARG A CA  1 
ATOM 2899  C C   . ARG A 1  877  ? 241.145 158.928 182.037 1.00 370.00 ? 877  ARG A C   1 
ATOM 2900  O O   . ARG A 1  877  ? 240.387 159.649 181.377 1.00 370.00 ? 877  ARG A O   1 
ATOM 2901  C CB  . ARG A 1  877  ? 240.463 156.533 182.379 1.00 370.00 ? 877  ARG A CB  1 
ATOM 2902  C CG  . ARG A 1  877  ? 240.413 155.129 181.794 1.00 370.00 ? 877  ARG A CG  1 
ATOM 2903  C CD  . ARG A 1  877  ? 239.605 154.175 182.656 1.00 370.00 ? 877  ARG A CD  1 
ATOM 2904  N NE  . ARG A 1  877  ? 239.520 152.853 182.043 1.00 370.00 ? 877  ARG A NE  1 
ATOM 2905  C CZ  . ARG A 1  877  ? 238.902 151.808 182.585 1.00 370.00 ? 877  ARG A CZ  1 
ATOM 2906  N NH1 . ARG A 1  877  ? 238.303 151.920 183.764 1.00 370.00 ? 877  ARG A NH1 1 
ATOM 2907  N NH2 . ARG A 1  877  ? 238.884 150.647 181.945 1.00 370.00 ? 877  ARG A NH2 1 
ATOM 2908  N N   . ALA A 1  878  ? 241.778 159.371 183.124 1.00 370.00 ? 878  ALA A N   1 
ATOM 2909  C CA  . ALA A 1  878  ? 241.597 160.743 183.590 1.00 370.00 ? 878  ALA A CA  1 
ATOM 2910  C C   . ALA A 1  878  ? 242.297 161.768 182.705 1.00 370.00 ? 878  ALA A C   1 
ATOM 2911  O O   . ALA A 1  878  ? 241.966 162.957 182.780 1.00 370.00 ? 878  ALA A O   1 
ATOM 2912  C CB  . ALA A 1  878  ? 242.094 160.880 185.028 1.00 370.00 ? 878  ALA A CB  1 
ATOM 2913  N N   . MET A 1  879  ? 243.262 161.342 181.883 1.00 370.00 ? 879  MET A N   1 
ATOM 2914  C CA  . MET A 1  879  ? 244.003 162.283 181.048 1.00 370.00 ? 879  MET A CA  1 
ATOM 2915  C C   . MET A 1  879  ? 243.136 162.834 179.921 1.00 370.00 ? 879  MET A C   1 
ATOM 2916  O O   . MET A 1  879  ? 243.116 164.048 179.685 1.00 370.00 ? 879  MET A O   1 
ATOM 2917  C CB  . MET A 1  879  ? 245.249 161.606 180.476 1.00 370.00 ? 879  MET A CB  1 
ATOM 2918  C CG  . MET A 1  879  ? 246.294 161.237 181.512 1.00 370.00 ? 879  MET A CG  1 
ATOM 2919  S SD  . MET A 1  879  ? 247.711 160.409 180.767 1.00 370.00 ? 879  MET A SD  1 
ATOM 2920  C CE  . MET A 1  879  ? 248.677 160.003 182.219 1.00 370.00 ? 879  MET A CE  1 
ATOM 2921  N N   . VAL A 1  880  ? 242.417 161.962 179.218 1.00 370.00 ? 880  VAL A N   1 
ATOM 2922  C CA  . VAL A 1  880  ? 241.576 162.353 178.086 1.00 370.00 ? 880  VAL A CA  1 
ATOM 2923  C C   . VAL A 1  880  ? 240.237 161.640 178.226 1.00 370.00 ? 880  VAL A C   1 
ATOM 2924  O O   . VAL A 1  880  ? 240.190 160.414 178.374 1.00 370.00 ? 880  VAL A O   1 
ATOM 2925  C CB  . VAL A 1  880  ? 242.231 162.019 176.724 1.00 370.00 ? 880  VAL A CB  1 
ATOM 2926  C CG1 . VAL A 1  880  ? 241.250 162.230 175.581 1.00 370.00 ? 880  VAL A CG1 1 
ATOM 2927  C CG2 . VAL A 1  880  ? 243.465 162.875 176.480 1.00 370.00 ? 880  VAL A CG2 1 
ATOM 2928  N N   . SER A 1  881  ? 239.146 162.412 178.183 1.00 370.00 ? 881  SER A N   1 
ATOM 2929  C CA  . SER A 1  881  ? 237.788 161.902 178.254 1.00 370.00 ? 881  SER A CA  1 
ATOM 2930  C C   . SER A 1  881  ? 237.217 161.738 176.850 1.00 370.00 ? 881  SER A C   1 
ATOM 2931  O O   . SER A 1  881  ? 237.721 162.338 175.895 1.00 370.00 ? 881  SER A O   1 
ATOM 2932  C CB  . SER A 1  881  ? 236.908 162.858 179.075 1.00 370.00 ? 881  SER A CB  1 
ATOM 2933  O OG  . SER A 1  881  ? 236.686 164.072 178.386 1.00 370.00 ? 881  SER A OG  1 
ATOM 2934  N N   . PRO A 1  882  ? 236.188 160.894 176.679 1.00 370.00 ? 882  PRO A N   1 
ATOM 2935  C CA  . PRO A 1  882  ? 235.533 160.793 175.361 1.00 370.00 ? 882  PRO A CA  1 
ATOM 2936  C C   . PRO A 1  882  ? 234.873 162.078 174.886 1.00 370.00 ? 882  PRO A C   1 
ATOM 2937  O O   . PRO A 1  882  ? 234.763 162.292 173.672 1.00 370.00 ? 882  PRO A O   1 
ATOM 2938  C CB  . PRO A 1  882  ? 234.498 159.681 175.579 1.00 370.00 ? 882  PRO A CB  1 
ATOM 2939  C CG  . PRO A 1  882  ? 235.078 158.844 176.656 1.00 370.00 ? 882  PRO A CG  1 
ATOM 2940  C CD  . PRO A 1  882  ? 235.775 159.796 177.575 1.00 370.00 ? 882  PRO A CD  1 
ATOM 2941  N N   . GLU A 1  883  ? 234.416 162.928 175.809 1.00 370.00 ? 883  GLU A N   1 
ATOM 2942  C CA  . GLU A 1  883  ? 233.778 164.184 175.427 1.00 370.00 ? 883  GLU A CA  1 
ATOM 2943  C C   . GLU A 1  883  ? 234.773 165.156 174.798 1.00 370.00 ? 883  GLU A C   1 
ATOM 2944  O O   . GLU A 1  883  ? 234.410 165.927 173.902 1.00 370.00 ? 883  GLU A O   1 
ATOM 2945  C CB  . GLU A 1  883  ? 233.096 164.814 176.642 1.00 370.00 ? 883  GLU A CB  1 
ATOM 2946  C CG  . GLU A 1  883  ? 231.878 164.042 177.144 1.00 370.00 ? 883  GLU A CG  1 
ATOM 2947  C CD  . GLU A 1  883  ? 232.230 162.938 178.128 1.00 370.00 ? 883  GLU A CD  1 
ATOM 2948  O OE1 . GLU A 1  883  ? 233.417 162.819 178.496 1.00 370.00 ? 883  GLU A OE1 1 
ATOM 2949  O OE2 . GLU A 1  883  ? 231.315 162.188 178.533 1.00 370.00 ? 883  GLU A OE2 1 
ATOM 2950  N N   . GLN A 1  884  ? 236.023 165.149 175.272 1.00 370.00 ? 884  GLN A N   1 
ATOM 2951  C CA  . GLN A 1  884  ? 237.040 166.052 174.733 1.00 370.00 ? 884  GLN A CA  1 
ATOM 2952  C C   . GLN A 1  884  ? 237.412 165.693 173.300 1.00 370.00 ? 884  GLN A C   1 
ATOM 2953  O O   . GLN A 1  884  ? 237.750 166.576 172.500 1.00 370.00 ? 884  GLN A O   1 
ATOM 2954  C CB  . GLN A 1  884  ? 238.284 166.035 175.618 1.00 370.00 ? 884  GLN A CB  1 
ATOM 2955  C CG  . GLN A 1  884  ? 238.090 166.648 176.988 1.00 370.00 ? 884  GLN A CG  1 
ATOM 2956  C CD  . GLN A 1  884  ? 239.343 166.575 177.833 1.00 370.00 ? 884  GLN A CD  1 
ATOM 2957  O OE1 . GLN A 1  884  ? 240.361 166.029 177.406 1.00 370.00 ? 884  GLN A OE1 1 
ATOM 2958  N NE2 . GLN A 1  884  ? 239.274 167.115 179.043 1.00 370.00 ? 884  GLN A NE2 1 
ATOM 2959  N N   . CYS A 1  885  ? 237.393 164.399 172.968 1.00 370.00 ? 885  CYS A N   1 
ATOM 2960  C CA  . CYS A 1  885  ? 237.722 163.967 171.611 1.00 370.00 ? 885  CYS A CA  1 
ATOM 2961  C C   . CYS A 1  885  ? 236.671 164.426 170.611 1.00 370.00 ? 885  CYS A C   1 
ATOM 2962  O O   . CYS A 1  885  ? 237.005 164.821 169.487 1.00 370.00 ? 885  CYS A O   1 
ATOM 2963  C CB  . CYS A 1  885  ? 237.867 162.446 171.566 1.00 370.00 ? 885  CYS A CB  1 
ATOM 2964  S SG  . CYS A 1  885  ? 239.270 161.796 172.487 1.00 370.00 ? 885  CYS A SG  1 
ATOM 2965  N N   . CYS A 1  886  ? 235.396 164.369 171.002 1.00 370.00 ? 886  CYS A N   1 
ATOM 2966  C CA  . CYS A 1  886  ? 234.305 164.744 170.108 1.00 370.00 ? 886  CYS A CA  1 
ATOM 2967  C C   . CYS A 1  886  ? 234.326 166.236 169.797 1.00 370.00 ? 886  CYS A C   1 
ATOM 2968  O O   . CYS A 1  886  ? 233.948 166.660 168.698 1.00 370.00 ? 886  CYS A O   1 
ATOM 2969  C CB  . CYS A 1  886  ? 232.973 164.328 170.731 1.00 370.00 ? 886  CYS A CB  1 
ATOM 2970  S SG  . CYS A 1  886  ? 232.825 162.537 170.914 1.00 370.00 ? 886  CYS A SG  1 
ATOM 2971  N N   . ALA A 1  887  ? 234.739 167.051 170.773 1.00 370.00 ? 887  ALA A N   1 
ATOM 2972  C CA  . ALA A 1  887  ? 234.888 168.487 170.555 1.00 370.00 ? 887  ALA A CA  1 
ATOM 2973  C C   . ALA A 1  887  ? 236.005 168.785 169.559 1.00 370.00 ? 887  ALA A C   1 
ATOM 2974  O O   . ALA A 1  887  ? 235.903 169.715 168.751 1.00 370.00 ? 887  ALA A O   1 
ATOM 2975  C CB  . ALA A 1  887  ? 235.148 169.188 171.886 1.00 370.00 ? 887  ALA A CB  1 
ATOM 2976  N N   . TYR A 1  888  ? 237.104 168.033 169.640 1.00 370.00 ? 888  TYR A N   1 
ATOM 2977  C CA  . TYR A 1  888  ? 238.170 168.152 168.651 1.00 370.00 ? 888  TYR A CA  1 
ATOM 2978  C C   . TYR A 1  888  ? 237.744 167.584 167.302 1.00 370.00 ? 888  TYR A C   1 
ATOM 2979  O O   . TYR A 1  888  ? 238.097 168.133 166.250 1.00 370.00 ? 888  TYR A O   1 
ATOM 2980  C CB  . TYR A 1  888  ? 239.429 167.455 169.157 1.00 370.00 ? 888  TYR A CB  1 
ATOM 2981  C CG  . TYR A 1  888  ? 240.538 167.412 168.139 1.00 370.00 ? 888  TYR A CG  1 
ATOM 2982  C CD1 . TYR A 1  888  ? 241.230 168.563 167.795 1.00 370.00 ? 888  TYR A CD1 1 
ATOM 2983  C CD2 . TYR A 1  888  ? 240.903 166.215 167.531 1.00 370.00 ? 888  TYR A CD2 1 
ATOM 2984  C CE1 . TYR A 1  888  ? 242.241 168.532 166.863 1.00 370.00 ? 888  TYR A CE1 1 
ATOM 2985  C CE2 . TYR A 1  888  ? 241.920 166.171 166.597 1.00 370.00 ? 888  TYR A CE2 1 
ATOM 2986  C CZ  . TYR A 1  888  ? 242.587 167.336 166.270 1.00 370.00 ? 888  TYR A CZ  1 
ATOM 2987  O OH  . TYR A 1  888  ? 243.603 167.314 165.343 1.00 370.00 ? 888  TYR A OH  1 
ATOM 2988  N N   . TYR A 1  889  ? 237.026 166.454 167.316 1.00 370.00 ? 889  TYR A N   1 
ATOM 2989  C CA  . TYR A 1  889  ? 236.539 165.840 166.081 1.00 370.00 ? 889  TYR A CA  1 
ATOM 2990  C C   . TYR A 1  889  ? 235.576 166.753 165.331 1.00 370.00 ? 889  TYR A C   1 
ATOM 2991  O O   . TYR A 1  889  ? 235.573 166.781 164.094 1.00 370.00 ? 889  TYR A O   1 
ATOM 2992  C CB  . TYR A 1  889  ? 235.860 164.502 166.384 1.00 370.00 ? 889  TYR A CB  1 
ATOM 2993  C CG  . TYR A 1  889  ? 236.798 163.368 166.743 1.00 370.00 ? 889  TYR A CG  1 
ATOM 2994  C CD1 . TYR A 1  889  ? 238.165 163.462 166.504 1.00 370.00 ? 889  TYR A CD1 1 
ATOM 2995  C CD2 . TYR A 1  889  ? 236.310 162.196 167.311 1.00 370.00 ? 889  TYR A CD2 1 
ATOM 2996  C CE1 . TYR A 1  889  ? 239.022 162.421 166.828 1.00 370.00 ? 889  TYR A CE1 1 
ATOM 2997  C CE2 . TYR A 1  889  ? 237.159 161.148 167.639 1.00 370.00 ? 889  TYR A CE2 1 
ATOM 2998  C CZ  . TYR A 1  889  ? 238.514 161.268 167.395 1.00 370.00 ? 889  TYR A CZ  1 
ATOM 2999  O OH  . TYR A 1  889  ? 239.368 160.235 167.715 1.00 370.00 ? 889  TYR A OH  1 
ATOM 3000  N N   . SER A 1  890  ? 234.737 167.487 166.065 1.00 370.00 ? 890  SER A N   1 
ATOM 3001  C CA  . SER A 1  890  ? 233.816 168.435 165.442 1.00 370.00 ? 890  SER A CA  1 
ATOM 3002  C C   . SER A 1  890  ? 234.559 169.597 164.796 1.00 370.00 ? 890  SER A C   1 
ATOM 3003  O O   . SER A 1  890  ? 234.119 170.130 163.770 1.00 370.00 ? 890  SER A O   1 
ATOM 3004  C CB  . SER A 1  890  ? 232.822 168.951 166.479 1.00 370.00 ? 890  SER A CB  1 
ATOM 3005  O OG  . SER A 1  890  ? 231.972 169.936 165.917 1.00 370.00 ? 890  SER A OG  1 
ATOM 3006  N N   . MET A 1  891  ? 235.672 170.018 165.401 1.00 370.00 ? 891  MET A N   1 
ATOM 3007  C CA  . MET A 1  891  ? 236.426 171.165 164.902 1.00 370.00 ? 891  MET A CA  1 
ATOM 3008  C C   . MET A 1  891  ? 237.097 170.852 163.569 1.00 370.00 ? 891  MET A C   1 
ATOM 3009  O O   . MET A 1  891  ? 236.956 171.606 162.600 1.00 370.00 ? 891  MET A O   1 
ATOM 3010  C CB  . MET A 1  891  ? 237.452 171.601 165.955 1.00 370.00 ? 891  MET A CB  1 
ATOM 3011  C CG  . MET A 1  891  ? 238.282 172.835 165.597 1.00 370.00 ? 891  MET A CG  1 
ATOM 3012  S SD  . MET A 1  891  ? 239.829 172.505 164.721 1.00 370.00 ? 891  MET A SD  1 
ATOM 3013  C CE  . MET A 1  891  ? 240.831 171.837 166.045 1.00 370.00 ? 891  MET A CE  1 
ATOM 3014  N N   . ILE A 1  892  ? 237.855 169.752 163.512 1.00 370.00 ? 892  ILE A N   1 
ATOM 3015  C CA  . ILE A 1  892  ? 238.638 169.430 162.318 1.00 370.00 ? 892  ILE A CA  1 
ATOM 3016  C C   . ILE A 1  892  ? 237.744 169.039 161.148 1.00 370.00 ? 892  ILE A C   1 
ATOM 3017  O O   . ILE A 1  892  ? 238.105 169.260 159.985 1.00 370.00 ? 892  ILE A O   1 
ATOM 3018  C CB  . ILE A 1  892  ? 239.684 168.340 162.638 1.00 370.00 ? 892  ILE A CB  1 
ATOM 3019  C CG1 . ILE A 1  892  ? 239.028 167.078 163.208 1.00 370.00 ? 892  ILE A CG1 1 
ATOM 3020  C CG2 . ILE A 1  892  ? 240.727 168.879 163.596 1.00 370.00 ? 892  ILE A CG2 1 
ATOM 3021  C CD1 . ILE A 1  892  ? 239.975 165.898 163.321 1.00 370.00 ? 892  ILE A CD1 1 
ATOM 3022  N N   . ALA A 1  893  ? 236.571 168.463 161.426 1.00 370.00 ? 893  ALA A N   1 
ATOM 3023  C CA  . ALA A 1  893  ? 235.611 168.178 160.364 1.00 370.00 ? 893  ALA A CA  1 
ATOM 3024  C C   . ALA A 1  893  ? 235.023 169.467 159.798 1.00 370.00 ? 893  ALA A C   1 
ATOM 3025  O O   . ALA A 1  893  ? 234.902 169.621 158.577 1.00 370.00 ? 893  ALA A O   1 
ATOM 3026  C CB  . ALA A 1  893  ? 234.506 167.261 160.888 1.00 370.00 ? 893  ALA A CB  1 
ATOM 3027  N N   . ALA A 1  894  ? 234.649 170.401 160.676 1.00 370.00 ? 894  ALA A N   1 
ATOM 3028  C CA  . ALA A 1  894  ? 234.102 171.680 160.227 1.00 370.00 ? 894  ALA A CA  1 
ATOM 3029  C C   . ALA A 1  894  ? 235.167 172.552 159.575 1.00 370.00 ? 894  ALA A C   1 
ATOM 3030  O O   . ALA A 1  894  ? 234.856 173.366 158.697 1.00 370.00 ? 894  ALA A O   1 
ATOM 3031  C CB  . ALA A 1  894  ? 233.464 172.417 161.399 1.00 370.00 ? 894  ALA A CB  1 
ATOM 3032  N N   . GLU A 1  895  ? 236.419 172.430 160.026 1.00 370.00 ? 895  GLU A N   1 
ATOM 3033  C CA  . GLU A 1  895  ? 237.515 173.170 159.407 1.00 370.00 ? 895  GLU A CA  1 
ATOM 3034  C C   . GLU A 1  895  ? 237.754 172.695 157.979 1.00 370.00 ? 895  GLU A C   1 
ATOM 3035  O O   . GLU A 1  895  ? 238.091 173.494 157.097 1.00 370.00 ? 895  GLU A O   1 
ATOM 3036  C CB  . GLU A 1  895  ? 238.785 173.022 160.247 1.00 370.00 ? 895  GLU A CB  1 
ATOM 3037  C CG  . GLU A 1  895  ? 239.967 173.851 159.774 1.00 370.00 ? 895  GLU A CG  1 
ATOM 3038  C CD  . GLU A 1  895  ? 241.174 173.703 160.678 1.00 370.00 ? 895  GLU A CD  1 
ATOM 3039  O OE1 . GLU A 1  895  ? 241.092 172.928 161.655 1.00 370.00 ? 895  GLU A OE1 1 
ATOM 3040  O OE2 . GLU A 1  895  ? 242.202 174.363 160.416 1.00 370.00 ? 895  GLU A OE2 1 
ATOM 3041  N N   . GLN A 1  896  ? 237.583 171.393 157.738 1.00 370.00 ? 896  GLN A N   1 
ATOM 3042  C CA  . GLN A 1  896  ? 237.669 170.857 156.383 1.00 370.00 ? 896  GLN A CA  1 
ATOM 3043  C C   . GLN A 1  896  ? 236.530 171.371 155.509 1.00 370.00 ? 896  GLN A C   1 
ATOM 3044  O O   . GLN A 1  896  ? 236.728 171.647 154.319 1.00 370.00 ? 896  GLN A O   1 
ATOM 3045  C CB  . GLN A 1  896  ? 237.669 169.328 156.436 1.00 370.00 ? 896  GLN A CB  1 
ATOM 3046  C CG  . GLN A 1  896  ? 237.862 168.649 155.094 1.00 370.00 ? 896  GLN A CG  1 
ATOM 3047  C CD  . GLN A 1  896  ? 239.196 168.987 154.464 1.00 370.00 ? 896  GLN A CD  1 
ATOM 3048  O OE1 . GLN A 1  896  ? 239.266 169.768 153.515 1.00 370.00 ? 896  GLN A OE1 1 
ATOM 3049  N NE2 . GLN A 1  896  ? 240.264 168.406 154.996 1.00 370.00 ? 896  GLN A NE2 1 
ATOM 3050  N N   . ARG A 1  897  ? 235.326 171.497 156.080 1.00 370.00 ? 897  ARG A N   1 
ATOM 3051  C CA  . ARG A 1  897  ? 234.184 171.998 155.321 1.00 370.00 ? 897  ARG A CA  1 
ATOM 3052  C C   . ARG A 1  897  ? 234.341 173.469 154.951 1.00 370.00 ? 897  ARG A C   1 
ATOM 3053  O O   . ARG A 1  897  ? 233.878 173.893 153.887 1.00 370.00 ? 897  ARG A O   1 
ATOM 3054  C CB  . ARG A 1  897  ? 232.887 171.786 156.107 1.00 370.00 ? 897  ARG A CB  1 
ATOM 3055  C CG  . ARG A 1  897  ? 232.476 170.328 156.262 1.00 370.00 ? 897  ARG A CG  1 
ATOM 3056  C CD  . ARG A 1  897  ? 231.044 170.202 156.765 1.00 370.00 ? 897  ARG A CD  1 
ATOM 3057  N NE  . ARG A 1  897  ? 230.859 170.727 158.115 1.00 370.00 ? 897  ARG A NE  1 
ATOM 3058  C CZ  . ARG A 1  897  ? 230.994 170.006 159.223 1.00 370.00 ? 897  ARG A CZ  1 
ATOM 3059  N NH1 . ARG A 1  897  ? 231.315 168.722 159.145 1.00 370.00 ? 897  ARG A NH1 1 
ATOM 3060  N NH2 . ARG A 1  897  ? 230.801 170.564 160.409 1.00 370.00 ? 897  ARG A NH2 1 
ATOM 3061  N N   . LEU A 1  898  ? 234.979 174.263 155.817 1.00 370.00 ? 898  LEU A N   1 
ATOM 3062  C CA  . LEU A 1  898  ? 235.207 175.672 155.504 1.00 370.00 ? 898  LEU A CA  1 
ATOM 3063  C C   . LEU A 1  898  ? 236.287 175.838 154.441 1.00 370.00 ? 898  LEU A C   1 
ATOM 3064  O O   . LEU A 1  898  ? 236.213 176.750 153.607 1.00 370.00 ? 898  LEU A O   1 
ATOM 3065  C CB  . LEU A 1  898  ? 235.572 176.445 156.770 1.00 370.00 ? 898  LEU A CB  1 
ATOM 3066  C CG  . LEU A 1  898  ? 234.461 176.601 157.808 1.00 370.00 ? 898  LEU A CG  1 
ATOM 3067  C CD1 . LEU A 1  898  ? 234.980 177.332 159.031 1.00 370.00 ? 898  LEU A CD1 1 
ATOM 3068  C CD2 . LEU A 1  898  ? 233.269 177.327 157.205 1.00 370.00 ? 898  LEU A CD2 1 
ATOM 3069  N N   . LYS A 1  899  ? 237.324 174.996 154.485 1.00 370.00 ? 899  LYS A N   1 
ATOM 3070  C CA  . LYS A 1  899  ? 238.343 175.000 153.437 1.00 370.00 ? 899  LYS A CA  1 
ATOM 3071  C C   . LYS A 1  899  ? 237.755 174.584 152.093 1.00 370.00 ? 899  LYS A C   1 
ATOM 3072  O O   . LYS A 1  899  ? 238.134 175.119 151.045 1.00 370.00 ? 899  LYS A O   1 
ATOM 3073  C CB  . LYS A 1  899  ? 239.504 174.083 153.826 1.00 370.00 ? 899  LYS A CB  1 
ATOM 3074  C CG  . LYS A 1  899  ? 240.348 174.600 154.978 1.00 370.00 ? 899  LYS A CG  1 
ATOM 3075  C CD  . LYS A 1  899  ? 241.482 173.641 155.301 1.00 370.00 ? 899  LYS A CD  1 
ATOM 3076  C CE  . LYS A 1  899  ? 242.288 174.126 156.494 1.00 370.00 ? 899  LYS A CE  1 
ATOM 3077  N NZ  . LYS A 1  899  ? 243.394 173.190 156.840 1.00 370.00 ? 899  LYS A NZ  1 
ATOM 3078  N N   . ASP A 1  900  ? 236.851 173.597 152.105 1.00 370.00 ? 900  ASP A N   1 
ATOM 3079  C CA  . ASP A 1  900  ? 236.139 173.202 150.892 1.00 370.00 ? 900  ASP A CA  1 
ATOM 3080  C C   . ASP A 1  900  ? 235.246 174.316 150.355 1.00 370.00 ? 900  ASP A C   1 
ATOM 3081  O O   . ASP A 1  900  ? 234.994 174.381 149.146 1.00 370.00 ? 900  ASP A O   1 
ATOM 3082  C CB  . ASP A 1  900  ? 235.311 171.945 151.157 1.00 370.00 ? 900  ASP A CB  1 
ATOM 3083  C CG  . ASP A 1  900  ? 236.171 170.715 151.359 1.00 370.00 ? 900  ASP A CG  1 
ATOM 3084  O OD1 . ASP A 1  900  ? 237.278 170.661 150.781 1.00 370.00 ? 900  ASP A OD1 1 
ATOM 3085  O OD2 . ASP A 1  900  ? 235.745 169.803 152.098 1.00 370.00 ? 900  ASP A OD2 1 
ATOM 3086  N N   . ALA A 1  901  ? 234.758 175.194 151.229 1.00 370.00 ? 901  ALA A N   1 
ATOM 3087  C CA  . ALA A 1  901  ? 233.906 176.306 150.833 1.00 370.00 ? 901  ALA A CA  1 
ATOM 3088  C C   . ALA A 1  901  ? 234.698 177.548 150.437 1.00 370.00 ? 901  ALA A C   1 
ATOM 3089  O O   . ALA A 1  901  ? 234.096 178.599 150.192 1.00 370.00 ? 901  ALA A O   1 
ATOM 3090  C CB  . ALA A 1  901  ? 232.930 176.649 151.961 1.00 370.00 ? 901  ALA A CB  1 
ATOM 3091  N N   . GLY A 1  902  ? 236.025 177.455 150.371 1.00 370.00 ? 902  GLY A N   1 
ATOM 3092  C CA  . GLY A 1  902  ? 236.856 178.558 149.939 1.00 370.00 ? 902  GLY A CA  1 
ATOM 3093  C C   . GLY A 1  902  ? 237.380 179.453 151.042 1.00 370.00 ? 902  GLY A C   1 
ATOM 3094  O O   . GLY A 1  902  ? 238.096 180.418 150.743 1.00 370.00 ? 902  GLY A O   1 
ATOM 3095  N N   . TYR A 1  903  ? 237.055 179.166 152.300 1.00 370.00 ? 903  TYR A N   1 
ATOM 3096  C CA  . TYR A 1  903  ? 237.499 179.975 153.431 1.00 370.00 ? 903  TYR A CA  1 
ATOM 3097  C C   . TYR A 1  903  ? 238.855 179.479 153.915 1.00 370.00 ? 903  TYR A C   1 
ATOM 3098  O O   . TYR A 1  903  ? 238.981 178.339 154.376 1.00 370.00 ? 903  TYR A O   1 
ATOM 3099  C CB  . TYR A 1  903  ? 236.464 179.933 154.552 1.00 370.00 ? 903  TYR A CB  1 
ATOM 3100  C CG  . TYR A 1  903  ? 235.248 180.789 154.290 1.00 370.00 ? 903  TYR A CG  1 
ATOM 3101  C CD1 . TYR A 1  903  ? 235.303 181.845 153.388 1.00 370.00 ? 903  TYR A CD1 1 
ATOM 3102  C CD2 . TYR A 1  903  ? 234.042 180.534 154.930 1.00 370.00 ? 903  TYR A CD2 1 
ATOM 3103  C CE1 . TYR A 1  903  ? 234.197 182.634 153.143 1.00 370.00 ? 903  TYR A CE1 1 
ATOM 3104  C CE2 . TYR A 1  903  ? 232.928 181.317 154.688 1.00 370.00 ? 903  TYR A CE2 1 
ATOM 3105  C CZ  . TYR A 1  903  ? 233.012 182.363 153.792 1.00 370.00 ? 903  TYR A CZ  1 
ATOM 3106  O OH  . TYR A 1  903  ? 231.906 183.148 153.545 1.00 370.00 ? 903  TYR A OH  1 
ATOM 3107  N N   . GLY A 1  904  ? 239.871 180.339 153.813 1.00 370.00 ? 904  GLY A N   1 
ATOM 3108  C CA  . GLY A 1  904  ? 241.185 180.023 154.326 1.00 370.00 ? 904  GLY A CA  1 
ATOM 3109  C C   . GLY A 1  904  ? 241.285 180.207 155.831 1.00 370.00 ? 904  GLY A C   1 
ATOM 3110  O O   . GLY A 1  904  ? 240.337 180.613 156.499 1.00 370.00 ? 904  GLY A O   1 
ATOM 3111  N N   . GLU A 1  905  ? 242.475 179.896 156.359 1.00 370.00 ? 905  GLU A N   1 
ATOM 3112  C CA  . GLU A 1  905  ? 242.714 179.963 157.799 1.00 370.00 ? 905  GLU A CA  1 
ATOM 3113  C C   . GLU A 1  905  ? 242.696 181.387 158.346 1.00 370.00 ? 905  GLU A C   1 
ATOM 3114  O O   . GLU A 1  905  ? 242.531 181.569 159.558 1.00 370.00 ? 905  GLU A O   1 
ATOM 3115  C CB  . GLU A 1  905  ? 244.049 179.297 158.143 1.00 370.00 ? 905  GLU A CB  1 
ATOM 3116  C CG  . GLU A 1  905  ? 244.065 177.792 157.929 1.00 370.00 ? 905  GLU A CG  1 
ATOM 3117  C CD  . GLU A 1  905  ? 245.398 177.166 158.288 1.00 370.00 ? 905  GLU A CD  1 
ATOM 3118  O OE1 . GLU A 1  905  ? 246.349 177.918 158.588 1.00 370.00 ? 905  GLU A OE1 1 
ATOM 3119  O OE2 . GLU A 1  905  ? 245.494 175.920 158.272 1.00 370.00 ? 905  GLU A OE2 1 
ATOM 3120  N N   . LYS A 1  906  ? 242.866 182.399 157.490 1.00 370.00 ? 906  LYS A N   1 
ATOM 3121  C CA  . LYS A 1  906  ? 242.826 183.782 157.954 1.00 370.00 ? 906  LYS A CA  1 
ATOM 3122  C C   . LYS A 1  906  ? 241.412 184.253 158.275 1.00 370.00 ? 906  LYS A C   1 
ATOM 3123  O O   . LYS A 1  906  ? 241.253 185.278 158.947 1.00 370.00 ? 906  LYS A O   1 
ATOM 3124  C CB  . LYS A 1  906  ? 243.452 184.707 156.909 1.00 370.00 ? 906  LYS A CB  1 
ATOM 3125  C CG  . LYS A 1  906  ? 244.900 184.385 156.594 1.00 370.00 ? 906  LYS A CG  1 
ATOM 3126  C CD  . LYS A 1  906  ? 245.786 184.605 157.808 1.00 370.00 ? 906  LYS A CD  1 
ATOM 3127  C CE  . LYS A 1  906  ? 247.253 184.420 157.460 1.00 370.00 ? 906  LYS A CE  1 
ATOM 3128  N NZ  . LYS A 1  906  ? 247.576 182.998 157.155 1.00 370.00 ? 906  LYS A NZ  1 
ATOM 3129  N N   . SER A 1  907  ? 240.386 183.532 157.817 1.00 370.00 ? 907  SER A N   1 
ATOM 3130  C CA  . SER A 1  907  ? 239.011 183.900 158.130 1.00 370.00 ? 907  SER A CA  1 
ATOM 3131  C C   . SER A 1  907  ? 238.578 183.423 159.508 1.00 370.00 ? 907  SER A C   1 
ATOM 3132  O O   . SER A 1  907  ? 237.570 183.909 160.030 1.00 370.00 ? 907  SER A O   1 
ATOM 3133  C CB  . SER A 1  907  ? 238.060 183.337 157.069 1.00 370.00 ? 907  SER A CB  1 
ATOM 3134  O OG  . SER A 1  907  ? 238.308 183.922 155.803 1.00 370.00 ? 907  SER A OG  1 
ATOM 3135  N N   . PHE A 1  908  ? 239.313 182.489 160.103 1.00 370.00 ? 908  PHE A N   1 
ATOM 3136  C CA  . PHE A 1  908  ? 239.018 182.004 161.445 1.00 370.00 ? 908  PHE A CA  1 
ATOM 3137  C C   . PHE A 1  908  ? 240.302 181.782 162.243 1.00 370.00 ? 908  PHE A C   1 
ATOM 3138  O O   . PHE A 1  908  ? 240.626 182.557 163.143 1.00 370.00 ? 908  PHE A O   1 
ATOM 3139  C CB  . PHE A 1  908  ? 238.174 180.718 161.387 1.00 370.00 ? 908  PHE A CB  1 
ATOM 3140  C CG  . PHE A 1  908  ? 238.774 179.612 160.547 1.00 370.00 ? 908  PHE A CG  1 
ATOM 3141  C CD1 . PHE A 1  908  ? 238.433 179.482 159.206 1.00 370.00 ? 908  PHE A CD1 1 
ATOM 3142  C CD2 . PHE A 1  908  ? 239.656 178.692 161.098 1.00 370.00 ? 908  PHE A CD2 1 
ATOM 3143  C CE1 . PHE A 1  908  ? 238.970 178.467 158.432 1.00 370.00 ? 908  PHE A CE1 1 
ATOM 3144  C CE2 . PHE A 1  908  ? 240.202 177.678 160.327 1.00 370.00 ? 908  PHE A CE2 1 
ATOM 3145  C CZ  . PHE A 1  908  ? 239.856 177.564 158.993 1.00 370.00 ? 908  PHE A CZ  1 
ATOM 3146  N N   . LYS A 1  922  ? 232.937 191.585 161.544 1.00 370.00 ? 922  LYS A N   1 
ATOM 3147  C CA  . LYS A 1  922  ? 234.240 191.376 160.922 1.00 370.00 ? 922  LYS A CA  1 
ATOM 3148  C C   . LYS A 1  922  ? 234.362 189.940 160.419 1.00 370.00 ? 922  LYS A C   1 
ATOM 3149  O O   . LYS A 1  922  ? 235.318 189.588 159.727 1.00 370.00 ? 922  LYS A O   1 
ATOM 3150  C CB  . LYS A 1  922  ? 235.379 191.689 161.905 1.00 370.00 ? 922  LYS A CB  1 
ATOM 3151  C CG  . LYS A 1  922  ? 235.777 190.550 162.853 1.00 370.00 ? 922  LYS A CG  1 
ATOM 3152  C CD  . LYS A 1  922  ? 234.811 190.363 164.013 1.00 370.00 ? 922  LYS A CD  1 
ATOM 3153  C CE  . LYS A 1  922  ? 234.933 191.495 165.017 1.00 370.00 ? 922  LYS A CE  1 
ATOM 3154  N NZ  . LYS A 1  922  ? 233.979 191.331 166.146 1.00 370.00 ? 922  LYS A NZ  1 
ATOM 3155  N N   . ILE A 1  923  ? 233.368 189.122 160.757 1.00 370.00 ? 923  ILE A N   1 
ATOM 3156  C CA  . ILE A 1  923  ? 233.406 187.684 160.528 1.00 370.00 ? 923  ILE A CA  1 
ATOM 3157  C C   . ILE A 1  923  ? 232.329 187.319 159.509 1.00 370.00 ? 923  ILE A C   1 
ATOM 3158  O O   . ILE A 1  923  ? 231.256 187.933 159.473 1.00 370.00 ? 923  ILE A O   1 
ATOM 3159  C CB  . ILE A 1  923  ? 233.252 186.915 161.865 1.00 370.00 ? 923  ILE A CB  1 
ATOM 3160  C CG1 . ILE A 1  923  ? 233.517 185.417 161.706 1.00 370.00 ? 923  ILE A CG1 1 
ATOM 3161  C CG2 . ILE A 1  923  ? 231.912 187.192 162.550 1.00 370.00 ? 923  ILE A CG2 1 
ATOM 3162  C CD1 . ILE A 1  923  ? 233.689 184.710 163.033 1.00 370.00 ? 923  ILE A CD1 1 
ATOM 3163  N N   . ASP A 1  924  ? 232.657 186.375 158.627 1.00 370.00 ? 924  ASP A N   1 
ATOM 3164  C CA  . ASP A 1  924  ? 231.733 185.952 157.582 1.00 370.00 ? 924  ASP A CA  1 
ATOM 3165  C C   . ASP A 1  924  ? 230.558 185.174 158.168 1.00 370.00 ? 924  ASP A C   1 
ATOM 3166  O O   . ASP A 1  924  ? 230.620 184.662 159.290 1.00 370.00 ? 924  ASP A O   1 
ATOM 3167  C CB  . ASP A 1  924  ? 232.459 185.105 156.537 1.00 370.00 ? 924  ASP A CB  1 
ATOM 3168  C CG  . ASP A 1  924  ? 233.457 185.911 155.728 1.00 370.00 ? 924  ASP A CG  1 
ATOM 3169  O OD1 . ASP A 1  924  ? 233.241 187.129 155.557 1.00 370.00 ? 924  ASP A OD1 1 
ATOM 3170  O OD2 . ASP A 1  924  ? 234.458 185.327 155.264 1.00 370.00 ? 924  ASP A OD2 1 
ATOM 3171  N N   . ASP A 1  925  ? 229.473 185.110 157.387 1.00 370.00 ? 925  ASP A N   1 
ATOM 3172  C CA  . ASP A 1  925  ? 228.228 184.499 157.848 1.00 370.00 ? 925  ASP A CA  1 
ATOM 3173  C C   . ASP A 1  925  ? 228.376 182.999 158.076 1.00 370.00 ? 925  ASP A C   1 
ATOM 3174  O O   . ASP A 1  925  ? 227.859 182.459 159.061 1.00 370.00 ? 925  ASP A O   1 
ATOM 3175  C CB  . ASP A 1  925  ? 227.113 184.776 156.838 1.00 370.00 ? 925  ASP A CB  1 
ATOM 3176  C CG  . ASP A 1  925  ? 226.750 186.244 156.761 1.00 370.00 ? 925  ASP A CG  1 
ATOM 3177  O OD1 . ASP A 1  925  ? 226.938 186.954 157.770 1.00 370.00 ? 925  ASP A OD1 1 
ATOM 3178  O OD2 . ASP A 1  925  ? 226.273 186.689 155.695 1.00 370.00 ? 925  ASP A OD2 1 
ATOM 3179  N N   . GLU A 1  926  ? 229.069 182.308 157.166 1.00 370.00 ? 926  GLU A N   1 
ATOM 3180  C CA  . GLU A 1  926  ? 229.261 180.868 157.306 1.00 370.00 ? 926  GLU A CA  1 
ATOM 3181  C C   . GLU A 1  926  ? 230.237 180.546 158.433 1.00 370.00 ? 926  GLU A C   1 
ATOM 3182  O O   . GLU A 1  926  ? 230.116 179.502 159.087 1.00 370.00 ? 926  GLU A O   1 
ATOM 3183  C CB  . GLU A 1  926  ? 229.736 180.277 155.974 1.00 370.00 ? 926  GLU A CB  1 
ATOM 3184  C CG  . GLU A 1  926  ? 229.873 178.760 155.956 1.00 370.00 ? 926  GLU A CG  1 
ATOM 3185  C CD  . GLU A 1  926  ? 228.540 178.052 156.114 1.00 370.00 ? 926  GLU A CD  1 
ATOM 3186  O OE1 . GLU A 1  926  ? 227.513 178.592 155.651 1.00 370.00 ? 926  GLU A OE1 1 
ATOM 3187  O OE2 . GLU A 1  926  ? 228.511 176.966 156.731 1.00 370.00 ? 926  GLU A OE2 1 
ATOM 3188  N N   . VAL A 1  927  ? 231.204 181.435 158.684 1.00 370.00 ? 927  VAL A N   1 
ATOM 3189  C CA  . VAL A 1  927  ? 232.139 181.230 159.788 1.00 370.00 ? 927  VAL A CA  1 
ATOM 3190  C C   . VAL A 1  927  ? 231.416 181.379 161.128 1.00 370.00 ? 927  VAL A C   1 
ATOM 3191  O O   . VAL A 1  927  ? 231.799 180.751 162.123 1.00 370.00 ? 927  VAL A O   1 
ATOM 3192  C CB  . VAL A 1  927  ? 233.340 182.193 159.646 1.00 370.00 ? 927  VAL A CB  1 
ATOM 3193  C CG1 . VAL A 1  927  ? 234.429 181.908 160.685 1.00 370.00 ? 927  VAL A CG1 1 
ATOM 3194  C CG2 . VAL A 1  927  ? 233.923 182.111 158.246 1.00 370.00 ? 927  VAL A CG2 1 
ATOM 3195  N N   . ARG A 1  928  ? 230.329 182.159 161.168 1.00 370.00 ? 928  ARG A N   1 
ATOM 3196  C CA  . ARG A 1  928  ? 229.488 182.228 162.361 1.00 370.00 ? 928  ARG A CA  1 
ATOM 3197  C C   . ARG A 1  928  ? 228.771 180.913 162.655 1.00 370.00 ? 928  ARG A C   1 
ATOM 3198  O O   . ARG A 1  928  ? 228.431 180.652 163.813 1.00 370.00 ? 928  ARG A O   1 
ATOM 3199  C CB  . ARG A 1  928  ? 228.448 183.341 162.218 1.00 370.00 ? 928  ARG A CB  1 
ATOM 3200  C CG  . ARG A 1  928  ? 229.001 184.758 162.194 1.00 370.00 ? 928  ARG A CG  1 
ATOM 3201  C CD  . ARG A 1  928  ? 227.860 185.756 162.030 1.00 370.00 ? 928  ARG A CD  1 
ATOM 3202  N NE  . ARG A 1  928  ? 228.313 187.137 161.880 1.00 370.00 ? 928  ARG A NE  1 
ATOM 3203  C CZ  . ARG A 1  928  ? 228.482 187.986 162.889 1.00 370.00 ? 928  ARG A CZ  1 
ATOM 3204  N NH1 . ARG A 1  928  ? 228.243 187.598 164.133 1.00 370.00 ? 928  ARG A NH1 1 
ATOM 3205  N NH2 . ARG A 1  928  ? 228.896 189.224 162.655 1.00 370.00 ? 928  ARG A NH2 1 
ATOM 3206  N N   . THR A 1  929  ? 228.535 180.082 161.636 1.00 370.00 ? 929  THR A N   1 
ATOM 3207  C CA  . THR A 1  929  ? 227.868 178.798 161.806 1.00 370.00 ? 929  THR A CA  1 
ATOM 3208  C C   . THR A 1  929  ? 228.813 177.688 162.249 1.00 370.00 ? 929  THR A C   1 
ATOM 3209  O O   . THR A 1  929  ? 228.360 176.551 162.427 1.00 370.00 ? 929  THR A O   1 
ATOM 3210  C CB  . THR A 1  929  ? 227.179 178.387 160.503 1.00 370.00 ? 929  THR A CB  1 
ATOM 3211  O OG1 . THR A 1  929  ? 228.165 178.190 159.483 1.00 370.00 ? 929  THR A OG1 1 
ATOM 3212  C CG2 . THR A 1  929  ? 226.222 179.476 160.052 1.00 370.00 ? 929  THR A CG2 1 
ATOM 3213  N N   . ALA A 1  930  ? 230.102 177.987 162.397 1.00 370.00 ? 930  ALA A N   1 
ATOM 3214  C CA  . ALA A 1  930  ? 231.065 177.003 162.868 1.00 370.00 ? 930  ALA A CA  1 
ATOM 3215  C C   . ALA A 1  930  ? 230.761 176.616 164.315 1.00 370.00 ? 930  ALA A C   1 
ATOM 3216  O O   . ALA A 1  930  ? 230.268 177.445 165.086 1.00 370.00 ? 930  ALA A O   1 
ATOM 3217  C CB  . ALA A 1  930  ? 232.487 177.559 162.756 1.00 370.00 ? 930  ALA A CB  1 
ATOM 3218  N N   . PRO A 1  931  ? 231.014 175.359 164.703 1.00 370.00 ? 931  PRO A N   1 
ATOM 3219  C CA  . PRO A 1  931  ? 230.705 174.937 166.078 1.00 370.00 ? 931  PRO A CA  1 
ATOM 3220  C C   . PRO A 1  931  ? 231.547 175.606 167.152 1.00 370.00 ? 931  PRO A C   1 
ATOM 3221  O O   . PRO A 1  931  ? 231.103 175.661 168.304 1.00 370.00 ? 931  PRO A O   1 
ATOM 3222  C CB  . PRO A 1  931  ? 230.942 173.421 166.040 1.00 370.00 ? 931  PRO A CB  1 
ATOM 3223  C CG  . PRO A 1  931  ? 231.878 173.209 164.905 1.00 370.00 ? 931  PRO A CG  1 
ATOM 3224  C CD  . PRO A 1  931  ? 231.502 174.236 163.885 1.00 370.00 ? 931  PRO A CD  1 
ATOM 3225  N N   . TRP A 1  932  ? 232.741 176.113 166.833 1.00 370.00 ? 932  TRP A N   1 
ATOM 3226  C CA  . TRP A 1  932  ? 233.467 176.871 167.850 1.00 370.00 ? 932  TRP A CA  1 
ATOM 3227  C C   . TRP A 1  932  ? 232.826 178.230 168.101 1.00 370.00 ? 932  TRP A C   1 
ATOM 3228  O O   . TRP A 1  932  ? 233.020 178.814 169.170 1.00 370.00 ? 932  TRP A O   1 
ATOM 3229  C CB  . TRP A 1  932  ? 234.944 177.038 167.479 1.00 370.00 ? 932  TRP A CB  1 
ATOM 3230  C CG  . TRP A 1  932  ? 235.228 177.746 166.192 1.00 370.00 ? 932  TRP A CG  1 
ATOM 3231  C CD1 . TRP A 1  932  ? 235.259 179.096 165.985 1.00 370.00 ? 932  TRP A CD1 1 
ATOM 3232  C CD2 . TRP A 1  932  ? 235.595 177.142 164.947 1.00 370.00 ? 932  TRP A CD2 1 
ATOM 3233  N NE1 . TRP A 1  932  ? 235.586 179.367 164.679 1.00 370.00 ? 932  TRP A NE1 1 
ATOM 3234  C CE2 . TRP A 1  932  ? 235.802 178.184 164.022 1.00 370.00 ? 932  TRP A CE2 1 
ATOM 3235  C CE3 . TRP A 1  932  ? 235.754 175.819 164.520 1.00 370.00 ? 932  TRP A CE3 1 
ATOM 3236  C CZ2 . TRP A 1  932  ? 236.158 177.945 162.695 1.00 370.00 ? 932  TRP A CZ2 1 
ATOM 3237  C CZ3 . TRP A 1  932  ? 236.108 175.584 163.203 1.00 370.00 ? 932  TRP A CZ3 1 
ATOM 3238  C CH2 . TRP A 1  932  ? 236.308 176.640 162.309 1.00 370.00 ? 932  TRP A CH2 1 
ATOM 3239  N N   . ASN A 1  933  ? 232.062 178.746 167.140 1.00 370.00 ? 933  ASN A N   1 
ATOM 3240  C CA  . ASN A 1  933  ? 231.361 180.011 167.317 1.00 370.00 ? 933  ASN A CA  1 
ATOM 3241  C C   . ASN A 1  933  ? 229.991 179.825 167.965 1.00 370.00 ? 933  ASN A C   1 
ATOM 3242  O O   . ASN A 1  933  ? 229.598 180.627 168.818 1.00 370.00 ? 933  ASN A O   1 
ATOM 3243  C CB  . ASN A 1  933  ? 231.229 180.727 165.970 1.00 370.00 ? 933  ASN A CB  1 
ATOM 3244  C CG  . ASN A 1  933  ? 232.550 181.297 165.484 1.00 370.00 ? 933  ASN A CG  1 
ATOM 3245  O OD1 . ASN A 1  933  ? 233.312 181.874 166.258 1.00 370.00 ? 933  ASN A OD1 1 
ATOM 3246  N ND2 . ASN A 1  933  ? 232.829 181.131 164.199 1.00 370.00 ? 933  ASN A ND2 1 
ATOM 3247  N N   . THR A 1  934  ? 229.254 178.781 167.567 1.00 370.00 ? 934  THR A N   1 
ATOM 3248  C CA  . THR A 1  934  ? 227.904 178.570 168.089 1.00 370.00 ? 934  THR A CA  1 
ATOM 3249  C C   . THR A 1  934  ? 227.916 178.140 169.553 1.00 370.00 ? 934  THR A C   1 
ATOM 3250  O O   . THR A 1  934  ? 227.094 178.611 170.349 1.00 370.00 ? 934  THR A O   1 
ATOM 3251  C CB  . THR A 1  934  ? 227.164 177.532 167.243 1.00 370.00 ? 934  THR A CB  1 
ATOM 3252  O OG1 . THR A 1  934  ? 227.859 176.281 167.299 1.00 370.00 ? 934  THR A OG1 1 
ATOM 3253  C CG2 . THR A 1  934  ? 227.057 177.991 165.795 1.00 370.00 ? 934  THR A CG2 1 
ATOM 3254  N N   . THR A 1  935  ? 228.828 177.236 169.926 1.00 370.00 ? 935  THR A N   1 
ATOM 3255  C CA  . THR A 1  935  ? 228.844 176.715 171.292 1.00 370.00 ? 935  THR A CA  1 
ATOM 3256  C C   . THR A 1  935  ? 229.354 177.752 172.287 1.00 370.00 ? 935  THR A C   1 
ATOM 3257  O O   . THR A 1  935  ? 228.848 177.831 173.412 1.00 370.00 ? 935  THR A O   1 
ATOM 3258  C CB  . THR A 1  935  ? 229.692 175.447 171.365 1.00 370.00 ? 935  THR A CB  1 
ATOM 3259  O OG1 . THR A 1  935  ? 231.019 175.735 170.910 1.00 370.00 ? 935  THR A OG1 1 
ATOM 3260  C CG2 . THR A 1  935  ? 229.082 174.344 170.513 1.00 370.00 ? 935  THR A CG2 1 
ATOM 3261  N N   . ARG A 1  936  ? 230.371 178.534 171.906 1.00 370.00 ? 936  ARG A N   1 
ATOM 3262  C CA  . ARG A 1  936  ? 230.825 179.636 172.753 1.00 370.00 ? 936  ARG A CA  1 
ATOM 3263  C C   . ARG A 1  936  ? 229.735 180.690 172.925 1.00 370.00 ? 936  ARG A C   1 
ATOM 3264  O O   . ARG A 1  936  ? 229.636 181.331 173.978 1.00 370.00 ? 936  ARG A O   1 
ATOM 3265  C CB  . ARG A 1  936  ? 232.102 180.259 172.183 1.00 370.00 ? 936  ARG A CB  1 
ATOM 3266  C CG  . ARG A 1  936  ? 233.350 179.412 172.393 1.00 370.00 ? 936  ARG A CG  1 
ATOM 3267  C CD  . ARG A 1  936  ? 234.577 180.051 171.753 1.00 370.00 ? 936  ARG A CD  1 
ATOM 3268  N NE  . ARG A 1  936  ? 234.905 181.334 172.362 1.00 370.00 ? 936  ARG A NE  1 
ATOM 3269  C CZ  . ARG A 1  936  ? 235.707 181.474 173.412 1.00 370.00 ? 936  ARG A CZ  1 
ATOM 3270  N NH1 . ARG A 1  936  ? 236.270 180.409 173.966 1.00 370.00 ? 936  ARG A NH1 1 
ATOM 3271  N NH2 . ARG A 1  936  ? 235.947 182.680 173.906 1.00 370.00 ? 936  ARG A NH2 1 
ATOM 3272  N N   . ALA A 1  937  ? 228.915 180.890 171.889 1.00 370.00 ? 937  ALA A N   1 
ATOM 3273  C CA  . ALA A 1  937  ? 227.774 181.796 171.999 1.00 370.00 ? 937  ALA A CA  1 
ATOM 3274  C C   . ALA A 1  937  ? 226.722 181.253 172.959 1.00 370.00 ? 937  ALA A C   1 
ATOM 3275  O O   . ALA A 1  937  ? 226.169 181.997 173.777 1.00 370.00 ? 937  ALA A O   1 
ATOM 3276  C CB  . ALA A 1  937  ? 227.163 182.036 170.620 1.00 370.00 ? 937  ALA A CB  1 
ATOM 3277  N N   . PHE A 1  938  ? 226.419 179.956 172.856 1.00 370.00 ? 938  PHE A N   1 
ATOM 3278  C CA  . PHE A 1  938  ? 225.323 179.381 173.629 1.00 370.00 ? 938  PHE A CA  1 
ATOM 3279  C C   . PHE A 1  938  ? 225.668 179.248 175.108 1.00 370.00 ? 938  PHE A C   1 
ATOM 3280  O O   . PHE A 1  938  ? 224.832 179.542 175.972 1.00 370.00 ? 938  PHE A O   1 
ATOM 3281  C CB  . PHE A 1  938  ? 224.931 178.021 173.057 1.00 370.00 ? 938  PHE A CB  1 
ATOM 3282  C CG  . PHE A 1  938  ? 223.823 177.364 173.812 1.00 370.00 ? 938  PHE A CG  1 
ATOM 3283  C CD1 . PHE A 1  938  ? 222.533 177.851 173.714 1.00 370.00 ? 938  PHE A CD1 1 
ATOM 3284  C CD2 . PHE A 1  938  ? 224.069 176.275 174.635 1.00 370.00 ? 938  PHE A CD2 1 
ATOM 3285  C CE1 . PHE A 1  938  ? 221.506 177.267 174.417 1.00 370.00 ? 938  PHE A CE1 1 
ATOM 3286  C CE2 . PHE A 1  938  ? 223.041 175.679 175.340 1.00 370.00 ? 938  PHE A CE2 1 
ATOM 3287  C CZ  . PHE A 1  938  ? 221.756 176.177 175.230 1.00 370.00 ? 938  PHE A CZ  1 
ATOM 3288  N N   . ILE A 1  939  ? 226.878 178.769 175.414 1.00 370.00 ? 939  ILE A N   1 
ATOM 3289  C CA  . ILE A 1  939  ? 227.264 178.493 176.798 1.00 370.00 ? 939  ILE A CA  1 
ATOM 3290  C C   . ILE A 1  939  ? 227.397 179.792 177.590 1.00 370.00 ? 939  ILE A C   1 
ATOM 3291  O O   . ILE A 1  939  ? 226.991 179.865 178.758 1.00 370.00 ? 939  ILE A O   1 
ATOM 3292  C CB  . ILE A 1  939  ? 228.559 177.654 176.821 1.00 370.00 ? 939  ILE A CB  1 
ATOM 3293  C CG1 . ILE A 1  939  ? 228.313 176.277 176.204 1.00 370.00 ? 939  ILE A CG1 1 
ATOM 3294  C CG2 . ILE A 1  939  ? 229.087 177.460 178.234 1.00 370.00 ? 939  ILE A CG2 1 
ATOM 3295  C CD1 . ILE A 1  939  ? 229.583 175.496 175.946 1.00 370.00 ? 939  ILE A CD1 1 
ATOM 3296  N N   . ALA A 1  940  ? 227.951 180.837 176.964 1.00 370.00 ? 940  ALA A N   1 
ATOM 3297  C CA  . ALA A 1  940  ? 227.973 182.161 177.583 1.00 370.00 ? 940  ALA A CA  1 
ATOM 3298  C C   . ALA A 1  940  ? 226.563 182.705 177.792 1.00 370.00 ? 940  ALA A C   1 
ATOM 3299  O O   . ALA A 1  940  ? 226.289 183.374 178.795 1.00 370.00 ? 940  ALA A O   1 
ATOM 3300  C CB  . ALA A 1  940  ? 228.799 183.125 176.731 1.00 370.00 ? 940  ALA A CB  1 
ATOM 3301  N N   . ALA A 1  941  ? 225.655 182.432 176.851 1.00 370.00 ? 941  ALA A N   1 
ATOM 3302  C CA  . ALA A 1  941  ? 224.257 182.800 177.044 1.00 370.00 ? 941  ALA A CA  1 
ATOM 3303  C C   . ALA A 1  941  ? 223.592 181.939 178.111 1.00 370.00 ? 941  ALA A C   1 
ATOM 3304  O O   . ALA A 1  941  ? 222.681 182.408 178.803 1.00 370.00 ? 941  ALA A O   1 
ATOM 3305  C CB  . ALA A 1  941  ? 223.495 182.695 175.726 1.00 370.00 ? 941  ALA A CB  1 
ATOM 3306  N N   . MET A 1  942  ? 224.018 180.679 178.241 1.00 370.00 ? 942  MET A N   1 
ATOM 3307  C CA  . MET A 1  942  ? 223.516 179.824 179.312 1.00 370.00 ? 942  MET A CA  1 
ATOM 3308  C C   . MET A 1  942  ? 223.986 180.308 180.678 1.00 370.00 ? 942  MET A C   1 
ATOM 3309  O O   . MET A 1  942  ? 223.246 180.205 181.664 1.00 370.00 ? 942  MET A O   1 
ATOM 3310  C CB  . MET A 1  942  ? 223.955 178.377 179.068 1.00 370.00 ? 942  MET A CB  1 
ATOM 3311  C CG  . MET A 1  942  ? 223.393 177.363 180.053 1.00 370.00 ? 942  MET A CG  1 
ATOM 3312  S SD  . MET A 1  942  ? 223.877 175.670 179.663 1.00 370.00 ? 942  MET A SD  1 
ATOM 3313  C CE  . MET A 1  942  ? 223.154 174.784 181.042 1.00 370.00 ? 942  MET A CE  1 
ATOM 3314  N N   . LYS A 1  943  ? 225.197 180.855 180.754 1.00 370.00 ? 943  LYS A N   1 
ATOM 3315  C CA  . LYS A 1  943  ? 225.749 181.371 181.998 1.00 370.00 ? 943  LYS A CA  1 
ATOM 3316  C C   . LYS A 1  943  ? 225.328 182.806 182.289 1.00 370.00 ? 943  LYS A C   1 
ATOM 3317  O O   . LYS A 1  943  ? 225.801 183.388 183.271 1.00 370.00 ? 943  LYS A O   1 
ATOM 3318  C CB  . LYS A 1  943  ? 227.279 181.282 181.972 1.00 370.00 ? 943  LYS A CB  1 
ATOM 3319  C CG  . LYS A 1  943  ? 227.821 179.860 181.981 1.00 370.00 ? 943  LYS A CG  1 
ATOM 3320  C CD  . LYS A 1  943  ? 229.341 179.849 181.957 1.00 370.00 ? 943  LYS A CD  1 
ATOM 3321  C CE  . LYS A 1  943  ? 229.885 178.429 181.925 1.00 370.00 ? 943  LYS A CE  1 
ATOM 3322  N NZ  . LYS A 1  943  ? 231.374 178.409 181.887 1.00 370.00 ? 943  LYS A NZ  1 
ATOM 3323  N N   . GLY A 1  944  ? 224.457 183.388 181.467 1.00 370.00 ? 944  GLY A N   1 
ATOM 3324  C CA  . GLY A 1  944  ? 223.992 184.742 181.683 1.00 370.00 ? 944  GLY A CA  1 
ATOM 3325  C C   . GLY A 1  944  ? 224.956 185.832 181.273 1.00 370.00 ? 944  GLY A C   1 
ATOM 3326  O O   . GLY A 1  944  ? 224.752 186.989 181.657 1.00 370.00 ? 944  GLY A O   1 
ATOM 3327  N N   . LYS A 1  945  ? 226.000 185.505 180.510 1.00 370.00 ? 945  LYS A N   1 
ATOM 3328  C CA  . LYS A 1  945  ? 226.973 186.510 180.097 1.00 370.00 ? 945  LYS A CA  1 
ATOM 3329  C C   . LYS A 1  945  ? 226.486 187.365 178.935 1.00 370.00 ? 945  LYS A C   1 
ATOM 3330  O O   . LYS A 1  945  ? 226.964 188.495 178.779 1.00 370.00 ? 945  LYS A O   1 
ATOM 3331  C CB  . LYS A 1  945  ? 228.293 185.840 179.710 1.00 370.00 ? 945  LYS A CB  1 
ATOM 3332  C CG  . LYS A 1  945  ? 229.053 185.238 180.880 1.00 370.00 ? 945  LYS A CG  1 
ATOM 3333  C CD  . LYS A 1  945  ? 230.273 184.448 180.420 1.00 370.00 ? 945  LYS A CD  1 
ATOM 3334  C CE  . LYS A 1  945  ? 231.546 185.289 180.427 1.00 370.00 ? 945  LYS A CE  1 
ATOM 3335  N NZ  . LYS A 1  945  ? 231.609 186.299 179.333 1.00 370.00 ? 945  LYS A NZ  1 
ATOM 3336  N N   . CYS A 1  946  ? 225.539 186.869 178.145 1.00 370.00 ? 946  CYS A N   1 
ATOM 3337  C CA  . CYS A 1  946  ? 225.064 187.549 176.941 1.00 370.00 ? 946  CYS A CA  1 
ATOM 3338  C C   . CYS A 1  946  ? 223.743 186.908 176.527 1.00 370.00 ? 946  CYS A C   1 
ATOM 3339  O O   . CYS A 1  946  ? 223.246 185.985 177.180 1.00 370.00 ? 946  CYS A O   1 
ATOM 3340  C CB  . CYS A 1  946  ? 226.092 187.470 175.811 1.00 370.00 ? 946  CYS A CB  1 
ATOM 3341  S SG  . CYS A 1  946  ? 226.435 185.785 175.255 1.00 370.00 ? 946  CYS A SG  1 
ATOM 3342  N N   . LEU A 1  947  ? 223.174 187.416 175.439 1.00 370.00 ? 947  LEU A N   1 
ATOM 3343  C CA  . LEU A 1  947  ? 221.967 186.874 174.831 1.00 370.00 ? 947  LEU A CA  1 
ATOM 3344  C C   . LEU A 1  947  ? 222.285 186.370 173.422 1.00 370.00 ? 947  LEU A C   1 
ATOM 3345  O O   . LEU A 1  947  ? 223.422 186.459 172.947 1.00 370.00 ? 947  LEU A O   1 
ATOM 3346  C CB  . LEU A 1  947  ? 220.852 187.924 174.823 1.00 370.00 ? 947  LEU A CB  1 
ATOM 3347  C CG  . LEU A 1  947  ? 220.334 188.351 176.199 1.00 370.00 ? 947  LEU A CG  1 
ATOM 3348  C CD1 . LEU A 1  947  ? 219.340 189.496 176.087 1.00 370.00 ? 947  LEU A CD1 1 
ATOM 3349  C CD2 . LEU A 1  947  ? 219.706 187.175 176.926 1.00 370.00 ? 947  LEU A CD2 1 
ATOM 3350  N N   . LEU A 1  948  ? 221.264 185.837 172.755 1.00 370.00 ? 948  LEU A N   1 
ATOM 3351  C CA  . LEU A 1  948  ? 221.409 185.182 171.461 1.00 370.00 ? 948  LEU A CA  1 
ATOM 3352  C C   . LEU A 1  948  ? 220.676 185.931 170.353 1.00 370.00 ? 948  LEU A C   1 
ATOM 3353  O O   . LEU A 1  948  ? 219.720 186.671 170.597 1.00 370.00 ? 948  LEU A O   1 
ATOM 3354  C CB  . LEU A 1  948  ? 220.905 183.739 171.516 1.00 370.00 ? 948  LEU A CB  1 
ATOM 3355  C CG  . LEU A 1  948  ? 221.774 182.811 172.357 1.00 370.00 ? 948  LEU A CG  1 
ATOM 3356  C CD1 . LEU A 1  948  ? 221.164 181.422 172.423 1.00 370.00 ? 948  LEU A CD1 1 
ATOM 3357  C CD2 . LEU A 1  948  ? 223.173 182.772 171.769 1.00 370.00 ? 948  LEU A CD2 1 
ATOM 3358  N N   . GLU A 1  949  ? 221.133 185.688 169.116 1.00 370.00 ? 949  GLU A N   1 
ATOM 3359  C CA  . GLU A 1  949  ? 220.671 186.407 167.926 1.00 370.00 ? 949  GLU A CA  1 
ATOM 3360  C C   . GLU A 1  949  ? 219.249 186.008 167.503 1.00 370.00 ? 949  GLU A C   1 
ATOM 3361  O O   . GLU A 1  949  ? 218.669 186.633 166.608 1.00 370.00 ? 949  GLU A O   1 
ATOM 3362  C CB  . GLU A 1  949  ? 221.644 186.169 166.762 1.00 370.00 ? 949  GLU A CB  1 
ATOM 3363  C CG  . GLU A 1  949  ? 221.619 187.243 165.652 1.00 370.00 ? 949  GLU A CG  1 
ATOM 3364  C CD  . GLU A 1  949  ? 222.391 186.854 164.407 1.00 370.00 ? 949  GLU A CD  1 
ATOM 3365  O OE1 . GLU A 1  949  ? 222.798 185.682 164.293 1.00 370.00 ? 949  GLU A OE1 1 
ATOM 3366  O OE2 . GLU A 1  949  ? 222.601 187.729 163.541 1.00 370.00 ? 949  GLU A OE2 1 
ATOM 3367  N N   . VAL A 1  950  ? 218.613 185.079 168.225 1.00 370.00 ? 950  VAL A N   1 
ATOM 3368  C CA  . VAL A 1  950  ? 217.905 183.888 167.742 1.00 370.00 ? 950  VAL A CA  1 
ATOM 3369  C C   . VAL A 1  950  ? 217.403 183.928 166.294 1.00 370.00 ? 950  VAL A C   1 
ATOM 3370  O O   . VAL A 1  950  ? 217.573 182.951 165.556 1.00 370.00 ? 950  VAL A O   1 
ATOM 3371  C CB  . VAL A 1  950  ? 216.729 183.616 168.703 1.00 370.00 ? 950  VAL A CB  1 
ATOM 3372  C CG1 . VAL A 1  950  ? 215.948 182.396 168.296 1.00 370.00 ? 950  VAL A CG1 1 
ATOM 3373  C CG2 . VAL A 1  950  ? 217.232 183.475 170.126 1.00 370.00 ? 950  VAL A CG2 1 
ATOM 3374  N N   . THR A 1  951  ? 216.796 185.026 165.849 1.00 370.00 ? 951  THR A N   1 
ATOM 3375  C CA  . THR A 1  951  ? 216.477 185.179 164.433 1.00 370.00 ? 951  THR A CA  1 
ATOM 3376  C C   . THR A 1  951  ? 217.712 185.723 163.718 1.00 370.00 ? 951  THR A C   1 
ATOM 3377  O O   . THR A 1  951  ? 218.025 186.914 163.830 1.00 370.00 ? 951  THR A O   1 
ATOM 3378  C CB  . THR A 1  951  ? 215.277 186.104 164.218 1.00 370.00 ? 951  THR A CB  1 
ATOM 3379  O OG1 . THR A 1  951  ? 214.131 185.562 164.885 1.00 370.00 ? 951  THR A OG1 1 
ATOM 3380  C CG2 . THR A 1  951  ? 214.955 186.237 162.732 1.00 370.00 ? 951  THR A CG2 1 
ATOM 3381  N N   . GLY A 1  952  ? 218.387 184.865 162.961 1.00 370.00 ? 952  GLY A N   1 
ATOM 3382  C CA  . GLY A 1  952  ? 219.670 185.241 162.401 1.00 370.00 ? 952  GLY A CA  1 
ATOM 3383  C C   . GLY A 1  952  ? 220.212 184.169 161.476 1.00 370.00 ? 952  GLY A C   1 
ATOM 3384  O O   . GLY A 1  952  ? 219.551 183.166 161.192 1.00 370.00 ? 952  GLY A O   1 
ATOM 3385  N N   . VAL A 1  953  ? 221.441 184.411 161.013 1.00 370.00 ? 953  VAL A N   1 
ATOM 3386  C CA  . VAL A 1  953  ? 221.993 183.655 159.894 1.00 370.00 ? 953  VAL A CA  1 
ATOM 3387  C C   . VAL A 1  953  ? 222.482 182.267 160.309 1.00 370.00 ? 953  VAL A C   1 
ATOM 3388  O O   . VAL A 1  953  ? 222.539 181.359 159.471 1.00 370.00 ? 953  VAL A O   1 
ATOM 3389  C CB  . VAL A 1  953  ? 223.103 184.495 159.221 1.00 370.00 ? 953  VAL A CB  1 
ATOM 3390  C CG1 . VAL A 1  953  ? 224.366 184.571 160.084 1.00 370.00 ? 953  VAL A CG1 1 
ATOM 3391  C CG2 . VAL A 1  953  ? 223.400 184.011 157.800 1.00 370.00 ? 953  VAL A CG2 1 
ATOM 3392  N N   . ALA A 1  954  ? 222.770 182.046 161.593 1.00 370.00 ? 954  ALA A N   1 
ATOM 3393  C CA  . ALA A 1  954  ? 223.296 180.766 162.056 1.00 370.00 ? 954  ALA A CA  1 
ATOM 3394  C C   . ALA A 1  954  ? 222.202 179.738 162.322 1.00 370.00 ? 954  ALA A C   1 
ATOM 3395  O O   . ALA A 1  954  ? 222.476 178.704 162.940 1.00 370.00 ? 954  ALA A O   1 
ATOM 3396  C CB  . ALA A 1  954  ? 224.152 180.960 163.311 1.00 370.00 ? 954  ALA A CB  1 
ATOM 3397  N N   . ASP A 1  955  ? 220.972 180.014 161.884 1.00 370.00 ? 955  ASP A N   1 
ATOM 3398  C CA  . ASP A 1  955  ? 219.841 179.098 161.853 1.00 370.00 ? 955  ASP A CA  1 
ATOM 3399  C C   . ASP A 1  955  ? 220.207 177.887 161.002 1.00 370.00 ? 955  ASP A C   1 
ATOM 3400  O O   . ASP A 1  955  ? 220.401 178.025 159.787 1.00 370.00 ? 955  ASP A O   1 
ATOM 3401  C CB  . ASP A 1  955  ? 218.612 179.820 161.288 1.00 370.00 ? 955  ASP A CB  1 
ATOM 3402  C CG  . ASP A 1  955  ? 217.319 179.036 161.456 1.00 370.00 ? 955  ASP A CG  1 
ATOM 3403  O OD1 . ASP A 1  955  ? 217.337 177.916 162.004 1.00 370.00 ? 955  ASP A OD1 1 
ATOM 3404  O OD2 . ASP A 1  955  ? 216.266 179.553 161.028 1.00 370.00 ? 955  ASP A OD2 1 
ATOM 3405  N N   . PRO A 1  956  ? 220.317 176.691 161.594 1.00 370.00 ? 956  PRO A N   1 
ATOM 3406  C CA  . PRO A 1  956  ? 220.691 175.514 160.795 1.00 370.00 ? 956  PRO A CA  1 
ATOM 3407  C C   . PRO A 1  956  ? 219.587 175.025 159.872 1.00 370.00 ? 956  PRO A C   1 
ATOM 3408  O O   . PRO A 1  956  ? 219.890 174.322 158.899 1.00 370.00 ? 956  PRO A O   1 
ATOM 3409  C CB  . PRO A 1  956  ? 221.033 174.464 161.858 1.00 370.00 ? 956  PRO A CB  1 
ATOM 3410  C CG  . PRO A 1  956  ? 220.198 174.847 163.029 1.00 370.00 ? 956  PRO A CG  1 
ATOM 3411  C CD  . PRO A 1  956  ? 220.121 176.354 163.014 1.00 370.00 ? 956  PRO A CD  1 
ATOM 3412  N N   . THR A 1  957  ? 218.326 175.370 160.134 1.00 370.00 ? 957  THR A N   1 
ATOM 3413  C CA  . THR A 1  957  ? 217.241 174.937 159.262 1.00 370.00 ? 957  THR A CA  1 
ATOM 3414  C C   . THR A 1  957  ? 217.057 175.845 158.053 1.00 370.00 ? 957  THR A C   1 
ATOM 3415  O O   . THR A 1  957  ? 216.547 175.387 157.025 1.00 370.00 ? 957  THR A O   1 
ATOM 3416  C CB  . THR A 1  957  ? 215.928 174.862 160.045 1.00 370.00 ? 957  THR A CB  1 
ATOM 3417  O OG1 . THR A 1  957  ? 215.593 176.163 160.546 1.00 370.00 ? 957  THR A OG1 1 
ATOM 3418  C CG2 . THR A 1  957  ? 216.061 173.894 161.211 1.00 370.00 ? 957  THR A CG2 1 
ATOM 3419  N N   . GLY A 1  958  ? 217.466 177.109 158.147 1.00 370.00 ? 958  GLY A N   1 
ATOM 3420  C CA  . GLY A 1  958  ? 217.371 178.041 157.040 1.00 370.00 ? 958  GLY A CA  1 
ATOM 3421  C C   . GLY A 1  958  ? 215.982 178.538 156.702 1.00 370.00 ? 958  GLY A C   1 
ATOM 3422  O O   . GLY A 1  958  ? 215.838 179.303 155.742 1.00 370.00 ? 958  GLY A O   1 
ATOM 3423  N N   . CYS A 1  959  ? 214.951 178.140 157.454 1.00 370.00 ? 959  CYS A N   1 
ATOM 3424  C CA  . CYS A 1  959  ? 213.582 178.548 157.166 1.00 370.00 ? 959  CYS A CA  1 
ATOM 3425  C C   . CYS A 1  959  ? 212.864 179.067 158.407 1.00 370.00 ? 959  CYS A C   1 
ATOM 3426  O O   . CYS A 1  959  ? 211.632 179.160 158.409 1.00 370.00 ? 959  CYS A O   1 
ATOM 3427  C CB  . CYS A 1  959  ? 212.791 177.393 156.544 1.00 370.00 ? 959  CYS A CB  1 
ATOM 3428  S SG  . CYS A 1  959  ? 212.592 175.952 157.614 1.00 370.00 ? 959  CYS A SG  1 
ATOM 3429  N N   . GLY A 1  960  ? 213.601 179.408 159.460 1.00 370.00 ? 960  GLY A N   1 
ATOM 3430  C CA  . GLY A 1  960  ? 212.998 179.967 160.651 1.00 370.00 ? 960  GLY A CA  1 
ATOM 3431  C C   . GLY A 1  960  ? 212.541 178.966 161.687 1.00 370.00 ? 960  GLY A C   1 
ATOM 3432  O O   . GLY A 1  960  ? 211.779 179.342 162.587 1.00 370.00 ? 960  GLY A O   1 
ATOM 3433  N N   . GLU A 1  961  ? 212.970 177.706 161.593 1.00 370.00 ? 961  GLU A N   1 
ATOM 3434  C CA  . GLU A 1  961  ? 212.526 176.655 162.503 1.00 370.00 ? 961  GLU A CA  1 
ATOM 3435  C C   . GLU A 1  961  ? 213.622 176.226 163.477 1.00 370.00 ? 961  GLU A C   1 
ATOM 3436  O O   . GLU A 1  961  ? 213.547 175.136 164.052 1.00 370.00 ? 961  GLU A O   1 
ATOM 3437  C CB  . GLU A 1  961  ? 212.008 175.459 161.700 1.00 370.00 ? 961  GLU A CB  1 
ATOM 3438  C CG  . GLU A 1  961  ? 210.781 175.799 160.859 1.00 370.00 ? 961  GLU A CG  1 
ATOM 3439  C CD  . GLU A 1  961  ? 210.252 174.636 160.035 1.00 370.00 ? 961  GLU A CD  1 
ATOM 3440  O OE1 . GLU A 1  961  ? 210.897 173.567 159.995 1.00 370.00 ? 961  GLU A OE1 1 
ATOM 3441  O OE2 . GLU A 1  961  ? 209.179 174.798 159.417 1.00 370.00 ? 961  GLU A OE2 1 
ATOM 3442  N N   . GLY A 1  962  ? 214.637 177.069 163.679 1.00 370.00 ? 962  GLY A N   1 
ATOM 3443  C CA  . GLY A 1  962  ? 215.730 176.758 164.579 1.00 370.00 ? 962  GLY A CA  1 
ATOM 3444  C C   . GLY A 1  962  ? 216.312 178.026 165.167 1.00 370.00 ? 962  GLY A C   1 
ATOM 3445  O O   . GLY A 1  962  ? 215.831 179.133 164.913 1.00 370.00 ? 962  GLY A O   1 
ATOM 3446  N N   . PHE A 1  963  ? 217.359 177.850 165.968 1.00 370.00 ? 963  PHE A N   1 
ATOM 3447  C CA  . PHE A 1  963  ? 217.975 178.942 166.710 1.00 370.00 ? 963  PHE A CA  1 
ATOM 3448  C C   . PHE A 1  963  ? 219.318 179.323 166.095 1.00 370.00 ? 963  PHE A C   1 
ATOM 3449  O O   . PHE A 1  963  ? 220.076 178.457 165.647 1.00 370.00 ? 963  PHE A O   1 
ATOM 3450  C CB  . PHE A 1  963  ? 218.187 178.548 168.172 1.00 370.00 ? 963  PHE A CB  1 
ATOM 3451  C CG  . PHE A 1  963  ? 216.918 178.298 168.939 1.00 370.00 ? 963  PHE A CG  1 
ATOM 3452  C CD1 . PHE A 1  963  ? 215.701 178.842 168.538 1.00 370.00 ? 963  PHE A CD1 1 
ATOM 3453  C CD2 . PHE A 1  963  ? 216.947 177.473 170.051 1.00 370.00 ? 963  PHE A CD2 1 
ATOM 3454  C CE1 . PHE A 1  963  ? 214.548 178.598 169.257 1.00 370.00 ? 963  PHE A CE1 1 
ATOM 3455  C CE2 . PHE A 1  963  ? 215.798 177.216 170.767 1.00 370.00 ? 963  PHE A CE2 1 
ATOM 3456  C CZ  . PHE A 1  963  ? 214.596 177.781 170.370 1.00 370.00 ? 963  PHE A CZ  1 
ATOM 3457  N N   . SER A 1  964  ? 219.606 180.624 166.085 1.00 370.00 ? 964  SER A N   1 
ATOM 3458  C CA  . SER A 1  964  ? 220.886 181.160 165.627 1.00 370.00 ? 964  SER A CA  1 
ATOM 3459  C C   . SER A 1  964  ? 221.749 181.487 166.843 1.00 370.00 ? 964  SER A C   1 
ATOM 3460  O O   . SER A 1  964  ? 221.431 182.403 167.609 1.00 370.00 ? 964  SER A O   1 
ATOM 3461  C CB  . SER A 1  964  ? 220.661 182.395 164.758 1.00 370.00 ? 964  SER A CB  1 
ATOM 3462  O OG  . SER A 1  964  ? 221.873 183.033 164.407 1.00 370.00 ? 964  SER A OG  1 
ATOM 3463  N N   . TYR A 1  965  ? 222.836 180.734 167.030 1.00 370.00 ? 965  TYR A N   1 
ATOM 3464  C CA  . TYR A 1  965  ? 223.709 180.898 168.197 1.00 370.00 ? 965  TYR A CA  1 
ATOM 3465  C C   . TYR A 1  965  ? 224.803 181.917 167.876 1.00 370.00 ? 965  TYR A C   1 
ATOM 3466  O O   . TYR A 1  965  ? 225.945 181.581 167.552 1.00 370.00 ? 965  TYR A O   1 
ATOM 3467  C CB  . TYR A 1  965  ? 224.297 179.556 168.618 1.00 370.00 ? 965  TYR A CB  1 
ATOM 3468  C CG  . TYR A 1  965  ? 223.295 178.579 169.210 1.00 370.00 ? 965  TYR A CG  1 
ATOM 3469  C CD1 . TYR A 1  965  ? 222.063 179.013 169.690 1.00 370.00 ? 965  TYR A CD1 1 
ATOM 3470  C CD2 . TYR A 1  965  ? 223.582 177.218 169.277 1.00 370.00 ? 965  TYR A CD2 1 
ATOM 3471  C CE1 . TYR A 1  965  ? 221.147 178.121 170.227 1.00 370.00 ? 965  TYR A CE1 1 
ATOM 3472  C CE2 . TYR A 1  965  ? 222.671 176.318 169.811 1.00 370.00 ? 965  TYR A CE2 1 
ATOM 3473  C CZ  . TYR A 1  965  ? 221.457 176.776 170.283 1.00 370.00 ? 965  TYR A CZ  1 
ATOM 3474  O OH  . TYR A 1  965  ? 220.552 175.886 170.814 1.00 370.00 ? 965  TYR A OH  1 
ATOM 3475  N N   . VAL A 1  966  ? 224.433 183.197 167.967 1.00 370.00 ? 966  VAL A N   1 
ATOM 3476  C CA  . VAL A 1  966  ? 225.346 184.325 167.790 1.00 370.00 ? 966  VAL A CA  1 
ATOM 3477  C C   . VAL A 1  966  ? 225.098 185.307 168.930 1.00 370.00 ? 966  VAL A C   1 
ATOM 3478  O O   . VAL A 1  966  ? 223.944 185.637 169.224 1.00 370.00 ? 966  VAL A O   1 
ATOM 3479  C CB  . VAL A 1  966  ? 225.162 185.015 166.420 1.00 370.00 ? 966  VAL A CB  1 
ATOM 3480  C CG1 . VAL A 1  966  ? 225.962 186.308 166.323 1.00 370.00 ? 966  VAL A CG1 1 
ATOM 3481  C CG2 . VAL A 1  966  ? 225.549 184.087 165.270 1.00 370.00 ? 966  VAL A CG2 1 
ATOM 3482  N N   . LYS A 1  967  ? 226.179 185.751 169.577 1.00 370.00 ? 967  LYS A N   1 
ATOM 3483  C CA  . LYS A 1  967  ? 226.085 186.609 170.754 1.00 370.00 ? 967  LYS A CA  1 
ATOM 3484  C C   . LYS A 1  967  ? 225.527 187.989 170.418 1.00 370.00 ? 967  LYS A C   1 
ATOM 3485  O O   . LYS A 1  967  ? 225.962 188.636 169.462 1.00 370.00 ? 967  LYS A O   1 
ATOM 3486  C CB  . LYS A 1  967  ? 227.466 186.770 171.392 1.00 370.00 ? 967  LYS A CB  1 
ATOM 3487  C CG  . LYS A 1  967  ? 228.057 185.507 171.988 1.00 370.00 ? 967  LYS A CG  1 
ATOM 3488  C CD  . LYS A 1  967  ? 229.408 185.790 172.638 1.00 370.00 ? 967  LYS A CD  1 
ATOM 3489  C CE  . LYS A 1  967  ? 230.019 184.527 173.225 1.00 370.00 ? 967  LYS A CE  1 
ATOM 3490  N NZ  . LYS A 1  967  ? 231.351 184.761 173.850 1.00 370.00 ? 967  LYS A NZ  1 
ATOM 3491  N N   . ILE A 1  968  ? 224.558 188.434 171.214 1.00 370.00 ? 968  ILE A N   1 
ATOM 3492  C CA  . ILE A 1  968  ? 224.178 189.845 171.281 1.00 370.00 ? 968  ILE A CA  1 
ATOM 3493  C C   . ILE A 1  968  ? 224.331 190.251 172.745 1.00 370.00 ? 968  ILE A C   1 
ATOM 3494  O O   . ILE A 1  968  ? 224.207 189.390 173.630 1.00 370.00 ? 968  ILE A O   1 
ATOM 3495  C CB  . ILE A 1  968  ? 222.758 190.096 170.734 1.00 370.00 ? 968  ILE A CB  1 
ATOM 3496  C CG1 . ILE A 1  968  ? 221.694 189.358 171.545 1.00 370.00 ? 968  ILE A CG1 1 
ATOM 3497  C CG2 . ILE A 1  968  ? 222.663 189.711 169.261 1.00 370.00 ? 968  ILE A CG2 1 
ATOM 3498  C CD1 . ILE A 1  968  ? 220.281 189.814 171.237 1.00 370.00 ? 968  ILE A CD1 1 
ATOM 3499  N N   . PRO A 1  969  ? 224.662 191.507 173.056 1.00 370.00 ? 969  PRO A N   1 
ATOM 3500  C CA  . PRO A 1  969  ? 224.849 191.888 174.462 1.00 370.00 ? 969  PRO A CA  1 
ATOM 3501  C C   . PRO A 1  969  ? 223.539 191.933 175.239 1.00 370.00 ? 969  PRO A C   1 
ATOM 3502  O O   . PRO A 1  969  ? 222.442 191.913 174.676 1.00 370.00 ? 969  PRO A O   1 
ATOM 3503  C CB  . PRO A 1  969  ? 225.493 193.278 174.374 1.00 370.00 ? 969  PRO A CB  1 
ATOM 3504  C CG  . PRO A 1  969  ? 225.071 193.805 173.056 1.00 370.00 ? 969  PRO A CG  1 
ATOM 3505  C CD  . PRO A 1  969  ? 224.998 192.616 172.143 1.00 370.00 ? 969  PRO A CD  1 
ATOM 3506  N N   . ASN A 1  970  ? 223.676 191.996 176.568 1.00 370.00 ? 970  ASN A N   1 
ATOM 3507  C CA  . ASN A 1  970  ? 222.526 192.027 177.468 1.00 370.00 ? 970  ASN A CA  1 
ATOM 3508  C C   . ASN A 1  970  ? 221.795 193.365 177.461 1.00 370.00 ? 970  ASN A C   1 
ATOM 3509  O O   . ASN A 1  970  ? 220.744 193.480 178.101 1.00 370.00 ? 970  ASN A O   1 
ATOM 3510  C CB  . ASN A 1  970  ? 222.967 191.690 178.893 1.00 370.00 ? 970  ASN A CB  1 
ATOM 3511  C CG  . ASN A 1  970  ? 223.346 190.232 179.054 1.00 370.00 ? 970  ASN A CG  1 
ATOM 3512  O OD1 . ASN A 1  970  ? 222.671 189.342 178.538 1.00 370.00 ? 970  ASN A OD1 1 
ATOM 3513  N ND2 . ASN A 1  970  ? 224.435 189.979 179.773 1.00 370.00 ? 970  ASN A ND2 1 
ATOM 3514  N N   . LYS A 1  971  ? 222.340 194.378 176.791 1.00 370.00 ? 971  LYS A N   1 
ATOM 3515  C CA  . LYS A 1  971  ? 221.688 195.677 176.643 1.00 370.00 ? 971  LYS A CA  1 
ATOM 3516  C C   . LYS A 1  971  ? 220.395 195.548 175.843 1.00 370.00 ? 971  LYS A C   1 
ATOM 3517  O O   . LYS A 1  971  ? 219.345 196.033 176.266 1.00 370.00 ? 971  LYS A O   1 
ATOM 3518  C CB  . LYS A 1  971  ? 222.651 196.672 175.977 1.00 370.00 ? 971  LYS A CB  1 
ATOM 3519  C CG  . LYS A 1  971  ? 222.172 198.126 175.881 1.00 370.00 ? 971  LYS A CG  1 
ATOM 3520  C CD  . LYS A 1  971  ? 221.624 198.477 174.493 1.00 370.00 ? 971  LYS A CD  1 
ATOM 3521  C CE  . LYS A 1  971  ? 221.353 199.966 174.360 1.00 370.00 ? 971  LYS A CE  1 
ATOM 3522  N NZ  . LYS A 1  971  ? 220.274 200.418 175.280 1.00 370.00 ? 971  LYS A NZ  1 
ATOM 3523  N N   . SER A 1  1054 ? 212.960 199.734 179.462 1.00 370.00 ? 1054 SER A N   1 
ATOM 3524  C CA  . SER A 1  1054 ? 213.430 199.406 178.122 1.00 370.00 ? 1054 SER A CA  1 
ATOM 3525  C C   . SER A 1  1054 ? 214.339 198.185 178.157 1.00 370.00 ? 1054 SER A C   1 
ATOM 3526  O O   . SER A 1  1054 ? 214.517 197.503 177.148 1.00 370.00 ? 1054 SER A O   1 
ATOM 3527  C CB  . SER A 1  1054 ? 214.165 200.595 177.501 1.00 370.00 ? 1054 SER A CB  1 
ATOM 3528  O OG  . SER A 1  1054 ? 214.642 200.274 176.205 1.00 370.00 ? 1054 SER A OG  1 
ATOM 3529  N N   . VAL A 1  1055 ? 214.912 197.908 179.331 1.00 370.00 ? 1055 VAL A N   1 
ATOM 3530  C CA  . VAL A 1  1055 ? 215.780 196.747 179.500 1.00 370.00 ? 1055 VAL A CA  1 
ATOM 3531  C C   . VAL A 1  1055 ? 215.001 195.527 179.984 1.00 370.00 ? 1055 VAL A C   1 
ATOM 3532  O O   . VAL A 1  1055 ? 215.472 194.390 179.810 1.00 370.00 ? 1055 VAL A O   1 
ATOM 3533  C CB  . VAL A 1  1055 ? 216.955 197.083 180.454 1.00 370.00 ? 1055 VAL A CB  1 
ATOM 3534  C CG1 . VAL A 1  1055 ? 216.487 197.180 181.906 1.00 370.00 ? 1055 VAL A CG1 1 
ATOM 3535  C CG2 . VAL A 1  1055 ? 218.143 196.124 180.278 1.00 370.00 ? 1055 VAL A CG2 1 
ATOM 3536  N N   . ALA A 1  1056 ? 213.797 195.719 180.526 1.00 370.00 ? 1056 ALA A N   1 
ATOM 3537  C CA  . ALA A 1  1056 ? 212.901 194.604 180.793 1.00 370.00 ? 1056 ALA A CA  1 
ATOM 3538  C C   . ALA A 1  1056 ? 212.133 194.188 179.550 1.00 370.00 ? 1056 ALA A C   1 
ATOM 3539  O O   . ALA A 1  1056 ? 211.708 193.033 179.451 1.00 370.00 ? 1056 ALA A O   1 
ATOM 3540  C CB  . ALA A 1  1056 ? 211.919 194.963 181.912 1.00 370.00 ? 1056 ALA A CB  1 
ATOM 3541  N N   . GLU A 1  1057 ? 211.953 195.111 178.603 1.00 370.00 ? 1057 GLU A N   1 
ATOM 3542  C CA  . GLU A 1  1057 ? 211.372 194.776 177.308 1.00 370.00 ? 1057 GLU A CA  1 
ATOM 3543  C C   . GLU A 1  1057 ? 212.382 194.072 176.410 1.00 370.00 ? 1057 GLU A C   1 
ATOM 3544  O O   . GLU A 1  1057 ? 211.997 193.227 175.592 1.00 370.00 ? 1057 GLU A O   1 
ATOM 3545  C CB  . GLU A 1  1057 ? 210.847 196.050 176.637 1.00 370.00 ? 1057 GLU A CB  1 
ATOM 3546  C CG  . GLU A 1  1057 ? 210.104 195.845 175.322 1.00 370.00 ? 1057 GLU A CG  1 
ATOM 3547  C CD  . GLU A 1  1057 ? 209.605 197.147 174.725 1.00 370.00 ? 1057 GLU A CD  1 
ATOM 3548  O OE1 . GLU A 1  1057 ? 209.855 198.213 175.326 1.00 370.00 ? 1057 GLU A OE1 1 
ATOM 3549  O OE2 . GLU A 1  1057 ? 208.966 197.103 173.654 1.00 370.00 ? 1057 GLU A OE2 1 
ATOM 3550  N N   . HIS A 1  1058 ? 213.669 194.408 176.555 1.00 370.00 ? 1058 HIS A N   1 
ATOM 3551  C CA  . HIS A 1  1058 ? 214.719 193.785 175.750 1.00 370.00 ? 1058 HIS A CA  1 
ATOM 3552  C C   . HIS A 1  1058 ? 214.859 192.300 176.063 1.00 370.00 ? 1058 HIS A C   1 
ATOM 3553  O O   . HIS A 1  1058 ? 215.026 191.479 175.153 1.00 370.00 ? 1058 HIS A O   1 
ATOM 3554  C CB  . HIS A 1  1058 ? 216.046 194.509 175.977 1.00 370.00 ? 1058 HIS A CB  1 
ATOM 3555  C CG  . HIS A 1  1058 ? 217.158 194.030 175.097 1.00 370.00 ? 1058 HIS A CG  1 
ATOM 3556  N ND1 . HIS A 1  1058 ? 217.973 192.971 175.436 1.00 370.00 ? 1058 HIS A ND1 1 
ATOM 3557  C CD2 . HIS A 1  1058 ? 217.597 194.470 173.894 1.00 370.00 ? 1058 HIS A CD2 1 
ATOM 3558  C CE1 . HIS A 1  1058 ? 218.862 192.776 174.478 1.00 370.00 ? 1058 HIS A CE1 1 
ATOM 3559  N NE2 . HIS A 1  1058 ? 218.655 193.673 173.530 1.00 370.00 ? 1058 HIS A NE2 1 
ATOM 3560  N N   . GLN A 1  1059 ? 214.795 191.935 177.345 1.00 370.00 ? 1059 GLN A N   1 
ATOM 3561  C CA  . GLN A 1  1059 ? 214.869 190.526 177.714 1.00 370.00 ? 1059 GLN A CA  1 
ATOM 3562  C C   . GLN A 1  1059 ? 213.542 189.806 177.504 1.00 370.00 ? 1059 GLN A C   1 
ATOM 3563  O O   . GLN A 1  1059 ? 213.536 188.586 177.298 1.00 370.00 ? 1059 GLN A O   1 
ATOM 3564  C CB  . GLN A 1  1059 ? 215.324 190.384 179.167 1.00 370.00 ? 1059 GLN A CB  1 
ATOM 3565  C CG  . GLN A 1  1059 ? 216.765 190.811 179.406 1.00 370.00 ? 1059 GLN A CG  1 
ATOM 3566  C CD  . GLN A 1  1059 ? 217.186 190.654 180.853 1.00 370.00 ? 1059 GLN A CD  1 
ATOM 3567  O OE1 . GLN A 1  1059 ? 216.384 190.283 181.709 1.00 370.00 ? 1059 GLN A OE1 1 
ATOM 3568  N NE2 . GLN A 1  1059 ? 218.453 190.935 181.134 1.00 370.00 ? 1059 GLN A NE2 1 
ATOM 3569  N N   . GLU A 1  1060 ? 212.417 190.527 177.567 1.00 370.00 ? 1060 GLU A N   1 
ATOM 3570  C CA  . GLU A 1  1060 ? 211.124 189.905 177.292 1.00 370.00 ? 1060 GLU A CA  1 
ATOM 3571  C C   . GLU A 1  1060 ? 210.967 189.569 175.815 1.00 370.00 ? 1060 GLU A C   1 
ATOM 3572  O O   . GLU A 1  1060 ? 210.414 188.516 175.479 1.00 370.00 ? 1060 GLU A O   1 
ATOM 3573  C CB  . GLU A 1  1060 ? 209.987 190.822 177.747 1.00 370.00 ? 1060 GLU A CB  1 
ATOM 3574  C CG  . GLU A 1  1060 ? 208.594 190.222 177.616 1.00 370.00 ? 1060 GLU A CG  1 
ATOM 3575  C CD  . GLU A 1  1060 ? 207.507 191.155 178.113 1.00 370.00 ? 1060 GLU A CD  1 
ATOM 3576  O OE1 . GLU A 1  1060 ? 207.838 192.281 178.540 1.00 370.00 ? 1060 GLU A OE1 1 
ATOM 3577  O OE2 . GLU A 1  1060 ? 206.322 190.762 178.076 1.00 370.00 ? 1060 GLU A OE2 1 
ATOM 3578  N N   . ARG A 1  1061 ? 211.466 190.436 174.927 1.00 370.00 ? 1061 ARG A N   1 
ATOM 3579  C CA  . ARG A 1  1061 ? 211.407 190.166 173.492 1.00 370.00 ? 1061 ARG A CA  1 
ATOM 3580  C C   . ARG A 1  1061 ? 212.319 189.001 173.121 1.00 370.00 ? 1061 ARG A C   1 
ATOM 3581  O O   . ARG A 1  1061 ? 212.026 188.248 172.183 1.00 370.00 ? 1061 ARG A O   1 
ATOM 3582  C CB  . ARG A 1  1061 ? 211.780 191.427 172.708 1.00 370.00 ? 1061 ARG A CB  1 
ATOM 3583  C CG  . ARG A 1  1061 ? 211.623 191.305 171.194 1.00 370.00 ? 1061 ARG A CG  1 
ATOM 3584  C CD  . ARG A 1  1061 ? 211.956 192.599 170.471 1.00 370.00 ? 1061 ARG A CD  1 
ATOM 3585  N NE  . ARG A 1  1061 ? 210.969 193.646 170.717 1.00 370.00 ? 1061 ARG A NE  1 
ATOM 3586  C CZ  . ARG A 1  1061 ? 211.107 194.905 170.314 1.00 370.00 ? 1061 ARG A CZ  1 
ATOM 3587  N NH1 . ARG A 1  1061 ? 212.191 195.270 169.642 1.00 370.00 ? 1061 ARG A NH1 1 
ATOM 3588  N NH2 . ARG A 1  1061 ? 210.162 195.797 170.577 1.00 370.00 ? 1061 ARG A NH2 1 
ATOM 3589  N N   . TYR A 1  1062 ? 213.428 188.845 173.848 1.00 370.00 ? 1062 TYR A N   1 
ATOM 3590  C CA  . TYR A 1  1062 ? 214.268 187.661 173.702 1.00 370.00 ? 1062 TYR A CA  1 
ATOM 3591  C C   . TYR A 1  1062 ? 213.513 186.399 174.101 1.00 370.00 ? 1062 TYR A C   1 
ATOM 3592  O O   . TYR A 1  1062 ? 213.591 185.374 173.415 1.00 370.00 ? 1062 TYR A O   1 
ATOM 3593  C CB  . TYR A 1  1062 ? 215.539 187.811 174.540 1.00 370.00 ? 1062 TYR A CB  1 
ATOM 3594  C CG  . TYR A 1  1062 ? 216.458 186.613 174.466 1.00 370.00 ? 1062 TYR A CG  1 
ATOM 3595  C CD1 . TYR A 1  1062 ? 217.215 186.364 173.328 1.00 370.00 ? 1062 TYR A CD1 1 
ATOM 3596  C CD2 . TYR A 1  1062 ? 216.572 185.730 175.537 1.00 370.00 ? 1062 TYR A CD2 1 
ATOM 3597  C CE1 . TYR A 1  1062 ? 218.056 185.269 173.254 1.00 370.00 ? 1062 TYR A CE1 1 
ATOM 3598  C CE2 . TYR A 1  1062 ? 217.414 184.632 175.472 1.00 370.00 ? 1062 TYR A CE2 1 
ATOM 3599  C CZ  . TYR A 1  1062 ? 218.151 184.408 174.329 1.00 370.00 ? 1062 TYR A CZ  1 
ATOM 3600  O OH  . TYR A 1  1062 ? 218.989 183.318 174.260 1.00 370.00 ? 1062 TYR A OH  1 
ATOM 3601  N N   . LYS A 1  1063 ? 212.781 186.457 175.218 1.00 370.00 ? 1063 LYS A N   1 
ATOM 3602  C CA  . LYS A 1  1063 ? 212.009 185.304 175.673 1.00 370.00 ? 1063 LYS A CA  1 
ATOM 3603  C C   . LYS A 1  1063 ? 210.853 185.000 174.725 1.00 370.00 ? 1063 LYS A C   1 
ATOM 3604  O O   . LYS A 1  1063 ? 210.533 183.830 174.486 1.00 370.00 ? 1063 LYS A O   1 
ATOM 3605  C CB  . LYS A 1  1063 ? 211.499 185.549 177.094 1.00 370.00 ? 1063 LYS A CB  1 
ATOM 3606  C CG  . LYS A 1  1063 ? 210.742 184.379 177.706 1.00 370.00 ? 1063 LYS A CG  1 
ATOM 3607  C CD  . LYS A 1  1063 ? 211.671 183.203 177.961 1.00 370.00 ? 1063 LYS A CD  1 
ATOM 3608  C CE  . LYS A 1  1063 ? 210.948 182.074 178.677 1.00 370.00 ? 1063 LYS A CE  1 
ATOM 3609  N NZ  . LYS A 1  1063 ? 209.900 181.465 177.813 1.00 370.00 ? 1063 LYS A NZ  1 
ATOM 3610  N N   . GLU A 1  1064 ? 210.213 186.042 174.183 1.00 370.00 ? 1064 GLU A N   1 
ATOM 3611  C CA  . GLU A 1  1064 ? 209.123 185.853 173.225 1.00 370.00 ? 1064 GLU A CA  1 
ATOM 3612  C C   . GLU A 1  1064 ? 209.614 185.211 171.933 1.00 370.00 ? 1064 GLU A C   1 
ATOM 3613  O O   . GLU A 1  1064 ? 208.941 184.342 171.364 1.00 370.00 ? 1064 GLU A O   1 
ATOM 3614  C CB  . GLU A 1  1064 ? 208.438 187.189 172.928 1.00 370.00 ? 1064 GLU A CB  1 
ATOM 3615  C CG  . GLU A 1  1064 ? 207.573 187.724 174.056 1.00 370.00 ? 1064 GLU A CG  1 
ATOM 3616  C CD  . GLU A 1  1064 ? 206.957 189.070 173.729 1.00 370.00 ? 1064 GLU A CD  1 
ATOM 3617  O OE1 . GLU A 1  1064 ? 207.308 189.644 172.677 1.00 370.00 ? 1064 GLU A OE1 1 
ATOM 3618  O OE2 . GLU A 1  1064 ? 206.119 189.553 174.520 1.00 370.00 ? 1064 GLU A OE2 1 
ATOM 3619  N N   . GLU A 1  1065 ? 210.772 185.651 171.435 1.00 370.00 ? 1065 GLU A N   1 
ATOM 3620  C CA  . GLU A 1  1065 ? 211.322 185.079 170.209 1.00 370.00 ? 1065 GLU A CA  1 
ATOM 3621  C C   . GLU A 1  1065 ? 211.799 183.649 170.437 1.00 370.00 ? 1065 GLU A C   1 
ATOM 3622  O O   . GLU A 1  1065 ? 211.658 182.788 169.557 1.00 370.00 ? 1065 GLU A O   1 
ATOM 3623  C CB  . GLU A 1  1065 ? 212.458 185.958 169.682 1.00 370.00 ? 1065 GLU A CB  1 
ATOM 3624  C CG  . GLU A 1  1065 ? 213.008 185.526 168.329 1.00 370.00 ? 1065 GLU A CG  1 
ATOM 3625  C CD  . GLU A 1  1065 ? 212.013 185.715 167.197 1.00 370.00 ? 1065 GLU A CD  1 
ATOM 3626  O OE1 . GLU A 1  1065 ? 211.164 186.629 167.283 1.00 370.00 ? 1065 GLU A OE1 1 
ATOM 3627  O OE2 . GLU A 1  1065 ? 212.079 184.945 166.216 1.00 370.00 ? 1065 GLU A OE2 1 
ATOM 3628  N N   . CYS A 1  1066 ? 212.394 183.385 171.607 1.00 370.00 ? 1066 CYS A N   1 
ATOM 3629  C CA  . CYS A 1  1066 ? 212.773 182.022 171.975 1.00 370.00 ? 1066 CYS A CA  1 
ATOM 3630  C C   . CYS A 1  1066 ? 211.558 181.106 172.080 1.00 370.00 ? 1066 CYS A C   1 
ATOM 3631  O O   . CYS A 1  1066 ? 211.580 179.977 171.580 1.00 370.00 ? 1066 CYS A O   1 
ATOM 3632  C CB  . CYS A 1  1066 ? 213.556 182.021 173.291 1.00 370.00 ? 1066 CYS A CB  1 
ATOM 3633  S SG  . CYS A 1  1066 ? 215.258 182.631 173.178 1.00 370.00 ? 1066 CYS A SG  1 
ATOM 3634  N N   . GLN A 1  1067 ? 210.489 181.582 172.728 1.00 370.00 ? 1067 GLN A N   1 
ATOM 3635  C CA  . GLN A 1  1067 ? 209.304 180.757 172.969 1.00 370.00 ? 1067 GLN A CA  1 
ATOM 3636  C C   . GLN A 1  1067 ? 208.574 180.417 171.672 1.00 370.00 ? 1067 GLN A C   1 
ATOM 3637  O O   . GLN A 1  1067 ? 208.021 179.319 171.530 1.00 370.00 ? 1067 GLN A O   1 
ATOM 3638  C CB  . GLN A 1  1067 ? 208.363 181.470 173.945 1.00 370.00 ? 1067 GLN A CB  1 
ATOM 3639  C CG  . GLN A 1  1067 ? 207.149 180.663 174.384 1.00 370.00 ? 1067 GLN A CG  1 
ATOM 3640  C CD  . GLN A 1  1067 ? 207.521 179.460 175.229 1.00 370.00 ? 1067 GLN A CD  1 
ATOM 3641  O OE1 . GLN A 1  1067 ? 208.396 179.538 176.092 1.00 370.00 ? 1067 GLN A OE1 1 
ATOM 3642  N NE2 . GLN A 1  1067 ? 206.857 178.336 174.982 1.00 370.00 ? 1067 GLN A NE2 1 
ATOM 3643  N N   . ARG A 1  1068 ? 208.540 181.363 170.726 1.00 370.00 ? 1068 ARG A N   1 
ATOM 3644  C CA  . ARG A 1  1068 ? 207.794 181.171 169.482 1.00 370.00 ? 1068 ARG A CA  1 
ATOM 3645  C C   . ARG A 1  1068 ? 208.394 180.058 168.629 1.00 370.00 ? 1068 ARG A C   1 
ATOM 3646  O O   . ARG A 1  1068 ? 207.674 179.181 168.137 1.00 370.00 ? 1068 ARG A O   1 
ATOM 3647  C CB  . ARG A 1  1068 ? 207.754 182.477 168.688 1.00 370.00 ? 1068 ARG A CB  1 
ATOM 3648  C CG  . ARG A 1  1068 ? 206.976 182.372 167.383 1.00 370.00 ? 1068 ARG A CG  1 
ATOM 3649  C CD  . ARG A 1  1068 ? 207.003 183.678 166.601 1.00 370.00 ? 1068 ARG A CD  1 
ATOM 3650  N NE  . ARG A 1  1068 ? 208.355 184.033 166.177 1.00 370.00 ? 1068 ARG A NE  1 
ATOM 3651  C CZ  . ARG A 1  1068 ? 208.936 183.586 165.068 1.00 370.00 ? 1068 ARG A CZ  1 
ATOM 3652  N NH1 . ARG A 1  1068 ? 208.281 182.772 164.252 1.00 370.00 ? 1068 ARG A NH1 1 
ATOM 3653  N NH2 . ARG A 1  1068 ? 210.172 183.963 164.769 1.00 370.00 ? 1068 ARG A NH2 1 
ATOM 3654  N N   . ILE A 1  1069 ? 209.713 180.083 168.443 1.00 370.00 ? 1069 ILE A N   1 
ATOM 3655  C CA  . ILE A 1  1069 ? 210.363 179.102 167.581 1.00 370.00 ? 1069 ILE A CA  1 
ATOM 3656  C C   . ILE A 1  1069 ? 210.437 177.746 168.278 1.00 370.00 ? 1069 ILE A C   1 
ATOM 3657  O O   . ILE A 1  1069 ? 210.330 176.695 167.630 1.00 370.00 ? 1069 ILE A O   1 
ATOM 3658  C CB  . ILE A 1  1069 ? 211.747 179.625 167.154 1.00 370.00 ? 1069 ILE A CB  1 
ATOM 3659  C CG1 . ILE A 1  1069 ? 211.600 180.979 166.458 1.00 370.00 ? 1069 ILE A CG1 1 
ATOM 3660  C CG2 . ILE A 1  1069 ? 212.446 178.661 166.202 1.00 370.00 ? 1069 ILE A CG2 1 
ATOM 3661  C CD1 . ILE A 1  1069 ? 212.913 181.666 166.189 1.00 370.00 ? 1069 ILE A CD1 1 
ATOM 3662  N N   . PHE A 1  1070 ? 210.614 177.751 169.606 1.00 370.00 ? 1070 PHE A N   1 
ATOM 3663  C CA  . PHE A 1  1070 ? 210.578 176.523 170.403 1.00 370.00 ? 1070 PHE A CA  1 
ATOM 3664  C C   . PHE A 1  1070 ? 209.234 175.817 170.285 1.00 370.00 ? 1070 PHE A C   1 
ATOM 3665  O O   . PHE A 1  1070 ? 209.174 174.595 170.116 1.00 370.00 ? 1070 PHE A O   1 
ATOM 3666  C CB  . PHE A 1  1070 ? 210.883 176.844 171.869 1.00 370.00 ? 1070 PHE A CB  1 
ATOM 3667  C CG  . PHE A 1  1070 ? 210.821 175.655 172.788 1.00 370.00 ? 1070 PHE A CG  1 
ATOM 3668  C CD1 . PHE A 1  1070 ? 211.826 174.699 172.778 1.00 370.00 ? 1070 PHE A CD1 1 
ATOM 3669  C CD2 . PHE A 1  1070 ? 209.769 175.512 173.686 1.00 370.00 ? 1070 PHE A CD2 1 
ATOM 3670  C CE1 . PHE A 1  1070 ? 211.773 173.610 173.633 1.00 370.00 ? 1070 PHE A CE1 1 
ATOM 3671  C CE2 . PHE A 1  1070 ? 209.713 174.426 174.543 1.00 370.00 ? 1070 PHE A CE2 1 
ATOM 3672  C CZ  . PHE A 1  1070 ? 210.716 173.475 174.516 1.00 370.00 ? 1070 PHE A CZ  1 
ATOM 3673  N N   . ASP A 1  1071 ? 208.142 176.579 170.372 1.00 370.00 ? 1071 ASP A N   1 
ATOM 3674  C CA  . ASP A 1  1071 ? 206.815 175.997 170.195 1.00 370.00 ? 1071 ASP A CA  1 
ATOM 3675  C C   . ASP A 1  1071 ? 206.576 175.590 168.747 1.00 370.00 ? 1071 ASP A C   1 
ATOM 3676  O O   . ASP A 1  1071 ? 205.860 174.618 168.482 1.00 370.00 ? 1071 ASP A O   1 
ATOM 3677  C CB  . ASP A 1  1071 ? 205.741 176.981 170.656 1.00 370.00 ? 1071 ASP A CB  1 
ATOM 3678  C CG  . ASP A 1  1071 ? 205.719 177.154 172.157 1.00 370.00 ? 1071 ASP A CG  1 
ATOM 3679  O OD1 . ASP A 1  1071 ? 206.091 176.197 172.870 1.00 370.00 ? 1071 ASP A OD1 1 
ATOM 3680  O OD2 . ASP A 1  1071 ? 205.326 178.243 172.626 1.00 370.00 ? 1071 ASP A OD2 1 
ATOM 3681  N N   . LEU A 1  1072 ? 207.142 176.341 167.801 1.00 370.00 ? 1072 LEU A N   1 
ATOM 3682  C CA  . LEU A 1  1072 ? 207.004 175.990 166.391 1.00 370.00 ? 1072 LEU A CA  1 
ATOM 3683  C C   . LEU A 1  1072 ? 207.792 174.721 166.071 1.00 370.00 ? 1072 LEU A C   1 
ATOM 3684  O O   . LEU A 1  1072 ? 207.334 173.874 165.294 1.00 370.00 ? 1072 LEU A O   1 
ATOM 3685  C CB  . LEU A 1  1072 ? 207.447 177.168 165.515 1.00 370.00 ? 1072 LEU A CB  1 
ATOM 3686  C CG  . LEU A 1  1072 ? 206.994 177.241 164.049 1.00 370.00 ? 1072 LEU A CG  1 
ATOM 3687  C CD1 . LEU A 1  1072 ? 206.893 178.696 163.618 1.00 370.00 ? 1072 LEU A CD1 1 
ATOM 3688  C CD2 . LEU A 1  1072 ? 207.917 176.496 163.105 1.00 370.00 ? 1072 LEU A CD2 1 
ATOM 3689  N N   . GLN A 1  1073 ? 208.998 174.595 166.636 1.00 370.00 ? 1073 GLN A N   1 
ATOM 3690  C CA  . GLN A 1  1073 ? 209.811 173.393 166.443 1.00 370.00 ? 1073 GLN A CA  1 
ATOM 3691  C C   . GLN A 1  1073 ? 209.151 172.169 167.072 1.00 370.00 ? 1073 GLN A C   1 
ATOM 3692  O O   . GLN A 1  1073 ? 209.264 171.053 166.548 1.00 370.00 ? 1073 GLN A O   1 
ATOM 3693  C CB  . GLN A 1  1073 ? 211.217 173.610 167.012 1.00 370.00 ? 1073 GLN A CB  1 
ATOM 3694  C CG  . GLN A 1  1073 ? 212.191 172.471 166.732 1.00 370.00 ? 1073 GLN A CG  1 
ATOM 3695  C CD  . GLN A 1  1073 ? 213.595 172.759 167.223 1.00 370.00 ? 1073 GLN A CD  1 
ATOM 3696  O OE1 . GLN A 1  1073 ? 213.861 173.810 167.804 1.00 370.00 ? 1073 GLN A OE1 1 
ATOM 3697  N NE2 . GLN A 1  1073 ? 214.504 171.820 166.992 1.00 370.00 ? 1073 GLN A NE2 1 
ATOM 3698  N N   . ASN A 1  1074 ? 208.489 172.354 168.221 1.00 370.00 ? 1074 ASN A N   1 
ATOM 3699  C CA  . ASN A 1  1074 ? 207.732 171.266 168.844 1.00 370.00 ? 1074 ASN A CA  1 
ATOM 3700  C C   . ASN A 1  1074 ? 206.587 170.797 167.953 1.00 370.00 ? 1074 ASN A C   1 
ATOM 3701  O O   . ASN A 1  1074 ? 206.263 169.603 167.921 1.00 370.00 ? 1074 ASN A O   1 
ATOM 3702  C CB  . ASN A 1  1074 ? 207.181 171.703 170.204 1.00 370.00 ? 1074 ASN A CB  1 
ATOM 3703  C CG  . ASN A 1  1074 ? 208.258 171.872 171.259 1.00 370.00 ? 1074 ASN A CG  1 
ATOM 3704  O OD1 . ASN A 1  1074 ? 209.183 171.070 171.365 1.00 370.00 ? 1074 ASN A OD1 1 
ATOM 3705  N ND2 . ASN A 1  1074 ? 208.135 172.926 172.053 1.00 370.00 ? 1074 ASN A ND2 1 
ATOM 3706  N N   . LYS A 1  1075 ? 205.955 171.723 167.231 1.00 370.00 ? 1075 LYS A N   1 
ATOM 3707  C CA  . LYS A 1  1075 ? 204.777 171.375 166.442 1.00 370.00 ? 1075 LYS A CA  1 
ATOM 3708  C C   . LYS A 1  1075 ? 205.157 170.661 165.148 1.00 370.00 ? 1075 LYS A C   1 
ATOM 3709  O O   . LYS A 1  1075 ? 204.486 169.703 164.746 1.00 370.00 ? 1075 LYS A O   1 
ATOM 3710  C CB  . LYS A 1  1075 ? 203.965 172.635 166.147 1.00 370.00 ? 1075 LYS A CB  1 
ATOM 3711  C CG  . LYS A 1  1075 ? 202.622 172.380 165.489 1.00 370.00 ? 1075 LYS A CG  1 
ATOM 3712  C CD  . LYS A 1  1075 ? 201.837 173.672 165.356 1.00 370.00 ? 1075 LYS A CD  1 
ATOM 3713  C CE  . LYS A 1  1075 ? 200.474 173.433 164.734 1.00 370.00 ? 1075 LYS A CE  1 
ATOM 3714  N NZ  . LYS A 1  1075 ? 199.684 174.691 164.630 1.00 370.00 ? 1075 LYS A NZ  1 
ATOM 3715  N N   . VAL A 1  1076 ? 206.219 171.117 164.479 1.00 370.00 ? 1076 VAL A N   1 
ATOM 3716  C CA  . VAL A 1  1076 ? 206.554 170.591 163.158 1.00 370.00 ? 1076 VAL A CA  1 
ATOM 3717  C C   . VAL A 1  1076 ? 207.169 169.197 163.258 1.00 370.00 ? 1076 VAL A C   1 
ATOM 3718  O O   . VAL A 1  1076 ? 206.744 168.267 162.561 1.00 370.00 ? 1076 VAL A O   1 
ATOM 3719  C CB  . VAL A 1  1076 ? 207.483 171.572 162.419 1.00 370.00 ? 1076 VAL A CB  1 
ATOM 3720  C CG1 . VAL A 1  1076 ? 207.972 170.970 161.111 1.00 370.00 ? 1076 VAL A CG1 1 
ATOM 3721  C CG2 . VAL A 1  1076 ? 206.763 172.888 162.158 1.00 370.00 ? 1076 VAL A CG2 1 
ATOM 3722  N N   . LEU A 1  1077 ? 208.153 169.019 164.143 1.00 370.00 ? 1077 LEU A N   1 
ATOM 3723  C CA  . LEU A 1  1077 ? 208.898 167.765 164.201 1.00 370.00 ? 1077 LEU A CA  1 
ATOM 3724  C C   . LEU A 1  1077 ? 208.125 166.636 164.871 1.00 370.00 ? 1077 LEU A C   1 
ATOM 3725  O O   . LEU A 1  1077 ? 208.524 165.473 164.745 1.00 370.00 ? 1077 LEU A O   1 
ATOM 3726  C CB  . LEU A 1  1077 ? 210.231 167.974 164.924 1.00 370.00 ? 1077 LEU A CB  1 
ATOM 3727  C CG  . LEU A 1  1077 ? 211.311 168.804 164.229 1.00 370.00 ? 1077 LEU A CG  1 
ATOM 3728  C CD1 . LEU A 1  1077 ? 212.515 168.997 165.145 1.00 370.00 ? 1077 LEU A CD1 1 
ATOM 3729  C CD2 . LEU A 1  1077 ? 211.718 168.135 162.926 1.00 370.00 ? 1077 LEU A CD2 1 
ATOM 3730  N N   . SER A 1  1078 ? 207.050 166.946 165.592 1.00 370.00 ? 1078 SER A N   1 
ATOM 3731  C CA  . SER A 1  1078 ? 206.186 165.924 166.169 1.00 370.00 ? 1078 SER A CA  1 
ATOM 3732  C C   . SER A 1  1078 ? 204.966 165.621 165.309 1.00 370.00 ? 1078 SER A C   1 
ATOM 3733  O O   . SER A 1  1078 ? 204.242 164.664 165.607 1.00 370.00 ? 1078 SER A O   1 
ATOM 3734  C CB  . SER A 1  1078 ? 205.730 166.347 167.570 1.00 370.00 ? 1078 SER A CB  1 
ATOM 3735  O OG  . SER A 1  1078 ? 204.903 167.496 167.511 1.00 370.00 ? 1078 SER A OG  1 
ATOM 3736  N N   . SER A 1  1079 ? 204.717 166.412 164.269 1.00 370.00 ? 1079 SER A N   1 
ATOM 3737  C CA  . SER A 1  1079 ? 203.533 166.226 163.442 1.00 370.00 ? 1079 SER A CA  1 
ATOM 3738  C C   . SER A 1  1079 ? 203.677 165.008 162.538 1.00 370.00 ? 1079 SER A C   1 
ATOM 3739  O O   . SER A 1  1079 ? 204.739 164.761 161.961 1.00 370.00 ? 1079 SER A O   1 
ATOM 3740  C CB  . SER A 1  1079 ? 203.275 167.471 162.594 1.00 370.00 ? 1079 SER A CB  1 
ATOM 3741  O OG  . SER A 1  1079 ? 202.143 167.293 161.760 1.00 370.00 ? 1079 SER A OG  1 
ATOM 3742  N N   . THR A 1  1080 ? 202.593 164.247 162.413 1.00 370.00 ? 1080 THR A N   1 
ATOM 3743  C CA  . THR A 1  1080 ? 202.537 163.091 161.529 1.00 370.00 ? 1080 THR A CA  1 
ATOM 3744  C C   . THR A 1  1080 ? 201.934 163.426 160.170 1.00 370.00 ? 1080 THR A C   1 
ATOM 3745  O O   . THR A 1  1080 ? 201.469 162.519 159.471 1.00 370.00 ? 1080 THR A O   1 
ATOM 3746  C CB  . THR A 1  1080 ? 201.748 161.959 162.190 1.00 370.00 ? 1080 THR A CB  1 
ATOM 3747  O OG1 . THR A 1  1080 ? 200.412 162.400 162.463 1.00 370.00 ? 1080 THR A OG1 1 
ATOM 3748  C CG2 . THR A 1  1080 ? 202.414 161.532 163.492 1.00 370.00 ? 1080 THR A CG2 1 
ATOM 3749  N N   . GLU A 1  1081 ? 201.898 164.710 159.805 1.00 370.00 ? 1081 GLU A N   1 
ATOM 3750  C CA  . GLU A 1  1081 ? 201.371 165.140 158.514 1.00 370.00 ? 1081 GLU A CA  1 
ATOM 3751  C C   . GLU A 1  1081 ? 202.220 164.613 157.362 1.00 370.00 ? 1081 GLU A C   1 
ATOM 3752  O O   . GLU A 1  1081 ? 203.453 164.647 157.410 1.00 370.00 ? 1081 GLU A O   1 
ATOM 3753  C CB  . GLU A 1  1081 ? 201.309 166.670 158.467 1.00 370.00 ? 1081 GLU A CB  1 
ATOM 3754  C CG  . GLU A 1  1081 ? 200.686 167.250 157.207 1.00 370.00 ? 1081 GLU A CG  1 
ATOM 3755  C CD  . GLU A 1  1081 ? 200.627 168.764 157.237 1.00 370.00 ? 1081 GLU A CD  1 
ATOM 3756  O OE1 . GLU A 1  1081 ? 201.095 169.356 158.232 1.00 370.00 ? 1081 GLU A OE1 1 
ATOM 3757  O OE2 . GLU A 1  1081 ? 200.111 169.363 156.270 1.00 370.00 ? 1081 GLU A OE2 1 
ATOM 3758  N N   . VAL A 1  1082 ? 201.548 164.126 156.322 1.00 370.00 ? 1082 VAL A N   1 
ATOM 3759  C CA  . VAL A 1  1082 ? 202.211 163.591 155.139 1.00 370.00 ? 1082 VAL A CA  1 
ATOM 3760  C C   . VAL A 1  1082 ? 202.354 164.712 154.119 1.00 370.00 ? 1082 VAL A C   1 
ATOM 3761  O O   . VAL A 1  1082 ? 201.355 165.223 153.601 1.00 370.00 ? 1082 VAL A O   1 
ATOM 3762  C CB  . VAL A 1  1082 ? 201.427 162.410 154.547 1.00 370.00 ? 1082 VAL A CB  1 
ATOM 3763  C CG1 . VAL A 1  1082 ? 202.141 161.855 153.321 1.00 370.00 ? 1082 VAL A CG1 1 
ATOM 3764  C CG2 . VAL A 1  1082 ? 201.207 161.332 155.596 1.00 370.00 ? 1082 VAL A CG2 1 
ATOM 3765  N N   . LEU A 1  1083 ? 203.594 165.093 153.826 1.00 370.00 ? 1083 LEU A N   1 
ATOM 3766  C CA  . LEU A 1  1083 ? 203.861 166.152 152.859 1.00 370.00 ? 1083 LEU A CA  1 
ATOM 3767  C C   . LEU A 1  1083 ? 204.324 165.581 151.523 1.00 370.00 ? 1083 LEU A C   1 
ATOM 3768  O O   . LEU A 1  1083 ? 204.688 164.409 151.432 1.00 370.00 ? 1083 LEU A O   1 
ATOM 3769  C CB  . LEU A 1  1083 ? 204.906 167.125 153.405 1.00 370.00 ? 1083 LEU A CB  1 
ATOM 3770  C CG  . LEU A 1  1083 ? 204.483 167.980 154.600 1.00 370.00 ? 1083 LEU A CG  1 
ATOM 3771  C CD1 . LEU A 1  1083 ? 205.674 168.756 155.135 1.00 370.00 ? 1083 LEU A CD1 1 
ATOM 3772  C CD2 . LEU A 1  1083 ? 203.356 168.925 154.206 1.00 370.00 ? 1083 LEU A CD2 1 
ATOM 3773  N N   . PHE B 2  20   ? 232.589 137.928 208.981 1.00 370.00 ? 20   PHE B N   1 
ATOM 3774  C CA  . PHE B 2  20   ? 231.545 137.838 207.965 1.00 370.00 ? 20   PHE B CA  1 
ATOM 3775  C C   . PHE B 2  20   ? 230.180 137.831 208.621 1.00 370.00 ? 20   PHE B C   1 
ATOM 3776  O O   . PHE B 2  20   ? 229.344 138.697 208.378 1.00 370.00 ? 20   PHE B O   1 
ATOM 3777  C CB  . PHE B 2  20   ? 231.708 136.573 207.118 1.00 370.00 ? 20   PHE B CB  1 
ATOM 3778  C CG  . PHE B 2  20   ? 232.899 136.591 206.208 1.00 370.00 ? 20   PHE B CG  1 
ATOM 3779  C CD1 . PHE B 2  20   ? 233.541 137.779 205.896 1.00 370.00 ? 20   PHE B CD1 1 
ATOM 3780  C CD2 . PHE B 2  20   ? 233.378 135.412 205.666 1.00 370.00 ? 20   PHE B CD2 1 
ATOM 3781  C CE1 . PHE B 2  20   ? 234.638 137.791 205.062 1.00 370.00 ? 20   PHE B CE1 1 
ATOM 3782  C CE2 . PHE B 2  20   ? 234.475 135.417 204.829 1.00 370.00 ? 20   PHE B CE2 1 
ATOM 3783  C CZ  . PHE B 2  20   ? 235.106 136.609 204.527 1.00 370.00 ? 20   PHE B CZ  1 
ATOM 3784  N N   . GLU B 2  21   ? 229.964 136.823 209.449 1.00 370.00 ? 21   GLU B N   1 
ATOM 3785  C CA  . GLU B 2  21   ? 228.693 136.643 210.118 1.00 370.00 ? 21   GLU B CA  1 
ATOM 3786  C C   . GLU B 2  21   ? 228.770 137.161 211.543 1.00 370.00 ? 21   GLU B C   1 
ATOM 3787  O O   . GLU B 2  21   ? 229.843 137.444 212.078 1.00 370.00 ? 21   GLU B O   1 
ATOM 3788  C CB  . GLU B 2  21   ? 228.302 135.172 210.111 1.00 370.00 ? 21   GLU B CB  1 
ATOM 3789  C CG  . GLU B 2  21   ? 228.051 134.631 208.729 1.00 370.00 ? 21   GLU B CG  1 
ATOM 3790  C CD  . GLU B 2  21   ? 227.744 133.157 208.746 1.00 370.00 ? 21   GLU B CD  1 
ATOM 3791  O OE1 . GLU B 2  21   ? 227.859 132.543 209.826 1.00 370.00 ? 21   GLU B OE1 1 
ATOM 3792  O OE2 . GLU B 2  21   ? 227.388 132.609 207.684 1.00 370.00 ? 21   GLU B OE2 1 
ATOM 3793  N N   . SER B 2  22   ? 227.622 137.280 212.152 1.00 370.00 ? 22   SER B N   1 
ATOM 3794  C CA  . SER B 2  22   ? 227.587 137.644 213.551 1.00 370.00 ? 22   SER B CA  1 
ATOM 3795  C C   . SER B 2  22   ? 227.995 136.445 214.393 1.00 370.00 ? 22   SER B C   1 
ATOM 3796  O O   . SER B 2  22   ? 227.595 135.319 214.089 1.00 370.00 ? 22   SER B O   1 
ATOM 3797  C CB  . SER B 2  22   ? 226.195 138.100 213.956 1.00 370.00 ? 22   SER B CB  1 
ATOM 3798  O OG  . SER B 2  22   ? 225.288 137.015 213.933 1.00 370.00 ? 22   SER B OG  1 
ATOM 3799  N N   . PRO B 2  23   ? 228.789 136.642 215.438 1.00 370.00 ? 23   PRO B N   1 
ATOM 3800  C CA  . PRO B 2  23   ? 228.921 135.638 216.509 1.00 370.00 ? 23   PRO B CA  1 
ATOM 3801  C C   . PRO B 2  23   ? 227.827 135.788 217.560 1.00 370.00 ? 23   PRO B C   1 
ATOM 3802  O O   . PRO B 2  23   ? 228.070 135.789 218.768 1.00 370.00 ? 23   PRO B O   1 
ATOM 3803  C CB  . PRO B 2  23   ? 230.315 135.941 217.068 1.00 370.00 ? 23   PRO B CB  1 
ATOM 3804  C CG  . PRO B 2  23   ? 230.488 137.385 216.840 1.00 370.00 ? 23   PRO B CG  1 
ATOM 3805  C CD  . PRO B 2  23   ? 229.806 137.697 215.542 1.00 370.00 ? 23   PRO B CD  1 
ATOM 3806  N N   . ARG B 2  24   ? 226.604 135.933 217.089 1.00 370.00 ? 24   ARG B N   1 
ATOM 3807  C CA  . ARG B 2  24   ? 225.448 136.185 217.920 1.00 370.00 ? 24   ARG B CA  1 
ATOM 3808  C C   . ARG B 2  24   ? 224.333 135.244 217.509 1.00 370.00 ? 24   ARG B C   1 
ATOM 3809  O O   . ARG B 2  24   ? 223.900 135.262 216.352 1.00 370.00 ? 24   ARG B O   1 
ATOM 3810  C CB  . ARG B 2  24   ? 224.999 137.635 217.794 1.00 370.00 ? 24   ARG B CB  1 
ATOM 3811  C CG  . ARG B 2  24   ? 225.997 138.616 218.348 1.00 370.00 ? 24   ARG B CG  1 
ATOM 3812  C CD  . ARG B 2  24   ? 226.172 138.341 219.820 1.00 370.00 ? 24   ARG B CD  1 
ATOM 3813  N NE  . ARG B 2  24   ? 224.873 138.329 220.479 1.00 370.00 ? 24   ARG B NE  1 
ATOM 3814  C CZ  . ARG B 2  24   ? 224.255 139.404 220.953 1.00 370.00 ? 24   ARG B CZ  1 
ATOM 3815  N NH1 . ARG B 2  24   ? 224.828 140.597 220.885 1.00 370.00 ? 24   ARG B NH1 1 
ATOM 3816  N NH2 . ARG B 2  24   ? 223.068 139.274 221.524 1.00 370.00 ? 24   ARG B NH2 1 
ATOM 3817  N N   . PRO B 2  25   ? 223.849 134.418 218.414 1.00 370.00 ? 25   PRO B N   1 
ATOM 3818  C CA  . PRO B 2  25   ? 222.855 133.411 218.035 1.00 370.00 ? 25   PRO B CA  1 
ATOM 3819  C C   . PRO B 2  25   ? 221.471 134.008 217.881 1.00 370.00 ? 25   PRO B C   1 
ATOM 3820  O O   . PRO B 2  25   ? 221.305 135.225 218.002 1.00 370.00 ? 25   PRO B O   1 
ATOM 3821  C CB  . PRO B 2  25   ? 222.899 132.421 219.205 1.00 370.00 ? 25   PRO B CB  1 
ATOM 3822  C CG  . PRO B 2  25   ? 224.162 132.736 219.941 1.00 370.00 ? 25   PRO B CG  1 
ATOM 3823  C CD  . PRO B 2  25   ? 224.347 134.201 219.778 1.00 370.00 ? 25   PRO B CD  1 
ATOM 3824  N N   . TYR B 2  26   ? 220.480 133.134 217.679 1.00 370.00 ? 26   TYR B N   1 
ATOM 3825  C CA  . TYR B 2  26   ? 219.039 133.418 217.730 1.00 370.00 ? 26   TYR B CA  1 
ATOM 3826  C C   . TYR B 2  26   ? 218.656 134.602 216.838 1.00 370.00 ? 26   TYR B C   1 
ATOM 3827  O O   . TYR B 2  26   ? 218.396 135.712 217.283 1.00 370.00 ? 26   TYR B O   1 
ATOM 3828  C CB  . TYR B 2  26   ? 218.517 133.551 219.173 1.00 370.00 ? 26   TYR B CB  1 
ATOM 3829  C CG  . TYR B 2  26   ? 219.226 134.473 220.138 1.00 370.00 ? 26   TYR B CG  1 
ATOM 3830  C CD1 . TYR B 2  26   ? 220.258 133.996 220.935 1.00 370.00 ? 26   TYR B CD1 1 
ATOM 3831  C CD2 . TYR B 2  26   ? 218.839 135.792 220.293 1.00 370.00 ? 26   TYR B CD2 1 
ATOM 3832  C CE1 . TYR B 2  26   ? 220.922 134.814 221.802 1.00 370.00 ? 26   TYR B CE1 1 
ATOM 3833  C CE2 . TYR B 2  26   ? 219.490 136.619 221.163 1.00 370.00 ? 26   TYR B CE2 1 
ATOM 3834  C CZ  . TYR B 2  26   ? 220.528 136.125 221.921 1.00 370.00 ? 26   TYR B CZ  1 
ATOM 3835  O OH  . TYR B 2  26   ? 221.180 136.949 222.803 1.00 370.00 ? 26   TYR B OH  1 
ATOM 3836  N N   . LYS B 2  27   ? 218.715 134.323 215.540 1.00 370.00 ? 27   LYS B N   1 
ATOM 3837  C CA  . LYS B 2  27   ? 218.278 135.252 214.510 1.00 370.00 ? 27   LYS B CA  1 
ATOM 3838  C C   . LYS B 2  27   ? 216.832 135.693 214.738 1.00 370.00 ? 27   LYS B C   1 
ATOM 3839  O O   . LYS B 2  27   ? 216.020 134.987 215.335 1.00 370.00 ? 27   LYS B O   1 
ATOM 3840  C CB  . LYS B 2  27   ? 218.412 134.602 213.140 1.00 370.00 ? 27   LYS B CB  1 
ATOM 3841  C CG  . LYS B 2  27   ? 219.843 134.248 212.776 1.00 370.00 ? 27   LYS B CG  1 
ATOM 3842  C CD  . LYS B 2  27   ? 219.917 133.557 211.416 1.00 370.00 ? 27   LYS B CD  1 
ATOM 3843  C CE  . LYS B 2  27   ? 221.349 133.172 211.047 1.00 370.00 ? 27   LYS B CE  1 
ATOM 3844  N NZ  . LYS B 2  27   ? 221.429 132.481 209.728 1.00 370.00 ? 27   LYS B NZ  1 
ATOM 3845  N N   . LEU B 2  28   ? 216.528 136.907 214.299 1.00 370.00 ? 28   LEU B N   1 
ATOM 3846  C CA  . LEU B 2  28   ? 215.294 137.575 214.680 1.00 370.00 ? 28   LEU B CA  1 
ATOM 3847  C C   . LEU B 2  28   ? 214.663 138.196 213.449 1.00 370.00 ? 28   LEU B C   1 
ATOM 3848  O O   . LEU B 2  28   ? 215.368 138.646 212.545 1.00 370.00 ? 28   LEU B O   1 
ATOM 3849  C CB  . LEU B 2  28   ? 215.566 138.663 215.700 1.00 370.00 ? 28   LEU B CB  1 
ATOM 3850  C CG  . LEU B 2  28   ? 216.308 138.257 216.967 1.00 370.00 ? 28   LEU B CG  1 
ATOM 3851  C CD1 . LEU B 2  28   ? 216.619 139.458 217.804 1.00 370.00 ? 28   LEU B CD1 1 
ATOM 3852  C CD2 . LEU B 2  28   ? 215.506 137.257 217.735 1.00 370.00 ? 28   LEU B CD2 1 
ATOM 3853  N N   . THR B 2  29   ? 213.329 138.217 213.398 1.00 370.00 ? 29   THR B N   1 
ATOM 3854  C CA  . THR B 2  29   ? 212.673 138.792 212.226 1.00 370.00 ? 29   THR B CA  1 
ATOM 3855  C C   . THR B 2  29   ? 211.822 140.009 212.554 1.00 370.00 ? 29   THR B C   1 
ATOM 3856  O O   . THR B 2  29   ? 212.008 141.061 211.940 1.00 370.00 ? 29   THR B O   1 
ATOM 3857  C CB  . THR B 2  29   ? 211.796 137.762 211.514 1.00 370.00 ? 29   THR B CB  1 
ATOM 3858  O OG1 . THR B 2  29   ? 210.668 137.466 212.333 1.00 370.00 ? 29   THR B OG1 1 
ATOM 3859  C CG2 . THR B 2  29   ? 212.562 136.487 211.250 1.00 370.00 ? 29   THR B CG2 1 
ATOM 3860  N N   . HIS B 2  30   ? 210.868 139.896 213.468 1.00 370.00 ? 30   HIS B N   1 
ATOM 3861  C CA  . HIS B 2  30   ? 209.839 140.915 213.580 1.00 370.00 ? 30   HIS B CA  1 
ATOM 3862  C C   . HIS B 2  30   ? 209.567 141.221 215.042 1.00 370.00 ? 30   HIS B C   1 
ATOM 3863  O O   . HIS B 2  30   ? 209.760 140.378 215.919 1.00 370.00 ? 30   HIS B O   1 
ATOM 3864  C CB  . HIS B 2  30   ? 208.546 140.473 212.885 1.00 370.00 ? 30   HIS B CB  1 
ATOM 3865  C CG  . HIS B 2  30   ? 207.483 141.525 212.859 1.00 370.00 ? 30   HIS B CG  1 
ATOM 3866  N ND1 . HIS B 2  30   ? 207.518 142.598 211.999 1.00 370.00 ? 30   HIS B ND1 1 
ATOM 3867  C CD2 . HIS B 2  30   ? 206.376 141.690 213.617 1.00 370.00 ? 30   HIS B CD2 1 
ATOM 3868  C CE1 . HIS B 2  30   ? 206.464 143.364 212.205 1.00 370.00 ? 30   HIS B CE1 1 
ATOM 3869  N NE2 . HIS B 2  30   ? 205.755 142.837 213.185 1.00 370.00 ? 30   HIS B NE2 1 
ATOM 3870  N N   . GLN B 2  31   ? 209.116 142.442 215.289 1.00 370.00 ? 31   GLN B N   1 
ATOM 3871  C CA  . GLN B 2  31   ? 208.788 142.872 216.633 1.00 370.00 ? 31   GLN B CA  1 
ATOM 3872  C C   . GLN B 2  31   ? 207.644 143.871 216.569 1.00 370.00 ? 31   GLN B C   1 
ATOM 3873  O O   . GLN B 2  31   ? 207.475 144.591 215.580 1.00 370.00 ? 31   GLN B O   1 
ATOM 3874  C CB  . GLN B 2  31   ? 210.014 143.474 217.307 1.00 370.00 ? 31   GLN B CB  1 
ATOM 3875  C CG  . GLN B 2  31   ? 209.893 143.819 218.768 1.00 370.00 ? 31   GLN B CG  1 
ATOM 3876  C CD  . GLN B 2  31   ? 211.132 144.521 219.249 1.00 370.00 ? 31   GLN B CD  1 
ATOM 3877  O OE1 . GLN B 2  31   ? 211.984 144.897 218.448 1.00 370.00 ? 31   GLN B OE1 1 
ATOM 3878  N NE2 . GLN B 2  31   ? 211.270 144.662 220.555 1.00 370.00 ? 31   GLN B NE2 1 
ATOM 3879  N N   . VAL B 2  32   ? 206.832 143.882 217.620 1.00 370.00 ? 32   VAL B N   1 
ATOM 3880  C CA  . VAL B 2  32   ? 205.664 144.742 217.707 1.00 370.00 ? 32   VAL B CA  1 
ATOM 3881  C C   . VAL B 2  32   ? 205.712 145.482 219.032 1.00 370.00 ? 32   VAL B C   1 
ATOM 3882  O O   . VAL B 2  32   ? 205.929 144.865 220.079 1.00 370.00 ? 32   VAL B O   1 
ATOM 3883  C CB  . VAL B 2  32   ? 204.362 143.927 217.589 1.00 370.00 ? 32   VAL B CB  1 
ATOM 3884  C CG1 . VAL B 2  32   ? 203.144 144.778 217.888 1.00 370.00 ? 32   VAL B CG1 1 
ATOM 3885  C CG2 . VAL B 2  32   ? 204.235 143.334 216.205 1.00 370.00 ? 32   VAL B CG2 1 
ATOM 3886  N N   . VAL B 2  33   ? 205.510 146.794 218.988 1.00 370.00 ? 33   VAL B N   1 
ATOM 3887  C CA  . VAL B 2  33   ? 205.324 147.554 220.212 1.00 370.00 ? 33   VAL B CA  1 
ATOM 3888  C C   . VAL B 2  33   ? 203.852 147.916 220.321 1.00 370.00 ? 33   VAL B C   1 
ATOM 3889  O O   . VAL B 2  33   ? 203.112 147.922 219.336 1.00 370.00 ? 33   VAL B O   1 
ATOM 3890  C CB  . VAL B 2  33   ? 206.207 148.820 220.278 1.00 370.00 ? 33   VAL B CB  1 
ATOM 3891  C CG1 . VAL B 2  33   ? 205.552 150.004 219.574 1.00 370.00 ? 33   VAL B CG1 1 
ATOM 3892  C CG2 . VAL B 2  33   ? 206.574 149.146 221.710 1.00 370.00 ? 33   VAL B CG2 1 
ATOM 3893  N N   . CYS B 2  34   ? 203.411 148.201 221.546 1.00 370.00 ? 34   CYS B N   1 
ATOM 3894  C CA  . CYS B 2  34   ? 202.084 148.775 221.777 1.00 370.00 ? 34   CYS B CA  1 
ATOM 3895  C C   . CYS B 2  34   ? 202.157 149.634 223.036 1.00 370.00 ? 34   CYS B C   1 
ATOM 3896  O O   . CYS B 2  34   ? 201.956 149.140 224.146 1.00 370.00 ? 34   CYS B O   1 
ATOM 3897  C CB  . CYS B 2  34   ? 201.018 147.703 221.917 1.00 370.00 ? 34   CYS B CB  1 
ATOM 3898  S SG  . CYS B 2  34   ? 199.394 148.379 222.320 1.00 370.00 ? 34   CYS B SG  1 
ATOM 3899  N N   . ILE B 2  35   ? 202.405 150.919 222.851 1.00 370.00 ? 35   ILE B N   1 
ATOM 3900  C CA  . ILE B 2  35   ? 202.341 151.834 223.980 1.00 370.00 ? 35   ILE B CA  1 
ATOM 3901  C C   . ILE B 2  35   ? 200.888 152.098 224.333 1.00 370.00 ? 35   ILE B C   1 
ATOM 3902  O O   . ILE B 2  35   ? 200.063 152.428 223.470 1.00 370.00 ? 35   ILE B O   1 
ATOM 3903  C CB  . ILE B 2  35   ? 203.102 153.136 223.698 1.00 370.00 ? 35   ILE B CB  1 
ATOM 3904  C CG1 . ILE B 2  35   ? 202.811 154.157 224.796 1.00 370.00 ? 35   ILE B CG1 1 
ATOM 3905  C CG2 . ILE B 2  35   ? 202.795 153.686 222.368 1.00 370.00 ? 35   ILE B CG2 1 
ATOM 3906  C CD1 . ILE B 2  35   ? 203.640 155.381 224.718 1.00 370.00 ? 35   ILE B CD1 1 
ATOM 3907  N N   . ASN B 2  36   ? 200.573 151.913 225.607 1.00 370.00 ? 36   ASN B N   1 
ATOM 3908  C CA  . ASN B 2  36   ? 199.261 152.186 226.142 1.00 370.00 ? 36   ASN B CA  1 
ATOM 3909  C C   . ASN B 2  36   ? 199.417 153.024 227.397 1.00 370.00 ? 36   ASN B C   1 
ATOM 3910  O O   . ASN B 2  36   ? 200.488 153.050 228.011 1.00 370.00 ? 36   ASN B O   1 
ATOM 3911  C CB  . ASN B 2  36   ? 198.533 150.882 226.431 1.00 370.00 ? 36   ASN B CB  1 
ATOM 3912  C CG  . ASN B 2  36   ? 198.299 150.082 225.178 1.00 370.00 ? 36   ASN B CG  1 
ATOM 3913  O OD1 . ASN B 2  36   ? 197.880 150.626 224.161 1.00 370.00 ? 36   ASN B OD1 1 
ATOM 3914  N ND2 . ASN B 2  36   ? 198.619 148.796 225.223 1.00 370.00 ? 36   ASN B ND2 1 
ATOM 3915  N N   . ASN B 2  37   ? 198.344 153.757 227.715 1.00 370.00 ? 37   ASN B N   1 
ATOM 3916  C CA  . ASN B 2  37   ? 198.135 154.405 229.014 1.00 370.00 ? 37   ASN B CA  1 
ATOM 3917  C C   . ASN B 2  37   ? 199.255 155.381 229.362 1.00 370.00 ? 37   ASN B C   1 
ATOM 3918  O O   . ASN B 2  37   ? 199.723 155.436 230.499 1.00 370.00 ? 37   ASN B O   1 
ATOM 3919  C CB  . ASN B 2  37   ? 197.960 153.363 230.118 1.00 370.00 ? 37   ASN B CB  1 
ATOM 3920  C CG  . ASN B 2  37   ? 196.662 152.590 229.987 1.00 370.00 ? 37   ASN B CG  1 
ATOM 3921  O OD1 . ASN B 2  37   ? 195.616 153.160 229.682 1.00 370.00 ? 37   ASN B OD1 1 
ATOM 3922  N ND2 . ASN B 2  37   ? 196.723 151.287 230.220 1.00 370.00 ? 37   ASN B ND2 1 
ATOM 3923  N N   . ILE B 2  38   ? 199.713 156.122 228.358 1.00 370.00 ? 38   ILE B N   1 
ATOM 3924  C CA  . ILE B 2  38   ? 200.799 157.068 228.555 1.00 370.00 ? 38   ILE B CA  1 
ATOM 3925  C C   . ILE B 2  38   ? 200.345 158.212 229.452 1.00 370.00 ? 38   ILE B C   1 
ATOM 3926  O O   . ILE B 2  38   ? 199.382 158.930 229.154 1.00 370.00 ? 38   ILE B O   1 
ATOM 3927  C CB  . ILE B 2  38   ? 201.320 157.560 227.199 1.00 370.00 ? 38   ILE B CB  1 
ATOM 3928  C CG1 . ILE B 2  38   ? 202.309 158.702 227.391 1.00 370.00 ? 38   ILE B CG1 1 
ATOM 3929  C CG2 . ILE B 2  38   ? 200.183 157.862 226.226 1.00 370.00 ? 38   ILE B CG2 1 
ATOM 3930  C CD1 . ILE B 2  38   ? 203.036 159.047 226.136 1.00 370.00 ? 38   ILE B CD1 1 
ATOM 3931  N N   . ASN B 2  39   ? 201.028 158.374 230.571 1.00 370.00 ? 39   ASN B N   1 
ATOM 3932  C CA  . ASN B 2  39   ? 200.558 159.248 231.626 1.00 370.00 ? 39   ASN B CA  1 
ATOM 3933  C C   . ASN B 2  39   ? 201.291 160.576 231.577 1.00 370.00 ? 39   ASN B C   1 
ATOM 3934  O O   . ASN B 2  39   ? 202.452 160.660 231.173 1.00 370.00 ? 39   ASN B O   1 
ATOM 3935  C CB  . ASN B 2  39   ? 200.738 158.585 232.992 1.00 370.00 ? 39   ASN B CB  1 
ATOM 3936  C CG  . ASN B 2  39   ? 200.013 159.311 234.115 1.00 370.00 ? 39   ASN B CG  1 
ATOM 3937  O OD1 . ASN B 2  39   ? 199.477 160.408 233.952 1.00 370.00 ? 39   ASN B OD1 1 
ATOM 3938  N ND2 . ASN B 2  39   ? 199.948 158.658 235.259 1.00 370.00 ? 39   ASN B ND2 1 
ATOM 3939  N N   . PHE B 2  40   ? 200.574 161.613 231.988 1.00 370.00 ? 40   PHE B N   1 
ATOM 3940  C CA  . PHE B 2  40   ? 201.124 162.942 232.157 1.00 370.00 ? 40   PHE B CA  1 
ATOM 3941  C C   . PHE B 2  40   ? 201.105 163.388 233.600 1.00 370.00 ? 40   PHE B C   1 
ATOM 3942  O O   . PHE B 2  40   ? 201.601 164.475 233.904 1.00 370.00 ? 40   PHE B O   1 
ATOM 3943  C CB  . PHE B 2  40   ? 200.339 163.956 231.331 1.00 370.00 ? 40   PHE B CB  1 
ATOM 3944  C CG  . PHE B 2  40   ? 200.538 163.825 229.869 1.00 370.00 ? 40   PHE B CG  1 
ATOM 3945  C CD1 . PHE B 2  40   ? 201.611 163.122 229.359 1.00 370.00 ? 40   PHE B CD1 1 
ATOM 3946  C CD2 . PHE B 2  40   ? 199.648 164.418 228.997 1.00 370.00 ? 40   PHE B CD2 1 
ATOM 3947  C CE1 . PHE B 2  40   ? 201.784 162.998 228.020 1.00 370.00 ? 40   PHE B CE1 1 
ATOM 3948  C CE2 . PHE B 2  40   ? 199.822 164.306 227.643 1.00 370.00 ? 40   PHE B CE2 1 
ATOM 3949  C CZ  . PHE B 2  40   ? 200.896 163.592 227.154 1.00 370.00 ? 40   PHE B CZ  1 
ATOM 3950  N N   . GLN B 2  41   ? 200.558 162.585 234.499 1.00 370.00 ? 41   GLN B N   1 
ATOM 3951  C CA  . GLN B 2  41   ? 200.402 163.007 235.878 1.00 370.00 ? 41   GLN B CA  1 
ATOM 3952  C C   . GLN B 2  41   ? 201.332 162.247 236.809 1.00 370.00 ? 41   GLN B C   1 
ATOM 3953  O O   . GLN B 2  41   ? 202.154 162.857 237.496 1.00 370.00 ? 41   GLN B O   1 
ATOM 3954  C CB  . GLN B 2  41   ? 198.945 162.828 236.296 1.00 370.00 ? 41   GLN B CB  1 
ATOM 3955  C CG  . GLN B 2  41   ? 198.017 163.626 235.429 1.00 370.00 ? 41   GLN B CG  1 
ATOM 3956  C CD  . GLN B 2  41   ? 198.287 165.104 235.534 1.00 370.00 ? 41   GLN B CD  1 
ATOM 3957  O OE1 . GLN B 2  41   ? 198.554 165.623 236.620 1.00 370.00 ? 41   GLN B OE1 1 
ATOM 3958  N NE2 . GLN B 2  41   ? 198.234 165.795 234.403 1.00 370.00 ? 41   GLN B NE2 1 
ATOM 3959  N N   . ARG B 2  42   ? 201.228 160.926 236.843 1.00 370.00 ? 42   ARG B N   1 
ATOM 3960  C CA  . ARG B 2  42   ? 202.301 160.126 237.398 1.00 370.00 ? 42   ARG B CA  1 
ATOM 3961  C C   . ARG B 2  42   ? 203.349 159.821 236.349 1.00 370.00 ? 42   ARG B C   1 
ATOM 3962  O O   . ARG B 2  42   ? 204.404 159.281 236.699 1.00 370.00 ? 42   ARG B O   1 
ATOM 3963  C CB  . ARG B 2  42   ? 201.759 158.827 237.995 1.00 370.00 ? 42   ARG B CB  1 
ATOM 3964  C CG  . ARG B 2  42   ? 200.723 159.049 239.076 1.00 370.00 ? 42   ARG B CG  1 
ATOM 3965  C CD  . ARG B 2  42   ? 201.346 159.717 240.286 1.00 370.00 ? 42   ARG B CD  1 
ATOM 3966  N NE  . ARG B 2  42   ? 200.413 159.838 241.404 1.00 370.00 ? 42   ARG B NE  1 
ATOM 3967  C CZ  . ARG B 2  42   ? 199.640 160.896 241.628 1.00 370.00 ? 42   ARG B CZ  1 
ATOM 3968  N NH1 . ARG B 2  42   ? 199.683 161.935 240.807 1.00 370.00 ? 42   ARG B NH1 1 
ATOM 3969  N NH2 . ARG B 2  42   ? 198.825 160.916 242.674 1.00 370.00 ? 42   ARG B NH2 1 
ATOM 3970  N N   . LYS B 2  43   ? 203.053 160.149 235.086 1.00 370.00 ? 43   LYS B N   1 
ATOM 3971  C CA  . LYS B 2  43   ? 204.030 160.251 234.008 1.00 370.00 ? 43   LYS B CA  1 
ATOM 3972  C C   . LYS B 2  43   ? 204.737 158.925 233.752 1.00 370.00 ? 43   LYS B C   1 
ATOM 3973  O O   . LYS B 2  43   ? 205.932 158.770 233.978 1.00 370.00 ? 43   LYS B O   1 
ATOM 3974  C CB  . LYS B 2  43   ? 205.022 161.363 234.316 1.00 370.00 ? 43   LYS B CB  1 
ATOM 3975  C CG  . LYS B 2  43   ? 204.381 162.697 234.248 1.00 370.00 ? 43   LYS B CG  1 
ATOM 3976  C CD  . LYS B 2  43   ? 205.304 163.766 234.700 1.00 370.00 ? 43   LYS B CD  1 
ATOM 3977  C CE  . LYS B 2  43   ? 205.473 163.645 236.189 1.00 370.00 ? 43   LYS B CE  1 
ATOM 3978  N NZ  . LYS B 2  43   ? 204.175 163.869 236.866 1.00 370.00 ? 43   LYS B NZ  1 
ATOM 3979  N N   . SER B 2  44   ? 203.963 157.959 233.297 1.00 370.00 ? 44   SER B N   1 
ATOM 3980  C CA  . SER B 2  44   ? 204.476 156.632 233.041 1.00 370.00 ? 44   SER B CA  1 
ATOM 3981  C C   . SER B 2  44   ? 203.866 156.104 231.756 1.00 370.00 ? 44   SER B C   1 
ATOM 3982  O O   . SER B 2  44   ? 202.989 156.727 231.150 1.00 370.00 ? 44   SER B O   1 
ATOM 3983  C CB  . SER B 2  44   ? 204.184 155.693 234.214 1.00 370.00 ? 44   SER B CB  1 
ATOM 3984  O OG  . SER B 2  44   ? 204.607 154.377 233.927 1.00 370.00 ? 44   SER B OG  1 
ATOM 3985  N N   . VAL B 2  45   ? 204.365 154.947 231.335 1.00 370.00 ? 45   VAL B N   1 
ATOM 3986  C CA  . VAL B 2  45   ? 203.973 154.310 230.085 1.00 370.00 ? 45   VAL B CA  1 
ATOM 3987  C C   . VAL B 2  45   ? 203.886 152.813 230.332 1.00 370.00 ? 45   VAL B C   1 
ATOM 3988  O O   . VAL B 2  45   ? 204.744 152.241 231.006 1.00 370.00 ? 45   VAL B O   1 
ATOM 3989  C CB  . VAL B 2  45   ? 204.977 154.646 228.961 1.00 370.00 ? 45   VAL B CB  1 
ATOM 3990  C CG1 . VAL B 2  45   ? 204.878 153.676 227.802 1.00 370.00 ? 45   VAL B CG1 1 
ATOM 3991  C CG2 . VAL B 2  45   ? 204.725 156.043 228.436 1.00 370.00 ? 45   VAL B CG2 1 
ATOM 3992  N N   . VAL B 2  46   ? 202.829 152.176 229.836 1.00 370.00 ? 46   VAL B N   1 
ATOM 3993  C CA  . VAL B 2  46   ? 202.773 150.726 229.888 1.00 370.00 ? 46   VAL B CA  1 
ATOM 3994  C C   . VAL B 2  46   ? 202.756 150.192 228.465 1.00 370.00 ? 46   VAL B C   1 
ATOM 3995  O O   . VAL B 2  46   ? 202.400 150.895 227.515 1.00 370.00 ? 46   VAL B O   1 
ATOM 3996  C CB  . VAL B 2  46   ? 201.563 150.214 230.688 1.00 370.00 ? 46   VAL B CB  1 
ATOM 3997  C CG1 . VAL B 2  46   ? 201.556 150.827 232.079 1.00 370.00 ? 46   VAL B CG1 1 
ATOM 3998  C CG2 . VAL B 2  46   ? 200.266 150.487 229.962 1.00 370.00 ? 46   VAL B CG2 1 
ATOM 3999  N N   . GLY B 2  47   ? 203.169 148.936 228.319 1.00 370.00 ? 47   GLY B N   1 
ATOM 4000  C CA  . GLY B 2  47   ? 203.181 148.334 227.003 1.00 370.00 ? 47   GLY B CA  1 
ATOM 4001  C C   . GLY B 2  47   ? 203.567 146.874 227.025 1.00 370.00 ? 47   GLY B C   1 
ATOM 4002  O O   . GLY B 2  47   ? 204.229 146.390 227.950 1.00 370.00 ? 47   GLY B O   1 
ATOM 4003  N N   . PHE B 2  48   ? 203.153 146.179 225.972 1.00 370.00 ? 48   PHE B N   1 
ATOM 4004  C CA  . PHE B 2  48   ? 203.555 144.804 225.736 1.00 370.00 ? 48   PHE B CA  1 
ATOM 4005  C C   . PHE B 2  48   ? 204.296 144.712 224.414 1.00 370.00 ? 48   PHE B C   1 
ATOM 4006  O O   . PHE B 2  48   ? 203.944 145.380 223.437 1.00 370.00 ? 48   PHE B O   1 
ATOM 4007  C CB  . PHE B 2  48   ? 202.360 143.845 225.749 1.00 370.00 ? 48   PHE B CB  1 
ATOM 4008  C CG  . PHE B 2  48   ? 201.316 144.138 224.707 1.00 370.00 ? 48   PHE B CG  1 
ATOM 4009  C CD1 . PHE B 2  48   ? 200.277 145.008 224.988 1.00 370.00 ? 48   PHE B CD1 1 
ATOM 4010  C CD2 . PHE B 2  48   ? 201.341 143.512 223.468 1.00 370.00 ? 48   PHE B CD2 1 
ATOM 4011  C CE1 . PHE B 2  48   ? 199.303 145.270 224.053 1.00 370.00 ? 48   PHE B CE1 1 
ATOM 4012  C CE2 . PHE B 2  48   ? 200.373 143.774 222.527 1.00 370.00 ? 48   PHE B CE2 1 
ATOM 4013  C CZ  . PHE B 2  48   ? 199.349 144.651 222.821 1.00 370.00 ? 48   PHE B CZ  1 
ATOM 4014  N N   . VAL B 2  49   ? 205.319 143.880 224.402 1.00 370.00 ? 49   VAL B N   1 
ATOM 4015  C CA  . VAL B 2  49   ? 206.133 143.655 223.221 1.00 370.00 ? 49   VAL B CA  1 
ATOM 4016  C C   . VAL B 2  49   ? 205.992 142.195 222.834 1.00 370.00 ? 49   VAL B C   1 
ATOM 4017  O O   . VAL B 2  49   ? 205.722 141.331 223.673 1.00 370.00 ? 49   VAL B O   1 
ATOM 4018  C CB  . VAL B 2  49   ? 207.611 144.045 223.467 1.00 370.00 ? 49   VAL B CB  1 
ATOM 4019  C CG1 . VAL B 2  49   ? 208.298 143.080 224.413 1.00 370.00 ? 49   VAL B CG1 1 
ATOM 4020  C CG2 . VAL B 2  49   ? 208.380 144.178 222.170 1.00 370.00 ? 49   VAL B CG2 1 
ATOM 4021  N N   . GLU B 2  50   ? 206.097 141.929 221.541 1.00 370.00 ? 50   GLU B N   1 
ATOM 4022  C CA  . GLU B 2  50   ? 206.160 140.570 221.040 1.00 370.00 ? 50   GLU B CA  1 
ATOM 4023  C C   . GLU B 2  50   ? 207.298 140.472 220.042 1.00 370.00 ? 50   GLU B C   1 
ATOM 4024  O O   . GLU B 2  50   ? 207.576 141.416 219.298 1.00 370.00 ? 50   GLU B O   1 
ATOM 4025  C CB  . GLU B 2  50   ? 204.830 140.135 220.421 1.00 370.00 ? 50   GLU B CB  1 
ATOM 4026  C CG  . GLU B 2  50   ? 203.746 139.934 221.471 1.00 370.00 ? 50   GLU B CG  1 
ATOM 4027  C CD  . GLU B 2  50   ? 202.381 139.638 220.898 1.00 370.00 ? 50   GLU B CD  1 
ATOM 4028  O OE1 . GLU B 2  50   ? 202.227 139.679 219.662 1.00 370.00 ? 50   GLU B OE1 1 
ATOM 4029  O OE2 . GLU B 2  50   ? 201.454 139.381 221.694 1.00 370.00 ? 50   GLU B OE2 1 
ATOM 4030  N N   . LEU B 2  51   ? 207.964 139.330 220.068 1.00 370.00 ? 51   LEU B N   1 
ATOM 4031  C CA  . LEU B 2  51   ? 209.222 139.113 219.380 1.00 370.00 ? 51   LEU B CA  1 
ATOM 4032  C C   . LEU B 2  51   ? 209.137 137.830 218.584 1.00 370.00 ? 51   LEU B C   1 
ATOM 4033  O O   . LEU B 2  51   ? 208.539 136.851 219.038 1.00 370.00 ? 51   LEU B O   1 
ATOM 4034  C CB  . LEU B 2  51   ? 210.390 139.006 220.347 1.00 370.00 ? 51   LEU B CB  1 
ATOM 4035  C CG  . LEU B 2  51   ? 211.015 140.273 220.913 1.00 370.00 ? 51   LEU B CG  1 
ATOM 4036  C CD1 . LEU B 2  51   ? 210.182 140.906 222.012 1.00 370.00 ? 51   LEU B CD1 1 
ATOM 4037  C CD2 . LEU B 2  51   ? 212.386 139.920 221.415 1.00 370.00 ? 51   LEU B CD2 1 
ATOM 4038  N N   . THR B 2  52   ? 209.773 137.830 217.421 1.00 370.00 ? 52   THR B N   1 
ATOM 4039  C CA  . THR B 2  52   ? 209.690 136.724 216.480 1.00 370.00 ? 52   THR B CA  1 
ATOM 4040  C C   . THR B 2  52   ? 211.101 136.197 216.273 1.00 370.00 ? 52   THR B C   1 
ATOM 4041  O O   . THR B 2  52   ? 211.934 136.863 215.641 1.00 370.00 ? 52   THR B O   1 
ATOM 4042  C CB  . THR B 2  52   ? 209.074 137.186 215.168 1.00 370.00 ? 52   THR B CB  1 
ATOM 4043  O OG1 . THR B 2  52   ? 207.925 137.994 215.445 1.00 370.00 ? 52   THR B OG1 1 
ATOM 4044  C CG2 . THR B 2  52   ? 208.625 135.980 214.371 1.00 370.00 ? 52   THR B CG2 1 
ATOM 4045  N N   . ILE B 2  53   ? 211.371 135.008 216.800 1.00 370.00 ? 53   ILE B N   1 
ATOM 4046  C CA  . ILE B 2  53   ? 212.734 134.528 216.965 1.00 370.00 ? 53   ILE B CA  1 
ATOM 4047  C C   . ILE B 2  53   ? 212.904 133.174 216.293 1.00 370.00 ? 53   ILE B C   1 
ATOM 4048  O O   . ILE B 2  53   ? 212.067 132.277 216.447 1.00 370.00 ? 53   ILE B O   1 
ATOM 4049  C CB  . ILE B 2  53   ? 213.114 134.475 218.456 1.00 370.00 ? 53   ILE B CB  1 
ATOM 4050  C CG1 . ILE B 2  53   ? 214.507 133.888 218.659 1.00 370.00 ? 53   ILE B CG1 1 
ATOM 4051  C CG2 . ILE B 2  53   ? 212.048 133.784 219.294 1.00 370.00 ? 53   ILE B CG2 1 
ATOM 4052  C CD1 . ILE B 2  53   ? 215.023 134.134 220.032 1.00 370.00 ? 53   ILE B CD1 1 
ATOM 4053  N N   . PHE B 2  54   ? 213.970 133.049 215.512 1.00 370.00 ? 54   PHE B N   1 
ATOM 4054  C CA  . PHE B 2  54   ? 214.496 131.760 215.094 1.00 370.00 ? 54   PHE B CA  1 
ATOM 4055  C C   . PHE B 2  54   ? 215.750 131.539 215.915 1.00 370.00 ? 54   PHE B C   1 
ATOM 4056  O O   . PHE B 2  54   ? 216.778 132.183 215.658 1.00 370.00 ? 54   PHE B O   1 
ATOM 4057  C CB  . PHE B 2  54   ? 214.830 131.742 213.602 1.00 370.00 ? 54   PHE B CB  1 
ATOM 4058  C CG  . PHE B 2  54   ? 213.640 131.854 212.698 1.00 370.00 ? 54   PHE B CG  1 
ATOM 4059  C CD1 . PHE B 2  54   ? 212.348 131.666 213.166 1.00 370.00 ? 54   PHE B CD1 1 
ATOM 4060  C CD2 . PHE B 2  54   ? 213.825 132.135 211.354 1.00 370.00 ? 54   PHE B CD2 1 
ATOM 4061  C CE1 . PHE B 2  54   ? 211.268 131.785 212.312 1.00 370.00 ? 54   PHE B CE1 1 
ATOM 4062  C CE2 . PHE B 2  54   ? 212.749 132.242 210.496 1.00 370.00 ? 54   PHE B CE2 1 
ATOM 4063  C CZ  . PHE B 2  54   ? 211.469 132.063 210.976 1.00 370.00 ? 54   PHE B CZ  1 
ATOM 4064  N N   . PRO B 2  55   ? 215.710 130.698 216.939 1.00 370.00 ? 55   PRO B N   1 
ATOM 4065  C CA  . PRO B 2  55   ? 216.932 130.358 217.668 1.00 370.00 ? 55   PRO B CA  1 
ATOM 4066  C C   . PRO B 2  55   ? 217.933 129.615 216.802 1.00 370.00 ? 55   PRO B C   1 
ATOM 4067  O O   . PRO B 2  55   ? 217.606 129.054 215.755 1.00 370.00 ? 55   PRO B O   1 
ATOM 4068  C CB  . PRO B 2  55   ? 216.425 129.474 218.806 1.00 370.00 ? 55   PRO B CB  1 
ATOM 4069  C CG  . PRO B 2  55   ? 215.046 129.954 219.029 1.00 370.00 ? 55   PRO B CG  1 
ATOM 4070  C CD  . PRO B 2  55   ? 214.505 130.327 217.692 1.00 370.00 ? 55   PRO B CD  1 
ATOM 4071  N N   . THR B 2  56   ? 219.175 129.611 217.270 1.00 370.00 ? 56   THR B N   1 
ATOM 4072  C CA  . THR B 2  56   ? 220.292 129.083 216.505 1.00 370.00 ? 56   THR B CA  1 
ATOM 4073  C C   . THR B 2  56   ? 220.702 127.681 216.914 1.00 370.00 ? 56   THR B C   1 
ATOM 4074  O O   . THR B 2  56   ? 220.836 126.813 216.049 1.00 370.00 ? 56   THR B O   1 
ATOM 4075  C CB  . THR B 2  56   ? 221.500 130.014 216.644 1.00 370.00 ? 56   THR B CB  1 
ATOM 4076  O OG1 . THR B 2  56   ? 221.141 131.316 216.167 1.00 370.00 ? 56   THR B OG1 1 
ATOM 4077  C CG2 . THR B 2  56   ? 222.686 129.495 215.847 1.00 370.00 ? 56   THR B CG2 1 
ATOM 4078  N N   . VAL B 2  57   ? 220.877 127.430 218.207 1.00 370.00 ? 57   VAL B N   1 
ATOM 4079  C CA  . VAL B 2  57   ? 221.317 126.129 218.685 1.00 370.00 ? 57   VAL B CA  1 
ATOM 4080  C C   . VAL B 2  57   ? 220.371 125.713 219.802 1.00 370.00 ? 57   VAL B C   1 
ATOM 4081  O O   . VAL B 2  57   ? 219.685 126.546 220.398 1.00 370.00 ? 57   VAL B O   1 
ATOM 4082  C CB  . VAL B 2  57   ? 222.798 126.191 219.144 1.00 370.00 ? 57   VAL B CB  1 
ATOM 4083  C CG1 . VAL B 2  57   ? 222.938 126.941 220.465 1.00 370.00 ? 57   VAL B CG1 1 
ATOM 4084  C CG2 . VAL B 2  57   ? 223.455 124.808 219.182 1.00 370.00 ? 57   VAL B CG2 1 
ATOM 4085  N N   . ALA B 2  58   ? 220.303 124.410 220.060 1.00 370.00 ? 58   ALA B N   1 
ATOM 4086  C CA  . ALA B 2  58   ? 219.528 123.928 221.186 1.00 370.00 ? 58   ALA B CA  1 
ATOM 4087  C C   . ALA B 2  58   ? 220.249 124.254 222.488 1.00 370.00 ? 58   ALA B C   1 
ATOM 4088  O O   . ALA B 2  58   ? 221.397 124.714 222.497 1.00 370.00 ? 58   ALA B O   1 
ATOM 4089  C CB  . ALA B 2  58   ? 219.282 122.426 221.070 1.00 370.00 ? 58   ALA B CB  1 
ATOM 4090  N N   . ASN B 2  59   ? 219.541 124.009 223.596 1.00 370.00 ? 59   ASN B N   1 
ATOM 4091  C CA  . ASN B 2  59   ? 219.921 124.450 224.943 1.00 370.00 ? 59   ASN B CA  1 
ATOM 4092  C C   . ASN B 2  59   ? 220.155 125.951 224.996 1.00 370.00 ? 59   ASN B C   1 
ATOM 4093  O O   . ASN B 2  59   ? 220.987 126.436 225.763 1.00 370.00 ? 59   ASN B O   1 
ATOM 4094  C CB  . ASN B 2  59   ? 221.142 123.696 225.480 1.00 370.00 ? 59   ASN B CB  1 
ATOM 4095  C CG  . ASN B 2  59   ? 220.831 122.260 225.818 1.00 370.00 ? 59   ASN B CG  1 
ATOM 4096  O OD1 . ASN B 2  59   ? 219.800 121.965 226.415 1.00 370.00 ? 59   ASN B OD1 1 
ATOM 4097  N ND2 . ASN B 2  59   ? 221.721 121.355 225.433 1.00 370.00 ? 59   ASN B ND2 1 
ATOM 4098  N N   . LEU B 2  60   ? 219.412 126.698 224.183 1.00 370.00 ? 60   LEU B N   1 
ATOM 4099  C CA  . LEU B 2  60   ? 219.477 128.153 224.196 1.00 370.00 ? 60   LEU B CA  1 
ATOM 4100  C C   . LEU B 2  60   ? 218.456 128.638 225.221 1.00 370.00 ? 60   LEU B C   1 
ATOM 4101  O O   . LEU B 2  60   ? 217.409 129.206 224.914 1.00 370.00 ? 60   LEU B O   1 
ATOM 4102  C CB  . LEU B 2  60   ? 219.230 128.703 222.799 1.00 370.00 ? 60   LEU B CB  1 
ATOM 4103  C CG  . LEU B 2  60   ? 219.490 130.176 222.504 1.00 370.00 ? 60   LEU B CG  1 
ATOM 4104  C CD1 . LEU B 2  60   ? 220.922 130.521 222.840 1.00 370.00 ? 60   LEU B CD1 1 
ATOM 4105  C CD2 . LEU B 2  60   ? 219.243 130.433 221.034 1.00 370.00 ? 60   LEU B CD2 1 
ATOM 4106  N N   . ASN B 2  61   ? 218.790 128.365 226.476 1.00 370.00 ? 61   ASN B N   1 
ATOM 4107  C CA  . ASN B 2  61   ? 217.812 128.361 227.550 1.00 370.00 ? 61   ASN B CA  1 
ATOM 4108  C C   . ASN B 2  61   ? 217.698 129.737 228.184 1.00 370.00 ? 61   ASN B C   1 
ATOM 4109  O O   . ASN B 2  61   ? 216.632 130.351 228.153 1.00 370.00 ? 61   ASN B O   1 
ATOM 4110  C CB  . ASN B 2  61   ? 218.209 127.306 228.581 1.00 370.00 ? 61   ASN B CB  1 
ATOM 4111  C CG  . ASN B 2  61   ? 218.275 125.920 227.981 1.00 370.00 ? 61   ASN B CG  1 
ATOM 4112  O OD1 . ASN B 2  61   ? 217.424 125.537 227.178 1.00 370.00 ? 61   ASN B OD1 1 
ATOM 4113  N ND2 . ASN B 2  61   ? 219.301 125.167 228.348 1.00 370.00 ? 61   ASN B ND2 1 
ATOM 4114  N N   . ARG B 2  62   ? 218.802 130.246 228.724 1.00 370.00 ? 62   ARG B N   1 
ATOM 4115  C CA  . ARG B 2  62   ? 218.826 131.560 229.361 1.00 370.00 ? 62   ARG B CA  1 
ATOM 4116  C C   . ARG B 2  62   ? 218.891 132.625 228.272 1.00 370.00 ? 62   ARG B C   1 
ATOM 4117  O O   . ARG B 2  62   ? 219.929 133.241 228.021 1.00 370.00 ? 62   ARG B O   1 
ATOM 4118  C CB  . ARG B 2  62   ? 220.014 131.676 230.304 1.00 370.00 ? 62   ARG B CB  1 
ATOM 4119  C CG  . ARG B 2  62   ? 220.007 130.683 231.434 1.00 370.00 ? 62   ARG B CG  1 
ATOM 4120  C CD  . ARG B 2  62   ? 221.179 130.905 232.359 1.00 370.00 ? 62   ARG B CD  1 
ATOM 4121  N NE  . ARG B 2  62   ? 222.443 130.556 231.728 1.00 370.00 ? 62   ARG B NE  1 
ATOM 4122  C CZ  . ARG B 2  62   ? 223.630 130.806 232.267 1.00 370.00 ? 62   ARG B CZ  1 
ATOM 4123  N NH1 . ARG B 2  62   ? 223.709 131.412 233.443 1.00 370.00 ? 62   ARG B NH1 1 
ATOM 4124  N NH2 . ARG B 2  62   ? 224.736 130.453 231.630 1.00 370.00 ? 62   ARG B NH2 1 
ATOM 4125  N N   . ILE B 2  63   ? 217.755 132.833 227.606 1.00 370.00 ? 63   ILE B N   1 
ATOM 4126  C CA  . ILE B 2  63   ? 217.675 133.830 226.550 1.00 370.00 ? 63   ILE B CA  1 
ATOM 4127  C C   . ILE B 2  63   ? 217.776 135.213 227.161 1.00 370.00 ? 63   ILE B C   1 
ATOM 4128  O O   . ILE B 2  63   ? 217.034 135.546 228.091 1.00 370.00 ? 63   ILE B O   1 
ATOM 4129  C CB  . ILE B 2  63   ? 216.370 133.687 225.764 1.00 370.00 ? 63   ILE B CB  1 
ATOM 4130  C CG1 . ILE B 2  63   ? 216.315 132.327 225.092 1.00 370.00 ? 63   ILE B CG1 1 
ATOM 4131  C CG2 . ILE B 2  63   ? 216.255 134.784 224.725 1.00 370.00 ? 63   ILE B CG2 1 
ATOM 4132  C CD1 . ILE B 2  63   ? 214.991 132.058 224.454 1.00 370.00 ? 63   ILE B CD1 1 
ATOM 4133  N N   . LYS B 2  64   ? 218.693 136.016 226.635 1.00 370.00 ? 64   LYS B N   1 
ATOM 4134  C CA  . LYS B 2  64   ? 218.980 137.347 227.139 1.00 370.00 ? 64   LYS B CA  1 
ATOM 4135  C C   . LYS B 2  64   ? 218.459 138.405 226.177 1.00 370.00 ? 64   LYS B C   1 
ATOM 4136  O O   . LYS B 2  64   ? 218.785 138.390 224.988 1.00 370.00 ? 64   LYS B O   1 
ATOM 4137  C CB  . LYS B 2  64   ? 220.480 137.537 227.343 1.00 370.00 ? 64   LYS B CB  1 
ATOM 4138  C CG  . LYS B 2  64   ? 220.820 138.930 227.803 1.00 370.00 ? 64   LYS B CG  1 
ATOM 4139  C CD  . LYS B 2  64   ? 222.307 139.156 227.943 1.00 370.00 ? 64   LYS B CD  1 
ATOM 4140  C CE  . LYS B 2  64   ? 222.558 140.612 228.282 1.00 370.00 ? 64   LYS B CE  1 
ATOM 4141  N NZ  . LYS B 2  64   ? 223.990 141.002 228.405 1.00 370.00 ? 64   LYS B NZ  1 
ATOM 4142  N N   . LEU B 2  65   ? 217.641 139.297 226.695 1.00 370.00 ? 65   LEU B N   1 
ATOM 4143  C CA  . LEU B 2  65   ? 217.485 140.642 226.175 1.00 370.00 ? 65   LEU B CA  1 
ATOM 4144  C C   . LEU B 2  65   ? 218.012 141.627 227.197 1.00 370.00 ? 65   LEU B C   1 
ATOM 4145  O O   . LEU B 2  65   ? 218.543 141.247 228.245 1.00 370.00 ? 65   LEU B O   1 
ATOM 4146  C CB  . LEU B 2  65   ? 216.038 140.955 225.833 1.00 370.00 ? 65   LEU B CB  1 
ATOM 4147  C CG  . LEU B 2  65   ? 215.686 140.783 224.370 1.00 370.00 ? 65   LEU B CG  1 
ATOM 4148  C CD1 . LEU B 2  65   ? 215.717 139.342 223.955 1.00 370.00 ? 65   LEU B CD1 1 
ATOM 4149  C CD2 . LEU B 2  65   ? 214.317 141.368 224.186 1.00 370.00 ? 65   LEU B CD2 1 
ATOM 4150  N N   . ASN B 2  66   ? 217.830 142.909 226.907 1.00 370.00 ? 66   ASN B N   1 
ATOM 4151  C CA  . ASN B 2  66   ? 218.473 143.907 227.736 1.00 370.00 ? 66   ASN B CA  1 
ATOM 4152  C C   . ASN B 2  66   ? 217.693 145.210 227.694 1.00 370.00 ? 66   ASN B C   1 
ATOM 4153  O O   . ASN B 2  66   ? 217.192 145.612 226.644 1.00 370.00 ? 66   ASN B O   1 
ATOM 4154  C CB  . ASN B 2  66   ? 219.915 144.110 227.277 1.00 370.00 ? 66   ASN B CB  1 
ATOM 4155  C CG  . ASN B 2  66   ? 220.762 144.781 228.322 1.00 370.00 ? 66   ASN B CG  1 
ATOM 4156  O OD1 . ASN B 2  66   ? 220.266 145.199 229.367 1.00 370.00 ? 66   ASN B OD1 1 
ATOM 4157  N ND2 . ASN B 2  66   ? 222.065 144.849 228.070 1.00 370.00 ? 66   ASN B ND2 1 
ATOM 4158  N N   . SER B 2  67   ? 217.614 145.858 228.853 1.00 370.00 ? 67   SER B N   1 
ATOM 4159  C CA  . SER B 2  67   ? 217.011 147.171 229.029 1.00 370.00 ? 67   SER B CA  1 
ATOM 4160  C C   . SER B 2  67   ? 217.490 147.722 230.356 1.00 370.00 ? 67   SER B C   1 
ATOM 4161  O O   . SER B 2  67   ? 218.088 147.006 231.160 1.00 370.00 ? 67   SER B O   1 
ATOM 4162  C CB  . SER B 2  67   ? 215.493 147.114 229.046 1.00 370.00 ? 67   SER B CB  1 
ATOM 4163  O OG  . SER B 2  67   ? 215.037 146.493 230.229 1.00 370.00 ? 67   SER B OG  1 
ATOM 4164  N N   . LYS B 2  68   ? 217.191 148.993 230.597 1.00 370.00 ? 68   LYS B N   1 
ATOM 4165  C CA  . LYS B 2  68   ? 217.281 149.521 231.946 1.00 370.00 ? 68   LYS B CA  1 
ATOM 4166  C C   . LYS B 2  68   ? 216.087 150.406 232.246 1.00 370.00 ? 68   LYS B C   1 
ATOM 4167  O O   . LYS B 2  68   ? 215.407 150.897 231.342 1.00 370.00 ? 68   LYS B O   1 
ATOM 4168  C CB  . LYS B 2  68   ? 218.550 150.326 232.212 1.00 370.00 ? 68   LYS B CB  1 
ATOM 4169  C CG  . LYS B 2  68   ? 219.795 149.508 232.344 1.00 370.00 ? 68   LYS B CG  1 
ATOM 4170  C CD  . LYS B 2  68   ? 220.898 150.363 232.892 1.00 370.00 ? 68   LYS B CD  1 
ATOM 4171  C CE  . LYS B 2  68   ? 220.646 150.615 234.373 1.00 370.00 ? 68   LYS B CE  1 
ATOM 4172  N NZ  . LYS B 2  68   ? 221.748 151.346 235.053 1.00 370.00 ? 68   LYS B NZ  1 
ATOM 4173  N N   . GLN B 2  69   ? 215.884 150.616 233.553 1.00 370.00 ? 69   GLN B N   1 
ATOM 4174  C CA  . GLN B 2  69   ? 214.772 151.379 234.126 1.00 370.00 ? 69   GLN B CA  1 
ATOM 4175  C C   . GLN B 2  69   ? 213.425 150.838 233.660 1.00 370.00 ? 69   GLN B C   1 
ATOM 4176  O O   . GLN B 2  69   ? 212.500 151.594 233.365 1.00 370.00 ? 69   GLN B O   1 
ATOM 4177  C CB  . GLN B 2  69   ? 214.905 152.871 233.824 1.00 370.00 ? 69   GLN B CB  1 
ATOM 4178  C CG  . GLN B 2  69   ? 216.128 153.501 234.453 1.00 370.00 ? 69   GLN B CG  1 
ATOM 4179  C CD  . GLN B 2  69   ? 216.231 154.978 234.147 1.00 370.00 ? 69   GLN B CD  1 
ATOM 4180  O OE1 . GLN B 2  69   ? 215.395 155.529 233.434 1.00 370.00 ? 69   GLN B OE1 1 
ATOM 4181  N NE2 . GLN B 2  69   ? 217.262 155.626 234.678 1.00 370.00 ? 69   GLN B NE2 1 
ATOM 4182  N N   . CYS B 2  70   ? 213.311 149.513 233.607 1.00 370.00 ? 70   CYS B N   1 
ATOM 4183  C CA  . CYS B 2  70   ? 212.120 148.837 233.098 1.00 370.00 ? 70   CYS B CA  1 
ATOM 4184  C C   . CYS B 2  70   ? 211.652 147.820 234.128 1.00 370.00 ? 70   CYS B C   1 
ATOM 4185  O O   . CYS B 2  70   ? 212.242 146.743 234.246 1.00 370.00 ? 70   CYS B O   1 
ATOM 4186  C CB  . CYS B 2  70   ? 212.406 148.143 231.772 1.00 370.00 ? 70   CYS B CB  1 
ATOM 4187  S SG  . CYS B 2  70   ? 212.804 149.222 230.399 1.00 370.00 ? 70   CYS B SG  1 
ATOM 4188  N N   . ARG B 2  71   ? 210.593 148.136 234.863 1.00 370.00 ? 71   ARG B N   1 
ATOM 4189  C CA  . ARG B 2  71   ? 209.950 147.090 235.642 1.00 370.00 ? 71   ARG B CA  1 
ATOM 4190  C C   . ARG B 2  71   ? 209.070 146.266 234.720 1.00 370.00 ? 71   ARG B C   1 
ATOM 4191  O O   . ARG B 2  71   ? 208.072 146.761 234.189 1.00 370.00 ? 71   ARG B O   1 
ATOM 4192  C CB  . ARG B 2  71   ? 209.124 147.638 236.795 1.00 370.00 ? 71   ARG B CB  1 
ATOM 4193  C CG  . ARG B 2  71   ? 208.495 146.479 237.541 1.00 370.00 ? 71   ARG B CG  1 
ATOM 4194  C CD  . ARG B 2  71   ? 207.715 146.876 238.758 1.00 370.00 ? 71   ARG B CD  1 
ATOM 4195  N NE  . ARG B 2  71   ? 207.106 145.696 239.360 1.00 370.00 ? 71   ARG B NE  1 
ATOM 4196  C CZ  . ARG B 2  71   ? 206.369 145.712 240.463 1.00 370.00 ? 71   ARG B CZ  1 
ATOM 4197  N NH1 . ARG B 2  71   ? 206.145 146.854 241.096 1.00 370.00 ? 71   ARG B NH1 1 
ATOM 4198  N NH2 . ARG B 2  71   ? 205.855 144.584 240.934 1.00 370.00 ? 71   ARG B NH2 1 
ATOM 4199  N N   . ILE B 2  72   ? 209.447 145.008 234.529 1.00 370.00 ? 72   ILE B N   1 
ATOM 4200  C CA  . ILE B 2  72   ? 208.651 144.104 233.720 1.00 370.00 ? 72   ILE B CA  1 
ATOM 4201  C C   . ILE B 2  72   ? 207.406 143.728 234.503 1.00 370.00 ? 72   ILE B C   1 
ATOM 4202  O O   . ILE B 2  72   ? 207.458 143.532 235.724 1.00 370.00 ? 72   ILE B O   1 
ATOM 4203  C CB  . ILE B 2  72   ? 209.486 142.865 233.362 1.00 370.00 ? 72   ILE B CB  1 
ATOM 4204  C CG1 . ILE B 2  72   ? 210.830 143.301 232.780 1.00 370.00 ? 72   ILE B CG1 1 
ATOM 4205  C CG2 . ILE B 2  72   ? 208.744 141.959 232.393 1.00 370.00 ? 72   ILE B CG2 1 
ATOM 4206  C CD1 . ILE B 2  72   ? 210.721 144.143 231.542 1.00 370.00 ? 72   ILE B CD1 1 
ATOM 4207  N N   . TYR B 2  73   ? 206.270 143.660 233.820 1.00 370.00 ? 73   TYR B N   1 
ATOM 4208  C CA  . TYR B 2  73   ? 205.106 143.154 234.528 1.00 370.00 ? 73   TYR B CA  1 
ATOM 4209  C C   . TYR B 2  73   ? 204.979 141.643 234.416 1.00 370.00 ? 73   TYR B C   1 
ATOM 4210  O O   . TYR B 2  73   ? 204.876 140.958 235.436 1.00 370.00 ? 73   TYR B O   1 
ATOM 4211  C CB  . TYR B 2  73   ? 203.843 143.866 234.055 1.00 370.00 ? 73   TYR B CB  1 
ATOM 4212  C CG  . TYR B 2  73   ? 203.668 145.204 234.736 1.00 370.00 ? 73   TYR B CG  1 
ATOM 4213  C CD1 . TYR B 2  73   ? 204.462 145.558 235.829 1.00 370.00 ? 73   TYR B CD1 1 
ATOM 4214  C CD2 . TYR B 2  73   ? 202.689 146.094 234.326 1.00 370.00 ? 73   TYR B CD2 1 
ATOM 4215  C CE1 . TYR B 2  73   ? 204.301 146.766 236.471 1.00 370.00 ? 73   TYR B CE1 1 
ATOM 4216  C CE2 . TYR B 2  73   ? 202.517 147.308 234.966 1.00 370.00 ? 73   TYR B CE2 1 
ATOM 4217  C CZ  . TYR B 2  73   ? 203.324 147.637 236.040 1.00 370.00 ? 73   TYR B CZ  1 
ATOM 4218  O OH  . TYR B 2  73   ? 203.164 148.846 236.676 1.00 370.00 ? 73   TYR B OH  1 
ATOM 4219  N N   . ARG B 2  74   ? 205.002 141.101 233.206 1.00 370.00 ? 74   ARG B N   1 
ATOM 4220  C CA  . ARG B 2  74   ? 205.129 139.660 233.091 1.00 370.00 ? 74   ARG B CA  1 
ATOM 4221  C C   . ARG B 2  74   ? 205.869 139.344 231.811 1.00 370.00 ? 74   ARG B C   1 
ATOM 4222  O O   . ARG B 2  74   ? 205.992 140.176 230.912 1.00 370.00 ? 74   ARG B O   1 
ATOM 4223  C CB  . ARG B 2  74   ? 203.769 138.941 233.130 1.00 370.00 ? 74   ARG B CB  1 
ATOM 4224  C CG  . ARG B 2  74   ? 202.880 139.077 231.903 1.00 370.00 ? 74   ARG B CG  1 
ATOM 4225  C CD  . ARG B 2  74   ? 202.913 137.813 231.033 1.00 370.00 ? 74   ARG B CD  1 
ATOM 4226  N NE  . ARG B 2  74   ? 201.991 137.900 229.908 1.00 370.00 ? 74   ARG B NE  1 
ATOM 4227  C CZ  . ARG B 2  74   ? 200.724 137.509 229.963 1.00 370.00 ? 74   ARG B CZ  1 
ATOM 4228  N NH1 . ARG B 2  74   ? 200.240 137.008 231.088 1.00 370.00 ? 74   ARG B NH1 1 
ATOM 4229  N NH2 . ARG B 2  74   ? 199.937 137.621 228.902 1.00 370.00 ? 74   ARG B NH2 1 
ATOM 4230  N N   . VAL B 2  75   ? 206.362 138.122 231.748 1.00 370.00 ? 75   VAL B N   1 
ATOM 4231  C CA  . VAL B 2  75   ? 207.013 137.589 230.567 1.00 370.00 ? 75   VAL B CA  1 
ATOM 4232  C C   . VAL B 2  75   ? 206.181 136.390 230.142 1.00 370.00 ? 75   VAL B C   1 
ATOM 4233  O O   . VAL B 2  75   ? 205.509 135.782 230.976 1.00 370.00 ? 75   VAL B O   1 
ATOM 4234  C CB  . VAL B 2  75   ? 208.473 137.193 230.883 1.00 370.00 ? 75   VAL B CB  1 
ATOM 4235  C CG1 . VAL B 2  75   ? 209.271 136.993 229.616 1.00 370.00 ? 75   VAL B CG1 1 
ATOM 4236  C CG2 . VAL B 2  75   ? 209.138 138.210 231.811 1.00 370.00 ? 75   VAL B CG2 1 
ATOM 4237  N N   . ARG B 2  76   ? 206.199 136.057 228.852 1.00 370.00 ? 76   ARG B N   1 
ATOM 4238  C CA  . ARG B 2  76   ? 205.410 134.929 228.382 1.00 370.00 ? 76   ARG B CA  1 
ATOM 4239  C C   . ARG B 2  76   ? 205.961 134.454 227.047 1.00 370.00 ? 76   ARG B C   1 
ATOM 4240  O O   . ARG B 2  76   ? 206.333 135.269 226.200 1.00 370.00 ? 76   ARG B O   1 
ATOM 4241  C CB  . ARG B 2  76   ? 203.934 135.324 228.242 1.00 370.00 ? 76   ARG B CB  1 
ATOM 4242  C CG  . ARG B 2  76   ? 202.986 134.190 227.954 1.00 370.00 ? 76   ARG B CG  1 
ATOM 4243  C CD  . ARG B 2  76   ? 201.563 134.700 228.041 1.00 370.00 ? 76   ARG B CD  1 
ATOM 4244  N NE  . ARG B 2  76   ? 201.237 135.678 227.008 1.00 370.00 ? 76   ARG B NE  1 
ATOM 4245  C CZ  . ARG B 2  76   ? 200.718 135.369 225.825 1.00 370.00 ? 76   ARG B CZ  1 
ATOM 4246  N NH1 . ARG B 2  76   ? 200.447 134.110 225.533 1.00 370.00 ? 76   ARG B NH1 1 
ATOM 4247  N NH2 . ARG B 2  76   ? 200.445 136.320 224.944 1.00 370.00 ? 76   ARG B NH2 1 
ATOM 4248  N N   . ILE B 2  77   ? 206.031 133.139 226.874 1.00 370.00 ? 77   ILE B N   1 
ATOM 4249  C CA  . ILE B 2  77   ? 206.254 132.533 225.568 1.00 370.00 ? 77   ILE B CA  1 
ATOM 4250  C C   . ILE B 2  77   ? 205.147 131.524 225.363 1.00 370.00 ? 77   ILE B C   1 
ATOM 4251  O O   . ILE B 2  77   ? 205.171 130.449 225.975 1.00 370.00 ? 77   ILE B O   1 
ATOM 4252  C CB  . ILE B 2  77   ? 207.620 131.855 225.441 1.00 370.00 ? 77   ILE B CB  1 
ATOM 4253  C CG1 . ILE B 2  77   ? 208.740 132.871 225.576 1.00 370.00 ? 77   ILE B CG1 1 
ATOM 4254  C CG2 . ILE B 2  77   ? 207.742 131.160 224.090 1.00 370.00 ? 77   ILE B CG2 1 
ATOM 4255  C CD1 . ILE B 2  77   ? 210.091 132.228 225.673 1.00 370.00 ? 77   ILE B CD1 1 
ATOM 4256  N N   . ASN B 2  78   ? 204.174 131.878 224.520 1.00 370.00 ? 78   ASN B N   1 
ATOM 4257  C CA  . ASN B 2  78   ? 203.104 130.993 224.058 1.00 370.00 ? 78   ASN B CA  1 
ATOM 4258  C C   . ASN B 2  78   ? 202.287 130.459 225.236 1.00 370.00 ? 78   ASN B C   1 
ATOM 4259  O O   . ASN B 2  78   ? 202.202 129.252 225.479 1.00 370.00 ? 78   ASN B O   1 
ATOM 4260  C CB  . ASN B 2  78   ? 203.675 129.862 223.197 1.00 370.00 ? 78   ASN B CB  1 
ATOM 4261  C CG  . ASN B 2  78   ? 204.285 130.375 221.909 1.00 370.00 ? 78   ASN B CG  1 
ATOM 4262  O OD1 . ASN B 2  78   ? 203.730 131.253 221.253 1.00 370.00 ? 78   ASN B OD1 1 
ATOM 4263  N ND2 . ASN B 2  78   ? 205.438 129.841 221.550 1.00 370.00 ? 78   ASN B ND2 1 
ATOM 4264  N N   . ASP B 2  79   ? 201.741 131.414 225.996 1.00 370.00 ? 79   ASP B N   1 
ATOM 4265  C CA  . ASP B 2  79   ? 200.946 131.184 227.205 1.00 370.00 ? 79   ASP B CA  1 
ATOM 4266  C C   . ASP B 2  79   ? 201.729 130.432 228.270 1.00 370.00 ? 79   ASP B C   1 
ATOM 4267  O O   . ASP B 2  79   ? 201.152 129.737 229.106 1.00 370.00 ? 79   ASP B O   1 
ATOM 4268  C CB  . ASP B 2  79   ? 199.623 130.481 226.891 1.00 370.00 ? 79   ASP B CB  1 
ATOM 4269  C CG  . ASP B 2  79   ? 198.654 131.386 226.166 1.00 370.00 ? 79   ASP B CG  1 
ATOM 4270  O OD1 . ASP B 2  79   ? 198.724 132.615 226.382 1.00 370.00 ? 79   ASP B OD1 1 
ATOM 4271  O OD2 . ASP B 2  79   ? 197.827 130.876 225.382 1.00 370.00 ? 79   ASP B OD2 1 
ATOM 4272  N N   . LEU B 2  80   ? 203.048 130.574 228.254 1.00 370.00 ? 80   LEU B N   1 
ATOM 4273  C CA  . LEU B 2  80   ? 203.909 129.986 229.270 1.00 370.00 ? 80   LEU B CA  1 
ATOM 4274  C C   . LEU B 2  80   ? 204.809 131.101 229.770 1.00 370.00 ? 80   LEU B C   1 
ATOM 4275  O O   . LEU B 2  80   ? 205.765 131.489 229.092 1.00 370.00 ? 80   LEU B O   1 
ATOM 4276  C CB  . LEU B 2  80   ? 204.720 128.821 228.726 1.00 370.00 ? 80   LEU B CB  1 
ATOM 4277  C CG  . LEU B 2  80   ? 203.887 127.630 228.269 1.00 370.00 ? 80   LEU B CG  1 
ATOM 4278  C CD1 . LEU B 2  80   ? 204.774 126.569 227.667 1.00 370.00 ? 80   LEU B CD1 1 
ATOM 4279  C CD2 . LEU B 2  80   ? 203.091 127.068 229.428 1.00 370.00 ? 80   LEU B CD2 1 
ATOM 4280  N N   . GLU B 2  81   ? 204.479 131.630 230.940 1.00 370.00 ? 81   GLU B N   1 
ATOM 4281  C CA  . GLU B 2  81   ? 205.394 132.510 231.644 1.00 370.00 ? 81   GLU B CA  1 
ATOM 4282  C C   . GLU B 2  81   ? 206.594 131.695 232.098 1.00 370.00 ? 81   GLU B C   1 
ATOM 4283  O O   . GLU B 2  81   ? 206.500 130.909 233.044 1.00 370.00 ? 81   GLU B O   1 
ATOM 4284  C CB  . GLU B 2  81   ? 204.692 133.174 232.823 1.00 370.00 ? 81   GLU B CB  1 
ATOM 4285  C CG  . GLU B 2  81   ? 205.606 134.056 233.657 1.00 370.00 ? 81   GLU B CG  1 
ATOM 4286  C CD  . GLU B 2  81   ? 204.847 134.941 234.619 1.00 370.00 ? 81   GLU B CD  1 
ATOM 4287  O OE1 . GLU B 2  81   ? 203.602 134.860 234.651 1.00 370.00 ? 81   GLU B OE1 1 
ATOM 4288  O OE2 . GLU B 2  81   ? 205.498 135.732 235.333 1.00 370.00 ? 81   GLU B OE2 1 
ATOM 4289  N N   . ALA B 2  82   ? 207.714 131.861 231.408 1.00 370.00 ? 82   ALA B N   1 
ATOM 4290  C CA  . ALA B 2  82   ? 208.946 131.172 231.759 1.00 370.00 ? 82   ALA B CA  1 
ATOM 4291  C C   . ALA B 2  82   ? 209.736 132.053 232.729 1.00 370.00 ? 82   ALA B C   1 
ATOM 4292  O O   . ALA B 2  82   ? 209.194 133.008 233.292 1.00 370.00 ? 82   ALA B O   1 
ATOM 4293  C CB  . ALA B 2  82   ? 209.711 130.799 230.489 1.00 370.00 ? 82   ALA B CB  1 
ATOM 4294  N N   . ALA B 2  83   ? 211.015 131.749 232.944 1.00 370.00 ? 83   ALA B N   1 
ATOM 4295  C CA  . ALA B 2  83   ? 211.742 132.321 234.069 1.00 370.00 ? 83   ALA B CA  1 
ATOM 4296  C C   . ALA B 2  83   ? 212.143 133.772 233.804 1.00 370.00 ? 83   ALA B C   1 
ATOM 4297  O O   . ALA B 2  83   ? 211.770 134.390 232.804 1.00 370.00 ? 83   ALA B O   1 
ATOM 4298  C CB  . ALA B 2  83   ? 212.966 131.476 234.396 1.00 370.00 ? 83   ALA B CB  1 
ATOM 4299  N N   . PHE B 2  84   ? 212.928 134.316 234.727 1.00 370.00 ? 84   PHE B N   1 
ATOM 4300  C CA  . PHE B 2  84   ? 213.086 135.758 234.840 1.00 370.00 ? 84   PHE B CA  1 
ATOM 4301  C C   . PHE B 2  84   ? 214.388 136.051 235.561 1.00 370.00 ? 84   PHE B C   1 
ATOM 4302  O O   . PHE B 2  84   ? 214.563 135.641 236.711 1.00 370.00 ? 84   PHE B O   1 
ATOM 4303  C CB  . PHE B 2  84   ? 211.903 136.348 235.602 1.00 370.00 ? 84   PHE B CB  1 
ATOM 4304  C CG  . PHE B 2  84   ? 211.943 137.834 235.742 1.00 370.00 ? 84   PHE B CG  1 
ATOM 4305  C CD1 . PHE B 2  84   ? 211.552 138.650 234.695 1.00 370.00 ? 84   PHE B CD1 1 
ATOM 4306  C CD2 . PHE B 2  84   ? 212.360 138.418 236.928 1.00 370.00 ? 84   PHE B CD2 1 
ATOM 4307  C CE1 . PHE B 2  84   ? 211.577 140.026 234.829 1.00 370.00 ? 84   PHE B CE1 1 
ATOM 4308  C CE2 . PHE B 2  84   ? 212.394 139.789 237.067 1.00 370.00 ? 84   PHE B CE2 1 
ATOM 4309  C CZ  . PHE B 2  84   ? 212.001 140.596 236.017 1.00 370.00 ? 84   PHE B CZ  1 
ATOM 4310  N N   . ILE B 2  85   ? 215.295 136.752 234.892 1.00 370.00 ? 85   ILE B N   1 
ATOM 4311  C CA  . ILE B 2  85   ? 216.553 137.189 235.481 1.00 370.00 ? 85   ILE B CA  1 
ATOM 4312  C C   . ILE B 2  85   ? 216.716 138.668 235.171 1.00 370.00 ? 85   ILE B C   1 
ATOM 4313  O O   . ILE B 2  85   ? 216.532 139.082 234.025 1.00 370.00 ? 85   ILE B O   1 
ATOM 4314  C CB  . ILE B 2  85   ? 217.745 136.366 234.949 1.00 370.00 ? 85   ILE B CB  1 
ATOM 4315  C CG1 . ILE B 2  85   ? 217.678 134.935 235.491 1.00 370.00 ? 85   ILE B CG1 1 
ATOM 4316  C CG2 . ILE B 2  85   ? 219.076 137.013 235.293 1.00 370.00 ? 85   ILE B CG2 1 
ATOM 4317  C CD1 . ILE B 2  85   ? 218.669 133.992 234.870 1.00 370.00 ? 85   ILE B CD1 1 
ATOM 4318  N N   . TYR B 2  86   ? 217.029 139.466 236.190 1.00 370.00 ? 86   TYR B N   1 
ATOM 4319  C CA  . TYR B 2  86   ? 217.058 140.916 236.044 1.00 370.00 ? 86   TYR B CA  1 
ATOM 4320  C C   . TYR B 2  86   ? 218.172 141.491 236.900 1.00 370.00 ? 86   TYR B C   1 
ATOM 4321  O O   . TYR B 2  86   ? 217.995 141.678 238.106 1.00 370.00 ? 86   TYR B O   1 
ATOM 4322  C CB  . TYR B 2  86   ? 215.705 141.505 236.442 1.00 370.00 ? 86   TYR B CB  1 
ATOM 4323  C CG  . TYR B 2  86   ? 215.574 142.999 236.302 1.00 370.00 ? 86   TYR B CG  1 
ATOM 4324  C CD1 . TYR B 2  86   ? 215.454 143.591 235.053 1.00 370.00 ? 86   TYR B CD1 1 
ATOM 4325  C CD2 . TYR B 2  86   ? 215.522 143.814 237.425 1.00 370.00 ? 86   TYR B CD2 1 
ATOM 4326  C CE1 . TYR B 2  86   ? 215.313 144.957 234.922 1.00 370.00 ? 86   TYR B CE1 1 
ATOM 4327  C CE2 . TYR B 2  86   ? 215.381 145.181 237.307 1.00 370.00 ? 86   TYR B CE2 1 
ATOM 4328  C CZ  . TYR B 2  86   ? 215.277 145.746 236.054 1.00 370.00 ? 86   TYR B CZ  1 
ATOM 4329  O OH  . TYR B 2  86   ? 215.138 147.107 235.937 1.00 370.00 ? 86   TYR B OH  1 
ATOM 4330  N N   . ASN B 2  87   ? 219.310 141.784 236.281 1.00 370.00 ? 87   ASN B N   1 
ATOM 4331  C CA  . ASN B 2  87   ? 220.412 142.425 236.978 1.00 370.00 ? 87   ASN B CA  1 
ATOM 4332  C C   . ASN B 2  87   ? 220.566 143.839 236.462 1.00 370.00 ? 87   ASN B C   1 
ATOM 4333  O O   . ASN B 2  87   ? 220.083 144.180 235.383 1.00 370.00 ? 87   ASN B O   1 
ATOM 4334  C CB  . ASN B 2  87   ? 221.742 141.689 236.793 1.00 370.00 ? 87   ASN B CB  1 
ATOM 4335  C CG  . ASN B 2  87   ? 221.866 140.487 237.679 1.00 370.00 ? 87   ASN B CG  1 
ATOM 4336  O OD1 . ASN B 2  87   ? 221.470 140.520 238.841 1.00 370.00 ? 87   ASN B OD1 1 
ATOM 4337  N ND2 . ASN B 2  87   ? 222.445 139.420 237.151 1.00 370.00 ? 87   ASN B ND2 1 
ATOM 4338  N N   . ASP B 2  88   ? 221.240 144.662 237.259 1.00 370.00 ? 88   ASP B N   1 
ATOM 4339  C CA  . ASP B 2  88   ? 221.735 145.965 236.811 1.00 370.00 ? 88   ASP B CA  1 
ATOM 4340  C C   . ASP B 2  88   ? 223.167 146.161 237.274 1.00 370.00 ? 88   ASP B C   1 
ATOM 4341  O O   . ASP B 2  88   ? 223.435 146.913 238.218 1.00 370.00 ? 88   ASP B O   1 
ATOM 4342  C CB  . ASP B 2  88   ? 220.847 147.098 237.322 1.00 370.00 ? 88   ASP B CB  1 
ATOM 4343  C CG  . ASP B 2  88   ? 219.552 147.210 236.555 1.00 370.00 ? 88   ASP B CG  1 
ATOM 4344  O OD1 . ASP B 2  88   ? 219.569 146.991 235.328 1.00 370.00 ? 88   ASP B OD1 1 
ATOM 4345  O OD2 . ASP B 2  88   ? 218.510 147.494 237.180 1.00 370.00 ? 88   ASP B OD2 1 
ATOM 4346  N N   . PRO B 2  89   ? 224.132 145.517 236.612 1.00 370.00 ? 89   PRO B N   1 
ATOM 4347  C CA  . PRO B 2  89   ? 225.535 145.819 236.894 1.00 370.00 ? 89   PRO B CA  1 
ATOM 4348  C C   . PRO B 2  89   ? 226.015 147.087 236.218 1.00 370.00 ? 89   PRO B C   1 
ATOM 4349  O O   . PRO B 2  89   ? 227.167 147.482 236.420 1.00 370.00 ? 89   PRO B O   1 
ATOM 4350  C CB  . PRO B 2  89   ? 226.264 144.589 236.347 1.00 370.00 ? 89   PRO B CB  1 
ATOM 4351  C CG  . PRO B 2  89   ? 225.433 144.149 235.255 1.00 370.00 ? 89   PRO B CG  1 
ATOM 4352  C CD  . PRO B 2  89   ? 224.015 144.447 235.609 1.00 370.00 ? 89   PRO B CD  1 
ATOM 4353  N N   . THR B 2  90   ? 225.145 147.745 235.449 1.00 370.00 ? 90   THR B N   1 
ATOM 4354  C CA  . THR B 2  90   ? 225.401 149.091 234.953 1.00 370.00 ? 90   THR B CA  1 
ATOM 4355  C C   . THR B 2  90   ? 225.454 150.095 236.096 1.00 370.00 ? 90   THR B C   1 
ATOM 4356  O O   . THR B 2  90   ? 226.063 151.160 235.967 1.00 370.00 ? 90   THR B O   1 
ATOM 4357  C CB  . THR B 2  90   ? 224.310 149.443 233.947 1.00 370.00 ? 90   THR B CB  1 
ATOM 4358  O OG1 . THR B 2  90   ? 224.172 148.359 233.022 1.00 370.00 ? 90   THR B OG1 1 
ATOM 4359  C CG2 . THR B 2  90   ? 224.646 150.701 233.154 1.00 370.00 ? 90   THR B CG2 1 
ATOM 4360  N N   . LEU B 2  91   ? 224.914 149.725 237.248 1.00 370.00 ? 91   LEU B N   1 
ATOM 4361  C CA  . LEU B 2  91   ? 225.089 150.459 238.484 1.00 370.00 ? 91   LEU B CA  1 
ATOM 4362  C C   . LEU B 2  91   ? 226.479 150.208 239.056 1.00 370.00 ? 91   LEU B C   1 
ATOM 4363  O O   . LEU B 2  91   ? 227.391 149.777 238.345 1.00 370.00 ? 91   LEU B O   1 
ATOM 4364  C CB  . LEU B 2  91   ? 224.008 150.053 239.473 1.00 370.00 ? 91   LEU B CB  1 
ATOM 4365  C CG  . LEU B 2  91   ? 222.631 150.357 238.900 1.00 370.00 ? 91   LEU B CG  1 
ATOM 4366  C CD1 . LEU B 2  91   ? 221.556 149.815 239.805 1.00 370.00 ? 91   LEU B CD1 1 
ATOM 4367  C CD2 . LEU B 2  91   ? 222.472 151.848 238.701 1.00 370.00 ? 91   LEU B CD2 1 
ATOM 4368  N N   . GLU B 2  92   ? 226.650 150.500 240.339 1.00 370.00 ? 92   GLU B N   1 
ATOM 4369  C CA  . GLU B 2  92   ? 227.958 150.742 240.923 1.00 370.00 ? 92   GLU B CA  1 
ATOM 4370  C C   . GLU B 2  92   ? 228.777 149.460 241.057 1.00 370.00 ? 92   GLU B C   1 
ATOM 4371  O O   . GLU B 2  92   ? 228.392 148.374 240.612 1.00 370.00 ? 92   GLU B O   1 
ATOM 4372  C CB  . GLU B 2  92   ? 227.800 151.350 242.305 1.00 370.00 ? 92   GLU B CB  1 
ATOM 4373  C CG  . GLU B 2  92   ? 226.793 152.457 242.368 1.00 370.00 ? 92   GLU B CG  1 
ATOM 4374  C CD  . GLU B 2  92   ? 226.842 153.157 243.702 1.00 370.00 ? 92   GLU B CD  1 
ATOM 4375  O OE1 . GLU B 2  92   ? 227.646 152.737 244.561 1.00 370.00 ? 92   GLU B OE1 1 
ATOM 4376  O OE2 . GLU B 2  92   ? 226.082 154.120 243.897 1.00 370.00 ? 92   GLU B OE2 1 
ATOM 4377  N N   . VAL B 2  93   ? 229.938 149.620 241.698 1.00 370.00 ? 93   VAL B N   1 
ATOM 4378  C CA  . VAL B 2  93   ? 230.785 148.497 242.067 1.00 370.00 ? 93   VAL B CA  1 
ATOM 4379  C C   . VAL B 2  93   ? 230.023 147.592 243.030 1.00 370.00 ? 93   VAL B C   1 
ATOM 4380  O O   . VAL B 2  93   ? 229.199 148.055 243.830 1.00 370.00 ? 93   VAL B O   1 
ATOM 4381  C CB  . VAL B 2  93   ? 232.088 149.040 242.684 1.00 370.00 ? 93   VAL B CB  1 
ATOM 4382  C CG1 . VAL B 2  93   ? 233.073 147.937 243.059 1.00 370.00 ? 93   VAL B CG1 1 
ATOM 4383  C CG2 . VAL B 2  93   ? 232.734 150.011 241.724 1.00 370.00 ? 93   VAL B CG2 1 
ATOM 4384  N N   . CYS B 2  94   ? 230.273 146.278 242.916 1.00 370.00 ? 94   CYS B N   1 
ATOM 4385  C CA  . CYS B 2  94   ? 229.620 145.262 243.737 1.00 370.00 ? 94   CYS B CA  1 
ATOM 4386  C C   . CYS B 2  94   ? 229.811 145.483 245.232 1.00 370.00 ? 94   CYS B C   1 
ATOM 4387  O O   . CYS B 2  94   ? 228.981 145.027 246.024 1.00 370.00 ? 94   CYS B O   1 
ATOM 4388  C CB  . CYS B 2  94   ? 230.141 143.881 243.346 1.00 370.00 ? 94   CYS B CB  1 
ATOM 4389  S SG  . CYS B 2  94   ? 229.733 143.399 241.654 1.00 370.00 ? 94   CYS B SG  1 
ATOM 4390  N N   . HIS B 2  95   ? 230.875 146.167 245.637 1.00 370.00 ? 95   HIS B N   1 
ATOM 4391  C CA  . HIS B 2  95   ? 230.964 146.747 246.966 1.00 370.00 ? 95   HIS B CA  1 
ATOM 4392  C C   . HIS B 2  95   ? 230.988 148.258 246.817 1.00 370.00 ? 95   HIS B C   1 
ATOM 4393  O O   . HIS B 2  95   ? 231.771 148.796 246.028 1.00 370.00 ? 95   HIS B O   1 
ATOM 4394  C CB  . HIS B 2  95   ? 232.198 146.259 247.711 1.00 370.00 ? 95   HIS B CB  1 
ATOM 4395  C CG  . HIS B 2  95   ? 232.191 146.611 249.162 1.00 370.00 ? 95   HIS B CG  1 
ATOM 4396  N ND1 . HIS B 2  95   ? 232.707 147.792 249.647 1.00 370.00 ? 95   HIS B ND1 1 
ATOM 4397  C CD2 . HIS B 2  95   ? 231.706 145.943 250.235 1.00 370.00 ? 95   HIS B CD2 1 
ATOM 4398  C CE1 . HIS B 2  95   ? 232.555 147.829 250.958 1.00 370.00 ? 95   HIS B CE1 1 
ATOM 4399  N NE2 . HIS B 2  95   ? 231.948 146.721 251.339 1.00 370.00 ? 95   HIS B NE2 1 
ATOM 4400  N N   . SER B 2  96   ? 230.125 148.935 247.572 1.00 370.00 ? 96   SER B N   1 
ATOM 4401  C CA  . SER B 2  96   ? 229.951 150.370 247.389 1.00 370.00 ? 96   SER B CA  1 
ATOM 4402  C C   . SER B 2  96   ? 231.139 151.158 247.915 1.00 370.00 ? 96   SER B C   1 
ATOM 4403  O O   . SER B 2  96   ? 231.341 152.306 247.511 1.00 370.00 ? 96   SER B O   1 
ATOM 4404  C CB  . SER B 2  96   ? 228.675 150.832 248.080 1.00 370.00 ? 96   SER B CB  1 
ATOM 4405  O OG  . SER B 2  96   ? 228.790 150.673 249.481 1.00 370.00 ? 96   SER B OG  1 
ATOM 4406  N N   . GLU B 2  97   ? 231.923 150.574 248.813 1.00 370.00 ? 97   GLU B N   1 
ATOM 4407  C CA  . GLU B 2  97   ? 233.103 151.221 249.372 1.00 370.00 ? 97   GLU B CA  1 
ATOM 4408  C C   . GLU B 2  97   ? 234.390 150.556 248.903 1.00 370.00 ? 97   GLU B C   1 
ATOM 4409  O O   . GLU B 2  97   ? 235.314 150.348 249.692 1.00 370.00 ? 97   GLU B O   1 
ATOM 4410  C CB  . GLU B 2  97   ? 233.065 151.223 250.895 1.00 370.00 ? 97   GLU B CB  1 
ATOM 4411  C CG  . GLU B 2  97   ? 231.989 152.061 251.516 1.00 370.00 ? 97   GLU B CG  1 
ATOM 4412  C CD  . GLU B 2  97   ? 232.032 151.975 253.023 1.00 370.00 ? 97   GLU B CD  1 
ATOM 4413  O OE1 . GLU B 2  97   ? 232.810 151.150 253.545 1.00 370.00 ? 97   GLU B OE1 1 
ATOM 4414  O OE2 . GLU B 2  97   ? 231.299 152.732 253.687 1.00 370.00 ? 97   GLU B OE2 1 
ATOM 4415  N N   . SER B 2  98   ? 234.457 150.188 247.628 1.00 370.00 ? 98   SER B N   1 
ATOM 4416  C CA  . SER B 2  98   ? 235.717 149.729 247.059 1.00 370.00 ? 98   SER B CA  1 
ATOM 4417  C C   . SER B 2  98   ? 236.678 150.905 247.031 1.00 370.00 ? 98   SER B C   1 
ATOM 4418  O O   . SER B 2  98   ? 236.556 151.798 246.189 1.00 370.00 ? 98   SER B O   1 
ATOM 4419  C CB  . SER B 2  98   ? 235.503 149.161 245.662 1.00 370.00 ? 98   SER B CB  1 
ATOM 4420  O OG  . SER B 2  98   ? 235.111 150.181 244.768 1.00 370.00 ? 98   SER B OG  1 
ATOM 4421  N N   . LYS B 2  99   ? 237.635 150.901 247.959 1.00 370.00 ? 99   LYS B N   1 
ATOM 4422  C CA  . LYS B 2  99   ? 238.474 152.059 248.234 1.00 370.00 ? 99   LYS B CA  1 
ATOM 4423  C C   . LYS B 2  99   ? 239.416 152.413 247.098 1.00 370.00 ? 99   LYS B C   1 
ATOM 4424  O O   . LYS B 2  99   ? 239.996 153.501 247.122 1.00 370.00 ? 99   LYS B O   1 
ATOM 4425  C CB  . LYS B 2  99   ? 239.291 151.817 249.495 1.00 370.00 ? 99   LYS B CB  1 
ATOM 4426  C CG  . LYS B 2  99   ? 238.466 151.741 250.753 1.00 370.00 ? 99   LYS B CG  1 
ATOM 4427  C CD  . LYS B 2  99   ? 239.369 151.528 251.949 1.00 370.00 ? 99   LYS B CD  1 
ATOM 4428  C CE  . LYS B 2  99   ? 238.576 151.431 253.236 1.00 370.00 ? 99   LYS B CE  1 
ATOM 4429  N NZ  . LYS B 2  99   ? 239.469 151.212 254.408 1.00 370.00 ? 99   LYS B NZ  1 
ATOM 4430  N N   . GLN B 2  100  ? 239.566 151.544 246.103 1.00 370.00 ? 100  GLN B N   1 
ATOM 4431  C CA  . GLN B 2  100  ? 240.395 151.815 244.935 1.00 370.00 ? 100  GLN B CA  1 
ATOM 4432  C C   . GLN B 2  100  ? 239.674 152.849 244.081 1.00 370.00 ? 100  GLN B C   1 
ATOM 4433  O O   . GLN B 2  100  ? 239.057 152.545 243.059 1.00 370.00 ? 100  GLN B O   1 
ATOM 4434  C CB  . GLN B 2  100  ? 240.634 150.528 244.170 1.00 370.00 ? 100  GLN B CB  1 
ATOM 4435  C CG  . GLN B 2  100  ? 241.365 149.483 244.969 1.00 370.00 ? 100  GLN B CG  1 
ATOM 4436  C CD  . GLN B 2  100  ? 241.428 148.158 244.247 1.00 370.00 ? 100  GLN B CD  1 
ATOM 4437  O OE1 . GLN B 2  100  ? 240.841 147.998 243.183 1.00 370.00 ? 100  GLN B OE1 1 
ATOM 4438  N NE2 . GLN B 2  100  ? 242.137 147.197 244.823 1.00 370.00 ? 100  GLN B NE2 1 
ATOM 4439  N N   . ARG B 2  101  ? 239.770 154.102 244.507 1.00 370.00 ? 101  ARG B N   1 
ATOM 4440  C CA  . ARG B 2  101  ? 238.936 155.178 243.995 1.00 370.00 ? 101  ARG B CA  1 
ATOM 4441  C C   . ARG B 2  101  ? 239.689 156.034 242.997 1.00 370.00 ? 101  ARG B C   1 
ATOM 4442  O O   . ARG B 2  101  ? 239.562 157.257 242.976 1.00 370.00 ? 101  ARG B O   1 
ATOM 4443  C CB  . ARG B 2  101  ? 238.394 156.033 245.129 1.00 370.00 ? 101  ARG B CB  1 
ATOM 4444  C CG  . ARG B 2  101  ? 237.393 155.295 245.958 1.00 370.00 ? 101  ARG B CG  1 
ATOM 4445  C CD  . ARG B 2  101  ? 236.792 156.184 247.000 1.00 370.00 ? 101  ARG B CD  1 
ATOM 4446  N NE  . ARG B 2  101  ? 235.818 155.453 247.794 1.00 370.00 ? 101  ARG B NE  1 
ATOM 4447  C CZ  . ARG B 2  101  ? 235.142 155.979 248.805 1.00 370.00 ? 101  ARG B CZ  1 
ATOM 4448  N NH1 . ARG B 2  101  ? 235.334 157.245 249.139 1.00 370.00 ? 101  ARG B NH1 1 
ATOM 4449  N NH2 . ARG B 2  101  ? 234.273 155.239 249.478 1.00 370.00 ? 101  ARG B NH2 1 
ATOM 4450  N N   . ASN B 2  102  ? 240.489 155.397 242.174 1.00 370.00 ? 102  ASN B N   1 
ATOM 4451  C CA  . ASN B 2  102  ? 241.265 156.106 241.189 1.00 370.00 ? 102  ASN B CA  1 
ATOM 4452  C C   . ASN B 2  102  ? 240.629 155.901 239.835 1.00 370.00 ? 102  ASN B C   1 
ATOM 4453  O O   . ASN B 2  102  ? 239.524 155.360 239.718 1.00 370.00 ? 102  ASN B O   1 
ATOM 4454  C CB  . ASN B 2  102  ? 242.703 155.626 241.225 1.00 370.00 ? 102  ASN B CB  1 
ATOM 4455  C CG  . ASN B 2  102  ? 243.269 155.725 242.593 1.00 370.00 ? 102  ASN B CG  1 
ATOM 4456  O OD1 . ASN B 2  102  ? 242.837 156.571 243.367 1.00 370.00 ? 102  ASN B OD1 1 
ATOM 4457  N ND2 . ASN B 2  102  ? 244.250 154.892 242.908 1.00 370.00 ? 102  ASN B ND2 1 
ATOM 4458  N N   . LEU B 2  103  ? 241.322 156.369 238.806 1.00 370.00 ? 103  LEU B N   1 
ATOM 4459  C CA  . LEU B 2  103  ? 240.850 156.139 237.454 1.00 370.00 ? 103  LEU B CA  1 
ATOM 4460  C C   . LEU B 2  103  ? 240.898 154.669 237.096 1.00 370.00 ? 103  LEU B C   1 
ATOM 4461  O O   . LEU B 2  103  ? 239.858 154.061 236.842 1.00 370.00 ? 103  LEU B O   1 
ATOM 4462  C CB  . LEU B 2  103  ? 241.687 156.923 236.460 1.00 370.00 ? 103  LEU B CB  1 
ATOM 4463  C CG  . LEU B 2  103  ? 241.253 156.557 235.042 1.00 370.00 ? 103  LEU B CG  1 
ATOM 4464  C CD1 . LEU B 2  103  ? 239.827 157.017 234.771 1.00 370.00 ? 103  LEU B CD1 1 
ATOM 4465  C CD2 . LEU B 2  103  ? 242.229 157.080 234.010 1.00 370.00 ? 103  LEU B CD2 1 
ATOM 4466  N N   . ASN B 2  104  ? 242.097 154.084 237.143 1.00 370.00 ? 104  ASN B N   1 
ATOM 4467  C CA  . ASN B 2  104  ? 242.459 152.963 236.282 1.00 370.00 ? 104  ASN B CA  1 
ATOM 4468  C C   . ASN B 2  104  ? 241.627 151.736 236.590 1.00 370.00 ? 104  ASN B C   1 
ATOM 4469  O O   . ASN B 2  104  ? 241.060 151.109 235.686 1.00 370.00 ? 104  ASN B O   1 
ATOM 4470  C CB  . ASN B 2  104  ? 243.937 152.674 236.472 1.00 370.00 ? 104  ASN B CB  1 
ATOM 4471  C CG  . ASN B 2  104  ? 244.790 153.863 236.132 1.00 370.00 ? 104  ASN B CG  1 
ATOM 4472  O OD1 . ASN B 2  104  ? 244.579 154.517 235.117 1.00 370.00 ? 104  ASN B OD1 1 
ATOM 4473  N ND2 . ASN B 2  104  ? 245.731 154.183 237.004 1.00 370.00 ? 104  ASN B ND2 1 
ATOM 4474  N N   . TYR B 2  105  ? 241.506 151.427 237.878 1.00 370.00 ? 105  TYR B N   1 
ATOM 4475  C CA  . TYR B 2  105  ? 240.623 150.370 238.341 1.00 370.00 ? 105  TYR B CA  1 
ATOM 4476  C C   . TYR B 2  105  ? 239.181 150.621 237.946 1.00 370.00 ? 105  TYR B C   1 
ATOM 4477  O O   . TYR B 2  105  ? 238.492 149.699 237.505 1.00 370.00 ? 105  TYR B O   1 
ATOM 4478  C CB  . TYR B 2  105  ? 240.739 150.244 239.852 1.00 370.00 ? 105  TYR B CB  1 
ATOM 4479  C CG  . TYR B 2  105  ? 239.719 149.329 240.457 1.00 370.00 ? 105  TYR B CG  1 
ATOM 4480  C CD1 . TYR B 2  105  ? 239.767 147.965 240.232 1.00 370.00 ? 105  TYR B CD1 1 
ATOM 4481  C CD2 . TYR B 2  105  ? 238.715 149.830 241.271 1.00 370.00 ? 105  TYR B CD2 1 
ATOM 4482  C CE1 . TYR B 2  105  ? 238.836 147.121 240.800 1.00 370.00 ? 105  TYR B CE1 1 
ATOM 4483  C CE2 . TYR B 2  105  ? 237.782 148.999 241.846 1.00 370.00 ? 105  TYR B CE2 1 
ATOM 4484  C CZ  . TYR B 2  105  ? 237.844 147.645 241.606 1.00 370.00 ? 105  TYR B CZ  1 
ATOM 4485  O OH  . TYR B 2  105  ? 236.910 146.810 242.174 1.00 370.00 ? 105  TYR B OH  1 
ATOM 4486  N N   . PHE B 2  106  ? 238.715 151.864 238.072 1.00 370.00 ? 106  PHE B N   1 
ATOM 4487  C CA  . PHE B 2  106  ? 237.320 152.141 237.761 1.00 370.00 ? 106  PHE B CA  1 
ATOM 4488  C C   . PHE B 2  106  ? 237.047 152.027 236.279 1.00 370.00 ? 106  PHE B C   1 
ATOM 4489  O O   . PHE B 2  106  ? 236.014 151.492 235.878 1.00 370.00 ? 106  PHE B O   1 
ATOM 4490  C CB  . PHE B 2  106  ? 236.906 153.528 238.218 1.00 370.00 ? 106  PHE B CB  1 
ATOM 4491  C CG  . PHE B 2  106  ? 235.510 153.854 237.824 1.00 370.00 ? 106  PHE B CG  1 
ATOM 4492  C CD1 . PHE B 2  106  ? 234.458 153.216 238.444 1.00 370.00 ? 106  PHE B CD1 1 
ATOM 4493  C CD2 . PHE B 2  106  ? 235.238 154.746 236.803 1.00 370.00 ? 106  PHE B CD2 1 
ATOM 4494  C CE1 . PHE B 2  106  ? 233.157 153.476 238.077 1.00 370.00 ? 106  PHE B CE1 1 
ATOM 4495  C CE2 . PHE B 2  106  ? 233.935 155.000 236.425 1.00 370.00 ? 106  PHE B CE2 1 
ATOM 4496  C CZ  . PHE B 2  106  ? 232.896 154.375 237.070 1.00 370.00 ? 106  PHE B CZ  1 
ATOM 4497  N N   . SER B 2  107  ? 237.929 152.601 235.475 1.00 370.00 ? 107  SER B N   1 
ATOM 4498  C CA  . SER B 2  107  ? 237.836 152.522 234.030 1.00 370.00 ? 107  SER B CA  1 
ATOM 4499  C C   . SER B 2  107  ? 237.797 151.081 233.570 1.00 370.00 ? 107  SER B C   1 
ATOM 4500  O O   . SER B 2  107  ? 236.893 150.682 232.832 1.00 370.00 ? 107  SER B O   1 
ATOM 4501  C CB  . SER B 2  107  ? 239.033 153.234 233.417 1.00 370.00 ? 107  SER B CB  1 
ATOM 4502  O OG  . SER B 2  107  ? 240.223 152.569 233.811 1.00 370.00 ? 107  SER B OG  1 
ATOM 4503  N N   . ASN B 2  108  ? 238.745 150.276 234.049 1.00 370.00 ? 108  ASN B N   1 
ATOM 4504  C CA  . ASN B 2  108  ? 238.827 148.887 233.625 1.00 370.00 ? 108  ASN B CA  1 
ATOM 4505  C C   . ASN B 2  108  ? 237.633 148.094 234.115 1.00 370.00 ? 108  ASN B C   1 
ATOM 4506  O O   . ASN B 2  108  ? 237.053 147.306 233.360 1.00 370.00 ? 108  ASN B O   1 
ATOM 4507  C CB  . ASN B 2  108  ? 240.116 148.282 234.153 1.00 370.00 ? 108  ASN B CB  1 
ATOM 4508  C CG  . ASN B 2  108  ? 241.324 148.937 233.569 1.00 370.00 ? 108  ASN B CG  1 
ATOM 4509  O OD1 . ASN B 2  108  ? 241.411 149.125 232.362 1.00 370.00 ? 108  ASN B OD1 1 
ATOM 4510  N ND2 . ASN B 2  108  ? 242.239 149.363 234.429 1.00 370.00 ? 108  ASN B ND2 1 
ATOM 4511  N N   . ALA B 2  109  ? 237.233 148.327 235.364 1.00 370.00 ? 109  ALA B N   1 
ATOM 4512  C CA  . ALA B 2  109  ? 236.129 147.595 235.953 1.00 370.00 ? 109  ALA B CA  1 
ATOM 4513  C C   . ALA B 2  109  ? 234.824 147.957 235.278 1.00 370.00 ? 109  ALA B C   1 
ATOM 4514  O O   . ALA B 2  109  ? 234.019 147.079 234.965 1.00 370.00 ? 109  ALA B O   1 
ATOM 4515  C CB  . ALA B 2  109  ? 236.061 147.891 237.449 1.00 370.00 ? 109  ALA B CB  1 
ATOM 4516  N N   . TYR B 2  110  ? 234.626 149.239 235.008 1.00 370.00 ? 110  TYR B N   1 
ATOM 4517  C CA  . TYR B 2  110  ? 233.426 149.692 234.337 1.00 370.00 ? 110  TYR B CA  1 
ATOM 4518  C C   . TYR B 2  110  ? 233.401 149.208 232.901 1.00 370.00 ? 110  TYR B C   1 
ATOM 4519  O O   . TYR B 2  110  ? 232.340 148.861 232.376 1.00 370.00 ? 110  TYR B O   1 
ATOM 4520  C CB  . TYR B 2  110  ? 233.374 151.211 234.412 1.00 370.00 ? 110  TYR B CB  1 
ATOM 4521  C CG  . TYR B 2  110  ? 232.139 151.816 233.824 1.00 370.00 ? 110  TYR B CG  1 
ATOM 4522  C CD1 . TYR B 2  110  ? 230.927 151.724 234.481 1.00 370.00 ? 110  TYR B CD1 1 
ATOM 4523  C CD2 . TYR B 2  110  ? 232.186 152.504 232.623 1.00 370.00 ? 110  TYR B CD2 1 
ATOM 4524  C CE1 . TYR B 2  110  ? 229.788 152.287 233.949 1.00 370.00 ? 110  TYR B CE1 1 
ATOM 4525  C CE2 . TYR B 2  110  ? 231.053 153.072 232.086 1.00 370.00 ? 110  TYR B CE2 1 
ATOM 4526  C CZ  . TYR B 2  110  ? 229.858 152.960 232.754 1.00 370.00 ? 110  TYR B CZ  1 
ATOM 4527  O OH  . TYR B 2  110  ? 228.722 153.518 232.227 1.00 370.00 ? 110  TYR B OH  1 
ATOM 4528  N N   . ALA B 2  111  ? 234.573 149.135 232.273 1.00 370.00 ? 111  ALA B N   1 
ATOM 4529  C CA  . ALA B 2  111  ? 234.662 148.649 230.907 1.00 370.00 ? 111  ALA B CA  1 
ATOM 4530  C C   . ALA B 2  111  ? 234.276 147.185 230.834 1.00 370.00 ? 111  ALA B C   1 
ATOM 4531  O O   . ALA B 2  111  ? 233.451 146.787 230.002 1.00 370.00 ? 111  ALA B O   1 
ATOM 4532  C CB  . ALA B 2  111  ? 236.080 148.858 230.382 1.00 370.00 ? 111  ALA B CB  1 
ATOM 4533  N N   . ALA B 2  112  ? 234.834 146.382 231.737 1.00 370.00 ? 112  ALA B N   1 
ATOM 4534  C CA  . ALA B 2  112  ? 234.495 144.969 231.790 1.00 370.00 ? 112  ALA B CA  1 
ATOM 4535  C C   . ALA B 2  112  ? 233.042 144.781 232.172 1.00 370.00 ? 112  ALA B C   1 
ATOM 4536  O O   . ALA B 2  112  ? 232.364 143.892 231.645 1.00 370.00 ? 112  ALA B O   1 
ATOM 4537  C CB  . ALA B 2  112  ? 235.403 144.250 232.781 1.00 370.00 ? 112  ALA B CB  1 
ATOM 4538  N N   . ALA B 2  113  ? 232.539 145.661 233.038 1.00 370.00 ? 113  ALA B N   1 
ATOM 4539  C CA  . ALA B 2  113  ? 231.170 145.576 233.512 1.00 370.00 ? 113  ALA B CA  1 
ATOM 4540  C C   . ALA B 2  113  ? 230.197 145.771 232.375 1.00 370.00 ? 113  ALA B C   1 
ATOM 4541  O O   . ALA B 2  113  ? 229.360 144.908 232.111 1.00 370.00 ? 113  ALA B O   1 
ATOM 4542  C CB  . ALA B 2  113  ? 230.932 146.626 234.594 1.00 370.00 ? 113  ALA B CB  1 
ATOM 4543  N N   . VAL B 2  114  ? 230.345 146.864 231.641 1.00 370.00 ? 114  VAL B N   1 
ATOM 4544  C CA  . VAL B 2  114  ? 229.357 147.140 230.622 1.00 370.00 ? 114  VAL B CA  1 
ATOM 4545  C C   . VAL B 2  114  ? 229.608 146.294 229.379 1.00 370.00 ? 114  VAL B C   1 
ATOM 4546  O O   . VAL B 2  114  ? 228.673 146.050 228.605 1.00 370.00 ? 114  VAL B O   1 
ATOM 4547  C CB  . VAL B 2  114  ? 229.334 148.655 230.386 1.00 370.00 ? 114  VAL B CB  1 
ATOM 4548  C CG1 . VAL B 2  114  ? 228.155 149.045 229.547 1.00 370.00 ? 114  VAL B CG1 1 
ATOM 4549  C CG2 . VAL B 2  114  ? 229.235 149.359 231.715 1.00 370.00 ? 114  VAL B CG2 1 
ATOM 4550  N N   . SER B 2  115  ? 230.825 145.764 229.204 1.00 370.00 ? 115  SER B N   1 
ATOM 4551  C CA  . SER B 2  115  ? 231.009 144.720 228.205 1.00 370.00 ? 115  SER B CA  1 
ATOM 4552  C C   . SER B 2  115  ? 230.237 143.467 228.582 1.00 370.00 ? 115  SER B C   1 
ATOM 4553  O O   . SER B 2  115  ? 229.660 142.808 227.711 1.00 370.00 ? 115  SER B O   1 
ATOM 4554  C CB  . SER B 2  115  ? 232.487 144.387 228.045 1.00 370.00 ? 115  SER B CB  1 
ATOM 4555  O OG  . SER B 2  115  ? 232.958 143.723 229.196 1.00 370.00 ? 115  SER B OG  1 
ATOM 4556  N N   . ALA B 2  116  ? 230.190 143.147 229.874 1.00 370.00 ? 116  ALA B N   1 
ATOM 4557  C CA  . ALA B 2  116  ? 229.374 142.029 230.318 1.00 370.00 ? 116  ALA B CA  1 
ATOM 4558  C C   . ALA B 2  116  ? 227.893 142.345 230.205 1.00 370.00 ? 116  ALA B C   1 
ATOM 4559  O O   . ALA B 2  116  ? 227.085 141.434 229.994 1.00 370.00 ? 116  ALA B O   1 
ATOM 4560  C CB  . ALA B 2  116  ? 229.734 141.657 231.753 1.00 370.00 ? 116  ALA B CB  1 
ATOM 4561  N N   . VAL B 2  117  ? 227.526 143.622 230.335 1.00 370.00 ? 117  VAL B N   1 
ATOM 4562  C CA  . VAL B 2  117  ? 226.135 144.020 230.151 1.00 370.00 ? 117  VAL B CA  1 
ATOM 4563  C C   . VAL B 2  117  ? 225.713 143.777 228.715 1.00 370.00 ? 117  VAL B C   1 
ATOM 4564  O O   . VAL B 2  117  ? 224.571 143.387 228.444 1.00 370.00 ? 117  VAL B O   1 
ATOM 4565  C CB  . VAL B 2  117  ? 225.942 145.491 230.563 1.00 370.00 ? 117  VAL B CB  1 
ATOM 4566  C CG1 . VAL B 2  117  ? 224.521 145.974 230.290 1.00 370.00 ? 117  VAL B CG1 1 
ATOM 4567  C CG2 . VAL B 2  117  ? 226.228 145.662 232.023 1.00 370.00 ? 117  VAL B CG2 1 
ATOM 4568  N N   . ASP B 2  118  ? 226.641 143.953 227.788 1.00 370.00 ? 118  ASP B N   1 
ATOM 4569  C CA  . ASP B 2  118  ? 226.377 143.652 226.399 1.00 370.00 ? 118  ASP B CA  1 
ATOM 4570  C C   . ASP B 2  118  ? 226.160 142.162 226.226 1.00 370.00 ? 118  ASP B C   1 
ATOM 4571  O O   . ASP B 2  118  ? 226.940 141.364 226.753 1.00 370.00 ? 118  ASP B O   1 
ATOM 4572  C CB  . ASP B 2  118  ? 227.539 144.092 225.535 1.00 370.00 ? 118  ASP B CB  1 
ATOM 4573  C CG  . ASP B 2  118  ? 227.692 145.563 225.527 1.00 370.00 ? 118  ASP B CG  1 
ATOM 4574  O OD1 . ASP B 2  118  ? 226.656 146.248 225.616 1.00 370.00 ? 118  ASP B OD1 1 
ATOM 4575  O OD2 . ASP B 2  118  ? 228.841 146.039 225.475 1.00 370.00 ? 118  ASP B OD2 1 
ATOM 4576  N N   . PRO B 2  119  ? 225.104 141.750 225.527 1.00 370.00 ? 119  PRO B N   1 
ATOM 4577  C CA  . PRO B 2  119  ? 224.957 140.344 225.148 1.00 370.00 ? 119  PRO B CA  1 
ATOM 4578  C C   . PRO B 2  119  ? 225.876 139.869 224.038 1.00 370.00 ? 119  PRO B C   1 
ATOM 4579  O O   . PRO B 2  119  ? 225.680 138.748 223.564 1.00 370.00 ? 119  PRO B O   1 
ATOM 4580  C CB  . PRO B 2  119  ? 223.496 140.262 224.702 1.00 370.00 ? 119  PRO B CB  1 
ATOM 4581  C CG  . PRO B 2  119  ? 223.084 141.653 224.458 1.00 370.00 ? 119  PRO B CG  1 
ATOM 4582  C CD  . PRO B 2  119  ? 223.823 142.461 225.441 1.00 370.00 ? 119  PRO B CD  1 
ATOM 4583  N N   . ASP B 2  120  ? 226.926 140.598 223.646 1.00 370.00 ? 120  ASP B N   1 
ATOM 4584  C CA  . ASP B 2  120  ? 227.838 140.077 222.630 1.00 370.00 ? 120  ASP B CA  1 
ATOM 4585  C C   . ASP B 2  120  ? 228.822 139.063 223.200 1.00 370.00 ? 120  ASP B C   1 
ATOM 4586  O O   . ASP B 2  120  ? 230.017 139.119 222.897 1.00 370.00 ? 120  ASP B O   1 
ATOM 4587  C CB  . ASP B 2  120  ? 228.626 141.216 221.990 1.00 370.00 ? 120  ASP B CB  1 
ATOM 4588  C CG  . ASP B 2  120  ? 227.790 142.054 221.072 1.00 370.00 ? 120  ASP B CG  1 
ATOM 4589  O OD1 . ASP B 2  120  ? 226.923 141.497 220.383 1.00 370.00 ? 120  ASP B OD1 1 
ATOM 4590  O OD2 . ASP B 2  120  ? 227.963 143.287 221.077 1.00 370.00 ? 120  ASP B OD2 1 
ATOM 4591  N N   . ALA B 2  121  ? 228.289 138.113 223.974 1.00 370.00 ? 121  ALA B N   1 
ATOM 4592  C CA  . ALA B 2  121  ? 228.905 136.980 224.647 1.00 370.00 ? 121  ALA B CA  1 
ATOM 4593  C C   . ALA B 2  121  ? 227.789 136.306 225.434 1.00 370.00 ? 121  ALA B C   1 
ATOM 4594  O O   . ALA B 2  121  ? 226.683 136.850 225.521 1.00 370.00 ? 121  ALA B O   1 
ATOM 4595  C CB  . ALA B 2  121  ? 230.040 137.391 225.586 1.00 370.00 ? 121  ALA B CB  1 
ATOM 4596  N N   . GLY B 2  122  ? 228.063 135.148 226.029 1.00 370.00 ? 122  GLY B N   1 
ATOM 4597  C CA  . GLY B 2  122  ? 227.106 134.547 226.938 1.00 370.00 ? 122  GLY B CA  1 
ATOM 4598  C C   . GLY B 2  122  ? 227.031 135.342 228.224 1.00 370.00 ? 122  GLY B C   1 
ATOM 4599  O O   . GLY B 2  122  ? 227.944 135.287 229.051 1.00 370.00 ? 122  GLY B O   1 
ATOM 4600  N N   . ASN B 2  123  ? 225.936 136.072 228.411 1.00 370.00 ? 123  ASN B N   1 
ATOM 4601  C CA  . ASN B 2  123  ? 225.870 137.117 229.419 1.00 370.00 ? 123  ASN B CA  1 
ATOM 4602  C C   . ASN B 2  123  ? 224.518 137.036 230.113 1.00 370.00 ? 123  ASN B C   1 
ATOM 4603  O O   . ASN B 2  123  ? 223.780 136.055 229.970 1.00 370.00 ? 123  ASN B O   1 
ATOM 4604  C CB  . ASN B 2  123  ? 226.085 138.486 228.767 1.00 370.00 ? 123  ASN B CB  1 
ATOM 4605  C CG  . ASN B 2  123  ? 227.464 138.648 228.200 1.00 370.00 ? 123  ASN B CG  1 
ATOM 4606  O OD1 . ASN B 2  123  ? 228.452 138.314 228.842 1.00 370.00 ? 123  ASN B OD1 1 
ATOM 4607  N ND2 . ASN B 2  123  ? 227.540 139.134 226.975 1.00 370.00 ? 123  ASN B ND2 1 
ATOM 4608  N N   . GLY B 2  124  ? 224.193 138.079 230.875 1.00 370.00 ? 124  GLY B N   1 
ATOM 4609  C CA  . GLY B 2  124  ? 222.849 138.208 231.398 1.00 370.00 ? 124  GLY B CA  1 
ATOM 4610  C C   . GLY B 2  124  ? 222.453 139.575 231.919 1.00 370.00 ? 124  GLY B C   1 
ATOM 4611  O O   . GLY B 2  124  ? 223.108 140.148 232.795 1.00 370.00 ? 124  GLY B O   1 
ATOM 4612  N N   . GLU B 2  125  ? 221.367 140.097 231.374 1.00 370.00 ? 125  GLU B N   1 
ATOM 4613  C CA  . GLU B 2  125  ? 220.585 141.190 231.927 1.00 370.00 ? 125  GLU B CA  1 
ATOM 4614  C C   . GLU B 2  125  ? 219.121 140.825 232.007 1.00 370.00 ? 125  GLU B C   1 
ATOM 4615  O O   . GLU B 2  125  ? 218.471 141.106 233.015 1.00 370.00 ? 125  GLU B O   1 
ATOM 4616  C CB  . GLU B 2  125  ? 220.730 142.452 231.075 1.00 370.00 ? 125  GLU B CB  1 
ATOM 4617  C CG  . GLU B 2  125  ? 222.131 142.987 230.995 1.00 370.00 ? 125  GLU B CG  1 
ATOM 4618  C CD  . GLU B 2  125  ? 222.647 143.475 232.315 1.00 370.00 ? 125  GLU B CD  1 
ATOM 4619  O OE1 . GLU B 2  125  ? 221.853 144.002 233.120 1.00 370.00 ? 125  GLU B OE1 1 
ATOM 4620  O OE2 . GLU B 2  125  ? 223.861 143.325 232.541 1.00 370.00 ? 125  GLU B OE2 1 
ATOM 4621  N N   . LEU B 2  126  ? 218.594 140.193 230.967 1.00 370.00 ? 126  LEU B N   1 
ATOM 4622  C CA  . LEU B 2  126  ? 217.233 139.685 230.935 1.00 370.00 ? 126  LEU B CA  1 
ATOM 4623  C C   . LEU B 2  126  ? 217.341 138.274 230.412 1.00 370.00 ? 126  LEU B C   1 
ATOM 4624  O O   . LEU B 2  126  ? 217.143 138.069 229.222 1.00 370.00 ? 126  LEU B O   1 
ATOM 4625  C CB  . LEU B 2  126  ? 216.359 140.517 230.053 1.00 370.00 ? 126  LEU B CB  1 
ATOM 4626  C CG  . LEU B 2  126  ? 216.182 141.972 230.439 1.00 370.00 ? 126  LEU B CG  1 
ATOM 4627  C CD1 . LEU B 2  126  ? 215.372 142.662 229.373 1.00 370.00 ? 126  LEU B CD1 1 
ATOM 4628  C CD2 . LEU B 2  126  ? 215.510 142.067 231.786 1.00 370.00 ? 126  LEU B CD2 1 
ATOM 4629  N N   . CYS B 2  127  ? 217.646 137.322 231.281 1.00 370.00 ? 127  CYS B N   1 
ATOM 4630  C CA  . CYS B 2  127  ? 217.739 135.922 230.878 1.00 370.00 ? 127  CYS B CA  1 
ATOM 4631  C C   . CYS B 2  127  ? 216.494 135.193 231.354 1.00 370.00 ? 127  CYS B C   1 
ATOM 4632  O O   . CYS B 2  127  ? 216.457 134.619 232.442 1.00 370.00 ? 127  CYS B O   1 
ATOM 4633  C CB  . CYS B 2  127  ? 218.994 135.256 231.397 1.00 370.00 ? 127  CYS B CB  1 
ATOM 4634  S SG  . CYS B 2  127  ? 220.469 135.685 230.483 1.00 370.00 ? 127  CYS B SG  1 
ATOM 4635  N N   . ILE B 2  128  ? 215.472 135.218 230.513 1.00 370.00 ? 128  ILE B N   1 
ATOM 4636  C CA  . ILE B 2  128  ? 214.384 134.270 230.652 1.00 370.00 ? 128  ILE B CA  1 
ATOM 4637  C C   . ILE B 2  128  ? 214.911 132.874 230.364 1.00 370.00 ? 128  ILE B C   1 
ATOM 4638  O O   . ILE B 2  128  ? 215.521 132.630 229.321 1.00 370.00 ? 128  ILE B O   1 
ATOM 4639  C CB  . ILE B 2  128  ? 213.230 134.643 229.715 1.00 370.00 ? 128  ILE B CB  1 
ATOM 4640  C CG1 . ILE B 2  128  ? 212.220 133.500 229.659 1.00 370.00 ? 128  ILE B CG1 1 
ATOM 4641  C CG2 . ILE B 2  128  ? 213.736 135.112 228.346 1.00 370.00 ? 128  ILE B CG2 1 
ATOM 4642  C CD1 . ILE B 2  128  ? 210.990 133.843 228.920 1.00 370.00 ? 128  ILE B CD1 1 
ATOM 4643  N N   . LYS B 2  129  ? 214.713 131.955 231.298 1.00 370.00 ? 129  LYS B N   1 
ATOM 4644  C CA  . LYS B 2  129  ? 215.146 130.587 231.070 1.00 370.00 ? 129  LYS B CA  1 
ATOM 4645  C C   . LYS B 2  129  ? 214.037 129.817 230.374 1.00 370.00 ? 129  LYS B C   1 
ATOM 4646  O O   . LYS B 2  129  ? 212.870 129.895 230.768 1.00 370.00 ? 129  LYS B O   1 
ATOM 4647  C CB  . LYS B 2  129  ? 215.546 129.892 232.370 1.00 370.00 ? 129  LYS B CB  1 
ATOM 4648  C CG  . LYS B 2  129  ? 216.770 130.498 233.029 1.00 370.00 ? 129  LYS B CG  1 
ATOM 4649  C CD  . LYS B 2  129  ? 217.269 129.658 234.199 1.00 370.00 ? 129  LYS B CD  1 
ATOM 4650  C CE  . LYS B 2  129  ? 218.515 130.270 234.833 1.00 370.00 ? 129  LYS B CE  1 
ATOM 4651  N NZ  . LYS B 2  129  ? 219.074 129.460 235.952 1.00 370.00 ? 129  LYS B NZ  1 
ATOM 4652  N N   . VAL B 2  130  ? 214.407 129.095 229.332 1.00 370.00 ? 130  VAL B N   1 
ATOM 4653  C CA  . VAL B 2  130  ? 213.458 128.242 228.614 1.00 370.00 ? 130  VAL B CA  1 
ATOM 4654  C C   . VAL B 2  130  ? 213.133 127.025 229.472 1.00 370.00 ? 130  VAL B C   1 
ATOM 4655  O O   . VAL B 2  130  ? 214.058 126.354 229.959 1.00 370.00 ? 130  VAL B O   1 
ATOM 4656  C CB  . VAL B 2  130  ? 214.052 127.825 227.273 1.00 370.00 ? 130  VAL B CB  1 
ATOM 4657  C CG1 . VAL B 2  130  ? 213.176 126.818 226.589 1.00 370.00 ? 130  VAL B CG1 1 
ATOM 4658  C CG2 . VAL B 2  130  ? 214.221 129.028 226.401 1.00 370.00 ? 130  VAL B CG2 1 
ATOM 4659  N N   . PRO B 2  131  ? 211.861 126.698 229.692 1.00 370.00 ? 131  PRO B N   1 
ATOM 4660  C CA  . PRO B 2  131  ? 211.539 125.468 230.417 1.00 370.00 ? 131  PRO B CA  1 
ATOM 4661  C C   . PRO B 2  131  ? 211.800 124.246 229.557 1.00 370.00 ? 131  PRO B C   1 
ATOM 4662  O O   . PRO B 2  131  ? 211.909 124.324 228.332 1.00 370.00 ? 131  PRO B O   1 
ATOM 4663  C CB  . PRO B 2  131  ? 210.048 125.616 230.728 1.00 370.00 ? 131  PRO B CB  1 
ATOM 4664  C CG  . PRO B 2  131  ? 209.544 126.466 229.647 1.00 370.00 ? 131  PRO B CG  1 
ATOM 4665  C CD  . PRO B 2  131  ? 210.649 127.428 229.296 1.00 370.00 ? 131  PRO B CD  1 
ATOM 4666  N N   . SER B 2  132  ? 211.891 123.099 230.235 1.00 370.00 ? 132  SER B N   1 
ATOM 4667  C CA  . SER B 2  132  ? 212.247 121.847 229.575 1.00 370.00 ? 132  SER B CA  1 
ATOM 4668  C C   . SER B 2  132  ? 211.191 121.415 228.573 1.00 370.00 ? 132  SER B C   1 
ATOM 4669  O O   . SER B 2  132  ? 211.515 120.745 227.586 1.00 370.00 ? 132  SER B O   1 
ATOM 4670  C CB  . SER B 2  132  ? 212.452 120.751 230.615 1.00 370.00 ? 132  SER B CB  1 
ATOM 4671  O OG  . SER B 2  132  ? 211.230 120.453 231.266 1.00 370.00 ? 132  SER B OG  1 
ATOM 4672  N N   . GLU B 2  133  ? 209.934 121.779 228.827 1.00 370.00 ? 133  GLU B N   1 
ATOM 4673  C CA  . GLU B 2  133  ? 208.876 121.644 227.836 1.00 370.00 ? 133  GLU B CA  1 
ATOM 4674  C C   . GLU B 2  133  ? 209.234 122.401 226.571 1.00 370.00 ? 133  GLU B C   1 
ATOM 4675  O O   . GLU B 2  133  ? 209.412 121.815 225.493 1.00 370.00 ? 133  GLU B O   1 
ATOM 4676  C CB  . GLU B 2  133  ? 207.582 122.195 228.417 1.00 370.00 ? 133  GLU B CB  1 
ATOM 4677  C CG  . GLU B 2  133  ? 207.122 121.493 229.661 1.00 370.00 ? 133  GLU B CG  1 
ATOM 4678  C CD  . GLU B 2  133  ? 205.938 122.185 230.285 1.00 370.00 ? 133  GLU B CD  1 
ATOM 4679  O OE1 . GLU B 2  133  ? 205.584 123.286 229.812 1.00 370.00 ? 133  GLU B OE1 1 
ATOM 4680  O OE2 . GLU B 2  133  ? 205.364 121.635 231.246 1.00 370.00 ? 133  GLU B OE2 1 
ATOM 4681  N N   . LEU B 2  134  ? 209.399 123.714 226.708 1.00 370.00 ? 134  LEU B N   1 
ATOM 4682  C CA  . LEU B 2  134  ? 209.790 124.534 225.580 1.00 370.00 ? 134  LEU B CA  1 
ATOM 4683  C C   . LEU B 2  134  ? 211.201 124.219 225.102 1.00 370.00 ? 134  LEU B C   1 
ATOM 4684  O O   . LEU B 2  134  ? 211.505 124.472 223.936 1.00 370.00 ? 134  LEU B O   1 
ATOM 4685  C CB  . LEU B 2  134  ? 209.643 126.014 225.939 1.00 370.00 ? 134  LEU B CB  1 
ATOM 4686  C CG  . LEU B 2  134  ? 208.203 126.485 226.170 1.00 370.00 ? 134  LEU B CG  1 
ATOM 4687  C CD1 . LEU B 2  134  ? 208.132 127.954 226.581 1.00 370.00 ? 134  LEU B CD1 1 
ATOM 4688  C CD2 . LEU B 2  134  ? 207.353 126.238 224.938 1.00 370.00 ? 134  LEU B CD2 1 
ATOM 4689  N N   . TRP B 2  135  ? 212.051 123.618 225.941 1.00 370.00 ? 135  TRP B N   1 
ATOM 4690  C CA  . TRP B 2  135  ? 213.338 123.151 225.433 1.00 370.00 ? 135  TRP B CA  1 
ATOM 4691  C C   . TRP B 2  135  ? 213.172 121.966 224.489 1.00 370.00 ? 135  TRP B C   1 
ATOM 4692  O O   . TRP B 2  135  ? 213.864 121.876 223.469 1.00 370.00 ? 135  TRP B O   1 
ATOM 4693  C CB  . TRP B 2  135  ? 214.279 122.770 226.568 1.00 370.00 ? 135  TRP B CB  1 
ATOM 4694  C CG  . TRP B 2  135  ? 215.543 122.239 226.002 1.00 370.00 ? 135  TRP B CG  1 
ATOM 4695  C CD1 . TRP B 2  135  ? 216.496 122.941 225.324 1.00 370.00 ? 135  TRP B CD1 1 
ATOM 4696  C CD2 . TRP B 2  135  ? 215.949 120.869 225.962 1.00 370.00 ? 135  TRP B CD2 1 
ATOM 4697  N NE1 . TRP B 2  135  ? 217.494 122.098 224.907 1.00 370.00 ? 135  TRP B NE1 1 
ATOM 4698  C CE2 . TRP B 2  135  ? 217.179 120.819 225.281 1.00 370.00 ? 135  TRP B CE2 1 
ATOM 4699  C CE3 . TRP B 2  135  ? 215.399 119.681 226.452 1.00 370.00 ? 135  TRP B CE3 1 
ATOM 4700  C CZ2 . TRP B 2  135  ? 217.877 119.633 225.089 1.00 370.00 ? 135  TRP B CZ2 1 
ATOM 4701  C CZ3 . TRP B 2  135  ? 216.091 118.504 226.260 1.00 370.00 ? 135  TRP B CZ3 1 
ATOM 4702  C CH2 . TRP B 2  135  ? 217.317 118.487 225.582 1.00 370.00 ? 135  TRP B CH2 1 
ATOM 4703  N N   . LYS B 2  136  ? 212.270 121.040 224.813 1.00 370.00 ? 136  LYS B N   1 
ATOM 4704  C CA  . LYS B 2  136  ? 211.979 119.965 223.875 1.00 370.00 ? 136  LYS B CA  1 
ATOM 4705  C C   . LYS B 2  136  ? 211.316 120.499 222.621 1.00 370.00 ? 136  LYS B C   1 
ATOM 4706  O O   . LYS B 2  136  ? 211.493 119.935 221.538 1.00 370.00 ? 136  LYS B O   1 
ATOM 4707  C CB  . LYS B 2  136  ? 211.099 118.913 224.532 1.00 370.00 ? 136  LYS B CB  1 
ATOM 4708  C CG  . LYS B 2  136  ? 211.814 118.127 225.599 1.00 370.00 ? 136  LYS B CG  1 
ATOM 4709  C CD  . LYS B 2  136  ? 210.895 117.098 226.219 1.00 370.00 ? 136  LYS B CD  1 
ATOM 4710  C CE  . LYS B 2  136  ? 211.600 116.336 227.325 1.00 370.00 ? 136  LYS B CE  1 
ATOM 4711  N NZ  . LYS B 2  136  ? 210.709 115.330 227.965 1.00 370.00 ? 136  LYS B NZ  1 
ATOM 4712  N N   . HIS B 2  137  ? 210.575 121.597 222.747 1.00 370.00 ? 137  HIS B N   1 
ATOM 4713  C CA  . HIS B 2  137  ? 210.075 122.266 221.552 1.00 370.00 ? 137  HIS B CA  1 
ATOM 4714  C C   . HIS B 2  137  ? 211.206 122.872 220.728 1.00 370.00 ? 137  HIS B C   1 
ATOM 4715  O O   . HIS B 2  137  ? 211.130 122.883 219.499 1.00 370.00 ? 137  HIS B O   1 
ATOM 4716  C CB  . HIS B 2  137  ? 209.054 123.333 221.924 1.00 370.00 ? 137  HIS B CB  1 
ATOM 4717  C CG  . HIS B 2  137  ? 207.774 122.774 222.452 1.00 370.00 ? 137  HIS B CG  1 
ATOM 4718  N ND1 . HIS B 2  137  ? 206.896 122.066 221.660 1.00 370.00 ? 137  HIS B ND1 1 
ATOM 4719  C CD2 . HIS B 2  137  ? 207.203 122.846 223.677 1.00 370.00 ? 137  HIS B CD2 1 
ATOM 4720  C CE1 . HIS B 2  137  ? 205.851 121.705 222.382 1.00 370.00 ? 137  HIS B CE1 1 
ATOM 4721  N NE2 . HIS B 2  137  ? 206.013 122.165 223.610 1.00 370.00 ? 137  HIS B NE2 1 
ATOM 4722  N N   . VAL B 2  138  ? 212.243 123.402 221.388 1.00 370.00 ? 138  VAL B N   1 
ATOM 4723  C CA  . VAL B 2  138  ? 213.440 123.880 220.689 1.00 370.00 ? 138  VAL B CA  1 
ATOM 4724  C C   . VAL B 2  138  ? 214.105 122.737 219.946 1.00 370.00 ? 138  VAL B C   1 
ATOM 4725  O O   . VAL B 2  138  ? 214.532 122.881 218.792 1.00 370.00 ? 138  VAL B O   1 
ATOM 4726  C CB  . VAL B 2  138  ? 214.416 124.541 221.684 1.00 370.00 ? 138  VAL B CB  1 
ATOM 4727  C CG1 . VAL B 2  138  ? 215.798 124.755 221.071 1.00 370.00 ? 138  VAL B CG1 1 
ATOM 4728  C CG2 . VAL B 2  138  ? 213.870 125.862 222.148 1.00 370.00 ? 138  VAL B CG2 1 
ATOM 4729  N N   . ASP B 2  139  ? 214.166 121.574 220.597 1.00 370.00 ? 139  ASP B N   1 
ATOM 4730  C CA  . ASP B 2  139  ? 214.635 120.356 219.952 1.00 370.00 ? 139  ASP B CA  1 
ATOM 4731  C C   . ASP B 2  139  ? 213.772 120.008 218.749 1.00 370.00 ? 139  ASP B C   1 
ATOM 4732  O O   . ASP B 2  139  ? 214.273 119.483 217.750 1.00 370.00 ? 139  ASP B O   1 
ATOM 4733  C CB  . ASP B 2  139  ? 214.617 119.208 220.954 1.00 370.00 ? 139  ASP B CB  1 
ATOM 4734  C CG  . ASP B 2  139  ? 215.387 119.528 222.207 1.00 370.00 ? 139  ASP B CG  1 
ATOM 4735  O OD1 . ASP B 2  139  ? 216.303 120.373 222.148 1.00 370.00 ? 139  ASP B OD1 1 
ATOM 4736  O OD2 . ASP B 2  139  ? 215.063 118.947 223.261 1.00 370.00 ? 139  ASP B OD2 1 
ATOM 4737  N N   . GLU B 2  140  ? 212.482 120.321 218.823 1.00 370.00 ? 140  GLU B N   1 
ATOM 4738  C CA  . GLU B 2  140  ? 211.599 120.161 217.679 1.00 370.00 ? 140  GLU B CA  1 
ATOM 4739  C C   . GLU B 2  140  ? 211.696 121.350 216.727 1.00 370.00 ? 140  GLU B C   1 
ATOM 4740  O O   . GLU B 2  140  ? 212.165 121.215 215.593 1.00 370.00 ? 140  GLU B O   1 
ATOM 4741  C CB  . GLU B 2  140  ? 210.170 119.984 218.189 1.00 370.00 ? 140  GLU B CB  1 
ATOM 4742  C CG  . GLU B 2  140  ? 209.982 118.703 218.976 1.00 370.00 ? 140  GLU B CG  1 
ATOM 4743  C CD  . GLU B 2  140  ? 208.693 118.691 219.763 1.00 370.00 ? 140  GLU B CD  1 
ATOM 4744  O OE1 . GLU B 2  140  ? 208.012 119.737 219.799 1.00 370.00 ? 140  GLU B OE1 1 
ATOM 4745  O OE2 . GLU B 2  140  ? 208.371 117.644 220.361 1.00 370.00 ? 140  GLU B OE2 1 
ATOM 4746  N N   . LEU B 2  141  ? 211.293 122.533 217.187 1.00 370.00 ? 141  LEU B N   1 
ATOM 4747  C CA  . LEU B 2  141  ? 211.122 123.695 216.323 1.00 370.00 ? 141  LEU B CA  1 
ATOM 4748  C C   . LEU B 2  141  ? 211.793 124.901 216.949 1.00 370.00 ? 141  LEU B C   1 
ATOM 4749  O O   . LEU B 2  141  ? 211.452 125.296 218.067 1.00 370.00 ? 141  LEU B O   1 
ATOM 4750  C CB  . LEU B 2  141  ? 209.643 124.003 216.091 1.00 370.00 ? 141  LEU B CB  1 
ATOM 4751  C CG  . LEU B 2  141  ? 208.837 123.005 215.271 1.00 370.00 ? 141  LEU B CG  1 
ATOM 4752  C CD1 . LEU B 2  141  ? 207.377 123.420 215.251 1.00 370.00 ? 141  LEU B CD1 1 
ATOM 4753  C CD2 . LEU B 2  141  ? 209.398 122.920 213.864 1.00 370.00 ? 141  LEU B CD2 1 
ATOM 4754  N N   . LYS B 2  142  ? 212.708 125.508 216.218 1.00 370.00 ? 142  LYS B N   1 
ATOM 4755  C CA  . LYS B 2  142  ? 213.333 126.742 216.671 1.00 370.00 ? 142  LYS B CA  1 
ATOM 4756  C C   . LYS B 2  142  ? 212.664 127.944 216.008 1.00 370.00 ? 142  LYS B C   1 
ATOM 4757  O O   . LYS B 2  142  ? 213.253 128.674 215.213 1.00 370.00 ? 142  LYS B O   1 
ATOM 4758  C CB  . LYS B 2  142  ? 214.827 126.686 216.400 1.00 370.00 ? 142  LYS B CB  1 
ATOM 4759  C CG  . LYS B 2  142  ? 215.460 125.562 217.186 1.00 370.00 ? 142  LYS B CG  1 
ATOM 4760  C CD  . LYS B 2  142  ? 216.929 125.403 216.917 1.00 370.00 ? 142  LYS B CD  1 
ATOM 4761  C CE  . LYS B 2  142  ? 217.470 124.222 217.696 1.00 370.00 ? 142  LYS B CE  1 
ATOM 4762  N NZ  . LYS B 2  142  ? 218.906 124.007 217.404 1.00 370.00 ? 142  LYS B NZ  1 
ATOM 4763  N N   . VAL B 2  143  ? 211.382 128.116 216.333 1.00 370.00 ? 143  VAL B N   1 
ATOM 4764  C CA  . VAL B 2  143  ? 210.568 129.253 215.905 1.00 370.00 ? 143  VAL B CA  1 
ATOM 4765  C C   . VAL B 2  143  ? 209.675 129.625 217.076 1.00 370.00 ? 143  VAL B C   1 
ATOM 4766  O O   . VAL B 2  143  ? 208.841 128.814 217.490 1.00 370.00 ? 143  VAL B O   1 
ATOM 4767  C CB  . VAL B 2  143  ? 209.676 128.938 214.689 1.00 370.00 ? 143  VAL B CB  1 
ATOM 4768  C CG1 . VAL B 2  143  ? 208.787 130.130 214.384 1.00 370.00 ? 143  VAL B CG1 1 
ATOM 4769  C CG2 . VAL B 2  143  ? 210.468 128.520 213.453 1.00 370.00 ? 143  VAL B CG2 1 
ATOM 4770  N N   . LEU B 2  144  ? 209.817 130.839 217.604 1.00 370.00 ? 144  LEU B N   1 
ATOM 4771  C CA  . LEU B 2  144  ? 208.977 131.226 218.730 1.00 370.00 ? 144  LEU B CA  1 
ATOM 4772  C C   . LEU B 2  144  ? 208.540 132.678 218.666 1.00 370.00 ? 144  LEU B C   1 
ATOM 4773  O O   . LEU B 2  144  ? 209.070 133.497 217.907 1.00 370.00 ? 144  LEU B O   1 
ATOM 4774  C CB  . LEU B 2  144  ? 209.659 131.024 220.079 1.00 370.00 ? 144  LEU B CB  1 
ATOM 4775  C CG  . LEU B 2  144  ? 209.855 129.610 220.591 1.00 370.00 ? 144  LEU B CG  1 
ATOM 4776  C CD1 . LEU B 2  144  ? 210.566 129.687 221.913 1.00 370.00 ? 144  LEU B CD1 1 
ATOM 4777  C CD2 . LEU B 2  144  ? 208.528 128.914 220.743 1.00 370.00 ? 144  LEU B CD2 1 
ATOM 4778  N N   . LYS B 2  145  ? 207.573 132.969 219.531 1.00 370.00 ? 145  LYS B N   1 
ATOM 4779  C CA  . LYS B 2  145  ? 207.029 134.294 219.764 1.00 370.00 ? 145  LYS B CA  1 
ATOM 4780  C C   . LYS B 2  145  ? 207.198 134.626 221.239 1.00 370.00 ? 145  LYS B C   1 
ATOM 4781  O O   . LYS B 2  145  ? 207.139 133.736 222.091 1.00 370.00 ? 145  LYS B O   1 
ATOM 4782  C CB  . LYS B 2  145  ? 205.550 134.346 219.393 1.00 370.00 ? 145  LYS B CB  1 
ATOM 4783  C CG  . LYS B 2  145  ? 205.254 134.082 217.928 1.00 370.00 ? 145  LYS B CG  1 
ATOM 4784  C CD  . LYS B 2  145  ? 203.756 134.154 217.659 1.00 370.00 ? 145  LYS B CD  1 
ATOM 4785  C CE  . LYS B 2  145  ? 203.432 133.883 216.200 1.00 370.00 ? 145  LYS B CE  1 
ATOM 4786  N NZ  . LYS B 2  145  ? 201.967 133.961 215.940 1.00 370.00 ? 145  LYS B NZ  1 
ATOM 4787  N N   . ILE B 2  146  ? 207.424 135.900 221.541 1.00 370.00 ? 146  ILE B N   1 
ATOM 4788  C CA  . ILE B 2  146  ? 207.683 136.337 222.909 1.00 370.00 ? 146  ILE B CA  1 
ATOM 4789  C C   . ILE B 2  146  ? 206.775 137.511 223.229 1.00 370.00 ? 146  ILE B C   1 
ATOM 4790  O O   . ILE B 2  146  ? 206.833 138.536 222.548 1.00 370.00 ? 146  ILE B O   1 
ATOM 4791  C CB  . ILE B 2  146  ? 209.147 136.743 223.112 1.00 370.00 ? 146  ILE B CB  1 
ATOM 4792  C CG1 . ILE B 2  146  ? 210.067 135.553 222.877 1.00 370.00 ? 146  ILE B CG1 1 
ATOM 4793  C CG2 . ILE B 2  146  ? 209.338 137.281 224.508 1.00 370.00 ? 146  ILE B CG2 1 
ATOM 4794  C CD1 . ILE B 2  146  ? 211.495 135.936 222.732 1.00 370.00 ? 146  ILE B CD1 1 
ATOM 4795  N N   . HIS B 2  147  ? 205.968 137.378 224.276 1.00 370.00 ? 147  HIS B N   1 
ATOM 4796  C CA  . HIS B 2  147  ? 205.018 138.403 224.685 1.00 370.00 ? 147  HIS B CA  1 
ATOM 4797  C C   . HIS B 2  147  ? 205.357 138.857 226.095 1.00 370.00 ? 147  HIS B C   1 
ATOM 4798  O O   . HIS B 2  147  ? 205.321 138.057 227.033 1.00 370.00 ? 147  HIS B O   1 
ATOM 4799  C CB  . HIS B 2  147  ? 203.592 137.863 224.623 1.00 370.00 ? 147  HIS B CB  1 
ATOM 4800  C CG  . HIS B 2  147  ? 202.561 138.819 225.129 1.00 370.00 ? 147  HIS B CG  1 
ATOM 4801  N ND1 . HIS B 2  147  ? 202.145 139.918 224.411 1.00 370.00 ? 147  HIS B ND1 1 
ATOM 4802  C CD2 . HIS B 2  147  ? 201.863 138.838 226.287 1.00 370.00 ? 147  HIS B CD2 1 
ATOM 4803  C CE1 . HIS B 2  147  ? 201.228 140.570 225.103 1.00 370.00 ? 147  HIS B CE1 1 
ATOM 4804  N NE2 . HIS B 2  147  ? 201.041 139.937 226.246 1.00 370.00 ? 147  HIS B NE2 1 
ATOM 4805  N N   . ILE B 2  148  ? 205.676 140.135 226.247 1.00 370.00 ? 148  ILE B N   1 
ATOM 4806  C CA  . ILE B 2  148  ? 206.143 140.681 227.513 1.00 370.00 ? 148  ILE B CA  1 
ATOM 4807  C C   . ILE B 2  148  ? 205.306 141.893 227.860 1.00 370.00 ? 148  ILE B C   1 
ATOM 4808  O O   . ILE B 2  148  ? 205.252 142.857 227.090 1.00 370.00 ? 148  ILE B O   1 
ATOM 4809  C CB  . ILE B 2  148  ? 207.623 141.070 227.455 1.00 370.00 ? 148  ILE B CB  1 
ATOM 4810  C CG1 . ILE B 2  148  ? 208.487 139.841 227.208 1.00 370.00 ? 148  ILE B CG1 1 
ATOM 4811  C CG2 . ILE B 2  148  ? 208.026 141.777 228.732 1.00 370.00 ? 148  ILE B CG2 1 
ATOM 4812  C CD1 . ILE B 2  148  ? 209.890 140.189 226.850 1.00 370.00 ? 148  ILE B CD1 1 
ATOM 4813  N N   . ASN B 2  149  ? 204.671 141.850 229.019 1.00 370.00 ? 149  ASN B N   1 
ATOM 4814  C CA  . ASN B 2  149  ? 204.086 143.031 229.610 1.00 370.00 ? 149  ASN B CA  1 
ATOM 4815  C C   . ASN B 2  149  ? 205.128 143.712 230.476 1.00 370.00 ? 149  ASN B C   1 
ATOM 4816  O O   . ASN B 2  149  ? 205.835 143.054 231.242 1.00 370.00 ? 149  ASN B O   1 
ATOM 4817  C CB  . ASN B 2  149  ? 202.879 142.665 230.463 1.00 370.00 ? 149  ASN B CB  1 
ATOM 4818  C CG  . ASN B 2  149  ? 202.088 143.875 230.892 1.00 370.00 ? 149  ASN B CG  1 
ATOM 4819  O OD1 . ASN B 2  149  ? 202.357 144.998 230.463 1.00 370.00 ? 149  ASN B OD1 1 
ATOM 4820  N ND2 . ASN B 2  149  ? 201.125 143.661 231.773 1.00 370.00 ? 149  ASN B ND2 1 
ATOM 4821  N N   . PHE B 2  150  ? 205.167 145.038 230.399 1.00 370.00 ? 150  PHE B N   1 
ATOM 4822  C CA  . PHE B 2  150  ? 206.159 145.820 231.118 1.00 370.00 ? 150  PHE B CA  1 
ATOM 4823  C C   . PHE B 2  150  ? 205.696 147.267 231.154 1.00 370.00 ? 150  PHE B C   1 
ATOM 4824  O O   . PHE B 2  150  ? 204.806 147.681 230.409 1.00 370.00 ? 150  PHE B O   1 
ATOM 4825  C CB  . PHE B 2  150  ? 207.537 145.694 230.469 1.00 370.00 ? 150  PHE B CB  1 
ATOM 4826  C CG  . PHE B 2  150  ? 207.576 146.149 229.042 1.00 370.00 ? 150  PHE B CG  1 
ATOM 4827  C CD1 . PHE B 2  150  ? 207.236 145.279 228.013 1.00 370.00 ? 150  PHE B CD1 1 
ATOM 4828  C CD2 . PHE B 2  150  ? 207.992 147.428 228.720 1.00 370.00 ? 150  PHE B CD2 1 
ATOM 4829  C CE1 . PHE B 2  150  ? 207.267 145.690 226.704 1.00 370.00 ? 150  PHE B CE1 1 
ATOM 4830  C CE2 . PHE B 2  150  ? 208.036 147.839 227.408 1.00 370.00 ? 150  PHE B CE2 1 
ATOM 4831  C CZ  . PHE B 2  150  ? 207.676 146.966 226.397 1.00 370.00 ? 150  PHE B CZ  1 
ATOM 4832  N N   . SER B 2  151  ? 206.319 148.039 232.029 1.00 370.00 ? 151  SER B N   1 
ATOM 4833  C CA  . SER B 2  151  ? 205.887 149.406 232.250 1.00 370.00 ? 151  SER B CA  1 
ATOM 4834  C C   . SER B 2  151  ? 207.103 150.264 232.511 1.00 370.00 ? 151  SER B C   1 
ATOM 4835  O O   . SER B 2  151  ? 207.836 150.029 233.475 1.00 370.00 ? 151  SER B O   1 
ATOM 4836  C CB  . SER B 2  151  ? 204.924 149.496 233.427 1.00 370.00 ? 151  SER B CB  1 
ATOM 4837  O OG  . SER B 2  151  ? 205.606 149.173 234.623 1.00 370.00 ? 151  SER B OG  1 
ATOM 4838  N N   . LEU B 2  152  ? 207.310 151.245 231.650 1.00 370.00 ? 152  LEU B N   1 
ATOM 4839  C CA  . LEU B 2  152  ? 208.227 152.323 231.956 1.00 370.00 ? 152  LEU B CA  1 
ATOM 4840  C C   . LEU B 2  152  ? 207.620 153.198 233.035 1.00 370.00 ? 152  LEU B C   1 
ATOM 4841  O O   . LEU B 2  152  ? 206.455 153.599 232.943 1.00 370.00 ? 152  LEU B O   1 
ATOM 4842  C CB  . LEU B 2  152  ? 208.496 153.149 230.707 1.00 370.00 ? 152  LEU B CB  1 
ATOM 4843  C CG  . LEU B 2  152  ? 209.230 152.405 229.602 1.00 370.00 ? 152  LEU B CG  1 
ATOM 4844  C CD1 . LEU B 2  152  ? 209.193 153.216 228.331 1.00 370.00 ? 152  LEU B CD1 1 
ATOM 4845  C CD2 . LEU B 2  152  ? 210.656 152.163 230.029 1.00 370.00 ? 152  LEU B CD2 1 
ATOM 4846  N N   . ASP B 2  153  ? 208.433 153.536 234.030 1.00 370.00 ? 153  ASP B N   1 
ATOM 4847  C CA  . ASP B 2  153  ? 208.068 154.418 235.132 1.00 370.00 ? 153  ASP B CA  1 
ATOM 4848  C C   . ASP B 2  153  ? 208.135 155.864 234.676 1.00 370.00 ? 153  ASP B C   1 
ATOM 4849  O O   . ASP B 2  153  ? 207.946 156.146 233.489 1.00 370.00 ? 153  ASP B O   1 
ATOM 4850  C CB  . ASP B 2  153  ? 208.996 154.187 236.317 1.00 370.00 ? 153  ASP B CB  1 
ATOM 4851  C CG  . ASP B 2  153  ? 208.844 152.805 236.894 1.00 370.00 ? 153  ASP B CG  1 
ATOM 4852  O OD1 . ASP B 2  153  ? 207.729 152.250 236.813 1.00 370.00 ? 153  ASP B OD1 1 
ATOM 4853  O OD2 . ASP B 2  153  ? 209.840 152.264 237.413 1.00 370.00 ? 153  ASP B OD2 1 
ATOM 4854  N N   . GLN B 2  154  ? 208.267 156.794 235.605 1.00 370.00 ? 154  GLN B N   1 
ATOM 4855  C CA  . GLN B 2  154  ? 208.856 158.054 235.198 1.00 370.00 ? 154  GLN B CA  1 
ATOM 4856  C C   . GLN B 2  154  ? 210.220 157.751 234.603 1.00 370.00 ? 154  GLN B C   1 
ATOM 4857  O O   . GLN B 2  154  ? 211.057 157.138 235.277 1.00 370.00 ? 154  GLN B O   1 
ATOM 4858  C CB  . GLN B 2  154  ? 208.979 159.034 236.343 1.00 370.00 ? 154  GLN B CB  1 
ATOM 4859  C CG  . GLN B 2  154  ? 207.662 159.560 236.774 1.00 370.00 ? 154  GLN B CG  1 
ATOM 4860  C CD  . GLN B 2  154  ? 207.804 160.645 237.791 1.00 370.00 ? 154  GLN B CD  1 
ATOM 4861  O OE1 . GLN B 2  154  ? 208.911 160.983 238.203 1.00 370.00 ? 154  GLN B OE1 1 
ATOM 4862  N NE2 . GLN B 2  154  ? 206.682 161.208 238.206 1.00 370.00 ? 154  GLN B NE2 1 
ATOM 4863  N N   . PRO B 2  155  ? 210.449 158.066 233.331 1.00 370.00 ? 155  PRO B N   1 
ATOM 4864  C CA  . PRO B 2  155  ? 211.703 157.672 232.683 1.00 370.00 ? 155  PRO B CA  1 
ATOM 4865  C C   . PRO B 2  155  ? 212.831 158.560 233.170 1.00 370.00 ? 155  PRO B C   1 
ATOM 4866  O O   . PRO B 2  155  ? 212.754 159.787 233.122 1.00 370.00 ? 155  PRO B O   1 
ATOM 4867  C CB  . PRO B 2  155  ? 211.412 157.870 231.195 1.00 370.00 ? 155  PRO B CB  1 
ATOM 4868  C CG  . PRO B 2  155  ? 210.353 158.919 231.169 1.00 370.00 ? 155  PRO B CG  1 
ATOM 4869  C CD  . PRO B 2  155  ? 209.535 158.754 232.407 1.00 370.00 ? 155  PRO B CD  1 
ATOM 4870  N N   . LYS B 2  156  ? 213.866 157.931 233.678 1.00 370.00 ? 156  LYS B N   1 
ATOM 4871  C CA  . LYS B 2  156  ? 214.872 158.678 234.397 1.00 370.00 ? 156  LYS B CA  1 
ATOM 4872  C C   . LYS B 2  156  ? 216.173 158.502 233.654 1.00 370.00 ? 156  LYS B C   1 
ATOM 4873  O O   . LYS B 2  156  ? 217.195 158.140 234.238 1.00 370.00 ? 156  LYS B O   1 
ATOM 4874  C CB  . LYS B 2  156  ? 214.918 158.193 235.836 1.00 370.00 ? 156  LYS B CB  1 
ATOM 4875  C CG  . LYS B 2  156  ? 213.633 158.570 236.533 1.00 370.00 ? 156  LYS B CG  1 
ATOM 4876  C CD  . LYS B 2  156  ? 213.362 157.812 237.801 1.00 370.00 ? 156  LYS B CD  1 
ATOM 4877  C CE  . LYS B 2  156  ? 211.966 158.153 238.293 1.00 370.00 ? 156  LYS B CE  1 
ATOM 4878  N NZ  . LYS B 2  156  ? 211.547 157.332 239.451 1.00 370.00 ? 156  LYS B NZ  1 
ATOM 4879  N N   . GLY B 2  157  ? 216.116 158.705 232.347 1.00 370.00 ? 157  GLY B N   1 
ATOM 4880  C CA  . GLY B 2  157  ? 217.292 158.544 231.530 1.00 370.00 ? 157  GLY B CA  1 
ATOM 4881  C C   . GLY B 2  157  ? 217.034 157.859 230.210 1.00 370.00 ? 157  GLY B C   1 
ATOM 4882  O O   . GLY B 2  157  ? 217.979 157.544 229.485 1.00 370.00 ? 157  GLY B O   1 
ATOM 4883  N N   . GLY B 2  158  ? 215.774 157.599 229.885 1.00 370.00 ? 158  GLY B N   1 
ATOM 4884  C CA  . GLY B 2  158  ? 215.504 157.061 228.571 1.00 370.00 ? 158  GLY B CA  1 
ATOM 4885  C C   . GLY B 2  158  ? 214.658 157.949 227.687 1.00 370.00 ? 158  GLY B C   1 
ATOM 4886  O O   . GLY B 2  158  ? 214.870 158.011 226.473 1.00 370.00 ? 158  GLY B O   1 
ATOM 4887  N N   . LEU B 2  159  ? 213.713 158.669 228.276 1.00 370.00 ? 159  LEU B N   1 
ATOM 4888  C CA  . LEU B 2  159  ? 212.745 159.374 227.453 1.00 370.00 ? 159  LEU B CA  1 
ATOM 4889  C C   . LEU B 2  159  ? 212.652 160.829 227.854 1.00 370.00 ? 159  LEU B C   1 
ATOM 4890  O O   . LEU B 2  159  ? 213.467 161.321 228.634 1.00 370.00 ? 159  LEU B O   1 
ATOM 4891  C CB  . LEU B 2  159  ? 211.367 158.746 227.577 1.00 370.00 ? 159  LEU B CB  1 
ATOM 4892  C CG  . LEU B 2  159  ? 211.256 157.267 227.260 1.00 370.00 ? 159  LEU B CG  1 
ATOM 4893  C CD1 . LEU B 2  159  ? 209.825 156.841 227.380 1.00 370.00 ? 159  LEU B CD1 1 
ATOM 4894  C CD2 . LEU B 2  159  ? 211.774 157.006 225.906 1.00 370.00 ? 159  LEU B CD2 1 
ATOM 4895  N N   . HIS B 2  160  ? 211.653 161.520 227.327 1.00 370.00 ? 160  HIS B N   1 
ATOM 4896  C CA  . HIS B 2  160  ? 211.363 162.865 227.774 1.00 370.00 ? 160  HIS B CA  1 
ATOM 4897  C C   . HIS B 2  160  ? 209.881 163.126 227.729 1.00 370.00 ? 160  HIS B C   1 
ATOM 4898  O O   . HIS B 2  160  ? 209.200 162.775 226.759 1.00 370.00 ? 160  HIS B O   1 
ATOM 4899  C CB  . HIS B 2  160  ? 212.048 163.919 226.939 1.00 370.00 ? 160  HIS B CB  1 
ATOM 4900  C CG  . HIS B 2  160  ? 213.493 164.059 227.232 1.00 370.00 ? 160  HIS B CG  1 
ATOM 4901  N ND1 . HIS B 2  160  ? 213.946 164.628 228.398 1.00 370.00 ? 160  HIS B ND1 1 
ATOM 4902  C CD2 . HIS B 2  160  ? 214.589 163.711 226.525 1.00 370.00 ? 160  HIS B CD2 1 
ATOM 4903  C CE1 . HIS B 2  160  ? 215.263 164.616 228.401 1.00 370.00 ? 160  HIS B CE1 1 
ATOM 4904  N NE2 . HIS B 2  160  ? 215.679 164.074 227.272 1.00 370.00 ? 160  HIS B NE2 1 
ATOM 4905  N N   . PHE B 2  161  ? 209.415 163.771 228.790 1.00 370.00 ? 161  PHE B N   1 
ATOM 4906  C CA  . PHE B 2  161  ? 208.062 164.287 228.928 1.00 370.00 ? 161  PHE B CA  1 
ATOM 4907  C C   . PHE B 2  161  ? 208.238 165.787 229.092 1.00 370.00 ? 161  PHE B C   1 
ATOM 4908  O O   . PHE B 2  161  ? 208.313 166.285 230.216 1.00 370.00 ? 161  PHE B O   1 
ATOM 4909  C CB  . PHE B 2  161  ? 207.339 163.710 230.139 1.00 370.00 ? 161  PHE B CB  1 
ATOM 4910  C CG  . PHE B 2  161  ? 207.082 162.236 230.076 1.00 370.00 ? 161  PHE B CG  1 
ATOM 4911  C CD1 . PHE B 2  161  ? 207.172 161.525 228.896 1.00 370.00 ? 161  PHE B CD1 1 
ATOM 4912  C CD2 . PHE B 2  161  ? 206.743 161.560 231.226 1.00 370.00 ? 161  PHE B CD2 1 
ATOM 4913  C CE1 . PHE B 2  161  ? 206.934 160.180 228.865 1.00 370.00 ? 161  PHE B CE1 1 
ATOM 4914  C CE2 . PHE B 2  161  ? 206.497 160.213 231.202 1.00 370.00 ? 161  PHE B CE2 1 
ATOM 4915  C CZ  . PHE B 2  161  ? 206.591 159.520 230.024 1.00 370.00 ? 161  PHE B CZ  1 
ATOM 4916  N N   . VAL B 2  162  ? 208.328 166.509 227.984 1.00 370.00 ? 162  VAL B N   1 
ATOM 4917  C CA  . VAL B 2  162  ? 208.446 167.951 228.070 1.00 370.00 ? 162  VAL B CA  1 
ATOM 4918  C C   . VAL B 2  162  ? 207.104 168.521 228.490 1.00 370.00 ? 162  VAL B C   1 
ATOM 4919  O O   . VAL B 2  162  ? 206.105 168.384 227.772 1.00 370.00 ? 162  VAL B O   1 
ATOM 4920  C CB  . VAL B 2  162  ? 208.895 168.533 226.738 1.00 370.00 ? 162  VAL B CB  1 
ATOM 4921  C CG1 . VAL B 2  162  ? 208.897 170.019 226.818 1.00 370.00 ? 162  VAL B CG1 1 
ATOM 4922  C CG2 . VAL B 2  162  ? 210.258 168.026 226.407 1.00 370.00 ? 162  VAL B CG2 1 
ATOM 4923  N N   . VAL B 2  163  ? 207.080 169.159 229.660 1.00 370.00 ? 163  VAL B N   1 
ATOM 4924  C CA  . VAL B 2  163  ? 205.853 169.614 230.290 1.00 370.00 ? 163  VAL B CA  1 
ATOM 4925  C C   . VAL B 2  163  ? 205.969 171.099 230.603 1.00 370.00 ? 163  VAL B C   1 
ATOM 4926  O O   . VAL B 2  163  ? 206.845 171.498 231.373 1.00 370.00 ? 163  VAL B O   1 
ATOM 4927  C CB  . VAL B 2  163  ? 205.550 168.839 231.583 1.00 370.00 ? 163  VAL B CB  1 
ATOM 4928  C CG1 . VAL B 2  163  ? 204.348 169.437 232.269 1.00 370.00 ? 163  VAL B CG1 1 
ATOM 4929  C CG2 . VAL B 2  163  ? 205.319 167.386 231.282 1.00 370.00 ? 163  VAL B CG2 1 
ATOM 4930  N N   . PRO B 2  164  ? 205.118 171.953 230.045 1.00 370.00 ? 164  PRO B N   1 
ATOM 4931  C CA  . PRO B 2  164  ? 205.037 173.325 230.537 1.00 370.00 ? 164  PRO B CA  1 
ATOM 4932  C C   . PRO B 2  164  ? 204.424 173.335 231.919 1.00 370.00 ? 164  PRO B C   1 
ATOM 4933  O O   . PRO B 2  164  ? 203.405 172.692 232.174 1.00 370.00 ? 164  PRO B O   1 
ATOM 4934  C CB  . PRO B 2  164  ? 204.134 174.018 229.515 1.00 370.00 ? 164  PRO B CB  1 
ATOM 4935  C CG  . PRO B 2  164  ? 203.315 172.933 228.952 1.00 370.00 ? 164  PRO B CG  1 
ATOM 4936  C CD  . PRO B 2  164  ? 204.179 171.713 228.947 1.00 370.00 ? 164  PRO B CD  1 
ATOM 4937  N N   . SER B 2  165  ? 205.055 174.077 232.822 1.00 370.00 ? 165  SER B N   1 
ATOM 4938  C CA  . SER B 2  165  ? 204.733 174.003 234.245 1.00 370.00 ? 165  SER B CA  1 
ATOM 4939  C C   . SER B 2  165  ? 203.416 174.725 234.524 1.00 370.00 ? 165  SER B C   1 
ATOM 4940  O O   . SER B 2  165  ? 203.363 175.793 235.133 1.00 370.00 ? 165  SER B O   1 
ATOM 4941  C CB  . SER B 2  165  ? 205.868 174.593 235.064 1.00 370.00 ? 165  SER B CB  1 
ATOM 4942  O OG  . SER B 2  165  ? 205.986 175.978 234.799 1.00 370.00 ? 165  SER B OG  1 
ATOM 4943  N N   . VAL B 2  166  ? 202.332 174.123 234.041 1.00 370.00 ? 166  VAL B N   1 
ATOM 4944  C CA  . VAL B 2  166  ? 200.982 174.644 234.213 1.00 370.00 ? 166  VAL B CA  1 
ATOM 4945  C C   . VAL B 2  166  ? 200.066 173.598 234.834 1.00 370.00 ? 166  VAL B C   1 
ATOM 4946  O O   . VAL B 2  166  ? 199.342 173.882 235.794 1.00 370.00 ? 166  VAL B O   1 
ATOM 4947  C CB  . VAL B 2  166  ? 200.401 175.149 232.874 1.00 370.00 ? 166  VAL B CB  1 
ATOM 4948  C CG1 . VAL B 2  166  ? 198.982 175.670 233.066 1.00 370.00 ? 166  VAL B CG1 1 
ATOM 4949  C CG2 . VAL B 2  166  ? 201.298 176.211 232.253 1.00 370.00 ? 166  VAL B CG2 1 
ATOM 4950  N N   . GLU B 2  167  ? 200.033 172.396 234.243 1.00 370.00 ? 167  GLU B N   1 
ATOM 4951  C CA  . GLU B 2  167  ? 199.445 171.155 234.756 1.00 370.00 ? 167  GLU B CA  1 
ATOM 4952  C C   . GLU B 2  167  ? 197.922 171.153 234.852 1.00 370.00 ? 167  GLU B C   1 
ATOM 4953  O O   . GLU B 2  167  ? 197.331 170.119 235.179 1.00 370.00 ? 167  GLU B O   1 
ATOM 4954  C CB  . GLU B 2  167  ? 200.032 170.796 236.128 1.00 370.00 ? 167  GLU B CB  1 
ATOM 4955  C CG  . GLU B 2  167  ? 201.510 170.474 236.111 1.00 370.00 ? 167  GLU B CG  1 
ATOM 4956  C CD  . GLU B 2  167  ? 202.049 170.168 237.491 1.00 370.00 ? 167  GLU B CD  1 
ATOM 4957  O OE1 . GLU B 2  167  ? 201.293 170.301 238.473 1.00 370.00 ? 167  GLU B OE1 1 
ATOM 4958  O OE2 . GLU B 2  167  ? 203.234 169.800 237.595 1.00 370.00 ? 167  GLU B OE2 1 
ATOM 4959  N N   . GLY B 2  168  ? 197.266 172.278 234.587 1.00 370.00 ? 168  GLY B N   1 
ATOM 4960  C CA  . GLY B 2  168  ? 195.820 172.281 234.625 1.00 370.00 ? 168  GLY B CA  1 
ATOM 4961  C C   . GLY B 2  168  ? 195.183 172.062 233.271 1.00 370.00 ? 168  GLY B C   1 
ATOM 4962  O O   . GLY B 2  168  ? 194.396 171.133 233.080 1.00 370.00 ? 168  GLY B O   1 
ATOM 4963  N N   . SER B 2  169  ? 195.534 172.893 232.331 1.00 370.00 ? 169  SER B N   1 
ATOM 4964  C CA  . SER B 2  169  ? 194.955 172.837 231.000 1.00 370.00 ? 169  SER B CA  1 
ATOM 4965  C C   . SER B 2  169  ? 196.017 172.839 229.924 1.00 370.00 ? 169  SER B C   1 
ATOM 4966  O O   . SER B 2  169  ? 195.868 172.154 228.914 1.00 370.00 ? 169  SER B O   1 
ATOM 4967  C CB  . SER B 2  169  ? 194.020 174.025 230.796 1.00 370.00 ? 169  SER B CB  1 
ATOM 4968  O OG  . SER B 2  169  ? 194.759 175.232 230.797 1.00 370.00 ? 169  SER B OG  1 
ATOM 4969  N N   . MET B 2  170  ? 197.095 173.583 230.128 1.00 370.00 ? 170  MET B N   1 
ATOM 4970  C CA  . MET B 2  170  ? 198.186 173.639 229.173 1.00 370.00 ? 170  MET B CA  1 
ATOM 4971  C C   . MET B 2  170  ? 199.038 172.381 229.194 1.00 370.00 ? 170  MET B C   1 
ATOM 4972  O O   . MET B 2  170  ? 199.877 172.200 228.307 1.00 370.00 ? 170  MET B O   1 
ATOM 4973  C CB  . MET B 2  170  ? 199.019 174.879 229.467 1.00 370.00 ? 170  MET B CB  1 
ATOM 4974  C CG  . MET B 2  170  ? 198.216 176.146 229.266 1.00 370.00 ? 170  MET B CG  1 
ATOM 4975  S SD  . MET B 2  170  ? 198.957 177.643 229.935 1.00 370.00 ? 170  MET B SD  1 
ATOM 4976  C CE  . MET B 2  170  ? 200.422 177.793 228.927 1.00 370.00 ? 170  MET B CE  1 
ATOM 4977  N N   . ALA B 2  171  ? 198.826 171.500 230.175 1.00 370.00 ? 171  ALA B N   1 
ATOM 4978  C CA  . ALA B 2  171  ? 199.356 170.148 230.101 1.00 370.00 ? 171  ALA B CA  1 
ATOM 4979  C C   . ALA B 2  171  ? 198.729 169.357 228.965 1.00 370.00 ? 171  ALA B C   1 
ATOM 4980  O O   . ALA B 2  171  ? 199.320 168.379 228.499 1.00 370.00 ? 171  ALA B O   1 
ATOM 4981  C CB  . ALA B 2  171  ? 199.131 169.423 231.425 1.00 370.00 ? 171  ALA B CB  1 
ATOM 4982  N N   . GLU B 2  172  ? 197.543 169.751 228.518 1.00 370.00 ? 172  GLU B N   1 
ATOM 4983  C CA  . GLU B 2  172  ? 196.952 169.132 227.345 1.00 370.00 ? 172  GLU B CA  1 
ATOM 4984  C C   . GLU B 2  172  ? 197.552 169.723 226.083 1.00 370.00 ? 172  GLU B C   1 
ATOM 4985  O O   . GLU B 2  172  ? 198.191 169.027 225.288 1.00 370.00 ? 172  GLU B O   1 
ATOM 4986  C CB  . GLU B 2  172  ? 195.455 169.367 227.383 1.00 370.00 ? 172  GLU B CB  1 
ATOM 4987  C CG  . GLU B 2  172  ? 194.871 168.943 228.689 1.00 370.00 ? 172  GLU B CG  1 
ATOM 4988  C CD  . GLU B 2  172  ? 193.502 169.498 228.878 1.00 370.00 ? 172  GLU B CD  1 
ATOM 4989  O OE1 . GLU B 2  172  ? 193.095 170.329 228.044 1.00 370.00 ? 172  GLU B OE1 1 
ATOM 4990  O OE2 . GLU B 2  172  ? 192.836 169.119 229.858 1.00 370.00 ? 172  GLU B OE2 1 
ATOM 4991  N N   . ARG B 2  173  ? 197.362 171.015 225.896 1.00 370.00 ? 173  ARG B N   1 
ATOM 4992  C CA  . ARG B 2  173  ? 197.907 171.742 224.764 1.00 370.00 ? 173  ARG B CA  1 
ATOM 4993  C C   . ARG B 2  173  ? 199.145 172.469 225.254 1.00 370.00 ? 173  ARG B C   1 
ATOM 4994  O O   . ARG B 2  173  ? 199.041 173.507 225.910 1.00 370.00 ? 173  ARG B O   1 
ATOM 4995  C CB  . ARG B 2  173  ? 196.895 172.726 224.202 1.00 370.00 ? 173  ARG B CB  1 
ATOM 4996  C CG  . ARG B 2  173  ? 195.705 172.092 223.540 1.00 370.00 ? 173  ARG B CG  1 
ATOM 4997  C CD  . ARG B 2  173  ? 194.848 173.167 222.894 1.00 370.00 ? 173  ARG B CD  1 
ATOM 4998  N NE  . ARG B 2  173  ? 193.722 172.616 222.145 1.00 370.00 ? 173  ARG B NE  1 
ATOM 4999  C CZ  . ARG B 2  173  ? 192.849 173.348 221.457 1.00 370.00 ? 173  ARG B CZ  1 
ATOM 5000  N NH1 . ARG B 2  173  ? 192.976 174.667 221.413 1.00 370.00 ? 173  ARG B NH1 1 
ATOM 5001  N NH2 . ARG B 2  173  ? 191.855 172.761 220.801 1.00 370.00 ? 173  ARG B NH2 1 
ATOM 5002  N N   . GLY B 2  174  ? 200.312 171.936 224.927 1.00 370.00 ? 174  GLY B N   1 
ATOM 5003  C CA  . GLY B 2  174  ? 201.536 172.614 225.289 1.00 370.00 ? 174  GLY B CA  1 
ATOM 5004  C C   . GLY B 2  174  ? 202.658 171.677 225.660 1.00 370.00 ? 174  GLY B C   1 
ATOM 5005  O O   . GLY B 2  174  ? 203.820 172.081 225.720 1.00 370.00 ? 174  GLY B O   1 
ATOM 5006  N N   . ALA B 2  175  ? 202.330 170.425 225.904 1.00 370.00 ? 175  ALA B N   1 
ATOM 5007  C CA  . ALA B 2  175  ? 203.338 169.446 226.253 1.00 370.00 ? 175  ALA B CA  1 
ATOM 5008  C C   . ALA B 2  175  ? 203.672 168.597 225.048 1.00 370.00 ? 175  ALA B C   1 
ATOM 5009  O O   . ALA B 2  175  ? 202.922 168.543 224.073 1.00 370.00 ? 175  ALA B O   1 
ATOM 5010  C CB  . ALA B 2  175  ? 202.855 168.562 227.398 1.00 370.00 ? 175  ALA B CB  1 
ATOM 5011  N N   . HIS B 2  176  ? 204.820 167.936 225.117 1.00 370.00 ? 176  HIS B N   1 
ATOM 5012  C CA  . HIS B 2  176  ? 205.076 166.884 224.154 1.00 370.00 ? 176  HIS B CA  1 
ATOM 5013  C C   . HIS B 2  176  ? 205.930 165.822 224.808 1.00 370.00 ? 176  HIS B C   1 
ATOM 5014  O O   . HIS B 2  176  ? 206.427 165.992 225.920 1.00 370.00 ? 176  HIS B O   1 
ATOM 5015  C CB  . HIS B 2  176  ? 205.732 167.386 222.868 1.00 370.00 ? 176  HIS B CB  1 
ATOM 5016  C CG  . HIS B 2  176  ? 207.163 167.783 223.015 1.00 370.00 ? 176  HIS B CG  1 
ATOM 5017  N ND1 . HIS B 2  176  ? 207.555 169.067 223.312 1.00 370.00 ? 176  HIS B ND1 1 
ATOM 5018  C CD2 . HIS B 2  176  ? 208.298 167.064 222.890 1.00 370.00 ? 176  HIS B CD2 1 
ATOM 5019  C CE1 . HIS B 2  176  ? 208.873 169.126 223.345 1.00 370.00 ? 176  HIS B CE1 1 
ATOM 5020  N NE2 . HIS B 2  176  ? 209.347 167.918 223.115 1.00 370.00 ? 176  HIS B NE2 1 
ATOM 5021  N N   . VAL B 2  177  ? 206.059 164.694 224.117 1.00 370.00 ? 177  VAL B N   1 
ATOM 5022  C CA  . VAL B 2  177  ? 206.667 163.488 224.664 1.00 370.00 ? 177  VAL B CA  1 
ATOM 5023  C C   . VAL B 2  177  ? 207.449 162.801 223.559 1.00 370.00 ? 177  VAL B C   1 
ATOM 5024  O O   . VAL B 2  177  ? 206.920 162.597 222.463 1.00 370.00 ? 177  VAL B O   1 
ATOM 5025  C CB  . VAL B 2  177  ? 205.601 162.532 225.240 1.00 370.00 ? 177  VAL B CB  1 
ATOM 5026  C CG1 . VAL B 2  177  ? 206.180 161.164 225.491 1.00 370.00 ? 177  VAL B CG1 1 
ATOM 5027  C CG2 . VAL B 2  177  ? 205.020 163.059 226.547 1.00 370.00 ? 177  VAL B CG2 1 
ATOM 5028  N N   . PHE B 2  178  ? 208.692 162.425 223.845 1.00 370.00 ? 178  PHE B N   1 
ATOM 5029  C CA  . PHE B 2  178  ? 209.523 161.801 222.825 1.00 370.00 ? 178  PHE B CA  1 
ATOM 5030  C C   . PHE B 2  178  ? 210.621 161.002 223.495 1.00 370.00 ? 178  PHE B C   1 
ATOM 5031  O O   . PHE B 2  178  ? 210.661 160.878 224.722 1.00 370.00 ? 178  PHE B O   1 
ATOM 5032  C CB  . PHE B 2  178  ? 210.124 162.834 221.883 1.00 370.00 ? 178  PHE B CB  1 
ATOM 5033  C CG  . PHE B 2  178  ? 211.127 163.699 222.533 1.00 370.00 ? 178  PHE B CG  1 
ATOM 5034  C CD1 . PHE B 2  178  ? 210.721 164.760 223.307 1.00 370.00 ? 178  PHE B CD1 1 
ATOM 5035  C CD2 . PHE B 2  178  ? 212.470 163.506 222.322 1.00 370.00 ? 178  PHE B CD2 1 
ATOM 5036  C CE1 . PHE B 2  178  ? 211.623 165.569 223.897 1.00 370.00 ? 178  PHE B CE1 1 
ATOM 5037  C CE2 . PHE B 2  178  ? 213.368 164.304 222.918 1.00 370.00 ? 178  PHE B CE2 1 
ATOM 5038  C CZ  . PHE B 2  178  ? 212.962 165.339 223.706 1.00 370.00 ? 178  PHE B CZ  1 
ATOM 5039  N N   . SER B 2  179  ? 211.529 160.471 222.679 1.00 370.00 ? 179  SER B N   1 
ATOM 5040  C CA  . SER B 2  179  ? 212.724 159.799 223.161 1.00 370.00 ? 179  SER B CA  1 
ATOM 5041  C C   . SER B 2  179  ? 213.965 160.455 222.589 1.00 370.00 ? 179  SER B C   1 
ATOM 5042  O O   . SER B 2  179  ? 214.263 160.304 221.404 1.00 370.00 ? 179  SER B O   1 
ATOM 5043  C CB  . SER B 2  179  ? 212.773 158.347 222.748 1.00 370.00 ? 179  SER B CB  1 
ATOM 5044  O OG  . SER B 2  179  ? 213.177 158.255 221.412 1.00 370.00 ? 179  SER B OG  1 
ATOM 5045  N N   . CYS B 2  180  ? 214.707 161.140 223.446 1.00 370.00 ? 180  CYS B N   1 
ATOM 5046  C CA  . CYS B 2  180  ? 216.091 161.456 223.163 1.00 370.00 ? 180  CYS B CA  1 
ATOM 5047  C C   . CYS B 2  180  ? 216.981 160.421 223.805 1.00 370.00 ? 180  CYS B C   1 
ATOM 5048  O O   . CYS B 2  180  ? 216.612 159.750 224.771 1.00 370.00 ? 180  CYS B O   1 
ATOM 5049  C CB  . CYS B 2  180  ? 216.519 162.834 223.654 1.00 370.00 ? 180  CYS B CB  1 
ATOM 5050  S SG  . CYS B 2  180  ? 216.729 164.115 222.395 1.00 370.00 ? 180  CYS B SG  1 
ATOM 5051  N N   . GLY B 2  181  ? 218.169 160.322 223.251 1.00 370.00 ? 181  GLY B N   1 
ATOM 5052  C CA  . GLY B 2  181  ? 219.136 159.345 223.690 1.00 370.00 ? 181  GLY B CA  1 
ATOM 5053  C C   . GLY B 2  181  ? 220.244 159.213 222.670 1.00 370.00 ? 181  GLY B C   1 
ATOM 5054  O O   . GLY B 2  181  ? 220.185 159.736 221.563 1.00 370.00 ? 181  GLY B O   1 
ATOM 5055  N N   . TYR B 2  182  ? 221.247 158.475 223.077 1.00 370.00 ? 182  TYR B N   1 
ATOM 5056  C CA  . TYR B 2  182  ? 222.451 158.203 222.317 1.00 370.00 ? 182  TYR B CA  1 
ATOM 5057  C C   . TYR B 2  182  ? 222.156 157.030 221.371 1.00 370.00 ? 182  TYR B C   1 
ATOM 5058  O O   . TYR B 2  182  ? 220.991 156.745 221.080 1.00 370.00 ? 182  TYR B O   1 
ATOM 5059  C CB  . TYR B 2  182  ? 223.576 157.972 223.322 1.00 370.00 ? 182  TYR B CB  1 
ATOM 5060  C CG  . TYR B 2  182  ? 224.944 158.053 222.782 1.00 370.00 ? 182  TYR B CG  1 
ATOM 5061  C CD1 . TYR B 2  182  ? 225.481 159.265 222.429 1.00 370.00 ? 182  TYR B CD1 1 
ATOM 5062  C CD2 . TYR B 2  182  ? 225.717 156.921 222.662 1.00 370.00 ? 182  TYR B CD2 1 
ATOM 5063  C CE1 . TYR B 2  182  ? 226.746 159.351 221.944 1.00 370.00 ? 182  TYR B CE1 1 
ATOM 5064  C CE2 . TYR B 2  182  ? 226.972 156.985 222.170 1.00 370.00 ? 182  TYR B CE2 1 
ATOM 5065  C CZ  . TYR B 2  182  ? 227.490 158.208 221.817 1.00 370.00 ? 182  TYR B CZ  1 
ATOM 5066  O OH  . TYR B 2  182  ? 228.766 158.286 221.323 1.00 370.00 ? 182  TYR B OH  1 
ATOM 5067  N N   . GLN B 2  183  ? 223.201 156.390 220.838 1.00 370.00 ? 183  GLN B N   1 
ATOM 5068  C CA  . GLN B 2  183  ? 223.069 155.256 219.928 1.00 370.00 ? 183  GLN B CA  1 
ATOM 5069  C C   . GLN B 2  183  ? 222.261 154.126 220.530 1.00 370.00 ? 183  GLN B C   1 
ATOM 5070  O O   . GLN B 2  183  ? 221.142 153.849 220.095 1.00 370.00 ? 183  GLN B O   1 
ATOM 5071  C CB  . GLN B 2  183  ? 224.452 154.743 219.606 1.00 370.00 ? 183  GLN B CB  1 
ATOM 5072  C CG  . GLN B 2  183  ? 225.334 155.808 219.097 1.00 370.00 ? 183  GLN B CG  1 
ATOM 5073  C CD  . GLN B 2  183  ? 226.732 155.329 219.013 1.00 370.00 ? 183  GLN B CD  1 
ATOM 5074  O OE1 . GLN B 2  183  ? 227.020 154.208 219.407 1.00 370.00 ? 183  GLN B OE1 1 
ATOM 5075  N NE2 . GLN B 2  183  ? 227.622 156.172 218.516 1.00 370.00 ? 183  GLN B NE2 1 
ATOM 5076  N N   . ASN B 2  184  ? 222.799 153.479 221.534 1.00 370.00 ? 184  ASN B N   1 
ATOM 5077  C CA  . ASN B 2  184  ? 222.120 152.374 222.179 1.00 370.00 ? 184  ASN B CA  1 
ATOM 5078  C C   . ASN B 2  184  ? 221.417 152.925 223.402 1.00 370.00 ? 184  ASN B C   1 
ATOM 5079  O O   . ASN B 2  184  ? 221.814 152.650 224.537 1.00 370.00 ? 184  ASN B O   1 
ATOM 5080  C CB  . ASN B 2  184  ? 223.102 151.272 222.549 1.00 370.00 ? 184  ASN B CB  1 
ATOM 5081  C CG  . ASN B 2  184  ? 223.665 150.576 221.332 1.00 370.00 ? 184  ASN B CG  1 
ATOM 5082  O OD1 . ASN B 2  184  ? 222.947 150.294 220.377 1.00 370.00 ? 184  ASN B OD1 1 
ATOM 5083  N ND2 . ASN B 2  184  ? 224.961 150.304 221.353 1.00 370.00 ? 184  ASN B ND2 1 
ATOM 5084  N N   . SER B 2  185  ? 220.382 153.709 223.166 1.00 370.00 ? 185  SER B N   1 
ATOM 5085  C CA  . SER B 2  185  ? 219.454 154.080 224.211 1.00 370.00 ? 185  SER B CA  1 
ATOM 5086  C C   . SER B 2  185  ? 218.101 153.428 224.021 1.00 370.00 ? 185  SER B C   1 
ATOM 5087  O O   . SER B 2  185  ? 217.184 153.696 224.804 1.00 370.00 ? 185  SER B O   1 
ATOM 5088  C CB  . SER B 2  185  ? 219.291 155.605 224.275 1.00 370.00 ? 185  SER B CB  1 
ATOM 5089  O OG  . SER B 2  185  ? 218.758 156.110 223.069 1.00 370.00 ? 185  SER B OG  1 
ATOM 5090  N N   . THR B 2  186  ? 217.958 152.575 223.007 1.00 370.00 ? 186  THR B N   1 
ATOM 5091  C CA  . THR B 2  186  ? 216.743 151.791 222.845 1.00 370.00 ? 186  THR B CA  1 
ATOM 5092  C C   . THR B 2  186  ? 216.574 150.822 224.007 1.00 370.00 ? 186  THR B C   1 
ATOM 5093  O O   . THR B 2  186  ? 215.444 150.496 224.392 1.00 370.00 ? 186  THR B O   1 
ATOM 5094  C CB  . THR B 2  186  ? 216.804 151.058 221.507 1.00 370.00 ? 186  THR B CB  1 
ATOM 5095  O OG1 . THR B 2  186  ? 217.077 152.007 220.471 1.00 370.00 ? 186  THR B OG1 1 
ATOM 5096  C CG2 . THR B 2  186  ? 215.489 150.383 221.188 1.00 370.00 ? 186  THR B CG2 1 
ATOM 5097  N N   . ARG B 2  187  ? 217.701 150.359 224.571 1.00 370.00 ? 187  ARG B N   1 
ATOM 5098  C CA  . ARG B 2  187  ? 217.716 149.677 225.863 1.00 370.00 ? 187  ARG B CA  1 
ATOM 5099  C C   . ARG B 2  187  ? 216.938 150.453 226.902 1.00 370.00 ? 187  ARG B C   1 
ATOM 5100  O O   . ARG B 2  187  ? 216.042 149.921 227.559 1.00 370.00 ? 187  ARG B O   1 
ATOM 5101  C CB  . ARG B 2  187  ? 219.143 149.526 226.371 1.00 370.00 ? 187  ARG B CB  1 
ATOM 5102  C CG  . ARG B 2  187  ? 220.029 148.587 225.646 1.00 370.00 ? 187  ARG B CG  1 
ATOM 5103  C CD  . ARG B 2  187  ? 221.311 148.515 226.426 1.00 370.00 ? 187  ARG B CD  1 
ATOM 5104  N NE  . ARG B 2  187  ? 222.251 147.558 225.872 1.00 370.00 ? 187  ARG B NE  1 
ATOM 5105  C CZ  . ARG B 2  187  ? 223.420 147.282 226.432 1.00 370.00 ? 187  ARG B CZ  1 
ATOM 5106  N NH1 . ARG B 2  187  ? 223.756 147.888 227.560 1.00 370.00 ? 187  ARG B NH1 1 
ATOM 5107  N NH2 . ARG B 2  187  ? 224.238 146.393 225.884 1.00 370.00 ? 187  ARG B NH2 1 
ATOM 5108  N N   . PHE B 2  188  ? 217.226 151.737 227.011 1.00 370.00 ? 188  PHE B N   1 
ATOM 5109  C CA  . PHE B 2  188  ? 216.621 152.555 228.040 1.00 370.00 ? 188  PHE B CA  1 
ATOM 5110  C C   . PHE B 2  188  ? 215.165 152.855 227.742 1.00 370.00 ? 188  PHE B C   1 
ATOM 5111  O O   . PHE B 2  188  ? 214.454 153.341 228.623 1.00 370.00 ? 188  PHE B O   1 
ATOM 5112  C CB  . PHE B 2  188  ? 217.437 153.832 228.164 1.00 370.00 ? 188  PHE B CB  1 
ATOM 5113  C CG  . PHE B 2  188  ? 218.866 153.594 228.572 1.00 370.00 ? 188  PHE B CG  1 
ATOM 5114  C CD1 . PHE B 2  188  ? 219.218 152.501 229.353 1.00 370.00 ? 188  PHE B CD1 1 
ATOM 5115  C CD2 . PHE B 2  188  ? 219.869 154.424 228.108 1.00 370.00 ? 188  PHE B CD2 1 
ATOM 5116  C CE1 . PHE B 2  188  ? 220.529 152.281 229.700 1.00 370.00 ? 188  PHE B CE1 1 
ATOM 5117  C CE2 . PHE B 2  188  ? 221.180 154.205 228.452 1.00 370.00 ? 188  PHE B CE2 1 
ATOM 5118  C CZ  . PHE B 2  188  ? 221.510 153.135 229.248 1.00 370.00 ? 188  PHE B CZ  1 
ATOM 5119  N N   . TRP B 2  189  ? 214.695 152.543 226.541 1.00 370.00 ? 189  TRP B N   1 
ATOM 5120  C CA  . TRP B 2  189  ? 213.300 152.731 226.202 1.00 370.00 ? 189  TRP B CA  1 
ATOM 5121  C C   . TRP B 2  189  ? 212.502 151.438 226.219 1.00 370.00 ? 189  TRP B C   1 
ATOM 5122  O O   . TRP B 2  189  ? 211.485 151.383 226.905 1.00 370.00 ? 189  TRP B O   1 
ATOM 5123  C CB  . TRP B 2  189  ? 213.195 153.440 224.852 1.00 370.00 ? 189  TRP B CB  1 
ATOM 5124  C CG  . TRP B 2  189  ? 211.815 153.585 224.345 1.00 370.00 ? 189  TRP B CG  1 
ATOM 5125  C CD1 . TRP B 2  189  ? 210.698 153.849 225.070 1.00 370.00 ? 189  TRP B CD1 1 
ATOM 5126  C CD2 . TRP B 2  189  ? 211.426 153.665 222.977 1.00 370.00 ? 189  TRP B CD2 1 
ATOM 5127  N NE1 . TRP B 2  189  ? 209.620 153.983 224.247 1.00 370.00 ? 189  TRP B NE1 1 
ATOM 5128  C CE2 . TRP B 2  189  ? 210.043 153.889 222.952 1.00 370.00 ? 189  TRP B CE2 1 
ATOM 5129  C CE3 . TRP B 2  189  ? 212.107 153.539 221.772 1.00 370.00 ? 189  TRP B CE3 1 
ATOM 5130  C CZ2 . TRP B 2  189  ? 209.328 153.979 221.775 1.00 370.00 ? 189  TRP B CZ2 1 
ATOM 5131  C CZ3 . TRP B 2  189  ? 211.392 153.616 220.606 1.00 370.00 ? 189  TRP B CZ3 1 
ATOM 5132  C CH2 . TRP B 2  189  ? 210.020 153.840 220.611 1.00 370.00 ? 189  TRP B CH2 1 
ATOM 5133  N N   . PHE B 2  190  ? 212.916 150.394 225.499 1.00 370.00 ? 190  PHE B N   1 
ATOM 5134  C CA  . PHE B 2  190  ? 212.155 149.144 225.606 1.00 370.00 ? 190  PHE B CA  1 
ATOM 5135  C C   . PHE B 2  190  ? 213.078 147.979 225.284 1.00 370.00 ? 190  PHE B C   1 
ATOM 5136  O O   . PHE B 2  190  ? 213.924 148.108 224.390 1.00 370.00 ? 190  PHE B O   1 
ATOM 5137  C CB  . PHE B 2  190  ? 210.914 149.130 224.699 1.00 370.00 ? 190  PHE B CB  1 
ATOM 5138  C CG  . PHE B 2  190  ? 211.215 149.064 223.262 1.00 370.00 ? 190  PHE B CG  1 
ATOM 5139  C CD1 . PHE B 2  190  ? 211.552 150.203 222.568 1.00 370.00 ? 190  PHE B CD1 1 
ATOM 5140  C CD2 . PHE B 2  190  ? 211.106 147.872 222.584 1.00 370.00 ? 190  PHE B CD2 1 
ATOM 5141  C CE1 . PHE B 2  190  ? 211.822 150.145 221.230 1.00 370.00 ? 190  PHE B CE1 1 
ATOM 5142  C CE2 . PHE B 2  190  ? 211.364 147.817 221.252 1.00 370.00 ? 190  PHE B CE2 1 
ATOM 5143  C CZ  . PHE B 2  190  ? 211.728 148.952 220.573 1.00 370.00 ? 190  PHE B CZ  1 
ATOM 5144  N N   . PRO B 2  191  ? 212.933 146.845 225.975 1.00 370.00 ? 191  PRO B N   1 
ATOM 5145  C CA  . PRO B 2  191  ? 213.998 145.831 225.980 1.00 370.00 ? 191  PRO B CA  1 
ATOM 5146  C C   . PRO B 2  191  ? 214.213 145.152 224.639 1.00 370.00 ? 191  PRO B C   1 
ATOM 5147  O O   . PRO B 2  191  ? 213.266 144.734 223.973 1.00 370.00 ? 191  PRO B O   1 
ATOM 5148  C CB  . PRO B 2  191  ? 213.523 144.830 227.033 1.00 370.00 ? 191  PRO B CB  1 
ATOM 5149  C CG  . PRO B 2  191  ? 212.082 145.070 227.162 1.00 370.00 ? 191  PRO B CG  1 
ATOM 5150  C CD  . PRO B 2  191  ? 211.884 146.519 226.952 1.00 370.00 ? 191  PRO B CD  1 
ATOM 5151  N N   . CYS B 2  192  ? 215.479 145.044 224.265 1.00 370.00 ? 192  CYS B N   1 
ATOM 5152  C CA  . CYS B 2  192  ? 215.906 144.480 222.998 1.00 370.00 ? 192  CYS B CA  1 
ATOM 5153  C C   . CYS B 2  192  ? 217.269 143.836 223.196 1.00 370.00 ? 192  CYS B C   1 
ATOM 5154  O O   . CYS B 2  192  ? 217.666 143.510 224.319 1.00 370.00 ? 192  CYS B O   1 
ATOM 5155  C CB  . CYS B 2  192  ? 215.954 145.545 221.895 1.00 370.00 ? 192  CYS B CB  1 
ATOM 5156  S SG  . CYS B 2  192  ? 214.380 146.118 221.319 1.00 370.00 ? 192  CYS B SG  1 
ATOM 5157  N N   . VAL B 2  193  ? 217.979 143.660 222.086 1.00 370.00 ? 193  VAL B N   1 
ATOM 5158  C CA  . VAL B 2  193  ? 219.309 143.072 221.962 1.00 370.00 ? 193  VAL B CA  1 
ATOM 5159  C C   . VAL B 2  193  ? 220.325 144.159 222.324 1.00 370.00 ? 193  VAL B C   1 
ATOM 5160  O O   . VAL B 2  193  ? 219.922 145.254 222.739 1.00 370.00 ? 193  VAL B O   1 
ATOM 5161  C CB  . VAL B 2  193  ? 219.496 142.544 220.522 1.00 370.00 ? 193  VAL B CB  1 
ATOM 5162  C CG1 . VAL B 2  193  ? 220.596 141.469 220.397 1.00 370.00 ? 193  VAL B CG1 1 
ATOM 5163  C CG2 . VAL B 2  193  ? 218.181 142.046 219.975 1.00 370.00 ? 193  VAL B CG2 1 
ATOM 5164  N N   . ASP B 2  194  ? 221.633 143.832 222.321 1.00 370.00 ? 194  ASP B N   1 
ATOM 5165  C CA  . ASP B 2  194  ? 222.597 144.837 221.882 1.00 370.00 ? 194  ASP B CA  1 
ATOM 5166  C C   . ASP B 2  194  ? 221.973 145.431 220.635 1.00 370.00 ? 194  ASP B C   1 
ATOM 5167  O O   . ASP B 2  194  ? 221.833 144.751 219.616 1.00 370.00 ? 194  ASP B O   1 
ATOM 5168  C CB  . ASP B 2  194  ? 223.984 144.253 221.569 1.00 370.00 ? 194  ASP B CB  1 
ATOM 5169  C CG  . ASP B 2  194  ? 224.890 144.187 222.772 1.00 370.00 ? 194  ASP B CG  1 
ATOM 5170  O OD1 . ASP B 2  194  ? 224.778 145.055 223.655 1.00 370.00 ? 194  ASP B OD1 1 
ATOM 5171  O OD2 . ASP B 2  194  ? 225.697 143.252 222.878 1.00 370.00 ? 194  ASP B OD2 1 
ATOM 5172  N N   . SER B 2  195  ? 221.566 146.693 220.739 1.00 370.00 ? 195  SER B N   1 
ATOM 5173  C CA  . SER B 2  195  ? 220.453 147.167 219.939 1.00 370.00 ? 195  SER B CA  1 
ATOM 5174  C C   . SER B 2  195  ? 220.822 147.365 218.486 1.00 370.00 ? 195  SER B C   1 
ATOM 5175  O O   . SER B 2  195  ? 219.929 147.406 217.634 1.00 370.00 ? 195  SER B O   1 
ATOM 5176  C CB  . SER B 2  195  ? 219.912 148.462 220.531 1.00 370.00 ? 195  SER B CB  1 
ATOM 5177  O OG  . SER B 2  195  ? 220.872 149.490 220.457 1.00 370.00 ? 195  SER B OG  1 
ATOM 5178  N N   . TYR B 2  196  ? 222.100 147.439 218.177 1.00 370.00 ? 196  TYR B N   1 
ATOM 5179  C CA  . TYR B 2  196  ? 222.500 147.583 216.800 1.00 370.00 ? 196  TYR B CA  1 
ATOM 5180  C C   . TYR B 2  196  ? 222.710 146.191 216.228 1.00 370.00 ? 196  TYR B C   1 
ATOM 5181  O O   . TYR B 2  196  ? 222.815 145.211 216.969 1.00 370.00 ? 196  TYR B O   1 
ATOM 5182  C CB  . TYR B 2  196  ? 223.771 148.420 216.698 1.00 370.00 ? 196  TYR B CB  1 
ATOM 5183  C CG  . TYR B 2  196  ? 223.808 149.191 215.419 1.00 370.00 ? 196  TYR B CG  1 
ATOM 5184  C CD1 . TYR B 2  196  ? 223.165 150.416 215.323 1.00 370.00 ? 196  TYR B CD1 1 
ATOM 5185  C CD2 . TYR B 2  196  ? 224.419 148.683 214.295 1.00 370.00 ? 196  TYR B CD2 1 
ATOM 5186  C CE1 . TYR B 2  196  ? 223.169 151.132 214.148 1.00 370.00 ? 196  TYR B CE1 1 
ATOM 5187  C CE2 . TYR B 2  196  ? 224.411 149.376 213.117 1.00 370.00 ? 196  TYR B CE2 1 
ATOM 5188  C CZ  . TYR B 2  196  ? 223.800 150.599 213.045 1.00 370.00 ? 196  TYR B CZ  1 
ATOM 5189  O OH  . TYR B 2  196  ? 223.829 151.282 211.848 1.00 370.00 ? 196  TYR B OH  1 
ATOM 5190  N N   . SER B 2  197  ? 222.709 146.118 214.898 1.00 370.00 ? 197  SER B N   1 
ATOM 5191  C CA  . SER B 2  197  ? 223.138 144.946 214.125 1.00 370.00 ? 197  SER B CA  1 
ATOM 5192  C C   . SER B 2  197  ? 222.224 143.746 214.350 1.00 370.00 ? 197  SER B C   1 
ATOM 5193  O O   . SER B 2  197  ? 222.686 142.621 214.536 1.00 370.00 ? 197  SER B O   1 
ATOM 5194  C CB  . SER B 2  197  ? 224.596 144.570 214.414 1.00 370.00 ? 197  SER B CB  1 
ATOM 5195  O OG  . SER B 2  197  ? 224.737 143.994 215.701 1.00 370.00 ? 197  SER B OG  1 
ATOM 5196  N N   . GLU B 2  198  ? 220.913 143.988 214.360 1.00 370.00 ? 198  GLU B N   1 
ATOM 5197  C CA  . GLU B 2  198  ? 219.918 142.914 214.378 1.00 370.00 ? 198  GLU B CA  1 
ATOM 5198  C C   . GLU B 2  198  ? 218.818 143.327 213.409 1.00 370.00 ? 198  GLU B C   1 
ATOM 5199  O O   . GLU B 2  198  ? 217.969 144.154 213.746 1.00 370.00 ? 198  GLU B O   1 
ATOM 5200  C CB  . GLU B 2  198  ? 219.353 142.669 215.772 1.00 370.00 ? 198  GLU B CB  1 
ATOM 5201  C CG  . GLU B 2  198  ? 220.358 142.220 216.810 1.00 370.00 ? 198  GLU B CG  1 
ATOM 5202  C CD  . GLU B 2  198  ? 220.979 140.882 216.495 1.00 370.00 ? 198  GLU B CD  1 
ATOM 5203  O OE1 . GLU B 2  198  ? 220.294 140.016 215.918 1.00 370.00 ? 198  GLU B OE1 1 
ATOM 5204  O OE2 . GLU B 2  198  ? 222.168 140.700 216.818 1.00 370.00 ? 198  GLU B OE2 1 
ATOM 5205  N N   . LEU B 2  199  ? 218.824 142.745 212.220 1.00 370.00 ? 199  LEU B N   1 
ATOM 5206  C CA  . LEU B 2  199  ? 217.923 143.178 211.158 1.00 370.00 ? 199  LEU B CA  1 
ATOM 5207  C C   . LEU B 2  199  ? 216.520 142.668 211.444 1.00 370.00 ? 199  LEU B C   1 
ATOM 5208  O O   . LEU B 2  199  ? 216.269 141.465 211.442 1.00 370.00 ? 199  LEU B O   1 
ATOM 5209  C CB  . LEU B 2  199  ? 218.422 142.679 209.813 1.00 370.00 ? 199  LEU B CB  1 
ATOM 5210  C CG  . LEU B 2  199  ? 219.746 143.304 209.395 1.00 370.00 ? 199  LEU B CG  1 
ATOM 5211  C CD1 . LEU B 2  199  ? 220.284 142.633 208.135 1.00 370.00 ? 199  LEU B CD1 1 
ATOM 5212  C CD2 . LEU B 2  199  ? 219.555 144.796 209.181 1.00 370.00 ? 199  LEU B CD2 1 
ATOM 5213  N N   . CYS B 2  200  ? 215.598 143.579 211.692 1.00 370.00 ? 200  CYS B N   1 
ATOM 5214  C CA  . CYS B 2  200  ? 214.225 143.197 211.960 1.00 370.00 ? 200  CYS B CA  1 
ATOM 5215  C C   . CYS B 2  200  ? 213.277 144.139 211.246 1.00 370.00 ? 200  CYS B C   1 
ATOM 5216  O O   . CYS B 2  200  ? 213.685 145.072 210.559 1.00 370.00 ? 200  CYS B O   1 
ATOM 5217  C CB  . CYS B 2  200  ? 213.932 143.196 213.458 1.00 370.00 ? 200  CYS B CB  1 
ATOM 5218  S SG  . CYS B 2  200  ? 214.790 141.927 214.371 1.00 370.00 ? 200  CYS B SG  1 
ATOM 5219  N N   . THR B 2  201  ? 211.994 143.877 211.437 1.00 370.00 ? 201  THR B N   1 
ATOM 5220  C CA  . THR B 2  201  ? 210.926 144.705 210.919 1.00 370.00 ? 201  THR B CA  1 
ATOM 5221  C C   . THR B 2  201  ? 209.853 144.800 211.987 1.00 370.00 ? 201  THR B C   1 
ATOM 5222  O O   . THR B 2  201  ? 209.725 143.915 212.838 1.00 370.00 ? 201  THR B O   1 
ATOM 5223  C CB  . THR B 2  201  ? 210.368 144.156 209.614 1.00 370.00 ? 201  THR B CB  1 
ATOM 5224  O OG1 . THR B 2  201  ? 209.255 144.954 209.202 1.00 370.00 ? 201  THR B OG1 1 
ATOM 5225  C CG2 . THR B 2  201  ? 209.965 142.706 209.768 1.00 370.00 ? 201  THR B CG2 1 
ATOM 5226  N N   . TRP B 2  202  ? 209.090 145.884 211.950 1.00 370.00 ? 202  TRP B N   1 
ATOM 5227  C CA  . TRP B 2  202  ? 208.313 146.256 213.118 1.00 370.00 ? 202  TRP B CA  1 
ATOM 5228  C C   . TRP B 2  202  ? 206.889 146.653 212.782 1.00 370.00 ? 202  TRP B C   1 
ATOM 5229  O O   . TRP B 2  202  ? 206.626 147.326 211.785 1.00 370.00 ? 202  TRP B O   1 
ATOM 5230  C CB  . TRP B 2  202  ? 208.962 147.404 213.846 1.00 370.00 ? 202  TRP B CB  1 
ATOM 5231  C CG  . TRP B 2  202  ? 210.121 147.013 214.657 1.00 370.00 ? 202  TRP B CG  1 
ATOM 5232  C CD1 . TRP B 2  202  ? 210.104 146.644 215.956 1.00 370.00 ? 202  TRP B CD1 1 
ATOM 5233  C CD2 . TRP B 2  202  ? 211.483 146.963 214.240 1.00 370.00 ? 202  TRP B CD2 1 
ATOM 5234  N NE1 . TRP B 2  202  ? 211.372 146.366 216.386 1.00 370.00 ? 202  TRP B NE1 1 
ATOM 5235  C CE2 . TRP B 2  202  ? 212.238 146.553 215.345 1.00 370.00 ? 202  TRP B CE2 1 
ATOM 5236  C CE3 . TRP B 2  202  ? 212.139 147.237 213.047 1.00 370.00 ? 202  TRP B CE3 1 
ATOM 5237  C CZ2 . TRP B 2  202  ? 213.607 146.402 215.288 1.00 370.00 ? 202  TRP B CZ2 1 
ATOM 5238  C CZ3 . TRP B 2  202  ? 213.485 147.075 212.997 1.00 370.00 ? 202  TRP B CZ3 1 
ATOM 5239  C CH2 . TRP B 2  202  ? 214.208 146.669 214.104 1.00 370.00 ? 202  TRP B CH2 1 
ATOM 5240  N N   . LYS B 2  203  ? 205.976 146.250 213.656 1.00 370.00 ? 203  LYS B N   1 
ATOM 5241  C CA  . LYS B 2  203  ? 204.639 146.820 213.691 1.00 370.00 ? 203  LYS B CA  1 
ATOM 5242  C C   . LYS B 2  203  ? 204.467 147.502 215.035 1.00 370.00 ? 203  LYS B C   1 
ATOM 5243  O O   . LYS B 2  203  ? 204.855 146.957 216.077 1.00 370.00 ? 203  LYS B O   1 
ATOM 5244  C CB  . LYS B 2  203  ? 203.552 145.775 213.466 1.00 370.00 ? 203  LYS B CB  1 
ATOM 5245  C CG  . LYS B 2  203  ? 202.182 146.401 213.251 1.00 370.00 ? 203  LYS B CG  1 
ATOM 5246  C CD  . LYS B 2  203  ? 201.124 145.365 212.911 1.00 370.00 ? 203  LYS B CD  1 
ATOM 5247  C CE  . LYS B 2  203  ? 199.773 146.017 212.662 1.00 370.00 ? 203  LYS B CE  1 
ATOM 5248  N NZ  . LYS B 2  203  ? 198.722 145.019 212.327 1.00 370.00 ? 203  LYS B NZ  1 
ATOM 5249  N N   . LEU B 2  204  ? 203.945 148.720 215.009 1.00 370.00 ? 204  LEU B N   1 
ATOM 5250  C CA  . LEU B 2  204  ? 204.079 149.622 216.135 1.00 370.00 ? 204  LEU B CA  1 
ATOM 5251  C C   . LEU B 2  204  ? 202.727 150.241 216.418 1.00 370.00 ? 204  LEU B C   1 
ATOM 5252  O O   . LEU B 2  204  ? 202.168 150.927 215.556 1.00 370.00 ? 204  LEU B O   1 
ATOM 5253  C CB  . LEU B 2  204  ? 205.105 150.699 215.818 1.00 370.00 ? 204  LEU B CB  1 
ATOM 5254  C CG  . LEU B 2  204  ? 206.500 150.244 215.377 1.00 370.00 ? 204  LEU B CG  1 
ATOM 5255  C CD1 . LEU B 2  204  ? 207.379 151.421 215.055 1.00 370.00 ? 204  LEU B CD1 1 
ATOM 5256  C CD2 . LEU B 2  204  ? 207.159 149.337 216.384 1.00 370.00 ? 204  LEU B CD2 1 
ATOM 5257  N N   . GLU B 2  205  ? 202.217 150.012 217.622 1.00 370.00 ? 205  GLU B N   1 
ATOM 5258  C CA  . GLU B 2  205  ? 200.878 150.410 218.018 1.00 370.00 ? 205  GLU B CA  1 
ATOM 5259  C C   . GLU B 2  205  ? 200.979 151.492 219.078 1.00 370.00 ? 205  GLU B C   1 
ATOM 5260  O O   . GLU B 2  205  ? 201.686 151.329 220.079 1.00 370.00 ? 205  GLU B O   1 
ATOM 5261  C CB  . GLU B 2  205  ? 200.090 149.212 218.541 1.00 370.00 ? 205  GLU B CB  1 
ATOM 5262  C CG  . GLU B 2  205  ? 198.660 149.552 218.899 1.00 370.00 ? 205  GLU B CG  1 
ATOM 5263  C CD  . GLU B 2  205  ? 197.815 148.337 219.240 1.00 370.00 ? 205  GLU B CD  1 
ATOM 5264  O OE1 . GLU B 2  205  ? 198.353 147.210 219.218 1.00 370.00 ? 205  GLU B OE1 1 
ATOM 5265  O OE2 . GLU B 2  205  ? 196.609 148.512 219.523 1.00 370.00 ? 205  GLU B OE2 1 
ATOM 5266  N N   . PHE B 2  206  ? 200.267 152.589 218.856 1.00 370.00 ? 206  PHE B N   1 
ATOM 5267  C CA  . PHE B 2  206  ? 200.520 153.846 219.541 1.00 370.00 ? 206  PHE B CA  1 
ATOM 5268  C C   . PHE B 2  206  ? 199.224 154.382 220.130 1.00 370.00 ? 206  PHE B C   1 
ATOM 5269  O O   . PHE B 2  206  ? 198.347 154.821 219.382 1.00 370.00 ? 206  PHE B O   1 
ATOM 5270  C CB  . PHE B 2  206  ? 201.120 154.844 218.553 1.00 370.00 ? 206  PHE B CB  1 
ATOM 5271  C CG  . PHE B 2  206  ? 202.524 154.506 218.106 1.00 370.00 ? 206  PHE B CG  1 
ATOM 5272  C CD1 . PHE B 2  206  ? 203.385 153.786 218.913 1.00 370.00 ? 206  PHE B CD1 1 
ATOM 5273  C CD2 . PHE B 2  206  ? 202.965 154.880 216.851 1.00 370.00 ? 206  PHE B CD2 1 
ATOM 5274  C CE1 . PHE B 2  206  ? 204.661 153.479 218.499 1.00 370.00 ? 206  PHE B CE1 1 
ATOM 5275  C CE2 . PHE B 2  206  ? 204.241 154.565 216.426 1.00 370.00 ? 206  PHE B CE2 1 
ATOM 5276  C CZ  . PHE B 2  206  ? 205.091 153.881 217.260 1.00 370.00 ? 206  PHE B CZ  1 
ATOM 5277  N N   . THR B 2  207  ? 199.111 154.376 221.460 1.00 370.00 ? 207  THR B N   1 
ATOM 5278  C CA  . THR B 2  207  ? 197.922 154.898 222.132 1.00 370.00 ? 207  THR B CA  1 
ATOM 5279  C C   . THR B 2  207  ? 198.104 156.394 222.320 1.00 370.00 ? 207  THR B C   1 
ATOM 5280  O O   . THR B 2  207  ? 198.823 156.833 223.218 1.00 370.00 ? 207  THR B O   1 
ATOM 5281  C CB  . THR B 2  207  ? 197.718 154.208 223.473 1.00 370.00 ? 207  THR B CB  1 
ATOM 5282  O OG1 . THR B 2  207  ? 197.606 152.794 223.275 1.00 370.00 ? 207  THR B OG1 1 
ATOM 5283  C CG2 . THR B 2  207  ? 196.464 154.730 224.153 1.00 370.00 ? 207  THR B CG2 1 
ATOM 5284  N N   . VAL B 2  208  ? 197.455 157.189 221.474 1.00 370.00 ? 208  VAL B N   1 
ATOM 5285  C CA  . VAL B 2  208  ? 197.709 158.617 221.416 1.00 370.00 ? 208  VAL B CA  1 
ATOM 5286  C C   . VAL B 2  208  ? 196.428 159.369 221.724 1.00 370.00 ? 208  VAL B C   1 
ATOM 5287  O O   . VAL B 2  208  ? 195.323 158.838 221.609 1.00 370.00 ? 208  VAL B O   1 
ATOM 5288  C CB  . VAL B 2  208  ? 198.246 159.039 220.038 1.00 370.00 ? 208  VAL B CB  1 
ATOM 5289  C CG1 . VAL B 2  208  ? 199.493 158.285 219.740 1.00 370.00 ? 208  VAL B CG1 1 
ATOM 5290  C CG2 . VAL B 2  208  ? 197.231 158.751 218.959 1.00 370.00 ? 208  VAL B CG2 1 
ATOM 5291  N N   . ASP B 2  209  ? 196.591 160.629 222.106 1.00 370.00 ? 209  ASP B N   1 
ATOM 5292  C CA  . ASP B 2  209  ? 195.465 161.544 222.081 1.00 370.00 ? 209  ASP B CA  1 
ATOM 5293  C C   . ASP B 2  209  ? 195.046 161.772 220.638 1.00 370.00 ? 209  ASP B C   1 
ATOM 5294  O O   . ASP B 2  209  ? 195.851 161.661 219.711 1.00 370.00 ? 209  ASP B O   1 
ATOM 5295  C CB  . ASP B 2  209  ? 195.830 162.876 222.730 1.00 370.00 ? 209  ASP B CB  1 
ATOM 5296  C CG  . ASP B 2  209  ? 194.626 163.784 222.948 1.00 370.00 ? 209  ASP B CG  1 
ATOM 5297  O OD1 . ASP B 2  209  ? 193.480 163.361 222.688 1.00 370.00 ? 209  ASP B OD1 1 
ATOM 5298  O OD2 . ASP B 2  209  ? 194.836 164.944 223.352 1.00 370.00 ? 209  ASP B OD2 1 
ATOM 5299  N N   . ALA B 2  210  ? 193.766 162.096 220.463 1.00 370.00 ? 210  ALA B N   1 
ATOM 5300  C CA  . ALA B 2  210  ? 193.242 162.387 219.135 1.00 370.00 ? 210  ALA B CA  1 
ATOM 5301  C C   . ALA B 2  210  ? 193.888 163.634 218.551 1.00 370.00 ? 210  ALA B C   1 
ATOM 5302  O O   . ALA B 2  210  ? 194.051 163.752 217.333 1.00 370.00 ? 210  ALA B O   1 
ATOM 5303  C CB  . ALA B 2  210  ? 191.726 162.541 219.200 1.00 370.00 ? 210  ALA B CB  1 
ATOM 5304  N N   . ALA B 2  211  ? 194.276 164.573 219.410 1.00 370.00 ? 211  ALA B N   1 
ATOM 5305  C CA  . ALA B 2  211  ? 195.040 165.716 218.931 1.00 370.00 ? 211  ALA B CA  1 
ATOM 5306  C C   . ALA B 2  211  ? 196.520 165.376 218.807 1.00 370.00 ? 211  ALA B C   1 
ATOM 5307  O O   . ALA B 2  211  ? 197.158 165.711 217.802 1.00 370.00 ? 211  ALA B O   1 
ATOM 5308  C CB  . ALA B 2  211  ? 194.838 166.908 219.865 1.00 370.00 ? 211  ALA B CB  1 
ATOM 5309  N N   . MET B 2  212  ? 197.079 164.704 219.809 1.00 370.00 ? 212  MET B N   1 
ATOM 5310  C CA  . MET B 2  212  ? 198.524 164.563 219.891 1.00 370.00 ? 212  MET B CA  1 
ATOM 5311  C C   . MET B 2  212  ? 199.009 163.473 218.949 1.00 370.00 ? 212  MET B C   1 
ATOM 5312  O O   . MET B 2  212  ? 198.641 162.303 219.066 1.00 370.00 ? 212  MET B O   1 
ATOM 5313  C CB  . MET B 2  212  ? 198.935 164.264 221.328 1.00 370.00 ? 212  MET B CB  1 
ATOM 5314  C CG  . MET B 2  212  ? 198.553 165.396 222.273 1.00 370.00 ? 212  MET B CG  1 
ATOM 5315  S SD  . MET B 2  212  ? 198.928 165.129 224.011 1.00 370.00 ? 212  MET B SD  1 
ATOM 5316  C CE  . MET B 2  212  ? 200.707 165.296 223.983 1.00 370.00 ? 212  MET B CE  1 
ATOM 5317  N N   . VAL B 2  213  ? 199.853 163.875 218.008 1.00 370.00 ? 213  VAL B N   1 
ATOM 5318  C CA  . VAL B 2  213  ? 200.268 163.027 216.902 1.00 370.00 ? 213  VAL B CA  1 
ATOM 5319  C C   . VAL B 2  213  ? 201.639 162.462 217.220 1.00 370.00 ? 213  VAL B C   1 
ATOM 5320  O O   . VAL B 2  213  ? 202.541 163.202 217.627 1.00 370.00 ? 213  VAL B O   1 
ATOM 5321  C CB  . VAL B 2  213  ? 200.292 163.811 215.582 1.00 370.00 ? 213  VAL B CB  1 
ATOM 5322  C CG1 . VAL B 2  213  ? 200.762 162.937 214.446 1.00 370.00 ? 213  VAL B CG1 1 
ATOM 5323  C CG2 . VAL B 2  213  ? 198.918 164.369 215.300 1.00 370.00 ? 213  VAL B CG2 1 
ATOM 5324  N N   . ALA B 2  214  ? 201.793 161.156 217.040 1.00 370.00 ? 214  ALA B N   1 
ATOM 5325  C CA  . ALA B 2  214  ? 203.010 160.443 217.383 1.00 370.00 ? 214  ALA B CA  1 
ATOM 5326  C C   . ALA B 2  214  ? 203.682 159.941 216.119 1.00 370.00 ? 214  ALA B C   1 
ATOM 5327  O O   . ALA B 2  214  ? 203.017 159.403 215.231 1.00 370.00 ? 214  ALA B O   1 
ATOM 5328  C CB  . ALA B 2  214  ? 202.701 159.280 218.309 1.00 370.00 ? 214  ALA B CB  1 
ATOM 5329  N N   . VAL B 2  215  ? 204.988 160.139 216.026 1.00 370.00 ? 215  VAL B N   1 
ATOM 5330  C CA  . VAL B 2  215  ? 205.721 159.878 214.798 1.00 370.00 ? 215  VAL B CA  1 
ATOM 5331  C C   . VAL B 2  215  ? 206.910 158.989 215.091 1.00 370.00 ? 215  VAL B C   1 
ATOM 5332  O O   . VAL B 2  215  ? 207.765 159.316 215.919 1.00 370.00 ? 215  VAL B O   1 
ATOM 5333  C CB  . VAL B 2  215  ? 206.204 161.177 214.140 1.00 370.00 ? 215  VAL B CB  1 
ATOM 5334  C CG1 . VAL B 2  215  ? 207.044 160.870 212.930 1.00 370.00 ? 215  VAL B CG1 1 
ATOM 5335  C CG2 . VAL B 2  215  ? 205.037 162.016 213.764 1.00 370.00 ? 215  VAL B CG2 1 
ATOM 5336  N N   . SER B 2  216  ? 206.980 157.867 214.378 1.00 370.00 ? 216  SER B N   1 
ATOM 5337  C CA  . SER B 2  216  ? 208.125 156.979 214.496 1.00 370.00 ? 216  SER B CA  1 
ATOM 5338  C C   . SER B 2  216  ? 208.569 156.541 213.119 1.00 370.00 ? 216  SER B C   1 
ATOM 5339  O O   . SER B 2  216  ? 208.226 157.177 212.125 1.00 370.00 ? 216  SER B O   1 
ATOM 5340  C CB  . SER B 2  216  ? 207.818 155.760 215.359 1.00 370.00 ? 216  SER B CB  1 
ATOM 5341  O OG  . SER B 2  216  ? 206.968 154.862 214.685 1.00 370.00 ? 216  SER B OG  1 
ATOM 5342  N N   . ASN B 2  217  ? 209.350 155.475 213.055 1.00 370.00 ? 217  ASN B N   1 
ATOM 5343  C CA  . ASN B 2  217  ? 209.780 154.958 211.775 1.00 370.00 ? 217  ASN B CA  1 
ATOM 5344  C C   . ASN B 2  217  ? 208.604 154.372 211.010 1.00 370.00 ? 217  ASN B C   1 
ATOM 5345  O O   . ASN B 2  217  ? 207.488 154.237 211.517 1.00 370.00 ? 217  ASN B O   1 
ATOM 5346  C CB  . ASN B 2  217  ? 210.813 153.855 211.948 1.00 370.00 ? 217  ASN B CB  1 
ATOM 5347  C CG  . ASN B 2  217  ? 212.005 154.302 212.728 1.00 370.00 ? 217  ASN B CG  1 
ATOM 5348  O OD1 . ASN B 2  217  ? 212.352 155.467 212.721 1.00 370.00 ? 217  ASN B OD1 1 
ATOM 5349  N ND2 . ASN B 2  217  ? 212.682 153.361 213.355 1.00 370.00 ? 217  ASN B ND2 1 
ATOM 5350  N N   . GLY B 2  218  ? 208.878 153.997 209.771 1.00 370.00 ? 218  GLY B N   1 
ATOM 5351  C CA  . GLY B 2  218  ? 207.914 153.218 209.032 1.00 370.00 ? 218  GLY B CA  1 
ATOM 5352  C C   . GLY B 2  218  ? 206.789 154.069 208.479 1.00 370.00 ? 218  GLY B C   1 
ATOM 5353  O O   . GLY B 2  218  ? 206.981 155.216 208.076 1.00 370.00 ? 218  GLY B O   1 
ATOM 5354  N N   . ASP B 2  219  ? 205.593 153.489 208.473 1.00 370.00 ? 219  ASP B N   1 
ATOM 5355  C CA  . ASP B 2  219  ? 204.527 153.997 207.633 1.00 370.00 ? 219  ASP B CA  1 
ATOM 5356  C C   . ASP B 2  219  ? 203.204 154.006 208.378 1.00 370.00 ? 219  ASP B C   1 
ATOM 5357  O O   . ASP B 2  219  ? 202.949 153.157 209.241 1.00 370.00 ? 219  ASP B O   1 
ATOM 5358  C CB  . ASP B 2  219  ? 204.407 153.148 206.375 1.00 370.00 ? 219  ASP B CB  1 
ATOM 5359  C CG  . ASP B 2  219  ? 205.637 153.230 205.506 1.00 370.00 ? 219  ASP B CG  1 
ATOM 5360  O OD1 . ASP B 2  219  ? 206.260 154.308 205.454 1.00 370.00 ? 219  ASP B OD1 1 
ATOM 5361  O OD2 . ASP B 2  219  ? 206.004 152.205 204.902 1.00 370.00 ? 219  ASP B OD2 1 
ATOM 5362  N N   . LEU B 2  220  ? 202.347 154.946 207.958 1.00 370.00 ? 220  LEU B N   1 
ATOM 5363  C CA  . LEU B 2  220  ? 200.992 155.187 208.444 1.00 370.00 ? 220  LEU B CA  1 
ATOM 5364  C C   . LEU B 2  220  ? 200.067 154.069 208.000 1.00 370.00 ? 220  LEU B C   1 
ATOM 5365  O O   . LEU B 2  220  ? 199.146 154.312 207.215 1.00 370.00 ? 220  LEU B O   1 
ATOM 5366  C CB  . LEU B 2  220  ? 200.425 156.482 207.845 1.00 370.00 ? 220  LEU B CB  1 
ATOM 5367  C CG  . LEU B 2  220  ? 200.864 157.942 207.921 1.00 370.00 ? 220  LEU B CG  1 
ATOM 5368  C CD1 . LEU B 2  220  ? 200.103 158.719 206.852 1.00 370.00 ? 220  LEU B CD1 1 
ATOM 5369  C CD2 . LEU B 2  220  ? 200.563 158.543 209.260 1.00 370.00 ? 220  LEU B CD2 1 
ATOM 5370  N N   . VAL B 2  221  ? 200.272 152.848 208.472 1.00 370.00 ? 221  VAL B N   1 
ATOM 5371  C CA  . VAL B 2  221  ? 199.647 151.741 207.769 1.00 370.00 ? 221  VAL B CA  1 
ATOM 5372  C C   . VAL B 2  221  ? 198.201 151.495 208.169 1.00 370.00 ? 221  VAL B C   1 
ATOM 5373  O O   . VAL B 2  221  ? 197.434 150.959 207.359 1.00 370.00 ? 221  VAL B O   1 
ATOM 5374  C CB  . VAL B 2  221  ? 200.481 150.467 207.944 1.00 370.00 ? 221  VAL B CB  1 
ATOM 5375  C CG1 . VAL B 2  221  ? 201.829 150.683 207.322 1.00 370.00 ? 221  VAL B CG1 1 
ATOM 5376  C CG2 . VAL B 2  221  ? 200.624 150.124 209.399 1.00 370.00 ? 221  VAL B CG2 1 
ATOM 5377  N N   . GLU B 2  222  ? 197.794 151.889 209.376 1.00 370.00 ? 222  GLU B N   1 
ATOM 5378  C CA  . GLU B 2  222  ? 196.445 151.565 209.830 1.00 370.00 ? 222  GLU B CA  1 
ATOM 5379  C C   . GLU B 2  222  ? 196.043 152.605 210.877 1.00 370.00 ? 222  GLU B C   1 
ATOM 5380  O O   . GLU B 2  222  ? 196.439 152.496 212.041 1.00 370.00 ? 222  GLU B O   1 
ATOM 5381  C CB  . GLU B 2  222  ? 196.401 150.150 210.387 1.00 370.00 ? 222  GLU B CB  1 
ATOM 5382  C CG  . GLU B 2  222  ? 195.036 149.599 210.712 1.00 370.00 ? 222  GLU B CG  1 
ATOM 5383  C CD  . GLU B 2  222  ? 194.261 149.221 209.470 1.00 370.00 ? 222  GLU B CD  1 
ATOM 5384  O OE1 . GLU B 2  222  ? 194.905 148.923 208.441 1.00 370.00 ? 222  GLU B OE1 1 
ATOM 5385  O OE2 . GLU B 2  222  ? 193.014 149.207 209.524 1.00 370.00 ? 222  GLU B OE2 1 
ATOM 5386  N N   . THR B 2  223  ? 195.263 153.600 210.451 1.00 370.00 ? 223  THR B N   1 
ATOM 5387  C CA  . THR B 2  223  ? 194.741 154.625 211.355 1.00 370.00 ? 223  THR B CA  1 
ATOM 5388  C C   . THR B 2  223  ? 193.519 155.280 210.731 1.00 370.00 ? 223  THR B C   1 
ATOM 5389  O O   . THR B 2  223  ? 193.615 155.883 209.658 1.00 370.00 ? 223  THR B O   1 
ATOM 5390  C CB  . THR B 2  223  ? 195.792 155.686 211.676 1.00 370.00 ? 223  THR B CB  1 
ATOM 5391  O OG1 . THR B 2  223  ? 196.860 155.105 212.435 1.00 370.00 ? 223  THR B OG1 1 
ATOM 5392  C CG2 . THR B 2  223  ? 195.169 156.810 212.471 1.00 370.00 ? 223  THR B CG2 1 
ATOM 5393  N N   . VAL B 2  224  ? 192.385 155.170 211.415 1.00 370.00 ? 224  VAL B N   1 
ATOM 5394  C CA  . VAL B 2  224  ? 191.181 155.962 211.189 1.00 370.00 ? 224  VAL B CA  1 
ATOM 5395  C C   . VAL B 2  224  ? 191.007 156.670 212.515 1.00 370.00 ? 224  VAL B C   1 
ATOM 5396  O O   . VAL B 2  224  ? 191.957 156.705 213.307 1.00 370.00 ? 224  VAL B O   1 
ATOM 5397  C CB  . VAL B 2  224  ? 189.954 155.113 210.820 1.00 370.00 ? 224  VAL B CB  1 
ATOM 5398  C CG1 . VAL B 2  224  ? 190.171 154.437 209.490 1.00 370.00 ? 224  VAL B CG1 1 
ATOM 5399  C CG2 . VAL B 2  224  ? 189.679 154.079 211.899 1.00 370.00 ? 224  VAL B CG2 1 
ATOM 5400  N N   . TYR B 2  225  ? 189.862 157.316 212.743 1.00 370.00 ? 225  TYR B N   1 
ATOM 5401  C CA  . TYR B 2  225  ? 189.573 157.595 214.142 1.00 370.00 ? 225  TYR B CA  1 
ATOM 5402  C C   . TYR B 2  225  ? 189.473 156.248 214.838 1.00 370.00 ? 225  TYR B C   1 
ATOM 5403  O O   . TYR B 2  225  ? 188.493 155.514 214.687 1.00 370.00 ? 225  TYR B O   1 
ATOM 5404  C CB  . TYR B 2  225  ? 188.303 158.407 214.356 1.00 370.00 ? 225  TYR B CB  1 
ATOM 5405  C CG  . TYR B 2  225  ? 188.100 158.686 215.828 1.00 370.00 ? 225  TYR B CG  1 
ATOM 5406  C CD1 . TYR B 2  225  ? 188.891 159.618 216.489 1.00 370.00 ? 225  TYR B CD1 1 
ATOM 5407  C CD2 . TYR B 2  225  ? 187.147 157.994 216.567 1.00 370.00 ? 225  TYR B CD2 1 
ATOM 5408  C CE1 . TYR B 2  225  ? 188.726 159.866 217.843 1.00 370.00 ? 225  TYR B CE1 1 
ATOM 5409  C CE2 . TYR B 2  225  ? 186.976 158.236 217.920 1.00 370.00 ? 225  TYR B CE2 1 
ATOM 5410  C CZ  . TYR B 2  225  ? 187.766 159.171 218.551 1.00 370.00 ? 225  TYR B CZ  1 
ATOM 5411  O OH  . TYR B 2  225  ? 187.588 159.407 219.895 1.00 370.00 ? 225  TYR B OH  1 
ATOM 5412  N N   . THR B 2  226  ? 190.519 155.926 215.587 1.00 370.00 ? 226  THR B N   1 
ATOM 5413  C CA  . THR B 2  226  ? 190.831 154.555 215.937 1.00 370.00 ? 226  THR B CA  1 
ATOM 5414  C C   . THR B 2  226  ? 190.271 154.253 217.320 1.00 370.00 ? 226  THR B C   1 
ATOM 5415  O O   . THR B 2  226  ? 190.167 155.148 218.160 1.00 370.00 ? 226  THR B O   1 
ATOM 5416  C CB  . THR B 2  226  ? 192.345 154.347 215.878 1.00 370.00 ? 226  THR B CB  1 
ATOM 5417  O OG1 . THR B 2  226  ? 192.840 154.876 214.642 1.00 370.00 ? 226  THR B OG1 1 
ATOM 5418  C CG2 . THR B 2  226  ? 192.680 152.876 215.893 1.00 370.00 ? 226  THR B CG2 1 
ATOM 5419  N N   . HIS B 2  227  ? 189.771 153.021 217.481 1.00 370.00 ? 227  HIS B N   1 
ATOM 5420  C CA  . HIS B 2  227  ? 189.137 152.378 218.641 1.00 370.00 ? 227  HIS B CA  1 
ATOM 5421  C C   . HIS B 2  227  ? 187.869 153.081 219.131 1.00 370.00 ? 227  HIS B C   1 
ATOM 5422  O O   . HIS B 2  227  ? 187.262 152.619 220.108 1.00 370.00 ? 227  HIS B O   1 
ATOM 5423  C CB  . HIS B 2  227  ? 190.099 152.147 219.830 1.00 370.00 ? 227  HIS B CB  1 
ATOM 5424  C CG  . HIS B 2  227  ? 190.497 153.382 220.575 1.00 370.00 ? 227  HIS B CG  1 
ATOM 5425  N ND1 . HIS B 2  227  ? 189.686 153.979 221.514 1.00 370.00 ? 227  HIS B ND1 1 
ATOM 5426  C CD2 . HIS B 2  227  ? 191.652 154.088 220.574 1.00 370.00 ? 227  HIS B CD2 1 
ATOM 5427  C CE1 . HIS B 2  227  ? 190.300 155.032 222.020 1.00 370.00 ? 227  HIS B CE1 1 
ATOM 5428  N NE2 . HIS B 2  227  ? 191.497 155.117 221.470 1.00 370.00 ? 227  HIS B NE2 1 
ATOM 5429  N N   . ASP B 2  228  ? 187.468 154.183 218.484 1.00 370.00 ? 228  ASP B N   1 
ATOM 5430  C CA  . ASP B 2  228  ? 186.125 154.765 218.514 1.00 370.00 ? 228  ASP B CA  1 
ATOM 5431  C C   . ASP B 2  228  ? 185.638 155.120 219.919 1.00 370.00 ? 228  ASP B C   1 
ATOM 5432  O O   . ASP B 2  228  ? 184.429 155.194 220.151 1.00 370.00 ? 228  ASP B O   1 
ATOM 5433  C CB  . ASP B 2  228  ? 185.123 153.831 217.825 1.00 370.00 ? 228  ASP B CB  1 
ATOM 5434  C CG  . ASP B 2  228  ? 185.385 153.693 216.332 1.00 370.00 ? 228  ASP B CG  1 
ATOM 5435  O OD1 . ASP B 2  228  ? 185.890 154.658 215.721 1.00 370.00 ? 228  ASP B OD1 1 
ATOM 5436  O OD2 . ASP B 2  228  ? 185.095 152.616 215.768 1.00 370.00 ? 228  ASP B OD2 1 
ATOM 5437  N N   . MET B 2  229  ? 186.530 155.335 220.885 1.00 370.00 ? 229  MET B N   1 
ATOM 5438  C CA  . MET B 2  229  ? 186.098 155.484 222.269 1.00 370.00 ? 229  MET B CA  1 
ATOM 5439  C C   . MET B 2  229  ? 186.352 156.893 222.789 1.00 370.00 ? 229  MET B C   1 
ATOM 5440  O O   . MET B 2  229  ? 185.402 157.637 223.037 1.00 370.00 ? 229  MET B O   1 
ATOM 5441  C CB  . MET B 2  229  ? 186.820 154.442 223.121 1.00 370.00 ? 229  MET B CB  1 
ATOM 5442  C CG  . MET B 2  229  ? 186.189 154.169 224.447 1.00 370.00 ? 229  MET B CG  1 
ATOM 5443  S SD  . MET B 2  229  ? 184.607 153.369 224.150 1.00 370.00 ? 229  MET B SD  1 
ATOM 5444  C CE  . MET B 2  229  ? 185.165 151.804 223.481 1.00 370.00 ? 229  MET B CE  1 
ATOM 5445  N N   . ARG B 2  230  ? 187.610 157.293 222.951 1.00 370.00 ? 230  ARG B N   1 
ATOM 5446  C CA  . ARG B 2  230  ? 187.935 158.689 223.228 1.00 370.00 ? 230  ARG B CA  1 
ATOM 5447  C C   . ARG B 2  230  ? 189.218 159.166 222.578 1.00 370.00 ? 230  ARG B C   1 
ATOM 5448  O O   . ARG B 2  230  ? 189.403 160.379 222.443 1.00 370.00 ? 230  ARG B O   1 
ATOM 5449  C CB  . ARG B 2  230  ? 188.023 158.941 224.732 1.00 370.00 ? 230  ARG B CB  1 
ATOM 5450  C CG  . ARG B 2  230  ? 189.156 158.224 225.416 1.00 370.00 ? 230  ARG B CG  1 
ATOM 5451  C CD  . ARG B 2  230  ? 189.142 158.533 226.894 1.00 370.00 ? 230  ARG B CD  1 
ATOM 5452  N NE  . ARG B 2  230  ? 190.225 157.870 227.611 1.00 370.00 ? 230  ARG B NE  1 
ATOM 5453  C CZ  . ARG B 2  230  ? 190.443 158.002 228.915 1.00 370.00 ? 230  ARG B CZ  1 
ATOM 5454  N NH1 . ARG B 2  230  ? 189.651 158.777 229.645 1.00 370.00 ? 230  ARG B NH1 1 
ATOM 5455  N NH2 . ARG B 2  230  ? 191.451 157.362 229.492 1.00 370.00 ? 230  ARG B NH2 1 
ATOM 5456  N N   . LYS B 2  231  ? 190.115 158.270 222.191 1.00 370.00 ? 231  LYS B N   1 
ATOM 5457  C CA  . LYS B 2  231  ? 191.464 158.622 221.784 1.00 370.00 ? 231  LYS B CA  1 
ATOM 5458  C C   . LYS B 2  231  ? 191.736 158.084 220.395 1.00 370.00 ? 231  LYS B C   1 
ATOM 5459  O O   . LYS B 2  231  ? 190.808 157.638 219.713 1.00 370.00 ? 231  LYS B O   1 
ATOM 5460  C CB  . LYS B 2  231  ? 192.483 158.046 222.754 1.00 370.00 ? 231  LYS B CB  1 
ATOM 5461  C CG  . LYS B 2  231  ? 192.609 158.725 224.078 1.00 370.00 ? 231  LYS B CG  1 
ATOM 5462  C CD  . LYS B 2  231  ? 193.756 158.062 224.814 1.00 370.00 ? 231  LYS B CD  1 
ATOM 5463  C CE  . LYS B 2  231  ? 193.992 158.648 226.185 1.00 370.00 ? 231  LYS B CE  1 
ATOM 5464  N NZ  . LYS B 2  231  ? 195.112 157.936 226.863 1.00 370.00 ? 231  LYS B NZ  1 
ATOM 5465  N N   . LYS B 2  232  ? 192.992 158.112 219.959 1.00 370.00 ? 232  LYS B N   1 
ATOM 5466  C CA  . LYS B 2  232  ? 193.368 157.470 218.713 1.00 370.00 ? 232  LYS B CA  1 
ATOM 5467  C C   . LYS B 2  232  ? 194.489 156.475 218.962 1.00 370.00 ? 232  LYS B C   1 
ATOM 5468  O O   . LYS B 2  232  ? 195.069 156.403 220.047 1.00 370.00 ? 232  LYS B O   1 
ATOM 5469  C CB  . LYS B 2  232  ? 193.783 158.497 217.657 1.00 370.00 ? 232  LYS B CB  1 
ATOM 5470  C CG  . LYS B 2  232  ? 192.612 159.272 217.092 1.00 370.00 ? 232  LYS B CG  1 
ATOM 5471  C CD  . LYS B 2  232  ? 193.071 160.312 216.097 1.00 370.00 ? 232  LYS B CD  1 
ATOM 5472  C CE  . LYS B 2  232  ? 193.656 159.659 214.868 1.00 370.00 ? 232  LYS B CE  1 
ATOM 5473  N NZ  . LYS B 2  232  ? 192.662 158.890 214.091 1.00 370.00 ? 232  LYS B NZ  1 
ATOM 5474  N N   . THR B 2  233  ? 194.780 155.689 217.934 1.00 370.00 ? 233  THR B N   1 
ATOM 5475  C CA  . THR B 2  233  ? 195.800 154.660 218.038 1.00 370.00 ? 233  THR B CA  1 
ATOM 5476  C C   . THR B 2  233  ? 196.408 154.453 216.666 1.00 370.00 ? 233  THR B C   1 
ATOM 5477  O O   . THR B 2  233  ? 195.693 154.214 215.690 1.00 370.00 ? 233  THR B O   1 
ATOM 5478  C CB  . THR B 2  233  ? 195.219 153.354 218.571 1.00 370.00 ? 233  THR B CB  1 
ATOM 5479  O OG1 . THR B 2  233  ? 194.708 153.563 219.892 1.00 370.00 ? 233  THR B OG1 1 
ATOM 5480  C CG2 . THR B 2  233  ? 196.279 152.300 218.622 1.00 370.00 ? 233  THR B CG2 1 
ATOM 5481  N N   . PHE B 2  234  ? 197.724 154.549 216.601 1.00 370.00 ? 234  PHE B N   1 
ATOM 5482  C CA  . PHE B 2  234  ? 198.435 154.603 215.338 1.00 370.00 ? 234  PHE B CA  1 
ATOM 5483  C C   . PHE B 2  234  ? 199.145 153.287 215.094 1.00 370.00 ? 234  PHE B C   1 
ATOM 5484  O O   . PHE B 2  234  ? 199.724 152.705 216.014 1.00 370.00 ? 234  PHE B O   1 
ATOM 5485  C CB  . PHE B 2  234  ? 199.461 155.735 215.320 1.00 370.00 ? 234  PHE B CB  1 
ATOM 5486  C CG  . PHE B 2  234  ? 198.864 157.114 215.381 1.00 370.00 ? 234  PHE B CG  1 
ATOM 5487  C CD1 . PHE B 2  234  ? 197.529 157.333 215.099 1.00 370.00 ? 234  PHE B CD1 1 
ATOM 5488  C CD2 . PHE B 2  234  ? 199.651 158.196 215.732 1.00 370.00 ? 234  PHE B CD2 1 
ATOM 5489  C CE1 . PHE B 2  234  ? 196.995 158.589 215.166 1.00 370.00 ? 234  PHE B CE1 1 
ATOM 5490  C CE2 . PHE B 2  234  ? 199.117 159.466 215.800 1.00 370.00 ? 234  PHE B CE2 1 
ATOM 5491  C CZ  . PHE B 2  234  ? 197.787 159.660 215.513 1.00 370.00 ? 234  PHE B CZ  1 
ATOM 5492  N N   . HIS B 2  235  ? 199.096 152.828 213.856 1.00 370.00 ? 235  HIS B N   1 
ATOM 5493  C CA  . HIS B 2  235  ? 199.923 151.723 213.400 1.00 370.00 ? 235  HIS B CA  1 
ATOM 5494  C C   . HIS B 2  235  ? 200.989 152.286 212.482 1.00 370.00 ? 235  HIS B C   1 
ATOM 5495  O O   . HIS B 2  235  ? 200.688 152.750 211.376 1.00 370.00 ? 235  HIS B O   1 
ATOM 5496  C CB  . HIS B 2  235  ? 199.111 150.666 212.673 1.00 370.00 ? 235  HIS B CB  1 
ATOM 5497  C CG  . HIS B 2  235  ? 198.254 149.834 213.564 1.00 370.00 ? 235  HIS B CG  1 
ATOM 5498  N ND1 . HIS B 2  235  ? 198.761 148.801 214.321 1.00 370.00 ? 235  HIS B ND1 1 
ATOM 5499  C CD2 . HIS B 2  235  ? 196.926 149.873 213.818 1.00 370.00 ? 235  HIS B CD2 1 
ATOM 5500  C CE1 . HIS B 2  235  ? 197.780 148.237 215.002 1.00 370.00 ? 235  HIS B CE1 1 
ATOM 5501  N NE2 . HIS B 2  235  ? 196.656 148.869 214.716 1.00 370.00 ? 235  HIS B NE2 1 
ATOM 5502  N N   . TYR B 2  236  ? 202.225 152.260 212.946 1.00 370.00 ? 236  TYR B N   1 
ATOM 5503  C CA  . TYR B 2  236  ? 203.368 152.479 212.077 1.00 370.00 ? 236  TYR B CA  1 
ATOM 5504  C C   . TYR B 2  236  ? 204.011 151.132 211.846 1.00 370.00 ? 236  TYR B C   1 
ATOM 5505  O O   . TYR B 2  236  ? 204.447 150.467 212.788 1.00 370.00 ? 236  TYR B O   1 
ATOM 5506  C CB  . TYR B 2  236  ? 204.351 153.485 212.663 1.00 370.00 ? 236  TYR B CB  1 
ATOM 5507  C CG  . TYR B 2  236  ? 203.882 154.906 212.508 1.00 370.00 ? 236  TYR B CG  1 
ATOM 5508  C CD1 . TYR B 2  236  ? 202.864 155.223 211.626 1.00 370.00 ? 236  TYR B CD1 1 
ATOM 5509  C CD2 . TYR B 2  236  ? 204.455 155.931 213.233 1.00 370.00 ? 236  TYR B CD2 1 
ATOM 5510  C CE1 . TYR B 2  236  ? 202.431 156.511 211.481 1.00 370.00 ? 236  TYR B CE1 1 
ATOM 5511  C CE2 . TYR B 2  236  ? 204.027 157.227 213.094 1.00 370.00 ? 236  TYR B CE2 1 
ATOM 5512  C CZ  . TYR B 2  236  ? 203.016 157.513 212.215 1.00 370.00 ? 236  TYR B CZ  1 
ATOM 5513  O OH  . TYR B 2  236  ? 202.587 158.809 212.073 1.00 370.00 ? 236  TYR B OH  1 
ATOM 5514  N N   . MET B 2  237  ? 204.024 150.707 210.601 1.00 370.00 ? 237  MET B N   1 
ATOM 5515  C CA  . MET B 2  237  ? 204.747 149.501 210.251 1.00 370.00 ? 237  MET B CA  1 
ATOM 5516  C C   . MET B 2  237  ? 205.974 149.881 209.450 1.00 370.00 ? 237  MET B C   1 
ATOM 5517  O O   . MET B 2  237  ? 205.876 150.597 208.448 1.00 370.00 ? 237  MET B O   1 
ATOM 5518  C CB  . MET B 2  237  ? 203.888 148.520 209.464 1.00 370.00 ? 237  MET B CB  1 
ATOM 5519  C CG  . MET B 2  237  ? 204.593 147.221 209.165 1.00 370.00 ? 237  MET B CG  1 
ATOM 5520  S SD  . MET B 2  237  ? 203.573 146.093 208.202 1.00 370.00 ? 237  MET B SD  1 
ATOM 5521  C CE  . MET B 2  237  ? 202.371 145.599 209.427 1.00 370.00 ? 237  MET B CE  1 
ATOM 5522  N N   . LEU B 2  238  ? 207.121 149.429 209.913 1.00 370.00 ? 238  LEU B N   1 
ATOM 5523  C CA  . LEU B 2  238  ? 208.341 149.506 209.137 1.00 370.00 ? 238  LEU B CA  1 
ATOM 5524  C C   . LEU B 2  238  ? 208.564 148.130 208.553 1.00 370.00 ? 238  LEU B C   1 
ATOM 5525  O O   . LEU B 2  238  ? 208.918 147.184 209.263 1.00 370.00 ? 238  LEU B O   1 
ATOM 5526  C CB  . LEU B 2  238  ? 209.523 149.962 209.972 1.00 370.00 ? 238  LEU B CB  1 
ATOM 5527  C CG  . LEU B 2  238  ? 210.780 150.037 209.115 1.00 370.00 ? 238  LEU B CG  1 
ATOM 5528  C CD1 . LEU B 2  238  ? 210.602 150.964 207.933 1.00 370.00 ? 238  LEU B CD1 1 
ATOM 5529  C CD2 . LEU B 2  238  ? 211.907 150.519 209.967 1.00 370.00 ? 238  LEU B CD2 1 
ATOM 5530  N N   . THR B 2  239  ? 208.303 148.035 207.257 1.00 370.00 ? 239  THR B N   1 
ATOM 5531  C CA  . THR B 2  239  ? 208.565 146.841 206.480 1.00 370.00 ? 239  THR B CA  1 
ATOM 5532  C C   . THR B 2  239  ? 210.035 146.750 206.110 1.00 370.00 ? 239  THR B C   1 
ATOM 5533  O O   . THR B 2  239  ? 210.587 145.648 206.019 1.00 370.00 ? 239  THR B O   1 
ATOM 5534  C CB  . THR B 2  239  ? 207.689 146.876 205.227 1.00 370.00 ? 239  THR B CB  1 
ATOM 5535  O OG1 . THR B 2  239  ? 206.331 147.109 205.615 1.00 370.00 ? 239  THR B OG1 1 
ATOM 5536  C CG2 . THR B 2  239  ? 207.753 145.566 204.462 1.00 370.00 ? 239  THR B CG2 1 
ATOM 5537  N N   . ILE B 2  240  ? 210.673 147.894 205.926 1.00 370.00 ? 240  ILE B N   1 
ATOM 5538  C CA  . ILE B 2  240  ? 212.075 147.950 205.510 1.00 370.00 ? 240  ILE B CA  1 
ATOM 5539  C C   . ILE B 2  240  ? 212.951 147.411 206.635 1.00 370.00 ? 240  ILE B C   1 
ATOM 5540  O O   . ILE B 2  240  ? 212.854 147.891 207.774 1.00 370.00 ? 240  ILE B O   1 
ATOM 5541  C CB  . ILE B 2  240  ? 212.461 149.381 205.142 1.00 370.00 ? 240  ILE B CB  1 
ATOM 5542  C CG1 . ILE B 2  240  ? 211.722 149.843 203.882 1.00 370.00 ? 240  ILE B CG1 1 
ATOM 5543  C CG2 . ILE B 2  240  ? 213.952 149.503 204.966 1.00 370.00 ? 240  ILE B CG2 1 
ATOM 5544  C CD1 . ILE B 2  240  ? 210.476 150.661 204.136 1.00 370.00 ? 240  ILE B CD1 1 
ATOM 5545  N N   . PRO B 2  241  ? 213.784 146.417 206.378 1.00 370.00 ? 241  PRO B N   1 
ATOM 5546  C CA  . PRO B 2  241  ? 214.455 145.707 207.472 1.00 370.00 ? 241  PRO B CA  1 
ATOM 5547  C C   . PRO B 2  241  ? 215.549 146.511 208.150 1.00 370.00 ? 241  PRO B C   1 
ATOM 5548  O O   . PRO B 2  241  ? 216.620 146.721 207.577 1.00 370.00 ? 241  PRO B O   1 
ATOM 5549  C CB  . PRO B 2  241  ? 215.023 144.469 206.777 1.00 370.00 ? 241  PRO B CB  1 
ATOM 5550  C CG  . PRO B 2  241  ? 215.172 144.885 205.349 1.00 370.00 ? 241  PRO B CG  1 
ATOM 5551  C CD  . PRO B 2  241  ? 214.073 145.828 205.061 1.00 370.00 ? 241  PRO B CD  1 
ATOM 5552  N N   . THR B 2  242  ? 215.289 146.978 209.374 1.00 370.00 ? 242  THR B N   1 
ATOM 5553  C CA  . THR B 2  242  ? 216.273 147.786 210.087 1.00 370.00 ? 242  THR B CA  1 
ATOM 5554  C C   . THR B 2  242  ? 216.605 147.197 211.449 1.00 370.00 ? 242  THR B C   1 
ATOM 5555  O O   . THR B 2  242  ? 216.244 146.053 211.745 1.00 370.00 ? 242  THR B O   1 
ATOM 5556  C CB  . THR B 2  242  ? 215.792 149.222 210.283 1.00 370.00 ? 242  THR B CB  1 
ATOM 5557  O OG1 . THR B 2  242  ? 214.676 149.231 211.161 1.00 370.00 ? 242  THR B OG1 1 
ATOM 5558  C CG2 . THR B 2  242  ? 215.386 149.859 208.967 1.00 370.00 ? 242  THR B CG2 1 
ATOM 5559  N N   . ALA B 2  243  ? 217.317 147.965 212.267 1.00 370.00 ? 243  ALA B N   1 
ATOM 5560  C CA  . ALA B 2  243  ? 217.719 147.558 213.603 1.00 370.00 ? 243  ALA B CA  1 
ATOM 5561  C C   . ALA B 2  243  ? 217.009 148.412 214.639 1.00 370.00 ? 243  ALA B C   1 
ATOM 5562  O O   . ALA B 2  243  ? 216.286 149.359 214.320 1.00 370.00 ? 243  ALA B O   1 
ATOM 5563  C CB  . ALA B 2  243  ? 219.235 147.661 213.790 1.00 370.00 ? 243  ALA B CB  1 
ATOM 5564  N N   . ALA B 2  244  ? 217.218 148.053 215.897 1.00 370.00 ? 244  ALA B N   1 
ATOM 5565  C CA  . ALA B 2  244  ? 216.431 148.639 216.964 1.00 370.00 ? 244  ALA B CA  1 
ATOM 5566  C C   . ALA B 2  244  ? 216.817 150.073 217.273 1.00 370.00 ? 244  ALA B C   1 
ATOM 5567  O O   . ALA B 2  244  ? 215.941 150.878 217.590 1.00 370.00 ? 244  ALA B O   1 
ATOM 5568  C CB  . ALA B 2  244  ? 216.557 147.790 218.222 1.00 370.00 ? 244  ALA B CB  1 
ATOM 5569  N N   . SER B 2  245  ? 218.085 150.436 217.151 1.00 370.00 ? 245  SER B N   1 
ATOM 5570  C CA  . SER B 2  245  ? 218.477 151.819 217.400 1.00 370.00 ? 245  SER B CA  1 
ATOM 5571  C C   . SER B 2  245  ? 218.182 152.717 216.228 1.00 370.00 ? 245  SER B C   1 
ATOM 5572  O O   . SER B 2  245  ? 219.084 153.341 215.678 1.00 370.00 ? 245  SER B O   1 
ATOM 5573  C CB  . SER B 2  245  ? 219.949 151.902 217.772 1.00 370.00 ? 245  SER B CB  1 
ATOM 5574  O OG  . SER B 2  245  ? 220.174 151.407 219.077 1.00 370.00 ? 245  SER B OG  1 
ATOM 5575  N N   . ASN B 2  246  ? 216.936 152.770 215.814 1.00 370.00 ? 246  ASN B N   1 
ATOM 5576  C CA  . ASN B 2  246  ? 216.459 153.787 214.903 1.00 370.00 ? 246  ASN B CA  1 
ATOM 5577  C C   . ASN B 2  246  ? 215.065 154.245 215.267 1.00 370.00 ? 246  ASN B C   1 
ATOM 5578  O O   . ASN B 2  246  ? 214.480 155.044 214.536 1.00 370.00 ? 246  ASN B O   1 
ATOM 5579  C CB  . ASN B 2  246  ? 216.477 153.262 213.478 1.00 370.00 ? 246  ASN B CB  1 
ATOM 5580  C CG  . ASN B 2  246  ? 217.843 153.300 212.879 1.00 370.00 ? 246  ASN B CG  1 
ATOM 5581  O OD1 . ASN B 2  246  ? 218.529 154.312 212.946 1.00 370.00 ? 246  ASN B OD1 1 
ATOM 5582  N ND2 . ASN B 2  246  ? 218.274 152.187 212.333 1.00 370.00 ? 246  ASN B ND2 1 
ATOM 5583  N N   . ILE B 2  247  ? 214.530 153.776 216.378 1.00 370.00 ? 247  ILE B N   1 
ATOM 5584  C CA  . ILE B 2  247  ? 213.108 153.827 216.641 1.00 370.00 ? 247  ILE B CA  1 
ATOM 5585  C C   . ILE B 2  247  ? 212.900 154.848 217.740 1.00 370.00 ? 247  ILE B C   1 
ATOM 5586  O O   . ILE B 2  247  ? 213.615 154.830 218.741 1.00 370.00 ? 247  ILE B O   1 
ATOM 5587  C CB  . ILE B 2  247  ? 212.603 152.448 217.054 1.00 370.00 ? 247  ILE B CB  1 
ATOM 5588  C CG1 . ILE B 2  247  ? 213.071 151.421 216.023 1.00 370.00 ? 247  ILE B CG1 1 
ATOM 5589  C CG2 . ILE B 2  247  ? 211.107 152.456 217.142 1.00 370.00 ? 247  ILE B CG2 1 
ATOM 5590  C CD1 . ILE B 2  247  ? 212.942 149.980 216.463 1.00 370.00 ? 247  ILE B CD1 1 
ATOM 5591  N N   . SER B 2  248  ? 211.920 155.728 217.560 1.00 370.00 ? 248  SER B N   1 
ATOM 5592  C CA  . SER B 2  248  ? 211.708 156.863 218.447 1.00 370.00 ? 248  SER B CA  1 
ATOM 5593  C C   . SER B 2  248  ? 210.386 157.528 218.122 1.00 370.00 ? 248  SER B C   1 
ATOM 5594  O O   . SER B 2  248  ? 210.020 157.634 216.955 1.00 370.00 ? 248  SER B O   1 
ATOM 5595  C CB  . SER B 2  248  ? 212.816 157.878 218.283 1.00 370.00 ? 248  SER B CB  1 
ATOM 5596  O OG  . SER B 2  248  ? 212.769 158.363 216.974 1.00 370.00 ? 248  SER B OG  1 
ATOM 5597  N N   . LEU B 2  249  ? 209.709 158.038 219.136 1.00 370.00 ? 249  LEU B N   1 
ATOM 5598  C CA  . LEU B 2  249  ? 208.313 158.401 219.002 1.00 370.00 ? 249  LEU B CA  1 
ATOM 5599  C C   . LEU B 2  249  ? 208.028 159.751 219.627 1.00 370.00 ? 249  LEU B C   1 
ATOM 5600  O O   . LEU B 2  249  ? 207.982 159.863 220.849 1.00 370.00 ? 249  LEU B O   1 
ATOM 5601  C CB  . LEU B 2  249  ? 207.448 157.355 219.674 1.00 370.00 ? 249  LEU B CB  1 
ATOM 5602  C CG  . LEU B 2  249  ? 205.978 157.605 219.422 1.00 370.00 ? 249  LEU B CG  1 
ATOM 5603  C CD1 . LEU B 2  249  ? 205.765 157.398 217.958 1.00 370.00 ? 249  LEU B CD1 1 
ATOM 5604  C CD2 . LEU B 2  249  ? 205.145 156.646 220.233 1.00 370.00 ? 249  LEU B CD2 1 
ATOM 5605  N N   . ALA B 2  250  ? 207.748 160.749 218.804 1.00 370.00 ? 250  ALA B N   1 
ATOM 5606  C CA  . ALA B 2  250  ? 207.515 162.101 219.288 1.00 370.00 ? 250  ALA B CA  1 
ATOM 5607  C C   . ALA B 2  250  ? 206.032 162.423 219.258 1.00 370.00 ? 250  ALA B C   1 
ATOM 5608  O O   . ALA B 2  250  ? 205.425 162.444 218.188 1.00 370.00 ? 250  ALA B O   1 
ATOM 5609  C CB  . ALA B 2  250  ? 208.279 163.110 218.449 1.00 370.00 ? 250  ALA B CB  1 
ATOM 5610  N N   . ILE B 2  251  ? 205.466 162.722 220.422 1.00 370.00 ? 251  ILE B N   1 
ATOM 5611  C CA  . ILE B 2  251  ? 204.024 162.725 220.623 1.00 370.00 ? 251  ILE B CA  1 
ATOM 5612  C C   . ILE B 2  251  ? 203.581 164.122 221.018 1.00 370.00 ? 251  ILE B C   1 
ATOM 5613  O O   . ILE B 2  251  ? 204.149 164.702 221.944 1.00 370.00 ? 251  ILE B O   1 
ATOM 5614  C CB  . ILE B 2  251  ? 203.639 161.727 221.720 1.00 370.00 ? 251  ILE B CB  1 
ATOM 5615  C CG1 . ILE B 2  251  ? 204.243 160.368 221.414 1.00 370.00 ? 251  ILE B CG1 1 
ATOM 5616  C CG2 . ILE B 2  251  ? 202.148 161.616 221.817 1.00 370.00 ? 251  ILE B CG2 1 
ATOM 5617  C CD1 . ILE B 2  251  ? 204.129 159.417 222.542 1.00 370.00 ? 251  ILE B CD1 1 
ATOM 5618  N N   . GLY B 2  252  ? 202.539 164.642 220.365 1.00 370.00 ? 252  GLY B N   1 
ATOM 5619  C CA  . GLY B 2  252  ? 202.118 166.002 220.637 1.00 370.00 ? 252  GLY B CA  1 
ATOM 5620  C C   . GLY B 2  252  ? 202.138 167.115 219.584 1.00 370.00 ? 252  GLY B C   1 
ATOM 5621  O O   . GLY B 2  252  ? 201.324 168.037 219.691 1.00 370.00 ? 252  GLY B O   1 
ATOM 5622  N N   . PRO B 2  253  ? 203.067 167.118 218.562 1.00 370.00 ? 253  PRO B N   1 
ATOM 5623  C CA  . PRO B 2  253  ? 203.129 168.296 217.685 1.00 370.00 ? 253  PRO B CA  1 
ATOM 5624  C C   . PRO B 2  253  ? 202.004 168.409 216.682 1.00 370.00 ? 253  PRO B C   1 
ATOM 5625  O O   . PRO B 2  253  ? 200.964 167.755 216.779 1.00 370.00 ? 253  PRO B O   1 
ATOM 5626  C CB  . PRO B 2  253  ? 204.464 168.131 216.956 1.00 370.00 ? 253  PRO B CB  1 
ATOM 5627  C CG  . PRO B 2  253  ? 204.652 166.728 216.894 1.00 370.00 ? 253  PRO B CG  1 
ATOM 5628  C CD  . PRO B 2  253  ? 204.149 166.186 218.177 1.00 370.00 ? 253  PRO B CD  1 
ATOM 5629  N N   . PHE B 2  254  ? 202.217 169.304 215.735 1.00 370.00 ? 254  PHE B N   1 
ATOM 5630  C CA  . PHE B 2  254  ? 201.272 169.638 214.692 1.00 370.00 ? 254  PHE B CA  1 
ATOM 5631  C C   . PHE B 2  254  ? 201.863 169.258 213.341 1.00 370.00 ? 254  PHE B C   1 
ATOM 5632  O O   . PHE B 2  254  ? 203.076 169.394 213.129 1.00 370.00 ? 254  PHE B O   1 
ATOM 5633  C CB  . PHE B 2  254  ? 200.967 171.127 214.733 1.00 370.00 ? 254  PHE B CB  1 
ATOM 5634  C CG  . PHE B 2  254  ? 199.821 171.535 213.871 1.00 370.00 ? 254  PHE B CG  1 
ATOM 5635  C CD1 . PHE B 2  254  ? 198.520 171.378 214.315 1.00 370.00 ? 254  PHE B CD1 1 
ATOM 5636  C CD2 . PHE B 2  254  ? 200.036 172.069 212.618 1.00 370.00 ? 254  PHE B CD2 1 
ATOM 5637  C CE1 . PHE B 2  254  ? 197.454 171.757 213.526 1.00 370.00 ? 254  PHE B CE1 1 
ATOM 5638  C CE2 . PHE B 2  254  ? 198.976 172.447 211.819 1.00 370.00 ? 254  PHE B CE2 1 
ATOM 5639  C CZ  . PHE B 2  254  ? 197.683 172.290 212.275 1.00 370.00 ? 254  PHE B CZ  1 
ATOM 5640  N N   . GLU B 2  255  ? 200.993 168.788 212.442 1.00 370.00 ? 255  GLU B N   1 
ATOM 5641  C CA  . GLU B 2  255  ? 201.375 168.373 211.097 1.00 370.00 ? 255  GLU B CA  1 
ATOM 5642  C C   . GLU B 2  255  ? 201.556 169.569 210.186 1.00 370.00 ? 255  GLU B C   1 
ATOM 5643  O O   . GLU B 2  255  ? 200.640 170.379 210.043 1.00 370.00 ? 255  GLU B O   1 
ATOM 5644  C CB  . GLU B 2  255  ? 200.296 167.509 210.443 1.00 370.00 ? 255  GLU B CB  1 
ATOM 5645  C CG  . GLU B 2  255  ? 200.037 166.111 210.941 1.00 370.00 ? 255  GLU B CG  1 
ATOM 5646  C CD  . GLU B 2  255  ? 199.037 165.373 210.033 1.00 370.00 ? 255  GLU B CD  1 
ATOM 5647  O OE1 . GLU B 2  255  ? 198.461 166.016 209.132 1.00 370.00 ? 255  GLU B OE1 1 
ATOM 5648  O OE2 . GLU B 2  255  ? 198.843 164.149 210.193 1.00 370.00 ? 255  GLU B OE2 1 
ATOM 5649  N N   . ILE B 2  256  ? 202.688 169.639 209.498 1.00 370.00 ? 256  ILE B N   1 
ATOM 5650  C CA  . ILE B 2  256  ? 202.758 170.350 208.231 1.00 370.00 ? 256  ILE B CA  1 
ATOM 5651  C C   . ILE B 2  256  ? 203.479 169.459 207.237 1.00 370.00 ? 256  ILE B C   1 
ATOM 5652  O O   . ILE B 2  256  ? 204.654 169.120 207.428 1.00 370.00 ? 256  ILE B O   1 
ATOM 5653  C CB  . ILE B 2  256  ? 203.456 171.717 208.312 1.00 370.00 ? 256  ILE B CB  1 
ATOM 5654  C CG1 . ILE B 2  256  ? 202.676 172.704 209.174 1.00 370.00 ? 256  ILE B CG1 1 
ATOM 5655  C CG2 . ILE B 2  256  ? 203.506 172.321 206.947 1.00 370.00 ? 256  ILE B CG2 1 
ATOM 5656  C CD1 . ILE B 2  256  ? 203.377 174.019 209.386 1.00 370.00 ? 256  ILE B CD1 1 
ATOM 5657  N N   . LEU B 2  257  ? 202.769 169.045 206.205 1.00 370.00 ? 257  LEU B N   1 
ATOM 5658  C CA  . LEU B 2  257  ? 203.438 168.623 204.993 1.00 370.00 ? 257  LEU B CA  1 
ATOM 5659  C C   . LEU B 2  257  ? 203.998 169.858 204.325 1.00 370.00 ? 257  LEU B C   1 
ATOM 5660  O O   . LEU B 2  257  ? 203.264 170.800 204.020 1.00 370.00 ? 257  LEU B O   1 
ATOM 5661  C CB  . LEU B 2  257  ? 202.493 167.881 204.064 1.00 370.00 ? 257  LEU B CB  1 
ATOM 5662  C CG  . LEU B 2  257  ? 202.248 166.451 204.518 1.00 370.00 ? 257  LEU B CG  1 
ATOM 5663  C CD1 . LEU B 2  257  ? 201.148 165.785 203.713 1.00 370.00 ? 257  LEU B CD1 1 
ATOM 5664  C CD2 . LEU B 2  257  ? 203.538 165.702 204.339 1.00 370.00 ? 257  LEU B CD2 1 
ATOM 5665  N N   . VAL B 2  258  ? 205.294 169.842 204.092 1.00 370.00 ? 258  VAL B N   1 
ATOM 5666  C CA  . VAL B 2  258  ? 205.995 170.971 203.514 1.00 370.00 ? 258  VAL B CA  1 
ATOM 5667  C C   . VAL B 2  258  ? 206.408 170.448 202.156 1.00 370.00 ? 258  VAL B C   1 
ATOM 5668  O O   . VAL B 2  258  ? 207.584 170.453 201.784 1.00 370.00 ? 258  VAL B O   1 
ATOM 5669  C CB  . VAL B 2  258  ? 207.183 171.454 204.351 1.00 370.00 ? 258  VAL B CB  1 
ATOM 5670  C CG1 . VAL B 2  258  ? 207.586 172.853 203.893 1.00 370.00 ? 258  VAL B CG1 1 
ATOM 5671  C CG2 . VAL B 2  258  ? 206.846 171.438 205.819 1.00 370.00 ? 258  VAL B CG2 1 
ATOM 5672  N N   . ASP B 2  259  ? 205.443 169.866 201.468 1.00 370.00 ? 259  ASP B N   1 
ATOM 5673  C CA  . ASP B 2  259  ? 205.743 169.050 200.303 1.00 370.00 ? 259  ASP B CA  1 
ATOM 5674  C C   . ASP B 2  259  ? 206.255 169.759 199.055 1.00 370.00 ? 259  ASP B C   1 
ATOM 5675  O O   . ASP B 2  259  ? 207.067 169.133 198.353 1.00 370.00 ? 259  ASP B O   1 
ATOM 5676  C CB  . ASP B 2  259  ? 204.494 168.244 199.961 1.00 370.00 ? 259  ASP B CB  1 
ATOM 5677  C CG  . ASP B 2  259  ? 204.275 167.116 200.920 1.00 370.00 ? 259  ASP B CG  1 
ATOM 5678  O OD1 . ASP B 2  259  ? 205.268 166.662 201.520 1.00 370.00 ? 259  ASP B OD1 1 
ATOM 5679  O OD2 . ASP B 2  259  ? 203.130 166.652 201.042 1.00 370.00 ? 259  ASP B OD2 1 
ATOM 5680  N N   . PRO B 2  260  ? 205.919 171.072 198.750 1.00 370.00 ? 260  PRO B N   1 
ATOM 5681  C CA  . PRO B 2  260  ? 205.459 171.429 197.393 1.00 370.00 ? 260  PRO B CA  1 
ATOM 5682  C C   . PRO B 2  260  ? 206.248 170.903 196.204 1.00 370.00 ? 260  PRO B C   1 
ATOM 5683  O O   . PRO B 2  260  ? 205.702 170.772 195.107 1.00 370.00 ? 260  PRO B O   1 
ATOM 5684  C CB  . PRO B 2  260  ? 205.519 172.961 197.408 1.00 370.00 ? 260  PRO B CB  1 
ATOM 5685  C CG  . PRO B 2  260  ? 206.583 173.269 198.303 1.00 370.00 ? 260  PRO B CG  1 
ATOM 5686  C CD  . PRO B 2  260  ? 206.481 172.277 199.393 1.00 370.00 ? 260  PRO B CD  1 
ATOM 5687  N N   . TYR B 2  261  ? 207.517 170.575 196.401 1.00 370.00 ? 261  TYR B N   1 
ATOM 5688  C CA  . TYR B 2  261  ? 208.290 170.082 195.279 1.00 370.00 ? 261  TYR B CA  1 
ATOM 5689  C C   . TYR B 2  261  ? 208.412 168.565 195.258 1.00 370.00 ? 261  TYR B C   1 
ATOM 5690  O O   . TYR B 2  261  ? 208.515 167.988 194.172 1.00 370.00 ? 261  TYR B O   1 
ATOM 5691  C CB  . TYR B 2  261  ? 209.678 170.714 195.285 1.00 370.00 ? 261  TYR B CB  1 
ATOM 5692  C CG  . TYR B 2  261  ? 209.696 172.207 195.046 1.00 370.00 ? 261  TYR B CG  1 
ATOM 5693  C CD1 . TYR B 2  261  ? 208.623 172.857 194.447 1.00 370.00 ? 261  TYR B CD1 1 
ATOM 5694  C CD2 . TYR B 2  261  ? 210.789 172.972 195.436 1.00 370.00 ? 261  TYR B CD2 1 
ATOM 5695  C CE1 . TYR B 2  261  ? 208.645 174.225 194.237 1.00 370.00 ? 261  TYR B CE1 1 
ATOM 5696  C CE2 . TYR B 2  261  ? 210.822 174.338 195.232 1.00 370.00 ? 261  TYR B CE2 1 
ATOM 5697  C CZ  . TYR B 2  261  ? 209.748 174.959 194.632 1.00 370.00 ? 261  TYR B CZ  1 
ATOM 5698  O OH  . TYR B 2  261  ? 209.780 176.319 194.427 1.00 370.00 ? 261  TYR B OH  1 
ATOM 5699  N N   . MET B 2  262  ? 208.404 167.884 196.410 1.00 370.00 ? 262  MET B N   1 
ATOM 5700  C CA  . MET B 2  262  ? 208.640 166.442 196.397 1.00 370.00 ? 262  MET B CA  1 
ATOM 5701  C C   . MET B 2  262  ? 207.593 165.622 197.145 1.00 370.00 ? 262  MET B C   1 
ATOM 5702  O O   . MET B 2  262  ? 207.858 164.458 197.469 1.00 370.00 ? 262  MET B O   1 
ATOM 5703  C CB  . MET B 2  262  ? 210.033 166.118 196.940 1.00 370.00 ? 262  MET B CB  1 
ATOM 5704  C CG  . MET B 2  262  ? 211.150 166.567 196.021 1.00 370.00 ? 262  MET B CG  1 
ATOM 5705  S SD  . MET B 2  262  ? 212.768 166.150 196.670 1.00 370.00 ? 262  MET B SD  1 
ATOM 5706  C CE  . MET B 2  262  ? 212.711 164.369 196.501 1.00 370.00 ? 262  MET B CE  1 
ATOM 5707  N N   . HIS B 2  263  ? 206.458 166.221 197.496 1.00 370.00 ? 263  HIS B N   1 
ATOM 5708  C CA  . HIS B 2  263  ? 205.161 165.561 197.641 1.00 370.00 ? 263  HIS B CA  1 
ATOM 5709  C C   . HIS B 2  263  ? 204.989 164.654 198.853 1.00 370.00 ? 263  HIS B C   1 
ATOM 5710  O O   . HIS B 2  263  ? 203.854 164.296 199.178 1.00 370.00 ? 263  HIS B O   1 
ATOM 5711  C CB  . HIS B 2  263  ? 204.856 164.731 196.391 1.00 370.00 ? 263  HIS B CB  1 
ATOM 5712  C CG  . HIS B 2  263  ? 204.860 165.520 195.122 1.00 370.00 ? 263  HIS B CG  1 
ATOM 5713  N ND1 . HIS B 2  263  ? 203.818 166.341 194.751 1.00 370.00 ? 263  HIS B ND1 1 
ATOM 5714  C CD2 . HIS B 2  263  ? 205.784 165.615 194.138 1.00 370.00 ? 263  HIS B CD2 1 
ATOM 5715  C CE1 . HIS B 2  263  ? 204.099 166.906 193.589 1.00 370.00 ? 263  HIS B CE1 1 
ATOM 5716  N NE2 . HIS B 2  263  ? 205.286 166.481 193.196 1.00 370.00 ? 263  HIS B NE2 1 
ATOM 5717  N N   . GLU B 2  264  ? 206.063 164.300 199.562 1.00 370.00 ? 264  GLU B N   1 
ATOM 5718  C CA  . GLU B 2  264  ? 205.929 163.329 200.647 1.00 370.00 ? 264  GLU B CA  1 
ATOM 5719  C C   . GLU B 2  264  ? 206.822 163.651 201.835 1.00 370.00 ? 264  GLU B C   1 
ATOM 5720  O O   . GLU B 2  264  ? 207.231 162.747 202.572 1.00 370.00 ? 264  GLU B O   1 
ATOM 5721  C CB  . GLU B 2  264  ? 206.227 161.912 200.171 1.00 370.00 ? 264  GLU B CB  1 
ATOM 5722  C CG  . GLU B 2  264  ? 205.108 161.252 199.401 1.00 370.00 ? 264  GLU B CG  1 
ATOM 5723  C CD  . GLU B 2  264  ? 205.463 159.856 198.966 1.00 370.00 ? 264  GLU B CD  1 
ATOM 5724  O OE1 . GLU B 2  264  ? 206.634 159.461 199.146 1.00 370.00 ? 264  GLU B OE1 1 
ATOM 5725  O OE2 . GLU B 2  264  ? 204.573 159.150 198.450 1.00 370.00 ? 264  GLU B OE2 1 
ATOM 5726  N N   . VAL B 2  265  ? 207.120 164.920 202.050 1.00 370.00 ? 265  VAL B N   1 
ATOM 5727  C CA  . VAL B 2  265  ? 208.113 165.333 203.024 1.00 370.00 ? 265  VAL B CA  1 
ATOM 5728  C C   . VAL B 2  265  ? 207.379 165.902 204.223 1.00 370.00 ? 265  VAL B C   1 
ATOM 5729  O O   . VAL B 2  265  ? 206.616 166.863 204.089 1.00 370.00 ? 265  VAL B O   1 
ATOM 5730  C CB  . VAL B 2  265  ? 209.060 166.365 202.414 1.00 370.00 ? 265  VAL B CB  1 
ATOM 5731  C CG1 . VAL B 2  265  ? 210.166 166.627 203.358 1.00 370.00 ? 265  VAL B CG1 1 
ATOM 5732  C CG2 . VAL B 2  265  ? 209.561 165.874 201.073 1.00 370.00 ? 265  VAL B CG2 1 
ATOM 5733  N N   . THR B 2  266  ? 207.621 165.344 205.399 1.00 370.00 ? 266  THR B N   1 
ATOM 5734  C CA  . THR B 2  266  ? 206.644 165.407 206.472 1.00 370.00 ? 266  THR B CA  1 
ATOM 5735  C C   . THR B 2  266  ? 207.242 166.035 207.721 1.00 370.00 ? 266  THR B C   1 
ATOM 5736  O O   . THR B 2  266  ? 208.319 165.625 208.168 1.00 370.00 ? 266  THR B O   1 
ATOM 5737  C CB  . THR B 2  266  ? 206.170 164.011 206.767 1.00 370.00 ? 266  THR B CB  1 
ATOM 5738  O OG1 . THR B 2  266  ? 205.986 163.324 205.525 1.00 370.00 ? 266  THR B OG1 1 
ATOM 5739  C CG2 . THR B 2  266  ? 204.844 164.069 207.434 1.00 370.00 ? 266  THR B CG2 1 
ATOM 5740  N N   . HIS B 2  267  ? 206.552 167.017 208.306 1.00 370.00 ? 267  HIS B N   1 
ATOM 5741  C CA  . HIS B 2  267  ? 207.175 167.842 209.326 1.00 370.00 ? 267  HIS B CA  1 
ATOM 5742  C C   . HIS B 2  267  ? 206.225 168.076 210.477 1.00 370.00 ? 267  HIS B C   1 
ATOM 5743  O O   . HIS B 2  267  ? 205.011 168.159 210.297 1.00 370.00 ? 267  HIS B O   1 
ATOM 5744  C CB  . HIS B 2  267  ? 207.616 169.145 208.718 1.00 370.00 ? 267  HIS B CB  1 
ATOM 5745  C CG  . HIS B 2  267  ? 208.751 168.961 207.786 1.00 370.00 ? 267  HIS B CG  1 
ATOM 5746  N ND1 . HIS B 2  267  ? 210.050 168.925 208.223 1.00 370.00 ? 267  HIS B ND1 1 
ATOM 5747  C CD2 . HIS B 2  267  ? 208.784 168.644 206.474 1.00 370.00 ? 267  HIS B CD2 1 
ATOM 5748  C CE1 . HIS B 2  267  ? 210.847 168.668 207.204 1.00 370.00 ? 267  HIS B CE1 1 
ATOM 5749  N NE2 . HIS B 2  267  ? 210.101 168.486 206.132 1.00 370.00 ? 267  HIS B NE2 1 
ATOM 5750  N N   . PHE B 2  268  ? 206.790 168.150 211.673 1.00 370.00 ? 268  PHE B N   1 
ATOM 5751  C CA  . PHE B 2  268  ? 205.990 168.118 212.888 1.00 370.00 ? 268  PHE B CA  1 
ATOM 5752  C C   . PHE B 2  268  ? 206.582 169.103 213.870 1.00 370.00 ? 268  PHE B C   1 
ATOM 5753  O O   . PHE B 2  268  ? 207.731 168.939 214.308 1.00 370.00 ? 268  PHE B O   1 
ATOM 5754  C CB  . PHE B 2  268  ? 205.958 166.718 213.478 1.00 370.00 ? 268  PHE B CB  1 
ATOM 5755  C CG  . PHE B 2  268  ? 205.245 165.743 212.624 1.00 370.00 ? 268  PHE B CG  1 
ATOM 5756  C CD1 . PHE B 2  268  ? 203.875 165.611 212.702 1.00 370.00 ? 268  PHE B CD1 1 
ATOM 5757  C CD2 . PHE B 2  268  ? 205.939 164.991 211.703 1.00 370.00 ? 268  PHE B CD2 1 
ATOM 5758  C CE1 . PHE B 2  268  ? 203.216 164.718 211.900 1.00 370.00 ? 268  PHE B CE1 1 
ATOM 5759  C CE2 . PHE B 2  268  ? 205.293 164.113 210.898 1.00 370.00 ? 268  PHE B CE2 1 
ATOM 5760  C CZ  . PHE B 2  268  ? 203.923 163.971 210.987 1.00 370.00 ? 268  PHE B CZ  1 
ATOM 5761  N N   . CYS B 2  269  ? 205.794 170.111 214.219 1.00 370.00 ? 269  CYS B N   1 
ATOM 5762  C CA  . CYS B 2  269  ? 206.278 171.150 215.106 1.00 370.00 ? 269  CYS B CA  1 
ATOM 5763  C C   . CYS B 2  269  ? 205.192 171.593 216.053 1.00 370.00 ? 269  CYS B C   1 
ATOM 5764  O O   . CYS B 2  269  ? 204.005 171.463 215.764 1.00 370.00 ? 269  CYS B O   1 
ATOM 5765  C CB  . CYS B 2  269  ? 206.784 172.357 214.350 1.00 370.00 ? 269  CYS B CB  1 
ATOM 5766  S SG  . CYS B 2  269  ? 208.340 172.029 213.582 1.00 370.00 ? 269  CYS B SG  1 
ATOM 5767  N N   . LEU B 2  270  ? 205.631 172.154 217.171 1.00 370.00 ? 270  LEU B N   1 
ATOM 5768  C CA  . LEU B 2  270  ? 204.734 172.601 218.214 1.00 370.00 ? 270  LEU B CA  1 
ATOM 5769  C C   . LEU B 2  270  ? 203.882 173.763 217.712 1.00 370.00 ? 270  LEU B C   1 
ATOM 5770  O O   . LEU B 2  270  ? 204.278 174.463 216.778 1.00 370.00 ? 270  LEU B O   1 
ATOM 5771  C CB  . LEU B 2  270  ? 205.557 173.008 219.422 1.00 370.00 ? 270  LEU B CB  1 
ATOM 5772  C CG  . LEU B 2  270  ? 206.305 171.784 219.907 1.00 370.00 ? 270  LEU B CG  1 
ATOM 5773  C CD1 . LEU B 2  270  ? 207.246 172.195 220.991 1.00 370.00 ? 270  LEU B CD1 1 
ATOM 5774  C CD2 . LEU B 2  270  ? 205.337 170.739 220.407 1.00 370.00 ? 270  LEU B CD2 1 
ATOM 5775  N N   . PRO B 2  271  ? 202.689 173.957 218.272 1.00 370.00 ? 271  PRO B N   1 
ATOM 5776  C CA  . PRO B 2  271  ? 201.835 175.039 217.795 1.00 370.00 ? 271  PRO B CA  1 
ATOM 5777  C C   . PRO B 2  271  ? 202.433 176.395 218.114 1.00 370.00 ? 271  PRO B C   1 
ATOM 5778  O O   . PRO B 2  271  ? 203.298 176.533 218.980 1.00 370.00 ? 271  PRO B O   1 
ATOM 5779  C CB  . PRO B 2  271  ? 200.528 174.819 218.553 1.00 370.00 ? 271  PRO B CB  1 
ATOM 5780  C CG  . PRO B 2  271  ? 200.925 174.099 219.757 1.00 370.00 ? 271  PRO B CG  1 
ATOM 5781  C CD  . PRO B 2  271  ? 202.018 173.190 219.332 1.00 370.00 ? 271  PRO B CD  1 
ATOM 5782  N N   . GLN B 2  272  ? 201.984 177.385 217.342 1.00 370.00 ? 272  GLN B N   1 
ATOM 5783  C CA  . GLN B 2  272  ? 202.517 178.742 217.288 1.00 370.00 ? 272  GLN B CA  1 
ATOM 5784  C C   . GLN B 2  272  ? 203.989 178.770 216.911 1.00 370.00 ? 272  GLN B C   1 
ATOM 5785  O O   . GLN B 2  272  ? 204.699 179.708 217.261 1.00 370.00 ? 272  GLN B O   1 
ATOM 5786  C CB  . GLN B 2  272  ? 202.282 179.489 218.599 1.00 370.00 ? 272  GLN B CB  1 
ATOM 5787  C CG  . GLN B 2  272  ? 200.824 179.702 218.889 1.00 370.00 ? 272  GLN B CG  1 
ATOM 5788  C CD  . GLN B 2  272  ? 200.590 180.335 220.239 1.00 370.00 ? 272  GLN B CD  1 
ATOM 5789  O OE1 . GLN B 2  272  ? 201.518 180.505 221.028 1.00 370.00 ? 272  GLN B OE1 1 
ATOM 5790  N NE2 . GLN B 2  272  ? 199.345 180.702 220.510 1.00 370.00 ? 272  GLN B NE2 1 
ATOM 5791  N N   . LEU B 2  273  ? 204.459 177.750 216.201 1.00 370.00 ? 273  LEU B N   1 
ATOM 5792  C CA  . LEU B 2  273  ? 205.791 177.732 215.631 1.00 370.00 ? 273  LEU B CA  1 
ATOM 5793  C C   . LEU B 2  273  ? 205.752 177.444 214.156 1.00 370.00 ? 273  LEU B C   1 
ATOM 5794  O O   . LEU B 2  273  ? 206.803 177.257 213.539 1.00 370.00 ? 273  LEU B O   1 
ATOM 5795  C CB  . LEU B 2  273  ? 206.651 176.666 216.288 1.00 370.00 ? 273  LEU B CB  1 
ATOM 5796  C CG  . LEU B 2  273  ? 206.886 176.908 217.753 1.00 370.00 ? 273  LEU B CG  1 
ATOM 5797  C CD1 . LEU B 2  273  ? 207.700 175.769 218.279 1.00 370.00 ? 273  LEU B CD1 1 
ATOM 5798  C CD2 . LEU B 2  273  ? 207.618 178.209 217.895 1.00 370.00 ? 273  LEU B CD2 1 
ATOM 5799  N N   . LEU B 2  274  ? 204.577 177.411 213.584 1.00 370.00 ? 274  LEU B N   1 
ATOM 5800  C CA  . LEU B 2  274  ? 204.385 176.719 212.317 1.00 370.00 ? 274  LEU B CA  1 
ATOM 5801  C C   . LEU B 2  274  ? 204.887 177.473 211.086 1.00 370.00 ? 274  LEU B C   1 
ATOM 5802  O O   . LEU B 2  274  ? 205.667 176.869 210.327 1.00 370.00 ? 274  LEU B O   1 
ATOM 5803  C CB  . LEU B 2  274  ? 202.914 176.329 212.239 1.00 370.00 ? 274  LEU B CB  1 
ATOM 5804  C CG  . LEU B 2  274  ? 202.673 175.534 213.524 1.00 370.00 ? 274  LEU B CG  1 
ATOM 5805  C CD1 . LEU B 2  274  ? 201.207 175.274 213.733 1.00 370.00 ? 274  LEU B CD1 1 
ATOM 5806  C CD2 . LEU B 2  274  ? 203.463 174.234 213.542 1.00 370.00 ? 274  LEU B CD2 1 
ATOM 5807  N N   . PRO B 2  275  ? 204.545 178.758 210.826 1.00 370.00 ? 275  PRO B N   1 
ATOM 5808  C CA  . PRO B 2  275  ? 204.970 179.368 209.550 1.00 370.00 ? 275  PRO B CA  1 
ATOM 5809  C C   . PRO B 2  275  ? 206.462 179.564 209.433 1.00 370.00 ? 275  PRO B C   1 
ATOM 5810  O O   . PRO B 2  275  ? 206.954 179.804 208.322 1.00 370.00 ? 275  PRO B O   1 
ATOM 5811  C CB  . PRO B 2  275  ? 204.259 180.719 209.549 1.00 370.00 ? 275  PRO B CB  1 
ATOM 5812  C CG  . PRO B 2  275  ? 204.136 181.051 210.942 1.00 370.00 ? 275  PRO B CG  1 
ATOM 5813  C CD  . PRO B 2  275  ? 203.838 179.778 211.633 1.00 370.00 ? 275  PRO B CD  1 
ATOM 5814  N N   . LEU B 2  276  ? 207.181 179.436 210.543 1.00 370.00 ? 276  LEU B N   1 
ATOM 5815  C CA  . LEU B 2  276  ? 208.628 179.477 210.524 1.00 370.00 ? 276  LEU B CA  1 
ATOM 5816  C C   . LEU B 2  276  ? 209.178 178.339 209.689 1.00 370.00 ? 276  LEU B C   1 
ATOM 5817  O O   . LEU B 2  276  ? 210.124 178.538 208.918 1.00 370.00 ? 276  LEU B O   1 
ATOM 5818  C CB  . LEU B 2  276  ? 209.156 179.377 211.947 1.00 370.00 ? 276  LEU B CB  1 
ATOM 5819  C CG  . LEU B 2  276  ? 208.433 180.219 212.999 1.00 370.00 ? 276  LEU B CG  1 
ATOM 5820  C CD1 . LEU B 2  276  ? 209.103 180.049 214.339 1.00 370.00 ? 276  LEU B CD1 1 
ATOM 5821  C CD2 . LEU B 2  276  ? 208.254 181.692 212.677 1.00 370.00 ? 276  LEU B CD2 1 
ATOM 5822  N N   . LEU B 2  277  ? 208.556 177.160 209.804 1.00 370.00 ? 277  LEU B N   1 
ATOM 5823  C CA  . LEU B 2  277  ? 208.884 176.036 208.941 1.00 370.00 ? 277  LEU B CA  1 
ATOM 5824  C C   . LEU B 2  277  ? 208.717 176.377 207.486 1.00 370.00 ? 277  LEU B C   1 
ATOM 5825  O O   . LEU B 2  277  ? 209.493 175.907 206.653 1.00 370.00 ? 277  LEU B O   1 
ATOM 5826  C CB  . LEU B 2  277  ? 207.986 174.859 209.232 1.00 370.00 ? 277  LEU B CB  1 
ATOM 5827  C CG  . LEU B 2  277  ? 208.165 174.065 210.487 1.00 370.00 ? 277  LEU B CG  1 
ATOM 5828  C CD1 . LEU B 2  277  ? 207.044 173.084 210.449 1.00 370.00 ? 277  LEU B CD1 1 
ATOM 5829  C CD2 . LEU B 2  277  ? 209.468 173.373 210.366 1.00 370.00 ? 277  LEU B CD2 1 
ATOM 5830  N N   . LYS B 2  278  ? 207.715 177.202 207.176 1.00 370.00 ? 278  LYS B N   1 
ATOM 5831  C CA  . LYS B 2  278  ? 207.482 177.638 205.810 1.00 370.00 ? 278  LYS B CA  1 
ATOM 5832  C C   . LYS B 2  278  ? 208.674 178.394 205.257 1.00 370.00 ? 278  LYS B C   1 
ATOM 5833  O O   . LYS B 2  278  ? 208.914 178.368 204.046 1.00 370.00 ? 278  LYS B O   1 
ATOM 5834  C CB  . LYS B 2  278  ? 206.237 178.510 205.753 1.00 370.00 ? 278  LYS B CB  1 
ATOM 5835  C CG  . LYS B 2  278  ? 204.961 177.799 206.126 1.00 370.00 ? 278  LYS B CG  1 
ATOM 5836  C CD  . LYS B 2  278  ? 204.548 176.824 205.048 1.00 370.00 ? 278  LYS B CD  1 
ATOM 5837  C CE  . LYS B 2  278  ? 203.192 176.219 205.366 1.00 370.00 ? 278  LYS B CE  1 
ATOM 5838  N NZ  . LYS B 2  278  ? 202.735 175.281 204.304 1.00 370.00 ? 278  LYS B NZ  1 
ATOM 5839  N N   . HIS B 2  279  ? 209.441 179.054 206.116 1.00 370.00 ? 279  HIS B N   1 
ATOM 5840  C CA  . HIS B 2  279  ? 210.725 179.509 205.625 1.00 370.00 ? 279  HIS B CA  1 
ATOM 5841  C C   . HIS B 2  279  ? 211.789 178.448 205.768 1.00 370.00 ? 279  HIS B C   1 
ATOM 5842  O O   . HIS B 2  279  ? 212.642 178.305 204.887 1.00 370.00 ? 279  HIS B O   1 
ATOM 5843  C CB  . HIS B 2  279  ? 211.200 180.739 206.366 1.00 370.00 ? 279  HIS B CB  1 
ATOM 5844  C CG  . HIS B 2  279  ? 212.520 181.207 205.878 1.00 370.00 ? 279  HIS B CG  1 
ATOM 5845  N ND1 . HIS B 2  279  ? 212.663 181.900 204.700 1.00 370.00 ? 279  HIS B ND1 1 
ATOM 5846  C CD2 . HIS B 2  279  ? 213.769 180.996 206.345 1.00 370.00 ? 279  HIS B CD2 1 
ATOM 5847  C CE1 . HIS B 2  279  ? 213.942 182.149 204.492 1.00 370.00 ? 279  HIS B CE1 1 
ATOM 5848  N NE2 . HIS B 2  279  ? 214.635 181.614 205.479 1.00 370.00 ? 279  HIS B NE2 1 
ATOM 5849  N N   . THR B 2  280  ? 211.744 177.721 206.877 1.00 370.00 ? 280  THR B N   1 
ATOM 5850  C CA  . THR B 2  280  ? 212.868 176.899 207.294 1.00 370.00 ? 280  THR B CA  1 
ATOM 5851  C C   . THR B 2  280  ? 213.070 175.721 206.374 1.00 370.00 ? 280  THR B C   1 
ATOM 5852  O O   . THR B 2  280  ? 214.171 175.490 205.866 1.00 370.00 ? 280  THR B O   1 
ATOM 5853  C CB  . THR B 2  280  ? 212.617 176.379 208.691 1.00 370.00 ? 280  THR B CB  1 
ATOM 5854  O OG1 . THR B 2  280  ? 212.492 177.485 209.584 1.00 370.00 ? 280  THR B OG1 1 
ATOM 5855  C CG2 . THR B 2  280  ? 213.760 175.505 209.112 1.00 370.00 ? 280  THR B CG2 1 
ATOM 5856  N N   . THR B 2  281  ? 211.993 174.986 206.143 1.00 370.00 ? 281  THR B N   1 
ATOM 5857  C CA  . THR B 2  281  ? 212.081 173.608 205.702 1.00 370.00 ? 281  THR B CA  1 
ATOM 5858  C C   . THR B 2  281  ? 212.624 173.499 204.295 1.00 370.00 ? 281  THR B C   1 
ATOM 5859  O O   . THR B 2  281  ? 213.463 172.640 204.013 1.00 370.00 ? 281  THR B O   1 
ATOM 5860  C CB  . THR B 2  281  ? 210.700 172.995 205.783 1.00 370.00 ? 281  THR B CB  1 
ATOM 5861  O OG1 . THR B 2  281  ? 210.223 173.083 207.128 1.00 370.00 ? 281  THR B OG1 1 
ATOM 5862  C CG2 . THR B 2  281  ? 210.744 171.589 205.354 1.00 370.00 ? 281  THR B CG2 1 
ATOM 5863  N N   . SER B 2  282  ? 212.208 174.407 203.427 1.00 370.00 ? 282  SER B N   1 
ATOM 5864  C CA  . SER B 2  282  ? 212.654 174.454 202.053 1.00 370.00 ? 282  SER B CA  1 
ATOM 5865  C C   . SER B 2  282  ? 214.166 174.652 201.968 1.00 370.00 ? 282  SER B C   1 
ATOM 5866  O O   . SER B 2  282  ? 214.819 175.058 202.933 1.00 370.00 ? 282  SER B O   1 
ATOM 5867  C CB  . SER B 2  282  ? 211.934 175.578 201.331 1.00 370.00 ? 282  SER B CB  1 
ATOM 5868  O OG  . SER B 2  282  ? 212.238 176.805 201.960 1.00 370.00 ? 282  SER B OG  1 
ATOM 5869  N N   . TYR B 2  283  ? 214.681 174.389 200.761 1.00 370.00 ? 283  TYR B N   1 
ATOM 5870  C CA  . TYR B 2  283  ? 216.033 174.043 200.292 1.00 370.00 ? 283  TYR B CA  1 
ATOM 5871  C C   . TYR B 2  283  ? 216.275 172.568 200.514 1.00 370.00 ? 283  TYR B C   1 
ATOM 5872  O O   . TYR B 2  283  ? 217.267 172.042 200.037 1.00 370.00 ? 283  TYR B O   1 
ATOM 5873  C CB  . TYR B 2  283  ? 217.154 174.839 200.961 1.00 370.00 ? 283  TYR B CB  1 
ATOM 5874  C CG  . TYR B 2  283  ? 216.993 176.298 200.718 1.00 370.00 ? 283  TYR B CG  1 
ATOM 5875  C CD1 . TYR B 2  283  ? 216.526 176.763 199.501 1.00 370.00 ? 283  TYR B CD1 1 
ATOM 5876  C CD2 . TYR B 2  283  ? 217.166 177.203 201.746 1.00 370.00 ? 283  TYR B CD2 1 
ATOM 5877  C CE1 . TYR B 2  283  ? 216.350 178.105 199.280 1.00 370.00 ? 283  TYR B CE1 1 
ATOM 5878  C CE2 . TYR B 2  283  ? 216.989 178.547 201.542 1.00 370.00 ? 283  TYR B CE2 1 
ATOM 5879  C CZ  . TYR B 2  283  ? 216.574 178.994 200.309 1.00 370.00 ? 283  TYR B CZ  1 
ATOM 5880  O OH  . TYR B 2  283  ? 216.389 180.339 200.104 1.00 370.00 ? 283  TYR B OH  1 
ATOM 5881  N N   . LEU B 2  284  ? 215.347 171.884 201.164 1.00 370.00 ? 284  LEU B N   1 
ATOM 5882  C CA  . LEU B 2  284  ? 215.452 170.458 201.411 1.00 370.00 ? 284  LEU B CA  1 
ATOM 5883  C C   . LEU B 2  284  ? 215.357 169.661 200.125 1.00 370.00 ? 284  LEU B C   1 
ATOM 5884  O O   . LEU B 2  284  ? 216.031 168.630 199.964 1.00 370.00 ? 284  LEU B O   1 
ATOM 5885  C CB  . LEU B 2  284  ? 214.335 170.084 202.359 1.00 370.00 ? 284  LEU B CB  1 
ATOM 5886  C CG  . LEU B 2  284  ? 214.052 168.693 202.832 1.00 370.00 ? 284  LEU B CG  1 
ATOM 5887  C CD1 . LEU B 2  284  ? 215.307 168.147 203.421 1.00 370.00 ? 284  LEU B CD1 1 
ATOM 5888  C CD2 . LEU B 2  284  ? 213.024 168.893 203.901 1.00 370.00 ? 284  LEU B CD2 1 
ATOM 5889  N N   . HIS B 2  285  ? 214.502 170.125 199.218 1.00 370.00 ? 285  HIS B N   1 
ATOM 5890  C CA  . HIS B 2  285  ? 214.333 169.481 197.928 1.00 370.00 ? 285  HIS B CA  1 
ATOM 5891  C C   . HIS B 2  285  ? 215.636 169.477 197.164 1.00 370.00 ? 285  HIS B C   1 
ATOM 5892  O O   . HIS B 2  285  ? 216.011 168.467 196.560 1.00 370.00 ? 285  HIS B O   1 
ATOM 5893  C CB  . HIS B 2  285  ? 213.285 170.232 197.128 1.00 370.00 ? 285  HIS B CB  1 
ATOM 5894  C CG  . HIS B 2  285  ? 211.991 170.405 197.845 1.00 370.00 ? 285  HIS B CG  1 
ATOM 5895  N ND1 . HIS B 2  285  ? 211.088 169.379 198.009 1.00 370.00 ? 285  HIS B ND1 1 
ATOM 5896  C CD2 . HIS B 2  285  ? 211.433 171.495 198.420 1.00 370.00 ? 285  HIS B CD2 1 
ATOM 5897  C CE1 . HIS B 2  285  ? 210.031 169.828 198.661 1.00 370.00 ? 285  HIS B CE1 1 
ATOM 5898  N NE2 . HIS B 2  285  ? 210.214 171.110 198.918 1.00 370.00 ? 285  HIS B NE2 1 
ATOM 5899  N N   . GLU B 2  286  ? 216.352 170.598 197.232 1.00 370.00 ? 286  GLU B N   1 
ATOM 5900  C CA  . GLU B 2  286  ? 217.657 170.723 196.606 1.00 370.00 ? 286  GLU B CA  1 
ATOM 5901  C C   . GLU B 2  286  ? 218.635 169.729 197.199 1.00 370.00 ? 286  GLU B C   1 
ATOM 5902  O O   . GLU B 2  286  ? 219.481 169.172 196.490 1.00 370.00 ? 286  GLU B O   1 
ATOM 5903  C CB  . GLU B 2  286  ? 218.161 172.150 196.797 1.00 370.00 ? 286  GLU B CB  1 
ATOM 5904  C CG  . GLU B 2  286  ? 219.396 172.524 196.007 1.00 370.00 ? 286  GLU B CG  1 
ATOM 5905  C CD  . GLU B 2  286  ? 219.113 172.693 194.528 1.00 370.00 ? 286  GLU B CD  1 
ATOM 5906  O OE1 . GLU B 2  286  ? 217.949 172.958 194.168 1.00 370.00 ? 286  GLU B OE1 1 
ATOM 5907  O OE2 . GLU B 2  286  ? 220.060 172.590 193.724 1.00 370.00 ? 286  GLU B OE2 1 
ATOM 5908  N N   . VAL B 2  287  ? 218.491 169.445 198.489 1.00 370.00 ? 287  VAL B N   1 
ATOM 5909  C CA  . VAL B 2  287  ? 219.393 168.505 199.127 1.00 370.00 ? 287  VAL B CA  1 
ATOM 5910  C C   . VAL B 2  287  ? 219.120 167.090 198.642 1.00 370.00 ? 287  VAL B C   1 
ATOM 5911  O O   . VAL B 2  287  ? 220.053 166.316 198.394 1.00 370.00 ? 287  VAL B O   1 
ATOM 5912  C CB  . VAL B 2  287  ? 219.267 168.617 200.649 1.00 370.00 ? 287  VAL B CB  1 
ATOM 5913  C CG1 . VAL B 2  287  ? 220.250 167.710 201.291 1.00 370.00 ? 287  VAL B CG1 1 
ATOM 5914  C CG2 . VAL B 2  287  ? 219.534 170.021 201.075 1.00 370.00 ? 287  VAL B CG2 1 
ATOM 5915  N N   . PHE B 2  288  ? 217.846 166.736 198.483 1.00 370.00 ? 288  PHE B N   1 
ATOM 5916  C CA  . PHE B 2  288  ? 217.531 165.393 198.004 1.00 370.00 ? 288  PHE B CA  1 
ATOM 5917  C C   . PHE B 2  288  ? 217.966 165.220 196.567 1.00 370.00 ? 288  PHE B C   1 
ATOM 5918  O O   . PHE B 2  288  ? 218.449 164.146 196.179 1.00 370.00 ? 288  PHE B O   1 
ATOM 5919  C CB  . PHE B 2  288  ? 216.045 165.119 198.114 1.00 370.00 ? 288  PHE B CB  1 
ATOM 5920  C CG  . PHE B 2  288  ? 215.558 165.010 199.508 1.00 370.00 ? 288  PHE B CG  1 
ATOM 5921  C CD1 . PHE B 2  288  ? 216.434 164.824 200.559 1.00 370.00 ? 288  PHE B CD1 1 
ATOM 5922  C CD2 . PHE B 2  288  ? 214.211 165.093 199.775 1.00 370.00 ? 288  PHE B CD2 1 
ATOM 5923  C CE1 . PHE B 2  288  ? 215.975 164.731 201.840 1.00 370.00 ? 288  PHE B CE1 1 
ATOM 5924  C CE2 . PHE B 2  288  ? 213.745 164.995 201.059 1.00 370.00 ? 288  PHE B CE2 1 
ATOM 5925  C CZ  . PHE B 2  288  ? 214.631 164.813 202.095 1.00 370.00 ? 288  PHE B CZ  1 
ATOM 5926  N N   . GLU B 2  289  ? 217.803 166.285 195.779 1.00 370.00 ? 289  GLU B N   1 
ATOM 5927  C CA  . GLU B 2  289  ? 218.358 166.338 194.435 1.00 370.00 ? 289  GLU B CA  1 
ATOM 5928  C C   . GLU B 2  289  ? 219.856 166.099 194.453 1.00 370.00 ? 289  GLU B C   1 
ATOM 5929  O O   . GLU B 2  289  ? 220.373 165.318 193.643 1.00 370.00 ? 289  GLU B O   1 
ATOM 5930  C CB  . GLU B 2  289  ? 218.050 167.693 193.809 1.00 370.00 ? 289  GLU B CB  1 
ATOM 5931  C CG  . GLU B 2  289  ? 216.594 167.897 193.463 1.00 370.00 ? 289  GLU B CG  1 
ATOM 5932  C CD  . GLU B 2  289  ? 216.283 169.341 193.126 1.00 370.00 ? 289  GLU B CD  1 
ATOM 5933  O OE1 . GLU B 2  289  ? 217.181 170.190 193.298 1.00 370.00 ? 289  GLU B OE1 1 
ATOM 5934  O OE2 . GLU B 2  289  ? 215.143 169.632 192.705 1.00 370.00 ? 289  GLU B OE2 1 
ATOM 5935  N N   . PHE B 2  290  ? 220.555 166.715 195.408 1.00 370.00 ? 290  PHE B N   1 
ATOM 5936  C CA  . PHE B 2  290  ? 221.996 166.537 195.476 1.00 370.00 ? 290  PHE B CA  1 
ATOM 5937  C C   . PHE B 2  290  ? 222.355 165.111 195.842 1.00 370.00 ? 290  PHE B C   1 
ATOM 5938  O O   . PHE B 2  290  ? 223.259 164.512 195.244 1.00 370.00 ? 290  PHE B O   1 
ATOM 5939  C CB  . PHE B 2  290  ? 222.614 167.483 196.492 1.00 370.00 ? 290  PHE B CB  1 
ATOM 5940  C CG  . PHE B 2  290  ? 224.097 167.483 196.430 1.00 370.00 ? 290  PHE B CG  1 
ATOM 5941  C CD1 . PHE B 2  290  ? 224.740 168.186 195.433 1.00 370.00 ? 290  PHE B CD1 1 
ATOM 5942  C CD2 . PHE B 2  290  ? 224.857 166.731 197.300 1.00 370.00 ? 290  PHE B CD2 1 
ATOM 5943  C CE1 . PHE B 2  290  ? 226.110 168.169 195.330 1.00 370.00 ? 290  PHE B CE1 1 
ATOM 5944  C CE2 . PHE B 2  290  ? 226.228 166.703 197.177 1.00 370.00 ? 290  PHE B CE2 1 
ATOM 5945  C CZ  . PHE B 2  290  ? 226.852 167.437 196.208 1.00 370.00 ? 290  PHE B CZ  1 
ATOM 5946  N N   . TYR B 2  291  ? 221.644 164.555 196.810 1.00 370.00 ? 291  TYR B N   1 
ATOM 5947  C CA  . TYR B 2  291  ? 221.999 163.237 197.296 1.00 370.00 ? 291  TYR B CA  1 
ATOM 5948  C C   . TYR B 2  291  ? 221.727 162.166 196.270 1.00 370.00 ? 291  TYR B C   1 
ATOM 5949  O O   . TYR B 2  291  ? 222.469 161.184 196.197 1.00 370.00 ? 291  TYR B O   1 
ATOM 5950  C CB  . TYR B 2  291  ? 221.269 162.918 198.589 1.00 370.00 ? 291  TYR B CB  1 
ATOM 5951  C CG  . TYR B 2  291  ? 221.926 163.515 199.801 1.00 370.00 ? 291  TYR B CG  1 
ATOM 5952  C CD1 . TYR B 2  291  ? 223.097 164.255 199.688 1.00 370.00 ? 291  TYR B CD1 1 
ATOM 5953  C CD2 . TYR B 2  291  ? 221.441 163.249 201.068 1.00 370.00 ? 291  TYR B CD2 1 
ATOM 5954  C CE1 . TYR B 2  291  ? 223.718 164.769 200.794 1.00 370.00 ? 291  TYR B CE1 1 
ATOM 5955  C CE2 . TYR B 2  291  ? 222.066 163.743 202.176 1.00 370.00 ? 291  TYR B CE2 1 
ATOM 5956  C CZ  . TYR B 2  291  ? 223.196 164.507 202.036 1.00 370.00 ? 291  TYR B CZ  1 
ATOM 5957  O OH  . TYR B 2  291  ? 223.810 165.007 203.151 1.00 370.00 ? 291  TYR B OH  1 
ATOM 5958  N N   . GLU B 2  292  ? 220.709 162.332 195.449 1.00 370.00 ? 292  GLU B N   1 
ATOM 5959  C CA  . GLU B 2  292  ? 220.581 161.299 194.450 1.00 370.00 ? 292  GLU B CA  1 
ATOM 5960  C C   . GLU B 2  292  ? 221.355 161.611 193.191 1.00 370.00 ? 292  GLU B C   1 
ATOM 5961  O O   . GLU B 2  292  ? 221.529 160.714 192.363 1.00 370.00 ? 292  GLU B O   1 
ATOM 5962  C CB  . GLU B 2  292  ? 219.120 160.998 194.143 1.00 370.00 ? 292  GLU B CB  1 
ATOM 5963  C CG  . GLU B 2  292  ? 218.357 160.473 195.358 1.00 370.00 ? 292  GLU B CG  1 
ATOM 5964  C CD  . GLU B 2  292  ? 218.977 159.244 196.039 1.00 370.00 ? 292  GLU B CD  1 
ATOM 5965  O OE1 . GLU B 2  292  ? 219.654 158.415 195.403 1.00 370.00 ? 292  GLU B OE1 1 
ATOM 5966  O OE2 . GLU B 2  292  ? 218.763 159.103 197.257 1.00 370.00 ? 292  GLU B OE2 1 
ATOM 5967  N N   . GLU B 2  293  ? 221.862 162.837 193.039 1.00 370.00 ? 293  GLU B N   1 
ATOM 5968  C CA  . GLU B 2  293  ? 222.939 163.007 192.075 1.00 370.00 ? 293  GLU B CA  1 
ATOM 5969  C C   . GLU B 2  293  ? 224.170 162.244 192.504 1.00 370.00 ? 293  GLU B C   1 
ATOM 5970  O O   . GLU B 2  293  ? 224.922 161.753 191.658 1.00 370.00 ? 293  GLU B O   1 
ATOM 5971  C CB  . GLU B 2  293  ? 223.313 164.469 191.882 1.00 370.00 ? 293  GLU B CB  1 
ATOM 5972  C CG  . GLU B 2  293  ? 222.368 165.249 191.017 1.00 370.00 ? 293  GLU B CG  1 
ATOM 5973  C CD  . GLU B 2  293  ? 222.917 166.619 190.701 1.00 370.00 ? 293  GLU B CD  1 
ATOM 5974  O OE1 . GLU B 2  293  ? 223.989 166.960 191.242 1.00 370.00 ? 293  GLU B OE1 1 
ATOM 5975  O OE2 . GLU B 2  293  ? 222.290 167.351 189.910 1.00 370.00 ? 293  GLU B OE2 1 
ATOM 5976  N N   . ILE B 2  294  ? 224.398 162.153 193.806 1.00 370.00 ? 294  ILE B N   1 
ATOM 5977  C CA  . ILE B 2  294  ? 225.475 161.304 194.287 1.00 370.00 ? 294  ILE B CA  1 
ATOM 5978  C C   . ILE B 2  294  ? 225.151 159.844 194.028 1.00 370.00 ? 294  ILE B C   1 
ATOM 5979  O O   . ILE B 2  294  ? 225.848 159.148 193.287 1.00 370.00 ? 294  ILE B O   1 
ATOM 5980  C CB  . ILE B 2  294  ? 225.702 161.519 195.782 1.00 370.00 ? 294  ILE B CB  1 
ATOM 5981  C CG1 . ILE B 2  294  ? 225.963 162.971 196.080 1.00 370.00 ? 294  ILE B CG1 1 
ATOM 5982  C CG2 . ILE B 2  294  ? 226.864 160.688 196.235 1.00 370.00 ? 294  ILE B CG2 1 
ATOM 5983  C CD1 . ILE B 2  294  ? 225.776 163.230 197.515 1.00 370.00 ? 294  ILE B CD1 1 
ATOM 5984  N N   . LEU B 2  295  ? 224.073 159.372 194.624 1.00 370.00 ? 295  LEU B N   1 
ATOM 5985  C CA  . LEU B 2  295  ? 223.942 157.959 194.909 1.00 370.00 ? 295  LEU B CA  1 
ATOM 5986  C C   . LEU B 2  295  ? 223.311 157.169 193.792 1.00 370.00 ? 295  LEU B C   1 
ATOM 5987  O O   . LEU B 2  295  ? 223.504 155.949 193.749 1.00 370.00 ? 295  LEU B O   1 
ATOM 5988  C CB  . LEU B 2  295  ? 223.123 157.781 196.175 1.00 370.00 ? 295  LEU B CB  1 
ATOM 5989  C CG  . LEU B 2  295  ? 223.914 158.398 197.318 1.00 370.00 ? 295  LEU B CG  1 
ATOM 5990  C CD1 . LEU B 2  295  ? 223.097 158.439 198.595 1.00 370.00 ? 295  LEU B CD1 1 
ATOM 5991  C CD2 . LEU B 2  295  ? 225.201 157.615 197.517 1.00 370.00 ? 295  LEU B CD2 1 
ATOM 5992  N N   . THR B 2  296  ? 222.571 157.844 192.914 1.00 370.00 ? 296  THR B N   1 
ATOM 5993  C CA  . THR B 2  296  ? 221.845 157.251 191.791 1.00 370.00 ? 296  THR B CA  1 
ATOM 5994  C C   . THR B 2  296  ? 220.881 156.167 192.288 1.00 370.00 ? 296  THR B C   1 
ATOM 5995  O O   . THR B 2  296  ? 220.984 154.982 191.965 1.00 370.00 ? 296  THR B O   1 
ATOM 5996  C CB  . THR B 2  296  ? 222.816 156.734 190.724 1.00 370.00 ? 296  THR B CB  1 
ATOM 5997  O OG1 . THR B 2  296  ? 223.834 157.718 190.527 1.00 370.00 ? 296  THR B OG1 1 
ATOM 5998  C CG2 . THR B 2  296  ? 222.099 156.553 189.387 1.00 370.00 ? 296  THR B CG2 1 
ATOM 5999  N N   . CYS B 2  297  ? 219.958 156.611 193.128 1.00 370.00 ? 297  CYS B N   1 
ATOM 6000  C CA  . CYS B 2  297  ? 218.837 155.832 193.630 1.00 370.00 ? 297  CYS B CA  1 
ATOM 6001  C C   . CYS B 2  297  ? 217.687 156.813 193.778 1.00 370.00 ? 297  CYS B C   1 
ATOM 6002  O O   . CYS B 2  297  ? 217.728 157.918 193.228 1.00 370.00 ? 297  CYS B O   1 
ATOM 6003  C CB  . CYS B 2  297  ? 219.173 155.156 194.971 1.00 370.00 ? 297  CYS B CB  1 
ATOM 6004  S SG  . CYS B 2  297  ? 220.451 153.892 194.933 1.00 370.00 ? 297  CYS B SG  1 
ATOM 6005  N N   . ARG B 2  298  ? 216.678 156.437 194.535 1.00 370.00 ? 298  ARG B N   1 
ATOM 6006  C CA  . ARG B 2  298  ? 215.810 157.428 195.133 1.00 370.00 ? 298  ARG B CA  1 
ATOM 6007  C C   . ARG B 2  298  ? 216.150 157.505 196.608 1.00 370.00 ? 298  ARG B C   1 
ATOM 6008  O O   . ARG B 2  298  ? 217.040 156.803 197.092 1.00 370.00 ? 298  ARG B O   1 
ATOM 6009  C CB  . ARG B 2  298  ? 214.333 157.104 194.906 1.00 370.00 ? 298  ARG B CB  1 
ATOM 6010  C CG  . ARG B 2  298  ? 213.891 157.339 193.474 1.00 370.00 ? 298  ARG B CG  1 
ATOM 6011  C CD  . ARG B 2  298  ? 212.401 157.102 193.280 1.00 370.00 ? 298  ARG B CD  1 
ATOM 6012  N NE  . ARG B 2  298  ? 212.002 157.320 191.889 1.00 370.00 ? 298  ARG B NE  1 
ATOM 6013  C CZ  . ARG B 2  298  ? 210.771 157.137 191.419 1.00 370.00 ? 298  ARG B CZ  1 
ATOM 6014  N NH1 . ARG B 2  298  ? 209.803 156.733 192.227 1.00 370.00 ? 298  ARG B NH1 1 
ATOM 6015  N NH2 . ARG B 2  298  ? 210.506 157.360 190.140 1.00 370.00 ? 298  ARG B NH2 1 
ATOM 6016  N N   . TYR B 2  299  ? 215.476 158.412 197.296 1.00 370.00 ? 299  TYR B N   1 
ATOM 6017  C CA  . TYR B 2  299  ? 215.476 158.408 198.746 1.00 370.00 ? 299  TYR B CA  1 
ATOM 6018  C C   . TYR B 2  299  ? 214.896 157.088 199.211 1.00 370.00 ? 299  TYR B C   1 
ATOM 6019  O O   . TYR B 2  299  ? 213.690 156.848 199.100 1.00 370.00 ? 299  TYR B O   1 
ATOM 6020  C CB  . TYR B 2  299  ? 214.689 159.586 199.294 1.00 370.00 ? 299  TYR B CB  1 
ATOM 6021  C CG  . TYR B 2  299  ? 214.370 159.465 200.756 1.00 370.00 ? 299  TYR B CG  1 
ATOM 6022  C CD1 . TYR B 2  299  ? 215.369 159.456 201.712 1.00 370.00 ? 299  TYR B CD1 1 
ATOM 6023  C CD2 . TYR B 2  299  ? 213.051 159.410 201.182 1.00 370.00 ? 299  TYR B CD2 1 
ATOM 6024  C CE1 . TYR B 2  299  ? 215.066 159.357 203.054 1.00 370.00 ? 299  TYR B CE1 1 
ATOM 6025  C CE2 . TYR B 2  299  ? 212.739 159.325 202.513 1.00 370.00 ? 299  TYR B CE2 1 
ATOM 6026  C CZ  . TYR B 2  299  ? 213.744 159.295 203.445 1.00 370.00 ? 299  TYR B CZ  1 
ATOM 6027  O OH  . TYR B 2  299  ? 213.409 159.200 204.772 1.00 370.00 ? 299  TYR B OH  1 
ATOM 6028  N N   . PRO B 2  300  ? 215.713 156.233 199.724 1.00 370.00 ? 300  PRO B N   1 
ATOM 6029  C CA  . PRO B 2  300  ? 215.393 154.807 199.731 1.00 370.00 ? 300  PRO B CA  1 
ATOM 6030  C C   . PRO B 2  300  ? 214.454 154.451 200.873 1.00 370.00 ? 300  PRO B C   1 
ATOM 6031  O O   . PRO B 2  300  ? 214.830 153.811 201.851 1.00 370.00 ? 300  PRO B O   1 
ATOM 6032  C CB  . PRO B 2  300  ? 216.777 154.176 199.859 1.00 370.00 ? 300  PRO B CB  1 
ATOM 6033  C CG  . PRO B 2  300  ? 217.525 155.157 200.655 1.00 370.00 ? 300  PRO B CG  1 
ATOM 6034  C CD  . PRO B 2  300  ? 217.032 156.503 200.307 1.00 370.00 ? 300  PRO B CD  1 
ATOM 6035  N N   . TYR B 2  301  ? 213.208 154.870 200.720 1.00 370.00 ? 301  TYR B N   1 
ATOM 6036  C CA  . TYR B 2  301  ? 212.174 154.795 201.741 1.00 370.00 ? 301  TYR B CA  1 
ATOM 6037  C C   . TYR B 2  301  ? 210.819 155.076 201.131 1.00 370.00 ? 301  TYR B C   1 
ATOM 6038  O O   . TYR B 2  301  ? 210.658 155.164 199.911 1.00 370.00 ? 301  TYR B O   1 
ATOM 6039  C CB  . TYR B 2  301  ? 212.412 155.791 202.858 1.00 370.00 ? 301  TYR B CB  1 
ATOM 6040  C CG  . TYR B 2  301  ? 213.083 155.194 204.028 1.00 370.00 ? 301  TYR B CG  1 
ATOM 6041  C CD1 . TYR B 2  301  ? 212.927 153.850 204.326 1.00 370.00 ? 301  TYR B CD1 1 
ATOM 6042  C CD2 . TYR B 2  301  ? 213.881 155.959 204.827 1.00 370.00 ? 301  TYR B CD2 1 
ATOM 6043  C CE1 . TYR B 2  301  ? 213.552 153.297 205.413 1.00 370.00 ? 301  TYR B CE1 1 
ATOM 6044  C CE2 . TYR B 2  301  ? 214.489 155.417 205.903 1.00 370.00 ? 301  TYR B CE2 1 
ATOM 6045  C CZ  . TYR B 2  301  ? 214.338 154.091 206.195 1.00 370.00 ? 301  TYR B CZ  1 
ATOM 6046  O OH  . TYR B 2  301  ? 214.974 153.568 207.285 1.00 370.00 ? 301  TYR B OH  1 
ATOM 6047  N N   . SER B 2  302  ? 209.835 155.201 202.017 1.00 370.00 ? 302  SER B N   1 
ATOM 6048  C CA  . SER B 2  302  ? 208.567 155.820 201.675 1.00 370.00 ? 302  SER B CA  1 
ATOM 6049  C C   . SER B 2  302  ? 208.642 157.332 201.826 1.00 370.00 ? 302  SER B C   1 
ATOM 6050  O O   . SER B 2  302  ? 208.550 158.074 200.845 1.00 370.00 ? 302  SER B O   1 
ATOM 6051  C CB  . SER B 2  302  ? 207.474 155.259 202.574 1.00 370.00 ? 302  SER B CB  1 
ATOM 6052  O OG  . SER B 2  302  ? 207.748 155.599 203.922 1.00 370.00 ? 302  SER B OG  1 
ATOM 6053  N N   . CYS B 2  303  ? 208.842 157.802 203.049 1.00 370.00 ? 303  CYS B N   1 
ATOM 6054  C CA  . CYS B 2  303  ? 208.790 159.221 203.340 1.00 370.00 ? 303  CYS B CA  1 
ATOM 6055  C C   . CYS B 2  303  ? 209.886 159.584 204.319 1.00 370.00 ? 303  CYS B C   1 
ATOM 6056  O O   . CYS B 2  303  ? 210.617 158.733 204.827 1.00 370.00 ? 303  CYS B O   1 
ATOM 6057  C CB  . CYS B 2  303  ? 207.441 159.639 203.927 1.00 370.00 ? 303  CYS B CB  1 
ATOM 6058  S SG  . CYS B 2  303  ? 206.058 159.483 202.806 1.00 370.00 ? 303  CYS B SG  1 
ATOM 6059  N N   . PHE B 2  304  ? 209.980 160.878 204.572 1.00 370.00 ? 304  PHE B N   1 
ATOM 6060  C CA  . PHE B 2  304  ? 210.954 161.438 205.487 1.00 370.00 ? 304  PHE B CA  1 
ATOM 6061  C C   . PHE B 2  304  ? 210.260 162.347 206.480 1.00 370.00 ? 304  PHE B C   1 
ATOM 6062  O O   . PHE B 2  304  ? 209.471 163.216 206.097 1.00 370.00 ? 304  PHE B O   1 
ATOM 6063  C CB  . PHE B 2  304  ? 212.029 162.195 204.731 1.00 370.00 ? 304  PHE B CB  1 
ATOM 6064  C CG  . PHE B 2  304  ? 212.895 163.008 205.607 1.00 370.00 ? 304  PHE B CG  1 
ATOM 6065  C CD1 . PHE B 2  304  ? 213.718 162.409 206.532 1.00 370.00 ? 304  PHE B CD1 1 
ATOM 6066  C CD2 . PHE B 2  304  ? 212.911 164.375 205.489 1.00 370.00 ? 304  PHE B CD2 1 
ATOM 6067  C CE1 . PHE B 2  304  ? 214.524 163.172 207.334 1.00 370.00 ? 304  PHE B CE1 1 
ATOM 6068  C CE2 . PHE B 2  304  ? 213.726 165.129 206.269 1.00 370.00 ? 304  PHE B CE2 1 
ATOM 6069  C CZ  . PHE B 2  304  ? 214.517 164.534 207.207 1.00 370.00 ? 304  PHE B CZ  1 
ATOM 6070  N N   . LYS B 2  305  ? 210.571 162.145 207.747 1.00 370.00 ? 305  LYS B N   1 
ATOM 6071  C CA  . LYS B 2  305  ? 209.827 162.717 208.849 1.00 370.00 ? 305  LYS B CA  1 
ATOM 6072  C C   . LYS B 2  305  ? 210.766 163.531 209.717 1.00 370.00 ? 305  LYS B C   1 
ATOM 6073  O O   . LYS B 2  305  ? 211.902 163.126 209.957 1.00 370.00 ? 305  LYS B O   1 
ATOM 6074  C CB  . LYS B 2  305  ? 209.177 161.597 209.639 1.00 370.00 ? 305  LYS B CB  1 
ATOM 6075  C CG  . LYS B 2  305  ? 208.123 160.910 208.818 1.00 370.00 ? 305  LYS B CG  1 
ATOM 6076  C CD  . LYS B 2  305  ? 207.616 159.660 209.472 1.00 370.00 ? 305  LYS B CD  1 
ATOM 6077  C CE  . LYS B 2  305  ? 208.620 158.560 209.241 1.00 370.00 ? 305  LYS B CE  1 
ATOM 6078  N NZ  . LYS B 2  305  ? 208.176 157.241 209.762 1.00 370.00 ? 305  LYS B NZ  1 
ATOM 6079  N N   . THR B 2  306  ? 210.307 164.694 210.161 1.00 370.00 ? 306  THR B N   1 
ATOM 6080  C CA  . THR B 2  306  ? 211.187 165.600 210.882 1.00 370.00 ? 306  THR B CA  1 
ATOM 6081  C C   . THR B 2  306  ? 210.443 166.271 212.010 1.00 370.00 ? 306  THR B C   1 
ATOM 6082  O O   . THR B 2  306  ? 209.421 166.919 211.781 1.00 370.00 ? 306  THR B O   1 
ATOM 6083  C CB  . THR B 2  306  ? 211.720 166.678 209.969 1.00 370.00 ? 306  THR B CB  1 
ATOM 6084  O OG1 . THR B 2  306  ? 212.311 166.070 208.832 1.00 370.00 ? 306  THR B OG1 1 
ATOM 6085  C CG2 . THR B 2  306  ? 212.750 167.479 210.675 1.00 370.00 ? 306  THR B CG2 1 
ATOM 6086  N N   . VAL B 2  307  ? 210.993 166.175 213.207 1.00 370.00 ? 307  VAL B N   1 
ATOM 6087  C CA  . VAL B 2  307  ? 210.316 166.653 214.400 1.00 370.00 ? 307  VAL B CA  1 
ATOM 6088  C C   . VAL B 2  307  ? 211.170 167.716 215.058 1.00 370.00 ? 307  VAL B C   1 
ATOM 6089  O O   . VAL B 2  307  ? 212.370 167.508 215.253 1.00 370.00 ? 307  VAL B O   1 
ATOM 6090  C CB  . VAL B 2  307  ? 210.065 165.503 215.378 1.00 370.00 ? 307  VAL B CB  1 
ATOM 6091  C CG1 . VAL B 2  307  ? 209.478 166.032 216.645 1.00 370.00 ? 307  VAL B CG1 1 
ATOM 6092  C CG2 . VAL B 2  307  ? 209.155 164.491 214.748 1.00 370.00 ? 307  VAL B CG2 1 
ATOM 6093  N N   . PHE B 2  308  ? 210.573 168.851 215.402 1.00 370.00 ? 308  PHE B N   1 
ATOM 6094  C CA  . PHE B 2  308  ? 211.333 169.840 216.147 1.00 370.00 ? 308  PHE B CA  1 
ATOM 6095  C C   . PHE B 2  308  ? 210.851 169.850 217.582 1.00 370.00 ? 308  PHE B C   1 
ATOM 6096  O O   . PHE B 2  308  ? 209.670 169.641 217.843 1.00 370.00 ? 308  PHE B O   1 
ATOM 6097  C CB  . PHE B 2  308  ? 211.224 171.241 215.572 1.00 370.00 ? 308  PHE B CB  1 
ATOM 6098  C CG  . PHE B 2  308  ? 211.858 171.412 214.228 1.00 370.00 ? 308  PHE B CG  1 
ATOM 6099  C CD1 . PHE B 2  308  ? 212.571 170.407 213.622 1.00 370.00 ? 308  PHE B CD1 1 
ATOM 6100  C CD2 . PHE B 2  308  ? 211.793 172.626 213.598 1.00 370.00 ? 308  PHE B CD2 1 
ATOM 6101  C CE1 . PHE B 2  308  ? 213.108 170.587 212.403 1.00 370.00 ? 308  PHE B CE1 1 
ATOM 6102  C CE2 . PHE B 2  308  ? 212.372 172.802 212.378 1.00 370.00 ? 308  PHE B CE2 1 
ATOM 6103  C CZ  . PHE B 2  308  ? 213.030 171.782 211.786 1.00 370.00 ? 308  PHE B CZ  1 
ATOM 6104  N N   . ILE B 2  309  ? 211.768 170.089 218.510 1.00 370.00 ? 309  ILE B N   1 
ATOM 6105  C CA  . ILE B 2  309  ? 211.521 169.858 219.931 1.00 370.00 ? 309  ILE B CA  1 
ATOM 6106  C C   . ILE B 2  309  ? 212.312 170.857 220.761 1.00 370.00 ? 309  ILE B C   1 
ATOM 6107  O O   . ILE B 2  309  ? 213.478 171.120 220.478 1.00 370.00 ? 309  ILE B O   1 
ATOM 6108  C CB  . ILE B 2  309  ? 211.895 168.407 220.286 1.00 370.00 ? 309  ILE B CB  1 
ATOM 6109  C CG1 . ILE B 2  309  ? 210.761 167.457 219.972 1.00 370.00 ? 309  ILE B CG1 1 
ATOM 6110  C CG2 . ILE B 2  309  ? 212.330 168.242 221.694 1.00 370.00 ? 309  ILE B CG2 1 
ATOM 6111  C CD1 . ILE B 2  309  ? 211.186 166.073 220.011 1.00 370.00 ? 309  ILE B CD1 1 
ATOM 6112  N N   . ASP B 2  310  ? 211.690 171.422 221.797 1.00 370.00 ? 310  ASP B N   1 
ATOM 6113  C CA  . ASP B 2  310  ? 212.465 172.132 222.814 1.00 370.00 ? 310  ASP B CA  1 
ATOM 6114  C C   . ASP B 2  310  ? 213.064 171.124 223.792 1.00 370.00 ? 310  ASP B C   1 
ATOM 6115  O O   . ASP B 2  310  ? 212.545 170.898 224.885 1.00 370.00 ? 310  ASP B O   1 
ATOM 6116  C CB  . ASP B 2  310  ? 211.625 173.142 223.573 1.00 370.00 ? 310  ASP B CB  1 
ATOM 6117  C CG  . ASP B 2  310  ? 212.470 174.030 224.486 1.00 370.00 ? 310  ASP B CG  1 
ATOM 6118  O OD1 . ASP B 2  310  ? 213.711 174.050 224.336 1.00 370.00 ? 310  ASP B OD1 1 
ATOM 6119  O OD2 . ASP B 2  310  ? 211.904 174.649 225.408 1.00 370.00 ? 310  ASP B OD2 1 
ATOM 6120  N N   . GLU B 2  311  ? 214.103 170.449 223.318 1.00 370.00 ? 311  GLU B N   1 
ATOM 6121  C CA  . GLU B 2  311  ? 215.259 169.881 224.001 1.00 370.00 ? 311  GLU B CA  1 
ATOM 6122  C C   . GLU B 2  311  ? 216.043 169.131 222.955 1.00 370.00 ? 311  GLU B C   1 
ATOM 6123  O O   . GLU B 2  311  ? 215.565 168.887 221.846 1.00 370.00 ? 311  GLU B O   1 
ATOM 6124  C CB  . GLU B 2  311  ? 215.011 168.922 225.139 1.00 370.00 ? 311  GLU B CB  1 
ATOM 6125  C CG  . GLU B 2  311  ? 214.936 169.560 226.465 1.00 370.00 ? 311  GLU B CG  1 
ATOM 6126  C CD  . GLU B 2  311  ? 214.806 168.539 227.530 1.00 370.00 ? 311  GLU B CD  1 
ATOM 6127  O OE1 . GLU B 2  311  ? 214.624 167.356 227.180 1.00 370.00 ? 311  GLU B OE1 1 
ATOM 6128  O OE2 . GLU B 2  311  ? 214.908 168.907 228.713 1.00 370.00 ? 311  GLU B OE2 1 
ATOM 6129  N N   . ALA B 2  312  ? 217.237 168.725 223.343 1.00 370.00 ? 312  ALA B N   1 
ATOM 6130  C CA  . ALA B 2  312  ? 217.966 167.717 222.595 1.00 370.00 ? 312  ALA B CA  1 
ATOM 6131  C C   . ALA B 2  312  ? 218.937 167.096 223.565 1.00 370.00 ? 312  ALA B C   1 
ATOM 6132  O O   . ALA B 2  312  ? 219.638 167.817 224.278 1.00 370.00 ? 312  ALA B O   1 
ATOM 6133  C CB  . ALA B 2  312  ? 218.705 168.315 221.410 1.00 370.00 ? 312  ALA B CB  1 
ATOM 6134  N N   . TYR B 2  313  ? 218.946 165.777 223.639 1.00 370.00 ? 313  TYR B N   1 
ATOM 6135  C CA  . TYR B 2  313  ? 220.137 165.136 224.152 1.00 370.00 ? 313  TYR B CA  1 
ATOM 6136  C C   . TYR B 2  313  ? 221.297 165.436 223.226 1.00 370.00 ? 313  TYR B C   1 
ATOM 6137  O O   . TYR B 2  313  ? 222.392 165.772 223.675 1.00 370.00 ? 313  TYR B O   1 
ATOM 6138  C CB  . TYR B 2  313  ? 219.896 163.644 224.279 1.00 370.00 ? 313  TYR B CB  1 
ATOM 6139  C CG  . TYR B 2  313  ? 220.978 162.816 224.890 1.00 370.00 ? 313  TYR B CG  1 
ATOM 6140  C CD1 . TYR B 2  313  ? 221.241 162.875 226.242 1.00 370.00 ? 313  TYR B CD1 1 
ATOM 6141  C CD2 . TYR B 2  313  ? 221.685 161.908 224.125 1.00 370.00 ? 313  TYR B CD2 1 
ATOM 6142  C CE1 . TYR B 2  313  ? 222.211 162.085 226.804 1.00 370.00 ? 313  TYR B CE1 1 
ATOM 6143  C CE2 . TYR B 2  313  ? 222.650 161.118 224.676 1.00 370.00 ? 313  TYR B CE2 1 
ATOM 6144  C CZ  . TYR B 2  313  ? 222.911 161.210 226.014 1.00 370.00 ? 313  TYR B CZ  1 
ATOM 6145  O OH  . TYR B 2  313  ? 223.878 160.409 226.558 1.00 370.00 ? 313  TYR B OH  1 
ATOM 6146  N N   . VAL B 2  314  ? 221.064 165.359 221.921 1.00 370.00 ? 314  VAL B N   1 
ATOM 6147  C CA  . VAL B 2  314  ? 222.048 165.703 220.904 1.00 370.00 ? 314  VAL B CA  1 
ATOM 6148  C C   . VAL B 2  314  ? 221.332 166.536 219.855 1.00 370.00 ? 314  VAL B C   1 
ATOM 6149  O O   . VAL B 2  314  ? 220.224 166.187 219.442 1.00 370.00 ? 314  VAL B O   1 
ATOM 6150  C CB  . VAL B 2  314  ? 222.670 164.446 220.263 1.00 370.00 ? 314  VAL B CB  1 
ATOM 6151  C CG1 . VAL B 2  314  ? 223.634 164.813 219.167 1.00 370.00 ? 314  VAL B CG1 1 
ATOM 6152  C CG2 . VAL B 2  314  ? 223.395 163.604 221.275 1.00 370.00 ? 314  VAL B CG2 1 
ATOM 6153  N N   . GLU B 2  315  ? 221.954 167.631 219.425 1.00 370.00 ? 315  GLU B N   1 
ATOM 6154  C CA  . GLU B 2  315  ? 221.343 168.483 218.415 1.00 370.00 ? 315  GLU B CA  1 
ATOM 6155  C C   . GLU B 2  315  ? 221.188 167.813 217.062 1.00 370.00 ? 315  GLU B C   1 
ATOM 6156  O O   . GLU B 2  315  ? 220.311 168.190 216.289 1.00 370.00 ? 315  GLU B O   1 
ATOM 6157  C CB  . GLU B 2  315  ? 222.172 169.731 218.246 1.00 370.00 ? 315  GLU B CB  1 
ATOM 6158  C CG  . GLU B 2  315  ? 221.961 170.692 219.337 1.00 370.00 ? 315  GLU B CG  1 
ATOM 6159  C CD  . GLU B 2  315  ? 220.614 171.343 219.228 1.00 370.00 ? 315  GLU B CD  1 
ATOM 6160  O OE1 . GLU B 2  315  ? 220.136 171.490 218.090 1.00 370.00 ? 315  GLU B OE1 1 
ATOM 6161  O OE2 . GLU B 2  315  ? 220.053 171.735 220.267 1.00 370.00 ? 315  GLU B OE2 1 
ATOM 6162  N N   . VAL B 2  316  ? 222.035 166.852 216.739 1.00 370.00 ? 316  VAL B N   1 
ATOM 6163  C CA  . VAL B 2  316  ? 222.056 166.337 215.381 1.00 370.00 ? 316  VAL B CA  1 
ATOM 6164  C C   . VAL B 2  316  ? 220.859 165.444 215.108 1.00 370.00 ? 316  VAL B C   1 
ATOM 6165  O O   . VAL B 2  316  ? 220.268 165.537 214.031 1.00 370.00 ? 316  VAL B O   1 
ATOM 6166  C CB  . VAL B 2  316  ? 223.388 165.596 215.161 1.00 370.00 ? 316  VAL B CB  1 
ATOM 6167  C CG1 . VAL B 2  316  ? 223.472 164.983 213.788 1.00 370.00 ? 316  VAL B CG1 1 
ATOM 6168  C CG2 . VAL B 2  316  ? 224.557 166.529 215.395 1.00 370.00 ? 316  VAL B CG2 1 
ATOM 6169  N N   . ALA B 2  317  ? 220.394 164.728 216.136 1.00 370.00 ? 317  ALA B N   1 
ATOM 6170  C CA  . ALA B 2  317  ? 219.871 163.355 216.136 1.00 370.00 ? 317  ALA B CA  1 
ATOM 6171  C C   . ALA B 2  317  ? 219.091 162.946 214.895 1.00 370.00 ? 317  ALA B C   1 
ATOM 6172  O O   . ALA B 2  317  ? 218.138 163.615 214.494 1.00 370.00 ? 317  ALA B O   1 
ATOM 6173  C CB  . ALA B 2  317  ? 218.987 163.170 217.368 1.00 370.00 ? 317  ALA B CB  1 
ATOM 6174  N N   . ALA B 2  318  ? 219.469 161.811 214.317 1.00 370.00 ? 318  ALA B N   1 
ATOM 6175  C CA  . ALA B 2  318  ? 218.925 161.367 213.045 1.00 370.00 ? 318  ALA B CA  1 
ATOM 6176  C C   . ALA B 2  318  ? 218.686 159.871 213.079 1.00 370.00 ? 318  ALA B C   1 
ATOM 6177  O O   . ALA B 2  318  ? 219.617 159.100 213.314 1.00 370.00 ? 318  ALA B O   1 
ATOM 6178  C CB  . ALA B 2  318  ? 219.875 161.710 211.905 1.00 370.00 ? 318  ALA B CB  1 
ATOM 6179  N N   . TYR B 2  319  ? 217.450 159.468 212.828 1.00 370.00 ? 319  TYR B N   1 
ATOM 6180  C CA  . TYR B 2  319  ? 217.006 158.082 212.891 1.00 370.00 ? 319  TYR B CA  1 
ATOM 6181  C C   . TYR B 2  319  ? 216.438 157.666 211.538 1.00 370.00 ? 319  TYR B C   1 
ATOM 6182  O O   . TYR B 2  319  ? 216.602 158.363 210.536 1.00 370.00 ? 319  TYR B O   1 
ATOM 6183  C CB  . TYR B 2  319  ? 215.978 157.910 213.999 1.00 370.00 ? 319  TYR B CB  1 
ATOM 6184  C CG  . TYR B 2  319  ? 216.564 158.017 215.364 1.00 370.00 ? 319  TYR B CG  1 
ATOM 6185  C CD1 . TYR B 2  319  ? 217.897 157.769 215.585 1.00 370.00 ? 319  TYR B CD1 1 
ATOM 6186  C CD2 . TYR B 2  319  ? 215.797 158.406 216.422 1.00 370.00 ? 319  TYR B CD2 1 
ATOM 6187  C CE1 . TYR B 2  319  ? 218.436 157.884 216.825 1.00 370.00 ? 319  TYR B CE1 1 
ATOM 6188  C CE2 . TYR B 2  319  ? 216.316 158.520 217.671 1.00 370.00 ? 319  TYR B CE2 1 
ATOM 6189  C CZ  . TYR B 2  319  ? 217.638 158.264 217.872 1.00 370.00 ? 319  TYR B CZ  1 
ATOM 6190  O OH  . TYR B 2  319  ? 218.163 158.387 219.135 1.00 370.00 ? 319  TYR B OH  1 
ATOM 6191  N N   . ALA B 2  320  ? 215.782 156.506 211.517 1.00 370.00 ? 320  ALA B N   1 
ATOM 6192  C CA  . ALA B 2  320  ? 215.239 155.948 210.285 1.00 370.00 ? 320  ALA B CA  1 
ATOM 6193  C C   . ALA B 2  320  ? 214.063 156.768 209.789 1.00 370.00 ? 320  ALA B C   1 
ATOM 6194  O O   . ALA B 2  320  ? 213.096 156.975 210.518 1.00 370.00 ? 320  ALA B O   1 
ATOM 6195  C CB  . ALA B 2  320  ? 214.790 154.512 210.505 1.00 370.00 ? 320  ALA B CB  1 
ATOM 6196  N N   . SER B 2  321  ? 214.157 157.250 208.550 1.00 370.00 ? 321  SER B N   1 
ATOM 6197  C CA  . SER B 2  321  ? 213.159 158.066 207.857 1.00 370.00 ? 321  SER B CA  1 
ATOM 6198  C C   . SER B 2  321  ? 212.761 159.313 208.625 1.00 370.00 ? 321  SER B C   1 
ATOM 6199  O O   . SER B 2  321  ? 211.705 159.895 208.350 1.00 370.00 ? 321  SER B O   1 
ATOM 6200  C CB  . SER B 2  321  ? 211.910 157.253 207.497 1.00 370.00 ? 321  SER B CB  1 
ATOM 6201  O OG  . SER B 2  321  ? 211.262 156.738 208.642 1.00 370.00 ? 321  SER B OG  1 
ATOM 6202  N N   . MET B 2  322  ? 213.600 159.760 209.550 1.00 370.00 ? 322  MET B N   1 
ATOM 6203  C CA  . MET B 2  322  ? 213.147 160.656 210.588 1.00 370.00 ? 322  MET B CA  1 
ATOM 6204  C C   . MET B 2  322  ? 214.320 161.259 211.329 1.00 370.00 ? 322  MET B C   1 
ATOM 6205  O O   . MET B 2  322  ? 215.212 160.553 211.792 1.00 370.00 ? 322  MET B O   1 
ATOM 6206  C CB  . MET B 2  322  ? 212.238 159.904 211.544 1.00 370.00 ? 322  MET B CB  1 
ATOM 6207  C CG  . MET B 2  322  ? 211.744 160.696 212.698 1.00 370.00 ? 322  MET B CG  1 
ATOM 6208  S SD  . MET B 2  322  ? 210.512 159.708 213.546 1.00 370.00 ? 322  MET B SD  1 
ATOM 6209  C CE  . MET B 2  322  ? 211.540 158.339 214.005 1.00 370.00 ? 322  MET B CE  1 
ATOM 6210  N N   . SER B 2  323  ? 214.312 162.572 211.441 1.00 370.00 ? 323  SER B N   1 
ATOM 6211  C CA  . SER B 2  323  ? 215.313 163.308 212.184 1.00 370.00 ? 323  SER B CA  1 
ATOM 6212  C C   . SER B 2  323  ? 214.598 164.167 213.203 1.00 370.00 ? 323  SER B C   1 
ATOM 6213  O O   . SER B 2  323  ? 213.658 164.901 212.873 1.00 370.00 ? 323  SER B O   1 
ATOM 6214  C CB  . SER B 2  323  ? 216.156 164.151 211.256 1.00 370.00 ? 323  SER B CB  1 
ATOM 6215  O OG  . SER B 2  323  ? 215.317 165.054 210.573 1.00 370.00 ? 323  SER B OG  1 
ATOM 6216  N N   . ILE B 2  324  ? 215.017 164.040 214.445 1.00 370.00 ? 324  ILE B N   1 
ATOM 6217  C CA  . ILE B 2  324  ? 214.280 164.595 215.556 1.00 370.00 ? 324  ILE B CA  1 
ATOM 6218  C C   . ILE B 2  324  ? 215.227 165.462 216.331 1.00 370.00 ? 324  ILE B C   1 
ATOM 6219  O O   . ILE B 2  324  ? 216.167 164.952 216.948 1.00 370.00 ? 324  ILE B O   1 
ATOM 6220  C CB  . ILE B 2  324  ? 213.717 163.501 216.451 1.00 370.00 ? 324  ILE B CB  1 
ATOM 6221  C CG1 . ILE B 2  324  ? 212.683 162.715 215.666 1.00 370.00 ? 324  ILE B CG1 1 
ATOM 6222  C CG2 . ILE B 2  324  ? 213.113 164.115 217.649 1.00 370.00 ? 324  ILE B CG2 1 
ATOM 6223  C CD1 . ILE B 2  324  ? 212.269 161.458 216.313 1.00 370.00 ? 324  ILE B CD1 1 
ATOM 6224  N N   . PHE B 2  325  ? 214.983 166.760 216.317 1.00 370.00 ? 325  PHE B N   1 
ATOM 6225  C CA  . PHE B 2  325  ? 216.002 167.671 216.787 1.00 370.00 ? 325  PHE B CA  1 
ATOM 6226  C C   . PHE B 2  325  ? 215.391 169.020 217.107 1.00 370.00 ? 325  PHE B C   1 
ATOM 6227  O O   . PHE B 2  325  ? 214.171 169.203 217.086 1.00 370.00 ? 325  PHE B O   1 
ATOM 6228  C CB  . PHE B 2  325  ? 217.133 167.778 215.776 1.00 370.00 ? 325  PHE B CB  1 
ATOM 6229  C CG  . PHE B 2  325  ? 216.705 168.168 214.431 1.00 370.00 ? 325  PHE B CG  1 
ATOM 6230  C CD1 . PHE B 2  325  ? 216.370 167.216 213.503 1.00 370.00 ? 325  PHE B CD1 1 
ATOM 6231  C CD2 . PHE B 2  325  ? 216.711 169.479 214.063 1.00 370.00 ? 325  PHE B CD2 1 
ATOM 6232  C CE1 . PHE B 2  325  ? 216.012 167.576 212.259 1.00 370.00 ? 325  PHE B CE1 1 
ATOM 6233  C CE2 . PHE B 2  325  ? 216.370 169.832 212.814 1.00 370.00 ? 325  PHE B CE2 1 
ATOM 6234  C CZ  . PHE B 2  325  ? 216.013 168.878 211.909 1.00 370.00 ? 325  PHE B CZ  1 
ATOM 6235  N N   . SER B 2  326  ? 216.259 169.966 217.403 1.00 370.00 ? 326  SER B N   1 
ATOM 6236  C CA  . SER B 2  326  ? 215.849 170.978 218.333 1.00 370.00 ? 326  SER B CA  1 
ATOM 6237  C C   . SER B 2  326  ? 215.069 172.064 217.650 1.00 370.00 ? 326  SER B C   1 
ATOM 6238  O O   . SER B 2  326  ? 215.153 172.270 216.444 1.00 370.00 ? 326  SER B O   1 
ATOM 6239  C CB  . SER B 2  326  ? 217.033 171.613 219.001 1.00 370.00 ? 326  SER B CB  1 
ATOM 6240  O OG  . SER B 2  326  ? 217.650 172.455 218.063 1.00 370.00 ? 326  SER B OG  1 
ATOM 6241  N N   . THR B 2  327  ? 214.314 172.778 218.458 1.00 370.00 ? 327  THR B N   1 
ATOM 6242  C CA  . THR B 2  327  ? 213.650 173.987 218.011 1.00 370.00 ? 327  THR B CA  1 
ATOM 6243  C C   . THR B 2  327  ? 214.545 175.179 218.343 1.00 370.00 ? 327  THR B C   1 
ATOM 6244  O O   . THR B 2  327  ? 214.200 176.106 219.063 1.00 370.00 ? 327  THR B O   1 
ATOM 6245  C CB  . THR B 2  327  ? 212.271 174.083 218.652 1.00 370.00 ? 327  THR B CB  1 
ATOM 6246  O OG1 . THR B 2  327  ? 211.618 172.823 218.494 1.00 370.00 ? 327  THR B OG1 1 
ATOM 6247  C CG2 . THR B 2  327  ? 211.399 175.103 217.941 1.00 370.00 ? 327  THR B CG2 1 
ATOM 6248  N N   . ASN B 2  328  ? 215.759 175.100 217.855 1.00 370.00 ? 328  ASN B N   1 
ATOM 6249  C CA  . ASN B 2  328  ? 216.584 176.272 217.793 1.00 370.00 ? 328  ASN B CA  1 
ATOM 6250  C C   . ASN B 2  328  ? 216.963 176.573 216.376 1.00 370.00 ? 328  ASN B C   1 
ATOM 6251  O O   . ASN B 2  328  ? 217.582 177.605 216.123 1.00 370.00 ? 328  ASN B O   1 
ATOM 6252  C CB  . ASN B 2  328  ? 217.864 176.092 218.600 1.00 370.00 ? 328  ASN B CB  1 
ATOM 6253  C CG  . ASN B 2  328  ? 217.594 175.738 220.011 1.00 370.00 ? 328  ASN B CG  1 
ATOM 6254  O OD1 . ASN B 2  328  ? 216.600 176.158 220.582 1.00 370.00 ? 328  ASN B OD1 1 
ATOM 6255  N ND2 . ASN B 2  328  ? 218.499 174.983 220.610 1.00 370.00 ? 328  ASN B ND2 1 
ATOM 6256  N N   . LEU B 2  329  ? 216.629 175.696 215.454 1.00 370.00 ? 329  LEU B N   1 
ATOM 6257  C CA  . LEU B 2  329  ? 217.153 175.767 214.108 1.00 370.00 ? 329  LEU B CA  1 
ATOM 6258  C C   . LEU B 2  329  ? 216.057 176.150 213.135 1.00 370.00 ? 329  LEU B C   1 
ATOM 6259  O O   . LEU B 2  329  ? 215.950 175.587 212.053 1.00 370.00 ? 329  LEU B O   1 
ATOM 6260  C CB  . LEU B 2  329  ? 217.787 174.444 213.714 1.00 370.00 ? 329  LEU B CB  1 
ATOM 6261  C CG  . LEU B 2  329  ? 218.870 174.015 214.699 1.00 370.00 ? 329  LEU B CG  1 
ATOM 6262  C CD1 . LEU B 2  329  ? 219.502 172.708 214.275 1.00 370.00 ? 329  LEU B CD1 1 
ATOM 6263  C CD2 . LEU B 2  329  ? 219.921 175.085 214.891 1.00 370.00 ? 329  LEU B CD2 1 
ATOM 6264  N N   . LEU B 2  330  ? 215.208 177.093 213.522 1.00 370.00 ? 330  LEU B N   1 
ATOM 6265  C CA  . LEU B 2  330  ? 214.160 177.514 212.608 1.00 370.00 ? 330  LEU B CA  1 
ATOM 6266  C C   . LEU B 2  330  ? 214.633 178.577 211.634 1.00 370.00 ? 330  LEU B C   1 
ATOM 6267  O O   . LEU B 2  330  ? 214.414 178.428 210.430 1.00 370.00 ? 330  LEU B O   1 
ATOM 6268  C CB  . LEU B 2  330  ? 212.946 177.978 213.386 1.00 370.00 ? 330  LEU B CB  1 
ATOM 6269  C CG  . LEU B 2  330  ? 212.195 176.713 213.753 1.00 370.00 ? 330  LEU B CG  1 
ATOM 6270  C CD1 . LEU B 2  330  ? 211.135 176.974 214.756 1.00 370.00 ? 330  LEU B CD1 1 
ATOM 6271  C CD2 . LEU B 2  330  ? 211.547 176.248 212.488 1.00 370.00 ? 330  LEU B CD2 1 
ATOM 6272  N N   . HIS B 2  331  ? 215.258 179.654 212.129 1.00 370.00 ? 331  HIS B N   1 
ATOM 6273  C CA  . HIS B 2  331  ? 215.920 180.667 211.297 1.00 370.00 ? 331  HIS B CA  1 
ATOM 6274  C C   . HIS B 2  331  ? 214.897 181.331 210.367 1.00 370.00 ? 331  HIS B C   1 
ATOM 6275  O O   . HIS B 2  331  ? 214.976 181.321 209.145 1.00 370.00 ? 331  HIS B O   1 
ATOM 6276  C CB  . HIS B 2  331  ? 217.120 180.008 210.593 1.00 370.00 ? 331  HIS B CB  1 
ATOM 6277  C CG  . HIS B 2  331  ? 217.812 180.845 209.569 1.00 370.00 ? 331  HIS B CG  1 
ATOM 6278  N ND1 . HIS B 2  331  ? 218.456 182.025 209.865 1.00 370.00 ? 331  HIS B ND1 1 
ATOM 6279  C CD2 . HIS B 2  331  ? 217.984 180.642 208.244 1.00 370.00 ? 331  HIS B CD2 1 
ATOM 6280  C CE1 . HIS B 2  331  ? 218.976 182.525 208.759 1.00 370.00 ? 331  HIS B CE1 1 
ATOM 6281  N NE2 . HIS B 2  331  ? 218.709 181.701 207.763 1.00 370.00 ? 331  HIS B NE2 1 
ATOM 6282  N N   . SER B 2  332  ? 213.866 181.858 211.009 1.00 370.00 ? 332  SER B N   1 
ATOM 6283  C CA  . SER B 2  332  ? 212.636 182.192 210.305 1.00 370.00 ? 332  SER B CA  1 
ATOM 6284  C C   . SER B 2  332  ? 212.782 183.511 209.551 1.00 370.00 ? 332  SER B C   1 
ATOM 6285  O O   . SER B 2  332  ? 212.368 184.579 210.009 1.00 370.00 ? 332  SER B O   1 
ATOM 6286  C CB  . SER B 2  332  ? 211.496 182.236 211.289 1.00 370.00 ? 332  SER B CB  1 
ATOM 6287  O OG  . SER B 2  332  ? 211.718 183.233 212.256 1.00 370.00 ? 332  SER B OG  1 
ATOM 6288  N N   . ALA B 2  333  ? 213.465 183.425 208.406 1.00 370.00 ? 333  ALA B N   1 
ATOM 6289  C CA  . ALA B 2  333  ? 213.407 184.343 207.266 1.00 370.00 ? 333  ALA B CA  1 
ATOM 6290  C C   . ALA B 2  333  ? 214.050 185.708 207.459 1.00 370.00 ? 333  ALA B C   1 
ATOM 6291  O O   . ALA B 2  333  ? 214.213 186.451 206.491 1.00 370.00 ? 333  ALA B O   1 
ATOM 6292  C CB  . ALA B 2  333  ? 211.955 184.539 206.828 1.00 370.00 ? 333  ALA B CB  1 
ATOM 6293  N N   . MET B 2  334  ? 214.446 186.056 208.667 1.00 370.00 ? 334  MET B N   1 
ATOM 6294  C CA  . MET B 2  334  ? 214.962 187.387 208.917 1.00 370.00 ? 334  MET B CA  1 
ATOM 6295  C C   . MET B 2  334  ? 216.234 187.360 209.736 1.00 370.00 ? 334  MET B C   1 
ATOM 6296  O O   . MET B 2  334  ? 216.695 188.413 210.171 1.00 370.00 ? 334  MET B O   1 
ATOM 6297  C CB  . MET B 2  334  ? 213.914 188.232 209.646 1.00 370.00 ? 334  MET B CB  1 
ATOM 6298  C CG  . MET B 2  334  ? 212.666 188.516 208.860 1.00 370.00 ? 334  MET B CG  1 
ATOM 6299  S SD  . MET B 2  334  ? 211.466 189.362 209.883 1.00 370.00 ? 334  MET B SD  1 
ATOM 6300  C CE  . MET B 2  334  ? 212.247 190.960 210.041 1.00 370.00 ? 334  MET B CE  1 
ATOM 6301  N N   . ILE B 2  335  ? 216.794 186.180 209.977 1.00 370.00 ? 335  ILE B N   1 
ATOM 6302  C CA  . ILE B 2  335  ? 217.653 185.919 211.123 1.00 370.00 ? 335  ILE B CA  1 
ATOM 6303  C C   . ILE B 2  335  ? 219.007 185.423 210.624 1.00 370.00 ? 335  ILE B C   1 
ATOM 6304  O O   . ILE B 2  335  ? 219.520 184.393 211.074 1.00 370.00 ? 335  ILE B O   1 
ATOM 6305  C CB  . ILE B 2  335  ? 216.987 184.940 212.103 1.00 370.00 ? 335  ILE B CB  1 
ATOM 6306  C CG1 . ILE B 2  335  ? 215.522 185.330 212.326 1.00 370.00 ? 335  ILE B CG1 1 
ATOM 6307  C CG2 . ILE B 2  335  ? 217.614 185.084 213.478 1.00 370.00 ? 335  ILE B CG2 1 
ATOM 6308  C CD1 . ILE B 2  335  ? 214.700 184.324 213.082 1.00 370.00 ? 335  ILE B CD1 1 
ATOM 6309  N N   . ILE B 2  336  ? 219.565 186.152 209.666 1.00 370.00 ? 336  ILE B N   1 
ATOM 6310  C CA  . ILE B 2  336  ? 220.586 185.768 208.698 1.00 370.00 ? 336  ILE B CA  1 
ATOM 6311  C C   . ILE B 2  336  ? 221.701 184.827 209.142 1.00 370.00 ? 336  ILE B C   1 
ATOM 6312  O O   . ILE B 2  336  ? 222.106 183.960 208.365 1.00 370.00 ? 336  ILE B O   1 
ATOM 6313  C CB  . ILE B 2  336  ? 221.167 187.080 208.155 1.00 370.00 ? 336  ILE B CB  1 
ATOM 6314  C CG1 . ILE B 2  336  ? 220.147 187.686 207.221 1.00 370.00 ? 336  ILE B CG1 1 
ATOM 6315  C CG2 . ILE B 2  336  ? 222.530 186.951 207.497 1.00 370.00 ? 336  ILE B CG2 1 
ATOM 6316  C CD1 . ILE B 2  336  ? 220.569 188.979 206.739 1.00 370.00 ? 336  ILE B CD1 1 
ATOM 6317  N N   . ASP B 2  337  ? 222.157 184.913 210.393 1.00 370.00 ? 337  ASP B N   1 
ATOM 6318  C CA  . ASP B 2  337  ? 223.329 184.123 210.785 1.00 370.00 ? 337  ASP B CA  1 
ATOM 6319  C C   . ASP B 2  337  ? 223.100 182.626 210.877 1.00 370.00 ? 337  ASP B C   1 
ATOM 6320  O O   . ASP B 2  337  ? 224.076 181.880 210.963 1.00 370.00 ? 337  ASP B O   1 
ATOM 6321  C CB  . ASP B 2  337  ? 223.901 184.599 212.104 1.00 370.00 ? 337  ASP B CB  1 
ATOM 6322  C CG  . ASP B 2  337  ? 224.999 185.579 211.905 1.00 370.00 ? 337  ASP B CG  1 
ATOM 6323  O OD1 . ASP B 2  337  ? 225.729 185.419 210.909 1.00 370.00 ? 337  ASP B OD1 1 
ATOM 6324  O OD2 . ASP B 2  337  ? 225.149 186.498 212.725 1.00 370.00 ? 337  ASP B OD2 1 
ATOM 6325  N N   . GLU B 2  338  ? 221.869 182.150 210.844 1.00 370.00 ? 338  GLU B N   1 
ATOM 6326  C CA  . GLU B 2  338  ? 221.697 180.722 210.683 1.00 370.00 ? 338  GLU B CA  1 
ATOM 6327  C C   . GLU B 2  338  ? 221.424 180.351 209.248 1.00 370.00 ? 338  GLU B C   1 
ATOM 6328  O O   . GLU B 2  338  ? 220.811 179.317 208.977 1.00 370.00 ? 338  GLU B O   1 
ATOM 6329  C CB  . GLU B 2  338  ? 220.612 180.204 211.606 1.00 370.00 ? 338  GLU B CB  1 
ATOM 6330  C CG  . GLU B 2  338  ? 221.034 180.274 213.025 1.00 370.00 ? 338  GLU B CG  1 
ATOM 6331  C CD  . GLU B 2  338  ? 220.110 179.527 213.923 1.00 370.00 ? 338  GLU B CD  1 
ATOM 6332  O OE1 . GLU B 2  338  ? 219.045 179.086 213.456 1.00 370.00 ? 338  GLU B OE1 1 
ATOM 6333  O OE2 . GLU B 2  338  ? 220.459 179.354 215.098 1.00 370.00 ? 338  GLU B OE2 1 
ATOM 6334  N N   . THR B 2  339  ? 221.846 181.202 208.334 1.00 370.00 ? 339  THR B N   1 
ATOM 6335  C CA  . THR B 2  339  ? 221.861 180.854 206.924 1.00 370.00 ? 339  THR B CA  1 
ATOM 6336  C C   . THR B 2  339  ? 222.720 179.630 206.641 1.00 370.00 ? 339  THR B C   1 
ATOM 6337  O O   . THR B 2  339  ? 222.260 178.774 205.869 1.00 370.00 ? 339  THR B O   1 
ATOM 6338  C CB  . THR B 2  339  ? 222.283 182.088 206.104 1.00 370.00 ? 339  THR B CB  1 
ATOM 6339  O OG1 . THR B 2  339  ? 221.331 183.138 206.296 1.00 370.00 ? 339  THR B OG1 1 
ATOM 6340  C CG2 . THR B 2  339  ? 222.393 181.789 204.629 1.00 370.00 ? 339  THR B CG2 1 
ATOM 6341  N N   . PRO B 2  340  ? 223.936 179.443 207.211 1.00 370.00 ? 340  PRO B N   1 
ATOM 6342  C CA  . PRO B 2  340  ? 224.502 178.098 207.115 1.00 370.00 ? 340  PRO B CA  1 
ATOM 6343  C C   . PRO B 2  340  ? 223.757 177.115 208.004 1.00 370.00 ? 340  PRO B C   1 
ATOM 6344  O O   . PRO B 2  340  ? 223.115 176.180 207.486 1.00 370.00 ? 340  PRO B O   1 
ATOM 6345  C CB  . PRO B 2  340  ? 225.961 178.292 207.543 1.00 370.00 ? 340  PRO B CB  1 
ATOM 6346  C CG  . PRO B 2  340  ? 225.981 179.519 208.341 1.00 370.00 ? 340  PRO B CG  1 
ATOM 6347  C CD  . PRO B 2  340  ? 224.922 180.384 207.785 1.00 370.00 ? 340  PRO B CD  1 
ATOM 6348  N N   . LEU B 2  341  ? 223.688 177.468 209.300 1.00 370.00 ? 341  LEU B N   1 
ATOM 6349  C CA  . LEU B 2  341  ? 223.684 176.485 210.379 1.00 370.00 ? 341  LEU B CA  1 
ATOM 6350  C C   . LEU B 2  341  ? 222.539 175.529 210.234 1.00 370.00 ? 341  LEU B C   1 
ATOM 6351  O O   . LEU B 2  341  ? 222.750 174.313 210.185 1.00 370.00 ? 341  LEU B O   1 
ATOM 6352  C CB  . LEU B 2  341  ? 223.631 177.166 211.735 1.00 370.00 ? 341  LEU B CB  1 
ATOM 6353  C CG  . LEU B 2  341  ? 224.995 177.693 212.128 1.00 370.00 ? 341  LEU B CG  1 
ATOM 6354  C CD1 . LEU B 2  341  ? 224.897 178.505 213.373 1.00 370.00 ? 341  LEU B CD1 1 
ATOM 6355  C CD2 . LEU B 2  341  ? 225.875 176.516 212.377 1.00 370.00 ? 341  LEU B CD2 1 
ATOM 6356  N N   . THR B 2  342  ? 221.362 176.088 209.982 1.00 370.00 ? 342  THR B N   1 
ATOM 6357  C CA  . THR B 2  342  ? 220.131 175.338 209.846 1.00 370.00 ? 342  THR B CA  1 
ATOM 6358  C C   . THR B 2  342  ? 220.254 174.250 208.808 1.00 370.00 ? 342  THR B C   1 
ATOM 6359  O O   . THR B 2  342  ? 220.284 173.061 209.150 1.00 370.00 ? 342  THR B O   1 
ATOM 6360  C CB  . THR B 2  342  ? 219.028 176.293 209.465 1.00 370.00 ? 342  THR B CB  1 
ATOM 6361  O OG1 . THR B 2  342  ? 218.898 177.260 210.505 1.00 370.00 ? 342  THR B OG1 1 
ATOM 6362  C CG2 . THR B 2  342  ? 217.740 175.544 209.292 1.00 370.00 ? 342  THR B CG2 1 
ATOM 6363  N N   . ARG B 2  343  ? 220.487 174.642 207.558 1.00 370.00 ? 343  ARG B N   1 
ATOM 6364  C CA  . ARG B 2  343  ? 220.573 173.608 206.543 1.00 370.00 ? 343  ARG B CA  1 
ATOM 6365  C C   . ARG B 2  343  ? 221.862 172.825 206.677 1.00 370.00 ? 343  ARG B C   1 
ATOM 6366  O O   . ARG B 2  343  ? 221.882 171.634 206.328 1.00 370.00 ? 343  ARG B O   1 
ATOM 6367  C CB  . ARG B 2  343  ? 220.392 174.175 205.134 1.00 370.00 ? 343  ARG B CB  1 
ATOM 6368  C CG  . ARG B 2  343  ? 221.171 175.404 204.760 1.00 370.00 ? 343  ARG B CG  1 
ATOM 6369  C CD  . ARG B 2  343  ? 220.180 176.552 204.667 1.00 370.00 ? 343  ARG B CD  1 
ATOM 6370  N NE  . ARG B 2  343  ? 220.760 177.806 204.194 1.00 370.00 ? 343  ARG B NE  1 
ATOM 6371  C CZ  . ARG B 2  343  ? 220.801 178.182 202.921 1.00 370.00 ? 343  ARG B CZ  1 
ATOM 6372  N NH1 . ARG B 2  343  ? 220.339 177.380 201.982 1.00 370.00 ? 343  ARG B NH1 1 
ATOM 6373  N NH2 . ARG B 2  343  ? 221.341 179.343 202.582 1.00 370.00 ? 343  ARG B NH2 1 
ATOM 6374  N N   . ARG B 2  344  ? 222.886 173.456 207.269 1.00 370.00 ? 344  ARG B N   1 
ATOM 6375  C CA  . ARG B 2  344  ? 224.104 172.764 207.665 1.00 370.00 ? 344  ARG B CA  1 
ATOM 6376  C C   . ARG B 2  344  ? 223.766 171.545 208.490 1.00 370.00 ? 344  ARG B C   1 
ATOM 6377  O O   . ARG B 2  344  ? 224.043 170.415 208.078 1.00 370.00 ? 344  ARG B O   1 
ATOM 6378  C CB  . ARG B 2  344  ? 224.996 173.713 208.445 1.00 370.00 ? 344  ARG B CB  1 
ATOM 6379  C CG  . ARG B 2  344  ? 226.096 173.092 209.237 1.00 370.00 ? 344  ARG B CG  1 
ATOM 6380  C CD  . ARG B 2  344  ? 227.320 172.709 208.484 1.00 370.00 ? 344  ARG B CD  1 
ATOM 6381  N NE  . ARG B 2  344  ? 228.271 172.222 209.470 1.00 370.00 ? 344  ARG B NE  1 
ATOM 6382  C CZ  . ARG B 2  344  ? 229.456 171.686 209.213 1.00 370.00 ? 344  ARG B CZ  1 
ATOM 6383  N NH1 . ARG B 2  344  ? 229.870 171.511 207.965 1.00 370.00 ? 344  ARG B NH1 1 
ATOM 6384  N NH2 . ARG B 2  344  ? 230.198 171.242 210.215 1.00 370.00 ? 344  ARG B NH2 1 
ATOM 6385  N N   . CYS B 2  345  ? 222.993 171.742 209.551 1.00 370.00 ? 345  CYS B N   1 
ATOM 6386  C CA  . CYS B 2  345  ? 222.679 170.595 210.377 1.00 370.00 ? 345  CYS B CA  1 
ATOM 6387  C C   . CYS B 2  345  ? 221.660 169.711 209.710 1.00 370.00 ? 345  CYS B C   1 
ATOM 6388  O O   . CYS B 2  345  ? 221.704 168.490 209.909 1.00 370.00 ? 345  CYS B O   1 
ATOM 6389  C CB  . CYS B 2  345  ? 222.222 171.030 211.755 1.00 370.00 ? 345  CYS B CB  1 
ATOM 6390  S SG  . CYS B 2  345  ? 223.624 171.599 212.748 1.00 370.00 ? 345  CYS B SG  1 
ATOM 6391  N N   . LEU B 2  346  ? 220.840 170.280 208.820 1.00 370.00 ? 346  LEU B N   1 
ATOM 6392  C CA  . LEU B 2  346  ? 219.922 169.446 208.063 1.00 370.00 ? 346  LEU B CA  1 
ATOM 6393  C C   . LEU B 2  346  ? 220.669 168.467 207.197 1.00 370.00 ? 346  LEU B C   1 
ATOM 6394  O O   . LEU B 2  346  ? 220.260 167.304 207.076 1.00 370.00 ? 346  LEU B O   1 
ATOM 6395  C CB  . LEU B 2  346  ? 218.987 170.278 207.211 1.00 370.00 ? 346  LEU B CB  1 
ATOM 6396  C CG  . LEU B 2  346  ? 217.821 170.742 208.047 1.00 370.00 ? 346  LEU B CG  1 
ATOM 6397  C CD1 . LEU B 2  346  ? 216.930 171.584 207.200 1.00 370.00 ? 346  LEU B CD1 1 
ATOM 6398  C CD2 . LEU B 2  346  ? 217.078 169.531 208.526 1.00 370.00 ? 346  LEU B CD2 1 
ATOM 6399  N N   . ALA B 2  347  ? 221.829 168.892 206.701 1.00 370.00 ? 347  ALA B N   1 
ATOM 6400  C CA  . ALA B 2  347  ? 222.644 168.023 205.878 1.00 370.00 ? 347  ALA B CA  1 
ATOM 6401  C C   . ALA B 2  347  ? 223.093 166.801 206.651 1.00 370.00 ? 347  ALA B C   1 
ATOM 6402  O O   . ALA B 2  347  ? 222.962 165.678 206.152 1.00 370.00 ? 347  ALA B O   1 
ATOM 6403  C CB  . ALA B 2  347  ? 223.837 168.795 205.354 1.00 370.00 ? 347  ALA B CB  1 
ATOM 6404  N N   . GLN B 2  348  ? 223.510 166.994 207.908 1.00 370.00 ? 348  GLN B N   1 
ATOM 6405  C CA  . GLN B 2  348  ? 223.880 165.846 208.724 1.00 370.00 ? 348  GLN B CA  1 
ATOM 6406  C C   . GLN B 2  348  ? 222.670 164.983 208.972 1.00 370.00 ? 348  GLN B C   1 
ATOM 6407  O O   . GLN B 2  348  ? 222.710 163.765 208.751 1.00 370.00 ? 348  GLN B O   1 
ATOM 6408  C CB  . GLN B 2  348  ? 224.477 166.281 210.051 1.00 370.00 ? 348  GLN B CB  1 
ATOM 6409  C CG  . GLN B 2  348  ? 225.762 166.988 209.921 1.00 370.00 ? 348  GLN B CG  1 
ATOM 6410  C CD  . GLN B 2  348  ? 226.346 167.348 211.251 1.00 370.00 ? 348  GLN B CD  1 
ATOM 6411  O OE1 . GLN B 2  348  ? 225.755 167.076 212.293 1.00 370.00 ? 348  GLN B OE1 1 
ATOM 6412  N NE2 . GLN B 2  348  ? 227.513 167.974 211.231 1.00 370.00 ? 348  GLN B NE2 1 
ATOM 6413  N N   . SER B 2  349  ? 221.536 165.621 209.219 1.00 370.00 ? 349  SER B N   1 
ATOM 6414  C CA  . SER B 2  349  ? 220.348 164.853 209.495 1.00 370.00 ? 349  SER B CA  1 
ATOM 6415  C C   . SER B 2  349  ? 219.768 164.222 208.253 1.00 370.00 ? 349  SER B C   1 
ATOM 6416  O O   . SER B 2  349  ? 218.699 163.620 208.330 1.00 370.00 ? 349  SER B O   1 
ATOM 6417  C CB  . SER B 2  349  ? 219.307 165.730 210.155 1.00 370.00 ? 349  SER B CB  1 
ATOM 6418  O OG  . SER B 2  349  ? 218.816 166.657 209.220 1.00 370.00 ? 349  SER B OG  1 
ATOM 6419  N N   . LEU B 2  350  ? 220.415 164.338 207.105 1.00 370.00 ? 350  LEU B N   1 
ATOM 6420  C CA  . LEU B 2  350  ? 220.058 163.432 206.040 1.00 370.00 ? 350  LEU B CA  1 
ATOM 6421  C C   . LEU B 2  350  ? 221.112 162.366 205.819 1.00 370.00 ? 350  LEU B C   1 
ATOM 6422  O O   . LEU B 2  350  ? 220.765 161.190 205.684 1.00 370.00 ? 350  LEU B O   1 
ATOM 6423  C CB  . LEU B 2  350  ? 219.809 164.231 204.774 1.00 370.00 ? 350  LEU B CB  1 
ATOM 6424  C CG  . LEU B 2  350  ? 218.626 165.153 205.056 1.00 370.00 ? 350  LEU B CG  1 
ATOM 6425  C CD1 . LEU B 2  350  ? 218.435 166.178 204.003 1.00 370.00 ? 350  LEU B CD1 1 
ATOM 6426  C CD2 . LEU B 2  350  ? 217.380 164.355 205.155 1.00 370.00 ? 350  LEU B CD2 1 
ATOM 6427  N N   . ALA B 2  351  ? 222.391 162.738 205.888 1.00 370.00 ? 351  ALA B N   1 
ATOM 6428  C CA  . ALA B 2  351  ? 223.435 161.850 205.392 1.00 370.00 ? 351  ALA B CA  1 
ATOM 6429  C C   . ALA B 2  351  ? 223.625 160.674 206.317 1.00 370.00 ? 351  ALA B C   1 
ATOM 6430  O O   . ALA B 2  351  ? 223.504 159.518 205.891 1.00 370.00 ? 351  ALA B O   1 
ATOM 6431  C CB  . ALA B 2  351  ? 224.744 162.602 205.235 1.00 370.00 ? 351  ALA B CB  1 
ATOM 6432  N N   . GLN B 2  352  ? 223.843 160.961 207.605 1.00 370.00 ? 352  GLN B N   1 
ATOM 6433  C CA  . GLN B 2  352  ? 223.814 159.921 208.627 1.00 370.00 ? 352  GLN B CA  1 
ATOM 6434  C C   . GLN B 2  352  ? 222.525 159.140 208.629 1.00 370.00 ? 352  GLN B C   1 
ATOM 6435  O O   . GLN B 2  352  ? 222.555 157.960 208.998 1.00 370.00 ? 352  GLN B O   1 
ATOM 6436  C CB  . GLN B 2  352  ? 224.013 160.469 210.036 1.00 370.00 ? 352  GLN B CB  1 
ATOM 6437  C CG  . GLN B 2  352  ? 225.425 160.407 210.529 1.00 370.00 ? 352  GLN B CG  1 
ATOM 6438  C CD  . GLN B 2  352  ? 225.511 160.690 211.996 1.00 370.00 ? 352  GLN B CD  1 
ATOM 6439  O OE1 . GLN B 2  352  ? 224.530 161.090 212.618 1.00 370.00 ? 352  GLN B OE1 1 
ATOM 6440  N NE2 . GLN B 2  352  ? 226.673 160.442 212.573 1.00 370.00 ? 352  GLN B NE2 1 
ATOM 6441  N N   . GLN B 2  353  ? 221.412 159.780 208.230 1.00 370.00 ? 353  GLN B N   1 
ATOM 6442  C CA  . GLN B 2  353  ? 220.139 159.093 208.065 1.00 370.00 ? 353  GLN B CA  1 
ATOM 6443  C C   . GLN B 2  353  ? 220.309 157.835 207.255 1.00 370.00 ? 353  GLN B C   1 
ATOM 6444  O O   . GLN B 2  353  ? 220.096 156.742 207.782 1.00 370.00 ? 353  GLN B O   1 
ATOM 6445  C CB  . GLN B 2  353  ? 219.135 159.990 207.382 1.00 370.00 ? 353  GLN B CB  1 
ATOM 6446  C CG  . GLN B 2  353  ? 217.860 159.291 207.149 1.00 370.00 ? 353  GLN B CG  1 
ATOM 6447  C CD  . GLN B 2  353  ? 216.895 160.191 206.479 1.00 370.00 ? 353  GLN B CD  1 
ATOM 6448  O OE1 . GLN B 2  353  ? 217.234 161.315 206.157 1.00 370.00 ? 353  GLN B OE1 1 
ATOM 6449  N NE2 . GLN B 2  353  ? 215.680 159.718 206.262 1.00 370.00 ? 353  GLN B NE2 1 
ATOM 6450  N N   . PHE B 2  354  ? 220.916 157.976 206.069 1.00 370.00 ? 354  PHE B N   1 
ATOM 6451  C CA  . PHE B 2  354  ? 221.108 156.851 205.162 1.00 370.00 ? 354  PHE B CA  1 
ATOM 6452  C C   . PHE B 2  354  ? 222.003 155.808 205.780 1.00 370.00 ? 354  PHE B C   1 
ATOM 6453  O O   . PHE B 2  354  ? 221.749 154.608 205.656 1.00 370.00 ? 354  PHE B O   1 
ATOM 6454  C CB  . PHE B 2  354  ? 221.731 157.313 203.852 1.00 370.00 ? 354  PHE B CB  1 
ATOM 6455  C CG  . PHE B 2  354  ? 220.860 158.231 203.049 1.00 370.00 ? 354  PHE B CG  1 
ATOM 6456  C CD1 . PHE B 2  354  ? 219.492 158.323 203.277 1.00 370.00 ? 354  PHE B CD1 1 
ATOM 6457  C CD2 . PHE B 2  354  ? 221.418 159.020 202.063 1.00 370.00 ? 354  PHE B CD2 1 
ATOM 6458  C CE1 . PHE B 2  354  ? 218.706 159.186 202.533 1.00 370.00 ? 354  PHE B CE1 1 
ATOM 6459  C CE2 . PHE B 2  354  ? 220.634 159.882 201.313 1.00 370.00 ? 354  PHE B CE2 1 
ATOM 6460  C CZ  . PHE B 2  354  ? 219.276 159.966 201.550 1.00 370.00 ? 354  PHE B CZ  1 
ATOM 6461  N N   . PHE B 2  355  ? 222.982 156.242 206.539 1.00 370.00 ? 355  PHE B N   1 
ATOM 6462  C CA  . PHE B 2  355  ? 223.912 155.294 207.094 1.00 370.00 ? 355  PHE B CA  1 
ATOM 6463  C C   . PHE B 2  355  ? 223.592 155.020 208.541 1.00 370.00 ? 355  PHE B C   1 
ATOM 6464  O O   . PHE B 2  355  ? 224.320 154.288 209.211 1.00 370.00 ? 355  PHE B O   1 
ATOM 6465  C CB  . PHE B 2  355  ? 225.321 155.816 206.904 1.00 370.00 ? 355  PHE B CB  1 
ATOM 6466  C CG  . PHE B 2  355  ? 225.706 155.970 205.456 1.00 370.00 ? 355  PHE B CG  1 
ATOM 6467  C CD1 . PHE B 2  355  ? 225.093 155.229 204.461 1.00 370.00 ? 355  PHE B CD1 1 
ATOM 6468  C CD2 . PHE B 2  355  ? 226.649 156.907 205.086 1.00 370.00 ? 355  PHE B CD2 1 
ATOM 6469  C CE1 . PHE B 2  355  ? 225.433 155.410 203.149 1.00 370.00 ? 355  PHE B CE1 1 
ATOM 6470  C CE2 . PHE B 2  355  ? 226.986 157.080 203.771 1.00 370.00 ? 355  PHE B CE2 1 
ATOM 6471  C CZ  . PHE B 2  355  ? 226.390 156.325 202.806 1.00 370.00 ? 355  PHE B CZ  1 
ATOM 6472  N N   . GLY B 2  356  ? 222.513 155.608 209.030 1.00 370.00 ? 356  GLY B N   1 
ATOM 6473  C CA  . GLY B 2  356  ? 221.818 155.076 210.170 1.00 370.00 ? 356  GLY B CA  1 
ATOM 6474  C C   . GLY B 2  356  ? 220.647 154.307 209.616 1.00 370.00 ? 356  GLY B C   1 
ATOM 6475  O O   . GLY B 2  356  ? 219.911 153.659 210.362 1.00 370.00 ? 356  GLY B O   1 
ATOM 6476  N N   . CYS B 2  357  ? 220.451 154.383 208.298 1.00 370.00 ? 357  CYS B N   1 
ATOM 6477  C CA  . CYS B 2  357  ? 219.477 153.487 207.684 1.00 370.00 ? 357  CYS B CA  1 
ATOM 6478  C C   . CYS B 2  357  ? 220.066 152.107 207.464 1.00 370.00 ? 357  CYS B C   1 
ATOM 6479  O O   . CYS B 2  357  ? 219.728 151.145 208.155 1.00 370.00 ? 357  CYS B O   1 
ATOM 6480  C CB  . CYS B 2  357  ? 219.018 154.017 206.323 1.00 370.00 ? 357  CYS B CB  1 
ATOM 6481  S SG  . CYS B 2  357  ? 217.855 155.345 206.235 1.00 370.00 ? 357  CYS B SG  1 
ATOM 6482  N N   . PHE B 2  358  ? 220.980 152.014 206.513 1.00 370.00 ? 358  PHE B N   1 
ATOM 6483  C CA  . PHE B 2  358  ? 221.153 150.774 205.781 1.00 370.00 ? 358  PHE B CA  1 
ATOM 6484  C C   . PHE B 2  358  ? 222.532 150.189 205.982 1.00 370.00 ? 358  PHE B C   1 
ATOM 6485  O O   . PHE B 2  358  ? 222.659 149.059 206.458 1.00 370.00 ? 358  PHE B O   1 
ATOM 6486  C CB  . PHE B 2  358  ? 220.895 151.025 204.298 1.00 370.00 ? 358  PHE B CB  1 
ATOM 6487  C CG  . PHE B 2  358  ? 219.462 151.279 203.975 1.00 370.00 ? 358  PHE B CG  1 
ATOM 6488  C CD1 . PHE B 2  358  ? 218.452 150.882 204.834 1.00 370.00 ? 358  PHE B CD1 1 
ATOM 6489  C CD2 . PHE B 2  358  ? 219.123 151.921 202.813 1.00 370.00 ? 358  PHE B CD2 1 
ATOM 6490  C CE1 . PHE B 2  358  ? 217.144 151.134 204.539 1.00 370.00 ? 358  PHE B CE1 1 
ATOM 6491  C CE2 . PHE B 2  358  ? 217.819 152.159 202.514 1.00 370.00 ? 358  PHE B CE2 1 
ATOM 6492  C CZ  . PHE B 2  358  ? 216.826 151.772 203.372 1.00 370.00 ? 358  PHE B CZ  1 
ATOM 6493  N N   . ILE B 2  359  ? 223.562 150.931 205.621 1.00 370.00 ? 359  ILE B N   1 
ATOM 6494  C CA  . ILE B 2  359  ? 224.892 150.531 205.999 1.00 370.00 ? 359  ILE B CA  1 
ATOM 6495  C C   . ILE B 2  359  ? 224.985 150.660 207.508 1.00 370.00 ? 359  ILE B C   1 
ATOM 6496  O O   . ILE B 2  359  ? 224.354 151.534 208.119 1.00 370.00 ? 359  ILE B O   1 
ATOM 6497  C CB  . ILE B 2  359  ? 225.914 151.383 205.236 1.00 370.00 ? 359  ILE B CB  1 
ATOM 6498  C CG1 . ILE B 2  359  ? 225.650 151.208 203.745 1.00 370.00 ? 359  ILE B CG1 1 
ATOM 6499  C CG2 . ILE B 2  359  ? 227.331 150.947 205.522 1.00 370.00 ? 359  ILE B CG2 1 
ATOM 6500  C CD1 . ILE B 2  359  ? 226.524 152.057 202.861 1.00 370.00 ? 359  ILE B CD1 1 
ATOM 6501  N N   . SER B 2  360  ? 225.695 149.730 208.123 1.00 370.00 ? 360  SER B N   1 
ATOM 6502  C CA  . SER B 2  360  ? 225.495 149.463 209.529 1.00 370.00 ? 360  SER B CA  1 
ATOM 6503  C C   . SER B 2  360  ? 226.712 148.729 210.057 1.00 370.00 ? 360  SER B C   1 
ATOM 6504  O O   . SER B 2  360  ? 227.238 147.826 209.400 1.00 370.00 ? 360  SER B O   1 
ATOM 6505  C CB  . SER B 2  360  ? 224.219 148.651 209.698 1.00 370.00 ? 360  SER B CB  1 
ATOM 6506  O OG  . SER B 2  360  ? 224.315 147.467 208.941 1.00 370.00 ? 360  SER B OG  1 
ATOM 6507  N N   . ARG B 2  361  ? 227.152 149.121 211.249 1.00 370.00 ? 361  ARG B N   1 
ATOM 6508  C CA  . ARG B 2  361  ? 228.408 148.613 211.778 1.00 370.00 ? 361  ARG B CA  1 
ATOM 6509  C C   . ARG B 2  361  ? 228.252 147.203 212.332 1.00 370.00 ? 361  ARG B C   1 
ATOM 6510  O O   . ARG B 2  361  ? 227.280 146.887 213.020 1.00 370.00 ? 361  ARG B O   1 
ATOM 6511  C CB  . ARG B 2  361  ? 228.972 149.556 212.848 1.00 370.00 ? 361  ARG B CB  1 
ATOM 6512  C CG  . ARG B 2  361  ? 228.182 149.680 214.143 1.00 370.00 ? 361  ARG B CG  1 
ATOM 6513  C CD  . ARG B 2  361  ? 227.365 150.939 214.180 1.00 370.00 ? 361  ARG B CD  1 
ATOM 6514  N NE  . ARG B 2  361  ? 226.445 150.935 215.310 1.00 370.00 ? 361  ARG B NE  1 
ATOM 6515  C CZ  . ARG B 2  361  ? 226.638 151.550 216.465 1.00 370.00 ? 361  ARG B CZ  1 
ATOM 6516  N NH1 . ARG B 2  361  ? 227.738 152.253 216.671 1.00 370.00 ? 361  ARG B NH1 1 
ATOM 6517  N NH2 . ARG B 2  361  ? 225.713 151.464 217.408 1.00 370.00 ? 361  ARG B NH2 1 
ATOM 6518  N N   . MET B 2  362  ? 229.200 146.337 211.988 1.00 370.00 ? 362  MET B N   1 
ATOM 6519  C CA  . MET B 2  362  ? 229.196 145.007 212.575 1.00 370.00 ? 362  MET B CA  1 
ATOM 6520  C C   . MET B 2  362  ? 229.634 145.035 214.026 1.00 370.00 ? 362  MET B C   1 
ATOM 6521  O O   . MET B 2  362  ? 229.323 144.109 214.782 1.00 370.00 ? 362  MET B O   1 
ATOM 6522  C CB  . MET B 2  362  ? 230.089 144.053 211.791 1.00 370.00 ? 362  MET B CB  1 
ATOM 6523  C CG  . MET B 2  362  ? 229.513 143.639 210.477 1.00 370.00 ? 362  MET B CG  1 
ATOM 6524  S SD  . MET B 2  362  ? 230.559 142.460 209.610 1.00 370.00 ? 362  MET B SD  1 
ATOM 6525  C CE  . MET B 2  362  ? 230.274 140.983 210.589 1.00 370.00 ? 362  MET B CE  1 
ATOM 6526  N N   . SER B 2  363  ? 230.362 146.065 214.426 1.00 370.00 ? 363  SER B N   1 
ATOM 6527  C CA  . SER B 2  363  ? 230.641 146.293 215.826 1.00 370.00 ? 363  SER B CA  1 
ATOM 6528  C C   . SER B 2  363  ? 230.889 147.770 216.003 1.00 370.00 ? 363  SER B C   1 
ATOM 6529  O O   . SER B 2  363  ? 231.044 148.511 215.036 1.00 370.00 ? 363  SER B O   1 
ATOM 6530  C CB  . SER B 2  363  ? 231.862 145.519 216.319 1.00 370.00 ? 363  SER B CB  1 
ATOM 6531  O OG  . SER B 2  363  ? 233.041 146.114 215.818 1.00 370.00 ? 363  SER B OG  1 
ATOM 6532  N N   . TRP B 2  364  ? 230.964 148.175 217.269 1.00 370.00 ? 364  TRP B N   1 
ATOM 6533  C CA  . TRP B 2  364  ? 231.433 149.511 217.606 1.00 370.00 ? 364  TRP B CA  1 
ATOM 6534  C C   . TRP B 2  364  ? 232.817 149.770 217.045 1.00 370.00 ? 364  TRP B C   1 
ATOM 6535  O O   . TRP B 2  364  ? 233.118 150.875 216.582 1.00 370.00 ? 364  TRP B O   1 
ATOM 6536  C CB  . TRP B 2  364  ? 231.454 149.687 219.114 1.00 370.00 ? 364  TRP B CB  1 
ATOM 6537  C CG  . TRP B 2  364  ? 232.034 150.956 219.451 1.00 370.00 ? 364  TRP B CG  1 
ATOM 6538  C CD1 . TRP B 2  364  ? 233.263 151.180 219.959 1.00 370.00 ? 364  TRP B CD1 1 
ATOM 6539  C CD2 . TRP B 2  364  ? 231.457 152.223 219.209 1.00 370.00 ? 364  TRP B CD2 1 
ATOM 6540  N NE1 . TRP B 2  364  ? 233.470 152.517 220.109 1.00 370.00 ? 364  TRP B NE1 1 
ATOM 6541  C CE2 . TRP B 2  364  ? 232.371 153.180 219.638 1.00 370.00 ? 364  TRP B CE2 1 
ATOM 6542  C CE3 . TRP B 2  364  ? 230.238 152.643 218.695 1.00 370.00 ? 364  TRP B CE3 1 
ATOM 6543  C CZ2 . TRP B 2  364  ? 232.108 154.530 219.565 1.00 370.00 ? 364  TRP B CZ2 1 
ATOM 6544  C CZ3 . TRP B 2  364  ? 229.986 153.972 218.620 1.00 370.00 ? 364  TRP B CZ3 1 
ATOM 6545  C CH2 . TRP B 2  364  ? 230.904 154.906 219.065 1.00 370.00 ? 364  TRP B CH2 1 
ATOM 6546  N N   . SER B 2  365  ? 233.655 148.742 217.044 1.00 370.00 ? 365  SER B N   1 
ATOM 6547  C CA  . SER B 2  365  ? 234.957 148.761 216.409 1.00 370.00 ? 365  SER B CA  1 
ATOM 6548  C C   . SER B 2  365  ? 234.890 148.613 214.899 1.00 370.00 ? 365  SER B C   1 
ATOM 6549  O O   . SER B 2  365  ? 235.898 148.264 214.288 1.00 370.00 ? 365  SER B O   1 
ATOM 6550  C CB  . SER B 2  365  ? 235.789 147.637 216.991 1.00 370.00 ? 365  SER B CB  1 
ATOM 6551  O OG  . SER B 2  365  ? 235.134 146.406 216.754 1.00 370.00 ? 365  SER B OG  1 
ATOM 6552  N N   . ASP B 2  366  ? 233.736 148.817 214.284 1.00 370.00 ? 366  ASP B N   1 
ATOM 6553  C CA  . ASP B 2  366  ? 233.631 148.762 212.842 1.00 370.00 ? 366  ASP B CA  1 
ATOM 6554  C C   . ASP B 2  366  ? 233.022 150.020 212.255 1.00 370.00 ? 366  ASP B C   1 
ATOM 6555  O O   . ASP B 2  366  ? 232.799 150.068 211.043 1.00 370.00 ? 366  ASP B O   1 
ATOM 6556  C CB  . ASP B 2  366  ? 232.800 147.553 212.439 1.00 370.00 ? 366  ASP B CB  1 
ATOM 6557  C CG  . ASP B 2  366  ? 233.483 146.264 212.755 1.00 370.00 ? 366  ASP B CG  1 
ATOM 6558  O OD1 . ASP B 2  366  ? 234.724 146.218 212.677 1.00 370.00 ? 366  ASP B OD1 1 
ATOM 6559  O OD2 . ASP B 2  366  ? 232.780 145.303 213.112 1.00 370.00 ? 366  ASP B OD2 1 
ATOM 6560  N N   . GLU B 2  367  ? 232.752 151.039 213.072 1.00 370.00 ? 367  GLU B N   1 
ATOM 6561  C CA  . GLU B 2  367  ? 231.810 152.050 212.618 1.00 370.00 ? 367  GLU B CA  1 
ATOM 6562  C C   . GLU B 2  367  ? 232.423 152.989 211.612 1.00 370.00 ? 367  GLU B C   1 
ATOM 6563  O O   . GLU B 2  367  ? 231.856 153.178 210.534 1.00 370.00 ? 367  GLU B O   1 
ATOM 6564  C CB  . GLU B 2  367  ? 231.235 152.856 213.774 1.00 370.00 ? 367  GLU B CB  1 
ATOM 6565  C CG  . GLU B 2  367  ? 230.187 153.820 213.235 1.00 370.00 ? 367  GLU B CG  1 
ATOM 6566  C CD  . GLU B 2  367  ? 229.247 154.362 214.271 1.00 370.00 ? 367  GLU B CD  1 
ATOM 6567  O OE1 . GLU B 2  367  ? 229.477 154.145 215.471 1.00 370.00 ? 367  GLU B OE1 1 
ATOM 6568  O OE2 . GLU B 2  367  ? 228.223 154.934 213.873 1.00 370.00 ? 367  GLU B OE2 1 
ATOM 6569  N N   . TRP B 2  368  ? 233.636 153.459 211.890 1.00 370.00 ? 368  TRP B N   1 
ATOM 6570  C CA  . TRP B 2  368  ? 234.207 154.704 211.384 1.00 370.00 ? 368  TRP B CA  1 
ATOM 6571  C C   . TRP B 2  368  ? 233.989 155.009 209.911 1.00 370.00 ? 368  TRP B C   1 
ATOM 6572  O O   . TRP B 2  368  ? 233.968 156.171 209.507 1.00 370.00 ? 368  TRP B O   1 
ATOM 6573  C CB  . TRP B 2  368  ? 235.701 154.712 211.648 1.00 370.00 ? 368  TRP B CB  1 
ATOM 6574  C CG  . TRP B 2  368  ? 236.413 153.640 210.963 1.00 370.00 ? 368  TRP B CG  1 
ATOM 6575  C CD1 . TRP B 2  368  ? 236.668 152.402 211.445 1.00 370.00 ? 368  TRP B CD1 1 
ATOM 6576  C CD2 . TRP B 2  368  ? 236.981 153.690 209.657 1.00 370.00 ? 368  TRP B CD2 1 
ATOM 6577  N NE1 . TRP B 2  368  ? 237.366 151.668 210.519 1.00 370.00 ? 368  TRP B NE1 1 
ATOM 6578  C CE2 . TRP B 2  368  ? 237.567 152.442 209.409 1.00 370.00 ? 368  TRP B CE2 1 
ATOM 6579  C CE3 . TRP B 2  368  ? 237.051 154.670 208.673 1.00 370.00 ? 368  TRP B CE3 1 
ATOM 6580  C CZ2 . TRP B 2  368  ? 238.219 152.153 208.221 1.00 370.00 ? 368  TRP B CZ2 1 
ATOM 6581  C CZ3 . TRP B 2  368  ? 237.685 154.379 207.495 1.00 370.00 ? 368  TRP B CZ3 1 
ATOM 6582  C CH2 . TRP B 2  368  ? 238.264 153.135 207.275 1.00 370.00 ? 368  TRP B CH2 1 
ATOM 6583  N N   . VAL B 2  369  ? 233.850 153.956 209.113 1.00 370.00 ? 369  VAL B N   1 
ATOM 6584  C CA  . VAL B 2  369  ? 233.451 154.083 207.725 1.00 370.00 ? 369  VAL B CA  1 
ATOM 6585  C C   . VAL B 2  369  ? 232.091 154.746 207.610 1.00 370.00 ? 369  VAL B C   1 
ATOM 6586  O O   . VAL B 2  369  ? 231.863 155.555 206.706 1.00 370.00 ? 369  VAL B O   1 
ATOM 6587  C CB  . VAL B 2  369  ? 233.451 152.692 207.094 1.00 370.00 ? 369  VAL B CB  1 
ATOM 6588  C CG1 . VAL B 2  369  ? 232.954 152.747 205.705 1.00 370.00 ? 369  VAL B CG1 1 
ATOM 6589  C CG2 . VAL B 2  369  ? 234.824 152.143 207.135 1.00 370.00 ? 369  VAL B CG2 1 
ATOM 6590  N N   . LEU B 2  370  ? 231.175 154.419 208.527 1.00 370.00 ? 370  LEU B N   1 
ATOM 6591  C CA  . LEU B 2  370  ? 229.832 154.996 208.514 1.00 370.00 ? 370  LEU B CA  1 
ATOM 6592  C C   . LEU B 2  370  ? 229.872 156.504 208.633 1.00 370.00 ? 370  LEU B C   1 
ATOM 6593  O O   . LEU B 2  370  ? 229.393 157.230 207.751 1.00 370.00 ? 370  LEU B O   1 
ATOM 6594  C CB  . LEU B 2  370  ? 228.996 154.440 209.659 1.00 370.00 ? 370  LEU B CB  1 
ATOM 6595  C CG  . LEU B 2  370  ? 228.414 153.052 209.487 1.00 370.00 ? 370  LEU B CG  1 
ATOM 6596  C CD1 . LEU B 2  370  ? 227.745 152.556 210.763 1.00 370.00 ? 370  LEU B CD1 1 
ATOM 6597  C CD2 . LEU B 2  370  ? 227.400 153.197 208.409 1.00 370.00 ? 370  LEU B CD2 1 
ATOM 6598  N N   . LYS B 2  371  ? 230.458 156.990 209.717 1.00 370.00 ? 371  LYS B N   1 
ATOM 6599  C CA  . LYS B 2  371  ? 230.500 158.421 209.928 1.00 370.00 ? 371  LYS B CA  1 
ATOM 6600  C C   . LYS B 2  371  ? 231.447 159.092 208.961 1.00 370.00 ? 371  LYS B C   1 
ATOM 6601  O O   . LYS B 2  371  ? 231.208 160.242 208.581 1.00 370.00 ? 371  LYS B O   1 
ATOM 6602  C CB  . LYS B 2  371  ? 230.836 158.695 211.379 1.00 370.00 ? 371  LYS B CB  1 
ATOM 6603  C CG  . LYS B 2  371  ? 229.606 158.416 212.181 1.00 370.00 ? 371  LYS B CG  1 
ATOM 6604  C CD  . LYS B 2  371  ? 229.791 158.418 213.653 1.00 370.00 ? 371  LYS B CD  1 
ATOM 6605  C CE  . LYS B 2  371  ? 228.440 158.109 214.235 1.00 370.00 ? 371  LYS B CE  1 
ATOM 6606  N NZ  . LYS B 2  371  ? 228.471 157.739 215.652 1.00 370.00 ? 371  LYS B NZ  1 
ATOM 6607  N N   . GLY B 2  372  ? 232.448 158.359 208.488 1.00 370.00 ? 372  GLY B N   1 
ATOM 6608  C CA  . GLY B 2  372  ? 233.278 158.765 207.382 1.00 370.00 ? 372  GLY B CA  1 
ATOM 6609  C C   . GLY B 2  372  ? 232.496 159.172 206.174 1.00 370.00 ? 372  GLY B C   1 
ATOM 6610  O O   . GLY B 2  372  ? 232.517 160.338 205.771 1.00 370.00 ? 372  GLY B O   1 
ATOM 6611  N N   . ILE B 2  373  ? 231.765 158.215 205.630 1.00 370.00 ? 373  ILE B N   1 
ATOM 6612  C CA  . ILE B 2  373  ? 231.114 158.467 204.370 1.00 370.00 ? 373  ILE B CA  1 
ATOM 6613  C C   . ILE B 2  373  ? 229.956 159.422 204.559 1.00 370.00 ? 373  ILE B C   1 
ATOM 6614  O O   . ILE B 2  373  ? 229.734 160.281 203.711 1.00 370.00 ? 373  ILE B O   1 
ATOM 6615  C CB  . ILE B 2  373  ? 230.711 157.138 203.729 1.00 370.00 ? 373  ILE B CB  1 
ATOM 6616  C CG1 . ILE B 2  373  ? 231.964 156.303 203.536 1.00 370.00 ? 373  ILE B CG1 1 
ATOM 6617  C CG2 . ILE B 2  373  ? 230.174 157.367 202.370 1.00 370.00 ? 373  ILE B CG2 1 
ATOM 6618  C CD1 . ILE B 2  373  ? 231.694 154.925 203.043 1.00 370.00 ? 373  ILE B CD1 1 
ATOM 6619  N N   . SER B 2  374  ? 229.290 159.384 205.716 1.00 370.00 ? 374  SER B N   1 
ATOM 6620  C CA  . SER B 2  374  ? 228.159 160.280 205.947 1.00 370.00 ? 374  SER B CA  1 
ATOM 6621  C C   . SER B 2  374  ? 228.603 161.731 206.025 1.00 370.00 ? 374  SER B C   1 
ATOM 6622  O O   . SER B 2  374  ? 228.093 162.594 205.290 1.00 370.00 ? 374  SER B O   1 
ATOM 6623  C CB  . SER B 2  374  ? 227.461 159.908 207.241 1.00 370.00 ? 374  SER B CB  1 
ATOM 6624  O OG  . SER B 2  374  ? 228.303 160.269 208.311 1.00 370.00 ? 374  SER B OG  1 
ATOM 6625  N N   . GLY B 2  375  ? 229.559 162.018 206.905 1.00 370.00 ? 375  GLY B N   1 
ATOM 6626  C CA  . GLY B 2  375  ? 230.043 163.371 207.008 1.00 370.00 ? 375  GLY B CA  1 
ATOM 6627  C C   . GLY B 2  375  ? 230.743 163.849 205.758 1.00 370.00 ? 375  GLY B C   1 
ATOM 6628  O O   . GLY B 2  375  ? 230.595 165.010 205.374 1.00 370.00 ? 375  GLY B O   1 
ATOM 6629  N N   . TYR B 2  376  ? 231.460 162.957 205.079 1.00 370.00 ? 376  TYR B N   1 
ATOM 6630  C CA  . TYR B 2  376  ? 232.106 163.339 203.838 1.00 370.00 ? 376  TYR B CA  1 
ATOM 6631  C C   . TYR B 2  376  ? 231.096 163.672 202.764 1.00 370.00 ? 376  TYR B C   1 
ATOM 6632  O O   . TYR B 2  376  ? 231.312 164.586 201.962 1.00 370.00 ? 376  TYR B O   1 
ATOM 6633  C CB  . TYR B 2  376  ? 233.006 162.221 203.366 1.00 370.00 ? 376  TYR B CB  1 
ATOM 6634  C CG  . TYR B 2  376  ? 233.441 162.446 201.968 1.00 370.00 ? 376  TYR B CG  1 
ATOM 6635  C CD1 . TYR B 2  376  ? 234.297 163.480 201.662 1.00 370.00 ? 376  TYR B CD1 1 
ATOM 6636  C CD2 . TYR B 2  376  ? 232.977 161.643 200.946 1.00 370.00 ? 376  TYR B CD2 1 
ATOM 6637  C CE1 . TYR B 2  376  ? 234.681 163.703 200.384 1.00 370.00 ? 376  TYR B CE1 1 
ATOM 6638  C CE2 . TYR B 2  376  ? 233.359 161.860 199.671 1.00 370.00 ? 376  TYR B CE2 1 
ATOM 6639  C CZ  . TYR B 2  376  ? 234.211 162.889 199.388 1.00 370.00 ? 376  TYR B CZ  1 
ATOM 6640  O OH  . TYR B 2  376  ? 234.595 163.094 198.093 1.00 370.00 ? 376  TYR B OH  1 
ATOM 6641  N N   . ILE B 2  377  ? 230.001 162.928 202.722 1.00 370.00 ? 377  ILE B N   1 
ATOM 6642  C CA  . ILE B 2  377  ? 228.961 163.215 201.756 1.00 370.00 ? 377  ILE B CA  1 
ATOM 6643  C C   . ILE B 2  377  ? 228.345 164.572 202.019 1.00 370.00 ? 377  ILE B C   1 
ATOM 6644  O O   . ILE B 2  377  ? 228.112 165.348 201.081 1.00 370.00 ? 377  ILE B O   1 
ATOM 6645  C CB  . ILE B 2  377  ? 227.927 162.084 201.759 1.00 370.00 ? 377  ILE B CB  1 
ATOM 6646  C CG1 . ILE B 2  377  ? 228.437 160.945 200.887 1.00 370.00 ? 377  ILE B CG1 1 
ATOM 6647  C CG2 . ILE B 2  377  ? 226.576 162.553 201.297 1.00 370.00 ? 377  ILE B CG2 1 
ATOM 6648  C CD1 . ILE B 2  377  ? 227.642 159.688 201.030 1.00 370.00 ? 377  ILE B CD1 1 
ATOM 6649  N N   . TYR B 2  378  ? 228.151 164.935 203.284 1.00 370.00 ? 378  TYR B N   1 
ATOM 6650  C CA  . TYR B 2  378  ? 227.592 166.273 203.387 1.00 370.00 ? 378  TYR B CA  1 
ATOM 6651  C C   . TYR B 2  378  ? 228.677 167.328 203.271 1.00 370.00 ? 378  TYR B C   1 
ATOM 6652  O O   . TYR B 2  378  ? 228.367 168.494 203.018 1.00 370.00 ? 378  TYR B O   1 
ATOM 6653  C CB  . TYR B 2  378  ? 226.756 166.474 204.642 1.00 370.00 ? 378  TYR B CB  1 
ATOM 6654  C CG  . TYR B 2  378  ? 227.396 167.094 205.831 1.00 370.00 ? 378  TYR B CG  1 
ATOM 6655  C CD1 . TYR B 2  378  ? 228.039 166.336 206.755 1.00 370.00 ? 378  TYR B CD1 1 
ATOM 6656  C CD2 . TYR B 2  378  ? 227.263 168.449 206.071 1.00 370.00 ? 378  TYR B CD2 1 
ATOM 6657  C CE1 . TYR B 2  378  ? 228.580 166.909 207.861 1.00 370.00 ? 378  TYR B CE1 1 
ATOM 6658  C CE2 . TYR B 2  378  ? 227.796 169.029 207.168 1.00 370.00 ? 378  TYR B CE2 1 
ATOM 6659  C CZ  . TYR B 2  378  ? 228.452 168.251 208.060 1.00 370.00 ? 378  TYR B CZ  1 
ATOM 6660  O OH  . TYR B 2  378  ? 228.996 168.780 209.187 1.00 370.00 ? 378  TYR B OH  1 
ATOM 6661  N N   . GLY B 2  379  ? 229.938 166.932 203.357 1.00 370.00 ? 379  GLY B N   1 
ATOM 6662  C CA  . GLY B 2  379  ? 230.988 167.810 202.883 1.00 370.00 ? 379  GLY B CA  1 
ATOM 6663  C C   . GLY B 2  379  ? 230.884 168.058 201.393 1.00 370.00 ? 379  GLY B C   1 
ATOM 6664  O O   . GLY B 2  379  ? 231.045 169.188 200.924 1.00 370.00 ? 379  GLY B O   1 
ATOM 6665  N N   . LEU B 2  380  ? 230.584 167.006 200.638 1.00 370.00 ? 380  LEU B N   1 
ATOM 6666  C CA  . LEU B 2  380  ? 230.375 167.141 199.204 1.00 370.00 ? 380  LEU B CA  1 
ATOM 6667  C C   . LEU B 2  380  ? 229.194 168.022 198.917 1.00 370.00 ? 380  LEU B C   1 
ATOM 6668  O O   . LEU B 2  380  ? 229.176 168.740 197.915 1.00 370.00 ? 380  LEU B O   1 
ATOM 6669  C CB  . LEU B 2  380  ? 230.126 165.788 198.567 1.00 370.00 ? 380  LEU B CB  1 
ATOM 6670  C CG  . LEU B 2  380  ? 231.291 164.833 198.536 1.00 370.00 ? 380  LEU B CG  1 
ATOM 6671  C CD1 . LEU B 2  380  ? 230.802 163.562 197.924 1.00 370.00 ? 380  LEU B CD1 1 
ATOM 6672  C CD2 . LEU B 2  380  ? 232.370 165.454 197.699 1.00 370.00 ? 380  LEU B CD2 1 
ATOM 6673  N N   . TRP B 2  381  ? 228.199 167.956 199.782 1.00 370.00 ? 381  TRP B N   1 
ATOM 6674  C CA  . TRP B 2  381  ? 227.093 168.885 199.704 1.00 370.00 ? 381  TRP B CA  1 
ATOM 6675  C C   . TRP B 2  381  ? 227.559 170.305 199.912 1.00 370.00 ? 381  TRP B C   1 
ATOM 6676  O O   . TRP B 2  381  ? 227.188 171.207 199.157 1.00 370.00 ? 381  TRP B O   1 
ATOM 6677  C CB  . TRP B 2  381  ? 226.053 168.509 200.725 1.00 370.00 ? 381  TRP B CB  1 
ATOM 6678  C CG  . TRP B 2  381  ? 225.038 169.482 200.768 1.00 370.00 ? 381  TRP B CG  1 
ATOM 6679  C CD1 . TRP B 2  381  ? 224.080 169.693 199.855 1.00 370.00 ? 381  TRP B CD1 1 
ATOM 6680  C CD2 . TRP B 2  381  ? 224.883 170.462 201.766 1.00 370.00 ? 381  TRP B CD2 1 
ATOM 6681  N NE1 . TRP B 2  381  ? 223.300 170.753 200.232 1.00 370.00 ? 381  TRP B NE1 1 
ATOM 6682  C CE2 . TRP B 2  381  ? 223.782 171.243 201.413 1.00 370.00 ? 381  TRP B CE2 1 
ATOM 6683  C CE3 . TRP B 2  381  ? 225.572 170.752 202.929 1.00 370.00 ? 381  TRP B CE3 1 
ATOM 6684  C CZ2 . TRP B 2  381  ? 223.346 172.291 202.188 1.00 370.00 ? 381  TRP B CZ2 1 
ATOM 6685  C CZ3 . TRP B 2  381  ? 225.146 171.778 203.696 1.00 370.00 ? 381  TRP B CZ3 1 
ATOM 6686  C CH2 . TRP B 2  381  ? 224.040 172.544 203.330 1.00 370.00 ? 381  TRP B CH2 1 
ATOM 6687  N N   . MET B 2  382  ? 228.390 170.514 200.924 1.00 370.00 ? 382  MET B N   1 
ATOM 6688  C CA  . MET B 2  382  ? 228.887 171.849 201.196 1.00 370.00 ? 382  MET B CA  1 
ATOM 6689  C C   . MET B 2  382  ? 229.755 172.397 200.081 1.00 370.00 ? 382  MET B C   1 
ATOM 6690  O O   . MET B 2  382  ? 229.879 173.618 199.978 1.00 370.00 ? 382  MET B O   1 
ATOM 6691  C CB  . MET B 2  382  ? 229.669 171.885 202.497 1.00 370.00 ? 382  MET B CB  1 
ATOM 6692  C CG  . MET B 2  382  ? 228.809 171.854 203.716 1.00 370.00 ? 382  MET B CG  1 
ATOM 6693  S SD  . MET B 2  382  ? 229.797 171.892 205.204 1.00 370.00 ? 382  MET B SD  1 
ATOM 6694  C CE  . MET B 2  382  ? 230.486 173.528 205.055 1.00 370.00 ? 382  MET B CE  1 
ATOM 6695  N N   . LYS B 2  383  ? 230.366 171.537 199.267 1.00 370.00 ? 383  LYS B N   1 
ATOM 6696  C CA  . LYS B 2  383  ? 230.985 172.021 198.039 1.00 370.00 ? 383  LYS B CA  1 
ATOM 6697  C C   . LYS B 2  383  ? 229.946 172.694 197.174 1.00 370.00 ? 383  LYS B C   1 
ATOM 6698  O O   . LYS B 2  383  ? 229.955 173.911 196.990 1.00 370.00 ? 383  LYS B O   1 
ATOM 6699  C CB  . LYS B 2  383  ? 231.595 170.899 197.202 1.00 370.00 ? 383  LYS B CB  1 
ATOM 6700  C CG  . LYS B 2  383  ? 232.892 170.324 197.650 1.00 370.00 ? 383  LYS B CG  1 
ATOM 6701  C CD  . LYS B 2  383  ? 233.302 169.277 196.645 1.00 370.00 ? 383  LYS B CD  1 
ATOM 6702  C CE  . LYS B 2  383  ? 234.611 168.635 197.011 1.00 370.00 ? 383  LYS B CE  1 
ATOM 6703  N NZ  . LYS B 2  383  ? 235.003 167.584 196.038 1.00 370.00 ? 383  LYS B NZ  1 
ATOM 6704  N N   . LYS B 2  384  ? 228.997 171.903 196.711 1.00 370.00 ? 384  LYS B N   1 
ATOM 6705  C CA  . LYS B 2  384  ? 228.116 172.337 195.647 1.00 370.00 ? 384  LYS B CA  1 
ATOM 6706  C C   . LYS B 2  384  ? 226.842 172.923 196.180 1.00 370.00 ? 384  LYS B C   1 
ATOM 6707  O O   . LYS B 2  384  ? 225.785 172.773 195.563 1.00 370.00 ? 384  LYS B O   1 
ATOM 6708  C CB  . LYS B 2  384  ? 227.823 171.175 194.704 1.00 370.00 ? 384  LYS B CB  1 
ATOM 6709  C CG  . LYS B 2  384  ? 229.054 170.591 194.034 1.00 370.00 ? 384  LYS B CG  1 
ATOM 6710  C CD  . LYS B 2  384  ? 229.642 171.553 193.020 1.00 370.00 ? 384  LYS B CD  1 
ATOM 6711  C CE  . LYS B 2  384  ? 230.821 170.926 192.301 1.00 370.00 ? 384  LYS B CE  1 
ATOM 6712  N NZ  . LYS B 2  384  ? 231.429 171.838 191.295 1.00 370.00 ? 384  LYS B NZ  1 
ATOM 6713  N N   . THR B 2  385  ? 226.896 173.548 197.337 1.00 370.00 ? 385  THR B N   1 
ATOM 6714  C CA  . THR B 2  385  ? 225.759 174.337 197.758 1.00 370.00 ? 385  THR B CA  1 
ATOM 6715  C C   . THR B 2  385  ? 226.147 175.776 198.005 1.00 370.00 ? 385  THR B C   1 
ATOM 6716  O O   . THR B 2  385  ? 225.451 176.686 197.543 1.00 370.00 ? 385  THR B O   1 
ATOM 6717  C CB  . THR B 2  385  ? 225.153 173.732 199.008 1.00 370.00 ? 385  THR B CB  1 
ATOM 6718  O OG1 . THR B 2  385  ? 225.029 172.331 198.785 1.00 370.00 ? 385  THR B OG1 1 
ATOM 6719  C CG2 . THR B 2  385  ? 223.773 174.307 199.246 1.00 370.00 ? 385  THR B CG2 1 
ATOM 6720  N N   . PHE B 2  386  ? 227.276 175.993 198.668 1.00 370.00 ? 386  PHE B N   1 
ATOM 6721  C CA  . PHE B 2  386  ? 227.734 177.334 198.986 1.00 370.00 ? 386  PHE B CA  1 
ATOM 6722  C C   . PHE B 2  386  ? 229.173 177.264 199.450 1.00 370.00 ? 386  PHE B C   1 
ATOM 6723  O O   . PHE B 2  386  ? 229.508 176.434 200.293 1.00 370.00 ? 386  PHE B O   1 
ATOM 6724  C CB  . PHE B 2  386  ? 226.853 177.996 200.052 1.00 370.00 ? 386  PHE B CB  1 
ATOM 6725  C CG  . PHE B 2  386  ? 226.727 177.225 201.319 1.00 370.00 ? 386  PHE B CG  1 
ATOM 6726  C CD1 . PHE B 2  386  ? 225.777 176.246 201.445 1.00 370.00 ? 386  PHE B CD1 1 
ATOM 6727  C CD2 . PHE B 2  386  ? 227.495 177.537 202.411 1.00 370.00 ? 386  PHE B CD2 1 
ATOM 6728  C CE1 . PHE B 2  386  ? 225.640 175.547 202.598 1.00 370.00 ? 386  PHE B CE1 1 
ATOM 6729  C CE2 . PHE B 2  386  ? 227.355 176.842 203.577 1.00 370.00 ? 386  PHE B CE2 1 
ATOM 6730  C CZ  . PHE B 2  386  ? 226.423 175.846 203.670 1.00 370.00 ? 386  PHE B CZ  1 
ATOM 6731  N N   . GLY B 2  387  ? 230.014 178.121 198.888 1.00 370.00 ? 387  GLY B N   1 
ATOM 6732  C CA  . GLY B 2  387  ? 231.320 178.334 199.462 1.00 370.00 ? 387  GLY B CA  1 
ATOM 6733  C C   . GLY B 2  387  ? 232.284 177.183 199.347 1.00 370.00 ? 387  GLY B C   1 
ATOM 6734  O O   . GLY B 2  387  ? 232.562 176.518 200.345 1.00 370.00 ? 387  GLY B O   1 
ATOM 6735  N N   . VAL B 2  388  ? 232.771 176.916 198.134 1.00 370.00 ? 388  VAL B N   1 
ATOM 6736  C CA  . VAL B 2  388  ? 233.881 175.988 197.959 1.00 370.00 ? 388  VAL B CA  1 
ATOM 6737  C C   . VAL B 2  388  ? 235.105 176.491 198.700 1.00 370.00 ? 388  VAL B C   1 
ATOM 6738  O O   . VAL B 2  388  ? 235.885 175.713 199.268 1.00 370.00 ? 388  VAL B O   1 
ATOM 6739  C CB  . VAL B 2  388  ? 234.151 175.816 196.462 1.00 370.00 ? 388  VAL B CB  1 
ATOM 6740  C CG1 . VAL B 2  388  ? 235.243 174.807 196.228 1.00 370.00 ? 388  VAL B CG1 1 
ATOM 6741  C CG2 . VAL B 2  388  ? 232.881 175.413 195.781 1.00 370.00 ? 388  VAL B CG2 1 
ATOM 6742  N N   . ASN B 2  389  ? 235.267 177.799 198.758 1.00 370.00 ? 389  ASN B N   1 
ATOM 6743  C CA  . ASN B 2  389  ? 236.277 178.336 199.640 1.00 370.00 ? 389  ASN B CA  1 
ATOM 6744  C C   . ASN B 2  389  ? 235.857 178.197 201.097 1.00 370.00 ? 389  ASN B C   1 
ATOM 6745  O O   . ASN B 2  389  ? 236.697 177.906 201.952 1.00 370.00 ? 389  ASN B O   1 
ATOM 6746  C CB  . ASN B 2  389  ? 236.542 179.771 199.256 1.00 370.00 ? 389  ASN B CB  1 
ATOM 6747  C CG  . ASN B 2  389  ? 236.918 179.885 197.814 1.00 370.00 ? 389  ASN B CG  1 
ATOM 6748  O OD1 . ASN B 2  389  ? 237.636 179.038 197.296 1.00 370.00 ? 389  ASN B OD1 1 
ATOM 6749  N ND2 . ASN B 2  389  ? 236.409 180.909 197.137 1.00 370.00 ? 389  ASN B ND2 1 
ATOM 6750  N N   . GLU B 2  390  ? 234.562 178.349 201.406 1.00 370.00 ? 390  GLU B N   1 
ATOM 6751  C CA  . GLU B 2  390  ? 234.148 178.054 202.776 1.00 370.00 ? 390  GLU B CA  1 
ATOM 6752  C C   . GLU B 2  390  ? 234.163 176.569 203.064 1.00 370.00 ? 390  GLU B C   1 
ATOM 6753  O O   . GLU B 2  390  ? 234.301 176.181 204.224 1.00 370.00 ? 390  GLU B O   1 
ATOM 6754  C CB  . GLU B 2  390  ? 232.763 178.604 203.114 1.00 370.00 ? 390  GLU B CB  1 
ATOM 6755  C CG  . GLU B 2  390  ? 232.769 180.103 203.332 1.00 370.00 ? 390  GLU B CG  1 
ATOM 6756  C CD  . GLU B 2  390  ? 231.604 180.619 204.164 1.00 370.00 ? 390  GLU B CD  1 
ATOM 6757  O OE1 . GLU B 2  390  ? 230.701 179.822 204.484 1.00 370.00 ? 390  GLU B OE1 1 
ATOM 6758  O OE2 . GLU B 2  390  ? 231.616 181.818 204.533 1.00 370.00 ? 390  GLU B OE2 1 
ATOM 6759  N N   . TYR B 2  391  ? 234.045 175.742 202.035 1.00 370.00 ? 391  TYR B N   1 
ATOM 6760  C CA  . TYR B 2  391  ? 234.311 174.321 202.176 1.00 370.00 ? 391  TYR B CA  1 
ATOM 6761  C C   . TYR B 2  391  ? 235.729 174.075 202.654 1.00 370.00 ? 391  TYR B C   1 
ATOM 6762  O O   . TYR B 2  391  ? 235.945 173.387 203.658 1.00 370.00 ? 391  TYR B O   1 
ATOM 6763  C CB  . TYR B 2  391  ? 234.059 173.663 200.836 1.00 370.00 ? 391  TYR B CB  1 
ATOM 6764  C CG  . TYR B 2  391  ? 234.529 172.274 200.669 1.00 370.00 ? 391  TYR B CG  1 
ATOM 6765  C CD1 . TYR B 2  391  ? 233.795 171.223 201.155 1.00 370.00 ? 391  TYR B CD1 1 
ATOM 6766  C CD2 . TYR B 2  391  ? 235.693 172.009 199.973 1.00 370.00 ? 391  TYR B CD2 1 
ATOM 6767  C CE1 . TYR B 2  391  ? 234.206 169.942 200.973 1.00 370.00 ? 391  TYR B CE1 1 
ATOM 6768  C CE2 . TYR B 2  391  ? 236.117 170.734 199.788 1.00 370.00 ? 391  TYR B CE2 1 
ATOM 6769  C CZ  . TYR B 2  391  ? 235.364 169.706 200.294 1.00 370.00 ? 391  TYR B CZ  1 
ATOM 6770  O OH  . TYR B 2  391  ? 235.776 168.416 200.114 1.00 370.00 ? 391  TYR B OH  1 
ATOM 6771  N N   . ARG B 2  392  ? 236.705 174.661 201.961 1.00 370.00 ? 392  ARG B N   1 
ATOM 6772  C CA  . ARG B 2  392  ? 238.101 174.514 202.364 1.00 370.00 ? 392  ARG B CA  1 
ATOM 6773  C C   . ARG B 2  392  ? 238.356 175.110 203.743 1.00 370.00 ? 392  ARG B C   1 
ATOM 6774  O O   . ARG B 2  392  ? 239.132 174.555 204.536 1.00 370.00 ? 392  ARG B O   1 
ATOM 6775  C CB  . ARG B 2  392  ? 239.006 175.164 201.321 1.00 370.00 ? 392  ARG B CB  1 
ATOM 6776  C CG  . ARG B 2  392  ? 238.919 174.493 199.977 1.00 370.00 ? 392  ARG B CG  1 
ATOM 6777  C CD  . ARG B 2  392  ? 239.557 173.135 200.056 1.00 370.00 ? 392  ARG B CD  1 
ATOM 6778  N NE  . ARG B 2  392  ? 239.333 172.341 198.855 1.00 370.00 ? 392  ARG B NE  1 
ATOM 6779  C CZ  . ARG B 2  392  ? 239.717 171.076 198.721 1.00 370.00 ? 392  ARG B CZ  1 
ATOM 6780  N NH1 . ARG B 2  392  ? 240.358 170.473 199.714 1.00 370.00 ? 392  ARG B NH1 1 
ATOM 6781  N NH2 . ARG B 2  392  ? 239.467 170.413 197.597 1.00 370.00 ? 392  ARG B NH2 1 
ATOM 6782  N N   . HIS B 2  393  ? 237.695 176.229 204.046 1.00 370.00 ? 393  HIS B N   1 
ATOM 6783  C CA  . HIS B 2  393  ? 237.741 176.811 205.382 1.00 370.00 ? 393  HIS B CA  1 
ATOM 6784  C C   . HIS B 2  393  ? 237.237 175.839 206.429 1.00 370.00 ? 393  HIS B C   1 
ATOM 6785  O O   . HIS B 2  393  ? 237.813 175.729 207.522 1.00 370.00 ? 393  HIS B O   1 
ATOM 6786  C CB  . HIS B 2  393  ? 236.903 178.078 205.424 1.00 370.00 ? 393  HIS B CB  1 
ATOM 6787  C CG  . HIS B 2  393  ? 236.627 178.550 206.809 1.00 370.00 ? 393  HIS B CG  1 
ATOM 6788  N ND1 . HIS B 2  393  ? 237.577 179.172 207.585 1.00 370.00 ? 393  HIS B ND1 1 
ATOM 6789  C CD2 . HIS B 2  393  ? 235.517 178.454 207.575 1.00 370.00 ? 393  HIS B CD2 1 
ATOM 6790  C CE1 . HIS B 2  393  ? 237.057 179.461 208.764 1.00 370.00 ? 393  HIS B CE1 1 
ATOM 6791  N NE2 . HIS B 2  393  ? 235.807 179.036 208.783 1.00 370.00 ? 393  HIS B NE2 1 
ATOM 6792  N N   . TRP B 2  394  ? 236.167 175.123 206.103 1.00 370.00 ? 394  TRP B N   1 
ATOM 6793  C CA  . TRP B 2  394  ? 235.628 174.143 207.023 1.00 370.00 ? 394  TRP B CA  1 
ATOM 6794  C C   . TRP B 2  394  ? 236.618 173.023 207.252 1.00 370.00 ? 394  TRP B C   1 
ATOM 6795  O O   . TRP B 2  394  ? 236.773 172.551 208.381 1.00 370.00 ? 394  TRP B O   1 
ATOM 6796  C CB  . TRP B 2  394  ? 234.324 173.591 206.486 1.00 370.00 ? 394  TRP B CB  1 
ATOM 6797  C CG  . TRP B 2  394  ? 233.789 172.599 207.377 1.00 370.00 ? 394  TRP B CG  1 
ATOM 6798  C CD1 . TRP B 2  394  ? 233.364 172.802 208.637 1.00 370.00 ? 394  TRP B CD1 1 
ATOM 6799  C CD2 . TRP B 2  394  ? 233.642 171.210 207.116 1.00 370.00 ? 394  TRP B CD2 1 
ATOM 6800  N NE1 . TRP B 2  394  ? 232.942 171.625 209.185 1.00 370.00 ? 394  TRP B NE1 1 
ATOM 6801  C CE2 . TRP B 2  394  ? 233.100 170.629 208.262 1.00 370.00 ? 394  TRP B CE2 1 
ATOM 6802  C CE3 . TRP B 2  394  ? 233.909 170.402 206.017 1.00 370.00 ? 394  TRP B CE3 1 
ATOM 6803  C CZ2 . TRP B 2  394  ? 232.819 169.281 208.345 1.00 370.00 ? 394  TRP B CZ2 1 
ATOM 6804  C CZ3 . TRP B 2  394  ? 233.635 169.069 206.104 1.00 370.00 ? 394  TRP B CZ3 1 
ATOM 6805  C CH2 . TRP B 2  394  ? 233.096 168.519 207.255 1.00 370.00 ? 394  TRP B CH2 1 
ATOM 6806  N N   . ILE B 2  395  ? 237.339 172.635 206.202 1.00 370.00 ? 395  ILE B N   1 
ATOM 6807  C CA  . ILE B 2  395  ? 238.355 171.598 206.354 1.00 370.00 ? 395  ILE B CA  1 
ATOM 6808  C C   . ILE B 2  395  ? 239.464 172.079 207.269 1.00 370.00 ? 395  ILE B C   1 
ATOM 6809  O O   . ILE B 2  395  ? 240.000 171.313 208.082 1.00 370.00 ? 395  ILE B O   1 
ATOM 6810  C CB  . ILE B 2  395  ? 238.928 171.196 204.993 1.00 370.00 ? 395  ILE B CB  1 
ATOM 6811  C CG1 . ILE B 2  395  ? 237.832 170.871 204.026 1.00 370.00 ? 395  ILE B CG1 1 
ATOM 6812  C CG2 . ILE B 2  395  ? 239.693 169.925 205.116 1.00 370.00 ? 395  ILE B CG2 1 
ATOM 6813  C CD1 . ILE B 2  395  ? 238.339 170.827 202.629 1.00 370.00 ? 395  ILE B CD1 1 
ATOM 6814  N N   . LYS B 2  396  ? 239.827 173.353 207.148 1.00 370.00 ? 396  LYS B N   1 
ATOM 6815  C CA  . LYS B 2  396  ? 240.866 173.876 208.021 1.00 370.00 ? 396  LYS B CA  1 
ATOM 6816  C C   . LYS B 2  396  ? 240.424 173.877 209.465 1.00 370.00 ? 396  LYS B C   1 
ATOM 6817  O O   . LYS B 2  396  ? 241.217 173.561 210.353 1.00 370.00 ? 396  LYS B O   1 
ATOM 6818  C CB  . LYS B 2  396  ? 241.280 175.276 207.632 1.00 370.00 ? 396  LYS B CB  1 
ATOM 6819  C CG  . LYS B 2  396  ? 242.194 175.322 206.484 1.00 370.00 ? 396  LYS B CG  1 
ATOM 6820  C CD  . LYS B 2  396  ? 242.610 176.731 206.231 1.00 370.00 ? 396  LYS B CD  1 
ATOM 6821  C CE  . LYS B 2  396  ? 243.630 177.227 207.242 1.00 370.00 ? 396  LYS B CE  1 
ATOM 6822  N NZ  . LYS B 2  396  ? 244.203 178.540 206.828 1.00 370.00 ? 396  LYS B NZ  1 
ATOM 6823  N N   . GLU B 2  397  ? 239.156 174.185 209.718 1.00 370.00 ? 397  GLU B N   1 
ATOM 6824  C CA  . GLU B 2  397  ? 238.675 174.095 211.095 1.00 370.00 ? 397  GLU B CA  1 
ATOM 6825  C C   . GLU B 2  397  ? 238.642 172.660 211.592 1.00 370.00 ? 397  GLU B C   1 
ATOM 6826  O O   . GLU B 2  397  ? 238.797 172.417 212.798 1.00 370.00 ? 397  GLU B O   1 
ATOM 6827  C CB  . GLU B 2  397  ? 237.291 174.700 211.232 1.00 370.00 ? 397  GLU B CB  1 
ATOM 6828  C CG  . GLU B 2  397  ? 237.257 176.183 211.124 1.00 370.00 ? 397  GLU B CG  1 
ATOM 6829  C CD  . GLU B 2  397  ? 235.856 176.693 211.282 1.00 370.00 ? 397  GLU B CD  1 
ATOM 6830  O OE1 . GLU B 2  397  ? 234.951 175.847 211.445 1.00 370.00 ? 397  GLU B OE1 1 
ATOM 6831  O OE2 . GLU B 2  397  ? 235.655 177.925 211.220 1.00 370.00 ? 397  GLU B OE2 1 
ATOM 6832  N N   . GLU B 2  398  ? 238.417 171.712 210.689 1.00 370.00 ? 398  GLU B N   1 
ATOM 6833  C CA  . GLU B 2  398  ? 238.494 170.318 211.082 1.00 370.00 ? 398  GLU B CA  1 
ATOM 6834  C C   . GLU B 2  398  ? 239.884 169.989 211.576 1.00 370.00 ? 398  GLU B C   1 
ATOM 6835  O O   . GLU B 2  398  ? 240.044 169.428 212.667 1.00 370.00 ? 398  GLU B O   1 
ATOM 6836  C CB  . GLU B 2  398  ? 238.116 169.422 209.917 1.00 370.00 ? 398  GLU B CB  1 
ATOM 6837  C CG  . GLU B 2  398  ? 236.695 169.575 209.517 1.00 370.00 ? 398  GLU B CG  1 
ATOM 6838  C CD  . GLU B 2  398  ? 235.760 169.083 210.572 1.00 370.00 ? 398  GLU B CD  1 
ATOM 6839  O OE1 . GLU B 2  398  ? 236.070 168.053 211.185 1.00 370.00 ? 398  GLU B OE1 1 
ATOM 6840  O OE2 . GLU B 2  398  ? 234.732 169.740 210.813 1.00 370.00 ? 398  GLU B OE2 1 
ATOM 6841  N N   . LEU B 2  399  ? 240.901 170.390 210.809 1.00 370.00 ? 399  LEU B N   1 
ATOM 6842  C CA  . LEU B 2  399  ? 242.274 170.185 211.258 1.00 370.00 ? 399  LEU B CA  1 
ATOM 6843  C C   . LEU B 2  399  ? 242.571 170.930 212.535 1.00 370.00 ? 399  LEU B C   1 
ATOM 6844  O O   . LEU B 2  399  ? 243.365 170.453 213.342 1.00 370.00 ? 399  LEU B O   1 
ATOM 6845  C CB  . LEU B 2  399  ? 243.283 170.607 210.210 1.00 370.00 ? 399  LEU B CB  1 
ATOM 6846  C CG  . LEU B 2  399  ? 243.481 169.590 209.122 1.00 370.00 ? 399  LEU B CG  1 
ATOM 6847  C CD1 . LEU B 2  399  ? 244.552 170.121 208.237 1.00 370.00 ? 399  LEU B CD1 1 
ATOM 6848  C CD2 . LEU B 2  399  ? 243.903 168.296 209.758 1.00 370.00 ? 399  LEU B CD2 1 
ATOM 6849  N N   . ASP B 2  400  ? 241.922 172.073 212.741 1.00 370.00 ? 400  ASP B N   1 
ATOM 6850  C CA  . ASP B 2  400  ? 242.085 172.803 213.988 1.00 370.00 ? 400  ASP B CA  1 
ATOM 6851  C C   . ASP B 2  400  ? 241.623 171.962 215.159 1.00 370.00 ? 400  ASP B C   1 
ATOM 6852  O O   . ASP B 2  400  ? 242.382 171.746 216.114 1.00 370.00 ? 400  ASP B O   1 
ATOM 6853  C CB  . ASP B 2  400  ? 241.306 174.112 213.939 1.00 370.00 ? 400  ASP B CB  1 
ATOM 6854  C CG  . ASP B 2  400  ? 241.846 175.068 212.904 1.00 370.00 ? 400  ASP B CG  1 
ATOM 6855  O OD1 . ASP B 2  400  ? 243.051 174.969 212.586 1.00 370.00 ? 400  ASP B OD1 1 
ATOM 6856  O OD2 . ASP B 2  400  ? 241.068 175.907 212.395 1.00 370.00 ? 400  ASP B OD2 1 
ATOM 6857  N N   . LYS B 2  401  ? 240.409 171.423 215.054 1.00 370.00 ? 401  LYS B N   1 
ATOM 6858  C CA  . LYS B 2  401  ? 239.870 170.559 216.095 1.00 370.00 ? 401  LYS B CA  1 
ATOM 6859  C C   . LYS B 2  401  ? 240.738 169.337 216.331 1.00 370.00 ? 401  LYS B C   1 
ATOM 6860  O O   . LYS B 2  401  ? 241.074 169.022 217.477 1.00 370.00 ? 401  LYS B O   1 
ATOM 6861  C CB  . LYS B 2  401  ? 238.470 170.117 215.728 1.00 370.00 ? 401  LYS B CB  1 
ATOM 6862  C CG  . LYS B 2  401  ? 237.387 171.101 215.997 1.00 370.00 ? 401  LYS B CG  1 
ATOM 6863  C CD  . LYS B 2  401  ? 236.075 170.439 215.676 1.00 370.00 ? 401  LYS B CD  1 
ATOM 6864  C CE  . LYS B 2  401  ? 234.904 171.318 215.953 1.00 370.00 ? 401  LYS B CE  1 
ATOM 6865  N NZ  . LYS B 2  401  ? 233.691 170.550 215.600 1.00 370.00 ? 401  LYS B NZ  1 
ATOM 6866  N N   . ILE B 2  402  ? 241.170 168.682 215.256 1.00 370.00 ? 402  ILE B N   1 
ATOM 6867  C CA  . ILE B 2  402  ? 241.874 167.411 215.392 1.00 370.00 ? 402  ILE B CA  1 
ATOM 6868  C C   . ILE B 2  402  ? 243.269 167.612 215.959 1.00 370.00 ? 402  ILE B C   1 
ATOM 6869  O O   . ILE B 2  402  ? 243.679 166.902 216.887 1.00 370.00 ? 402  ILE B O   1 
ATOM 6870  C CB  . ILE B 2  402  ? 241.910 166.674 214.050 1.00 370.00 ? 402  ILE B CB  1 
ATOM 6871  C CG1 . ILE B 2  402  ? 240.560 166.042 213.808 1.00 370.00 ? 402  ILE B CG1 1 
ATOM 6872  C CG2 . ILE B 2  402  ? 242.984 165.634 214.014 1.00 370.00 ? 402  ILE B CG2 1 
ATOM 6873  C CD1 . ILE B 2  402  ? 240.474 165.386 212.502 1.00 370.00 ? 402  ILE B CD1 1 
ATOM 6874  N N   . VAL B 2  403  ? 244.020 168.561 215.397 1.00 370.00 ? 403  VAL B N   1 
ATOM 6875  C CA  . VAL B 2  403  ? 245.372 168.826 215.864 1.00 370.00 ? 403  VAL B CA  1 
ATOM 6876  C C   . VAL B 2  403  ? 245.350 169.281 217.308 1.00 370.00 ? 403  VAL B C   1 
ATOM 6877  O O   . VAL B 2  403  ? 246.122 168.779 218.139 1.00 370.00 ? 403  VAL B O   1 
ATOM 6878  C CB  . VAL B 2  403  ? 246.046 169.860 214.952 1.00 370.00 ? 403  VAL B CB  1 
ATOM 6879  C CG1 . VAL B 2  403  ? 247.340 170.325 215.554 1.00 370.00 ? 403  VAL B CG1 1 
ATOM 6880  C CG2 . VAL B 2  403  ? 246.326 169.244 213.610 1.00 370.00 ? 403  VAL B CG2 1 
ATOM 6881  N N   . ALA B 2  404  ? 244.404 170.160 217.648 1.00 370.00 ? 404  ALA B N   1 
ATOM 6882  C CA  . ALA B 2  404  ? 244.307 170.632 219.017 1.00 370.00 ? 404  ALA B CA  1 
ATOM 6883  C C   . ALA B 2  404  ? 243.947 169.506 219.966 1.00 370.00 ? 404  ALA B C   1 
ATOM 6884  O O   . ALA B 2  404  ? 244.496 169.426 221.068 1.00 370.00 ? 404  ALA B O   1 
ATOM 6885  C CB  . ALA B 2  404  ? 243.282 171.755 219.106 1.00 370.00 ? 404  ALA B CB  1 
ATOM 6886  N N   . TYR B 2  405  ? 243.096 168.585 219.536 1.00 370.00 ? 405  TYR B N   1 
ATOM 6887  C CA  . TYR B 2  405  ? 242.695 167.575 220.495 1.00 370.00 ? 405  TYR B CA  1 
ATOM 6888  C C   . TYR B 2  405  ? 243.748 166.499 220.654 1.00 370.00 ? 405  TYR B C   1 
ATOM 6889  O O   . TYR B 2  405  ? 244.055 166.092 221.777 1.00 370.00 ? 405  TYR B O   1 
ATOM 6890  C CB  . TYR B 2  405  ? 241.374 166.950 220.116 1.00 370.00 ? 405  TYR B CB  1 
ATOM 6891  C CG  . TYR B 2  405  ? 240.956 165.969 221.161 1.00 370.00 ? 405  TYR B CG  1 
ATOM 6892  C CD1 . TYR B 2  405  ? 240.632 166.403 222.427 1.00 370.00 ? 405  TYR B CD1 1 
ATOM 6893  C CD2 . TYR B 2  405  ? 240.890 164.620 220.894 1.00 370.00 ? 405  TYR B CD2 1 
ATOM 6894  C CE1 . TYR B 2  405  ? 240.258 165.528 223.395 1.00 370.00 ? 405  TYR B CE1 1 
ATOM 6895  C CE2 . TYR B 2  405  ? 240.503 163.736 221.856 1.00 370.00 ? 405  TYR B CE2 1 
ATOM 6896  C CZ  . TYR B 2  405  ? 240.192 164.198 223.106 1.00 370.00 ? 405  TYR B CZ  1 
ATOM 6897  O OH  . TYR B 2  405  ? 239.806 163.323 224.083 1.00 370.00 ? 405  TYR B OH  1 
ATOM 6898  N N   . GLU B 2  406  ? 244.335 166.037 219.562 1.00 370.00 ? 406  GLU B N   1 
ATOM 6899  C CA  . GLU B 2  406  ? 245.350 165.017 219.754 1.00 370.00 ? 406  GLU B CA  1 
ATOM 6900  C C   . GLU B 2  406  ? 246.699 165.592 220.137 1.00 370.00 ? 406  GLU B C   1 
ATOM 6901  O O   . GLU B 2  406  ? 247.668 164.836 220.227 1.00 370.00 ? 406  GLU B O   1 
ATOM 6902  C CB  . GLU B 2  406  ? 245.500 164.135 218.523 1.00 370.00 ? 406  GLU B CB  1 
ATOM 6903  C CG  . GLU B 2  406  ? 244.302 163.248 218.264 1.00 370.00 ? 406  GLU B CG  1 
ATOM 6904  C CD  . GLU B 2  406  ? 244.606 162.142 217.271 1.00 370.00 ? 406  GLU B CD  1 
ATOM 6905  O OE1 . GLU B 2  406  ? 245.748 162.081 216.776 1.00 370.00 ? 406  GLU B OE1 1 
ATOM 6906  O OE2 . GLU B 2  406  ? 243.717 161.308 217.004 1.00 370.00 ? 406  GLU B OE2 1 
ATOM 6907  N N   . LEU B 2  407  ? 246.803 166.897 220.346 1.00 370.00 ? 407  LEU B N   1 
ATOM 6908  C CA  . LEU B 2  407  ? 247.923 167.384 221.127 1.00 370.00 ? 407  LEU B CA  1 
ATOM 6909  C C   . LEU B 2  407  ? 247.544 167.708 222.557 1.00 370.00 ? 407  LEU B C   1 
ATOM 6910  O O   . LEU B 2  407  ? 248.425 167.765 223.415 1.00 370.00 ? 407  LEU B O   1 
ATOM 6911  C CB  . LEU B 2  407  ? 248.543 168.602 220.457 1.00 370.00 ? 407  LEU B CB  1 
ATOM 6912  C CG  . LEU B 2  407  ? 249.225 168.180 219.159 1.00 370.00 ? 407  LEU B CG  1 
ATOM 6913  C CD1 . LEU B 2  407  ? 249.692 169.388 218.391 1.00 370.00 ? 407  LEU B CD1 1 
ATOM 6914  C CD2 . LEU B 2  407  ? 250.387 167.264 219.466 1.00 370.00 ? 407  LEU B CD2 1 
ATOM 6915  N N   . LYS B 2  408  ? 246.262 167.935 222.835 1.00 370.00 ? 408  LYS B N   1 
ATOM 6916  C CA  . LYS B 2  408  ? 245.804 167.835 224.214 1.00 370.00 ? 408  LYS B CA  1 
ATOM 6917  C C   . LYS B 2  408  ? 245.969 166.425 224.732 1.00 370.00 ? 408  LYS B C   1 
ATOM 6918  O O   . LYS B 2  408  ? 246.448 166.211 225.850 1.00 370.00 ? 408  LYS B O   1 
ATOM 6919  C CB  . LYS B 2  408  ? 244.331 168.198 224.336 1.00 370.00 ? 408  LYS B CB  1 
ATOM 6920  C CG  . LYS B 2  408  ? 243.946 169.633 224.289 1.00 370.00 ? 408  LYS B CG  1 
ATOM 6921  C CD  . LYS B 2  408  ? 242.453 169.664 224.476 1.00 370.00 ? 408  LYS B CD  1 
ATOM 6922  C CE  . LYS B 2  408  ? 241.906 171.047 224.436 1.00 370.00 ? 408  LYS B CE  1 
ATOM 6923  N NZ  . LYS B 2  408  ? 240.436 170.968 224.550 1.00 370.00 ? 408  LYS B NZ  1 
ATOM 6924  N N   . THR B 2  409  ? 245.553 165.459 223.936 1.00 370.00 ? 409  THR B N   1 
ATOM 6925  C CA  . THR B 2  409  ? 245.248 164.130 224.405 1.00 370.00 ? 409  THR B CA  1 
ATOM 6926  C C   . THR B 2  409  ? 245.964 163.166 223.475 1.00 370.00 ? 409  THR B C   1 
ATOM 6927  O O   . THR B 2  409  ? 246.681 163.579 222.563 1.00 370.00 ? 409  THR B O   1 
ATOM 6928  C CB  . THR B 2  409  ? 243.726 163.933 224.414 1.00 370.00 ? 409  THR B CB  1 
ATOM 6929  O OG1 . THR B 2  409  ? 243.117 165.165 224.802 1.00 370.00 ? 409  THR B OG1 1 
ATOM 6930  C CG2 . THR B 2  409  ? 243.299 162.937 225.475 1.00 370.00 ? 409  THR B CG2 1 
ATOM 6931  N N   . GLY B 2  410  ? 245.774 161.875 223.691 1.00 370.00 ? 410  GLY B N   1 
ATOM 6932  C CA  . GLY B 2  410  ? 246.275 160.877 222.784 1.00 370.00 ? 410  GLY B CA  1 
ATOM 6933  C C   . GLY B 2  410  ? 245.456 160.801 221.514 1.00 370.00 ? 410  GLY B C   1 
ATOM 6934  O O   . GLY B 2  410  ? 244.655 161.677 221.183 1.00 370.00 ? 410  GLY B O   1 
ATOM 6935  N N   . GLY B 2  411  ? 245.665 159.709 220.795 1.00 370.00 ? 411  GLY B N   1 
ATOM 6936  C CA  . GLY B 2  411  ? 245.101 159.585 219.475 1.00 370.00 ? 411  GLY B CA  1 
ATOM 6937  C C   . GLY B 2  411  ? 243.613 159.308 219.477 1.00 370.00 ? 411  GLY B C   1 
ATOM 6938  O O   . GLY B 2  411  ? 242.997 159.051 220.505 1.00 370.00 ? 411  GLY B O   1 
ATOM 6939  N N   . VAL B 2  412  ? 243.021 159.388 218.293 1.00 370.00 ? 412  VAL B N   1 
ATOM 6940  C CA  . VAL B 2  412  ? 241.663 158.920 218.068 1.00 370.00 ? 412  VAL B CA  1 
ATOM 6941  C C   . VAL B 2  412  ? 241.765 157.789 217.061 1.00 370.00 ? 412  VAL B C   1 
ATOM 6942  O O   . VAL B 2  412  ? 241.917 158.019 215.864 1.00 370.00 ? 412  VAL B O   1 
ATOM 6943  C CB  . VAL B 2  412  ? 240.746 160.030 217.570 1.00 370.00 ? 412  VAL B CB  1 
ATOM 6944  C CG1 . VAL B 2  412  ? 239.355 159.483 217.366 1.00 370.00 ? 412  VAL B CG1 1 
ATOM 6945  C CG2 . VAL B 2  412  ? 240.743 161.175 218.541 1.00 370.00 ? 412  VAL B CG2 1 
ATOM 6946  N N   . LEU B 2  413  ? 241.704 156.563 217.538 1.00 370.00 ? 413  LEU B N   1 
ATOM 6947  C CA  . LEU B 2  413  ? 242.095 155.435 216.721 1.00 370.00 ? 413  LEU B CA  1 
ATOM 6948  C C   . LEU B 2  413  ? 240.858 154.722 216.206 1.00 370.00 ? 413  LEU B C   1 
ATOM 6949  O O   . LEU B 2  413  ? 239.799 154.767 216.831 1.00 370.00 ? 413  LEU B O   1 
ATOM 6950  C CB  . LEU B 2  413  ? 242.984 154.503 217.531 1.00 370.00 ? 413  LEU B CB  1 
ATOM 6951  C CG  . LEU B 2  413  ? 243.698 153.384 216.796 1.00 370.00 ? 413  LEU B CG  1 
ATOM 6952  C CD1 . LEU B 2  413  ? 244.545 153.965 215.693 1.00 370.00 ? 413  LEU B CD1 1 
ATOM 6953  C CD2 . LEU B 2  413  ? 244.562 152.626 217.769 1.00 370.00 ? 413  LEU B CD2 1 
ATOM 6954  N N   . LEU B 2  414  ? 240.985 154.093 215.043 1.00 370.00 ? 414  LEU B N   1 
ATOM 6955  C CA  . LEU B 2  414  ? 239.873 153.394 214.413 1.00 370.00 ? 414  LEU B CA  1 
ATOM 6956  C C   . LEU B 2  414  ? 240.241 151.920 214.378 1.00 370.00 ? 414  LEU B C   1 
ATOM 6957  O O   . LEU B 2  414  ? 240.783 151.431 213.391 1.00 370.00 ? 414  LEU B O   1 
ATOM 6958  C CB  . LEU B 2  414  ? 239.631 153.910 213.046 1.00 370.00 ? 414  LEU B CB  1 
ATOM 6959  C CG  . LEU B 2  414  ? 239.527 155.422 212.909 1.00 370.00 ? 414  LEU B CG  1 
ATOM 6960  C CD1 . LEU B 2  414  ? 239.223 155.791 211.486 1.00 370.00 ? 414  LEU B CD1 1 
ATOM 6961  C CD2 . LEU B 2  414  ? 238.504 155.981 213.814 1.00 370.00 ? 414  LEU B CD2 1 
ATOM 6962  N N   . HIS B 2  415  ? 239.950 151.225 215.470 1.00 370.00 ? 415  HIS B N   1 
ATOM 6963  C CA  . HIS B 2  415  ? 240.314 149.822 215.597 1.00 370.00 ? 415  HIS B CA  1 
ATOM 6964  C C   . HIS B 2  415  ? 239.618 148.964 214.553 1.00 370.00 ? 415  HIS B C   1 
ATOM 6965  O O   . HIS B 2  415  ? 238.495 149.282 214.152 1.00 370.00 ? 415  HIS B O   1 
ATOM 6966  C CB  . HIS B 2  415  ? 239.946 149.268 216.971 1.00 370.00 ? 415  HIS B CB  1 
ATOM 6967  C CG  . HIS B 2  415  ? 240.959 149.530 218.033 1.00 370.00 ? 415  HIS B CG  1 
ATOM 6968  N ND1 . HIS B 2  415  ? 242.164 148.865 218.080 1.00 370.00 ? 415  HIS B ND1 1 
ATOM 6969  C CD2 . HIS B 2  415  ? 240.927 150.333 219.120 1.00 370.00 ? 415  HIS B CD2 1 
ATOM 6970  C CE1 . HIS B 2  415  ? 242.846 149.270 219.135 1.00 370.00 ? 415  HIS B CE1 1 
ATOM 6971  N NE2 . HIS B 2  415  ? 242.118 150.161 219.783 1.00 370.00 ? 415  HIS B NE2 1 
ATOM 6972  N N   . PRO B 2  416  ? 240.296 147.981 213.992 1.00 370.00 ? 416  PRO B N   1 
ATOM 6973  C CA  . PRO B 2  416  ? 239.659 146.682 213.771 1.00 370.00 ? 416  PRO B CA  1 
ATOM 6974  C C   . PRO B 2  416  ? 240.035 145.722 214.890 1.00 370.00 ? 416  PRO B C   1 
ATOM 6975  O O   . PRO B 2  416  ? 239.452 144.646 215.034 1.00 370.00 ? 416  PRO B O   1 
ATOM 6976  C CB  . PRO B 2  416  ? 240.234 146.238 212.424 1.00 370.00 ? 416  PRO B CB  1 
ATOM 6977  C CG  . PRO B 2  416  ? 241.583 146.852 212.405 1.00 370.00 ? 416  PRO B CG  1 
ATOM 6978  C CD  . PRO B 2  416  ? 241.464 148.170 213.117 1.00 370.00 ? 416  PRO B CD  1 
ATOM 6979  N N   . ILE B 2  417  ? 241.001 146.124 215.702 1.00 370.00 ? 417  ILE B N   1 
ATOM 6980  C CA  . ILE B 2  417  ? 241.730 145.206 216.563 1.00 370.00 ? 417  ILE B CA  1 
ATOM 6981  C C   . ILE B 2  417  ? 241.076 145.169 217.931 1.00 370.00 ? 417  ILE B C   1 
ATOM 6982  O O   . ILE B 2  417  ? 240.722 146.210 218.492 1.00 370.00 ? 417  ILE B O   1 
ATOM 6983  C CB  . ILE B 2  417  ? 243.207 145.619 216.658 1.00 370.00 ? 417  ILE B CB  1 
ATOM 6984  C CG1 . ILE B 2  417  ? 243.842 145.538 215.278 1.00 370.00 ? 417  ILE B CG1 1 
ATOM 6985  C CG2 . ILE B 2  417  ? 243.992 144.736 217.613 1.00 370.00 ? 417  ILE B CG2 1 
ATOM 6986  C CD1 . ILE B 2  417  ? 245.214 146.128 215.221 1.00 370.00 ? 417  ILE B CD1 1 
ATOM 6987  N N   . PHE B 2  418  ? 240.900 143.965 218.455 1.00 370.00 ? 418  PHE B N   1 
ATOM 6988  C CA  . PHE B 2  418  ? 240.435 143.748 219.810 1.00 370.00 ? 418  PHE B CA  1 
ATOM 6989  C C   . PHE B 2  418  ? 241.591 143.600 220.786 1.00 370.00 ? 418  PHE B C   1 
ATOM 6990  O O   . PHE B 2  418  ? 242.754 143.454 220.411 1.00 370.00 ? 418  PHE B O   1 
ATOM 6991  C CB  . PHE B 2  418  ? 239.567 142.500 219.880 1.00 370.00 ? 418  PHE B CB  1 
ATOM 6992  C CG  . PHE B 2  418  ? 238.200 142.691 219.336 1.00 370.00 ? 418  PHE B CG  1 
ATOM 6993  C CD1 . PHE B 2  418  ? 237.696 143.961 219.131 1.00 370.00 ? 418  PHE B CD1 1 
ATOM 6994  C CD2 . PHE B 2  418  ? 237.406 141.601 219.045 1.00 370.00 ? 418  PHE B CD2 1 
ATOM 6995  C CE1 . PHE B 2  418  ? 236.427 144.145 218.642 1.00 370.00 ? 418  PHE B CE1 1 
ATOM 6996  C CE2 . PHE B 2  418  ? 236.131 141.777 218.549 1.00 370.00 ? 418  PHE B CE2 1 
ATOM 6997  C CZ  . PHE B 2  418  ? 235.642 143.054 218.347 1.00 370.00 ? 418  PHE B CZ  1 
ATOM 6998  N N   . GLY B 2  419  ? 241.242 143.646 222.066 1.00 370.00 ? 419  GLY B N   1 
ATOM 6999  C CA  . GLY B 2  419  ? 242.081 143.139 223.129 1.00 370.00 ? 419  GLY B CA  1 
ATOM 7000  C C   . GLY B 2  419  ? 241.491 141.833 223.615 1.00 370.00 ? 419  GLY B C   1 
ATOM 7001  O O   . GLY B 2  419  ? 241.372 141.605 224.822 1.00 370.00 ? 419  GLY B O   1 
ATOM 7002  N N   . GLY B 2  420  ? 241.082 140.996 222.663 1.00 370.00 ? 420  GLY B N   1 
ATOM 7003  C CA  . GLY B 2  420  ? 240.306 139.806 222.982 1.00 370.00 ? 420  GLY B CA  1 
ATOM 7004  C C   . GLY B 2  420  ? 241.120 138.788 223.757 1.00 370.00 ? 420  GLY B C   1 
ATOM 7005  O O   . GLY B 2  420  ? 242.292 138.537 223.448 1.00 370.00 ? 420  GLY B O   1 
ATOM 7006  N N   . GLY B 2  421  ? 240.501 138.198 224.769 1.00 370.00 ? 421  GLY B N   1 
ATOM 7007  C CA  . GLY B 2  421  ? 241.207 137.400 225.738 1.00 370.00 ? 421  GLY B CA  1 
ATOM 7008  C C   . GLY B 2  421  ? 241.725 138.182 226.921 1.00 370.00 ? 421  GLY B C   1 
ATOM 7009  O O   . GLY B 2  421  ? 242.829 137.881 227.394 1.00 370.00 ? 421  GLY B O   1 
ATOM 7010  N N   . LYS B 2  422  ? 240.978 139.198 227.380 1.00 370.00 ? 422  LYS B N   1 
ATOM 7011  C CA  . LYS B 2  422  ? 241.312 140.050 228.533 1.00 370.00 ? 422  LYS B CA  1 
ATOM 7012  C C   . LYS B 2  422  ? 242.628 140.803 228.328 1.00 370.00 ? 422  LYS B C   1 
ATOM 7013  O O   . LYS B 2  422  ? 243.370 141.071 229.275 1.00 370.00 ? 422  LYS B O   1 
ATOM 7014  C CB  . LYS B 2  422  ? 241.332 139.244 229.836 1.00 370.00 ? 422  LYS B CB  1 
ATOM 7015  C CG  . LYS B 2  422  ? 239.985 138.658 230.202 1.00 370.00 ? 422  LYS B CG  1 
ATOM 7016  C CD  . LYS B 2  422  ? 240.062 137.877 231.496 1.00 370.00 ? 422  LYS B CD  1 
ATOM 7017  C CE  . LYS B 2  422  ? 238.716 137.272 231.847 1.00 370.00 ? 422  LYS B CE  1 
ATOM 7018  N NZ  . LYS B 2  422  ? 238.774 136.500 233.118 1.00 370.00 ? 422  LYS B NZ  1 
ATOM 7019  N N   . GLU B 2  423  ? 242.906 141.168 227.083 1.00 370.00 ? 423  GLU B N   1 
ATOM 7020  C CA  . GLU B 2  423  ? 244.121 141.866 226.703 1.00 370.00 ? 423  GLU B CA  1 
ATOM 7021  C C   . GLU B 2  423  ? 243.806 143.341 226.517 1.00 370.00 ? 423  GLU B C   1 
ATOM 7022  O O   . GLU B 2  423  ? 242.654 143.724 226.314 1.00 370.00 ? 423  GLU B O   1 
ATOM 7023  C CB  . GLU B 2  423  ? 244.692 141.267 225.417 1.00 370.00 ? 423  GLU B CB  1 
ATOM 7024  C CG  . GLU B 2  423  ? 245.100 139.810 225.577 1.00 370.00 ? 423  GLU B CG  1 
ATOM 7025  C CD  . GLU B 2  423  ? 245.509 139.162 224.271 1.00 370.00 ? 423  GLU B CD  1 
ATOM 7026  O OE1 . GLU B 2  423  ? 245.362 139.805 223.212 1.00 370.00 ? 423  GLU B OE1 1 
ATOM 7027  O OE2 . GLU B 2  423  ? 245.968 138.003 224.304 1.00 370.00 ? 423  GLU B OE2 1 
ATOM 7028  N N   . LYS B 2  424  ? 244.833 144.181 226.612 1.00 370.00 ? 424  LYS B N   1 
ATOM 7029  C CA  . LYS B 2  424  ? 244.557 145.608 226.526 1.00 370.00 ? 424  LYS B CA  1 
ATOM 7030  C C   . LYS B 2  424  ? 244.876 146.162 225.145 1.00 370.00 ? 424  LYS B C   1 
ATOM 7031  O O   . LYS B 2  424  ? 243.954 146.506 224.397 1.00 370.00 ? 424  LYS B O   1 
ATOM 7032  C CB  . LYS B 2  424  ? 245.356 146.348 227.596 1.00 370.00 ? 424  LYS B CB  1 
ATOM 7033  C CG  . LYS B 2  424  ? 244.951 145.954 229.003 1.00 370.00 ? 424  LYS B CG  1 
ATOM 7034  C CD  . LYS B 2  424  ? 245.801 146.644 230.046 1.00 370.00 ? 424  LYS B CD  1 
ATOM 7035  C CE  . LYS B 2  424  ? 245.428 146.175 231.438 1.00 370.00 ? 424  LYS B CE  1 
ATOM 7036  N NZ  . LYS B 2  424  ? 246.276 146.803 232.482 1.00 370.00 ? 424  LYS B NZ  1 
ATOM 7037  N N   . ASP B 2  425  ? 246.161 146.128 224.777 1.00 370.00 ? 425  ASP B N   1 
ATOM 7038  C CA  . ASP B 2  425  ? 246.699 146.698 223.534 1.00 370.00 ? 425  ASP B CA  1 
ATOM 7039  C C   . ASP B 2  425  ? 246.192 148.118 223.285 1.00 370.00 ? 425  ASP B C   1 
ATOM 7040  O O   . ASP B 2  425  ? 245.682 148.448 222.212 1.00 370.00 ? 425  ASP B O   1 
ATOM 7041  C CB  . ASP B 2  425  ? 246.399 145.792 222.341 1.00 370.00 ? 425  ASP B CB  1 
ATOM 7042  C CG  . ASP B 2  425  ? 247.199 144.507 222.378 1.00 370.00 ? 425  ASP B CG  1 
ATOM 7043  O OD1 . ASP B 2  425  ? 248.308 144.512 222.951 1.00 370.00 ? 425  ASP B OD1 1 
ATOM 7044  O OD2 . ASP B 2  425  ? 246.725 143.491 221.829 1.00 370.00 ? 425  ASP B OD2 1 
ATOM 7045  N N   . ASN B 2  426  ? 246.321 148.964 224.300 1.00 370.00 ? 426  ASN B N   1 
ATOM 7046  C CA  . ASN B 2  426  ? 245.741 150.302 224.260 1.00 370.00 ? 426  ASN B CA  1 
ATOM 7047  C C   . ASN B 2  426  ? 246.756 151.342 224.697 1.00 370.00 ? 426  ASN B C   1 
ATOM 7048  O O   . ASN B 2  426  ? 246.804 151.727 225.873 1.00 370.00 ? 426  ASN B O   1 
ATOM 7049  C CB  . ASN B 2  426  ? 244.493 150.367 225.123 1.00 370.00 ? 426  ASN B CB  1 
ATOM 7050  C CG  . ASN B 2  426  ? 243.392 149.525 224.572 1.00 370.00 ? 426  ASN B CG  1 
ATOM 7051  O OD1 . ASN B 2  426  ? 243.170 149.498 223.363 1.00 370.00 ? 426  ASN B OD1 1 
ATOM 7052  N ND2 . ASN B 2  426  ? 242.715 148.793 225.443 1.00 370.00 ? 426  ASN B ND2 1 
ATOM 7053  N N   . PRO B 2  427  ? 247.583 151.828 223.772 1.00 370.00 ? 427  PRO B N   1 
ATOM 7054  C CA  . PRO B 2  427  ? 248.328 153.055 224.058 1.00 370.00 ? 427  PRO B CA  1 
ATOM 7055  C C   . PRO B 2  427  ? 247.408 154.247 224.168 1.00 370.00 ? 427  PRO B C   1 
ATOM 7056  O O   . PRO B 2  427  ? 247.676 155.157 224.960 1.00 370.00 ? 427  PRO B O   1 
ATOM 7057  C CB  . PRO B 2  427  ? 249.280 153.173 222.862 1.00 370.00 ? 427  PRO B CB  1 
ATOM 7058  C CG  . PRO B 2  427  ? 248.570 152.474 221.760 1.00 370.00 ? 427  PRO B CG  1 
ATOM 7059  C CD  . PRO B 2  427  ? 247.813 151.345 222.401 1.00 370.00 ? 427  PRO B CD  1 
ATOM 7060  N N   . ALA B 2  428  ? 246.275 154.216 223.459 1.00 370.00 ? 428  ALA B N   1 
ATOM 7061  C CA  . ALA B 2  428  ? 245.239 155.239 223.460 1.00 370.00 ? 428  ALA B CA  1 
ATOM 7062  C C   . ALA B 2  428  ? 244.320 155.142 224.661 1.00 370.00 ? 428  ALA B C   1 
ATOM 7063  O O   . ALA B 2  428  ? 243.231 155.726 224.675 1.00 370.00 ? 428  ALA B O   1 
ATOM 7064  C CB  . ALA B 2  428  ? 244.424 155.161 222.169 1.00 370.00 ? 428  ALA B CB  1 
ATOM 7065  N N   . SER B 2  429  ? 244.769 154.450 225.697 1.00 370.00 ? 429  SER B N   1 
ATOM 7066  C CA  . SER B 2  429  ? 244.108 154.405 226.983 1.00 370.00 ? 429  SER B CA  1 
ATOM 7067  C C   . SER B 2  429  ? 244.680 155.509 227.851 1.00 370.00 ? 429  SER B C   1 
ATOM 7068  O O   . SER B 2  429  ? 244.884 155.320 229.052 1.00 370.00 ? 429  SER B O   1 
ATOM 7069  C CB  . SER B 2  429  ? 244.316 153.046 227.632 1.00 370.00 ? 429  SER B CB  1 
ATOM 7070  O OG  . SER B 2  429  ? 245.700 152.829 227.827 1.00 370.00 ? 429  SER B OG  1 
ATOM 7071  N N   . HIS B 2  430  ? 244.996 156.643 227.222 1.00 370.00 ? 430  HIS B N   1 
ATOM 7072  C CA  . HIS B 2  430  ? 245.472 157.814 227.939 1.00 370.00 ? 430  HIS B CA  1 
ATOM 7073  C C   . HIS B 2  430  ? 244.428 158.317 228.919 1.00 370.00 ? 430  HIS B C   1 
ATOM 7074  O O   . HIS B 2  430  ? 244.765 158.904 229.951 1.00 370.00 ? 430  HIS B O   1 
ATOM 7075  C CB  . HIS B 2  430  ? 245.852 158.895 226.937 1.00 370.00 ? 430  HIS B CB  1 
ATOM 7076  C CG  . HIS B 2  430  ? 246.917 158.467 225.978 1.00 370.00 ? 430  HIS B CG  1 
ATOM 7077  N ND1 . HIS B 2  430  ? 248.245 158.375 226.330 1.00 370.00 ? 430  HIS B ND1 1 
ATOM 7078  C CD2 . HIS B 2  430  ? 246.844 158.086 224.683 1.00 370.00 ? 430  HIS B CD2 1 
ATOM 7079  C CE1 . HIS B 2  430  ? 248.947 157.970 225.288 1.00 370.00 ? 430  HIS B CE1 1 
ATOM 7080  N NE2 . HIS B 2  430  ? 248.120 157.785 224.276 1.00 370.00 ? 430  HIS B NE2 1 
ATOM 7081  N N   . LEU B 2  431  ? 243.155 158.093 228.624 1.00 370.00 ? 431  LEU B N   1 
ATOM 7082  C CA  . LEU B 2  431  ? 242.158 158.093 229.679 1.00 370.00 ? 431  LEU B CA  1 
ATOM 7083  C C   . LEU B 2  431  ? 241.446 156.754 229.798 1.00 370.00 ? 431  LEU B C   1 
ATOM 7084  O O   . LEU B 2  431  ? 241.373 156.210 230.901 1.00 370.00 ? 431  LEU B O   1 
ATOM 7085  C CB  . LEU B 2  431  ? 241.163 159.235 229.474 1.00 370.00 ? 431  LEU B CB  1 
ATOM 7086  C CG  . LEU B 2  431  ? 239.896 159.265 230.333 1.00 370.00 ? 431  LEU B CG  1 
ATOM 7087  C CD1 . LEU B 2  431  ? 240.168 159.194 231.803 1.00 370.00 ? 431  LEU B CD1 1 
ATOM 7088  C CD2 . LEU B 2  431  ? 239.115 160.531 230.022 1.00 370.00 ? 431  LEU B CD2 1 
ATOM 7089  N N   . HIS B 2  432  ? 240.916 156.200 228.719 1.00 370.00 ? 432  HIS B N   1 
ATOM 7090  C CA  . HIS B 2  432  ? 239.818 155.270 228.904 1.00 370.00 ? 432  HIS B CA  1 
ATOM 7091  C C   . HIS B 2  432  ? 239.745 154.267 227.767 1.00 370.00 ? 432  HIS B C   1 
ATOM 7092  O O   . HIS B 2  432  ? 240.475 154.347 226.775 1.00 370.00 ? 432  HIS B O   1 
ATOM 7093  C CB  . HIS B 2  432  ? 238.511 156.034 229.007 1.00 370.00 ? 432  HIS B CB  1 
ATOM 7094  C CG  . HIS B 2  432  ? 238.196 156.810 227.776 1.00 370.00 ? 432  HIS B CG  1 
ATOM 7095  N ND1 . HIS B 2  432  ? 238.860 157.965 227.441 1.00 370.00 ? 432  HIS B ND1 1 
ATOM 7096  C CD2 . HIS B 2  432  ? 237.298 156.596 226.792 1.00 370.00 ? 432  HIS B CD2 1 
ATOM 7097  C CE1 . HIS B 2  432  ? 238.388 158.431 226.304 1.00 370.00 ? 432  HIS B CE1 1 
ATOM 7098  N NE2 . HIS B 2  432  ? 237.437 157.619 225.890 1.00 370.00 ? 432  HIS B NE2 1 
ATOM 7099  N N   . PHE B 2  433  ? 238.825 153.324 227.937 1.00 370.00 ? 433  PHE B N   1 
ATOM 7100  C CA  . PHE B 2  433  ? 238.609 152.234 227.002 1.00 370.00 ? 433  PHE B CA  1 
ATOM 7101  C C   . PHE B 2  433  ? 238.022 152.760 225.709 1.00 370.00 ? 433  PHE B C   1 
ATOM 7102  O O   . PHE B 2  433  ? 237.370 153.795 225.679 1.00 370.00 ? 433  PHE B O   1 
ATOM 7103  C CB  . PHE B 2  433  ? 237.666 151.212 227.629 1.00 370.00 ? 433  PHE B CB  1 
ATOM 7104  C CG  . PHE B 2  433  ? 237.364 150.038 226.767 1.00 370.00 ? 433  PHE B CG  1 
ATOM 7105  C CD1 . PHE B 2  433  ? 238.282 149.009 226.637 1.00 370.00 ? 433  PHE B CD1 1 
ATOM 7106  C CD2 . PHE B 2  433  ? 236.161 149.954 226.089 1.00 370.00 ? 433  PHE B CD2 1 
ATOM 7107  C CE1 . PHE B 2  433  ? 238.004 147.909 225.844 1.00 370.00 ? 433  PHE B CE1 1 
ATOM 7108  C CE2 . PHE B 2  433  ? 235.885 148.861 225.301 1.00 370.00 ? 433  PHE B CE2 1 
ATOM 7109  C CZ  . PHE B 2  433  ? 236.800 147.835 225.185 1.00 370.00 ? 433  PHE B CZ  1 
ATOM 7110  N N   . SER B 2  434  ? 238.294 152.067 224.620 1.00 370.00 ? 434  SER B N   1 
ATOM 7111  C CA  . SER B 2  434  ? 237.607 152.417 223.389 1.00 370.00 ? 434  SER B CA  1 
ATOM 7112  C C   . SER B 2  434  ? 237.126 151.236 222.579 1.00 370.00 ? 434  SER B C   1 
ATOM 7113  O O   . SER B 2  434  ? 236.153 151.408 221.838 1.00 370.00 ? 434  SER B O   1 
ATOM 7114  C CB  . SER B 2  434  ? 238.510 153.280 222.510 1.00 370.00 ? 434  SER B CB  1 
ATOM 7115  O OG  . SER B 2  434  ? 239.667 152.566 222.131 1.00 370.00 ? 434  SER B OG  1 
ATOM 7116  N N   . ILE B 2  435  ? 237.711 150.044 222.760 1.00 370.00 ? 435  ILE B N   1 
ATOM 7117  C CA  . ILE B 2  435  ? 237.822 149.047 221.691 1.00 370.00 ? 435  ILE B CA  1 
ATOM 7118  C C   . ILE B 2  435  ? 236.452 148.560 221.257 1.00 370.00 ? 435  ILE B C   1 
ATOM 7119  O O   . ILE B 2  435  ? 236.071 148.664 220.087 1.00 370.00 ? 435  ILE B O   1 
ATOM 7120  C CB  . ILE B 2  435  ? 238.684 147.854 222.142 1.00 370.00 ? 435  ILE B CB  1 
ATOM 7121  C CG1 . ILE B 2  435  ? 240.106 148.264 222.508 1.00 370.00 ? 435  ILE B CG1 1 
ATOM 7122  C CG2 . ILE B 2  435  ? 238.733 146.819 221.057 1.00 370.00 ? 435  ILE B CG2 1 
ATOM 7123  C CD1 . ILE B 2  435  ? 240.888 147.125 223.133 1.00 370.00 ? 435  ILE B CD1 1 
ATOM 7124  N N   . LYS B 2  436  ? 235.687 148.054 222.201 1.00 370.00 ? 436  LYS B N   1 
ATOM 7125  C CA  . LYS B 2  436  ? 234.417 147.426 221.923 1.00 370.00 ? 436  LYS B CA  1 
ATOM 7126  C C   . LYS B 2  436  ? 233.250 148.293 222.328 1.00 370.00 ? 436  LYS B C   1 
ATOM 7127  O O   . LYS B 2  436  ? 232.124 147.792 222.385 1.00 370.00 ? 436  LYS B O   1 
ATOM 7128  C CB  . LYS B 2  436  ? 234.341 146.079 222.650 1.00 370.00 ? 436  LYS B CB  1 
ATOM 7129  C CG  . LYS B 2  436  ? 235.378 145.081 222.157 1.00 370.00 ? 436  LYS B CG  1 
ATOM 7130  C CD  . LYS B 2  436  ? 235.286 143.741 222.863 1.00 370.00 ? 436  LYS B CD  1 
ATOM 7131  C CE  . LYS B 2  436  ? 236.346 142.779 222.339 1.00 370.00 ? 436  LYS B CE  1 
ATOM 7132  N NZ  . LYS B 2  436  ? 236.305 141.446 223.005 1.00 370.00 ? 436  LYS B NZ  1 
ATOM 7133  N N   . HIS B 2  437  ? 233.473 149.570 222.613 1.00 370.00 ? 437  HIS B N   1 
ATOM 7134  C CA  . HIS B 2  437  ? 232.393 150.182 223.300 1.00 370.00 ? 437  HIS B CA  1 
ATOM 7135  C C   . HIS B 2  437  ? 232.141 151.643 222.982 1.00 370.00 ? 437  HIS B C   1 
ATOM 7136  O O   . HIS B 2  437  ? 233.086 152.438 222.915 1.00 370.00 ? 437  HIS B O   1 
ATOM 7137  C CB  . HIS B 2  437  ? 232.651 150.036 224.781 1.00 370.00 ? 437  HIS B CB  1 
ATOM 7138  C CG  . HIS B 2  437  ? 231.404 149.992 225.573 1.00 370.00 ? 437  HIS B CG  1 
ATOM 7139  N ND1 . HIS B 2  437  ? 230.577 148.893 225.561 1.00 370.00 ? 437  HIS B ND1 1 
ATOM 7140  C CD2 . HIS B 2  437  ? 230.831 150.896 226.395 1.00 370.00 ? 437  HIS B CD2 1 
ATOM 7141  C CE1 . HIS B 2  437  ? 229.543 149.120 226.345 1.00 370.00 ? 437  HIS B CE1 1 
ATOM 7142  N NE2 . HIS B 2  437  ? 229.670 150.330 226.859 1.00 370.00 ? 437  HIS B NE2 1 
ATOM 7143  N N   . PRO B 2  438  ? 230.888 152.015 222.778 1.00 370.00 ? 438  PRO B N   1 
ATOM 7144  C CA  . PRO B 2  438  ? 230.561 153.424 222.591 1.00 370.00 ? 438  PRO B CA  1 
ATOM 7145  C C   . PRO B 2  438  ? 230.677 154.184 223.881 1.00 370.00 ? 438  PRO B C   1 
ATOM 7146  O O   . PRO B 2  438  ? 231.295 155.245 223.937 1.00 370.00 ? 438  PRO B O   1 
ATOM 7147  C CB  . PRO B 2  438  ? 229.116 153.391 222.088 1.00 370.00 ? 438  PRO B CB  1 
ATOM 7148  C CG  . PRO B 2  438  ? 228.565 152.117 222.578 1.00 370.00 ? 438  PRO B CG  1 
ATOM 7149  C CD  . PRO B 2  438  ? 229.710 151.149 222.632 1.00 370.00 ? 438  PRO B CD  1 
ATOM 7150  N N   . HIS B 2  439  ? 230.170 153.594 224.951 1.00 370.00 ? 439  HIS B N   1 
ATOM 7151  C CA  . HIS B 2  439  ? 229.832 154.331 226.151 1.00 370.00 ? 439  HIS B CA  1 
ATOM 7152  C C   . HIS B 2  439  ? 231.008 154.482 227.082 1.00 370.00 ? 439  HIS B C   1 
ATOM 7153  O O   . HIS B 2  439  ? 230.830 154.548 228.301 1.00 370.00 ? 439  HIS B O   1 
ATOM 7154  C CB  . HIS B 2  439  ? 228.681 153.643 226.863 1.00 370.00 ? 439  HIS B CB  1 
ATOM 7155  C CG  . HIS B 2  439  ? 227.570 153.266 225.951 1.00 370.00 ? 439  HIS B CG  1 
ATOM 7156  N ND1 . HIS B 2  439  ? 226.911 154.183 225.171 1.00 370.00 ? 439  HIS B ND1 1 
ATOM 7157  C CD2 . HIS B 2  439  ? 226.965 152.081 225.729 1.00 370.00 ? 439  HIS B CD2 1 
ATOM 7158  C CE1 . HIS B 2  439  ? 225.966 153.573 224.481 1.00 370.00 ? 439  HIS B CE1 1 
ATOM 7159  N NE2 . HIS B 2  439  ? 225.974 152.296 224.806 1.00 370.00 ? 439  HIS B NE2 1 
ATOM 7160  N N   . THR B 2  440  ? 232.214 154.485 226.551 1.00 370.00 ? 440  THR B N   1 
ATOM 7161  C CA  . THR B 2  440  ? 233.350 154.889 227.342 1.00 370.00 ? 440  THR B CA  1 
ATOM 7162  C C   . THR B 2  440  ? 233.821 156.284 226.971 1.00 370.00 ? 440  THR B C   1 
ATOM 7163  O O   . THR B 2  440  ? 234.457 156.959 227.786 1.00 370.00 ? 440  THR B O   1 
ATOM 7164  C CB  . THR B 2  440  ? 234.490 153.894 227.139 1.00 370.00 ? 440  THR B CB  1 
ATOM 7165  O OG1 . THR B 2  440  ? 233.958 152.567 227.113 1.00 370.00 ? 440  THR B OG1 1 
ATOM 7166  C CG2 . THR B 2  440  ? 235.449 153.972 228.301 1.00 370.00 ? 440  THR B CG2 1 
ATOM 7167  N N   . LEU B 2  441  ? 233.448 156.763 225.802 1.00 370.00 ? 441  LEU B N   1 
ATOM 7168  C CA  . LEU B 2  441  ? 234.200 157.826 225.176 1.00 370.00 ? 441  LEU B CA  1 
ATOM 7169  C C   . LEU B 2  441  ? 233.737 159.206 225.634 1.00 370.00 ? 441  LEU B C   1 
ATOM 7170  O O   . LEU B 2  441  ? 232.686 159.361 226.255 1.00 370.00 ? 441  LEU B O   1 
ATOM 7171  C CB  . LEU B 2  441  ? 234.067 157.685 223.674 1.00 370.00 ? 441  LEU B CB  1 
ATOM 7172  C CG  . LEU B 2  441  ? 234.392 156.254 223.281 1.00 370.00 ? 441  LEU B CG  1 
ATOM 7173  C CD1 . LEU B 2  441  ? 234.182 156.159 221.840 1.00 370.00 ? 441  LEU B CD1 1 
ATOM 7174  C CD2 . LEU B 2  441  ? 235.799 155.864 223.601 1.00 370.00 ? 441  LEU B CD2 1 
ATOM 7175  N N   . SER B 2  442  ? 234.544 160.214 225.326 1.00 370.00 ? 442  SER B N   1 
ATOM 7176  C CA  . SER B 2  442  ? 234.167 161.592 225.573 1.00 370.00 ? 442  SER B CA  1 
ATOM 7177  C C   . SER B 2  442  ? 233.575 162.194 224.318 1.00 370.00 ? 442  SER B C   1 
ATOM 7178  O O   . SER B 2  442  ? 233.826 161.745 223.200 1.00 370.00 ? 442  SER B O   1 
ATOM 7179  C CB  . SER B 2  442  ? 235.361 162.442 225.965 1.00 370.00 ? 442  SER B CB  1 
ATOM 7180  O OG  . SER B 2  442  ? 236.065 162.828 224.800 1.00 370.00 ? 442  SER B OG  1 
ATOM 7181  N N   . TRP B 2  443  ? 232.817 163.258 224.518 1.00 370.00 ? 443  TRP B N   1 
ATOM 7182  C CA  . TRP B 2  443  ? 232.314 164.016 223.389 1.00 370.00 ? 443  TRP B CA  1 
ATOM 7183  C C   . TRP B 2  443  ? 233.415 164.716 222.646 1.00 370.00 ? 443  TRP B C   1 
ATOM 7184  O O   . TRP B 2  443  ? 233.299 164.934 221.437 1.00 370.00 ? 443  TRP B O   1 
ATOM 7185  C CB  . TRP B 2  443  ? 231.288 164.996 223.875 1.00 370.00 ? 443  TRP B CB  1 
ATOM 7186  C CG  . TRP B 2  443  ? 230.137 164.267 223.942 1.00 370.00 ? 443  TRP B CG  1 
ATOM 7187  C CD1 . TRP B 2  443  ? 229.722 163.508 224.960 1.00 370.00 ? 443  TRP B CD1 1 
ATOM 7188  C CD2 . TRP B 2  443  ? 229.197 164.130 222.905 1.00 370.00 ? 443  TRP B CD2 1 
ATOM 7189  N NE1 . TRP B 2  443  ? 228.555 162.892 224.631 1.00 370.00 ? 443  TRP B NE1 1 
ATOM 7190  C CE2 . TRP B 2  443  ? 228.202 163.273 223.367 1.00 370.00 ? 443  TRP B CE2 1 
ATOM 7191  C CE3 . TRP B 2  443  ? 229.089 164.667 221.629 1.00 370.00 ? 443  TRP B CE3 1 
ATOM 7192  C CZ2 . TRP B 2  443  ? 227.106 162.936 222.606 1.00 370.00 ? 443  TRP B CZ2 1 
ATOM 7193  C CZ3 . TRP B 2  443  ? 228.009 164.331 220.872 1.00 370.00 ? 443  TRP B CZ3 1 
ATOM 7194  C CH2 . TRP B 2  443  ? 227.027 163.475 221.359 1.00 370.00 ? 443  TRP B CH2 1 
ATOM 7195  N N   . GLU B 2  444  ? 234.476 165.072 223.352 1.00 370.00 ? 444  GLU B N   1 
ATOM 7196  C CA  . GLU B 2  444  ? 235.683 165.473 222.667 1.00 370.00 ? 444  GLU B CA  1 
ATOM 7197  C C   . GLU B 2  444  ? 236.192 164.332 221.806 1.00 370.00 ? 444  GLU B C   1 
ATOM 7198  O O   . GLU B 2  444  ? 236.447 164.520 220.611 1.00 370.00 ? 444  GLU B O   1 
ATOM 7199  C CB  . GLU B 2  444  ? 236.713 165.922 223.690 1.00 370.00 ? 444  GLU B CB  1 
ATOM 7200  C CG  . GLU B 2  444  ? 236.225 167.112 224.500 1.00 370.00 ? 444  GLU B CG  1 
ATOM 7201  C CD  . GLU B 2  444  ? 237.224 167.592 225.535 1.00 370.00 ? 444  GLU B CD  1 
ATOM 7202  O OE1 . GLU B 2  444  ? 238.296 166.971 225.673 1.00 370.00 ? 444  GLU B OE1 1 
ATOM 7203  O OE2 . GLU B 2  444  ? 236.930 168.586 226.228 1.00 370.00 ? 444  GLU B OE2 1 
ATOM 7204  N N   . TYR B 2  445  ? 236.213 163.120 222.361 1.00 370.00 ? 445  TYR B N   1 
ATOM 7205  C CA  . TYR B 2  445  ? 236.696 161.984 221.592 1.00 370.00 ? 445  TYR B CA  1 
ATOM 7206  C C   . TYR B 2  445  ? 235.740 161.626 220.471 1.00 370.00 ? 445  TYR B C   1 
ATOM 7207  O O   . TYR B 2  445  ? 236.173 161.316 219.362 1.00 370.00 ? 445  TYR B O   1 
ATOM 7208  C CB  . TYR B 2  445  ? 236.897 160.773 222.484 1.00 370.00 ? 445  TYR B CB  1 
ATOM 7209  C CG  . TYR B 2  445  ? 237.554 159.651 221.755 1.00 370.00 ? 445  TYR B CG  1 
ATOM 7210  C CD1 . TYR B 2  445  ? 238.913 159.665 221.543 1.00 370.00 ? 445  TYR B CD1 1 
ATOM 7211  C CD2 . TYR B 2  445  ? 236.818 158.595 221.248 1.00 370.00 ? 445  TYR B CD2 1 
ATOM 7212  C CE1 . TYR B 2  445  ? 239.525 158.658 220.877 1.00 370.00 ? 445  TYR B CE1 1 
ATOM 7213  C CE2 . TYR B 2  445  ? 237.421 157.590 220.562 1.00 370.00 ? 445  TYR B CE2 1 
ATOM 7214  C CZ  . TYR B 2  445  ? 238.778 157.625 220.375 1.00 370.00 ? 445  TYR B CZ  1 
ATOM 7215  O OH  . TYR B 2  445  ? 239.406 156.614 219.690 1.00 370.00 ? 445  TYR B OH  1 
ATOM 7216  N N   . TYR B 2  446  ? 234.446 161.654 220.739 1.00 370.00 ? 446  TYR B N   1 
ATOM 7217  C CA  . TYR B 2  446  ? 233.489 161.211 219.740 1.00 370.00 ? 446  TYR B CA  1 
ATOM 7218  C C   . TYR B 2  446  ? 233.371 162.225 218.616 1.00 370.00 ? 446  TYR B C   1 
ATOM 7219  O O   . TYR B 2  446  ? 233.241 161.866 217.433 1.00 370.00 ? 446  TYR B O   1 
ATOM 7220  C CB  . TYR B 2  446  ? 232.165 160.988 220.431 1.00 370.00 ? 446  TYR B CB  1 
ATOM 7221  C CG  . TYR B 2  446  ? 231.048 160.517 219.569 1.00 370.00 ? 446  TYR B CG  1 
ATOM 7222  C CD1 . TYR B 2  446  ? 230.954 159.199 219.165 1.00 370.00 ? 446  TYR B CD1 1 
ATOM 7223  C CD2 . TYR B 2  446  ? 230.053 161.389 219.196 1.00 370.00 ? 446  TYR B CD2 1 
ATOM 7224  C CE1 . TYR B 2  446  ? 229.900 158.779 218.397 1.00 370.00 ? 446  TYR B CE1 1 
ATOM 7225  C CE2 . TYR B 2  446  ? 229.006 160.981 218.433 1.00 370.00 ? 446  TYR B CE2 1 
ATOM 7226  C CZ  . TYR B 2  446  ? 228.931 159.685 218.039 1.00 370.00 ? 446  TYR B CZ  1 
ATOM 7227  O OH  . TYR B 2  446  ? 227.869 159.307 217.272 1.00 370.00 ? 446  TYR B OH  1 
ATOM 7228  N N   . SER B 2  447  ? 233.462 163.497 218.970 1.00 370.00 ? 447  SER B N   1 
ATOM 7229  C CA  . SER B 2  447  ? 233.514 164.547 217.973 1.00 370.00 ? 447  SER B CA  1 
ATOM 7230  C C   . SER B 2  447  ? 234.736 164.393 217.082 1.00 370.00 ? 447  SER B C   1 
ATOM 7231  O O   . SER B 2  447  ? 234.616 164.375 215.852 1.00 370.00 ? 447  SER B O   1 
ATOM 7232  C CB  . SER B 2  447  ? 233.502 165.894 218.679 1.00 370.00 ? 447  SER B CB  1 
ATOM 7233  O OG  . SER B 2  447  ? 234.592 165.969 219.571 1.00 370.00 ? 447  SER B OG  1 
ATOM 7234  N N   . MET B 2  448  ? 235.911 164.197 217.684 1.00 370.00 ? 448  MET B N   1 
ATOM 7235  C CA  . MET B 2  448  ? 237.110 164.073 216.867 1.00 370.00 ? 448  MET B CA  1 
ATOM 7236  C C   . MET B 2  448  ? 237.128 162.791 216.071 1.00 370.00 ? 448  MET B C   1 
ATOM 7237  O O   . MET B 2  448  ? 237.782 162.729 215.028 1.00 370.00 ? 448  MET B O   1 
ATOM 7238  C CB  . MET B 2  448  ? 238.354 164.138 217.723 1.00 370.00 ? 448  MET B CB  1 
ATOM 7239  C CG  . MET B 2  448  ? 238.549 165.454 218.367 1.00 370.00 ? 448  MET B CG  1 
ATOM 7240  S SD  . MET B 2  448  ? 238.442 166.838 217.241 1.00 370.00 ? 448  MET B SD  1 
ATOM 7241  C CE  . MET B 2  448  ? 236.937 167.586 217.862 1.00 370.00 ? 448  MET B CE  1 
ATOM 7242  N N   . PHE B 2  449  ? 236.440 161.767 216.559 1.00 370.00 ? 449  PHE B N   1 
ATOM 7243  C CA  . PHE B 2  449  ? 236.202 160.567 215.779 1.00 370.00 ? 449  PHE B CA  1 
ATOM 7244  C C   . PHE B 2  449  ? 235.512 160.908 214.477 1.00 370.00 ? 449  PHE B C   1 
ATOM 7245  O O   . PHE B 2  449  ? 235.969 160.520 213.396 1.00 370.00 ? 449  PHE B O   1 
ATOM 7246  C CB  . PHE B 2  449  ? 235.364 159.629 216.620 1.00 370.00 ? 449  PHE B CB  1 
ATOM 7247  C CG  . PHE B 2  449  ? 234.923 158.410 215.932 1.00 370.00 ? 449  PHE B CG  1 
ATOM 7248  C CD1 . PHE B 2  449  ? 235.746 157.317 215.852 1.00 370.00 ? 449  PHE B CD1 1 
ATOM 7249  C CD2 . PHE B 2  449  ? 233.647 158.336 215.403 1.00 370.00 ? 449  PHE B CD2 1 
ATOM 7250  C CE1 . PHE B 2  449  ? 235.306 156.166 215.249 1.00 370.00 ? 449  PHE B CE1 1 
ATOM 7251  C CE2 . PHE B 2  449  ? 233.212 157.205 214.789 1.00 370.00 ? 449  PHE B CE2 1 
ATOM 7252  C CZ  . PHE B 2  449  ? 234.042 156.111 214.709 1.00 370.00 ? 449  PHE B CZ  1 
ATOM 7253  N N   . GLN B 2  450  ? 234.441 161.696 214.564 1.00 370.00 ? 450  GLN B N   1 
ATOM 7254  C CA  . GLN B 2  450  ? 233.765 162.118 213.339 1.00 370.00 ? 450  GLN B CA  1 
ATOM 7255  C C   . GLN B 2  450  ? 234.643 163.022 212.473 1.00 370.00 ? 450  GLN B C   1 
ATOM 7256  O O   . GLN B 2  450  ? 234.574 162.979 211.236 1.00 370.00 ? 450  GLN B O   1 
ATOM 7257  C CB  . GLN B 2  450  ? 232.460 162.810 213.696 1.00 370.00 ? 450  GLN B CB  1 
ATOM 7258  C CG  . GLN B 2  450  ? 231.506 161.859 214.353 1.00 370.00 ? 450  GLN B CG  1 
ATOM 7259  C CD  . GLN B 2  450  ? 230.168 162.468 214.618 1.00 370.00 ? 450  GLN B CD  1 
ATOM 7260  O OE1 . GLN B 2  450  ? 229.943 163.638 214.338 1.00 370.00 ? 450  GLN B OE1 1 
ATOM 7261  N NE2 . GLN B 2  450  ? 229.262 161.677 215.165 1.00 370.00 ? 450  GLN B NE2 1 
ATOM 7262  N N   . CYS B 2  451  ? 235.505 163.801 213.098 1.00 370.00 ? 451  CYS B N   1 
ATOM 7263  C CA  . CYS B 2  451  ? 236.338 164.712 212.328 1.00 370.00 ? 451  CYS B CA  1 
ATOM 7264  C C   . CYS B 2  451  ? 237.414 163.959 211.548 1.00 370.00 ? 451  CYS B C   1 
ATOM 7265  O O   . CYS B 2  451  ? 237.632 164.212 210.348 1.00 370.00 ? 451  CYS B O   1 
ATOM 7266  C CB  . CYS B 2  451  ? 236.929 165.732 213.279 1.00 370.00 ? 451  CYS B CB  1 
ATOM 7267  S SG  . CYS B 2  451  ? 235.645 166.743 214.037 1.00 370.00 ? 451  CYS B SG  1 
ATOM 7268  N N   . LYS B 2  452  ? 238.059 162.991 212.202 1.00 370.00 ? 452  LYS B N   1 
ATOM 7269  C CA  . LYS B 2  452  ? 238.976 162.109 211.499 1.00 370.00 ? 452  LYS B CA  1 
ATOM 7270  C C   . LYS B 2  452  ? 238.262 161.299 210.454 1.00 370.00 ? 452  LYS B C   1 
ATOM 7271  O O   . LYS B 2  452  ? 238.865 160.940 209.442 1.00 370.00 ? 452  LYS B O   1 
ATOM 7272  C CB  . LYS B 2  452  ? 239.690 161.157 212.446 1.00 370.00 ? 452  LYS B CB  1 
ATOM 7273  C CG  . LYS B 2  452  ? 240.843 161.784 213.147 1.00 370.00 ? 452  LYS B CG  1 
ATOM 7274  C CD  . LYS B 2  452  ? 241.567 160.796 214.011 1.00 370.00 ? 452  LYS B CD  1 
ATOM 7275  C CE  . LYS B 2  452  ? 242.381 159.856 213.162 1.00 370.00 ? 452  LYS B CE  1 
ATOM 7276  N NZ  . LYS B 2  452  ? 243.191 158.937 214.005 1.00 370.00 ? 452  LYS B NZ  1 
ATOM 7277  N N   . ALA B 2  453  ? 236.982 161.027 210.670 1.00 370.00 ? 453  ALA B N   1 
ATOM 7278  C CA  . ALA B 2  453  ? 236.207 160.318 209.668 1.00 370.00 ? 453  ALA B CA  1 
ATOM 7279  C C   . ALA B 2  453  ? 236.110 161.122 208.370 1.00 370.00 ? 453  ALA B C   1 
ATOM 7280  O O   . ALA B 2  453  ? 236.386 160.586 207.277 1.00 370.00 ? 453  ALA B O   1 
ATOM 7281  C CB  . ALA B 2  453  ? 234.845 159.988 210.261 1.00 370.00 ? 453  ALA B CB  1 
ATOM 7282  N N   . HIS B 2  454  ? 235.806 162.428 208.490 1.00 370.00 ? 454  HIS B N   1 
ATOM 7283  C CA  . HIS B 2  454  ? 235.826 163.325 207.326 1.00 370.00 ? 454  HIS B CA  1 
ATOM 7284  C C   . HIS B 2  454  ? 237.164 163.290 206.622 1.00 370.00 ? 454  HIS B C   1 
ATOM 7285  O O   . HIS B 2  454  ? 237.252 163.135 205.395 1.00 370.00 ? 454  HIS B O   1 
ATOM 7286  C CB  . HIS B 2  454  ? 235.616 164.771 207.720 1.00 370.00 ? 454  HIS B CB  1 
ATOM 7287  C CG  . HIS B 2  454  ? 234.358 165.043 208.455 1.00 370.00 ? 454  HIS B CG  1 
ATOM 7288  N ND1 . HIS B 2  454  ? 233.115 164.931 207.877 1.00 370.00 ? 454  HIS B ND1 1 
ATOM 7289  C CD2 . HIS B 2  454  ? 234.156 165.543 209.694 1.00 370.00 ? 454  HIS B CD2 1 
ATOM 7290  C CE1 . HIS B 2  454  ? 232.198 165.294 208.757 1.00 370.00 ? 454  HIS B CE1 1 
ATOM 7291  N NE2 . HIS B 2  454  ? 232.803 165.660 209.869 1.00 370.00 ? 454  HIS B NE2 1 
ATOM 7292  N N   . LEU B 2  455  ? 238.222 163.422 207.393 1.00 370.00 ? 455  LEU B N   1 
ATOM 7293  C CA  . LEU B 2  455  ? 239.479 163.686 206.723 1.00 370.00 ? 455  LEU B CA  1 
ATOM 7294  C C   . LEU B 2  455  ? 240.112 162.420 206.170 1.00 370.00 ? 455  LEU B C   1 
ATOM 7295  O O   . LEU B 2  455  ? 240.853 162.478 205.179 1.00 370.00 ? 455  LEU B O   1 
ATOM 7296  C CB  . LEU B 2  455  ? 240.409 164.416 207.674 1.00 370.00 ? 455  LEU B CB  1 
ATOM 7297  C CG  . LEU B 2  455  ? 239.728 165.678 208.214 1.00 370.00 ? 455  LEU B CG  1 
ATOM 7298  C CD1 . LEU B 2  455  ? 240.701 166.457 209.036 1.00 370.00 ? 455  LEU B CD1 1 
ATOM 7299  C CD2 . LEU B 2  455  ? 239.128 166.571 207.149 1.00 370.00 ? 455  LEU B CD2 1 
ATOM 7300  N N   . VAL B 2  456  ? 239.774 161.266 206.727 1.00 370.00 ? 456  VAL B N   1 
ATOM 7301  C CA  . VAL B 2  456  ? 240.276 160.049 206.126 1.00 370.00 ? 456  VAL B CA  1 
ATOM 7302  C C   . VAL B 2  456  ? 239.513 159.733 204.848 1.00 370.00 ? 456  VAL B C   1 
ATOM 7303  O O   . VAL B 2  456  ? 240.097 159.220 203.877 1.00 370.00 ? 456  VAL B O   1 
ATOM 7304  C CB  . VAL B 2  456  ? 240.244 158.933 207.176 1.00 370.00 ? 456  VAL B CB  1 
ATOM 7305  C CG1 . VAL B 2  456  ? 240.546 157.584 206.575 1.00 370.00 ? 456  VAL B CG1 1 
ATOM 7306  C CG2 . VAL B 2  456  ? 241.300 159.230 208.196 1.00 370.00 ? 456  VAL B CG2 1 
ATOM 7307  N N   . MET B 2  457  ? 238.236 160.117 204.767 1.00 370.00 ? 457  MET B N   1 
ATOM 7308  C CA  . MET B 2  457  ? 237.598 160.003 203.458 1.00 370.00 ? 457  MET B CA  1 
ATOM 7309  C C   . MET B 2  457  ? 238.191 160.969 202.441 1.00 370.00 ? 457  MET B C   1 
ATOM 7310  O O   . MET B 2  457  ? 238.224 160.668 201.239 1.00 370.00 ? 457  MET B O   1 
ATOM 7311  C CB  . MET B 2  457  ? 236.114 160.230 203.583 1.00 370.00 ? 457  MET B CB  1 
ATOM 7312  C CG  . MET B 2  457  ? 235.443 159.200 204.415 1.00 370.00 ? 457  MET B CG  1 
ATOM 7313  S SD  . MET B 2  457  ? 235.593 157.531 203.795 1.00 370.00 ? 457  MET B SD  1 
ATOM 7314  C CE  . MET B 2  457  ? 236.672 156.811 205.021 1.00 370.00 ? 457  MET B CE  1 
ATOM 7315  N N   . ARG B 2  458  ? 238.695 162.110 202.902 1.00 370.00 ? 458  ARG B N   1 
ATOM 7316  C CA  . ARG B 2  458  ? 239.442 162.966 201.986 1.00 370.00 ? 458  ARG B CA  1 
ATOM 7317  C C   . ARG B 2  458  ? 240.732 162.319 201.532 1.00 370.00 ? 458  ARG B C   1 
ATOM 7318  O O   . ARG B 2  458  ? 241.167 162.533 200.400 1.00 370.00 ? 458  ARG B O   1 
ATOM 7319  C CB  . ARG B 2  458  ? 239.768 164.283 202.636 1.00 370.00 ? 458  ARG B CB  1 
ATOM 7320  C CG  . ARG B 2  458  ? 238.557 164.996 202.960 1.00 370.00 ? 458  ARG B CG  1 
ATOM 7321  C CD  . ARG B 2  458  ? 238.883 166.340 203.477 1.00 370.00 ? 458  ARG B CD  1 
ATOM 7322  N NE  . ARG B 2  458  ? 237.647 167.024 203.792 1.00 370.00 ? 458  ARG B NE  1 
ATOM 7323  C CZ  . ARG B 2  458  ? 236.949 167.690 202.887 1.00 370.00 ? 458  ARG B CZ  1 
ATOM 7324  N NH1 . ARG B 2  458  ? 237.401 167.765 201.646 1.00 370.00 ? 458  ARG B NH1 1 
ATOM 7325  N NH2 . ARG B 2  458  ? 235.825 168.300 203.217 1.00 370.00 ? 458  ARG B NH2 1 
ATOM 7326  N N   . LEU B 2  459  ? 241.363 161.534 202.394 1.00 370.00 ? 459  LEU B N   1 
ATOM 7327  C CA  . LEU B 2  459  ? 242.525 160.788 201.923 1.00 370.00 ? 459  LEU B CA  1 
ATOM 7328  C C   . LEU B 2  459  ? 242.141 159.724 200.909 1.00 370.00 ? 459  LEU B C   1 
ATOM 7329  O O   . LEU B 2  459  ? 242.921 159.421 199.997 1.00 370.00 ? 459  LEU B O   1 
ATOM 7330  C CB  . LEU B 2  459  ? 243.273 160.175 203.092 1.00 370.00 ? 459  LEU B CB  1 
ATOM 7331  C CG  . LEU B 2  459  ? 244.115 161.235 203.794 1.00 370.00 ? 459  LEU B CG  1 
ATOM 7332  C CD1 . LEU B 2  459  ? 244.757 160.690 205.040 1.00 370.00 ? 459  LEU B CD1 1 
ATOM 7333  C CD2 . LEU B 2  459  ? 245.188 161.711 202.842 1.00 370.00 ? 459  LEU B CD2 1 
ATOM 7334  N N   . ILE B 2  460  ? 240.939 159.174 201.028 1.00 370.00 ? 460  ILE B N   1 
ATOM 7335  C CA  . ILE B 2  460  ? 240.528 158.205 200.026 1.00 370.00 ? 460  ILE B CA  1 
ATOM 7336  C C   . ILE B 2  460  ? 240.200 158.895 198.704 1.00 370.00 ? 460  ILE B C   1 
ATOM 7337  O O   . ILE B 2  460  ? 240.435 158.328 197.629 1.00 370.00 ? 460  ILE B O   1 
ATOM 7338  C CB  . ILE B 2  460  ? 239.393 157.347 200.594 1.00 370.00 ? 460  ILE B CB  1 
ATOM 7339  C CG1 . ILE B 2  460  ? 239.981 156.497 201.715 1.00 370.00 ? 460  ILE B CG1 1 
ATOM 7340  C CG2 . ILE B 2  460  ? 238.798 156.423 199.563 1.00 370.00 ? 460  ILE B CG2 1 
ATOM 7341  C CD1 . ILE B 2  460  ? 238.997 155.631 202.431 1.00 370.00 ? 460  ILE B CD1 1 
ATOM 7342  N N   . GLU B 2  461  ? 239.734 160.145 198.748 1.00 370.00 ? 461  GLU B N   1 
ATOM 7343  C CA  . GLU B 2  461  ? 239.800 160.983 197.547 1.00 370.00 ? 461  GLU B CA  1 
ATOM 7344  C C   . GLU B 2  461  ? 241.223 161.110 197.030 1.00 370.00 ? 461  GLU B C   1 
ATOM 7345  O O   . GLU B 2  461  ? 241.467 161.062 195.820 1.00 370.00 ? 461  GLU B O   1 
ATOM 7346  C CB  . GLU B 2  461  ? 239.304 162.394 197.811 1.00 370.00 ? 461  GLU B CB  1 
ATOM 7347  C CG  . GLU B 2  461  ? 237.865 162.640 197.892 1.00 370.00 ? 461  GLU B CG  1 
ATOM 7348  C CD  . GLU B 2  461  ? 237.607 164.119 198.071 1.00 370.00 ? 461  GLU B CD  1 
ATOM 7349  O OE1 . GLU B 2  461  ? 238.573 164.859 198.350 1.00 370.00 ? 461  GLU B OE1 1 
ATOM 7350  O OE2 . GLU B 2  461  ? 236.458 164.564 197.898 1.00 370.00 ? 461  GLU B OE2 1 
ATOM 7351  N N   . ASN B 2  462  ? 242.170 161.296 197.942 1.00 370.00 ? 462  ASN B N   1 
ATOM 7352  C CA  . ASN B 2  462  ? 243.528 161.597 197.536 1.00 370.00 ? 462  ASN B CA  1 
ATOM 7353  C C   . ASN B 2  462  ? 244.222 160.411 196.911 1.00 370.00 ? 462  ASN B C   1 
ATOM 7354  O O   . ASN B 2  462  ? 245.193 160.602 196.179 1.00 370.00 ? 462  ASN B O   1 
ATOM 7355  C CB  . ASN B 2  462  ? 244.315 162.099 198.726 1.00 370.00 ? 462  ASN B CB  1 
ATOM 7356  C CG  . ASN B 2  462  ? 243.837 163.438 199.171 1.00 370.00 ? 462  ASN B CG  1 
ATOM 7357  O OD1 . ASN B 2  462  ? 243.565 164.302 198.345 1.00 370.00 ? 462  ASN B OD1 1 
ATOM 7358  N ND2 . ASN B 2  462  ? 243.674 163.615 200.472 1.00 370.00 ? 462  ASN B ND2 1 
ATOM 7359  N N   . ARG B 2  463  ? 243.750 159.199 197.162 1.00 370.00 ? 463  ARG B N   1 
ATOM 7360  C CA  . ARG B 2  463  ? 244.284 158.087 196.397 1.00 370.00 ? 463  ARG B CA  1 
ATOM 7361  C C   . ARG B 2  463  ? 243.359 157.598 195.301 1.00 370.00 ? 463  ARG B C   1 
ATOM 7362  O O   . ARG B 2  463  ? 243.821 156.886 194.408 1.00 370.00 ? 463  ARG B O   1 
ATOM 7363  C CB  . ARG B 2  463  ? 244.646 156.909 197.305 1.00 370.00 ? 463  ARG B CB  1 
ATOM 7364  C CG  . ARG B 2  463  ? 245.906 157.165 198.112 1.00 370.00 ? 463  ARG B CG  1 
ATOM 7365  C CD  . ARG B 2  463  ? 246.400 155.947 198.906 1.00 370.00 ? 463  ARG B CD  1 
ATOM 7366  N NE  . ARG B 2  463  ? 247.597 156.284 199.685 1.00 370.00 ? 463  ARG B NE  1 
ATOM 7367  C CZ  . ARG B 2  463  ? 248.256 155.446 200.483 1.00 370.00 ? 463  ARG B CZ  1 
ATOM 7368  N NH1 . ARG B 2  463  ? 247.856 154.199 200.611 1.00 370.00 ? 463  ARG B NH1 1 
ATOM 7369  N NH2 . ARG B 2  463  ? 249.328 155.854 201.146 1.00 370.00 ? 463  ARG B NH2 1 
ATOM 7370  N N   . ILE B 2  464  ? 242.077 157.945 195.331 1.00 370.00 ? 464  ILE B N   1 
ATOM 7371  C CA  . ILE B 2  464  ? 241.097 157.306 194.458 1.00 370.00 ? 464  ILE B CA  1 
ATOM 7372  C C   . ILE B 2  464  ? 240.097 158.337 193.954 1.00 370.00 ? 464  ILE B C   1 
ATOM 7373  O O   . ILE B 2  464  ? 239.662 159.211 194.709 1.00 370.00 ? 464  ILE B O   1 
ATOM 7374  C CB  . ILE B 2  464  ? 240.403 156.124 195.180 1.00 370.00 ? 464  ILE B CB  1 
ATOM 7375  C CG1 . ILE B 2  464  ? 241.307 154.886 195.187 1.00 370.00 ? 464  ILE B CG1 1 
ATOM 7376  C CG2 . ILE B 2  464  ? 239.039 155.769 194.612 1.00 370.00 ? 464  ILE B CG2 1 
ATOM 7377  C CD1 . ILE B 2  464  ? 240.778 153.733 195.992 1.00 370.00 ? 464  ILE B CD1 1 
ATOM 7378  N N   . SER B 2  465  ? 239.774 158.239 192.661 1.00 370.00 ? 465  SER B N   1 
ATOM 7379  C CA  . SER B 2  465  ? 238.761 159.029 191.972 1.00 370.00 ? 465  SER B CA  1 
ATOM 7380  C C   . SER B 2  465  ? 237.435 159.142 192.709 1.00 370.00 ? 465  SER B C   1 
ATOM 7381  O O   . SER B 2  465  ? 236.885 158.155 193.195 1.00 370.00 ? 465  SER B O   1 
ATOM 7382  C CB  . SER B 2  465  ? 238.468 158.404 190.617 1.00 370.00 ? 465  SER B CB  1 
ATOM 7383  O OG  . SER B 2  465  ? 237.273 158.940 190.090 1.00 370.00 ? 465  SER B OG  1 
ATOM 7384  N N   . MET B 2  466  ? 236.909 160.373 192.720 1.00 370.00 ? 466  MET B N   1 
ATOM 7385  C CA  . MET B 2  466  ? 235.541 160.658 193.140 1.00 370.00 ? 466  MET B CA  1 
ATOM 7386  C C   . MET B 2  466  ? 234.524 159.839 192.372 1.00 370.00 ? 466  MET B C   1 
ATOM 7387  O O   . MET B 2  466  ? 233.506 159.425 192.939 1.00 370.00 ? 466  MET B O   1 
ATOM 7388  C CB  . MET B 2  466  ? 235.236 162.130 192.908 1.00 370.00 ? 466  MET B CB  1 
ATOM 7389  C CG  . MET B 2  466  ? 236.012 163.092 193.754 1.00 370.00 ? 466  MET B CG  1 
ATOM 7390  S SD  . MET B 2  466  ? 235.775 164.777 193.145 1.00 370.00 ? 466  MET B SD  1 
ATOM 7391  C CE  . MET B 2  466  ? 234.023 165.022 193.426 1.00 370.00 ? 466  MET B CE  1 
ATOM 7392  N N   . GLU B 2  467  ? 234.755 159.652 191.070 1.00 370.00 ? 467  GLU B N   1 
ATOM 7393  C CA  . GLU B 2  467  ? 233.885 158.803 190.271 1.00 370.00 ? 467  GLU B CA  1 
ATOM 7394  C C   . GLU B 2  467  ? 233.908 157.386 190.796 1.00 370.00 ? 467  GLU B C   1 
ATOM 7395  O O   . GLU B 2  467  ? 232.870 156.725 190.875 1.00 370.00 ? 467  GLU B O   1 
ATOM 7396  C CB  . GLU B 2  467  ? 234.322 158.824 188.812 1.00 370.00 ? 467  GLU B CB  1 
ATOM 7397  C CG  . GLU B 2  467  ? 234.215 160.180 188.156 1.00 370.00 ? 467  GLU B CG  1 
ATOM 7398  C CD  . GLU B 2  467  ? 234.785 160.195 186.744 1.00 370.00 ? 467  GLU B CD  1 
ATOM 7399  O OE1 . GLU B 2  467  ? 235.391 159.184 186.334 1.00 370.00 ? 467  GLU B OE1 1 
ATOM 7400  O OE2 . GLU B 2  467  ? 234.634 161.220 186.045 1.00 370.00 ? 467  GLU B OE2 1 
ATOM 7401  N N   . PHE B 2  468  ? 235.078 156.930 191.223 1.00 370.00 ? 468  PHE B N   1 
ATOM 7402  C CA  . PHE B 2  468  ? 235.152 155.611 191.823 1.00 370.00 ? 468  PHE B CA  1 
ATOM 7403  C C   . PHE B 2  468  ? 234.470 155.593 193.177 1.00 370.00 ? 468  PHE B C   1 
ATOM 7404  O O   . PHE B 2  468  ? 233.985 154.546 193.606 1.00 370.00 ? 468  PHE B O   1 
ATOM 7405  C CB  . PHE B 2  468  ? 236.601 155.169 191.970 1.00 370.00 ? 468  PHE B CB  1 
ATOM 7406  C CG  . PHE B 2  468  ? 237.312 154.931 190.677 1.00 370.00 ? 468  PHE B CG  1 
ATOM 7407  C CD1 . PHE B 2  468  ? 236.621 154.795 189.487 1.00 370.00 ? 468  PHE B CD1 1 
ATOM 7408  C CD2 . PHE B 2  468  ? 238.688 154.825 190.660 1.00 370.00 ? 468  PHE B CD2 1 
ATOM 7409  C CE1 . PHE B 2  468  ? 237.285 154.572 188.308 1.00 370.00 ? 468  PHE B CE1 1 
ATOM 7410  C CE2 . PHE B 2  468  ? 239.363 154.601 189.482 1.00 370.00 ? 468  PHE B CE2 1 
ATOM 7411  C CZ  . PHE B 2  468  ? 238.659 154.474 188.304 1.00 370.00 ? 468  PHE B CZ  1 
ATOM 7412  N N   . MET B 2  469  ? 234.408 156.739 193.853 1.00 370.00 ? 469  MET B N   1 
ATOM 7413  C CA  . MET B 2  469  ? 233.683 156.799 195.113 1.00 370.00 ? 469  MET B CA  1 
ATOM 7414  C C   . MET B 2  469  ? 232.198 156.645 194.871 1.00 370.00 ? 469  MET B C   1 
ATOM 7415  O O   . MET B 2  469  ? 231.513 155.926 195.609 1.00 370.00 ? 469  MET B O   1 
ATOM 7416  C CB  . MET B 2  469  ? 233.985 158.113 195.819 1.00 370.00 ? 469  MET B CB  1 
ATOM 7417  C CG  . MET B 2  469  ? 235.457 158.264 196.023 1.00 370.00 ? 469  MET B CG  1 
ATOM 7418  S SD  . MET B 2  469  ? 236.067 159.808 196.679 1.00 370.00 ? 469  MET B SD  1 
ATOM 7419  C CE  . MET B 2  469  ? 235.792 159.561 198.426 1.00 370.00 ? 469  MET B CE  1 
ATOM 7420  N N   . LEU B 2  470  ? 231.705 157.292 193.815 1.00 370.00 ? 470  LEU B N   1 
ATOM 7421  C CA  . LEU B 2  470  ? 230.336 157.084 193.369 1.00 370.00 ? 470  LEU B CA  1 
ATOM 7422  C C   . LEU B 2  470  ? 230.091 155.628 193.029 1.00 370.00 ? 470  LEU B C   1 
ATOM 7423  O O   . LEU B 2  470  ? 229.047 155.069 193.386 1.00 370.00 ? 470  LEU B O   1 
ATOM 7424  C CB  . LEU B 2  470  ? 230.055 157.948 192.151 1.00 370.00 ? 470  LEU B CB  1 
ATOM 7425  C CG  . LEU B 2  470  ? 230.166 159.443 192.394 1.00 370.00 ? 470  LEU B CG  1 
ATOM 7426  C CD1 . LEU B 2  470  ? 230.021 160.197 191.085 1.00 370.00 ? 470  LEU B CD1 1 
ATOM 7427  C CD2 . LEU B 2  470  ? 229.110 159.867 193.385 1.00 370.00 ? 470  LEU B CD2 1 
ATOM 7428  N N   . GLN B 2  471  ? 231.069 154.997 192.375 1.00 370.00 ? 471  GLN B N   1 
ATOM 7429  C CA  . GLN B 2  471  ? 230.962 153.588 192.011 1.00 370.00 ? 471  GLN B CA  1 
ATOM 7430  C C   . GLN B 2  471  ? 230.852 152.702 193.242 1.00 370.00 ? 471  GLN B C   1 
ATOM 7431  O O   . GLN B 2  471  ? 229.977 151.828 193.313 1.00 370.00 ? 471  GLN B O   1 
ATOM 7432  C CB  . GLN B 2  471  ? 232.169 153.171 191.179 1.00 370.00 ? 471  GLN B CB  1 
ATOM 7433  C CG  . GLN B 2  471  ? 232.219 153.751 189.795 1.00 370.00 ? 471  GLN B CG  1 
ATOM 7434  C CD  . GLN B 2  471  ? 233.476 153.344 189.071 1.00 370.00 ? 471  GLN B CD  1 
ATOM 7435  O OE1 . GLN B 2  471  ? 234.329 152.662 189.635 1.00 370.00 ? 471  GLN B OE1 1 
ATOM 7436  N NE2 . GLN B 2  471  ? 233.602 153.757 187.817 1.00 370.00 ? 471  GLN B NE2 1 
ATOM 7437  N N   . VAL B 2  472  ? 231.727 152.938 194.227 1.00 370.00 ? 472  VAL B N   1 
ATOM 7438  C CA  . VAL B 2  472  ? 231.731 152.159 195.461 1.00 370.00 ? 472  VAL B CA  1 
ATOM 7439  C C   . VAL B 2  472  ? 230.400 152.292 196.171 1.00 370.00 ? 472  VAL B C   1 
ATOM 7440  O O   . VAL B 2  472  ? 229.756 151.289 196.489 1.00 370.00 ? 472  VAL B O   1 
ATOM 7441  C CB  . VAL B 2  472  ? 232.888 152.590 196.378 1.00 370.00 ? 472  VAL B CB  1 
ATOM 7442  C CG1 . VAL B 2  472  ? 232.713 151.981 197.751 1.00 370.00 ? 472  VAL B CG1 1 
ATOM 7443  C CG2 . VAL B 2  472  ? 234.200 152.134 195.813 1.00 370.00 ? 472  VAL B CG2 1 
ATOM 7444  N N   . PHE B 2  473  ? 229.929 153.527 196.332 1.00 370.00 ? 473  PHE B N   1 
ATOM 7445  C CA  . PHE B 2  473  ? 228.752 153.761 197.157 1.00 370.00 ? 473  PHE B CA  1 
ATOM 7446  C C   . PHE B 2  473  ? 227.510 153.239 196.466 1.00 370.00 ? 473  PHE B C   1 
ATOM 7447  O O   . PHE B 2  473  ? 226.596 152.731 197.121 1.00 370.00 ? 473  PHE B O   1 
ATOM 7448  C CB  . PHE B 2  473  ? 228.588 155.247 197.451 1.00 370.00 ? 473  PHE B CB  1 
ATOM 7449  C CG  . PHE B 2  473  ? 229.756 155.873 198.149 1.00 370.00 ? 473  PHE B CG  1 
ATOM 7450  C CD1 . PHE B 2  473  ? 230.652 155.122 198.896 1.00 370.00 ? 473  PHE B CD1 1 
ATOM 7451  C CD2 . PHE B 2  473  ? 229.979 157.229 198.015 1.00 370.00 ? 473  PHE B CD2 1 
ATOM 7452  C CE1 . PHE B 2  473  ? 231.730 155.712 199.491 1.00 370.00 ? 473  PHE B CE1 1 
ATOM 7453  C CE2 . PHE B 2  473  ? 231.058 157.822 198.612 1.00 370.00 ? 473  PHE B CE2 1 
ATOM 7454  C CZ  . PHE B 2  473  ? 231.940 157.063 199.344 1.00 370.00 ? 473  PHE B CZ  1 
ATOM 7455  N N   . ASN B 2  474  ? 227.482 153.324 195.136 1.00 370.00 ? 474  ASN B N   1 
ATOM 7456  C CA  . ASN B 2  474  ? 226.366 152.763 194.396 1.00 370.00 ? 474  ASN B CA  1 
ATOM 7457  C C   . ASN B 2  474  ? 226.356 151.252 194.506 1.00 370.00 ? 474  ASN B C   1 
ATOM 7458  O O   . ASN B 2  474  ? 225.288 150.652 194.631 1.00 370.00 ? 474  ASN B O   1 
ATOM 7459  C CB  . ASN B 2  474  ? 226.433 153.191 192.932 1.00 370.00 ? 474  ASN B CB  1 
ATOM 7460  C CG  . ASN B 2  474  ? 225.128 152.949 192.183 1.00 370.00 ? 474  ASN B CG  1 
ATOM 7461  O OD1 . ASN B 2  474  ? 224.140 152.488 192.750 1.00 370.00 ? 474  ASN B OD1 1 
ATOM 7462  N ND2 . ASN B 2  474  ? 225.124 153.269 190.897 1.00 370.00 ? 474  ASN B ND2 1 
ATOM 7463  N N   . LYS B 2  475  ? 227.533 150.625 194.498 1.00 370.00 ? 475  LYS B N   1 
ATOM 7464  C CA  . LYS B 2  475  ? 227.573 149.182 194.696 1.00 370.00 ? 475  LYS B CA  1 
ATOM 7465  C C   . LYS B 2  475  ? 227.114 148.808 196.095 1.00 370.00 ? 475  LYS B C   1 
ATOM 7466  O O   . LYS B 2  475  ? 226.373 147.830 196.265 1.00 370.00 ? 475  LYS B O   1 
ATOM 7467  C CB  . LYS B 2  475  ? 228.973 148.655 194.426 1.00 370.00 ? 475  LYS B CB  1 
ATOM 7468  C CG  . LYS B 2  475  ? 229.326 148.682 192.960 1.00 370.00 ? 475  LYS B CG  1 
ATOM 7469  C CD  . LYS B 2  475  ? 230.735 148.201 192.730 1.00 370.00 ? 475  LYS B CD  1 
ATOM 7470  C CE  . LYS B 2  475  ? 231.103 148.290 191.266 1.00 370.00 ? 475  LYS B CE  1 
ATOM 7471  N NZ  . LYS B 2  475  ? 232.502 147.839 191.042 1.00 370.00 ? 475  LYS B NZ  1 
ATOM 7472  N N   . LEU B 2  476  ? 227.503 149.618 197.084 1.00 370.00 ? 476  LEU B N   1 
ATOM 7473  C CA  . LEU B 2  476  ? 227.074 149.431 198.466 1.00 370.00 ? 476  LEU B CA  1 
ATOM 7474  C C   . LEU B 2  476  ? 225.565 149.440 198.568 1.00 370.00 ? 476  LEU B C   1 
ATOM 7475  O O   . LEU B 2  476  ? 224.944 148.477 199.035 1.00 370.00 ? 476  LEU B O   1 
ATOM 7476  C CB  . LEU B 2  476  ? 227.621 150.553 199.345 1.00 370.00 ? 476  LEU B CB  1 
ATOM 7477  C CG  . LEU B 2  476  ? 229.111 150.779 199.569 1.00 370.00 ? 476  LEU B CG  1 
ATOM 7478  C CD1 . LEU B 2  476  ? 229.344 152.043 200.382 1.00 370.00 ? 476  LEU B CD1 1 
ATOM 7479  C CD2 . LEU B 2  476  ? 229.765 149.581 200.209 1.00 370.00 ? 476  LEU B CD2 1 
ATOM 7480  N N   . LEU B 2  477  ? 224.963 150.505 198.076 1.00 370.00 ? 477  LEU B N   1 
ATOM 7481  C CA  . LEU B 2  477  ? 223.546 150.687 198.288 1.00 370.00 ? 477  LEU B CA  1 
ATOM 7482  C C   . LEU B 2  477  ? 222.735 149.802 197.366 1.00 370.00 ? 477  LEU B C   1 
ATOM 7483  O O   . LEU B 2  477  ? 221.604 149.442 197.700 1.00 370.00 ? 477  LEU B O   1 
ATOM 7484  C CB  . LEU B 2  477  ? 223.223 152.154 198.110 1.00 370.00 ? 477  LEU B CB  1 
ATOM 7485  C CG  . LEU B 2  477  ? 224.092 152.858 199.148 1.00 370.00 ? 477  LEU B CG  1 
ATOM 7486  C CD1 . LEU B 2  477  ? 224.075 154.330 198.914 1.00 370.00 ? 477  LEU B CD1 1 
ATOM 7487  C CD2 . LEU B 2  477  ? 223.652 152.534 200.553 1.00 370.00 ? 477  LEU B CD2 1 
ATOM 7488  N N   . SER B 2  478  ? 223.317 149.395 196.241 1.00 370.00 ? 478  SER B N   1 
ATOM 7489  C CA  . SER B 2  478  ? 222.676 148.414 195.385 1.00 370.00 ? 478  SER B CA  1 
ATOM 7490  C C   . SER B 2  478  ? 222.564 147.084 196.097 1.00 370.00 ? 478  SER B C   1 
ATOM 7491  O O   . SER B 2  478  ? 221.481 146.493 196.153 1.00 370.00 ? 478  SER B O   1 
ATOM 7492  C CB  . SER B 2  478  ? 223.477 148.247 194.104 1.00 370.00 ? 478  SER B CB  1 
ATOM 7493  O OG  . SER B 2  478  ? 224.706 147.614 194.402 1.00 370.00 ? 478  SER B OG  1 
ATOM 7494  N N   . LEU B 2  479  ? 223.675 146.616 196.674 1.00 370.00 ? 479  LEU B N   1 
ATOM 7495  C CA  . LEU B 2  479  ? 223.655 145.350 197.391 1.00 370.00 ? 479  LEU B CA  1 
ATOM 7496  C C   . LEU B 2  479  ? 222.765 145.419 198.621 1.00 370.00 ? 479  LEU B C   1 
ATOM 7497  O O   . LEU B 2  479  ? 222.085 144.441 198.948 1.00 370.00 ? 479  LEU B O   1 
ATOM 7498  C CB  . LEU B 2  479  ? 225.077 144.954 197.777 1.00 370.00 ? 479  LEU B CB  1 
ATOM 7499  C CG  . LEU B 2  479  ? 226.019 144.643 196.610 1.00 370.00 ? 479  LEU B CG  1 
ATOM 7500  C CD1 . LEU B 2  479  ? 227.446 144.435 197.086 1.00 370.00 ? 479  LEU B CD1 1 
ATOM 7501  C CD2 . LEU B 2  479  ? 225.531 143.445 195.827 1.00 370.00 ? 479  LEU B CD2 1 
ATOM 7502  N N   . ALA B 2  480  ? 222.702 146.582 199.266 1.00 370.00 ? 480  ALA B N   1 
ATOM 7503  C CA  . ALA B 2  480  ? 221.881 146.712 200.463 1.00 370.00 ? 480  ALA B CA  1 
ATOM 7504  C C   . ALA B 2  480  ? 220.397 146.735 200.124 1.00 370.00 ? 480  ALA B C   1 
ATOM 7505  O O   . ALA B 2  480  ? 219.611 145.965 200.688 1.00 370.00 ? 480  ALA B O   1 
ATOM 7506  C CB  . ALA B 2  480  ? 222.272 147.971 201.224 1.00 370.00 ? 480  ALA B CB  1 
ATOM 7507  N N   . SER B 2  481  ? 219.992 147.622 199.213 1.00 370.00 ? 481  SER B N   1 
ATOM 7508  C CA  . SER B 2  481  ? 218.597 147.725 198.821 1.00 370.00 ? 481  SER B CA  1 
ATOM 7509  C C   . SER B 2  481  ? 218.114 146.488 198.094 1.00 370.00 ? 481  SER B C   1 
ATOM 7510  O O   . SER B 2  481  ? 216.916 146.196 198.119 1.00 370.00 ? 481  SER B O   1 
ATOM 7511  C CB  . SER B 2  481  ? 218.406 148.948 197.943 1.00 370.00 ? 481  SER B CB  1 
ATOM 7512  O OG  . SER B 2  481  ? 219.182 148.809 196.772 1.00 370.00 ? 481  SER B OG  1 
ATOM 7513  N N   . THR B 2  482  ? 219.020 145.756 197.455 1.00 370.00 ? 482  THR B N   1 
ATOM 7514  C CA  . THR B 2  482  ? 218.686 144.430 196.975 1.00 370.00 ? 482  THR B CA  1 
ATOM 7515  C C   . THR B 2  482  ? 218.429 143.496 198.139 1.00 370.00 ? 482  THR B C   1 
ATOM 7516  O O   . THR B 2  482  ? 217.403 142.808 198.179 1.00 370.00 ? 482  THR B O   1 
ATOM 7517  C CB  . THR B 2  482  ? 219.825 143.896 196.121 1.00 370.00 ? 482  THR B CB  1 
ATOM 7518  O OG1 . THR B 2  482  ? 220.104 144.827 195.072 1.00 370.00 ? 482  THR B OG1 1 
ATOM 7519  C CG2 . THR B 2  482  ? 219.445 142.566 195.517 1.00 370.00 ? 482  THR B CG2 1 
ATOM 7520  N N   . ALA B 2  483  ? 219.333 143.493 199.121 1.00 370.00 ? 483  ALA B N   1 
ATOM 7521  C CA  . ALA B 2  483  ? 219.216 142.616 200.276 1.00 370.00 ? 483  ALA B CA  1 
ATOM 7522  C C   . ALA B 2  483  ? 218.083 143.013 201.207 1.00 370.00 ? 483  ALA B C   1 
ATOM 7523  O O   . ALA B 2  483  ? 217.746 142.239 202.109 1.00 370.00 ? 483  ALA B O   1 
ATOM 7524  C CB  . ALA B 2  483  ? 220.534 142.593 201.049 1.00 370.00 ? 483  ALA B CB  1 
ATOM 7525  N N   . SER B 2  484  ? 217.496 144.185 201.017 1.00 370.00 ? 484  SER B N   1 
ATOM 7526  C CA  . SER B 2  484  ? 216.342 144.601 201.784 1.00 370.00 ? 484  SER B CA  1 
ATOM 7527  C C   . SER B 2  484  ? 215.071 144.229 201.038 1.00 370.00 ? 484  SER B C   1 
ATOM 7528  O O   . SER B 2  484  ? 215.106 143.744 199.903 1.00 370.00 ? 484  SER B O   1 
ATOM 7529  C CB  . SER B 2  484  ? 216.382 146.104 202.035 1.00 370.00 ? 484  SER B CB  1 
ATOM 7530  O OG  . SER B 2  484  ? 216.164 146.795 200.820 1.00 370.00 ? 484  SER B OG  1 
ATOM 7531  N N   . SER B 2  485  ? 213.937 144.465 201.709 1.00 370.00 ? 485  SER B N   1 
ATOM 7532  C CA  . SER B 2  485  ? 212.600 144.530 201.106 1.00 370.00 ? 485  SER B CA  1 
ATOM 7533  C C   . SER B 2  485  ? 212.192 143.216 200.449 1.00 370.00 ? 485  SER B C   1 
ATOM 7534  O O   . SER B 2  485  ? 211.672 143.196 199.334 1.00 370.00 ? 485  SER B O   1 
ATOM 7535  C CB  . SER B 2  485  ? 212.494 145.686 200.104 1.00 370.00 ? 485  SER B CB  1 
ATOM 7536  O OG  . SER B 2  485  ? 213.249 145.445 198.927 1.00 370.00 ? 485  SER B OG  1 
ATOM 7537  N N   . GLN B 2  486  ? 212.447 142.105 201.129 1.00 370.00 ? 486  GLN B N   1 
ATOM 7538  C CA  . GLN B 2  486  ? 212.137 140.795 200.577 1.00 370.00 ? 486  GLN B CA  1 
ATOM 7539  C C   . GLN B 2  486  ? 211.466 139.967 201.662 1.00 370.00 ? 486  GLN B C   1 
ATOM 7540  O O   . GLN B 2  486  ? 211.105 140.475 202.727 1.00 370.00 ? 486  GLN B O   1 
ATOM 7541  C CB  . GLN B 2  486  ? 213.403 140.138 200.019 1.00 370.00 ? 486  GLN B CB  1 
ATOM 7542  C CG  . GLN B 2  486  ? 213.905 140.792 198.748 1.00 370.00 ? 486  GLN B CG  1 
ATOM 7543  C CD  . GLN B 2  486  ? 215.240 140.270 198.331 1.00 370.00 ? 486  GLN B CD  1 
ATOM 7544  O OE1 . GLN B 2  486  ? 215.843 139.474 199.037 1.00 370.00 ? 486  GLN B OE1 1 
ATOM 7545  N NE2 . GLN B 2  486  ? 215.724 140.721 197.183 1.00 370.00 ? 486  GLN B NE2 1 
ATOM 7546  N N   . LYS B 2  487  ? 211.330 138.666 201.404 1.00 370.00 ? 487  LYS B N   1 
ATOM 7547  C CA  . LYS B 2  487  ? 210.588 137.756 202.268 1.00 370.00 ? 487  LYS B CA  1 
ATOM 7548  C C   . LYS B 2  487  ? 211.443 137.251 203.434 1.00 370.00 ? 487  LYS B C   1 
ATOM 7549  O O   . LYS B 2  487  ? 211.120 136.219 204.041 1.00 370.00 ? 487  LYS B O   1 
ATOM 7550  C CB  . LYS B 2  487  ? 210.052 136.591 201.425 1.00 370.00 ? 487  LYS B CB  1 
ATOM 7551  C CG  . LYS B 2  487  ? 208.837 135.825 201.972 1.00 370.00 ? 487  LYS B CG  1 
ATOM 7552  C CD  . LYS B 2  487  ? 208.503 134.624 201.117 1.00 370.00 ? 487  LYS B CD  1 
ATOM 7553  C CE  . LYS B 2  487  ? 207.359 133.835 201.728 1.00 370.00 ? 487  LYS B CE  1 
ATOM 7554  N NZ  . LYS B 2  487  ? 207.028 132.627 200.928 1.00 370.00 ? 487  LYS B NZ  1 
ATOM 7555  N N   . PHE B 2  488  ? 212.509 137.983 203.777 1.00 370.00 ? 488  PHE B N   1 
ATOM 7556  C CA  . PHE B 2  488  ? 213.586 137.523 204.644 1.00 370.00 ? 488  PHE B CA  1 
ATOM 7557  C C   . PHE B 2  488  ? 214.179 136.252 204.080 1.00 370.00 ? 488  PHE B C   1 
ATOM 7558  O O   . PHE B 2  488  ? 213.726 135.151 204.418 1.00 370.00 ? 488  PHE B O   1 
ATOM 7559  C CB  . PHE B 2  488  ? 213.211 137.312 206.107 1.00 370.00 ? 488  PHE B CB  1 
ATOM 7560  C CG  . PHE B 2  488  ? 214.384 136.906 206.941 1.00 370.00 ? 488  PHE B CG  1 
ATOM 7561  C CD1 . PHE B 2  488  ? 215.377 137.824 207.232 1.00 370.00 ? 488  PHE B CD1 1 
ATOM 7562  C CD2 . PHE B 2  488  ? 214.522 135.608 207.405 1.00 370.00 ? 488  PHE B CD2 1 
ATOM 7563  C CE1 . PHE B 2  488  ? 216.467 137.465 207.990 1.00 370.00 ? 488  PHE B CE1 1 
ATOM 7564  C CE2 . PHE B 2  488  ? 215.619 135.246 208.156 1.00 370.00 ? 488  PHE B CE2 1 
ATOM 7565  C CZ  . PHE B 2  488  ? 216.595 136.178 208.443 1.00 370.00 ? 488  PHE B CZ  1 
ATOM 7566  N N   . GLN B 2  489  ? 215.023 136.415 203.074 1.00 370.00 ? 489  GLN B N   1 
ATOM 7567  C CA  . GLN B 2  489  ? 215.973 135.374 202.742 1.00 370.00 ? 489  GLN B CA  1 
ATOM 7568  C C   . GLN B 2  489  ? 216.621 134.872 204.020 1.00 370.00 ? 489  GLN B C   1 
ATOM 7569  O O   . GLN B 2  489  ? 217.375 135.593 204.682 1.00 370.00 ? 489  GLN B O   1 
ATOM 7570  C CB  . GLN B 2  489  ? 217.041 135.920 201.814 1.00 370.00 ? 489  GLN B CB  1 
ATOM 7571  C CG  . GLN B 2  489  ? 216.497 136.477 200.542 1.00 370.00 ? 489  GLN B CG  1 
ATOM 7572  C CD  . GLN B 2  489  ? 217.592 137.057 199.691 1.00 370.00 ? 489  GLN B CD  1 
ATOM 7573  O OE1 . GLN B 2  489  ? 218.756 137.068 200.087 1.00 370.00 ? 489  GLN B OE1 1 
ATOM 7574  N NE2 . GLN B 2  489  ? 217.227 137.567 198.522 1.00 370.00 ? 489  GLN B NE2 1 
ATOM 7575  N N   . SER B 2  490  ? 216.297 133.639 204.372 1.00 370.00 ? 490  SER B N   1 
ATOM 7576  C CA  . SER B 2  490  ? 216.801 133.043 205.589 1.00 370.00 ? 490  SER B CA  1 
ATOM 7577  C C   . SER B 2  490  ? 218.253 132.674 205.376 1.00 370.00 ? 490  SER B C   1 
ATOM 7578  O O   . SER B 2  490  ? 218.628 132.229 204.286 1.00 370.00 ? 490  SER B O   1 
ATOM 7579  C CB  . SER B 2  490  ? 215.977 131.814 205.954 1.00 370.00 ? 490  SER B CB  1 
ATOM 7580  O OG  . SER B 2  490  ? 214.623 132.175 206.157 1.00 370.00 ? 490  SER B OG  1 
ATOM 7581  N N   . HIS B 2  491  ? 219.083 132.966 206.386 1.00 370.00 ? 491  HIS B N   1 
ATOM 7582  C CA  . HIS B 2  491  ? 220.527 132.718 206.437 1.00 370.00 ? 491  HIS B CA  1 
ATOM 7583  C C   . HIS B 2  491  ? 221.300 133.558 205.412 1.00 370.00 ? 491  HIS B C   1 
ATOM 7584  O O   . HIS B 2  491  ? 222.525 133.438 205.307 1.00 370.00 ? 491  HIS B O   1 
ATOM 7585  C CB  . HIS B 2  491  ? 220.810 131.206 206.286 1.00 370.00 ? 491  HIS B CB  1 
ATOM 7586  C CG  . HIS B 2  491  ? 222.202 130.779 206.635 1.00 370.00 ? 491  HIS B CG  1 
ATOM 7587  N ND1 . HIS B 2  491  ? 223.233 130.795 205.721 1.00 370.00 ? 491  HIS B ND1 1 
ATOM 7588  C CD2 . HIS B 2  491  ? 222.725 130.292 207.784 1.00 370.00 ? 491  HIS B CD2 1 
ATOM 7589  C CE1 . HIS B 2  491  ? 224.336 130.354 206.297 1.00 370.00 ? 491  HIS B CE1 1 
ATOM 7590  N NE2 . HIS B 2  491  ? 224.056 130.043 207.550 1.00 370.00 ? 491  HIS B NE2 1 
ATOM 7591  N N   . MET B 2  492  ? 220.625 134.446 204.676 1.00 370.00 ? 492  MET B N   1 
ATOM 7592  C CA  . MET B 2  492  ? 221.181 135.119 203.506 1.00 370.00 ? 492  MET B CA  1 
ATOM 7593  C C   . MET B 2  492  ? 220.785 136.588 203.499 1.00 370.00 ? 492  MET B C   1 
ATOM 7594  O O   . MET B 2  492  ? 220.381 137.132 202.469 1.00 370.00 ? 492  MET B O   1 
ATOM 7595  C CB  . MET B 2  492  ? 220.711 134.439 202.218 1.00 370.00 ? 492  MET B CB  1 
ATOM 7596  C CG  . MET B 2  492  ? 221.212 133.009 202.022 1.00 370.00 ? 492  MET B CG  1 
ATOM 7597  S SD  . MET B 2  492  ? 220.459 132.158 200.625 1.00 370.00 ? 492  MET B SD  1 
ATOM 7598  C CE  . MET B 2  492  ? 221.212 133.030 199.259 1.00 370.00 ? 492  MET B CE  1 
ATOM 7599  N N   . TRP B 2  493  ? 220.892 137.258 204.643 1.00 370.00 ? 493  TRP B N   1 
ATOM 7600  C CA  . TRP B 2  493  ? 220.212 138.533 204.819 1.00 370.00 ? 493  TRP B CA  1 
ATOM 7601  C C   . TRP B 2  493  ? 221.072 139.657 205.386 1.00 370.00 ? 493  TRP B C   1 
ATOM 7602  O O   . TRP B 2  493  ? 220.711 140.828 205.217 1.00 370.00 ? 493  TRP B O   1 
ATOM 7603  C CB  . TRP B 2  493  ? 219.004 138.337 205.738 1.00 370.00 ? 493  TRP B CB  1 
ATOM 7604  C CG  . TRP B 2  493  ? 218.058 139.458 205.734 1.00 370.00 ? 493  TRP B CG  1 
ATOM 7605  C CD1 . TRP B 2  493  ? 217.924 140.426 206.674 1.00 370.00 ? 493  TRP B CD1 1 
ATOM 7606  C CD2 . TRP B 2  493  ? 217.091 139.733 204.728 1.00 370.00 ? 493  TRP B CD2 1 
ATOM 7607  N NE1 . TRP B 2  493  ? 216.928 141.293 206.316 1.00 370.00 ? 493  TRP B NE1 1 
ATOM 7608  C CE2 . TRP B 2  493  ? 216.399 140.889 205.121 1.00 370.00 ? 493  TRP B CE2 1 
ATOM 7609  C CE3 . TRP B 2  493  ? 216.742 139.113 203.528 1.00 370.00 ? 493  TRP B CE3 1 
ATOM 7610  C CZ2 . TRP B 2  493  ? 215.375 141.437 204.359 1.00 370.00 ? 493  TRP B CZ2 1 
ATOM 7611  C CZ3 . TRP B 2  493  ? 215.727 139.659 202.768 1.00 370.00 ? 493  TRP B CZ3 1 
ATOM 7612  C CH2 . TRP B 2  493  ? 215.051 140.805 203.187 1.00 370.00 ? 493  TRP B CH2 1 
ATOM 7613  N N   . SER B 2  494  ? 222.212 139.355 206.004 1.00 370.00 ? 494  SER B N   1 
ATOM 7614  C CA  . SER B 2  494  ? 222.974 140.342 206.756 1.00 370.00 ? 494  SER B CA  1 
ATOM 7615  C C   . SER B 2  494  ? 223.928 141.127 205.886 1.00 370.00 ? 494  SER B C   1 
ATOM 7616  O O   . SER B 2  494  ? 224.964 141.593 206.369 1.00 370.00 ? 494  SER B O   1 
ATOM 7617  C CB  . SER B 2  494  ? 223.749 139.668 207.882 1.00 370.00 ? 494  SER B CB  1 
ATOM 7618  O OG  . SER B 2  494  ? 224.798 138.882 207.350 1.00 370.00 ? 494  SER B OG  1 
ATOM 7619  N N   . GLN B 2  495  ? 223.615 141.277 204.606 1.00 370.00 ? 495  GLN B N   1 
ATOM 7620  C CA  . GLN B 2  495  ? 224.446 142.060 203.715 1.00 370.00 ? 495  GLN B CA  1 
ATOM 7621  C C   . GLN B 2  495  ? 224.365 143.551 203.992 1.00 370.00 ? 495  GLN B C   1 
ATOM 7622  O O   . GLN B 2  495  ? 225.159 144.307 203.431 1.00 370.00 ? 495  GLN B O   1 
ATOM 7623  C CB  . GLN B 2  495  ? 224.038 141.765 202.282 1.00 370.00 ? 495  GLN B CB  1 
ATOM 7624  C CG  . GLN B 2  495  ? 224.269 140.320 201.906 1.00 370.00 ? 495  GLN B CG  1 
ATOM 7625  C CD  . GLN B 2  495  ? 223.765 139.986 200.519 1.00 370.00 ? 495  GLN B CD  1 
ATOM 7626  O OE1 . GLN B 2  495  ? 223.155 140.818 199.850 1.00 370.00 ? 495  GLN B OE1 1 
ATOM 7627  N NE2 . GLN B 2  495  ? 224.019 138.758 200.077 1.00 370.00 ? 495  GLN B NE2 1 
ATOM 7628  N N   . MET B 2  496  ? 223.432 143.991 204.824 1.00 370.00 ? 496  MET B N   1 
ATOM 7629  C CA  . MET B 2  496  ? 223.357 145.380 205.235 1.00 370.00 ? 496  MET B CA  1 
ATOM 7630  C C   . MET B 2  496  ? 224.288 145.702 206.393 1.00 370.00 ? 496  MET B C   1 
ATOM 7631  O O   . MET B 2  496  ? 224.414 146.865 206.770 1.00 370.00 ? 496  MET B O   1 
ATOM 7632  C CB  . MET B 2  496  ? 221.915 145.705 205.574 1.00 370.00 ? 496  MET B CB  1 
ATOM 7633  C CG  . MET B 2  496  ? 221.060 145.607 204.340 1.00 370.00 ? 496  MET B CG  1 
ATOM 7634  S SD  . MET B 2  496  ? 219.303 145.669 204.676 1.00 370.00 ? 496  MET B SD  1 
ATOM 7635  C CE  . MET B 2  496  ? 219.110 147.355 205.211 1.00 370.00 ? 496  MET B CE  1 
ATOM 7636  N N   . LEU B 2  497  ? 224.968 144.717 206.947 1.00 370.00 ? 497  LEU B N   1 
ATOM 7637  C CA  . LEU B 2  497  ? 226.140 144.989 207.767 1.00 370.00 ? 497  LEU B CA  1 
ATOM 7638  C C   . LEU B 2  497  ? 227.334 145.113 206.846 1.00 370.00 ? 497  LEU B C   1 
ATOM 7639  O O   . LEU B 2  497  ? 227.920 144.115 206.429 1.00 370.00 ? 497  LEU B O   1 
ATOM 7640  C CB  . LEU B 2  497  ? 226.351 143.888 208.784 1.00 370.00 ? 497  LEU B CB  1 
ATOM 7641  C CG  . LEU B 2  497  ? 225.411 143.972 209.964 1.00 370.00 ? 497  LEU B CG  1 
ATOM 7642  C CD1 . LEU B 2  497  ? 225.574 142.755 210.835 1.00 370.00 ? 497  LEU B CD1 1 
ATOM 7643  C CD2 . LEU B 2  497  ? 225.780 145.187 210.729 1.00 370.00 ? 497  LEU B CD2 1 
ATOM 7644  N N   . VAL B 2  498  ? 227.717 146.341 206.542 1.00 370.00 ? 498  VAL B N   1 
ATOM 7645  C CA  . VAL B 2  498  ? 228.602 146.596 205.415 1.00 370.00 ? 498  VAL B CA  1 
ATOM 7646  C C   . VAL B 2  498  ? 229.897 147.153 205.997 1.00 370.00 ? 498  VAL B C   1 
ATOM 7647  O O   . VAL B 2  498  ? 230.403 148.193 205.564 1.00 370.00 ? 498  VAL B O   1 
ATOM 7648  C CB  . VAL B 2  498  ? 227.951 147.538 204.381 1.00 370.00 ? 498  VAL B CB  1 
ATOM 7649  C CG1 . VAL B 2  498  ? 228.642 147.453 203.024 1.00 370.00 ? 498  VAL B CG1 1 
ATOM 7650  C CG2 . VAL B 2  498  ? 226.483 147.260 204.219 1.00 370.00 ? 498  VAL B CG2 1 
ATOM 7651  N N   . SER B 2  499  ? 230.385 146.526 207.058 1.00 370.00 ? 499  SER B N   1 
ATOM 7652  C CA  . SER B 2  499  ? 231.462 147.087 207.862 1.00 370.00 ? 499  SER B CA  1 
ATOM 7653  C C   . SER B 2  499  ? 232.807 147.044 207.133 1.00 370.00 ? 499  SER B C   1 
ATOM 7654  O O   . SER B 2  499  ? 232.909 146.685 205.956 1.00 370.00 ? 499  SER B O   1 
ATOM 7655  C CB  . SER B 2  499  ? 231.565 146.347 209.185 1.00 370.00 ? 499  SER B CB  1 
ATOM 7656  O OG  . SER B 2  499  ? 232.055 145.038 208.973 1.00 370.00 ? 499  SER B OG  1 
ATOM 7657  N N   . THR B 2  500  ? 233.858 147.349 207.907 1.00 370.00 ? 500  THR B N   1 
ATOM 7658  C CA  . THR B 2  500  ? 235.132 147.867 207.408 1.00 370.00 ? 500  THR B CA  1 
ATOM 7659  C C   . THR B 2  500  ? 235.815 146.922 206.432 1.00 370.00 ? 500  THR B C   1 
ATOM 7660  O O   . THR B 2  500  ? 236.295 147.350 205.376 1.00 370.00 ? 500  THR B O   1 
ATOM 7661  C CB  . THR B 2  500  ? 236.053 148.134 208.602 1.00 370.00 ? 500  THR B CB  1 
ATOM 7662  O OG1 . THR B 2  500  ? 235.451 149.091 209.482 1.00 370.00 ? 500  THR B OG1 1 
ATOM 7663  C CG2 . THR B 2  500  ? 237.394 148.652 208.157 1.00 370.00 ? 500  THR B CG2 1 
ATOM 7664  N N   . SER B 2  501  ? 235.830 145.632 206.758 1.00 370.00 ? 501  SER B N   1 
ATOM 7665  C CA  . SER B 2  501  ? 236.664 144.671 206.049 1.00 370.00 ? 501  SER B CA  1 
ATOM 7666  C C   . SER B 2  501  ? 236.185 144.457 204.622 1.00 370.00 ? 501  SER B C   1 
ATOM 7667  O O   . SER B 2  501  ? 236.925 144.704 203.664 1.00 370.00 ? 501  SER B O   1 
ATOM 7668  C CB  . SER B 2  501  ? 236.666 143.354 206.812 1.00 370.00 ? 501  SER B CB  1 
ATOM 7669  O OG  . SER B 2  501  ? 235.366 142.802 206.810 1.00 370.00 ? 501  SER B OG  1 
ATOM 7670  N N   . GLY B 2  502  ? 234.939 144.011 204.461 1.00 370.00 ? 502  GLY B N   1 
ATOM 7671  C CA  . GLY B 2  502  ? 234.405 143.797 203.129 1.00 370.00 ? 502  GLY B CA  1 
ATOM 7672  C C   . GLY B 2  502  ? 234.235 145.081 202.350 1.00 370.00 ? 502  GLY B C   1 
ATOM 7673  O O   . GLY B 2  502  ? 234.284 145.076 201.118 1.00 370.00 ? 502  GLY B O   1 
ATOM 7674  N N   . PHE B 2  503  ? 234.059 146.196 203.054 1.00 370.00 ? 503  PHE B N   1 
ATOM 7675  C CA  . PHE B 2  503  ? 234.038 147.494 202.402 1.00 370.00 ? 503  PHE B CA  1 
ATOM 7676  C C   . PHE B 2  503  ? 235.369 147.815 201.761 1.00 370.00 ? 503  PHE B C   1 
ATOM 7677  O O   . PHE B 2  503  ? 235.425 148.237 200.603 1.00 370.00 ? 503  PHE B O   1 
ATOM 7678  C CB  . PHE B 2  503  ? 233.690 148.565 203.408 1.00 370.00 ? 503  PHE B CB  1 
ATOM 7679  C CG  . PHE B 2  503  ? 233.973 149.919 202.924 1.00 370.00 ? 503  PHE B CG  1 
ATOM 7680  C CD1 . PHE B 2  503  ? 233.261 150.446 201.872 1.00 370.00 ? 503  PHE B CD1 1 
ATOM 7681  C CD2 . PHE B 2  503  ? 234.943 150.681 203.528 1.00 370.00 ? 503  PHE B CD2 1 
ATOM 7682  C CE1 . PHE B 2  503  ? 233.523 151.706 201.419 1.00 370.00 ? 503  PHE B CE1 1 
ATOM 7683  C CE2 . PHE B 2  503  ? 235.194 151.953 203.097 1.00 370.00 ? 503  PHE B CE2 1 
ATOM 7684  C CZ  . PHE B 2  503  ? 234.491 152.466 202.035 1.00 370.00 ? 503  PHE B CZ  1 
ATOM 7685  N N   . LEU B 2  504  ? 236.438 147.685 202.539 1.00 370.00 ? 504  LEU B N   1 
ATOM 7686  C CA  . LEU B 2  504  ? 237.801 147.751 202.036 1.00 370.00 ? 504  LEU B CA  1 
ATOM 7687  C C   . LEU B 2  504  ? 238.020 146.835 200.841 1.00 370.00 ? 504  LEU B C   1 
ATOM 7688  O O   . LEU B 2  504  ? 238.652 147.228 199.845 1.00 370.00 ? 504  LEU B O   1 
ATOM 7689  C CB  . LEU B 2  504  ? 238.738 147.368 203.171 1.00 370.00 ? 504  LEU B CB  1 
ATOM 7690  C CG  . LEU B 2  504  ? 240.183 147.123 202.787 1.00 370.00 ? 504  LEU B CG  1 
ATOM 7691  C CD1 . LEU B 2  504  ? 240.799 148.402 202.271 1.00 370.00 ? 504  LEU B CD1 1 
ATOM 7692  C CD2 . LEU B 2  504  ? 240.932 146.560 203.977 1.00 370.00 ? 504  LEU B CD2 1 
ATOM 7693  N N   . LYS B 2  505  ? 237.516 145.604 200.946 1.00 370.00 ? 505  LYS B N   1 
ATOM 7694  C CA  . LYS B 2  505  ? 237.600 144.651 199.849 1.00 370.00 ? 505  LYS B CA  1 
ATOM 7695  C C   . LYS B 2  505  ? 236.920 145.187 198.605 1.00 370.00 ? 505  LYS B C   1 
ATOM 7696  O O   . LYS B 2  505  ? 237.465 145.088 197.506 1.00 370.00 ? 505  LYS B O   1 
ATOM 7697  C CB  . LYS B 2  505  ? 236.965 143.330 200.259 1.00 370.00 ? 505  LYS B CB  1 
ATOM 7698  C CG  . LYS B 2  505  ? 237.708 142.585 201.336 1.00 370.00 ? 505  LYS B CG  1 
ATOM 7699  C CD  . LYS B 2  505  ? 236.957 141.323 201.716 1.00 370.00 ? 505  LYS B CD  1 
ATOM 7700  C CE  . LYS B 2  505  ? 237.642 140.584 202.847 1.00 370.00 ? 505  LYS B CE  1 
ATOM 7701  N NZ  . LYS B 2  505  ? 236.883 139.365 203.235 1.00 370.00 ? 505  LYS B NZ  1 
ATOM 7702  N N   . SER B 2  506  ? 235.755 145.808 198.773 1.00 370.00 ? 506  SER B N   1 
ATOM 7703  C CA  . SER B 2  506  ? 235.031 146.356 197.635 1.00 370.00 ? 506  SER B CA  1 
ATOM 7704  C C   . SER B 2  506  ? 235.738 147.560 197.037 1.00 370.00 ? 506  SER B C   1 
ATOM 7705  O O   . SER B 2  506  ? 235.657 147.780 195.821 1.00 370.00 ? 506  SER B O   1 
ATOM 7706  C CB  . SER B 2  506  ? 233.621 146.744 198.055 1.00 370.00 ? 506  SER B CB  1 
ATOM 7707  O OG  . SER B 2  506  ? 232.936 147.346 196.974 1.00 370.00 ? 506  SER B OG  1 
ATOM 7708  N N   . ILE B 2  507  ? 236.406 148.349 197.881 1.00 370.00 ? 507  ILE B N   1 
ATOM 7709  C CA  . ILE B 2  507  ? 237.235 149.445 197.391 1.00 370.00 ? 507  ILE B CA  1 
ATOM 7710  C C   . ILE B 2  507  ? 238.300 148.916 196.457 1.00 370.00 ? 507  ILE B C   1 
ATOM 7711  O O   . ILE B 2  507  ? 238.426 149.352 195.305 1.00 370.00 ? 507  ILE B O   1 
ATOM 7712  C CB  . ILE B 2  507  ? 237.908 150.181 198.551 1.00 370.00 ? 507  ILE B CB  1 
ATOM 7713  C CG1 . ILE B 2  507  ? 236.916 150.804 199.491 1.00 370.00 ? 507  ILE B CG1 1 
ATOM 7714  C CG2 . ILE B 2  507  ? 238.784 151.256 198.000 1.00 370.00 ? 507  ILE B CG2 1 
ATOM 7715  C CD1 . ILE B 2  507  ? 237.618 151.223 200.714 1.00 370.00 ? 507  ILE B CD1 1 
ATOM 7716  N N   . SER B 2  508  ? 239.076 147.952 196.948 1.00 370.00 ? 508  SER B N   1 
ATOM 7717  C CA  . SER B 2  508  ? 240.162 147.403 196.151 1.00 370.00 ? 508  SER B CA  1 
ATOM 7718  C C   . SER B 2  508  ? 239.640 146.640 194.947 1.00 370.00 ? 508  SER B C   1 
ATOM 7719  O O   . SER B 2  508  ? 240.336 146.526 193.934 1.00 370.00 ? 508  SER B O   1 
ATOM 7720  C CB  . SER B 2  508  ? 241.033 146.504 197.016 1.00 370.00 ? 508  SER B CB  1 
ATOM 7721  O OG  . SER B 2  508  ? 241.617 147.252 198.063 1.00 370.00 ? 508  SER B OG  1 
ATOM 7722  N N   . ASN B 2  509  ? 238.415 146.131 195.033 1.00 370.00 ? 509  ASN B N   1 
ATOM 7723  C CA  . ASN B 2  509  ? 237.781 145.560 193.859 1.00 370.00 ? 509  ASN B CA  1 
ATOM 7724  C C   . ASN B 2  509  ? 237.487 146.633 192.827 1.00 370.00 ? 509  ASN B C   1 
ATOM 7725  O O   . ASN B 2  509  ? 237.604 146.387 191.623 1.00 370.00 ? 509  ASN B O   1 
ATOM 7726  C CB  . ASN B 2  509  ? 236.508 144.823 194.259 1.00 370.00 ? 509  ASN B CB  1 
ATOM 7727  C CG  . ASN B 2  509  ? 236.795 143.528 194.987 1.00 370.00 ? 509  ASN B CG  1 
ATOM 7728  O OD1 . ASN B 2  509  ? 237.689 142.775 194.607 1.00 370.00 ? 509  ASN B OD1 1 
ATOM 7729  N ND2 . ASN B 2  509  ? 236.053 143.275 196.056 1.00 370.00 ? 509  ASN B ND2 1 
ATOM 7730  N N   . VAL B 2  510  ? 237.126 147.834 193.272 1.00 370.00 ? 510  VAL B N   1 
ATOM 7731  C CA  . VAL B 2  510  ? 236.968 148.922 192.319 1.00 370.00 ? 510  VAL B CA  1 
ATOM 7732  C C   . VAL B 2  510  ? 238.326 149.382 191.820 1.00 370.00 ? 510  VAL B C   1 
ATOM 7733  O O   . VAL B 2  510  ? 238.563 149.477 190.612 1.00 370.00 ? 510  VAL B O   1 
ATOM 7734  C CB  . VAL B 2  510  ? 236.170 150.071 192.939 1.00 370.00 ? 510  VAL B CB  1 
ATOM 7735  C CG1 . VAL B 2  510  ? 236.189 151.264 192.014 1.00 370.00 ? 510  VAL B CG1 1 
ATOM 7736  C CG2 . VAL B 2  510  ? 234.762 149.607 193.158 1.00 370.00 ? 510  VAL B CG2 1 
ATOM 7737  N N   . SER B 2  511  ? 239.243 149.651 192.737 1.00 370.00 ? 511  SER B N   1 
ATOM 7738  C CA  . SER B 2  511  ? 240.619 149.927 192.345 1.00 370.00 ? 511  SER B CA  1 
ATOM 7739  C C   . SER B 2  511  ? 241.523 149.449 193.466 1.00 370.00 ? 511  SER B C   1 
ATOM 7740  O O   . SER B 2  511  ? 241.534 150.036 194.550 1.00 370.00 ? 511  SER B O   1 
ATOM 7741  C CB  . SER B 2  511  ? 240.841 151.404 192.061 1.00 370.00 ? 511  SER B CB  1 
ATOM 7742  O OG  . SER B 2  511  ? 242.193 151.630 191.719 1.00 370.00 ? 511  SER B OG  1 
ATOM 7743  N N   . GLY B 2  512  ? 242.279 148.395 193.200 1.00 370.00 ? 512  GLY B N   1 
ATOM 7744  C CA  . GLY B 2  512  ? 243.225 147.922 194.181 1.00 370.00 ? 512  GLY B CA  1 
ATOM 7745  C C   . GLY B 2  512  ? 244.496 148.725 194.122 1.00 370.00 ? 512  GLY B C   1 
ATOM 7746  O O   . GLY B 2  512  ? 245.341 148.526 193.247 1.00 370.00 ? 512  GLY B O   1 
ATOM 7747  N N   . LYS B 2  513  ? 244.636 149.648 195.049 1.00 370.00 ? 513  LYS B N   1 
ATOM 7748  C CA  . LYS B 2  513  ? 245.861 150.403 195.183 1.00 370.00 ? 513  LYS B CA  1 
ATOM 7749  C C   . LYS B 2  513  ? 246.415 150.134 196.575 1.00 370.00 ? 513  LYS B C   1 
ATOM 7750  O O   . LYS B 2  513  ? 245.883 149.315 197.326 1.00 370.00 ? 513  LYS B O   1 
ATOM 7751  C CB  . LYS B 2  513  ? 245.600 151.879 194.894 1.00 370.00 ? 513  LYS B CB  1 
ATOM 7752  C CG  . LYS B 2  513  ? 245.220 152.117 193.444 1.00 370.00 ? 513  LYS B CG  1 
ATOM 7753  C CD  . LYS B 2  513  ? 245.007 153.579 193.141 1.00 370.00 ? 513  LYS B CD  1 
ATOM 7754  C CE  . LYS B 2  513  ? 244.654 153.773 191.681 1.00 370.00 ? 513  LYS B CE  1 
ATOM 7755  N NZ  . LYS B 2  513  ? 244.418 155.197 191.342 1.00 370.00 ? 513  LYS B NZ  1 
ATOM 7756  N N   . ASP B 2  514  ? 247.484 150.833 196.929 1.00 370.00 ? 514  ASP B N   1 
ATOM 7757  C CA  . ASP B 2  514  ? 248.185 150.556 198.182 1.00 370.00 ? 514  ASP B CA  1 
ATOM 7758  C C   . ASP B 2  514  ? 247.548 151.283 199.357 1.00 370.00 ? 514  ASP B C   1 
ATOM 7759  O O   . ASP B 2  514  ? 248.195 152.012 200.097 1.00 370.00 ? 514  ASP B O   1 
ATOM 7760  C CB  . ASP B 2  514  ? 249.650 150.928 198.032 1.00 370.00 ? 514  ASP B CB  1 
ATOM 7761  C CG  . ASP B 2  514  ? 250.343 150.086 196.995 1.00 370.00 ? 514  ASP B CG  1 
ATOM 7762  O OD1 . ASP B 2  514  ? 249.895 148.941 196.778 1.00 370.00 ? 514  ASP B OD1 1 
ATOM 7763  O OD2 . ASP B 2  514  ? 251.325 150.563 196.393 1.00 370.00 ? 514  ASP B OD2 1 
ATOM 7764  N N   . ILE B 2  515  ? 246.249 151.066 199.529 1.00 370.00 ? 515  ILE B N   1 
ATOM 7765  C CA  . ILE B 2  515  ? 245.471 151.774 200.529 1.00 370.00 ? 515  ILE B CA  1 
ATOM 7766  C C   . ILE B 2  515  ? 245.515 151.094 201.876 1.00 370.00 ? 515  ILE B C   1 
ATOM 7767  O O   . ILE B 2  515  ? 244.981 151.630 202.853 1.00 370.00 ? 515  ILE B O   1 
ATOM 7768  C CB  . ILE B 2  515  ? 244.031 151.880 200.021 1.00 370.00 ? 515  ILE B CB  1 
ATOM 7769  C CG1 . ILE B 2  515  ? 243.514 150.476 199.763 1.00 370.00 ? 515  ILE B CG1 1 
ATOM 7770  C CG2 . ILE B 2  515  ? 244.010 152.660 198.743 1.00 370.00 ? 515  ILE B CG2 1 
ATOM 7771  C CD1 . ILE B 2  515  ? 242.080 150.425 199.401 1.00 370.00 ? 515  ILE B CD1 1 
ATOM 7772  N N   . GLN B 2  516  ? 246.092 149.933 201.958 1.00 370.00 ? 516  GLN B N   1 
ATOM 7773  C CA  . GLN B 2  516  ? 246.301 149.339 203.262 1.00 370.00 ? 516  GLN B CA  1 
ATOM 7774  C C   . GLN B 2  516  ? 247.460 150.032 203.984 1.00 370.00 ? 516  GLN B C   1 
ATOM 7775  O O   . GLN B 2  516  ? 247.409 150.145 205.217 1.00 370.00 ? 516  GLN B O   1 
ATOM 7776  C CB  . GLN B 2  516  ? 246.481 147.836 203.097 1.00 370.00 ? 516  GLN B CB  1 
ATOM 7777  C CG  . GLN B 2  516  ? 245.253 147.244 202.441 1.00 370.00 ? 516  GLN B CG  1 
ATOM 7778  C CD  . GLN B 2  516  ? 245.398 145.785 202.100 1.00 370.00 ? 516  GLN B CD  1 
ATOM 7779  O OE1 . GLN B 2  516  ? 246.446 145.186 202.324 1.00 370.00 ? 516  GLN B OE1 1 
ATOM 7780  N NE2 . GLN B 2  516  ? 244.348 145.206 201.531 1.00 370.00 ? 516  GLN B NE2 1 
ATOM 7781  N N   . PRO B 2  517  ? 248.511 150.511 203.294 1.00 370.00 ? 517  PRO B N   1 
ATOM 7782  C CA  . PRO B 2  517  ? 249.316 151.586 203.896 1.00 370.00 ? 517  PRO B CA  1 
ATOM 7783  C C   . PRO B 2  517  ? 248.532 152.812 204.330 1.00 370.00 ? 517  PRO B C   1 
ATOM 7784  O O   . PRO B 2  517  ? 248.868 153.378 205.372 1.00 370.00 ? 517  PRO B O   1 
ATOM 7785  C CB  . PRO B 2  517  ? 250.317 151.922 202.789 1.00 370.00 ? 517  PRO B CB  1 
ATOM 7786  C CG  . PRO B 2  517  ? 250.576 150.632 202.190 1.00 370.00 ? 517  PRO B CG  1 
ATOM 7787  C CD  . PRO B 2  517  ? 249.286 149.866 202.212 1.00 370.00 ? 517  PRO B CD  1 
ATOM 7788  N N   . LEU B 2  518  ? 247.507 153.236 203.584 1.00 370.00 ? 518  LEU B N   1 
ATOM 7789  C CA  . LEU B 2  518  ? 246.686 154.357 204.035 1.00 370.00 ? 518  LEU B CA  1 
ATOM 7790  C C   . LEU B 2  518  ? 245.981 154.036 205.337 1.00 370.00 ? 518  LEU B C   1 
ATOM 7791  O O   . LEU B 2  518  ? 245.893 154.883 206.232 1.00 370.00 ? 518  LEU B O   1 
ATOM 7792  C CB  . LEU B 2  518  ? 245.655 154.713 202.978 1.00 370.00 ? 518  LEU B CB  1 
ATOM 7793  C CG  . LEU B 2  518  ? 244.654 155.793 203.343 1.00 370.00 ? 518  LEU B CG  1 
ATOM 7794  C CD1 . LEU B 2  518  ? 245.376 157.094 203.499 1.00 370.00 ? 518  LEU B CD1 1 
ATOM 7795  C CD2 . LEU B 2  518  ? 243.585 155.896 202.290 1.00 370.00 ? 518  LEU B CD2 1 
ATOM 7796  N N   . ILE B 2  519  ? 245.479 152.812 205.447 1.00 370.00 ? 519  ILE B N   1 
ATOM 7797  C CA  . ILE B 2  519  ? 244.868 152.336 206.680 1.00 370.00 ? 519  ILE B CA  1 
ATOM 7798  C C   . ILE B 2  519  ? 245.866 152.390 207.819 1.00 370.00 ? 519  ILE B C   1 
ATOM 7799  O O   . ILE B 2  519  ? 245.667 153.093 208.813 1.00 370.00 ? 519  ILE B O   1 
ATOM 7800  C CB  . ILE B 2  519  ? 244.350 150.906 206.491 1.00 370.00 ? 519  ILE B CB  1 
ATOM 7801  C CG1 . ILE B 2  519  ? 243.234 150.879 205.467 1.00 370.00 ? 519  ILE B CG1 1 
ATOM 7802  C CG2 . ILE B 2  519  ? 243.897 150.320 207.815 1.00 370.00 ? 519  ILE B CG2 1 
ATOM 7803  C CD1 . ILE B 2  519  ? 242.938 149.512 205.026 1.00 370.00 ? 519  ILE B CD1 1 
ATOM 7804  N N   . LYS B 2  520  ? 246.980 151.680 207.664 1.00 370.00 ? 520  LYS B N   1 
ATOM 7805  C CA  . LYS B 2  520  ? 247.902 151.513 208.775 1.00 370.00 ? 520  LYS B CA  1 
ATOM 7806  C C   . LYS B 2  520  ? 248.630 152.798 209.110 1.00 370.00 ? 520  LYS B C   1 
ATOM 7807  O O   . LYS B 2  520  ? 249.135 152.941 210.227 1.00 370.00 ? 520  LYS B O   1 
ATOM 7808  C CB  . LYS B 2  520  ? 248.876 150.385 208.466 1.00 370.00 ? 520  LYS B CB  1 
ATOM 7809  C CG  . LYS B 2  520  ? 248.169 149.052 208.437 1.00 370.00 ? 520  LYS B CG  1 
ATOM 7810  C CD  . LYS B 2  520  ? 249.104 147.899 208.188 1.00 370.00 ? 520  LYS B CD  1 
ATOM 7811  C CE  . LYS B 2  520  ? 248.314 146.601 208.135 1.00 370.00 ? 520  LYS B CE  1 
ATOM 7812  N NZ  . LYS B 2  520  ? 249.165 145.407 207.882 1.00 370.00 ? 520  LYS B NZ  1 
ATOM 7813  N N   . GLN B 2  521  ? 248.647 153.755 208.192 1.00 370.00 ? 521  GLN B N   1 
ATOM 7814  C CA  . GLN B 2  521  ? 248.990 155.099 208.602 1.00 370.00 ? 521  GLN B CA  1 
ATOM 7815  C C   . GLN B 2  521  ? 247.855 155.712 209.402 1.00 370.00 ? 521  GLN B C   1 
ATOM 7816  O O   . GLN B 2  521  ? 247.971 155.902 210.610 1.00 370.00 ? 521  GLN B O   1 
ATOM 7817  C CB  . GLN B 2  521  ? 249.327 155.947 207.378 1.00 370.00 ? 521  GLN B CB  1 
ATOM 7818  C CG  . GLN B 2  521  ? 250.698 155.654 206.798 1.00 370.00 ? 521  GLN B CG  1 
ATOM 7819  C CD  . GLN B 2  521  ? 250.989 156.459 205.553 1.00 370.00 ? 521  GLN B CD  1 
ATOM 7820  O OE1 . GLN B 2  521  ? 250.111 157.123 205.012 1.00 370.00 ? 521  GLN B OE1 1 
ATOM 7821  N NE2 . GLN B 2  521  ? 252.236 156.428 205.110 1.00 370.00 ? 521  GLN B NE2 1 
ATOM 7822  N N   . TRP B 2  522  ? 246.715 155.942 208.779 1.00 370.00 ? 522  TRP B N   1 
ATOM 7823  C CA  . TRP B 2  522  ? 245.793 156.871 209.404 1.00 370.00 ? 522  TRP B CA  1 
ATOM 7824  C C   . TRP B 2  522  ? 244.661 156.197 210.149 1.00 370.00 ? 522  TRP B C   1 
ATOM 7825  O O   . TRP B 2  522  ? 244.269 156.667 211.219 1.00 370.00 ? 522  TRP B O   1 
ATOM 7826  C CB  . TRP B 2  522  ? 245.241 157.813 208.349 1.00 370.00 ? 522  TRP B CB  1 
ATOM 7827  C CG  . TRP B 2  522  ? 246.345 158.499 207.679 1.00 370.00 ? 522  TRP B CG  1 
ATOM 7828  C CD1 . TRP B 2  522  ? 246.817 158.248 206.444 1.00 370.00 ? 522  TRP B CD1 1 
ATOM 7829  C CD2 . TRP B 2  522  ? 247.192 159.493 208.239 1.00 370.00 ? 522  TRP B CD2 1 
ATOM 7830  N NE1 . TRP B 2  522  ? 247.872 159.064 206.162 1.00 370.00 ? 522  TRP B NE1 1 
ATOM 7831  C CE2 . TRP B 2  522  ? 248.129 159.835 207.260 1.00 370.00 ? 522  TRP B CE2 1 
ATOM 7832  C CE3 . TRP B 2  522  ? 247.237 160.144 209.468 1.00 370.00 ? 522  TRP B CE3 1 
ATOM 7833  C CZ2 . TRP B 2  522  ? 249.101 160.797 207.466 1.00 370.00 ? 522  TRP B CZ2 1 
ATOM 7834  C CZ3 . TRP B 2  522  ? 248.201 161.099 209.672 1.00 370.00 ? 522  TRP B CZ3 1 
ATOM 7835  C CH2 . TRP B 2  522  ? 249.123 161.416 208.680 1.00 370.00 ? 522  TRP B CH2 1 
ATOM 7836  N N   . VAL B 2  523  ? 244.124 155.111 209.606 1.00 370.00 ? 523  VAL B N   1 
ATOM 7837  C CA  . VAL B 2  523  ? 243.104 154.368 210.324 1.00 370.00 ? 523  VAL B CA  1 
ATOM 7838  C C   . VAL B 2  523  ? 243.712 153.688 211.540 1.00 370.00 ? 523  VAL B C   1 
ATOM 7839  O O   . VAL B 2  523  ? 243.103 153.649 212.615 1.00 370.00 ? 523  VAL B O   1 
ATOM 7840  C CB  . VAL B 2  523  ? 242.443 153.361 209.373 1.00 370.00 ? 523  VAL B CB  1 
ATOM 7841  C CG1 . VAL B 2  523  ? 241.402 152.529 210.085 1.00 370.00 ? 523  VAL B CG1 1 
ATOM 7842  C CG2 . VAL B 2  523  ? 241.854 154.089 208.196 1.00 370.00 ? 523  VAL B CG2 1 
ATOM 7843  N N   . ASP B 2  524  ? 244.943 153.196 211.415 1.00 370.00 ? 524  ASP B N   1 
ATOM 7844  C CA  . ASP B 2  524  ? 245.520 152.370 212.467 1.00 370.00 ? 524  ASP B CA  1 
ATOM 7845  C C   . ASP B 2  524  ? 246.851 152.880 212.990 1.00 370.00 ? 524  ASP B C   1 
ATOM 7846  O O   . ASP B 2  524  ? 247.668 152.087 213.462 1.00 370.00 ? 524  ASP B O   1 
ATOM 7847  C CB  . ASP B 2  524  ? 245.648 150.932 211.990 1.00 370.00 ? 524  ASP B CB  1 
ATOM 7848  C CG  . ASP B 2  524  ? 244.319 150.259 211.921 1.00 370.00 ? 524  ASP B CG  1 
ATOM 7849  O OD1 . ASP B 2  524  ? 243.449 150.674 212.705 1.00 370.00 ? 524  ASP B OD1 1 
ATOM 7850  O OD2 . ASP B 2  524  ? 244.135 149.344 211.096 1.00 370.00 ? 524  ASP B OD2 1 
ATOM 7851  N N   . GLN B 2  525  ? 247.085 154.180 212.932 1.00 370.00 ? 525  GLN B N   1 
ATOM 7852  C CA  . GLN B 2  525  ? 248.083 154.810 213.795 1.00 370.00 ? 525  GLN B CA  1 
ATOM 7853  C C   . GLN B 2  525  ? 247.574 156.229 214.030 1.00 370.00 ? 525  GLN B C   1 
ATOM 7854  O O   . GLN B 2  525  ? 247.805 157.134 213.229 1.00 370.00 ? 525  GLN B O   1 
ATOM 7855  C CB  . GLN B 2  525  ? 249.481 154.782 213.196 1.00 370.00 ? 525  GLN B CB  1 
ATOM 7856  C CG  . GLN B 2  525  ? 250.533 155.339 214.119 1.00 370.00 ? 525  GLN B CG  1 
ATOM 7857  C CD  . GLN B 2  525  ? 250.691 154.502 215.364 1.00 370.00 ? 525  GLN B CD  1 
ATOM 7858  O OE1 . GLN B 2  525  ? 250.676 153.273 215.304 1.00 370.00 ? 525  GLN B OE1 1 
ATOM 7859  N NE2 . GLN B 2  525  ? 250.835 155.162 216.506 1.00 370.00 ? 525  GLN B NE2 1 
ATOM 7860  N N   . SER B 2  526  ? 246.868 156.415 215.138 1.00 370.00 ? 526  SER B N   1 
ATOM 7861  C CA  . SER B 2  526  ? 246.211 157.684 215.428 1.00 370.00 ? 526  SER B CA  1 
ATOM 7862  C C   . SER B 2  526  ? 247.243 158.704 215.884 1.00 370.00 ? 526  SER B C   1 
ATOM 7863  O O   . SER B 2  526  ? 247.392 159.008 217.069 1.00 370.00 ? 526  SER B O   1 
ATOM 7864  C CB  . SER B 2  526  ? 245.140 157.481 216.474 1.00 370.00 ? 526  SER B CB  1 
ATOM 7865  O OG  . SER B 2  526  ? 245.706 156.947 217.652 1.00 370.00 ? 526  SER B OG  1 
ATOM 7866  N N   . GLY B 2  527  ? 247.955 159.256 214.911 1.00 370.00 ? 527  GLY B N   1 
ATOM 7867  C CA  . GLY B 2  527  ? 248.966 160.242 215.207 1.00 370.00 ? 527  GLY B CA  1 
ATOM 7868  C C   . GLY B 2  527  ? 248.911 161.409 214.255 1.00 370.00 ? 527  GLY B C   1 
ATOM 7869  O O   . GLY B 2  527  ? 248.720 161.233 213.051 1.00 370.00 ? 527  GLY B O   1 
ATOM 7870  N N   . VAL B 2  528  ? 249.049 162.596 214.784 1.00 370.00 ? 528  VAL B N   1 
ATOM 7871  C CA  . VAL B 2  528  ? 249.116 163.802 213.974 1.00 370.00 ? 528  VAL B CA  1 
ATOM 7872  C C   . VAL B 2  528  ? 250.585 164.069 213.693 1.00 370.00 ? 528  VAL B C   1 
ATOM 7873  O O   . VAL B 2  528  ? 251.453 163.747 214.513 1.00 370.00 ? 528  VAL B O   1 
ATOM 7874  C CB  . VAL B 2  528  ? 248.433 164.978 214.700 1.00 370.00 ? 528  VAL B CB  1 
ATOM 7875  C CG1 . VAL B 2  528  ? 248.389 166.226 213.845 1.00 370.00 ? 528  VAL B CG1 1 
ATOM 7876  C CG2 . VAL B 2  528  ? 247.041 164.592 215.092 1.00 370.00 ? 528  VAL B CG2 1 
ATOM 7877  N N   . VAL B 2  529  ? 250.881 164.609 212.517 1.00 370.00 ? 529  VAL B N   1 
ATOM 7878  C CA  . VAL B 2  529  ? 252.246 164.747 212.048 1.00 370.00 ? 529  VAL B CA  1 
ATOM 7879  C C   . VAL B 2  529  ? 252.545 166.228 211.892 1.00 370.00 ? 529  VAL B C   1 
ATOM 7880  O O   . VAL B 2  529  ? 251.947 166.897 211.045 1.00 370.00 ? 529  VAL B O   1 
ATOM 7881  C CB  . VAL B 2  529  ? 252.447 164.011 210.725 1.00 370.00 ? 529  VAL B CB  1 
ATOM 7882  C CG1 . VAL B 2  529  ? 253.895 164.020 210.361 1.00 370.00 ? 529  VAL B CG1 1 
ATOM 7883  C CG2 . VAL B 2  529  ? 251.922 162.601 210.819 1.00 370.00 ? 529  VAL B CG2 1 
ATOM 7884  N N   . LYS B 2  530  ? 253.459 166.752 212.704 1.00 370.00 ? 530  LYS B N   1 
ATOM 7885  C CA  . LYS B 2  530  ? 254.020 168.059 212.397 1.00 370.00 ? 530  LYS B CA  1 
ATOM 7886  C C   . LYS B 2  530  ? 255.106 167.919 211.337 1.00 370.00 ? 530  LYS B C   1 
ATOM 7887  O O   . LYS B 2  530  ? 255.461 166.823 210.909 1.00 370.00 ? 530  LYS B O   1 
ATOM 7888  C CB  . LYS B 2  530  ? 254.617 168.733 213.628 1.00 370.00 ? 530  LYS B CB  1 
ATOM 7889  C CG  . LYS B 2  530  ? 253.661 169.229 214.672 1.00 370.00 ? 530  LYS B CG  1 
ATOM 7890  C CD  . LYS B 2  530  ? 254.471 169.989 215.710 1.00 370.00 ? 530  LYS B CD  1 
ATOM 7891  C CE  . LYS B 2  530  ? 253.612 170.550 216.823 1.00 370.00 ? 530  LYS B CE  1 
ATOM 7892  N NZ  . LYS B 2  530  ? 254.411 171.345 217.800 1.00 370.00 ? 530  LYS B NZ  1 
ATOM 7893  N N   . PHE B 2  531  ? 255.638 169.052 210.897 1.00 370.00 ? 531  PHE B N   1 
ATOM 7894  C CA  . PHE B 2  531  ? 256.550 169.056 209.760 1.00 370.00 ? 531  PHE B CA  1 
ATOM 7895  C C   . PHE B 2  531  ? 257.585 170.142 209.942 1.00 370.00 ? 531  PHE B C   1 
ATOM 7896  O O   . PHE B 2  531  ? 257.242 171.326 209.994 1.00 370.00 ? 531  PHE B O   1 
ATOM 7897  C CB  . PHE B 2  531  ? 255.797 169.273 208.462 1.00 370.00 ? 531  PHE B CB  1 
ATOM 7898  C CG  . PHE B 2  531  ? 254.946 168.137 208.093 1.00 370.00 ? 531  PHE B CG  1 
ATOM 7899  C CD1 . PHE B 2  531  ? 255.507 167.016 207.530 1.00 370.00 ? 531  PHE B CD1 1 
ATOM 7900  C CD2 . PHE B 2  531  ? 253.592 168.162 208.341 1.00 370.00 ? 531  PHE B CD2 1 
ATOM 7901  C CE1 . PHE B 2  531  ? 254.730 165.946 207.194 1.00 370.00 ? 531  PHE B CE1 1 
ATOM 7902  C CE2 . PHE B 2  531  ? 252.810 167.091 208.008 1.00 370.00 ? 531  PHE B CE2 1 
ATOM 7903  C CZ  . PHE B 2  531  ? 253.376 165.986 207.429 1.00 370.00 ? 531  PHE B CZ  1 
ATOM 7904  N N   . TYR B 2  532  ? 258.839 169.747 210.071 1.00 370.00 ? 532  TYR B N   1 
ATOM 7905  C CA  . TYR B 2  532  ? 259.931 170.696 210.028 1.00 370.00 ? 532  TYR B CA  1 
ATOM 7906  C C   . TYR B 2  532  ? 260.570 170.609 208.645 1.00 370.00 ? 532  TYR B C   1 
ATOM 7907  O O   . TYR B 2  532  ? 261.706 170.183 208.445 1.00 370.00 ? 532  TYR B O   1 
ATOM 7908  C CB  . TYR B 2  532  ? 260.889 170.421 211.175 1.00 370.00 ? 532  TYR B CB  1 
ATOM 7909  C CG  . TYR B 2  532  ? 260.201 170.626 212.515 1.00 370.00 ? 532  TYR B CG  1 
ATOM 7910  C CD1 . TYR B 2  532  ? 259.133 171.523 212.651 1.00 370.00 ? 532  TYR B CD1 1 
ATOM 7911  C CD2 . TYR B 2  532  ? 260.554 169.868 213.618 1.00 370.00 ? 532  TYR B CD2 1 
ATOM 7912  C CE1 . TYR B 2  532  ? 258.480 171.687 213.850 1.00 370.00 ? 532  TYR B CE1 1 
ATOM 7913  C CE2 . TYR B 2  532  ? 259.903 170.029 214.830 1.00 370.00 ? 532  TYR B CE2 1 
ATOM 7914  C CZ  . TYR B 2  532  ? 258.869 170.939 214.937 1.00 370.00 ? 532  TYR B CZ  1 
ATOM 7915  O OH  . TYR B 2  532  ? 258.224 171.100 216.139 1.00 370.00 ? 532  TYR B OH  1 
ATOM 7916  N N   . GLY B 2  533  ? 259.770 170.985 207.661 1.00 370.00 ? 533  GLY B N   1 
ATOM 7917  C CA  . GLY B 2  533  ? 260.308 171.065 206.328 1.00 370.00 ? 533  GLY B CA  1 
ATOM 7918  C C   . GLY B 2  533  ? 261.061 172.370 206.269 1.00 370.00 ? 533  GLY B C   1 
ATOM 7919  O O   . GLY B 2  533  ? 260.477 173.446 206.121 1.00 370.00 ? 533  GLY B O   1 
ATOM 7920  N N   . SER B 2  534  ? 262.373 172.275 206.400 1.00 370.00 ? 534  SER B N   1 
ATOM 7921  C CA  . SER B 2  534  ? 263.207 173.446 206.610 1.00 370.00 ? 534  SER B CA  1 
ATOM 7922  C C   . SER B 2  534  ? 263.569 174.067 205.270 1.00 370.00 ? 534  SER B C   1 
ATOM 7923  O O   . SER B 2  534  ? 264.213 173.431 204.427 1.00 370.00 ? 534  SER B O   1 
ATOM 7924  C CB  . SER B 2  534  ? 264.446 173.056 207.404 1.00 370.00 ? 534  SER B CB  1 
ATOM 7925  O OG  . SER B 2  534  ? 265.188 172.078 206.710 1.00 370.00 ? 534  SER B OG  1 
ATOM 7926  N N   . PHE B 2  535  ? 263.155 175.319 205.091 1.00 370.00 ? 535  PHE B N   1 
ATOM 7927  C CA  . PHE B 2  535  ? 263.467 176.105 203.906 1.00 370.00 ? 535  PHE B CA  1 
ATOM 7928  C C   . PHE B 2  535  ? 264.962 176.340 203.781 1.00 370.00 ? 535  PHE B C   1 
ATOM 7929  O O   . PHE B 2  535  ? 265.582 176.939 204.663 1.00 370.00 ? 535  PHE B O   1 
ATOM 7930  C CB  . PHE B 2  535  ? 262.745 177.441 203.966 1.00 370.00 ? 535  PHE B CB  1 
ATOM 7931  C CG  . PHE B 2  535  ? 263.262 178.433 202.983 1.00 370.00 ? 535  PHE B CG  1 
ATOM 7932  C CD1 . PHE B 2  535  ? 262.993 178.290 201.640 1.00 370.00 ? 535  PHE B CD1 1 
ATOM 7933  C CD2 . PHE B 2  535  ? 264.032 179.506 203.400 1.00 370.00 ? 535  PHE B CD2 1 
ATOM 7934  C CE1 . PHE B 2  535  ? 263.466 179.198 200.730 1.00 370.00 ? 535  PHE B CE1 1 
ATOM 7935  C CE2 . PHE B 2  535  ? 264.522 180.401 202.494 1.00 370.00 ? 535  PHE B CE2 1 
ATOM 7936  C CZ  . PHE B 2  535  ? 264.238 180.249 201.157 1.00 370.00 ? 535  PHE B CZ  1 
ATOM 7937  N N   . ALA B 2  536  ? 265.531 175.908 202.670 1.00 370.00 ? 536  ALA B N   1 
ATOM 7938  C CA  . ALA B 2  536  ? 266.843 176.358 202.244 1.00 370.00 ? 536  ALA B CA  1 
ATOM 7939  C C   . ALA B 2  536  ? 266.710 177.081 200.913 1.00 370.00 ? 536  ALA B C   1 
ATOM 7940  O O   . ALA B 2  536  ? 265.671 177.040 200.259 1.00 370.00 ? 536  ALA B O   1 
ATOM 7941  C CB  . ALA B 2  536  ? 267.815 175.186 202.126 1.00 370.00 ? 536  ALA B CB  1 
ATOM 7942  N N   . PHE B 2  537  ? 267.785 177.741 200.504 1.00 370.00 ? 537  PHE B N   1 
ATOM 7943  C CA  . PHE B 2  537  ? 267.734 178.637 199.352 1.00 370.00 ? 537  PHE B CA  1 
ATOM 7944  C C   . PHE B 2  537  ? 268.924 178.363 198.436 1.00 370.00 ? 537  PHE B C   1 
ATOM 7945  O O   . PHE B 2  537  ? 269.982 178.987 198.504 1.00 370.00 ? 537  PHE B O   1 
ATOM 7946  C CB  . PHE B 2  537  ? 267.624 180.115 199.809 1.00 370.00 ? 537  PHE B CB  1 
ATOM 7947  C CG  . PHE B 2  537  ? 268.620 180.530 200.874 1.00 370.00 ? 537  PHE B CG  1 
ATOM 7948  C CD1 . PHE B 2  537  ? 268.355 180.302 202.219 1.00 370.00 ? 537  PHE B CD1 1 
ATOM 7949  C CD2 . PHE B 2  537  ? 269.765 181.238 200.542 1.00 370.00 ? 537  PHE B CD2 1 
ATOM 7950  C CE1 . PHE B 2  537  ? 269.250 180.686 203.191 1.00 370.00 ? 537  PHE B CE1 1 
ATOM 7951  C CE2 . PHE B 2  537  ? 270.664 181.627 201.511 1.00 370.00 ? 537  PHE B CE2 1 
ATOM 7952  C CZ  . PHE B 2  537  ? 270.402 181.356 202.837 1.00 370.00 ? 537  PHE B CZ  1 
ATOM 7953  N N   . ASN B 2  538  ? 268.745 177.404 197.547 1.00 370.00 ? 538  ASN B N   1 
ATOM 7954  C CA  . ASN B 2  538  ? 269.698 177.206 196.473 1.00 370.00 ? 538  ASN B CA  1 
ATOM 7955  C C   . ASN B 2  538  ? 269.155 177.796 195.190 1.00 370.00 ? 538  ASN B C   1 
ATOM 7956  O O   . ASN B 2  538  ? 267.974 178.128 195.089 1.00 370.00 ? 538  ASN B O   1 
ATOM 7957  C CB  . ASN B 2  538  ? 270.057 175.738 196.320 1.00 370.00 ? 538  ASN B CB  1 
ATOM 7958  C CG  . ASN B 2  538  ? 271.163 175.340 197.245 1.00 370.00 ? 538  ASN B CG  1 
ATOM 7959  O OD1 . ASN B 2  538  ? 272.115 176.096 197.438 1.00 370.00 ? 538  ASN B OD1 1 
ATOM 7960  N ND2 . ASN B 2  538  ? 271.069 174.150 197.811 1.00 370.00 ? 538  ASN B ND2 1 
ATOM 7961  N N   . ARG B 2  539  ? 270.045 177.920 194.204 1.00 370.00 ? 539  ARG B N   1 
ATOM 7962  C CA  . ARG B 2  539  ? 269.983 179.005 193.224 1.00 370.00 ? 539  ARG B CA  1 
ATOM 7963  C C   . ARG B 2  539  ? 269.699 180.334 193.910 1.00 370.00 ? 539  ARG B C   1 
ATOM 7964  O O   . ARG B 2  539  ? 268.808 181.088 193.520 1.00 370.00 ? 539  ARG B O   1 
ATOM 7965  C CB  . ARG B 2  539  ? 268.974 178.738 192.107 1.00 370.00 ? 539  ARG B CB  1 
ATOM 7966  C CG  . ARG B 2  539  ? 269.521 177.848 191.034 1.00 370.00 ? 539  ARG B CG  1 
ATOM 7967  C CD  . ARG B 2  539  ? 268.498 177.476 189.972 1.00 370.00 ? 539  ARG B CD  1 
ATOM 7968  N NE  . ARG B 2  539  ? 268.163 178.599 189.106 1.00 370.00 ? 539  ARG B NE  1 
ATOM 7969  C CZ  . ARG B 2  539  ? 267.220 178.566 188.172 1.00 370.00 ? 539  ARG B CZ  1 
ATOM 7970  N NH1 . ARG B 2  539  ? 266.519 177.461 187.975 1.00 370.00 ? 539  ARG B NH1 1 
ATOM 7971  N NH2 . ARG B 2  539  ? 266.984 179.637 187.430 1.00 370.00 ? 539  ARG B NH2 1 
ATOM 7972  N N   . LYS B 2  540  ? 270.465 180.616 194.960 1.00 370.00 ? 540  LYS B N   1 
ATOM 7973  C CA  . LYS B 2  540  ? 270.635 181.979 195.448 1.00 370.00 ? 540  LYS B CA  1 
ATOM 7974  C C   . LYS B 2  540  ? 271.901 182.533 194.793 1.00 370.00 ? 540  LYS B C   1 
ATOM 7975  O O   . LYS B 2  540  ? 272.866 182.956 195.430 1.00 370.00 ? 540  LYS B O   1 
ATOM 7976  C CB  . LYS B 2  540  ? 270.689 181.983 196.974 1.00 370.00 ? 540  LYS B CB  1 
ATOM 7977  C CG  . LYS B 2  540  ? 270.586 183.333 197.659 1.00 370.00 ? 540  LYS B CG  1 
ATOM 7978  C CD  . LYS B 2  540  ? 269.300 184.016 197.263 1.00 370.00 ? 540  LYS B CD  1 
ATOM 7979  C CE  . LYS B 2  540  ? 268.063 183.271 197.746 1.00 370.00 ? 540  LYS B CE  1 
ATOM 7980  N NZ  . LYS B 2  540  ? 266.833 183.955 197.252 1.00 370.00 ? 540  LYS B NZ  1 
ATOM 7981  N N   . ARG B 2  541  ? 271.853 182.494 193.460 1.00 370.00 ? 541  ARG B N   1 
ATOM 7982  C CA  . ARG B 2  541  ? 273.011 182.268 192.598 1.00 370.00 ? 541  ARG B CA  1 
ATOM 7983  C C   . ARG B 2  541  ? 273.898 181.160 193.162 1.00 370.00 ? 541  ARG B C   1 
ATOM 7984  O O   . ARG B 2  541  ? 275.115 181.295 193.288 1.00 370.00 ? 541  ARG B O   1 
ATOM 7985  C CB  . ARG B 2  541  ? 273.789 183.560 192.361 1.00 370.00 ? 541  ARG B CB  1 
ATOM 7986  C CG  . ARG B 2  541  ? 273.039 184.527 191.462 1.00 370.00 ? 541  ARG B CG  1 
ATOM 7987  C CD  . ARG B 2  541  ? 273.768 185.846 191.270 1.00 370.00 ? 541  ARG B CD  1 
ATOM 7988  N NE  . ARG B 2  541  ? 272.973 186.777 190.473 1.00 370.00 ? 541  ARG B NE  1 
ATOM 7989  C CZ  . ARG B 2  541  ? 273.326 188.030 190.208 1.00 370.00 ? 541  ARG B CZ  1 
ATOM 7990  N NH1 . ARG B 2  541  ? 274.468 188.514 190.677 1.00 370.00 ? 541  ARG B NH1 1 
ATOM 7991  N NH2 . ARG B 2  541  ? 272.536 188.802 189.475 1.00 370.00 ? 541  ARG B NH2 1 
ATOM 7992  N N   . ASN B 2  542  ? 273.265 180.042 193.505 1.00 370.00 ? 542  ASN B N   1 
ATOM 7993  C CA  . ASN B 2  542  ? 273.972 178.907 194.069 1.00 370.00 ? 542  ASN B CA  1 
ATOM 7994  C C   . ASN B 2  542  ? 274.200 177.846 193.008 1.00 370.00 ? 542  ASN B C   1 
ATOM 7995  O O   . ASN B 2  542  ? 273.406 177.686 192.077 1.00 370.00 ? 542  ASN B O   1 
ATOM 7996  C CB  . ASN B 2  542  ? 273.218 178.301 195.250 1.00 370.00 ? 542  ASN B CB  1 
ATOM 7997  C CG  . ASN B 2  542  ? 273.319 179.143 196.491 1.00 370.00 ? 542  ASN B CG  1 
ATOM 7998  O OD1 . ASN B 2  542  ? 274.344 179.771 196.740 1.00 370.00 ? 542  ASN B OD1 1 
ATOM 7999  N ND2 . ASN B 2  542  ? 272.284 179.118 197.311 1.00 370.00 ? 542  ASN B ND2 1 
ATOM 8000  N N   . VAL B 2  543  ? 275.321 177.138 193.158 1.00 370.00 ? 543  VAL B N   1 
ATOM 8001  C CA  . VAL B 2  543  ? 275.654 176.039 192.259 1.00 370.00 ? 543  VAL B CA  1 
ATOM 8002  C C   . VAL B 2  543  ? 274.634 174.924 192.404 1.00 370.00 ? 543  VAL B C   1 
ATOM 8003  O O   . VAL B 2  543  ? 274.105 174.404 191.415 1.00 370.00 ? 543  VAL B O   1 
ATOM 8004  C CB  . VAL B 2  543  ? 277.079 175.536 192.544 1.00 370.00 ? 543  VAL B CB  1 
ATOM 8005  C CG1 . VAL B 2  543  ? 277.418 174.351 191.653 1.00 370.00 ? 543  VAL B CG1 1 
ATOM 8006  C CG2 . VAL B 2  543  ? 278.080 176.661 192.366 1.00 370.00 ? 543  VAL B CG2 1 
ATOM 8007  N N   . LEU B 2  544  ? 274.341 174.548 193.643 1.00 370.00 ? 544  LEU B N   1 
ATOM 8008  C CA  . LEU B 2  544  ? 273.176 173.723 193.900 1.00 370.00 ? 544  LEU B CA  1 
ATOM 8009  C C   . LEU B 2  544  ? 271.930 174.534 193.594 1.00 370.00 ? 544  LEU B C   1 
ATOM 8010  O O   . LEU B 2  544  ? 271.929 175.763 193.689 1.00 370.00 ? 544  LEU B O   1 
ATOM 8011  C CB  . LEU B 2  544  ? 273.177 173.250 195.344 1.00 370.00 ? 544  LEU B CB  1 
ATOM 8012  C CG  . LEU B 2  544  ? 274.353 172.347 195.689 1.00 370.00 ? 544  LEU B CG  1 
ATOM 8013  C CD1 . LEU B 2  544  ? 274.365 172.053 197.173 1.00 370.00 ? 544  LEU B CD1 1 
ATOM 8014  C CD2 . LEU B 2  544  ? 274.280 171.065 194.881 1.00 370.00 ? 544  LEU B CD2 1 
ATOM 8015  N N   . GLU B 2  545  ? 270.876 173.852 193.169 1.00 370.00 ? 545  GLU B N   1 
ATOM 8016  C CA  . GLU B 2  545  ? 269.783 174.531 192.488 1.00 370.00 ? 545  GLU B CA  1 
ATOM 8017  C C   . GLU B 2  545  ? 268.446 174.199 193.128 1.00 370.00 ? 545  GLU B C   1 
ATOM 8018  O O   . GLU B 2  545  ? 267.924 173.096 192.932 1.00 370.00 ? 545  GLU B O   1 
ATOM 8019  C CB  . GLU B 2  545  ? 269.773 174.180 191.003 1.00 370.00 ? 545  GLU B CB  1 
ATOM 8020  C CG  . GLU B 2  545  ? 271.007 174.656 190.261 1.00 370.00 ? 545  GLU B CG  1 
ATOM 8021  C CD  . GLU B 2  545  ? 270.849 174.579 188.768 1.00 370.00 ? 545  GLU B CD  1 
ATOM 8022  O OE1 . GLU B 2  545  ? 269.809 174.063 188.311 1.00 370.00 ? 545  GLU B OE1 1 
ATOM 8023  O OE2 . GLU B 2  545  ? 271.754 175.051 188.050 1.00 370.00 ? 545  GLU B OE2 1 
ATOM 8024  N N   . LEU B 2  546  ? 267.895 175.177 193.856 1.00 370.00 ? 546  LEU B N   1 
ATOM 8025  C CA  . LEU B 2  546  ? 266.517 175.179 194.350 1.00 370.00 ? 546  LEU B CA  1 
ATOM 8026  C C   . LEU B 2  546  ? 266.248 173.972 195.252 1.00 370.00 ? 546  LEU B C   1 
ATOM 8027  O O   . LEU B 2  546  ? 265.638 172.985 194.862 1.00 370.00 ? 546  LEU B O   1 
ATOM 8028  C CB  . LEU B 2  546  ? 265.535 175.271 193.181 1.00 370.00 ? 546  LEU B CB  1 
ATOM 8029  C CG  . LEU B 2  546  ? 265.618 176.668 192.572 1.00 370.00 ? 546  LEU B CG  1 
ATOM 8030  C CD1 . LEU B 2  546  ? 264.794 176.800 191.329 1.00 370.00 ? 546  LEU B CD1 1 
ATOM 8031  C CD2 . LEU B 2  546  ? 265.143 177.678 193.590 1.00 370.00 ? 546  LEU B CD2 1 
ATOM 8032  N N   . GLU B 2  547  ? 266.851 174.030 196.433 1.00 370.00 ? 547  GLU B N   1 
ATOM 8033  C CA  . GLU B 2  547  ? 266.852 172.909 197.355 1.00 370.00 ? 547  GLU B CA  1 
ATOM 8034  C C   . GLU B 2  547  ? 266.327 173.343 198.720 1.00 370.00 ? 547  GLU B C   1 
ATOM 8035  O O   . GLU B 2  547  ? 266.560 174.472 199.160 1.00 370.00 ? 547  GLU B O   1 
ATOM 8036  C CB  . GLU B 2  547  ? 268.267 172.337 197.475 1.00 370.00 ? 547  GLU B CB  1 
ATOM 8037  C CG  . GLU B 2  547  ? 268.837 171.882 196.138 1.00 370.00 ? 547  GLU B CG  1 
ATOM 8038  C CD  . GLU B 2  547  ? 270.248 171.349 196.234 1.00 370.00 ? 547  GLU B CD  1 
ATOM 8039  O OE1 . GLU B 2  547  ? 270.829 171.387 197.336 1.00 370.00 ? 547  GLU B OE1 1 
ATOM 8040  O OE2 . GLU B 2  547  ? 270.784 170.911 195.193 1.00 370.00 ? 547  GLU B OE2 1 
ATOM 8041  N N   . ILE B 2  548  ? 265.608 172.429 199.375 1.00 370.00 ? 548  ILE B N   1 
ATOM 8042  C CA  . ILE B 2  548  ? 264.990 172.613 200.688 1.00 370.00 ? 548  ILE B CA  1 
ATOM 8043  C C   . ILE B 2  548  ? 265.071 171.278 201.421 1.00 370.00 ? 548  ILE B C   1 
ATOM 8044  O O   . ILE B 2  548  ? 264.955 170.216 200.802 1.00 370.00 ? 548  ILE B O   1 
ATOM 8045  C CB  . ILE B 2  548  ? 263.533 173.132 200.546 1.00 370.00 ? 548  ILE B CB  1 
ATOM 8046  C CG1 . ILE B 2  548  ? 263.512 174.640 200.286 1.00 370.00 ? 548  ILE B CG1 1 
ATOM 8047  C CG2 . ILE B 2  548  ? 262.608 172.750 201.711 1.00 370.00 ? 548  ILE B CG2 1 
ATOM 8048  C CD1 . ILE B 2  548  ? 262.170 175.192 199.909 1.00 370.00 ? 548  ILE B CD1 1 
ATOM 8049  N N   . LYS B 2  549  ? 265.335 171.314 202.724 1.00 370.00 ? 549  LYS B N   1 
ATOM 8050  C CA  . LYS B 2  549  ? 265.494 170.069 203.448 1.00 370.00 ? 549  LYS B CA  1 
ATOM 8051  C C   . LYS B 2  549  ? 264.186 169.643 204.093 1.00 370.00 ? 549  LYS B C   1 
ATOM 8052  O O   . LYS B 2  549  ? 263.366 170.468 204.491 1.00 370.00 ? 549  LYS B O   1 
ATOM 8053  C CB  . LYS B 2  549  ? 266.577 170.206 204.507 1.00 370.00 ? 549  LYS B CB  1 
ATOM 8054  C CG  . LYS B 2  549  ? 267.935 170.454 203.926 1.00 370.00 ? 549  LYS B CG  1 
ATOM 8055  C CD  . LYS B 2  549  ? 268.983 170.494 205.014 1.00 370.00 ? 549  LYS B CD  1 
ATOM 8056  C CE  . LYS B 2  549  ? 270.346 170.833 204.445 1.00 370.00 ? 549  LYS B CE  1 
ATOM 8057  N NZ  . LYS B 2  549  ? 271.392 170.877 205.501 1.00 370.00 ? 549  LYS B NZ  1 
ATOM 8058  N N   . GLN B 2  550  ? 263.994 168.336 204.169 1.00 370.00 ? 550  GLN B N   1 
ATOM 8059  C CA  . GLN B 2  550  ? 262.879 167.729 204.873 1.00 370.00 ? 550  GLN B CA  1 
ATOM 8060  C C   . GLN B 2  550  ? 263.345 167.322 206.261 1.00 370.00 ? 550  GLN B C   1 
ATOM 8061  O O   . GLN B 2  550  ? 264.396 166.680 206.399 1.00 370.00 ? 550  GLN B O   1 
ATOM 8062  C CB  . GLN B 2  550  ? 262.372 166.485 204.139 1.00 370.00 ? 550  GLN B CB  1 
ATOM 8063  C CG  . GLN B 2  550  ? 261.853 166.694 202.720 1.00 370.00 ? 550  GLN B CG  1 
ATOM 8064  C CD  . GLN B 2  550  ? 261.354 165.391 202.074 1.00 370.00 ? 550  GLN B CD  1 
ATOM 8065  O OE1 . GLN B 2  550  ? 261.394 164.324 202.684 1.00 370.00 ? 550  GLN B OE1 1 
ATOM 8066  N NE2 . GLN B 2  550  ? 260.919 165.480 200.820 1.00 370.00 ? 550  GLN B NE2 1 
ATOM 8067  N N   . ASP B 2  551  ? 262.529 167.638 207.272 1.00 370.00 ? 551  ASP B N   1 
ATOM 8068  C CA  . ASP B 2  551  ? 262.845 167.374 208.665 1.00 370.00 ? 551  ASP B CA  1 
ATOM 8069  C C   . ASP B 2  551  ? 261.556 167.090 209.419 1.00 370.00 ? 551  ASP B C   1 
ATOM 8070  O O   . ASP B 2  551  ? 260.508 167.655 209.093 1.00 370.00 ? 551  ASP B O   1 
ATOM 8071  C CB  . ASP B 2  551  ? 263.531 168.586 209.301 1.00 370.00 ? 551  ASP B CB  1 
ATOM 8072  C CG  . ASP B 2  551  ? 264.911 168.844 208.745 1.00 370.00 ? 551  ASP B CG  1 
ATOM 8073  O OD1 . ASP B 2  551  ? 265.682 167.882 208.567 1.00 370.00 ? 551  ASP B OD1 1 
ATOM 8074  O OD2 . ASP B 2  551  ? 265.208 170.014 208.434 1.00 370.00 ? 551  ASP B OD2 1 
ATOM 8075  N N   . TYR B 2  552  ? 261.650 166.200 210.421 1.00 370.00 ? 552  TYR B N   1 
ATOM 8076  C CA  . TYR B 2  552  ? 260.674 166.055 211.505 1.00 370.00 ? 552  TYR B CA  1 
ATOM 8077  C C   . TYR B 2  552  ? 261.131 165.140 212.643 1.00 370.00 ? 552  TYR B C   1 
ATOM 8078  O O   . TYR B 2  552  ? 261.617 164.036 212.383 1.00 370.00 ? 552  TYR B O   1 
ATOM 8079  C CB  . TYR B 2  552  ? 259.332 165.502 211.010 1.00 370.00 ? 552  TYR B CB  1 
ATOM 8080  C CG  . TYR B 2  552  ? 258.395 165.347 212.158 1.00 370.00 ? 552  TYR B CG  1 
ATOM 8081  C CD1 . TYR B 2  552  ? 257.971 166.461 212.849 1.00 370.00 ? 552  TYR B CD1 1 
ATOM 8082  C CD2 . TYR B 2  552  ? 257.961 164.094 212.578 1.00 370.00 ? 552  TYR B CD2 1 
ATOM 8083  C CE1 . TYR B 2  552  ? 257.152 166.344 213.918 1.00 370.00 ? 552  TYR B CE1 1 
ATOM 8084  C CE2 . TYR B 2  552  ? 257.125 163.965 213.658 1.00 370.00 ? 552  TYR B CE2 1 
ATOM 8085  C CZ  . TYR B 2  552  ? 256.720 165.103 214.320 1.00 370.00 ? 552  TYR B CZ  1 
ATOM 8086  O OH  . TYR B 2  552  ? 255.874 165.037 215.398 1.00 370.00 ? 552  TYR B OH  1 
ATOM 8087  N N   . THR B 2  553  ? 260.940 165.581 213.896 1.00 370.00 ? 553  THR B N   1 
ATOM 8088  C CA  . THR B 2  553  ? 260.808 164.713 215.076 1.00 370.00 ? 553  THR B CA  1 
ATOM 8089  C C   . THR B 2  553  ? 260.185 165.525 216.201 1.00 370.00 ? 553  THR B C   1 
ATOM 8090  O O   . THR B 2  553  ? 260.766 166.535 216.608 1.00 370.00 ? 553  THR B O   1 
ATOM 8091  C CB  . THR B 2  553  ? 262.158 164.145 215.541 1.00 370.00 ? 553  THR B CB  1 
ATOM 8092  O OG1 . THR B 2  553  ? 262.655 163.216 214.568 1.00 370.00 ? 553  THR B OG1 1 
ATOM 8093  C CG2 . THR B 2  553  ? 262.018 163.455 216.890 1.00 370.00 ? 553  THR B CG2 1 
ATOM 8094  N N   . SER B 2  554  ? 259.020 165.091 216.722 1.00 370.00 ? 554  SER B N   1 
ATOM 8095  C CA  . SER B 2  554  ? 258.484 165.757 217.912 1.00 370.00 ? 554  SER B CA  1 
ATOM 8096  C C   . SER B 2  554  ? 257.569 164.847 218.720 1.00 370.00 ? 554  SER B C   1 
ATOM 8097  O O   . SER B 2  554  ? 256.342 164.949 218.611 1.00 370.00 ? 554  SER B O   1 
ATOM 8098  C CB  . SER B 2  554  ? 257.703 167.018 217.547 1.00 370.00 ? 554  SER B CB  1 
ATOM 8099  O OG  . SER B 2  554  ? 256.446 166.683 216.996 1.00 370.00 ? 554  SER B OG  1 
ATOM 8100  N N   . PRO B 2  555  ? 258.115 164.009 219.586 1.00 370.00 ? 555  PRO B N   1 
ATOM 8101  C CA  . PRO B 2  555  ? 257.287 163.045 220.320 1.00 370.00 ? 555  PRO B CA  1 
ATOM 8102  C C   . PRO B 2  555  ? 256.430 163.645 221.416 1.00 370.00 ? 555  PRO B C   1 
ATOM 8103  O O   . PRO B 2  555  ? 256.272 164.862 221.530 1.00 370.00 ? 555  PRO B O   1 
ATOM 8104  C CB  . PRO B 2  555  ? 258.319 162.072 220.896 1.00 370.00 ? 555  PRO B CB  1 
ATOM 8105  C CG  . PRO B 2  555  ? 259.547 162.868 221.016 1.00 370.00 ? 555  PRO B CG  1 
ATOM 8106  C CD  . PRO B 2  555  ? 259.547 163.822 219.861 1.00 370.00 ? 555  PRO B CD  1 
ATOM 8107  N N   . GLY B 2  556  ? 255.868 162.765 222.231 1.00 370.00 ? 556  GLY B N   1 
ATOM 8108  C CA  . GLY B 2  556  ? 254.712 163.091 223.028 1.00 370.00 ? 556  GLY B CA  1 
ATOM 8109  C C   . GLY B 2  556  ? 253.505 162.604 222.266 1.00 370.00 ? 556  GLY B C   1 
ATOM 8110  O O   . GLY B 2  556  ? 252.761 161.746 222.744 1.00 370.00 ? 556  GLY B O   1 
ATOM 8111  N N   . THR B 2  557  ? 253.305 163.138 221.068 1.00 370.00 ? 557  THR B N   1 
ATOM 8112  C CA  . THR B 2  557  ? 252.399 162.519 220.104 1.00 370.00 ? 557  THR B CA  1 
ATOM 8113  C C   . THR B 2  557  ? 252.989 162.821 218.727 1.00 370.00 ? 557  THR B C   1 
ATOM 8114  O O   . THR B 2  557  ? 252.718 163.868 218.138 1.00 370.00 ? 557  THR B O   1 
ATOM 8115  C CB  . THR B 2  557  ? 250.974 163.036 220.231 1.00 370.00 ? 557  THR B CB  1 
ATOM 8116  O OG1 . THR B 2  557  ? 250.492 162.797 221.558 1.00 370.00 ? 557  THR B OG1 1 
ATOM 8117  C CG2 . THR B 2  557  ? 250.061 162.322 219.247 1.00 370.00 ? 557  THR B CG2 1 
ATOM 8118  N N   . GLN B 2  558  ? 253.804 161.906 218.230 1.00 370.00 ? 558  GLN B N   1 
ATOM 8119  C CA  . GLN B 2  558  ? 254.384 162.071 216.910 1.00 370.00 ? 558  GLN B CA  1 
ATOM 8120  C C   . GLN B 2  558  ? 254.029 160.882 216.039 1.00 370.00 ? 558  GLN B C   1 
ATOM 8121  O O   . GLN B 2  558  ? 253.432 159.903 216.488 1.00 370.00 ? 558  GLN B O   1 
ATOM 8122  C CB  . GLN B 2  558  ? 255.905 162.239 216.957 1.00 370.00 ? 558  GLN B CB  1 
ATOM 8123  C CG  . GLN B 2  558  ? 256.734 161.030 217.315 1.00 370.00 ? 558  GLN B CG  1 
ATOM 8124  C CD  . GLN B 2  558  ? 258.214 161.358 217.294 1.00 370.00 ? 558  GLN B CD  1 
ATOM 8125  O OE1 . GLN B 2  558  ? 258.609 162.468 216.936 1.00 370.00 ? 558  GLN B OE1 1 
ATOM 8126  N NE2 . GLN B 2  558  ? 259.041 160.395 217.668 1.00 370.00 ? 558  GLN B NE2 1 
ATOM 8127  N N   . LYS B 2  559  ? 254.447 160.987 214.783 1.00 370.00 ? 559  LYS B N   1 
ATOM 8128  C CA  . LYS B 2  559  ? 254.212 159.996 213.750 1.00 370.00 ? 559  LYS B CA  1 
ATOM 8129  C C   . LYS B 2  559  ? 255.060 160.385 212.555 1.00 370.00 ? 559  LYS B C   1 
ATOM 8130  O O   . LYS B 2  559  ? 255.220 161.574 212.273 1.00 370.00 ? 559  LYS B O   1 
ATOM 8131  C CB  . LYS B 2  559  ? 252.734 159.955 213.379 1.00 370.00 ? 559  LYS B CB  1 
ATOM 8132  C CG  . LYS B 2  559  ? 252.356 158.858 212.470 1.00 370.00 ? 559  LYS B CG  1 
ATOM 8133  C CD  . LYS B 2  559  ? 250.877 158.889 212.369 1.00 370.00 ? 559  LYS B CD  1 
ATOM 8134  C CE  . LYS B 2  559  ? 250.377 157.899 211.386 1.00 370.00 ? 559  LYS B CE  1 
ATOM 8135  N NZ  . LYS B 2  559  ? 248.895 157.994 211.348 1.00 370.00 ? 559  LYS B NZ  1 
ATOM 8136  N N   . TYR B 2  560  ? 255.625 159.398 211.875 1.00 370.00 ? 560  TYR B N   1 
ATOM 8137  C CA  . TYR B 2  560  ? 256.573 159.659 210.800 1.00 370.00 ? 560  TYR B CA  1 
ATOM 8138  C C   . TYR B 2  560  ? 255.945 159.177 209.503 1.00 370.00 ? 560  TYR B C   1 
ATOM 8139  O O   . TYR B 2  560  ? 255.804 157.970 209.290 1.00 370.00 ? 560  TYR B O   1 
ATOM 8140  C CB  . TYR B 2  560  ? 257.904 158.958 211.060 1.00 370.00 ? 560  TYR B CB  1 
ATOM 8141  C CG  . TYR B 2  560  ? 258.671 159.445 212.278 1.00 370.00 ? 560  TYR B CG  1 
ATOM 8142  C CD1 . TYR B 2  560  ? 258.407 160.678 212.859 1.00 370.00 ? 560  TYR B CD1 1 
ATOM 8143  C CD2 . TYR B 2  560  ? 259.652 158.652 212.856 1.00 370.00 ? 560  TYR B CD2 1 
ATOM 8144  C CE1 . TYR B 2  560  ? 259.101 161.106 213.974 1.00 370.00 ? 560  TYR B CE1 1 
ATOM 8145  C CE2 . TYR B 2  560  ? 260.350 159.074 213.967 1.00 370.00 ? 560  TYR B CE2 1 
ATOM 8146  C CZ  . TYR B 2  560  ? 260.070 160.299 214.519 1.00 370.00 ? 560  TYR B CZ  1 
ATOM 8147  O OH  . TYR B 2  560  ? 260.767 160.713 215.623 1.00 370.00 ? 560  TYR B OH  1 
ATOM 8148  N N   . VAL B 2  561  ? 255.557 160.112 208.645 1.00 370.00 ? 561  VAL B N   1 
ATOM 8149  C CA  . VAL B 2  561  ? 254.996 159.795 207.340 1.00 370.00 ? 561  VAL B CA  1 
ATOM 8150  C C   . VAL B 2  561  ? 255.967 160.282 206.285 1.00 370.00 ? 561  VAL B C   1 
ATOM 8151  O O   . VAL B 2  561  ? 256.337 161.460 206.270 1.00 370.00 ? 561  VAL B O   1 
ATOM 8152  C CB  . VAL B 2  561  ? 253.612 160.426 207.132 1.00 370.00 ? 561  VAL B CB  1 
ATOM 8153  C CG1 . VAL B 2  561  ? 253.099 160.122 205.735 1.00 370.00 ? 561  VAL B CG1 1 
ATOM 8154  C CG2 . VAL B 2  561  ? 252.657 159.907 208.171 1.00 370.00 ? 561  VAL B CG2 1 
ATOM 8155  N N   . GLY B 2  562  ? 256.346 159.390 205.389 1.00 370.00 ? 562  GLY B N   1 
ATOM 8156  C CA  . GLY B 2  562  ? 257.395 159.659 204.449 1.00 370.00 ? 562  GLY B CA  1 
ATOM 8157  C C   . GLY B 2  562  ? 256.837 160.075 203.116 1.00 370.00 ? 562  GLY B C   1 
ATOM 8158  O O   . GLY B 2  562  ? 256.510 161.241 202.893 1.00 370.00 ? 562  GLY B O   1 
ATOM 8159  N N   . PRO B 2  563  ? 256.695 159.111 202.220 1.00 370.00 ? 563  PRO B N   1 
ATOM 8160  C CA  . PRO B 2  563  ? 256.577 159.418 200.791 1.00 370.00 ? 563  PRO B CA  1 
ATOM 8161  C C   . PRO B 2  563  ? 255.282 160.094 200.386 1.00 370.00 ? 563  PRO B C   1 
ATOM 8162  O O   . PRO B 2  563  ? 254.210 159.491 200.289 1.00 370.00 ? 563  PRO B O   1 
ATOM 8163  C CB  . PRO B 2  563  ? 256.701 158.040 200.139 1.00 370.00 ? 563  PRO B CB  1 
ATOM 8164  C CG  . PRO B 2  563  ? 256.203 157.093 201.182 1.00 370.00 ? 563  PRO B CG  1 
ATOM 8165  C CD  . PRO B 2  563  ? 256.604 157.669 202.496 1.00 370.00 ? 563  PRO B CD  1 
ATOM 8166  N N   . LEU B 2  564  ? 255.409 161.395 200.162 1.00 370.00 ? 564  LEU B N   1 
ATOM 8167  C CA  . LEU B 2  564  ? 254.333 162.291 199.782 1.00 370.00 ? 564  LEU B CA  1 
ATOM 8168  C C   . LEU B 2  564  ? 254.961 163.257 198.791 1.00 370.00 ? 564  LEU B C   1 
ATOM 8169  O O   . LEU B 2  564  ? 256.053 162.996 198.280 1.00 370.00 ? 564  LEU B O   1 
ATOM 8170  C CB  . LEU B 2  564  ? 253.764 162.997 201.015 1.00 370.00 ? 564  LEU B CB  1 
ATOM 8171  C CG  . LEU B 2  564  ? 253.317 162.161 202.215 1.00 370.00 ? 564  LEU B CG  1 
ATOM 8172  C CD1 . LEU B 2  564  ? 253.306 163.026 203.432 1.00 370.00 ? 564  LEU B CD1 1 
ATOM 8173  C CD2 . LEU B 2  564  ? 251.969 161.514 201.985 1.00 370.00 ? 564  LEU B CD2 1 
ATOM 8174  N N   . LYS B 2  565  ? 254.309 164.389 198.515 1.00 370.00 ? 565  LYS B N   1 
ATOM 8175  C CA  . LYS B 2  565  ? 254.920 165.394 197.648 1.00 370.00 ? 565  LYS B CA  1 
ATOM 8176  C C   . LYS B 2  565  ? 254.674 166.800 198.182 1.00 370.00 ? 565  LYS B C   1 
ATOM 8177  O O   . LYS B 2  565  ? 254.012 167.009 199.202 1.00 370.00 ? 565  LYS B O   1 
ATOM 8178  C CB  . LYS B 2  565  ? 254.438 165.288 196.195 1.00 370.00 ? 565  LYS B CB  1 
ATOM 8179  C CG  . LYS B 2  565  ? 255.025 164.107 195.445 1.00 370.00 ? 565  LYS B CG  1 
ATOM 8180  C CD  . LYS B 2  565  ? 254.631 164.062 193.996 1.00 370.00 ? 565  LYS B CD  1 
ATOM 8181  C CE  . LYS B 2  565  ? 255.428 165.063 193.193 1.00 370.00 ? 565  LYS B CE  1 
ATOM 8182  N NZ  . LYS B 2  565  ? 256.859 164.686 193.090 1.00 370.00 ? 565  LYS B NZ  1 
ATOM 8183  N N   . VAL B 2  566  ? 255.250 167.762 197.461 1.00 370.00 ? 566  VAL B N   1 
ATOM 8184  C CA  . VAL B 2  566  ? 255.489 169.127 197.913 1.00 370.00 ? 566  VAL B CA  1 
ATOM 8185  C C   . VAL B 2  566  ? 255.069 170.072 196.800 1.00 370.00 ? 566  VAL B C   1 
ATOM 8186  O O   . VAL B 2  566  ? 255.461 169.865 195.649 1.00 370.00 ? 566  VAL B O   1 
ATOM 8187  C CB  . VAL B 2  566  ? 256.980 169.341 198.237 1.00 370.00 ? 566  VAL B CB  1 
ATOM 8188  C CG1 . VAL B 2  566  ? 257.274 170.790 198.555 1.00 370.00 ? 566  VAL B CG1 1 
ATOM 8189  C CG2 . VAL B 2  566  ? 257.443 168.444 199.373 1.00 370.00 ? 566  VAL B CG2 1 
ATOM 8190  N N   . THR B 2  567  ? 254.321 171.121 197.144 1.00 370.00 ? 567  THR B N   1 
ATOM 8191  C CA  . THR B 2  567  ? 253.769 172.073 196.187 1.00 370.00 ? 567  THR B CA  1 
ATOM 8192  C C   . THR B 2  567  ? 254.361 173.464 196.393 1.00 370.00 ? 567  THR B C   1 
ATOM 8193  O O   . THR B 2  567  ? 254.162 174.083 197.438 1.00 370.00 ? 567  THR B O   1 
ATOM 8194  C CB  . THR B 2  567  ? 252.256 172.136 196.332 1.00 370.00 ? 567  THR B CB  1 
ATOM 8195  O OG1 . THR B 2  567  ? 251.696 170.852 196.029 1.00 370.00 ? 567  THR B OG1 1 
ATOM 8196  C CG2 . THR B 2  567  ? 251.672 173.209 195.419 1.00 370.00 ? 567  THR B CG2 1 
ATOM 8197  N N   . VAL B 2  568  ? 255.037 173.979 195.374 1.00 370.00 ? 568  VAL B N   1 
ATOM 8198  C CA  . VAL B 2  568  ? 255.766 175.238 195.454 1.00 370.00 ? 568  VAL B CA  1 
ATOM 8199  C C   . VAL B 2  568  ? 255.301 176.128 194.308 1.00 370.00 ? 568  VAL B C   1 
ATOM 8200  O O   . VAL B 2  568  ? 255.158 175.653 193.178 1.00 370.00 ? 568  VAL B O   1 
ATOM 8201  C CB  . VAL B 2  568  ? 257.290 175.002 195.366 1.00 370.00 ? 568  VAL B CB  1 
ATOM 8202  C CG1 . VAL B 2  568  ? 258.065 176.311 195.425 1.00 370.00 ? 568  VAL B CG1 1 
ATOM 8203  C CG2 . VAL B 2  568  ? 257.769 174.037 196.449 1.00 370.00 ? 568  VAL B CG2 1 
ATOM 8204  N N   . GLN B 2  569  ? 255.056 177.410 194.587 1.00 370.00 ? 569  GLN B N   1 
ATOM 8205  C CA  . GLN B 2  569  ? 254.871 178.362 193.497 1.00 370.00 ? 569  GLN B CA  1 
ATOM 8206  C C   . GLN B 2  569  ? 256.147 179.136 193.222 1.00 370.00 ? 569  GLN B C   1 
ATOM 8207  O O   . GLN B 2  569  ? 256.736 179.728 194.135 1.00 370.00 ? 569  GLN B O   1 
ATOM 8208  C CB  . GLN B 2  569  ? 253.752 179.365 193.762 1.00 370.00 ? 569  GLN B CB  1 
ATOM 8209  C CG  . GLN B 2  569  ? 252.365 178.796 193.719 1.00 370.00 ? 569  GLN B CG  1 
ATOM 8210  C CD  . GLN B 2  569  ? 251.325 179.864 193.449 1.00 370.00 ? 569  GLN B CD  1 
ATOM 8211  O OE1 . GLN B 2  569  ? 251.665 181.010 193.196 1.00 370.00 ? 569  GLN B OE1 1 
ATOM 8212  N NE2 . GLN B 2  569  ? 250.052 179.491 193.503 1.00 370.00 ? 569  GLN B NE2 1 
ATOM 8213  N N   . GLU B 2  570  ? 256.508 179.190 191.939 1.00 370.00 ? 570  GLU B N   1 
ATOM 8214  C CA  . GLU B 2  570  ? 257.606 179.987 191.415 1.00 370.00 ? 570  GLU B CA  1 
ATOM 8215  C C   . GLU B 2  570  ? 257.197 181.455 191.376 1.00 370.00 ? 570  GLU B C   1 
ATOM 8216  O O   . GLU B 2  570  ? 256.171 181.851 191.936 1.00 370.00 ? 570  GLU B O   1 
ATOM 8217  C CB  . GLU B 2  570  ? 257.983 179.485 190.022 1.00 370.00 ? 570  GLU B CB  1 
ATOM 8218  C CG  . GLU B 2  570  ? 258.444 178.036 190.046 1.00 370.00 ? 570  GLU B CG  1 
ATOM 8219  C CD  . GLU B 2  570  ? 258.710 177.443 188.680 1.00 370.00 ? 570  GLU B CD  1 
ATOM 8220  O OE1 . GLU B 2  570  ? 258.436 178.120 187.670 1.00 370.00 ? 570  GLU B OE1 1 
ATOM 8221  O OE2 . GLU B 2  570  ? 259.182 176.289 188.607 1.00 370.00 ? 570  GLU B OE2 1 
ATOM 8222  N N   . LEU B 2  571  ? 258.025 182.284 190.736 1.00 370.00 ? 571  LEU B N   1 
ATOM 8223  C CA  . LEU B 2  571  ? 257.609 183.664 190.534 1.00 370.00 ? 571  LEU B CA  1 
ATOM 8224  C C   . LEU B 2  571  ? 256.384 183.729 189.643 1.00 370.00 ? 571  LEU B C   1 
ATOM 8225  O O   . LEU B 2  571  ? 255.266 183.906 190.131 1.00 370.00 ? 571  LEU B O   1 
ATOM 8226  C CB  . LEU B 2  571  ? 258.711 184.498 189.901 1.00 370.00 ? 571  LEU B CB  1 
ATOM 8227  C CG  . LEU B 2  571  ? 259.966 184.713 190.721 1.00 370.00 ? 571  LEU B CG  1 
ATOM 8228  C CD1 . LEU B 2  571  ? 260.956 185.602 189.983 1.00 370.00 ? 571  LEU B CD1 1 
ATOM 8229  C CD2 . LEU B 2  571  ? 259.682 185.224 192.123 1.00 370.00 ? 571  LEU B CD2 1 
ATOM 8230  N N   . ASP B 2  572  ? 256.570 183.464 188.365 1.00 370.00 ? 572  ASP B N   1 
ATOM 8231  C CA  . ASP B 2  572  ? 255.465 183.344 187.427 1.00 370.00 ? 572  ASP B CA  1 
ATOM 8232  C C   . ASP B 2  572  ? 255.732 182.033 186.718 1.00 370.00 ? 572  ASP B C   1 
ATOM 8233  O O   . ASP B 2  572  ? 256.298 182.007 185.625 1.00 370.00 ? 572  ASP B O   1 
ATOM 8234  C CB  . ASP B 2  572  ? 255.386 184.524 186.452 1.00 370.00 ? 572  ASP B CB  1 
ATOM 8235  C CG  . ASP B 2  572  ? 255.052 185.839 187.131 1.00 370.00 ? 572  ASP B CG  1 
ATOM 8236  O OD1 . ASP B 2  572  ? 254.540 185.836 188.255 1.00 370.00 ? 572  ASP B OD1 1 
ATOM 8237  O OD2 . ASP B 2  572  ? 255.253 186.899 186.519 1.00 370.00 ? 572  ASP B OD2 1 
ATOM 8238  N N   . GLY B 2  573  ? 255.331 180.937 187.343 1.00 370.00 ? 573  GLY B N   1 
ATOM 8239  C CA  . GLY B 2  573  ? 255.702 179.665 186.775 1.00 370.00 ? 573  GLY B CA  1 
ATOM 8240  C C   . GLY B 2  573  ? 255.110 178.452 187.444 1.00 370.00 ? 573  GLY B C   1 
ATOM 8241  O O   . GLY B 2  573  ? 254.027 178.511 188.034 1.00 370.00 ? 573  GLY B O   1 
ATOM 8242  N N   . SER B 2  574  ? 255.845 177.348 187.372 1.00 370.00 ? 574  SER B N   1 
ATOM 8243  C CA  . SER B 2  574  ? 255.272 176.028 187.564 1.00 370.00 ? 574  SER B CA  1 
ATOM 8244  C C   . SER B 2  574  ? 254.981 175.739 189.024 1.00 370.00 ? 574  SER B C   1 
ATOM 8245  O O   . SER B 2  574  ? 255.751 176.100 189.918 1.00 370.00 ? 574  SER B O   1 
ATOM 8246  C CB  . SER B 2  574  ? 256.209 174.954 187.017 1.00 370.00 ? 574  SER B CB  1 
ATOM 8247  O OG  . SER B 2  574  ? 257.367 174.829 187.815 1.00 370.00 ? 574  SER B OG  1 
ATOM 8248  N N   . PHE B 2  575  ? 253.859 175.073 189.251 1.00 370.00 ? 575  PHE B N   1 
ATOM 8249  C CA  . PHE B 2  575  ? 253.553 174.495 190.550 1.00 370.00 ? 575  PHE B CA  1 
ATOM 8250  C C   . PHE B 2  575  ? 254.477 173.308 190.728 1.00 370.00 ? 575  PHE B C   1 
ATOM 8251  O O   . PHE B 2  575  ? 254.172 172.200 190.300 1.00 370.00 ? 575  PHE B O   1 
ATOM 8252  C CB  . PHE B 2  575  ? 252.099 174.056 190.613 1.00 370.00 ? 575  PHE B CB  1 
ATOM 8253  C CG  . PHE B 2  575  ? 251.110 175.177 190.652 1.00 370.00 ? 575  PHE B CG  1 
ATOM 8254  C CD1 . PHE B 2  575  ? 251.498 176.483 190.907 1.00 370.00 ? 575  PHE B CD1 1 
ATOM 8255  C CD2 . PHE B 2  575  ? 249.765 174.910 190.458 1.00 370.00 ? 575  PHE B CD2 1 
ATOM 8256  C CE1 . PHE B 2  575  ? 250.561 177.498 190.943 1.00 370.00 ? 575  PHE B CE1 1 
ATOM 8257  C CE2 . PHE B 2  575  ? 248.823 175.922 190.500 1.00 370.00 ? 575  PHE B CE2 1 
ATOM 8258  C CZ  . PHE B 2  575  ? 249.220 177.213 190.752 1.00 370.00 ? 575  PHE B CZ  1 
ATOM 8259  N N   . ASN B 2  576  ? 255.624 173.539 191.336 1.00 370.00 ? 576  ASN B N   1 
ATOM 8260  C CA  . ASN B 2  576  ? 256.639 172.511 191.448 1.00 370.00 ? 576  ASN B CA  1 
ATOM 8261  C C   . ASN B 2  576  ? 256.278 171.540 192.554 1.00 370.00 ? 576  ASN B C   1 
ATOM 8262  O O   . ASN B 2  576  ? 255.989 171.946 193.678 1.00 370.00 ? 576  ASN B O   1 
ATOM 8263  C CB  . ASN B 2  576  ? 258.002 173.139 191.700 1.00 370.00 ? 576  ASN B CB  1 
ATOM 8264  C CG  . ASN B 2  576  ? 258.559 173.789 190.460 1.00 370.00 ? 576  ASN B CG  1 
ATOM 8265  O OD1 . ASN B 2  576  ? 258.341 173.305 189.352 1.00 370.00 ? 576  ASN B OD1 1 
ATOM 8266  N ND2 . ASN B 2  576  ? 259.297 174.871 190.631 1.00 370.00 ? 576  ASN B ND2 1 
ATOM 8267  N N   . HIS B 2  577  ? 256.293 170.258 192.232 1.00 370.00 ? 577  HIS B N   1 
ATOM 8268  C CA  . HIS B 2  577  ? 255.886 169.240 193.179 1.00 370.00 ? 577  HIS B CA  1 
ATOM 8269  C C   . HIS B 2  577  ? 256.991 168.213 193.301 1.00 370.00 ? 577  HIS B C   1 
ATOM 8270  O O   . HIS B 2  577  ? 257.541 167.758 192.294 1.00 370.00 ? 577  HIS B O   1 
ATOM 8271  C CB  . HIS B 2  577  ? 254.592 168.584 192.748 1.00 370.00 ? 577  HIS B CB  1 
ATOM 8272  C CG  . HIS B 2  577  ? 253.548 169.568 192.359 1.00 370.00 ? 577  HIS B CG  1 
ATOM 8273  N ND1 . HIS B 2  577  ? 253.115 170.558 193.210 1.00 370.00 ? 577  HIS B ND1 1 
ATOM 8274  C CD2 . HIS B 2  577  ? 252.814 169.686 191.230 1.00 370.00 ? 577  HIS B CD2 1 
ATOM 8275  C CE1 . HIS B 2  577  ? 252.184 171.271 192.606 1.00 370.00 ? 577  HIS B CE1 1 
ATOM 8276  N NE2 . HIS B 2  577  ? 251.985 170.766 191.403 1.00 370.00 ? 577  HIS B NE2 1 
ATOM 8277  N N   . THR B 2  578  ? 257.309 167.855 194.530 1.00 370.00 ? 578  THR B N   1 
ATOM 8278  C CA  . THR B 2  578  ? 258.526 167.100 194.773 1.00 370.00 ? 578  THR B CA  1 
ATOM 8279  C C   . THR B 2  578  ? 258.246 165.986 195.770 1.00 370.00 ? 578  THR B C   1 
ATOM 8280  O O   . THR B 2  578  ? 257.526 166.187 196.748 1.00 370.00 ? 578  THR B O   1 
ATOM 8281  C CB  . THR B 2  578  ? 259.641 168.035 195.259 1.00 370.00 ? 578  THR B CB  1 
ATOM 8282  O OG1 . THR B 2  578  ? 259.793 169.105 194.317 1.00 370.00 ? 578  THR B OG1 1 
ATOM 8283  C CG2 . THR B 2  578  ? 260.972 167.307 195.350 1.00 370.00 ? 578  THR B CG2 1 
ATOM 8284  N N   . LEU B 2  579  ? 258.815 164.813 195.496 1.00 370.00 ? 579  LEU B N   1 
ATOM 8285  C CA  . LEU B 2  579  ? 258.602 163.598 196.263 1.00 370.00 ? 579  LEU B CA  1 
ATOM 8286  C C   . LEU B 2  579  ? 259.134 163.729 197.683 1.00 370.00 ? 579  LEU B C   1 
ATOM 8287  O O   . LEU B 2  579  ? 259.910 164.625 198.019 1.00 370.00 ? 579  LEU B O   1 
ATOM 8288  C CB  . LEU B 2  579  ? 259.296 162.420 195.594 1.00 370.00 ? 579  LEU B CB  1 
ATOM 8289  C CG  . LEU B 2  579  ? 258.782 162.018 194.219 1.00 370.00 ? 579  LEU B CG  1 
ATOM 8290  C CD1 . LEU B 2  579  ? 259.699 160.974 193.613 1.00 370.00 ? 579  LEU B CD1 1 
ATOM 8291  C CD2 . LEU B 2  579  ? 257.379 161.479 194.340 1.00 370.00 ? 579  LEU B CD2 1 
ATOM 8292  N N   . GLN B 2  580  ? 258.703 162.802 198.526 1.00 370.00 ? 580  GLN B N   1 
ATOM 8293  C CA  . GLN B 2  580  ? 259.193 162.709 199.885 1.00 370.00 ? 580  GLN B CA  1 
ATOM 8294  C C   . GLN B 2  580  ? 259.589 161.269 200.149 1.00 370.00 ? 580  GLN B C   1 
ATOM 8295  O O   . GLN B 2  580  ? 259.304 160.370 199.357 1.00 370.00 ? 580  GLN B O   1 
ATOM 8296  C CB  . GLN B 2  580  ? 258.144 163.167 200.888 1.00 370.00 ? 580  GLN B CB  1 
ATOM 8297  C CG  . GLN B 2  580  ? 257.643 164.563 200.647 1.00 370.00 ? 580  GLN B CG  1 
ATOM 8298  C CD  . GLN B 2  580  ? 256.562 164.931 201.602 1.00 370.00 ? 580  GLN B CD  1 
ATOM 8299  O OE1 . GLN B 2  580  ? 256.305 164.203 202.557 1.00 370.00 ? 580  GLN B OE1 1 
ATOM 8300  N NE2 . GLN B 2  580  ? 255.858 166.020 201.315 1.00 370.00 ? 580  GLN B NE2 1 
ATOM 8301  N N   . ILE B 2  581  ? 260.333 161.064 201.238 1.00 370.00 ? 581  ILE B N   1 
ATOM 8302  C CA  . ILE B 2  581  ? 260.837 159.752 201.633 1.00 370.00 ? 581  ILE B CA  1 
ATOM 8303  C C   . ILE B 2  581  ? 260.658 159.654 203.147 1.00 370.00 ? 581  ILE B C   1 
ATOM 8304  O O   . ILE B 2  581  ? 260.477 160.657 203.836 1.00 370.00 ? 581  ILE B O   1 
ATOM 8305  C CB  . ILE B 2  581  ? 262.335 159.543 201.253 1.00 370.00 ? 581  ILE B CB  1 
ATOM 8306  C CG1 . ILE B 2  581  ? 262.678 160.017 199.842 1.00 370.00 ? 581  ILE B CG1 1 
ATOM 8307  C CG2 . ILE B 2  581  ? 262.717 158.067 201.183 1.00 370.00 ? 581  ILE B CG2 1 
ATOM 8308  C CD1 . ILE B 2  581  ? 264.161 160.129 199.589 1.00 370.00 ? 581  ILE B CD1 1 
ATOM 8309  N N   . GLU B 2  582  ? 260.703 158.425 203.664 1.00 370.00 ? 582  GLU B N   1 
ATOM 8310  C CA  . GLU B 2  582  ? 261.011 158.161 205.065 1.00 370.00 ? 582  GLU B CA  1 
ATOM 8311  C C   . GLU B 2  582  ? 262.510 158.355 205.310 1.00 370.00 ? 582  GLU B C   1 
ATOM 8312  O O   . GLU B 2  582  ? 263.256 158.778 204.420 1.00 370.00 ? 582  GLU B O   1 
ATOM 8313  C CB  . GLU B 2  582  ? 260.574 156.753 205.451 1.00 370.00 ? 582  GLU B CB  1 
ATOM 8314  C CG  . GLU B 2  582  ? 259.075 156.528 205.569 1.00 370.00 ? 582  GLU B CG  1 
ATOM 8315  C CD  . GLU B 2  582  ? 258.477 157.170 206.805 1.00 370.00 ? 582  GLU B CD  1 
ATOM 8316  O OE1 . GLU B 2  582  ? 259.215 157.354 207.795 1.00 370.00 ? 582  GLU B OE1 1 
ATOM 8317  O OE2 . GLU B 2  582  ? 257.261 157.444 206.807 1.00 370.00 ? 582  GLU B OE2 1 
ATOM 8318  N N   . GLU B 2  583  ? 262.963 157.999 206.519 1.00 370.00 ? 583  GLU B N   1 
ATOM 8319  C CA  . GLU B 2  583  ? 264.327 158.229 207.020 1.00 370.00 ? 583  GLU B CA  1 
ATOM 8320  C C   . GLU B 2  583  ? 264.699 159.705 206.886 1.00 370.00 ? 583  GLU B C   1 
ATOM 8321  O O   . GLU B 2  583  ? 265.580 160.116 206.133 1.00 370.00 ? 583  GLU B O   1 
ATOM 8322  C CB  . GLU B 2  583  ? 265.344 157.318 206.335 1.00 370.00 ? 583  GLU B CB  1 
ATOM 8323  C CG  . GLU B 2  583  ? 265.149 155.876 206.703 1.00 370.00 ? 583  GLU B CG  1 
ATOM 8324  C CD  . GLU B 2  583  ? 266.151 154.980 206.033 1.00 370.00 ? 583  GLU B CD  1 
ATOM 8325  O OE1 . GLU B 2  583  ? 266.919 155.484 205.189 1.00 370.00 ? 583  GLU B OE1 1 
ATOM 8326  O OE2 . GLU B 2  583  ? 266.174 153.773 206.349 1.00 370.00 ? 583  GLU B OE2 1 
ATOM 8327  N N   . ASN B 2  584  ? 263.985 160.478 207.681 1.00 370.00 ? 584  ASN B N   1 
ATOM 8328  C CA  . ASN B 2  584  ? 263.566 161.828 207.359 1.00 370.00 ? 584  ASN B CA  1 
ATOM 8329  C C   . ASN B 2  584  ? 264.641 162.886 207.552 1.00 370.00 ? 584  ASN B C   1 
ATOM 8330  O O   . ASN B 2  584  ? 264.308 164.073 207.590 1.00 370.00 ? 584  ASN B O   1 
ATOM 8331  C CB  . ASN B 2  584  ? 262.338 162.153 208.199 1.00 370.00 ? 584  ASN B CB  1 
ATOM 8332  C CG  . ASN B 2  584  ? 261.179 161.239 207.874 1.00 370.00 ? 584  ASN B CG  1 
ATOM 8333  O OD1 . ASN B 2  584  ? 260.897 160.984 206.706 1.00 370.00 ? 584  ASN B OD1 1 
ATOM 8334  N ND2 . ASN B 2  584  ? 260.526 160.708 208.903 1.00 370.00 ? 584  ASN B ND2 1 
ATOM 8335  N N   . SER B 2  585  ? 265.910 162.512 207.668 1.00 370.00 ? 585  SER B N   1 
ATOM 8336  C CA  . SER B 2  585  ? 266.988 163.497 207.691 1.00 370.00 ? 585  SER B CA  1 
ATOM 8337  C C   . SER B 2  585  ? 267.329 163.837 206.245 1.00 370.00 ? 585  SER B C   1 
ATOM 8338  O O   . SER B 2  585  ? 268.355 163.427 205.699 1.00 370.00 ? 585  SER B O   1 
ATOM 8339  C CB  . SER B 2  585  ? 268.192 162.946 208.439 1.00 370.00 ? 585  SER B CB  1 
ATOM 8340  O OG  . SER B 2  585  ? 268.734 161.832 207.751 1.00 370.00 ? 585  SER B OG  1 
ATOM 8341  N N   . LEU B 2  586  ? 266.447 164.596 205.600 1.00 370.00 ? 586  LEU B N   1 
ATOM 8342  C CA  . LEU B 2  586  ? 266.461 164.602 204.149 1.00 370.00 ? 586  LEU B CA  1 
ATOM 8343  C C   . LEU B 2  586  ? 266.743 165.987 203.594 1.00 370.00 ? 586  LEU B C   1 
ATOM 8344  O O   . LEU B 2  586  ? 266.469 167.001 204.227 1.00 370.00 ? 586  LEU B O   1 
ATOM 8345  C CB  . LEU B 2  586  ? 265.141 164.062 203.600 1.00 370.00 ? 586  LEU B CB  1 
ATOM 8346  C CG  . LEU B 2  586  ? 264.968 162.582 203.951 1.00 370.00 ? 586  LEU B CG  1 
ATOM 8347  C CD1 . LEU B 2  586  ? 263.596 162.074 203.598 1.00 370.00 ? 586  LEU B CD1 1 
ATOM 8348  C CD2 . LEU B 2  586  ? 266.039 161.740 203.278 1.00 370.00 ? 586  LEU B CD2 1 
ATOM 8349  N N   . LYS B 2  587  ? 267.305 166.000 202.391 1.00 370.00 ? 587  LYS B N   1 
ATOM 8350  C CA  . LYS B 2  587  ? 267.588 167.207 201.633 1.00 370.00 ? 587  LYS B CA  1 
ATOM 8351  C C   . LYS B 2  587  ? 267.036 166.964 200.242 1.00 370.00 ? 587  LYS B C   1 
ATOM 8352  O O   . LYS B 2  587  ? 267.246 165.884 199.687 1.00 370.00 ? 587  LYS B O   1 
ATOM 8353  C CB  . LYS B 2  587  ? 269.088 167.458 201.547 1.00 370.00 ? 587  LYS B CB  1 
ATOM 8354  C CG  . LYS B 2  587  ? 269.796 167.499 202.878 1.00 370.00 ? 587  LYS B CG  1 
ATOM 8355  C CD  . LYS B 2  587  ? 271.281 167.686 202.679 1.00 370.00 ? 587  LYS B CD  1 
ATOM 8356  C CE  . LYS B 2  587  ? 272.024 167.599 203.993 1.00 370.00 ? 587  LYS B CE  1 
ATOM 8357  N NZ  . LYS B 2  587  ? 273.488 167.739 203.808 1.00 370.00 ? 587  LYS B NZ  1 
ATOM 8358  N N   . HIS B 2  588  ? 266.340 167.938 199.667 1.00 370.00 ? 588  HIS B N   1 
ATOM 8359  C CA  . HIS B 2  588  ? 265.663 167.688 198.407 1.00 370.00 ? 588  HIS B CA  1 
ATOM 8360  C C   . HIS B 2  588  ? 265.713 168.917 197.525 1.00 370.00 ? 588  HIS B C   1 
ATOM 8361  O O   . HIS B 2  588  ? 266.048 170.013 197.966 1.00 370.00 ? 588  HIS B O   1 
ATOM 8362  C CB  . HIS B 2  588  ? 264.226 167.250 198.648 1.00 370.00 ? 588  HIS B CB  1 
ATOM 8363  C CG  . HIS B 2  588  ? 264.115 165.851 199.156 1.00 370.00 ? 588  HIS B CG  1 
ATOM 8364  N ND1 . HIS B 2  588  ? 264.066 164.762 198.314 1.00 370.00 ? 588  HIS B ND1 1 
ATOM 8365  C CD2 . HIS B 2  588  ? 264.140 165.354 200.413 1.00 370.00 ? 588  HIS B CD2 1 
ATOM 8366  C CE1 . HIS B 2  588  ? 263.997 163.657 199.033 1.00 370.00 ? 588  HIS B CE1 1 
ATOM 8367  N NE2 . HIS B 2  588  ? 264.039 163.989 200.311 1.00 370.00 ? 588  HIS B NE2 1 
ATOM 8368  N N   . ASP B 2  589  ? 265.375 168.713 196.266 1.00 370.00 ? 589  ASP B N   1 
ATOM 8369  C CA  . ASP B 2  589  ? 265.549 169.718 195.240 1.00 370.00 ? 589  ASP B CA  1 
ATOM 8370  C C   . ASP B 2  589  ? 264.181 170.225 194.798 1.00 370.00 ? 589  ASP B C   1 
ATOM 8371  O O   . ASP B 2  589  ? 263.147 169.852 195.354 1.00 370.00 ? 589  ASP B O   1 
ATOM 8372  C CB  . ASP B 2  589  ? 266.330 169.115 194.078 1.00 370.00 ? 589  ASP B CB  1 
ATOM 8373  C CG  . ASP B 2  589  ? 267.607 168.437 194.530 1.00 370.00 ? 589  ASP B CG  1 
ATOM 8374  O OD1 . ASP B 2  589  ? 268.145 168.791 195.599 1.00 370.00 ? 589  ASP B OD1 1 
ATOM 8375  O OD2 . ASP B 2  589  ? 268.075 167.539 193.804 1.00 370.00 ? 589  ASP B OD2 1 
ATOM 8376  N N   . ILE B 2  590  ? 264.166 171.093 193.792 1.00 370.00 ? 590  ILE B N   1 
ATOM 8377  C CA  . ILE B 2  590  ? 262.927 171.602 193.207 1.00 370.00 ? 590  ILE B CA  1 
ATOM 8378  C C   . ILE B 2  590  ? 263.073 171.466 191.698 1.00 370.00 ? 590  ILE B C   1 
ATOM 8379  O O   . ILE B 2  590  ? 264.169 171.694 191.168 1.00 370.00 ? 590  ILE B O   1 
ATOM 8380  C CB  . ILE B 2  590  ? 262.663 173.056 193.644 1.00 370.00 ? 590  ILE B CB  1 
ATOM 8381  C CG1 . ILE B 2  590  ? 262.399 173.132 195.148 1.00 370.00 ? 590  ILE B CG1 1 
ATOM 8382  C CG2 . ILE B 2  590  ? 261.519 173.707 192.895 1.00 370.00 ? 590  ILE B CG2 1 
ATOM 8383  C CD1 . ILE B 2  590  ? 262.593 174.507 195.724 1.00 370.00 ? 590  ILE B CD1 1 
ATOM 8384  N N   . PRO B 2  591  ? 262.013 171.087 190.968 1.00 370.00 ? 591  PRO B N   1 
ATOM 8385  C CA  . PRO B 2  591  ? 262.083 171.086 189.503 1.00 370.00 ? 591  PRO B CA  1 
ATOM 8386  C C   . PRO B 2  591  ? 262.168 172.503 188.967 1.00 370.00 ? 591  PRO B C   1 
ATOM 8387  O O   . PRO B 2  591  ? 261.158 173.177 188.746 1.00 370.00 ? 591  PRO B O   1 
ATOM 8388  C CB  . PRO B 2  591  ? 260.795 170.368 189.082 1.00 370.00 ? 591  PRO B CB  1 
ATOM 8389  C CG  . PRO B 2  591  ? 259.903 170.446 190.247 1.00 370.00 ? 591  PRO B CG  1 
ATOM 8390  C CD  . PRO B 2  591  ? 260.784 170.440 191.455 1.00 370.00 ? 591  PRO B CD  1 
ATOM 8391  N N   . CYS B 2  592  ? 263.422 172.928 188.803 1.00 370.00 ? 592  CYS B N   1 
ATOM 8392  C CA  . CYS B 2  592  ? 263.836 174.325 188.821 1.00 370.00 ? 592  CYS B CA  1 
ATOM 8393  C C   . CYS B 2  592  ? 263.119 175.217 187.815 1.00 370.00 ? 592  CYS B C   1 
ATOM 8394  O O   . CYS B 2  592  ? 262.807 174.812 186.693 1.00 370.00 ? 592  CYS B O   1 
ATOM 8395  C CB  . CYS B 2  592  ? 265.340 174.400 188.574 1.00 370.00 ? 592  CYS B CB  1 
ATOM 8396  S SG  . CYS B 2  592  ? 266.341 173.735 189.911 1.00 370.00 ? 592  CYS B SG  1 
ATOM 8397  N N   . HIS B 2  593  ? 262.872 176.449 188.247 1.00 370.00 ? 593  HIS B N   1 
ATOM 8398  C CA  . HIS B 2  593  ? 262.384 177.534 187.415 1.00 370.00 ? 593  HIS B CA  1 
ATOM 8399  C C   . HIS B 2  593  ? 263.477 177.952 186.430 1.00 370.00 ? 593  HIS B C   1 
ATOM 8400  O O   . HIS B 2  593  ? 264.646 177.584 186.561 1.00 370.00 ? 593  HIS B O   1 
ATOM 8401  C CB  . HIS B 2  593  ? 261.947 178.696 188.321 1.00 370.00 ? 593  HIS B CB  1 
ATOM 8402  C CG  . HIS B 2  593  ? 261.295 179.848 187.614 1.00 370.00 ? 593  HIS B CG  1 
ATOM 8403  N ND1 . HIS B 2  593  ? 260.031 179.779 187.071 1.00 370.00 ? 593  HIS B ND1 1 
ATOM 8404  C CD2 . HIS B 2  593  ? 261.734 181.107 187.377 1.00 370.00 ? 593  HIS B CD2 1 
ATOM 8405  C CE1 . HIS B 2  593  ? 259.721 180.940 186.526 1.00 370.00 ? 593  HIS B CE1 1 
ATOM 8406  N NE2 . HIS B 2  593  ? 260.739 181.763 186.696 1.00 370.00 ? 593  HIS B NE2 1 
ATOM 8407  N N   . SER B 2  594  ? 263.087 178.728 185.424 1.00 370.00 ? 594  SER B N   1 
ATOM 8408  C CA  . SER B 2  594  ? 264.034 179.318 184.497 1.00 370.00 ? 594  SER B CA  1 
ATOM 8409  C C   . SER B 2  594  ? 264.868 180.394 185.190 1.00 370.00 ? 594  SER B C   1 
ATOM 8410  O O   . SER B 2  594  ? 264.643 180.761 186.346 1.00 370.00 ? 594  SER B O   1 
ATOM 8411  C CB  . SER B 2  594  ? 263.296 179.927 183.313 1.00 370.00 ? 594  SER B CB  1 
ATOM 8412  O OG  . SER B 2  594  ? 262.529 181.041 183.739 1.00 370.00 ? 594  SER B OG  1 
ATOM 8413  N N   . LYS B 2  595  ? 265.841 180.924 184.457 1.00 370.00 ? 595  LYS B N   1 
ATOM 8414  C CA  . LYS B 2  595  ? 266.605 182.073 184.931 1.00 370.00 ? 595  LYS B CA  1 
ATOM 8415  C C   . LYS B 2  595  ? 265.705 183.290 184.814 1.00 370.00 ? 595  LYS B C   1 
ATOM 8416  O O   . LYS B 2  595  ? 265.733 184.025 183.827 1.00 370.00 ? 595  LYS B O   1 
ATOM 8417  C CB  . LYS B 2  595  ? 267.886 182.249 184.132 1.00 370.00 ? 595  LYS B CB  1 
ATOM 8418  C CG  . LYS B 2  595  ? 268.908 181.164 184.369 1.00 370.00 ? 595  LYS B CG  1 
ATOM 8419  C CD  . LYS B 2  595  ? 270.173 181.432 183.577 1.00 370.00 ? 595  LYS B CD  1 
ATOM 8420  C CE  . LYS B 2  595  ? 271.201 180.334 183.791 1.00 370.00 ? 595  LYS B CE  1 
ATOM 8421  N NZ  . LYS B 2  595  ? 272.446 180.584 183.015 1.00 370.00 ? 595  LYS B NZ  1 
ATOM 8422  N N   . SER B 2  596  ? 264.889 183.502 185.842 1.00 370.00 ? 596  SER B N   1 
ATOM 8423  C CA  . SER B 2  596  ? 263.959 184.624 185.880 1.00 370.00 ? 596  SER B CA  1 
ATOM 8424  C C   . SER B 2  596  ? 264.767 185.891 186.123 1.00 370.00 ? 596  SER B C   1 
ATOM 8425  O O   . SER B 2  596  ? 264.886 186.392 187.242 1.00 370.00 ? 596  SER B O   1 
ATOM 8426  C CB  . SER B 2  596  ? 262.916 184.414 186.964 1.00 370.00 ? 596  SER B CB  1 
ATOM 8427  O OG  . SER B 2  596  ? 263.533 184.410 188.238 1.00 370.00 ? 596  SER B OG  1 
ATOM 8428  N N   . ARG B 2  597  ? 265.345 186.410 185.047 1.00 370.00 ? 597  ARG B N   1 
ATOM 8429  C CA  . ARG B 2  597  ? 266.184 187.591 185.112 1.00 370.00 ? 597  ARG B CA  1 
ATOM 8430  C C   . ARG B 2  597  ? 265.656 188.618 184.126 1.00 370.00 ? 597  ARG B C   1 
ATOM 8431  O O   . ARG B 2  597  ? 264.871 188.291 183.232 1.00 370.00 ? 597  ARG B O   1 
ATOM 8432  C CB  . ARG B 2  597  ? 267.652 187.251 184.825 1.00 370.00 ? 597  ARG B CB  1 
ATOM 8433  C CG  . ARG B 2  597  ? 268.229 186.233 185.794 1.00 370.00 ? 597  ARG B CG  1 
ATOM 8434  C CD  . ARG B 2  597  ? 268.185 186.778 187.212 1.00 370.00 ? 597  ARG B CD  1 
ATOM 8435  N NE  . ARG B 2  597  ? 268.743 185.856 188.197 1.00 370.00 ? 597  ARG B NE  1 
ATOM 8436  C CZ  . ARG B 2  597  ? 268.678 186.049 189.510 1.00 370.00 ? 597  ARG B CZ  1 
ATOM 8437  N NH1 . ARG B 2  597  ? 268.069 187.122 189.991 1.00 370.00 ? 597  ARG B NH1 1 
ATOM 8438  N NH2 . ARG B 2  597  ? 269.211 185.170 190.347 1.00 370.00 ? 597  ARG B NH2 1 
ATOM 8439  N N   . ARG B 2  598  ? 266.131 189.857 184.290 1.00 370.00 ? 598  ARG B N   1 
ATOM 8440  C CA  . ARG B 2  598  ? 265.557 191.052 183.660 1.00 370.00 ? 598  ARG B CA  1 
ATOM 8441  C C   . ARG B 2  598  ? 264.053 191.104 183.901 1.00 370.00 ? 598  ARG B C   1 
ATOM 8442  O O   . ARG B 2  598  ? 263.243 191.209 182.980 1.00 370.00 ? 598  ARG B O   1 
ATOM 8443  C CB  . ARG B 2  598  ? 265.887 191.127 182.168 1.00 370.00 ? 598  ARG B CB  1 
ATOM 8444  C CG  . ARG B 2  598  ? 267.363 191.299 181.873 1.00 370.00 ? 598  ARG B CG  1 
ATOM 8445  C CD  . ARG B 2  598  ? 267.848 192.664 182.330 1.00 370.00 ? 598  ARG B CD  1 
ATOM 8446  N NE  . ARG B 2  598  ? 269.232 192.915 181.940 1.00 370.00 ? 598  ARG B NE  1 
ATOM 8447  C CZ  . ARG B 2  598  ? 270.287 192.607 182.688 1.00 370.00 ? 598  ARG B CZ  1 
ATOM 8448  N NH1 . ARG B 2  598  ? 270.118 192.029 183.869 1.00 370.00 ? 598  ARG B NH1 1 
ATOM 8449  N NH2 . ARG B 2  598  ? 271.511 192.874 182.253 1.00 370.00 ? 598  ARG B NH2 1 
ATOM 8450  N N   . ASN B 2  599  ? 263.685 191.002 185.168 1.00 370.00 ? 599  ASN B N   1 
ATOM 8451  C CA  . ASN B 2  599  ? 262.290 190.854 185.535 1.00 370.00 ? 599  ASN B CA  1 
ATOM 8452  C C   . ASN B 2  599  ? 261.559 192.181 185.583 1.00 370.00 ? 599  ASN B C   1 
ATOM 8453  O O   . ASN B 2  599  ? 260.346 192.201 185.813 1.00 370.00 ? 599  ASN B O   1 
ATOM 8454  C CB  . ASN B 2  599  ? 262.208 190.130 186.868 1.00 370.00 ? 599  ASN B CB  1 
ATOM 8455  C CG  . ASN B 2  599  ? 262.765 188.731 186.778 1.00 370.00 ? 599  ASN B CG  1 
ATOM 8456  O OD1 . ASN B 2  599  ? 262.530 188.026 185.798 1.00 370.00 ? 599  ASN B OD1 1 
ATOM 8457  N ND2 . ASN B 2  599  ? 263.528 188.329 187.784 1.00 370.00 ? 599  ASN B ND2 1 
ATOM 8458  N N   . LYS B 2  600  ? 262.269 193.285 185.374 1.00 370.00 ? 600  LYS B N   1 
ATOM 8459  C CA  . LYS B 2  600  ? 261.599 194.510 184.973 1.00 370.00 ? 600  LYS B CA  1 
ATOM 8460  C C   . LYS B 2  600  ? 260.972 194.341 183.598 1.00 370.00 ? 600  LYS B C   1 
ATOM 8461  O O   . LYS B 2  600  ? 259.909 194.904 183.318 1.00 370.00 ? 600  LYS B O   1 
ATOM 8462  C CB  . LYS B 2  600  ? 262.592 195.664 184.976 1.00 370.00 ? 600  LYS B CB  1 
ATOM 8463  C CG  . LYS B 2  600  ? 263.143 195.958 186.345 1.00 370.00 ? 600  LYS B CG  1 
ATOM 8464  C CD  . LYS B 2  600  ? 264.107 197.121 186.320 1.00 370.00 ? 600  LYS B CD  1 
ATOM 8465  C CE  . LYS B 2  600  ? 264.664 197.385 187.706 1.00 370.00 ? 600  LYS B CE  1 
ATOM 8466  N NZ  . LYS B 2  600  ? 265.619 198.525 187.712 1.00 370.00 ? 600  LYS B NZ  1 
ATOM 8467  N N   . LYS B 2  601  ? 261.624 193.570 182.724 1.00 370.00 ? 601  LYS B N   1 
ATOM 8468  C CA  . LYS B 2  601  ? 261.027 193.215 181.442 1.00 370.00 ? 601  LYS B CA  1 
ATOM 8469  C C   . LYS B 2  601  ? 260.098 192.019 181.580 1.00 370.00 ? 601  LYS B C   1 
ATOM 8470  O O   . LYS B 2  601  ? 258.998 192.017 181.016 1.00 370.00 ? 601  LYS B O   1 
ATOM 8471  C CB  . LYS B 2  601  ? 262.113 192.922 180.409 1.00 370.00 ? 601  LYS B CB  1 
ATOM 8472  C CG  . LYS B 2  601  ? 262.917 194.136 179.982 1.00 370.00 ? 601  LYS B CG  1 
ATOM 8473  C CD  . LYS B 2  601  ? 263.935 193.763 178.917 1.00 370.00 ? 601  LYS B CD  1 
ATOM 8474  C CE  . LYS B 2  601  ? 264.753 194.967 178.483 1.00 370.00 ? 601  LYS B CE  1 
ATOM 8475  N NZ  . LYS B 2  601  ? 265.755 194.607 177.443 1.00 370.00 ? 601  LYS B NZ  1 
ATOM 8476  N N   . LYS B 2  602  ? 260.507 191.001 182.337 1.00 370.00 ? 602  LYS B N   1 
ATOM 8477  C CA  . LYS B 2  602  ? 259.627 189.878 182.657 1.00 370.00 ? 602  LYS B CA  1 
ATOM 8478  C C   . LYS B 2  602  ? 258.628 190.353 183.706 1.00 370.00 ? 602  LYS B C   1 
ATOM 8479  O O   . LYS B 2  602  ? 258.719 190.023 184.889 1.00 370.00 ? 602  LYS B O   1 
ATOM 8480  C CB  . LYS B 2  602  ? 260.418 188.682 183.167 1.00 370.00 ? 602  LYS B CB  1 
ATOM 8481  C CG  . LYS B 2  602  ? 261.301 187.993 182.155 1.00 370.00 ? 602  LYS B CG  1 
ATOM 8482  C CD  . LYS B 2  602  ? 261.975 186.794 182.805 1.00 370.00 ? 602  LYS B CD  1 
ATOM 8483  C CE  . LYS B 2  602  ? 262.898 186.065 181.850 1.00 370.00 ? 602  LYS B CE  1 
ATOM 8484  N NZ  . LYS B 2  602  ? 263.592 184.932 182.523 1.00 370.00 ? 602  LYS B NZ  1 
ATOM 8485  N N   . LYS B 2  603  ? 257.652 191.143 183.255 1.00 370.00 ? 603  LYS B N   1 
ATOM 8486  C CA  . LYS B 2  603  ? 256.699 191.738 184.181 1.00 370.00 ? 603  LYS B CA  1 
ATOM 8487  C C   . LYS B 2  603  ? 255.734 190.690 184.702 1.00 370.00 ? 603  LYS B C   1 
ATOM 8488  O O   . LYS B 2  603  ? 255.696 190.401 185.902 1.00 370.00 ? 603  LYS B O   1 
ATOM 8489  C CB  . LYS B 2  603  ? 255.937 192.865 183.494 1.00 370.00 ? 603  LYS B CB  1 
ATOM 8490  C CG  . LYS B 2  603  ? 256.800 194.034 183.143 1.00 370.00 ? 603  LYS B CG  1 
ATOM 8491  C CD  . LYS B 2  603  ? 255.980 195.164 182.580 1.00 370.00 ? 603  LYS B CD  1 
ATOM 8492  C CE  . LYS B 2  603  ? 256.858 196.359 182.281 1.00 370.00 ? 603  LYS B CE  1 
ATOM 8493  N NZ  . LYS B 2  603  ? 256.073 197.494 181.728 1.00 370.00 ? 603  LYS B NZ  1 
ATOM 8494  N N   . ILE B 2  604  ? 254.935 190.117 183.813 1.00 370.00 ? 604  ILE B N   1 
ATOM 8495  C CA  . ILE B 2  604  ? 254.129 188.948 184.146 1.00 370.00 ? 604  ILE B CA  1 
ATOM 8496  C C   . ILE B 2  604  ? 254.388 187.911 183.060 1.00 370.00 ? 604  ILE B C   1 
ATOM 8497  O O   . ILE B 2  604  ? 253.723 187.937 182.014 1.00 370.00 ? 604  ILE B O   1 
ATOM 8498  C CB  . ILE B 2  604  ? 252.635 189.299 184.253 1.00 370.00 ? 604  ILE B CB  1 
ATOM 8499  C CG1 . ILE B 2  604  ? 252.411 190.358 185.324 1.00 370.00 ? 604  ILE B CG1 1 
ATOM 8500  C CG2 . ILE B 2  604  ? 251.803 188.067 184.617 1.00 370.00 ? 604  ILE B CG2 1 
ATOM 8501  C CD1 . ILE B 2  604  ? 251.187 191.133 185.116 1.00 370.00 ? 604  ILE B CD1 1 
ATOM 8502  N N   . PRO B 2  605  ? 255.371 187.028 183.216 1.00 370.00 ? 605  PRO B N   1 
ATOM 8503  C CA  . PRO B 2  605  ? 255.353 185.787 182.423 1.00 370.00 ? 605  PRO B CA  1 
ATOM 8504  C C   . PRO B 2  605  ? 254.455 184.711 183.031 1.00 370.00 ? 605  PRO B C   1 
ATOM 8505  O O   . PRO B 2  605  ? 254.913 183.623 183.395 1.00 370.00 ? 605  PRO B O   1 
ATOM 8506  C CB  . PRO B 2  605  ? 256.835 185.387 182.402 1.00 370.00 ? 605  PRO B CB  1 
ATOM 8507  C CG  . PRO B 2  605  ? 257.436 186.042 183.572 1.00 370.00 ? 605  PRO B CG  1 
ATOM 8508  C CD  . PRO B 2  605  ? 256.725 187.338 183.706 1.00 370.00 ? 605  PRO B CD  1 
ATOM 8509  N N   . LEU B 2  606  ? 253.153 185.023 183.112 1.00 370.00 ? 606  LEU B N   1 
ATOM 8510  C CA  . LEU B 2  606  ? 252.062 184.083 183.400 1.00 370.00 ? 606  LEU B CA  1 
ATOM 8511  C C   . LEU B 2  606  ? 252.207 183.459 184.794 1.00 370.00 ? 606  LEU B C   1 
ATOM 8512  O O   . LEU B 2  606  ? 252.695 182.341 184.969 1.00 370.00 ? 606  LEU B O   1 
ATOM 8513  C CB  . LEU B 2  606  ? 251.956 183.019 182.294 1.00 370.00 ? 606  LEU B CB  1 
ATOM 8514  C CG  . LEU B 2  606  ? 250.659 182.222 182.089 1.00 370.00 ? 606  LEU B CG  1 
ATOM 8515  C CD1 . LEU B 2  606  ? 250.524 181.868 180.614 1.00 370.00 ? 606  LEU B CD1 1 
ATOM 8516  C CD2 . LEU B 2  606  ? 250.564 180.954 182.929 1.00 370.00 ? 606  LEU B CD2 1 
ATOM 8517  N N   . MET B 2  607  ? 251.880 184.275 185.796 1.00 370.00 ? 607  MET B N   1 
ATOM 8518  C CA  . MET B 2  607  ? 251.808 183.781 187.166 1.00 370.00 ? 607  MET B CA  1 
ATOM 8519  C C   . MET B 2  607  ? 250.840 182.615 187.370 1.00 370.00 ? 607  MET B C   1 
ATOM 8520  O O   . MET B 2  607  ? 251.301 181.490 187.573 1.00 370.00 ? 607  MET B O   1 
ATOM 8521  C CB  . MET B 2  607  ? 251.496 184.955 188.091 1.00 370.00 ? 607  MET B CB  1 
ATOM 8522  C CG  . MET B 2  607  ? 250.516 185.954 187.555 1.00 370.00 ? 607  MET B CG  1 
ATOM 8523  S SD  . MET B 2  607  ? 250.483 187.389 188.633 1.00 370.00 ? 607  MET B SD  1 
ATOM 8524  C CE  . MET B 2  607  ? 252.087 188.071 188.263 1.00 370.00 ? 607  MET B CE  1 
ATOM 8525  N N   . ASN B 2  608  ? 249.526 182.837 187.263 1.00 370.00 ? 608  ASN B N   1 
ATOM 8526  C CA  . ASN B 2  608  ? 248.540 181.752 187.310 1.00 370.00 ? 608  ASN B CA  1 
ATOM 8527  C C   . ASN B 2  608  ? 247.339 182.192 186.487 1.00 370.00 ? 608  ASN B C   1 
ATOM 8528  O O   . ASN B 2  608  ? 246.432 182.836 187.013 1.00 370.00 ? 608  ASN B O   1 
ATOM 8529  C CB  . ASN B 2  608  ? 248.121 181.398 188.729 1.00 370.00 ? 608  ASN B CB  1 
ATOM 8530  C CG  . ASN B 2  608  ? 249.074 180.457 189.385 1.00 370.00 ? 608  ASN B CG  1 
ATOM 8531  O OD1 . ASN B 2  608  ? 249.575 179.545 188.738 1.00 370.00 ? 608  ASN B OD1 1 
ATOM 8532  N ND2 . ASN B 2  608  ? 249.340 180.662 190.667 1.00 370.00 ? 608  ASN B ND2 1 
ATOM 8533  N N   . GLY B 2  609  ? 247.313 181.790 185.229 1.00 370.00 ? 609  GLY B N   1 
ATOM 8534  C CA  . GLY B 2  609  ? 246.341 182.367 184.326 1.00 370.00 ? 609  GLY B CA  1 
ATOM 8535  C C   . GLY B 2  609  ? 246.693 183.822 184.109 1.00 370.00 ? 609  GLY B C   1 
ATOM 8536  O O   . GLY B 2  609  ? 247.869 184.202 184.113 1.00 370.00 ? 609  GLY B O   1 
ATOM 8537  N N   . GLU B 2  610  ? 245.675 184.663 183.975 1.00 370.00 ? 610  GLU B N   1 
ATOM 8538  C CA  . GLU B 2  610  ? 245.864 186.069 183.639 1.00 370.00 ? 610  GLU B CA  1 
ATOM 8539  C C   . GLU B 2  610  ? 245.847 186.952 184.880 1.00 370.00 ? 610  GLU B C   1 
ATOM 8540  O O   . GLU B 2  610  ? 245.328 188.068 184.858 1.00 370.00 ? 610  GLU B O   1 
ATOM 8541  C CB  . GLU B 2  610  ? 244.817 186.542 182.635 1.00 370.00 ? 610  GLU B CB  1 
ATOM 8542  C CG  . GLU B 2  610  ? 245.001 185.980 181.238 1.00 370.00 ? 610  GLU B CG  1 
ATOM 8543  C CD  . GLU B 2  610  ? 243.988 186.526 180.253 1.00 370.00 ? 610  GLU B CD  1 
ATOM 8544  O OE1 . GLU B 2  610  ? 243.063 187.246 180.682 1.00 370.00 ? 610  GLU B OE1 1 
ATOM 8545  O OE2 . GLU B 2  610  ? 244.120 186.241 179.045 1.00 370.00 ? 610  GLU B OE2 1 
ATOM 8546  N N   . GLU B 2  611  ? 246.403 186.452 185.978 1.00 370.00 ? 611  GLU B N   1 
ATOM 8547  C CA  . GLU B 2  611  ? 246.583 187.277 187.159 1.00 370.00 ? 611  GLU B CA  1 
ATOM 8548  C C   . GLU B 2  611  ? 247.628 188.348 186.885 1.00 370.00 ? 611  GLU B C   1 
ATOM 8549  O O   . GLU B 2  611  ? 248.588 188.138 186.140 1.00 370.00 ? 611  GLU B O   1 
ATOM 8550  C CB  . GLU B 2  611  ? 246.996 186.411 188.338 1.00 370.00 ? 611  GLU B CB  1 
ATOM 8551  C CG  . GLU B 2  611  ? 245.930 185.444 188.796 1.00 370.00 ? 611  GLU B CG  1 
ATOM 8552  C CD  . GLU B 2  611  ? 246.484 184.420 189.757 1.00 370.00 ? 611  GLU B CD  1 
ATOM 8553  O OE1 . GLU B 2  611  ? 247.719 184.414 189.944 1.00 370.00 ? 611  GLU B OE1 1 
ATOM 8554  O OE2 . GLU B 2  611  ? 245.705 183.621 190.314 1.00 370.00 ? 611  GLU B OE2 1 
ATOM 8555  N N   . VAL B 2  612  ? 247.414 189.522 187.460 1.00 370.00 ? 612  VAL B N   1 
ATOM 8556  C CA  . VAL B 2  612  ? 248.213 190.696 187.145 1.00 370.00 ? 612  VAL B CA  1 
ATOM 8557  C C   . VAL B 2  612  ? 248.822 191.211 188.432 1.00 370.00 ? 612  VAL B C   1 
ATOM 8558  O O   . VAL B 2  612  ? 248.106 191.705 189.312 1.00 370.00 ? 612  VAL B O   1 
ATOM 8559  C CB  . VAL B 2  612  ? 247.395 191.790 186.451 1.00 370.00 ? 612  VAL B CB  1 
ATOM 8560  C CG1 . VAL B 2  612  ? 248.232 193.056 186.303 1.00 370.00 ? 612  VAL B CG1 1 
ATOM 8561  C CG2 . VAL B 2  612  ? 246.924 191.316 185.088 1.00 370.00 ? 612  VAL B CG2 1 
ATOM 8562  N N   . ASP B 2  613  ? 250.144 191.119 188.532 1.00 370.00 ? 613  ASP B N   1 
ATOM 8563  C CA  . ASP B 2  613  ? 250.874 191.556 189.714 1.00 370.00 ? 613  ASP B CA  1 
ATOM 8564  C C   . ASP B 2  613  ? 252.302 191.907 189.341 1.00 370.00 ? 613  ASP B C   1 
ATOM 8565  O O   . ASP B 2  613  ? 252.910 191.243 188.498 1.00 370.00 ? 613  ASP B O   1 
ATOM 8566  C CB  . ASP B 2  613  ? 250.853 190.484 190.802 1.00 370.00 ? 613  ASP B CB  1 
ATOM 8567  C CG  . ASP B 2  613  ? 249.654 190.602 191.712 1.00 370.00 ? 613  ASP B CG  1 
ATOM 8568  O OD1 . ASP B 2  613  ? 249.207 191.740 191.963 1.00 370.00 ? 613  ASP B OD1 1 
ATOM 8569  O OD2 . ASP B 2  613  ? 249.158 189.560 192.181 1.00 370.00 ? 613  ASP B OD2 1 
ATOM 8570  N N   . MET B 2  614  ? 252.824 192.966 189.964 1.00 370.00 ? 614  MET B N   1 
ATOM 8571  C CA  . MET B 2  614  ? 254.216 193.400 189.814 1.00 370.00 ? 614  MET B CA  1 
ATOM 8572  C C   . MET B 2  614  ? 254.700 193.952 191.157 1.00 370.00 ? 614  MET B C   1 
ATOM 8573  O O   . MET B 2  614  ? 254.181 194.957 191.647 1.00 370.00 ? 614  MET B O   1 
ATOM 8574  C CB  . MET B 2  614  ? 254.359 194.442 188.708 1.00 370.00 ? 614  MET B CB  1 
ATOM 8575  C CG  . MET B 2  614  ? 254.240 193.929 187.275 1.00 370.00 ? 614  MET B CG  1 
ATOM 8576  S SD  . MET B 2  614  ? 254.321 195.265 186.070 1.00 370.00 ? 614  MET B SD  1 
ATOM 8577  C CE  . MET B 2  614  ? 256.020 195.794 186.279 1.00 370.00 ? 614  MET B CE  1 
ATOM 8578  N N   . ASP B 2  615  ? 255.687 193.283 191.750 1.00 370.00 ? 615  ASP B N   1 
ATOM 8579  C CA  . ASP B 2  615  ? 256.511 193.873 192.796 1.00 370.00 ? 615  ASP B CA  1 
ATOM 8580  C C   . ASP B 2  615  ? 257.929 193.361 192.697 1.00 370.00 ? 615  ASP B C   1 
ATOM 8581  O O   . ASP B 2  615  ? 258.173 192.156 192.759 1.00 370.00 ? 615  ASP B O   1 
ATOM 8582  C CB  . ASP B 2  615  ? 256.022 193.582 194.209 1.00 370.00 ? 615  ASP B CB  1 
ATOM 8583  C CG  . ASP B 2  615  ? 254.984 194.557 194.680 1.00 370.00 ? 615  ASP B CG  1 
ATOM 8584  O OD1 . ASP B 2  615  ? 255.031 195.721 194.245 1.00 370.00 ? 615  ASP B OD1 1 
ATOM 8585  O OD2 . ASP B 2  615  ? 254.136 194.174 195.506 1.00 370.00 ? 615  ASP B OD2 1 
ATOM 8586  N N   . LEU B 2  616  ? 258.859 194.296 192.585 1.00 370.00 ? 616  LEU B N   1 
ATOM 8587  C CA  . LEU B 2  616  ? 260.246 194.041 192.915 1.00 370.00 ? 616  LEU B CA  1 
ATOM 8588  C C   . LEU B 2  616  ? 260.518 194.295 194.383 1.00 370.00 ? 616  LEU B C   1 
ATOM 8589  O O   . LEU B 2  616  ? 261.681 194.400 194.784 1.00 370.00 ? 616  LEU B O   1 
ATOM 8590  C CB  . LEU B 2  616  ? 261.153 194.904 192.049 1.00 370.00 ? 616  LEU B CB  1 
ATOM 8591  C CG  . LEU B 2  616  ? 261.011 194.564 190.570 1.00 370.00 ? 616  LEU B CG  1 
ATOM 8592  C CD1 . LEU B 2  616  ? 261.772 195.555 189.732 1.00 370.00 ? 616  LEU B CD1 1 
ATOM 8593  C CD2 . LEU B 2  616  ? 261.501 193.156 190.304 1.00 370.00 ? 616  LEU B CD2 1 
ATOM 8594  N N   . SER B 2  617  ? 259.461 194.384 195.188 1.00 370.00 ? 617  SER B N   1 
ATOM 8595  C CA  . SER B 2  617  ? 259.569 194.779 196.579 1.00 370.00 ? 617  SER B CA  1 
ATOM 8596  C C   . SER B 2  617  ? 260.249 193.729 197.442 1.00 370.00 ? 617  SER B C   1 
ATOM 8597  O O   . SER B 2  617  ? 260.773 194.069 198.506 1.00 370.00 ? 617  SER B O   1 
ATOM 8598  C CB  . SER B 2  617  ? 258.176 195.080 197.124 1.00 370.00 ? 617  SER B CB  1 
ATOM 8599  O OG  . SER B 2  617  ? 257.390 193.905 197.154 1.00 370.00 ? 617  SER B OG  1 
ATOM 8600  N N   . ALA B 2  618  ? 260.272 192.472 197.017 1.00 370.00 ? 618  ALA B N   1 
ATOM 8601  C CA  . ALA B 2  618  ? 260.860 191.419 197.832 1.00 370.00 ? 618  ALA B CA  1 
ATOM 8602  C C   . ALA B 2  618  ? 262.378 191.422 197.668 1.00 370.00 ? 618  ALA B C   1 
ATOM 8603  O O   . ALA B 2  618  ? 262.950 192.276 196.987 1.00 370.00 ? 618  ALA B O   1 
ATOM 8604  C CB  . ALA B 2  618  ? 260.243 190.073 197.475 1.00 370.00 ? 618  ALA B CB  1 
ATOM 8605  N N   . MET B 2  619  ? 263.060 190.437 198.261 1.00 370.00 ? 619  MET B N   1 
ATOM 8606  C CA  . MET B 2  619  ? 264.517 190.308 198.152 1.00 370.00 ? 619  MET B CA  1 
ATOM 8607  C C   . MET B 2  619  ? 264.913 189.768 196.778 1.00 370.00 ? 619  MET B C   1 
ATOM 8608  O O   . MET B 2  619  ? 265.519 188.710 196.630 1.00 370.00 ? 619  MET B O   1 
ATOM 8609  C CB  . MET B 2  619  ? 265.062 189.410 199.253 1.00 370.00 ? 619  MET B CB  1 
ATOM 8610  C CG  . MET B 2  619  ? 265.036 190.032 200.617 1.00 370.00 ? 619  MET B CG  1 
ATOM 8611  S SD  . MET B 2  619  ? 265.558 188.923 201.932 1.00 370.00 ? 619  MET B SD  1 
ATOM 8612  C CE  . MET B 2  619  ? 267.313 188.832 201.599 1.00 370.00 ? 619  MET B CE  1 
ATOM 8613  N N   . ASP B 2  620  ? 264.611 190.566 195.768 1.00 370.00 ? 620  ASP B N   1 
ATOM 8614  C CA  . ASP B 2  620  ? 264.474 190.087 194.411 1.00 370.00 ? 620  ASP B CA  1 
ATOM 8615  C C   . ASP B 2  620  ? 265.743 190.231 193.606 1.00 370.00 ? 620  ASP B C   1 
ATOM 8616  O O   . ASP B 2  620  ? 265.682 190.242 192.374 1.00 370.00 ? 620  ASP B O   1 
ATOM 8617  C CB  . ASP B 2  620  ? 263.310 190.812 193.753 1.00 370.00 ? 620  ASP B CB  1 
ATOM 8618  C CG  . ASP B 2  620  ? 262.000 190.418 194.369 1.00 370.00 ? 620  ASP B CG  1 
ATOM 8619  O OD1 . ASP B 2  620  ? 261.910 189.251 194.798 1.00 370.00 ? 620  ASP B OD1 1 
ATOM 8620  O OD2 . ASP B 2  620  ? 261.084 191.257 194.459 1.00 370.00 ? 620  ASP B OD2 1 
ATOM 8621  N N   . ALA B 2  621  ? 266.887 190.361 194.275 1.00 370.00 ? 621  ALA B N   1 
ATOM 8622  C CA  . ALA B 2  621  ? 268.149 190.157 193.585 1.00 370.00 ? 621  ALA B CA  1 
ATOM 8623  C C   . ALA B 2  621  ? 268.243 188.729 193.082 1.00 370.00 ? 621  ALA B C   1 
ATOM 8624  O O   . ALA B 2  621  ? 268.433 188.495 191.885 1.00 370.00 ? 621  ALA B O   1 
ATOM 8625  C CB  . ALA B 2  621  ? 269.316 190.479 194.513 1.00 370.00 ? 621  ALA B CB  1 
ATOM 8626  N N   . ASP B 2  622  ? 268.045 187.765 193.972 1.00 370.00 ? 622  ASP B N   1 
ATOM 8627  C CA  . ASP B 2  622  ? 268.157 186.362 193.618 1.00 370.00 ? 622  ASP B CA  1 
ATOM 8628  C C   . ASP B 2  622  ? 267.046 185.535 194.235 1.00 370.00 ? 622  ASP B C   1 
ATOM 8629  O O   . ASP B 2  622  ? 267.308 184.449 194.755 1.00 370.00 ? 622  ASP B O   1 
ATOM 8630  C CB  . ASP B 2  622  ? 269.499 185.795 194.061 1.00 370.00 ? 622  ASP B CB  1 
ATOM 8631  C CG  . ASP B 2  622  ? 270.644 186.317 193.249 1.00 370.00 ? 622  ASP B CG  1 
ATOM 8632  O OD1 . ASP B 2  622  ? 270.465 186.536 192.036 1.00 370.00 ? 622  ASP B OD1 1 
ATOM 8633  O OD2 . ASP B 2  622  ? 271.728 186.519 193.826 1.00 370.00 ? 622  ASP B OD2 1 
ATOM 8634  N N   . SER B 2  623  ? 265.807 186.023 194.217 1.00 370.00 ? 623  SER B N   1 
ATOM 8635  C CA  . SER B 2  623  ? 264.675 185.260 194.742 1.00 370.00 ? 623  SER B CA  1 
ATOM 8636  C C   . SER B 2  623  ? 263.757 184.864 193.596 1.00 370.00 ? 623  SER B C   1 
ATOM 8637  O O   . SER B 2  623  ? 262.830 185.610 193.245 1.00 370.00 ? 623  SER B O   1 
ATOM 8638  C CB  . SER B 2  623  ? 263.907 186.050 195.794 1.00 370.00 ? 623  SER B CB  1 
ATOM 8639  O OG  . SER B 2  623  ? 263.252 187.160 195.216 1.00 370.00 ? 623  SER B OG  1 
ATOM 8640  N N   . PRO B 2  624  ? 263.961 183.693 192.994 1.00 370.00 ? 624  PRO B N   1 
ATOM 8641  C CA  . PRO B 2  624  ? 263.044 183.240 191.948 1.00 370.00 ? 624  PRO B CA  1 
ATOM 8642  C C   . PRO B 2  624  ? 261.903 182.421 192.525 1.00 370.00 ? 624  PRO B C   1 
ATOM 8643  O O   . PRO B 2  624  ? 261.100 181.837 191.791 1.00 370.00 ? 624  PRO B O   1 
ATOM 8644  C CB  . PRO B 2  624  ? 263.941 182.392 191.048 1.00 370.00 ? 624  PRO B CB  1 
ATOM 8645  C CG  . PRO B 2  624  ? 264.896 181.793 192.008 1.00 370.00 ? 624  PRO B CG  1 
ATOM 8646  C CD  . PRO B 2  624  ? 265.139 182.817 193.081 1.00 370.00 ? 624  PRO B CD  1 
ATOM 8647  N N   . LEU B 2  625  ? 261.831 182.373 193.845 1.00 370.00 ? 625  LEU B N   1 
ATOM 8648  C CA  . LEU B 2  625  ? 260.835 181.600 194.558 1.00 370.00 ? 625  LEU B CA  1 
ATOM 8649  C C   . LEU B 2  625  ? 259.713 182.518 194.992 1.00 370.00 ? 625  LEU B C   1 
ATOM 8650  O O   . LEU B 2  625  ? 259.929 183.707 195.238 1.00 370.00 ? 625  LEU B O   1 
ATOM 8651  C CB  . LEU B 2  625  ? 261.445 180.937 195.793 1.00 370.00 ? 625  LEU B CB  1 
ATOM 8652  C CG  . LEU B 2  625  ? 262.502 179.880 195.505 1.00 370.00 ? 625  LEU B CG  1 
ATOM 8653  C CD1 . LEU B 2  625  ? 263.241 179.461 196.767 1.00 370.00 ? 625  LEU B CD1 1 
ATOM 8654  C CD2 . LEU B 2  625  ? 261.815 178.693 194.875 1.00 370.00 ? 625  LEU B CD2 1 
ATOM 8655  N N   . LEU B 2  626  ? 258.508 181.970 195.082 1.00 370.00 ? 626  LEU B N   1 
ATOM 8656  C CA  . LEU B 2  626  ? 257.498 182.662 195.855 1.00 370.00 ? 626  LEU B CA  1 
ATOM 8657  C C   . LEU B 2  626  ? 256.990 181.892 197.060 1.00 370.00 ? 626  LEU B C   1 
ATOM 8658  O O   . LEU B 2  626  ? 257.152 182.375 198.179 1.00 370.00 ? 626  LEU B O   1 
ATOM 8659  C CB  . LEU B 2  626  ? 256.333 183.069 194.963 1.00 370.00 ? 626  LEU B CB  1 
ATOM 8660  C CG  . LEU B 2  626  ? 256.692 184.282 194.125 1.00 370.00 ? 626  LEU B CG  1 
ATOM 8661  C CD1 . LEU B 2  626  ? 255.508 184.706 193.314 1.00 370.00 ? 626  LEU B CD1 1 
ATOM 8662  C CD2 . LEU B 2  626  ? 257.152 185.424 195.006 1.00 370.00 ? 626  LEU B CD2 1 
ATOM 8663  N N   . TRP B 2  627  ? 256.381 180.713 196.909 1.00 370.00 ? 627  TRP B N   1 
ATOM 8664  C CA  . TRP B 2  627  ? 255.766 180.158 198.114 1.00 370.00 ? 627  TRP B CA  1 
ATOM 8665  C C   . TRP B 2  627  ? 255.994 178.673 198.271 1.00 370.00 ? 627  TRP B C   1 
ATOM 8666  O O   . TRP B 2  627  ? 255.885 177.903 197.317 1.00 370.00 ? 627  TRP B O   1 
ATOM 8667  C CB  . TRP B 2  627  ? 254.259 180.412 198.197 1.00 370.00 ? 627  TRP B CB  1 
ATOM 8668  C CG  . TRP B 2  627  ? 254.046 181.818 198.187 1.00 370.00 ? 627  TRP B CG  1 
ATOM 8669  C CD1 . TRP B 2  627  ? 254.346 182.693 199.177 1.00 370.00 ? 627  TRP B CD1 1 
ATOM 8670  C CD2 . TRP B 2  627  ? 253.565 182.576 197.103 1.00 370.00 ? 627  TRP B CD2 1 
ATOM 8671  N NE1 . TRP B 2  627  ? 254.102 183.966 198.764 1.00 370.00 ? 627  TRP B NE1 1 
ATOM 8672  C CE2 . TRP B 2  627  ? 253.575 183.917 197.504 1.00 370.00 ? 627  TRP B CE2 1 
ATOM 8673  C CE3 . TRP B 2  627  ? 253.087 182.253 195.838 1.00 370.00 ? 627  TRP B CE3 1 
ATOM 8674  C CZ2 . TRP B 2  627  ? 253.146 184.936 196.683 1.00 370.00 ? 627  TRP B CZ2 1 
ATOM 8675  C CZ3 . TRP B 2  627  ? 252.667 183.271 195.027 1.00 370.00 ? 627  TRP B CZ3 1 
ATOM 8676  C CH2 . TRP B 2  627  ? 252.679 184.594 195.457 1.00 370.00 ? 627  TRP B CH2 1 
ATOM 8677  N N   . ILE B 2  628  ? 256.246 178.293 199.514 1.00 370.00 ? 628  ILE B N   1 
ATOM 8678  C CA  . ILE B 2  628  ? 256.384 176.913 199.942 1.00 370.00 ? 628  ILE B CA  1 
ATOM 8679  C C   . ILE B 2  628  ? 254.986 176.392 200.235 1.00 370.00 ? 628  ILE B C   1 
ATOM 8680  O O   . ILE B 2  628  ? 254.102 177.155 200.642 1.00 370.00 ? 628  ILE B O   1 
ATOM 8681  C CB  . ILE B 2  628  ? 257.301 176.829 201.183 1.00 370.00 ? 628  ILE B CB  1 
ATOM 8682  C CG1 . ILE B 2  628  ? 258.653 177.469 200.887 1.00 370.00 ? 628  ILE B CG1 1 
ATOM 8683  C CG2 . ILE B 2  628  ? 257.557 175.400 201.658 1.00 370.00 ? 628  ILE B CG2 1 
ATOM 8684  C CD1 . ILE B 2  628  ? 259.519 177.601 202.111 1.00 370.00 ? 628  ILE B CD1 1 
ATOM 8685  N N   . ARG B 2  629  ? 254.782 175.100 200.004 1.00 370.00 ? 629  ARG B N   1 
ATOM 8686  C CA  . ARG B 2  629  ? 253.555 174.426 200.368 1.00 370.00 ? 629  ARG B CA  1 
ATOM 8687  C C   . ARG B 2  629  ? 253.860 172.946 200.447 1.00 370.00 ? 629  ARG B C   1 
ATOM 8688  O O   . ARG B 2  629  ? 254.643 172.429 199.655 1.00 370.00 ? 629  ARG B O   1 
ATOM 8689  C CB  . ARG B 2  629  ? 252.463 174.689 199.327 1.00 370.00 ? 629  ARG B CB  1 
ATOM 8690  C CG  . ARG B 2  629  ? 251.170 173.956 199.564 1.00 370.00 ? 629  ARG B CG  1 
ATOM 8691  C CD  . ARG B 2  629  ? 250.653 174.342 200.906 1.00 370.00 ? 629  ARG B CD  1 
ATOM 8692  N NE  . ARG B 2  629  ? 250.512 175.783 200.964 1.00 370.00 ? 629  ARG B NE  1 
ATOM 8693  C CZ  . ARG B 2  629  ? 250.534 176.469 202.093 1.00 370.00 ? 629  ARG B CZ  1 
ATOM 8694  N NH1 . ARG B 2  629  ? 250.411 177.783 202.074 1.00 370.00 ? 629  ARG B NH1 1 
ATOM 8695  N NH2 . ARG B 2  629  ? 250.712 175.839 203.241 1.00 370.00 ? 629  ARG B NH2 1 
ATOM 8696  N N   . ILE B 2  630  ? 253.258 172.265 201.400 1.00 370.00 ? 630  ILE B N   1 
ATOM 8697  C CA  . ILE B 2  630  ? 253.137 170.826 201.300 1.00 370.00 ? 630  ILE B CA  1 
ATOM 8698  C C   . ILE B 2  630  ? 251.663 170.494 201.268 1.00 370.00 ? 630  ILE B C   1 
ATOM 8699  O O   . ILE B 2  630  ? 250.955 170.726 202.253 1.00 370.00 ? 630  ILE B O   1 
ATOM 8700  C CB  . ILE B 2  630  ? 253.843 170.111 202.451 1.00 370.00 ? 630  ILE B CB  1 
ATOM 8701  C CG1 . ILE B 2  630  ? 255.326 170.461 202.421 1.00 370.00 ? 630  ILE B CG1 1 
ATOM 8702  C CG2 . ILE B 2  630  ? 253.645 168.606 202.309 1.00 370.00 ? 630  ILE B CG2 1 
ATOM 8703  C CD1 . ILE B 2  630  ? 256.075 170.045 203.651 1.00 370.00 ? 630  ILE B CD1 1 
ATOM 8704  N N   . ASP B 2  631  ? 251.223 169.951 200.133 1.00 370.00 ? 631  ASP B N   1 
ATOM 8705  C CA  . ASP B 2  631  ? 249.901 169.388 199.906 1.00 370.00 ? 631  ASP B CA  1 
ATOM 8706  C C   . ASP B 2  631  ? 248.809 170.394 200.226 1.00 370.00 ? 631  ASP B C   1 
ATOM 8707  O O   . ASP B 2  631  ? 248.178 170.306 201.285 1.00 370.00 ? 631  ASP B O   1 
ATOM 8708  C CB  . ASP B 2  631  ? 249.736 168.118 200.733 1.00 370.00 ? 631  ASP B CB  1 
ATOM 8709  C CG  . ASP B 2  631  ? 250.725 167.054 200.333 1.00 370.00 ? 631  ASP B CG  1 
ATOM 8710  O OD1 . ASP B 2  631  ? 251.125 167.040 199.153 1.00 370.00 ? 631  ASP B OD1 1 
ATOM 8711  O OD2 . ASP B 2  631  ? 251.125 166.249 201.192 1.00 370.00 ? 631  ASP B OD2 1 
ATOM 8712  N N   . PRO B 2  632  ? 248.598 171.382 199.352 1.00 370.00 ? 632  PRO B N   1 
ATOM 8713  C CA  . PRO B 2  632  ? 247.614 172.434 199.634 1.00 370.00 ? 632  PRO B CA  1 
ATOM 8714  C C   . PRO B 2  632  ? 246.198 171.926 199.718 1.00 370.00 ? 632  PRO B C   1 
ATOM 8715  O O   . PRO B 2  632  ? 245.365 172.565 200.369 1.00 370.00 ? 632  PRO B O   1 
ATOM 8716  C CB  . PRO B 2  632  ? 247.770 173.379 198.444 1.00 370.00 ? 632  PRO B CB  1 
ATOM 8717  C CG  . PRO B 2  632  ? 248.192 172.473 197.340 1.00 370.00 ? 632  PRO B CG  1 
ATOM 8718  C CD  . PRO B 2  632  ? 249.048 171.411 197.955 1.00 370.00 ? 632  PRO B CD  1 
ATOM 8719  N N   . ASP B 2  633  ? 245.911 170.771 199.124 1.00 370.00 ? 633  ASP B N   1 
ATOM 8720  C CA  . ASP B 2  633  ? 244.632 170.100 199.276 1.00 370.00 ? 633  ASP B CA  1 
ATOM 8721  C C   . ASP B 2  633  ? 244.525 169.344 200.588 1.00 370.00 ? 633  ASP B C   1 
ATOM 8722  O O   . ASP B 2  633  ? 243.586 168.556 200.742 1.00 370.00 ? 633  ASP B O   1 
ATOM 8723  C CB  . ASP B 2  633  ? 244.408 169.148 198.105 1.00 370.00 ? 633  ASP B CB  1 
ATOM 8724  C CG  . ASP B 2  633  ? 244.353 169.871 196.781 1.00 370.00 ? 633  ASP B CG  1 
ATOM 8725  O OD1 . ASP B 2  633  ? 243.972 171.060 196.759 1.00 370.00 ? 633  ASP B OD1 1 
ATOM 8726  O OD2 . ASP B 2  633  ? 244.702 169.252 195.758 1.00 370.00 ? 633  ASP B OD2 1 
ATOM 8727  N N   . MET B 2  634  ? 245.499 169.542 201.486 1.00 370.00 ? 634  MET B N   1 
ATOM 8728  C CA  . MET B 2  634  ? 245.399 169.219 202.904 1.00 370.00 ? 634  MET B CA  1 
ATOM 8729  C C   . MET B 2  634  ? 245.286 167.720 203.106 1.00 370.00 ? 634  MET B C   1 
ATOM 8730  O O   . MET B 2  634  ? 244.410 167.231 203.819 1.00 370.00 ? 634  MET B O   1 
ATOM 8731  C CB  . MET B 2  634  ? 244.221 169.951 203.534 1.00 370.00 ? 634  MET B CB  1 
ATOM 8732  C CG  . MET B 2  634  ? 244.329 171.427 203.374 1.00 370.00 ? 634  MET B CG  1 
ATOM 8733  S SD  . MET B 2  634  ? 242.788 172.197 203.839 1.00 370.00 ? 634  MET B SD  1 
ATOM 8734  C CE  . MET B 2  634  ? 242.813 171.844 205.583 1.00 370.00 ? 634  MET B CE  1 
ATOM 8735  N N   . SER B 2  635  ? 246.168 166.988 202.434 1.00 370.00 ? 635  SER B N   1 
ATOM 8736  C CA  . SER B 2  635  ? 246.102 165.536 202.475 1.00 370.00 ? 635  SER B CA  1 
ATOM 8737  C C   . SER B 2  635  ? 246.469 165.016 203.854 1.00 370.00 ? 635  SER B C   1 
ATOM 8738  O O   . SER B 2  635  ? 245.636 164.450 204.566 1.00 370.00 ? 635  SER B O   1 
ATOM 8739  C CB  . SER B 2  635  ? 247.031 164.954 201.415 1.00 370.00 ? 635  SER B CB  1 
ATOM 8740  O OG  . SER B 2  635  ? 248.375 165.264 201.725 1.00 370.00 ? 635  SER B OG  1 
ATOM 8741  N N   . VAL B 2  636  ? 247.677 165.250 204.265 1.00 370.00 ? 636  VAL B N   1 
ATOM 8742  C CA  . VAL B 2  636  ? 248.154 164.695 205.515 1.00 370.00 ? 636  VAL B CA  1 
ATOM 8743  C C   . VAL B 2  636  ? 247.752 165.604 206.657 1.00 370.00 ? 636  VAL B C   1 
ATOM 8744  O O   . VAL B 2  636  ? 247.791 166.832 206.535 1.00 370.00 ? 636  VAL B O   1 
ATOM 8745  C CB  . VAL B 2  636  ? 249.668 164.479 205.421 1.00 370.00 ? 636  VAL B CB  1 
ATOM 8746  C CG1 . VAL B 2  636  ? 250.294 164.195 206.764 1.00 370.00 ? 636  VAL B CG1 1 
ATOM 8747  C CG2 . VAL B 2  636  ? 249.878 163.316 204.513 1.00 370.00 ? 636  VAL B CG2 1 
ATOM 8748  N N   . LEU B 2  637  ? 247.282 164.984 207.739 1.00 370.00 ? 637  LEU B N   1 
ATOM 8749  C CA  . LEU B 2  637  ? 246.983 165.650 208.993 1.00 370.00 ? 637  LEU B CA  1 
ATOM 8750  C C   . LEU B 2  637  ? 248.241 166.362 209.457 1.00 370.00 ? 637  LEU B C   1 
ATOM 8751  O O   . LEU B 2  637  ? 249.237 165.712 209.787 1.00 370.00 ? 637  LEU B O   1 
ATOM 8752  C CB  . LEU B 2  637  ? 246.537 164.629 210.031 1.00 370.00 ? 637  LEU B CB  1 
ATOM 8753  C CG  . LEU B 2  637  ? 245.456 163.658 209.569 1.00 370.00 ? 637  LEU B CG  1 
ATOM 8754  C CD1 . LEU B 2  637  ? 245.079 162.718 210.690 1.00 370.00 ? 637  LEU B CD1 1 
ATOM 8755  C CD2 . LEU B 2  637  ? 244.244 164.365 209.032 1.00 370.00 ? 637  LEU B CD2 1 
ATOM 8756  N N   . ARG B 2  638  ? 248.221 167.689 209.470 1.00 370.00 ? 638  ARG B N   1 
ATOM 8757  C CA  . ARG B 2  638  ? 249.470 168.423 209.457 1.00 370.00 ? 638  ARG B CA  1 
ATOM 8758  C C   . ARG B 2  638  ? 249.449 169.587 210.428 1.00 370.00 ? 638  ARG B C   1 
ATOM 8759  O O   . ARG B 2  638  ? 248.399 170.097 210.818 1.00 370.00 ? 638  ARG B O   1 
ATOM 8760  C CB  . ARG B 2  638  ? 249.774 168.929 208.056 1.00 370.00 ? 638  ARG B CB  1 
ATOM 8761  C CG  . ARG B 2  638  ? 248.817 169.957 207.559 1.00 370.00 ? 638  ARG B CG  1 
ATOM 8762  C CD  . ARG B 2  638  ? 249.072 170.192 206.106 1.00 370.00 ? 638  ARG B CD  1 
ATOM 8763  N NE  . ARG B 2  638  ? 248.234 171.251 205.574 1.00 370.00 ? 638  ARG B NE  1 
ATOM 8764  C CZ  . ARG B 2  638  ? 248.221 171.594 204.295 1.00 370.00 ? 638  ARG B CZ  1 
ATOM 8765  N NH1 . ARG B 2  638  ? 248.983 170.938 203.437 1.00 370.00 ? 638  ARG B NH1 1 
ATOM 8766  N NH2 . ARG B 2  638  ? 247.441 172.577 203.873 1.00 370.00 ? 638  ARG B NH2 1 
ATOM 8767  N N   . LYS B 2  639  ? 250.650 169.981 210.825 1.00 370.00 ? 639  LYS B N   1 
ATOM 8768  C CA  . LYS B 2  639  ? 250.877 171.235 211.526 1.00 370.00 ? 639  LYS B CA  1 
ATOM 8769  C C   . LYS B 2  639  ? 252.273 171.676 211.106 1.00 370.00 ? 639  LYS B C   1 
ATOM 8770  O O   . LYS B 2  639  ? 253.267 171.276 211.716 1.00 370.00 ? 639  LYS B O   1 
ATOM 8771  C CB  . LYS B 2  639  ? 250.759 171.060 213.027 1.00 370.00 ? 639  LYS B CB  1 
ATOM 8772  C CG  . LYS B 2  639  ? 250.905 172.339 213.795 1.00 370.00 ? 639  LYS B CG  1 
ATOM 8773  C CD  . LYS B 2  639  ? 250.681 172.077 215.258 1.00 370.00 ? 639  LYS B CD  1 
ATOM 8774  C CE  . LYS B 2  639  ? 250.894 173.314 216.098 1.00 370.00 ? 639  LYS B CE  1 
ATOM 8775  N NZ  . LYS B 2  639  ? 250.679 173.012 217.542 1.00 370.00 ? 639  LYS B NZ  1 
ATOM 8776  N N   . VAL B 2  640  ? 252.333 172.483 210.064 1.00 370.00 ? 640  VAL B N   1 
ATOM 8777  C CA  . VAL B 2  640  ? 253.563 172.696 209.319 1.00 370.00 ? 640  VAL B CA  1 
ATOM 8778  C C   . VAL B 2  640  ? 254.297 173.885 209.904 1.00 370.00 ? 640  VAL B C   1 
ATOM 8779  O O   . VAL B 2  640  ? 253.708 174.952 210.106 1.00 370.00 ? 640  VAL B O   1 
ATOM 8780  C CB  . VAL B 2  640  ? 253.257 172.913 207.833 1.00 370.00 ? 640  VAL B CB  1 
ATOM 8781  C CG1 . VAL B 2  640  ? 254.529 173.111 207.051 1.00 370.00 ? 640  VAL B CG1 1 
ATOM 8782  C CG2 . VAL B 2  640  ? 252.478 171.738 207.307 1.00 370.00 ? 640  VAL B CG2 1 
ATOM 8783  N N   . GLU B 2  641  ? 255.581 173.704 210.195 1.00 370.00 ? 641  GLU B N   1 
ATOM 8784  C CA  . GLU B 2  641  ? 256.392 174.766 210.768 1.00 370.00 ? 641  GLU B CA  1 
ATOM 8785  C C   . GLU B 2  641  ? 257.638 174.960 209.924 1.00 370.00 ? 641  GLU B C   1 
ATOM 8786  O O   . GLU B 2  641  ? 258.389 174.007 209.690 1.00 370.00 ? 641  GLU B O   1 
ATOM 8787  C CB  . GLU B 2  641  ? 256.758 174.457 212.219 1.00 370.00 ? 641  GLU B CB  1 
ATOM 8788  C CG  . GLU B 2  641  ? 255.538 174.273 213.099 1.00 370.00 ? 641  GLU B CG  1 
ATOM 8789  C CD  . GLU B 2  641  ? 254.617 175.486 213.101 1.00 370.00 ? 641  GLU B CD  1 
ATOM 8790  O OE1 . GLU B 2  641  ? 255.107 176.634 213.081 1.00 370.00 ? 641  GLU B OE1 1 
ATOM 8791  O OE2 . GLU B 2  641  ? 253.385 175.286 213.094 1.00 370.00 ? 641  GLU B OE2 1 
ATOM 8792  N N   . PHE B 2  642  ? 257.854 176.195 209.487 1.00 370.00 ? 642  PHE B N   1 
ATOM 8793  C CA  . PHE B 2  642  ? 258.952 176.564 208.607 1.00 370.00 ? 642  PHE B CA  1 
ATOM 8794  C C   . PHE B 2  642  ? 259.044 178.080 208.614 1.00 370.00 ? 642  PHE B C   1 
ATOM 8795  O O   . PHE B 2  642  ? 258.267 178.763 209.285 1.00 370.00 ? 642  PHE B O   1 
ATOM 8796  C CB  . PHE B 2  642  ? 258.741 176.037 207.188 1.00 370.00 ? 642  PHE B CB  1 
ATOM 8797  C CG  . PHE B 2  642  ? 257.601 176.683 206.475 1.00 370.00 ? 642  PHE B CG  1 
ATOM 8798  C CD1 . PHE B 2  642  ? 256.311 176.246 206.687 1.00 370.00 ? 642  PHE B CD1 1 
ATOM 8799  C CD2 . PHE B 2  642  ? 257.816 177.701 205.561 1.00 370.00 ? 642  PHE B CD2 1 
ATOM 8800  C CE1 . PHE B 2  642  ? 255.256 176.831 206.040 1.00 370.00 ? 642  PHE B CE1 1 
ATOM 8801  C CE2 . PHE B 2  642  ? 256.763 178.288 204.913 1.00 370.00 ? 642  PHE B CE2 1 
ATOM 8802  C CZ  . PHE B 2  642  ? 255.482 177.847 205.145 1.00 370.00 ? 642  PHE B CZ  1 
ATOM 8803  N N   . GLU B 2  643  ? 259.983 178.609 207.835 1.00 370.00 ? 643  GLU B N   1 
ATOM 8804  C CA  . GLU B 2  643  ? 260.199 180.046 207.760 1.00 370.00 ? 643  GLU B CA  1 
ATOM 8805  C C   . GLU B 2  643  ? 260.507 180.451 206.330 1.00 370.00 ? 643  GLU B C   1 
ATOM 8806  O O   . GLU B 2  643  ? 261.288 179.785 205.649 1.00 370.00 ? 643  GLU B O   1 
ATOM 8807  C CB  . GLU B 2  643  ? 261.351 180.483 208.670 1.00 370.00 ? 643  GLU B CB  1 
ATOM 8808  C CG  . GLU B 2  643  ? 261.073 180.368 210.159 1.00 370.00 ? 643  GLU B CG  1 
ATOM 8809  C CD  . GLU B 2  643  ? 262.275 180.722 210.999 1.00 370.00 ? 643  GLU B CD  1 
ATOM 8810  O OE1 . GLU B 2  643  ? 263.352 180.960 210.415 1.00 370.00 ? 643  GLU B OE1 1 
ATOM 8811  O OE2 . GLU B 2  643  ? 262.148 180.750 212.241 1.00 370.00 ? 643  GLU B OE2 1 
ATOM 8812  N N   . GLN B 2  644  ? 259.905 181.544 205.891 1.00 370.00 ? 644  GLN B N   1 
ATOM 8813  C CA  . GLN B 2  644  ? 260.220 182.181 204.624 1.00 370.00 ? 644  GLN B CA  1 
ATOM 8814  C C   . GLN B 2  644  ? 260.714 183.595 204.872 1.00 370.00 ? 644  GLN B C   1 
ATOM 8815  O O   . GLN B 2  644  ? 260.839 184.049 206.010 1.00 370.00 ? 644  GLN B O   1 
ATOM 8816  C CB  . GLN B 2  644  ? 258.997 182.241 203.722 1.00 370.00 ? 644  GLN B CB  1 
ATOM 8817  C CG  . GLN B 2  644  ? 258.457 180.935 203.280 1.00 370.00 ? 644  GLN B CG  1 
ATOM 8818  C CD  . GLN B 2  644  ? 257.210 181.125 202.455 1.00 370.00 ? 644  GLN B CD  1 
ATOM 8819  O OE1 . GLN B 2  644  ? 256.736 182.248 202.292 1.00 370.00 ? 644  GLN B OE1 1 
ATOM 8820  N NE2 . GLN B 2  644  ? 256.667 180.039 201.932 1.00 370.00 ? 644  GLN B NE2 1 
ATOM 8821  N N   . ALA B 2  645  ? 260.968 184.308 203.782 1.00 370.00 ? 645  ALA B N   1 
ATOM 8822  C CA  . ALA B 2  645  ? 261.075 185.752 203.875 1.00 370.00 ? 645  ALA B CA  1 
ATOM 8823  C C   . ALA B 2  645  ? 259.686 186.327 204.065 1.00 370.00 ? 645  ALA B C   1 
ATOM 8824  O O   . ALA B 2  645  ? 258.715 185.839 203.486 1.00 370.00 ? 645  ALA B O   1 
ATOM 8825  C CB  . ALA B 2  645  ? 261.725 186.340 202.627 1.00 370.00 ? 645  ALA B CB  1 
ATOM 8826  N N   . ASP B 2  646  ? 259.605 187.381 204.870 1.00 370.00 ? 646  ASP B N   1 
ATOM 8827  C CA  . ASP B 2  646  ? 258.320 187.933 205.272 1.00 370.00 ? 646  ASP B CA  1 
ATOM 8828  C C   . ASP B 2  646  ? 257.624 188.582 204.100 1.00 370.00 ? 646  ASP B C   1 
ATOM 8829  O O   . ASP B 2  646  ? 256.390 188.667 204.065 1.00 370.00 ? 646  ASP B O   1 
ATOM 8830  C CB  . ASP B 2  646  ? 258.573 188.932 206.371 1.00 370.00 ? 646  ASP B CB  1 
ATOM 8831  C CG  . ASP B 2  646  ? 259.532 188.390 207.375 1.00 370.00 ? 646  ASP B CG  1 
ATOM 8832  O OD1 . ASP B 2  646  ? 259.608 187.150 207.485 1.00 370.00 ? 646  ASP B OD1 1 
ATOM 8833  O OD2 . ASP B 2  646  ? 260.222 189.184 208.041 1.00 370.00 ? 646  ASP B OD2 1 
ATOM 8834  N N   . PHE B 2  647  ? 258.429 189.028 203.140 1.00 370.00 ? 647  PHE B N   1 
ATOM 8835  C CA  . PHE B 2  647  ? 257.962 189.506 201.851 1.00 370.00 ? 647  PHE B CA  1 
ATOM 8836  C C   . PHE B 2  647  ? 257.092 188.472 201.171 1.00 370.00 ? 647  PHE B C   1 
ATOM 8837  O O   . PHE B 2  647  ? 256.057 188.806 200.590 1.00 370.00 ? 647  PHE B O   1 
ATOM 8838  C CB  . PHE B 2  647  ? 259.173 189.805 200.979 1.00 370.00 ? 647  PHE B CB  1 
ATOM 8839  C CG  . PHE B 2  647  ? 260.073 190.857 201.535 1.00 370.00 ? 647  PHE B CG  1 
ATOM 8840  C CD1 . PHE B 2  647  ? 259.581 191.852 202.364 1.00 370.00 ? 647  PHE B CD1 1 
ATOM 8841  C CD2 . PHE B 2  647  ? 261.431 190.812 201.290 1.00 370.00 ? 647  PHE B CD2 1 
ATOM 8842  C CE1 . PHE B 2  647  ? 260.417 192.805 202.895 1.00 370.00 ? 647  PHE B CE1 1 
ATOM 8843  C CE2 . PHE B 2  647  ? 262.267 191.771 201.814 1.00 370.00 ? 647  PHE B CE2 1 
ATOM 8844  C CZ  . PHE B 2  647  ? 261.765 192.761 202.618 1.00 370.00 ? 647  PHE B CZ  1 
ATOM 8845  N N   . MET B 2  648  ? 257.488 187.205 201.262 1.00 370.00 ? 648  MET B N   1 
ATOM 8846  C CA  . MET B 2  648  ? 256.784 186.150 200.552 1.00 370.00 ? 648  MET B CA  1 
ATOM 8847  C C   . MET B 2  648  ? 255.436 185.892 201.202 1.00 370.00 ? 648  MET B C   1 
ATOM 8848  O O   . MET B 2  648  ? 254.431 185.678 200.515 1.00 370.00 ? 648  MET B O   1 
ATOM 8849  C CB  . MET B 2  648  ? 257.649 184.893 200.550 1.00 370.00 ? 648  MET B CB  1 
ATOM 8850  C CG  . MET B 2  648  ? 259.104 185.218 200.233 1.00 370.00 ? 648  MET B CG  1 
ATOM 8851  S SD  . MET B 2  648  ? 260.317 183.877 200.269 1.00 370.00 ? 648  MET B SD  1 
ATOM 8852  C CE  . MET B 2  648  ? 260.224 183.241 198.595 1.00 370.00 ? 648  MET B CE  1 
ATOM 8853  N N   . TRP B 2  649  ? 255.395 185.969 202.537 1.00 370.00 ? 649  TRP B N   1 
ATOM 8854  C CA  . TRP B 2  649  ? 254.143 185.830 203.270 1.00 370.00 ? 649  TRP B CA  1 
ATOM 8855  C C   . TRP B 2  649  ? 253.189 186.963 202.931 1.00 370.00 ? 649  TRP B C   1 
ATOM 8856  O O   . TRP B 2  649  ? 252.015 186.733 202.608 1.00 370.00 ? 649  TRP B O   1 
ATOM 8857  C CB  . TRP B 2  649  ? 254.414 185.844 204.771 1.00 370.00 ? 649  TRP B CB  1 
ATOM 8858  C CG  . TRP B 2  649  ? 255.326 184.801 205.298 1.00 370.00 ? 649  TRP B CG  1 
ATOM 8859  C CD1 . TRP B 2  649  ? 256.653 184.934 205.525 1.00 370.00 ? 649  TRP B CD1 1 
ATOM 8860  C CD2 . TRP B 2  649  ? 254.978 183.486 205.733 1.00 370.00 ? 649  TRP B CD2 1 
ATOM 8861  N NE1 . TRP B 2  649  ? 257.172 183.782 206.046 1.00 370.00 ? 649  TRP B NE1 1 
ATOM 8862  C CE2 . TRP B 2  649  ? 256.162 182.870 206.183 1.00 370.00 ? 649  TRP B CE2 1 
ATOM 8863  C CE3 . TRP B 2  649  ? 253.788 182.762 205.771 1.00 370.00 ? 649  TRP B CE3 1 
ATOM 8864  C CZ2 . TRP B 2  649  ? 256.192 181.567 206.666 1.00 370.00 ? 649  TRP B CZ2 1 
ATOM 8865  C CZ3 . TRP B 2  649  ? 253.821 181.464 206.246 1.00 370.00 ? 649  TRP B CZ3 1 
ATOM 8866  C CH2 . TRP B 2  649  ? 255.012 180.884 206.697 1.00 370.00 ? 649  TRP B CH2 1 
ATOM 8867  N N   . GLN B 2  650  ? 253.693 188.196 202.981 1.00 370.00 ? 650  GLN B N   1 
ATOM 8868  C CA  . GLN B 2  650  ? 252.860 189.356 202.704 1.00 370.00 ? 650  GLN B CA  1 
ATOM 8869  C C   . GLN B 2  650  ? 252.397 189.370 201.257 1.00 370.00 ? 650  GLN B C   1 
ATOM 8870  O O   . GLN B 2  650  ? 251.277 189.789 200.955 1.00 370.00 ? 650  GLN B O   1 
ATOM 8871  C CB  . GLN B 2  650  ? 253.637 190.626 203.023 1.00 370.00 ? 650  GLN B CB  1 
ATOM 8872  C CG  . GLN B 2  650  ? 253.982 190.785 204.481 1.00 370.00 ? 650  GLN B CG  1 
ATOM 8873  C CD  . GLN B 2  650  ? 254.785 192.036 204.750 1.00 370.00 ? 650  GLN B CD  1 
ATOM 8874  O OE1 . GLN B 2  650  ? 255.125 192.779 203.830 1.00 370.00 ? 650  GLN B OE1 1 
ATOM 8875  N NE2 . GLN B 2  650  ? 255.098 192.276 206.018 1.00 370.00 ? 650  GLN B NE2 1 
ATOM 8876  N N   . TYR B 2  651  ? 253.230 188.875 200.353 1.00 370.00 ? 651  TYR B N   1 
ATOM 8877  C CA  . TYR B 2  651  ? 252.862 188.898 198.952 1.00 370.00 ? 651  TYR B CA  1 
ATOM 8878  C C   . TYR B 2  651  ? 251.881 187.785 198.645 1.00 370.00 ? 651  TYR B C   1 
ATOM 8879  O O   . TYR B 2  651  ? 251.058 187.897 197.729 1.00 370.00 ? 651  TYR B O   1 
ATOM 8880  C CB  . TYR B 2  651  ? 254.106 188.743 198.101 1.00 370.00 ? 651  TYR B CB  1 
ATOM 8881  C CG  . TYR B 2  651  ? 253.900 189.224 196.706 1.00 370.00 ? 651  TYR B CG  1 
ATOM 8882  C CD1 . TYR B 2  651  ? 253.992 190.569 196.426 1.00 370.00 ? 651  TYR B CD1 1 
ATOM 8883  C CD2 . TYR B 2  651  ? 253.578 188.349 195.672 1.00 370.00 ? 651  TYR B CD2 1 
ATOM 8884  C CE1 . TYR B 2  651  ? 253.810 191.037 195.168 1.00 370.00 ? 651  TYR B CE1 1 
ATOM 8885  C CE2 . TYR B 2  651  ? 253.384 188.822 194.382 1.00 370.00 ? 651  TYR B CE2 1 
ATOM 8886  C CZ  . TYR B 2  651  ? 253.506 190.176 194.149 1.00 370.00 ? 651  TYR B CZ  1 
ATOM 8887  O OH  . TYR B 2  651  ? 253.328 190.698 192.889 1.00 370.00 ? 651  TYR B OH  1 
ATOM 8888  N N   . GLN B 2  652  ? 251.970 186.692 199.400 1.00 370.00 ? 652  GLN B N   1 
ATOM 8889  C CA  . GLN B 2  652  ? 250.935 185.675 199.363 1.00 370.00 ? 652  GLN B CA  1 
ATOM 8890  C C   . GLN B 2  652  ? 249.634 186.262 199.838 1.00 370.00 ? 652  GLN B C   1 
ATOM 8891  O O   . GLN B 2  652  ? 248.557 185.915 199.351 1.00 370.00 ? 652  GLN B O   1 
ATOM 8892  C CB  . GLN B 2  652  ? 251.332 184.521 200.260 1.00 370.00 ? 652  GLN B CB  1 
ATOM 8893  C CG  . GLN B 2  652  ? 250.724 183.221 199.901 1.00 370.00 ? 652  GLN B CG  1 
ATOM 8894  C CD  . GLN B 2  652  ? 251.368 182.114 200.685 1.00 370.00 ? 652  GLN B CD  1 
ATOM 8895  O OE1 . GLN B 2  652  ? 252.116 182.366 201.623 1.00 370.00 ? 652  GLN B OE1 1 
ATOM 8896  N NE2 . GLN B 2  652  ? 251.146 180.884 200.263 1.00 370.00 ? 652  GLN B NE2 1 
ATOM 8897  N N   . LEU B 2  653  ? 249.723 187.173 200.790 1.00 370.00 ? 653  LEU B N   1 
ATOM 8898  C CA  . LEU B 2  653  ? 248.529 187.874 201.196 1.00 370.00 ? 653  LEU B CA  1 
ATOM 8899  C C   . LEU B 2  653  ? 248.146 188.949 200.198 1.00 370.00 ? 653  LEU B C   1 
ATOM 8900  O O   . LEU B 2  653  ? 247.049 189.507 200.288 1.00 370.00 ? 653  LEU B O   1 
ATOM 8901  C CB  . LEU B 2  653  ? 248.721 188.444 202.587 1.00 370.00 ? 653  LEU B CB  1 
ATOM 8902  C CG  . LEU B 2  653  ? 248.865 187.258 203.531 1.00 370.00 ? 653  LEU B CG  1 
ATOM 8903  C CD1 . LEU B 2  653  ? 249.094 187.715 204.934 1.00 370.00 ? 653  LEU B CD1 1 
ATOM 8904  C CD2 . LEU B 2  653  ? 247.649 186.368 203.475 1.00 370.00 ? 653  LEU B CD2 1 
ATOM 8905  N N   . ARG B 2  654  ? 249.022 189.274 199.244 1.00 370.00 ? 654  ARG B N   1 
ATOM 8906  C CA  . ARG B 2  654  ? 248.542 190.149 198.184 1.00 370.00 ? 654  ARG B CA  1 
ATOM 8907  C C   . ARG B 2  654  ? 247.599 189.390 197.267 1.00 370.00 ? 654  ARG B C   1 
ATOM 8908  O O   . ARG B 2  654  ? 246.496 189.869 196.984 1.00 370.00 ? 654  ARG B O   1 
ATOM 8909  C CB  . ARG B 2  654  ? 249.669 190.803 197.390 1.00 370.00 ? 654  ARG B CB  1 
ATOM 8910  C CG  . ARG B 2  654  ? 249.054 191.877 196.496 1.00 370.00 ? 654  ARG B CG  1 
ATOM 8911  C CD  . ARG B 2  654  ? 249.990 192.868 195.822 1.00 370.00 ? 654  ARG B CD  1 
ATOM 8912  N NE  . ARG B 2  654  ? 250.706 192.398 194.640 1.00 370.00 ? 654  ARG B NE  1 
ATOM 8913  C CZ  . ARG B 2  654  ? 251.543 193.172 193.950 1.00 370.00 ? 654  ARG B CZ  1 
ATOM 8914  N NH1 . ARG B 2  654  ? 251.755 194.420 194.331 1.00 370.00 ? 654  ARG B NH1 1 
ATOM 8915  N NH2 . ARG B 2  654  ? 252.170 192.717 192.883 1.00 370.00 ? 654  ARG B NH2 1 
ATOM 8916  N N   . TYR B 2  655  ? 247.996 188.193 196.827 1.00 370.00 ? 655  TYR B N   1 
ATOM 8917  C CA  . TYR B 2  655  ? 247.014 187.193 196.419 1.00 370.00 ? 655  TYR B CA  1 
ATOM 8918  C C   . TYR B 2  655  ? 247.589 185.788 196.496 1.00 370.00 ? 655  TYR B C   1 
ATOM 8919  O O   . TYR B 2  655  ? 248.796 185.584 196.343 1.00 370.00 ? 655  TYR B O   1 
ATOM 8920  C CB  . TYR B 2  655  ? 246.467 187.422 195.000 1.00 370.00 ? 655  TYR B CB  1 
ATOM 8921  C CG  . TYR B 2  655  ? 245.269 186.531 194.730 1.00 370.00 ? 655  TYR B CG  1 
ATOM 8922  C CD1 . TYR B 2  655  ? 244.058 186.771 195.359 1.00 370.00 ? 655  TYR B CD1 1 
ATOM 8923  C CD2 . TYR B 2  655  ? 245.366 185.418 193.909 1.00 370.00 ? 655  TYR B CD2 1 
ATOM 8924  C CE1 . TYR B 2  655  ? 242.967 185.948 195.152 1.00 370.00 ? 655  TYR B CE1 1 
ATOM 8925  C CE2 . TYR B 2  655  ? 244.278 184.595 193.695 1.00 370.00 ? 655  TYR B CE2 1 
ATOM 8926  C CZ  . TYR B 2  655  ? 243.085 184.863 194.320 1.00 370.00 ? 655  TYR B CZ  1 
ATOM 8927  O OH  . TYR B 2  655  ? 242.005 184.044 194.109 1.00 370.00 ? 655  TYR B OH  1 
ATOM 8928  N N   . GLU B 2  656  ? 246.724 184.830 196.807 1.00 370.00 ? 656  GLU B N   1 
ATOM 8929  C CA  . GLU B 2  656  ? 246.958 183.424 196.556 1.00 370.00 ? 656  GLU B CA  1 
ATOM 8930  C C   . GLU B 2  656  ? 245.604 182.789 196.262 1.00 370.00 ? 656  GLU B C   1 
ATOM 8931  O O   . GLU B 2  656  ? 244.562 183.296 196.681 1.00 370.00 ? 656  GLU B O   1 
ATOM 8932  C CB  . GLU B 2  656  ? 247.659 182.773 197.753 1.00 370.00 ? 656  GLU B CB  1 
ATOM 8933  C CG  . GLU B 2  656  ? 248.139 181.353 197.545 1.00 370.00 ? 656  GLU B CG  1 
ATOM 8934  C CD  . GLU B 2  656  ? 249.261 181.264 196.549 1.00 370.00 ? 656  GLU B CD  1 
ATOM 8935  O OE1 . GLU B 2  656  ? 250.009 182.250 196.415 1.00 370.00 ? 656  GLU B OE1 1 
ATOM 8936  O OE2 . GLU B 2  656  ? 249.392 180.208 195.901 1.00 370.00 ? 656  GLU B OE2 1 
ATOM 8937  N N   . ARG B 2  657  ? 245.613 181.687 195.516 1.00 370.00 ? 657  ARG B N   1 
ATOM 8938  C CA  . ARG B 2  657  ? 244.393 180.959 195.209 1.00 370.00 ? 657  ARG B CA  1 
ATOM 8939  C C   . ARG B 2  657  ? 244.021 179.936 196.278 1.00 370.00 ? 657  ARG B C   1 
ATOM 8940  O O   . ARG B 2  657  ? 243.326 178.964 195.968 1.00 370.00 ? 657  ARG B O   1 
ATOM 8941  C CB  . ARG B 2  657  ? 244.513 180.273 193.848 1.00 370.00 ? 657  ARG B CB  1 
ATOM 8942  C CG  . ARG B 2  657  ? 244.476 181.230 192.673 1.00 370.00 ? 657  ARG B CG  1 
ATOM 8943  C CD  . ARG B 2  657  ? 244.573 180.520 191.333 1.00 370.00 ? 657  ARG B CD  1 
ATOM 8944  N NE  . ARG B 2  657  ? 244.449 181.453 190.215 1.00 370.00 ? 657  ARG B NE  1 
ATOM 8945  C CZ  . ARG B 2  657  ? 244.559 181.115 188.933 1.00 370.00 ? 657  ARG B CZ  1 
ATOM 8946  N NH1 . ARG B 2  657  ? 244.814 179.859 188.586 1.00 370.00 ? 657  ARG B NH1 1 
ATOM 8947  N NH2 . ARG B 2  657  ? 244.426 182.041 187.997 1.00 370.00 ? 657  ARG B NH2 1 
ATOM 8948  N N   . ASP B 2  658  ? 244.472 180.119 197.518 1.00 370.00 ? 658  ASP B N   1 
ATOM 8949  C CA  . ASP B 2  658  ? 244.043 179.291 198.638 1.00 370.00 ? 658  ASP B CA  1 
ATOM 8950  C C   . ASP B 2  658  ? 243.705 180.135 199.847 1.00 370.00 ? 658  ASP B C   1 
ATOM 8951  O O   . ASP B 2  658  ? 244.551 180.877 200.353 1.00 370.00 ? 658  ASP B O   1 
ATOM 8952  C CB  . ASP B 2  658  ? 245.092 178.269 199.055 1.00 370.00 ? 658  ASP B CB  1 
ATOM 8953  C CG  . ASP B 2  658  ? 245.041 177.030 198.222 1.00 370.00 ? 658  ASP B CG  1 
ATOM 8954  O OD1 . ASP B 2  658  ? 243.943 176.717 197.723 1.00 370.00 ? 658  ASP B OD1 1 
ATOM 8955  O OD2 . ASP B 2  658  ? 246.082 176.359 198.082 1.00 370.00 ? 658  ASP B OD2 1 
ATOM 8956  N N   . VAL B 2  659  ? 242.481 179.954 200.334 1.00 370.00 ? 659  VAL B N   1 
ATOM 8957  C CA  . VAL B 2  659  ? 242.082 180.417 201.652 1.00 370.00 ? 659  VAL B CA  1 
ATOM 8958  C C   . VAL B 2  659  ? 242.984 179.824 202.719 1.00 370.00 ? 659  VAL B C   1 
ATOM 8959  O O   . VAL B 2  659  ? 243.286 180.479 203.729 1.00 370.00 ? 659  VAL B O   1 
ATOM 8960  C CB  . VAL B 2  659  ? 240.610 180.030 201.854 1.00 370.00 ? 659  VAL B CB  1 
ATOM 8961  C CG1 . VAL B 2  659  ? 240.114 180.397 203.225 1.00 370.00 ? 659  VAL B CG1 1 
ATOM 8962  C CG2 . VAL B 2  659  ? 239.781 180.689 200.791 1.00 370.00 ? 659  VAL B CG2 1 
ATOM 8963  N N   . VAL B 2  660  ? 243.430 178.585 202.493 1.00 370.00 ? 660  VAL B N   1 
ATOM 8964  C CA  . VAL B 2  660  ? 244.388 177.913 203.363 1.00 370.00 ? 660  VAL B CA  1 
ATOM 8965  C C   . VAL B 2  660  ? 245.642 178.743 203.518 1.00 370.00 ? 660  VAL B C   1 
ATOM 8966  O O   . VAL B 2  660  ? 246.048 179.094 204.636 1.00 370.00 ? 660  VAL B O   1 
ATOM 8967  C CB  . VAL B 2  660  ? 244.721 176.524 202.797 1.00 370.00 ? 660  VAL B CB  1 
ATOM 8968  C CG1 . VAL B 2  660  ? 245.812 175.865 203.621 1.00 370.00 ? 660  VAL B CG1 1 
ATOM 8969  C CG2 . VAL B 2  660  ? 243.473 175.668 202.739 1.00 370.00 ? 660  VAL B CG2 1 
ATOM 8970  N N   . ALA B 2  661  ? 246.241 179.097 202.388 1.00 370.00 ? 661  ALA B N   1 
ATOM 8971  C CA  . ALA B 2  661  ? 247.450 179.889 202.401 1.00 370.00 ? 661  ALA B CA  1 
ATOM 8972  C C   . ALA B 2  661  ? 247.206 181.251 203.010 1.00 370.00 ? 661  ALA B C   1 
ATOM 8973  O O   . ALA B 2  661  ? 248.045 181.743 203.773 1.00 370.00 ? 661  ALA B O   1 
ATOM 8974  C CB  . ALA B 2  661  ? 247.978 180.022 200.982 1.00 370.00 ? 661  ALA B CB  1 
ATOM 8975  N N   . GLN B 2  662  ? 246.033 181.829 202.751 1.00 370.00 ? 662  GLN B N   1 
ATOM 8976  C CA  . GLN B 2  662  ? 245.772 183.185 203.203 1.00 370.00 ? 662  GLN B CA  1 
ATOM 8977  C C   . GLN B 2  662  ? 245.646 183.244 204.714 1.00 370.00 ? 662  GLN B C   1 
ATOM 8978  O O   . GLN B 2  662  ? 246.319 184.048 205.365 1.00 370.00 ? 662  GLN B O   1 
ATOM 8979  C CB  . GLN B 2  662  ? 244.537 183.742 202.506 1.00 370.00 ? 662  GLN B CB  1 
ATOM 8980  C CG  . GLN B 2  662  ? 244.816 184.023 201.042 1.00 370.00 ? 662  GLN B CG  1 
ATOM 8981  C CD  . GLN B 2  662  ? 243.632 184.572 200.288 1.00 370.00 ? 662  GLN B CD  1 
ATOM 8982  O OE1 . GLN B 2  662  ? 242.552 184.750 200.843 1.00 370.00 ? 662  GLN B OE1 1 
ATOM 8983  N NE2 . GLN B 2  662  ? 243.824 184.832 199.002 1.00 370.00 ? 662  GLN B NE2 1 
ATOM 8984  N N   . GLN B 2  663  ? 244.878 182.341 205.305 1.00 370.00 ? 663  GLN B N   1 
ATOM 8985  C CA  . GLN B 2  663  ? 244.810 182.414 206.752 1.00 370.00 ? 663  GLN B CA  1 
ATOM 8986  C C   . GLN B 2  663  ? 246.041 181.845 207.441 1.00 370.00 ? 663  GLN B C   1 
ATOM 8987  O O   . GLN B 2  663  ? 246.314 182.211 208.590 1.00 370.00 ? 663  GLN B O   1 
ATOM 8988  C CB  . GLN B 2  663  ? 243.548 181.766 207.295 1.00 370.00 ? 663  GLN B CB  1 
ATOM 8989  C CG  . GLN B 2  663  ? 242.339 182.626 207.072 1.00 370.00 ? 663  GLN B CG  1 
ATOM 8990  C CD  . GLN B 2  663  ? 241.193 182.242 207.966 1.00 370.00 ? 663  GLN B CD  1 
ATOM 8991  O OE1 . GLN B 2  663  ? 241.287 181.293 208.740 1.00 370.00 ? 663  GLN B OE1 1 
ATOM 8992  N NE2 . GLN B 2  663  ? 240.107 182.998 207.890 1.00 370.00 ? 663  GLN B NE2 1 
ATOM 8993  N N   . GLU B 2  664  ? 246.853 181.037 206.772 1.00 370.00 ? 664  GLU B N   1 
ATOM 8994  C CA  . GLU B 2  664  ? 248.041 180.621 207.498 1.00 370.00 ? 664  GLU B CA  1 
ATOM 8995  C C   . GLU B 2  664  ? 249.128 181.671 207.452 1.00 370.00 ? 664  GLU B C   1 
ATOM 8996  O O   . GLU B 2  664  ? 249.880 181.821 208.421 1.00 370.00 ? 664  GLU B O   1 
ATOM 8997  C CB  . GLU B 2  664  ? 248.519 179.277 206.999 1.00 370.00 ? 664  GLU B CB  1 
ATOM 8998  C CG  . GLU B 2  664  ? 247.526 178.248 207.426 1.00 370.00 ? 664  GLU B CG  1 
ATOM 8999  C CD  . GLU B 2  664  ? 247.371 178.209 208.935 1.00 370.00 ? 664  GLU B