data_6NMY
# 
_entry.id   6NMY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6NMY         
WWPDB D_1000238975 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6NMY 
_pdbx_database_status.recvd_initial_deposition_date   2019-01-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Dhagat, U.'      1 ? 
'Kan, W.L.'       2 ? 
'Hercus, T.R.'    3 ? 
'Broughton, S.E.' 4 ? 
'Nero, T.L.'      5 ? 
'Lopez, A.F.'     6 ? 
'Parker, M.W.'    7 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'To Be Published' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            0353 
_citation.journal_id_ISSN           ? 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            ? 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     'Signalling conformation of cell surface receptor' 
_citation.year                      ? 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Dhagat, U.'   1 ? 
primary 'Parker, M.W.' 2 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6NMY 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     111.647 
_cell.length_a_esd                 ? 
_cell.length_b                     157.251 
_cell.length_b_esd                 ? 
_cell.length_c                     168.306 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6NMY 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Interleukin-3 receptor subunit alpha' 33225.520 2  ? N194Q ? ? 
2 polymer     man 'Cytokine receptor common subunit beta' 24585.598 2  ? ?     ? ? 
3 polymer     man Interleukin-3 13382.270 2  ? W13Y  ? 'The first 4 N-terminal residues (GAMG) are derived from fusion protein' 
4 polymer     man 'Cytokine receptor common subunit beta' 22691.234 2  ? N346Q ? ? 
5 branched    nat 
;beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose
;
732.682   2  ? ?     ? ?                                                                        
6 branched    nat 
'beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 586.542   3  
? ?     ? ?                                                                        
7 branched    nat '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   2  ? ?     ? 
?                                                                        
8 non-polymer nat 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   1  ? ?     ? ? 
9 water       nat water 18.015    12 ? ?     ? ?                                                                        
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 IL-3RA 
2 'CDw131,GM-CSF/IL-3/IL-5 receptor common beta subunit' 
3 
'IL-3,Hematopoietic growth factor,Mast cell growth factor,MCGF,Multipotential colony-stimulating factor,P-cell-stimulating factor' 
4 'CDw131,GM-CSF/IL-3/IL-5 receptor common beta subunit' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;KEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPEN
SGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQS
SHILVRGRSAAFGIPCTDKFVVFSQIEILTPPQMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTS
FQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTS
;
;KEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPEN
SGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQS
SHILVRGRSAAFGIPCTDKFVVFSQIEILTPPQMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTS
FQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTS
;
F,M ? 
2 'polypeptide(L)' no no 
;EETIPLQTLRCYNDYTSHITCRWADTQDAQRLVNVTLIRRVNEDLLEPVSCDLSDDMPWSACPHPRCVPRRCVIPCQSFV
VTDVDYFSFQPDRPLGTRLTVTLTQHVQPPEPRDLQISTDQDHFLLTWSVALGSPQSHWLSPGDLEFEVVYKRLQDSWED
AAILLSNTSQATLGPEHLMPSSTYVARVRTRLAPGSRLSGRPSKWSPEVCWDSQPG
;
;EETIPLQTLRCYNDYTSHITCRWADTQDAQRLVNVTLIRRVNEDLLEPVSCDLSDDMPWSACPHPRCVPRRCVIPCQSFV
VTDVDYFSFQPDRPLGTRLTVTLTQHVQPPEPRDLQISTDQDHFLLTWSVALGSPQSHWLSPGDLEFEVVYKRLQDSWED
AAILLSNTSQATLGPEHLMPSSTYVARVRTRLAPGSRLSGRPSKWSPEVCWDSQPG
;
A,C ? 
3 'polypeptide(L)' no no 
;GAMGSYVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPL
ATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQ
;
;GAMGSYVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPL
ATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQ
;
I,J ? 
4 'polypeptide(L)' no no 
;DEAQPQNLECFFDGAAVLSCSWEVRKEVASSVSFGLFYKPSPDAGEEECSPVLREGLGSLHTRHHCQIPVPDPATHGQYI
VSVQPRRAEKHIKSSVNIQMAPPSLQVTKDGDSYSLRWETMKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALP
ALEPSTRYWARVRVRTSRTGYNGIWSEWSEARSWDTES
;
;DEAQPQNLECFFDGAAVLSCSWEVRKEVASSVSFGLFYKPSPDAGEEECSPVLREGLGSLHTRHHCQIPVPDPATHGQYI
VSVQPRRAEKHIKSSVNIQMAPPSLQVTKDGDSYSLRWETMKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALP
ALEPSTRYWARVRVRTSRTGYNGIWSEWSEARSWDTES
;
B,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LYS n 
1 2   GLU n 
1 3   ASP n 
1 4   PRO n 
1 5   ASN n 
1 6   PRO n 
1 7   PRO n 
1 8   ILE n 
1 9   THR n 
1 10  ASN n 
1 11  LEU n 
1 12  ARG n 
1 13  MET n 
1 14  LYS n 
1 15  ALA n 
1 16  LYS n 
1 17  ALA n 
1 18  GLN n 
1 19  GLN n 
1 20  LEU n 
1 21  THR n 
1 22  TRP n 
1 23  ASP n 
1 24  LEU n 
1 25  ASN n 
1 26  ARG n 
1 27  ASN n 
1 28  VAL n 
1 29  THR n 
1 30  ASP n 
1 31  ILE n 
1 32  GLU n 
1 33  CYS n 
1 34  VAL n 
1 35  LYS n 
1 36  ASP n 
1 37  ALA n 
1 38  ASP n 
1 39  TYR n 
1 40  SER n 
1 41  MET n 
1 42  PRO n 
1 43  ALA n 
1 44  VAL n 
1 45  ASN n 
1 46  ASN n 
1 47  SER n 
1 48  TYR n 
1 49  CYS n 
1 50  GLN n 
1 51  PHE n 
1 52  GLY n 
1 53  ALA n 
1 54  ILE n 
1 55  SER n 
1 56  LEU n 
1 57  CYS n 
1 58  GLU n 
1 59  VAL n 
1 60  THR n 
1 61  ASN n 
1 62  TYR n 
1 63  THR n 
1 64  VAL n 
1 65  ARG n 
1 66  VAL n 
1 67  ALA n 
1 68  ASN n 
1 69  PRO n 
1 70  PRO n 
1 71  PHE n 
1 72  SER n 
1 73  THR n 
1 74  TRP n 
1 75  ILE n 
1 76  LEU n 
1 77  PHE n 
1 78  PRO n 
1 79  GLU n 
1 80  ASN n 
1 81  SER n 
1 82  GLY n 
1 83  LYS n 
1 84  PRO n 
1 85  TRP n 
1 86  ALA n 
1 87  GLY n 
1 88  ALA n 
1 89  GLU n 
1 90  ASN n 
1 91  LEU n 
1 92  THR n 
1 93  CYS n 
1 94  TRP n 
1 95  ILE n 
1 96  HIS n 
1 97  ASP n 
1 98  VAL n 
1 99  ASP n 
1 100 PHE n 
1 101 LEU n 
1 102 SER n 
1 103 CYS n 
1 104 SER n 
1 105 TRP n 
1 106 ALA n 
1 107 VAL n 
1 108 GLY n 
1 109 PRO n 
1 110 GLY n 
1 111 ALA n 
1 112 PRO n 
1 113 ALA n 
1 114 ASP n 
1 115 VAL n 
1 116 GLN n 
1 117 TYR n 
1 118 ASP n 
1 119 LEU n 
1 120 TYR n 
1 121 LEU n 
1 122 ASN n 
1 123 VAL n 
1 124 ALA n 
1 125 ASN n 
1 126 ARG n 
1 127 ARG n 
1 128 GLN n 
1 129 GLN n 
1 130 TYR n 
1 131 GLU n 
1 132 CYS n 
1 133 LEU n 
1 134 HIS n 
1 135 TYR n 
1 136 LYS n 
1 137 THR n 
1 138 ASP n 
1 139 ALA n 
1 140 GLN n 
1 141 GLY n 
1 142 THR n 
1 143 ARG n 
1 144 ILE n 
1 145 GLY n 
1 146 CYS n 
1 147 ARG n 
1 148 PHE n 
1 149 ASP n 
1 150 ASP n 
1 151 ILE n 
1 152 SER n 
1 153 ARG n 
1 154 LEU n 
1 155 SER n 
1 156 SER n 
1 157 GLY n 
1 158 SER n 
1 159 GLN n 
1 160 SER n 
1 161 SER n 
1 162 HIS n 
1 163 ILE n 
1 164 LEU n 
1 165 VAL n 
1 166 ARG n 
1 167 GLY n 
1 168 ARG n 
1 169 SER n 
1 170 ALA n 
1 171 ALA n 
1 172 PHE n 
1 173 GLY n 
1 174 ILE n 
1 175 PRO n 
1 176 CYS n 
1 177 THR n 
1 178 ASP n 
1 179 LYS n 
1 180 PHE n 
1 181 VAL n 
1 182 VAL n 
1 183 PHE n 
1 184 SER n 
1 185 GLN n 
1 186 ILE n 
1 187 GLU n 
1 188 ILE n 
1 189 LEU n 
1 190 THR n 
1 191 PRO n 
1 192 PRO n 
1 193 GLN n 
1 194 MET n 
1 195 THR n 
1 196 ALA n 
1 197 LYS n 
1 198 CYS n 
1 199 ASN n 
1 200 LYS n 
1 201 THR n 
1 202 HIS n 
1 203 SER n 
1 204 PHE n 
1 205 MET n 
1 206 HIS n 
1 207 TRP n 
1 208 LYS n 
1 209 MET n 
1 210 ARG n 
1 211 SER n 
1 212 HIS n 
1 213 PHE n 
1 214 ASN n 
1 215 ARG n 
1 216 LYS n 
1 217 PHE n 
1 218 ARG n 
1 219 TYR n 
1 220 GLU n 
1 221 LEU n 
1 222 GLN n 
1 223 ILE n 
1 224 GLN n 
1 225 LYS n 
1 226 ARG n 
1 227 MET n 
1 228 GLN n 
1 229 PRO n 
1 230 VAL n 
1 231 ILE n 
1 232 THR n 
1 233 GLU n 
1 234 GLN n 
1 235 VAL n 
1 236 ARG n 
1 237 ASP n 
1 238 ARG n 
1 239 THR n 
1 240 SER n 
1 241 PHE n 
1 242 GLN n 
1 243 LEU n 
1 244 LEU n 
1 245 ASN n 
1 246 PRO n 
1 247 GLY n 
1 248 THR n 
1 249 TYR n 
1 250 THR n 
1 251 VAL n 
1 252 GLN n 
1 253 ILE n 
1 254 ARG n 
1 255 ALA n 
1 256 ARG n 
1 257 GLU n 
1 258 ARG n 
1 259 VAL n 
1 260 TYR n 
1 261 GLU n 
1 262 PHE n 
1 263 LEU n 
1 264 SER n 
1 265 ALA n 
1 266 TRP n 
1 267 SER n 
1 268 THR n 
1 269 PRO n 
1 270 GLN n 
1 271 ARG n 
1 272 PHE n 
1 273 GLU n 
1 274 CYS n 
1 275 ASP n 
1 276 GLN n 
1 277 GLU n 
1 278 GLU n 
1 279 GLY n 
1 280 ALA n 
1 281 ASN n 
1 282 THR n 
1 283 ARG n 
1 284 ALA n 
1 285 TRP n 
1 286 ARG n 
1 287 THR n 
1 288 SER n 
2 1   GLU n 
2 2   GLU n 
2 3   THR n 
2 4   ILE n 
2 5   PRO n 
2 6   LEU n 
2 7   GLN n 
2 8   THR n 
2 9   LEU n 
2 10  ARG n 
2 11  CYS n 
2 12  TYR n 
2 13  ASN n 
2 14  ASP n 
2 15  TYR n 
2 16  THR n 
2 17  SER n 
2 18  HIS n 
2 19  ILE n 
2 20  THR n 
2 21  CYS n 
2 22  ARG n 
2 23  TRP n 
2 24  ALA n 
2 25  ASP n 
2 26  THR n 
2 27  GLN n 
2 28  ASP n 
2 29  ALA n 
2 30  GLN n 
2 31  ARG n 
2 32  LEU n 
2 33  VAL n 
2 34  ASN n 
2 35  VAL n 
2 36  THR n 
2 37  LEU n 
2 38  ILE n 
2 39  ARG n 
2 40  ARG n 
2 41  VAL n 
2 42  ASN n 
2 43  GLU n 
2 44  ASP n 
2 45  LEU n 
2 46  LEU n 
2 47  GLU n 
2 48  PRO n 
2 49  VAL n 
2 50  SER n 
2 51  CYS n 
2 52  ASP n 
2 53  LEU n 
2 54  SER n 
2 55  ASP n 
2 56  ASP n 
2 57  MET n 
2 58  PRO n 
2 59  TRP n 
2 60  SER n 
2 61  ALA n 
2 62  CYS n 
2 63  PRO n 
2 64  HIS n 
2 65  PRO n 
2 66  ARG n 
2 67  CYS n 
2 68  VAL n 
2 69  PRO n 
2 70  ARG n 
2 71  ARG n 
2 72  CYS n 
2 73  VAL n 
2 74  ILE n 
2 75  PRO n 
2 76  CYS n 
2 77  GLN n 
2 78  SER n 
2 79  PHE n 
2 80  VAL n 
2 81  VAL n 
2 82  THR n 
2 83  ASP n 
2 84  VAL n 
2 85  ASP n 
2 86  TYR n 
2 87  PHE n 
2 88  SER n 
2 89  PHE n 
2 90  GLN n 
2 91  PRO n 
2 92  ASP n 
2 93  ARG n 
2 94  PRO n 
2 95  LEU n 
2 96  GLY n 
2 97  THR n 
2 98  ARG n 
2 99  LEU n 
2 100 THR n 
2 101 VAL n 
2 102 THR n 
2 103 LEU n 
2 104 THR n 
2 105 GLN n 
2 106 HIS n 
2 107 VAL n 
2 108 GLN n 
2 109 PRO n 
2 110 PRO n 
2 111 GLU n 
2 112 PRO n 
2 113 ARG n 
2 114 ASP n 
2 115 LEU n 
2 116 GLN n 
2 117 ILE n 
2 118 SER n 
2 119 THR n 
2 120 ASP n 
2 121 GLN n 
2 122 ASP n 
2 123 HIS n 
2 124 PHE n 
2 125 LEU n 
2 126 LEU n 
2 127 THR n 
2 128 TRP n 
2 129 SER n 
2 130 VAL n 
2 131 ALA n 
2 132 LEU n 
2 133 GLY n 
2 134 SER n 
2 135 PRO n 
2 136 GLN n 
2 137 SER n 
2 138 HIS n 
2 139 TRP n 
2 140 LEU n 
2 141 SER n 
2 142 PRO n 
2 143 GLY n 
2 144 ASP n 
2 145 LEU n 
2 146 GLU n 
2 147 PHE n 
2 148 GLU n 
2 149 VAL n 
2 150 VAL n 
2 151 TYR n 
2 152 LYS n 
2 153 ARG n 
2 154 LEU n 
2 155 GLN n 
2 156 ASP n 
2 157 SER n 
2 158 TRP n 
2 159 GLU n 
2 160 ASP n 
2 161 ALA n 
2 162 ALA n 
2 163 ILE n 
2 164 LEU n 
2 165 LEU n 
2 166 SER n 
2 167 ASN n 
2 168 THR n 
2 169 SER n 
2 170 GLN n 
2 171 ALA n 
2 172 THR n 
2 173 LEU n 
2 174 GLY n 
2 175 PRO n 
2 176 GLU n 
2 177 HIS n 
2 178 LEU n 
2 179 MET n 
2 180 PRO n 
2 181 SER n 
2 182 SER n 
2 183 THR n 
2 184 TYR n 
2 185 VAL n 
2 186 ALA n 
2 187 ARG n 
2 188 VAL n 
2 189 ARG n 
2 190 THR n 
2 191 ARG n 
2 192 LEU n 
2 193 ALA n 
2 194 PRO n 
2 195 GLY n 
2 196 SER n 
2 197 ARG n 
2 198 LEU n 
2 199 SER n 
2 200 GLY n 
2 201 ARG n 
2 202 PRO n 
2 203 SER n 
2 204 LYS n 
2 205 TRP n 
2 206 SER n 
2 207 PRO n 
2 208 GLU n 
2 209 VAL n 
2 210 CYS n 
2 211 TRP n 
2 212 ASP n 
2 213 SER n 
2 214 GLN n 
2 215 PRO n 
2 216 GLY n 
3 1   GLY n 
3 2   ALA n 
3 3   MET n 
3 4   GLY n 
3 5   SER n 
3 6   TYR n 
3 7   VAL n 
3 8   ASN n 
3 9   CYS n 
3 10  SER n 
3 11  ASN n 
3 12  MET n 
3 13  ILE n 
3 14  ASP n 
3 15  GLU n 
3 16  ILE n 
3 17  ILE n 
3 18  THR n 
3 19  HIS n 
3 20  LEU n 
3 21  LYS n 
3 22  GLN n 
3 23  PRO n 
3 24  PRO n 
3 25  LEU n 
3 26  PRO n 
3 27  LEU n 
3 28  LEU n 
3 29  ASP n 
3 30  PHE n 
3 31  ASN n 
3 32  ASN n 
3 33  LEU n 
3 34  ASN n 
3 35  GLY n 
3 36  GLU n 
3 37  ASP n 
3 38  GLN n 
3 39  ASP n 
3 40  ILE n 
3 41  LEU n 
3 42  MET n 
3 43  GLU n 
3 44  ASN n 
3 45  ASN n 
3 46  LEU n 
3 47  ARG n 
3 48  ARG n 
3 49  PRO n 
3 50  ASN n 
3 51  LEU n 
3 52  GLU n 
3 53  ALA n 
3 54  PHE n 
3 55  ASN n 
3 56  ARG n 
3 57  ALA n 
3 58  VAL n 
3 59  LYS n 
3 60  SER n 
3 61  LEU n 
3 62  GLN n 
3 63  ASN n 
3 64  ALA n 
3 65  SER n 
3 66  ALA n 
3 67  ILE n 
3 68  GLU n 
3 69  SER n 
3 70  ILE n 
3 71  LEU n 
3 72  LYS n 
3 73  ASN n 
3 74  LEU n 
3 75  LEU n 
3 76  PRO n 
3 77  CYS n 
3 78  LEU n 
3 79  PRO n 
3 80  LEU n 
3 81  ALA n 
3 82  THR n 
3 83  ALA n 
3 84  ALA n 
3 85  PRO n 
3 86  THR n 
3 87  ARG n 
3 88  HIS n 
3 89  PRO n 
3 90  ILE n 
3 91  HIS n 
3 92  ILE n 
3 93  LYS n 
3 94  ASP n 
3 95  GLY n 
3 96  ASP n 
3 97  TRP n 
3 98  ASN n 
3 99  GLU n 
3 100 PHE n 
3 101 ARG n 
3 102 ARG n 
3 103 LYS n 
3 104 LEU n 
3 105 THR n 
3 106 PHE n 
3 107 TYR n 
3 108 LEU n 
3 109 LYS n 
3 110 THR n 
3 111 LEU n 
3 112 GLU n 
3 113 ASN n 
3 114 ALA n 
3 115 GLN n 
3 116 ALA n 
3 117 GLN n 
3 118 GLN n 
4 1   ASP n 
4 2   GLU n 
4 3   ALA n 
4 4   GLN n 
4 5   PRO n 
4 6   GLN n 
4 7   ASN n 
4 8   LEU n 
4 9   GLU n 
4 10  CYS n 
4 11  PHE n 
4 12  PHE n 
4 13  ASP n 
4 14  GLY n 
4 15  ALA n 
4 16  ALA n 
4 17  VAL n 
4 18  LEU n 
4 19  SER n 
4 20  CYS n 
4 21  SER n 
4 22  TRP n 
4 23  GLU n 
4 24  VAL n 
4 25  ARG n 
4 26  LYS n 
4 27  GLU n 
4 28  VAL n 
4 29  ALA n 
4 30  SER n 
4 31  SER n 
4 32  VAL n 
4 33  SER n 
4 34  PHE n 
4 35  GLY n 
4 36  LEU n 
4 37  PHE n 
4 38  TYR n 
4 39  LYS n 
4 40  PRO n 
4 41  SER n 
4 42  PRO n 
4 43  ASP n 
4 44  ALA n 
4 45  GLY n 
4 46  GLU n 
4 47  GLU n 
4 48  GLU n 
4 49  CYS n 
4 50  SER n 
4 51  PRO n 
4 52  VAL n 
4 53  LEU n 
4 54  ARG n 
4 55  GLU n 
4 56  GLY n 
4 57  LEU n 
4 58  GLY n 
4 59  SER n 
4 60  LEU n 
4 61  HIS n 
4 62  THR n 
4 63  ARG n 
4 64  HIS n 
4 65  HIS n 
4 66  CYS n 
4 67  GLN n 
4 68  ILE n 
4 69  PRO n 
4 70  VAL n 
4 71  PRO n 
4 72  ASP n 
4 73  PRO n 
4 74  ALA n 
4 75  THR n 
4 76  HIS n 
4 77  GLY n 
4 78  GLN n 
4 79  TYR n 
4 80  ILE n 
4 81  VAL n 
4 82  SER n 
4 83  VAL n 
4 84  GLN n 
4 85  PRO n 
4 86  ARG n 
4 87  ARG n 
4 88  ALA n 
4 89  GLU n 
4 90  LYS n 
4 91  HIS n 
4 92  ILE n 
4 93  LYS n 
4 94  SER n 
4 95  SER n 
4 96  VAL n 
4 97  ASN n 
4 98  ILE n 
4 99  GLN n 
4 100 MET n 
4 101 ALA n 
4 102 PRO n 
4 103 PRO n 
4 104 SER n 
4 105 LEU n 
4 106 GLN n 
4 107 VAL n 
4 108 THR n 
4 109 LYS n 
4 110 ASP n 
4 111 GLY n 
4 112 ASP n 
4 113 SER n 
4 114 TYR n 
4 115 SER n 
4 116 LEU n 
4 117 ARG n 
4 118 TRP n 
4 119 GLU n 
4 120 THR n 
4 121 MET n 
4 122 LYS n 
4 123 MET n 
4 124 ARG n 
4 125 TYR n 
4 126 GLU n 
4 127 HIS n 
4 128 ILE n 
4 129 ASP n 
4 130 HIS n 
4 131 THR n 
4 132 PHE n 
4 133 GLU n 
4 134 ILE n 
4 135 GLN n 
4 136 TYR n 
4 137 ARG n 
4 138 LYS n 
4 139 ASP n 
4 140 THR n 
4 141 ALA n 
4 142 THR n 
4 143 TRP n 
4 144 LYS n 
4 145 ASP n 
4 146 SER n 
4 147 LYS n 
4 148 THR n 
4 149 GLU n 
4 150 THR n 
4 151 LEU n 
4 152 GLN n 
4 153 ASN n 
4 154 ALA n 
4 155 HIS n 
4 156 SER n 
4 157 MET n 
4 158 ALA n 
4 159 LEU n 
4 160 PRO n 
4 161 ALA n 
4 162 LEU n 
4 163 GLU n 
4 164 PRO n 
4 165 SER n 
4 166 THR n 
4 167 ARG n 
4 168 TYR n 
4 169 TRP n 
4 170 ALA n 
4 171 ARG n 
4 172 VAL n 
4 173 ARG n 
4 174 VAL n 
4 175 ARG n 
4 176 THR n 
4 177 SER n 
4 178 ARG n 
4 179 THR n 
4 180 GLY n 
4 181 TYR n 
4 182 ASN n 
4 183 GLY n 
4 184 ILE n 
4 185 TRP n 
4 186 SER n 
4 187 GLU n 
4 188 TRP n 
4 189 SER n 
4 190 GLU n 
4 191 ALA n 
4 192 ARG n 
4 193 SER n 
4 194 TRP n 
4 195 ASP n 
4 196 THR n 
4 197 GLU n 
4 198 SER n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 288 Human ? 'IL3RA, IL3R'          ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'fall armyworm' 'Spodoptera frugiperda' 7108  ? ? ? ? ? ? ? ? ? ? ? ? ? ? baculovirus ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 216 Human ? 'CSF2RB, IL3RB, IL5RB' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'fall armyworm' 'Spodoptera frugiperda' 7108  ? ? ? ? ? ? ? ? ? ? ? ? ? ? baculovirus ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 118 Human ? IL3                    ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli K-12' 83333 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?           ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 198 Human ? 'CSF2RB, IL3RB, IL5RB' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'fall armyworm' 'Spodoptera frugiperda' 7108  ? ? ? ? ? ? ? ? ? ? ? ? ? ? baculovirus ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP IL3RA_HUMAN P26951 ? 1 
;KEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPEN
SGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQS
SHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTS
FQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTS
;
20  
2 UNP IL3RB_HUMAN P32927 ? 2 
;EETIPLQTLRCYNDYTSHITCRWADTQDAQRLVNVTLIRRVNEDLLEPVSCDLSDDMPWSACPHPRCVPRRCVIPCQSFV
VTDVDYFSFQPDRPLGTRLTVTLTQHVQPPEPRDLQISTDQDHFLLTWSVALGSPQSHWLSPGDLEFEVVYKRLQDSWED
AAILLSNTSQATLGPEHLMPSSTYVARVRTRLAPGSRLSGRPSKWSPEVCWDSQPG
;
25  
3 UNP IL3_HUMAN   P08700 ? 3 
;SWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAA
PTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQ
;
31  
4 UNP IL3RB_HUMAN P32927 ? 4 
;DEAQPQNLECFFDGAAVLSCSWEVRKEVASSVSFGLFYKPSPDAGEEECSPVLREGLGSLHTRHHCQIPVPDPATHGQYI
VSVQPRRAEKHIKSSVNIQMAPPSLNVTKDGDSYSLRWETMKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALP
ALEPSTRYWARVRVRTSRTGYNGIWSEWSEARSWDTES
;
241 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6NMY F 1 ? 288 ? P26951 20  ? 307 ? 20  307 
2 1 6NMY M 1 ? 288 ? P26951 20  ? 307 ? 20  307 
3 2 6NMY A 1 ? 216 ? P32927 25  ? 240 ? 25  240 
4 2 6NMY C 1 ? 216 ? P32927 25  ? 240 ? 25  240 
5 3 6NMY I 5 ? 118 ? P08700 31  ? 144 ? 12  125 
6 3 6NMY J 5 ? 118 ? P08700 31  ? 144 ? 12  125 
7 4 6NMY B 1 ? 198 ? P32927 241 ? 438 ? 241 438 
8 4 6NMY D 1 ? 198 ? P32927 241 ? 438 ? 241 438 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6NMY GLN F 193 ? UNP P26951 ASN 212 'engineered mutation' 212 1  
2 6NMY GLN M 193 ? UNP P26951 ASN 212 'engineered mutation' 212 2  
5 6NMY GLY I 1   ? UNP P08700 ?   ?   'expression tag'      8   3  
5 6NMY ALA I 2   ? UNP P08700 ?   ?   'expression tag'      9   4  
5 6NMY MET I 3   ? UNP P08700 ?   ?   'expression tag'      10  5  
5 6NMY GLY I 4   ? UNP P08700 ?   ?   'expression tag'      11  6  
5 6NMY TYR I 6   ? UNP P08700 TRP 32  'engineered mutation' 13  7  
6 6NMY GLY J 1   ? UNP P08700 ?   ?   'expression tag'      8   8  
6 6NMY ALA J 2   ? UNP P08700 ?   ?   'expression tag'      9   9  
6 6NMY MET J 3   ? UNP P08700 ?   ?   'expression tag'      10  10 
6 6NMY GLY J 4   ? UNP P08700 ?   ?   'expression tag'      11  11 
6 6NMY TYR J 6   ? UNP P08700 TRP 32  'engineered mutation' 13  12 
7 6NMY GLN B 106 ? UNP P32927 ASN 346 'engineered mutation' 346 13 
8 6NMY GLN D 106 ? UNP P32927 ASN 346 'engineered mutation' 346 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose                     ? 'C6 H12 O6'      180.156 
CYS 'L-peptide linking'           y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                     ? 'C6 H12 O5'      164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6NMY 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.93 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         68.69 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.8 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'Crystals were grown in 10 mM Tris pH6.8, 8% PEG 8000, 0.15 M magnesium chloride' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-06-14 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.95370 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.95370 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   MX2 
_diffrn_source.pdbx_synchrotron_site       'Australian Synchrotron' 
# 
_reflns.B_iso_Wilson_estimate            97.580 
_reflns.entry_id                         6NMY 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.300 
_reflns.d_resolution_low                 47.760 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       45227 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.800 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.500 
_reflns.pdbx_Rmerge_I_obs                0.175 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            8.800 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             95 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.194 
_reflns.pdbx_Rpim_I_all                  0.081 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         248002 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.996 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
3.300  3.420  ? ? 24488 ? ? ? 4368 99.500 ? ? ? ? 1.728 ? ? ? ? ? ? ? ? 5.600 ? ? ? 1.100  1.914 0.807 ? 1 1 0.310 ? 
12.780 47.760 ? ? 3883  ? ? ? 836  95.000 ? ? ? ? 0.027 ? ? ? ? ? ? ? ? 4.600 ? ? ? 41.100 0.030 0.013 ? 2 1 0.999 ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                180.510 
_refine.B_iso_mean                               95.1938 
_refine.B_iso_min                                30.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6NMY 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.3010 
_refine.ls_d_res_low                             47.4480 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     45149 
_refine.ls_number_reflns_R_free                  2233 
_refine.ls_number_reflns_R_work                  42916 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.8100 
_refine.ls_percent_reflns_R_free                 4.9500 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2384 
_refine.ls_R_factor_R_free                       0.2778 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2364 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      '4NKQ, 5UV8' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 29.4800 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.5500 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       3.3010 
_refine_hist.d_res_low                        47.4480 
_refine_hist.number_atoms_solvent             12 
_refine_hist.number_atoms_total               12975 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       1571 
_refine_hist.pdbx_B_iso_mean_ligand           133.92 
_refine_hist.pdbx_B_iso_mean_solvent          76.94 
_refine_hist.pdbx_number_atoms_protein        12678 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         285 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.3010 3.3724 . . 138 2647 99.0000  . . . 0.4071 0.0000 0.3917 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3724 3.4509 . . 149 2609 100.0000 . . . 0.3619 0.0000 0.3714 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4509 3.5371 . . 135 2652 100.0000 . . . 0.3815 0.0000 0.3370 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5371 3.6328 . . 168 2614 100.0000 . . . 0.3492 0.0000 0.3185 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6328 3.7396 . . 144 2668 100.0000 . . . 0.3349 0.0000 0.3067 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7396 3.8603 . . 130 2668 100.0000 . . . 0.3349 0.0000 0.2935 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8603 3.9982 . . 137 2656 100.0000 . . . 0.3299 0.0000 0.2786 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9982 4.1582 . . 131 2660 100.0000 . . . 0.3255 0.0000 0.2547 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1582 4.3473 . . 126 2698 100.0000 . . . 0.2785 0.0000 0.2364 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3473 4.5763 . . 116 2693 100.0000 . . . 0.2379 0.0000 0.2132 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.5763 4.8628 . . 130 2683 100.0000 . . . 0.2272 0.0000 0.2053 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.8628 5.2378 . . 151 2684 100.0000 . . . 0.2555 0.0000 0.1965 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.2378 5.7641 . . 159 2679 100.0000 . . . 0.2599 0.0000 0.2032 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.7641 6.5962 . . 156 2713 100.0000 . . . 0.2638 0.0000 0.2240 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.5962 8.3033 . . 140 2745 100.0000 . . . 0.2619 0.0000 0.2128 . . . . . . . . . . 
'X-RAY DIFFRACTION' 8.3033 47.448 . . 123 2847 98.0000  . . . 0.2165 0.0000 0.1906 . . . . . . . . . . 
# 
_struct.entry_id                     6NMY 
_struct.title                        'A Cytokine-receptor complex' 
_struct.pdbx_descriptor              'Granulocyte-macrophage colony-stimulating factor, Fab Heavy chain, 	Fab Light Chain' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6NMY 
_struct_keywords.text            'cytokine-receptor complex, receptor assembly, cell surface, CYTOKINE' 
_struct_keywords.pdbx_keywords   CYTOKINE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 6 ? 
L N N 6 ? 
M N N 7 ? 
N N N 6 ? 
O N N 7 ? 
P N N 8 ? 
Q N N 9 ? 
R N N 9 ? 
S N N 9 ? 
T N N 9 ? 
U N N 9 ? 
V N N 9 ? 
W N N 9 ? 
X N N 9 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 150 ? SER A 155 ? ASP F 169 SER F 174 1 ? 6  
HELX_P HELX_P2  AA2 SER A 184 ? ILE A 186 ? SER F 203 ILE F 205 5 ? 3  
HELX_P HELX_P3  AA3 VAL B 44  ? ASN B 46  ? VAL M 63  ASN M 65  5 ? 3  
HELX_P HELX_P4  AA4 ASP B 150 ? SER B 155 ? ASP M 169 SER M 174 1 ? 6  
HELX_P HELX_P5  AA5 PHE B 183 ? GLU B 187 ? PHE M 202 GLU M 206 1 ? 5  
HELX_P HELX_P6  AA6 THR C 3   ? LEU C 9   ? THR A 27  LEU A 33  1 ? 7  
HELX_P HELX_P7  AA7 GLN C 27  ? ARG C 31  ? GLN A 51  ARG A 55  1 ? 5  
HELX_P HELX_P8  AA8 SER C 157 ? ALA C 161 ? SER A 181 ALA A 185 5 ? 5  
HELX_P HELX_P9  AA9 THR D 3   ? LEU D 9   ? THR C 27  LEU C 33  1 ? 7  
HELX_P HELX_P10 AB1 ASP D 28  ? LEU D 32  ? ASP C 52  LEU C 56  5 ? 5  
HELX_P HELX_P11 AB2 THR D 104 ? HIS D 106 ? THR C 128 HIS C 130 5 ? 3  
HELX_P HELX_P12 AB3 SER D 157 ? ALA D 161 ? SER C 181 ALA C 185 5 ? 5  
HELX_P HELX_P13 AB4 VAL E 7   ? LEU E 20  ? VAL I 14  LEU I 27  1 ? 14 
HELX_P HELX_P14 AB5 ASP E 29  ? LEU E 33  ? ASP I 36  LEU I 40  5 ? 5  
HELX_P HELX_P15 AB6 ASN E 34  ? GLU E 43  ? ASN I 41  GLU I 50  1 ? 10 
HELX_P HELX_P16 AB7 LEU E 46  ? VAL E 58  ? LEU I 53  VAL I 65  1 ? 13 
HELX_P HELX_P17 AB8 LYS E 59  ? LEU E 61  ? LYS I 66  LEU I 68  5 ? 3  
HELX_P HELX_P18 AB9 ALA E 64  ? LEU E 74  ? ALA I 71  LEU I 81  1 ? 11 
HELX_P HELX_P19 AC1 LEU E 75  ? LEU E 78  ? LEU I 82  LEU I 85  5 ? 4  
HELX_P HELX_P20 AC2 ASP E 96  ? LEU E 111 ? ASP I 103 LEU I 118 1 ? 16 
HELX_P HELX_P21 AC3 ASN F 8   ? LEU F 20  ? ASN J 15  LEU J 27  1 ? 13 
HELX_P HELX_P22 AC4 ASP F 29  ? LEU F 33  ? ASP J 36  LEU J 40  5 ? 5  
HELX_P HELX_P23 AC5 ASN F 34  ? GLU F 43  ? ASN J 41  GLU J 50  1 ? 10 
HELX_P HELX_P24 AC6 LEU F 46  ? VAL F 58  ? LEU J 53  VAL J 65  1 ? 13 
HELX_P HELX_P25 AC7 LYS F 59  ? LEU F 61  ? LYS J 66  LEU J 68  5 ? 3  
HELX_P HELX_P26 AC8 ALA F 64  ? ASN F 73  ? ALA J 71  ASN J 80  1 ? 10 
HELX_P HELX_P27 AC9 LEU F 74  ? LEU F 78  ? LEU J 81  LEU J 85  5 ? 5  
HELX_P HELX_P28 AD1 ASP F 96  ? GLU F 112 ? ASP J 103 GLU J 119 1 ? 17 
HELX_P HELX_P29 AD2 LYS G 26  ? VAL G 32  ? LYS B 266 VAL B 272 1 ? 7  
HELX_P HELX_P30 AD3 SER G 95  ? ASN G 97  ? SER B 335 ASN B 337 5 ? 3  
HELX_P HELX_P31 AD4 LYS H 26  ? VAL H 32  ? LYS D 266 VAL D 272 1 ? 7  
HELX_P HELX_P32 AD5 SER H 95  ? ASN H 97  ? SER D 335 ASN D 337 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 33  SG  ? ? ? 1_555 A CYS 49  SG ? ? F CYS 52  F CYS 68  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf2  disulf ?    ? A CYS 57  SG  ? ? ? 1_555 A CYS 176 SG ? ? F CYS 76  F CYS 195 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf3  disulf ?    ? A CYS 93  SG  ? ? ? 1_555 A CYS 103 SG ? ? F CYS 112 F CYS 122 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf4  disulf ?    ? A CYS 132 SG  ? ? ? 1_555 A CYS 146 SG ? ? F CYS 151 F CYS 165 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf5  disulf ?    ? A CYS 198 SG  ? ? ? 1_555 A CYS 274 SG ? ? F CYS 217 F CYS 293 1_555 ? ? ? ? ? ? ? 2.026 ? ?               
disulf6  disulf ?    ? B CYS 33  SG  ? ? ? 1_555 B CYS 49  SG ? ? M CYS 52  M CYS 68  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf7  disulf ?    ? B CYS 57  SG  ? ? ? 1_555 B CYS 176 SG ? ? M CYS 76  M CYS 195 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf8  disulf ?    ? B CYS 93  SG  ? ? ? 1_555 B CYS 103 SG ? ? M CYS 112 M CYS 122 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf9  disulf ?    ? B CYS 132 SG  ? ? ? 1_555 B CYS 146 SG ? ? M CYS 151 M CYS 165 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf10 disulf ?    ? B CYS 198 SG  ? ? ? 1_555 B CYS 274 SG ? ? M CYS 217 M CYS 293 1_555 ? ? ? ? ? ? ? 2.026 ? ?               
disulf11 disulf ?    ? C CYS 11  SG  ? ? ? 1_555 C CYS 21  SG ? ? A CYS 35  A CYS 45  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf12 disulf ?    ? C CYS 51  SG  ? ? ? 1_555 C CYS 72  SG ? ? A CYS 75  A CYS 96  1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf13 disulf ?    ? C CYS 62  SG  ? ? ? 1_555 C CYS 67  SG ? ? A CYS 86  A CYS 91  1_555 ? ? ? ? ? ? ? 2.023 ? ?               
disulf14 disulf ?    ? D CYS 11  SG  ? ? ? 1_555 D CYS 21  SG ? ? C CYS 35  C CYS 45  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf15 disulf ?    ? D CYS 51  SG  ? ? ? 1_555 D CYS 72  SG ? ? C CYS 75  C CYS 96  1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf16 disulf ?    ? D CYS 62  SG  ? ? ? 1_555 D CYS 67  SG ? ? C CYS 86  C CYS 91  1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf17 disulf ?    ? E CYS 9   SG  ? ? ? 1_555 E CYS 77  SG ? ? I CYS 16  I CYS 84  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf18 disulf ?    ? F CYS 9   SG  ? ? ? 1_555 F CYS 77  SG ? ? J CYS 16  J CYS 84  1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf19 disulf ?    ? G CYS 10  SG  ? ? ? 1_555 G CYS 20  SG ? ? B CYS 250 B CYS 260 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf20 disulf ?    ? G CYS 49  SG  ? ? ? 1_555 G CYS 66  SG ? ? B CYS 289 B CYS 306 1_555 ? ? ? ? ? ? ? 2.026 ? ?               
disulf21 disulf ?    ? H CYS 10  SG  ? ? ? 1_555 H CYS 20  SG ? ? D CYS 250 D CYS 260 1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf22 disulf ?    ? H CYS 49  SG  ? ? ? 1_555 H CYS 66  SG ? ? D CYS 289 D CYS 306 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
covale1  covale one  ? A ASN 45  ND2 ? ? ? 1_555 K NAG .   C1 ? ? F ASN 64  H NAG 1   1_555 ? ? ? ? ? ? ? 1.457 ? N-Glycosylation 
covale2  covale one  ? A ASN 61  ND2 ? ? ? 1_555 I NAG .   C1 ? ? F ASN 80  E NAG 1   1_555 ? ? ? ? ? ? ? 1.444 ? N-Glycosylation 
covale3  covale one  ? A ASN 199 ND2 ? ? ? 1_555 J NAG .   C1 ? ? F ASN 218 G NAG 1   1_555 ? ? ? ? ? ? ? 1.439 ? N-Glycosylation 
covale4  covale one  ? B ASN 61  ND2 ? ? ? 1_555 M NAG .   C1 ? ? M ASN 80  L NAG 1   1_555 ? ? ? ? ? ? ? 1.444 ? N-Glycosylation 
covale5  covale one  ? B ASN 199 ND2 ? ? ? 1_555 L NAG .   C1 ? ? M ASN 218 K NAG 1   1_555 ? ? ? ? ? ? ? 1.440 ? N-Glycosylation 
covale6  covale one  ? C ASN 34  ND2 ? ? ? 1_555 N NAG .   C1 ? ? A ASN 58  N NAG 1   1_555 ? ? ? ? ? ? ? 1.423 ? N-Glycosylation 
covale7  covale one  ? D ASN 34  ND2 ? ? ? 1_555 O NAG .   C1 ? ? C ASN 58  O NAG 1   1_555 ? ? ? ? ? ? ? 1.454 ? N-Glycosylation 
covale8  covale one  ? D ASN 167 ND2 ? ? ? 1_555 P NAG .   C1 ? ? C ASN 191 C NAG 301 1_555 ? ? ? ? ? ? ? 1.446 ? N-Glycosylation 
covale9  covale both ? I NAG .   O4  ? ? ? 1_555 I NAG .   C1 ? ? E NAG 1   E NAG 2   1_555 ? ? ? ? ? ? ? 1.450 ? ?               
covale10 covale one  ? I NAG .   O6  ? ? ? 1_555 I FUC .   C1 ? ? E NAG 1   E FUC 4   1_555 ? ? ? ? ? ? ? 1.445 ? ?               
covale11 covale both ? I NAG .   O4  ? ? ? 1_555 I BMA .   C1 ? ? E NAG 2   E BMA 3   1_555 ? ? ? ? ? ? ? 1.461 ? ?               
covale12 covale both ? J NAG .   O4  ? ? ? 1_555 J NAG .   C1 ? ? G NAG 1   G NAG 2   1_555 ? ? ? ? ? ? ? 1.451 ? ?               
covale13 covale one  ? J NAG .   O6  ? ? ? 1_555 J FUC .   C1 ? ? G NAG 1   G FUC 4   1_555 ? ? ? ? ? ? ? 1.474 ? ?               
covale14 covale both ? J NAG .   O4  ? ? ? 1_555 J BMA .   C1 ? ? G NAG 2   G BMA 3   1_555 ? ? ? ? ? ? ? 1.452 ? ?               
covale15 covale both ? K NAG .   O4  ? ? ? 1_555 K NAG .   C1 ? ? H NAG 1   H NAG 2   1_555 ? ? ? ? ? ? ? 1.429 ? ?               
covale16 covale both ? K NAG .   O4  ? ? ? 1_555 K BMA .   C1 ? ? H NAG 2   H BMA 3   1_555 ? ? ? ? ? ? ? 1.452 ? ?               
covale17 covale both ? L NAG .   O4  ? ? ? 1_555 L NAG .   C1 ? ? K NAG 1   K NAG 2   1_555 ? ? ? ? ? ? ? 1.460 ? ?               
covale18 covale both ? L NAG .   O4  ? ? ? 1_555 L BMA .   C1 ? ? K NAG 2   K BMA 3   1_555 ? ? ? ? ? ? ? 1.442 ? ?               
covale19 covale both ? M NAG .   O4  ? ? ? 1_555 M NAG .   C1 ? ? L NAG 1   L NAG 2   1_555 ? ? ? ? ? ? ? 1.466 ? ?               
covale20 covale both ? N NAG .   O4  ? ? ? 1_555 N NAG .   C1 ? ? N NAG 1   N NAG 2   1_555 ? ? ? ? ? ? ? 1.416 ? ?               
covale21 covale both ? N NAG .   O4  ? ? ? 1_555 N BMA .   C1 ? ? N NAG 2   N BMA 3   1_555 ? ? ? ? ? ? ? 1.454 ? ?               
covale22 covale both ? O NAG .   O4  ? ? ? 1_555 O NAG .   C1 ? ? O NAG 1   O NAG 2   1_555 ? ? ? ? ? ? ? 1.442 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASN 68 A . ? ASN 87  F PRO 69 A ? PRO 88  F 1 -1.04 
2 PHE 77 A . ? PHE 96  F PRO 78 A ? PRO 97  F 1 -2.95 
3 ASN 68 B . ? ASN 87  M PRO 69 B ? PRO 88  M 1 0.52  
4 PHE 77 B . ? PHE 96  M PRO 78 B ? PRO 97  M 1 -1.97 
5 SER 50 G . ? SER 290 B PRO 51 G ? PRO 291 B 1 3.76  
6 SER 50 H . ? SER 290 D PRO 51 H ? PRO 291 D 1 2.85  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 3 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 3 ? 
AA6 ? 4 ? 
AA7 ? 3 ? 
AA8 ? 4 ? 
AA9 ? 4 ? 
AB1 ? 4 ? 
AB2 ? 3 ? 
AB3 ? 4 ? 
AB4 ? 4 ? 
AB5 ? 4 ? 
AB6 ? 4 ? 
AB7 ? 4 ? 
AB8 ? 3 ? 
AB9 ? 4 ? 
AC1 ? 4 ? 
AC2 ? 4 ? 
AC3 ? 4 ? 
AC4 ? 3 ? 
AC5 ? 4 ? 
AC6 ? 4 ? 
AC7 ? 3 ? 
AC8 ? 4 ? 
AC9 ? 4 ? 
AD1 ? 3 ? 
AD2 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC2 3 4 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC8 3 4 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AC9 3 4 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD2 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 12  ? LYS A 14  ? ARG F 31  LYS F 33  
AA1 2 GLN A 19  ? THR A 21  ? GLN F 38  THR F 40  
AA1 3 TYR A 48  ? GLN A 50  ? TYR F 67  GLN F 69  
AA2 1 ILE A 31  ? LYS A 35  ? ILE F 50  LYS F 54  
AA2 2 THR A 60  ? VAL A 66  ? THR F 79  VAL F 85  
AA2 3 PHE A 71  ? PHE A 77  ? PHE F 90  PHE F 96  
AA3 1 GLU A 89  ? HIS A 96  ? GLU F 108 HIS F 115 
AA3 2 PHE A 100 ? ALA A 106 ? PHE F 119 ALA F 125 
AA3 3 ARG A 143 ? PHE A 148 ? ARG F 162 PHE F 167 
AA3 4 HIS A 134 ? THR A 137 ? HIS F 153 THR F 156 
AA4 1 GLN A 128 ? GLU A 131 ? GLN F 147 GLU F 150 
AA4 2 GLN A 116 ? VAL A 123 ? GLN F 135 VAL F 142 
AA4 3 SER A 160 ? ARG A 168 ? SER F 179 ARG F 187 
AA4 4 GLY A 173 ? VAL A 182 ? GLY F 192 VAL F 201 
AA5 1 GLN A 193 ? CYS A 198 ? GLN F 212 CYS F 217 
AA5 2 HIS A 202 ? LYS A 208 ? HIS F 221 LYS F 227 
AA5 3 SER A 240 ? LEU A 244 ? SER F 259 LEU F 263 
AA6 1 ILE A 231 ? GLU A 233 ? ILE F 250 GLU F 252 
AA6 2 PHE A 217 ? LYS A 225 ? PHE F 236 LYS F 244 
AA6 3 TYR A 249 ? GLU A 257 ? TYR F 268 GLU F 276 
AA6 4 GLN A 270 ? PHE A 272 ? GLN F 289 PHE F 291 
AA7 1 ARG B 12  ? LYS B 14  ? ARG M 31  LYS M 33  
AA7 2 GLN B 19  ? THR B 21  ? GLN M 38  THR M 40  
AA7 3 TYR B 48  ? GLN B 50  ? TYR M 67  GLN M 69  
AA8 1 TYR B 39  ? PRO B 42  ? TYR M 58  PRO M 61  
AA8 2 ILE B 31  ? LYS B 35  ? ILE M 50  LYS M 54  
AA8 3 THR B 60  ? VAL B 66  ? THR M 79  VAL M 85  
AA8 4 ILE B 75  ? PHE B 77  ? ILE M 94  PHE M 96  
AA9 1 GLU B 89  ? HIS B 96  ? GLU M 108 HIS M 115 
AA9 2 PHE B 100 ? ALA B 106 ? PHE M 119 ALA M 125 
AA9 3 ARG B 143 ? PHE B 148 ? ARG M 162 PHE M 167 
AA9 4 TYR B 135 ? THR B 137 ? TYR M 154 THR M 156 
AB1 1 GLN B 129 ? GLU B 131 ? GLN M 148 GLU M 150 
AB1 2 GLN B 116 ? VAL B 123 ? GLN M 135 VAL M 142 
AB1 3 SER B 160 ? ARG B 168 ? SER M 179 ARG M 187 
AB1 4 GLY B 173 ? VAL B 182 ? GLY M 192 VAL M 201 
AB2 1 GLN B 193 ? CYS B 198 ? GLN M 212 CYS M 217 
AB2 2 HIS B 202 ? LYS B 208 ? HIS M 221 LYS M 227 
AB2 3 SER B 240 ? LEU B 244 ? SER M 259 LEU M 263 
AB3 1 ILE B 231 ? GLU B 233 ? ILE M 250 GLU M 252 
AB3 2 PHE B 217 ? LYS B 225 ? PHE M 236 LYS M 244 
AB3 3 THR B 248 ? GLU B 257 ? THR M 267 GLU M 276 
AB3 4 GLN B 270 ? GLU B 273 ? GLN M 289 GLU M 292 
AB4 1 ARG C 10  ? ASN C 13  ? ARG A 34  ASN A 37  
AB4 2 ILE C 19  ? ARG C 22  ? ILE A 43  ARG A 46  
AB4 3 CYS C 67  ? ILE C 74  ? CYS A 91  ILE A 98  
AB4 4 ALA C 24  ? THR C 26  ? ALA A 48  THR A 50  
AB5 1 ARG C 10  ? ASN C 13  ? ARG A 34  ASN A 37  
AB5 2 ILE C 19  ? ARG C 22  ? ILE A 43  ARG A 46  
AB5 3 CYS C 67  ? ILE C 74  ? CYS A 91  ILE A 98  
AB5 4 CYS C 51  ? LEU C 53  ? CYS A 75  LEU A 77  
AB6 1 LEU C 46  ? PRO C 48  ? LEU A 70  PRO A 72  
AB6 2 VAL C 35  ? ARG C 40  ? VAL A 59  ARG A 64  
AB6 3 VAL C 84  ? PRO C 91  ? VAL A 108 PRO A 115 
AB6 4 LYS G 90  ? LYS G 93  ? LYS B 330 LYS B 333 
AB7 1 THR C 97  ? THR C 102 ? THR A 121 THR A 126 
AB7 2 GLN G 78  ? PRO G 85  ? GLN B 318 PRO B 325 
AB7 3 PHE G 34  ? LYS G 39  ? PHE B 274 LYS B 279 
AB7 4 GLU G 47  ? GLU G 48  ? GLU B 287 GLU B 288 
AB8 1 ARG C 113 ? THR C 119 ? ARG A 137 THR A 143 
AB8 2 PHE C 124 ? SER C 129 ? PHE A 148 SER A 153 
AB8 3 GLN C 170 ? LEU C 173 ? GLN A 194 LEU A 197 
AB9 1 ALA C 162 ? SER C 166 ? ALA A 186 SER A 190 
AB9 2 LEU C 145 ? ARG C 153 ? LEU A 169 ARG A 177 
AB9 3 THR C 183 ? LEU C 192 ? THR A 207 LEU A 216 
AB9 4 VAL C 209 ? ASP C 212 ? VAL A 233 ASP A 236 
AC1 1 ARG D 10  ? ASN D 13  ? ARG C 34  ASN C 37  
AC1 2 ILE D 19  ? THR D 26  ? ILE C 43  THR C 50  
AC1 3 CYS D 67  ? ILE D 74  ? CYS C 91  ILE C 98  
AC1 4 CYS D 51  ? LEU D 53  ? CYS C 75  LEU C 77  
AC2 1 LEU D 46  ? PRO D 48  ? LEU C 70  PRO C 72  
AC2 2 VAL D 35  ? ARG D 40  ? VAL C 59  ARG C 64  
AC2 3 VAL D 84  ? PRO D 91  ? VAL C 108 PRO C 115 
AC2 4 GLU H 89  ? LYS H 93  ? GLU D 329 LYS D 333 
AC3 1 THR D 97  ? THR D 102 ? THR C 121 THR C 126 
AC3 2 GLN H 78  ? PRO H 85  ? GLN D 318 PRO D 325 
AC3 3 PHE H 34  ? LYS H 39  ? PHE D 274 LYS D 279 
AC3 4 GLU H 47  ? GLU H 48  ? GLU D 287 GLU D 288 
AC4 1 ARG D 113 ? SER D 118 ? ARG C 137 SER C 142 
AC4 2 PHE D 124 ? SER D 129 ? PHE C 148 SER C 153 
AC4 3 GLN D 170 ? LEU D 173 ? GLN C 194 LEU C 197 
AC5 1 ALA D 162 ? SER D 166 ? ALA C 186 SER C 190 
AC5 2 LEU D 145 ? ARG D 153 ? LEU C 169 ARG C 177 
AC5 3 THR D 183 ? LEU D 192 ? THR C 207 LEU C 216 
AC5 4 VAL D 209 ? ASP D 212 ? VAL C 233 ASP C 236 
AC6 1 GLN G 6   ? PHE G 12  ? GLN B 246 PHE B 252 
AC6 2 VAL G 17  ? ARG G 25  ? VAL B 257 ARG B 265 
AC6 3 HIS G 61  ? PRO G 69  ? HIS B 301 PRO B 309 
AC6 4 ARG G 54  ? GLU G 55  ? ARG B 294 GLU B 295 
AC7 1 SER G 104 ? ASP G 110 ? SER B 344 ASP B 350 
AC7 2 SER G 113 ? GLU G 119 ? SER B 353 GLU B 359 
AC7 3 SER G 156 ? ALA G 158 ? SER B 396 ALA B 398 
AC8 1 LYS G 147 ? GLN G 152 ? LYS B 387 GLN B 392 
AC8 2 HIS G 130 ? LYS G 138 ? HIS B 370 LYS B 378 
AC8 3 ARG G 167 ? THR G 176 ? ARG B 407 THR B 416 
AC8 4 ARG G 192 ? ASP G 195 ? ARG B 432 ASP B 435 
AC9 1 GLN H 6   ? PHE H 12  ? GLN D 246 PHE D 252 
AC9 2 VAL H 17  ? ARG H 25  ? VAL D 257 ARG D 265 
AC9 3 HIS H 61  ? PRO H 69  ? HIS D 301 PRO D 309 
AC9 4 VAL H 52  ? LEU H 57  ? VAL D 292 LEU D 297 
AD1 1 SER H 104 ? ASP H 110 ? SER D 344 ASP D 350 
AD1 2 SER H 113 ? GLU H 119 ? SER D 353 GLU D 359 
AD1 3 SER H 156 ? ALA H 158 ? SER D 396 ALA D 398 
AD2 1 LYS H 147 ? GLN H 152 ? LYS D 387 GLN D 392 
AD2 2 HIS H 130 ? LYS H 138 ? HIS D 370 LYS D 378 
AD2 3 ARG H 167 ? THR H 176 ? ARG D 407 THR D 416 
AD2 4 ARG H 192 ? ASP H 195 ? ARG D 432 ASP D 435 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LYS A 14  ? N LYS F 33  O GLN A 19  ? O GLN F 38  
AA1 2 3 N LEU A 20  ? N LEU F 39  O CYS A 49  ? O CYS F 68  
AA2 1 2 N GLU A 32  ? N GLU F 51  O ARG A 65  ? O ARG F 84  
AA2 2 3 N VAL A 64  ? N VAL F 83  O THR A 73  ? O THR F 92  
AA3 1 2 N GLU A 89  ? N GLU F 108 O ALA A 106 ? O ALA F 125 
AA3 2 3 N TRP A 105 ? N TRP F 124 O ILE A 144 ? O ILE F 163 
AA3 3 4 O ILE A 144 ? O ILE F 163 N LYS A 136 ? N LYS F 155 
AA4 1 2 O TYR A 130 ? O TYR F 149 N LEU A 121 ? N LEU F 140 
AA4 2 3 N TYR A 120 ? N TYR F 139 O LEU A 164 ? O LEU F 183 
AA4 3 4 N ILE A 163 ? N ILE F 182 O LYS A 179 ? O LYS F 198 
AA5 1 2 N THR A 195 ? N THR F 214 O HIS A 206 ? O HIS F 225 
AA5 2 3 N MET A 205 ? N MET F 224 O PHE A 241 ? O PHE F 260 
AA6 1 2 O ILE A 231 ? O ILE F 250 N ILE A 223 ? N ILE F 242 
AA6 2 3 N GLN A 222 ? N GLN F 241 O GLN A 252 ? O GLN F 271 
AA6 3 4 N VAL A 251 ? N VAL F 270 O GLN A 270 ? O GLN F 289 
AA7 1 2 N LYS B 14  ? N LYS M 33  O GLN B 19  ? O GLN M 38  
AA7 2 3 N LEU B 20  ? N LEU M 39  O CYS B 49  ? O CYS M 68  
AA8 1 2 O TYR B 39  ? O TYR M 58  N LYS B 35  ? N LYS M 54  
AA8 2 3 N VAL B 34  ? N VAL M 53  O THR B 63  ? O THR M 82  
AA8 3 4 N TYR B 62  ? N TYR M 81  O ILE B 75  ? O ILE M 94  
AA9 1 2 N HIS B 96  ? N HIS M 115 O PHE B 100 ? O PHE M 119 
AA9 2 3 N LEU B 101 ? N LEU M 120 O PHE B 148 ? O PHE M 167 
AA9 3 4 O ILE B 144 ? O ILE M 163 N LYS B 136 ? N LYS M 155 
AB1 1 2 O TYR B 130 ? O TYR M 149 N LEU B 121 ? N LEU M 140 
AB1 2 3 N TYR B 120 ? N TYR M 139 O LEU B 164 ? O LEU M 183 
AB1 3 4 N ILE B 163 ? N ILE M 182 O LYS B 179 ? O LYS M 198 
AB2 1 2 N THR B 195 ? N THR M 214 O HIS B 206 ? O HIS M 225 
AB2 2 3 N MET B 205 ? N MET M 224 O PHE B 241 ? O PHE M 260 
AB3 1 2 O ILE B 231 ? O ILE M 250 N ILE B 223 ? N ILE M 242 
AB3 2 3 N GLN B 222 ? N GLN M 241 O GLN B 252 ? O GLN M 271 
AB3 3 4 N VAL B 251 ? N VAL M 270 O GLN B 270 ? O GLN M 289 
AB4 1 2 N TYR C 12  ? N TYR A 36  O THR C 20  ? O THR A 44  
AB4 2 3 N ILE C 19  ? N ILE A 43  O ILE C 74  ? O ILE A 98  
AB4 3 4 O VAL C 68  ? O VAL A 92  N ASP C 25  ? N ASP A 49  
AB5 1 2 N TYR C 12  ? N TYR A 36  O THR C 20  ? O THR A 44  
AB5 2 3 N ILE C 19  ? N ILE A 43  O ILE C 74  ? O ILE A 98  
AB5 3 4 O ARG C 71  ? O ARG A 95  N ASP C 52  ? N ASP A 76  
AB6 1 2 O GLU C 47  ? O GLU A 71  N ARG C 39  ? N ARG A 63  
AB6 2 3 N ILE C 38  ? N ILE A 62  O SER C 88  ? O SER A 112 
AB6 3 4 N ASP C 85  ? N ASP A 109 O ILE G 92  ? O ILE B 332 
AB7 1 2 N VAL C 101 ? N VAL A 125 O TYR G 79  ? O TYR B 319 
AB7 2 3 O SER G 82  ? O SER B 322 N PHE G 37  ? N PHE B 277 
AB7 3 4 N TYR G 38  ? N TYR B 278 O GLU G 47  ? O GLU B 287 
AB8 1 2 N ARG C 113 ? N ARG A 137 O SER C 129 ? O SER A 153 
AB8 2 3 N PHE C 124 ? N PHE A 148 O LEU C 173 ? O LEU A 197 
AB9 1 2 O LEU C 164 ? O LEU A 188 N VAL C 149 ? N VAL A 173 
AB9 2 3 N LYS C 152 ? N LYS A 176 O VAL C 185 ? O VAL A 209 
AB9 3 4 N TYR C 184 ? N TYR A 208 O TRP C 211 ? O TRP A 235 
AC1 1 2 N TYR D 12  ? N TYR C 36  O THR D 20  ? O THR C 44  
AC1 2 3 N ILE D 19  ? N ILE C 43  O ILE D 74  ? O ILE C 98  
AC1 3 4 O ARG D 71  ? O ARG C 95  N ASP D 52  ? N ASP C 76  
AC2 1 2 O GLU D 47  ? O GLU C 71  N ARG D 39  ? N ARG C 63  
AC2 2 3 N ILE D 38  ? N ILE C 62  O SER D 88  ? O SER C 112 
AC2 3 4 N PHE D 87  ? N PHE C 111 O LYS H 90  ? O LYS D 330 
AC3 1 2 N LEU D 99  ? N LEU C 123 O VAL H 81  ? O VAL D 321 
AC3 2 3 O SER H 82  ? O SER D 322 N PHE H 37  ? N PHE D 277 
AC3 3 4 N TYR H 38  ? N TYR D 278 O GLU H 47  ? O GLU D 287 
AC4 1 2 N ARG D 113 ? N ARG C 137 O SER D 129 ? O SER C 153 
AC4 2 3 N PHE D 124 ? N PHE C 148 O LEU D 173 ? O LEU C 197 
AC5 1 2 O ALA D 162 ? O ALA C 186 N TYR D 151 ? N TYR C 175 
AC5 2 3 N LYS D 152 ? N LYS C 176 O VAL D 185 ? O VAL C 209 
AC5 3 4 N TYR D 184 ? N TYR C 208 O TRP D 211 ? O TRP C 235 
AC6 1 2 N GLU G 9   ? N GLU B 249 O SER G 21  ? O SER B 261 
AC6 2 3 N LEU G 18  ? N LEU B 258 O ILE G 68  ? O ILE B 308 
AC6 3 4 O ARG G 63  ? O ARG B 303 N GLU G 55  ? N GLU B 295 
AC7 1 2 N GLN G 106 ? N GLN B 346 O ARG G 117 ? O ARG B 357 
AC7 2 3 N LEU G 116 ? N LEU B 356 O MET G 157 ? O MET B 397 
AC8 1 2 O GLU G 149 ? O GLU B 389 N ILE G 134 ? N ILE B 374 
AC8 2 3 N GLN G 135 ? N GLN B 375 O ARG G 171 ? O ARG B 411 
AC8 3 4 N TYR G 168 ? N TYR B 408 O TRP G 194 ? O TRP B 434 
AC9 1 2 N GLU H 9   ? N GLU D 249 O SER H 21  ? O SER D 261 
AC9 2 3 N LEU H 18  ? N LEU D 258 O ILE H 68  ? O ILE D 308 
AC9 3 4 O HIS H 65  ? O HIS D 305 N LEU H 53  ? N LEU D 293 
AD1 1 2 N SER H 104 ? N SER D 344 O GLU H 119 ? O GLU D 359 
AD1 2 3 N LEU H 116 ? N LEU D 356 O MET H 157 ? O MET D 397 
AD2 1 2 O LEU H 151 ? O LEU D 391 N PHE H 132 ? N PHE D 372 
AD2 2 3 N THR H 131 ? N THR D 371 O ARG H 175 ? O ARG D 415 
AD2 3 4 N TYR H 168 ? N TYR D 408 O TRP H 194 ? O TRP D 434 
# 
_atom_sites.entry_id                    6NMY 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.008957 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006359 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005942 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . PRO A 1 7   ? 39.763  23.855  -19.916 1.00 133.13 ? 26  PRO F N   1 
ATOM   2     C CA  . PRO A 1 7   ? 38.472  24.188  -19.302 1.00 131.91 ? 26  PRO F CA  1 
ATOM   3     C C   . PRO A 1 7   ? 37.432  23.083  -19.465 1.00 133.72 ? 26  PRO F C   1 
ATOM   4     O O   . PRO A 1 7   ? 37.403  22.412  -20.498 1.00 138.63 ? 26  PRO F O   1 
ATOM   5     C CB  . PRO A 1 7   ? 38.038  25.453  -20.054 1.00 131.96 ? 26  PRO F CB  1 
ATOM   6     C CG  . PRO A 1 7   ? 38.849  25.459  -21.313 1.00 129.77 ? 26  PRO F CG  1 
ATOM   7     C CD  . PRO A 1 7   ? 40.152  24.832  -20.946 1.00 129.31 ? 26  PRO F CD  1 
ATOM   8     N N   . ILE A 1 8   ? 36.592  22.906  -18.447 1.00 133.80 ? 27  ILE F N   1 
ATOM   9     C CA  . ILE A 1 8   ? 35.518  21.909  -18.452 1.00 127.89 ? 27  ILE F CA  1 
ATOM   10    C C   . ILE A 1 8   ? 34.277  22.639  -17.943 1.00 127.23 ? 27  ILE F C   1 
ATOM   11    O O   . ILE A 1 8   ? 33.989  22.644  -16.741 1.00 121.75 ? 27  ILE F O   1 
ATOM   12    C CB  . ILE A 1 8   ? 35.842  20.687  -17.586 1.00 118.42 ? 27  ILE F CB  1 
ATOM   13    C CG1 . ILE A 1 8   ? 37.165  20.043  -18.017 1.00 113.76 ? 27  ILE F CG1 1 
ATOM   14    C CG2 . ILE A 1 8   ? 34.715  19.673  -17.650 1.00 114.91 ? 27  ILE F CG2 1 
ATOM   15    C CD1 . ILE A 1 8   ? 38.368  20.500  -17.213 1.00 112.09 ? 27  ILE F CD1 1 
ATOM   16    N N   . THR A 1 9   ? 33.527  23.255  -18.860 1.00 130.62 ? 28  THR F N   1 
ATOM   17    C CA  . THR A 1 9   ? 32.605  24.322  -18.479 1.00 128.50 ? 28  THR F CA  1 
ATOM   18    C C   . THR A 1 9   ? 31.201  24.171  -19.056 1.00 126.65 ? 28  THR F C   1 
ATOM   19    O O   . THR A 1 9   ? 30.802  23.085  -19.493 1.00 118.64 ? 28  THR F O   1 
ATOM   20    C CB  . THR A 1 9   ? 33.183  25.679  -18.907 1.00 130.93 ? 28  THR F CB  1 
ATOM   21    O OG1 . THR A 1 9   ? 32.237  26.720  -18.627 1.00 135.46 ? 28  THR F OG1 1 
ATOM   22    C CG2 . THR A 1 9   ? 33.508  25.686  -20.400 1.00 129.41 ? 28  THR F CG2 1 
ATOM   23    N N   . ASN A 1 10  ? 30.450  25.277  -19.019 1.00 128.91 ? 29  ASN F N   1 
ATOM   24    C CA  . ASN A 1 10  ? 29.089  25.394  -19.531 1.00 129.82 ? 29  ASN F CA  1 
ATOM   25    C C   . ASN A 1 10  ? 28.119  24.527  -18.739 1.00 125.33 ? 29  ASN F C   1 
ATOM   26    O O   . ASN A 1 10  ? 27.666  23.488  -19.229 1.00 125.04 ? 29  ASN F O   1 
ATOM   27    C CB  . ASN A 1 10  ? 29.044  25.043  -21.020 1.00 131.74 ? 29  ASN F CB  1 
ATOM   28    C CG  . ASN A 1 10  ? 29.412  26.222  -21.903 1.00 133.45 ? 29  ASN F CG  1 
ATOM   29    O OD1 . ASN A 1 10  ? 30.582  26.593  -22.003 1.00 129.43 ? 29  ASN F OD1 1 
ATOM   30    N ND2 . ASN A 1 10  ? 28.415  26.810  -22.555 1.00 135.57 ? 29  ASN F ND2 1 
ATOM   31    N N   . LEU A 1 11  ? 27.784  24.952  -17.521 1.00 109.90 ? 30  LEU F N   1 
ATOM   32    C CA  . LEU A 1 11  ? 26.880  24.210  -16.657 1.00 107.25 ? 30  LEU F CA  1 
ATOM   33    C C   . LEU A 1 11  ? 25.654  25.056  -16.337 1.00 104.75 ? 30  LEU F C   1 
ATOM   34    O O   . LEU A 1 11  ? 25.734  26.284  -16.226 1.00 101.78 ? 30  LEU F O   1 
ATOM   35    C CB  . LEU A 1 11  ? 27.577  23.777  -15.357 1.00 105.57 ? 30  LEU F CB  1 
ATOM   36    C CG  . LEU A 1 11  ? 27.950  24.806  -14.290 1.00 104.54 ? 30  LEU F CG  1 
ATOM   37    C CD1 . LEU A 1 11  ? 26.871  24.877  -13.231 1.00 103.31 ? 30  LEU F CD1 1 
ATOM   38    C CD2 . LEU A 1 11  ? 29.286  24.460  -13.661 1.00 104.10 ? 30  LEU F CD2 1 
ATOM   39    N N   . ARG A 1 12  ? 24.517  24.381  -16.185 1.00 101.08 ? 31  ARG F N   1 
ATOM   40    C CA  . ARG A 1 12  ? 23.266  25.040  -15.851 1.00 100.41 ? 31  ARG F CA  1 
ATOM   41    C C   . ARG A 1 12  ? 22.437  24.102  -14.980 1.00 97.75  ? 31  ARG F C   1 
ATOM   42    O O   . ARG A 1 12  ? 22.867  22.998  -14.623 1.00 91.97  ? 31  ARG F O   1 
ATOM   43    C CB  . ARG A 1 12  ? 22.503  25.446  -17.116 1.00 103.64 ? 31  ARG F CB  1 
ATOM   44    C CG  . ARG A 1 12  ? 21.979  24.267  -17.918 1.00 105.40 ? 31  ARG F CG  1 
ATOM   45    C CD  . ARG A 1 12  ? 22.169  24.466  -19.411 1.00 105.77 ? 31  ARG F CD  1 
ATOM   46    N NE  . ARG A 1 12  ? 22.151  23.194  -20.128 1.00 106.75 ? 31  ARG F NE  1 
ATOM   47    C CZ  . ARG A 1 12  ? 23.206  22.394  -20.256 1.00 104.29 ? 31  ARG F CZ  1 
ATOM   48    N NH1 . ARG A 1 12  ? 24.367  22.729  -19.710 1.00 101.05 ? 31  ARG F NH1 1 
ATOM   49    N NH2 . ARG A 1 12  ? 23.100  21.254  -20.925 1.00 98.35  ? 31  ARG F NH2 1 
ATOM   50    N N   . MET A 1 13  ? 21.234  24.559  -14.643 1.00 84.99  ? 32  MET F N   1 
ATOM   51    C CA  . MET A 1 13  ? 20.310  23.837  -13.775 1.00 83.34  ? 32  MET F CA  1 
ATOM   52    C C   . MET A 1 13  ? 19.011  23.601  -14.534 1.00 83.25  ? 32  MET F C   1 
ATOM   53    O O   . MET A 1 13  ? 18.236  24.539  -14.757 1.00 87.36  ? 32  MET F O   1 
ATOM   54    C CB  . MET A 1 13  ? 20.053  24.617  -12.486 1.00 83.80  ? 32  MET F CB  1 
ATOM   55    C CG  . MET A 1 13  ? 18.959  24.034  -11.605 1.00 82.63  ? 32  MET F CG  1 
ATOM   56    S SD  . MET A 1 13  ? 19.411  22.461  -10.849 1.00 80.18  ? 32  MET F SD  1 
ATOM   57    C CE  . MET A 1 13  ? 20.502  23.014  -9.548  1.00 81.32  ? 32  MET F CE  1 
ATOM   58    N N   . LYS A 1 14  ? 18.779  22.357  -14.943 1.00 84.83  ? 33  LYS F N   1 
ATOM   59    C CA  . LYS A 1 14  ? 17.483  21.945  -15.468 1.00 88.13  ? 33  LYS F CA  1 
ATOM   60    C C   . LYS A 1 14  ? 16.526  21.837  -14.288 1.00 85.11  ? 33  LYS F C   1 
ATOM   61    O O   . LYS A 1 14  ? 16.593  20.891  -13.497 1.00 81.72  ? 33  LYS F O   1 
ATOM   62    C CB  . LYS A 1 14  ? 17.622  20.631  -16.226 1.00 92.97  ? 33  LYS F CB  1 
ATOM   63    C CG  . LYS A 1 14  ? 18.610  20.733  -17.379 1.00 97.28  ? 33  LYS F CG  1 
ATOM   64    C CD  . LYS A 1 14  ? 18.662  19.471  -18.219 1.00 104.19 ? 33  LYS F CD  1 
ATOM   65    C CE  . LYS A 1 14  ? 19.438  19.718  -19.508 1.00 110.10 ? 33  LYS F CE  1 
ATOM   66    N NZ  . LYS A 1 14  ? 19.629  18.480  -20.314 1.00 112.45 ? 33  LYS F NZ  1 
ATOM   67    N N   . ALA A 1 15  ? 15.632  22.823  -14.168 1.00 78.71  ? 34  ALA F N   1 
ATOM   68    C CA  . ALA A 1 15  ? 14.926  23.071  -12.915 1.00 78.40  ? 34  ALA F CA  1 
ATOM   69    C C   . ALA A 1 15  ? 13.799  22.077  -12.669 1.00 81.83  ? 34  ALA F C   1 
ATOM   70    O O   . ALA A 1 15  ? 13.567  21.679  -11.522 1.00 86.20  ? 34  ALA F O   1 
ATOM   71    C CB  . ALA A 1 15  ? 14.380  24.498  -12.900 1.00 77.74  ? 34  ALA F CB  1 
ATOM   72    N N   . LYS A 1 16  ? 13.070  21.681  -13.712 1.00 83.81  ? 35  LYS F N   1 
ATOM   73    C CA  . LYS A 1 16  ? 11.952  20.769  -13.497 1.00 86.19  ? 35  LYS F CA  1 
ATOM   74    C C   . LYS A 1 16  ? 12.455  19.376  -13.141 1.00 84.92  ? 35  LYS F C   1 
ATOM   75    O O   . LYS A 1 16  ? 12.028  18.786  -12.142 1.00 83.16  ? 35  LYS F O   1 
ATOM   76    C CB  . LYS A 1 16  ? 11.051  20.722  -14.732 1.00 93.02  ? 35  LYS F CB  1 
ATOM   77    C CG  . LYS A 1 16  ? 9.566   20.682  -14.390 1.00 96.37  ? 35  LYS F CG  1 
ATOM   78    C CD  . LYS A 1 16  ? 8.739   19.972  -15.448 1.00 97.26  ? 35  LYS F CD  1 
ATOM   79    C CE  . LYS A 1 16  ? 8.935   18.467  -15.370 1.00 99.21  ? 35  LYS F CE  1 
ATOM   80    N NZ  . LYS A 1 16  ? 8.363   17.768  -16.553 1.00 102.11 ? 35  LYS F NZ  1 
ATOM   81    N N   . ALA A 1 17  ? 13.376  18.838  -13.944 1.00 84.42  ? 36  ALA F N   1 
ATOM   82    C CA  . ALA A 1 17  ? 13.976  17.547  -13.639 1.00 85.17  ? 36  ALA F CA  1 
ATOM   83    C C   . ALA A 1 17  ? 14.957  17.621  -12.481 1.00 82.37  ? 36  ALA F C   1 
ATOM   84    O O   . ALA A 1 17  ? 15.440  16.572  -12.039 1.00 80.26  ? 36  ALA F O   1 
ATOM   85    C CB  . ALA A 1 17  ? 14.681  16.983  -14.872 1.00 88.94  ? 36  ALA F CB  1 
ATOM   86    N N   . GLN A 1 18  ? 15.256  18.823  -11.992 1.00 78.48  ? 37  GLN F N   1 
ATOM   87    C CA  . GLN A 1 18  ? 16.151  19.041  -10.858 1.00 75.20  ? 37  GLN F CA  1 
ATOM   88    C C   . GLN A 1 18  ? 17.496  18.355  -11.092 1.00 74.43  ? 37  GLN F C   1 
ATOM   89    O O   . GLN A 1 18  ? 17.936  17.487  -10.337 1.00 74.59  ? 37  GLN F O   1 
ATOM   90    C CB  . GLN A 1 18  ? 15.491  18.581  -9.555  1.00 73.79  ? 37  GLN F CB  1 
ATOM   91    C CG  . GLN A 1 18  ? 14.251  19.395  -9.199  1.00 75.83  ? 37  GLN F CG  1 
ATOM   92    C CD  . GLN A 1 18  ? 13.565  18.926  -7.931  1.00 78.04  ? 37  GLN F CD  1 
ATOM   93    O OE1 . GLN A 1 18  ? 13.721  17.779  -7.513  1.00 75.83  ? 37  GLN F OE1 1 
ATOM   94    N NE2 . GLN A 1 18  ? 12.793  19.815  -7.312  1.00 77.10  ? 37  GLN F NE2 1 
ATOM   95    N N   . GLN A 1 19  ? 18.147  18.765  -12.178 1.00 80.32  ? 38  GLN F N   1 
ATOM   96    C CA  . GLN A 1 19  ? 19.432  18.204  -12.571 1.00 83.62  ? 38  GLN F CA  1 
ATOM   97    C C   . GLN A 1 19  ? 20.417  19.336  -12.806 1.00 82.43  ? 38  GLN F C   1 
ATOM   98    O O   . GLN A 1 19  ? 20.154  20.231  -13.612 1.00 86.86  ? 38  GLN F O   1 
ATOM   99    C CB  . GLN A 1 19  ? 19.314  17.360  -13.845 1.00 91.82  ? 38  GLN F CB  1 
ATOM   100   C CG  . GLN A 1 19  ? 18.387  16.169  -13.747 1.00 95.96  ? 38  GLN F CG  1 
ATOM   101   C CD  . GLN A 1 19  ? 18.157  15.507  -15.092 1.00 100.08 ? 38  GLN F CD  1 
ATOM   102   O OE1 . GLN A 1 19  ? 17.709  16.143  -16.049 1.00 105.55 ? 38  GLN F OE1 1 
ATOM   103   N NE2 . GLN A 1 19  ? 18.462  14.219  -15.171 1.00 106.33 ? 38  GLN F NE2 1 
ATOM   104   N N   . LEU A 1 20  ? 21.552  19.292  -12.120 1.00 85.30  ? 39  LEU F N   1 
ATOM   105   C CA  . LEU A 1 20  ? 22.636  20.233  -12.382 1.00 86.84  ? 39  LEU F CA  1 
ATOM   106   C C   . LEU A 1 20  ? 23.570  19.593  -13.402 1.00 90.61  ? 39  LEU F C   1 
ATOM   107   O O   . LEU A 1 20  ? 24.261  18.619  -13.090 1.00 91.63  ? 39  LEU F O   1 
ATOM   108   C CB  . LEU A 1 20  ? 23.370  20.594  -11.094 1.00 89.07  ? 39  LEU F CB  1 
ATOM   109   C CG  . LEU A 1 20  ? 24.449  21.672  -11.204 1.00 90.72  ? 39  LEU F CG  1 
ATOM   110   C CD1 . LEU A 1 20  ? 23.854  23.045  -10.963 1.00 93.23  ? 39  LEU F CD1 1 
ATOM   111   C CD2 . LEU A 1 20  ? 25.569  21.392  -10.217 1.00 91.43  ? 39  LEU F CD2 1 
ATOM   112   N N   . THR A 1 21  ? 23.582  20.123  -14.623 1.00 98.79  ? 40  THR F N   1 
ATOM   113   C CA  . THR A 1 21  ? 24.313  19.492  -15.711 1.00 98.89  ? 40  THR F CA  1 
ATOM   114   C C   . THR A 1 21  ? 25.390  20.424  -16.249 1.00 99.28  ? 40  THR F C   1 
ATOM   115   O O   . THR A 1 21  ? 25.371  21.634  -16.013 1.00 101.43 ? 40  THR F O   1 
ATOM   116   C CB  . THR A 1 21  ? 23.374  19.074  -16.850 1.00 99.86  ? 40  THR F CB  1 
ATOM   117   O OG1 . THR A 1 21  ? 24.134  18.445  -17.891 1.00 102.52 ? 40  THR F OG1 1 
ATOM   118   C CG2 . THR A 1 21  ? 22.644  20.283  -17.412 1.00 98.25  ? 40  THR F CG2 1 
ATOM   119   N N   . TRP A 1 22  ? 26.333  19.839  -16.982 1.00 104.62 ? 41  TRP F N   1 
ATOM   120   C CA  . TRP A 1 22  ? 27.467  20.579  -17.520 1.00 106.92 ? 41  TRP F CA  1 
ATOM   121   C C   . TRP A 1 22  ? 27.929  19.897  -18.801 1.00 110.09 ? 41  TRP F C   1 
ATOM   122   O O   . TRP A 1 22  ? 27.310  18.939  -19.274 1.00 110.41 ? 41  TRP F O   1 
ATOM   123   C CB  . TRP A 1 22  ? 28.596  20.663  -16.487 1.00 106.61 ? 41  TRP F CB  1 
ATOM   124   C CG  . TRP A 1 22  ? 29.078  19.328  -16.032 1.00 105.69 ? 41  TRP F CG  1 
ATOM   125   C CD1 . TRP A 1 22  ? 29.977  18.519  -16.665 1.00 105.28 ? 41  TRP F CD1 1 
ATOM   126   C CD2 . TRP A 1 22  ? 28.684  18.637  -14.843 1.00 104.04 ? 41  TRP F CD2 1 
ATOM   127   N NE1 . TRP A 1 22  ? 30.168  17.367  -15.942 1.00 104.54 ? 41  TRP F NE1 1 
ATOM   128   C CE2 . TRP A 1 22  ? 29.386  17.415  -14.818 1.00 103.13 ? 41  TRP F CE2 1 
ATOM   129   C CE3 . TRP A 1 22  ? 27.808  18.933  -13.795 1.00 102.34 ? 41  TRP F CE3 1 
ATOM   130   C CZ2 . TRP A 1 22  ? 29.238  16.492  -13.787 1.00 101.55 ? 41  TRP F CZ2 1 
ATOM   131   C CZ3 . TRP A 1 22  ? 27.662  18.016  -12.774 1.00 101.51 ? 41  TRP F CZ3 1 
ATOM   132   C CH2 . TRP A 1 22  ? 28.373  16.810  -12.777 1.00 104.91 ? 41  TRP F CH2 1 
ATOM   133   N N   . ASP A 1 23  ? 29.029  20.397  -19.361 1.00 124.50 ? 42  ASP F N   1 
ATOM   134   C CA  . ASP A 1 23  ? 29.664  19.816  -20.537 1.00 122.99 ? 42  ASP F CA  1 
ATOM   135   C C   . ASP A 1 23  ? 31.132  19.559  -20.227 1.00 120.47 ? 42  ASP F C   1 
ATOM   136   O O   . ASP A 1 23  ? 31.838  20.461  -19.761 1.00 115.13 ? 42  ASP F O   1 
ATOM   137   C CB  . ASP A 1 23  ? 29.536  20.738  -21.758 1.00 123.77 ? 42  ASP F CB  1 
ATOM   138   C CG  . ASP A 1 23  ? 28.092  21.097  -22.077 1.00 121.79 ? 42  ASP F CG  1 
ATOM   139   O OD1 . ASP A 1 23  ? 27.183  20.323  -21.713 1.00 120.10 ? 42  ASP F OD1 1 
ATOM   140   O OD2 . ASP A 1 23  ? 27.868  22.166  -22.685 1.00 119.73 ? 42  ASP F OD2 1 
ATOM   141   N N   . LEU A 1 24  ? 31.587  18.338  -20.482 1.00 122.40 ? 43  LEU F N   1 
ATOM   142   C CA  . LEU A 1 24  ? 32.987  18.000  -20.280 1.00 127.01 ? 43  LEU F CA  1 
ATOM   143   C C   . LEU A 1 24  ? 33.776  18.166  -21.577 1.00 132.77 ? 43  LEU F C   1 
ATOM   144   O O   . LEU A 1 24  ? 33.218  18.193  -22.676 1.00 135.16 ? 43  LEU F O   1 
ATOM   145   C CB  . LEU A 1 24  ? 33.133  16.573  -19.742 1.00 126.81 ? 43  LEU F CB  1 
ATOM   146   C CG  . LEU A 1 24  ? 32.250  15.454  -20.299 1.00 128.57 ? 43  LEU F CG  1 
ATOM   147   C CD1 . LEU A 1 24  ? 32.661  15.051  -21.711 1.00 130.64 ? 43  LEU F CD1 1 
ATOM   148   C CD2 . LEU A 1 24  ? 32.292  14.256  -19.364 1.00 122.79 ? 43  LEU F CD2 1 
ATOM   149   N N   . ASN A 1 25  ? 35.097  18.283  -21.430 1.00 140.03 ? 44  ASN F N   1 
ATOM   150   C CA  . ASN A 1 25  ? 35.987  18.450  -22.571 1.00 139.57 ? 44  ASN F CA  1 
ATOM   151   C C   . ASN A 1 25  ? 37.158  17.477  -22.584 1.00 139.90 ? 44  ASN F C   1 
ATOM   152   O O   . ASN A 1 25  ? 37.872  17.418  -23.590 1.00 143.17 ? 44  ASN F O   1 
ATOM   153   C CB  . ASN A 1 25  ? 36.529  19.888  -22.621 1.00 139.49 ? 44  ASN F CB  1 
ATOM   154   C CG  . ASN A 1 25  ? 35.463  20.899  -23.010 1.00 139.46 ? 44  ASN F CG  1 
ATOM   155   O OD1 . ASN A 1 25  ? 34.468  20.555  -23.648 1.00 135.41 ? 44  ASN F OD1 1 
ATOM   156   N ND2 . ASN A 1 25  ? 35.667  22.154  -22.624 1.00 140.80 ? 44  ASN F ND2 1 
ATOM   157   N N   . ARG A 1 26  ? 37.379  16.722  -21.510 1.00 148.56 ? 45  ARG F N   1 
ATOM   158   C CA  . ARG A 1 26  ? 38.414  15.701  -21.455 1.00 147.19 ? 45  ARG F CA  1 
ATOM   159   C C   . ARG A 1 26  ? 37.884  14.519  -20.659 1.00 145.10 ? 45  ARG F C   1 
ATOM   160   O O   . ARG A 1 26  ? 36.813  14.584  -20.049 1.00 137.55 ? 45  ARG F O   1 
ATOM   161   C CB  . ARG A 1 26  ? 39.705  16.226  -20.810 1.00 146.70 ? 45  ARG F CB  1 
ATOM   162   C CG  . ARG A 1 26  ? 40.392  17.356  -21.556 1.00 146.68 ? 45  ARG F CG  1 
ATOM   163   C CD  . ARG A 1 26  ? 41.682  17.749  -20.854 1.00 146.10 ? 45  ARG F CD  1 
ATOM   164   N NE  . ARG A 1 26  ? 42.217  19.016  -21.343 1.00 147.75 ? 45  ARG F NE  1 
ATOM   165   C CZ  . ARG A 1 26  ? 43.310  19.600  -20.863 1.00 142.85 ? 45  ARG F CZ  1 
ATOM   166   N NH1 . ARG A 1 26  ? 43.985  19.034  -19.871 1.00 131.04 ? 45  ARG F NH1 1 
ATOM   167   N NH2 . ARG A 1 26  ? 43.726  20.753  -21.368 1.00 141.97 ? 45  ARG F NH2 1 
ATOM   168   N N   . ASN A 1 27  ? 38.645  13.427  -20.662 1.00 139.37 ? 46  ASN F N   1 
ATOM   169   C CA  . ASN A 1 27  ? 38.353  12.349  -19.731 1.00 140.04 ? 46  ASN F CA  1 
ATOM   170   C C   . ASN A 1 27  ? 38.654  12.817  -18.310 1.00 139.68 ? 46  ASN F C   1 
ATOM   171   O O   . ASN A 1 27  ? 39.637  13.523  -18.062 1.00 140.94 ? 46  ASN F O   1 
ATOM   172   C CB  . ASN A 1 27  ? 39.140  11.080  -20.096 1.00 140.77 ? 46  ASN F CB  1 
ATOM   173   C CG  . ASN A 1 27  ? 40.492  10.986  -19.406 1.00 141.45 ? 46  ASN F CG  1 
ATOM   174   O OD1 . ASN A 1 27  ? 41.284  11.930  -19.418 1.00 138.54 ? 46  ASN F OD1 1 
ATOM   175   N ND2 . ASN A 1 27  ? 40.753  9.841   -18.781 1.00 141.20 ? 46  ASN F ND2 1 
ATOM   176   N N   . VAL A 1 28  ? 37.771  12.467  -17.380 1.00 137.16 ? 47  VAL F N   1 
ATOM   177   C CA  . VAL A 1 28  ? 37.837  12.990  -16.022 1.00 129.73 ? 47  VAL F CA  1 
ATOM   178   C C   . VAL A 1 28  ? 37.435  11.902  -15.039 1.00 126.51 ? 47  VAL F C   1 
ATOM   179   O O   . VAL A 1 28  ? 36.690  10.975  -15.373 1.00 121.82 ? 47  VAL F O   1 
ATOM   180   C CB  . VAL A 1 28  ? 36.939  14.234  -15.852 1.00 125.70 ? 47  VAL F CB  1 
ATOM   181   C CG1 . VAL A 1 28  ? 37.661  15.479  -16.345 1.00 125.37 ? 47  VAL F CG1 1 
ATOM   182   C CG2 . VAL A 1 28  ? 35.629  14.041  -16.598 1.00 122.74 ? 47  VAL F CG2 1 
ATOM   183   N N   . THR A 1 29  ? 37.936  12.024  -13.812 1.00 124.08 ? 48  THR F N   1 
ATOM   184   C CA  . THR A 1 29  ? 37.589  11.082  -12.755 1.00 125.82 ? 48  THR F CA  1 
ATOM   185   C C   . THR A 1 29  ? 36.356  11.555  -11.996 1.00 124.38 ? 48  THR F C   1 
ATOM   186   O O   . THR A 1 29  ? 35.416  12.085  -12.598 1.00 122.62 ? 48  THR F O   1 
ATOM   187   C CB  . THR A 1 29  ? 38.765  10.889  -11.797 1.00 125.89 ? 48  THR F CB  1 
ATOM   188   O OG1 . THR A 1 29  ? 39.021  12.113  -11.096 1.00 121.82 ? 48  THR F OG1 1 
ATOM   189   C CG2 . THR A 1 29  ? 40.013  10.471  -12.564 1.00 124.05 ? 48  THR F CG2 1 
ATOM   190   N N   . ASP A 1 30  ? 36.357  11.375  -10.676 1.00 121.11 ? 49  ASP F N   1 
ATOM   191   C CA  . ASP A 1 30  ? 35.182  11.676  -9.868  1.00 120.14 ? 49  ASP F CA  1 
ATOM   192   C C   . ASP A 1 30  ? 34.823  13.157  -9.934  1.00 115.56 ? 49  ASP F C   1 
ATOM   193   O O   . ASP A 1 30  ? 35.680  14.024  -10.124 1.00 112.06 ? 49  ASP F O   1 
ATOM   194   C CB  . ASP A 1 30  ? 35.427  11.271  -8.417  1.00 121.49 ? 49  ASP F CB  1 
ATOM   195   C CG  . ASP A 1 30  ? 36.502  12.108  -7.761  1.00 123.64 ? 49  ASP F CG  1 
ATOM   196   O OD1 . ASP A 1 30  ? 37.690  11.757  -7.914  1.00 120.84 ? 49  ASP F OD1 1 
ATOM   197   O OD2 . ASP A 1 30  ? 36.165  13.115  -7.100  1.00 126.96 ? 49  ASP F OD2 1 
ATOM   198   N N   . ILE A 1 31  ? 33.532  13.437  -9.773  1.00 106.85 ? 50  ILE F N   1 
ATOM   199   C CA  . ILE A 1 31  ? 33.001  14.796  -9.737  1.00 105.44 ? 50  ILE F CA  1 
ATOM   200   C C   . ILE A 1 31  ? 31.949  14.865  -8.640  1.00 107.48 ? 50  ILE F C   1 
ATOM   201   O O   . ILE A 1 31  ? 31.064  14.005  -8.571  1.00 107.70 ? 50  ILE F O   1 
ATOM   202   C CB  . ILE A 1 31  ? 32.388  15.220  -11.087 1.00 102.37 ? 50  ILE F CB  1 
ATOM   203   C CG1 . ILE A 1 31  ? 33.417  15.142  -12.215 1.00 97.75  ? 50  ILE F CG1 1 
ATOM   204   C CG2 . ILE A 1 31  ? 31.809  16.614  -10.993 1.00 104.05 ? 50  ILE F CG2 1 
ATOM   205   C CD1 . ILE A 1 31  ? 32.843  15.474  -13.570 1.00 96.78  ? 50  ILE F CD1 1 
ATOM   206   N N   . GLU A 1 32  ? 32.035  15.883  -7.784  1.00 99.39  ? 51  GLU F N   1 
ATOM   207   C CA  . GLU A 1 32  ? 31.050  16.073  -6.726  1.00 96.60  ? 51  GLU F CA  1 
ATOM   208   C C   . GLU A 1 32  ? 30.440  17.465  -6.812  1.00 94.15  ? 51  GLU F C   1 
ATOM   209   O O   . GLU A 1 32  ? 31.144  18.455  -7.040  1.00 99.79  ? 51  GLU F O   1 
ATOM   210   C CB  . GLU A 1 32  ? 31.656  15.838  -5.329  1.00 97.91  ? 51  GLU F CB  1 
ATOM   211   C CG  . GLU A 1 32  ? 32.691  16.855  -4.869  1.00 97.31  ? 51  GLU F CG  1 
ATOM   212   C CD  . GLU A 1 32  ? 33.139  16.616  -3.434  1.00 94.91  ? 51  GLU F CD  1 
ATOM   213   O OE1 . GLU A 1 32  ? 33.307  17.607  -2.690  1.00 90.20  ? 51  GLU F OE1 1 
ATOM   214   O OE2 . GLU A 1 32  ? 33.310  15.439  -3.048  1.00 97.14  ? 51  GLU F OE2 1 
ATOM   215   N N   . CYS A 1 33  ? 29.123  17.531  -6.638  1.00 84.43  ? 52  CYS F N   1 
ATOM   216   C CA  . CYS A 1 33  ? 28.390  18.789  -6.643  1.00 84.30  ? 52  CYS F CA  1 
ATOM   217   C C   . CYS A 1 33  ? 28.057  19.177  -5.210  1.00 83.95  ? 52  CYS F C   1 
ATOM   218   O O   . CYS A 1 33  ? 27.378  18.429  -4.499  1.00 83.80  ? 52  CYS F O   1 
ATOM   219   C CB  . CYS A 1 33  ? 27.113  18.686  -7.477  1.00 86.84  ? 52  CYS F CB  1 
ATOM   220   S SG  . CYS A 1 33  ? 27.316  17.870  -9.069  1.00 93.20  ? 52  CYS F SG  1 
ATOM   221   N N   . VAL A 1 34  ? 28.531  20.338  -4.794  1.00 76.89  ? 53  VAL F N   1 
ATOM   222   C CA  . VAL A 1 34  ? 28.258  20.874  -3.471  1.00 76.04  ? 53  VAL F CA  1 
ATOM   223   C C   . VAL A 1 34  ? 27.156  21.913  -3.589  1.00 75.36  ? 53  VAL F C   1 
ATOM   224   O O   . VAL A 1 34  ? 27.166  22.748  -4.504  1.00 74.73  ? 53  VAL F O   1 
ATOM   225   C CB  . VAL A 1 34  ? 29.527  21.479  -2.848  1.00 79.60  ? 53  VAL F CB  1 
ATOM   226   C CG1 . VAL A 1 34  ? 29.294  21.787  -1.380  1.00 81.78  ? 53  VAL F CG1 1 
ATOM   227   C CG2 . VAL A 1 34  ? 30.700  20.534  -3.030  1.00 82.49  ? 53  VAL F CG2 1 
ATOM   228   N N   . LYS A 1 35  ? 26.203  21.862  -2.663  1.00 70.69  ? 54  LYS F N   1 
ATOM   229   C CA  . LYS A 1 35  ? 25.049  22.754  -2.654  1.00 71.53  ? 54  LYS F CA  1 
ATOM   230   C C   . LYS A 1 35  ? 25.117  23.615  -1.398  1.00 72.67  ? 54  LYS F C   1 
ATOM   231   O O   . LYS A 1 35  ? 24.909  23.115  -0.287  1.00 72.06  ? 54  LYS F O   1 
ATOM   232   C CB  . LYS A 1 35  ? 23.749  21.953  -2.714  1.00 71.65  ? 54  LYS F CB  1 
ATOM   233   C CG  . LYS A 1 35  ? 22.484  22.787  -2.663  1.00 71.61  ? 54  LYS F CG  1 
ATOM   234   C CD  . LYS A 1 35  ? 21.250  21.900  -2.681  1.00 72.94  ? 54  LYS F CD  1 
ATOM   235   C CE  . LYS A 1 35  ? 19.997  22.688  -2.347  1.00 75.79  ? 54  LYS F CE  1 
ATOM   236   N NZ  . LYS A 1 35  ? 18.776  21.843  -2.401  1.00 78.53  ? 54  LYS F NZ  1 
ATOM   237   N N   . ASP A 1 36  ? 25.416  24.905  -1.581  1.00 80.25  ? 55  ASP F N   1 
ATOM   238   C CA  . ASP A 1 36  ? 25.533  25.879  -0.491  1.00 81.84  ? 55  ASP F CA  1 
ATOM   239   C C   . ASP A 1 36  ? 26.645  25.515  0.493   1.00 81.74  ? 55  ASP F C   1 
ATOM   240   O O   . ASP A 1 36  ? 26.528  25.766  1.695   1.00 80.18  ? 55  ASP F O   1 
ATOM   241   C CB  . ASP A 1 36  ? 24.206  26.064  0.250   1.00 84.42  ? 55  ASP F CB  1 
ATOM   242   C CG  . ASP A 1 36  ? 23.558  27.400  -0.050  1.00 87.97  ? 55  ASP F CG  1 
ATOM   243   O OD1 . ASP A 1 36  ? 24.051  28.108  -0.957  1.00 85.48  ? 55  ASP F OD1 1 
ATOM   244   O OD2 . ASP A 1 36  ? 22.564  27.745  0.624   1.00 89.95  ? 55  ASP F OD2 1 
ATOM   245   N N   . ALA A 1 37  ? 27.722  24.914  -0.016  1.00 82.74  ? 56  ALA F N   1 
ATOM   246   C CA  . ALA A 1 37  ? 28.960  24.694  0.734   1.00 82.69  ? 56  ALA F CA  1 
ATOM   247   C C   . ALA A 1 37  ? 28.748  23.921  2.038   1.00 80.93  ? 56  ALA F C   1 
ATOM   248   O O   . ALA A 1 37  ? 29.453  24.155  3.022   1.00 83.50  ? 56  ALA F O   1 
ATOM   249   C CB  . ALA A 1 37  ? 29.672  26.021  1.019   1.00 85.66  ? 56  ALA F CB  1 
ATOM   250   N N   . ASP A 1 38  ? 27.782  22.991  2.063   1.00 83.92  ? 57  ASP F N   1 
ATOM   251   C CA  . ASP A 1 38  ? 27.653  22.113  3.232   1.00 83.90  ? 57  ASP F CA  1 
ATOM   252   C C   . ASP A 1 38  ? 26.964  20.795  2.898   1.00 80.30  ? 57  ASP F C   1 
ATOM   253   O O   . ASP A 1 38  ? 26.526  20.099  3.820   1.00 80.78  ? 57  ASP F O   1 
ATOM   254   C CB  . ASP A 1 38  ? 26.922  22.833  4.385   1.00 88.49  ? 57  ASP F CB  1 
ATOM   255   C CG  . ASP A 1 38  ? 25.487  23.219  4.046   1.00 93.28  ? 57  ASP F CG  1 
ATOM   256   O OD1 . ASP A 1 38  ? 24.942  22.725  3.038   1.00 95.92  ? 57  ASP F OD1 1 
ATOM   257   O OD2 . ASP A 1 38  ? 24.891  24.013  4.809   1.00 95.12  ? 57  ASP F OD2 1 
ATOM   258   N N   . TYR A 1 39  ? 26.862  20.426  1.625   1.00 76.51  ? 58  TYR F N   1 
ATOM   259   C CA  . TYR A 1 39  ? 26.195  19.191  1.229   1.00 76.63  ? 58  TYR F CA  1 
ATOM   260   C C   . TYR A 1 39  ? 26.791  18.738  -0.095  1.00 76.73  ? 58  TYR F C   1 
ATOM   261   O O   . TYR A 1 39  ? 26.544  19.360  -1.133  1.00 76.11  ? 58  TYR F O   1 
ATOM   262   C CB  . TYR A 1 39  ? 24.690  19.399  1.114   1.00 74.37  ? 58  TYR F CB  1 
ATOM   263   C CG  . TYR A 1 39  ? 23.935  18.152  0.729   1.00 72.54  ? 58  TYR F CG  1 
ATOM   264   C CD1 . TYR A 1 39  ? 23.557  17.225  1.688   1.00 75.08  ? 58  TYR F CD1 1 
ATOM   265   C CD2 . TYR A 1 39  ? 23.598  17.902  -0.592  1.00 72.85  ? 58  TYR F CD2 1 
ATOM   266   C CE1 . TYR A 1 39  ? 22.863  16.083  1.341   1.00 73.88  ? 58  TYR F CE1 1 
ATOM   267   C CE2 . TYR A 1 39  ? 22.906  16.762  -0.948  1.00 72.65  ? 58  TYR F CE2 1 
ATOM   268   C CZ  . TYR A 1 39  ? 22.541  15.857  0.022   1.00 71.93  ? 58  TYR F CZ  1 
ATOM   269   O OH  . TYR A 1 39  ? 21.851  14.722  -0.332  1.00 71.61  ? 58  TYR F OH  1 
ATOM   270   N N   . SER A 1 40  ? 27.566  17.662  -0.060  1.00 77.31  ? 59  SER F N   1 
ATOM   271   C CA  . SER A 1 40  ? 28.196  17.120  -1.252  1.00 78.58  ? 59  SER F CA  1 
ATOM   272   C C   . SER A 1 40  ? 27.337  16.010  -1.849  1.00 82.51  ? 59  SER F C   1 
ATOM   273   O O   . SER A 1 40  ? 26.449  15.457  -1.195  1.00 83.94  ? 59  SER F O   1 
ATOM   274   C CB  . SER A 1 40  ? 29.596  16.592  -0.926  1.00 82.31  ? 59  SER F CB  1 
ATOM   275   O OG  . SER A 1 40  ? 30.282  16.194  -2.100  1.00 90.66  ? 59  SER F OG  1 
ATOM   276   N N   . MET A 1 41  ? 27.613  15.693  -3.114  1.00 85.99  ? 60  MET F N   1 
ATOM   277   C CA  . MET A 1 41  ? 26.869  14.657  -3.819  1.00 82.80  ? 60  MET F CA  1 
ATOM   278   C C   . MET A 1 41  ? 27.661  14.133  -5.011  1.00 82.40  ? 60  MET F C   1 
ATOM   279   O O   . MET A 1 41  ? 28.069  14.914  -5.880  1.00 83.06  ? 60  MET F O   1 
ATOM   280   C CB  . MET A 1 41  ? 25.516  15.192  -4.281  1.00 81.39  ? 60  MET F CB  1 
ATOM   281   C CG  . MET A 1 41  ? 24.693  14.175  -5.030  1.00 84.09  ? 60  MET F CG  1 
ATOM   282   S SD  . MET A 1 41  ? 22.991  14.699  -5.256  1.00 93.17  ? 60  MET F SD  1 
ATOM   283   C CE  . MET A 1 41  ? 22.198  13.104  -5.435  1.00 97.91  ? 60  MET F CE  1 
ATOM   284   N N   . PRO A 1 42  ? 27.910  12.826  -5.081  1.00 86.96  ? 61  PRO F N   1 
ATOM   285   C CA  . PRO A 1 42  ? 28.611  12.273  -6.246  1.00 88.06  ? 61  PRO F CA  1 
ATOM   286   C C   . PRO A 1 42  ? 27.773  12.394  -7.509  1.00 89.15  ? 61  PRO F C   1 
ATOM   287   O O   . PRO A 1 42  ? 26.554  12.208  -7.492  1.00 85.25  ? 61  PRO F O   1 
ATOM   288   C CB  . PRO A 1 42  ? 28.836  10.804  -5.865  1.00 90.96  ? 61  PRO F CB  1 
ATOM   289   C CG  . PRO A 1 42  ? 27.889  10.537  -4.738  1.00 93.85  ? 61  PRO F CG  1 
ATOM   290   C CD  . PRO A 1 42  ? 27.730  11.832  -4.014  1.00 91.20  ? 61  PRO F CD  1 
ATOM   291   N N   . ALA A 1 43  ? 28.445  12.704  -8.614  1.00 92.47  ? 62  ALA F N   1 
ATOM   292   C CA  . ALA A 1 43  ? 27.767  12.885  -9.888  1.00 91.23  ? 62  ALA F CA  1 
ATOM   293   C C   . ALA A 1 43  ? 27.514  11.543  -10.566 1.00 90.78  ? 62  ALA F C   1 
ATOM   294   O O   . ALA A 1 43  ? 28.247  10.570  -10.364 1.00 92.77  ? 62  ALA F O   1 
ATOM   295   C CB  . ALA A 1 43  ? 28.588  13.790  -10.806 1.00 92.11  ? 62  ALA F CB  1 
ATOM   296   N N   . VAL A 1 44  ? 26.467  11.504  -11.383 1.00 91.53  ? 63  VAL F N   1 
ATOM   297   C CA  . VAL A 1 44  ? 26.050  10.288  -12.073 1.00 93.92  ? 63  VAL F CA  1 
ATOM   298   C C   . VAL A 1 44  ? 26.796  10.196  -13.400 1.00 94.82  ? 63  VAL F C   1 
ATOM   299   O O   . VAL A 1 44  ? 26.680  11.088  -14.248 1.00 98.09  ? 63  VAL F O   1 
ATOM   300   C CB  . VAL A 1 44  ? 24.528  10.272  -12.291 1.00 96.30  ? 63  VAL F CB  1 
ATOM   301   C CG1 . VAL A 1 44  ? 24.151  9.294   -13.389 1.00 96.27  ? 63  VAL F CG1 1 
ATOM   302   C CG2 . VAL A 1 44  ? 23.811  9.929   -10.996 1.00 101.99 ? 63  VAL F CG2 1 
ATOM   303   N N   . ASN A 1 45  ? 27.565  9.116   -13.577 1.00 99.69  ? 64  ASN F N   1 
ATOM   304   C CA  . ASN A 1 45  ? 28.361  8.867   -14.786 1.00 99.56  ? 64  ASN F CA  1 
ATOM   305   C C   . ASN A 1 45  ? 29.259  10.057  -15.145 1.00 96.62  ? 64  ASN F C   1 
ATOM   306   O O   . ASN A 1 45  ? 29.647  10.216  -16.306 1.00 97.31  ? 64  ASN F O   1 
ATOM   307   C CB  . ASN A 1 45  ? 27.472  8.511   -15.988 1.00 102.86 ? 64  ASN F CB  1 
ATOM   308   C CG  . ASN A 1 45  ? 27.164  7.011   -16.103 1.00 101.04 ? 64  ASN F CG  1 
ATOM   309   O OD1 . ASN A 1 45  ? 27.328  6.245   -15.154 1.00 107.87 ? 64  ASN F OD1 1 
ATOM   310   N ND2 . ASN A 1 45  ? 26.716  6.603   -17.301 1.00 102.54 ? 64  ASN F ND2 1 
ATOM   311   N N   . ASN A 1 46  ? 29.582  10.907  -14.165 1.00 102.07 ? 65  ASN F N   1 
ATOM   312   C CA  . ASN A 1 46  ? 30.451  12.073  -14.364 1.00 102.50 ? 65  ASN F CA  1 
ATOM   313   C C   . ASN A 1 46  ? 29.905  13.016  -15.437 1.00 100.82 ? 65  ASN F C   1 
ATOM   314   O O   . ASN A 1 46  ? 30.651  13.533  -16.270 1.00 103.98 ? 65  ASN F O   1 
ATOM   315   C CB  . ASN A 1 46  ? 31.884  11.649  -14.702 1.00 103.00 ? 65  ASN F CB  1 
ATOM   316   C CG  . ASN A 1 46  ? 32.576  10.950  -13.546 1.00 108.45 ? 65  ASN F CG  1 
ATOM   317   O OD1 . ASN A 1 46  ? 32.434  11.347  -12.388 1.00 113.46 ? 65  ASN F OD1 1 
ATOM   318   N ND2 . ASN A 1 46  ? 33.333  9.903   -13.857 1.00 115.23 ? 65  ASN F ND2 1 
ATOM   319   N N   . SER A 1 47  ? 28.594  13.253  -15.413 1.00 93.62  ? 66  SER F N   1 
ATOM   320   C CA  . SER A 1 47  ? 27.979  14.153  -16.386 1.00 96.28  ? 66  SER F CA  1 
ATOM   321   C C   . SER A 1 47  ? 26.925  15.087  -15.809 1.00 99.70  ? 66  SER F C   1 
ATOM   322   O O   . SER A 1 47  ? 26.710  16.158  -16.387 1.00 103.91 ? 66  SER F O   1 
ATOM   323   C CB  . SER A 1 47  ? 27.353  13.351  -17.532 1.00 96.55  ? 66  SER F CB  1 
ATOM   324   O OG  . SER A 1 47  ? 26.763  12.161  -17.045 1.00 97.92  ? 66  SER F OG  1 
ATOM   325   N N   . TYR A 1 48  ? 26.266  14.745  -14.705 1.00 96.06  ? 67  TYR F N   1 
ATOM   326   C CA  . TYR A 1 48  ? 25.260  15.612  -14.103 1.00 96.84  ? 67  TYR F CA  1 
ATOM   327   C C   . TYR A 1 48  ? 24.985  15.124  -12.688 1.00 95.65  ? 67  TYR F C   1 
ATOM   328   O O   . TYR A 1 48  ? 25.292  13.982  -12.336 1.00 97.95  ? 67  TYR F O   1 
ATOM   329   C CB  . TYR A 1 48  ? 23.964  15.636  -14.921 1.00 99.33  ? 67  TYR F CB  1 
ATOM   330   C CG  . TYR A 1 48  ? 23.124  14.387  -14.764 1.00 98.57  ? 67  TYR F CG  1 
ATOM   331   C CD1 . TYR A 1 48  ? 23.483  13.203  -15.394 1.00 99.90  ? 67  TYR F CD1 1 
ATOM   332   C CD2 . TYR A 1 48  ? 21.973  14.392  -13.987 1.00 97.79  ? 67  TYR F CD2 1 
ATOM   333   C CE1 . TYR A 1 48  ? 22.721  12.057  -15.253 1.00 98.78  ? 67  TYR F CE1 1 
ATOM   334   C CE2 . TYR A 1 48  ? 21.205  13.251  -13.839 1.00 99.04  ? 67  TYR F CE2 1 
ATOM   335   C CZ  . TYR A 1 48  ? 21.583  12.088  -14.475 1.00 97.68  ? 67  TYR F CZ  1 
ATOM   336   O OH  . TYR A 1 48  ? 20.821  10.952  -14.331 1.00 96.19  ? 67  TYR F OH  1 
ATOM   337   N N   . CYS A 1 49  ? 24.397  16.004  -11.886 1.00 88.56  ? 68  CYS F N   1 
ATOM   338   C CA  . CYS A 1 49  ? 23.978  15.679  -10.531 1.00 90.74  ? 68  CYS F CA  1 
ATOM   339   C C   . CYS A 1 49  ? 22.458  15.701  -10.452 1.00 90.17  ? 68  CYS F C   1 
ATOM   340   O O   . CYS A 1 49  ? 21.812  16.603  -10.998 1.00 89.94  ? 68  CYS F O   1 
ATOM   341   C CB  . CYS A 1 49  ? 24.576  16.657  -9.518  1.00 91.50  ? 68  CYS F CB  1 
ATOM   342   S SG  . CYS A 1 49  ? 26.208  16.175  -8.915  1.00 101.19 ? 68  CYS F SG  1 
ATOM   343   N N   . GLN A 1 50  ? 21.898  14.708  -9.766  1.00 84.11  ? 69  GLN F N   1 
ATOM   344   C CA  . GLN A 1 50  ? 20.456  14.474  -9.706  1.00 82.51  ? 69  GLN F CA  1 
ATOM   345   C C   . GLN A 1 50  ? 19.970  14.824  -8.300  1.00 80.13  ? 69  GLN F C   1 
ATOM   346   O O   . GLN A 1 50  ? 19.903  13.967  -7.418  1.00 83.41  ? 69  GLN F O   1 
ATOM   347   C CB  . GLN A 1 50  ? 20.136  13.019  -10.075 1.00 85.85  ? 69  GLN F CB  1 
ATOM   348   C CG  . GLN A 1 50  ? 18.675  12.608  -9.924  1.00 87.15  ? 69  GLN F CG  1 
ATOM   349   C CD  . GLN A 1 50  ? 17.711  13.589  -10.559 1.00 86.08  ? 69  GLN F CD  1 
ATOM   350   O OE1 . GLN A 1 50  ? 17.709  13.773  -11.776 1.00 89.85  ? 69  GLN F OE1 1 
ATOM   351   N NE2 . GLN A 1 50  ? 16.878  14.217  -9.738  1.00 86.90  ? 69  GLN F NE2 1 
ATOM   352   N N   . PHE A 1 51  ? 19.635  16.094  -8.094  1.00 75.67  ? 70  PHE F N   1 
ATOM   353   C CA  . PHE A 1 51  ? 19.076  16.523  -6.823  1.00 75.57  ? 70  PHE F CA  1 
ATOM   354   C C   . PHE A 1 51  ? 17.582  16.214  -6.770  1.00 77.14  ? 70  PHE F C   1 
ATOM   355   O O   . PHE A 1 51  ? 16.959  15.843  -7.768  1.00 78.90  ? 70  PHE F O   1 
ATOM   356   C CB  . PHE A 1 51  ? 19.322  18.013  -6.602  1.00 71.22  ? 70  PHE F CB  1 
ATOM   357   C CG  . PHE A 1 51  ? 20.770  18.374  -6.444  1.00 70.71  ? 70  PHE F CG  1 
ATOM   358   C CD1 . PHE A 1 51  ? 21.471  17.998  -5.312  1.00 72.99  ? 70  PHE F CD1 1 
ATOM   359   C CD2 . PHE A 1 51  ? 21.428  19.095  -7.424  1.00 71.51  ? 70  PHE F CD2 1 
ATOM   360   C CE1 . PHE A 1 51  ? 22.805  18.329  -5.163  1.00 74.92  ? 70  PHE F CE1 1 
ATOM   361   C CE2 . PHE A 1 51  ? 22.763  19.430  -7.280  1.00 74.64  ? 70  PHE F CE2 1 
ATOM   362   C CZ  . PHE A 1 51  ? 23.451  19.046  -6.148  1.00 75.67  ? 70  PHE F CZ  1 
ATOM   363   N N   . GLY A 1 52  ? 17.001  16.374  -5.583  1.00 71.97  ? 71  GLY F N   1 
ATOM   364   C CA  . GLY A 1 52  ? 15.607  16.027  -5.389  1.00 73.41  ? 71  GLY F CA  1 
ATOM   365   C C   . GLY A 1 52  ? 14.795  17.053  -4.625  1.00 73.54  ? 71  GLY F C   1 
ATOM   366   O O   . GLY A 1 52  ? 13.595  16.860  -4.408  1.00 78.24  ? 71  GLY F O   1 
ATOM   367   N N   . ALA A 1 53  ? 15.428  18.145  -4.211  1.00 68.78  ? 72  ALA F N   1 
ATOM   368   C CA  . ALA A 1 53  ? 14.737  19.186  -3.459  1.00 68.46  ? 72  ALA F CA  1 
ATOM   369   C C   . ALA A 1 53  ? 15.344  20.546  -3.792  1.00 68.40  ? 72  ALA F C   1 
ATOM   370   O O   . ALA A 1 53  ? 15.764  21.299  -2.912  1.00 67.88  ? 72  ALA F O   1 
ATOM   371   C CB  . ALA A 1 53  ? 14.789  18.901  -1.959  1.00 67.82  ? 72  ALA F CB  1 
ATOM   372   N N   . ILE A 1 54  ? 15.389  20.874  -5.079  1.00 69.24  ? 73  ILE F N   1 
ATOM   373   C CA  . ILE A 1 54  ? 15.934  22.148  -5.533  1.00 69.28  ? 73  ILE F CA  1 
ATOM   374   C C   . ILE A 1 54  ? 14.917  23.248  -5.271  1.00 69.25  ? 73  ILE F C   1 
ATOM   375   O O   . ILE A 1 54  ? 13.782  23.184  -5.755  1.00 69.70  ? 73  ILE F O   1 
ATOM   376   C CB  . ILE A 1 54  ? 16.300  22.092  -7.019  1.00 69.99  ? 73  ILE F CB  1 
ATOM   377   C CG1 . ILE A 1 54  ? 17.416  21.077  -7.238  1.00 70.03  ? 73  ILE F CG1 1 
ATOM   378   C CG2 . ILE A 1 54  ? 16.716  23.463  -7.506  1.00 70.10  ? 73  ILE F CG2 1 
ATOM   379   C CD1 . ILE A 1 54  ? 18.670  21.426  -6.488  1.00 70.41  ? 73  ILE F CD1 1 
ATOM   380   N N   . SER A 1 55  ? 15.326  24.268  -4.521  1.00 69.48  ? 74  SER F N   1 
ATOM   381   C CA  . SER A 1 55  ? 14.447  25.402  -4.276  1.00 69.46  ? 74  SER F CA  1 
ATOM   382   C C   . SER A 1 55  ? 14.367  26.285  -5.515  1.00 70.03  ? 74  SER F C   1 
ATOM   383   O O   . SER A 1 55  ? 15.348  26.451  -6.246  1.00 70.21  ? 74  SER F O   1 
ATOM   384   C CB  . SER A 1 55  ? 14.944  26.217  -3.083  1.00 68.79  ? 74  SER F CB  1 
ATOM   385   O OG  . SER A 1 55  ? 14.238  27.440  -2.982  1.00 68.82  ? 74  SER F OG  1 
ATOM   386   N N   . LEU A 1 56  ? 13.186  26.841  -5.757  1.00 69.72  ? 75  LEU F N   1 
ATOM   387   C CA  . LEU A 1 56  ? 12.947  27.696  -6.908  1.00 70.32  ? 75  LEU F CA  1 
ATOM   388   C C   . LEU A 1 56  ? 12.922  29.175  -6.549  1.00 72.27  ? 75  LEU F C   1 
ATOM   389   O O   . LEU A 1 56  ? 12.798  30.013  -7.447  1.00 76.80  ? 75  LEU F O   1 
ATOM   390   C CB  . LEU A 1 56  ? 11.627  27.313  -7.590  1.00 71.85  ? 75  LEU F CB  1 
ATOM   391   C CG  . LEU A 1 56  ? 11.601  26.178  -8.617  1.00 73.88  ? 75  LEU F CG  1 
ATOM   392   C CD1 . LEU A 1 56  ? 12.384  24.963  -8.153  1.00 79.31  ? 75  LEU F CD1 1 
ATOM   393   C CD2 . LEU A 1 56  ? 10.163  25.792  -8.927  1.00 74.94  ? 75  LEU F CD2 1 
ATOM   394   N N   . CYS A 1 57  ? 13.042  29.520  -5.264  1.00 77.86  ? 76  CYS F N   1 
ATOM   395   C CA  . CYS A 1 57  ? 12.932  30.907  -4.829  1.00 82.35  ? 76  CYS F CA  1 
ATOM   396   C C   . CYS A 1 57  ? 14.033  31.324  -3.861  1.00 82.91  ? 76  CYS F C   1 
ATOM   397   O O   . CYS A 1 57  ? 13.990  32.448  -3.344  1.00 88.43  ? 76  CYS F O   1 
ATOM   398   C CB  . CYS A 1 57  ? 11.567  31.156  -4.181  1.00 85.04  ? 76  CYS F CB  1 
ATOM   399   S SG  . CYS A 1 57  ? 10.184  30.512  -5.132  1.00 90.79  ? 76  CYS F SG  1 
ATOM   400   N N   . GLU A 1 58  ? 15.007  30.459  -3.594  1.00 83.62  ? 77  GLU F N   1 
ATOM   401   C CA  . GLU A 1 58  ? 16.106  30.780  -2.690  1.00 85.33  ? 77  GLU F CA  1 
ATOM   402   C C   . GLU A 1 58  ? 17.408  30.646  -3.466  1.00 84.42  ? 77  GLU F C   1 
ATOM   403   O O   . GLU A 1 58  ? 17.806  29.534  -3.832  1.00 83.81  ? 77  GLU F O   1 
ATOM   404   C CB  . GLU A 1 58  ? 16.092  29.874  -1.460  1.00 86.18  ? 77  GLU F CB  1 
ATOM   405   C CG  . GLU A 1 58  ? 16.912  30.411  -0.298  1.00 88.43  ? 77  GLU F CG  1 
ATOM   406   C CD  . GLU A 1 58  ? 17.128  29.380  0.793   1.00 95.22  ? 77  GLU F CD  1 
ATOM   407   O OE1 . GLU A 1 58  ? 17.131  28.170  0.481   1.00 100.82 ? 77  GLU F OE1 1 
ATOM   408   O OE2 . GLU A 1 58  ? 17.299  29.782  1.964   1.00 102.02 ? 77  GLU F OE2 1 
ATOM   409   N N   . VAL A 1 59  ? 18.058  31.782  -3.727  1.00 84.37  ? 78  VAL F N   1 
ATOM   410   C CA  . VAL A 1 59  ? 19.316  31.789  -4.465  1.00 82.73  ? 78  VAL F CA  1 
ATOM   411   C C   . VAL A 1 59  ? 20.332  30.925  -3.732  1.00 78.86  ? 78  VAL F C   1 
ATOM   412   O O   . VAL A 1 59  ? 20.699  31.205  -2.584  1.00 82.20  ? 78  VAL F O   1 
ATOM   413   C CB  . VAL A 1 59  ? 19.816  33.225  -4.661  1.00 87.71  ? 78  VAL F CB  1 
ATOM   414   C CG1 . VAL A 1 59  ? 19.046  33.901  -5.781  1.00 90.03  ? 78  VAL F CG1 1 
ATOM   415   C CG2 . VAL A 1 59  ? 19.659  34.028  -3.374  1.00 90.80  ? 78  VAL F CG2 1 
ATOM   416   N N   . THR A 1 60  ? 20.775  29.852  -4.384  1.00 77.20  ? 79  THR F N   1 
ATOM   417   C CA  . THR A 1 60  ? 21.732  28.929  -3.793  1.00 78.58  ? 79  THR F CA  1 
ATOM   418   C C   . THR A 1 60  ? 22.904  28.718  -4.743  1.00 77.50  ? 79  THR F C   1 
ATOM   419   O O   . THR A 1 60  ? 22.754  28.754  -5.970  1.00 75.58  ? 79  THR F O   1 
ATOM   420   C CB  . THR A 1 60  ? 21.077  27.583  -3.434  1.00 79.89  ? 79  THR F CB  1 
ATOM   421   O OG1 . THR A 1 60  ? 20.308  27.106  -4.543  1.00 82.25  ? 79  THR F OG1 1 
ATOM   422   C CG2 . THR A 1 60  ? 20.165  27.738  -2.225  1.00 80.89  ? 79  THR F CG2 1 
ATOM   423   N N   . ASN A 1 61  ? 24.075  28.498  -4.147  1.00 81.24  ? 80  ASN F N   1 
ATOM   424   C CA  . ASN A 1 61  ? 25.347  28.423  -4.858  1.00 81.85  ? 80  ASN F CA  1 
ATOM   425   C C   . ASN A 1 61  ? 25.675  26.954  -5.102  1.00 80.09  ? 80  ASN F C   1 
ATOM   426   O O   . ASN A 1 61  ? 25.935  26.205  -4.154  1.00 83.46  ? 80  ASN F O   1 
ATOM   427   C CB  . ASN A 1 61  ? 26.437  29.118  -4.040  1.00 87.56  ? 80  ASN F CB  1 
ATOM   428   C CG  . ASN A 1 61  ? 27.788  29.174  -4.749  1.00 90.48  ? 80  ASN F CG  1 
ATOM   429   O OD1 . ASN A 1 61  ? 28.051  28.425  -5.689  1.00 90.34  ? 80  ASN F OD1 1 
ATOM   430   N ND2 . ASN A 1 61  ? 28.659  30.069  -4.279  1.00 90.35  ? 80  ASN F ND2 1 
ATOM   431   N N   . TYR A 1 62  ? 25.665  26.543  -6.367  1.00 76.27  ? 81  TYR F N   1 
ATOM   432   C CA  . TYR A 1 62  ? 25.994  25.174  -6.748  1.00 79.26  ? 81  TYR F CA  1 
ATOM   433   C C   . TYR A 1 62  ? 27.413  25.143  -7.302  1.00 79.09  ? 81  TYR F C   1 
ATOM   434   O O   . TYR A 1 62  ? 27.688  25.754  -8.339  1.00 80.22  ? 81  TYR F O   1 
ATOM   435   C CB  . TYR A 1 62  ? 25.010  24.631  -7.785  1.00 78.41  ? 81  TYR F CB  1 
ATOM   436   C CG  . TYR A 1 62  ? 23.579  24.580  -7.309  1.00 77.33  ? 81  TYR F CG  1 
ATOM   437   C CD1 . TYR A 1 62  ? 22.767  25.702  -7.376  1.00 79.40  ? 81  TYR F CD1 1 
ATOM   438   C CD2 . TYR A 1 62  ? 23.044  23.415  -6.775  1.00 75.56  ? 81  TYR F CD2 1 
ATOM   439   C CE1 . TYR A 1 62  ? 21.460  25.663  -6.941  1.00 79.92  ? 81  TYR F CE1 1 
ATOM   440   C CE2 . TYR A 1 62  ? 21.736  23.369  -6.329  1.00 75.36  ? 81  TYR F CE2 1 
ATOM   441   C CZ  . TYR A 1 62  ? 20.949  24.497  -6.416  1.00 77.13  ? 81  TYR F CZ  1 
ATOM   442   O OH  . TYR A 1 62  ? 19.645  24.468  -5.980  1.00 77.23  ? 81  TYR F OH  1 
ATOM   443   N N   . THR A 1 63  ? 28.304  24.435  -6.616  1.00 81.82  ? 82  THR F N   1 
ATOM   444   C CA  . THR A 1 63  ? 29.689  24.303  -7.040  1.00 83.09  ? 82  THR F CA  1 
ATOM   445   C C   . THR A 1 63  ? 29.936  22.881  -7.532  1.00 85.82  ? 82  THR F C   1 
ATOM   446   O O   . THR A 1 63  ? 29.357  21.924  -7.015  1.00 89.86  ? 82  THR F O   1 
ATOM   447   C CB  . THR A 1 63  ? 30.646  24.642  -5.892  1.00 85.18  ? 82  THR F CB  1 
ATOM   448   O OG1 . THR A 1 63  ? 30.288  25.913  -5.338  1.00 86.53  ? 82  THR F OG1 1 
ATOM   449   C CG2 . THR A 1 63  ? 32.083  24.711  -6.385  1.00 87.87  ? 82  THR F CG2 1 
ATOM   450   N N   . VAL A 1 64  ? 30.786  22.746  -8.546  1.00 92.22  ? 83  VAL F N   1 
ATOM   451   C CA  . VAL A 1 64  ? 31.092  21.455  -9.157  1.00 92.78  ? 83  VAL F CA  1 
ATOM   452   C C   . VAL A 1 64  ? 32.599  21.251  -9.082  1.00 94.00  ? 83  VAL F C   1 
ATOM   453   O O   . VAL A 1 64  ? 33.360  21.971  -9.741  1.00 97.64  ? 83  VAL F O   1 
ATOM   454   C CB  . VAL A 1 64  ? 30.600  21.378  -10.608 1.00 93.00  ? 83  VAL F CB  1 
ATOM   455   C CG1 . VAL A 1 64  ? 30.774  19.978  -11.149 1.00 93.48  ? 83  VAL F CG1 1 
ATOM   456   C CG2 . VAL A 1 64  ? 29.145  21.808  -10.701 1.00 96.58  ? 83  VAL F CG2 1 
ATOM   457   N N   . ARG A 1 65  ? 33.037  20.272  -8.291  1.00 99.13  ? 84  ARG F N   1 
ATOM   458   C CA  . ARG A 1 65  ? 34.454  20.018  -8.073  1.00 101.70 ? 84  ARG F CA  1 
ATOM   459   C C   . ARG A 1 65  ? 34.873  18.714  -8.737  1.00 104.35 ? 84  ARG F C   1 
ATOM   460   O O   . ARG A 1 65  ? 34.124  17.729  -8.728  1.00 106.63 ? 84  ARG F O   1 
ATOM   461   C CB  . ARG A 1 65  ? 34.787  19.956  -6.579  1.00 106.17 ? 84  ARG F CB  1 
ATOM   462   C CG  . ARG A 1 65  ? 34.729  21.291  -5.858  1.00 106.44 ? 84  ARG F CG  1 
ATOM   463   C CD  . ARG A 1 65  ? 35.415  21.208  -4.501  1.00 106.26 ? 84  ARG F CD  1 
ATOM   464   N NE  . ARG A 1 65  ? 34.739  20.296  -3.580  1.00 104.61 ? 84  ARG F NE  1 
ATOM   465   C CZ  . ARG A 1 65  ? 34.206  20.667  -2.420  1.00 102.08 ? 84  ARG F CZ  1 
ATOM   466   N NH1 . ARG A 1 65  ? 34.272  21.934  -2.033  1.00 97.96  ? 84  ARG F NH1 1 
ATOM   467   N NH2 . ARG A 1 65  ? 33.613  19.771  -1.641  1.00 96.60  ? 84  ARG F NH2 1 
ATOM   468   N N   . VAL A 1 66  ? 36.081  18.720  -9.306  1.00 114.94 ? 85  VAL F N   1 
ATOM   469   C CA  . VAL A 1 66  ? 36.700  17.548  -9.907  1.00 116.66 ? 85  VAL F CA  1 
ATOM   470   C C   . VAL A 1 66  ? 38.025  17.293  -9.199  1.00 119.01 ? 85  VAL F C   1 
ATOM   471   O O   . VAL A 1 66  ? 38.610  18.187  -8.581  1.00 121.81 ? 85  VAL F O   1 
ATOM   472   C CB  . VAL A 1 66  ? 36.918  17.718  -11.427 1.00 110.82 ? 85  VAL F CB  1 
ATOM   473   C CG1 . VAL A 1 66  ? 37.052  16.364  -12.112 1.00 110.48 ? 85  VAL F CG1 1 
ATOM   474   C CG2 . VAL A 1 66  ? 35.788  18.523  -12.044 1.00 107.27 ? 85  VAL F CG2 1 
ATOM   475   N N   . ALA A 1 67  ? 38.498  16.049  -9.292  1.00 126.05 ? 86  ALA F N   1 
ATOM   476   C CA  . ALA A 1 67  ? 39.791  15.657  -8.742  1.00 126.31 ? 86  ALA F CA  1 
ATOM   477   C C   . ALA A 1 67  ? 40.895  15.656  -9.794  1.00 128.48 ? 86  ALA F C   1 
ATOM   478   O O   . ALA A 1 67  ? 41.965  16.230  -9.570  1.00 124.05 ? 86  ALA F O   1 
ATOM   479   C CB  . ALA A 1 67  ? 39.692  14.274  -8.086  1.00 125.34 ? 86  ALA F CB  1 
ATOM   480   N N   . ASN A 1 68  ? 40.658  15.016  -10.934 1.00 131.34 ? 87  ASN F N   1 
ATOM   481   C CA  . ASN A 1 68  ? 41.608  15.008  -12.048 1.00 131.67 ? 87  ASN F CA  1 
ATOM   482   C C   . ASN A 1 68  ? 40.962  15.649  -13.267 1.00 130.90 ? 87  ASN F C   1 
ATOM   483   O O   . ASN A 1 68  ? 40.093  15.023  -13.903 1.00 120.88 ? 87  ASN F O   1 
ATOM   484   C CB  . ASN A 1 68  ? 42.064  13.586  -12.377 1.00 131.03 ? 87  ASN F CB  1 
ATOM   485   C CG  . ASN A 1 68  ? 42.977  13.003  -11.316 1.00 129.09 ? 87  ASN F CG  1 
ATOM   486   O OD1 . ASN A 1 68  ? 43.626  13.735  -10.568 1.00 128.60 ? 87  ASN F OD1 1 
ATOM   487   N ND2 . ASN A 1 68  ? 43.038  11.677  -11.250 1.00 131.80 ? 87  ASN F ND2 1 
ATOM   488   N N   . PRO A 1 69  ? 41.339  16.882  -13.640 1.00 125.71 ? 88  PRO F N   1 
ATOM   489   C CA  . PRO A 1 69  ? 42.333  17.714  -12.954 1.00 126.64 ? 88  PRO F CA  1 
ATOM   490   C C   . PRO A 1 69  ? 41.744  18.491  -11.779 1.00 126.64 ? 88  PRO F C   1 
ATOM   491   O O   . PRO A 1 69  ? 40.521  18.615  -11.695 1.00 136.89 ? 88  PRO F O   1 
ATOM   492   C CB  . PRO A 1 69  ? 42.789  18.671  -14.054 1.00 129.98 ? 88  PRO F CB  1 
ATOM   493   C CG  . PRO A 1 69  ? 41.561  18.864  -14.876 1.00 128.49 ? 88  PRO F CG  1 
ATOM   494   C CD  . PRO A 1 69  ? 40.828  17.539  -14.857 1.00 126.30 ? 88  PRO F CD  1 
ATOM   495   N N   . PRO A 1 70  ? 42.598  18.999  -10.881 1.00 128.89 ? 89  PRO F N   1 
ATOM   496   C CA  . PRO A 1 70  ? 42.096  19.856  -9.798  1.00 128.40 ? 89  PRO F CA  1 
ATOM   497   C C   . PRO A 1 70  ? 41.361  21.071  -10.341 1.00 126.84 ? 89  PRO F C   1 
ATOM   498   O O   . PRO A 1 70  ? 41.976  22.106  -10.617 1.00 124.12 ? 89  PRO F O   1 
ATOM   499   C CB  . PRO A 1 70  ? 43.370  20.254  -9.043  1.00 128.49 ? 89  PRO F CB  1 
ATOM   500   C CG  . PRO A 1 70  ? 44.341  19.161  -9.344  1.00 128.66 ? 89  PRO F CG  1 
ATOM   501   C CD  . PRO A 1 70  ? 44.041  18.733  -10.752 1.00 129.37 ? 89  PRO F CD  1 
ATOM   502   N N   . PHE A 1 71  ? 40.045  20.951  -10.502 1.00 123.56 ? 90  PHE F N   1 
ATOM   503   C CA  . PHE A 1 71  ? 39.233  21.985  -11.122 1.00 122.00 ? 90  PHE F CA  1 
ATOM   504   C C   . PHE A 1 71  ? 37.968  22.217  -10.307 1.00 120.02 ? 90  PHE F C   1 
ATOM   505   O O   . PHE A 1 71  ? 37.558  21.377  -9.501  1.00 119.24 ? 90  PHE F O   1 
ATOM   506   C CB  . PHE A 1 71  ? 38.864  21.611  -12.564 1.00 121.37 ? 90  PHE F CB  1 
ATOM   507   C CG  . PHE A 1 71  ? 38.163  22.703  -13.313 1.00 118.86 ? 90  PHE F CG  1 
ATOM   508   C CD1 . PHE A 1 71  ? 38.705  23.975  -13.377 1.00 119.61 ? 90  PHE F CD1 1 
ATOM   509   C CD2 . PHE A 1 71  ? 36.958  22.459  -13.947 1.00 119.87 ? 90  PHE F CD2 1 
ATOM   510   C CE1 . PHE A 1 71  ? 38.062  24.982  -14.066 1.00 120.04 ? 90  PHE F CE1 1 
ATOM   511   C CE2 . PHE A 1 71  ? 36.309  23.462  -14.637 1.00 121.69 ? 90  PHE F CE2 1 
ATOM   512   C CZ  . PHE A 1 71  ? 36.863  24.726  -14.697 1.00 121.77 ? 90  PHE F CZ  1 
ATOM   513   N N   . SER A 1 72  ? 37.351  23.375  -10.535 1.00 112.42 ? 91  SER F N   1 
ATOM   514   C CA  . SER A 1 72  ? 36.119  23.750  -9.857  1.00 108.40 ? 91  SER F CA  1 
ATOM   515   C C   . SER A 1 72  ? 35.471  24.901  -10.612 1.00 108.31 ? 91  SER F C   1 
ATOM   516   O O   . SER A 1 72  ? 36.129  25.627  -11.362 1.00 111.72 ? 91  SER F O   1 
ATOM   517   C CB  . SER A 1 72  ? 36.378  24.135  -8.398  1.00 107.78 ? 91  SER F CB  1 
ATOM   518   O OG  . SER A 1 72  ? 35.193  24.054  -7.627  1.00 106.72 ? 91  SER F OG  1 
ATOM   519   N N   . THR A 1 73  ? 34.166  25.053  -10.401 1.00 98.02  ? 92  THR F N   1 
ATOM   520   C CA  . THR A 1 73  ? 33.362  26.105  -11.013 1.00 97.47  ? 92  THR F CA  1 
ATOM   521   C C   . THR A 1 73  ? 32.013  26.114  -10.304 1.00 95.73  ? 92  THR F C   1 
ATOM   522   O O   . THR A 1 73  ? 31.661  25.165  -9.598  1.00 99.16  ? 92  THR F O   1 
ATOM   523   C CB  . THR A 1 73  ? 33.197  25.895  -12.521 1.00 96.37  ? 92  THR F CB  1 
ATOM   524   O OG1 . THR A 1 73  ? 32.219  26.809  -13.033 1.00 95.57  ? 92  THR F OG1 1 
ATOM   525   C CG2 . THR A 1 73  ? 32.766  24.468  -12.817 1.00 97.67  ? 92  THR F CG2 1 
ATOM   526   N N   . TRP A 1 74  ? 31.259  27.196  -10.495 1.00 90.45  ? 93  TRP F N   1 
ATOM   527   C CA  . TRP A 1 74  ? 30.032  27.378  -9.732  1.00 91.03  ? 93  TRP F CA  1 
ATOM   528   C C   . TRP A 1 74  ? 28.985  28.112  -10.562 1.00 91.19  ? 93  TRP F C   1 
ATOM   529   O O   . TRP A 1 74  ? 29.268  28.656  -11.634 1.00 98.41  ? 93  TRP F O   1 
ATOM   530   C CB  . TRP A 1 74  ? 30.300  28.135  -8.428  1.00 90.76  ? 93  TRP F CB  1 
ATOM   531   C CG  . TRP A 1 74  ? 30.815  29.523  -8.646  1.00 94.16  ? 93  TRP F CG  1 
ATOM   532   C CD1 . TRP A 1 74  ? 32.105  29.890  -8.896  1.00 96.52  ? 93  TRP F CD1 1 
ATOM   533   C CD2 . TRP A 1 74  ? 30.047  30.732  -8.643  1.00 94.79  ? 93  TRP F CD2 1 
ATOM   534   N NE1 . TRP A 1 74  ? 32.189  31.253  -9.045  1.00 96.27  ? 93  TRP F NE1 1 
ATOM   535   C CE2 . TRP A 1 74  ? 30.938  31.793  -8.894  1.00 95.25  ? 93  TRP F CE2 1 
ATOM   536   C CE3 . TRP A 1 74  ? 28.693  31.019  -8.452  1.00 97.46  ? 93  TRP F CE3 1 
ATOM   537   C CZ2 . TRP A 1 74  ? 30.518  33.120  -8.958  1.00 98.60  ? 93  TRP F CZ2 1 
ATOM   538   C CZ3 . TRP A 1 74  ? 28.278  32.336  -8.516  1.00 96.71  ? 93  TRP F CZ3 1 
ATOM   539   C CH2 . TRP A 1 74  ? 29.187  33.370  -8.767  1.00 98.43  ? 93  TRP F CH2 1 
ATOM   540   N N   . ILE A 1 75  ? 27.760  28.113  -10.033 1.00 84.21  ? 94  ILE F N   1 
ATOM   541   C CA  . ILE A 1 75  ? 26.615  28.802  -10.612 1.00 84.68  ? 94  ILE F CA  1 
ATOM   542   C C   . ILE A 1 75  ? 25.686  29.176  -9.462  1.00 81.43  ? 94  ILE F C   1 
ATOM   543   O O   . ILE A 1 75  ? 25.815  28.676  -8.343  1.00 80.61  ? 94  ILE F O   1 
ATOM   544   C CB  . ILE A 1 75  ? 25.868  27.928  -11.643 1.00 89.98  ? 94  ILE F CB  1 
ATOM   545   C CG1 . ILE A 1 75  ? 24.982  28.777  -12.555 1.00 98.57  ? 94  ILE F CG1 1 
ATOM   546   C CG2 . ILE A 1 75  ? 25.013  26.892  -10.931 1.00 89.51  ? 94  ILE F CG2 1 
ATOM   547   C CD1 . ILE A 1 75  ? 24.170  27.958  -13.538 1.00 99.44  ? 94  ILE F CD1 1 
ATOM   548   N N   . LEU A 1 76  ? 24.744  30.072  -9.733  1.00 78.38  ? 95  LEU F N   1 
ATOM   549   C CA  . LEU A 1 76  ? 23.678  30.396  -8.793  1.00 77.82  ? 95  LEU F CA  1 
ATOM   550   C C   . LEU A 1 76  ? 22.349  29.972  -9.395  1.00 79.75  ? 95  LEU F C   1 
ATOM   551   O O   . LEU A 1 76  ? 22.088  30.239  -10.571 1.00 81.19  ? 95  LEU F O   1 
ATOM   552   C CB  . LEU A 1 76  ? 23.645  31.890  -8.464  1.00 77.62  ? 95  LEU F CB  1 
ATOM   553   C CG  . LEU A 1 76  ? 24.738  32.493  -7.582  1.00 77.16  ? 95  LEU F CG  1 
ATOM   554   C CD1 . LEU A 1 76  ? 24.220  33.737  -6.900  1.00 76.80  ? 95  LEU F CD1 1 
ATOM   555   C CD2 . LEU A 1 76  ? 25.221  31.495  -6.565  1.00 76.66  ? 95  LEU F CD2 1 
ATOM   556   N N   . PHE A 1 77  ? 21.513  29.303  -8.593  1.00 79.92  ? 96  PHE F N   1 
ATOM   557   C CA  . PHE A 1 77  ? 20.144  29.035  -9.016  1.00 77.65  ? 96  PHE F CA  1 
ATOM   558   C C   . PHE A 1 77  ? 19.225  29.262  -7.821  1.00 75.04  ? 96  PHE F C   1 
ATOM   559   O O   . PHE A 1 77  ? 19.482  28.717  -6.733  1.00 76.92  ? 96  PHE F O   1 
ATOM   560   C CB  . PHE A 1 77  ? 19.933  27.628  -9.578  1.00 77.58  ? 96  PHE F CB  1 
ATOM   561   C CG  . PHE A 1 77  ? 18.527  27.387  -10.053 1.00 75.84  ? 96  PHE F CG  1 
ATOM   562   C CD1 . PHE A 1 77  ? 18.158  27.707  -11.345 1.00 77.90  ? 96  PHE F CD1 1 
ATOM   563   C CD2 . PHE A 1 77  ? 17.570  26.861  -9.201  1.00 76.51  ? 96  PHE F CD2 1 
ATOM   564   C CE1 . PHE A 1 77  ? 16.870  27.502  -11.782 1.00 79.26  ? 96  PHE F CE1 1 
ATOM   565   C CE2 . PHE A 1 77  ? 16.277  26.654  -9.634  1.00 78.15  ? 96  PHE F CE2 1 
ATOM   566   C CZ  . PHE A 1 77  ? 15.928  26.976  -10.929 1.00 78.65  ? 96  PHE F CZ  1 
ATOM   567   N N   . PRO A 1 78  ? 18.153  30.052  -7.982  1.00 77.42  ? 97  PRO F N   1 
ATOM   568   C CA  . PRO A 1 78  ? 17.883  30.744  -9.244  1.00 79.01  ? 97  PRO F CA  1 
ATOM   569   C C   . PRO A 1 78  ? 18.718  32.008  -9.357  1.00 82.69  ? 97  PRO F C   1 
ATOM   570   O O   . PRO A 1 78  ? 19.511  32.288  -8.461  1.00 79.94  ? 97  PRO F O   1 
ATOM   571   C CB  . PRO A 1 78  ? 16.386  31.077  -9.160  1.00 79.36  ? 97  PRO F CB  1 
ATOM   572   C CG  . PRO A 1 78  ? 15.927  30.623  -7.787  1.00 79.98  ? 97  PRO F CG  1 
ATOM   573   C CD  . PRO A 1 78  ? 17.141  30.367  -6.965  1.00 78.64  ? 97  PRO F CD  1 
ATOM   574   N N   . GLU A 1 79  ? 18.565  32.750  -10.448 1.00 93.48  ? 98  GLU F N   1 
ATOM   575   C CA  . GLU A 1 79  ? 19.246  34.027  -10.570 1.00 95.80  ? 98  GLU F CA  1 
ATOM   576   C C   . GLU A 1 79  ? 18.517  35.068  -9.734  1.00 92.17  ? 98  GLU F C   1 
ATOM   577   O O   . GLU A 1 79  ? 17.286  35.057  -9.637  1.00 91.11  ? 98  GLU F O   1 
ATOM   578   C CB  . GLU A 1 79  ? 19.321  34.464  -12.033 1.00 102.40 ? 98  GLU F CB  1 
ATOM   579   C CG  . GLU A 1 79  ? 19.894  33.402  -12.962 1.00 104.91 ? 98  GLU F CG  1 
ATOM   580   C CD  . GLU A 1 79  ? 21.413  33.405  -12.994 1.00 103.88 ? 98  GLU F CD  1 
ATOM   581   O OE1 . GLU A 1 79  ? 22.003  34.506  -13.041 1.00 105.47 ? 98  GLU F OE1 1 
ATOM   582   O OE2 . GLU A 1 79  ? 22.013  32.306  -12.975 1.00 94.84  ? 98  GLU F OE2 1 
ATOM   583   N N   . ASN A 1 80  ? 19.283  35.956  -9.111  1.00 91.51  ? 99  ASN F N   1 
ATOM   584   C CA  . ASN A 1 80  ? 18.705  36.962  -8.229  1.00 89.97  ? 99  ASN F CA  1 
ATOM   585   C C   . ASN A 1 80  ? 17.905  37.970  -9.045  1.00 89.32  ? 99  ASN F C   1 
ATOM   586   O O   . ASN A 1 80  ? 18.448  38.616  -9.947  1.00 89.90  ? 99  ASN F O   1 
ATOM   587   C CB  . ASN A 1 80  ? 19.809  37.660  -7.442  1.00 89.68  ? 99  ASN F CB  1 
ATOM   588   C CG  . ASN A 1 80  ? 19.548  37.657  -5.957  1.00 90.42  ? 99  ASN F CG  1 
ATOM   589   O OD1 . ASN A 1 80  ? 18.433  37.936  -5.515  1.00 91.27  ? 99  ASN F OD1 1 
ATOM   590   N ND2 . ASN A 1 80  ? 20.573  37.342  -5.174  1.00 85.73  ? 99  ASN F ND2 1 
ATOM   591   N N   . SER A 1 81  ? 16.617  38.102  -8.734  1.00 87.09  ? 100 SER F N   1 
ATOM   592   C CA  . SER A 1 81  ? 15.764  39.048  -9.441  1.00 90.09  ? 100 SER F CA  1 
ATOM   593   C C   . SER A 1 81  ? 14.541  39.354  -8.591  1.00 88.28  ? 100 SER F C   1 
ATOM   594   O O   . SER A 1 81  ? 14.222  38.632  -7.642  1.00 81.21  ? 100 SER F O   1 
ATOM   595   C CB  . SER A 1 81  ? 15.336  38.515  -10.813 1.00 89.14  ? 100 SER F CB  1 
ATOM   596   O OG  . SER A 1 81  ? 14.243  37.622  -10.691 1.00 93.29  ? 100 SER F OG  1 
ATOM   597   N N   . GLY A 1 82  ? 13.859  40.433  -8.954  1.00 92.14  ? 101 GLY F N   1 
ATOM   598   C CA  . GLY A 1 82  ? 12.666  40.868  -8.264  1.00 92.37  ? 101 GLY F CA  1 
ATOM   599   C C   . GLY A 1 82  ? 12.953  41.975  -7.264  1.00 91.25  ? 101 GLY F C   1 
ATOM   600   O O   . GLY A 1 82  ? 14.085  42.183  -6.821  1.00 88.35  ? 101 GLY F O   1 
ATOM   601   N N   . LYS A 1 83  ? 11.899  42.701  -6.911  1.00 91.47  ? 102 LYS F N   1 
ATOM   602   C CA  . LYS A 1 83  ? 11.995  43.744  -5.901  1.00 89.55  ? 102 LYS F CA  1 
ATOM   603   C C   . LYS A 1 83  ? 12.364  43.118  -4.562  1.00 90.52  ? 102 LYS F C   1 
ATOM   604   O O   . LYS A 1 83  ? 11.613  42.271  -4.057  1.00 91.87  ? 102 LYS F O   1 
ATOM   605   C CB  . LYS A 1 83  ? 10.673  44.504  -5.800  1.00 91.21  ? 102 LYS F CB  1 
ATOM   606   C CG  . LYS A 1 83  ? 10.658  45.619  -4.764  1.00 98.71  ? 102 LYS F CG  1 
ATOM   607   C CD  . LYS A 1 83  ? 9.556   46.630  -5.062  1.00 101.25 ? 102 LYS F CD  1 
ATOM   608   C CE  . LYS A 1 83  ? 9.360   47.613  -3.914  1.00 102.35 ? 102 LYS F CE  1 
ATOM   609   N NZ  . LYS A 1 83  ? 10.616  47.894  -3.163  1.00 101.73 ? 102 LYS F NZ  1 
ATOM   610   N N   . PRO A 1 84  ? 13.502  43.477  -3.968  1.00 96.55  ? 103 PRO F N   1 
ATOM   611   C CA  . PRO A 1 84  ? 13.949  42.785  -2.753  1.00 97.64  ? 103 PRO F CA  1 
ATOM   612   C C   . PRO A 1 84  ? 12.971  42.967  -1.601  1.00 97.13  ? 103 PRO F C   1 
ATOM   613   O O   . PRO A 1 84  ? 12.335  44.013  -1.453  1.00 89.63  ? 103 PRO F O   1 
ATOM   614   C CB  . PRO A 1 84  ? 15.303  43.438  -2.449  1.00 99.21  ? 103 PRO F CB  1 
ATOM   615   C CG  . PRO A 1 84  ? 15.751  44.016  -3.756  1.00 96.34  ? 103 PRO F CG  1 
ATOM   616   C CD  . PRO A 1 84  ? 14.493  44.457  -4.442  1.00 96.79  ? 103 PRO F CD  1 
ATOM   617   N N   . TRP A 1 85  ? 12.852  41.913  -0.790  1.00 100.32 ? 104 TRP F N   1 
ATOM   618   C CA  . TRP A 1 85  ? 11.984  41.894  0.389   1.00 98.76  ? 104 TRP F CA  1 
ATOM   619   C C   . TRP A 1 85  ? 10.521  42.153  0.033   1.00 95.20  ? 104 TRP F C   1 
ATOM   620   O O   . TRP A 1 85  ? 9.753   42.662  0.853   1.00 92.09  ? 104 TRP F O   1 
ATOM   621   C CB  . TRP A 1 85  ? 12.466  42.891  1.448   1.00 99.65  ? 104 TRP F CB  1 
ATOM   622   C CG  . TRP A 1 85  ? 13.762  42.487  2.078   1.00 100.17 ? 104 TRP F CG  1 
ATOM   623   C CD1 . TRP A 1 85  ? 14.990  42.467  1.485   1.00 94.16  ? 104 TRP F CD1 1 
ATOM   624   C CD2 . TRP A 1 85  ? 13.958  42.023  3.421   1.00 110.84 ? 104 TRP F CD2 1 
ATOM   625   N NE1 . TRP A 1 85  ? 15.940  42.027  2.375   1.00 100.36 ? 104 TRP F NE1 1 
ATOM   626   C CE2 . TRP A 1 85  ? 15.332  41.748  3.572   1.00 110.35 ? 104 TRP F CE2 1 
ATOM   627   C CE3 . TRP A 1 85  ? 13.105  41.817  4.512   1.00 112.53 ? 104 TRP F CE3 1 
ATOM   628   C CZ2 . TRP A 1 85  ? 15.875  41.279  4.770   1.00 110.92 ? 104 TRP F CZ2 1 
ATOM   629   C CZ3 . TRP A 1 85  ? 13.645  41.350  5.701   1.00 107.19 ? 104 TRP F CZ3 1 
ATOM   630   C CH2 . TRP A 1 85  ? 15.017  41.087  5.819   1.00 107.28 ? 104 TRP F CH2 1 
ATOM   631   N N   . ALA A 1 86  ? 10.122  41.800  -1.192  1.00 91.56  ? 105 ALA F N   1 
ATOM   632   C CA  . ALA A 1 86  ? 8.740   41.927  -1.628  1.00 91.16  ? 105 ALA F CA  1 
ATOM   633   C C   . ALA A 1 86  ? 8.006   40.599  -1.705  1.00 89.43  ? 105 ALA F C   1 
ATOM   634   O O   . ALA A 1 86  ? 6.771   40.593  -1.668  1.00 83.83  ? 105 ALA F O   1 
ATOM   635   C CB  . ALA A 1 86  ? 8.667   42.612  -3.000  1.00 93.46  ? 105 ALA F CB  1 
ATOM   636   N N   . GLY A 1 87  ? 8.727   39.490  -1.818  1.00 86.37  ? 106 GLY F N   1 
ATOM   637   C CA  . GLY A 1 87  ? 8.100   38.188  -1.800  1.00 88.64  ? 106 GLY F CA  1 
ATOM   638   C C   . GLY A 1 87  ? 7.559   37.842  -0.427  1.00 86.29  ? 106 GLY F C   1 
ATOM   639   O O   . GLY A 1 87  ? 7.886   38.460  0.588   1.00 93.15  ? 106 GLY F O   1 
ATOM   640   N N   . ALA A 1 88  ? 6.700   36.828  -0.403  1.00 81.43  ? 107 ALA F N   1 
ATOM   641   C CA  . ALA A 1 88  ? 6.115   36.381  0.853   1.00 82.44  ? 107 ALA F CA  1 
ATOM   642   C C   . ALA A 1 88  ? 7.194   35.820  1.772   1.00 85.17  ? 107 ALA F C   1 
ATOM   643   O O   . ALA A 1 88  ? 8.241   35.345  1.322   1.00 89.54  ? 107 ALA F O   1 
ATOM   644   C CB  . ALA A 1 88  ? 5.039   35.328  0.594   1.00 82.65  ? 107 ALA F CB  1 
ATOM   645   N N   . GLU A 1 89  ? 6.934   35.883  3.075   1.00 87.02  ? 108 GLU F N   1 
ATOM   646   C CA  . GLU A 1 89  ? 7.878   35.403  4.073   1.00 91.07  ? 108 GLU F CA  1 
ATOM   647   C C   . GLU A 1 89  ? 7.121   34.672  5.173   1.00 88.56  ? 108 GLU F C   1 
ATOM   648   O O   . GLU A 1 89  ? 5.895   34.770  5.286   1.00 82.37  ? 108 GLU F O   1 
ATOM   649   C CB  . GLU A 1 89  ? 8.703   36.554  4.663   1.00 97.47  ? 108 GLU F CB  1 
ATOM   650   C CG  . GLU A 1 89  ? 9.969   36.881  3.886   1.00 100.43 ? 108 GLU F CG  1 
ATOM   651   C CD  . GLU A 1 89  ? 10.630  38.164  4.362   1.00 101.56 ? 108 GLU F CD  1 
ATOM   652   O OE1 . GLU A 1 89  ? 10.515  38.484  5.566   1.00 97.87  ? 108 GLU F OE1 1 
ATOM   653   O OE2 . GLU A 1 89  ? 11.254  38.856  3.530   1.00 102.64 ? 108 GLU F OE2 1 
ATOM   654   N N   . ASN A 1 90  ? 7.878   33.934  5.989   1.00 83.46  ? 109 ASN F N   1 
ATOM   655   C CA  . ASN A 1 90  ? 7.337   33.213  7.143   1.00 86.88  ? 109 ASN F CA  1 
ATOM   656   C C   . ASN A 1 90  ? 6.252   32.224  6.720   1.00 87.89  ? 109 ASN F C   1 
ATOM   657   O O   . ASN A 1 90  ? 5.228   32.072  7.391   1.00 89.25  ? 109 ASN F O   1 
ATOM   658   C CB  . ASN A 1 90  ? 6.804   34.181  8.205   1.00 91.71  ? 109 ASN F CB  1 
ATOM   659   C CG  . ASN A 1 90  ? 7.900   34.732  9.106   1.00 93.97  ? 109 ASN F CG  1 
ATOM   660   O OD1 . ASN A 1 90  ? 8.847   35.369  8.639   1.00 95.50  ? 109 ASN F OD1 1 
ATOM   661   N ND2 . ASN A 1 90  ? 7.771   34.491  10.408  1.00 92.15  ? 109 ASN F ND2 1 
ATOM   662   N N   . LEU A 1 91  ? 6.477   31.548  5.595   1.00 74.37  ? 110 LEU F N   1 
ATOM   663   C CA  . LEU A 1 91  ? 5.516   30.581  5.080   1.00 71.69  ? 110 LEU F CA  1 
ATOM   664   C C   . LEU A 1 91  ? 5.594   29.299  5.899   1.00 71.48  ? 110 LEU F C   1 
ATOM   665   O O   . LEU A 1 91  ? 6.663   28.686  6.000   1.00 71.10  ? 110 LEU F O   1 
ATOM   666   C CB  . LEU A 1 91  ? 5.786   30.299  3.604   1.00 72.02  ? 110 LEU F CB  1 
ATOM   667   C CG  . LEU A 1 91  ? 4.879   29.279  2.913   1.00 72.58  ? 110 LEU F CG  1 
ATOM   668   C CD1 . LEU A 1 91  ? 4.543   29.756  1.528   1.00 73.15  ? 110 LEU F CD1 1 
ATOM   669   C CD2 . LEU A 1 91  ? 5.540   27.926  2.832   1.00 72.42  ? 110 LEU F CD2 1 
ATOM   670   N N   . THR A 1 92  ? 4.467   28.895  6.485   1.00 70.99  ? 111 THR F N   1 
ATOM   671   C CA  . THR A 1 92  ? 4.380   27.632  7.208   1.00 72.95  ? 111 THR F CA  1 
ATOM   672   C C   . THR A 1 92  ? 3.088   26.925  6.834   1.00 73.46  ? 111 THR F C   1 
ATOM   673   O O   . THR A 1 92  ? 2.020   27.545  6.811   1.00 70.68  ? 111 THR F O   1 
ATOM   674   C CB  . THR A 1 92  ? 4.434   27.839  8.725   1.00 70.81  ? 111 THR F CB  1 
ATOM   675   O OG1 . THR A 1 92  ? 3.694   29.014  9.073   1.00 70.57  ? 111 THR F OG1 1 
ATOM   676   C CG2 . THR A 1 92  ? 5.875   27.980  9.195   1.00 71.65  ? 111 THR F CG2 1 
ATOM   677   N N   . CYS A 1 93  ? 3.190   25.630  6.549   1.00 69.92  ? 112 CYS F N   1 
ATOM   678   C CA  . CYS A 1 93  ? 2.042   24.815  6.189   1.00 68.21  ? 112 CYS F CA  1 
ATOM   679   C C   . CYS A 1 93  ? 1.914   23.649  7.157   1.00 68.05  ? 112 CYS F C   1 
ATOM   680   O O   . CYS A 1 93  ? 2.911   23.120  7.658   1.00 70.20  ? 112 CYS F O   1 
ATOM   681   C CB  . CYS A 1 93  ? 2.156   24.297  4.758   1.00 70.00  ? 112 CYS F CB  1 
ATOM   682   S SG  . CYS A 1 93  ? 2.290   25.621  3.544   1.00 77.27  ? 112 CYS F SG  1 
ATOM   683   N N   . TRP A 1 94  ? 0.671   23.254  7.410   1.00 65.60  ? 113 TRP F N   1 
ATOM   684   C CA  . TRP A 1 94  ? 0.380   22.230  8.399   1.00 65.58  ? 113 TRP F CA  1 
ATOM   685   C C   . TRP A 1 94  ? -0.946  21.567  8.055   1.00 66.33  ? 113 TRP F C   1 
ATOM   686   O O   . TRP A 1 94  ? -1.871  22.226  7.573   1.00 66.84  ? 113 TRP F O   1 
ATOM   687   C CB  . TRP A 1 94  ? 0.337   22.826  9.812   1.00 65.29  ? 113 TRP F CB  1 
ATOM   688   C CG  . TRP A 1 94  ? -0.860  23.694  10.064  1.00 65.75  ? 113 TRP F CG  1 
ATOM   689   C CD1 . TRP A 1 94  ? -2.014  23.335  10.698  1.00 66.24  ? 113 TRP F CD1 1 
ATOM   690   C CD2 . TRP A 1 94  ? -1.020  25.069  9.693   1.00 65.81  ? 113 TRP F CD2 1 
ATOM   691   N NE1 . TRP A 1 94  ? -2.885  24.398  10.739  1.00 66.79  ? 113 TRP F NE1 1 
ATOM   692   C CE2 . TRP A 1 94  ? -2.297  25.475  10.129  1.00 66.35  ? 113 TRP F CE2 1 
ATOM   693   C CE3 . TRP A 1 94  ? -0.207  25.996  9.031   1.00 65.50  ? 113 TRP F CE3 1 
ATOM   694   C CZ2 . TRP A 1 94  ? -2.781  26.766  9.925   1.00 66.57  ? 113 TRP F CZ2 1 
ATOM   695   C CZ3 . TRP A 1 94  ? -0.690  27.278  8.829   1.00 65.71  ? 113 TRP F CZ3 1 
ATOM   696   C CH2 . TRP A 1 94  ? -1.963  27.650  9.276   1.00 66.23  ? 113 TRP F CH2 1 
ATOM   697   N N   . ILE A 1 95  ? -1.024  20.264  8.291   1.00 66.42  ? 114 ILE F N   1 
ATOM   698   C CA  . ILE A 1 95  ? -2.263  19.515  8.135   1.00 67.14  ? 114 ILE F CA  1 
ATOM   699   C C   . ILE A 1 95  ? -2.963  19.473  9.481   1.00 67.23  ? 114 ILE F C   1 
ATOM   700   O O   . ILE A 1 95  ? -2.337  19.190  10.508  1.00 66.75  ? 114 ILE F O   1 
ATOM   701   C CB  . ILE A 1 95  ? -1.989  18.097  7.614   1.00 67.25  ? 114 ILE F CB  1 
ATOM   702   C CG1 . ILE A 1 95  ? -1.270  18.165  6.273   1.00 67.20  ? 114 ILE F CG1 1 
ATOM   703   C CG2 . ILE A 1 95  ? -3.277  17.314  7.486   1.00 68.03  ? 114 ILE F CG2 1 
ATOM   704   C CD1 . ILE A 1 95  ? -0.496  16.936  5.974   1.00 67.03  ? 114 ILE F CD1 1 
ATOM   705   N N   . HIS A 1 96  ? -4.260  19.759  9.485   1.00 67.91  ? 115 HIS F N   1 
ATOM   706   C CA  . HIS A 1 96  ? -4.994  19.835  10.737  1.00 68.09  ? 115 HIS F CA  1 
ATOM   707   C C   . HIS A 1 96  ? -6.320  19.109  10.598  1.00 68.95  ? 115 HIS F C   1 
ATOM   708   O O   . HIS A 1 96  ? -6.789  18.826  9.493   1.00 69.45  ? 115 HIS F O   1 
ATOM   709   C CB  . HIS A 1 96  ? -5.207  21.289  11.175  1.00 68.02  ? 115 HIS F CB  1 
ATOM   710   C CG  . HIS A 1 96  ? -5.879  22.139  10.146  1.00 68.51  ? 115 HIS F CG  1 
ATOM   711   N ND1 . HIS A 1 96  ? -7.218  22.025  9.843   1.00 69.37  ? 115 HIS F ND1 1 
ATOM   712   C CD2 . HIS A 1 96  ? -5.392  23.110  9.338   1.00 68.31  ? 115 HIS F CD2 1 
ATOM   713   C CE1 . HIS A 1 96  ? -7.530  22.897  8.902   1.00 69.67  ? 115 HIS F CE1 1 
ATOM   714   N NE2 . HIS A 1 96  ? -6.438  23.563  8.573   1.00 69.03  ? 115 HIS F NE2 1 
ATOM   715   N N   . ASP A 1 97  ? -6.920  18.822  11.752  1.00 72.68  ? 116 ASP F N   1 
ATOM   716   C CA  . ASP A 1 97  ? -8.085  17.952  11.836  1.00 75.32  ? 116 ASP F CA  1 
ATOM   717   C C   . ASP A 1 97  ? -7.750  16.617  11.182  1.00 74.21  ? 116 ASP F C   1 
ATOM   718   O O   . ASP A 1 97  ? -7.012  15.814  11.762  1.00 75.86  ? 116 ASP F O   1 
ATOM   719   C CB  . ASP A 1 97  ? -9.307  18.620  11.205  1.00 77.38  ? 116 ASP F CB  1 
ATOM   720   C CG  . ASP A 1 97  ? -9.868  19.728  12.080  1.00 82.58  ? 116 ASP F CG  1 
ATOM   721   O OD1 . ASP A 1 97  ? -10.645 19.415  13.008  1.00 79.17  ? 116 ASP F OD1 1 
ATOM   722   O OD2 . ASP A 1 97  ? -9.525  20.908  11.849  1.00 94.50  ? 116 ASP F OD2 1 
ATOM   723   N N   . VAL A 1 98  ? -8.257  16.364  9.978   1.00 70.52  ? 117 VAL F N   1 
ATOM   724   C CA  . VAL A 1 98  ? -7.887  15.138  9.278   1.00 70.85  ? 117 VAL F CA  1 
ATOM   725   C C   . VAL A 1 98  ? -7.593  15.436  7.815   1.00 72.14  ? 117 VAL F C   1 
ATOM   726   O O   . VAL A 1 98  ? -6.512  15.118  7.309   1.00 71.26  ? 117 VAL F O   1 
ATOM   727   C CB  . VAL A 1 98  ? -8.985  14.064  9.391   1.00 74.64  ? 117 VAL F CB  1 
ATOM   728   C CG1 . VAL A 1 98  ? -8.637  12.867  8.523   1.00 78.48  ? 117 VAL F CG1 1 
ATOM   729   C CG2 . VAL A 1 98  ? -9.173  13.628  10.826  1.00 77.52  ? 117 VAL F CG2 1 
ATOM   730   N N   . ASP A 1 99  ? -8.556  16.050  7.130   1.00 76.09  ? 118 ASP F N   1 
ATOM   731   C CA  . ASP A 1 99  ? -8.573  16.135  5.676   1.00 78.63  ? 118 ASP F CA  1 
ATOM   732   C C   . ASP A 1 99  ? -8.169  17.508  5.150   1.00 75.29  ? 118 ASP F C   1 
ATOM   733   O O   . ASP A 1 99  ? -8.392  17.799  3.972   1.00 73.10  ? 118 ASP F O   1 
ATOM   734   C CB  . ASP A 1 99  ? -9.969  15.774  5.165   1.00 76.92  ? 118 ASP F CB  1 
ATOM   735   C CG  . ASP A 1 99  ? -10.280 14.303  5.318   1.00 76.60  ? 118 ASP F CG  1 
ATOM   736   O OD1 . ASP A 1 99  ? -9.333  13.516  5.498   1.00 73.45  ? 118 ASP F OD1 1 
ATOM   737   O OD2 . ASP A 1 99  ? -11.474 13.937  5.283   1.00 80.31  ? 118 ASP F OD2 1 
ATOM   738   N N   . PHE A 1 100 ? -7.574  18.352  5.987   1.00 70.77  ? 119 PHE F N   1 
ATOM   739   C CA  . PHE A 1 100 ? -7.363  19.757  5.663   1.00 70.58  ? 119 PHE F CA  1 
ATOM   740   C C   . PHE A 1 100 ? -5.885  20.105  5.719   1.00 69.65  ? 119 PHE F C   1 
ATOM   741   O O   . PHE A 1 100 ? -5.208  19.793  6.705   1.00 69.04  ? 119 PHE F O   1 
ATOM   742   C CB  . PHE A 1 100 ? -8.132  20.645  6.637   1.00 70.73  ? 119 PHE F CB  1 
ATOM   743   C CG  . PHE A 1 100 ? -9.611  20.614  6.444   1.00 72.69  ? 119 PHE F CG  1 
ATOM   744   C CD1 . PHE A 1 100 ? -10.186 21.176  5.317   1.00 77.20  ? 119 PHE F CD1 1 
ATOM   745   C CD2 . PHE A 1 100 ? -10.427 20.002  7.377   1.00 72.10  ? 119 PHE F CD2 1 
ATOM   746   C CE1 . PHE A 1 100 ? -11.554 21.144  5.134   1.00 78.83  ? 119 PHE F CE1 1 
ATOM   747   C CE2 . PHE A 1 100 ? -11.792 19.962  7.201   1.00 75.13  ? 119 PHE F CE2 1 
ATOM   748   C CZ  . PHE A 1 100 ? -12.358 20.534  6.078   1.00 82.33  ? 119 PHE F CZ  1 
ATOM   749   N N   . LEU A 1 101 ? -5.396  20.773  4.676   1.00 69.60  ? 120 LEU F N   1 
ATOM   750   C CA  . LEU A 1 101 ? -4.052  21.340  4.690   1.00 68.80  ? 120 LEU F CA  1 
ATOM   751   C C   . LEU A 1 101 ? -4.177  22.856  4.683   1.00 68.75  ? 120 LEU F C   1 
ATOM   752   O O   . LEU A 1 101 ? -5.050  23.400  4.012   1.00 69.39  ? 120 LEU F O   1 
ATOM   753   C CB  . LEU A 1 101 ? -3.230  20.867  3.486   1.00 68.75  ? 120 LEU F CB  1 
ATOM   754   C CG  . LEU A 1 101 ? -1.872  21.540  3.263   1.00 68.06  ? 120 LEU F CG  1 
ATOM   755   C CD1 . LEU A 1 101 ? -0.991  21.381  4.483   1.00 67.27  ? 120 LEU F CD1 1 
ATOM   756   C CD2 . LEU A 1 101 ? -1.180  20.959  2.051   1.00 68.17  ? 120 LEU F CD2 1 
ATOM   757   N N   . SER A 1 102 ? -3.331  23.547  5.439   1.00 68.03  ? 121 SER F N   1 
ATOM   758   C CA  . SER A 1 102 ? -3.448  24.996  5.509   1.00 67.98  ? 121 SER F CA  1 
ATOM   759   C C   . SER A 1 102 ? -2.070  25.632  5.527   1.00 68.54  ? 121 SER F C   1 
ATOM   760   O O   . SER A 1 102 ? -1.158  25.145  6.199   1.00 72.37  ? 121 SER F O   1 
ATOM   761   C CB  . SER A 1 102 ? -4.239  25.431  6.744   1.00 68.07  ? 121 SER F CB  1 
ATOM   762   O OG  . SER A 1 102 ? -5.468  24.737  6.816   1.00 68.78  ? 121 SER F OG  1 
ATOM   763   N N   . CYS A 1 103 ? -1.931  26.731  4.796   1.00 73.28  ? 122 CYS F N   1 
ATOM   764   C CA  . CYS A 1 103 ? -0.681  27.466  4.713   1.00 74.83  ? 122 CYS F CA  1 
ATOM   765   C C   . CYS A 1 103 ? -0.906  28.905  5.149   1.00 74.65  ? 122 CYS F C   1 
ATOM   766   O O   . CYS A 1 103 ? -1.983  29.469  4.945   1.00 78.00  ? 122 CYS F O   1 
ATOM   767   C CB  . CYS A 1 103 ? -0.114  27.436  3.290   1.00 75.60  ? 122 CYS F CB  1 
ATOM   768   S SG  . CYS A 1 103 ? 0.429   25.802  2.745   1.00 78.71  ? 122 CYS F SG  1 
ATOM   769   N N   . SER A 1 104 ? 0.120   29.496  5.753   1.00 75.22  ? 123 SER F N   1 
ATOM   770   C CA  . SER A 1 104 ? 0.033   30.887  6.171   1.00 72.57  ? 123 SER F CA  1 
ATOM   771   C C   . SER A 1 104 ? 1.403   31.527  6.031   1.00 71.73  ? 123 SER F C   1 
ATOM   772   O O   . SER A 1 104 ? 2.404   30.962  6.484   1.00 69.52  ? 123 SER F O   1 
ATOM   773   C CB  . SER A 1 104 ? -0.469  31.004  7.613   1.00 72.76  ? 123 SER F CB  1 
ATOM   774   O OG  . SER A 1 104 ? 0.561   30.696  8.535   1.00 73.25  ? 123 SER F OG  1 
ATOM   775   N N   . TRP A 1 105 ? 1.439   32.696  5.394   1.00 77.10  ? 124 TRP F N   1 
ATOM   776   C CA  . TRP A 1 105 ? 2.668   33.462  5.238   1.00 78.36  ? 124 TRP F CA  1 
ATOM   777   C C   . TRP A 1 105 ? 2.430   34.906  5.655   1.00 79.50  ? 124 TRP F C   1 
ATOM   778   O O   . TRP A 1 105 ? 1.354   35.240  6.160   1.00 83.35  ? 124 TRP F O   1 
ATOM   779   C CB  . TRP A 1 105 ? 3.167   33.401  3.793   1.00 77.16  ? 124 TRP F CB  1 
ATOM   780   C CG  . TRP A 1 105 ? 2.151   33.860  2.795   1.00 75.73  ? 124 TRP F CG  1 
ATOM   781   C CD1 . TRP A 1 105 ? 2.046   35.102  2.245   1.00 77.20  ? 124 TRP F CD1 1 
ATOM   782   C CD2 . TRP A 1 105 ? 1.089   33.083  2.232   1.00 77.06  ? 124 TRP F CD2 1 
ATOM   783   N NE1 . TRP A 1 105 ? 0.988   35.147  1.372   1.00 76.04  ? 124 TRP F NE1 1 
ATOM   784   C CE2 . TRP A 1 105 ? 0.383   33.919  1.347   1.00 76.24  ? 124 TRP F CE2 1 
ATOM   785   C CE3 . TRP A 1 105 ? 0.667   31.760  2.391   1.00 79.67  ? 124 TRP F CE3 1 
ATOM   786   C CZ2 . TRP A 1 105 ? -0.721  33.477  0.623   1.00 77.82  ? 124 TRP F CZ2 1 
ATOM   787   C CZ3 . TRP A 1 105 ? -0.429  31.324  1.672   1.00 78.43  ? 124 TRP F CZ3 1 
ATOM   788   C CH2 . TRP A 1 105 ? -1.109  32.179  0.799   1.00 77.78  ? 124 TRP F CH2 1 
ATOM   789   N N   . ALA A 1 106 ? 3.421   35.768  5.453   1.00 81.21  ? 125 ALA F N   1 
ATOM   790   C CA  . ALA A 1 106 ? 3.287   37.188  5.739   1.00 86.72  ? 125 ALA F CA  1 
ATOM   791   C C   . ALA A 1 106 ? 3.689   37.979  4.505   1.00 84.52  ? 125 ALA F C   1 
ATOM   792   O O   . ALA A 1 106 ? 4.649   37.620  3.816   1.00 82.42  ? 125 ALA F O   1 
ATOM   793   C CB  . ALA A 1 106 ? 4.144   37.605  6.941   1.00 92.24  ? 125 ALA F CB  1 
ATOM   794   N N   . VAL A 1 107 ? 2.943   39.048  4.223   1.00 80.42  ? 126 VAL F N   1 
ATOM   795   C CA  . VAL A 1 107 ? 3.224   39.863  3.048   1.00 82.46  ? 126 VAL F CA  1 
ATOM   796   C C   . VAL A 1 107 ? 4.561   40.565  3.231   1.00 79.98  ? 126 VAL F C   1 
ATOM   797   O O   . VAL A 1 107 ? 4.836   41.148  4.288   1.00 77.39  ? 126 VAL F O   1 
ATOM   798   C CB  . VAL A 1 107 ? 2.085   40.863  2.798   1.00 85.55  ? 126 VAL F CB  1 
ATOM   799   C CG1 . VAL A 1 107 ? 1.716   41.588  4.084   1.00 88.19  ? 126 VAL F CG1 1 
ATOM   800   C CG2 . VAL A 1 107 ? 2.471   41.850  1.706   1.00 84.19  ? 126 VAL F CG2 1 
ATOM   801   N N   . GLY A 1 108 ? 5.407   40.495  2.205   1.00 84.55  ? 127 GLY F N   1 
ATOM   802   C CA  . GLY A 1 108 ? 6.746   41.029  2.266   1.00 88.36  ? 127 GLY F CA  1 
ATOM   803   C C   . GLY A 1 108 ? 6.780   42.490  2.660   1.00 93.00  ? 127 GLY F C   1 
ATOM   804   O O   . GLY A 1 108 ? 5.927   43.288  2.258   1.00 93.86  ? 127 GLY F O   1 
ATOM   805   N N   . PRO A 1 109 ? 7.778   42.869  3.465   1.00 96.19  ? 128 PRO F N   1 
ATOM   806   C CA  . PRO A 1 109 ? 7.829   44.260  3.942   1.00 93.92  ? 128 PRO F CA  1 
ATOM   807   C C   . PRO A 1 109 ? 8.087   45.266  2.836   1.00 91.60  ? 128 PRO F C   1 
ATOM   808   O O   . PRO A 1 109 ? 7.482   46.345  2.837   1.00 92.58  ? 128 PRO F O   1 
ATOM   809   C CB  . PRO A 1 109 ? 8.970   44.231  4.969   1.00 97.04  ? 128 PRO F CB  1 
ATOM   810   C CG  . PRO A 1 109 ? 9.843   43.107  4.519   1.00 98.68  ? 128 PRO F CG  1 
ATOM   811   C CD  . PRO A 1 109 ? 8.916   42.069  3.950   1.00 97.73  ? 128 PRO F CD  1 
ATOM   812   N N   . GLY A 1 110 ? 8.968   44.947  1.891   1.00 88.54  ? 129 GLY F N   1 
ATOM   813   C CA  . GLY A 1 110 ? 9.261   45.854  0.800   1.00 90.14  ? 129 GLY F CA  1 
ATOM   814   C C   . GLY A 1 110 ? 8.403   45.607  -0.424  1.00 90.23  ? 129 GLY F C   1 
ATOM   815   O O   . GLY A 1 110 ? 8.902   45.626  -1.552  1.00 91.61  ? 129 GLY F O   1 
ATOM   816   N N   . ALA A 1 111 ? 7.108   45.376  -0.214  1.00 88.80  ? 130 ALA F N   1 
ATOM   817   C CA  . ALA A 1 111 ? 6.188   45.102  -1.300  1.00 88.24  ? 130 ALA F CA  1 
ATOM   818   C C   . ALA A 1 111 ? 5.100   46.166  -1.363  1.00 88.44  ? 130 ALA F C   1 
ATOM   819   O O   . ALA A 1 111 ? 4.592   46.593  -0.320  1.00 93.48  ? 130 ALA F O   1 
ATOM   820   C CB  . ALA A 1 111 ? 5.539   43.721  -1.135  1.00 90.24  ? 130 ALA F CB  1 
ATOM   821   N N   . PRO A 1 112 ? 4.721   46.611  -2.558  1.00 87.78  ? 131 PRO F N   1 
ATOM   822   C CA  . PRO A 1 112 ? 3.660   47.618  -2.674  1.00 89.87  ? 131 PRO F CA  1 
ATOM   823   C C   . PRO A 1 112 ? 2.316   47.056  -2.240  1.00 92.36  ? 131 PRO F C   1 
ATOM   824   O O   . PRO A 1 112 ? 2.129   45.849  -2.086  1.00 102.16 ? 131 PRO F O   1 
ATOM   825   C CB  . PRO A 1 112 ? 3.657   47.960  -4.166  1.00 91.26  ? 131 PRO F CB  1 
ATOM   826   C CG  . PRO A 1 112 ? 4.225   46.741  -4.826  1.00 88.52  ? 131 PRO F CG  1 
ATOM   827   C CD  . PRO A 1 112 ? 5.266   46.231  -3.873  1.00 86.38  ? 131 PRO F CD  1 
ATOM   828   N N   . ALA A 1 113 ? 1.357   47.967  -2.047  1.00 94.76  ? 132 ALA F N   1 
ATOM   829   C CA  . ALA A 1 113 ? -0.030  47.549  -1.885  1.00 97.85  ? 132 ALA F CA  1 
ATOM   830   C C   . ALA A 1 113 ? -0.578  46.916  -3.155  1.00 97.82  ? 132 ALA F C   1 
ATOM   831   O O   . ALA A 1 113 ? -1.674  46.343  -3.128  1.00 102.09 ? 132 ALA F O   1 
ATOM   832   C CB  . ALA A 1 113 ? -0.898  48.739  -1.472  1.00 97.88  ? 132 ALA F CB  1 
ATOM   833   N N   . ASP A 1 114 ? 0.168   47.008  -4.257  1.00 92.72  ? 133 ASP F N   1 
ATOM   834   C CA  . ASP A 1 114 ? -0.222  46.374  -5.509  1.00 93.11  ? 133 ASP F CA  1 
ATOM   835   C C   . ASP A 1 114 ? -0.210  44.853  -5.401  1.00 95.86  ? 133 ASP F C   1 
ATOM   836   O O   . ASP A 1 114 ? -1.044  44.183  -6.021  1.00 103.49 ? 133 ASP F O   1 
ATOM   837   C CB  . ASP A 1 114 ? 0.733   46.836  -6.613  1.00 94.13  ? 133 ASP F CB  1 
ATOM   838   C CG  . ASP A 1 114 ? 0.191   46.602  -8.008  1.00 94.02  ? 133 ASP F CG  1 
ATOM   839   O OD1 . ASP A 1 114 ? -0.694  45.740  -8.181  1.00 94.77  ? 133 ASP F OD1 1 
ATOM   840   O OD2 . ASP A 1 114 ? 0.672   47.277  -8.944  1.00 92.42  ? 133 ASP F OD2 1 
ATOM   841   N N   . VAL A 1 115 ? 0.707   44.296  -4.603  1.00 92.20  ? 134 VAL F N   1 
ATOM   842   C CA  . VAL A 1 115 ? 1.023   42.874  -4.702  1.00 88.50  ? 134 VAL F CA  1 
ATOM   843   C C   . VAL A 1 115 ? -0.192  42.005  -4.409  1.00 86.98  ? 134 VAL F C   1 
ATOM   844   O O   . VAL A 1 115 ? -1.088  42.371  -3.636  1.00 89.08  ? 134 VAL F O   1 
ATOM   845   C CB  . VAL A 1 115 ? 2.175   42.482  -3.761  1.00 89.30  ? 134 VAL F CB  1 
ATOM   846   C CG1 . VAL A 1 115 ? 3.438   43.231  -4.118  1.00 95.62  ? 134 VAL F CG1 1 
ATOM   847   C CG2 . VAL A 1 115 ? 1.783   42.701  -2.304  1.00 86.88  ? 134 VAL F CG2 1 
ATOM   848   N N   . GLN A 1 116 ? -0.217  40.839  -5.050  1.00 83.66  ? 135 GLN F N   1 
ATOM   849   C CA  . GLN A 1 116 ? -1.091  39.743  -4.666  1.00 83.54  ? 135 GLN F CA  1 
ATOM   850   C C   . GLN A 1 116 ? -0.285  38.457  -4.758  1.00 83.39  ? 135 GLN F C   1 
ATOM   851   O O   . GLN A 1 116 ? 0.682   38.375  -5.515  1.00 80.72  ? 135 GLN F O   1 
ATOM   852   C CB  . GLN A 1 116 ? -2.348  39.668  -5.545  1.00 86.38  ? 135 GLN F CB  1 
ATOM   853   C CG  . GLN A 1 116 ? -3.429  38.709  -5.044  1.00 89.39  ? 135 GLN F CG  1 
ATOM   854   C CD  . GLN A 1 116 ? -3.993  39.093  -3.687  1.00 88.81  ? 135 GLN F CD  1 
ATOM   855   O OE1 . GLN A 1 116 ? -3.305  39.024  -2.668  1.00 88.53  ? 135 GLN F OE1 1 
ATOM   856   N NE2 . GLN A 1 116 ? -5.256  39.507  -3.669  1.00 93.58  ? 135 GLN F NE2 1 
ATOM   857   N N   . TYR A 1 117 ? -0.666  37.457  -3.972  1.00 80.76  ? 136 TYR F N   1 
ATOM   858   C CA  . TYR A 1 117 ? 0.101   36.224  -3.876  1.00 78.02  ? 136 TYR F CA  1 
ATOM   859   C C   . TYR A 1 117 ? -0.729  35.046  -4.360  1.00 81.00  ? 136 TYR F C   1 
ATOM   860   O O   . TYR A 1 117 ? -1.900  34.913  -3.991  1.00 76.82  ? 136 TYR F O   1 
ATOM   861   C CB  . TYR A 1 117 ? 0.573   35.992  -2.443  1.00 77.02  ? 136 TYR F CB  1 
ATOM   862   C CG  . TYR A 1 117 ? 1.609   36.988  -1.982  1.00 75.81  ? 136 TYR F CG  1 
ATOM   863   C CD1 . TYR A 1 117 ? 2.901   36.954  -2.488  1.00 75.22  ? 136 TYR F CD1 1 
ATOM   864   C CD2 . TYR A 1 117 ? 1.299   37.957  -1.040  1.00 75.42  ? 136 TYR F CD2 1 
ATOM   865   C CE1 . TYR A 1 117 ? 3.855   37.857  -2.068  1.00 78.95  ? 136 TYR F CE1 1 
ATOM   866   C CE2 . TYR A 1 117 ? 2.246   38.867  -0.615  1.00 79.14  ? 136 TYR F CE2 1 
ATOM   867   C CZ  . TYR A 1 117 ? 3.522   38.812  -1.132  1.00 79.97  ? 136 TYR F CZ  1 
ATOM   868   O OH  . TYR A 1 117 ? 4.469   39.716  -0.711  1.00 83.44  ? 136 TYR F OH  1 
ATOM   869   N N   . ASP A 1 118 ? -0.118  34.195  -5.183  1.00 81.84  ? 137 ASP F N   1 
ATOM   870   C CA  . ASP A 1 118 ? -0.735  32.968  -5.668  1.00 79.73  ? 137 ASP F CA  1 
ATOM   871   C C   . ASP A 1 118 ? 0.051   31.776  -5.141  1.00 75.94  ? 137 ASP F C   1 
ATOM   872   O O   . ASP A 1 118 ? 1.281   31.731  -5.274  1.00 74.78  ? 137 ASP F O   1 
ATOM   873   C CB  . ASP A 1 118 ? -0.780  32.935  -7.198  1.00 82.35  ? 137 ASP F CB  1 
ATOM   874   C CG  . ASP A 1 118 ? -1.771  33.924  -7.776  1.00 82.99  ? 137 ASP F CG  1 
ATOM   875   O OD1 . ASP A 1 118 ? -2.902  34.004  -7.252  1.00 81.92  ? 137 ASP F OD1 1 
ATOM   876   O OD2 . ASP A 1 118 ? -1.427  34.606  -8.765  1.00 76.91  ? 137 ASP F OD2 1 
ATOM   877   N N   . LEU A 1 119 ? -0.658  30.815  -4.552  1.00 71.94  ? 138 LEU F N   1 
ATOM   878   C CA  . LEU A 1 119 ? -0.055  29.619  -3.981  1.00 71.44  ? 138 LEU F CA  1 
ATOM   879   C C   . LEU A 1 119 ? -0.339  28.424  -4.882  1.00 72.05  ? 138 LEU F C   1 
ATOM   880   O O   . LEU A 1 119 ? -1.484  28.205  -5.291  1.00 72.80  ? 138 LEU F O   1 
ATOM   881   C CB  . LEU A 1 119 ? -0.582  29.359  -2.566  1.00 71.07  ? 138 LEU F CB  1 
ATOM   882   C CG  . LEU A 1 119 ? -0.008  28.182  -1.768  1.00 71.67  ? 138 LEU F CG  1 
ATOM   883   C CD1 . LEU A 1 119 ? -0.078  28.465  -0.281  1.00 71.84  ? 138 LEU F CD1 1 
ATOM   884   C CD2 . LEU A 1 119 ? -0.726  26.885  -2.076  1.00 73.13  ? 138 LEU F CD2 1 
ATOM   885   N N   . TYR A 1 120 ? 0.702   27.648  -5.170  1.00 69.81  ? 139 TYR F N   1 
ATOM   886   C CA  . TYR A 1 120 ? 0.608   26.447  -5.984  1.00 70.32  ? 139 TYR F CA  1 
ATOM   887   C C   . TYR A 1 120 ? 1.252   25.290  -5.233  1.00 70.80  ? 139 TYR F C   1 
ATOM   888   O O   . TYR A 1 120 ? 2.342   25.438  -4.669  1.00 72.03  ? 139 TYR F O   1 
ATOM   889   C CB  . TYR A 1 120 ? 1.285   26.647  -7.341  1.00 70.71  ? 139 TYR F CB  1 
ATOM   890   C CG  . TYR A 1 120 ? 0.756   27.828  -8.115  1.00 71.29  ? 139 TYR F CG  1 
ATOM   891   C CD1 . TYR A 1 120 ? -0.484  27.778  -8.733  1.00 72.53  ? 139 TYR F CD1 1 
ATOM   892   C CD2 . TYR A 1 120 ? 1.496   28.997  -8.223  1.00 70.97  ? 139 TYR F CD2 1 
ATOM   893   C CE1 . TYR A 1 120 ? -0.970  28.854  -9.441  1.00 75.74  ? 139 TYR F CE1 1 
ATOM   894   C CE2 . TYR A 1 120 ? 1.018   30.083  -8.930  1.00 74.33  ? 139 TYR F CE2 1 
ATOM   895   C CZ  . TYR A 1 120 ? -0.217  30.005  -9.537  1.00 78.14  ? 139 TYR F CZ  1 
ATOM   896   O OH  . TYR A 1 120 ? -0.711  31.076  -10.245 1.00 91.22  ? 139 TYR F OH  1 
ATOM   897   N N   . LEU A 1 121 ? 0.585   24.141  -5.237  1.00 70.11  ? 140 LEU F N   1 
ATOM   898   C CA  . LEU A 1 121 ? 1.042   22.955  -4.532  1.00 69.65  ? 140 LEU F CA  1 
ATOM   899   C C   . LEU A 1 121 ? 1.358   21.867  -5.549  1.00 70.09  ? 140 LEU F C   1 
ATOM   900   O O   . LEU A 1 121 ? 0.499   21.512  -6.361  1.00 70.92  ? 140 LEU F O   1 
ATOM   901   C CB  . LEU A 1 121 ? -0.027  22.494  -3.534  1.00 69.71  ? 140 LEU F CB  1 
ATOM   902   C CG  . LEU A 1 121 ? 0.085   21.218  -2.706  1.00 69.39  ? 140 LEU F CG  1 
ATOM   903   C CD1 . LEU A 1 121 ? -0.762  21.371  -1.477  1.00 69.26  ? 140 LEU F CD1 1 
ATOM   904   C CD2 . LEU A 1 121 ? -0.418  20.040  -3.493  1.00 70.09  ? 140 LEU F CD2 1 
ATOM   905   N N   . ASN A 1 122 ? 2.581   21.344  -5.509  1.00 69.59  ? 141 ASN F N   1 
ATOM   906   C CA  . ASN A 1 122 ? 3.027   20.293  -6.412  1.00 69.96  ? 141 ASN F CA  1 
ATOM   907   C C   . ASN A 1 122 ? 3.241   19.004  -5.632  1.00 69.60  ? 141 ASN F C   1 
ATOM   908   O O   . ASN A 1 122 ? 3.763   19.026  -4.513  1.00 68.84  ? 141 ASN F O   1 
ATOM   909   C CB  . ASN A 1 122 ? 4.322   20.691  -7.119  1.00 69.78  ? 141 ASN F CB  1 
ATOM   910   C CG  . ASN A 1 122 ? 4.244   22.064  -7.747  1.00 70.03  ? 141 ASN F CG  1 
ATOM   911   O OD1 . ASN A 1 122 ? 4.825   23.024  -7.241  1.00 69.46  ? 141 ASN F OD1 1 
ATOM   912   N ND2 . ASN A 1 122 ? 3.543   22.162  -8.865  1.00 70.91  ? 141 ASN F ND2 1 
ATOM   913   N N   . VAL A 1 123 ? 2.848   17.879  -6.232  1.00 70.80  ? 142 VAL F N   1 
ATOM   914   C CA  . VAL A 1 123 ? 2.939   16.577  -5.584  1.00 72.49  ? 142 VAL F CA  1 
ATOM   915   C C   . VAL A 1 123 ? 3.579   15.568  -6.530  1.00 77.76  ? 142 VAL F C   1 
ATOM   916   O O   . VAL A 1 123 ? 3.728   15.808  -7.729  1.00 82.88  ? 142 VAL F O   1 
ATOM   917   C CB  . VAL A 1 123 ? 1.566   16.059  -5.113  1.00 72.48  ? 142 VAL F CB  1 
ATOM   918   C CG1 . VAL A 1 123 ? 1.058   16.883  -3.957  1.00 71.61  ? 142 VAL F CG1 1 
ATOM   919   C CG2 . VAL A 1 123 ? 0.578   16.100  -6.258  1.00 76.01  ? 142 VAL F CG2 1 
ATOM   920   N N   . ALA A 1 124 ? 3.955   14.425  -5.955  1.00 85.89  ? 143 ALA F N   1 
ATOM   921   C CA  . ALA A 1 124 ? 4.397   13.236  -6.687  1.00 88.60  ? 143 ALA F CA  1 
ATOM   922   C C   . ALA A 1 124 ? 5.532   13.565  -7.660  1.00 90.12  ? 143 ALA F C   1 
ATOM   923   O O   . ALA A 1 124 ? 5.386   13.489  -8.877  1.00 90.11  ? 143 ALA F O   1 
ATOM   924   C CB  . ALA A 1 124 ? 3.217   12.587  -7.417  1.00 84.92  ? 143 ALA F CB  1 
ATOM   925   N N   . ASN A 1 125 ? 6.679   13.921  -7.076  1.00 94.90  ? 144 ASN F N   1 
ATOM   926   C CA  . ASN A 1 125 ? 7.886   14.263  -7.836  1.00 97.16  ? 144 ASN F CA  1 
ATOM   927   C C   . ASN A 1 125 ? 7.627   15.417  -8.803  1.00 98.26  ? 144 ASN F C   1 
ATOM   928   O O   . ASN A 1 125 ? 8.151   15.442  -9.920  1.00 99.10  ? 144 ASN F O   1 
ATOM   929   C CB  . ASN A 1 125 ? 8.442   13.044  -8.583  1.00 97.59  ? 144 ASN F CB  1 
ATOM   930   C CG  . ASN A 1 125 ? 9.034   12.000  -7.649  1.00 99.17  ? 144 ASN F CG  1 
ATOM   931   O OD1 . ASN A 1 125 ? 9.852   12.316  -6.783  1.00 96.39  ? 144 ASN F OD1 1 
ATOM   932   N ND2 . ASN A 1 125 ? 8.622   10.747  -7.824  1.00 96.62  ? 144 ASN F ND2 1 
ATOM   933   N N   . ARG A 1 126 ? 6.808   16.378  -8.367  1.00 94.43  ? 145 ARG F N   1 
ATOM   934   C CA  . ARG A 1 126 ? 6.484   17.575  -9.150  1.00 92.96  ? 145 ARG F CA  1 
ATOM   935   C C   . ARG A 1 126 ? 5.805   17.219  -10.473 1.00 94.81  ? 145 ARG F C   1 
ATOM   936   O O   . ARG A 1 126 ? 6.035   17.859  -11.501 1.00 95.14  ? 145 ARG F O   1 
ATOM   937   C CB  . ARG A 1 126 ? 7.730   18.431  -9.398  1.00 91.94  ? 145 ARG F CB  1 
ATOM   938   C CG  . ARG A 1 126 ? 8.501   18.823  -8.146  1.00 90.38  ? 145 ARG F CG  1 
ATOM   939   C CD  . ARG A 1 126 ? 8.156   20.239  -7.705  1.00 93.62  ? 145 ARG F CD  1 
ATOM   940   N NE  . ARG A 1 126 ? 8.034   21.150  -8.843  1.00 100.53 ? 145 ARG F NE  1 
ATOM   941   C CZ  . ARG A 1 126 ? 7.565   22.393  -8.763  1.00 99.94  ? 145 ARG F CZ  1 
ATOM   942   N NH1 . ARG A 1 126 ? 7.186   22.888  -7.592  1.00 93.71  ? 145 ARG F NH1 1 
ATOM   943   N NH2 . ARG A 1 126 ? 7.484   23.149  -9.852  1.00 94.74  ? 145 ARG F NH2 1 
ATOM   944   N N   . ARG A 1 127 ? 4.956   16.189  -10.449 1.00 96.89  ? 146 ARG F N   1 
ATOM   945   C CA  . ARG A 1 127 ? 4.233   15.776  -11.646 1.00 89.30  ? 146 ARG F CA  1 
ATOM   946   C C   . ARG A 1 127 ? 2.859   16.416  -11.778 1.00 84.40  ? 146 ARG F C   1 
ATOM   947   O O   . ARG A 1 127 ? 2.326   16.469  -12.891 1.00 87.73  ? 146 ARG F O   1 
ATOM   948   C CB  . ARG A 1 127 ? 4.076   14.249  -11.681 1.00 90.04  ? 146 ARG F CB  1 
ATOM   949   C CG  . ARG A 1 127 ? 5.372   13.484  -11.896 1.00 97.76  ? 146 ARG F CG  1 
ATOM   950   C CD  . ARG A 1 127 ? 5.895   13.639  -13.314 1.00 101.77 ? 146 ARG F CD  1 
ATOM   951   N NE  . ARG A 1 127 ? 5.306   12.645  -14.211 1.00 107.91 ? 146 ARG F NE  1 
ATOM   952   C CZ  . ARG A 1 127 ? 5.741   11.394  -14.334 1.00 106.34 ? 146 ARG F CZ  1 
ATOM   953   N NH1 . ARG A 1 127 ? 6.771   10.974  -13.610 1.00 99.00  ? 146 ARG F NH1 1 
ATOM   954   N NH2 . ARG A 1 127 ? 5.143   10.558  -15.174 1.00 102.82 ? 146 ARG F NH2 1 
ATOM   955   N N   . GLN A 1 128 ? 2.274   16.905  -10.686 1.00 73.03  ? 147 GLN F N   1 
ATOM   956   C CA  . GLN A 1 128 ? 0.924   17.447  -10.723 1.00 73.58  ? 147 GLN F CA  1 
ATOM   957   C C   . GLN A 1 128 ? 0.829   18.640  -9.785  1.00 72.93  ? 147 GLN F C   1 
ATOM   958   O O   . GLN A 1 128 ? 1.342   18.604  -8.662  1.00 72.06  ? 147 GLN F O   1 
ATOM   959   C CB  . GLN A 1 128 ? -0.111  16.382  -10.341 1.00 73.95  ? 147 GLN F CB  1 
ATOM   960   C CG  . GLN A 1 128 ? -1.211  16.181  -11.371 1.00 75.14  ? 147 GLN F CG  1 
ATOM   961   C CD  . GLN A 1 128 ? -2.273  17.255  -11.309 1.00 75.51  ? 147 GLN F CD  1 
ATOM   962   O OE1 . GLN A 1 128 ? -2.324  18.034  -10.362 1.00 74.87  ? 147 GLN F OE1 1 
ATOM   963   N NE2 . GLN A 1 128 ? -3.134  17.298  -12.317 1.00 76.59  ? 147 GLN F NE2 1 
ATOM   964   N N   . GLN A 1 129 ? 0.159   19.688  -10.256 1.00 73.41  ? 148 GLN F N   1 
ATOM   965   C CA  . GLN A 1 129 ? 0.035   20.953  -9.547  1.00 72.93  ? 148 GLN F CA  1 
ATOM   966   C C   . GLN A 1 129 ? -1.432  21.295  -9.330  1.00 73.48  ? 148 GLN F C   1 
ATOM   967   O O   . GLN A 1 129 ? -2.269  21.083  -10.214 1.00 74.44  ? 148 GLN F O   1 
ATOM   968   C CB  . GLN A 1 129 ? 0.720   22.078  -10.331 1.00 72.97  ? 148 GLN F CB  1 
ATOM   969   C CG  . GLN A 1 129 ? 0.584   23.461  -9.722  1.00 72.56  ? 148 GLN F CG  1 
ATOM   970   C CD  . GLN A 1 129 ? 1.467   24.482  -10.413 1.00 72.50  ? 148 GLN F CD  1 
ATOM   971   O OE1 . GLN A 1 129 ? 2.623   24.201  -10.730 1.00 72.21  ? 148 GLN F OE1 1 
ATOM   972   N NE2 . GLN A 1 129 ? 0.923   25.668  -10.663 1.00 72.80  ? 148 GLN F NE2 1 
ATOM   973   N N   . TYR A 1 130 ? -1.738  21.821  -8.147  1.00 72.91  ? 149 TYR F N   1 
ATOM   974   C CA  . TYR A 1 130 ? -3.055  22.354  -7.838  1.00 73.38  ? 149 TYR F CA  1 
ATOM   975   C C   . TYR A 1 130 ? -2.916  23.785  -7.338  1.00 72.92  ? 149 TYR F C   1 
ATOM   976   O O   . TYR A 1 130 ? -1.934  24.141  -6.682  1.00 72.04  ? 149 TYR F O   1 
ATOM   977   C CB  . TYR A 1 130 ? -3.787  21.512  -6.786  1.00 73.28  ? 149 TYR F CB  1 
ATOM   978   C CG  . TYR A 1 130 ? -3.854  20.041  -7.108  1.00 73.63  ? 149 TYR F CG  1 
ATOM   979   C CD1 . TYR A 1 130 ? -4.889  19.524  -7.874  1.00 74.67  ? 149 TYR F CD1 1 
ATOM   980   C CD2 . TYR A 1 130 ? -2.892  19.165  -6.631  1.00 72.95  ? 149 TYR F CD2 1 
ATOM   981   C CE1 . TYR A 1 130 ? -4.956  18.169  -8.169  1.00 75.02  ? 149 TYR F CE1 1 
ATOM   982   C CE2 . TYR A 1 130 ? -2.951  17.813  -6.917  1.00 73.28  ? 149 TYR F CE2 1 
ATOM   983   C CZ  . TYR A 1 130 ? -3.983  17.319  -7.685  1.00 74.30  ? 149 TYR F CZ  1 
ATOM   984   O OH  . TYR A 1 130 ? -4.032  15.972  -7.966  1.00 74.65  ? 149 TYR F OH  1 
ATOM   985   N N   . GLU A 1 131 ? -3.909  24.606  -7.660  1.00 73.55  ? 150 GLU F N   1 
ATOM   986   C CA  . GLU A 1 131 ? -3.956  25.987  -7.203  1.00 73.24  ? 150 GLU F CA  1 
ATOM   987   C C   . GLU A 1 131 ? -4.917  26.104  -6.030  1.00 73.15  ? 150 GLU F C   1 
ATOM   988   O O   . GLU A 1 131 ? -5.973  25.465  -6.013  1.00 74.72  ? 150 GLU F O   1 
ATOM   989   C CB  . GLU A 1 131 ? -4.382  26.928  -8.333  1.00 74.07  ? 150 GLU F CB  1 
ATOM   990   C CG  . GLU A 1 131 ? -4.589  28.371  -7.896  1.00 78.20  ? 150 GLU F CG  1 
ATOM   991   C CD  . GLU A 1 131 ? -4.499  29.355  -9.047  1.00 81.59  ? 150 GLU F CD  1 
ATOM   992   O OE1 . GLU A 1 131 ? -4.637  30.575  -8.803  1.00 78.77  ? 150 GLU F OE1 1 
ATOM   993   O OE2 . GLU A 1 131 ? -4.284  28.909  -10.195 1.00 82.17  ? 150 GLU F OE2 1 
ATOM   994   N N   . CYS A 1 132 ? -4.534  26.910  -5.043  1.00 74.58  ? 151 CYS F N   1 
ATOM   995   C CA  . CYS A 1 132 ? -5.397  27.162  -3.899  1.00 76.00  ? 151 CYS F CA  1 
ATOM   996   C C   . CYS A 1 132 ? -6.722  27.763  -4.349  1.00 76.96  ? 151 CYS F C   1 
ATOM   997   O O   . CYS A 1 132 ? -6.771  28.600  -5.254  1.00 80.51  ? 151 CYS F O   1 
ATOM   998   C CB  . CYS A 1 132 ? -4.702  28.102  -2.918  1.00 77.92  ? 151 CYS F CB  1 
ATOM   999   S SG  . CYS A 1 132 ? -5.602  28.355  -1.378  1.00 85.55  ? 151 CYS F SG  1 
ATOM   1000  N N   . LEU A 1 133 ? -7.807  27.324  -3.716  1.00 78.02  ? 152 LEU F N   1 
ATOM   1001  C CA  . LEU A 1 133 ? -9.128  27.857  -4.023  1.00 79.72  ? 152 LEU F CA  1 
ATOM   1002  C C   . LEU A 1 133 ? -9.659  28.769  -2.928  1.00 80.49  ? 152 LEU F C   1 
ATOM   1003  O O   . LEU A 1 133 ? -10.271 29.800  -3.229  1.00 87.96  ? 152 LEU F O   1 
ATOM   1004  C CB  . LEU A 1 133 ? -10.127 26.721  -4.263  1.00 82.54  ? 152 LEU F CB  1 
ATOM   1005  C CG  . LEU A 1 133 ? -9.775  25.614  -5.265  1.00 84.14  ? 152 LEU F CG  1 
ATOM   1006  C CD1 . LEU A 1 133 ? -10.999 24.771  -5.600  1.00 85.21  ? 152 LEU F CD1 1 
ATOM   1007  C CD2 . LEU A 1 133 ? -9.194  26.197  -6.537  1.00 81.54  ? 152 LEU F CD2 1 
ATOM   1008  N N   . HIS A 1 134 ? -9.427  28.424  -1.663  1.00 81.94  ? 153 HIS F N   1 
ATOM   1009  C CA  . HIS A 1 134 ? -9.966  29.158  -0.523  1.00 86.02  ? 153 HIS F CA  1 
ATOM   1010  C C   . HIS A 1 134 ? -8.824  29.921  0.145   1.00 82.97  ? 153 HIS F C   1 
ATOM   1011  O O   . HIS A 1 134 ? -8.239  29.470  1.130   1.00 87.69  ? 153 HIS F O   1 
ATOM   1012  C CB  . HIS A 1 134 ? -10.669 28.200  0.469   1.00 89.55  ? 153 HIS F CB  1 
ATOM   1013  C CG  . HIS A 1 134 ? -11.816 27.440  -0.126  1.00 92.00  ? 153 HIS F CG  1 
ATOM   1014  N ND1 . HIS A 1 134 ? -11.657 26.514  -1.136  1.00 95.27  ? 153 HIS F ND1 1 
ATOM   1015  C CD2 . HIS A 1 134 ? -13.142 27.475  0.145   1.00 91.03  ? 153 HIS F CD2 1 
ATOM   1016  C CE1 . HIS A 1 134 ? -12.834 26.008  -1.457  1.00 95.79  ? 153 HIS F CE1 1 
ATOM   1017  N NE2 . HIS A 1 134 ? -13.752 26.576  -0.695  1.00 96.12  ? 153 HIS F NE2 1 
ATOM   1018  N N   . TYR A 1 135 ? -8.512  31.094  -0.399  1.00 81.71  ? 154 TYR F N   1 
ATOM   1019  C CA  . TYR A 1 135 ? -7.498  31.944  0.204   1.00 80.25  ? 154 TYR F CA  1 
ATOM   1020  C C   . TYR A 1 135 ? -8.052  32.656  1.435   1.00 78.43  ? 154 TYR F C   1 
ATOM   1021  O O   . TYR A 1 135 ? -9.261  32.852  1.586   1.00 78.57  ? 154 TYR F O   1 
ATOM   1022  C CB  . TYR A 1 135 ? -6.987  32.987  -0.790  1.00 78.61  ? 154 TYR F CB  1 
ATOM   1023  C CG  . TYR A 1 135 ? -6.117  32.454  -1.905  1.00 77.02  ? 154 TYR F CG  1 
ATOM   1024  C CD1 . TYR A 1 135 ? -4.758  32.244  -1.711  1.00 72.95  ? 154 TYR F CD1 1 
ATOM   1025  C CD2 . TYR A 1 135 ? -6.646  32.201  -3.164  1.00 79.65  ? 154 TYR F CD2 1 
ATOM   1026  C CE1 . TYR A 1 135 ? -3.955  31.773  -2.731  1.00 75.14  ? 154 TYR F CE1 1 
ATOM   1027  C CE2 . TYR A 1 135 ? -5.851  31.732  -4.192  1.00 83.52  ? 154 TYR F CE2 1 
ATOM   1028  C CZ  . TYR A 1 135 ? -4.506  31.520  -3.971  1.00 81.28  ? 154 TYR F CZ  1 
ATOM   1029  O OH  . TYR A 1 135 ? -3.713  31.054  -4.996  1.00 82.13  ? 154 TYR F OH  1 
ATOM   1030  N N   . LYS A 1 136 ? -7.142  33.048  2.321   1.00 82.57  ? 155 LYS F N   1 
ATOM   1031  C CA  . LYS A 1 136 ? -7.468  33.888  3.463   1.00 87.77  ? 155 LYS F CA  1 
ATOM   1032  C C   . LYS A 1 136 ? -7.081  35.323  3.138   1.00 93.03  ? 155 LYS F C   1 
ATOM   1033  O O   . LYS A 1 136 ? -5.954  35.583  2.700   1.00 95.69  ? 155 LYS F O   1 
ATOM   1034  C CB  . LYS A 1 136 ? -6.748  33.418  4.728   1.00 89.91  ? 155 LYS F CB  1 
ATOM   1035  C CG  . LYS A 1 136 ? -6.865  34.396  5.887   1.00 92.93  ? 155 LYS F CG  1 
ATOM   1036  C CD  . LYS A 1 136 ? -6.292  33.826  7.172   1.00 94.57  ? 155 LYS F CD  1 
ATOM   1037  C CE  . LYS A 1 136 ? -6.288  34.871  8.279   1.00 96.76  ? 155 LYS F CE  1 
ATOM   1038  N NZ  . LYS A 1 136 ? -6.274  34.253  9.634   1.00 101.12 ? 155 LYS F NZ  1 
ATOM   1039  N N   . THR A 1 137 ? -8.012  36.248  3.352   1.00 102.61 ? 156 THR F N   1 
ATOM   1040  C CA  . THR A 1 137 ? -7.842  37.627  2.919   1.00 100.69 ? 156 THR F CA  1 
ATOM   1041  C C   . THR A 1 137 ? -7.217  38.476  4.019   1.00 99.30  ? 156 THR F C   1 
ATOM   1042  O O   . THR A 1 137 ? -7.533  38.322  5.202   1.00 95.03  ? 156 THR F O   1 
ATOM   1043  C CB  . THR A 1 137 ? -9.184  38.230  2.499   1.00 102.48 ? 156 THR F CB  1 
ATOM   1044  O OG1 . THR A 1 137 ? -10.188 37.892  3.464   1.00 108.38 ? 156 THR F OG1 1 
ATOM   1045  C CG2 . THR A 1 137 ? -9.603  37.702  1.134   1.00 100.90 ? 156 THR F CG2 1 
ATOM   1046  N N   . ASP A 1 138 ? -6.321  39.368  3.612   1.00 108.14 ? 157 ASP F N   1 
ATOM   1047  C CA  . ASP A 1 138 ? -5.741  40.348  4.514   1.00 106.15 ? 157 ASP F CA  1 
ATOM   1048  C C   . ASP A 1 138 ? -6.757  41.454  4.788   1.00 108.33 ? 157 ASP F C   1 
ATOM   1049  O O   . ASP A 1 138 ? -7.754  41.604  4.076   1.00 107.70 ? 157 ASP F O   1 
ATOM   1050  C CB  . ASP A 1 138 ? -4.460  40.924  3.901   1.00 104.48 ? 157 ASP F CB  1 
ATOM   1051  C CG  . ASP A 1 138 ? -3.746  41.900  4.815   1.00 104.88 ? 157 ASP F CG  1 
ATOM   1052  O OD1 . ASP A 1 138 ? -4.038  41.907  6.029   1.00 109.80 ? 157 ASP F OD1 1 
ATOM   1053  O OD2 . ASP A 1 138 ? -2.899  42.671  4.311   1.00 101.67 ? 157 ASP F OD2 1 
ATOM   1054  N N   . ALA A 1 139 ? -6.502  42.226  5.849   1.00 111.83 ? 158 ALA F N   1 
ATOM   1055  C CA  . ALA A 1 139 ? -7.359  43.369  6.155   1.00 109.71 ? 158 ALA F CA  1 
ATOM   1056  C C   . ALA A 1 139 ? -7.455  44.319  4.967   1.00 105.98 ? 158 ALA F C   1 
ATOM   1057  O O   . ALA A 1 139 ? -8.542  44.810  4.640   1.00 96.75  ? 158 ALA F O   1 
ATOM   1058  C CB  . ALA A 1 139 ? -6.833  44.101  7.390   1.00 107.81 ? 158 ALA F CB  1 
ATOM   1059  N N   . GLN A 1 140 ? -6.328  44.579  4.303   1.00 111.09 ? 159 GLN F N   1 
ATOM   1060  C CA  . GLN A 1 140 ? -6.336  45.422  3.113   1.00 110.84 ? 159 GLN F CA  1 
ATOM   1061  C C   . GLN A 1 140 ? -7.058  44.733  1.960   1.00 110.13 ? 159 GLN F C   1 
ATOM   1062  O O   . GLN A 1 140 ? -8.033  45.260  1.413   1.00 107.77 ? 159 GLN F O   1 
ATOM   1063  C CB  . GLN A 1 140 ? -4.901  45.774  2.714   1.00 113.00 ? 159 GLN F CB  1 
ATOM   1064  C CG  . GLN A 1 140 ? -4.007  46.170  3.878   1.00 114.20 ? 159 GLN F CG  1 
ATOM   1065  C CD  . GLN A 1 140 ? -2.654  46.677  3.418   1.00 122.58 ? 159 GLN F CD  1 
ATOM   1066  O OE1 . GLN A 1 140 ? -1.773  45.892  3.060   1.00 130.57 ? 159 GLN F OE1 1 
ATOM   1067  N NE2 . GLN A 1 140 ? -2.485  47.995  3.413   1.00 129.28 ? 159 GLN F NE2 1 
ATOM   1068  N N   . GLY A 1 141 ? -6.586  43.550  1.578   1.00 105.06 ? 160 GLY F N   1 
ATOM   1069  C CA  . GLY A 1 141 ? -7.168  42.819  0.471   1.00 103.73 ? 160 GLY F CA  1 
ATOM   1070  C C   . GLY A 1 141 ? -6.224  41.784  -0.103  1.00 106.34 ? 160 GLY F C   1 
ATOM   1071  O O   . GLY A 1 141 ? -6.633  40.943  -0.910  1.00 102.42 ? 160 GLY F O   1 
ATOM   1072  N N   . THR A 1 142 ? -4.957  41.834  0.307   1.00 104.81 ? 161 THR F N   1 
ATOM   1073  C CA  . THR A 1 142 ? -3.977  40.866  -0.160  1.00 101.39 ? 161 THR F CA  1 
ATOM   1074  C C   . THR A 1 142 ? -4.269  39.485  0.433   1.00 99.97  ? 161 THR F C   1 
ATOM   1075  O O   . THR A 1 142 ? -5.143  39.312  1.288   1.00 96.92  ? 161 THR F O   1 
ATOM   1076  C CB  . THR A 1 142 ? -2.556  41.319  0.189   1.00 98.64  ? 161 THR F CB  1 
ATOM   1077  O OG1 . THR A 1 142 ? -2.443  41.523  1.601   1.00 92.83  ? 161 THR F OG1 1 
ATOM   1078  C CG2 . THR A 1 142 ? -2.210  42.626  -0.529  1.00 98.27  ? 161 THR F CG2 1 
ATOM   1079  N N   . ARG A 1 143 ? -3.532  38.489  -0.048  1.00 92.13  ? 162 ARG F N   1 
ATOM   1080  C CA  . ARG A 1 143 ? -3.734  37.101  0.350   1.00 86.02  ? 162 ARG F CA  1 
ATOM   1081  C C   . ARG A 1 143 ? -2.648  36.702  1.342   1.00 84.91  ? 162 ARG F C   1 
ATOM   1082  O O   . ARG A 1 143 ? -1.458  36.719  1.007   1.00 81.48  ? 162 ARG F O   1 
ATOM   1083  C CB  . ARG A 1 143 ? -3.723  36.177  -0.868  1.00 84.02  ? 162 ARG F CB  1 
ATOM   1084  C CG  . ARG A 1 143 ? -5.006  36.212  -1.685  1.00 81.03  ? 162 ARG F CG  1 
ATOM   1085  C CD  . ARG A 1 143 ? -4.769  35.706  -3.092  1.00 79.74  ? 162 ARG F CD  1 
ATOM   1086  N NE  . ARG A 1 143 ? -6.012  35.491  -3.823  1.00 79.70  ? 162 ARG F NE  1 
ATOM   1087  C CZ  . ARG A 1 143 ? -6.076  35.263  -5.129  1.00 80.65  ? 162 ARG F CZ  1 
ATOM   1088  N NH1 . ARG A 1 143 ? -4.965  35.219  -5.852  1.00 79.32  ? 162 ARG F NH1 1 
ATOM   1089  N NH2 . ARG A 1 143 ? -7.251  35.080  -5.714  1.00 81.74  ? 162 ARG F NH2 1 
ATOM   1090  N N   . ILE A 1 144 ? -3.063  36.348  2.557   1.00 82.91  ? 163 ILE F N   1 
ATOM   1091  C CA  . ILE A 1 144 ? -2.133  36.044  3.629   1.00 83.82  ? 163 ILE F CA  1 
ATOM   1092  C C   . ILE A 1 144 ? -2.061  34.548  3.921   1.00 84.31  ? 163 ILE F C   1 
ATOM   1093  O O   . ILE A 1 144 ? -1.019  34.068  4.386   1.00 83.36  ? 163 ILE F O   1 
ATOM   1094  C CB  . ILE A 1 144 ? -2.499  36.839  4.906   1.00 84.33  ? 163 ILE F CB  1 
ATOM   1095  C CG1 . ILE A 1 144 ? -1.376  36.748  5.946   1.00 87.44  ? 163 ILE F CG1 1 
ATOM   1096  C CG2 . ILE A 1 144 ? -3.844  36.380  5.487   1.00 87.22  ? 163 ILE F CG2 1 
ATOM   1097  C CD1 . ILE A 1 144 ? -1.631  37.504  7.232   1.00 87.92  ? 163 ILE F CD1 1 
ATOM   1098  N N   . GLY A 1 145 ? -3.120  33.797  3.631   1.00 81.06  ? 164 GLY F N   1 
ATOM   1099  C CA  . GLY A 1 145 ? -3.136  32.373  3.892   1.00 80.19  ? 164 GLY F CA  1 
ATOM   1100  C C   . GLY A 1 145 ? -3.841  31.553  2.830   1.00 79.46  ? 164 GLY F C   1 
ATOM   1101  O O   . GLY A 1 145 ? -4.190  32.069  1.764   1.00 84.73  ? 164 GLY F O   1 
ATOM   1102  N N   . CYS A 1 146 ? -4.053  30.271  3.114   1.00 75.23  ? 165 CYS F N   1 
ATOM   1103  C CA  . CYS A 1 146 ? -4.706  29.367  2.177   1.00 76.74  ? 165 CYS F CA  1 
ATOM   1104  C C   . CYS A 1 146 ? -5.083  28.082  2.899   1.00 75.48  ? 165 CYS F C   1 
ATOM   1105  O O   . CYS A 1 146 ? -4.496  27.736  3.928   1.00 78.18  ? 165 CYS F O   1 
ATOM   1106  C CB  . CYS A 1 146 ? -3.809  29.052  0.980   1.00 80.02  ? 165 CYS F CB  1 
ATOM   1107  S SG  . CYS A 1 146 ? -4.358  27.618  0.052   1.00 84.76  ? 165 CYS F SG  1 
ATOM   1108  N N   . ARG A 1 147 ? -6.048  27.360  2.323   1.00 73.96  ? 166 ARG F N   1 
ATOM   1109  C CA  . ARG A 1 147 ? -6.515  26.103  2.908   1.00 75.60  ? 166 ARG F CA  1 
ATOM   1110  C C   . ARG A 1 147 ? -7.036  25.177  1.813   1.00 72.16  ? 166 ARG F C   1 
ATOM   1111  O O   . ARG A 1 147 ? -8.061  25.468  1.188   1.00 72.66  ? 166 ARG F O   1 
ATOM   1112  C CB  . ARG A 1 147 ? -7.593  26.366  3.955   1.00 78.63  ? 166 ARG F CB  1 
ATOM   1113  C CG  . ARG A 1 147 ? -7.914  25.166  4.830   1.00 80.22  ? 166 ARG F CG  1 
ATOM   1114  C CD  . ARG A 1 147 ? -9.331  25.236  5.368   1.00 81.01  ? 166 ARG F CD  1 
ATOM   1115  N NE  . ARG A 1 147 ? -10.314 25.149  4.294   1.00 83.11  ? 166 ARG F NE  1 
ATOM   1116  C CZ  . ARG A 1 147 ? -11.620 25.320  4.462   1.00 86.68  ? 166 ARG F CZ  1 
ATOM   1117  N NH1 . ARG A 1 147 ? -12.442 25.226  3.425   1.00 85.48  ? 166 ARG F NH1 1 
ATOM   1118  N NH2 . ARG A 1 147 ? -12.104 25.595  5.667   1.00 85.81  ? 166 ARG F NH2 1 
ATOM   1119  N N   . PHE A 1 148 ? -6.340  24.056  1.600   1.00 70.86  ? 167 PHE F N   1 
ATOM   1120  C CA  . PHE A 1 148 ? -6.820  22.983  0.741   1.00 71.54  ? 167 PHE F CA  1 
ATOM   1121  C C   . PHE A 1 148 ? -7.782  22.082  1.504   1.00 71.92  ? 167 PHE F C   1 
ATOM   1122  O O   . PHE A 1 148 ? -7.514  21.684  2.649   1.00 71.40  ? 167 PHE F O   1 
ATOM   1123  C CB  . PHE A 1 148 ? -5.655  22.156  0.194   1.00 71.12  ? 167 PHE F CB  1 
ATOM   1124  C CG  . PHE A 1 148 ? -4.755  22.912  -0.740  1.00 70.91  ? 167 PHE F CG  1 
ATOM   1125  C CD1 . PHE A 1 148 ? -3.748  23.728  -0.258  1.00 70.11  ? 167 PHE F CD1 1 
ATOM   1126  C CD2 . PHE A 1 148 ? -4.920  22.800  -2.106  1.00 71.57  ? 167 PHE F CD2 1 
ATOM   1127  C CE1 . PHE A 1 148 ? -2.923  24.416  -1.125  1.00 69.96  ? 167 PHE F CE1 1 
ATOM   1128  C CE2 . PHE A 1 148 ? -4.101  23.487  -2.976  1.00 71.44  ? 167 PHE F CE2 1 
ATOM   1129  C CZ  . PHE A 1 148 ? -3.102  24.296  -2.487  1.00 70.64  ? 167 PHE F CZ  1 
ATOM   1130  N N   . ASP A 1 149 ? -8.879  21.719  0.829   1.00 74.64  ? 168 ASP F N   1 
ATOM   1131  C CA  . ASP A 1 149 ? -10.078 21.225  1.500   1.00 78.83  ? 168 ASP F CA  1 
ATOM   1132  C C   . ASP A 1 149 ? -9.993  19.734  1.796   1.00 77.98  ? 168 ASP F C   1 
ATOM   1133  O O   . ASP A 1 149 ? -10.336 19.296  2.898   1.00 83.22  ? 168 ASP F O   1 
ATOM   1134  C CB  . ASP A 1 149 ? -11.316 21.531  0.654   1.00 83.80  ? 168 ASP F CB  1 
ATOM   1135  C CG  . ASP A 1 149 ? -12.062 22.751  1.147   1.00 87.18  ? 168 ASP F CG  1 
ATOM   1136  O OD1 . ASP A 1 149 ? -12.150 22.957  2.375   1.00 93.02  ? 168 ASP F OD1 1 
ATOM   1137  O OD2 . ASP A 1 149 ? -12.565 23.509  0.291   1.00 86.71  ? 168 ASP F OD2 1 
ATOM   1138  N N   . ASP A 1 150 ? -9.568  18.931  0.819   1.00 73.87  ? 169 ASP F N   1 
ATOM   1139  C CA  . ASP A 1 150 ? -9.508  17.478  0.976   1.00 75.00  ? 169 ASP F CA  1 
ATOM   1140  C C   . ASP A 1 150 ? -8.133  17.027  0.501   1.00 75.36  ? 169 ASP F C   1 
ATOM   1141  O O   . ASP A 1 150 ? -7.977  16.526  -0.615  1.00 77.29  ? 169 ASP F O   1 
ATOM   1142  C CB  . ASP A 1 150 ? -10.638 16.792  0.213   1.00 77.06  ? 169 ASP F CB  1 
ATOM   1143  C CG  . ASP A 1 150 ? -10.730 15.313  0.522   1.00 82.50  ? 169 ASP F CG  1 
ATOM   1144  O OD1 . ASP A 1 150 ? -9.941  14.834  1.358   1.00 84.37  ? 169 ASP F OD1 1 
ATOM   1145  O OD2 . ASP A 1 150 ? -11.602 14.630  -0.059  1.00 88.20  ? 169 ASP F OD2 1 
ATOM   1146  N N   . ILE A 1 151 ? -7.134  17.207  1.369   1.00 72.05  ? 170 ILE F N   1 
ATOM   1147  C CA  . ILE A 1 151 ? -5.748  16.962  0.995   1.00 71.39  ? 170 ILE F CA  1 
ATOM   1148  C C   . ILE A 1 151 ? -5.493  15.498  0.679   1.00 71.53  ? 170 ILE F C   1 
ATOM   1149  O O   . ILE A 1 151 ? -4.557  15.183  -0.063  1.00 71.31  ? 170 ILE F O   1 
ATOM   1150  C CB  . ILE A 1 151 ? -4.807  17.456  2.112   1.00 70.40  ? 170 ILE F CB  1 
ATOM   1151  C CG1 . ILE A 1 151 ? -3.360  17.483  1.616   1.00 69.77  ? 170 ILE F CG1 1 
ATOM   1152  C CG2 . ILE A 1 151 ? -4.942  16.585  3.353   1.00 70.16  ? 170 ILE F CG2 1 
ATOM   1153  C CD1 . ILE A 1 151 ? -3.148  18.396  0.426   1.00 69.99  ? 170 ILE F CD1 1 
ATOM   1154  N N   . SER A 1 152 ? -6.310  14.588  1.215   1.00 72.13  ? 171 SER F N   1 
ATOM   1155  C CA  . SER A 1 152 ? -6.084  13.165  0.975   1.00 73.37  ? 171 SER F CA  1 
ATOM   1156  C C   . SER A 1 152 ? -6.171  12.832  -0.508  1.00 75.28  ? 171 SER F C   1 
ATOM   1157  O O   . SER A 1 152 ? -5.419  11.987  -1.007  1.00 72.61  ? 171 SER F O   1 
ATOM   1158  C CB  . SER A 1 152 ? -7.089  12.332  1.768   1.00 72.73  ? 171 SER F CB  1 
ATOM   1159  O OG  . SER A 1 152 ? -7.007  10.966  1.403   1.00 76.08  ? 171 SER F OG  1 
ATOM   1160  N N   . ARG A 1 153 ? -7.075  13.496  -1.232  1.00 74.96  ? 172 ARG F N   1 
ATOM   1161  C CA  . ARG A 1 153 ? -7.260  13.204  -2.648  1.00 77.22  ? 172 ARG F CA  1 
ATOM   1162  C C   . ARG A 1 153 ? -6.252  13.933  -3.524  1.00 76.08  ? 172 ARG F C   1 
ATOM   1163  O O   . ARG A 1 153 ? -5.913  13.446  -4.609  1.00 77.52  ? 172 ARG F O   1 
ATOM   1164  C CB  . ARG A 1 153 ? -8.681  13.571  -3.074  1.00 81.44  ? 172 ARG F CB  1 
ATOM   1165  C CG  . ARG A 1 153 ? -9.754  13.092  -2.116  1.00 87.30  ? 172 ARG F CG  1 
ATOM   1166  C CD  . ARG A 1 153 ? -10.186 11.670  -2.437  1.00 90.05  ? 172 ARG F CD  1 
ATOM   1167  N NE  . ARG A 1 153 ? -11.622 11.488  -2.244  1.00 92.07  ? 172 ARG F NE  1 
ATOM   1168  C CZ  . ARG A 1 153 ? -12.549 11.867  -3.119  1.00 89.50  ? 172 ARG F CZ  1 
ATOM   1169  N NH1 . ARG A 1 153 ? -12.195 12.447  -4.260  1.00 82.97  ? 172 ARG F NH1 1 
ATOM   1170  N NH2 . ARG A 1 153 ? -13.833 11.664  -2.856  1.00 88.32  ? 172 ARG F NH2 1 
ATOM   1171  N N   . LEU A 1 154 ? -5.768  15.092  -3.079  1.00 73.29  ? 173 LEU F N   1 
ATOM   1172  C CA  . LEU A 1 154 ? -4.808  15.839  -3.882  1.00 73.01  ? 173 LEU F CA  1 
ATOM   1173  C C   . LEU A 1 154 ? -3.430  15.190  -3.851  1.00 72.32  ? 173 LEU F C   1 
ATOM   1174  O O   . LEU A 1 154 ? -2.663  15.317  -4.811  1.00 72.35  ? 173 LEU F O   1 
ATOM   1175  C CB  . LEU A 1 154 ? -4.730  17.282  -3.386  1.00 72.57  ? 173 LEU F CB  1 
ATOM   1176  C CG  . LEU A 1 154 ? -6.026  18.090  -3.468  1.00 73.26  ? 173 LEU F CG  1 
ATOM   1177  C CD1 . LEU A 1 154 ? -5.936  19.346  -2.615  1.00 72.70  ? 173 LEU F CD1 1 
ATOM   1178  C CD2 . LEU A 1 154 ? -6.362  18.434  -4.901  1.00 74.10  ? 173 LEU F CD2 1 
ATOM   1179  N N   . SER A 1 155 ? -3.104  14.491  -2.768  1.00 71.95  ? 174 SER F N   1 
ATOM   1180  C CA  . SER A 1 155 ? -1.800  13.866  -2.585  1.00 71.05  ? 174 SER F CA  1 
ATOM   1181  C C   . SER A 1 155 ? -1.912  12.347  -2.571  1.00 74.56  ? 174 SER F C   1 
ATOM   1182  O O   . SER A 1 155 ? -1.346  11.677  -1.704  1.00 85.62  ? 174 SER F O   1 
ATOM   1183  C CB  . SER A 1 155 ? -1.149  14.348  -1.293  1.00 73.04  ? 174 SER F CB  1 
ATOM   1184  O OG  . SER A 1 155 ? -1.811  13.803  -0.162  1.00 70.05  ? 174 SER F OG  1 
ATOM   1185  N N   . SER A 1 156 ? -2.652  11.789  -3.529  1.00 78.65  ? 175 SER F N   1 
ATOM   1186  C CA  . SER A 1 156 ? -2.893  10.353  -3.576  1.00 81.40  ? 175 SER F CA  1 
ATOM   1187  C C   . SER A 1 156 ? -1.587  9.571   -3.603  1.00 80.15  ? 175 SER F C   1 
ATOM   1188  O O   . SER A 1 156 ? -0.955  9.436   -4.655  1.00 77.03  ? 175 SER F O   1 
ATOM   1189  C CB  . SER A 1 156 ? -3.748  9.993   -4.794  1.00 87.09  ? 175 SER F CB  1 
ATOM   1190  O OG  . SER A 1 156 ? -5.119  10.259  -4.553  1.00 92.77  ? 175 SER F OG  1 
ATOM   1191  N N   . GLY A 1 157 ? -1.171  9.068   -2.443  1.00 78.47  ? 176 GLY F N   1 
ATOM   1192  C CA  . GLY A 1 157 ? 0.003   8.223   -2.362  1.00 82.64  ? 176 GLY F CA  1 
ATOM   1193  C C   . GLY A 1 157 ? 1.278   8.948   -1.987  1.00 79.17  ? 176 GLY F C   1 
ATOM   1194  O O   . GLY A 1 157 ? 2.073   8.439   -1.191  1.00 83.64  ? 176 GLY F O   1 
ATOM   1195  N N   . SER A 1 158 ? 1.486   10.133  -2.555  1.00 79.46  ? 177 SER F N   1 
ATOM   1196  C CA  . SER A 1 158 ? 2.710   10.882  -2.306  1.00 74.42  ? 177 SER F CA  1 
ATOM   1197  C C   . SER A 1 158 ? 2.793   11.327  -0.851  1.00 69.59  ? 177 SER F C   1 
ATOM   1198  O O   . SER A 1 158 ? 1.816   11.809  -0.272  1.00 68.64  ? 177 SER F O   1 
ATOM   1199  C CB  . SER A 1 158 ? 2.781   12.090  -3.238  1.00 76.04  ? 177 SER F CB  1 
ATOM   1200  O OG  . SER A 1 158 ? 1.492   12.643  -3.445  1.00 74.57  ? 177 SER F OG  1 
ATOM   1201  N N   . GLN A 1 159 ? 3.975   11.157  -0.257  1.00 67.81  ? 178 GLN F N   1 
ATOM   1202  C CA  . GLN A 1 159 ? 4.193   11.524  1.135   1.00 68.12  ? 178 GLN F CA  1 
ATOM   1203  C C   . GLN A 1 159 ? 4.902   12.861  1.310   1.00 66.64  ? 178 GLN F C   1 
ATOM   1204  O O   . GLN A 1 159 ? 5.010   13.335  2.446   1.00 66.14  ? 178 GLN F O   1 
ATOM   1205  C CB  . GLN A 1 159 ? 4.990   10.434  1.861   1.00 67.09  ? 178 GLN F CB  1 
ATOM   1206  C CG  . GLN A 1 159 ? 6.041   9.748   1.019   1.00 67.46  ? 178 GLN F CG  1 
ATOM   1207  C CD  . GLN A 1 159 ? 6.499   8.439   1.637   1.00 69.46  ? 178 GLN F CD  1 
ATOM   1208  O OE1 . GLN A 1 159 ? 5.849   7.900   2.536   1.00 67.95  ? 178 GLN F OE1 1 
ATOM   1209  N NE2 . GLN A 1 159 ? 7.626   7.922   1.160   1.00 71.10  ? 178 GLN F NE2 1 
ATOM   1210  N N   . SER A 1 160 ? 5.386   13.474  0.232   1.00 66.78  ? 179 SER F N   1 
ATOM   1211  C CA  . SER A 1 160 ? 6.026   14.781  0.292   1.00 66.37  ? 179 SER F CA  1 
ATOM   1212  C C   . SER A 1 160 ? 5.396   15.697  -0.748  1.00 66.90  ? 179 SER F C   1 
ATOM   1213  O O   . SER A 1 160 ? 4.649   15.258  -1.626  1.00 67.59  ? 179 SER F O   1 
ATOM   1214  C CB  . SER A 1 160 ? 7.545   14.680  0.078   1.00 65.95  ? 179 SER F CB  1 
ATOM   1215  O OG  . SER A 1 160 ? 7.862   14.314  -1.252  1.00 66.42  ? 179 SER F OG  1 
ATOM   1216  N N   . SER A 1 161 ? 5.704   16.987  -0.643  1.00 66.61  ? 180 SER F N   1 
ATOM   1217  C CA  . SER A 1 161 ? 5.101   17.973  -1.527  1.00 67.09  ? 180 SER F CA  1 
ATOM   1218  C C   . SER A 1 161 ? 5.969   19.222  -1.568  1.00 66.68  ? 180 SER F C   1 
ATOM   1219  O O   . SER A 1 161 ? 6.799   19.458  -0.686  1.00 69.54  ? 180 SER F O   1 
ATOM   1220  C CB  . SER A 1 161 ? 3.678   18.323  -1.082  1.00 67.42  ? 180 SER F CB  1 
ATOM   1221  O OG  . SER A 1 161 ? 3.326   19.630  -1.492  1.00 67.61  ? 180 SER F OG  1 
ATOM   1222  N N   . HIS A 1 162 ? 5.754   20.024  -2.609  1.00 67.13  ? 181 HIS F N   1 
ATOM   1223  C CA  . HIS A 1 162 ? 6.489   21.264  -2.843  1.00 66.96  ? 181 HIS F CA  1 
ATOM   1224  C C   . HIS A 1 162 ? 5.466   22.389  -2.925  1.00 67.18  ? 181 HIS F C   1 
ATOM   1225  O O   . HIS A 1 162 ? 4.680   22.447  -3.874  1.00 72.21  ? 181 HIS F O   1 
ATOM   1226  C CB  . HIS A 1 162 ? 7.316   21.159  -4.127  1.00 70.85  ? 181 HIS F CB  1 
ATOM   1227  C CG  . HIS A 1 162 ? 8.052   22.412  -4.498  1.00 71.19  ? 181 HIS F CG  1 
ATOM   1228  N ND1 . HIS A 1 162 ? 7.428   23.629  -4.668  1.00 68.22  ? 181 HIS F ND1 1 
ATOM   1229  C CD2 . HIS A 1 162 ? 9.361   22.622  -4.774  1.00 73.97  ? 181 HIS F CD2 1 
ATOM   1230  C CE1 . HIS A 1 162 ? 8.323   24.539  -5.008  1.00 70.51  ? 181 HIS F CE1 1 
ATOM   1231  N NE2 . HIS A 1 162 ? 9.504   23.954  -5.079  1.00 75.03  ? 181 HIS F NE2 1 
ATOM   1232  N N   . ILE A 1 163 ? 5.464   23.279  -1.941  1.00 66.69  ? 182 ILE F N   1 
ATOM   1233  C CA  . ILE A 1 163 ? 4.523   24.391  -1.917  1.00 66.95  ? 182 ILE F CA  1 
ATOM   1234  C C   . ILE A 1 163 ? 5.261   25.650  -2.339  1.00 66.78  ? 182 ILE F C   1 
ATOM   1235  O O   . ILE A 1 163 ? 6.400   25.883  -1.921  1.00 66.20  ? 182 ILE F O   1 
ATOM   1236  C CB  . ILE A 1 163 ? 3.882   24.537  -0.526  1.00 66.62  ? 182 ILE F CB  1 
ATOM   1237  C CG1 . ILE A 1 163 ? 3.025   23.308  -0.248  1.00 66.94  ? 182 ILE F CG1 1 
ATOM   1238  C CG2 . ILE A 1 163 ? 3.028   25.784  -0.459  1.00 66.86  ? 182 ILE F CG2 1 
ATOM   1239  C CD1 . ILE A 1 163 ? 2.613   23.153  1.179   1.00 66.59  ? 182 ILE F CD1 1 
ATOM   1240  N N   . LEU A 1 164 ? 4.625   26.453  -3.188  1.00 68.75  ? 183 LEU F N   1 
ATOM   1241  C CA  . LEU A 1 164 ? 5.261   27.608  -3.801  1.00 68.78  ? 183 LEU F CA  1 
ATOM   1242  C C   . LEU A 1 164 ? 4.276   28.765  -3.769  1.00 69.69  ? 183 LEU F C   1 
ATOM   1243  O O   . LEU A 1 164 ? 3.070   28.554  -3.896  1.00 71.17  ? 183 LEU F O   1 
ATOM   1244  C CB  . LEU A 1 164 ? 5.681   27.279  -5.241  1.00 70.61  ? 183 LEU F CB  1 
ATOM   1245  C CG  . LEU A 1 164 ? 5.878   28.364  -6.297  1.00 71.27  ? 183 LEU F CG  1 
ATOM   1246  C CD1 . LEU A 1 164 ? 6.958   29.333  -5.876  1.00 73.56  ? 183 LEU F CD1 1 
ATOM   1247  C CD2 . LEU A 1 164 ? 6.216   27.731  -7.634  1.00 71.77  ? 183 LEU F CD2 1 
ATOM   1248  N N   . VAL A 1 165 ? 4.778   29.981  -3.576  1.00 71.57  ? 184 VAL F N   1 
ATOM   1249  C CA  . VAL A 1 165 ? 3.934   31.169  -3.521  1.00 71.82  ? 184 VAL F CA  1 
ATOM   1250  C C   . VAL A 1 165 ? 4.639   32.261  -4.311  1.00 71.95  ? 184 VAL F C   1 
ATOM   1251  O O   . VAL A 1 165 ? 5.690   32.755  -3.888  1.00 78.66  ? 184 VAL F O   1 
ATOM   1252  C CB  . VAL A 1 165 ? 3.659   31.634  -2.082  1.00 71.30  ? 184 VAL F CB  1 
ATOM   1253  C CG1 . VAL A 1 165 ? 3.069   33.029  -2.082  1.00 71.50  ? 184 VAL F CG1 1 
ATOM   1254  C CG2 . VAL A 1 165 ? 2.711   30.678  -1.390  1.00 71.41  ? 184 VAL F CG2 1 
ATOM   1255  N N   . ARG A 1 166 ? 4.075   32.636  -5.452  1.00 76.16  ? 185 ARG F N   1 
ATOM   1256  C CA  . ARG A 1 166 ? 4.644   33.723  -6.232  1.00 78.19  ? 185 ARG F CA  1 
ATOM   1257  C C   . ARG A 1 166 ? 3.798   34.981  -6.089  1.00 77.20  ? 185 ARG F C   1 
ATOM   1258  O O   . ARG A 1 166 ? 2.651   34.944  -5.638  1.00 73.16  ? 185 ARG F O   1 
ATOM   1259  C CB  . ARG A 1 166 ? 4.797   33.343  -7.709  1.00 82.25  ? 185 ARG F CB  1 
ATOM   1260  C CG  . ARG A 1 166 ? 3.630   32.606  -8.337  1.00 84.67  ? 185 ARG F CG  1 
ATOM   1261  C CD  . ARG A 1 166 ? 4.027   32.099  -9.720  1.00 82.58  ? 185 ARG F CD  1 
ATOM   1262  N NE  . ARG A 1 166 ? 5.306   31.393  -9.685  1.00 85.39  ? 185 ARG F NE  1 
ATOM   1263  C CZ  . ARG A 1 166 ? 5.975   30.990  -10.762 1.00 85.55  ? 185 ARG F CZ  1 
ATOM   1264  N NH1 . ARG A 1 166 ? 5.487   31.220  -11.975 1.00 84.71  ? 185 ARG F NH1 1 
ATOM   1265  N NH2 . ARG A 1 166 ? 7.135   30.356  -10.626 1.00 78.29  ? 185 ARG F NH2 1 
ATOM   1266  N N   . GLY A 1 167 ? 4.396   36.109  -6.461  1.00 79.87  ? 186 GLY F N   1 
ATOM   1267  C CA  . GLY A 1 167 ? 3.779   37.406  -6.276  1.00 80.46  ? 186 GLY F CA  1 
ATOM   1268  C C   . GLY A 1 167 ? 3.530   38.102  -7.599  1.00 80.14  ? 186 GLY F C   1 
ATOM   1269  O O   . GLY A 1 167 ? 4.237   37.875  -8.582  1.00 81.16  ? 186 GLY F O   1 
ATOM   1270  N N   . ARG A 1 168 ? 2.510   38.956  -7.613  1.00 82.06  ? 187 ARG F N   1 
ATOM   1271  C CA  . ARG A 1 168 ? 2.141   39.739  -8.780  1.00 84.49  ? 187 ARG F CA  1 
ATOM   1272  C C   . ARG A 1 168 ? 2.050   41.207  -8.396  1.00 87.26  ? 187 ARG F C   1 
ATOM   1273  O O   . ARG A 1 168 ? 1.554   41.551  -7.315  1.00 86.57  ? 187 ARG F O   1 
ATOM   1274  C CB  . ARG A 1 168 ? 0.801   39.287  -9.374  1.00 83.87  ? 187 ARG F CB  1 
ATOM   1275  C CG  . ARG A 1 168 ? 0.650   37.793  -9.551  1.00 83.48  ? 187 ARG F CG  1 
ATOM   1276  C CD  . ARG A 1 168 ? -0.752  37.458  -10.029 1.00 84.41  ? 187 ARG F CD  1 
ATOM   1277  N NE  . ARG A 1 168 ? -1.779  37.916  -9.099  1.00 84.43  ? 187 ARG F NE  1 
ATOM   1278  C CZ  . ARG A 1 168 ? -3.036  37.486  -9.106  1.00 88.31  ? 187 ARG F CZ  1 
ATOM   1279  N NH1 . ARG A 1 168 ? -3.425  36.582  -9.996  1.00 88.24  ? 187 ARG F NH1 1 
ATOM   1280  N NH2 . ARG A 1 168 ? -3.907  37.962  -8.226  1.00 87.40  ? 187 ARG F NH2 1 
ATOM   1281  N N   . SER A 1 169 ? 2.534   42.062  -9.294  1.00 91.68  ? 188 SER F N   1 
ATOM   1282  C CA  . SER A 1 169 ? 2.418   43.507  -9.170  1.00 92.48  ? 188 SER F CA  1 
ATOM   1283  C C   . SER A 1 169 ? 2.543   44.101  -10.564 1.00 97.85  ? 188 SER F C   1 
ATOM   1284  O O   . SER A 1 169 ? 3.288   43.581  -11.398 1.00 96.00  ? 188 SER F O   1 
ATOM   1285  C CB  . SER A 1 169 ? 3.491   44.087  -8.239  1.00 90.47  ? 188 SER F CB  1 
ATOM   1286  O OG  . SER A 1 169 ? 3.285   45.474  -8.015  1.00 84.32  ? 188 SER F OG  1 
ATOM   1287  N N   . ALA A 1 170 ? 1.799   45.179  -10.814 1.00 100.03 ? 189 ALA F N   1 
ATOM   1288  C CA  . ALA A 1 170 ? 1.880   45.831  -12.115 1.00 96.97  ? 189 ALA F CA  1 
ATOM   1289  C C   . ALA A 1 170 ? 3.187   46.593  -12.278 1.00 96.49  ? 189 ALA F C   1 
ATOM   1290  O O   . ALA A 1 170 ? 3.717   46.682  -13.391 1.00 96.13  ? 189 ALA F O   1 
ATOM   1291  C CB  . ALA A 1 170 ? 0.687   46.766  -12.311 1.00 98.01  ? 189 ALA F CB  1 
ATOM   1292  N N   . ALA A 1 171 ? 3.729   47.131  -11.183 1.00 99.99  ? 190 ALA F N   1 
ATOM   1293  C CA  . ALA A 1 171 ? 4.935   47.945  -11.267 1.00 100.21 ? 190 ALA F CA  1 
ATOM   1294  C C   . ALA A 1 171 ? 6.208   47.109  -11.269 1.00 100.22 ? 190 ALA F C   1 
ATOM   1295  O O   . ALA A 1 171 ? 7.201   47.504  -11.892 1.00 97.56  ? 190 ALA F O   1 
ATOM   1296  C CB  . ALA A 1 171 ? 4.971   48.947  -10.112 1.00 98.37  ? 190 ALA F CB  1 
ATOM   1297  N N   . PHE A 1 172 ? 6.209   45.963  -10.594 1.00 102.29 ? 191 PHE F N   1 
ATOM   1298  C CA  . PHE A 1 172 ? 7.412   45.159  -10.445 1.00 100.05 ? 191 PHE F CA  1 
ATOM   1299  C C   . PHE A 1 172 ? 7.114   43.697  -10.738 1.00 96.90  ? 191 PHE F C   1 
ATOM   1300  O O   . PHE A 1 172 ? 5.963   43.286  -10.901 1.00 92.71  ? 191 PHE F O   1 
ATOM   1301  C CB  . PHE A 1 172 ? 7.998   45.272  -9.030  1.00 101.15 ? 191 PHE F CB  1 
ATOM   1302  C CG  . PHE A 1 172 ? 8.166   46.680  -8.548  1.00 103.19 ? 191 PHE F CG  1 
ATOM   1303  C CD1 . PHE A 1 172 ? 7.151   47.311  -7.849  1.00 103.11 ? 191 PHE F CD1 1 
ATOM   1304  C CD2 . PHE A 1 172 ? 9.345   47.367  -8.776  1.00 101.62 ? 191 PHE F CD2 1 
ATOM   1305  C CE1 . PHE A 1 172 ? 7.304   48.603  -7.396  1.00 102.86 ? 191 PHE F CE1 1 
ATOM   1306  C CE2 . PHE A 1 172 ? 9.505   48.662  -8.325  1.00 100.86 ? 191 PHE F CE2 1 
ATOM   1307  C CZ  . PHE A 1 172 ? 8.482   49.281  -7.634  1.00 102.55 ? 191 PHE F CZ  1 
ATOM   1308  N N   . GLY A 1 173 ? 8.186   42.912  -10.803 1.00 95.40  ? 192 GLY F N   1 
ATOM   1309  C CA  . GLY A 1 173 ? 8.097   41.469  -10.707 1.00 96.58  ? 192 GLY F CA  1 
ATOM   1310  C C   . GLY A 1 173 ? 8.526   41.054  -9.312  1.00 94.21  ? 192 GLY F C   1 
ATOM   1311  O O   . GLY A 1 173 ? 9.614   41.410  -8.854  1.00 88.92  ? 192 GLY F O   1 
ATOM   1312  N N   . ILE A 1 174 ? 7.653   40.322  -8.637  1.00 88.51  ? 193 ILE F N   1 
ATOM   1313  C CA  . ILE A 1 174 ? 7.842   39.956  -7.235  1.00 86.87  ? 193 ILE F CA  1 
ATOM   1314  C C   . ILE A 1 174 ? 8.485   38.576  -7.179  1.00 85.17  ? 193 ILE F C   1 
ATOM   1315  O O   . ILE A 1 174 ? 8.016   37.662  -7.872  1.00 98.46  ? 193 ILE F O   1 
ATOM   1316  C CB  . ILE A 1 174 ? 6.509   39.969  -6.465  1.00 87.64  ? 193 ILE F CB  1 
ATOM   1317  C CG1 . ILE A 1 174 ? 5.762   41.282  -6.710  1.00 91.36  ? 193 ILE F CG1 1 
ATOM   1318  C CG2 . ILE A 1 174 ? 6.748   39.762  -4.975  1.00 86.96  ? 193 ILE F CG2 1 
ATOM   1319  C CD1 . ILE A 1 174 ? 6.519   42.512  -6.255  1.00 96.17  ? 193 ILE F CD1 1 
ATOM   1320  N N   . PRO A 1 175 ? 9.539   38.383  -6.392  1.00 84.08  ? 194 PRO F N   1 
ATOM   1321  C CA  . PRO A 1 175 ? 10.097  37.039  -6.225  1.00 87.09  ? 194 PRO F CA  1 
ATOM   1322  C C   . PRO A 1 175 ? 9.171   36.163  -5.395  1.00 90.60  ? 194 PRO F C   1 
ATOM   1323  O O   . PRO A 1 175 ? 8.306   36.642  -4.658  1.00 97.69  ? 194 PRO F O   1 
ATOM   1324  C CB  . PRO A 1 175 ? 11.423  37.292  -5.503  1.00 87.96  ? 194 PRO F CB  1 
ATOM   1325  C CG  . PRO A 1 175 ? 11.190  38.555  -4.750  1.00 88.91  ? 194 PRO F CG  1 
ATOM   1326  C CD  . PRO A 1 175 ? 10.282  39.390  -5.615  1.00 87.97  ? 194 PRO F CD  1 
ATOM   1327  N N   . CYS A 1 176 ? 9.370   34.858  -5.521  1.00 88.99  ? 195 CYS F N   1 
ATOM   1328  C CA  . CYS A 1 176 ? 8.488   33.877  -4.916  1.00 87.91  ? 195 CYS F CA  1 
ATOM   1329  C C   . CYS A 1 176 ? 9.065   33.386  -3.588  1.00 84.85  ? 195 CYS F C   1 
ATOM   1330  O O   . CYS A 1 176 ? 10.076  33.892  -3.093  1.00 87.48  ? 195 CYS F O   1 
ATOM   1331  C CB  . CYS A 1 176 ? 8.259   32.724  -5.894  1.00 89.12  ? 195 CYS F CB  1 
ATOM   1332  S SG  . CYS A 1 176 ? 9.781   31.962  -6.502  1.00 93.14  ? 195 CYS F SG  1 
ATOM   1333  N N   . THR A 1 177 ? 8.410   32.386  -3.003  1.00 80.03  ? 196 THR F N   1 
ATOM   1334  C CA  . THR A 1 177 ? 8.850   31.752  -1.767  1.00 77.21  ? 196 THR F CA  1 
ATOM   1335  C C   . THR A 1 177 ? 8.306   30.334  -1.757  1.00 78.64  ? 196 THR F C   1 
ATOM   1336  O O   . THR A 1 177 ? 7.099   30.138  -1.918  1.00 77.37  ? 196 THR F O   1 
ATOM   1337  C CB  . THR A 1 177 ? 8.359   32.513  -0.529  1.00 77.81  ? 196 THR F CB  1 
ATOM   1338  O OG1 . THR A 1 177 ? 8.711   33.900  -0.635  1.00 84.99  ? 196 THR F OG1 1 
ATOM   1339  C CG2 . THR A 1 177 ? 8.968   31.923  0.734   1.00 79.40  ? 196 THR F CG2 1 
ATOM   1340  N N   . ASP A 1 178 ? 9.185   29.353  -1.574  1.00 74.24  ? 197 ASP F N   1 
ATOM   1341  C CA  . ASP A 1 178 ? 8.787   27.955  -1.627  1.00 71.27  ? 197 ASP F CA  1 
ATOM   1342  C C   . ASP A 1 178 ? 9.291   27.202  -0.402  1.00 68.23  ? 197 ASP F C   1 
ATOM   1343  O O   . ASP A 1 178 ? 10.177  27.659  0.325   1.00 73.95  ? 197 ASP F O   1 
ATOM   1344  C CB  . ASP A 1 178 ? 9.285   27.287  -2.919  1.00 71.86  ? 197 ASP F CB  1 
ATOM   1345  C CG  . ASP A 1 178 ? 10.795  27.255  -3.016  1.00 71.49  ? 197 ASP F CG  1 
ATOM   1346  O OD1 . ASP A 1 178 ? 11.441  28.195  -2.509  1.00 74.92  ? 197 ASP F OD1 1 
ATOM   1347  O OD2 . ASP A 1 178 ? 11.338  26.296  -3.604  1.00 72.82  ? 197 ASP F OD2 1 
ATOM   1348  N N   . LYS A 1 179 ? 8.691   26.035  -0.182  1.00 64.77  ? 198 LYS F N   1 
ATOM   1349  C CA  . LYS A 1 179 ? 9.005   25.185  0.955   1.00 64.30  ? 198 LYS F CA  1 
ATOM   1350  C C   . LYS A 1 179 ? 8.701   23.738  0.596   1.00 64.60  ? 198 LYS F C   1 
ATOM   1351  O O   . LYS A 1 179 ? 7.670   23.443  -0.018  1.00 67.02  ? 198 LYS F O   1 
ATOM   1352  C CB  . LYS A 1 179 ? 8.211   25.604  2.199   1.00 65.11  ? 198 LYS F CB  1 
ATOM   1353  C CG  . LYS A 1 179 ? 8.235   24.588  3.331   1.00 69.67  ? 198 LYS F CG  1 
ATOM   1354  C CD  . LYS A 1 179 ? 7.641   25.149  4.617   1.00 70.95  ? 198 LYS F CD  1 
ATOM   1355  C CE  . LYS A 1 179 ? 8.588   26.132  5.285   1.00 74.12  ? 198 LYS F CE  1 
ATOM   1356  N NZ  . LYS A 1 179 ? 8.114   26.506  6.646   1.00 76.39  ? 198 LYS F NZ  1 
ATOM   1357  N N   . PHE A 1 180 ? 9.605   22.842  0.979   1.00 64.26  ? 199 PHE F N   1 
ATOM   1358  C CA  . PHE A 1 180 ? 9.400   21.410  0.821   1.00 64.48  ? 199 PHE F CA  1 
ATOM   1359  C C   . PHE A 1 180 ? 8.827   20.845  2.112   1.00 64.23  ? 199 PHE F C   1 
ATOM   1360  O O   . PHE A 1 180 ? 9.376   21.082  3.193   1.00 63.70  ? 199 PHE F O   1 
ATOM   1361  C CB  . PHE A 1 180 ? 10.715  20.718  0.471   1.00 64.30  ? 199 PHE F CB  1 
ATOM   1362  C CG  . PHE A 1 180 ? 11.233  21.067  -0.891  1.00 66.14  ? 199 PHE F CG  1 
ATOM   1363  C CD1 . PHE A 1 180 ? 12.046  22.174  -1.073  1.00 68.81  ? 199 PHE F CD1 1 
ATOM   1364  C CD2 . PHE A 1 180 ? 10.912  20.288  -1.991  1.00 71.28  ? 199 PHE F CD2 1 
ATOM   1365  C CE1 . PHE A 1 180 ? 12.525  22.503  -2.326  1.00 68.19  ? 199 PHE F CE1 1 
ATOM   1366  C CE2 . PHE A 1 180 ? 11.392  20.608  -3.249  1.00 70.58  ? 199 PHE F CE2 1 
ATOM   1367  C CZ  . PHE A 1 180 ? 12.199  21.718  -3.415  1.00 69.47  ? 199 PHE F CZ  1 
ATOM   1368  N N   . VAL A 1 181 ? 7.723   20.108  2.003   1.00 64.66  ? 200 VAL F N   1 
ATOM   1369  C CA  . VAL A 1 181 ? 7.034   19.581  3.173   1.00 64.54  ? 200 VAL F CA  1 
ATOM   1370  C C   . VAL A 1 181 ? 6.917   18.068  3.064   1.00 64.75  ? 200 VAL F C   1 
ATOM   1371  O O   . VAL A 1 181 ? 6.824   17.504  1.970   1.00 65.20  ? 200 VAL F O   1 
ATOM   1372  C CB  . VAL A 1 181 ? 5.638   20.216  3.351   1.00 64.91  ? 200 VAL F CB  1 
ATOM   1373  C CG1 . VAL A 1 181 ? 5.765   21.669  3.772   1.00 64.62  ? 200 VAL F CG1 1 
ATOM   1374  C CG2 . VAL A 1 181 ? 4.838   20.097  2.065   1.00 65.64  ? 200 VAL F CG2 1 
ATOM   1375  N N   . VAL A 1 182 ? 6.933   17.413  4.220   1.00 64.45  ? 201 VAL F N   1 
ATOM   1376  C CA  . VAL A 1 182 ? 6.611   15.998  4.344   1.00 64.66  ? 201 VAL F CA  1 
ATOM   1377  C C   . VAL A 1 182 ? 5.384   15.915  5.237   1.00 64.84  ? 201 VAL F C   1 
ATOM   1378  O O   . VAL A 1 182 ? 5.456   16.247  6.428   1.00 64.47  ? 201 VAL F O   1 
ATOM   1379  C CB  . VAL A 1 182 ? 7.773   15.183  4.923   1.00 64.19  ? 201 VAL F CB  1 
ATOM   1380  C CG1 . VAL A 1 182 ? 7.419   13.710  4.939   1.00 64.47  ? 201 VAL F CG1 1 
ATOM   1381  C CG2 . VAL A 1 182 ? 9.030   15.415  4.115   1.00 64.02  ? 201 VAL F CG2 1 
ATOM   1382  N N   . PHE A 1 183 ? 4.261   15.476  4.663   1.00 65.48  ? 202 PHE F N   1 
ATOM   1383  C CA  . PHE A 1 183 ? 2.975   15.528  5.355   1.00 65.79  ? 202 PHE F CA  1 
ATOM   1384  C C   . PHE A 1 183 ? 3.047   14.898  6.742   1.00 65.47  ? 202 PHE F C   1 
ATOM   1385  O O   . PHE A 1 183 ? 2.555   15.470  7.723   1.00 65.38  ? 202 PHE F O   1 
ATOM   1386  C CB  . PHE A 1 183 ? 1.908   14.831  4.513   1.00 66.56  ? 202 PHE F CB  1 
ATOM   1387  C CG  . PHE A 1 183 ? 1.699   15.446  3.160   1.00 67.00  ? 202 PHE F CG  1 
ATOM   1388  C CD1 . PHE A 1 183 ? 1.279   16.761  3.037   1.00 67.09  ? 202 PHE F CD1 1 
ATOM   1389  C CD2 . PHE A 1 183 ? 1.912   14.707  2.011   1.00 67.38  ? 202 PHE F CD2 1 
ATOM   1390  C CE1 . PHE A 1 183 ? 1.075   17.326  1.794   1.00 67.54  ? 202 PHE F CE1 1 
ATOM   1391  C CE2 . PHE A 1 183 ? 1.714   15.268  0.766   1.00 67.85  ? 202 PHE F CE2 1 
ATOM   1392  C CZ  . PHE A 1 183 ? 1.293   16.579  0.657   1.00 67.93  ? 202 PHE F CZ  1 
ATOM   1393  N N   . SER A 1 184 ? 3.676   13.722  6.837   1.00 66.98  ? 203 SER F N   1 
ATOM   1394  C CA  . SER A 1 184 ? 3.776   13.007  8.106   1.00 65.07  ? 203 SER F CA  1 
ATOM   1395  C C   . SER A 1 184 ? 4.310   13.893  9.221   1.00 64.87  ? 203 SER F C   1 
ATOM   1396  O O   . SER A 1 184 ? 3.972   13.690  10.392  1.00 69.32  ? 203 SER F O   1 
ATOM   1397  C CB  . SER A 1 184 ? 4.685   11.789  7.943   1.00 64.90  ? 203 SER F CB  1 
ATOM   1398  O OG  . SER A 1 184 ? 4.510   11.195  6.669   1.00 69.16  ? 203 SER F OG  1 
ATOM   1399  N N   . GLN A 1 185 ? 5.129   14.886  8.876   1.00 64.44  ? 204 GLN F N   1 
ATOM   1400  C CA  . GLN A 1 185 ? 5.819   15.707  9.858   1.00 64.35  ? 204 GLN F CA  1 
ATOM   1401  C C   . GLN A 1 185 ? 5.099   17.006  10.179  1.00 63.72  ? 204 GLN F C   1 
ATOM   1402  O O   . GLN A 1 185 ? 5.539   17.730  11.078  1.00 63.34  ? 204 GLN F O   1 
ATOM   1403  C CB  . GLN A 1 185 ? 7.234   16.029  9.365   1.00 65.25  ? 204 GLN F CB  1 
ATOM   1404  C CG  . GLN A 1 185 ? 7.974   14.842  8.764   1.00 66.67  ? 204 GLN F CG  1 
ATOM   1405  C CD  . GLN A 1 185 ? 8.030   13.645  9.698   1.00 66.70  ? 204 GLN F CD  1 
ATOM   1406  O OE1 . GLN A 1 185 ? 7.175   12.761  9.648   1.00 65.52  ? 204 GLN F OE1 1 
ATOM   1407  N NE2 . GLN A 1 185 ? 9.047   13.607  10.550  1.00 66.04  ? 204 GLN F NE2 1 
ATOM   1408  N N   . ILE A 1 186 ? 4.010   17.326  9.482   1.00 64.23  ? 205 ILE F N   1 
ATOM   1409  C CA  . ILE A 1 186 ? 3.359   18.613  9.680   1.00 64.34  ? 205 ILE F CA  1 
ATOM   1410  C C   . ILE A 1 186 ? 1.891   18.455  10.089  1.00 64.89  ? 205 ILE F C   1 
ATOM   1411  O O   . ILE A 1 186 ? 1.128   19.412  10.042  1.00 65.15  ? 205 ILE F O   1 
ATOM   1412  C CB  . ILE A 1 186 ? 3.502   19.506  8.432   1.00 64.45  ? 205 ILE F CB  1 
ATOM   1413  C CG1 . ILE A 1 186 ? 2.633   18.970  7.296   1.00 65.10  ? 205 ILE F CG1 1 
ATOM   1414  C CG2 . ILE A 1 186 ? 4.952   19.601  8.004   1.00 63.97  ? 205 ILE F CG2 1 
ATOM   1415  C CD1 . ILE A 1 186 ? 2.625   19.853  6.064   1.00 65.33  ? 205 ILE F CD1 1 
ATOM   1416  N N   . GLU A 1 187 ? 1.489   17.263  10.522  1.00 65.10  ? 206 GLU F N   1 
ATOM   1417  C CA  . GLU A 1 187 ? 0.109   17.026  10.921  1.00 65.68  ? 206 GLU F CA  1 
ATOM   1418  C C   . GLU A 1 187 ? -0.077  17.346  12.397  1.00 65.53  ? 206 GLU F C   1 
ATOM   1419  O O   . GLU A 1 187 ? 0.642   16.817  13.251  1.00 65.14  ? 206 GLU F O   1 
ATOM   1420  C CB  . GLU A 1 187 ? -0.312  15.582  10.646  1.00 66.08  ? 206 GLU F CB  1 
ATOM   1421  C CG  . GLU A 1 187 ? -1.675  15.240  11.244  1.00 66.69  ? 206 GLU F CG  1 
ATOM   1422  C CD  . GLU A 1 187 ? -2.278  13.967  10.676  1.00 67.23  ? 206 GLU F CD  1 
ATOM   1423  O OE1 . GLU A 1 187 ? -3.382  13.580  11.117  1.00 67.79  ? 206 GLU F OE1 1 
ATOM   1424  O OE2 . GLU A 1 187 ? -1.651  13.357  9.785   1.00 67.14  ? 206 GLU F OE2 1 
ATOM   1425  N N   . ILE A 1 188 ? -1.039  18.216  12.690  1.00 65.87  ? 207 ILE F N   1 
ATOM   1426  C CA  . ILE A 1 188 ? -1.546  18.368  14.050  1.00 65.96  ? 207 ILE F CA  1 
ATOM   1427  C C   . ILE A 1 188 ? -2.498  17.201  14.284  1.00 66.53  ? 207 ILE F C   1 
ATOM   1428  O O   . ILE A 1 188 ? -3.599  17.163  13.730  1.00 67.17  ? 207 ILE F O   1 
ATOM   1429  C CB  . ILE A 1 188 ? -2.241  19.719  14.261  1.00 66.17  ? 207 ILE F CB  1 
ATOM   1430  C CG1 . ILE A 1 188 ? -1.219  20.839  14.494  1.00 65.55  ? 207 ILE F CG1 1 
ATOM   1431  C CG2 . ILE A 1 188 ? -3.202  19.662  15.447  1.00 66.59  ? 207 ILE F CG2 1 
ATOM   1432  C CD1 . ILE A 1 188 ? -0.480  21.292  13.256  1.00 65.28  ? 207 ILE F CD1 1 
ATOM   1433  N N   . LEU A 1 189 ? -2.060  16.231  15.080  1.00 66.33  ? 208 LEU F N   1 
ATOM   1434  C CA  . LEU A 1 189 ? -2.782  14.971  15.196  1.00 66.83  ? 208 LEU F CA  1 
ATOM   1435  C C   . LEU A 1 189 ? -4.153  15.185  15.819  1.00 67.51  ? 208 LEU F C   1 
ATOM   1436  O O   . LEU A 1 189 ? -4.268  15.745  16.914  1.00 67.46  ? 208 LEU F O   1 
ATOM   1437  C CB  . LEU A 1 189 ? -1.975  13.979  16.025  1.00 66.47  ? 208 LEU F CB  1 
ATOM   1438  C CG  . LEU A 1 189 ? -0.776  13.332  15.333  1.00 65.99  ? 208 LEU F CG  1 
ATOM   1439  C CD1 . LEU A 1 189 ? -0.062  12.381  16.275  1.00 65.70  ? 208 LEU F CD1 1 
ATOM   1440  C CD2 . LEU A 1 189 ? -1.215  12.609  14.078  1.00 66.40  ? 208 LEU F CD2 1 
ATOM   1441  N N   . THR A 1 190 ? -5.190  14.748  15.119  1.00 68.19  ? 209 THR F N   1 
ATOM   1442  C CA  . THR A 1 190 ? -6.516  14.778  15.699  1.00 68.92  ? 209 THR F CA  1 
ATOM   1443  C C   . THR A 1 190 ? -6.655  13.668  16.738  1.00 69.08  ? 209 THR F C   1 
ATOM   1444  O O   . THR A 1 190 ? -6.193  12.544  16.515  1.00 68.95  ? 209 THR F O   1 
ATOM   1445  C CB  . THR A 1 190 ? -7.586  14.628  14.615  1.00 69.67  ? 209 THR F CB  1 
ATOM   1446  O OG1 . THR A 1 190 ? -8.885  14.779  15.193  1.00 70.43  ? 209 THR F OG1 1 
ATOM   1447  C CG2 . THR A 1 190 ? -7.483  13.283  13.934  1.00 69.84  ? 209 THR F CG2 1 
ATOM   1448  N N   . PRO A 1 191 ? -7.245  13.964  17.894  1.00 69.36  ? 210 PRO F N   1 
ATOM   1449  C CA  . PRO A 1 191 ? -7.444  12.926  18.901  1.00 69.60  ? 210 PRO F CA  1 
ATOM   1450  C C   . PRO A 1 191 ? -8.376  11.842  18.382  1.00 70.33  ? 210 PRO F C   1 
ATOM   1451  O O   . PRO A 1 191 ? -9.231  12.100  17.518  1.00 70.86  ? 210 PRO F O   1 
ATOM   1452  C CB  . PRO A 1 191 ? -8.079  13.685  20.074  1.00 69.92  ? 210 PRO F CB  1 
ATOM   1453  C CG  . PRO A 1 191 ? -8.518  14.997  19.510  1.00 70.04  ? 210 PRO F CG  1 
ATOM   1454  C CD  . PRO A 1 191 ? -7.589  15.303  18.397  1.00 69.42  ? 210 PRO F CD  1 
ATOM   1455  N N   . PRO A 1 192 ? -8.252  10.626  18.900  1.00 72.37  ? 211 PRO F N   1 
ATOM   1456  C CA  . PRO A 1 192 ? -9.144  9.551   18.456  1.00 73.77  ? 211 PRO F CA  1 
ATOM   1457  C C   . PRO A 1 192 ? -10.553 9.734   18.997  1.00 74.56  ? 211 PRO F C   1 
ATOM   1458  O O   . PRO A 1 192 ? -10.773 10.356  20.039  1.00 75.60  ? 211 PRO F O   1 
ATOM   1459  C CB  . PRO A 1 192 ? -8.483  8.287   19.020  1.00 73.07  ? 211 PRO F CB  1 
ATOM   1460  C CG  . PRO A 1 192 ? -7.724  8.771   20.211  1.00 71.04  ? 211 PRO F CG  1 
ATOM   1461  C CD  . PRO A 1 192 ? -7.248  10.153  19.869  1.00 71.09  ? 211 PRO F CD  1 
ATOM   1462  N N   . GLN A 1 193 ? -11.518 9.198   18.254  1.00 79.02  ? 212 GLN F N   1 
ATOM   1463  C CA  . GLN A 1 193 ? -12.918 9.246   18.653  1.00 83.42  ? 212 GLN F CA  1 
ATOM   1464  C C   . GLN A 1 193 ? -13.247 7.966   19.408  1.00 82.46  ? 212 GLN F C   1 
ATOM   1465  O O   . GLN A 1 193 ? -13.057 6.867   18.876  1.00 80.50  ? 212 GLN F O   1 
ATOM   1466  C CB  . GLN A 1 193 ? -13.828 9.406   17.437  1.00 87.81  ? 212 GLN F CB  1 
ATOM   1467  C CG  . GLN A 1 193 ? -13.464 10.570  16.535  1.00 90.79  ? 212 GLN F CG  1 
ATOM   1468  C CD  . GLN A 1 193 ? -14.313 10.618  15.280  1.00 92.42  ? 212 GLN F CD  1 
ATOM   1469  O OE1 . GLN A 1 193 ? -14.455 9.619   14.573  1.00 91.49  ? 212 GLN F OE1 1 
ATOM   1470  N NE2 . GLN A 1 193 ? -14.886 11.783  14.999  1.00 89.80  ? 212 GLN F NE2 1 
ATOM   1471  N N   . MET A 1 194 ? -13.741 8.109   20.637  1.00 83.83  ? 213 MET F N   1 
ATOM   1472  C CA  . MET A 1 194 ? -13.917 6.989   21.555  1.00 83.63  ? 213 MET F CA  1 
ATOM   1473  C C   . MET A 1 194 ? -15.385 6.827   21.924  1.00 87.52  ? 213 MET F C   1 
ATOM   1474  O O   . MET A 1 194 ? -15.994 7.745   22.481  1.00 93.42  ? 213 MET F O   1 
ATOM   1475  C CB  . MET A 1 194 ? -13.076 7.187   22.817  1.00 82.27  ? 213 MET F CB  1 
ATOM   1476  C CG  . MET A 1 194 ? -13.298 6.126   23.882  1.00 83.97  ? 213 MET F CG  1 
ATOM   1477  S SD  . MET A 1 194 ? -12.139 6.275   25.255  1.00 84.96  ? 213 MET F SD  1 
ATOM   1478  C CE  . MET A 1 194 ? -12.425 7.976   25.743  1.00 90.59  ? 213 MET F CE  1 
ATOM   1479  N N   . THR A 1 195 ? -15.939 5.656   21.627  1.00 91.31  ? 214 THR F N   1 
ATOM   1480  C CA  . THR A 1 195 ? -17.248 5.230   22.095  1.00 91.95  ? 214 THR F CA  1 
ATOM   1481  C C   . THR A 1 195 ? -17.072 4.130   23.137  1.00 90.92  ? 214 THR F C   1 
ATOM   1482  O O   . THR A 1 195 ? -15.992 3.549   23.285  1.00 91.38  ? 214 THR F O   1 
ATOM   1483  C CB  . THR A 1 195 ? -18.117 4.748   20.927  1.00 92.12  ? 214 THR F CB  1 
ATOM   1484  O OG1 . THR A 1 195 ? -17.413 3.741   20.189  1.00 94.63  ? 214 THR F OG1 1 
ATOM   1485  C CG2 . THR A 1 195 ? -18.461 5.906   20.004  1.00 93.35  ? 214 THR F CG2 1 
ATOM   1486  N N   . ALA A 1 196 ? -18.139 3.846   23.881  1.00 98.55  ? 215 ALA F N   1 
ATOM   1487  C CA  . ALA A 1 196 ? -18.018 2.858   24.944  1.00 98.31  ? 215 ALA F CA  1 
ATOM   1488  C C   . ALA A 1 196 ? -19.385 2.302   25.318  1.00 104.57 ? 215 ALA F C   1 
ATOM   1489  O O   . ALA A 1 196 ? -20.383 3.028   25.321  1.00 111.63 ? 215 ALA F O   1 
ATOM   1490  C CB  . ALA A 1 196 ? -17.339 3.453   26.184  1.00 93.38  ? 215 ALA F CB  1 
ATOM   1491  N N   . LYS A 1 197 ? -19.410 1.009   25.629  1.00 114.33 ? 216 LYS F N   1 
ATOM   1492  C CA  . LYS A 1 197 ? -20.566 0.338   26.209  1.00 111.73 ? 216 LYS F CA  1 
ATOM   1493  C C   . LYS A 1 197 ? -20.263 0.049   27.674  1.00 109.38 ? 216 LYS F C   1 
ATOM   1494  O O   . LYS A 1 197 ? -19.368 -0.748  27.981  1.00 108.06 ? 216 LYS F O   1 
ATOM   1495  C CB  . LYS A 1 197 ? -20.888 -0.960  25.465  1.00 112.74 ? 216 LYS F CB  1 
ATOM   1496  C CG  . LYS A 1 197 ? -20.814 -0.872  23.950  1.00 114.09 ? 216 LYS F CG  1 
ATOM   1497  C CD  . LYS A 1 197 ? -22.203 -0.813  23.339  1.00 117.07 ? 216 LYS F CD  1 
ATOM   1498  C CE  . LYS A 1 197 ? -22.194 -1.346  21.917  1.00 118.33 ? 216 LYS F CE  1 
ATOM   1499  N NZ  . LYS A 1 197 ? -23.494 -1.112  21.234  1.00 122.35 ? 216 LYS F NZ  1 
ATOM   1500  N N   . CYS A 1 198 ? -21.003 0.693   28.570  1.00 114.10 ? 217 CYS F N   1 
ATOM   1501  C CA  . CYS A 1 198 ? -20.845 0.506   30.002  1.00 114.92 ? 217 CYS F CA  1 
ATOM   1502  C C   . CYS A 1 198 ? -21.974 -0.375  30.534  1.00 118.11 ? 217 CYS F C   1 
ATOM   1503  O O   . CYS A 1 198 ? -23.015 -0.542  29.890  1.00 118.76 ? 217 CYS F O   1 
ATOM   1504  C CB  . CYS A 1 198 ? -20.807 1.862   30.722  1.00 117.99 ? 217 CYS F CB  1 
ATOM   1505  S SG  . CYS A 1 198 ? -20.249 1.792   32.437  1.00 128.38 ? 217 CYS F SG  1 
ATOM   1506  N N   . ASN A 1 199 ? -21.765 -0.922  31.732  1.00 123.21 ? 218 ASN F N   1 
ATOM   1507  C CA  . ASN A 1 199 ? -22.593 -2.000  32.266  1.00 119.76 ? 218 ASN F CA  1 
ATOM   1508  C C   . ASN A 1 199 ? -22.133 -2.272  33.695  1.00 117.91 ? 218 ASN F C   1 
ATOM   1509  O O   . ASN A 1 199 ? -21.002 -1.949  34.069  1.00 119.31 ? 218 ASN F O   1 
ATOM   1510  C CB  . ASN A 1 199 ? -22.495 -3.222  31.336  1.00 120.91 ? 218 ASN F CB  1 
ATOM   1511  C CG  . ASN A 1 199 ? -22.796 -4.566  31.995  1.00 121.01 ? 218 ASN F CG  1 
ATOM   1512  O OD1 . ASN A 1 199 ? -23.407 -4.690  33.058  1.00 117.13 ? 218 ASN F OD1 1 
ATOM   1513  N ND2 . ASN A 1 199 ? -22.341 -5.599  31.300  1.00 125.56 ? 218 ASN F ND2 1 
ATOM   1514  N N   . LYS A 1 200 ? -23.041 -2.841  34.496  1.00 114.29 ? 219 LYS F N   1 
ATOM   1515  C CA  . LYS A 1 200 ? -22.822 -2.985  35.937  1.00 117.23 ? 219 LYS F CA  1 
ATOM   1516  C C   . LYS A 1 200 ? -21.474 -3.626  36.254  1.00 113.04 ? 219 LYS F C   1 
ATOM   1517  O O   . LYS A 1 200 ? -20.721 -3.134  37.103  1.00 104.17 ? 219 LYS F O   1 
ATOM   1518  C CB  . LYS A 1 200 ? -23.964 -3.803  36.547  1.00 124.37 ? 219 LYS F CB  1 
ATOM   1519  C CG  . LYS A 1 200 ? -23.646 -4.472  37.880  1.00 126.31 ? 219 LYS F CG  1 
ATOM   1520  C CD  . LYS A 1 200 ? -23.647 -3.484  39.035  1.00 122.84 ? 219 LYS F CD  1 
ATOM   1521  C CE  . LYS A 1 200 ? -23.613 -4.216  40.369  1.00 119.76 ? 219 LYS F CE  1 
ATOM   1522  N NZ  . LYS A 1 200 ? -23.670 -3.284  41.526  1.00 121.95 ? 219 LYS F NZ  1 
ATOM   1523  N N   . THR A 1 201 ? -21.149 -4.725  35.577  1.00 106.72 ? 220 THR F N   1 
ATOM   1524  C CA  . THR A 1 201 ? -19.945 -5.491  35.876  1.00 109.07 ? 220 THR F CA  1 
ATOM   1525  C C   . THR A 1 201 ? -18.784 -5.185  34.940  1.00 112.23 ? 220 THR F C   1 
ATOM   1526  O O   . THR A 1 201 ? -17.629 -5.193  35.378  1.00 113.59 ? 220 THR F O   1 
ATOM   1527  C CB  . THR A 1 201 ? -20.252 -6.989  35.822  1.00 115.20 ? 220 THR F CB  1 
ATOM   1528  O OG1 . THR A 1 201 ? -20.589 -7.357  34.479  1.00 113.31 ? 220 THR F OG1 1 
ATOM   1529  C CG2 . THR A 1 201 ? -21.414 -7.325  36.741  1.00 120.23 ? 220 THR F CG2 1 
ATOM   1530  N N   . HIS A 1 202 ? -19.051 -4.922  33.663  1.00 111.62 ? 221 HIS F N   1 
ATOM   1531  C CA  . HIS A 1 202 ? -18.002 -4.688  32.683  1.00 110.06 ? 221 HIS F CA  1 
ATOM   1532  C C   . HIS A 1 202 ? -18.248 -3.373  31.958  1.00 109.07 ? 221 HIS F C   1 
ATOM   1533  O O   . HIS A 1 202 ? -19.342 -2.808  32.005  1.00 111.40 ? 221 HIS F O   1 
ATOM   1534  C CB  . HIS A 1 202 ? -17.929 -5.822  31.652  1.00 109.21 ? 221 HIS F CB  1 
ATOM   1535  C CG  . HIS A 1 202 ? -17.698 -7.172  32.251  1.00 112.39 ? 221 HIS F CG  1 
ATOM   1536  N ND1 . HIS A 1 202 ? -18.656 -7.829  32.992  1.00 114.33 ? 221 HIS F ND1 1 
ATOM   1537  C CD2 . HIS A 1 202 ? -16.623 -7.994  32.210  1.00 114.82 ? 221 HIS F CD2 1 
ATOM   1538  C CE1 . HIS A 1 202 ? -18.179 -8.996  33.386  1.00 118.67 ? 221 HIS F CE1 1 
ATOM   1539  N NE2 . HIS A 1 202 ? -16.948 -9.121  32.925  1.00 114.05 ? 221 HIS F NE2 1 
ATOM   1540  N N   . SER A 1 203 ? -17.209 -2.890  31.278  1.00 103.86 ? 222 SER F N   1 
ATOM   1541  C CA  . SER A 1 203 ? -17.363 -1.783  30.340  1.00 101.85 ? 222 SER F CA  1 
ATOM   1542  C C   . SER A 1 203 ? -16.293 -1.901  29.267  1.00 100.85 ? 222 SER F C   1 
ATOM   1543  O O   . SER A 1 203 ? -15.096 -1.922  29.575  1.00 102.87 ? 222 SER F O   1 
ATOM   1544  C CB  . SER A 1 203 ? -17.272 -0.430  31.049  1.00 100.97 ? 222 SER F CB  1 
ATOM   1545  O OG  . SER A 1 203 ? -15.964 0.103   30.967  1.00 101.62 ? 222 SER F OG  1 
ATOM   1546  N N   . PHE A 1 204 ? -16.727 -1.979  28.013  1.00 96.14  ? 223 PHE F N   1 
ATOM   1547  C CA  . PHE A 1 204 ? -15.826 -2.053  26.871  1.00 100.62 ? 223 PHE F CA  1 
ATOM   1548  C C   . PHE A 1 204 ? -15.729 -0.680  26.220  1.00 97.55  ? 223 PHE F C   1 
ATOM   1549  O O   . PHE A 1 204 ? -16.746 -0.010  26.018  1.00 99.23  ? 223 PHE F O   1 
ATOM   1550  C CB  . PHE A 1 204 ? -16.311 -3.087  25.850  1.00 106.56 ? 223 PHE F CB  1 
ATOM   1551  C CG  . PHE A 1 204 ? -16.224 -4.520  26.326  1.00 110.82 ? 223 PHE F CG  1 
ATOM   1552  C CD1 . PHE A 1 204 ? -15.631 -4.841  27.537  1.00 108.60 ? 223 PHE F CD1 1 
ATOM   1553  C CD2 . PHE A 1 204 ? -16.749 -5.547  25.553  1.00 113.93 ? 223 PHE F CD2 1 
ATOM   1554  C CE1 . PHE A 1 204 ? -15.559 -6.158  27.966  1.00 103.79 ? 223 PHE F CE1 1 
ATOM   1555  C CE2 . PHE A 1 204 ? -16.681 -6.864  25.977  1.00 111.21 ? 223 PHE F CE2 1 
ATOM   1556  C CZ  . PHE A 1 204 ? -16.085 -7.170  27.184  1.00 106.02 ? 223 PHE F CZ  1 
ATOM   1557  N N   . MET A 1 205 ? -14.512 -0.258  25.894  1.00 90.61  ? 224 MET F N   1 
ATOM   1558  C CA  . MET A 1 205 ? -14.279 1.004   25.212  1.00 88.46  ? 224 MET F CA  1 
ATOM   1559  C C   . MET A 1 205 ? -13.599 0.727   23.882  1.00 89.69  ? 224 MET F C   1 
ATOM   1560  O O   . MET A 1 205 ? -12.732 -0.148  23.792  1.00 92.67  ? 224 MET F O   1 
ATOM   1561  C CB  . MET A 1 205 ? -13.413 1.944   26.056  1.00 85.49  ? 224 MET F CB  1 
ATOM   1562  C CG  . MET A 1 205 ? -13.941 2.187   27.459  1.00 87.17  ? 224 MET F CG  1 
ATOM   1563  S SD  . MET A 1 205 ? -12.789 3.140   28.469  1.00 85.55  ? 224 MET F SD  1 
ATOM   1564  C CE  . MET A 1 205 ? -12.419 1.971   29.772  1.00 86.84  ? 224 MET F CE  1 
ATOM   1565  N N   . HIS A 1 206 ? -13.997 1.475   22.856  1.00 85.78  ? 225 HIS F N   1 
ATOM   1566  C CA  . HIS A 1 206 ? -13.451 1.337   21.516  1.00 86.25  ? 225 HIS F CA  1 
ATOM   1567  C C   . HIS A 1 206 ? -13.198 2.730   20.962  1.00 81.11  ? 225 HIS F C   1 
ATOM   1568  O O   . HIS A 1 206 ? -13.851 3.694   21.363  1.00 81.78  ? 225 HIS F O   1 
ATOM   1569  C CB  . HIS A 1 206 ? -14.410 0.551   20.608  1.00 91.88  ? 225 HIS F CB  1 
ATOM   1570  C CG  . HIS A 1 206 ? -13.877 0.293   19.233  1.00 98.61  ? 225 HIS F CG  1 
ATOM   1571  N ND1 . HIS A 1 206 ? -13.136 -0.826  18.919  1.00 99.94  ? 225 HIS F ND1 1 
ATOM   1572  C CD2 . HIS A 1 206 ? -13.990 1.003   18.085  1.00 99.31  ? 225 HIS F CD2 1 
ATOM   1573  C CE1 . HIS A 1 206 ? -12.809 -0.791  17.639  1.00 95.04  ? 225 HIS F CE1 1 
ATOM   1574  N NE2 . HIS A 1 206 ? -13.315 0.309   17.110  1.00 95.09  ? 225 HIS F NE2 1 
ATOM   1575  N N   . TRP A 1 207 ? -12.232 2.842   20.053  1.00 76.66  ? 226 TRP F N   1 
ATOM   1576  C CA  . TRP A 1 207 ? -11.938 4.139   19.466  1.00 76.21  ? 226 TRP F CA  1 
ATOM   1577  C C   . TRP A 1 207 ? -11.376 3.960   18.065  1.00 75.86  ? 226 TRP F C   1 
ATOM   1578  O O   . TRP A 1 207 ? -10.785 2.927   17.741  1.00 75.64  ? 226 TRP F O   1 
ATOM   1579  C CB  . TRP A 1 207 ? -10.949 4.947   20.313  1.00 75.39  ? 226 TRP F CB  1 
ATOM   1580  C CG  . TRP A 1 207 ? -9.690  4.222   20.648  1.00 74.66  ? 226 TRP F CG  1 
ATOM   1581  C CD1 . TRP A 1 207 ? -8.589  4.084   19.856  1.00 73.94  ? 226 TRP F CD1 1 
ATOM   1582  C CD2 . TRP A 1 207 ? -9.386  3.559   21.878  1.00 74.62  ? 226 TRP F CD2 1 
ATOM   1583  N NE1 . TRP A 1 207 ? -7.621  3.364   20.511  1.00 73.46  ? 226 TRP F NE1 1 
ATOM   1584  C CE2 . TRP A 1 207 ? -8.085  3.033   21.757  1.00 73.86  ? 226 TRP F CE2 1 
ATOM   1585  C CE3 . TRP A 1 207 ? -10.084 3.364   23.072  1.00 75.20  ? 226 TRP F CE3 1 
ATOM   1586  C CZ2 . TRP A 1 207 ? -7.472  2.318   22.779  1.00 73.66  ? 226 TRP F CZ2 1 
ATOM   1587  C CZ3 . TRP A 1 207 ? -9.474  2.654   24.086  1.00 75.01  ? 226 TRP F CZ3 1 
ATOM   1588  C CH2 . TRP A 1 207 ? -8.181  2.139   23.934  1.00 74.24  ? 226 TRP F CH2 1 
ATOM   1589  N N   . LYS A 1 208 ? -11.574 4.983   17.240  1.00 75.97  ? 227 LYS F N   1 
ATOM   1590  C CA  . LYS A 1 208 ? -10.980 5.055   15.913  1.00 79.15  ? 227 LYS F CA  1 
ATOM   1591  C C   . LYS A 1 208 ? -10.030 6.239   15.862  1.00 77.34  ? 227 LYS F C   1 
ATOM   1592  O O   . LYS A 1 208 ? -10.375 7.337   16.312  1.00 77.03  ? 227 LYS F O   1 
ATOM   1593  C CB  . LYS A 1 208 ? -12.040 5.189   14.816  1.00 84.10  ? 227 LYS F CB  1 
ATOM   1594  C CG  . LYS A 1 208 ? -11.584 4.626   13.474  1.00 90.53  ? 227 LYS F CG  1 
ATOM   1595  C CD  . LYS A 1 208 ? -12.452 5.109   12.320  1.00 91.90  ? 227 LYS F CD  1 
ATOM   1596  C CE  . LYS A 1 208 ? -11.764 4.866   10.979  1.00 93.04  ? 227 LYS F CE  1 
ATOM   1597  N NZ  . LYS A 1 208 ? -12.239 5.798   9.912   1.00 94.65  ? 227 LYS F NZ  1 
ATOM   1598  N N   . MET A 1 209 ? -8.838  6.009   15.321  1.00 71.62  ? 228 MET F N   1 
ATOM   1599  C CA  . MET A 1 209 ? -7.831  7.045   15.133  1.00 70.82  ? 228 MET F CA  1 
ATOM   1600  C C   . MET A 1 209 ? -7.693  7.306   13.640  1.00 70.84  ? 228 MET F C   1 
ATOM   1601  O O   . MET A 1 209 ? -7.406  6.383   12.871  1.00 73.31  ? 228 MET F O   1 
ATOM   1602  C CB  . MET A 1 209 ? -6.494  6.624   15.742  1.00 70.02  ? 228 MET F CB  1 
ATOM   1603  C CG  . MET A 1 209 ? -5.365  7.615   15.528  1.00 69.20  ? 228 MET F CG  1 
ATOM   1604  S SD  . MET A 1 209 ? -5.706  9.238   16.230  1.00 69.12  ? 228 MET F SD  1 
ATOM   1605  C CE  . MET A 1 209 ? -4.286  10.160  15.648  1.00 69.49  ? 228 MET F CE  1 
ATOM   1606  N N   . ARG A 1 210 ? -7.908  8.552   13.231  1.00 70.83  ? 229 ARG F N   1 
ATOM   1607  C CA  . ARG A 1 210 ? -7.914  8.924   11.824  1.00 70.97  ? 229 ARG F CA  1 
ATOM   1608  C C   . ARG A 1 210 ? -6.708  9.793   11.510  1.00 70.14  ? 229 ARG F C   1 
ATOM   1609  O O   . ARG A 1 210 ? -6.457  10.789  12.197  1.00 69.75  ? 229 ARG F O   1 
ATOM   1610  C CB  . ARG A 1 210 ? -9.199  9.665   11.454  1.00 74.63  ? 229 ARG F CB  1 
ATOM   1611  C CG  . ARG A 1 210 ? -10.231 8.802   10.754  1.00 78.13  ? 229 ARG F CG  1 
ATOM   1612  C CD  . ARG A 1 210 ? -11.072 9.635   9.801   1.00 83.50  ? 229 ARG F CD  1 
ATOM   1613  N NE  . ARG A 1 210 ? -10.569 9.575   8.430   1.00 87.54  ? 229 ARG F NE  1 
ATOM   1614  C CZ  . ARG A 1 210 ? -10.959 10.386  7.450   1.00 87.52  ? 229 ARG F CZ  1 
ATOM   1615  N NH1 . ARG A 1 210 ? -11.860 11.333  7.681   1.00 88.80  ? 229 ARG F NH1 1 
ATOM   1616  N NH2 . ARG A 1 210 ? -10.450 10.251  6.234   1.00 86.44  ? 229 ARG F NH2 1 
ATOM   1617  N N   . SER A 1 211 ? -5.971  9.410   10.471  1.00 69.93  ? 230 SER F N   1 
ATOM   1618  C CA  . SER A 1 211 ? -4.864  10.193  9.945   1.00 69.26  ? 230 SER F CA  1 
ATOM   1619  C C   . SER A 1 211 ? -4.457  9.591   8.613   1.00 69.39  ? 230 SER F C   1 
ATOM   1620  O O   . SER A 1 211 ? -4.399  8.367   8.476   1.00 69.57  ? 230 SER F O   1 
ATOM   1621  C CB  . SER A 1 211 ? -3.670  10.211  10.903  1.00 68.42  ? 230 SER F CB  1 
ATOM   1622  O OG  . SER A 1 211 ? -2.515  10.705  10.250  1.00 67.85  ? 230 SER F OG  1 
ATOM   1623  N N   . HIS A 1 212 ? -4.177  10.455  7.640   1.00 69.32  ? 231 HIS F N   1 
ATOM   1624  C CA  . HIS A 1 212 ? -3.836  10.004  6.300   1.00 69.53  ? 231 HIS F CA  1 
ATOM   1625  C C   . HIS A 1 212 ? -2.350  9.760   6.104   1.00 68.82  ? 231 HIS F C   1 
ATOM   1626  O O   . HIS A 1 212 ? -1.976  9.021   5.188   1.00 68.99  ? 231 HIS F O   1 
ATOM   1627  C CB  . HIS A 1 212 ? -4.304  11.025  5.263   1.00 69.93  ? 231 HIS F CB  1 
ATOM   1628  C CG  . HIS A 1 212 ? -5.788  11.085  5.105   1.00 70.82  ? 231 HIS F CG  1 
ATOM   1629  N ND1 . HIS A 1 212 ? -6.542  9.985   4.758   1.00 71.53  ? 231 HIS F ND1 1 
ATOM   1630  C CD2 . HIS A 1 212 ? -6.658  12.112  5.238   1.00 71.16  ? 231 HIS F CD2 1 
ATOM   1631  C CE1 . HIS A 1 212 ? -7.814  10.332  4.687   1.00 72.28  ? 231 HIS F CE1 1 
ATOM   1632  N NE2 . HIS A 1 212 ? -7.911  11.618  4.974   1.00 72.08  ? 231 HIS F NE2 1 
ATOM   1633  N N   . PHE A 1 213 ? -1.499  10.357  6.932   1.00 68.08  ? 232 PHE F N   1 
ATOM   1634  C CA  . PHE A 1 213 ? -0.064  10.321  6.716   1.00 67.44  ? 232 PHE F CA  1 
ATOM   1635  C C   . PHE A 1 213 ? 0.718   9.780   7.901   1.00 66.86  ? 232 PHE F C   1 
ATOM   1636  O O   . PHE A 1 213 ? 1.909   9.490   7.749   1.00 66.40  ? 232 PHE F O   1 
ATOM   1637  C CB  . PHE A 1 213 ? 0.446   11.724  6.354   1.00 67.10  ? 232 PHE F CB  1 
ATOM   1638  C CG  . PHE A 1 213 ? -0.485  12.481  5.448   1.00 67.68  ? 232 PHE F CG  1 
ATOM   1639  C CD1 . PHE A 1 213 ? -0.413  12.328  4.075   1.00 68.07  ? 232 PHE F CD1 1 
ATOM   1640  C CD2 . PHE A 1 213 ? -1.450  13.324  5.971   1.00 67.91  ? 232 PHE F CD2 1 
ATOM   1641  C CE1 . PHE A 1 213 ? -1.273  13.014  3.241   1.00 68.67  ? 232 PHE F CE1 1 
ATOM   1642  C CE2 . PHE A 1 213 ? -2.315  14.007  5.142   1.00 68.49  ? 232 PHE F CE2 1 
ATOM   1643  C CZ  . PHE A 1 213 ? -2.225  13.853  3.776   1.00 68.87  ? 232 PHE F CZ  1 
ATOM   1644  N N   . ASN A 1 214 ? 0.094   9.635   9.065   1.00 66.92  ? 233 ASN F N   1 
ATOM   1645  C CA  . ASN A 1 214 ? 0.677   8.929   10.199  1.00 66.53  ? 233 ASN F CA  1 
ATOM   1646  C C   . ASN A 1 214 ? -0.179  7.701   10.467  1.00 67.06  ? 233 ASN F C   1 
ATOM   1647  O O   . ASN A 1 214 ? -1.378  7.827   10.736  1.00 67.59  ? 233 ASN F O   1 
ATOM   1648  C CB  . ASN A 1 214 ? 0.755   9.829   11.432  1.00 66.15  ? 233 ASN F CB  1 
ATOM   1649  C CG  . ASN A 1 214 ? 1.492   11.126  11.158  1.00 65.69  ? 233 ASN F CG  1 
ATOM   1650  O OD1 . ASN A 1 214 ? 2.722   11.171  11.182  1.00 65.14  ? 233 ASN F OD1 1 
ATOM   1651  N ND2 . ASN A 1 214 ? 0.741   12.189  10.893  1.00 65.94  ? 233 ASN F ND2 1 
ATOM   1652  N N   . ARG A 1 215 ? 0.431   6.519   10.387  1.00 70.53  ? 234 ARG F N   1 
ATOM   1653  C CA  . ARG A 1 215 ? -0.311  5.263   10.375  1.00 71.55  ? 234 ARG F CA  1 
ATOM   1654  C C   . ARG A 1 215 ? -0.175  4.445   11.649  1.00 69.63  ? 234 ARG F C   1 
ATOM   1655  O O   . ARG A 1 215 ? -1.166  3.884   12.117  1.00 75.35  ? 234 ARG F O   1 
ATOM   1656  C CB  . ARG A 1 215 ? 0.128   4.408   9.181   1.00 74.11  ? 234 ARG F CB  1 
ATOM   1657  C CG  . ARG A 1 215 ? -0.057  5.089   7.830   1.00 78.11  ? 234 ARG F CG  1 
ATOM   1658  C CD  . ARG A 1 215 ? -1.485  5.601   7.652   1.00 81.48  ? 234 ARG F CD  1 
ATOM   1659  N NE  . ARG A 1 215 ? -2.316  4.672   6.889   1.00 85.08  ? 234 ARG F NE  1 
ATOM   1660  C CZ  . ARG A 1 215 ? -3.638  4.768   6.770   1.00 86.15  ? 234 ARG F CZ  1 
ATOM   1661  N NH1 . ARG A 1 215 ? -4.294  5.761   7.360   1.00 89.97  ? 234 ARG F NH1 1 
ATOM   1662  N NH2 . ARG A 1 215 ? -4.306  3.871   6.056   1.00 85.32  ? 234 ARG F NH2 1 
ATOM   1663  N N   . LYS A 1 216 ? 1.021   4.351   12.222  1.00 68.55  ? 235 LYS F N   1 
ATOM   1664  C CA  . LYS A 1 216 ? 1.255   3.552   13.419  1.00 67.34  ? 235 LYS F CA  1 
ATOM   1665  C C   . LYS A 1 216 ? 1.242   4.454   14.646  1.00 66.34  ? 235 LYS F C   1 
ATOM   1666  O O   . LYS A 1 216 ? 1.996   5.429   14.712  1.00 65.84  ? 235 LYS F O   1 
ATOM   1667  C CB  . LYS A 1 216 ? 2.585   2.804   13.323  1.00 69.44  ? 235 LYS F CB  1 
ATOM   1668  C CG  . LYS A 1 216 ? 2.624   1.756   12.223  1.00 72.19  ? 235 LYS F CG  1 
ATOM   1669  C CD  . LYS A 1 216 ? 1.793   0.537   12.596  1.00 76.23  ? 235 LYS F CD  1 
ATOM   1670  C CE  . LYS A 1 216 ? 1.131   -0.081  11.374  1.00 77.87  ? 235 LYS F CE  1 
ATOM   1671  N NZ  . LYS A 1 216 ? 2.126   -0.531  10.362  1.00 79.16  ? 235 LYS F NZ  1 
ATOM   1672  N N   . PHE A 1 217 ? 0.390   4.123   15.615  1.00 66.71  ? 236 PHE F N   1 
ATOM   1673  C CA  . PHE A 1 217 ? 0.206   4.938   16.807  1.00 66.59  ? 236 PHE F CA  1 
ATOM   1674  C C   . PHE A 1 217 ? 0.348   4.084   18.059  1.00 66.62  ? 236 PHE F C   1 
ATOM   1675  O O   . PHE A 1 217 ? 0.435   2.855   18.004  1.00 66.79  ? 236 PHE F O   1 
ATOM   1676  C CB  . PHE A 1 217 ? -1.166  5.628   16.815  1.00 67.15  ? 236 PHE F CB  1 
ATOM   1677  C CG  . PHE A 1 217 ? -1.317  6.691   15.772  1.00 67.12  ? 236 PHE F CG  1 
ATOM   1678  C CD1 . PHE A 1 217 ? -0.674  7.907   15.908  1.00 66.61  ? 236 PHE F CD1 1 
ATOM   1679  C CD2 . PHE A 1 217 ? -2.117  6.482   14.664  1.00 67.66  ? 236 PHE F CD2 1 
ATOM   1680  C CE1 . PHE A 1 217 ? -0.813  8.891   14.950  1.00 66.61  ? 236 PHE F CE1 1 
ATOM   1681  C CE2 . PHE A 1 217 ? -2.261  7.462   13.705  1.00 67.68  ? 236 PHE F CE2 1 
ATOM   1682  C CZ  . PHE A 1 217 ? -1.607  8.668   13.848  1.00 67.15  ? 236 PHE F CZ  1 
ATOM   1683  N N   . ARG A 1 218 ? 0.375   4.768   19.200  1.00 66.48  ? 237 ARG F N   1 
ATOM   1684  C CA  . ARG A 1 218 ? 0.298   4.140   20.512  1.00 66.64  ? 237 ARG F CA  1 
ATOM   1685  C C   . ARG A 1 218 ? -0.526  5.061   21.397  1.00 66.92  ? 237 ARG F C   1 
ATOM   1686  O O   . ARG A 1 218 ? -0.312  6.274   21.388  1.00 66.83  ? 237 ARG F O   1 
ATOM   1687  C CB  . ARG A 1 218 ? 1.688   3.911   21.107  1.00 66.05  ? 237 ARG F CB  1 
ATOM   1688  C CG  . ARG A 1 218 ? 2.016   2.455   21.355  1.00 67.75  ? 237 ARG F CG  1 
ATOM   1689  C CD  . ARG A 1 218 ? 3.414   2.313   21.915  1.00 67.58  ? 237 ARG F CD  1 
ATOM   1690  N NE  . ARG A 1 218 ? 4.427   2.331   20.866  1.00 66.44  ? 237 ARG F NE  1 
ATOM   1691  C CZ  . ARG A 1 218 ? 5.720   2.534   21.091  1.00 70.70  ? 237 ARG F CZ  1 
ATOM   1692  N NH1 . ARG A 1 218 ? 6.150   2.742   22.330  1.00 70.83  ? 237 ARG F NH1 1 
ATOM   1693  N NH2 . ARG A 1 218 ? 6.583   2.534   20.082  1.00 69.37  ? 237 ARG F NH2 1 
ATOM   1694  N N   . TYR A 1 219 ? -1.468  4.506   22.144  1.00 67.52  ? 238 TYR F N   1 
ATOM   1695  C CA  . TYR A 1 219 ? -2.472  5.326   22.802  1.00 67.95  ? 238 TYR F CA  1 
ATOM   1696  C C   . TYR A 1 219 ? -2.227  5.410   24.303  1.00 67.95  ? 238 TYR F C   1 
ATOM   1697  O O   . TYR A 1 219 ? -1.397  4.701   24.872  1.00 67.69  ? 238 TYR F O   1 
ATOM   1698  C CB  . TYR A 1 219 ? -3.871  4.788   22.486  1.00 68.78  ? 238 TYR F CB  1 
ATOM   1699  C CG  . TYR A 1 219 ? -4.075  4.618   20.999  1.00 68.84  ? 238 TYR F CG  1 
ATOM   1700  C CD1 . TYR A 1 219 ? -4.323  5.713   20.187  1.00 68.78  ? 238 TYR F CD1 1 
ATOM   1701  C CD2 . TYR A 1 219 ? -3.978  3.371   20.401  1.00 68.98  ? 238 TYR F CD2 1 
ATOM   1702  C CE1 . TYR A 1 219 ? -4.495  5.571   18.827  1.00 68.89  ? 238 TYR F CE1 1 
ATOM   1703  C CE2 . TYR A 1 219 ? -4.150  3.218   19.038  1.00 69.09  ? 238 TYR F CE2 1 
ATOM   1704  C CZ  . TYR A 1 219 ? -4.407  4.322   18.256  1.00 69.05  ? 238 TYR F CZ  1 
ATOM   1705  O OH  . TYR A 1 219 ? -4.576  4.183   16.898  1.00 69.22  ? 238 TYR F OH  1 
ATOM   1706  N N   . GLU A 1 220 ? -2.949  6.333   24.931  1.00 68.26  ? 239 GLU F N   1 
ATOM   1707  C CA  . GLU A 1 220 ? -2.849  6.596   26.360  1.00 68.36  ? 239 GLU F CA  1 
ATOM   1708  C C   . GLU A 1 220 ? -4.250  6.843   26.890  1.00 69.17  ? 239 GLU F C   1 
ATOM   1709  O O   . GLU A 1 220 ? -5.019  7.585   26.271  1.00 69.41  ? 239 GLU F O   1 
ATOM   1710  C CB  . GLU A 1 220 ? -1.956  7.809   26.641  1.00 67.76  ? 239 GLU F CB  1 
ATOM   1711  C CG  . GLU A 1 220 ? -0.726  7.517   27.470  1.00 67.32  ? 239 GLU F CG  1 
ATOM   1712  C CD  . GLU A 1 220 ? 0.180   8.728   27.606  1.00 66.74  ? 239 GLU F CD  1 
ATOM   1713  O OE1 . GLU A 1 220 ? 0.307   9.260   28.731  1.00 66.83  ? 239 GLU F OE1 1 
ATOM   1714  O OE2 . GLU A 1 220 ? 0.765   9.149   26.585  1.00 66.24  ? 239 GLU F OE2 1 
ATOM   1715  N N   . LEU A 1 221 ? -4.583  6.231   28.023  1.00 69.65  ? 240 LEU F N   1 
ATOM   1716  C CA  . LEU A 1 221 ? -5.882  6.412   28.647  1.00 70.49  ? 240 LEU F CA  1 
ATOM   1717  C C   . LEU A 1 221 ? -5.700  7.059   30.008  1.00 70.58  ? 240 LEU F C   1 
ATOM   1718  O O   . LEU A 1 221 ? -4.854  6.625   30.795  1.00 70.33  ? 240 LEU F O   1 
ATOM   1719  C CB  . LEU A 1 221 ? -6.616  5.077   28.802  1.00 71.17  ? 240 LEU F CB  1 
ATOM   1720  C CG  . LEU A 1 221 ? -7.166  4.420   27.538  1.00 71.38  ? 240 LEU F CG  1 
ATOM   1721  C CD1 . LEU A 1 221 ? -7.967  3.191   27.904  1.00 72.15  ? 240 LEU F CD1 1 
ATOM   1722  C CD2 . LEU A 1 221 ? -8.026  5.401   26.773  1.00 71.64  ? 240 LEU F CD2 1 
ATOM   1723  N N   . GLN A 1 222 ? -6.486  8.094   30.284  1.00 70.97  ? 241 GLN F N   1 
ATOM   1724  C CA  . GLN A 1 222 ? -6.605  8.645   31.627  1.00 71.29  ? 241 GLN F CA  1 
ATOM   1725  C C   . GLN A 1 222 ? -7.998  8.328   32.145  1.00 72.34  ? 241 GLN F C   1 
ATOM   1726  O O   . GLN A 1 222 ? -8.996  8.776   31.566  1.00 75.51  ? 241 GLN F O   1 
ATOM   1727  C CB  . GLN A 1 222 ? -6.352  10.151  31.653  1.00 70.95  ? 241 GLN F CB  1 
ATOM   1728  C CG  . GLN A 1 222 ? -4.926  10.517  31.994  1.00 71.50  ? 241 GLN F CG  1 
ATOM   1729  C CD  . GLN A 1 222 ? -4.784  11.962  32.408  1.00 75.16  ? 241 GLN F CD  1 
ATOM   1730  O OE1 . GLN A 1 222 ? -5.767  12.702  32.462  1.00 80.36  ? 241 GLN F OE1 1 
ATOM   1731  N NE2 . GLN A 1 222 ? -3.559  12.371  32.716  1.00 79.10  ? 241 GLN F NE2 1 
ATOM   1732  N N   . ILE A 1 223 ? -8.057  7.542   33.216  1.00 72.78  ? 242 ILE F N   1 
ATOM   1733  C CA  . ILE A 1 223 ? -9.295  7.173   33.885  1.00 73.84  ? 242 ILE F CA  1 
ATOM   1734  C C   . ILE A 1 223 ? -9.340  7.913   35.213  1.00 74.19  ? 242 ILE F C   1 
ATOM   1735  O O   . ILE A 1 223 ? -8.381  7.853   35.996  1.00 73.84  ? 242 ILE F O   1 
ATOM   1736  C CB  . ILE A 1 223 ? -9.381  5.653   34.106  1.00 74.19  ? 242 ILE F CB  1 
ATOM   1737  C CG1 . ILE A 1 223 ? -8.841  4.896   32.890  1.00 73.59  ? 242 ILE F CG1 1 
ATOM   1738  C CG2 . ILE A 1 223 ? -10.811 5.242   34.404  1.00 75.31  ? 242 ILE F CG2 1 
ATOM   1739  C CD1 . ILE A 1 223 ? -9.789  4.852   31.720  1.00 73.91  ? 242 ILE F CD1 1 
ATOM   1740  N N   . GLN A 1 224 ? -10.445 8.614   35.465  1.00 86.74  ? 243 GLN F N   1 
ATOM   1741  C CA  . GLN A 1 224 ? -10.665 9.336   36.710  1.00 88.83  ? 243 GLN F CA  1 
ATOM   1742  C C   . GLN A 1 224 ? -11.934 8.794   37.352  1.00 90.47  ? 243 GLN F C   1 
ATOM   1743  O O   . GLN A 1 224 ? -13.020 8.883   36.766  1.00 89.80  ? 243 GLN F O   1 
ATOM   1744  C CB  . GLN A 1 224 ? -10.773 10.844  36.465  1.00 88.47  ? 243 GLN F CB  1 
ATOM   1745  C CG  . GLN A 1 224 ? -11.156 11.671  37.690  1.00 92.20  ? 243 GLN F CG  1 
ATOM   1746  C CD  . GLN A 1 224 ? -10.211 11.475  38.864  1.00 93.80  ? 243 GLN F CD  1 
ATOM   1747  O OE1 . GLN A 1 224 ? -10.330 10.508  39.619  1.00 89.69  ? 243 GLN F OE1 1 
ATOM   1748  N NE2 . GLN A 1 224 ? -9.275  12.403  39.031  1.00 94.09  ? 243 GLN F NE2 1 
ATOM   1749  N N   . LYS A 1 225 ? -11.792 8.224   38.545  1.00 97.76  ? 244 LYS F N   1 
ATOM   1750  C CA  . LYS A 1 225 ? -12.886 7.579   39.257  1.00 102.98 ? 244 LYS F CA  1 
ATOM   1751  C C   . LYS A 1 225 ? -13.066 8.249   40.610  1.00 108.39 ? 244 LYS F C   1 
ATOM   1752  O O   . LYS A 1 225 ? -12.092 8.423   41.350  1.00 105.55 ? 244 LYS F O   1 
ATOM   1753  C CB  . LYS A 1 225 ? -12.608 6.083   39.437  1.00 100.63 ? 244 LYS F CB  1 
ATOM   1754  C CG  . LYS A 1 225 ? -13.844 5.211   39.538  1.00 100.33 ? 244 LYS F CG  1 
ATOM   1755  C CD  . LYS A 1 225 ? -13.449 3.751   39.685  1.00 102.26 ? 244 LYS F CD  1 
ATOM   1756  C CE  . LYS A 1 225 ? -14.494 2.976   40.466  1.00 105.81 ? 244 LYS F CE  1 
ATOM   1757  N NZ  . LYS A 1 225 ? -14.220 1.514   40.468  1.00 108.06 ? 244 LYS F NZ  1 
ATOM   1758  N N   . ARG A 1 226 ? -14.309 8.621   40.929  1.00 114.34 ? 245 ARG F N   1 
ATOM   1759  C CA  . ARG A 1 226 ? -14.664 9.249   42.210  1.00 106.22 ? 245 ARG F CA  1 
ATOM   1760  C C   . ARG A 1 226 ? -13.697 10.409  42.446  1.00 98.42  ? 245 ARG F C   1 
ATOM   1761  O O   . ARG A 1 226 ? -13.495 11.227  41.539  1.00 99.40  ? 245 ARG F O   1 
ATOM   1762  C CB  . ARG A 1 226 ? -14.672 8.194   43.308  1.00 108.07 ? 245 ARG F CB  1 
ATOM   1763  C CG  . ARG A 1 226 ? -15.672 7.069   43.165  1.00 110.51 ? 245 ARG F CG  1 
ATOM   1764  C CD  . ARG A 1 226 ? -15.377 6.036   44.240  1.00 112.74 ? 245 ARG F CD  1 
ATOM   1765  N NE  . ARG A 1 226 ? -16.501 5.147   44.515  1.00 118.23 ? 245 ARG F NE  1 
ATOM   1766  C CZ  . ARG A 1 226 ? -16.443 4.122   45.360  1.00 119.70 ? 245 ARG F CZ  1 
ATOM   1767  N NH1 . ARG A 1 226 ? -15.315 3.862   46.011  1.00 116.22 ? 245 ARG F NH1 1 
ATOM   1768  N NH2 . ARG A 1 226 ? -17.510 3.361   45.562  1.00 118.73 ? 245 ARG F NH2 1 
ATOM   1769  N N   . MET A 1 227 ? -13.088 10.515  43.626  1.00 96.10  ? 246 MET F N   1 
ATOM   1770  C CA  . MET A 1 227 ? -11.930 11.370  43.833  1.00 94.18  ? 246 MET F CA  1 
ATOM   1771  C C   . MET A 1 227 ? -10.709 10.503  44.102  1.00 93.96  ? 246 MET F C   1 
ATOM   1772  O O   . MET A 1 227 ? -10.021 10.678  45.112  1.00 90.34  ? 246 MET F O   1 
ATOM   1773  C CB  . MET A 1 227 ? -12.162 12.341  44.986  1.00 93.03  ? 246 MET F CB  1 
ATOM   1774  C CG  . MET A 1 227 ? -13.063 13.494  44.627  1.00 95.40  ? 246 MET F CG  1 
ATOM   1775  S SD  . MET A 1 227 ? -12.289 15.068  45.022  1.00 103.91 ? 246 MET F SD  1 
ATOM   1776  C CE  . MET A 1 227 ? -12.260 14.985  46.806  1.00 95.25  ? 246 MET F CE  1 
ATOM   1777  N N   . GLN A 1 228 ? -10.457 9.546   43.218  1.00 90.76  ? 247 GLN F N   1 
ATOM   1778  C CA  . GLN A 1 228 ? -9.261  8.727   43.274  1.00 92.67  ? 247 GLN F CA  1 
ATOM   1779  C C   . GLN A 1 228 ? -8.107  9.433   42.572  1.00 88.74  ? 247 GLN F C   1 
ATOM   1780  O O   . GLN A 1 228 ? -8.321  10.366  41.793  1.00 85.65  ? 247 GLN F O   1 
ATOM   1781  C CB  . GLN A 1 228 ? -9.521  7.378   42.613  1.00 98.69  ? 247 GLN F CB  1 
ATOM   1782  C CG  . GLN A 1 228 ? -10.466 6.475   43.368  1.00 97.94  ? 247 GLN F CG  1 
ATOM   1783  C CD  . GLN A 1 228 ? -9.763  5.246   43.888  1.00 101.73 ? 247 GLN F CD  1 
ATOM   1784  O OE1 . GLN A 1 228 ? -8.926  5.328   44.787  1.00 103.36 ? 247 GLN F OE1 1 
ATOM   1785  N NE2 . GLN A 1 228 ? -10.088 4.093   43.312  1.00 108.28 ? 247 GLN F NE2 1 
ATOM   1786  N N   . PRO A 1 229 ? -6.869  9.012   42.829  1.00 80.61  ? 248 PRO F N   1 
ATOM   1787  C CA  . PRO A 1 229 ? -5.761  9.496   42.000  1.00 79.72  ? 248 PRO F CA  1 
ATOM   1788  C C   . PRO A 1 229 ? -5.956  9.037   40.563  1.00 79.90  ? 248 PRO F C   1 
ATOM   1789  O O   . PRO A 1 229 ? -6.476  7.951   40.309  1.00 79.16  ? 248 PRO F O   1 
ATOM   1790  C CB  . PRO A 1 229 ? -4.526  8.865   42.652  1.00 79.85  ? 248 PRO F CB  1 
ATOM   1791  C CG  . PRO A 1 229 ? -5.054  7.673   43.385  1.00 80.28  ? 248 PRO F CG  1 
ATOM   1792  C CD  . PRO A 1 229 ? -6.412  8.074   43.870  1.00 82.56  ? 248 PRO F CD  1 
ATOM   1793  N N   . VAL A 1 230 ? -5.561  9.894   39.617  1.00 74.36  ? 249 VAL F N   1 
ATOM   1794  C CA  . VAL A 1 230 ? -5.801  9.607   38.207  1.00 73.96  ? 249 VAL F CA  1 
ATOM   1795  C C   . VAL A 1 230 ? -5.027  8.365   37.797  1.00 73.50  ? 249 VAL F C   1 
ATOM   1796  O O   . VAL A 1 230 ? -3.815  8.258   38.028  1.00 72.93  ? 249 VAL F O   1 
ATOM   1797  C CB  . VAL A 1 230 ? -5.422  10.814  37.335  1.00 73.26  ? 249 VAL F CB  1 
ATOM   1798  C CG1 . VAL A 1 230 ? -5.237  10.388  35.884  1.00 72.67  ? 249 VAL F CG1 1 
ATOM   1799  C CG2 . VAL A 1 230 ? -6.498  11.878  37.406  1.00 73.80  ? 249 VAL F CG2 1 
ATOM   1800  N N   . ILE A 1 231 ? -5.730  7.412   37.193  1.00 72.70  ? 250 ILE F N   1 
ATOM   1801  C CA  . ILE A 1 231 ? -5.101  6.219   36.644  1.00 72.30  ? 250 ILE F CA  1 
ATOM   1802  C C   . ILE A 1 231 ? -4.714  6.511   35.202  1.00 71.53  ? 250 ILE F C   1 
ATOM   1803  O O   . ILE A 1 231 ? -5.523  7.025   34.425  1.00 71.68  ? 250 ILE F O   1 
ATOM   1804  C CB  . ILE A 1 231 ? -6.039  5.001   36.737  1.00 73.13  ? 250 ILE F CB  1 
ATOM   1805  C CG1 . ILE A 1 231 ? -6.330  4.640   38.198  1.00 78.37  ? 250 ILE F CG1 1 
ATOM   1806  C CG2 . ILE A 1 231 ? -5.447  3.804   36.010  1.00 74.55  ? 250 ILE F CG2 1 
ATOM   1807  C CD1 . ILE A 1 231 ? -7.599  5.256   38.758  1.00 82.92  ? 250 ILE F CD1 1 
ATOM   1808  N N   . THR A 1 232 ? -3.466  6.222   34.849  1.00 70.76  ? 251 THR F N   1 
ATOM   1809  C CA  . THR A 1 232 ? -2.991  6.394   33.480  1.00 70.05  ? 251 THR F CA  1 
ATOM   1810  C C   . THR A 1 232 ? -2.559  5.033   32.960  1.00 69.87  ? 251 THR F C   1 
ATOM   1811  O O   . THR A 1 232 ? -1.553  4.479   33.413  1.00 69.56  ? 251 THR F O   1 
ATOM   1812  C CB  . THR A 1 232 ? -1.847  7.402   33.403  1.00 69.29  ? 251 THR F CB  1 
ATOM   1813  O OG1 . THR A 1 232 ? -2.182  8.562   34.176  1.00 69.55  ? 251 THR F OG1 1 
ATOM   1814  C CG2 . THR A 1 232 ? -1.600  7.808   31.959  1.00 68.70  ? 251 THR F CG2 1 
ATOM   1815  N N   . GLU A 1 233 ? -3.324  4.493   32.020  1.00 70.11  ? 252 GLU F N   1 
ATOM   1816  C CA  . GLU A 1 233 ? -3.025  3.198   31.429  1.00 70.00  ? 252 GLU F CA  1 
ATOM   1817  C C   . GLU A 1 233 ? -2.387  3.382   30.061  1.00 71.08  ? 252 GLU F C   1 
ATOM   1818  O O   . GLU A 1 233 ? -2.906  4.119   29.212  1.00 71.54  ? 252 GLU F O   1 
ATOM   1819  C CB  . GLU A 1 233 ? -4.284  2.341   31.315  1.00 73.79  ? 252 GLU F CB  1 
ATOM   1820  C CG  . GLU A 1 233 ? -4.869  1.902   32.652  1.00 76.19  ? 252 GLU F CG  1 
ATOM   1821  C CD  . GLU A 1 233 ? -3.897  1.081   33.494  1.00 78.15  ? 252 GLU F CD  1 
ATOM   1822  O OE1 . GLU A 1 233 ? -2.908  0.549   32.940  1.00 76.98  ? 252 GLU F OE1 1 
ATOM   1823  O OE2 . GLU A 1 233 ? -4.125  0.971   34.720  1.00 75.88  ? 252 GLU F OE2 1 
ATOM   1824  N N   . GLN A 1 234 ? -1.257  2.713   29.859  1.00 70.96  ? 253 GLN F N   1 
ATOM   1825  C CA  . GLN A 1 234 ? -0.535  2.782   28.598  1.00 68.69  ? 253 GLN F CA  1 
ATOM   1826  C C   . GLN A 1 234 ? -0.931  1.603   27.715  1.00 69.15  ? 253 GLN F C   1 
ATOM   1827  O O   . GLN A 1 234 ? -0.188  0.640   27.536  1.00 73.47  ? 253 GLN F O   1 
ATOM   1828  C CB  . GLN A 1 234 ? 0.970   2.808   28.846  1.00 70.03  ? 253 GLN F CB  1 
ATOM   1829  C CG  . GLN A 1 234 ? 1.753   3.478   27.730  1.00 71.04  ? 253 GLN F CG  1 
ATOM   1830  C CD  . GLN A 1 234 ? 1.720   4.980   27.835  1.00 72.58  ? 253 GLN F CD  1 
ATOM   1831  O OE1 . GLN A 1 234 ? 1.555   5.538   28.924  1.00 66.80  ? 253 GLN F OE1 1 
ATOM   1832  N NE2 . GLN A 1 234 ? 1.901   5.650   26.705  1.00 82.30  ? 253 GLN F NE2 1 
ATOM   1833  N N   . VAL A 1 235 ? -2.155  1.669   27.193  1.00 68.91  ? 254 VAL F N   1 
ATOM   1834  C CA  . VAL A 1 235 ? -2.538  0.720   26.159  1.00 69.13  ? 254 VAL F CA  1 
ATOM   1835  C C   . VAL A 1 235 ? -1.616  0.934   24.956  1.00 69.30  ? 254 VAL F C   1 
ATOM   1836  O O   . VAL A 1 235 ? -1.161  2.051   24.680  1.00 78.91  ? 254 VAL F O   1 
ATOM   1837  C CB  . VAL A 1 235 ? -4.023  0.870   25.783  1.00 69.90  ? 254 VAL F CB  1 
ATOM   1838  C CG1 . VAL A 1 235 ? -4.274  2.165   25.035  1.00 70.24  ? 254 VAL F CG1 1 
ATOM   1839  C CG2 . VAL A 1 235 ? -4.480  -0.318  24.967  1.00 75.28  ? 254 VAL F CG2 1 
ATOM   1840  N N   . ARG A 1 236 ? -1.293  -0.145  24.262  1.00 69.99  ? 255 ARG F N   1 
ATOM   1841  C CA  . ARG A 1 236 ? -0.242  -0.100  23.248  1.00 73.81  ? 255 ARG F CA  1 
ATOM   1842  C C   . ARG A 1 236 ? -0.849  -0.491  21.908  1.00 76.28  ? 255 ARG F C   1 
ATOM   1843  O O   . ARG A 1 236 ? -1.162  -1.666  21.691  1.00 94.50  ? 255 ARG F O   1 
ATOM   1844  C CB  . ARG A 1 236 ? 0.911   -1.024  23.628  1.00 74.63  ? 255 ARG F CB  1 
ATOM   1845  C CG  . ARG A 1 236 ? 1.428   -0.816  25.041  1.00 73.39  ? 255 ARG F CG  1 
ATOM   1846  C CD  . ARG A 1 236 ? 1.998   -2.104  25.602  1.00 72.18  ? 255 ARG F CD  1 
ATOM   1847  N NE  . ARG A 1 236 ? 2.693   -1.901  26.869  1.00 73.50  ? 255 ARG F NE  1 
ATOM   1848  C CZ  . ARG A 1 236 ? 2.215   -2.269  28.053  1.00 73.14  ? 255 ARG F CZ  1 
ATOM   1849  N NH1 . ARG A 1 236 ? 1.026   -2.851  28.141  1.00 72.27  ? 255 ARG F NH1 1 
ATOM   1850  N NH2 . ARG A 1 236 ? 2.922   -2.047  29.153  1.00 70.47  ? 255 ARG F NH2 1 
ATOM   1851  N N   . ASP A 1 237 ? -1.053  0.495   21.030  1.00 73.11  ? 256 ASP F N   1 
ATOM   1852  C CA  . ASP A 1 237 ? -1.385  0.229   19.633  1.00 74.71  ? 256 ASP F CA  1 
ATOM   1853  C C   . ASP A 1 237 ? -2.783  -0.380  19.493  1.00 73.21  ? 256 ASP F C   1 
ATOM   1854  O O   . ASP A 1 237 ? -3.312  -0.497  18.382  1.00 69.31  ? 256 ASP F O   1 
ATOM   1855  C CB  . ASP A 1 237 ? -0.284  -0.666  19.029  1.00 74.99  ? 256 ASP F CB  1 
ATOM   1856  C CG  . ASP A 1 237 ? -0.707  -1.380  17.759  1.00 75.54  ? 256 ASP F CG  1 
ATOM   1857  O OD1 . ASP A 1 237 ? -1.065  -0.693  16.780  1.00 83.28  ? 256 ASP F OD1 1 
ATOM   1858  O OD2 . ASP A 1 237 ? -0.674  -2.632  17.740  1.00 73.90  ? 256 ASP F OD2 1 
ATOM   1859  N N   . ARG A 1 238 ? -3.414  -0.725  20.614  1.00 76.45  ? 257 ARG F N   1 
ATOM   1860  C CA  . ARG A 1 238 ? -4.720  -1.366  20.599  1.00 77.36  ? 257 ARG F CA  1 
ATOM   1861  C C   . ARG A 1 238 ? -5.832  -0.355  20.326  1.00 75.94  ? 257 ARG F C   1 
ATOM   1862  O O   . ARG A 1 238 ? -5.698  0.845   20.576  1.00 73.45  ? 257 ARG F O   1 
ATOM   1863  C CB  . ARG A 1 238 ? -4.988  -2.077  21.925  1.00 80.60  ? 257 ARG F CB  1 
ATOM   1864  C CG  . ARG A 1 238 ? -4.034  -3.220  22.215  1.00 83.24  ? 257 ARG F CG  1 
ATOM   1865  C CD  . ARG A 1 238 ? -3.870  -4.107  20.992  1.00 81.87  ? 257 ARG F CD  1 
ATOM   1866  N NE  . ARG A 1 238 ? -3.200  -5.365  21.304  1.00 80.25  ? 257 ARG F NE  1 
ATOM   1867  C CZ  . ARG A 1 238 ? -2.737  -6.206  20.386  1.00 81.56  ? 257 ARG F CZ  1 
ATOM   1868  N NH1 . ARG A 1 238 ? -2.138  -7.333  20.752  1.00 77.90  ? 257 ARG F NH1 1 
ATOM   1869  N NH2 . ARG A 1 238 ? -2.872  -5.917  19.097  1.00 84.08  ? 257 ARG F NH2 1 
ATOM   1870  N N   . THR A 1 239 ? -6.952  -0.867  19.818  1.00 81.22  ? 258 THR F N   1 
ATOM   1871  C CA  . THR A 1 239 ? -8.107  -0.051  19.472  1.00 79.85  ? 258 THR F CA  1 
ATOM   1872  C C   . THR A 1 239 ? -9.225  -0.121  20.506  1.00 80.91  ? 258 THR F C   1 
ATOM   1873  O O   . THR A 1 239 ? -10.179 0.659   20.416  1.00 82.73  ? 258 THR F O   1 
ATOM   1874  C CB  . THR A 1 239 ? -8.659  -0.473  18.102  1.00 80.50  ? 258 THR F CB  1 
ATOM   1875  O OG1 . THR A 1 239 ? -9.454  0.584   17.553  1.00 83.84  ? 258 THR F OG1 1 
ATOM   1876  C CG2 . THR A 1 239 ? -9.514  -1.725  18.234  1.00 83.01  ? 258 THR F CG2 1 
ATOM   1877  N N   . SER A 1 240 ? -9.136  -1.025  21.479  1.00 84.83  ? 259 SER F N   1 
ATOM   1878  C CA  . SER A 1 240 ? -10.179 -1.196  22.479  1.00 81.94  ? 259 SER F CA  1 
ATOM   1879  C C   . SER A 1 240 ? -9.541  -1.490  23.832  1.00 79.98  ? 259 SER F C   1 
ATOM   1880  O O   . SER A 1 240 ? -8.337  -1.735  23.939  1.00 77.48  ? 259 SER F O   1 
ATOM   1881  C CB  . SER A 1 240 ? -11.158 -2.307  22.078  1.00 82.26  ? 259 SER F CB  1 
ATOM   1882  O OG  . SER A 1 240 ? -10.481 -3.381  21.447  1.00 82.36  ? 259 SER F OG  1 
ATOM   1883  N N   . PHE A 1 241 ? -10.371 -1.458  24.874  1.00 77.94  ? 260 PHE F N   1 
ATOM   1884  C CA  . PHE A 1 241 ? -9.885  -1.630  26.239  1.00 78.72  ? 260 PHE F CA  1 
ATOM   1885  C C   . PHE A 1 241 ? -11.053 -1.989  27.144  1.00 82.81  ? 260 PHE F C   1 
ATOM   1886  O O   . PHE A 1 241 ? -12.113 -1.362  27.065  1.00 84.62  ? 260 PHE F O   1 
ATOM   1887  C CB  . PHE A 1 241 ? -9.197  -0.354  26.732  1.00 76.40  ? 260 PHE F CB  1 
ATOM   1888  C CG  . PHE A 1 241 ? -8.612  -0.466  28.109  1.00 76.27  ? 260 PHE F CG  1 
ATOM   1889  C CD1 . PHE A 1 241 ? -7.432  -1.153  28.320  1.00 76.11  ? 260 PHE F CD1 1 
ATOM   1890  C CD2 . PHE A 1 241 ? -9.238  0.125   29.192  1.00 76.77  ? 260 PHE F CD2 1 
ATOM   1891  C CE1 . PHE A 1 241 ? -6.886  -1.249  29.583  1.00 77.76  ? 260 PHE F CE1 1 
ATOM   1892  C CE2 . PHE A 1 241 ? -8.698  0.030   30.458  1.00 76.71  ? 260 PHE F CE2 1 
ATOM   1893  C CZ  . PHE A 1 241 ? -7.521  -0.658  30.653  1.00 76.12  ? 260 PHE F CZ  1 
ATOM   1894  N N   . GLN A 1 242 ? -10.858 -2.982  28.005  1.00 88.83  ? 261 GLN F N   1 
ATOM   1895  C CA  . GLN A 1 242 ? -11.895 -3.434  28.920  1.00 88.57  ? 261 GLN F CA  1 
ATOM   1896  C C   . GLN A 1 242 ? -11.618 -2.937  30.335  1.00 83.47  ? 261 GLN F C   1 
ATOM   1897  O O   . GLN A 1 242 ? -10.466 -2.812  30.757  1.00 80.13  ? 261 GLN F O   1 
ATOM   1898  C CB  . GLN A 1 242 ? -12.007 -4.964  28.907  1.00 96.77  ? 261 GLN F CB  1 
ATOM   1899  C CG  . GLN A 1 242 ? -10.863 -5.710  29.597  1.00 103.81 ? 261 GLN F CG  1 
ATOM   1900  C CD  . GLN A 1 242 ? -9.587  -5.758  28.764  1.00 104.11 ? 261 GLN F CD  1 
ATOM   1901  O OE1 . GLN A 1 242 ? -8.838  -4.783  28.693  1.00 97.11  ? 261 GLN F OE1 1 
ATOM   1902  N NE2 . GLN A 1 242 ? -9.333  -6.903  28.139  1.00 110.09 ? 261 GLN F NE2 1 
ATOM   1903  N N   . LEU A 1 243 ? -12.691 -2.647  31.068  1.00 89.91  ? 262 LEU F N   1 
ATOM   1904  C CA  . LEU A 1 243 ? -12.577 -2.146  32.433  1.00 94.26  ? 262 LEU F CA  1 
ATOM   1905  C C   . LEU A 1 243 ? -13.641 -2.819  33.287  1.00 97.71  ? 262 LEU F C   1 
ATOM   1906  O O   . LEU A 1 243 ? -14.833 -2.739  32.974  1.00 97.55  ? 262 LEU F O   1 
ATOM   1907  C CB  . LEU A 1 243 ? -12.720 -0.620  32.467  1.00 93.19  ? 262 LEU F CB  1 
ATOM   1908  C CG  . LEU A 1 243 ? -12.787 0.071   33.830  1.00 94.70  ? 262 LEU F CG  1 
ATOM   1909  C CD1 . LEU A 1 243 ? -11.651 -0.389  34.733  1.00 97.54  ? 262 LEU F CD1 1 
ATOM   1910  C CD2 . LEU A 1 243 ? -12.756 1.581   33.653  1.00 90.14  ? 262 LEU F CD2 1 
ATOM   1911  N N   . LEU A 1 244 ? -13.209 -3.477  34.363  1.00 97.28  ? 263 LEU F N   1 
ATOM   1912  C CA  . LEU A 1 244 ? -14.092 -4.291  35.189  1.00 95.89  ? 263 LEU F CA  1 
ATOM   1913  C C   . LEU A 1 244 ? -14.645 -3.487  36.359  1.00 97.10  ? 263 LEU F C   1 
ATOM   1914  O O   . LEU A 1 244 ? -13.935 -2.676  36.960  1.00 97.70  ? 263 LEU F O   1 
ATOM   1915  C CB  . LEU A 1 244 ? -13.348 -5.519  35.718  1.00 94.29  ? 263 LEU F CB  1 
ATOM   1916  C CG  . LEU A 1 244 ? -12.685 -6.455  34.706  1.00 94.18  ? 263 LEU F CG  1 
ATOM   1917  C CD1 . LEU A 1 244 ? -12.386 -7.794  35.353  1.00 91.12  ? 263 LEU F CD1 1 
ATOM   1918  C CD2 . LEU A 1 244 ? -13.557 -6.644  33.475  1.00 99.33  ? 263 LEU F CD2 1 
ATOM   1919  N N   . ASN A 1 245 ? -15.912 -3.738  36.683  1.00 98.82  ? 264 ASN F N   1 
ATOM   1920  C CA  . ASN A 1 245 ? -16.596 -3.099  37.803  1.00 100.18 ? 264 ASN F CA  1 
ATOM   1921  C C   . ASN A 1 245 ? -16.410 -1.580  37.779  1.00 96.04  ? 264 ASN F C   1 
ATOM   1922  O O   . ASN A 1 245 ? -15.800 -1.009  38.689  1.00 91.97  ? 264 ASN F O   1 
ATOM   1923  C CB  . ASN A 1 245 ? -16.124 -3.682  39.127  1.00 100.76 ? 264 ASN F CB  1 
ATOM   1924  C CG  . ASN A 1 245 ? -16.351 -5.185  39.224  1.00 100.22 ? 264 ASN F CG  1 
ATOM   1925  O OD1 . ASN A 1 245 ? -15.789 -5.850  40.092  1.00 99.54  ? 264 ASN F OD1 1 
ATOM   1926  N ND2 . ASN A 1 245 ? -17.192 -5.721  38.345  1.00 96.50  ? 264 ASN F ND2 1 
ATOM   1927  N N   . PRO A 1 246 ? -16.934 -0.899  36.756  1.00 100.69 ? 265 PRO F N   1 
ATOM   1928  C CA  . PRO A 1 246 ? -16.521 0.495   36.527  1.00 101.26 ? 265 PRO F CA  1 
ATOM   1929  C C   . PRO A 1 246 ? -17.127 1.483   37.502  1.00 104.90 ? 265 PRO F C   1 
ATOM   1930  O O   . PRO A 1 246 ? -16.423 2.379   37.984  1.00 108.74 ? 265 PRO F O   1 
ATOM   1931  C CB  . PRO A 1 246 ? -16.995 0.765   35.089  1.00 100.05 ? 265 PRO F CB  1 
ATOM   1932  C CG  . PRO A 1 246 ? -17.366 -0.582  34.523  1.00 101.59 ? 265 PRO F CG  1 
ATOM   1933  C CD  . PRO A 1 246 ? -17.813 -1.391  35.687  1.00 102.88 ? 265 PRO F CD  1 
ATOM   1934  N N   . GLY A 1 247 ? -18.414 1.356   37.805  1.00 109.45 ? 266 GLY F N   1 
ATOM   1935  C CA  . GLY A 1 247 ? -19.071 2.415   38.547  1.00 110.11 ? 266 GLY F CA  1 
ATOM   1936  C C   . GLY A 1 247 ? -19.193 3.649   37.674  1.00 108.96 ? 266 GLY F C   1 
ATOM   1937  O O   . GLY A 1 247 ? -19.513 3.566   36.483  1.00 108.14 ? 266 GLY F O   1 
ATOM   1938  N N   . THR A 1 248 ? -18.922 4.809   38.263  1.00 108.90 ? 267 THR F N   1 
ATOM   1939  C CA  . THR A 1 248 ? -18.928 6.077   37.544  1.00 107.41 ? 267 THR F CA  1 
ATOM   1940  C C   . THR A 1 248 ? -17.487 6.523   37.339  1.00 105.84 ? 267 THR F C   1 
ATOM   1941  O O   . THR A 1 248 ? -16.754 6.728   38.313  1.00 104.46 ? 267 THR F O   1 
ATOM   1942  C CB  . THR A 1 248 ? -19.715 7.146   38.304  1.00 111.10 ? 267 THR F CB  1 
ATOM   1943  O OG1 . THR A 1 248 ? -19.050 7.448   39.538  1.00 115.97 ? 267 THR F OG1 1 
ATOM   1944  C CG2 . THR A 1 248 ? -21.127 6.660   38.600  1.00 111.99 ? 267 THR F CG2 1 
ATOM   1945  N N   . TYR A 1 249 ? -17.082 6.664   36.079  1.00 96.95  ? 268 TYR F N   1 
ATOM   1946  C CA  . TYR A 1 249 ? -15.728 7.087   35.752  1.00 94.46  ? 268 TYR F CA  1 
ATOM   1947  C C   . TYR A 1 249 ? -15.758 7.978   34.522  1.00 92.50  ? 268 TYR F C   1 
ATOM   1948  O O   . TYR A 1 249 ? -16.609 7.821   33.643  1.00 92.74  ? 268 TYR F O   1 
ATOM   1949  C CB  . TYR A 1 249 ? -14.799 5.887   35.509  1.00 94.54  ? 268 TYR F CB  1 
ATOM   1950  C CG  . TYR A 1 249 ? -15.039 5.152   34.204  1.00 93.11  ? 268 TYR F CG  1 
ATOM   1951  C CD1 . TYR A 1 249 ? -15.946 4.105   34.132  1.00 92.94  ? 268 TYR F CD1 1 
ATOM   1952  C CD2 . TYR A 1 249 ? -14.338 5.489   33.052  1.00 93.74  ? 268 TYR F CD2 1 
ATOM   1953  C CE1 . TYR A 1 249 ? -16.164 3.426   32.945  1.00 92.36  ? 268 TYR F CE1 1 
ATOM   1954  C CE2 . TYR A 1 249 ? -14.549 4.816   31.862  1.00 90.66  ? 268 TYR F CE2 1 
ATOM   1955  C CZ  . TYR A 1 249 ? -15.462 3.785   31.815  1.00 89.33  ? 268 TYR F CZ  1 
ATOM   1956  O OH  . TYR A 1 249 ? -15.674 3.111   30.634  1.00 84.33  ? 268 TYR F OH  1 
ATOM   1957  N N   . THR A 1 250 ? -14.813 8.909   34.460  1.00 87.50  ? 269 THR F N   1 
ATOM   1958  C CA  . THR A 1 250 ? -14.655 9.779   33.304  1.00 89.29  ? 269 THR F CA  1 
ATOM   1959  C C   . THR A 1 250 ? -13.288 9.541   32.671  1.00 86.09  ? 269 THR F C   1 
ATOM   1960  O O   . THR A 1 250 ? -12.272 9.440   33.368  1.00 88.62  ? 269 THR F O   1 
ATOM   1961  C CB  . THR A 1 250 ? -14.836 11.257  33.689  1.00 89.37  ? 269 THR F CB  1 
ATOM   1962  O OG1 . THR A 1 250 ? -14.349 12.093  32.633  1.00 93.15  ? 269 THR F OG1 1 
ATOM   1963  C CG2 . THR A 1 250 ? -14.107 11.581  34.988  1.00 88.41  ? 269 THR F CG2 1 
ATOM   1964  N N   . VAL A 1 251 ? -13.267 9.448   31.344  1.00 80.07  ? 270 VAL F N   1 
ATOM   1965  C CA  . VAL A 1 251 ? -12.104 8.954   30.614  1.00 79.11  ? 270 VAL F CA  1 
ATOM   1966  C C   . VAL A 1 251 ? -11.710 9.943   29.522  1.00 78.48  ? 270 VAL F C   1 
ATOM   1967  O O   . VAL A 1 251 ? -12.570 10.580  28.899  1.00 81.97  ? 270 VAL F O   1 
ATOM   1968  C CB  . VAL A 1 251 ? -12.381 7.553   30.019  1.00 79.95  ? 270 VAL F CB  1 
ATOM   1969  C CG1 . VAL A 1 251 ? -13.671 7.555   29.215  1.00 80.15  ? 270 VAL F CG1 1 
ATOM   1970  C CG2 . VAL A 1 251 ? -11.209 7.066   29.172  1.00 82.18  ? 270 VAL F CG2 1 
ATOM   1971  N N   . GLN A 1 252 ? -10.398 10.087  29.317  1.00 75.60  ? 271 GLN F N   1 
ATOM   1972  C CA  . GLN A 1 252 ? -9.838  10.759  28.152  1.00 76.53  ? 271 GLN F CA  1 
ATOM   1973  C C   . GLN A 1 252 ? -8.812  9.849   27.490  1.00 74.88  ? 271 GLN F C   1 
ATOM   1974  O O   . GLN A 1 252 ? -8.241  8.960   28.127  1.00 77.69  ? 271 GLN F O   1 
ATOM   1975  C CB  . GLN A 1 252 ? -9.170  12.094  28.506  1.00 78.00  ? 271 GLN F CB  1 
ATOM   1976  C CG  . GLN A 1 252 ? -10.095 13.147  29.068  1.00 76.98  ? 271 GLN F CG  1 
ATOM   1977  C CD  . GLN A 1 252 ? -9.334  14.249  29.771  1.00 77.04  ? 271 GLN F CD  1 
ATOM   1978  O OE1 . GLN A 1 252 ? -9.314  15.394  29.319  1.00 83.59  ? 271 GLN F OE1 1 
ATOM   1979  N NE2 . GLN A 1 252 ? -8.712  13.911  30.893  1.00 76.28  ? 271 GLN F NE2 1 
ATOM   1980  N N   . ILE A 1 253 ? -8.564  10.094  26.203  1.00 71.21  ? 272 ILE F N   1 
ATOM   1981  C CA  . ILE A 1 253 ? -7.630  9.288   25.428  1.00 70.62  ? 272 ILE F CA  1 
ATOM   1982  C C   . ILE A 1 253 ? -6.754  10.202  24.583  1.00 69.85  ? 272 ILE F C   1 
ATOM   1983  O O   . ILE A 1 253 ? -7.189  11.261  24.122  1.00 69.93  ? 272 ILE F O   1 
ATOM   1984  C CB  . ILE A 1 253 ? -8.364  8.262   24.539  1.00 71.12  ? 272 ILE F CB  1 
ATOM   1985  C CG1 . ILE A 1 253 ? -7.354  7.407   23.770  1.00 72.94  ? 272 ILE F CG1 1 
ATOM   1986  C CG2 . ILE A 1 253 ? -9.322  8.971   23.595  1.00 71.55  ? 272 ILE F CG2 1 
ATOM   1987  C CD1 . ILE A 1 253 ? -7.953  6.232   23.073  1.00 71.98  ? 272 ILE F CD1 1 
ATOM   1988  N N   . ARG A 1 254 ? -5.506  9.780   24.386  1.00 69.14  ? 273 ARG F N   1 
ATOM   1989  C CA  . ARG A 1 254 ? -4.541  10.525  23.590  1.00 68.41  ? 273 ARG F CA  1 
ATOM   1990  C C   . ARG A 1 254 ? -3.781  9.561   22.690  1.00 68.04  ? 273 ARG F C   1 
ATOM   1991  O O   . ARG A 1 254 ? -3.645  8.379   23.006  1.00 68.15  ? 273 ARG F O   1 
ATOM   1992  C CB  . ARG A 1 254 ? -3.568  11.295  24.490  1.00 67.87  ? 273 ARG F CB  1 
ATOM   1993  C CG  . ARG A 1 254 ? -2.706  12.315  23.775  1.00 67.36  ? 273 ARG F CG  1 
ATOM   1994  C CD  . ARG A 1 254 ? -1.919  13.140  24.775  1.00 67.55  ? 273 ARG F CD  1 
ATOM   1995  N NE  . ARG A 1 254 ? -1.128  12.296  25.666  1.00 66.63  ? 273 ARG F NE  1 
ATOM   1996  C CZ  . ARG A 1 254 ? -0.265  12.764  26.560  1.00 66.29  ? 273 ARG F CZ  1 
ATOM   1997  N NH1 . ARG A 1 254 ? -0.076  14.072  26.679  1.00 66.08  ? 273 ARG F NH1 1 
ATOM   1998  N NH2 . ARG A 1 254 ? 0.414   11.923  27.330  1.00 66.19  ? 273 ARG F NH2 1 
ATOM   1999  N N   . ALA A 1 255 ? -3.283  10.073  21.567  1.00 67.62  ? 274 ALA F N   1 
ATOM   2000  C CA  . ALA A 1 255 ? -2.522  9.280   20.614  1.00 67.28  ? 274 ALA F CA  1 
ATOM   2001  C C   . ALA A 1 255 ? -1.098  9.806   20.511  1.00 66.48  ? 274 ALA F C   1 
ATOM   2002  O O   . ALA A 1 255 ? -0.855  11.009  20.641  1.00 66.21  ? 274 ALA F O   1 
ATOM   2003  C CB  . ALA A 1 255 ? -3.178  9.294   19.230  1.00 67.60  ? 274 ALA F CB  1 
ATOM   2004  N N   . ARG A 1 256 ? -0.156  8.898   20.262  1.00 66.13  ? 275 ARG F N   1 
ATOM   2005  C CA  . ARG A 1 256 ? 1.253   9.238   20.120  1.00 65.43  ? 275 ARG F CA  1 
ATOM   2006  C C   . ARG A 1 256 ? 1.814   8.541   18.892  1.00 65.26  ? 275 ARG F C   1 
ATOM   2007  O O   . ARG A 1 256 ? 1.695   7.319   18.759  1.00 65.49  ? 275 ARG F O   1 
ATOM   2008  C CB  . ARG A 1 256 ? 2.053   8.832   21.363  1.00 65.17  ? 275 ARG F CB  1 
ATOM   2009  C CG  . ARG A 1 256 ? 3.541   9.108   21.246  1.00 64.50  ? 275 ARG F CG  1 
ATOM   2010  C CD  . ARG A 1 256 ? 4.297   8.699   22.504  1.00 64.53  ? 275 ARG F CD  1 
ATOM   2011  N NE  . ARG A 1 256 ? 4.242   9.716   23.553  1.00 64.31  ? 275 ARG F NE  1 
ATOM   2012  C CZ  . ARG A 1 256 ? 3.380   9.706   24.565  1.00 64.76  ? 275 ARG F CZ  1 
ATOM   2013  N NH1 . ARG A 1 256 ? 2.492   8.725   24.680  1.00 65.27  ? 275 ARG F NH1 1 
ATOM   2014  N NH2 . ARG A 1 256 ? 3.409   10.676  25.470  1.00 64.74  ? 275 ARG F NH2 1 
ATOM   2015  N N   . GLU A 1 257 ? 2.422   9.319   18.001  1.00 64.90  ? 276 GLU F N   1 
ATOM   2016  C CA  . GLU A 1 257 ? 3.036   8.767   16.802  1.00 64.75  ? 276 GLU F CA  1 
ATOM   2017  C C   . GLU A 1 257 ? 4.227   7.894   17.178  1.00 64.38  ? 276 GLU F C   1 
ATOM   2018  O O   . GLU A 1 257 ? 4.988   8.215   18.092  1.00 64.01  ? 276 GLU F O   1 
ATOM   2019  C CB  . GLU A 1 257 ? 3.460   9.902   15.873  1.00 64.48  ? 276 GLU F CB  1 
ATOM   2020  C CG  . GLU A 1 257 ? 3.678   9.516   14.424  1.00 64.55  ? 276 GLU F CG  1 
ATOM   2021  C CD  . GLU A 1 257 ? 5.026   8.877   14.195  1.00 64.14  ? 276 GLU F CD  1 
ATOM   2022  O OE1 . GLU A 1 257 ? 6.016   9.359   14.787  1.00 63.65  ? 276 GLU F OE1 1 
ATOM   2023  O OE2 . GLU A 1 257 ? 5.095   7.897   13.421  1.00 64.33  ? 276 GLU F OE2 1 
ATOM   2024  N N   . ARG A 1 258 ? 4.383   6.779   16.464  1.00 64.51  ? 277 ARG F N   1 
ATOM   2025  C CA  . ARG A 1 258 ? 5.330   5.748   16.881  1.00 64.28  ? 277 ARG F CA  1 
ATOM   2026  C C   . ARG A 1 258 ? 6.773   6.233   16.795  1.00 63.69  ? 277 ARG F C   1 
ATOM   2027  O O   . ARG A 1 258 ? 7.558   6.044   17.732  1.00 63.41  ? 277 ARG F O   1 
ATOM   2028  C CB  . ARG A 1 258 ? 5.135   4.493   16.029  1.00 66.56  ? 277 ARG F CB  1 
ATOM   2029  C CG  . ARG A 1 258 ? 6.119   3.374   16.332  1.00 69.39  ? 277 ARG F CG  1 
ATOM   2030  C CD  . ARG A 1 258 ? 5.733   2.081   15.622  1.00 70.69  ? 277 ARG F CD  1 
ATOM   2031  N NE  . ARG A 1 258 ? 5.932   2.150   14.177  1.00 72.49  ? 277 ARG F NE  1 
ATOM   2032  C CZ  . ARG A 1 258 ? 5.867   1.098   13.365  1.00 71.38  ? 277 ARG F CZ  1 
ATOM   2033  N NH1 . ARG A 1 258 ? 5.612   -0.108  13.856  1.00 68.28  ? 277 ARG F NH1 1 
ATOM   2034  N NH2 . ARG A 1 258 ? 6.060   1.252   12.061  1.00 68.44  ? 277 ARG F NH2 1 
ATOM   2035  N N   . VAL A 1 259 ? 7.142   6.862   15.684  1.00 63.54  ? 278 VAL F N   1 
ATOM   2036  C CA  . VAL A 1 259 ? 8.550   7.107   15.384  1.00 63.06  ? 278 VAL F CA  1 
ATOM   2037  C C   . VAL A 1 259 ? 9.038   8.411   16.000  1.00 62.69  ? 278 VAL F C   1 
ATOM   2038  O O   . VAL A 1 259 ? 10.061  8.436   16.690  1.00 62.35  ? 278 VAL F O   1 
ATOM   2039  C CB  . VAL A 1 259 ? 8.774   7.087   13.858  1.00 63.14  ? 278 VAL F CB  1 
ATOM   2040  C CG1 . VAL A 1 259 ? 10.210  7.427   13.535  1.00 62.70  ? 278 VAL F CG1 1 
ATOM   2041  C CG2 . VAL A 1 259 ? 8.404   5.729   13.286  1.00 63.52  ? 278 VAL F CG2 1 
ATOM   2042  N N   . TYR A 1 260 ? 8.328   9.513   15.759  1.00 62.78  ? 279 TYR F N   1 
ATOM   2043  C CA  . TYR A 1 260 ? 8.747   10.829  16.227  1.00 62.46  ? 279 TYR F CA  1 
ATOM   2044  C C   . TYR A 1 260 ? 7.958   11.318  17.435  1.00 62.59  ? 279 TYR F C   1 
ATOM   2045  O O   . TYR A 1 260 ? 8.199   12.435  17.903  1.00 62.38  ? 279 TYR F O   1 
ATOM   2046  C CB  . TYR A 1 260 ? 8.637   11.850  15.092  1.00 62.44  ? 279 TYR F CB  1 
ATOM   2047  C CG  . TYR A 1 260 ? 9.674   11.672  14.010  1.00 62.26  ? 279 TYR F CG  1 
ATOM   2048  C CD1 . TYR A 1 260 ? 10.970  12.128  14.189  1.00 61.83  ? 279 TYR F CD1 1 
ATOM   2049  C CD2 . TYR A 1 260 ? 9.356   11.062  12.805  1.00 62.56  ? 279 TYR F CD2 1 
ATOM   2050  C CE1 . TYR A 1 260 ? 11.922  11.972  13.206  1.00 61.72  ? 279 TYR F CE1 1 
ATOM   2051  C CE2 . TYR A 1 260 ? 10.304  10.904  11.814  1.00 62.44  ? 279 TYR F CE2 1 
ATOM   2052  C CZ  . TYR A 1 260 ? 11.584  11.361  12.024  1.00 62.02  ? 279 TYR F CZ  1 
ATOM   2053  O OH  . TYR A 1 260 ? 12.541  11.214  11.053  1.00 61.96  ? 279 TYR F OH  1 
ATOM   2054  N N   . GLU A 1 261 ? 7.019   10.517  17.938  1.00 62.98  ? 280 GLU F N   1 
ATOM   2055  C CA  . GLU A 1 261 ? 6.282   10.823  19.165  1.00 63.19  ? 280 GLU F CA  1 
ATOM   2056  C C   . GLU A 1 261 ? 5.476   12.114  19.040  1.00 63.33  ? 280 GLU F C   1 
ATOM   2057  O O   . GLU A 1 261 ? 5.393   12.907  19.978  1.00 63.28  ? 280 GLU F O   1 
ATOM   2058  C CB  . GLU A 1 261 ? 7.219   10.874  20.373  1.00 63.30  ? 280 GLU F CB  1 
ATOM   2059  C CG  . GLU A 1 261 ? 7.937   9.558   20.628  1.00 65.49  ? 280 GLU F CG  1 
ATOM   2060  C CD  . GLU A 1 261 ? 8.557   9.477   22.010  1.00 67.60  ? 280 GLU F CD  1 
ATOM   2061  O OE1 . GLU A 1 261 ? 9.429   8.604   22.216  1.00 69.35  ? 280 GLU F OE1 1 
ATOM   2062  O OE2 . GLU A 1 261 ? 8.163   10.274  22.891  1.00 71.37  ? 280 GLU F OE2 1 
ATOM   2063  N N   . PHE A 1 262 ? 4.877   12.327  17.871  1.00 63.54  ? 281 PHE F N   1 
ATOM   2064  C CA  . PHE A 1 262 ? 3.872   13.372  17.729  1.00 63.81  ? 281 PHE F CA  1 
ATOM   2065  C C   . PHE A 1 262 ? 2.665   13.027  18.587  1.00 64.33  ? 281 PHE F C   1 
ATOM   2066  O O   . PHE A 1 262 ? 2.140   11.915  18.514  1.00 64.69  ? 281 PHE F O   1 
ATOM   2067  C CB  . PHE A 1 262 ? 3.444   13.513  16.270  1.00 64.02  ? 281 PHE F CB  1 
ATOM   2068  C CG  . PHE A 1 262 ? 4.537   13.964  15.351  1.00 63.60  ? 281 PHE F CG  1 
ATOM   2069  C CD1 . PHE A 1 262 ? 5.029   15.254  15.422  1.00 63.27  ? 281 PHE F CD1 1 
ATOM   2070  C CD2 . PHE A 1 262 ? 5.054   13.106  14.397  1.00 63.58  ? 281 PHE F CD2 1 
ATOM   2071  C CE1 . PHE A 1 262 ? 6.032   15.675  14.569  1.00 62.94  ? 281 PHE F CE1 1 
ATOM   2072  C CE2 . PHE A 1 262 ? 6.054   13.520  13.540  1.00 63.25  ? 281 PHE F CE2 1 
ATOM   2073  C CZ  . PHE A 1 262 ? 6.546   14.804  13.627  1.00 62.93  ? 281 PHE F CZ  1 
ATOM   2074  N N   . LEU A 1 263 ? 2.221   13.973  19.405  1.00 64.42  ? 282 LEU F N   1 
ATOM   2075  C CA  . LEU A 1 263 ? 1.085   13.749  20.285  1.00 64.96  ? 282 LEU F CA  1 
ATOM   2076  C C   . LEU A 1 263 ? -0.142  14.483  19.767  1.00 65.44  ? 282 LEU F C   1 
ATOM   2077  O O   . LEU A 1 263 ? -0.043  15.609  19.271  1.00 65.27  ? 282 LEU F O   1 
ATOM   2078  C CB  . LEU A 1 263 ? 1.381   14.207  21.715  1.00 64.85  ? 282 LEU F CB  1 
ATOM   2079  C CG  . LEU A 1 263 ? 2.352   13.357  22.531  1.00 64.57  ? 282 LEU F CG  1 
ATOM   2080  C CD1 . LEU A 1 263 ? 3.747   13.962  22.511  1.00 63.93  ? 282 LEU F CD1 1 
ATOM   2081  C CD2 . LEU A 1 263 ? 1.850   13.211  23.952  1.00 64.93  ? 282 LEU F CD2 1 
ATOM   2082  N N   . SER A 1 264 ? -1.294  13.835  19.877  1.00 66.07  ? 283 SER F N   1 
ATOM   2083  C CA  . SER A 1 264 ? -2.550  14.527  19.675  1.00 66.63  ? 283 SER F CA  1 
ATOM   2084  C C   . SER A 1 264 ? -2.975  15.201  20.976  1.00 66.83  ? 283 SER F C   1 
ATOM   2085  O O   . SER A 1 264 ? -2.400  14.971  22.042  1.00 66.61  ? 283 SER F O   1 
ATOM   2086  C CB  . SER A 1 264 ? -3.629  13.557  19.202  1.00 67.31  ? 283 SER F CB  1 
ATOM   2087  O OG  . SER A 1 264 ? -4.184  12.853  20.298  1.00 67.72  ? 283 SER F OG  1 
ATOM   2088  N N   . ALA A 1 265 ? -3.993  16.049  20.884  1.00 67.29  ? 284 ALA F N   1 
ATOM   2089  C CA  . ALA A 1 265 ? -4.577  16.614  22.089  1.00 68.00  ? 284 ALA F CA  1 
ATOM   2090  C C   . ALA A 1 265 ? -5.429  15.566  22.793  1.00 68.26  ? 284 ALA F C   1 
ATOM   2091  O O   . ALA A 1 265 ? -5.985  14.664  22.162  1.00 68.64  ? 284 ALA F O   1 
ATOM   2092  C CB  . ALA A 1 265 ? -5.423  17.841  21.753  1.00 75.02  ? 284 ALA F CB  1 
ATOM   2093  N N   . TRP A 1 266 ? -5.511  15.677  24.118  1.00 69.26  ? 285 TRP F N   1 
ATOM   2094  C CA  . TRP A 1 266 ? -6.379  14.788  24.879  1.00 69.12  ? 285 TRP F CA  1 
ATOM   2095  C C   . TRP A 1 266 ? -7.819  14.959  24.417  1.00 69.93  ? 285 TRP F C   1 
ATOM   2096  O O   . TRP A 1 266 ? -8.308  16.084  24.279  1.00 70.96  ? 285 TRP F O   1 
ATOM   2097  C CB  . TRP A 1 266 ? -6.267  15.082  26.374  1.00 69.23  ? 285 TRP F CB  1 
ATOM   2098  C CG  . TRP A 1 266 ? -5.048  14.507  27.028  1.00 68.69  ? 285 TRP F CG  1 
ATOM   2099  C CD1 . TRP A 1 266 ? -3.911  15.178  27.370  1.00 68.05  ? 285 TRP F CD1 1 
ATOM   2100  C CD2 . TRP A 1 266 ? -4.852  13.150  27.445  1.00 68.80  ? 285 TRP F CD2 1 
ATOM   2101  N NE1 . TRP A 1 266 ? -3.014  14.322  27.961  1.00 67.76  ? 285 TRP F NE1 1 
ATOM   2102  C CE2 . TRP A 1 266 ? -3.568  13.071  28.020  1.00 68.20  ? 285 TRP F CE2 1 
ATOM   2103  C CE3 . TRP A 1 266 ? -5.636  11.993  27.383  1.00 69.37  ? 285 TRP F CE3 1 
ATOM   2104  C CZ2 . TRP A 1 266 ? -3.049  11.882  28.530  1.00 68.15  ? 285 TRP F CZ2 1 
ATOM   2105  C CZ3 . TRP A 1 266 ? -5.118  10.813  27.891  1.00 69.30  ? 285 TRP F CZ3 1 
ATOM   2106  C CH2 . TRP A 1 266 ? -3.838  10.767  28.456  1.00 68.70  ? 285 TRP F CH2 1 
ATOM   2107  N N   . SER A 1 267 ? -8.492  13.841  24.157  1.00 70.44  ? 286 SER F N   1 
ATOM   2108  C CA  . SER A 1 267 ? -9.885  13.903  23.741  1.00 71.75  ? 286 SER F CA  1 
ATOM   2109  C C   . SER A 1 267 ? -10.732 14.545  24.833  1.00 75.41  ? 286 SER F C   1 
ATOM   2110  O O   . SER A 1 267 ? -10.383 14.517  26.017  1.00 77.51  ? 286 SER F O   1 
ATOM   2111  C CB  . SER A 1 267 ? -10.411 12.504  23.418  1.00 74.02  ? 286 SER F CB  1 
ATOM   2112  O OG  . SER A 1 267 ? -10.957 11.882  24.570  1.00 77.02  ? 286 SER F OG  1 
ATOM   2113  N N   . THR A 1 268 ? -11.844 15.147  24.424  1.00 84.70  ? 287 THR F N   1 
ATOM   2114  C CA  . THR A 1 268 ? -12.738 15.769  25.388  1.00 80.87  ? 287 THR F CA  1 
ATOM   2115  C C   . THR A 1 268 ? -13.270 14.709  26.350  1.00 79.04  ? 287 THR F C   1 
ATOM   2116  O O   . THR A 1 268 ? -13.663 13.619  25.915  1.00 77.27  ? 287 THR F O   1 
ATOM   2117  C CB  . THR A 1 268 ? -13.894 16.480  24.681  1.00 81.48  ? 287 THR F CB  1 
ATOM   2118  O OG1 . THR A 1 268 ? -14.410 15.644  23.638  1.00 81.80  ? 287 THR F OG1 1 
ATOM   2119  C CG2 . THR A 1 268 ? -13.421 17.797  24.077  1.00 82.04  ? 287 THR F CG2 1 
ATOM   2120  N N   . PRO A 1 269 ? -13.285 14.986  27.656  1.00 81.40  ? 288 PRO F N   1 
ATOM   2121  C CA  . PRO A 1 269 ? -13.602 13.936  28.633  1.00 80.58  ? 288 PRO F CA  1 
ATOM   2122  C C   . PRO A 1 269 ? -14.992 13.361  28.415  1.00 80.06  ? 288 PRO F C   1 
ATOM   2123  O O   . PRO A 1 269 ? -15.923 14.059  28.010  1.00 84.59  ? 288 PRO F O   1 
ATOM   2124  C CB  . PRO A 1 269 ? -13.504 14.661  29.982  1.00 79.39  ? 288 PRO F CB  1 
ATOM   2125  C CG  . PRO A 1 269 ? -12.690 15.886  29.709  1.00 79.98  ? 288 PRO F CG  1 
ATOM   2126  C CD  . PRO A 1 269 ? -13.014 16.281  28.302  1.00 81.73  ? 288 PRO F CD  1 
ATOM   2127  N N   . GLN A 1 270 ? -15.124 12.063  28.678  1.00 83.18  ? 289 GLN F N   1 
ATOM   2128  C CA  . GLN A 1 270 ? -16.401 11.384  28.521  1.00 85.96  ? 289 GLN F CA  1 
ATOM   2129  C C   . GLN A 1 270 ? -16.765 10.685  29.821  1.00 89.86  ? 289 GLN F C   1 
ATOM   2130  O O   . GLN A 1 270 ? -15.965 9.916   30.363  1.00 94.02  ? 289 GLN F O   1 
ATOM   2131  C CB  . GLN A 1 270 ? -16.360 10.390  27.356  1.00 87.04  ? 289 GLN F CB  1 
ATOM   2132  C CG  . GLN A 1 270 ? -15.857 11.010  26.056  1.00 89.73  ? 289 GLN F CG  1 
ATOM   2133  C CD  . GLN A 1 270 ? -15.918 10.054  24.883  1.00 88.88  ? 289 GLN F CD  1 
ATOM   2134  O OE1 . GLN A 1 270 ? -16.883 9.304   24.730  1.00 88.39  ? 289 GLN F OE1 1 
ATOM   2135  N NE2 . GLN A 1 270 ? -14.886 10.077  24.044  1.00 80.22  ? 289 GLN F NE2 1 
ATOM   2136  N N   . ARG A 1 271 ? -17.968 10.969  30.317  1.00 101.04 ? 290 ARG F N   1 
ATOM   2137  C CA  . ARG A 1 271 ? -18.469 10.423  31.571  1.00 99.57  ? 290 ARG F CA  1 
ATOM   2138  C C   . ARG A 1 271 ? -19.233 9.130   31.312  1.00 99.52  ? 290 ARG F C   1 
ATOM   2139  O O   . ARG A 1 271 ? -19.916 8.995   30.293  1.00 99.24  ? 290 ARG F O   1 
ATOM   2140  C CB  . ARG A 1 271 ? -19.383 11.442  32.254  1.00 101.00 ? 290 ARG F CB  1 
ATOM   2141  C CG  . ARG A 1 271 ? -19.794 11.104  33.674  1.00 101.20 ? 290 ARG F CG  1 
ATOM   2142  C CD  . ARG A 1 271 ? -20.733 12.176  34.216  1.00 104.77 ? 290 ARG F CD  1 
ATOM   2143  N NE  . ARG A 1 271 ? -21.184 11.892  35.576  1.00 106.56 ? 290 ARG F NE  1 
ATOM   2144  C CZ  . ARG A 1 271 ? -20.550 12.293  36.673  1.00 104.88 ? 290 ARG F CZ  1 
ATOM   2145  N NH1 . ARG A 1 271 ? -19.435 13.009  36.574  1.00 106.66 ? 290 ARG F NH1 1 
ATOM   2146  N NH2 . ARG A 1 271 ? -21.034 11.987  37.870  1.00 106.95 ? 290 ARG F NH2 1 
ATOM   2147  N N   . PHE A 1 272 ? -19.121 8.182   32.243  1.00 97.93  ? 291 PHE F N   1 
ATOM   2148  C CA  . PHE A 1 272 ? -19.814 6.902   32.109  1.00 97.80  ? 291 PHE F CA  1 
ATOM   2149  C C   . PHE A 1 272 ? -20.217 6.433   33.500  1.00 105.31 ? 291 PHE F C   1 
ATOM   2150  O O   . PHE A 1 272 ? -19.354 6.102   34.322  1.00 113.95 ? 291 PHE F O   1 
ATOM   2151  C CB  . PHE A 1 272 ? -18.933 5.868   31.412  1.00 95.64  ? 291 PHE F CB  1 
ATOM   2152  C CG  . PHE A 1 272 ? -18.732 6.134   29.947  1.00 95.30  ? 291 PHE F CG  1 
ATOM   2153  C CD1 . PHE A 1 272 ? -19.647 5.677   29.014  1.00 99.12  ? 291 PHE F CD1 1 
ATOM   2154  C CD2 . PHE A 1 272 ? -17.628 6.841   29.502  1.00 99.36  ? 291 PHE F CD2 1 
ATOM   2155  C CE1 . PHE A 1 272 ? -19.465 5.924   27.666  1.00 103.55 ? 291 PHE F CE1 1 
ATOM   2156  C CE2 . PHE A 1 272 ? -17.441 7.090   28.156  1.00 101.96 ? 291 PHE F CE2 1 
ATOM   2157  C CZ  . PHE A 1 272 ? -18.361 6.632   27.237  1.00 102.88 ? 291 PHE F CZ  1 
ATOM   2158  N N   . GLU A 1 273 ? -21.520 6.420   33.762  1.00 117.73 ? 292 GLU F N   1 
ATOM   2159  C CA  . GLU A 1 273 ? -22.073 5.928   35.014  1.00 117.43 ? 292 GLU F CA  1 
ATOM   2160  C C   . GLU A 1 273 ? -22.583 4.508   34.806  1.00 118.22 ? 292 GLU F C   1 
ATOM   2161  O O   . GLU A 1 273 ? -23.100 4.179   33.734  1.00 117.74 ? 292 GLU F O   1 
ATOM   2162  C CB  . GLU A 1 273 ? -23.209 6.829   35.500  1.00 116.98 ? 292 GLU F CB  1 
ATOM   2163  C CG  . GLU A 1 273 ? -22.803 8.275   35.715  1.00 118.29 ? 292 GLU F CG  1 
ATOM   2164  C CD  . GLU A 1 273 ? -23.992 9.182   35.958  1.00 119.96 ? 292 GLU F CD  1 
ATOM   2165  O OE1 . GLU A 1 273 ? -24.906 9.209   35.106  1.00 123.32 ? 292 GLU F OE1 1 
ATOM   2166  O OE2 . GLU A 1 273 ? -24.014 9.867   37.001  1.00 121.61 ? 292 GLU F OE2 1 
ATOM   2167  N N   . CYS A 1 274 ? -22.431 3.667   35.829  1.00 128.53 ? 293 CYS F N   1 
ATOM   2168  C CA  . CYS A 1 274 ? -22.819 2.267   35.706  1.00 128.43 ? 293 CYS F CA  1 
ATOM   2169  C C   . CYS A 1 274 ? -23.302 1.707   37.037  1.00 125.14 ? 293 CYS F C   1 
ATOM   2170  O O   . CYS A 1 274 ? -23.030 0.550   37.379  1.00 117.31 ? 293 CYS F O   1 
ATOM   2171  C CB  . CYS A 1 274 ? -21.683 1.421   35.137  1.00 131.10 ? 293 CYS F CB  1 
ATOM   2172  S SG  . CYS A 1 274 ? -21.921 1.161   33.391  1.00 145.19 ? 293 CYS F SG  1 
ATOM   2173  N N   . ASP A 1 275 ? -24.035 2.516   37.795  1.00 134.88 ? 294 ASP F N   1 
ATOM   2174  C CA  . ASP A 1 275 ? -24.782 2.044   38.953  1.00 140.15 ? 294 ASP F CA  1 
ATOM   2175  C C   . ASP A 1 275 ? -26.228 2.523   38.826  1.00 144.31 ? 294 ASP F C   1 
ATOM   2176  O O   . ASP A 1 275 ? -26.735 3.308   39.626  1.00 141.75 ? 294 ASP F O   1 
ATOM   2177  C CB  . ASP A 1 275 ? -24.135 2.503   40.257  1.00 140.03 ? 294 ASP F CB  1 
ATOM   2178  C CG  . ASP A 1 275 ? -22.965 1.623   40.664  1.00 136.81 ? 294 ASP F CG  1 
ATOM   2179  O OD1 . ASP A 1 275 ? -23.139 0.386   40.709  1.00 133.80 ? 294 ASP F OD1 1 
ATOM   2180  O OD2 . ASP A 1 275 ? -21.870 2.164   40.930  1.00 133.21 ? 294 ASP F OD2 1 
ATOM   2181  N N   . GLN A 1 276 ? -26.893 2.039   37.781  1.00 151.72 ? 295 GLN F N   1 
ATOM   2182  C CA  . GLN A 1 276 ? -28.280 2.385   37.513  1.00 153.56 ? 295 GLN F CA  1 
ATOM   2183  C C   . GLN A 1 276 ? -29.201 1.540   38.387  1.00 157.09 ? 295 GLN F C   1 
ATOM   2184  O O   . GLN A 1 276 ? -28.808 0.478   38.875  1.00 154.49 ? 295 GLN F O   1 
ATOM   2185  C CB  . GLN A 1 276 ? -28.602 2.186   36.028  1.00 151.67 ? 295 GLN F CB  1 
ATOM   2186  C CG  . GLN A 1 276 ? -29.613 3.169   35.440  1.00 152.03 ? 295 GLN F CG  1 
ATOM   2187  C CD  . GLN A 1 276 ? -31.062 2.728   35.611  1.00 155.46 ? 295 GLN F CD  1 
ATOM   2188  O OE1 . GLN A 1 276 ? -31.452 2.202   36.653  1.00 160.46 ? 295 GLN F OE1 1 
ATOM   2189  N NE2 . GLN A 1 276 ? -31.868 2.946   34.578  1.00 149.59 ? 295 GLN F NE2 1 
ATOM   2190  N N   . THR B 1 9   ? 68.980  -7.284  26.273  1.00 168.13 ? 28  THR M N   1 
ATOM   2191  C CA  . THR B 1 9   ? 67.610  -7.557  26.690  1.00 169.35 ? 28  THR M CA  1 
ATOM   2192  C C   . THR B 1 9   ? 67.516  -8.835  27.523  1.00 169.13 ? 28  THR M C   1 
ATOM   2193  O O   . THR B 1 9   ? 66.953  -9.838  27.082  1.00 170.97 ? 28  THR M O   1 
ATOM   2194  C CB  . THR B 1 9   ? 66.661  -7.671  25.478  1.00 164.64 ? 28  THR M CB  1 
ATOM   2195  O OG1 . THR B 1 9   ? 67.074  -8.760  24.641  1.00 169.04 ? 28  THR M OG1 1 
ATOM   2196  C CG2 . THR B 1 9   ? 66.656  -6.378  24.674  1.00 154.66 ? 28  THR M CG2 1 
ATOM   2197  N N   . ASN B 1 10  ? 68.078  -8.789  28.730  1.00 161.12 ? 29  ASN M N   1 
ATOM   2198  C CA  . ASN B 1 10  ? 67.923  -9.863  29.709  1.00 162.75 ? 29  ASN M CA  1 
ATOM   2199  C C   . ASN B 1 10  ? 66.851  -9.419  30.700  1.00 166.37 ? 29  ASN M C   1 
ATOM   2200  O O   . ASN B 1 10  ? 67.134  -8.953  31.804  1.00 174.22 ? 29  ASN M O   1 
ATOM   2201  C CB  . ASN B 1 10  ? 69.251  -10.164 30.398  1.00 162.92 ? 29  ASN M CB  1 
ATOM   2202  C CG  . ASN B 1 10  ? 70.052  -11.226 29.678  1.00 164.82 ? 29  ASN M CG  1 
ATOM   2203  O OD1 . ASN B 1 10  ? 69.670  -12.396 29.651  1.00 167.66 ? 29  ASN M OD1 1 
ATOM   2204  N ND2 . ASN B 1 10  ? 71.170  -10.823 29.087  1.00 163.28 ? 29  ASN M ND2 1 
ATOM   2205  N N   . LEU B 1 11  ? 65.597  -9.566  30.284  1.00 161.58 ? 30  LEU M N   1 
ATOM   2206  C CA  . LEU B 1 11  ? 64.479  -8.963  30.988  1.00 160.29 ? 30  LEU M CA  1 
ATOM   2207  C C   . LEU B 1 11  ? 63.898  -9.929  32.015  1.00 161.43 ? 30  LEU M C   1 
ATOM   2208  O O   . LEU B 1 11  ? 63.864  -11.147 31.810  1.00 164.88 ? 30  LEU M O   1 
ATOM   2209  C CB  . LEU B 1 11  ? 63.403  -8.521  29.991  1.00 157.39 ? 30  LEU M CB  1 
ATOM   2210  C CG  . LEU B 1 11  ? 62.371  -9.477  29.386  1.00 155.52 ? 30  LEU M CG  1 
ATOM   2211  C CD1 . LEU B 1 11  ? 61.120  -9.547  30.249  1.00 157.63 ? 30  LEU M CD1 1 
ATOM   2212  C CD2 . LEU B 1 11  ? 62.027  -9.069  27.959  1.00 150.06 ? 30  LEU M CD2 1 
ATOM   2213  N N   . ARG B 1 12  ? 63.446  -9.367  33.135  1.00 156.88 ? 31  ARG M N   1 
ATOM   2214  C CA  . ARG B 1 12  ? 62.822  -10.132 34.202  1.00 156.48 ? 31  ARG M CA  1 
ATOM   2215  C C   . ARG B 1 12  ? 61.821  -9.233  34.920  1.00 157.90 ? 31  ARG M C   1 
ATOM   2216  O O   . ARG B 1 12  ? 61.624  -8.065  34.557  1.00 157.01 ? 31  ARG M O   1 
ATOM   2217  C CB  . ARG B 1 12  ? 63.876  -10.697 35.161  1.00 158.86 ? 31  ARG M CB  1 
ATOM   2218  C CG  . ARG B 1 12  ? 64.629  -9.638  35.949  1.00 159.84 ? 31  ARG M CG  1 
ATOM   2219  C CD  . ARG B 1 12  ? 66.127  -9.907  35.957  1.00 154.80 ? 31  ARG M CD  1 
ATOM   2220  N NE  . ARG B 1 12  ? 66.891  -8.716  36.323  1.00 156.31 ? 31  ARG M NE  1 
ATOM   2221  C CZ  . ARG B 1 12  ? 67.251  -7.765  35.467  1.00 153.05 ? 31  ARG M CZ  1 
ATOM   2222  N NH1 . ARG B 1 12  ? 66.915  -7.860  34.187  1.00 148.58 ? 31  ARG M NH1 1 
ATOM   2223  N NH2 . ARG B 1 12  ? 67.945  -6.717  35.888  1.00 150.15 ? 31  ARG M NH2 1 
ATOM   2224  N N   . MET B 1 13  ? 61.182  -9.794  35.945  1.00 149.37 ? 32  MET M N   1 
ATOM   2225  C CA  . MET B 1 13  ? 60.113  -9.130  36.685  1.00 149.58 ? 32  MET M CA  1 
ATOM   2226  C C   . MET B 1 13  ? 60.522  -8.990  38.146  1.00 144.18 ? 32  MET M C   1 
ATOM   2227  O O   . MET B 1 13  ? 60.588  -9.986  38.875  1.00 142.01 ? 32  MET M O   1 
ATOM   2228  C CB  . MET B 1 13  ? 58.802  -9.910  36.565  1.00 148.45 ? 32  MET M CB  1 
ATOM   2229  C CG  . MET B 1 13  ? 57.640  -9.305  37.340  1.00 146.69 ? 32  MET M CG  1 
ATOM   2230  S SD  . MET B 1 13  ? 57.148  -7.682  36.723  1.00 139.28 ? 32  MET M SD  1 
ATOM   2231  C CE  . MET B 1 13  ? 56.685  -8.093  35.044  1.00 138.16 ? 32  MET M CE  1 
ATOM   2232  N N   . LYS B 1 14  ? 60.800  -7.760  38.569  1.00 136.78 ? 33  LYS M N   1 
ATOM   2233  C CA  . LYS B 1 14  ? 60.962  -7.442  39.983  1.00 142.37 ? 33  LYS M CA  1 
ATOM   2234  C C   . LYS B 1 14  ? 59.560  -7.379  40.578  1.00 142.13 ? 33  LYS M C   1 
ATOM   2235  O O   . LYS B 1 14  ? 58.825  -6.408  40.373  1.00 147.21 ? 33  LYS M O   1 
ATOM   2236  C CB  . LYS B 1 14  ? 61.723  -6.133  40.153  1.00 141.00 ? 33  LYS M CB  1 
ATOM   2237  C CG  . LYS B 1 14  ? 62.277  -5.895  41.545  1.00 138.38 ? 33  LYS M CG  1 
ATOM   2238  C CD  . LYS B 1 14  ? 63.438  -4.917  41.492  1.00 138.12 ? 33  LYS M CD  1 
ATOM   2239  C CE  . LYS B 1 14  ? 64.626  -5.516  40.754  1.00 137.58 ? 33  LYS M CE  1 
ATOM   2240  N NZ  . LYS B 1 14  ? 65.707  -4.519  40.525  1.00 136.05 ? 33  LYS M NZ  1 
ATOM   2241  N N   . ALA B 1 15  ? 59.183  -8.433  41.308  1.00 141.51 ? 34  ALA M N   1 
ATOM   2242  C CA  . ALA B 1 15  ? 57.784  -8.661  41.653  1.00 132.09 ? 34  ALA M CA  1 
ATOM   2243  C C   . ALA B 1 15  ? 57.286  -7.754  42.771  1.00 130.96 ? 34  ALA M C   1 
ATOM   2244  O O   . ALA B 1 15  ? 56.089  -7.451  42.823  1.00 135.63 ? 34  ALA M O   1 
ATOM   2245  C CB  . ALA B 1 15  ? 57.577  -10.124 42.047  1.00 129.05 ? 34  ALA M CB  1 
ATOM   2246  N N   . LYS B 1 16  ? 58.165  -7.316  43.672  1.00 131.20 ? 35  LYS M N   1 
ATOM   2247  C CA  . LYS B 1 16  ? 57.696  -6.545  44.819  1.00 136.91 ? 35  LYS M CA  1 
ATOM   2248  C C   . LYS B 1 16  ? 57.519  -5.069  44.481  1.00 137.19 ? 35  LYS M C   1 
ATOM   2249  O O   . LYS B 1 16  ? 56.541  -4.447  44.909  1.00 137.48 ? 35  LYS M O   1 
ATOM   2250  C CB  . LYS B 1 16  ? 58.647  -6.736  45.999  1.00 139.77 ? 35  LYS M CB  1 
ATOM   2251  C CG  . LYS B 1 16  ? 58.570  -8.143  46.572  1.00 139.56 ? 35  LYS M CG  1 
ATOM   2252  C CD  . LYS B 1 16  ? 59.509  -8.343  47.743  1.00 137.12 ? 35  LYS M CD  1 
ATOM   2253  C CE  . LYS B 1 16  ? 59.390  -9.755  48.294  1.00 137.49 ? 35  LYS M CE  1 
ATOM   2254  N NZ  . LYS B 1 16  ? 60.423  -10.044 49.326  1.00 142.17 ? 35  LYS M NZ  1 
ATOM   2255  N N   . ALA B 1 17  ? 58.445  -4.491  43.718  1.00 140.52 ? 36  ALA M N   1 
ATOM   2256  C CA  . ALA B 1 17  ? 58.251  -3.154  43.171  1.00 139.98 ? 36  ALA M CA  1 
ATOM   2257  C C   . ALA B 1 17  ? 57.359  -3.156  41.937  1.00 141.29 ? 36  ALA M C   1 
ATOM   2258  O O   . ALA B 1 17  ? 57.014  -2.076  41.439  1.00 135.22 ? 36  ALA M O   1 
ATOM   2259  C CB  . ALA B 1 17  ? 59.603  -2.518  42.836  1.00 135.77 ? 36  ALA M CB  1 
ATOM   2260  N N   . GLN B 1 18  ? 56.979  -4.337  41.447  1.00 137.55 ? 37  GLN M N   1 
ATOM   2261  C CA  . GLN B 1 18  ? 56.120  -4.498  40.276  1.00 130.87 ? 37  GLN M CA  1 
ATOM   2262  C C   . GLN B 1 18  ? 56.704  -3.766  39.070  1.00 128.58 ? 37  GLN M C   1 
ATOM   2263  O O   . GLN B 1 18  ? 56.109  -2.844  38.510  1.00 139.28 ? 37  GLN M O   1 
ATOM   2264  C CB  . GLN B 1 18  ? 54.692  -4.031  40.577  1.00 128.72 ? 37  GLN M CB  1 
ATOM   2265  C CG  . GLN B 1 18  ? 54.067  -4.713  41.787  1.00 128.10 ? 37  GLN M CG  1 
ATOM   2266  C CD  . GLN B 1 18  ? 52.551  -4.711  41.749  1.00 123.76 ? 37  GLN M CD  1 
ATOM   2267  O OE1 . GLN B 1 18  ? 51.934  -5.577  41.127  1.00 115.03 ? 37  GLN M OE1 1 
ATOM   2268  N NE2 . GLN B 1 18  ? 51.941  -3.743  42.424  1.00 123.19 ? 37  GLN M NE2 1 
ATOM   2269  N N   . GLN B 1 19  ? 57.900  -4.199  38.675  1.00 137.21 ? 38  GLN M N   1 
ATOM   2270  C CA  . GLN B 1 19  ? 58.633  -3.572  37.583  1.00 137.24 ? 38  GLN M CA  1 
ATOM   2271  C C   . GLN B 1 19  ? 59.092  -4.634  36.597  1.00 139.48 ? 38  GLN M C   1 
ATOM   2272  O O   . GLN B 1 19  ? 59.675  -5.645  36.995  1.00 148.53 ? 38  GLN M O   1 
ATOM   2273  C CB  . GLN B 1 19  ? 59.844  -2.789  38.102  1.00 136.46 ? 38  GLN M CB  1 
ATOM   2274  C CG  . GLN B 1 19  ? 59.497  -1.598  38.971  1.00 139.33 ? 38  GLN M CG  1 
ATOM   2275  C CD  . GLN B 1 19  ? 60.714  -0.997  39.644  1.00 142.24 ? 38  GLN M CD  1 
ATOM   2276  O OE1 . GLN B 1 19  ? 61.458  -1.687  40.340  1.00 145.31 ? 38  GLN M OE1 1 
ATOM   2277  N NE2 . GLN B 1 19  ? 60.921  0.299   39.442  1.00 145.61 ? 38  GLN M NE2 1 
ATOM   2278  N N   . LEU B 1 20  ? 58.839  -4.401  35.316  1.00 145.81 ? 39  LEU M N   1 
ATOM   2279  C CA  . LEU B 1 20  ? 59.354  -5.257  34.253  1.00 145.73 ? 39  LEU M CA  1 
ATOM   2280  C C   . LEU B 1 20  ? 60.604  -4.580  33.704  1.00 150.55 ? 39  LEU M C   1 
ATOM   2281  O O   . LEU B 1 20  ? 60.507  -3.544  33.042  1.00 146.24 ? 39  LEU M O   1 
ATOM   2282  C CB  . LEU B 1 20  ? 58.303  -5.465  33.164  1.00 141.84 ? 39  LEU M CB  1 
ATOM   2283  C CG  . LEU B 1 20  ? 58.520  -6.528  32.082  1.00 142.89 ? 39  LEU M CG  1 
ATOM   2284  C CD1 . LEU B 1 20  ? 57.197  -6.842  31.417  1.00 140.86 ? 39  LEU M CD1 1 
ATOM   2285  C CD2 . LEU B 1 20  ? 59.537  -6.100  31.036  1.00 144.90 ? 39  LEU M CD2 1 
ATOM   2286  N N   . THR B 1 21  ? 61.776  -5.151  33.982  1.00 157.93 ? 40  THR M N   1 
ATOM   2287  C CA  . THR B 1 21  ? 63.024  -4.504  33.606  1.00 156.41 ? 40  THR M CA  1 
ATOM   2288  C C   . THR B 1 21  ? 63.801  -5.371  32.625  1.00 155.91 ? 40  THR M C   1 
ATOM   2289  O O   . THR B 1 21  ? 63.549  -6.569  32.488  1.00 146.77 ? 40  THR M O   1 
ATOM   2290  C CB  . THR B 1 21  ? 63.894  -4.198  34.833  1.00 156.45 ? 40  THR M CB  1 
ATOM   2291  O OG1 . THR B 1 21  ? 65.066  -3.483  34.420  1.00 155.25 ? 40  THR M OG1 1 
ATOM   2292  C CG2 . THR B 1 21  ? 64.307  -5.483  35.530  1.00 155.61 ? 40  THR M CG2 1 
ATOM   2293  N N   . TRP B 1 22  ? 64.752  -4.746  31.942  1.00 156.17 ? 41  TRP M N   1 
ATOM   2294  C CA  . TRP B 1 22  ? 65.552  -5.426  30.929  1.00 159.87 ? 41  TRP M CA  1 
ATOM   2295  C C   . TRP B 1 22  ? 66.932  -4.777  30.888  1.00 158.83 ? 41  TRP M C   1 
ATOM   2296  O O   . TRP B 1 22  ? 67.338  -4.090  31.831  1.00 158.43 ? 41  TRP M O   1 
ATOM   2297  C CB  . TRP B 1 22  ? 64.839  -5.384  29.566  1.00 160.80 ? 41  TRP M CB  1 
ATOM   2298  C CG  . TRP B 1 22  ? 64.510  -4.001  29.103  1.00 161.32 ? 41  TRP M CG  1 
ATOM   2299  C CD1 . TRP B 1 22  ? 65.344  -3.128  28.467  1.00 162.09 ? 41  TRP M CD1 1 
ATOM   2300  C CD2 . TRP B 1 22  ? 63.253  -3.330  29.237  1.00 160.63 ? 41  TRP M CD2 1 
ATOM   2301  N NE1 . TRP B 1 22  ? 64.684  -1.953  28.199  1.00 159.20 ? 41  TRP M NE1 1 
ATOM   2302  C CE2 . TRP B 1 22  ? 63.398  -2.052  28.661  1.00 159.40 ? 41  TRP M CE2 1 
ATOM   2303  C CE3 . TRP B 1 22  ? 62.018  -3.685  29.789  1.00 159.80 ? 41  TRP M CE3 1 
ATOM   2304  C CZ2 . TRP B 1 22  ? 62.356  -1.129  28.621  1.00 158.34 ? 41  TRP M CZ2 1 
ATOM   2305  C CZ3 . TRP B 1 22  ? 60.985  -2.767  29.748  1.00 161.34 ? 41  TRP M CZ3 1 
ATOM   2306  C CH2 . TRP B 1 22  ? 61.160  -1.505  29.168  1.00 160.38 ? 41  TRP M CH2 1 
ATOM   2307  N N   . ASP B 1 23  ? 67.655  -4.996  29.790  1.00 167.58 ? 42  ASP M N   1 
ATOM   2308  C CA  . ASP B 1 23  ? 68.970  -4.412  29.572  1.00 164.51 ? 42  ASP M CA  1 
ATOM   2309  C C   . ASP B 1 23  ? 69.037  -3.836  28.165  1.00 161.55 ? 42  ASP M C   1 
ATOM   2310  O O   . ASP B 1 23  ? 68.491  -4.415  27.221  1.00 154.52 ? 42  ASP M O   1 
ATOM   2311  C CB  . ASP B 1 23  ? 70.083  -5.449  29.769  1.00 163.88 ? 42  ASP M CB  1 
ATOM   2312  C CG  . ASP B 1 23  ? 70.095  -6.034  31.169  1.00 162.25 ? 42  ASP M CG  1 
ATOM   2313  O OD1 . ASP B 1 23  ? 69.934  -5.267  32.141  1.00 160.43 ? 42  ASP M OD1 1 
ATOM   2314  O OD2 . ASP B 1 23  ? 70.264  -7.264  31.297  1.00 162.16 ? 42  ASP M OD2 1 
ATOM   2315  N N   . LEU B 1 24  ? 69.708  -2.695  28.030  1.00 162.79 ? 43  LEU M N   1 
ATOM   2316  C CA  . LEU B 1 24  ? 69.815  -2.040  26.736  1.00 166.04 ? 43  LEU M CA  1 
ATOM   2317  C C   . LEU B 1 24  ? 70.785  -2.791  25.826  1.00 171.79 ? 43  LEU M C   1 
ATOM   2318  O O   . LEU B 1 24  ? 71.588  -3.618  26.268  1.00 175.57 ? 43  LEU M O   1 
ATOM   2319  C CB  . LEU B 1 24  ? 70.267  -0.587  26.906  1.00 163.50 ? 43  LEU M CB  1 
ATOM   2320  C CG  . LEU B 1 24  ? 71.715  -0.339  27.339  1.00 163.12 ? 43  LEU M CG  1 
ATOM   2321  C CD1 . LEU B 1 24  ? 72.574  0.112   26.163  1.00 158.27 ? 43  LEU M CD1 1 
ATOM   2322  C CD2 . LEU B 1 24  ? 71.772  0.681   28.467  1.00 160.81 ? 43  LEU M CD2 1 
ATOM   2323  N N   . ASN B 1 25  ? 70.696  -2.490  24.530  1.00 175.27 ? 44  ASN M N   1 
ATOM   2324  C CA  . ASN B 1 25  ? 71.597  -3.059  23.533  1.00 171.59 ? 44  ASN M CA  1 
ATOM   2325  C C   . ASN B 1 25  ? 72.387  -1.978  22.809  1.00 175.14 ? 44  ASN M C   1 
ATOM   2326  O O   . ASN B 1 25  ? 73.621  -1.984  22.860  1.00 170.07 ? 44  ASN M O   1 
ATOM   2327  C CB  . ASN B 1 25  ? 70.811  -3.912  22.527  1.00 166.27 ? 44  ASN M CB  1 
ATOM   2328  C CG  . ASN B 1 25  ? 69.714  -4.724  23.181  1.00 162.76 ? 44  ASN M CG  1 
ATOM   2329  O OD1 . ASN B 1 25  ? 68.538  -4.584  22.843  1.00 152.45 ? 44  ASN M OD1 1 
ATOM   2330  N ND2 . ASN B 1 25  ? 70.092  -5.581  24.121  1.00 163.54 ? 44  ASN M ND2 1 
ATOM   2331  N N   . ARG B 1 26  ? 71.714  -1.045  22.141  1.00 174.22 ? 45  ARG M N   1 
ATOM   2332  C CA  . ARG B 1 26  ? 72.391  -0.004  21.378  1.00 171.50 ? 45  ARG M CA  1 
ATOM   2333  C C   . ARG B 1 26  ? 71.539  1.257   21.278  1.00 170.09 ? 45  ARG M C   1 
ATOM   2334  O O   . ARG B 1 26  ? 70.684  1.510   22.127  1.00 173.12 ? 45  ARG M O   1 
ATOM   2335  C CB  . ARG B 1 26  ? 72.739  -0.516  19.979  1.00 168.06 ? 45  ARG M CB  1 
ATOM   2336  C CG  . ARG B 1 26  ? 71.671  -1.409  19.366  1.00 164.68 ? 45  ARG M CG  1 
ATOM   2337  C CD  . ARG B 1 26  ? 72.180  -2.090  18.107  1.00 164.46 ? 45  ARG M CD  1 
ATOM   2338  N NE  . ARG B 1 26  ? 73.060  -3.214  18.413  1.00 170.16 ? 45  ARG M NE  1 
ATOM   2339  C CZ  . ARG B 1 26  ? 74.058  -3.618  17.632  1.00 172.78 ? 45  ARG M CZ  1 
ATOM   2340  N NH1 . ARG B 1 26  ? 74.311  -2.985  16.495  1.00 172.15 ? 45  ARG M NH1 1 
ATOM   2341  N NH2 . ARG B 1 26  ? 74.806  -4.653  17.991  1.00 176.49 ? 45  ARG M NH2 1 
ATOM   2342  N N   . ASP B 1 30  ? 61.399  4.290   21.202  1.00 159.56 ? 49  ASP M N   1 
ATOM   2343  C CA  . ASP B 1 30  ? 60.472  4.021   22.296  1.00 159.75 ? 49  ASP M CA  1 
ATOM   2344  C C   . ASP B 1 30  ? 60.202  2.523   22.453  1.00 162.27 ? 49  ASP M C   1 
ATOM   2345  O O   . ASP B 1 30  ? 60.387  1.744   21.516  1.00 156.61 ? 49  ASP M O   1 
ATOM   2346  C CB  . ASP B 1 30  ? 59.162  4.784   22.084  1.00 156.53 ? 49  ASP M CB  1 
ATOM   2347  C CG  . ASP B 1 30  ? 58.571  4.567   20.703  1.00 155.33 ? 49  ASP M CG  1 
ATOM   2348  O OD1 . ASP B 1 30  ? 59.070  3.694   19.962  1.00 154.68 ? 49  ASP M OD1 1 
ATOM   2349  O OD2 . ASP B 1 30  ? 57.602  5.273   20.357  1.00 152.88 ? 49  ASP M OD2 1 
ATOM   2350  N N   . ILE B 1 31  ? 59.772  2.128   23.649  1.00 159.49 ? 50  ILE M N   1 
ATOM   2351  C CA  . ILE B 1 31  ? 59.554  0.728   23.995  1.00 154.89 ? 50  ILE M CA  1 
ATOM   2352  C C   . ILE B 1 31  ? 58.180  0.593   24.636  1.00 151.53 ? 50  ILE M C   1 
ATOM   2353  O O   . ILE B 1 31  ? 57.775  1.441   25.439  1.00 138.83 ? 50  ILE M O   1 
ATOM   2354  C CB  . ILE B 1 31  ? 60.650  0.202   24.946  1.00 156.31 ? 50  ILE M CB  1 
ATOM   2355  C CG1 . ILE B 1 31  ? 62.040  0.508   24.387  1.00 156.82 ? 50  ILE M CG1 1 
ATOM   2356  C CG2 . ILE B 1 31  ? 60.494  -1.284  25.167  1.00 151.46 ? 50  ILE M CG2 1 
ATOM   2357  C CD1 . ILE B 1 31  ? 63.150  0.349   25.396  1.00 157.55 ? 50  ILE M CD1 1 
ATOM   2358  N N   . GLU B 1 32  ? 57.464  -0.475  24.284  1.00 149.98 ? 51  GLU M N   1 
ATOM   2359  C CA  . GLU B 1 32  ? 56.136  -0.728  24.831  1.00 153.68 ? 51  GLU M CA  1 
ATOM   2360  C C   . GLU B 1 32  ? 56.062  -2.145  25.379  1.00 148.67 ? 51  GLU M C   1 
ATOM   2361  O O   . GLU B 1 32  ? 56.441  -3.103  24.697  1.00 141.19 ? 51  GLU M O   1 
ATOM   2362  C CB  . GLU B 1 32  ? 55.046  -0.498  23.775  1.00 155.39 ? 51  GLU M CB  1 
ATOM   2363  C CG  . GLU B 1 32  ? 54.970  0.944   23.288  1.00 154.66 ? 51  GLU M CG  1 
ATOM   2364  C CD  . GLU B 1 32  ? 53.777  1.209   22.390  1.00 150.08 ? 51  GLU M CD  1 
ATOM   2365  O OE1 . GLU B 1 32  ? 52.719  0.579   22.599  1.00 143.44 ? 51  GLU M OE1 1 
ATOM   2366  O OE2 . GLU B 1 32  ? 53.896  2.055   21.478  1.00 148.30 ? 51  GLU M OE2 1 
ATOM   2367  N N   . CYS B 1 33  ? 55.576  -2.271  26.612  1.00 143.17 ? 52  CYS M N   1 
ATOM   2368  C CA  . CYS B 1 33  ? 55.436  -3.555  27.284  1.00 139.59 ? 52  CYS M CA  1 
ATOM   2369  C C   . CYS B 1 33  ? 53.979  -3.996  27.237  1.00 134.02 ? 52  CYS M C   1 
ATOM   2370  O O   . CYS B 1 33  ? 53.074  -3.200  27.506  1.00 137.81 ? 52  CYS M O   1 
ATOM   2371  C CB  . CYS B 1 33  ? 55.920  -3.470  28.733  1.00 141.52 ? 52  CYS M CB  1 
ATOM   2372  S SG  . CYS B 1 33  ? 57.345  -2.382  28.983  1.00 142.67 ? 52  CYS M SG  1 
ATOM   2373  N N   . VAL B 1 34  ? 53.761  -5.265  26.907  1.00 128.00 ? 53  VAL M N   1 
ATOM   2374  C CA  . VAL B 1 34  ? 52.432  -5.811  26.674  1.00 127.61 ? 53  VAL M CA  1 
ATOM   2375  C C   . VAL B 1 34  ? 52.196  -6.959  27.645  1.00 126.15 ? 53  VAL M C   1 
ATOM   2376  O O   . VAL B 1 34  ? 53.045  -7.848  27.784  1.00 131.36 ? 53  VAL M O   1 
ATOM   2377  C CB  . VAL B 1 34  ? 52.267  -6.278  25.217  1.00 126.62 ? 53  VAL M CB  1 
ATOM   2378  C CG1 . VAL B 1 34  ? 51.027  -7.127  25.073  1.00 123.24 ? 53  VAL M CG1 1 
ATOM   2379  C CG2 . VAL B 1 34  ? 52.206  -5.078  24.287  1.00 129.52 ? 53  VAL M CG2 1 
ATOM   2380  N N   . LYS B 1 35  ? 51.039  -6.940  28.307  1.00 131.65 ? 54  LYS M N   1 
ATOM   2381  C CA  . LYS B 1 35  ? 50.670  -7.946  29.298  1.00 131.49 ? 54  LYS M CA  1 
ATOM   2382  C C   . LYS B 1 35  ? 49.714  -8.945  28.651  1.00 129.59 ? 54  LYS M C   1 
ATOM   2383  O O   . LYS B 1 35  ? 48.592  -8.585  28.279  1.00 133.64 ? 54  LYS M O   1 
ATOM   2384  C CB  . LYS B 1 35  ? 50.037  -7.284  30.522  1.00 115.59 ? 54  LYS M CB  1 
ATOM   2385  C CG  . LYS B 1 35  ? 50.305  -7.995  31.841  1.00 116.22 ? 54  LYS M CG  1 
ATOM   2386  C CD  . LYS B 1 35  ? 49.999  -7.093  33.030  1.00 116.32 ? 54  LYS M CD  1 
ATOM   2387  C CE  . LYS B 1 35  ? 48.804  -7.605  33.818  1.00 116.21 ? 54  LYS M CE  1 
ATOM   2388  N NZ  . LYS B 1 35  ? 48.555  -6.792  35.039  1.00 116.39 ? 54  LYS M NZ  1 
ATOM   2389  N N   . ASP B 1 36  ? 50.175  -10.192 28.504  1.00 140.34 ? 55  ASP M N   1 
ATOM   2390  C CA  . ASP B 1 36  ? 49.383  -11.318 27.983  1.00 141.19 ? 55  ASP M CA  1 
ATOM   2391  C C   . ASP B 1 36  ? 48.641  -10.973 26.689  1.00 139.90 ? 55  ASP M C   1 
ATOM   2392  O O   . ASP B 1 36  ? 47.600  -11.555 26.376  1.00 141.01 ? 55  ASP M O   1 
ATOM   2393  C CB  . ASP B 1 36  ? 48.430  -11.873 29.055  1.00 123.64 ? 55  ASP M CB  1 
ATOM   2394  C CG  . ASP B 1 36  ? 47.182  -11.027 29.254  1.00 123.10 ? 55  ASP M CG  1 
ATOM   2395  O OD1 . ASP B 1 36  ? 47.218  -10.101 30.093  1.00 123.13 ? 55  ASP M OD1 1 
ATOM   2396  O OD2 . ASP B 1 36  ? 46.157  -11.303 28.597  1.00 122.71 ? 55  ASP M OD2 1 
ATOM   2397  N N   . ALA B 1 37  ? 49.205  -10.048 25.908  1.00 130.61 ? 56  ALA M N   1 
ATOM   2398  C CA  . ALA B 1 37  ? 48.698  -9.704  24.577  1.00 136.15 ? 56  ALA M CA  1 
ATOM   2399  C C   . ALA B 1 37  ? 47.255  -9.205  24.640  1.00 140.83 ? 56  ALA M C   1 
ATOM   2400  O O   . ALA B 1 37  ? 46.361  -9.722  23.966  1.00 146.30 ? 56  ALA M O   1 
ATOM   2401  C CB  . ALA B 1 37  ? 48.831  -10.888 23.615  1.00 132.94 ? 56  ALA M CB  1 
ATOM   2402  N N   . ASP B 1 38  ? 47.034  -8.179  25.461  1.00 141.07 ? 57  ASP M N   1 
ATOM   2403  C CA  . ASP B 1 38  ? 45.703  -7.613  25.632  1.00 136.58 ? 57  ASP M CA  1 
ATOM   2404  C C   . ASP B 1 38  ? 45.815  -6.208  26.212  1.00 133.14 ? 57  ASP M C   1 
ATOM   2405  O O   . ASP B 1 38  ? 44.875  -5.410  26.122  1.00 131.30 ? 57  ASP M O   1 
ATOM   2406  C CB  . ASP B 1 38  ? 44.851  -8.530  26.522  1.00 134.69 ? 57  ASP M CB  1 
ATOM   2407  C CG  . ASP B 1 38  ? 43.600  -7.852  27.056  1.00 131.61 ? 57  ASP M CG  1 
ATOM   2408  O OD1 . ASP B 1 38  ? 43.693  -7.140  28.080  1.00 134.17 ? 57  ASP M OD1 1 
ATOM   2409  O OD2 . ASP B 1 38  ? 42.523  -8.026  26.449  1.00 131.84 ? 57  ASP M OD2 1 
ATOM   2410  N N   . TYR B 1 39  ? 46.975  -5.890  26.782  1.00 123.26 ? 58  TYR M N   1 
ATOM   2411  C CA  . TYR B 1 39  ? 47.209  -4.620  27.452  1.00 119.60 ? 58  TYR M CA  1 
ATOM   2412  C C   . TYR B 1 39  ? 48.618  -4.139  27.139  1.00 121.12 ? 58  TYR M C   1 
ATOM   2413  O O   . TYR B 1 39  ? 49.567  -4.922  27.197  1.00 122.60 ? 58  TYR M O   1 
ATOM   2414  C CB  . TYR B 1 39  ? 47.017  -4.767  28.967  1.00 114.78 ? 58  TYR M CB  1 
ATOM   2415  C CG  . TYR B 1 39  ? 47.114  -3.478  29.747  1.00 114.97 ? 58  TYR M CG  1 
ATOM   2416  C CD1 . TYR B 1 39  ? 45.997  -2.681  29.945  1.00 114.31 ? 58  TYR M CD1 1 
ATOM   2417  C CD2 . TYR B 1 39  ? 48.318  -3.070  30.304  1.00 113.99 ? 58  TYR M CD2 1 
ATOM   2418  C CE1 . TYR B 1 39  ? 46.079  -1.506  30.664  1.00 112.30 ? 58  TYR M CE1 1 
ATOM   2419  C CE2 . TYR B 1 39  ? 48.410  -1.897  31.024  1.00 114.44 ? 58  TYR M CE2 1 
ATOM   2420  C CZ  . TYR B 1 39  ? 47.287  -1.118  31.200  1.00 114.06 ? 58  TYR M CZ  1 
ATOM   2421  O OH  . TYR B 1 39  ? 47.372  0.053   31.918  1.00 118.17 ? 58  TYR M OH  1 
ATOM   2422  N N   . SER B 1 40  ? 48.752  -2.856  26.810  1.00 125.79 ? 59  SER M N   1 
ATOM   2423  C CA  . SER B 1 40  ? 50.036  -2.258  26.467  1.00 126.21 ? 59  SER M CA  1 
ATOM   2424  C C   . SER B 1 40  ? 50.378  -1.143  27.450  1.00 126.34 ? 59  SER M C   1 
ATOM   2425  O O   . SER B 1 40  ? 49.546  -0.710  28.251  1.00 128.43 ? 59  SER M O   1 
ATOM   2426  C CB  . SER B 1 40  ? 50.029  -1.712  25.033  1.00 126.62 ? 59  SER M CB  1 
ATOM   2427  O OG  . SER B 1 40  ? 49.641  -0.349  25.007  1.00 126.76 ? 59  SER M OG  1 
ATOM   2428  N N   . MET B 1 41  ? 51.627  -0.672  27.377  1.00 127.60 ? 60  MET M N   1 
ATOM   2429  C CA  . MET B 1 41  ? 52.101  0.366   28.286  1.00 130.13 ? 60  MET M CA  1 
ATOM   2430  C C   . MET B 1 41  ? 53.415  0.970   27.806  1.00 132.72 ? 60  MET M C   1 
ATOM   2431  O O   . MET B 1 41  ? 54.372  0.235   27.527  1.00 134.45 ? 60  MET M O   1 
ATOM   2432  C CB  . MET B 1 41  ? 52.280  -0.196  29.695  1.00 132.44 ? 60  MET M CB  1 
ATOM   2433  C CG  . MET B 1 41  ? 52.727  0.836   30.708  1.00 137.61 ? 60  MET M CG  1 
ATOM   2434  S SD  . MET B 1 41  ? 52.529  0.274   32.406  1.00 141.18 ? 60  MET M SD  1 
ATOM   2435  C CE  . MET B 1 41  ? 52.548  1.845   33.260  1.00 137.31 ? 60  MET M CE  1 
ATOM   2436  N N   . PRO B 1 42  ? 53.502  2.294   27.692  1.00 135.92 ? 61  PRO M N   1 
ATOM   2437  C CA  . PRO B 1 42  ? 54.783  2.919   27.344  1.00 140.00 ? 61  PRO M CA  1 
ATOM   2438  C C   . PRO B 1 42  ? 55.783  2.795   28.483  1.00 138.93 ? 61  PRO M C   1 
ATOM   2439  O O   . PRO B 1 42  ? 55.451  2.999   29.653  1.00 137.58 ? 61  PRO M O   1 
ATOM   2440  C CB  . PRO B 1 42  ? 54.412  4.384   27.087  1.00 142.87 ? 61  PRO M CB  1 
ATOM   2441  C CG  . PRO B 1 42  ? 53.082  4.574   27.752  1.00 141.97 ? 61  PRO M CG  1 
ATOM   2442  C CD  . PRO B 1 42  ? 52.388  3.254   27.665  1.00 139.98 ? 61  PRO M CD  1 
ATOM   2443  N N   . ALA B 1 43  ? 57.021  2.460   28.127  1.00 145.16 ? 62  ALA M N   1 
ATOM   2444  C CA  . ALA B 1 43  ? 58.078  2.300   29.116  1.00 145.66 ? 62  ALA M CA  1 
ATOM   2445  C C   . ALA B 1 43  ? 58.634  3.654   29.532  1.00 145.47 ? 62  ALA M C   1 
ATOM   2446  O O   . ALA B 1 43  ? 58.850  4.537   28.696  1.00 148.76 ? 62  ALA M O   1 
ATOM   2447  C CB  . ALA B 1 43  ? 59.201  1.421   28.563  1.00 143.19 ? 62  ALA M CB  1 
ATOM   2448  N N   . VAL B 1 44  ? 58.866  3.814   30.832  1.00 141.97 ? 63  VAL M N   1 
ATOM   2449  C CA  . VAL B 1 44  ? 59.407  5.062   31.361  1.00 147.04 ? 63  VAL M CA  1 
ATOM   2450  C C   . VAL B 1 44  ? 60.925  5.055   31.221  1.00 152.85 ? 63  VAL M C   1 
ATOM   2451  O O   . VAL B 1 44  ? 61.598  4.098   31.623  1.00 171.90 ? 63  VAL M O   1 
ATOM   2452  C CB  . VAL B 1 44  ? 58.961  5.278   32.819  1.00 144.86 ? 63  VAL M CB  1 
ATOM   2453  C CG1 . VAL B 1 44  ? 59.451  4.159   33.726  1.00 143.38 ? 63  VAL M CG1 1 
ATOM   2454  C CG2 . VAL B 1 44  ? 59.446  6.634   33.323  1.00 138.34 ? 63  VAL M CG2 1 
ATOM   2455  N N   . ASN B 1 45  ? 61.462  6.115   30.614  1.00 162.16 ? 64  ASN M N   1 
ATOM   2456  C CA  . ASN B 1 45  ? 62.892  6.281   30.350  1.00 158.68 ? 64  ASN M CA  1 
ATOM   2457  C C   . ASN B 1 45  ? 63.492  5.115   29.563  1.00 157.39 ? 64  ASN M C   1 
ATOM   2458  O O   . ASN B 1 45  ? 64.715  4.928   29.569  1.00 157.46 ? 64  ASN M O   1 
ATOM   2459  C CB  . ASN B 1 45  ? 63.675  6.500   31.649  1.00 156.53 ? 64  ASN M CB  1 
ATOM   2460  C CG  . ASN B 1 45  ? 63.798  7.963   32.012  1.00 151.78 ? 64  ASN M CG  1 
ATOM   2461  O OD1 . ASN B 1 45  ? 63.258  8.833   31.329  1.00 148.35 ? 64  ASN M OD1 1 
ATOM   2462  N ND2 . ASN B 1 45  ? 64.500  8.243   33.102  1.00 145.40 ? 64  ASN M ND2 1 
ATOM   2463  N N   . ASN B 1 46  ? 62.650  4.326   28.891  1.00 158.07 ? 65  ASN M N   1 
ATOM   2464  C CA  . ASN B 1 46  ? 63.089  3.260   27.981  1.00 159.18 ? 65  ASN M CA  1 
ATOM   2465  C C   . ASN B 1 46  ? 64.033  2.270   28.664  1.00 156.86 ? 65  ASN M C   1 
ATOM   2466  O O   . ASN B 1 46  ? 64.990  1.778   28.063  1.00 163.58 ? 65  ASN M O   1 
ATOM   2467  C CB  . ASN B 1 46  ? 63.736  3.845   26.725  1.00 159.26 ? 65  ASN M CB  1 
ATOM   2468  C CG  . ASN B 1 46  ? 62.729  4.506   25.798  1.00 158.20 ? 65  ASN M CG  1 
ATOM   2469  O OD1 . ASN B 1 46  ? 61.613  4.014   25.621  1.00 151.36 ? 65  ASN M OD1 1 
ATOM   2470  N ND2 . ASN B 1 46  ? 63.120  5.627   25.204  1.00 153.16 ? 65  ASN M ND2 1 
ATOM   2471  N N   . SER B 1 47  ? 63.755  1.967   29.932  1.00 155.82 ? 66  SER M N   1 
ATOM   2472  C CA  . SER B 1 47  ? 64.552  1.011   30.694  1.00 152.87 ? 66  SER M CA  1 
ATOM   2473  C C   . SER B 1 47  ? 63.727  0.032   31.516  1.00 158.60 ? 66  SER M C   1 
ATOM   2474  O O   . SER B 1 47  ? 64.237  -1.050  31.835  1.00 155.67 ? 66  SER M O   1 
ATOM   2475  C CB  . SER B 1 47  ? 65.530  1.744   31.632  1.00 149.34 ? 66  SER M CB  1 
ATOM   2476  O OG  . SER B 1 47  ? 64.939  2.885   32.227  1.00 147.50 ? 66  SER M OG  1 
ATOM   2477  N N   . TYR B 1 48  ? 62.484  0.359   31.858  1.00 151.48 ? 67  TYR M N   1 
ATOM   2478  C CA  . TYR B 1 48  ? 61.618  -0.553  32.592  1.00 153.10 ? 67  TYR M CA  1 
ATOM   2479  C C   . TYR B 1 48  ? 60.183  -0.054  32.503  1.00 154.95 ? 67  TYR M C   1 
ATOM   2480  O O   . TYR B 1 48  ? 59.930  1.120   32.222  1.00 162.44 ? 67  TYR M O   1 
ATOM   2481  C CB  . TYR B 1 48  ? 62.047  -0.684  34.059  1.00 151.61 ? 67  TYR M CB  1 
ATOM   2482  C CG  . TYR B 1 48  ? 61.716  0.520   34.910  1.00 150.99 ? 67  TYR M CG  1 
ATOM   2483  C CD1 . TYR B 1 48  ? 62.503  1.665   34.868  1.00 150.17 ? 67  TYR M CD1 1 
ATOM   2484  C CD2 . TYR B 1 48  ? 60.618  0.511   35.759  1.00 151.74 ? 67  TYR M CD2 1 
ATOM   2485  C CE1 . TYR B 1 48  ? 62.202  2.767   35.651  1.00 147.75 ? 67  TYR M CE1 1 
ATOM   2486  C CE2 . TYR B 1 48  ? 60.310  1.605   36.542  1.00 148.50 ? 67  TYR M CE2 1 
ATOM   2487  C CZ  . TYR B 1 48  ? 61.105  2.730   36.486  1.00 144.97 ? 67  TYR M CZ  1 
ATOM   2488  O OH  . TYR B 1 48  ? 60.803  3.824   37.264  1.00 140.70 ? 67  TYR M OH  1 
ATOM   2489  N N   . CYS B 1 49  ? 59.250  -0.970  32.745  1.00 149.18 ? 68  CYS M N   1 
ATOM   2490  C CA  . CYS B 1 49  ? 57.825  -0.671  32.798  1.00 142.19 ? 68  CYS M CA  1 
ATOM   2491  C C   . CYS B 1 49  ? 57.343  -0.784  34.237  1.00 143.56 ? 68  CYS M C   1 
ATOM   2492  O O   . CYS B 1 49  ? 57.669  -1.754  34.932  1.00 154.86 ? 68  CYS M O   1 
ATOM   2493  C CB  . CYS B 1 49  ? 57.033  -1.617  31.895  1.00 138.92 ? 68  CYS M CB  1 
ATOM   2494  S SG  . CYS B 1 49  ? 56.675  -0.950  30.257  1.00 141.47 ? 68  CYS M SG  1 
ATOM   2495  N N   . GLN B 1 50  ? 56.563  0.202   34.674  1.00 135.42 ? 69  GLN M N   1 
ATOM   2496  C CA  . GLN B 1 50  ? 56.103  0.322   36.056  1.00 133.14 ? 69  GLN M CA  1 
ATOM   2497  C C   . GLN B 1 50  ? 54.624  -0.062  36.108  1.00 132.63 ? 69  GLN M C   1 
ATOM   2498  O O   . GLN B 1 50  ? 53.741  0.790   36.008  1.00 137.15 ? 69  GLN M O   1 
ATOM   2499  C CB  . GLN B 1 50  ? 56.339  1.744   36.580  1.00 130.10 ? 69  GLN M CB  1 
ATOM   2500  C CG  . GLN B 1 50  ? 55.807  2.005   37.983  1.00 126.33 ? 69  GLN M CG  1 
ATOM   2501  C CD  . GLN B 1 50  ? 56.164  0.902   38.955  1.00 126.77 ? 69  GLN M CD  1 
ATOM   2502  O OE1 . GLN B 1 50  ? 57.333  0.699   39.278  1.00 127.53 ? 69  GLN M OE1 1 
ATOM   2503  N NE2 . GLN B 1 50  ? 55.156  0.178   39.425  1.00 126.30 ? 69  GLN M NE2 1 
ATOM   2504  N N   . PHE B 1 51  ? 54.360  -1.356  36.266  1.00 127.21 ? 70  PHE M N   1 
ATOM   2505  C CA  . PHE B 1 51  ? 52.996  -1.828  36.434  1.00 124.10 ? 70  PHE M CA  1 
ATOM   2506  C C   . PHE B 1 51  ? 52.532  -1.590  37.870  1.00 122.76 ? 70  PHE M C   1 
ATOM   2507  O O   . PHE B 1 51  ? 53.268  -1.070  38.714  1.00 125.92 ? 70  PHE M O   1 
ATOM   2508  C CB  . PHE B 1 51  ? 52.891  -3.302  36.054  1.00 123.76 ? 70  PHE M CB  1 
ATOM   2509  C CG  . PHE B 1 51  ? 53.097  -3.567  34.591  1.00 126.51 ? 70  PHE M CG  1 
ATOM   2510  C CD1 . PHE B 1 51  ? 52.138  -3.189  33.665  1.00 129.03 ? 70  PHE M CD1 1 
ATOM   2511  C CD2 . PHE B 1 51  ? 54.246  -4.194  34.140  1.00 129.03 ? 70  PHE M CD2 1 
ATOM   2512  C CE1 . PHE B 1 51  ? 52.321  -3.431  32.318  1.00 128.82 ? 70  PHE M CE1 1 
ATOM   2513  C CE2 . PHE B 1 51  ? 54.435  -4.438  32.792  1.00 134.09 ? 70  PHE M CE2 1 
ATOM   2514  C CZ  . PHE B 1 51  ? 53.470  -4.056  31.880  1.00 131.22 ? 70  PHE M CZ  1 
ATOM   2515  N N   . GLY B 1 52  ? 51.290  -1.976  38.156  1.00 118.38 ? 71  GLY M N   1 
ATOM   2516  C CA  . GLY B 1 52  ? 50.721  -1.740  39.468  1.00 117.83 ? 71  GLY M CA  1 
ATOM   2517  C C   . GLY B 1 52  ? 49.804  -2.837  39.970  1.00 113.31 ? 71  GLY M C   1 
ATOM   2518  O O   . GLY B 1 52  ? 49.269  -2.742  41.079  1.00 112.08 ? 71  GLY M O   1 
ATOM   2519  N N   . ALA B 1 53  ? 49.611  -3.882  39.172  1.00 108.11 ? 72  ALA M N   1 
ATOM   2520  C CA  . ALA B 1 53  ? 48.740  -4.989  39.546  1.00 112.76 ? 72  ALA M CA  1 
ATOM   2521  C C   . ALA B 1 53  ? 49.250  -6.275  38.896  1.00 114.38 ? 72  ALA M C   1 
ATOM   2522  O O   . ALA B 1 53  ? 48.589  -6.900  38.068  1.00 109.34 ? 72  ALA M O   1 
ATOM   2523  C CB  . ALA B 1 53  ? 47.293  -4.690  39.159  1.00 112.37 ? 72  ALA M CB  1 
ATOM   2524  N N   . ILE B 1 54  ? 50.453  -6.690  39.284  1.00 120.20 ? 73  ILE M N   1 
ATOM   2525  C CA  . ILE B 1 54  ? 51.059  -7.906  38.751  1.00 120.81 ? 73  ILE M CA  1 
ATOM   2526  C C   . ILE B 1 54  ? 50.571  -9.099  39.562  1.00 116.95 ? 73  ILE M C   1 
ATOM   2527  O O   . ILE B 1 54  ? 50.750  -9.147  40.784  1.00 108.67 ? 73  ILE M O   1 
ATOM   2528  C CB  . ILE B 1 54  ? 52.591  -7.817  38.771  1.00 124.52 ? 73  ILE M CB  1 
ATOM   2529  C CG1 . ILE B 1 54  ? 53.068  -6.663  37.888  1.00 125.86 ? 73  ILE M CG1 1 
ATOM   2530  C CG2 . ILE B 1 54  ? 53.205  -9.133  38.321  1.00 123.46 ? 73  ILE M CG2 1 
ATOM   2531  C CD1 . ILE B 1 54  ? 52.694  -6.826  36.434  1.00 125.03 ? 73  ILE M CD1 1 
ATOM   2532  N N   . SER B 1 55  ? 49.960  -10.065 38.883  1.00 118.62 ? 74  SER M N   1 
ATOM   2533  C CA  . SER B 1 55  ? 49.487  -11.266 39.556  1.00 119.88 ? 74  SER M CA  1 
ATOM   2534  C C   . SER B 1 55  ? 50.657  -12.176 39.901  1.00 121.84 ? 74  SER M C   1 
ATOM   2535  O O   . SER B 1 55  ? 51.567  -12.380 39.093  1.00 123.85 ? 74  SER M O   1 
ATOM   2536  C CB  . SER B 1 55  ? 48.485  -12.013 38.676  1.00 119.86 ? 74  SER M CB  1 
ATOM   2537  O OG  . SER B 1 55  ? 48.220  -13.306 39.192  1.00 118.50 ? 74  SER M OG  1 
ATOM   2538  N N   . LEU B 1 56  ? 50.631  -12.724 41.113  1.00 119.98 ? 75  LEU M N   1 
ATOM   2539  C CA  . LEU B 1 56  ? 51.676  -13.620 41.587  1.00 117.70 ? 75  LEU M CA  1 
ATOM   2540  C C   . LEU B 1 56  ? 51.275  -15.086 41.531  1.00 118.17 ? 75  LEU M C   1 
ATOM   2541  O O   . LEU B 1 56  ? 52.042  -15.939 41.988  1.00 130.59 ? 75  LEU M O   1 
ATOM   2542  C CB  . LEU B 1 56  ? 52.080  -13.252 43.019  1.00 117.87 ? 75  LEU M CB  1 
ATOM   2543  C CG  . LEU B 1 56  ? 52.895  -11.970 43.207  1.00 116.66 ? 75  LEU M CG  1 
ATOM   2544  C CD1 . LEU B 1 56  ? 52.007  -10.818 43.643  1.00 117.13 ? 75  LEU M CD1 1 
ATOM   2545  C CD2 . LEU B 1 56  ? 54.009  -12.193 44.213  1.00 116.76 ? 75  LEU M CD2 1 
ATOM   2546  N N   . CYS B 1 57  ? 50.102  -15.404 40.981  1.00 125.87 ? 76  CYS M N   1 
ATOM   2547  C CA  . CYS B 1 57  ? 49.649  -16.787 40.918  1.00 131.45 ? 76  CYS M CA  1 
ATOM   2548  C C   . CYS B 1 57  ? 49.037  -17.178 39.580  1.00 131.69 ? 76  CYS M C   1 
ATOM   2549  O O   . CYS B 1 57  ? 48.576  -18.316 39.446  1.00 125.45 ? 76  CYS M O   1 
ATOM   2550  C CB  . CYS B 1 57  ? 48.634  -17.064 42.036  1.00 139.70 ? 76  CYS M CB  1 
ATOM   2551  S SG  . CYS B 1 57  ? 49.188  -16.562 43.681  1.00 147.47 ? 76  CYS M SG  1 
ATOM   2552  N N   . GLU B 1 58  ? 49.013  -16.286 38.594  1.00 135.69 ? 77  GLU M N   1 
ATOM   2553  C CA  . GLU B 1 58  ? 48.472  -16.580 37.272  1.00 136.54 ? 77  GLU M CA  1 
ATOM   2554  C C   . GLU B 1 58  ? 49.572  -16.337 36.248  1.00 136.44 ? 77  GLU M C   1 
ATOM   2555  O O   . GLU B 1 58  ? 50.016  -15.198 36.068  1.00 128.69 ? 77  GLU M O   1 
ATOM   2556  C CB  . GLU B 1 58  ? 47.243  -15.721 36.977  1.00 139.50 ? 77  GLU M CB  1 
ATOM   2557  C CG  . GLU B 1 58  ? 46.442  -16.177 35.769  1.00 137.82 ? 77  GLU M CG  1 
ATOM   2558  C CD  . GLU B 1 58  ? 45.321  -15.219 35.421  1.00 135.88 ? 77  GLU M CD  1 
ATOM   2559  O OE1 . GLU B 1 58  ? 45.541  -13.992 35.496  1.00 134.65 ? 77  GLU M OE1 1 
ATOM   2560  O OE2 . GLU B 1 58  ? 44.219  -15.693 35.070  1.00 134.68 ? 77  GLU M OE2 1 
ATOM   2561  N N   . VAL B 1 59  ? 50.013  -17.408 35.587  1.00 140.42 ? 78  VAL M N   1 
ATOM   2562  C CA  . VAL B 1 59  ? 51.055  -17.322 34.571  1.00 139.19 ? 78  VAL M CA  1 
ATOM   2563  C C   . VAL B 1 59  ? 50.616  -16.356 33.477  1.00 136.41 ? 78  VAL M C   1 
ATOM   2564  O O   . VAL B 1 59  ? 49.714  -16.655 32.685  1.00 128.45 ? 78  VAL M O   1 
ATOM   2565  C CB  . VAL B 1 59  ? 51.393  -18.713 33.999  1.00 137.91 ? 78  VAL M CB  1 
ATOM   2566  C CG1 . VAL B 1 59  ? 52.297  -19.468 34.957  1.00 137.97 ? 78  VAL M CG1 1 
ATOM   2567  C CG2 . VAL B 1 59  ? 50.125  -19.516 33.748  1.00 135.28 ? 78  VAL M CG2 1 
ATOM   2568  N N   . THR B 1 60  ? 51.239  -15.182 33.437  1.00 138.37 ? 79  THR M N   1 
ATOM   2569  C CA  . THR B 1 60  ? 50.907  -14.151 32.466  1.00 137.04 ? 79  THR M CA  1 
ATOM   2570  C C   . THR B 1 60  ? 52.106  -13.860 31.573  1.00 134.94 ? 79  THR M C   1 
ATOM   2571  O O   . THR B 1 60  ? 53.257  -13.891 32.024  1.00 137.89 ? 79  THR M O   1 
ATOM   2572  C CB  . THR B 1 60  ? 50.426  -12.871 33.160  1.00 138.47 ? 79  THR M CB  1 
ATOM   2573  O OG1 . THR B 1 60  ? 51.276  -12.577 34.274  1.00 133.35 ? 79  THR M OG1 1 
ATOM   2574  C CG2 . THR B 1 60  ? 48.992  -13.037 33.644  1.00 139.47 ? 79  THR M CG2 1 
ATOM   2575  N N   . ASN B 1 61  ? 51.815  -13.574 30.306  1.00 138.45 ? 80  ASN M N   1 
ATOM   2576  C CA  . ASN B 1 61  ? 52.821  -13.441 29.260  1.00 136.02 ? 80  ASN M CA  1 
ATOM   2577  C C   . ASN B 1 61  ? 53.233  -11.979 29.154  1.00 130.68 ? 80  ASN M C   1 
ATOM   2578  O O   . ASN B 1 61  ? 52.398  -11.121 28.852  1.00 138.68 ? 80  ASN M O   1 
ATOM   2579  C CB  . ASN B 1 61  ? 52.250  -13.943 27.934  1.00 134.38 ? 80  ASN M CB  1 
ATOM   2580  C CG  . ASN B 1 61  ? 53.308  -14.151 26.866  1.00 137.01 ? 80  ASN M CG  1 
ATOM   2581  O OD1 . ASN B 1 61  ? 54.333  -13.471 26.838  1.00 137.78 ? 80  ASN M OD1 1 
ATOM   2582  N ND2 . ASN B 1 61  ? 53.049  -15.099 25.967  1.00 139.12 ? 80  ASN M ND2 1 
ATOM   2583  N N   . TYR B 1 62  ? 54.509  -11.688 29.402  1.00 125.67 ? 81  TYR M N   1 
ATOM   2584  C CA  . TYR B 1 62  ? 55.013  -10.318 29.366  1.00 131.99 ? 81  TYR M CA  1 
ATOM   2585  C C   . TYR B 1 62  ? 55.913  -10.162 28.148  1.00 135.95 ? 81  TYR M C   1 
ATOM   2586  O O   . TYR B 1 62  ? 56.997  -10.754 28.093  1.00 153.72 ? 81  TYR M O   1 
ATOM   2587  C CB  . TYR B 1 62  ? 55.761  -9.974  30.652  1.00 128.49 ? 81  TYR M CB  1 
ATOM   2588  C CG  . TYR B 1 62  ? 54.874  -9.940  31.872  1.00 130.18 ? 81  TYR M CG  1 
ATOM   2589  C CD1 . TYR B 1 62  ? 54.567  -11.104 32.560  1.00 132.43 ? 81  TYR M CD1 1 
ATOM   2590  C CD2 . TYR B 1 62  ? 54.323  -8.749  32.323  1.00 131.18 ? 81  TYR M CD2 1 
ATOM   2591  C CE1 . TYR B 1 62  ? 53.755  -11.083 33.671  1.00 133.57 ? 81  TYR M CE1 1 
ATOM   2592  C CE2 . TYR B 1 62  ? 53.503  -8.718  33.435  1.00 136.15 ? 81  TYR M CE2 1 
ATOM   2593  C CZ  . TYR B 1 62  ? 53.221  -9.890  34.105  1.00 135.00 ? 81  TYR M CZ  1 
ATOM   2594  O OH  . TYR B 1 62  ? 52.407  -9.874  35.213  1.00 134.75 ? 81  TYR M OH  1 
ATOM   2595  N N   . THR B 1 63  ? 55.467  -9.367  27.178  1.00 142.35 ? 82  THR M N   1 
ATOM   2596  C CA  . THR B 1 63  ? 56.207  -9.122  25.950  1.00 138.43 ? 82  THR M CA  1 
ATOM   2597  C C   . THR B 1 63  ? 56.745  -7.695  25.958  1.00 138.91 ? 82  THR M C   1 
ATOM   2598  O O   . THR B 1 63  ? 56.145  -6.795  26.548  1.00 141.55 ? 82  THR M O   1 
ATOM   2599  C CB  . THR B 1 63  ? 55.313  -9.348  24.722  1.00 133.41 ? 82  THR M CB  1 
ATOM   2600  O OG1 . THR B 1 63  ? 54.745  -10.661 24.783  1.00 130.76 ? 82  THR M OG1 1 
ATOM   2601  C CG2 . THR B 1 63  ? 56.106  -9.219  23.429  1.00 131.14 ? 82  THR M CG2 1 
ATOM   2602  N N   . VAL B 1 64  ? 57.894  -7.494  25.319  1.00 137.13 ? 83  VAL M N   1 
ATOM   2603  C CA  . VAL B 1 64  ? 58.509  -6.178  25.199  1.00 141.60 ? 83  VAL M CA  1 
ATOM   2604  C C   . VAL B 1 64  ? 58.790  -5.918  23.726  1.00 152.11 ? 83  VAL M C   1 
ATOM   2605  O O   . VAL B 1 64  ? 59.434  -6.737  23.061  1.00 159.72 ? 83  VAL M O   1 
ATOM   2606  C CB  . VAL B 1 64  ? 59.802  -6.077  26.030  1.00 139.87 ? 83  VAL M CB  1 
ATOM   2607  C CG1 . VAL B 1 64  ? 60.360  -4.675  25.976  1.00 135.83 ? 83  VAL M CG1 1 
ATOM   2608  C CG2 . VAL B 1 64  ? 59.534  -6.477  27.467  1.00 143.24 ? 83  VAL M CG2 1 
ATOM   2609  N N   . ARG B 1 65  ? 58.308  -4.785  23.212  1.00 157.13 ? 84  ARG M N   1 
ATOM   2610  C CA  . ARG B 1 65  ? 58.448  -4.455  21.801  1.00 150.17 ? 84  ARG M CA  1 
ATOM   2611  C C   . ARG B 1 65  ? 59.163  -3.121  21.637  1.00 149.25 ? 84  ARG M C   1 
ATOM   2612  O O   . ARG B 1 65  ? 58.948  -2.186  22.417  1.00 141.64 ? 84  ARG M O   1 
ATOM   2613  C CB  . ARG B 1 65  ? 57.087  -4.399  21.104  1.00 150.54 ? 84  ARG M CB  1 
ATOM   2614  C CG  . ARG B 1 65  ? 56.467  -5.758  20.835  1.00 147.81 ? 84  ARG M CG  1 
ATOM   2615  C CD  . ARG B 1 65  ? 55.129  -5.606  20.139  1.00 143.97 ? 84  ARG M CD  1 
ATOM   2616  N NE  . ARG B 1 65  ? 54.341  -4.525  20.721  1.00 144.62 ? 84  ARG M NE  1 
ATOM   2617  C CZ  . ARG B 1 65  ? 53.014  -4.520  20.790  1.00 142.02 ? 84  ARG M CZ  1 
ATOM   2618  N NH1 . ARG B 1 65  ? 52.320  -5.542  20.309  1.00 142.85 ? 84  ARG M NH1 1 
ATOM   2619  N NH2 . ARG B 1 65  ? 52.382  -3.489  21.334  1.00 137.38 ? 84  ARG M NH2 1 
ATOM   2620  N N   . VAL B 1 66  ? 60.007  -3.045  20.607  1.00 154.10 ? 85  VAL M N   1 
ATOM   2621  C CA  . VAL B 1 66  ? 60.768  -1.849  20.278  1.00 156.90 ? 85  VAL M CA  1 
ATOM   2622  C C   . VAL B 1 66  ? 60.367  -1.405  18.875  1.00 157.14 ? 85  VAL M C   1 
ATOM   2623  O O   . VAL B 1 66  ? 59.791  -2.170  18.098  1.00 153.52 ? 85  VAL M O   1 
ATOM   2624  C CB  . VAL B 1 66  ? 62.291  -2.096  20.368  1.00 153.45 ? 85  VAL M CB  1 
ATOM   2625  C CG1 . VAL B 1 66  ? 63.062  -0.781  20.480  1.00 151.92 ? 85  VAL M CG1 1 
ATOM   2626  C CG2 . VAL B 1 66  ? 62.621  -3.022  21.536  1.00 152.64 ? 85  VAL M CG2 1 
ATOM   2627  N N   . ALA B 1 67  ? 60.673  -0.146  18.558  1.00 155.32 ? 86  ALA M N   1 
ATOM   2628  C CA  . ALA B 1 67  ? 60.403  0.420   17.240  1.00 155.59 ? 86  ALA M CA  1 
ATOM   2629  C C   . ALA B 1 67  ? 61.619  0.375   16.321  1.00 161.93 ? 86  ALA M C   1 
ATOM   2630  O O   . ALA B 1 67  ? 61.513  -0.066  15.173  1.00 157.60 ? 86  ALA M O   1 
ATOM   2631  C CB  . ALA B 1 67  ? 59.908  1.866   17.374  1.00 151.58 ? 86  ALA M CB  1 
ATOM   2632  N N   . ASN B 1 68  ? 62.778  0.824   16.808  1.00 165.02 ? 87  ASN M N   1 
ATOM   2633  C CA  . ASN B 1 68  ? 64.019  0.854   16.035  1.00 159.35 ? 87  ASN M CA  1 
ATOM   2634  C C   . ASN B 1 68  ? 65.071  0.030   16.767  1.00 154.88 ? 87  ASN M C   1 
ATOM   2635  O O   . ASN B 1 68  ? 65.783  0.554   17.639  1.00 148.31 ? 87  ASN M O   1 
ATOM   2636  C CB  . ASN B 1 68  ? 64.504  2.290   15.824  1.00 154.95 ? 87  ASN M CB  1 
ATOM   2637  C CG  . ASN B 1 68  ? 63.364  3.270   15.628  1.00 151.60 ? 87  ASN M CG  1 
ATOM   2638  O OD1 . ASN B 1 68  ? 62.582  3.522   16.545  1.00 147.76 ? 87  ASN M OD1 1 
ATOM   2639  N ND2 . ASN B 1 68  ? 63.260  3.824   14.424  1.00 147.93 ? 87  ASN M ND2 1 
ATOM   2640  N N   . PRO B 1 69  ? 65.213  -1.268  16.445  1.00 154.62 ? 88  PRO M N   1 
ATOM   2641  C CA  . PRO B 1 69  ? 64.463  -2.014  15.435  1.00 153.78 ? 88  PRO M CA  1 
ATOM   2642  C C   . PRO B 1 69  ? 63.234  -2.732  16.005  1.00 157.78 ? 88  PRO M C   1 
ATOM   2643  O O   . PRO B 1 69  ? 63.096  -2.807  17.226  1.00 164.47 ? 88  PRO M O   1 
ATOM   2644  C CB  . PRO B 1 69  ? 65.505  -3.012  14.940  1.00 151.35 ? 88  PRO M CB  1 
ATOM   2645  C CG  . PRO B 1 69  ? 66.243  -3.377  16.198  1.00 150.40 ? 88  PRO M CG  1 
ATOM   2646  C CD  . PRO B 1 69  ? 66.222  -2.132  17.088  1.00 151.23 ? 88  PRO M CD  1 
ATOM   2647  N N   . PRO B 1 70  ? 62.345  -3.238  15.128  1.00 157.57 ? 89  PRO M N   1 
ATOM   2648  C CA  . PRO B 1 70  ? 61.188  -4.016  15.586  1.00 154.64 ? 89  PRO M CA  1 
ATOM   2649  C C   . PRO B 1 70  ? 61.589  -5.229  16.423  1.00 150.60 ? 89  PRO M C   1 
ATOM   2650  O O   . PRO B 1 70  ? 62.030  -6.230  15.861  1.00 138.48 ? 89  PRO M O   1 
ATOM   2651  C CB  . PRO B 1 70  ? 60.520  -4.459  14.279  1.00 152.40 ? 89  PRO M CB  1 
ATOM   2652  C CG  . PRO B 1 70  ? 60.917  -3.427  13.285  1.00 151.42 ? 89  PRO M CG  1 
ATOM   2653  C CD  . PRO B 1 70  ? 62.299  -2.981  13.677  1.00 155.22 ? 89  PRO M CD  1 
ATOM   2654  N N   . TRP B 1 74  ? 60.089  -11.926 25.090  1.00 149.18 ? 93  TRP M N   1 
ATOM   2655  C CA  . TRP B 1 74  ? 59.011  -12.182 26.040  1.00 149.99 ? 93  TRP M CA  1 
ATOM   2656  C C   . TRP B 1 74  ? 59.455  -13.121 27.155  1.00 149.08 ? 93  TRP M C   1 
ATOM   2657  O O   . TRP B 1 74  ? 60.402  -13.888 26.989  1.00 154.66 ? 93  TRP M O   1 
ATOM   2658  C CB  . TRP B 1 74  ? 57.799  -12.789 25.331  1.00 142.75 ? 93  TRP M CB  1 
ATOM   2659  C CG  . TRP B 1 74  ? 58.070  -14.153 24.774  1.00 134.99 ? 93  TRP M CG  1 
ATOM   2660  C CD1 . TRP B 1 74  ? 58.640  -14.448 23.572  1.00 140.11 ? 93  TRP M CD1 1 
ATOM   2661  C CD2 . TRP B 1 74  ? 57.818  -15.409 25.418  1.00 136.84 ? 93  TRP M CD2 1 
ATOM   2662  N NE1 . TRP B 1 74  ? 58.739  -15.810 23.416  1.00 143.99 ? 93  TRP M NE1 1 
ATOM   2663  C CE2 . TRP B 1 74  ? 58.244  -16.422 24.537  1.00 142.54 ? 93  TRP M CE2 1 
ATOM   2664  C CE3 . TRP B 1 74  ? 57.267  -15.775 26.651  1.00 137.86 ? 93  TRP M CE3 1 
ATOM   2665  C CZ2 . TRP B 1 74  ? 58.136  -17.777 24.849  1.00 144.71 ? 93  TRP M CZ2 1 
ATOM   2666  C CZ3 . TRP B 1 74  ? 57.161  -17.120 26.958  1.00 141.53 ? 93  TRP M CZ3 1 
ATOM   2667  C CH2 . TRP B 1 74  ? 57.593  -18.105 26.061  1.00 144.66 ? 93  TRP M CH2 1 
ATOM   2668  N N   . ILE B 1 75  ? 58.761  -13.056 28.291  1.00 147.87 ? 94  ILE M N   1 
ATOM   2669  C CA  . ILE B 1 75  ? 58.908  -14.014 29.380  1.00 142.19 ? 94  ILE M CA  1 
ATOM   2670  C C   . ILE B 1 75  ? 57.525  -14.337 29.936  1.00 137.11 ? 94  ILE M C   1 
ATOM   2671  O O   . ILE B 1 75  ? 56.504  -13.819 29.474  1.00 133.35 ? 94  ILE M O   1 
ATOM   2672  C CB  . ILE B 1 75  ? 59.826  -13.503 30.514  1.00 145.72 ? 94  ILE M CB  1 
ATOM   2673  C CG1 . ILE B 1 75  ? 59.172  -12.327 31.245  1.00 141.72 ? 94  ILE M CG1 1 
ATOM   2674  C CG2 . ILE B 1 75  ? 61.214  -13.145 29.990  1.00 147.64 ? 94  ILE M CG2 1 
ATOM   2675  C CD1 . ILE B 1 75  ? 59.803  -12.018 32.587  1.00 141.59 ? 94  ILE M CD1 1 
ATOM   2676  N N   . LEU B 1 76  ? 57.502  -15.200 30.947  1.00 131.95 ? 95  LEU M N   1 
ATOM   2677  C CA  . LEU B 1 76  ? 56.300  -15.518 31.700  1.00 132.70 ? 95  LEU M CA  1 
ATOM   2678  C C   . LEU B 1 76  ? 56.523  -15.159 33.161  1.00 136.91 ? 95  LEU M C   1 
ATOM   2679  O O   . LEU B 1 76  ? 57.614  -15.375 33.700  1.00 139.36 ? 95  LEU M O   1 
ATOM   2680  C CB  . LEU B 1 76  ? 55.941  -17.006 31.588  1.00 128.57 ? 95  LEU M CB  1 
ATOM   2681  C CG  . LEU B 1 76  ? 55.434  -17.555 30.254  1.00 129.38 ? 95  LEU M CG  1 
ATOM   2682  C CD1 . LEU B 1 76  ? 54.737  -18.888 30.470  1.00 128.56 ? 95  LEU M CD1 1 
ATOM   2683  C CD2 . LEU B 1 76  ? 54.502  -16.573 29.578  1.00 131.18 ? 95  LEU M CD2 1 
ATOM   2684  N N   . PHE B 1 77  ? 55.493  -14.601 33.804  1.00 140.56 ? 96  PHE M N   1 
ATOM   2685  C CA  . PHE B 1 77  ? 55.546  -14.412 35.249  1.00 138.09 ? 96  PHE M CA  1 
ATOM   2686  C C   . PHE B 1 77  ? 54.156  -14.663 35.823  1.00 141.97 ? 96  PHE M C   1 
ATOM   2687  O O   . PHE B 1 77  ? 53.168  -14.091 35.326  1.00 143.58 ? 96  PHE M O   1 
ATOM   2688  C CB  . PHE B 1 77  ? 56.046  -13.026 35.668  1.00 133.44 ? 96  PHE M CB  1 
ATOM   2689  C CG  . PHE B 1 77  ? 56.178  -12.869 37.158  1.00 133.64 ? 96  PHE M CG  1 
ATOM   2690  C CD1 . PHE B 1 77  ? 57.343  -13.245 37.803  1.00 134.95 ? 96  PHE M CD1 1 
ATOM   2691  C CD2 . PHE B 1 77  ? 55.136  -12.358 37.915  1.00 138.02 ? 96  PHE M CD2 1 
ATOM   2692  C CE1 . PHE B 1 77  ? 57.470  -13.114 39.171  1.00 135.83 ? 96  PHE M CE1 1 
ATOM   2693  C CE2 . PHE B 1 77  ? 55.259  -12.224 39.286  1.00 139.00 ? 96  PHE M CE2 1 
ATOM   2694  C CZ  . PHE B 1 77  ? 56.428  -12.603 39.913  1.00 133.46 ? 96  PHE M CZ  1 
ATOM   2695  N N   . PRO B 1 78  ? 54.040  -15.510 36.858  1.00 138.28 ? 97  PRO M N   1 
ATOM   2696  C CA  . PRO B 1 78  ? 55.184  -16.229 37.425  1.00 139.65 ? 97  PRO M CA  1 
ATOM   2697  C C   . PRO B 1 78  ? 55.529  -17.463 36.603  1.00 144.11 ? 97  PRO M C   1 
ATOM   2698  O O   . PRO B 1 78  ? 54.839  -17.748 35.627  1.00 143.47 ? 97  PRO M O   1 
ATOM   2699  C CB  . PRO B 1 78  ? 54.703  -16.623 38.829  1.00 138.81 ? 97  PRO M CB  1 
ATOM   2700  C CG  . PRO B 1 78  ? 53.254  -16.182 38.920  1.00 137.98 ? 97  PRO M CG  1 
ATOM   2701  C CD  . PRO B 1 78  ? 52.789  -15.863 37.541  1.00 136.36 ? 97  PRO M CD  1 
ATOM   2702  N N   . GLU B 1 79  ? 56.585  -18.176 36.980  1.00 152.49 ? 98  GLU M N   1 
ATOM   2703  C CA  . GLU B 1 79  ? 56.962  -19.380 36.258  1.00 147.43 ? 98  GLU M CA  1 
ATOM   2704  C C   . GLU B 1 79  ? 56.051  -20.533 36.656  1.00 141.97 ? 98  GLU M C   1 
ATOM   2705  O O   . GLU B 1 79  ? 55.721  -20.707 37.832  1.00 136.00 ? 98  GLU M O   1 
ATOM   2706  C CB  . GLU B 1 79  ? 58.427  -19.731 36.520  1.00 147.05 ? 98  GLU M CB  1 
ATOM   2707  C CG  . GLU B 1 79  ? 59.398  -18.647 36.069  1.00 143.15 ? 98  GLU M CG  1 
ATOM   2708  C CD  . GLU B 1 79  ? 60.850  -19.060 36.204  1.00 144.67 ? 98  GLU M CD  1 
ATOM   2709  O OE1 . GLU B 1 79  ? 61.141  -19.986 36.992  1.00 147.17 ? 98  GLU M OE1 1 
ATOM   2710  O OE2 . GLU B 1 79  ? 61.702  -18.458 35.517  1.00 145.10 ? 98  GLU M OE2 1 
ATOM   2711  N N   . ASN B 1 80  ? 55.634  -21.311 35.660  1.00 142.21 ? 99  ASN M N   1 
ATOM   2712  C CA  . ASN B 1 80  ? 54.675  -22.385 35.885  1.00 142.48 ? 99  ASN M CA  1 
ATOM   2713  C C   . ASN B 1 80  ? 55.290  -23.466 36.765  1.00 148.61 ? 99  ASN M C   1 
ATOM   2714  O O   . ASN B 1 80  ? 56.310  -24.064 36.408  1.00 161.39 ? 99  ASN M O   1 
ATOM   2715  C CB  . ASN B 1 80  ? 54.218  -22.971 34.552  1.00 139.46 ? 99  ASN M CB  1 
ATOM   2716  C CG  . ASN B 1 80  ? 52.714  -23.136 34.476  1.00 136.89 ? 99  ASN M CG  1 
ATOM   2717  O OD1 . ASN B 1 80  ? 52.078  -23.582 35.432  1.00 132.98 ? 99  ASN M OD1 1 
ATOM   2718  N ND2 . ASN B 1 80  ? 52.135  -22.777 33.335  1.00 137.22 ? 99  ASN M ND2 1 
ATOM   2719  N N   . SER B 1 81  ? 54.668  -23.714 37.913  1.00 147.33 ? 100 SER M N   1 
ATOM   2720  C CA  . SER B 1 81  ? 55.130  -24.742 38.834  1.00 146.51 ? 100 SER M CA  1 
ATOM   2721  C C   . SER B 1 81  ? 53.947  -25.198 39.676  1.00 143.80 ? 100 SER M C   1 
ATOM   2722  O O   . SER B 1 81  ? 52.847  -24.647 39.590  1.00 145.89 ? 100 SER M O   1 
ATOM   2723  C CB  . SER B 1 81  ? 56.275  -24.235 39.716  1.00 148.11 ? 100 SER M CB  1 
ATOM   2724  O OG  . SER B 1 81  ? 55.793  -23.389 40.745  1.00 148.69 ? 100 SER M OG  1 
ATOM   2725  N N   . GLY B 1 82  ? 54.190  -26.215 40.491  1.00 146.77 ? 101 GLY M N   1 
ATOM   2726  C CA  . GLY B 1 82  ? 53.162  -26.763 41.345  1.00 144.49 ? 101 GLY M CA  1 
ATOM   2727  C C   . GLY B 1 82  ? 52.275  -27.764 40.626  1.00 145.11 ? 101 GLY M C   1 
ATOM   2728  O O   . GLY B 1 82  ? 52.181  -27.799 39.399  1.00 144.94 ? 101 GLY M O   1 
ATOM   2729  N N   . LYS B 1 83  ? 51.617  -28.597 41.421  1.00 145.37 ? 102 LYS M N   1 
ATOM   2730  C CA  . LYS B 1 83  ? 50.717  -29.610 40.890  1.00 148.79 ? 102 LYS M CA  1 
ATOM   2731  C C   . LYS B 1 83  ? 49.581  -28.937 40.129  1.00 148.01 ? 102 LYS M C   1 
ATOM   2732  O O   . LYS B 1 83  ? 48.888  -28.081 40.699  1.00 148.47 ? 102 LYS M O   1 
ATOM   2733  C CB  . LYS B 1 83  ? 50.166  -30.474 42.022  1.00 154.91 ? 102 LYS M CB  1 
ATOM   2734  C CG  . LYS B 1 83  ? 49.368  -31.684 41.565  1.00 156.89 ? 102 LYS M CG  1 
ATOM   2735  C CD  . LYS B 1 83  ? 49.051  -32.603 42.736  1.00 158.92 ? 102 LYS M CD  1 
ATOM   2736  C CE  . LYS B 1 83  ? 48.219  -33.798 42.299  1.00 158.21 ? 102 LYS M CE  1 
ATOM   2737  N NZ  . LYS B 1 83  ? 47.521  -34.434 43.450  1.00 160.08 ? 102 LYS M NZ  1 
ATOM   2738  N N   . PRO B 1 84  ? 49.371  -29.262 38.854  1.00 152.15 ? 103 PRO M N   1 
ATOM   2739  C CA  . PRO B 1 84  ? 48.300  -28.607 38.097  1.00 154.12 ? 103 PRO M CA  1 
ATOM   2740  C C   . PRO B 1 84  ? 46.927  -28.954 38.650  1.00 153.00 ? 103 PRO M C   1 
ATOM   2741  O O   . PRO B 1 84  ? 46.700  -30.044 39.182  1.00 149.82 ? 103 PRO M O   1 
ATOM   2742  C CB  . PRO B 1 84  ? 48.480  -29.151 36.674  1.00 152.35 ? 103 PRO M CB  1 
ATOM   2743  C CG  . PRO B 1 84  ? 49.274  -30.408 36.838  1.00 154.66 ? 103 PRO M CG  1 
ATOM   2744  C CD  . PRO B 1 84  ? 50.163  -30.180 38.020  1.00 154.63 ? 103 PRO M CD  1 
ATOM   2745  N N   . TRP B 1 85  ? 46.007  -27.995 38.521  1.00 155.30 ? 104 TRP M N   1 
ATOM   2746  C CA  . TRP B 1 85  ? 44.631  -28.108 39.004  1.00 152.22 ? 104 TRP M CA  1 
ATOM   2747  C C   . TRP B 1 85  ? 44.555  -28.300 40.515  1.00 149.96 ? 104 TRP M C   1 
ATOM   2748  O O   . TRP B 1 85  ? 43.536  -28.772 41.029  1.00 151.51 ? 104 TRP M O   1 
ATOM   2749  C CB  . TRP B 1 85  ? 43.877  -29.246 38.301  1.00 155.94 ? 104 TRP M CB  1 
ATOM   2750  C CG  . TRP B 1 85  ? 43.605  -29.013 36.847  1.00 159.24 ? 104 TRP M CG  1 
ATOM   2751  C CD1 . TRP B 1 85  ? 43.593  -27.816 36.190  1.00 151.64 ? 104 TRP M CD1 1 
ATOM   2752  C CD2 . TRP B 1 85  ? 43.291  -30.012 35.869  1.00 163.10 ? 104 TRP M CD2 1 
ATOM   2753  N NE1 . TRP B 1 85  ? 43.297  -28.009 34.861  1.00 153.27 ? 104 TRP M NE1 1 
ATOM   2754  C CE2 . TRP B 1 85  ? 43.106  -29.348 34.639  1.00 159.89 ? 104 TRP M CE2 1 
ATOM   2755  C CE3 . TRP B 1 85  ? 43.151  -31.403 35.913  1.00 155.64 ? 104 TRP M CE3 1 
ATOM   2756  C CZ2 . TRP B 1 85  ? 42.789  -30.029 33.464  1.00 151.49 ? 104 TRP M CZ2 1 
ATOM   2757  C CZ3 . TRP B 1 85  ? 42.835  -32.077 34.747  1.00 147.54 ? 104 TRP M CZ3 1 
ATOM   2758  C CH2 . TRP B 1 85  ? 42.658  -31.390 33.539  1.00 146.41 ? 104 TRP M CH2 1 
ATOM   2759  N N   . ALA B 1 86  ? 45.609  -27.940 41.249  1.00 148.03 ? 105 ALA M N   1 
ATOM   2760  C CA  . ALA B 1 86  ? 45.641  -28.116 42.697  1.00 145.70 ? 105 ALA M CA  1 
ATOM   2761  C C   . ALA B 1 86  ? 45.417  -26.837 43.489  1.00 144.54 ? 105 ALA M C   1 
ATOM   2762  O O   . ALA B 1 86  ? 44.974  -26.914 44.635  1.00 145.28 ? 105 ALA M O   1 
ATOM   2763  C CB  . ALA B 1 86  ? 46.981  -28.721 43.133  1.00 146.66 ? 105 ALA M CB  1 
ATOM   2764  N N   . GLY B 1 87  ? 45.725  -25.672 42.930  1.00 140.93 ? 106 GLY M N   1 
ATOM   2765  C CA  . GLY B 1 87  ? 45.520  -24.435 43.655  1.00 143.52 ? 106 GLY M CA  1 
ATOM   2766  C C   . GLY B 1 87  ? 44.049  -24.106 43.826  1.00 145.56 ? 106 GLY M C   1 
ATOM   2767  O O   . GLY B 1 87  ? 43.170  -24.672 43.175  1.00 149.04 ? 106 GLY M O   1 
ATOM   2768  N N   . ALA B 1 88  ? 43.782  -23.164 44.729  1.00 139.09 ? 107 ALA M N   1 
ATOM   2769  C CA  . ALA B 1 88  ? 42.415  -22.727 44.974  1.00 134.69 ? 107 ALA M CA  1 
ATOM   2770  C C   . ALA B 1 88  ? 41.839  -22.046 43.737  1.00 136.74 ? 107 ALA M C   1 
ATOM   2771  O O   . ALA B 1 88  ? 42.560  -21.441 42.940  1.00 144.15 ? 107 ALA M O   1 
ATOM   2772  C CB  . ALA B 1 88  ? 42.368  -21.773 46.168  1.00 129.82 ? 107 ALA M CB  1 
ATOM   2773  N N   . GLU B 1 89  ? 40.521  -22.149 43.577  1.00 135.02 ? 108 GLU M N   1 
ATOM   2774  C CA  . GLU B 1 89  ? 39.844  -21.587 42.418  1.00 134.69 ? 108 GLU M CA  1 
ATOM   2775  C C   . GLU B 1 89  ? 38.504  -21.008 42.846  1.00 128.38 ? 108 GLU M C   1 
ATOM   2776  O O   . GLU B 1 89  ? 38.007  -21.274 43.944  1.00 130.46 ? 108 GLU M O   1 
ATOM   2777  C CB  . GLU B 1 89  ? 39.652  -22.637 41.317  1.00 139.76 ? 108 GLU M CB  1 
ATOM   2778  C CG  . GLU B 1 89  ? 40.849  -22.787 40.392  1.00 140.95 ? 108 GLU M CG  1 
ATOM   2779  C CD  . GLU B 1 89  ? 40.726  -23.982 39.468  1.00 142.65 ? 108 GLU M CD  1 
ATOM   2780  O OE1 . GLU B 1 89  ? 39.635  -24.181 38.891  1.00 148.58 ? 108 GLU M OE1 1 
ATOM   2781  O OE2 . GLU B 1 89  ? 41.720  -24.726 39.322  1.00 138.17 ? 108 GLU M OE2 1 
ATOM   2782  N N   . ASN B 1 90  ? 37.922  -20.206 41.951  1.00 123.24 ? 109 ASN M N   1 
ATOM   2783  C CA  . ASN B 1 90  ? 36.641  -19.538 42.192  1.00 121.93 ? 109 ASN M CA  1 
ATOM   2784  C C   . ASN B 1 90  ? 36.694  -18.671 43.448  1.00 118.15 ? 109 ASN M C   1 
ATOM   2785  O O   . ASN B 1 90  ? 35.718  -18.563 44.193  1.00 118.57 ? 109 ASN M O   1 
ATOM   2786  C CB  . ASN B 1 90  ? 35.492  -20.547 42.271  1.00 120.91 ? 109 ASN M CB  1 
ATOM   2787  C CG  . ASN B 1 90  ? 35.043  -21.027 40.905  1.00 121.02 ? 109 ASN M CG  1 
ATOM   2788  O OD1 . ASN B 1 90  ? 35.861  -21.391 40.059  1.00 117.58 ? 109 ASN M OD1 1 
ATOM   2789  N ND2 . ASN B 1 90  ? 33.734  -21.018 40.678  1.00 120.80 ? 109 ASN M ND2 1 
ATOM   2790  N N   . LEU B 1 91  ? 37.844  -18.044 43.682  1.00 106.75 ? 110 LEU M N   1 
ATOM   2791  C CA  . LEU B 1 91  ? 38.001  -17.164 44.833  1.00 111.32 ? 110 LEU M CA  1 
ATOM   2792  C C   . LEU B 1 91  ? 37.231  -15.872 44.598  1.00 111.74 ? 110 LEU M C   1 
ATOM   2793  O O   . LEU B 1 91  ? 37.486  -15.155 43.625  1.00 118.30 ? 110 LEU M O   1 
ATOM   2794  C CB  . LEU B 1 91  ? 39.479  -16.872 45.080  1.00 114.97 ? 110 LEU M CB  1 
ATOM   2795  C CG  . LEU B 1 91  ? 39.822  -15.896 46.210  1.00 116.72 ? 110 LEU M CG  1 
ATOM   2796  C CD1 . LEU B 1 91  ? 41.019  -16.401 46.979  1.00 121.06 ? 110 LEU M CD1 1 
ATOM   2797  C CD2 . LEU B 1 91  ? 40.100  -14.502 45.677  1.00 117.37 ? 110 LEU M CD2 1 
ATOM   2798  N N   . THR B 1 92  ? 36.289  -15.574 45.487  1.00 110.66 ? 111 THR M N   1 
ATOM   2799  C CA  . THR B 1 92  ? 35.526  -14.337 45.429  1.00 110.21 ? 111 THR M CA  1 
ATOM   2800  C C   . THR B 1 92  ? 35.473  -13.729 46.820  1.00 106.70 ? 111 THR M C   1 
ATOM   2801  O O   . THR B 1 92  ? 35.222  -14.436 47.802  1.00 105.95 ? 111 THR M O   1 
ATOM   2802  C CB  . THR B 1 92  ? 34.109  -14.572 44.897  1.00 110.05 ? 111 THR M CB  1 
ATOM   2803  O OG1 . THR B 1 92  ? 33.618  -15.825 45.387  1.00 108.56 ? 111 THR M OG1 1 
ATOM   2804  C CG2 . THR B 1 92  ? 34.102  -14.576 43.371  1.00 107.59 ? 111 THR M CG2 1 
ATOM   2805  N N   . CYS B 1 93  ? 35.712  -12.424 46.899  1.00 103.34 ? 112 CYS M N   1 
ATOM   2806  C CA  . CYS B 1 93  ? 35.754  -11.703 48.160  1.00 108.00 ? 112 CYS M CA  1 
ATOM   2807  C C   . CYS B 1 93  ? 34.762  -10.550 48.130  1.00 104.61 ? 112 CYS M C   1 
ATOM   2808  O O   . CYS B 1 93  ? 34.606  -9.878  47.105  1.00 107.71 ? 112 CYS M O   1 
ATOM   2809  C CB  . CYS B 1 93  ? 37.164  -11.180 48.447  1.00 110.59 ? 112 CYS M CB  1 
ATOM   2810  S SG  . CYS B 1 93  ? 38.396  -12.487 48.646  1.00 118.42 ? 112 CYS M SG  1 
ATOM   2811  N N   . TRP B 1 94  ? 34.098  -10.327 49.260  1.00 101.20 ? 113 TRP M N   1 
ATOM   2812  C CA  . TRP B 1 94  ? 33.079  -9.296  49.362  1.00 102.39 ? 113 TRP M CA  1 
ATOM   2813  C C   . TRP B 1 94  ? 32.990  -8.808  50.801  1.00 99.31  ? 113 TRP M C   1 
ATOM   2814  O O   . TRP B 1 94  ? 33.157  -9.585  51.746  1.00 98.56  ? 113 TRP M O   1 
ATOM   2815  C CB  . TRP B 1 94  ? 31.713  -9.810  48.883  1.00 103.71 ? 113 TRP M CB  1 
ATOM   2816  C CG  . TRP B 1 94  ? 31.052  -10.793 49.815  1.00 104.09 ? 113 TRP M CG  1 
ATOM   2817  C CD1 . TRP B 1 94  ? 29.977  -10.560 50.623  1.00 104.96 ? 113 TRP M CD1 1 
ATOM   2818  C CD2 . TRP B 1 94  ? 31.402  -12.172 50.005  1.00 100.93 ? 113 TRP M CD2 1 
ATOM   2819  N NE1 . TRP B 1 94  ? 29.648  -11.699 51.317  1.00 105.97 ? 113 TRP M NE1 1 
ATOM   2820  C CE2 . TRP B 1 94  ? 30.506  -12.703 50.955  1.00 100.27 ? 113 TRP M CE2 1 
ATOM   2821  C CE3 . TRP B 1 94  ? 32.389  -13.006 49.471  1.00 102.13 ? 113 TRP M CE3 1 
ATOM   2822  C CZ2 . TRP B 1 94  ? 30.568  -14.027 51.382  1.00 98.08  ? 113 TRP M CZ2 1 
ATOM   2823  C CZ3 . TRP B 1 94  ? 32.449  -14.320 49.898  1.00 103.36 ? 113 TRP M CZ3 1 
ATOM   2824  C CH2 . TRP B 1 94  ? 31.544  -14.817 50.842  1.00 100.83 ? 113 TRP M CH2 1 
ATOM   2825  N N   . ILE B 1 95  ? 32.746  -7.519  50.954  1.00 95.16  ? 114 ILE M N   1 
ATOM   2826  C CA  . ILE B 1 95  ? 32.509  -6.922  52.260  1.00 92.64  ? 114 ILE M CA  1 
ATOM   2827  C C   . ILE B 1 95  ? 31.013  -6.930  52.526  1.00 95.42  ? 114 ILE M C   1 
ATOM   2828  O O   . ILE B 1 95  ? 30.204  -6.690  51.623  1.00 101.20 ? 114 ILE M O   1 
ATOM   2829  C CB  . ILE B 1 95  ? 33.086  -5.497  52.325  1.00 90.24  ? 114 ILE M CB  1 
ATOM   2830  C CG1 . ILE B 1 95  ? 34.530  -5.499  51.825  1.00 90.51  ? 114 ILE M CG1 1 
ATOM   2831  C CG2 . ILE B 1 95  ? 33.001  -4.951  53.740  1.00 89.98  ? 114 ILE M CG2 1 
ATOM   2832  C CD1 . ILE B 1 95  ? 35.308  -4.284  52.220  1.00 91.97  ? 114 ILE M CD1 1 
ATOM   2833  N N   . HIS B 1 96  ? 30.643  -7.223  53.768  1.00 98.50  ? 115 HIS M N   1 
ATOM   2834  C CA  . HIS B 1 96  ? 29.251  -7.278  54.172  1.00 100.20 ? 115 HIS M CA  1 
ATOM   2835  C C   . HIS B 1 96  ? 29.121  -6.805  55.615  1.00 101.58 ? 115 HIS M C   1 
ATOM   2836  O O   . HIS B 1 96  ? 30.115  -6.623  56.341  1.00 100.80 ? 115 HIS M O   1 
ATOM   2837  C CB  . HIS B 1 96  ? 28.656  -8.684  53.979  1.00 101.88 ? 115 HIS M CB  1 
ATOM   2838  C CG  . HIS B 1 96  ? 29.301  -9.749  54.812  1.00 102.51 ? 115 HIS M CG  1 
ATOM   2839  N ND1 . HIS B 1 96  ? 28.610  -10.849 55.272  1.00 102.77 ? 115 HIS M ND1 1 
ATOM   2840  C CD2 . HIS B 1 96  ? 30.575  -9.899  55.243  1.00 103.71 ? 115 HIS M CD2 1 
ATOM   2841  C CE1 . HIS B 1 96  ? 29.427  -11.622 55.965  1.00 106.79 ? 115 HIS M CE1 1 
ATOM   2842  N NE2 . HIS B 1 96  ? 30.626  -11.067 55.963  1.00 107.74 ? 115 HIS M NE2 1 
ATOM   2843  N N   . ASP B 1 97  ? 27.858  -6.622  56.010  1.00 104.03 ? 116 ASP M N   1 
ATOM   2844  C CA  . ASP B 1 97  ? 27.459  -5.885  57.202  1.00 106.38 ? 116 ASP M CA  1 
ATOM   2845  C C   . ASP B 1 97  ? 28.019  -4.472  57.131  1.00 102.35 ? 116 ASP M C   1 
ATOM   2846  O O   . ASP B 1 97  ? 27.547  -3.663  56.326  1.00 110.26 ? 116 ASP M O   1 
ATOM   2847  C CB  . ASP B 1 97  ? 27.889  -6.634  58.458  1.00 108.32 ? 116 ASP M CB  1 
ATOM   2848  C CG  . ASP B 1 97  ? 27.288  -8.020  58.520  1.00 109.89 ? 116 ASP M CG  1 
ATOM   2849  O OD1 . ASP B 1 97  ? 27.670  -8.865  57.683  1.00 100.10 ? 116 ASP M OD1 1 
ATOM   2850  O OD2 . ASP B 1 97  ? 26.421  -8.261  59.387  1.00 122.18 ? 116 ASP M OD2 1 
ATOM   2851  N N   . VAL B 1 98  ? 29.020  -4.151  57.943  1.00 97.95  ? 117 VAL M N   1 
ATOM   2852  C CA  . VAL B 1 98  ? 29.640  -2.836  57.842  1.00 99.13  ? 117 VAL M CA  1 
ATOM   2853  C C   . VAL B 1 98  ? 31.145  -3.006  57.734  1.00 102.54 ? 117 VAL M C   1 
ATOM   2854  O O   . VAL B 1 98  ? 31.812  -2.303  56.966  1.00 100.02 ? 117 VAL M O   1 
ATOM   2855  C CB  . VAL B 1 98  ? 29.266  -1.942  59.038  1.00 98.52  ? 117 VAL M CB  1 
ATOM   2856  C CG1 . VAL B 1 98  ? 30.096  -0.669  59.030  1.00 98.43  ? 117 VAL M CG1 1 
ATOM   2857  C CG2 . VAL B 1 98  ? 27.787  -1.607  59.002  1.00 98.33  ? 117 VAL M CG2 1 
ATOM   2858  N N   . ASP B 1 99  ? 31.686  -3.960  58.487  1.00 107.93 ? 118 ASP M N   1 
ATOM   2859  C CA  . ASP B 1 99  ? 33.128  -4.115  58.610  1.00 110.58 ? 118 ASP M CA  1 
ATOM   2860  C C   . ASP B 1 99  ? 33.556  -5.576  58.515  1.00 107.74 ? 118 ASP M C   1 
ATOM   2861  O O   . ASP B 1 99  ? 34.564  -5.964  59.111  1.00 109.08 ? 118 ASP M O   1 
ATOM   2862  C CB  . ASP B 1 99  ? 33.622  -3.497  59.921  1.00 114.22 ? 118 ASP M CB  1 
ATOM   2863  C CG  . ASP B 1 99  ? 32.697  -3.793  61.097  1.00 115.42 ? 118 ASP M CG  1 
ATOM   2864  O OD1 . ASP B 1 99  ? 31.463  -3.698  60.928  1.00 111.78 ? 118 ASP M OD1 1 
ATOM   2865  O OD2 . ASP B 1 99  ? 33.202  -4.135  62.188  1.00 111.36 ? 118 ASP M OD2 1 
ATOM   2866  N N   . PHE B 1 100 ? 32.828  -6.403  57.761  1.00 102.28 ? 119 PHE M N   1 
ATOM   2867  C CA  . PHE B 1 100 ? 33.188  -7.813  57.647  1.00 103.40 ? 119 PHE M CA  1 
ATOM   2868  C C   . PHE B 1 100 ? 33.629  -8.108  56.218  1.00 102.00 ? 119 PHE M C   1 
ATOM   2869  O O   . PHE B 1 100 ? 32.816  -8.070  55.298  1.00 106.66 ? 119 PHE M O   1 
ATOM   2870  C CB  . PHE B 1 100 ? 32.016  -8.700  58.058  1.00 105.06 ? 119 PHE M CB  1 
ATOM   2871  C CG  . PHE B 1 100 ? 31.791  -8.758  59.542  1.00 104.42 ? 119 PHE M CG  1 
ATOM   2872  C CD1 . PHE B 1 100 ? 31.261  -7.673  60.221  1.00 104.06 ? 119 PHE M CD1 1 
ATOM   2873  C CD2 . PHE B 1 100 ? 32.112  -9.898  60.258  1.00 101.91 ? 119 PHE M CD2 1 
ATOM   2874  C CE1 . PHE B 1 100 ? 31.054  -7.726  61.585  1.00 103.49 ? 119 PHE M CE1 1 
ATOM   2875  C CE2 . PHE B 1 100 ? 31.908  -9.957  61.622  1.00 102.89 ? 119 PHE M CE2 1 
ATOM   2876  C CZ  . PHE B 1 100 ? 31.378  -8.870  62.287  1.00 104.37 ? 119 PHE M CZ  1 
ATOM   2877  N N   . LEU B 1 101 ? 34.908  -8.408  56.022  1.00 98.18  ? 120 LEU M N   1 
ATOM   2878  C CA  . LEU B 1 101 ? 35.396  -8.834  54.715  1.00 96.74  ? 120 LEU M CA  1 
ATOM   2879  C C   . LEU B 1 101 ? 35.468  -10.355 54.694  1.00 93.85  ? 120 LEU M C   1 
ATOM   2880  O O   . LEU B 1 101 ? 36.225  -10.951 55.467  1.00 99.56  ? 120 LEU M O   1 
ATOM   2881  C CB  . LEU B 1 101 ? 36.763  -8.230  54.398  1.00 96.83  ? 120 LEU M CB  1 
ATOM   2882  C CG  . LEU B 1 101 ? 37.423  -8.820  53.148  1.00 99.92  ? 120 LEU M CG  1 
ATOM   2883  C CD1 . LEU B 1 101 ? 36.520  -8.667  51.932  1.00 99.86  ? 120 LEU M CD1 1 
ATOM   2884  C CD2 . LEU B 1 101 ? 38.769  -8.177  52.889  1.00 101.31 ? 120 LEU M CD2 1 
ATOM   2885  N N   . SER B 1 102 ? 34.684  -10.981 53.817  1.00 98.34  ? 121 SER M N   1 
ATOM   2886  C CA  . SER B 1 102 ? 34.637  -12.432 53.707  1.00 100.43 ? 121 SER M CA  1 
ATOM   2887  C C   . SER B 1 102 ? 35.132  -12.862 52.335  1.00 101.70 ? 121 SER M C   1 
ATOM   2888  O O   . SER B 1 102 ? 34.842  -12.214 51.326  1.00 114.09 ? 121 SER M O   1 
ATOM   2889  C CB  . SER B 1 102 ? 33.217  -12.963 53.928  1.00 96.45  ? 121 SER M CB  1 
ATOM   2890  O OG  . SER B 1 102 ? 32.613  -12.363 55.058  1.00 98.14  ? 121 SER M OG  1 
ATOM   2891  N N   . CYS B 1 103 ? 35.870  -13.965 52.298  1.00 105.24 ? 122 CYS M N   1 
ATOM   2892  C CA  . CYS B 1 103 ? 36.312  -14.561 51.049  1.00 106.48 ? 122 CYS M CA  1 
ATOM   2893  C C   . CYS B 1 103 ? 35.873  -16.015 51.012  1.00 106.82 ? 122 CYS M C   1 
ATOM   2894  O O   . CYS B 1 103 ? 35.762  -16.670 52.051  1.00 112.38 ? 122 CYS M O   1 
ATOM   2895  C CB  . CYS B 1 103 ? 37.834  -14.472 50.882  1.00 112.43 ? 122 CYS M CB  1 
ATOM   2896  S SG  . CYS B 1 103 ? 38.465  -12.795 50.656  1.00 122.08 ? 122 CYS M SG  1 
ATOM   2897  N N   . SER B 1 104 ? 35.620  -16.517 49.807  1.00 109.91 ? 123 SER M N   1 
ATOM   2898  C CA  . SER B 1 104 ? 35.247  -17.916 49.648  1.00 112.01 ? 123 SER M CA  1 
ATOM   2899  C C   . SER B 1 104 ? 35.807  -18.431 48.333  1.00 114.90 ? 123 SER M C   1 
ATOM   2900  O O   . SER B 1 104 ? 35.692  -17.763 47.301  1.00 120.58 ? 123 SER M O   1 
ATOM   2901  C CB  . SER B 1 104 ? 33.725  -18.100 49.694  1.00 106.67 ? 123 SER M CB  1 
ATOM   2902  O OG  . SER B 1 104 ? 33.122  -17.746 48.462  1.00 105.52 ? 123 SER M OG  1 
ATOM   2903  N N   . TRP B 1 105 ? 36.420  -19.613 48.380  1.00 121.80 ? 124 TRP M N   1 
ATOM   2904  C CA  . TRP B 1 105 ? 36.930  -20.259 47.179  1.00 121.40 ? 124 TRP M CA  1 
ATOM   2905  C C   . TRP B 1 105 ? 36.515  -21.724 47.159  1.00 122.32 ? 124 TRP M C   1 
ATOM   2906  O O   . TRP B 1 105 ? 35.691  -22.151 47.973  1.00 120.15 ? 124 TRP M O   1 
ATOM   2907  C CB  . TRP B 1 105 ? 38.453  -20.127 47.095  1.00 120.71 ? 124 TRP M CB  1 
ATOM   2908  C CG  . TRP B 1 105 ? 39.184  -20.653 48.294  1.00 120.51 ? 124 TRP M CG  1 
ATOM   2909  C CD1 . TRP B 1 105 ? 39.760  -21.883 48.427  1.00 122.17 ? 124 TRP M CD1 1 
ATOM   2910  C CD2 . TRP B 1 105 ? 39.433  -19.960 49.524  1.00 121.20 ? 124 TRP M CD2 1 
ATOM   2911  N NE1 . TRP B 1 105 ? 40.346  -22.001 49.664  1.00 125.60 ? 124 TRP M NE1 1 
ATOM   2912  C CE2 . TRP B 1 105 ? 40.159  -20.834 50.357  1.00 122.00 ? 124 TRP M CE2 1 
ATOM   2913  C CE3 . TRP B 1 105 ? 39.110  -18.687 50.003  1.00 121.39 ? 124 TRP M CE3 1 
ATOM   2914  C CZ2 . TRP B 1 105 ? 40.566  -20.477 51.640  1.00 121.90 ? 124 TRP M CZ2 1 
ATOM   2915  C CZ3 . TRP B 1 105 ? 39.514  -18.335 51.278  1.00 118.38 ? 124 TRP M CZ3 1 
ATOM   2916  C CH2 . TRP B 1 105 ? 40.235  -19.226 52.081  1.00 118.78 ? 124 TRP M CH2 1 
ATOM   2917  N N   . ALA B 1 106 ? 37.070  -22.498 46.230  1.00 128.07 ? 125 ALA M N   1 
ATOM   2918  C CA  . ALA B 1 106 ? 36.797  -23.923 46.133  1.00 127.19 ? 125 ALA M CA  1 
ATOM   2919  C C   . ALA B 1 106 ? 38.114  -24.675 46.014  1.00 132.39 ? 125 ALA M C   1 
ATOM   2920  O O   . ALA B 1 106 ? 39.018  -24.249 45.289  1.00 130.26 ? 125 ALA M O   1 
ATOM   2921  C CB  . ALA B 1 106 ? 35.893  -24.242 44.935  1.00 123.90 ? 125 ALA M CB  1 
ATOM   2922  N N   . VAL B 1 107 ? 38.218  -25.791 46.738  1.00 136.96 ? 126 VAL M N   1 
ATOM   2923  C CA  . VAL B 1 107 ? 39.447  -26.577 46.741  1.00 135.78 ? 126 VAL M CA  1 
ATOM   2924  C C   . VAL B 1 107 ? 39.693  -27.140 45.348  1.00 131.39 ? 126 VAL M C   1 
ATOM   2925  O O   . VAL B 1 107 ? 38.781  -27.680 44.708  1.00 130.55 ? 126 VAL M O   1 
ATOM   2926  C CB  . VAL B 1 107 ? 39.370  -27.690 47.797  1.00 136.09 ? 126 VAL M CB  1 
ATOM   2927  C CG1 . VAL B 1 107 ? 38.039  -28.429 47.708  1.00 132.30 ? 126 VAL M CG1 1 
ATOM   2928  C CG2 . VAL B 1 107 ? 40.537  -28.654 47.645  1.00 138.06 ? 126 VAL M CG2 1 
ATOM   2929  N N   . GLY B 1 108 ? 40.929  -27.001 44.867  1.00 134.64 ? 127 GLY M N   1 
ATOM   2930  C CA  . GLY B 1 108 ? 41.297  -27.434 43.539  1.00 138.30 ? 127 GLY M CA  1 
ATOM   2931  C C   . GLY B 1 108 ? 41.000  -28.899 43.292  1.00 141.45 ? 127 GLY M C   1 
ATOM   2932  O O   . GLY B 1 108 ? 41.161  -29.746 44.176  1.00 152.29 ? 127 GLY M O   1 
ATOM   2933  N N   . PRO B 1 109 ? 40.556  -29.224 42.073  1.00 142.33 ? 128 PRO M N   1 
ATOM   2934  C CA  . PRO B 1 109 ? 40.170  -30.618 41.796  1.00 141.57 ? 128 PRO M CA  1 
ATOM   2935  C C   . PRO B 1 109 ? 41.342  -31.583 41.797  1.00 145.68 ? 128 PRO M C   1 
ATOM   2936  O O   . PRO B 1 109 ? 41.217  -32.700 42.314  1.00 145.74 ? 128 PRO M O   1 
ATOM   2937  C CB  . PRO B 1 109 ? 39.504  -30.523 40.416  1.00 135.82 ? 128 PRO M CB  1 
ATOM   2938  C CG  . PRO B 1 109 ? 40.132  -29.328 39.782  1.00 136.05 ? 128 PRO M CG  1 
ATOM   2939  C CD  . PRO B 1 109 ? 40.377  -28.352 40.899  1.00 139.08 ? 128 PRO M CD  1 
ATOM   2940  N N   . GLY B 1 110 ? 42.480  -31.188 41.232  1.00 148.94 ? 129 GLY M N   1 
ATOM   2941  C CA  . GLY B 1 110 ? 43.643  -32.052 41.203  1.00 148.95 ? 129 GLY M CA  1 
ATOM   2942  C C   . GLY B 1 110 ? 44.557  -31.860 42.396  1.00 148.58 ? 129 GLY M C   1 
ATOM   2943  O O   . GLY B 1 110 ? 45.780  -31.788 42.246  1.00 152.40 ? 129 GLY M O   1 
ATOM   2944  N N   . ALA B 1 111 ? 43.973  -31.771 43.588  1.00 145.36 ? 130 ALA M N   1 
ATOM   2945  C CA  . ALA B 1 111 ? 44.729  -31.585 44.812  1.00 149.61 ? 130 ALA M CA  1 
ATOM   2946  C C   . ALA B 1 111 ? 44.493  -32.755 45.760  1.00 150.15 ? 130 ALA M C   1 
ATOM   2947  O O   . ALA B 1 111 ? 43.401  -33.334 45.776  1.00 141.94 ? 130 ALA M O   1 
ATOM   2948  C CB  . ALA B 1 111 ? 44.342  -30.276 45.512  1.00 148.60 ? 130 ALA M CB  1 
ATOM   2949  N N   . PRO B 1 112 ? 45.493  -33.132 46.551  1.00 148.33 ? 131 PRO M N   1 
ATOM   2950  C CA  . PRO B 1 112 ? 45.297  -34.218 47.515  1.00 151.54 ? 131 PRO M CA  1 
ATOM   2951  C C   . PRO B 1 112 ? 44.416  -33.776 48.672  1.00 156.75 ? 131 PRO M C   1 
ATOM   2952  O O   . PRO B 1 112 ? 44.178  -32.587 48.893  1.00 167.19 ? 131 PRO M O   1 
ATOM   2953  C CB  . PRO B 1 112 ? 46.719  -34.529 47.994  1.00 146.14 ? 131 PRO M CB  1 
ATOM   2954  C CG  . PRO B 1 112 ? 47.450  -33.237 47.823  1.00 142.49 ? 131 PRO M CG  1 
ATOM   2955  C CD  . PRO B 1 112 ? 46.869  -32.605 46.585  1.00 144.21 ? 131 PRO M CD  1 
ATOM   2956  N N   . ALA B 1 113 ? 43.925  -34.765 49.424  1.00 153.72 ? 132 ALA M N   1 
ATOM   2957  C CA  . ALA B 1 113 ? 43.289  -34.461 50.700  1.00 150.27 ? 132 ALA M CA  1 
ATOM   2958  C C   . ALA B 1 113 ? 44.281  -33.890 51.703  1.00 151.94 ? 132 ALA M C   1 
ATOM   2959  O O   . ALA B 1 113 ? 43.865  -33.392 52.755  1.00 148.77 ? 132 ALA M O   1 
ATOM   2960  C CB  . ALA B 1 113 ? 42.623  -35.714 51.272  1.00 143.71 ? 132 ALA M CB  1 
ATOM   2961  N N   . ASP B 1 114 ? 45.577  -33.952 51.390  1.00 150.30 ? 133 ASP M N   1 
ATOM   2962  C CA  . ASP B 1 114 ? 46.609  -33.383 52.250  1.00 152.41 ? 133 ASP M CA  1 
ATOM   2963  C C   . ASP B 1 114 ? 46.533  -31.860 52.277  1.00 154.30 ? 133 ASP M C   1 
ATOM   2964  O O   . ASP B 1 114 ? 46.743  -31.242 53.326  1.00 159.60 ? 133 ASP M O   1 
ATOM   2965  C CB  . ASP B 1 114 ? 47.982  -33.845 51.753  1.00 156.10 ? 133 ASP M CB  1 
ATOM   2966  C CG  . ASP B 1 114 ? 49.093  -33.631 52.767  1.00 155.64 ? 133 ASP M CG  1 
ATOM   2967  O OD1 . ASP B 1 114 ? 48.943  -32.789 53.676  1.00 157.34 ? 133 ASP M OD1 1 
ATOM   2968  O OD2 . ASP B 1 114 ? 50.136  -34.306 52.640  1.00 152.26 ? 133 ASP M OD2 1 
ATOM   2969  N N   . VAL B 1 115 ? 46.213  -31.244 51.135  1.00 156.07 ? 134 VAL M N   1 
ATOM   2970  C CA  . VAL B 1 115 ? 46.400  -29.807 50.975  1.00 147.55 ? 134 VAL M CA  1 
ATOM   2971  C C   . VAL B 1 115 ? 45.528  -29.018 51.951  1.00 145.65 ? 134 VAL M C   1 
ATOM   2972  O O   . VAL B 1 115 ? 44.411  -29.421 52.302  1.00 135.04 ? 134 VAL M O   1 
ATOM   2973  C CB  . VAL B 1 115 ? 46.113  -29.385 49.523  1.00 141.88 ? 134 VAL M CB  1 
ATOM   2974  C CG1 . VAL B 1 115 ? 44.625  -29.472 49.213  1.00 141.20 ? 134 VAL M CG1 1 
ATOM   2975  C CG2 . VAL B 1 115 ? 46.623  -27.978 49.263  1.00 138.19 ? 134 VAL M CG2 1 
ATOM   2976  N N   . GLN B 1 116 ? 46.065  -27.888 52.413  1.00 141.86 ? 135 GLN M N   1 
ATOM   2977  C CA  . GLN B 1 116 ? 45.289  -26.878 53.116  1.00 143.12 ? 135 GLN M CA  1 
ATOM   2978  C C   . GLN B 1 116 ? 45.766  -25.502 52.676  1.00 144.02 ? 135 GLN M C   1 
ATOM   2979  O O   . GLN B 1 116 ? 46.929  -25.320 52.307  1.00 140.41 ? 135 GLN M O   1 
ATOM   2980  C CB  . GLN B 1 116 ? 45.392  -27.009 54.641  1.00 145.51 ? 135 GLN M CB  1 
ATOM   2981  C CG  . GLN B 1 116 ? 44.106  -27.496 55.292  1.00 147.80 ? 135 GLN M CG  1 
ATOM   2982  C CD  . GLN B 1 116 ? 43.986  -27.079 56.745  1.00 150.04 ? 135 GLN M CD  1 
ATOM   2983  O OE1 . GLN B 1 116 ? 44.984  -26.971 57.458  1.00 153.35 ? 135 GLN M OE1 1 
ATOM   2984  N NE2 . GLN B 1 116 ? 42.757  -26.833 57.188  1.00 144.42 ? 135 GLN M NE2 1 
ATOM   2985  N N   . TYR B 1 117 ? 44.862  -24.530 52.725  1.00 143.21 ? 136 TYR M N   1 
ATOM   2986  C CA  . TYR B 1 117 ? 45.101  -23.217 52.146  1.00 131.92 ? 136 TYR M CA  1 
ATOM   2987  C C   . TYR B 1 117 ? 45.264  -22.163 53.232  1.00 130.36 ? 136 TYR M C   1 
ATOM   2988  O O   . TYR B 1 117 ? 44.531  -22.157 54.225  1.00 130.30 ? 136 TYR M O   1 
ATOM   2989  C CB  . TYR B 1 117 ? 43.958  -22.829 51.208  1.00 127.64 ? 136 TYR M CB  1 
ATOM   2990  C CG  . TYR B 1 117 ? 43.819  -23.745 50.016  1.00 127.57 ? 136 TYR M CG  1 
ATOM   2991  C CD1 . TYR B 1 117 ? 44.741  -23.712 48.980  1.00 130.34 ? 136 TYR M CD1 1 
ATOM   2992  C CD2 . TYR B 1 117 ? 42.762  -24.641 49.925  1.00 124.19 ? 136 TYR M CD2 1 
ATOM   2993  C CE1 . TYR B 1 117 ? 44.618  -24.548 47.887  1.00 131.12 ? 136 TYR M CE1 1 
ATOM   2994  C CE2 . TYR B 1 117 ? 42.629  -25.480 48.837  1.00 125.38 ? 136 TYR M CE2 1 
ATOM   2995  C CZ  . TYR B 1 117 ? 43.559  -25.429 47.821  1.00 129.11 ? 136 TYR M CZ  1 
ATOM   2996  O OH  . TYR B 1 117 ? 43.429  -26.264 46.735  1.00 131.59 ? 136 TYR M OH  1 
ATOM   2997  N N   . ASP B 1 118 ? 46.231  -21.273 53.030  1.00 122.87 ? 137 ASP M N   1 
ATOM   2998  C CA  . ASP B 1 118 ? 46.454  -20.117 53.890  1.00 128.29 ? 137 ASP M CA  1 
ATOM   2999  C C   . ASP B 1 118 ? 46.180  -18.843 53.103  1.00 124.62 ? 137 ASP M C   1 
ATOM   3000  O O   . ASP B 1 118 ? 46.735  -18.652 52.015  1.00 127.77 ? 137 ASP M O   1 
ATOM   3001  C CB  . ASP B 1 118 ? 47.884  -20.095 54.436  1.00 132.92 ? 137 ASP M CB  1 
ATOM   3002  C CG  . ASP B 1 118 ? 48.101  -21.100 55.548  1.00 136.50 ? 137 ASP M CG  1 
ATOM   3003  O OD1 . ASP B 1 118 ? 47.211  -21.227 56.415  1.00 132.21 ? 137 ASP M OD1 1 
ATOM   3004  O OD2 . ASP B 1 118 ? 49.165  -21.755 55.563  1.00 139.45 ? 137 ASP M OD2 1 
ATOM   3005  N N   . LEU B 1 119 ? 45.339  -17.973 53.657  1.00 121.52 ? 138 LEU M N   1 
ATOM   3006  C CA  . LEU B 1 119 ? 44.977  -16.717 53.013  1.00 119.02 ? 138 LEU M CA  1 
ATOM   3007  C C   . LEU B 1 119 ? 45.761  -15.573 53.644  1.00 120.89 ? 138 LEU M C   1 
ATOM   3008  O O   . LEU B 1 119 ? 45.866  -15.483 54.872  1.00 120.78 ? 138 LEU M O   1 
ATOM   3009  C CB  . LEU B 1 119 ? 43.471  -16.461 53.120  1.00 115.87 ? 138 LEU M CB  1 
ATOM   3010  C CG  . LEU B 1 119 ? 42.868  -15.256 52.389  1.00 111.48 ? 138 LEU M CG  1 
ATOM   3011  C CD1 . LEU B 1 119 ? 41.424  -15.536 52.018  1.00 109.51 ? 138 LEU M CD1 1 
ATOM   3012  C CD2 . LEU B 1 119 ? 42.952  -13.989 53.226  1.00 110.80 ? 138 LEU M CD2 1 
ATOM   3013  N N   . TYR B 1 120 ? 46.299  -14.699 52.797  1.00 116.55 ? 139 TYR M N   1 
ATOM   3014  C CA  . TYR B 1 120 ? 47.058  -13.531 53.218  1.00 118.40 ? 139 TYR M CA  1 
ATOM   3015  C C   . TYR B 1 120 ? 46.536  -12.309 52.477  1.00 113.67 ? 139 TYR M C   1 
ATOM   3016  O O   . TYR B 1 120 ? 46.347  -12.347 51.256  1.00 111.69 ? 139 TYR M O   1 
ATOM   3017  C CB  . TYR B 1 120 ? 48.558  -13.720 52.956  1.00 123.94 ? 139 TYR M CB  1 
ATOM   3018  C CG  . TYR B 1 120 ? 49.158  -14.927 53.646  1.00 127.70 ? 139 TYR M CG  1 
ATOM   3019  C CD1 . TYR B 1 120 ? 49.400  -14.920 55.014  1.00 131.15 ? 139 TYR M CD1 1 
ATOM   3020  C CD2 . TYR B 1 120 ? 49.484  -16.072 52.930  1.00 130.98 ? 139 TYR M CD2 1 
ATOM   3021  C CE1 . TYR B 1 120 ? 49.950  -16.022 55.650  1.00 134.72 ? 139 TYR M CE1 1 
ATOM   3022  C CE2 . TYR B 1 120 ? 50.033  -17.180 53.558  1.00 132.01 ? 139 TYR M CE2 1 
ATOM   3023  C CZ  . TYR B 1 120 ? 50.264  -17.148 54.918  1.00 132.15 ? 139 TYR M CZ  1 
ATOM   3024  O OH  . TYR B 1 120 ? 50.810  -18.242 55.551  1.00 123.27 ? 139 TYR M OH  1 
ATOM   3025  N N   . LEU B 1 121 ? 46.310  -11.231 53.217  1.00 111.03 ? 140 LEU M N   1 
ATOM   3026  C CA  . LEU B 1 121 ? 45.769  -9.991  52.682  1.00 111.43 ? 140 LEU M CA  1 
ATOM   3027  C C   . LEU B 1 121 ? 46.834  -8.906  52.770  1.00 111.28 ? 140 LEU M C   1 
ATOM   3028  O O   . LEU B 1 121 ? 47.454  -8.723  53.823  1.00 118.35 ? 140 LEU M O   1 
ATOM   3029  C CB  . LEU B 1 121 ? 44.510  -9.582  53.452  1.00 114.25 ? 140 LEU M CB  1 
ATOM   3030  C CG  . LEU B 1 121 ? 43.649  -8.391  53.022  1.00 117.21 ? 140 LEU M CG  1 
ATOM   3031  C CD1 . LEU B 1 121 ? 42.277  -8.528  53.646  1.00 121.05 ? 140 LEU M CD1 1 
ATOM   3032  C CD2 . LEU B 1 121 ? 44.260  -7.052  53.414  1.00 114.85 ? 140 LEU M CD2 1 
ATOM   3033  N N   . ASN B 1 122 ? 47.037  -8.186  51.670  1.00 115.50 ? 141 ASN M N   1 
ATOM   3034  C CA  . ASN B 1 122 ? 47.946  -7.054  51.626  1.00 115.66 ? 141 ASN M CA  1 
ATOM   3035  C C   . ASN B 1 122 ? 47.162  -5.801  51.267  1.00 113.33 ? 141 ASN M C   1 
ATOM   3036  O O   . ASN B 1 122 ? 46.212  -5.850  50.482  1.00 114.32 ? 141 ASN M O   1 
ATOM   3037  C CB  . ASN B 1 122 ? 49.073  -7.274  50.604  1.00 114.89 ? 141 ASN M CB  1 
ATOM   3038  C CG  . ASN B 1 122 ? 49.782  -8.602  50.789  1.00 113.28 ? 141 ASN M CG  1 
ATOM   3039  O OD1 . ASN B 1 122 ? 50.876  -8.659  51.349  1.00 117.80 ? 141 ASN M OD1 1 
ATOM   3040  N ND2 . ASN B 1 122 ? 49.170  -9.677  50.303  1.00 108.02 ? 141 ASN M ND2 1 
ATOM   3041  N N   . VAL B 1 123 ? 47.561  -4.678  51.848  1.00 114.89 ? 142 VAL M N   1 
ATOM   3042  C CA  . VAL B 1 123 ? 46.920  -3.401  51.579  1.00 117.68 ? 142 VAL M CA  1 
ATOM   3043  C C   . VAL B 1 123 ? 47.850  -2.543  50.730  1.00 124.89 ? 142 VAL M C   1 
ATOM   3044  O O   . VAL B 1 123 ? 49.074  -2.711  50.729  1.00 127.80 ? 142 VAL M O   1 
ATOM   3045  C CB  . VAL B 1 123 ? 46.521  -2.685  52.881  1.00 118.22 ? 142 VAL M CB  1 
ATOM   3046  C CG1 . VAL B 1 123 ? 45.351  -3.402  53.529  1.00 117.37 ? 142 VAL M CG1 1 
ATOM   3047  C CG2 . VAL B 1 123 ? 47.688  -2.677  53.827  1.00 119.87 ? 142 VAL M CG2 1 
ATOM   3048  N N   . ALA B 1 124 ? 47.246  -1.603  49.998  1.00 128.19 ? 143 ALA M N   1 
ATOM   3049  C CA  . ALA B 1 124 ? 47.971  -0.868  48.963  1.00 130.34 ? 143 ALA M CA  1 
ATOM   3050  C C   . ALA B 1 124 ? 49.085  -0.009  49.552  1.00 131.76 ? 143 ALA M C   1 
ATOM   3051  O O   . ALA B 1 124 ? 50.268  -0.226  49.268  1.00 129.68 ? 143 ALA M O   1 
ATOM   3052  C CB  . ALA B 1 124 ? 46.994  -0.008  48.159  1.00 129.66 ? 143 ALA M CB  1 
ATOM   3053  N N   . ASN B 1 125 ? 48.727  0.979   50.374  1.00 134.29 ? 144 ASN M N   1 
ATOM   3054  C CA  . ASN B 1 125 ? 49.723  1.930   50.857  1.00 135.23 ? 144 ASN M CA  1 
ATOM   3055  C C   . ASN B 1 125 ? 50.500  1.389   52.051  1.00 131.47 ? 144 ASN M C   1 
ATOM   3056  O O   . ASN B 1 125 ? 51.718  1.582   52.139  1.00 128.13 ? 144 ASN M O   1 
ATOM   3057  C CB  . ASN B 1 125 ? 49.051  3.257   51.215  1.00 135.86 ? 144 ASN M CB  1 
ATOM   3058  C CG  . ASN B 1 125 ? 48.330  3.883   50.035  1.00 127.44 ? 144 ASN M CG  1 
ATOM   3059  O OD1 . ASN B 1 125 ? 48.909  4.062   48.963  1.00 123.08 ? 144 ASN M OD1 1 
ATOM   3060  N ND2 . ASN B 1 125 ? 47.059  4.220   50.228  1.00 116.63 ? 144 ASN M ND2 1 
ATOM   3061  N N   . ARG B 1 126 ? 49.822  0.713   52.973  1.00 130.43 ? 145 ARG M N   1 
ATOM   3062  C CA  . ARG B 1 126 ? 50.466  0.251   54.193  1.00 133.55 ? 145 ARG M CA  1 
ATOM   3063  C C   . ARG B 1 126 ? 51.338  -0.970  53.920  1.00 135.79 ? 145 ARG M C   1 
ATOM   3064  O O   . ARG B 1 126 ? 51.065  -1.772  53.021  1.00 130.51 ? 145 ARG M O   1 
ATOM   3065  C CB  . ARG B 1 126 ? 49.419  -0.078  55.256  1.00 133.48 ? 145 ARG M CB  1 
ATOM   3066  C CG  . ARG B 1 126 ? 48.283  0.928   55.327  1.00 133.47 ? 145 ARG M CG  1 
ATOM   3067  C CD  . ARG B 1 126 ? 47.259  0.527   56.374  1.00 135.02 ? 145 ARG M CD  1 
ATOM   3068  N NE  . ARG B 1 126 ? 46.770  1.680   57.123  1.00 138.81 ? 145 ARG M NE  1 
ATOM   3069  C CZ  . ARG B 1 126 ? 47.410  2.227   58.152  1.00 143.57 ? 145 ARG M CZ  1 
ATOM   3070  N NH1 . ARG B 1 126 ? 48.568  1.723   58.560  1.00 148.47 ? 145 ARG M NH1 1 
ATOM   3071  N NH2 . ARG B 1 126 ? 46.893  3.278   58.777  1.00 146.64 ? 145 ARG M NH2 1 
ATOM   3072  N N   . ARG B 1 127 ? 52.394  -1.106  54.718  1.00 138.07 ? 146 ARG M N   1 
ATOM   3073  C CA  . ARG B 1 127 ? 53.395  -2.150  54.540  1.00 138.34 ? 146 ARG M CA  1 
ATOM   3074  C C   . ARG B 1 127 ? 53.032  -3.461  55.228  1.00 130.63 ? 146 ARG M C   1 
ATOM   3075  O O   . ARG B 1 127 ? 53.769  -4.441  55.084  1.00 125.81 ? 146 ARG M O   1 
ATOM   3076  C CB  . ARG B 1 127 ? 54.751  -1.665  55.064  1.00 143.83 ? 146 ARG M CB  1 
ATOM   3077  C CG  . ARG B 1 127 ? 55.179  -0.296  54.551  1.00 142.23 ? 146 ARG M CG  1 
ATOM   3078  C CD  . ARG B 1 127 ? 55.627  -0.357  53.097  1.00 141.25 ? 146 ARG M CD  1 
ATOM   3079  N NE  . ARG B 1 127 ? 56.701  -1.329  52.891  1.00 144.53 ? 146 ARG M NE  1 
ATOM   3080  C CZ  . ARG B 1 127 ? 57.958  -1.168  53.298  1.00 143.49 ? 146 ARG M CZ  1 
ATOM   3081  N NH1 . ARG B 1 127 ? 58.322  -0.067  53.943  1.00 144.47 ? 146 ARG M NH1 1 
ATOM   3082  N NH2 . ARG B 1 127 ? 58.857  -2.114  53.060  1.00 136.04 ? 146 ARG M NH2 1 
ATOM   3083  N N   . GLN B 1 128 ? 51.927  -3.506  55.966  1.00 124.53 ? 147 GLN M N   1 
ATOM   3084  C CA  . GLN B 1 128 ? 51.585  -4.686  56.745  1.00 122.27 ? 147 GLN M CA  1 
ATOM   3085  C C   . GLN B 1 128 ? 50.844  -5.716  55.900  1.00 120.95 ? 147 GLN M C   1 
ATOM   3086  O O   . GLN B 1 128 ? 50.053  -5.371  55.017  1.00 121.45 ? 147 GLN M O   1 
ATOM   3087  C CB  . GLN B 1 128 ? 50.731  -4.291  57.952  1.00 120.68 ? 147 GLN M CB  1 
ATOM   3088  C CG  . GLN B 1 128 ? 50.396  -5.439  58.895  1.00 126.17 ? 147 GLN M CG  1 
ATOM   3089  C CD  . GLN B 1 128 ? 51.581  -5.883  59.729  1.00 130.86 ? 147 GLN M CD  1 
ATOM   3090  O OE1 . GLN B 1 128 ? 52.570  -5.163  59.859  1.00 140.24 ? 147 GLN M OE1 1 
ATOM   3091  N NE2 . GLN B 1 128 ? 51.485  -7.079  60.301  1.00 123.53 ? 147 GLN M NE2 1 
ATOM   3092  N N   . GLN B 1 129 ? 51.119  -6.988  56.171  1.00 120.03 ? 148 GLN M N   1 
ATOM   3093  C CA  . GLN B 1 129 ? 50.358  -8.106  55.635  1.00 118.91 ? 148 GLN M CA  1 
ATOM   3094  C C   . GLN B 1 129 ? 49.636  -8.800  56.782  1.00 118.60 ? 148 GLN M C   1 
ATOM   3095  O O   . GLN B 1 129 ? 50.183  -8.926  57.882  1.00 123.16 ? 148 GLN M O   1 
ATOM   3096  C CB  . GLN B 1 129 ? 51.270  -9.098  54.906  1.00 118.14 ? 148 GLN M CB  1 
ATOM   3097  C CG  . GLN B 1 129 ? 50.615  -10.427 54.561  1.00 117.83 ? 148 GLN M CG  1 
ATOM   3098  C CD  . GLN B 1 129 ? 51.561  -11.380 53.859  1.00 118.01 ? 148 GLN M CD  1 
ATOM   3099  O OE1 . GLN B 1 129 ? 52.248  -11.006 52.910  1.00 118.79 ? 148 GLN M OE1 1 
ATOM   3100  N NE2 . GLN B 1 129 ? 51.601  -12.622 54.326  1.00 119.85 ? 148 GLN M NE2 1 
ATOM   3101  N N   . TYR B 1 130 ? 48.407  -9.241  56.532  1.00 116.12 ? 149 TYR M N   1 
ATOM   3102  C CA  . TYR B 1 130 ? 47.588  -9.862  57.559  1.00 117.93 ? 149 TYR M CA  1 
ATOM   3103  C C   . TYR B 1 130 ? 47.231  -11.285 57.152  1.00 119.34 ? 149 TYR M C   1 
ATOM   3104  O O   . TYR B 1 130 ? 47.079  -11.589 55.967  1.00 118.95 ? 149 TYR M O   1 
ATOM   3105  C CB  . TYR B 1 130 ? 46.312  -9.053  57.812  1.00 116.04 ? 149 TYR M CB  1 
ATOM   3106  C CG  . TYR B 1 130 ? 46.573  -7.599  58.140  1.00 116.36 ? 149 TYR M CG  1 
ATOM   3107  C CD1 . TYR B 1 130 ? 46.731  -6.657  57.130  1.00 114.10 ? 149 TYR M CD1 1 
ATOM   3108  C CD2 . TYR B 1 130 ? 46.660  -7.168  59.456  1.00 118.37 ? 149 TYR M CD2 1 
ATOM   3109  C CE1 . TYR B 1 130 ? 46.971  -5.329  57.423  1.00 116.66 ? 149 TYR M CE1 1 
ATOM   3110  C CE2 . TYR B 1 130 ? 46.898  -5.840  59.759  1.00 119.74 ? 149 TYR M CE2 1 
ATOM   3111  C CZ  . TYR B 1 130 ? 47.052  -4.925  58.738  1.00 117.50 ? 149 TYR M CZ  1 
ATOM   3112  O OH  . TYR B 1 130 ? 47.290  -3.602  59.033  1.00 114.83 ? 149 TYR M OH  1 
ATOM   3113  N N   . GLU B 1 131 ? 47.109  -12.159 58.144  1.00 122.62 ? 150 GLU M N   1 
ATOM   3114  C CA  . GLU B 1 131 ? 46.727  -13.545 57.925  1.00 122.60 ? 150 GLU M CA  1 
ATOM   3115  C C   . GLU B 1 131 ? 45.322  -13.773 58.462  1.00 117.57 ? 150 GLU M C   1 
ATOM   3116  O O   . GLU B 1 131 ? 44.958  -13.244 59.517  1.00 117.14 ? 150 GLU M O   1 
ATOM   3117  C CB  . GLU B 1 131 ? 47.712  -14.505 58.601  1.00 129.69 ? 150 GLU M CB  1 
ATOM   3118  C CG  . GLU B 1 131 ? 47.324  -15.974 58.496  1.00 133.30 ? 150 GLU M CG  1 
ATOM   3119  C CD  . GLU B 1 131 ? 48.474  -16.910 58.815  1.00 132.81 ? 150 GLU M CD  1 
ATOM   3120  O OE1 . GLU B 1 131 ? 49.565  -16.414 59.170  1.00 130.88 ? 150 GLU M OE1 1 
ATOM   3121  O OE2 . GLU B 1 131 ? 48.286  -18.141 58.712  1.00 126.18 ? 150 GLU M OE2 1 
ATOM   3122  N N   . CYS B 1 132 ? 44.531  -14.549 57.724  1.00 113.87 ? 151 CYS M N   1 
ATOM   3123  C CA  . CYS B 1 132 ? 43.185  -14.873 58.174  1.00 115.40 ? 151 CYS M CA  1 
ATOM   3124  C C   . CYS B 1 132 ? 43.235  -15.676 59.466  1.00 115.33 ? 151 CYS M C   1 
ATOM   3125  O O   . CYS B 1 132 ? 44.046  -16.594 59.618  1.00 118.39 ? 151 CYS M O   1 
ATOM   3126  C CB  . CYS B 1 132 ? 42.435  -15.659 57.100  1.00 118.35 ? 151 CYS M CB  1 
ATOM   3127  S SG  . CYS B 1 132 ? 40.705  -15.984 57.516  1.00 124.63 ? 151 CYS M SG  1 
ATOM   3128  N N   . LEU B 1 133 ? 42.360  -15.322 60.403  1.00 117.38 ? 152 LEU M N   1 
ATOM   3129  C CA  . LEU B 1 133 ? 42.271  -16.012 61.682  1.00 115.48 ? 152 LEU M CA  1 
ATOM   3130  C C   . LEU B 1 133 ? 41.057  -16.922 61.776  1.00 113.60 ? 152 LEU M C   1 
ATOM   3131  O O   . LEU B 1 133 ? 41.158  -18.030 62.313  1.00 122.52 ? 152 LEU M O   1 
ATOM   3132  C CB  . LEU B 1 133 ? 42.233  -14.998 62.831  1.00 118.70 ? 152 LEU M CB  1 
ATOM   3133  C CG  . LEU B 1 133 ? 43.359  -13.964 62.920  1.00 118.47 ? 152 LEU M CG  1 
ATOM   3134  C CD1 . LEU B 1 133 ? 43.298  -13.212 64.243  1.00 116.03 ? 152 LEU M CD1 1 
ATOM   3135  C CD2 . LEU B 1 133 ? 44.717  -14.624 62.740  1.00 116.43 ? 152 LEU M CD2 1 
ATOM   3136  N N   . HIS B 1 134 ? 39.913  -16.486 61.254  1.00 113.30 ? 153 HIS M N   1 
ATOM   3137  C CA  . HIS B 1 134 ? 38.651  -17.208 61.383  1.00 117.99 ? 153 HIS M CA  1 
ATOM   3138  C C   . HIS B 1 134 ? 38.322  -17.853 60.038  1.00 113.95 ? 153 HIS M C   1 
ATOM   3139  O O   . HIS B 1 134 ? 37.522  -17.338 59.257  1.00 114.99 ? 153 HIS M O   1 
ATOM   3140  C CB  . HIS B 1 134 ? 37.527  -16.263 61.851  1.00 125.34 ? 153 HIS M CB  1 
ATOM   3141  C CG  . HIS B 1 134 ? 37.761  -15.655 63.201  1.00 132.74 ? 153 HIS M CG  1 
ATOM   3142  N ND1 . HIS B 1 134 ? 38.979  -15.139 63.592  1.00 132.53 ? 153 HIS M ND1 1 
ATOM   3143  C CD2 . HIS B 1 134 ? 36.927  -15.481 64.254  1.00 132.26 ? 153 HIS M CD2 1 
ATOM   3144  C CE1 . HIS B 1 134 ? 38.884  -14.673 64.825  1.00 130.31 ? 153 HIS M CE1 1 
ATOM   3145  N NE2 . HIS B 1 134 ? 37.649  -14.870 65.250  1.00 131.64 ? 153 HIS M NE2 1 
ATOM   3146  N N   . TYR B 1 135 ? 38.946  -18.999 59.775  1.00 122.30 ? 154 TYR M N   1 
ATOM   3147  C CA  . TYR B 1 135 ? 38.666  -19.739 58.554  1.00 122.11 ? 154 TYR M CA  1 
ATOM   3148  C C   . TYR B 1 135 ? 37.324  -20.460 58.653  1.00 121.13 ? 154 TYR M C   1 
ATOM   3149  O O   . TYR B 1 135 ? 36.767  -20.654 59.737  1.00 121.00 ? 154 TYR M O   1 
ATOM   3150  C CB  . TYR B 1 135 ? 39.770  -20.761 58.265  1.00 118.26 ? 154 TYR M CB  1 
ATOM   3151  C CG  . TYR B 1 135 ? 41.098  -20.164 57.860  1.00 116.92 ? 154 TYR M CG  1 
ATOM   3152  C CD1 . TYR B 1 135 ? 41.362  -19.849 56.533  1.00 116.54 ? 154 TYR M CD1 1 
ATOM   3153  C CD2 . TYR B 1 135 ? 42.094  -19.936 58.798  1.00 119.10 ? 154 TYR M CD2 1 
ATOM   3154  C CE1 . TYR B 1 135 ? 42.576  -19.308 56.155  1.00 122.49 ? 154 TYR M CE1 1 
ATOM   3155  C CE2 . TYR B 1 135 ? 43.312  -19.397 58.431  1.00 123.23 ? 154 TYR M CE2 1 
ATOM   3156  C CZ  . TYR B 1 135 ? 43.549  -19.084 57.109  1.00 126.15 ? 154 TYR M CZ  1 
ATOM   3157  O OH  . TYR B 1 135 ? 44.764  -18.547 56.746  1.00 123.62 ? 154 TYR M OH  1 
ATOM   3158  N N   . LYS B 1 136 ? 36.806  -20.858 57.494  1.00 124.66 ? 155 LYS M N   1 
ATOM   3159  C CA  . LYS B 1 136 ? 35.628  -21.707 57.403  1.00 128.92 ? 155 LYS M CA  1 
ATOM   3160  C C   . LYS B 1 136 ? 36.042  -23.090 56.920  1.00 132.30 ? 155 LYS M C   1 
ATOM   3161  O O   . LYS B 1 136 ? 36.872  -23.218 56.012  1.00 130.46 ? 155 LYS M O   1 
ATOM   3162  C CB  . LYS B 1 136 ? 34.579  -21.108 56.462  1.00 130.37 ? 155 LYS M CB  1 
ATOM   3163  C CG  . LYS B 1 136 ? 33.413  -20.461 57.190  1.00 129.93 ? 155 LYS M CG  1 
ATOM   3164  C CD  . LYS B 1 136 ? 32.940  -19.200 56.486  1.00 129.77 ? 155 LYS M CD  1 
ATOM   3165  C CE  . LYS B 1 136 ? 32.253  -18.252 57.459  1.00 125.86 ? 155 LYS M CE  1 
ATOM   3166  N NZ  . LYS B 1 136 ? 31.969  -16.927 56.840  1.00 123.24 ? 155 LYS M NZ  1 
ATOM   3167  N N   . THR B 1 137 ? 35.466  -24.121 57.529  1.00 142.30 ? 156 THR M N   1 
ATOM   3168  C CA  . THR B 1 137 ? 35.915  -25.486 57.301  1.00 138.92 ? 156 THR M CA  1 
ATOM   3169  C C   . THR B 1 137 ? 35.107  -26.165 56.201  1.00 138.34 ? 156 THR M C   1 
ATOM   3170  O O   . THR B 1 137 ? 33.898  -25.949 56.068  1.00 132.22 ? 156 THR M O   1 
ATOM   3171  C CB  . THR B 1 137 ? 35.833  -26.298 58.598  1.00 136.12 ? 156 THR M CB  1 
ATOM   3172  O OG1 . THR B 1 137 ? 36.429  -27.586 58.398  1.00 132.92 ? 156 THR M OG1 1 
ATOM   3173  C CG2 . THR B 1 137 ? 34.394  -26.452 59.066  1.00 132.55 ? 156 THR M CG2 1 
ATOM   3174  N N   . ASP B 1 138 ? 35.799  -26.966 55.395  1.00 141.42 ? 157 ASP M N   1 
ATOM   3175  C CA  . ASP B 1 138 ? 35.174  -27.772 54.360  1.00 137.33 ? 157 ASP M CA  1 
ATOM   3176  C C   . ASP B 1 138 ? 34.499  -28.989 54.988  1.00 137.91 ? 157 ASP M C   1 
ATOM   3177  O O   . ASP B 1 138 ? 34.740  -29.335 56.148  1.00 141.12 ? 157 ASP M O   1 
ATOM   3178  C CB  . ASP B 1 138 ? 36.220  -28.201 53.324  1.00 136.12 ? 157 ASP M CB  1 
ATOM   3179  C CG  . ASP B 1 138 ? 35.638  -29.041 52.199  1.00 135.85 ? 157 ASP M CG  1 
ATOM   3180  O OD1 . ASP B 1 138 ? 34.399  -29.067 52.045  1.00 127.84 ? 157 ASP M OD1 1 
ATOM   3181  O OD2 . ASP B 1 138 ? 36.426  -29.679 51.468  1.00 142.34 ? 157 ASP M OD2 1 
ATOM   3182  N N   . ALA B 1 139 ? 33.630  -29.636 54.206  1.00 136.74 ? 158 ALA M N   1 
ATOM   3183  C CA  . ALA B 1 139 ? 32.988  -30.861 54.673  1.00 139.59 ? 158 ALA M CA  1 
ATOM   3184  C C   . ALA B 1 139 ? 34.011  -31.940 55.009  1.00 144.94 ? 158 ALA M C   1 
ATOM   3185  O O   . ALA B 1 139 ? 33.752  -32.794 55.864  1.00 146.96 ? 158 ALA M O   1 
ATOM   3186  C CB  . ALA B 1 139 ? 32.000  -31.370 53.623  1.00 135.42 ? 158 ALA M CB  1 
ATOM   3187  N N   . GLN B 1 140 ? 35.175  -31.917 54.357  1.00 146.68 ? 159 GLN M N   1 
ATOM   3188  C CA  . GLN B 1 140 ? 36.220  -32.895 54.635  1.00 144.45 ? 159 GLN M CA  1 
ATOM   3189  C C   . GLN B 1 140 ? 37.200  -32.429 55.705  1.00 141.18 ? 159 GLN M C   1 
ATOM   3190  O O   . GLN B 1 140 ? 37.752  -33.264 56.430  1.00 143.12 ? 159 GLN M O   1 
ATOM   3191  C CB  . GLN B 1 140 ? 36.982  -33.239 53.349  1.00 143.79 ? 159 GLN M CB  1 
ATOM   3192  C CG  . GLN B 1 140 ? 38.250  -32.426 53.118  1.00 147.00 ? 159 GLN M CG  1 
ATOM   3193  C CD  . GLN B 1 140 ? 39.090  -32.956 51.973  1.00 148.34 ? 159 GLN M CD  1 
ATOM   3194  O OE1 . GLN B 1 140 ? 40.090  -33.643 52.188  1.00 145.91 ? 159 GLN M OE1 1 
ATOM   3195  N NE2 . GLN B 1 140 ? 38.690  -32.637 50.746  1.00 151.95 ? 159 GLN M NE2 1 
ATOM   3196  N N   . GLY B 1 141 ? 37.424  -31.122 55.832  1.00 140.90 ? 160 GLY M N   1 
ATOM   3197  C CA  . GLY B 1 141 ? 38.363  -30.619 56.815  1.00 140.07 ? 160 GLY M CA  1 
ATOM   3198  C C   . GLY B 1 141 ? 39.270  -29.520 56.301  1.00 143.69 ? 160 GLY M C   1 
ATOM   3199  O O   . GLY B 1 141 ? 39.873  -28.790 57.093  1.00 143.17 ? 160 GLY M O   1 
ATOM   3200  N N   . THR B 1 142 ? 39.378  -29.387 54.980  1.00 140.04 ? 161 THR M N   1 
ATOM   3201  C CA  . THR B 1 142 ? 40.206  -28.342 54.396  1.00 140.00 ? 161 THR M CA  1 
ATOM   3202  C C   . THR B 1 142 ? 39.550  -26.975 54.600  1.00 142.82 ? 161 THR M C   1 
ATOM   3203  O O   . THR B 1 142 ? 38.445  -26.853 55.137  1.00 141.71 ? 161 THR M O   1 
ATOM   3204  C CB  . THR B 1 142 ? 40.453  -28.620 52.913  1.00 135.90 ? 161 THR M CB  1 
ATOM   3205  O OG1 . THR B 1 142 ? 39.202  -28.720 52.222  1.00 131.38 ? 161 THR M OG1 1 
ATOM   3206  C CG2 . THR B 1 142 ? 41.228  -29.918 52.737  1.00 131.57 ? 161 THR M CG2 1 
ATOM   3207  N N   . ARG B 1 143 ? 40.246  -25.928 54.170  1.00 137.18 ? 162 ARG M N   1 
ATOM   3208  C CA  . ARG B 1 143 ? 39.784  -24.557 54.345  1.00 132.91 ? 162 ARG M CA  1 
ATOM   3209  C C   . ARG B 1 143 ? 39.152  -24.068 53.047  1.00 133.82 ? 162 ARG M C   1 
ATOM   3210  O O   . ARG B 1 143 ? 39.829  -23.974 52.017  1.00 135.24 ? 162 ARG M O   1 
ATOM   3211  C CB  . ARG B 1 143 ? 40.937  -23.649 54.772  1.00 127.76 ? 162 ARG M CB  1 
ATOM   3212  C CG  . ARG B 1 143 ? 41.312  -23.804 56.238  1.00 125.10 ? 162 ARG M CG  1 
ATOM   3213  C CD  . ARG B 1 143 ? 42.714  -23.300 56.517  1.00 124.80 ? 162 ARG M CD  1 
ATOM   3214  N NE  . ARG B 1 143 ? 43.008  -23.266 57.947  1.00 126.95 ? 162 ARG M NE  1 
ATOM   3215  C CZ  . ARG B 1 143 ? 44.221  -23.076 58.456  1.00 127.56 ? 162 ARG M CZ  1 
ATOM   3216  N NH1 . ARG B 1 143 ? 45.261  -22.899 57.652  1.00 124.76 ? 162 ARG M NH1 1 
ATOM   3217  N NH2 . ARG B 1 143 ? 44.395  -23.061 59.770  1.00 125.16 ? 162 ARG M NH2 1 
ATOM   3218  N N   . ILE B 1 144 ? 37.856  -23.757 53.104  1.00 132.64 ? 163 ILE M N   1 
ATOM   3219  C CA  . ILE B 1 144 ? 37.109  -23.340 51.922  1.00 126.48 ? 163 ILE M CA  1 
ATOM   3220  C C   . ILE B 1 144 ? 36.857  -21.834 51.882  1.00 123.57 ? 163 ILE M C   1 
ATOM   3221  O O   . ILE B 1 144 ? 36.653  -21.282 50.789  1.00 125.46 ? 163 ILE M O   1 
ATOM   3222  C CB  . ILE B 1 144 ? 35.774  -24.112 51.829  1.00 125.23 ? 163 ILE M CB  1 
ATOM   3223  C CG1 . ILE B 1 144 ? 35.174  -24.004 50.426  1.00 127.23 ? 163 ILE M CG1 1 
ATOM   3224  C CG2 . ILE B 1 144 ? 34.784  -23.613 52.872  1.00 125.09 ? 163 ILE M CG2 1 
ATOM   3225  C CD1 . ILE B 1 144 ? 33.961  -24.882 50.211  1.00 127.35 ? 163 ILE M CD1 1 
ATOM   3226  N N   . GLY B 1 145 ? 36.880  -21.154 53.027  1.00 122.27 ? 164 GLY M N   1 
ATOM   3227  C CA  . GLY B 1 145 ? 36.627  -19.727 53.070  1.00 121.30 ? 164 GLY M CA  1 
ATOM   3228  C C   . GLY B 1 145 ? 37.333  -19.013 54.205  1.00 121.99 ? 164 GLY M C   1 
ATOM   3229  O O   . GLY B 1 145 ? 38.209  -19.585 54.864  1.00 126.73 ? 164 GLY M O   1 
ATOM   3230  N N   . CYS B 1 146 ? 36.957  -17.760 54.441  1.00 112.33 ? 165 CYS M N   1 
ATOM   3231  C CA  . CYS B 1 146 ? 37.588  -16.931 55.458  1.00 112.79 ? 165 CYS M CA  1 
ATOM   3232  C C   . CYS B 1 146 ? 36.721  -15.704 55.684  1.00 114.20 ? 165 CYS M C   1 
ATOM   3233  O O   . CYS B 1 146 ? 35.903  -15.340 54.835  1.00 118.83 ? 165 CYS M O   1 
ATOM   3234  C CB  . CYS B 1 146 ? 39.004  -16.512 55.051  1.00 112.71 ? 165 CYS M CB  1 
ATOM   3235  S SG  . CYS B 1 146 ? 39.648  -15.121 56.008  1.00 117.17 ? 165 CYS M SG  1 
ATOM   3236  N N   . ARG B 1 147 ? 36.931  -15.052 56.827  1.00 107.19 ? 166 ARG M N   1 
ATOM   3237  C CA  . ARG B 1 147 ? 36.167  -13.853 57.165  1.00 102.99 ? 166 ARG M CA  1 
ATOM   3238  C C   . ARG B 1 147 ? 36.974  -13.019 58.151  1.00 98.28  ? 166 ARG M C   1 
ATOM   3239  O O   . ARG B 1 147 ? 37.113  -13.406 59.315  1.00 101.03 ? 166 ARG M O   1 
ATOM   3240  C CB  . ARG B 1 147 ? 34.808  -14.224 57.746  1.00 105.90 ? 166 ARG M CB  1 
ATOM   3241  C CG  . ARG B 1 147 ? 33.859  -13.048 57.902  1.00 105.99 ? 166 ARG M CG  1 
ATOM   3242  C CD  . ARG B 1 147 ? 32.869  -13.296 59.021  1.00 105.44 ? 166 ARG M CD  1 
ATOM   3243  N NE  . ARG B 1 147 ? 33.531  -13.313 60.321  1.00 107.70 ? 166 ARG M NE  1 
ATOM   3244  C CZ  . ARG B 1 147 ? 32.982  -13.789 61.432  1.00 107.75 ? 166 ARG M CZ  1 
ATOM   3245  N NH1 . ARG B 1 147 ? 31.754  -14.289 61.404  1.00 104.30 ? 166 ARG M NH1 1 
ATOM   3246  N NH2 . ARG B 1 147 ? 33.661  -13.768 62.571  1.00 108.65 ? 166 ARG M NH2 1 
ATOM   3247  N N   . PHE B 1 148 ? 37.496  -11.886 57.689  1.00 98.04  ? 167 PHE M N   1 
ATOM   3248  C CA  . PHE B 1 148 ? 38.126  -10.931 58.588  1.00 104.60 ? 167 PHE M CA  1 
ATOM   3249  C C   . PHE B 1 148 ? 37.066  -10.227 59.430  1.00 106.66 ? 167 PHE M C   1 
ATOM   3250  O O   . PHE B 1 148 ? 35.931  -10.018 58.992  1.00 104.00 ? 167 PHE M O   1 
ATOM   3251  C CB  . PHE B 1 148 ? 38.946  -9.910  57.799  1.00 106.30 ? 167 PHE M CB  1 
ATOM   3252  C CG  . PHE B 1 148 ? 40.159  -10.492 57.125  1.00 104.74 ? 167 PHE M CG  1 
ATOM   3253  C CD1 . PHE B 1 148 ? 40.039  -11.197 55.941  1.00 101.26 ? 167 PHE M CD1 1 
ATOM   3254  C CD2 . PHE B 1 148 ? 41.419  -10.326 57.674  1.00 109.64 ? 167 PHE M CD2 1 
ATOM   3255  C CE1 . PHE B 1 148 ? 41.151  -11.730 55.320  1.00 103.73 ? 167 PHE M CE1 1 
ATOM   3256  C CE2 . PHE B 1 148 ? 42.536  -10.857 57.057  1.00 109.85 ? 167 PHE M CE2 1 
ATOM   3257  C CZ  . PHE B 1 148 ? 42.401  -11.560 55.879  1.00 108.23 ? 167 PHE M CZ  1 
ATOM   3258  N N   . ASP B 1 149 ? 37.447  -9.854  60.652  1.00 112.71 ? 168 ASP M N   1 
ATOM   3259  C CA  . ASP B 1 149 ? 36.468  -9.414  61.642  1.00 111.61 ? 168 ASP M CA  1 
ATOM   3260  C C   . ASP B 1 149 ? 36.268  -7.901  61.646  1.00 109.21 ? 168 ASP M C   1 
ATOM   3261  O O   . ASP B 1 149 ? 35.128  -7.427  61.665  1.00 110.26 ? 168 ASP M O   1 
ATOM   3262  C CB  . ASP B 1 149 ? 36.881  -9.902  63.034  1.00 116.08 ? 168 ASP M CB  1 
ATOM   3263  C CG  . ASP B 1 149 ? 36.153  -11.173 63.445  1.00 118.59 ? 168 ASP M CG  1 
ATOM   3264  O OD1 . ASP B 1 149 ? 34.995  -11.359 63.016  1.00 112.18 ? 168 ASP M OD1 1 
ATOM   3265  O OD2 . ASP B 1 149 ? 36.739  -11.989 64.190  1.00 122.05 ? 168 ASP M OD2 1 
ATOM   3266  N N   . ASP B 1 150 ? 37.355  -7.126  61.637  1.00 108.07 ? 169 ASP M N   1 
ATOM   3267  C CA  . ASP B 1 150 ? 37.283  -5.661  61.660  1.00 109.14 ? 169 ASP M CA  1 
ATOM   3268  C C   . ASP B 1 150 ? 38.110  -5.129  60.491  1.00 114.49 ? 169 ASP M C   1 
ATOM   3269  O O   . ASP B 1 150 ? 39.248  -4.689  60.669  1.00 123.20 ? 169 ASP M O   1 
ATOM   3270  C CB  . ASP B 1 150 ? 37.764  -5.109  63.000  1.00 112.97 ? 169 ASP M CB  1 
ATOM   3271  C CG  . ASP B 1 150 ? 37.598  -3.604  63.104  1.00 119.44 ? 169 ASP M CG  1 
ATOM   3272  O OD1 . ASP B 1 150 ? 36.859  -3.026  62.280  1.00 129.19 ? 169 ASP M OD1 1 
ATOM   3273  O OD2 . ASP B 1 150 ? 38.207  -2.999  64.012  1.00 121.12 ? 169 ASP M OD2 1 
ATOM   3274  N N   . ILE B 1 151 ? 37.525  -5.165  59.291  1.00 113.21 ? 170 ILE M N   1 
ATOM   3275  C CA  . ILE B 1 151 ? 38.234  -4.704  58.104  1.00 110.18 ? 170 ILE M CA  1 
ATOM   3276  C C   . ILE B 1 151 ? 38.440  -3.195  58.123  1.00 106.98 ? 170 ILE M C   1 
ATOM   3277  O O   . ILE B 1 151 ? 39.290  -2.679  57.387  1.00 100.23 ? 170 ILE M O   1 
ATOM   3278  C CB  . ILE B 1 151 ? 37.479  -5.143  56.834  1.00 107.76 ? 170 ILE M CB  1 
ATOM   3279  C CG1 . ILE B 1 151 ? 38.375  -5.028  55.600  1.00 107.00 ? 170 ILE M CG1 1 
ATOM   3280  C CG2 . ILE B 1 151 ? 36.220  -4.316  56.650  1.00 108.02 ? 170 ILE M CG2 1 
ATOM   3281  C CD1 . ILE B 1 151 ? 39.559  -5.963  55.618  1.00 107.62 ? 170 ILE M CD1 1 
ATOM   3282  N N   . SER B 1 152 ? 37.694  -2.473  58.961  1.00 110.00 ? 171 SER M N   1 
ATOM   3283  C CA  . SER B 1 152 ? 37.785  -1.016  58.986  1.00 112.67 ? 171 SER M CA  1 
ATOM   3284  C C   . SER B 1 152 ? 39.188  -0.557  59.366  1.00 112.57 ? 171 SER M C   1 
ATOM   3285  O O   . SER B 1 152 ? 39.840  0.178   58.615  1.00 105.11 ? 171 SER M O   1 
ATOM   3286  C CB  . SER B 1 152 ? 36.748  -0.444  59.954  1.00 112.88 ? 171 SER M CB  1 
ATOM   3287  O OG  . SER B 1 152 ? 36.977  0.936   60.179  1.00 112.23 ? 171 SER M OG  1 
ATOM   3288  N N   . ARG B 1 153 ? 39.671  -0.979  60.536  1.00 115.31 ? 172 ARG M N   1 
ATOM   3289  C CA  . ARG B 1 153 ? 40.993  -0.567  60.992  1.00 118.72 ? 172 ARG M CA  1 
ATOM   3290  C C   . ARG B 1 153 ? 42.113  -1.427  60.425  1.00 110.91 ? 172 ARG M C   1 
ATOM   3291  O O   . ARG B 1 153 ? 43.288  -1.108  60.642  1.00 112.95 ? 172 ARG M O   1 
ATOM   3292  C CB  . ARG B 1 153 ? 41.054  -0.571  62.524  1.00 123.62 ? 172 ARG M CB  1 
ATOM   3293  C CG  . ARG B 1 153 ? 40.306  0.598   63.154  1.00 123.88 ? 172 ARG M CG  1 
ATOM   3294  C CD  . ARG B 1 153 ? 40.435  1.839   62.275  1.00 121.08 ? 172 ARG M CD  1 
ATOM   3295  N NE  . ARG B 1 153 ? 39.964  3.059   62.921  1.00 113.63 ? 172 ARG M NE  1 
ATOM   3296  C CZ  . ARG B 1 153 ? 40.460  4.267   62.675  1.00 107.56 ? 172 ARG M CZ  1 
ATOM   3297  N NH1 . ARG B 1 153 ? 39.973  5.328   63.304  1.00 102.20 ? 172 ARG M NH1 1 
ATOM   3298  N NH2 . ARG B 1 153 ? 41.439  4.417   61.794  1.00 105.26 ? 172 ARG M NH2 1 
ATOM   3299  N N   . LEU B 1 154 ? 41.784  -2.498  59.703  1.00 109.23 ? 173 LEU M N   1 
ATOM   3300  C CA  . LEU B 1 154 ? 42.815  -3.253  59.001  1.00 112.21 ? 173 LEU M CA  1 
ATOM   3301  C C   . LEU B 1 154 ? 43.285  -2.518  57.751  1.00 113.07 ? 173 LEU M C   1 
ATOM   3302  O O   . LEU B 1 154 ? 44.466  -2.594  57.394  1.00 113.43 ? 173 LEU M O   1 
ATOM   3303  C CB  . LEU B 1 154 ? 42.285  -4.647  58.652  1.00 111.78 ? 173 LEU M CB  1 
ATOM   3304  C CG  . LEU B 1 154 ? 43.213  -5.724  58.085  1.00 114.11 ? 173 LEU M CG  1 
ATOM   3305  C CD1 . LEU B 1 154 ? 42.642  -7.092  58.395  1.00 112.72 ? 173 LEU M CD1 1 
ATOM   3306  C CD2 . LEU B 1 154 ? 43.398  -5.575  56.581  1.00 114.51 ? 173 LEU M CD2 1 
ATOM   3307  N N   . SER B 1 155 ? 42.385  -1.800  57.087  1.00 117.73 ? 174 SER M N   1 
ATOM   3308  C CA  . SER B 1 155 ? 42.657  -1.129  55.820  1.00 115.36 ? 174 SER M CA  1 
ATOM   3309  C C   . SER B 1 155 ? 42.561  0.387   55.954  1.00 114.30 ? 174 SER M C   1 
ATOM   3310  O O   . SER B 1 155 ? 42.074  1.076   55.055  1.00 111.45 ? 174 SER M O   1 
ATOM   3311  C CB  . SER B 1 155 ? 41.693  -1.612  54.747  1.00 114.72 ? 174 SER M CB  1 
ATOM   3312  O OG  . SER B 1 155 ? 40.359  -1.230  55.058  1.00 109.67 ? 174 SER M OG  1 
ATOM   3313  N N   . SER B 1 156 ? 43.018  0.917   57.089  1.00 117.51 ? 175 SER M N   1 
ATOM   3314  C CA  . SER B 1 156 ? 42.887  2.334   57.413  1.00 118.79 ? 175 SER M CA  1 
ATOM   3315  C C   . SER B 1 156 ? 43.420  3.224   56.298  1.00 119.52 ? 175 SER M C   1 
ATOM   3316  O O   . SER B 1 156 ? 44.635  3.395   56.156  1.00 122.30 ? 175 SER M O   1 
ATOM   3317  C CB  . SER B 1 156 ? 43.613  2.646   58.723  1.00 121.35 ? 175 SER M CB  1 
ATOM   3318  O OG  . SER B 1 156 ? 42.861  2.208   59.842  1.00 116.46 ? 175 SER M OG  1 
ATOM   3319  N N   . GLY B 1 157 ? 42.516  3.790   55.503  1.00 117.46 ? 176 GLY M N   1 
ATOM   3320  C CA  . GLY B 1 157 ? 42.897  4.731   54.469  1.00 118.99 ? 176 GLY M CA  1 
ATOM   3321  C C   . GLY B 1 157 ? 42.936  4.148   53.072  1.00 119.17 ? 176 GLY M C   1 
ATOM   3322  O O   . GLY B 1 157 ? 42.403  4.745   52.131  1.00 113.09 ? 176 GLY M O   1 
ATOM   3323  N N   . SER B 1 158 ? 43.568  2.986   52.922  1.00 121.33 ? 177 SER M N   1 
ATOM   3324  C CA  . SER B 1 158 ? 43.725  2.380   51.607  1.00 118.25 ? 177 SER M CA  1 
ATOM   3325  C C   . SER B 1 158 ? 42.383  1.900   51.068  1.00 116.00 ? 177 SER M C   1 
ATOM   3326  O O   . SER B 1 158 ? 41.558  1.350   51.804  1.00 117.78 ? 177 SER M O   1 
ATOM   3327  C CB  . SER B 1 158 ? 44.712  1.214   51.674  1.00 118.98 ? 177 SER M CB  1 
ATOM   3328  O OG  . SER B 1 158 ? 45.876  1.569   52.401  1.00 122.09 ? 177 SER M OG  1 
ATOM   3329  N N   . GLN B 1 159 ? 42.169  2.108   49.769  1.00 108.66 ? 178 GLN M N   1 
ATOM   3330  C CA  . GLN B 1 159 ? 40.911  1.758   49.126  1.00 110.04 ? 178 GLN M CA  1 
ATOM   3331  C C   . GLN B 1 159 ? 40.986  0.480   48.300  1.00 108.76 ? 178 GLN M C   1 
ATOM   3332  O O   . GLN B 1 159 ? 39.947  0.009   47.825  1.00 102.21 ? 178 GLN M O   1 
ATOM   3333  C CB  . GLN B 1 159 ? 40.432  2.918   48.238  1.00 107.00 ? 178 GLN M CB  1 
ATOM   3334  C CG  . GLN B 1 159 ? 41.556  3.684   47.554  1.00 108.09 ? 178 GLN M CG  1 
ATOM   3335  C CD  . GLN B 1 159 ? 41.089  4.994   46.940  1.00 107.20 ? 178 GLN M CD  1 
ATOM   3336  O OE1 . GLN B 1 159 ? 40.004  5.489   47.250  1.00 102.83 ? 178 GLN M OE1 1 
ATOM   3337  N NE2 . GLN B 1 159 ? 41.914  5.566   46.069  1.00 108.37 ? 178 GLN M NE2 1 
ATOM   3338  N N   . SER B 1 160 ? 42.175  -0.091  48.122  1.00 106.80 ? 179 SER M N   1 
ATOM   3339  C CA  . SER B 1 160 ? 42.353  -1.311  47.348  1.00 105.72 ? 179 SER M CA  1 
ATOM   3340  C C   . SER B 1 160 ? 43.166  -2.311  48.159  1.00 106.90 ? 179 SER M C   1 
ATOM   3341  O O   . SER B 1 160 ? 43.771  -1.974  49.180  1.00 109.04 ? 179 SER M O   1 
ATOM   3342  C CB  . SER B 1 160 ? 43.040  -1.030  46.005  1.00 107.12 ? 179 SER M CB  1 
ATOM   3343  O OG  . SER B 1 160 ? 44.391  -0.650  46.193  1.00 107.68 ? 179 SER M OG  1 
ATOM   3344  N N   . SER B 1 161 ? 43.181  -3.555  47.689  1.00 104.92 ? 180 SER M N   1 
ATOM   3345  C CA  . SER B 1 161 ? 43.868  -4.617  48.409  1.00 108.60 ? 180 SER M CA  1 
ATOM   3346  C C   . SER B 1 161 ? 44.219  -5.749  47.455  1.00 109.82 ? 180 SER M C   1 
ATOM   3347  O O   . SER B 1 161 ? 43.652  -5.874  46.364  1.00 114.89 ? 180 SER M O   1 
ATOM   3348  C CB  . SER B 1 161 ? 43.020  -5.144  49.569  1.00 109.59 ? 180 SER M CB  1 
ATOM   3349  O OG  . SER B 1 161 ? 43.683  -6.198  50.244  1.00 110.92 ? 180 SER M OG  1 
ATOM   3350  N N   . HIS B 1 162 ? 45.153  -6.586  47.907  1.00 113.24 ? 181 HIS M N   1 
ATOM   3351  C CA  . HIS B 1 162 ? 45.653  -7.739  47.166  1.00 110.77 ? 181 HIS M CA  1 
ATOM   3352  C C   . HIS B 1 162 ? 45.464  -8.967  48.048  1.00 108.63 ? 181 HIS M C   1 
ATOM   3353  O O   . HIS B 1 162 ? 46.130  -9.102  49.081  1.00 113.65 ? 181 HIS M O   1 
ATOM   3354  C CB  . HIS B 1 162 ? 47.127  -7.541  46.802  1.00 112.83 ? 181 HIS M CB  1 
ATOM   3355  C CG  . HIS B 1 162 ? 47.759  -8.705  46.102  1.00 110.38 ? 181 HIS M CG  1 
ATOM   3356  N ND1 . HIS B 1 162 ? 48.346  -8.578  44.862  1.00 107.39 ? 181 HIS M ND1 1 
ATOM   3357  C CD2 . HIS B 1 162 ? 47.955  -9.992  46.479  1.00 108.67 ? 181 HIS M CD2 1 
ATOM   3358  C CE1 . HIS B 1 162 ? 48.839  -9.744  44.485  1.00 110.62 ? 181 HIS M CE1 1 
ATOM   3359  N NE2 . HIS B 1 162 ? 48.623  -10.617 45.453  1.00 112.36 ? 181 HIS M NE2 1 
ATOM   3360  N N   . ILE B 1 163 ? 44.579  -9.864  47.646  1.00 109.12 ? 182 ILE M N   1 
ATOM   3361  C CA  . ILE B 1 163 ? 44.272  -11.053 48.428  1.00 108.96 ? 182 ILE M CA  1 
ATOM   3362  C C   . ILE B 1 163 ? 44.920  -12.255 47.759  1.00 108.48 ? 182 ILE M C   1 
ATOM   3363  O O   . ILE B 1 163 ? 44.883  -12.392 46.531  1.00 110.10 ? 182 ILE M O   1 
ATOM   3364  C CB  . ILE B 1 163 ? 42.749  -11.230 48.572  1.00 107.98 ? 182 ILE M CB  1 
ATOM   3365  C CG1 . ILE B 1 163 ? 42.188  -10.113 49.456  1.00 109.87 ? 182 ILE M CG1 1 
ATOM   3366  C CG2 . ILE B 1 163 ? 42.412  -12.591 49.145  1.00 106.20 ? 182 ILE M CG2 1 
ATOM   3367  C CD1 . ILE B 1 163 ? 40.691  -9.977  49.400  1.00 113.46 ? 182 ILE M CD1 1 
ATOM   3368  N N   . LEU B 1 164 ? 45.527  -13.127 48.565  1.00 118.13 ? 183 LEU M N   1 
ATOM   3369  C CA  . LEU B 1 164 ? 46.326  -14.232 48.059  1.00 118.67 ? 183 LEU M CA  1 
ATOM   3370  C C   . LEU B 1 164 ? 46.029  -15.469 48.894  1.00 119.65 ? 183 LEU M C   1 
ATOM   3371  O O   . LEU B 1 164 ? 45.743  -15.369 50.088  1.00 118.73 ? 183 LEU M O   1 
ATOM   3372  C CB  . LEU B 1 164 ? 47.819  -13.863 48.105  1.00 120.69 ? 183 LEU M CB  1 
ATOM   3373  C CG  . LEU B 1 164 ? 48.948  -14.888 48.232  1.00 119.81 ? 183 LEU M CG  1 
ATOM   3374  C CD1 . LEU B 1 164 ? 48.938  -15.861 47.076  1.00 116.25 ? 183 LEU M CD1 1 
ATOM   3375  C CD2 . LEU B 1 164 ? 50.289  -14.175 48.323  1.00 121.17 ? 183 LEU M CD2 1 
ATOM   3376  N N   . VAL B 1 165 ? 46.075  -16.639 48.259  1.00 121.37 ? 184 VAL M N   1 
ATOM   3377  C CA  . VAL B 1 165 ? 45.804  -17.907 48.933  1.00 124.37 ? 184 VAL M CA  1 
ATOM   3378  C C   . VAL B 1 165 ? 46.841  -18.924 48.469  1.00 129.05 ? 184 VAL M C   1 
ATOM   3379  O O   . VAL B 1 165 ? 46.819  -19.354 47.309  1.00 130.14 ? 184 VAL M O   1 
ATOM   3380  C CB  . VAL B 1 165 ? 44.381  -18.423 48.666  1.00 120.62 ? 184 VAL M CB  1 
ATOM   3381  C CG1 . VAL B 1 165 ? 44.247  -19.870 49.102  1.00 119.77 ? 184 VAL M CG1 1 
ATOM   3382  C CG2 . VAL B 1 165 ? 43.366  -17.569 49.403  1.00 120.94 ? 184 VAL M CG2 1 
ATOM   3383  N N   . ARG B 1 166 ? 47.745  -19.307 49.368  1.00 131.60 ? 185 ARG M N   1 
ATOM   3384  C CA  . ARG B 1 166 ? 48.744  -20.328 49.094  1.00 131.07 ? 185 ARG M CA  1 
ATOM   3385  C C   . ARG B 1 166 ? 48.262  -21.689 49.587  1.00 129.14 ? 185 ARG M C   1 
ATOM   3386  O O   . ARG B 1 166 ? 47.359  -21.792 50.419  1.00 129.86 ? 185 ARG M O   1 
ATOM   3387  C CB  . ARG B 1 166 ? 50.080  -19.978 49.755  1.00 129.82 ? 185 ARG M CB  1 
ATOM   3388  C CG  . ARG B 1 166 ? 50.667  -18.644 49.324  1.00 133.75 ? 185 ARG M CG  1 
ATOM   3389  C CD  . ARG B 1 166 ? 51.669  -18.121 50.345  1.00 136.37 ? 185 ARG M CD  1 
ATOM   3390  N NE  . ARG B 1 166 ? 52.027  -16.726 50.095  1.00 141.37 ? 185 ARG M NE  1 
ATOM   3391  C CZ  . ARG B 1 166 ? 52.589  -15.924 50.995  1.00 140.32 ? 185 ARG M CZ  1 
ATOM   3392  N NH1 . ARG B 1 166 ? 52.862  -16.379 52.211  1.00 145.23 ? 185 ARG M NH1 1 
ATOM   3393  N NH2 . ARG B 1 166 ? 52.881  -14.668 50.681  1.00 127.80 ? 185 ARG M NH2 1 
ATOM   3394  N N   . GLY B 1 167 ? 48.886  -22.741 49.067  1.00 136.30 ? 186 GLY M N   1 
ATOM   3395  C CA  . GLY B 1 167 ? 48.532  -24.102 49.423  1.00 138.62 ? 186 GLY M CA  1 
ATOM   3396  C C   . GLY B 1 167 ? 49.716  -24.854 49.998  1.00 140.26 ? 186 GLY M C   1 
ATOM   3397  O O   . GLY B 1 167 ? 50.862  -24.639 49.598  1.00 136.66 ? 186 GLY M O   1 
ATOM   3398  N N   . ARG B 1 168 ? 49.428  -25.746 50.946  1.00 144.34 ? 187 ARG M N   1 
ATOM   3399  C CA  . ARG B 1 168 ? 50.439  -26.579 51.581  1.00 142.63 ? 187 ARG M CA  1 
ATOM   3400  C C   . ARG B 1 168 ? 50.042  -28.043 51.471  1.00 145.26 ? 187 ARG M C   1 
ATOM   3401  O O   . ARG B 1 168 ? 48.871  -28.398 51.649  1.00 143.11 ? 187 ARG M O   1 
ATOM   3402  C CB  . ARG B 1 168 ? 50.634  -26.223 53.058  1.00 141.25 ? 187 ARG M CB  1 
ATOM   3403  C CG  . ARG B 1 168 ? 50.919  -24.763 53.333  1.00 143.02 ? 187 ARG M CG  1 
ATOM   3404  C CD  . ARG B 1 168 ? 50.687  -24.463 54.800  1.00 141.61 ? 187 ARG M CD  1 
ATOM   3405  N NE  . ARG B 1 168 ? 49.418  -25.019 55.260  1.00 142.19 ? 187 ARG M NE  1 
ATOM   3406  C CZ  . ARG B 1 168 ? 48.872  -24.765 56.444  1.00 143.49 ? 187 ARG M CZ  1 
ATOM   3407  N NH1 . ARG B 1 168 ? 49.485  -23.958 57.300  1.00 146.49 ? 187 ARG M NH1 1 
ATOM   3408  N NH2 . ARG B 1 168 ? 47.714  -25.320 56.774  1.00 140.42 ? 187 ARG M NH2 1 
ATOM   3409  N N   . SER B 1 169 ? 51.035  -28.882 51.185  1.00 149.88 ? 188 SER M N   1 
ATOM   3410  C CA  . SER B 1 169 ? 50.865  -30.325 51.112  1.00 152.83 ? 188 SER M CA  1 
ATOM   3411  C C   . SER B 1 169 ? 52.224  -30.968 51.344  1.00 152.82 ? 188 SER M C   1 
ATOM   3412  O O   . SER B 1 169 ? 53.245  -30.444 50.892  1.00 145.90 ? 188 SER M O   1 
ATOM   3413  C CB  . SER B 1 169 ? 50.286  -30.757 49.759  1.00 153.26 ? 188 SER M CB  1 
ATOM   3414  O OG  . SER B 1 169 ? 49.995  -32.144 49.741  1.00 153.52 ? 188 SER M OG  1 
ATOM   3415  N N   . ALA B 1 170 ? 52.232  -32.094 52.058  1.00 155.20 ? 189 ALA M N   1 
ATOM   3416  C CA  . ALA B 1 170 ? 53.494  -32.770 52.334  1.00 155.63 ? 189 ALA M CA  1 
ATOM   3417  C C   . ALA B 1 170 ? 54.089  -33.386 51.075  1.00 161.33 ? 189 ALA M C   1 
ATOM   3418  O O   . ALA B 1 170 ? 55.316  -33.488 50.957  1.00 164.82 ? 189 ALA M O   1 
ATOM   3419  C CB  . ALA B 1 170 ? 53.297  -33.839 53.408  1.00 151.03 ? 189 ALA M CB  1 
ATOM   3420  N N   . ALA B 1 171 ? 53.246  -33.788 50.124  1.00 161.56 ? 190 ALA M N   1 
ATOM   3421  C CA  . ALA B 1 171 ? 53.719  -34.468 48.925  1.00 161.44 ? 190 ALA M CA  1 
ATOM   3422  C C   . ALA B 1 171 ? 54.049  -33.513 47.785  1.00 160.44 ? 190 ALA M C   1 
ATOM   3423  O O   . ALA B 1 171 ? 54.941  -33.811 46.982  1.00 163.65 ? 190 ALA M O   1 
ATOM   3424  C CB  . ALA B 1 171 ? 52.676  -35.486 48.452  1.00 157.62 ? 190 ALA M CB  1 
ATOM   3425  N N   . PHE B 1 172 ? 53.363  -32.375 47.692  1.00 164.00 ? 191 PHE M N   1 
ATOM   3426  C CA  . PHE B 1 172 ? 53.542  -31.450 46.584  1.00 158.75 ? 191 PHE M CA  1 
ATOM   3427  C C   . PHE B 1 172 ? 53.636  -30.024 47.104  1.00 159.02 ? 191 PHE M C   1 
ATOM   3428  O O   . PHE B 1 172 ? 53.303  -29.722 48.250  1.00 155.29 ? 191 PHE M O   1 
ATOM   3429  C CB  . PHE B 1 172 ? 52.389  -31.544 45.574  1.00 155.82 ? 191 PHE M CB  1 
ATOM   3430  C CG  . PHE B 1 172 ? 52.059  -32.945 45.154  1.00 156.93 ? 191 PHE M CG  1 
ATOM   3431  C CD1 . PHE B 1 172 ? 52.695  -33.529 44.073  1.00 155.49 ? 191 PHE M CD1 1 
ATOM   3432  C CD2 . PHE B 1 172 ? 51.094  -33.672 45.832  1.00 157.57 ? 191 PHE M CD2 1 
ATOM   3433  C CE1 . PHE B 1 172 ? 52.385  -34.820 43.684  1.00 157.51 ? 191 PHE M CE1 1 
ATOM   3434  C CE2 . PHE B 1 172 ? 50.779  -34.960 45.449  1.00 154.04 ? 191 PHE M CE2 1 
ATOM   3435  C CZ  . PHE B 1 172 ? 51.424  -35.535 44.374  1.00 155.03 ? 191 PHE M CZ  1 
ATOM   3436  N N   . GLY B 1 173 ? 54.111  -29.133 46.222  1.00 151.08 ? 192 GLY M N   1 
ATOM   3437  C CA  . GLY B 1 173 ? 53.989  -27.712 46.423  1.00 151.35 ? 192 GLY M CA  1 
ATOM   3438  C C   . GLY B 1 173 ? 52.848  -27.205 45.566  1.00 156.36 ? 192 GLY M C   1 
ATOM   3439  O O   . GLY B 1 173 ? 52.843  -27.396 44.349  1.00 163.50 ? 192 GLY M O   1 
ATOM   3440  N N   . ILE B 1 174 ? 51.876  -26.575 46.208  1.00 151.00 ? 193 ILE M N   1 
ATOM   3441  C CA  . ILE B 1 174 ? 50.604  -26.226 45.579  1.00 149.48 ? 193 ILE M CA  1 
ATOM   3442  C C   . ILE B 1 174 ? 50.683  -24.788 45.077  1.00 148.78 ? 193 ILE M C   1 
ATOM   3443  O O   . ILE B 1 174 ? 51.148  -23.913 45.821  1.00 146.28 ? 193 ILE M O   1 
ATOM   3444  C CB  . ILE B 1 174 ? 49.430  -26.401 46.558  1.00 147.28 ? 193 ILE M CB  1 
ATOM   3445  C CG1 . ILE B 1 174 ? 49.446  -27.815 47.138  1.00 153.37 ? 193 ILE M CG1 1 
ATOM   3446  C CG2 . ILE B 1 174 ? 48.098  -26.112 45.876  1.00 143.50 ? 193 ILE M CG2 1 
ATOM   3447  C CD1 . ILE B 1 174 ? 49.325  -28.902 46.096  1.00 151.96 ? 193 ILE M CD1 1 
ATOM   3448  N N   . PRO B 1 175 ? 50.255  -24.507 43.849  1.00 147.93 ? 194 PRO M N   1 
ATOM   3449  C CA  . PRO B 1 175 ? 50.219  -23.120 43.378  1.00 142.81 ? 194 PRO M CA  1 
ATOM   3450  C C   . PRO B 1 175 ? 49.137  -22.323 44.088  1.00 142.38 ? 194 PRO M C   1 
ATOM   3451  O O   . PRO B 1 175 ? 48.147  -22.861 44.590  1.00 142.32 ? 194 PRO M O   1 
ATOM   3452  C CB  . PRO B 1 175 ? 49.917  -23.261 41.883  1.00 142.67 ? 194 PRO M CB  1 
ATOM   3453  C CG  . PRO B 1 175 ? 49.181  -24.555 41.782  1.00 142.76 ? 194 PRO M CG  1 
ATOM   3454  C CD  . PRO B 1 175 ? 49.797  -25.454 42.817  1.00 144.85 ? 194 PRO M CD  1 
ATOM   3455  N N   . CYS B 1 176 ? 49.339  -21.011 44.112  1.00 136.88 ? 195 CYS M N   1 
ATOM   3456  C CA  . CYS B 1 176 ? 48.485  -20.110 44.867  1.00 139.15 ? 195 CYS M CA  1 
ATOM   3457  C C   . CYS B 1 176 ? 47.378  -19.560 43.968  1.00 136.22 ? 195 CYS M C   1 
ATOM   3458  O O   . CYS B 1 176 ? 47.221  -19.965 42.813  1.00 138.57 ? 195 CYS M O   1 
ATOM   3459  C CB  . CYS B 1 176 ? 49.330  -18.998 45.485  1.00 140.92 ? 195 CYS M CB  1 
ATOM   3460  S SG  . CYS B 1 176 ? 50.369  -18.093 44.311  1.00 148.41 ? 195 CYS M SG  1 
ATOM   3461  N N   . THR B 1 177 ? 46.592  -18.625 44.501  1.00 133.51 ? 196 THR M N   1 
ATOM   3462  C CA  . THR B 1 177 ? 45.539  -17.954 43.748  1.00 130.08 ? 196 THR M CA  1 
ATOM   3463  C C   . THR B 1 177 ? 45.315  -16.583 44.367  1.00 127.99 ? 196 THR M C   1 
ATOM   3464  O O   . THR B 1 177 ? 45.079  -16.486 45.573  1.00 130.13 ? 196 THR M O   1 
ATOM   3465  C CB  . THR B 1 177 ? 44.235  -18.759 43.760  1.00 131.40 ? 196 THR M CB  1 
ATOM   3466  O OG1 . THR B 1 177 ? 44.504  -20.123 43.411  1.00 137.19 ? 196 THR M OG1 1 
ATOM   3467  C CG2 . THR B 1 177 ? 43.239  -18.175 42.771  1.00 131.35 ? 196 THR M CG2 1 
ATOM   3468  N N   . ASP B 1 178 ? 45.391  -15.531 43.554  1.00 123.71 ? 197 ASP M N   1 
ATOM   3469  C CA  . ASP B 1 178 ? 45.302  -14.170 44.062  1.00 124.91 ? 197 ASP M CA  1 
ATOM   3470  C C   . ASP B 1 178 ? 44.246  -13.382 43.296  1.00 120.45 ? 197 ASP M C   1 
ATOM   3471  O O   . ASP B 1 178 ? 43.715  -13.826 42.274  1.00 121.26 ? 197 ASP M O   1 
ATOM   3472  C CB  . ASP B 1 178 ? 46.660  -13.455 43.991  1.00 125.22 ? 197 ASP M CB  1 
ATOM   3473  C CG  . ASP B 1 178 ? 47.105  -13.185 42.569  1.00 122.63 ? 197 ASP M CG  1 
ATOM   3474  O OD1 . ASP B 1 178 ? 46.828  -14.024 41.685  1.00 125.60 ? 197 ASP M OD1 1 
ATOM   3475  O OD2 . ASP B 1 178 ? 47.738  -12.133 42.337  1.00 117.79 ? 197 ASP M OD2 1 
ATOM   3476  N N   . LYS B 1 179 ? 43.948  -12.194 43.818  1.00 111.20 ? 198 LYS M N   1 
ATOM   3477  C CA  . LYS B 1 179 ? 42.915  -11.328 43.268  1.00 108.01 ? 198 LYS M CA  1 
ATOM   3478  C C   . LYS B 1 179 ? 43.116  -9.914  43.796  1.00 106.39 ? 198 LYS M C   1 
ATOM   3479  O O   . LYS B 1 179 ? 43.369  -9.719  44.989  1.00 111.35 ? 198 LYS M O   1 
ATOM   3480  C CB  . LYS B 1 179 ? 41.513  -11.837 43.628  1.00 104.69 ? 198 LYS M CB  1 
ATOM   3481  C CG  . LYS B 1 179 ? 40.387  -10.865 43.307  1.00 104.06 ? 198 LYS M CG  1 
ATOM   3482  C CD  . LYS B 1 179 ? 39.024  -11.537 43.399  1.00 102.78 ? 198 LYS M CD  1 
ATOM   3483  C CE  . LYS B 1 179 ? 38.794  -12.491 42.238  1.00 103.18 ? 198 LYS M CE  1 
ATOM   3484  N NZ  . LYS B 1 179 ? 37.391  -12.988 42.202  1.00 103.74 ? 198 LYS M NZ  1 
ATOM   3485  N N   . PHE B 1 180 ? 43.007  -8.934  42.901  1.00 103.90 ? 199 PHE M N   1 
ATOM   3486  C CA  . PHE B 1 180 ? 43.042  -7.527  43.278  1.00 104.59 ? 199 PHE M CA  1 
ATOM   3487  C C   . PHE B 1 180 ? 41.619  -7.025  43.475  1.00 101.98 ? 199 PHE M C   1 
ATOM   3488  O O   . PHE B 1 180 ? 40.772  -7.188  42.591  1.00 109.85 ? 199 PHE M O   1 
ATOM   3489  C CB  . PHE B 1 180 ? 43.751  -6.697  42.209  1.00 107.19 ? 199 PHE M CB  1 
ATOM   3490  C CG  . PHE B 1 180 ? 45.217  -6.981  42.095  1.00 109.04 ? 199 PHE M CG  1 
ATOM   3491  C CD1 . PHE B 1 180 ? 45.677  -7.994  41.270  1.00 109.70 ? 199 PHE M CD1 1 
ATOM   3492  C CD2 . PHE B 1 180 ? 46.139  -6.227  42.803  1.00 106.64 ? 199 PHE M CD2 1 
ATOM   3493  C CE1 . PHE B 1 180 ? 47.026  -8.257  41.162  1.00 115.78 ? 199 PHE M CE1 1 
ATOM   3494  C CE2 . PHE B 1 180 ? 47.490  -6.483  42.697  1.00 112.86 ? 199 PHE M CE2 1 
ATOM   3495  C CZ  . PHE B 1 180 ? 47.935  -7.501  41.876  1.00 120.73 ? 199 PHE M CZ  1 
ATOM   3496  N N   . VAL B 1 181 ? 41.354  -6.418  44.631  1.00 99.74  ? 200 VAL M N   1 
ATOM   3497  C CA  . VAL B 1 181 ? 40.008  -5.977  44.964  1.00 100.24 ? 200 VAL M CA  1 
ATOM   3498  C C   . VAL B 1 181 ? 40.024  -4.500  45.323  1.00 98.76  ? 200 VAL M C   1 
ATOM   3499  O O   . VAL B 1 181 ? 41.022  -3.965  45.815  1.00 97.46  ? 200 VAL M O   1 
ATOM   3500  C CB  . VAL B 1 181 ? 39.396  -6.801  46.120  1.00 103.19 ? 200 VAL M CB  1 
ATOM   3501  C CG1 . VAL B 1 181 ? 39.084  -8.218  45.661  1.00 99.62  ? 200 VAL M CG1 1 
ATOM   3502  C CG2 . VAL B 1 181 ? 40.333  -6.815  47.315  1.00 110.23 ? 200 VAL M CG2 1 
ATOM   3503  N N   . VAL B 1 182 ? 38.902  -3.838  45.055  1.00 96.07  ? 201 VAL M N   1 
ATOM   3504  C CA  . VAL B 1 182 ? 38.628  -2.491  45.539  1.00 97.62  ? 201 VAL M CA  1 
ATOM   3505  C C   . VAL B 1 182 ? 37.422  -2.593  46.461  1.00 99.40  ? 201 VAL M C   1 
ATOM   3506  O O   . VAL B 1 182 ? 36.372  -3.107  46.056  1.00 102.62 ? 201 VAL M O   1 
ATOM   3507  C CB  . VAL B 1 182 ? 38.365  -1.505  44.391  1.00 95.23  ? 201 VAL M CB  1 
ATOM   3508  C CG1 . VAL B 1 182 ? 38.215  -0.093  44.934  1.00 94.78  ? 201 VAL M CG1 1 
ATOM   3509  C CG2 . VAL B 1 182 ? 39.485  -1.575  43.364  1.00 94.96  ? 201 VAL M CG2 1 
ATOM   3510  N N   . PHE B 1 183 ? 37.575  -2.118  47.699  1.00 99.52  ? 202 PHE M N   1 
ATOM   3511  C CA  . PHE B 1 183 ? 36.538  -2.337  48.703  1.00 99.71  ? 202 PHE M CA  1 
ATOM   3512  C C   . PHE B 1 183 ? 35.218  -1.701  48.289  1.00 96.01  ? 202 PHE M C   1 
ATOM   3513  O O   . PHE B 1 183 ? 34.155  -2.326  48.410  1.00 89.55  ? 202 PHE M O   1 
ATOM   3514  C CB  . PHE B 1 183 ? 36.992  -1.796  50.058  1.00 103.14 ? 202 PHE M CB  1 
ATOM   3515  C CG  . PHE B 1 183 ? 38.287  -2.384  50.548  1.00 104.62 ? 202 PHE M CG  1 
ATOM   3516  C CD1 . PHE B 1 183 ? 38.416  -3.751  50.735  1.00 102.13 ? 202 PHE M CD1 1 
ATOM   3517  C CD2 . PHE B 1 183 ? 39.370  -1.569  50.833  1.00 100.81 ? 202 PHE M CD2 1 
ATOM   3518  C CE1 . PHE B 1 183 ? 39.602  -4.295  51.187  1.00 99.22  ? 202 PHE M CE1 1 
ATOM   3519  C CE2 . PHE B 1 183 ? 40.560  -2.107  51.286  1.00 98.71  ? 202 PHE M CE2 1 
ATOM   3520  C CZ  . PHE B 1 183 ? 40.675  -3.471  51.464  1.00 99.60  ? 202 PHE M CZ  1 
ATOM   3521  N N   . SER B 1 184 ? 35.269  -0.467  47.778  1.00 98.75  ? 203 SER M N   1 
ATOM   3522  C CA  . SER B 1 184 ? 34.055  0.243   47.390  1.00 95.43  ? 203 SER M CA  1 
ATOM   3523  C C   . SER B 1 184 ? 33.198  -0.575  46.436  1.00 91.17  ? 203 SER M C   1 
ATOM   3524  O O   . SER B 1 184 ? 31.969  -0.441  46.432  1.00 86.88  ? 203 SER M O   1 
ATOM   3525  C CB  . SER B 1 184 ? 34.416  1.584   46.745  1.00 93.89  ? 203 SER M CB  1 
ATOM   3526  O OG  . SER B 1 184 ? 35.531  2.179   47.386  1.00 97.57  ? 203 SER M OG  1 
ATOM   3527  N N   . GLN B 1 185 ? 33.822  -1.437  45.638  1.00 92.24  ? 204 GLN M N   1 
ATOM   3528  C CA  . GLN B 1 185 ? 33.119  -2.199  44.620  1.00 92.37  ? 204 GLN M CA  1 
ATOM   3529  C C   . GLN B 1 185 ? 32.611  -3.548  45.109  1.00 91.80  ? 204 GLN M C   1 
ATOM   3530  O O   . GLN B 1 185 ? 31.819  -4.181  44.404  1.00 95.46  ? 204 GLN M O   1 
ATOM   3531  C CB  . GLN B 1 185 ? 34.032  -2.418  43.409  1.00 92.02  ? 204 GLN M CB  1 
ATOM   3532  C CG  . GLN B 1 185 ? 34.762  -1.170  42.941  1.00 91.76  ? 204 GLN M CG  1 
ATOM   3533  C CD  . GLN B 1 185 ? 33.825  -0.004  42.699  1.00 91.27  ? 204 GLN M CD  1 
ATOM   3534  O OE1 . GLN B 1 185 ? 33.608  0.828   43.582  1.00 90.73  ? 204 GLN M OE1 1 
ATOM   3535  N NE2 . GLN B 1 185 ? 33.256  0.057   41.502  1.00 90.86  ? 204 GLN M NE2 1 
ATOM   3536  N N   . ILE B 1 186 ? 33.039  -4.009  46.285  1.00 89.57  ? 205 ILE M N   1 
ATOM   3537  C CA  . ILE B 1 186 ? 32.687  -5.345  46.744  1.00 91.94  ? 205 ILE M CA  1 
ATOM   3538  C C   . ILE B 1 186 ? 31.840  -5.319  48.008  1.00 95.27  ? 205 ILE M C   1 
ATOM   3539  O O   . ILE B 1 186 ? 31.593  -6.369  48.602  1.00 101.73 ? 205 ILE M O   1 
ATOM   3540  C CB  . ILE B 1 186 ? 33.942  -6.217  46.950  1.00 93.09  ? 205 ILE M CB  1 
ATOM   3541  C CG1 . ILE B 1 186 ? 34.736  -5.735  48.162  1.00 95.54  ? 205 ILE M CG1 1 
ATOM   3542  C CG2 . ILE B 1 186 ? 34.808  -6.215  45.701  1.00 95.79  ? 205 ILE M CG2 1 
ATOM   3543  C CD1 . ILE B 1 186 ? 35.917  -6.612  48.490  1.00 99.33  ? 205 ILE M CD1 1 
ATOM   3544  N N   . GLU B 1 187 ? 31.379  -4.144  48.430  1.00 96.82  ? 206 GLU M N   1 
ATOM   3545  C CA  . GLU B 1 187 ? 30.567  -4.043  49.636  1.00 94.17  ? 206 GLU M CA  1 
ATOM   3546  C C   . GLU B 1 187 ? 29.107  -4.327  49.310  1.00 91.75  ? 206 GLU M C   1 
ATOM   3547  O O   . GLU B 1 187 ? 28.518  -3.671  48.443  1.00 92.33  ? 206 GLU M O   1 
ATOM   3548  C CB  . GLU B 1 187 ? 30.697  -2.662  50.275  1.00 88.91  ? 206 GLU M CB  1 
ATOM   3549  C CG  . GLU B 1 187 ? 29.640  -2.411  51.344  1.00 90.60  ? 206 GLU M CG  1 
ATOM   3550  C CD  . GLU B 1 187 ? 30.024  -1.315  52.314  1.00 95.79  ? 206 GLU M CD  1 
ATOM   3551  O OE1 . GLU B 1 187 ? 31.027  -0.619  52.055  1.00 94.56  ? 206 GLU M OE1 1 
ATOM   3552  O OE2 . GLU B 1 187 ? 29.328  -1.157  53.342  1.00 94.85  ? 206 GLU M OE2 1 
ATOM   3553  N N   . ILE B 1 188 ? 28.526  -5.305  50.000  1.00 90.86  ? 207 ILE M N   1 
ATOM   3554  C CA  . ILE B 1 188 ? 27.076  -5.461  50.029  1.00 92.15  ? 207 ILE M CA  1 
ATOM   3555  C C   . ILE B 1 188 ? 26.552  -4.420  51.013  1.00 91.64  ? 207 ILE M C   1 
ATOM   3556  O O   . ILE B 1 188 ? 26.790  -4.516  52.220  1.00 90.96  ? 207 ILE M O   1 
ATOM   3557  C CB  . ILE B 1 188 ? 26.653  -6.881  50.427  1.00 92.58  ? 207 ILE M CB  1 
ATOM   3558  C CG1 . ILE B 1 188 ? 26.783  -7.850  49.245  1.00 92.22  ? 207 ILE M CG1 1 
ATOM   3559  C CG2 . ILE B 1 188 ? 25.214  -6.891  50.919  1.00 92.84  ? 207 ILE M CG2 1 
ATOM   3560  C CD1 . ILE B 1 188 ? 28.201  -8.219  48.868  1.00 92.67  ? 207 ILE M CD1 1 
ATOM   3561  N N   . LEU B 1 189 ? 25.869  -3.403  50.492  1.00 86.26  ? 208 LEU M N   1 
ATOM   3562  C CA  . LEU B 1 189 ? 25.540  -2.235  51.296  1.00 89.03  ? 208 LEU M CA  1 
ATOM   3563  C C   . LEU B 1 189 ? 24.590  -2.603  52.426  1.00 89.44  ? 208 LEU M C   1 
ATOM   3564  O O   . LEU B 1 189 ? 23.606  -3.318  52.221  1.00 84.83  ? 208 LEU M O   1 
ATOM   3565  C CB  . LEU B 1 189 ? 24.918  -1.150  50.415  1.00 87.62  ? 208 LEU M CB  1 
ATOM   3566  C CG  . LEU B 1 189 ? 25.864  -0.431  49.455  1.00 85.04  ? 208 LEU M CG  1 
ATOM   3567  C CD1 . LEU B 1 189 ? 25.091  0.547   48.592  1.00 88.40  ? 208 LEU M CD1 1 
ATOM   3568  C CD2 . LEU B 1 189 ? 26.964  0.282   50.220  1.00 85.31  ? 208 LEU M CD2 1 
ATOM   3569  N N   . THR B 1 190 ? 24.896  -2.120  53.622  1.00 88.22  ? 209 THR M N   1 
ATOM   3570  C CA  . THR B 1 190 ? 23.980  -2.300  54.740  1.00 89.73  ? 209 THR M CA  1 
ATOM   3571  C C   . THR B 1 190 ? 22.902  -1.220  54.703  1.00 88.29  ? 209 THR M C   1 
ATOM   3572  O O   . THR B 1 190 ? 23.211  -0.050  54.451  1.00 90.97  ? 209 THR M O   1 
ATOM   3573  C CB  . THR B 1 190 ? 24.729  -2.266  56.071  1.00 94.74  ? 209 THR M CB  1 
ATOM   3574  O OG1 . THR B 1 190 ? 23.806  -2.462  57.151  1.00 97.78  ? 209 THR M OG1 1 
ATOM   3575  C CG2 . THR B 1 190 ? 25.471  -0.949  56.257  1.00 97.47  ? 209 THR M CG2 1 
ATOM   3576  N N   . PRO B 1 191 ? 21.636  -1.578  54.894  1.00 90.01  ? 210 PRO M N   1 
ATOM   3577  C CA  . PRO B 1 191 ? 20.565  -0.574  54.904  1.00 88.53  ? 210 PRO M CA  1 
ATOM   3578  C C   . PRO B 1 191 ? 20.820  0.488   55.957  1.00 85.66  ? 210 PRO M C   1 
ATOM   3579  O O   . PRO B 1 191 ? 21.575  0.264   56.914  1.00 84.27  ? 210 PRO M O   1 
ATOM   3580  C CB  . PRO B 1 191 ? 19.306  -1.391  55.238  1.00 88.97  ? 210 PRO M CB  1 
ATOM   3581  C CG  . PRO B 1 191 ? 19.680  -2.833  55.090  1.00 91.43  ? 210 PRO M CG  1 
ATOM   3582  C CD  . PRO B 1 191 ? 21.129  -2.952  54.750  1.00 91.34  ? 210 PRO M CD  1 
ATOM   3583  N N   . PRO B 1 192 ? 20.217  1.663   55.814  1.00 85.39  ? 211 PRO M N   1 
ATOM   3584  C CA  . PRO B 1 192 ? 20.373  2.697   56.837  1.00 89.10  ? 211 PRO M CA  1 
ATOM   3585  C C   . PRO B 1 192 ? 19.533  2.399   58.068  1.00 91.86  ? 211 PRO M C   1 
ATOM   3586  O O   . PRO B 1 192 ? 18.458  1.800   57.992  1.00 88.73  ? 211 PRO M O   1 
ATOM   3587  C CB  . PRO B 1 192 ? 19.886  3.967   56.129  1.00 91.35  ? 211 PRO M CB  1 
ATOM   3588  C CG  . PRO B 1 192 ? 18.912  3.469   55.117  1.00 87.54  ? 211 PRO M CG  1 
ATOM   3589  C CD  . PRO B 1 192 ? 19.429  2.134   54.661  1.00 86.46  ? 211 PRO M CD  1 
ATOM   3590  N N   . GLN B 1 193 ? 20.052  2.819   59.220  1.00 101.00 ? 212 GLN M N   1 
ATOM   3591  C CA  . GLN B 1 193 ? 19.345  2.677   60.487  1.00 101.80 ? 212 GLN M CA  1 
ATOM   3592  C C   . GLN B 1 193 ? 18.500  3.925   60.708  1.00 97.33  ? 212 GLN M C   1 
ATOM   3593  O O   . GLN B 1 193 ? 19.024  5.043   60.692  1.00 88.70  ? 212 GLN M O   1 
ATOM   3594  C CB  . GLN B 1 193 ? 20.329  2.464   61.638  1.00 105.69 ? 212 GLN M CB  1 
ATOM   3595  C CG  . GLN B 1 193 ? 19.693  2.481   63.019  1.00 106.49 ? 212 GLN M CG  1 
ATOM   3596  C CD  . GLN B 1 193 ? 20.389  3.439   63.968  1.00 107.41 ? 212 GLN M CD  1 
ATOM   3597  O OE1 . GLN B 1 193 ? 21.606  3.377   64.149  1.00 108.07 ? 212 GLN M OE1 1 
ATOM   3598  N NE2 . GLN B 1 193 ? 19.618  4.336   64.576  1.00 102.49 ? 212 GLN M NE2 1 
ATOM   3599  N N   . MET B 1 194 ? 17.200  3.735   60.918  1.00 98.17  ? 213 MET M N   1 
ATOM   3600  C CA  . MET B 1 194 ? 16.226  4.815   60.826  1.00 99.41  ? 213 MET M CA  1 
ATOM   3601  C C   . MET B 1 194 ? 15.436  4.942   62.122  1.00 100.60 ? 213 MET M C   1 
ATOM   3602  O O   . MET B 1 194 ? 14.797  3.980   62.563  1.00 98.92  ? 213 MET M O   1 
ATOM   3603  C CB  . MET B 1 194 ? 15.284  4.573   59.647  1.00 99.17  ? 213 MET M CB  1 
ATOM   3604  C CG  . MET B 1 194 ? 14.201  5.612   59.490  1.00 99.30  ? 213 MET M CG  1 
ATOM   3605  S SD  . MET B 1 194 ? 13.054  5.151   58.185  1.00 101.05 ? 213 MET M SD  1 
ATOM   3606  C CE  . MET B 1 194 ? 11.941  6.543   58.235  1.00 99.63  ? 213 MET M CE  1 
ATOM   3607  N N   . THR B 1 195 ? 15.470  6.130   62.717  1.00 97.34  ? 214 THR M N   1 
ATOM   3608  C CA  . THR B 1 195 ? 14.645  6.485   63.861  1.00 99.90  ? 214 THR M CA  1 
ATOM   3609  C C   . THR B 1 195 ? 13.649  7.563   63.451  1.00 102.85 ? 214 THR M C   1 
ATOM   3610  O O   . THR B 1 195 ? 13.766  8.178   62.387  1.00 114.24 ? 214 THR M O   1 
ATOM   3611  C CB  . THR B 1 195 ? 15.510  6.975   65.027  1.00 101.14 ? 214 THR M CB  1 
ATOM   3612  O OG1 . THR B 1 195 ? 16.303  8.088   64.595  1.00 98.02  ? 214 THR M OG1 1 
ATOM   3613  C CG2 . THR B 1 195 ? 16.425  5.861   65.517  1.00 102.91 ? 214 THR M CG2 1 
ATOM   3614  N N   . ALA B 1 196 ? 12.659  7.799   64.311  1.00 108.07 ? 215 ALA M N   1 
ATOM   3615  C CA  . ALA B 1 196 ? 11.643  8.793   63.995  1.00 106.46 ? 215 ALA M CA  1 
ATOM   3616  C C   . ALA B 1 196 ? 10.935  9.244   65.265  1.00 106.80 ? 215 ALA M C   1 
ATOM   3617  O O   . ALA B 1 196 ? 10.692  8.441   66.168  1.00 108.18 ? 215 ALA M O   1 
ATOM   3618  C CB  . ALA B 1 196 ? 10.621  8.244   62.993  1.00 104.85 ? 215 ALA M CB  1 
ATOM   3619  N N   . LYS B 1 197 ? 10.609  10.534  65.316  1.00 115.44 ? 216 LYS M N   1 
ATOM   3620  C CA  . LYS B 1 197 ? 9.767   11.109  66.357  1.00 115.78 ? 216 LYS M CA  1 
ATOM   3621  C C   . LYS B 1 197 ? 8.472   11.591  65.714  1.00 115.35 ? 216 LYS M C   1 
ATOM   3622  O O   . LYS B 1 197 ? 8.494   12.490  64.865  1.00 118.39 ? 216 LYS M O   1 
ATOM   3623  C CB  . LYS B 1 197 ? 10.471  12.264  67.069  1.00 115.04 ? 216 LYS M CB  1 
ATOM   3624  C CG  . LYS B 1 197 ? 11.558  11.836  68.040  1.00 119.43 ? 216 LYS M CG  1 
ATOM   3625  C CD  . LYS B 1 197 ? 11.895  12.963  69.005  1.00 120.57 ? 216 LYS M CD  1 
ATOM   3626  C CE  . LYS B 1 197 ? 13.229  12.733  69.693  1.00 123.94 ? 216 LYS M CE  1 
ATOM   3627  N NZ  . LYS B 1 197 ? 14.149  13.885  69.488  1.00 129.97 ? 216 LYS M NZ  1 
ATOM   3628  N N   . CYS B 1 198 ? 7.352   10.996  66.115  1.00 125.26 ? 217 CYS M N   1 
ATOM   3629  C CA  . CYS B 1 198 ? 6.057   11.332  65.543  1.00 125.34 ? 217 CYS M CA  1 
ATOM   3630  C C   . CYS B 1 198 ? 5.246   12.206  66.490  1.00 120.85 ? 217 CYS M C   1 
ATOM   3631  O O   . CYS B 1 198 ? 5.487   12.260  67.696  1.00 123.48 ? 217 CYS M O   1 
ATOM   3632  C CB  . CYS B 1 198 ? 5.259   10.071  65.196  1.00 126.34 ? 217 CYS M CB  1 
ATOM   3633  S SG  . CYS B 1 198 ? 4.079   10.345  63.842  1.00 141.45 ? 217 CYS M SG  1 
ATOM   3634  N N   . ASN B 1 199 ? 4.264   12.894  65.917  1.00 123.58 ? 218 ASN M N   1 
ATOM   3635  C CA  . ASN B 1 199 ? 3.384   13.756  66.688  1.00 125.04 ? 218 ASN M CA  1 
ATOM   3636  C C   . ASN B 1 199 ? 2.020   13.752  66.007  1.00 129.08 ? 218 ASN M C   1 
ATOM   3637  O O   . ASN B 1 199 ? 1.858   13.214  64.912  1.00 141.53 ? 218 ASN M O   1 
ATOM   3638  C CB  . ASN B 1 199 ? 3.968   15.174  66.807  1.00 120.48 ? 218 ASN M CB  1 
ATOM   3639  C CG  . ASN B 1 199 ? 3.159   16.053  67.728  1.00 121.19 ? 218 ASN M CG  1 
ATOM   3640  O OD1 . ASN B 1 199 ? 2.233   15.571  68.374  1.00 125.21 ? 218 ASN M OD1 1 
ATOM   3641  N ND2 . ASN B 1 199 ? 3.486   17.336  67.807  1.00 124.82 ? 218 ASN M ND2 1 
ATOM   3642  N N   . LYS B 1 200 ? 1.033   14.362  66.674  1.00 126.60 ? 219 LYS M N   1 
ATOM   3643  C CA  . LYS B 1 200 ? -0.321  14.436  66.126  1.00 127.39 ? 219 LYS M CA  1 
ATOM   3644  C C   . LYS B 1 200 ? -0.344  15.089  64.749  1.00 122.56 ? 219 LYS M C   1 
ATOM   3645  O O   . LYS B 1 200 ? -1.034  14.615  63.838  1.00 123.53 ? 219 LYS M O   1 
ATOM   3646  C CB  . LYS B 1 200 ? -1.226  15.206  67.091  1.00 135.17 ? 219 LYS M CB  1 
ATOM   3647  C CG  . LYS B 1 200 ? -2.479  15.795  66.457  1.00 135.12 ? 219 LYS M CG  1 
ATOM   3648  C CD  . LYS B 1 200 ? -3.524  14.735  66.153  1.00 136.01 ? 219 LYS M CD  1 
ATOM   3649  C CE  . LYS B 1 200 ? -4.894  15.367  65.958  1.00 134.97 ? 219 LYS M CE  1 
ATOM   3650  N NZ  . LYS B 1 200 ? -5.975  14.347  65.902  1.00 136.13 ? 219 LYS M NZ  1 
ATOM   3651  N N   . THR B 1 201 ? 0.402   16.176  64.576  1.00 116.11 ? 220 THR M N   1 
ATOM   3652  C CA  . THR B 1 201 ? 0.368   16.943  63.339  1.00 117.24 ? 220 THR M CA  1 
ATOM   3653  C C   . THR B 1 201 ? 1.630   16.833  62.496  1.00 116.60 ? 220 THR M C   1 
ATOM   3654  O O   . THR B 1 201 ? 1.536   16.904  61.269  1.00 111.45 ? 220 THR M O   1 
ATOM   3655  C CB  . THR B 1 201 ? 0.098   18.421  63.642  1.00 116.52 ? 220 THR M CB  1 
ATOM   3656  O OG1 . THR B 1 201 ? 0.361   19.211  62.475  1.00 115.61 ? 220 THR M OG1 1 
ATOM   3657  C CG2 . THR B 1 201 ? 0.954   18.893  64.803  1.00 116.23 ? 220 THR M CG2 1 
ATOM   3658  N N   . HIS B 1 202 ? 2.801   16.666  63.105  1.00 112.99 ? 221 HIS M N   1 
ATOM   3659  C CA  . HIS B 1 202 ? 4.050   16.518  62.372  1.00 112.36 ? 221 HIS M CA  1 
ATOM   3660  C C   . HIS B 1 202 ? 4.712   15.192  62.724  1.00 112.03 ? 221 HIS M C   1 
ATOM   3661  O O   . HIS B 1 202 ? 4.309   14.495  63.658  1.00 123.97 ? 221 HIS M O   1 
ATOM   3662  C CB  . HIS B 1 202 ? 5.018   17.672  62.668  1.00 113.12 ? 221 HIS M CB  1 
ATOM   3663  C CG  . HIS B 1 202 ? 4.473   19.026  62.340  1.00 113.77 ? 221 HIS M CG  1 
ATOM   3664  N ND1 . HIS B 1 202 ? 3.472   19.625  63.074  1.00 111.99 ? 221 HIS M ND1 1 
ATOM   3665  C CD2 . HIS B 1 202 ? 4.796   19.903  61.360  1.00 115.93 ? 221 HIS M CD2 1 
ATOM   3666  C CE1 . HIS B 1 202 ? 3.199   20.810  62.559  1.00 117.33 ? 221 HIS M CE1 1 
ATOM   3667  N NE2 . HIS B 1 202 ? 3.988   21.003  61.517  1.00 117.37 ? 221 HIS M NE2 1 
ATOM   3668  N N   . SER B 1 203 ? 5.737   14.844  61.948  1.00 107.62 ? 222 SER M N   1 
ATOM   3669  C CA  . SER B 1 203 ? 6.600   13.719  62.283  1.00 105.87 ? 222 SER M CA  1 
ATOM   3670  C C   . SER B 1 203 ? 7.920   13.887  61.551  1.00 104.55 ? 222 SER M C   1 
ATOM   3671  O O   . SER B 1 203 ? 7.933   14.106  60.335  1.00 111.52 ? 222 SER M O   1 
ATOM   3672  C CB  . SER B 1 203 ? 5.956   12.383  61.910  1.00 103.41 ? 222 SER M CB  1 
ATOM   3673  O OG  . SER B 1 203 ? 6.468   11.885  60.689  1.00 100.60 ? 222 SER M OG  1 
ATOM   3674  N N   . PHE B 1 204 ? 9.021   13.784  62.287  1.00 103.54 ? 223 PHE M N   1 
ATOM   3675  C CA  . PHE B 1 204 ? 10.355  13.863  61.711  1.00 106.16 ? 223 PHE M CA  1 
ATOM   3676  C C   . PHE B 1 204 ? 10.987  12.477  61.710  1.00 107.62 ? 223 PHE M C   1 
ATOM   3677  O O   . PHE B 1 204 ? 10.908  11.746  62.703  1.00 115.52 ? 223 PHE M O   1 
ATOM   3678  C CB  . PHE B 1 204 ? 11.249  14.842  62.486  1.00 103.43 ? 223 PHE M CB  1 
ATOM   3679  C CG  . PHE B 1 204 ? 10.716  16.255  62.552  1.00 109.40 ? 223 PHE M CG  1 
ATOM   3680  C CD1 . PHE B 1 204 ? 9.681   16.675  61.731  1.00 108.18 ? 223 PHE M CD1 1 
ATOM   3681  C CD2 . PHE B 1 204 ? 11.259  17.163  63.448  1.00 116.30 ? 223 PHE M CD2 1 
ATOM   3682  C CE1 . PHE B 1 204 ? 9.200   17.971  61.803  1.00 115.00 ? 223 PHE M CE1 1 
ATOM   3683  C CE2 . PHE B 1 204 ? 10.782  18.460  63.524  1.00 117.76 ? 223 PHE M CE2 1 
ATOM   3684  C CZ  . PHE B 1 204 ? 9.752   18.864  62.700  1.00 119.79 ? 223 PHE M CZ  1 
ATOM   3685  N N   . MET B 1 205 ? 11.601  12.108  60.590  1.00 100.78 ? 224 MET M N   1 
ATOM   3686  C CA  . MET B 1 205 ? 12.332  10.856  60.476  1.00 92.53  ? 224 MET M CA  1 
ATOM   3687  C C   . MET B 1 205 ? 13.784  11.172  60.165  1.00 93.21  ? 224 MET M C   1 
ATOM   3688  O O   . MET B 1 205 ? 14.073  12.103  59.410  1.00 97.69  ? 224 MET M O   1 
ATOM   3689  C CB  . MET B 1 205 ? 11.743  9.959   59.382  1.00 88.31  ? 224 MET M CB  1 
ATOM   3690  C CG  . MET B 1 205 ? 10.245  9.734   59.495  1.00 91.13  ? 224 MET M CG  1 
ATOM   3691  S SD  . MET B 1 205 ? 9.539   8.962   58.024  1.00 95.10  ? 224 MET M SD  1 
ATOM   3692  C CE  . MET B 1 205 ? 8.356   10.205  57.514  1.00 97.11  ? 224 MET M CE  1 
ATOM   3693  N N   . HIS B 1 206 ? 14.692  10.397  60.751  1.00 91.96  ? 225 HIS M N   1 
ATOM   3694  C CA  . HIS B 1 206 ? 16.123  10.600  60.592  1.00 96.54  ? 225 HIS M CA  1 
ATOM   3695  C C   . HIS B 1 206 ? 16.783  9.237   60.446  1.00 96.16  ? 225 HIS M C   1 
ATOM   3696  O O   . HIS B 1 206 ? 16.240  8.225   60.897  1.00 97.51  ? 225 HIS M O   1 
ATOM   3697  C CB  . HIS B 1 206 ? 16.696  11.377  61.790  1.00 100.44 ? 225 HIS M CB  1 
ATOM   3698  C CG  . HIS B 1 206 ? 18.183  11.542  61.759  1.00 105.43 ? 225 HIS M CG  1 
ATOM   3699  N ND1 . HIS B 1 206 ? 18.846  12.145  60.712  1.00 106.25 ? 225 HIS M ND1 1 
ATOM   3700  C CD2 . HIS B 1 206 ? 19.136  11.185  62.653  1.00 108.45 ? 225 HIS M CD2 1 
ATOM   3701  C CE1 . HIS B 1 206 ? 20.144  12.150  60.960  1.00 106.24 ? 225 HIS M CE1 1 
ATOM   3702  N NE2 . HIS B 1 206 ? 20.346  11.573  62.132  1.00 110.27 ? 225 HIS M NE2 1 
ATOM   3703  N N   . TRP B 1 207 ? 17.942  9.201   59.790  1.00 93.88  ? 226 TRP M N   1 
ATOM   3704  C CA  . TRP B 1 207 ? 18.634  7.931   59.619  1.00 97.37  ? 226 TRP M CA  1 
ATOM   3705  C C   . TRP B 1 207 ? 20.135  8.145   59.491  1.00 95.63  ? 226 TRP M C   1 
ATOM   3706  O O   . TRP B 1 207 ? 20.602  9.212   59.082  1.00 89.87  ? 226 TRP M O   1 
ATOM   3707  C CB  . TRP B 1 207 ? 18.118  7.155   58.400  1.00 96.64  ? 226 TRP M CB  1 
ATOM   3708  C CG  . TRP B 1 207 ? 18.108  7.937   57.125  1.00 94.99  ? 226 TRP M CG  1 
ATOM   3709  C CD1 . TRP B 1 207 ? 19.161  8.148   56.284  1.00 95.14  ? 226 TRP M CD1 1 
ATOM   3710  C CD2 . TRP B 1 207 ? 16.982  8.594   56.530  1.00 91.78  ? 226 TRP M CD2 1 
ATOM   3711  N NE1 . TRP B 1 207 ? 18.765  8.905   55.207  1.00 87.82  ? 226 TRP M NE1 1 
ATOM   3712  C CE2 . TRP B 1 207 ? 17.430  9.188   55.334  1.00 87.91  ? 226 TRP M CE2 1 
ATOM   3713  C CE3 . TRP B 1 207 ? 15.638  8.732   56.890  1.00 90.70  ? 226 TRP M CE3 1 
ATOM   3714  C CZ2 . TRP B 1 207 ? 16.584  9.916   54.500  1.00 86.12  ? 226 TRP M CZ2 1 
ATOM   3715  C CZ3 . TRP B 1 207 ? 14.800  9.456   56.060  1.00 86.99  ? 226 TRP M CZ3 1 
ATOM   3716  C CH2 . TRP B 1 207 ? 15.277  10.039  54.881  1.00 84.10  ? 226 TRP M CH2 1 
ATOM   3717  N N   . LYS B 1 208 ? 20.879  7.108   59.862  1.00 91.73  ? 227 LYS M N   1 
ATOM   3718  C CA  . LYS B 1 208 ? 22.315  7.030   59.650  1.00 91.46  ? 227 LYS M CA  1 
ATOM   3719  C C   . LYS B 1 208 ? 22.599  5.987   58.582  1.00 88.32  ? 227 LYS M C   1 
ATOM   3720  O O   . LYS B 1 208 ? 21.991  4.910   58.575  1.00 82.51  ? 227 LYS M O   1 
ATOM   3721  C CB  . LYS B 1 208 ? 23.061  6.658   60.936  1.00 96.79  ? 227 LYS M CB  1 
ATOM   3722  C CG  . LYS B 1 208 ? 23.015  7.700   62.042  1.00 104.97 ? 227 LYS M CG  1 
ATOM   3723  C CD  . LYS B 1 208 ? 23.625  7.140   63.324  1.00 109.25 ? 227 LYS M CD  1 
ATOM   3724  C CE  . LYS B 1 208 ? 23.395  8.062   64.512  1.00 112.29 ? 227 LYS M CE  1 
ATOM   3725  N NZ  . LYS B 1 208 ? 23.864  7.439   65.783  1.00 114.68 ? 227 LYS M NZ  1 
ATOM   3726  N N   . MET B 1 209 ? 23.514  6.317   57.676  1.00 88.13  ? 228 MET M N   1 
ATOM   3727  C CA  . MET B 1 209 ? 23.993  5.395   56.655  1.00 88.00  ? 228 MET M CA  1 
ATOM   3728  C C   . MET B 1 209 ? 25.463  5.121   56.925  1.00 86.83  ? 228 MET M C   1 
ATOM   3729  O O   . MET B 1 209 ? 26.274  6.053   56.959  1.00 84.18  ? 228 MET M O   1 
ATOM   3730  C CB  . MET B 1 209 ? 23.802  5.965   55.252  1.00 88.32  ? 228 MET M CB  1 
ATOM   3731  C CG  . MET B 1 209 ? 24.304  5.044   54.154  1.00 87.34  ? 228 MET M CG  1 
ATOM   3732  S SD  . MET B 1 209 ? 23.534  3.412   54.206  1.00 89.13  ? 228 MET M SD  1 
ATOM   3733  C CE  . MET B 1 209 ? 24.505  2.542   52.978  1.00 88.34  ? 228 MET M CE  1 
ATOM   3734  N N   . ARG B 1 210 ? 25.802  3.849   57.112  1.00 89.65  ? 229 ARG M N   1 
ATOM   3735  C CA  . ARG B 1 210 ? 27.126  3.453   57.565  1.00 90.28  ? 229 ARG M CA  1 
ATOM   3736  C C   . ARG B 1 210 ? 27.812  2.622   56.493  1.00 87.42  ? 229 ARG M C   1 
ATOM   3737  O O   . ARG B 1 210 ? 27.237  1.653   55.989  1.00 84.32  ? 229 ARG M O   1 
ATOM   3738  C CB  . ARG B 1 210 ? 27.038  2.665   58.876  1.00 97.98  ? 229 ARG M CB  1 
ATOM   3739  C CG  . ARG B 1 210 ? 26.026  3.232   59.860  1.00 100.50 ? 229 ARG M CG  1 
ATOM   3740  C CD  . ARG B 1 210 ? 25.992  2.448   61.160  1.00 98.11  ? 229 ARG M CD  1 
ATOM   3741  N NE  . ARG B 1 210 ? 25.704  3.322   62.292  1.00 95.46  ? 229 ARG M NE  1 
ATOM   3742  C CZ  . ARG B 1 210 ? 26.632  3.994   62.967  1.00 98.90  ? 229 ARG M CZ  1 
ATOM   3743  N NH1 . ARG B 1 210 ? 27.911  3.888   62.626  1.00 95.19  ? 229 ARG M NH1 1 
ATOM   3744  N NH2 . ARG B 1 210 ? 26.281  4.772   63.983  1.00 97.27  ? 229 ARG M NH2 1 
ATOM   3745  N N   . SER B 1 211 ? 29.036  3.013   56.150  1.00 92.89  ? 230 SER M N   1 
ATOM   3746  C CA  . SER B 1 211 ? 29.918  2.264   55.266  1.00 91.36  ? 230 SER M CA  1 
ATOM   3747  C C   . SER B 1 211 ? 31.285  2.924   55.308  1.00 92.05  ? 230 SER M C   1 
ATOM   3748  O O   . SER B 1 211 ? 31.389  4.146   55.437  1.00 92.40  ? 230 SER M O   1 
ATOM   3749  C CB  . SER B 1 211 ? 29.394  2.219   53.827  1.00 91.89  ? 230 SER M CB  1 
ATOM   3750  O OG  . SER B 1 211 ? 30.414  1.792   52.940  1.00 89.98  ? 230 SER M OG  1 
ATOM   3751  N N   . HIS B 1 212 ? 32.330  2.106   55.197  1.00 95.43  ? 231 HIS M N   1 
ATOM   3752  C CA  . HIS B 1 212 ? 33.692  2.610   55.297  1.00 101.32 ? 231 HIS M CA  1 
ATOM   3753  C C   . HIS B 1 212 ? 34.296  2.981   53.952  1.00 99.02  ? 231 HIS M C   1 
ATOM   3754  O O   . HIS B 1 212 ? 35.300  3.703   53.920  1.00 96.54  ? 231 HIS M O   1 
ATOM   3755  C CB  . HIS B 1 212 ? 34.592  1.573   55.977  1.00 105.31 ? 231 HIS M CB  1 
ATOM   3756  C CG  . HIS B 1 212 ? 34.209  1.277   57.393  1.00 104.84 ? 231 HIS M CG  1 
ATOM   3757  N ND1 . HIS B 1 212 ? 34.275  2.220   58.396  1.00 100.49 ? 231 HIS M ND1 1 
ATOM   3758  C CD2 . HIS B 1 212 ? 33.748  0.143   57.973  1.00 103.85 ? 231 HIS M CD2 1 
ATOM   3759  C CE1 . HIS B 1 212 ? 33.875  1.679   59.533  1.00 106.18 ? 231 HIS M CE1 1 
ATOM   3760  N NE2 . HIS B 1 212 ? 33.550  0.420   59.303  1.00 105.53 ? 231 HIS M NE2 1 
ATOM   3761  N N   . PHE B 1 213 ? 33.711  2.517   52.847  1.00 98.43  ? 232 PHE M N   1 
ATOM   3762  C CA  . PHE B 1 213 ? 34.319  2.670   51.534  1.00 99.13  ? 232 PHE M CA  1 
ATOM   3763  C C   . PHE B 1 213 ? 33.395  3.271   50.483  1.00 97.86  ? 232 PHE M C   1 
ATOM   3764  O O   . PHE B 1 213 ? 33.864  3.566   49.378  1.00 96.31  ? 232 PHE M O   1 
ATOM   3765  C CB  . PHE B 1 213 ? 34.843  1.315   51.035  1.00 96.44  ? 232 PHE M CB  1 
ATOM   3766  C CG  . PHE B 1 213 ? 35.398  0.447   52.130  1.00 97.96  ? 232 PHE M CG  1 
ATOM   3767  C CD1 . PHE B 1 213 ? 34.584  -0.451  52.802  1.00 99.47  ? 232 PHE M CD1 1 
ATOM   3768  C CD2 . PHE B 1 213 ? 36.727  0.549   52.508  1.00 99.21  ? 232 PHE M CD2 1 
ATOM   3769  C CE1 . PHE B 1 213 ? 35.086  -1.241  53.817  1.00 95.26  ? 232 PHE M CE1 1 
ATOM   3770  C CE2 . PHE B 1 213 ? 37.236  -0.243  53.520  1.00 99.29  ? 232 PHE M CE2 1 
ATOM   3771  C CZ  . PHE B 1 213 ? 36.413  -1.139  54.175  1.00 98.24  ? 232 PHE M CZ  1 
ATOM   3772  N N   . ASN B 1 214 ? 32.112  3.458   50.782  1.00 94.63  ? 233 ASN M N   1 
ATOM   3773  C CA  . ASN B 1 214 ? 31.194  4.196   49.923  1.00 90.48  ? 233 ASN M CA  1 
ATOM   3774  C C   . ASN B 1 214 ? 30.624  5.347   50.737  1.00 92.65  ? 233 ASN M C   1 
ATOM   3775  O O   . ASN B 1 214 ? 30.049  5.126   51.808  1.00 95.34  ? 233 ASN M O   1 
ATOM   3776  C CB  . ASN B 1 214 ? 30.083  3.289   49.392  1.00 90.25  ? 233 ASN M CB  1 
ATOM   3777  C CG  . ASN B 1 214 ? 30.624  2.043   48.720  1.00 92.06  ? 233 ASN M CG  1 
ATOM   3778  O OD1 . ASN B 1 214 ? 31.007  2.070   47.550  1.00 87.19  ? 233 ASN M OD1 1 
ATOM   3779  N ND2 . ASN B 1 214 ? 30.667  0.943   49.463  1.00 96.26  ? 233 ASN M ND2 1 
ATOM   3780  N N   . ARG B 1 215 ? 30.789  6.571   50.237  1.00 91.28  ? 234 ARG M N   1 
ATOM   3781  C CA  . ARG B 1 215 ? 30.527  7.776   51.014  1.00 90.54  ? 234 ARG M CA  1 
ATOM   3782  C C   . ARG B 1 215 ? 29.284  8.531   50.570  1.00 89.89  ? 234 ARG M C   1 
ATOM   3783  O O   . ARG B 1 215 ? 28.490  8.957   51.413  1.00 94.67  ? 234 ARG M O   1 
ATOM   3784  C CB  . ARG B 1 215 ? 31.749  8.704   50.954  1.00 92.49  ? 234 ARG M CB  1 
ATOM   3785  C CG  . ARG B 1 215 ? 32.972  8.134   51.653  1.00 99.55  ? 234 ARG M CG  1 
ATOM   3786  C CD  . ARG B 1 215 ? 32.630  7.704   53.069  1.00 106.16 ? 234 ARG M CD  1 
ATOM   3787  N NE  . ARG B 1 215 ? 33.799  7.248   53.816  1.00 105.66 ? 234 ARG M NE  1 
ATOM   3788  C CZ  . ARG B 1 215 ? 33.757  6.837   55.080  1.00 101.49 ? 234 ARG M CZ  1 
ATOM   3789  N NH1 . ARG B 1 215 ? 32.606  6.834   55.738  1.00 102.17 ? 234 ARG M NH1 1 
ATOM   3790  N NH2 . ARG B 1 215 ? 34.865  6.432   55.686  1.00 102.65 ? 234 ARG M NH2 1 
ATOM   3791  N N   . LYS B 1 216 ? 29.090  8.720   49.268  1.00 90.44  ? 235 LYS M N   1 
ATOM   3792  C CA  . LYS B 1 216 ? 27.969  9.492   48.748  1.00 84.58  ? 235 LYS M CA  1 
ATOM   3793  C C   . LYS B 1 216 ? 26.838  8.551   48.350  1.00 82.15  ? 235 LYS M C   1 
ATOM   3794  O O   . LYS B 1 216 ? 27.070  7.551   47.662  1.00 78.18  ? 235 LYS M O   1 
ATOM   3795  C CB  . LYS B 1 216 ? 28.406  10.341  47.553  1.00 87.11  ? 235 LYS M CB  1 
ATOM   3796  C CG  . LYS B 1 216 ? 29.574  11.273  47.851  1.00 91.83  ? 235 LYS M CG  1 
ATOM   3797  C CD  . LYS B 1 216 ? 29.139  12.468  48.689  1.00 94.63  ? 235 LYS M CD  1 
ATOM   3798  C CE  . LYS B 1 216 ? 30.328  13.333  49.081  1.00 96.76  ? 235 LYS M CE  1 
ATOM   3799  N NZ  . LYS B 1 216 ? 29.926  14.738  49.386  1.00 96.64  ? 235 LYS M NZ  1 
ATOM   3800  N N   . PHE B 1 217 ? 25.618  8.877   48.777  1.00 82.59  ? 236 PHE M N   1 
ATOM   3801  C CA  . PHE B 1 217 ? 24.472  7.995   48.595  1.00 83.09  ? 236 PHE M CA  1 
ATOM   3802  C C   . PHE B 1 217 ? 23.268  8.798   48.114  1.00 82.77  ? 236 PHE M C   1 
ATOM   3803  O O   . PHE B 1 217 ? 23.312  10.028  48.000  1.00 85.01  ? 236 PHE M O   1 
ATOM   3804  C CB  . PHE B 1 217 ? 24.128  7.259   49.896  1.00 83.99  ? 236 PHE M CB  1 
ATOM   3805  C CG  . PHE B 1 217 ? 25.134  6.219   50.294  1.00 83.41  ? 236 PHE M CG  1 
ATOM   3806  C CD1 . PHE B 1 217 ? 25.134  4.968   49.698  1.00 83.84  ? 236 PHE M CD1 1 
ATOM   3807  C CD2 . PHE B 1 217 ? 26.078  6.488   51.270  1.00 80.60  ? 236 PHE M CD2 1 
ATOM   3808  C CE1 . PHE B 1 217 ? 26.058  4.007   50.066  1.00 82.08  ? 236 PHE M CE1 1 
ATOM   3809  C CE2 . PHE B 1 217 ? 27.003  5.531   51.641  1.00 83.03  ? 236 PHE M CE2 1 
ATOM   3810  C CZ  . PHE B 1 217 ? 26.993  4.289   51.038  1.00 81.69  ? 236 PHE M CZ  1 
ATOM   3811  N N   . ARG B 1 218 ? 22.184  8.077   47.825  1.00 78.22  ? 237 ARG M N   1 
ATOM   3812  C CA  . ARG B 1 218 ? 20.884  8.676   47.544  1.00 80.76  ? 237 ARG M CA  1 
ATOM   3813  C C   . ARG B 1 218 ? 19.820  7.700   48.023  1.00 82.39  ? 237 ARG M C   1 
ATOM   3814  O O   . ARG B 1 218 ? 19.901  6.507   47.723  1.00 81.33  ? 237 ARG M O   1 
ATOM   3815  C CB  . ARG B 1 218 ? 20.718  8.976   46.050  1.00 84.93  ? 237 ARG M CB  1 
ATOM   3816  C CG  . ARG B 1 218 ? 19.526  9.854   45.706  1.00 86.46  ? 237 ARG M CG  1 
ATOM   3817  C CD  . ARG B 1 218 ? 19.683  10.464  44.318  1.00 84.90  ? 237 ARG M CD  1 
ATOM   3818  N NE  . ARG B 1 218 ? 21.050  10.924  44.078  1.00 81.26  ? 237 ARG M NE  1 
ATOM   3819  C CZ  . ARG B 1 218 ? 21.821  10.497  43.083  1.00 75.23  ? 237 ARG M CZ  1 
ATOM   3820  N NH1 . ARG B 1 218 ? 21.359  9.603   42.219  1.00 72.55  ? 237 ARG M NH1 1 
ATOM   3821  N NH2 . ARG B 1 218 ? 23.052  10.968  42.947  1.00 70.35  ? 237 ARG M NH2 1 
ATOM   3822  N N   . TYR B 1 219 ? 18.830  8.191   48.758  1.00 83.21  ? 238 TYR M N   1 
ATOM   3823  C CA  . TYR B 1 219 ? 17.942  7.316   49.509  1.00 79.75  ? 238 TYR M CA  1 
ATOM   3824  C C   . TYR B 1 219 ? 16.543  7.263   48.903  1.00 78.26  ? 238 TYR M C   1 
ATOM   3825  O O   . TYR B 1 219 ? 16.176  8.045   48.024  1.00 77.67  ? 238 TYR M O   1 
ATOM   3826  C CB  . TYR B 1 219 ? 17.886  7.753   50.975  1.00 80.65  ? 238 TYR M CB  1 
ATOM   3827  C CG  . TYR B 1 219 ? 19.258  7.982   51.567  1.00 82.08  ? 238 TYR M CG  1 
ATOM   3828  C CD1 . TYR B 1 219 ? 20.087  6.913   51.885  1.00 81.68  ? 238 TYR M CD1 1 
ATOM   3829  C CD2 . TYR B 1 219 ? 19.728  9.264   51.806  1.00 83.28  ? 238 TYR M CD2 1 
ATOM   3830  C CE1 . TYR B 1 219 ? 21.345  7.118   52.424  1.00 80.26  ? 238 TYR M CE1 1 
ATOM   3831  C CE2 . TYR B 1 219 ? 20.982  9.479   52.348  1.00 81.62  ? 238 TYR M CE2 1 
ATOM   3832  C CZ  . TYR B 1 219 ? 21.786  8.404   52.654  1.00 80.46  ? 238 TYR M CZ  1 
ATOM   3833  O OH  . TYR B 1 219 ? 23.033  8.624   53.191  1.00 86.75  ? 238 TYR M OH  1 
ATOM   3834  N N   . GLU B 1 220 ? 15.769  6.297   49.395  1.00 74.88  ? 239 GLU M N   1 
ATOM   3835  C CA  . GLU B 1 220 ? 14.432  5.984   48.905  1.00 76.75  ? 239 GLU M CA  1 
ATOM   3836  C C   . GLU B 1 220 ? 13.535  5.669   50.090  1.00 77.22  ? 239 GLU M C   1 
ATOM   3837  O O   . GLU B 1 220 ? 13.903  4.845   50.934  1.00 82.41  ? 239 GLU M O   1 
ATOM   3838  C CB  . GLU B 1 220 ? 14.465  4.781   47.955  1.00 77.71  ? 239 GLU M CB  1 
ATOM   3839  C CG  . GLU B 1 220 ? 13.909  5.040   46.581  1.00 79.24  ? 239 GLU M CG  1 
ATOM   3840  C CD  . GLU B 1 220 ? 14.078  3.858   45.650  1.00 80.31  ? 239 GLU M CD  1 
ATOM   3841  O OE1 . GLU B 1 220 ? 13.060  3.218   45.310  1.00 80.30  ? 239 GLU M OE1 1 
ATOM   3842  O OE2 . GLU B 1 220 ? 15.228  3.574   45.254  1.00 75.30  ? 239 GLU M OE2 1 
ATOM   3843  N N   . LEU B 1 221 ? 12.361  6.301   50.149  1.00 75.40  ? 240 LEU M N   1 
ATOM   3844  C CA  . LEU B 1 221 ? 11.417  6.093   51.241  1.00 74.99  ? 240 LEU M CA  1 
ATOM   3845  C C   . LEU B 1 221 ? 10.140  5.476   50.694  1.00 76.57  ? 240 LEU M C   1 
ATOM   3846  O O   . LEU B 1 221 ? 9.507   6.048   49.800  1.00 83.27  ? 240 LEU M O   1 
ATOM   3847  C CB  . LEU B 1 221 ? 11.097  7.405   51.956  1.00 75.41  ? 240 LEU M CB  1 
ATOM   3848  C CG  . LEU B 1 221 ? 12.201  8.051   52.792  1.00 76.19  ? 240 LEU M CG  1 
ATOM   3849  C CD1 . LEU B 1 221 ? 11.664  9.271   53.514  1.00 77.63  ? 240 LEU M CD1 1 
ATOM   3850  C CD2 . LEU B 1 221 ? 12.761  7.054   53.782  1.00 77.42  ? 240 LEU M CD2 1 
ATOM   3851  N N   . GLN B 1 222 ? 9.760   4.319   51.231  1.00 83.08  ? 241 GLN M N   1 
ATOM   3852  C CA  . GLN B 1 222 ? 8.448   3.738   50.983  1.00 82.85  ? 241 GLN M CA  1 
ATOM   3853  C C   . GLN B 1 222 ? 7.576   3.974   52.208  1.00 84.49  ? 241 GLN M C   1 
ATOM   3854  O O   . GLN B 1 222 ? 7.883   3.477   53.299  1.00 84.89  ? 241 GLN M O   1 
ATOM   3855  C CB  . GLN B 1 222 ? 8.538   2.244   50.671  1.00 82.75  ? 241 GLN M CB  1 
ATOM   3856  C CG  . GLN B 1 222 ? 8.582   1.930   49.186  1.00 85.02  ? 241 GLN M CG  1 
ATOM   3857  C CD  . GLN B 1 222 ? 8.303   0.470   48.887  1.00 87.06  ? 241 GLN M CD  1 
ATOM   3858  O OE1 . GLN B 1 222 ? 8.173   -0.350  49.798  1.00 87.38  ? 241 GLN M OE1 1 
ATOM   3859  N NE2 . GLN B 1 222 ? 8.197   0.139   47.605  1.00 89.46  ? 241 GLN M NE2 1 
ATOM   3860  N N   . ILE B 1 223 ? 6.502   4.739   52.024  1.00 79.94  ? 242 ILE M N   1 
ATOM   3861  C CA  . ILE B 1 223 ? 5.535   5.051   53.067  1.00 80.97  ? 242 ILE M CA  1 
ATOM   3862  C C   . ILE B 1 223 ? 4.233   4.347   52.718  1.00 81.31  ? 242 ILE M C   1 
ATOM   3863  O O   . ILE B 1 223 ? 3.705   4.519   51.610  1.00 80.75  ? 242 ILE M O   1 
ATOM   3864  C CB  . ILE B 1 223 ? 5.317   6.568   53.191  1.00 80.95  ? 242 ILE M CB  1 
ATOM   3865  C CG1 . ILE B 1 223 ? 6.638   7.315   53.003  1.00 80.26  ? 242 ILE M CG1 1 
ATOM   3866  C CG2 . ILE B 1 223 ? 4.686   6.906   54.531  1.00 82.12  ? 242 ILE M CG2 1 
ATOM   3867  C CD1 . ILE B 1 223 ? 7.529   7.302   54.212  1.00 80.83  ? 242 ILE M CD1 1 
ATOM   3868  N N   . GLN B 1 224 ? 3.718   3.555   53.659  1.00 91.97  ? 243 GLN M N   1 
ATOM   3869  C CA  . GLN B 1 224 ? 2.484   2.799   53.490  1.00 91.68  ? 243 GLN M CA  1 
ATOM   3870  C C   . GLN B 1 224 ? 1.520   3.253   54.577  1.00 92.46  ? 243 GLN M C   1 
ATOM   3871  O O   . GLN B 1 224 ? 1.761   3.019   55.768  1.00 94.94  ? 243 GLN M O   1 
ATOM   3872  C CB  . GLN B 1 224 ? 2.747   1.295   53.570  1.00 91.84  ? 243 GLN M CB  1 
ATOM   3873  C CG  . GLN B 1 224 ? 1.504   0.415   53.538  1.00 94.03  ? 243 GLN M CG  1 
ATOM   3874  C CD  . GLN B 1 224 ? 0.660   0.630   52.295  1.00 94.92  ? 243 GLN M CD  1 
ATOM   3875  O OE1 . GLN B 1 224 ? -0.132  1.570   52.221  1.00 94.62  ? 243 GLN M OE1 1 
ATOM   3876  N NE2 . GLN B 1 224 ? 0.818   -0.253  51.314  1.00 94.00  ? 243 GLN M NE2 1 
ATOM   3877  N N   . LYS B 1 225 ? 0.437   3.907   54.165  1.00 99.93  ? 244 LYS M N   1 
ATOM   3878  C CA  . LYS B 1 225 ? -0.555  4.479   55.067  1.00 104.67 ? 244 LYS M CA  1 
ATOM   3879  C C   . LYS B 1 225 ? -1.940  3.930   54.753  1.00 105.26 ? 244 LYS M C   1 
ATOM   3880  O O   . LYS B 1 225 ? -2.315  3.822   53.583  1.00 109.60 ? 244 LYS M O   1 
ATOM   3881  C CB  . LYS B 1 225 ? -0.656  5.999   54.867  1.00 102.94 ? 244 LYS M CB  1 
ATOM   3882  C CG  . LYS B 1 225 ? -1.079  6.784   56.092  1.00 99.79  ? 244 LYS M CG  1 
ATOM   3883  C CD  . LYS B 1 225 ? -1.310  8.248   55.749  1.00 98.81  ? 244 LYS M CD  1 
ATOM   3884  C CE  . LYS B 1 225 ? -2.397  8.828   56.631  1.00 101.46 ? 244 LYS M CE  1 
ATOM   3885  N NZ  . LYS B 1 225 ? -2.479  10.307  56.526  1.00 102.13 ? 244 LYS M NZ  1 
ATOM   3886  N N   . ARG B 1 226 ? -2.655  3.579   55.829  1.00 104.77 ? 245 ARG M N   1 
ATOM   3887  C CA  . ARG B 1 226 ? -3.982  2.926   55.683  1.00 105.26 ? 245 ARG M CA  1 
ATOM   3888  C C   . ARG B 1 226 ? -3.774  1.856   54.617  1.00 100.34 ? 245 ARG M C   1 
ATOM   3889  O O   . ARG B 1 226 ? -2.649  1.322   54.536  1.00 100.28 ? 245 ARG M O   1 
ATOM   3890  C CB  . ARG B 1 226 ? -5.077  3.917   55.284  1.00 30.00  ? 245 ARG M CB  1 
ATOM   3891  C CG  . ARG B 1 226 ? -5.402  4.946   56.355  1.00 30.00  ? 245 ARG M CG  1 
ATOM   3892  C CD  . ARG B 1 226 ? -6.523  5.902   55.978  1.00 30.00  ? 245 ARG M CD  1 
ATOM   3893  N NE  . ARG B 1 226 ? -6.751  6.912   57.007  1.00 30.00  ? 245 ARG M NE  1 
ATOM   3894  C CZ  . ARG B 1 226 ? -7.589  7.930   56.878  1.00 30.00  ? 245 ARG M CZ  1 
ATOM   3895  N NH1 . ARG B 1 226 ? -8.290  8.078   55.761  1.00 30.00  ? 245 ARG M NH1 1 
ATOM   3896  N NH2 . ARG B 1 226 ? -7.733  8.804   57.867  1.00 30.00  ? 245 ARG M NH2 1 
ATOM   3897  N N   . MET B 1 227 ? -4.804  1.552   53.832  1.00 96.33  ? 246 MET M N   1 
ATOM   3898  C CA  . MET B 1 227 ? -4.613  0.617   52.737  1.00 97.40  ? 246 MET M CA  1 
ATOM   3899  C C   . MET B 1 227 ? -4.680  1.547   51.540  1.00 97.63  ? 246 MET M C   1 
ATOM   3900  O O   . MET B 1 227 ? -5.544  1.396   50.667  1.00 92.77  ? 246 MET M O   1 
ATOM   3901  C CB  . MET B 1 227 ? -5.710  -0.445  52.679  1.00 97.28  ? 246 MET M CB  1 
ATOM   3902  C CG  . MET B 1 227 ? -5.582  -1.516  53.725  1.00 98.51  ? 246 MET M CG  1 
ATOM   3903  S SD  . MET B 1 227 ? -6.962  -2.650  53.663  1.00 108.31 ? 246 MET M SD  1 
ATOM   3904  C CE  . MET B 1 227 ? -6.918  -3.126  51.947  1.00 104.15 ? 246 MET M CE  1 
ATOM   3905  N N   . GLN B 1 228 ? -3.809  2.559   51.537  1.00 96.38  ? 247 GLN M N   1 
ATOM   3906  C CA  . GLN B 1 228 ? -3.631  3.475   50.424  1.00 93.51  ? 247 GLN M CA  1 
ATOM   3907  C C   . GLN B 1 228 ? -2.526  2.958   49.522  1.00 94.47  ? 247 GLN M C   1 
ATOM   3908  O O   . GLN B 1 228 ? -1.758  2.077   49.917  1.00 96.05  ? 247 GLN M O   1 
ATOM   3909  C CB  . GLN B 1 228 ? -3.291  4.880   50.928  1.00 95.61  ? 247 GLN M CB  1 
ATOM   3910  C CG  . GLN B 1 228 ? -4.316  5.490   51.862  1.00 98.37  ? 247 GLN M CG  1 
ATOM   3911  C CD  . GLN B 1 228 ? -4.082  6.967   52.113  1.00 100.24 ? 247 GLN M CD  1 
ATOM   3912  O OE1 . GLN B 1 228 ? -3.151  7.568   51.571  1.00 102.16 ? 247 GLN M OE1 1 
ATOM   3913  N NE2 . GLN B 1 228 ? -4.924  7.559   52.950  1.00 100.65 ? 247 GLN M NE2 1 
ATOM   3914  N N   . PRO B 1 229 ? -2.426  3.456   48.290  1.00 87.08  ? 248 PRO M N   1 
ATOM   3915  C CA  . PRO B 1 229 ? -1.295  3.053   47.449  1.00 86.62  ? 248 PRO M CA  1 
ATOM   3916  C C   . PRO B 1 229 ? 0.030   3.479   48.065  1.00 82.87  ? 248 PRO M C   1 
ATOM   3917  O O   . PRO B 1 229 ? 0.117   4.483   48.775  1.00 81.71  ? 248 PRO M O   1 
ATOM   3918  C CB  . PRO B 1 229 ? -1.564  3.766   46.117  1.00 87.16  ? 248 PRO M CB  1 
ATOM   3919  C CG  . PRO B 1 229 ? -2.516  4.865   46.448  1.00 86.93  ? 248 PRO M CG  1 
ATOM   3920  C CD  . PRO B 1 229 ? -3.363  4.330   47.560  1.00 88.63  ? 248 PRO M CD  1 
ATOM   3921  N N   . VAL B 1 230 ? 1.068   2.681   47.802  1.00 80.64  ? 249 VAL M N   1 
ATOM   3922  C CA  . VAL B 1 230 ? 2.380   2.935   48.386  1.00 79.51  ? 249 VAL M CA  1 
ATOM   3923  C C   . VAL B 1 230 ? 2.935   4.243   47.842  1.00 79.96  ? 249 VAL M C   1 
ATOM   3924  O O   . VAL B 1 230 ? 2.990   4.454   46.623  1.00 83.77  ? 249 VAL M O   1 
ATOM   3925  C CB  . VAL B 1 230 ? 3.341   1.771   48.101  1.00 80.00  ? 249 VAL M CB  1 
ATOM   3926  C CG1 . VAL B 1 230 ? 4.782   2.205   48.328  1.00 78.95  ? 249 VAL M CG1 1 
ATOM   3927  C CG2 . VAL B 1 230 ? 3.017   0.590   48.989  1.00 81.64  ? 249 VAL M CG2 1 
ATOM   3928  N N   . ILE B 1 231 ? 3.339   5.132   48.744  1.00 78.70  ? 250 ILE M N   1 
ATOM   3929  C CA  . ILE B 1 231 ? 3.988   6.380   48.357  1.00 79.18  ? 250 ILE M CA  1 
ATOM   3930  C C   . ILE B 1 231 ? 5.493   6.150   48.376  1.00 76.71  ? 250 ILE M C   1 
ATOM   3931  O O   . ILE B 1 231 ? 6.055   5.742   49.395  1.00 77.31  ? 250 ILE M O   1 
ATOM   3932  C CB  . ILE B 1 231 ? 3.592   7.537   49.289  1.00 82.90  ? 250 ILE M CB  1 
ATOM   3933  C CG1 . ILE B 1 231 ? 2.089   7.821   49.211  1.00 90.91  ? 250 ILE M CG1 1 
ATOM   3934  C CG2 . ILE B 1 231 ? 4.382   8.786   48.947  1.00 78.94  ? 250 ILE M CG2 1 
ATOM   3935  C CD1 . ILE B 1 231 ? 1.265   7.129   50.279  1.00 92.37  ? 250 ILE M CD1 1 
ATOM   3936  N N   . THR B 1 232 ? 6.150   6.390   47.249  1.00 77.11  ? 251 THR M N   1 
ATOM   3937  C CA  . THR B 1 232 ? 7.598   6.238   47.155  1.00 74.26  ? 251 THR M CA  1 
ATOM   3938  C C   . THR B 1 232 ? 8.201   7.610   46.905  1.00 73.76  ? 251 THR M C   1 
ATOM   3939  O O   . THR B 1 232 ? 8.071   8.163   45.808  1.00 80.87  ? 251 THR M O   1 
ATOM   3940  C CB  . THR B 1 232 ? 7.992   5.259   46.053  1.00 73.63  ? 251 THR M CB  1 
ATOM   3941  O OG1 . THR B 1 232 ? 7.149   4.102   46.118  1.00 74.10  ? 251 THR M OG1 1 
ATOM   3942  C CG2 . THR B 1 232 ? 9.442   4.834   46.225  1.00 73.34  ? 251 THR M CG2 1 
ATOM   3943  N N   . GLU B 1 233 ? 8.850   8.160   47.921  1.00 73.67  ? 252 GLU M N   1 
ATOM   3944  C CA  . GLU B 1 233 ? 9.530   9.438   47.795  1.00 74.31  ? 252 GLU M CA  1 
ATOM   3945  C C   . GLU B 1 233 ? 11.008  9.212   47.514  1.00 74.24  ? 252 GLU M C   1 
ATOM   3946  O O   . GLU B 1 233 ? 11.653  8.357   48.132  1.00 70.66  ? 252 GLU M O   1 
ATOM   3947  C CB  . GLU B 1 233 ? 9.346   10.293  49.051  1.00 77.63  ? 252 GLU M CB  1 
ATOM   3948  C CG  . GLU B 1 233 ? 7.902   10.720  49.311  1.00 80.62  ? 252 GLU M CG  1 
ATOM   3949  C CD  . GLU B 1 233 ? 7.302   11.549  48.178  1.00 80.62  ? 252 GLU M CD  1 
ATOM   3950  O OE1 . GLU B 1 233 ? 8.063   12.080  47.339  1.00 78.76  ? 252 GLU M OE1 1 
ATOM   3951  O OE2 . GLU B 1 233 ? 6.058   11.673  48.127  1.00 80.28  ? 252 GLU M OE2 1 
ATOM   3952  N N   . GLN B 1 234 ? 11.532  9.982   46.562  1.00 79.14  ? 253 GLN M N   1 
ATOM   3953  C CA  . GLN B 1 234 ? 12.917  9.847   46.140  1.00 79.84  ? 253 GLN M CA  1 
ATOM   3954  C C   . GLN B 1 234 ? 13.728  10.983  46.750  1.00 81.25  ? 253 GLN M C   1 
ATOM   3955  O O   . GLN B 1 234 ? 14.207  11.863  46.029  1.00 82.06  ? 253 GLN M O   1 
ATOM   3956  C CB  . GLN B 1 234 ? 13.012  9.857   44.610  1.00 80.27  ? 253 GLN M CB  1 
ATOM   3957  C CG  . GLN B 1 234 ? 14.400  9.590   44.046  1.00 81.82  ? 253 GLN M CG  1 
ATOM   3958  C CD  . GLN B 1 234 ? 14.678  8.110   43.874  1.00 83.03  ? 253 GLN M CD  1 
ATOM   3959  O OE1 . GLN B 1 234 ? 14.076  7.275   44.547  1.00 76.46  ? 253 GLN M OE1 1 
ATOM   3960  N NE2 . GLN B 1 234 ? 15.600  7.777   42.979  1.00 83.16  ? 253 GLN M NE2 1 
ATOM   3961  N N   . VAL B 1 235 ? 13.848  11.000  48.081  1.00 77.58  ? 254 VAL M N   1 
ATOM   3962  C CA  . VAL B 1 235 ? 14.677  12.009  48.730  1.00 78.03  ? 254 VAL M CA  1 
ATOM   3963  C C   . VAL B 1 235 ? 16.126  11.845  48.269  1.00 78.70  ? 254 VAL M C   1 
ATOM   3964  O O   . VAL B 1 235 ? 16.593  10.736  47.981  1.00 86.01  ? 254 VAL M O   1 
ATOM   3965  C CB  . VAL B 1 235 ? 14.553  11.917  50.261  1.00 77.70  ? 254 VAL M CB  1 
ATOM   3966  C CG1 . VAL B 1 235 ? 15.219  10.651  50.781  1.00 83.06  ? 254 VAL M CG1 1 
ATOM   3967  C CG2 . VAL B 1 235 ? 15.139  13.158  50.917  1.00 76.53  ? 254 VAL M CG2 1 
ATOM   3968  N N   . ARG B 1 236 ? 16.837  12.957  48.180  1.00 73.84  ? 255 ARG M N   1 
ATOM   3969  C CA  . ARG B 1 236 ? 18.117  13.010  47.480  1.00 75.79  ? 255 ARG M CA  1 
ATOM   3970  C C   . ARG B 1 236 ? 19.222  13.300  48.492  1.00 78.41  ? 255 ARG M C   1 
ATOM   3971  O O   . ARG B 1 236 ? 19.359  14.430  48.967  1.00 94.71  ? 255 ARG M O   1 
ATOM   3972  C CB  . ARG B 1 236 ? 18.049  14.058  46.372  1.00 77.02  ? 255 ARG M CB  1 
ATOM   3973  C CG  . ARG B 1 236 ? 16.855  13.850  45.441  1.00 76.88  ? 255 ARG M CG  1 
ATOM   3974  C CD  . ARG B 1 236 ? 16.367  15.147  44.816  1.00 74.75  ? 255 ARG M CD  1 
ATOM   3975  N NE  . ARG B 1 236 ? 15.235  14.925  43.920  1.00 74.69  ? 255 ARG M NE  1 
ATOM   3976  C CZ  . ARG B 1 236 ? 13.976  15.241  44.205  1.00 78.03  ? 255 ARG M CZ  1 
ATOM   3977  N NH1 . ARG B 1 236 ? 13.678  15.790  45.374  1.00 85.43  ? 255 ARG M NH1 1 
ATOM   3978  N NH2 . ARG B 1 236 ? 13.012  15.001  43.325  1.00 74.77  ? 255 ARG M NH2 1 
ATOM   3979  N N   . ASP B 1 237 ? 19.984  12.259  48.838  1.00 81.07  ? 256 ASP M N   1 
ATOM   3980  C CA  . ASP B 1 237 ? 21.152  12.311  49.719  1.00 83.96  ? 256 ASP M CA  1 
ATOM   3981  C C   . ASP B 1 237 ? 20.896  13.028  51.045  1.00 86.19  ? 256 ASP M C   1 
ATOM   3982  O O   . ASP B 1 237 ? 21.842  13.315  51.785  1.00 87.41  ? 256 ASP M O   1 
ATOM   3983  C CB  . ASP B 1 237 ? 22.355  12.943  48.988  1.00 84.52  ? 256 ASP M CB  1 
ATOM   3984  C CG  . ASP B 1 237 ? 22.321  14.473  48.960  1.00 81.94  ? 256 ASP M CG  1 
ATOM   3985  O OD1 . ASP B 1 237 ? 22.746  15.106  49.952  1.00 85.28  ? 256 ASP M OD1 1 
ATOM   3986  O OD2 . ASP B 1 237 ? 21.889  15.049  47.937  1.00 81.36  ? 256 ASP M OD2 1 
ATOM   3987  N N   . ARG B 1 238 ? 19.634  13.297  51.376  1.00 87.38  ? 257 ARG M N   1 
ATOM   3988  C CA  . ARG B 1 238 ? 19.314  13.903  52.660  1.00 85.62  ? 257 ARG M CA  1 
ATOM   3989  C C   . ARG B 1 238 ? 19.253  12.838  53.751  1.00 87.90  ? 257 ARG M C   1 
ATOM   3990  O O   . ARG B 1 238 ? 18.971  11.666  53.489  1.00 90.04  ? 257 ARG M O   1 
ATOM   3991  C CB  . ARG B 1 238 ? 17.984  14.655  52.590  1.00 83.76  ? 257 ARG M CB  1 
ATOM   3992  C CG  . ARG B 1 238 ? 17.960  15.801  51.590  1.00 83.52  ? 257 ARG M CG  1 
ATOM   3993  C CD  . ARG B 1 238 ? 19.155  16.725  51.760  1.00 82.31  ? 257 ARG M CD  1 
ATOM   3994  N NE  . ARG B 1 238 ? 18.926  18.030  51.147  1.00 80.54  ? 257 ARG M NE  1 
ATOM   3995  C CZ  . ARG B 1 238 ? 19.893  18.856  50.760  1.00 83.30  ? 257 ARG M CZ  1 
ATOM   3996  N NH1 . ARG B 1 238 ? 21.165  18.511  50.916  1.00 85.91  ? 257 ARG M NH1 1 
ATOM   3997  N NH2 . ARG B 1 238 ? 19.590  20.026  50.213  1.00 80.79  ? 257 ARG M NH2 1 
ATOM   3998  N N   . THR B 1 239 ? 19.523  13.255  54.986  1.00 92.50  ? 258 THR M N   1 
ATOM   3999  C CA  . THR B 1 239 ? 19.546  12.332  56.113  1.00 90.16  ? 258 THR M CA  1 
ATOM   4000  C C   . THR B 1 239 ? 18.210  12.230  56.836  1.00 90.61  ? 258 THR M C   1 
ATOM   4001  O O   . THR B 1 239 ? 18.031  11.309  57.641  1.00 90.78  ? 258 THR M O   1 
ATOM   4002  C CB  . THR B 1 239 ? 20.624  12.748  57.120  1.00 94.94  ? 258 THR M CB  1 
ATOM   4003  O OG1 . THR B 1 239 ? 20.498  14.147  57.407  1.00 94.23  ? 258 THR M OG1 1 
ATOM   4004  C CG2 . THR B 1 239 ? 22.011  12.475  56.560  1.00 95.96  ? 258 THR M CG2 1 
ATOM   4005  N N   . SER B 1 240 ? 17.274  13.141  56.575  1.00 94.62  ? 259 SER M N   1 
ATOM   4006  C CA  . SER B 1 240 ? 16.025  13.209  57.320  1.00 93.76  ? 259 SER M CA  1 
ATOM   4007  C C   . SER B 1 240 ? 14.877  13.505  56.361  1.00 91.27  ? 259 SER M C   1 
ATOM   4008  O O   . SER B 1 240 ? 15.077  13.714  55.160  1.00 93.69  ? 259 SER M O   1 
ATOM   4009  C CB  . SER B 1 240 ? 16.109  14.265  58.431  1.00 96.50  ? 259 SER M CB  1 
ATOM   4010  O OG  . SER B 1 240 ? 16.825  15.410  58.002  1.00 94.08  ? 259 SER M OG  1 
ATOM   4011  N N   . PHE B 1 241 ? 13.661  13.519  56.906  1.00 90.52  ? 260 PHE M N   1 
ATOM   4012  C CA  . PHE B 1 241 ? 12.468  13.789  56.111  1.00 91.31  ? 260 PHE M CA  1 
ATOM   4013  C C   . PHE B 1 241 ? 11.309  14.118  57.043  1.00 92.65  ? 260 PHE M C   1 
ATOM   4014  O O   . PHE B 1 241 ? 11.094  13.419  58.039  1.00 91.45  ? 260 PHE M O   1 
ATOM   4015  C CB  . PHE B 1 241 ? 12.125  12.589  55.218  1.00 89.03  ? 260 PHE M CB  1 
ATOM   4016  C CG  . PHE B 1 241 ? 10.952  12.821  54.310  1.00 89.91  ? 260 PHE M CG  1 
ATOM   4017  C CD1 . PHE B 1 241 ? 11.045  13.708  53.252  1.00 93.06  ? 260 PHE M CD1 1 
ATOM   4018  C CD2 . PHE B 1 241 ? 9.762   12.139  54.502  1.00 90.08  ? 260 PHE M CD2 1 
ATOM   4019  C CE1 . PHE B 1 241 ? 9.972   13.920  52.409  1.00 94.88  ? 260 PHE M CE1 1 
ATOM   4020  C CE2 . PHE B 1 241 ? 8.684   12.348  53.661  1.00 90.60  ? 260 PHE M CE2 1 
ATOM   4021  C CZ  . PHE B 1 241 ? 8.791   13.240  52.613  1.00 92.07  ? 260 PHE M CZ  1 
ATOM   4022  N N   . GLN B 1 242 ? 10.570  15.177  56.721  1.00 92.69  ? 261 GLN M N   1 
ATOM   4023  C CA  . GLN B 1 242 ? 9.423   15.603  57.510  1.00 97.76  ? 261 GLN M CA  1 
ATOM   4024  C C   . GLN B 1 242 ? 8.125   15.178  56.831  1.00 95.38  ? 261 GLN M C   1 
ATOM   4025  O O   . GLN B 1 242 ? 8.044   15.092  55.603  1.00 94.52  ? 261 GLN M O   1 
ATOM   4026  C CB  . GLN B 1 242 ? 9.441   17.122  57.728  1.00 101.15 ? 261 GLN M CB  1 
ATOM   4027  C CG  . GLN B 1 242 ? 8.855   17.955  56.589  1.00 108.08 ? 261 GLN M CG  1 
ATOM   4028  C CD  . GLN B 1 242 ? 9.802   18.099  55.403  1.00 111.98 ? 261 GLN M CD  1 
ATOM   4029  O OE1 . GLN B 1 242 ? 10.079  17.132  54.693  1.00 114.37 ? 261 GLN M OE1 1 
ATOM   4030  N NE2 . GLN B 1 242 ? 10.292  19.315  55.181  1.00 103.74 ? 261 GLN M NE2 1 
ATOM   4031  N N   . LEU B 1 243 ? 7.107   14.900  57.645  1.00 96.70  ? 262 LEU M N   1 
ATOM   4032  C CA  . LEU B 1 243 ? 5.826   14.430  57.133  1.00 97.68  ? 262 LEU M CA  1 
ATOM   4033  C C   . LEU B 1 243 ? 4.705   15.013  57.980  1.00 95.61  ? 262 LEU M C   1 
ATOM   4034  O O   . LEU B 1 243 ? 4.760   14.950  59.211  1.00 98.44  ? 262 LEU M O   1 
ATOM   4035  C CB  . LEU B 1 243 ? 5.768   12.898  57.137  1.00 98.38  ? 262 LEU M CB  1 
ATOM   4036  C CG  . LEU B 1 243 ? 4.463   12.225  56.718  1.00 99.43  ? 262 LEU M CG  1 
ATOM   4037  C CD1 . LEU B 1 243 ? 4.005   12.749  55.365  1.00 99.44  ? 262 LEU M CD1 1 
ATOM   4038  C CD2 . LEU B 1 243 ? 4.646   10.720  56.677  1.00 100.42 ? 262 LEU M CD2 1 
ATOM   4039  N N   . LEU B 1 244 ? 3.688   15.568  57.322  1.00 95.40  ? 263 LEU M N   1 
ATOM   4040  C CA  . LEU B 1 244 ? 2.620   16.298  57.994  1.00 94.87  ? 263 LEU M CA  1 
ATOM   4041  C C   . LEU B 1 244 ? 1.372   15.435  58.134  1.00 96.99  ? 263 LEU M C   1 
ATOM   4042  O O   . LEU B 1 244 ? 1.019   14.685  57.218  1.00 95.88  ? 263 LEU M O   1 
ATOM   4043  C CB  . LEU B 1 244 ? 2.273   17.576  57.229  1.00 91.59  ? 263 LEU M CB  1 
ATOM   4044  C CG  . LEU B 1 244 ? 3.409   18.552  56.921  1.00 91.54  ? 263 LEU M CG  1 
ATOM   4045  C CD1 . LEU B 1 244 ? 2.842   19.909  56.545  1.00 93.09  ? 263 LEU M CD1 1 
ATOM   4046  C CD2 . LEU B 1 244 ? 4.362   18.679  58.097  1.00 93.30  ? 263 LEU M CD2 1 
ATOM   4047  N N   . ASN B 1 245 ? 0.701   15.567  59.277  1.00 99.89  ? 264 ASN M N   1 
ATOM   4048  C CA  . ASN B 1 245 ? -0.520  14.830  59.586  1.00 99.46  ? 264 ASN M CA  1 
ATOM   4049  C C   . ASN B 1 245 ? -0.346  13.326  59.346  1.00 97.87  ? 264 ASN M C   1 
ATOM   4050  O O   . ASN B 1 245 ? -1.029  12.744  58.501  1.00 95.01  ? 264 ASN M O   1 
ATOM   4051  C CB  . ASN B 1 245 ? -1.696  15.371  58.784  1.00 97.95  ? 264 ASN M CB  1 
ATOM   4052  C CG  . ASN B 1 245 ? -1.869  16.870  58.943  1.00 98.19  ? 264 ASN M CG  1 
ATOM   4053  O OD1 . ASN B 1 245 ? -1.277  17.485  59.829  1.00 97.15  ? 264 ASN M OD1 1 
ATOM   4054  N ND2 . ASN B 1 245 ? -2.687  17.463  58.084  1.00 97.47  ? 264 ASN M ND2 1 
ATOM   4055  N N   . PRO B 1 246 ? 0.550   12.673  60.090  1.00 103.89 ? 265 PRO M N   1 
ATOM   4056  C CA  . PRO B 1 246 ? 0.971   11.313  59.722  1.00 103.04 ? 265 PRO M CA  1 
ATOM   4057  C C   . PRO B 1 246 ? -0.104  10.258  59.922  1.00 104.88 ? 265 PRO M C   1 
ATOM   4058  O O   . PRO B 1 246 ? -0.351  9.442   59.028  1.00 103.48 ? 265 PRO M O   1 
ATOM   4059  C CB  . PRO B 1 246 ? 2.171   11.056  60.646  1.00 104.64 ? 265 PRO M CB  1 
ATOM   4060  C CG  . PRO B 1 246 ? 2.526   12.401  61.231  1.00 105.14 ? 265 PRO M CG  1 
ATOM   4061  C CD  . PRO B 1 246 ? 1.248   13.154  61.291  1.00 105.02 ? 265 PRO M CD  1 
ATOM   4062  N N   . GLY B 1 247 ? -0.743  10.260  61.085  1.00 114.95 ? 266 GLY M N   1 
ATOM   4063  C CA  . GLY B 1 247 ? -1.670  9.184   61.400  1.00 117.58 ? 266 GLY M CA  1 
ATOM   4064  C C   . GLY B 1 247 ? -0.899  7.928   61.751  1.00 118.42 ? 266 GLY M C   1 
ATOM   4065  O O   . GLY B 1 247 ? 0.059   7.960   62.531  1.00 119.49 ? 266 GLY M O   1 
ATOM   4066  N N   . THR B 1 248 ? -1.305  6.805   61.168  1.00 113.31 ? 267 THR M N   1 
ATOM   4067  C CA  . THR B 1 248 ? -0.617  5.532   61.346  1.00 114.98 ? 267 THR M CA  1 
ATOM   4068  C C   . THR B 1 248 ? -0.014  5.117   60.012  1.00 113.29 ? 267 THR M C   1 
ATOM   4069  O O   . THR B 1 248 ? -0.745  4.906   59.038  1.00 109.90 ? 267 THR M O   1 
ATOM   4070  C CB  . THR B 1 248 ? -1.571  4.454   61.861  1.00 120.17 ? 267 THR M CB  1 
ATOM   4071  O OG1 . THR B 1 248 ? -2.580  4.197   60.875  1.00 129.61 ? 267 THR M OG1 1 
ATOM   4072  C CG2 . THR B 1 248 ? -2.233  4.902   63.158  1.00 116.84 ? 267 THR M CG2 1 
ATOM   4073  N N   . TYR B 1 249 ? 1.313   5.001   59.966  1.00 107.36 ? 268 TYR M N   1 
ATOM   4074  C CA  . TYR B 1 249 ? 1.996   4.645   58.729  1.00 100.04 ? 268 TYR M CA  1 
ATOM   4075  C C   . TYR B 1 249 ? 3.189   3.753   59.034  1.00 100.27 ? 268 TYR M C   1 
ATOM   4076  O O   . TYR B 1 249 ? 3.797   3.848   60.101  1.00 103.68 ? 268 TYR M O   1 
ATOM   4077  C CB  . TYR B 1 249 ? 2.463   5.890   57.961  1.00 95.77  ? 268 TYR M CB  1 
ATOM   4078  C CG  . TYR B 1 249 ? 3.626   6.623   58.597  1.00 96.23  ? 268 TYR M CG  1 
ATOM   4079  C CD1 . TYR B 1 249 ? 4.940   6.309   58.266  1.00 95.64  ? 268 TYR M CD1 1 
ATOM   4080  C CD2 . TYR B 1 249 ? 3.410   7.631   59.527  1.00 97.82  ? 268 TYR M CD2 1 
ATOM   4081  C CE1 . TYR B 1 249 ? 6.004   6.977   58.844  1.00 95.07  ? 268 TYR M CE1 1 
ATOM   4082  C CE2 . TYR B 1 249 ? 4.469   8.306   60.111  1.00 99.39  ? 268 TYR M CE2 1 
ATOM   4083  C CZ  . TYR B 1 249 ? 5.762   7.975   59.766  1.00 96.36  ? 268 TYR M CZ  1 
ATOM   4084  O OH  . TYR B 1 249 ? 6.815   8.646   60.345  1.00 95.13  ? 268 TYR M OH  1 
ATOM   4085  N N   . THR B 1 250 ? 3.530   2.895   58.078  1.00 97.87  ? 269 THR M N   1 
ATOM   4086  C CA  . THR B 1 250 ? 4.710   2.049   58.182  1.00 96.21  ? 269 THR M CA  1 
ATOM   4087  C C   . THR B 1 250 ? 5.671   2.365   57.039  1.00 93.57  ? 269 THR M C   1 
ATOM   4088  O O   . THR B 1 250 ? 5.258   2.535   55.885  1.00 93.39  ? 269 THR M O   1 
ATOM   4089  C CB  . THR B 1 250 ? 4.322   0.557   58.203  1.00 95.96  ? 269 THR M CB  1 
ATOM   4090  O OG1 . THR B 1 250 ? 5.495   -0.248  58.374  1.00 97.31  ? 269 THR M OG1 1 
ATOM   4091  C CG2 . THR B 1 250 ? 3.588   0.151   56.932  1.00 92.26  ? 269 THR M CG2 1 
ATOM   4092  N N   . VAL B 1 251 ? 6.957   2.462   57.366  1.00 88.20  ? 270 VAL M N   1 
ATOM   4093  C CA  . VAL B 1 251 ? 7.948   3.023   56.455  1.00 87.42  ? 270 VAL M CA  1 
ATOM   4094  C C   . VAL B 1 251 ? 9.133   2.074   56.316  1.00 91.15  ? 270 VAL M C   1 
ATOM   4095  O O   . VAL B 1 251 ? 9.535   1.411   57.281  1.00 92.45  ? 270 VAL M O   1 
ATOM   4096  C CB  . VAL B 1 251 ? 8.411   4.418   56.934  1.00 86.47  ? 270 VAL M CB  1 
ATOM   4097  C CG1 . VAL B 1 251 ? 8.819   4.377   58.399  1.00 86.99  ? 270 VAL M CG1 1 
ATOM   4098  C CG2 . VAL B 1 251 ? 9.543   4.953   56.064  1.00 86.09  ? 270 VAL M CG2 1 
ATOM   4099  N N   . GLN B 1 252 ? 9.669   1.996   55.096  1.00 87.84  ? 271 GLN M N   1 
ATOM   4100  C CA  . GLN B 1 252 ? 10.950  1.363   54.809  1.00 85.50  ? 271 GLN M CA  1 
ATOM   4101  C C   . GLN B 1 252 ? 11.834  2.355   54.061  1.00 87.02  ? 271 GLN M C   1 
ATOM   4102  O O   . GLN B 1 252 ? 11.346  3.304   53.443  1.00 93.65  ? 271 GLN M O   1 
ATOM   4103  C CB  . GLN B 1 252 ? 10.786  0.086   53.975  1.00 81.62  ? 271 GLN M CB  1 
ATOM   4104  C CG  . GLN B 1 252 ? 9.962   -0.997  54.636  1.00 83.01  ? 271 GLN M CG  1 
ATOM   4105  C CD  . GLN B 1 252 ? 9.448   -2.020  53.643  1.00 81.19  ? 271 GLN M CD  1 
ATOM   4106  O OE1 . GLN B 1 252 ? 8.444   -1.795  52.966  1.00 78.76  ? 271 GLN M OE1 1 
ATOM   4107  N NE2 . GLN B 1 252 ? 10.136  -3.153  53.550  1.00 79.00  ? 271 GLN M NE2 1 
ATOM   4108  N N   . ILE B 1 253 ? 13.146  2.122   54.106  1.00 84.50  ? 272 ILE M N   1 
ATOM   4109  C CA  . ILE B 1 253 ? 14.113  3.012   53.470  1.00 80.95  ? 272 ILE M CA  1 
ATOM   4110  C C   . ILE B 1 253 ? 15.219  2.189   52.821  1.00 81.19  ? 272 ILE M C   1 
ATOM   4111  O O   . ILE B 1 253 ? 15.625  1.146   53.343  1.00 85.42  ? 272 ILE M O   1 
ATOM   4112  C CB  . ILE B 1 253 ? 14.701  4.024   54.475  1.00 79.46  ? 272 ILE M CB  1 
ATOM   4113  C CG1 . ILE B 1 253 ? 15.751  4.902   53.796  1.00 78.75  ? 272 ILE M CG1 1 
ATOM   4114  C CG2 . ILE B 1 253 ? 15.281  3.313   55.680  1.00 84.96  ? 272 ILE M CG2 1 
ATOM   4115  C CD1 . ILE B 1 253 ? 16.264  5.992   54.664  1.00 81.15  ? 272 ILE M CD1 1 
ATOM   4116  N N   . ARG B 1 254 ? 15.705  2.670   51.679  1.00 81.86  ? 273 ARG M N   1 
ATOM   4117  C CA  . ARG B 1 254 ? 16.759  2.012   50.923  1.00 77.47  ? 273 ARG M CA  1 
ATOM   4118  C C   . ARG B 1 254 ? 17.808  3.037   50.512  1.00 76.13  ? 273 ARG M C   1 
ATOM   4119  O O   . ARG B 1 254 ? 17.525  4.231   50.405  1.00 76.02  ? 273 ARG M O   1 
ATOM   4120  C CB  . ARG B 1 254 ? 16.185  1.304   49.688  1.00 76.97  ? 273 ARG M CB  1 
ATOM   4121  C CG  . ARG B 1 254 ? 17.145  0.368   48.987  1.00 78.41  ? 273 ARG M CG  1 
ATOM   4122  C CD  . ARG B 1 254 ? 16.428  -0.450  47.932  1.00 79.85  ? 273 ARG M CD  1 
ATOM   4123  N NE  . ARG B 1 254 ? 15.725  0.394   46.974  1.00 75.67  ? 273 ARG M NE  1 
ATOM   4124  C CZ  . ARG B 1 254 ? 15.127  -0.065  45.882  1.00 77.26  ? 273 ARG M CZ  1 
ATOM   4125  N NH1 . ARG B 1 254 ? 15.148  -1.362  45.610  1.00 77.18  ? 273 ARG M NH1 1 
ATOM   4126  N NH2 . ARG B 1 254 ? 14.509  0.774   45.059  1.00 80.85  ? 273 ARG M NH2 1 
ATOM   4127  N N   . ALA B 1 255 ? 19.030  2.561   50.281  1.00 74.62  ? 274 ALA M N   1 
ATOM   4128  C CA  . ALA B 1 255 ? 20.147  3.411   49.892  1.00 74.16  ? 274 ALA M CA  1 
ATOM   4129  C C   . ALA B 1 255 ? 20.718  2.955   48.556  1.00 73.34  ? 274 ALA M C   1 
ATOM   4130  O O   . ALA B 1 255 ? 20.818  1.753   48.291  1.00 73.33  ? 274 ALA M O   1 
ATOM   4131  C CB  . ALA B 1 255 ? 21.248  3.397   50.956  1.00 74.77  ? 274 ALA M CB  1 
ATOM   4132  N N   . ARG B 1 256 ? 21.105  3.919   47.721  1.00 78.17  ? 275 ARG M N   1 
ATOM   4133  C CA  . ARG B 1 256 ? 21.687  3.653   46.414  1.00 77.11  ? 275 ARG M CA  1 
ATOM   4134  C C   . ARG B 1 256 ? 23.004  4.402   46.302  1.00 77.95  ? 275 ARG M C   1 
ATOM   4135  O O   . ARG B 1 256 ? 23.053  5.617   46.528  1.00 72.38  ? 275 ARG M O   1 
ATOM   4136  C CB  . ARG B 1 256 ? 20.739  4.075   45.285  1.00 80.63  ? 275 ARG M CB  1 
ATOM   4137  C CG  . ARG B 1 256 ? 21.181  3.610   43.901  1.00 83.75  ? 275 ARG M CG  1 
ATOM   4138  C CD  . ARG B 1 256 ? 20.255  4.115   42.797  1.00 81.12  ? 275 ARG M CD  1 
ATOM   4139  N NE  . ARG B 1 256 ? 18.920  3.528   42.878  1.00 76.48  ? 275 ARG M NE  1 
ATOM   4140  C CZ  . ARG B 1 256 ? 17.863  4.139   43.404  1.00 79.61  ? 275 ARG M CZ  1 
ATOM   4141  N NH1 . ARG B 1 256 ? 17.978  5.366   43.898  1.00 79.36  ? 275 ARG M NH1 1 
ATOM   4142  N NH2 . ARG B 1 256 ? 16.689  3.524   43.434  1.00 75.90  ? 275 ARG M NH2 1 
ATOM   4143  N N   . GLU B 1 257 ? 24.065  3.677   45.960  1.00 79.74  ? 276 GLU M N   1 
ATOM   4144  C CA  . GLU B 1 257 ? 25.374  4.291   45.785  1.00 82.04  ? 276 GLU M CA  1 
ATOM   4145  C C   . GLU B 1 257 ? 25.345  5.248   44.598  1.00 82.31  ? 276 GLU M C   1 
ATOM   4146  O O   . GLU B 1 257 ? 24.723  4.966   43.571  1.00 79.10  ? 276 GLU M O   1 
ATOM   4147  C CB  . GLU B 1 257 ? 26.435  3.207   45.588  1.00 82.93  ? 276 GLU M CB  1 
ATOM   4148  C CG  . GLU B 1 257 ? 27.855  3.629   45.927  1.00 85.45  ? 276 GLU M CG  1 
ATOM   4149  C CD  . GLU B 1 257 ? 28.510  4.429   44.823  1.00 85.31  ? 276 GLU M CD  1 
ATOM   4150  O OE1 . GLU B 1 257 ? 28.319  4.080   43.638  1.00 84.00  ? 276 GLU M OE1 1 
ATOM   4151  O OE2 . GLU B 1 257 ? 29.220  5.408   45.144  1.00 84.10  ? 276 GLU M OE2 1 
ATOM   4152  N N   . ARG B 1 258 ? 26.024  6.388   44.741  1.00 82.39  ? 277 ARG M N   1 
ATOM   4153  C CA  . ARG B 1 258 ? 25.880  7.472   43.770  1.00 80.94  ? 277 ARG M CA  1 
ATOM   4154  C C   . ARG B 1 258 ? 26.418  7.090   42.394  1.00 81.25  ? 277 ARG M C   1 
ATOM   4155  O O   . ARG B 1 258 ? 25.718  7.232   41.384  1.00 83.84  ? 277 ARG M O   1 
ATOM   4156  C CB  . ARG B 1 258 ? 26.574  8.730   44.285  1.00 79.87  ? 277 ARG M CB  1 
ATOM   4157  C CG  . ARG B 1 258 ? 26.498  9.893   43.320  1.00 80.21  ? 277 ARG M CG  1 
ATOM   4158  C CD  . ARG B 1 258 ? 27.045  11.159  43.945  1.00 80.60  ? 277 ARG M CD  1 
ATOM   4159  N NE  . ARG B 1 258 ? 28.492  11.133  44.109  1.00 79.74  ? 277 ARG M NE  1 
ATOM   4160  C CZ  . ARG B 1 258 ? 29.219  12.202  44.418  1.00 82.60  ? 277 ARG M CZ  1 
ATOM   4161  N NH1 . ARG B 1 258 ? 28.630  13.376  44.600  1.00 77.48  ? 277 ARG M NH1 1 
ATOM   4162  N NH2 . ARG B 1 258 ? 30.533  12.099  44.555  1.00 87.33  ? 277 ARG M NH2 1 
ATOM   4163  N N   . VAL B 1 259 ? 27.653  6.600   42.336  1.00 82.21  ? 278 VAL M N   1 
ATOM   4164  C CA  . VAL B 1 259 ? 28.377  6.450   41.073  1.00 79.69  ? 278 VAL M CA  1 
ATOM   4165  C C   . VAL B 1 259 ? 28.006  5.159   40.344  1.00 78.67  ? 278 VAL M C   1 
ATOM   4166  O O   . VAL B 1 259 ? 27.773  5.171   39.133  1.00 81.24  ? 278 VAL M O   1 
ATOM   4167  C CB  . VAL B 1 259 ? 29.894  6.528   41.338  1.00 78.62  ? 278 VAL M CB  1 
ATOM   4168  C CG1 . VAL B 1 259 ? 30.683  6.268   40.058  1.00 77.06  ? 278 VAL M CG1 1 
ATOM   4169  C CG2 . VAL B 1 259 ? 30.268  7.881   41.946  1.00 78.67  ? 278 VAL M CG2 1 
ATOM   4170  N N   . TYR B 1 260 ? 27.958  4.025   41.040  1.00 77.81  ? 279 TYR M N   1 
ATOM   4171  C CA  . TYR B 1 260 ? 27.682  2.742   40.402  1.00 80.05  ? 279 TYR M CA  1 
ATOM   4172  C C   . TYR B 1 260 ? 26.304  2.190   40.732  1.00 80.09  ? 279 TYR M C   1 
ATOM   4173  O O   . TYR B 1 260 ? 25.973  1.086   40.287  1.00 78.85  ? 279 TYR M O   1 
ATOM   4174  C CB  . TYR B 1 260 ? 28.754  1.715   40.787  1.00 82.09  ? 279 TYR M CB  1 
ATOM   4175  C CG  . TYR B 1 260 ? 30.054  1.891   40.040  1.00 80.81  ? 279 TYR M CG  1 
ATOM   4176  C CD1 . TYR B 1 260 ? 31.040  2.736   40.525  1.00 82.62  ? 279 TYR M CD1 1 
ATOM   4177  C CD2 . TYR B 1 260 ? 30.300  1.208   38.857  1.00 79.21  ? 279 TYR M CD2 1 
ATOM   4178  C CE1 . TYR B 1 260 ? 32.232  2.908   39.847  1.00 80.25  ? 279 TYR M CE1 1 
ATOM   4179  C CE2 . TYR B 1 260 ? 31.489  1.370   38.174  1.00 83.06  ? 279 TYR M CE2 1 
ATOM   4180  C CZ  . TYR B 1 260 ? 32.452  2.221   38.674  1.00 82.07  ? 279 TYR M CZ  1 
ATOM   4181  O OH  . TYR B 1 260 ? 33.634  2.377   37.986  1.00 83.99  ? 279 TYR M OH  1 
ATOM   4182  N N   . GLU B 1 261 ? 25.500  2.928   41.497  1.00 78.52  ? 280 GLU M N   1 
ATOM   4183  C CA  . GLU B 1 261 ? 24.127  2.541   41.819  1.00 84.18  ? 280 GLU M CA  1 
ATOM   4184  C C   . GLU B 1 261 ? 24.066  1.169   42.491  1.00 85.16  ? 280 GLU M C   1 
ATOM   4185  O O   . GLU B 1 261 ? 23.197  0.348   42.190  1.00 82.75  ? 280 GLU M O   1 
ATOM   4186  C CB  . GLU B 1 261 ? 23.234  2.589   40.576  1.00 89.66  ? 280 GLU M CB  1 
ATOM   4187  C CG  . GLU B 1 261 ? 23.065  3.993   40.003  1.00 88.67  ? 280 GLU M CG  1 
ATOM   4188  C CD  . GLU B 1 261 ? 21.967  4.084   38.959  1.00 89.63  ? 280 GLU M CD  1 
ATOM   4189  O OE1 . GLU B 1 261 ? 21.986  5.045   38.162  1.00 93.56  ? 280 GLU M OE1 1 
ATOM   4190  O OE2 . GLU B 1 261 ? 21.084  3.199   38.934  1.00 88.56  ? 280 GLU M OE2 1 
ATOM   4191  N N   . PHE B 1 262 ? 25.004  0.916   43.404  1.00 83.68  ? 281 PHE M N   1 
ATOM   4192  C CA  . PHE B 1 262 ? 24.860  -0.207  44.320  1.00 79.64  ? 281 PHE M CA  1 
ATOM   4193  C C   . PHE B 1 262 ? 23.645  0.025   45.205  1.00 80.22  ? 281 PHE M C   1 
ATOM   4194  O O   . PHE B 1 262 ? 23.448  1.120   45.737  1.00 82.13  ? 281 PHE M O   1 
ATOM   4195  C CB  . PHE B 1 262 ? 26.105  -0.369  45.195  1.00 80.95  ? 281 PHE M CB  1 
ATOM   4196  C CG  . PHE B 1 262 ? 27.352  -0.703  44.433  1.00 82.42  ? 281 PHE M CG  1 
ATOM   4197  C CD1 . PHE B 1 262 ? 27.500  -1.940  43.831  1.00 82.62  ? 281 PHE M CD1 1 
ATOM   4198  C CD2 . PHE B 1 262 ? 28.390  0.209   44.345  1.00 81.46  ? 281 PHE M CD2 1 
ATOM   4199  C CE1 . PHE B 1 262 ? 28.651  -2.254  43.134  1.00 84.97  ? 281 PHE M CE1 1 
ATOM   4200  C CE2 . PHE B 1 262 ? 29.546  -0.099  43.652  1.00 83.46  ? 281 PHE M CE2 1 
ATOM   4201  C CZ  . PHE B 1 262 ? 29.675  -1.332  43.044  1.00 85.27  ? 281 PHE M CZ  1 
ATOM   4202  N N   . LEU B 1 263 ? 22.824  -1.006  45.364  1.00 77.38  ? 282 LEU M N   1 
ATOM   4203  C CA  . LEU B 1 263 ? 21.618  -0.910  46.170  1.00 78.35  ? 282 LEU M CA  1 
ATOM   4204  C C   . LEU B 1 263 ? 21.775  -1.702  47.458  1.00 77.46  ? 282 LEU M C   1 
ATOM   4205  O O   . LEU B 1 263 ? 22.292  -2.823  47.450  1.00 76.82  ? 282 LEU M O   1 
ATOM   4206  C CB  . LEU B 1 263 ? 20.393  -1.419  45.408  1.00 79.70  ? 282 LEU M CB  1 
ATOM   4207  C CG  . LEU B 1 263 ? 19.793  -0.479  44.365  1.00 84.80  ? 282 LEU M CG  1 
ATOM   4208  C CD1 . LEU B 1 263 ? 20.311  -0.803  42.968  1.00 88.18  ? 282 LEU M CD1 1 
ATOM   4209  C CD2 . LEU B 1 263 ? 18.278  -0.548  44.418  1.00 87.44  ? 282 LEU M CD2 1 
ATOM   4210  N N   . SER B 1 264 ? 21.333  -1.108  48.562  1.00 79.50  ? 283 SER M N   1 
ATOM   4211  C CA  . SER B 1 264 ? 21.168  -1.850  49.797  1.00 79.90  ? 283 SER M CA  1 
ATOM   4212  C C   . SER B 1 264 ? 19.802  -2.530  49.809  1.00 80.09  ? 283 SER M C   1 
ATOM   4213  O O   . SER B 1 264 ? 18.944  -2.278  48.961  1.00 78.53  ? 283 SER M O   1 
ATOM   4214  C CB  . SER B 1 264 ? 21.311  -0.929  51.007  1.00 78.74  ? 283 SER M CB  1 
ATOM   4215  O OG  . SER B 1 264 ? 20.090  -0.264  51.280  1.00 77.49  ? 283 SER M OG  1 
ATOM   4216  N N   . ALA B 1 265 ? 19.605  -3.411  50.781  1.00 83.45  ? 284 ALA M N   1 
ATOM   4217  C CA  . ALA B 1 265 ? 18.288  -3.995  50.955  1.00 83.74  ? 284 ALA M CA  1 
ATOM   4218  C C   . ALA B 1 265 ? 17.365  -2.990  51.636  1.00 80.06  ? 284 ALA M C   1 
ATOM   4219  O O   . ALA B 1 265 ? 17.808  -2.075  52.333  1.00 79.99  ? 284 ALA M O   1 
ATOM   4220  C CB  . ALA B 1 265 ? 18.374  -5.286  51.770  1.00 87.28  ? 284 ALA M CB  1 
ATOM   4221  N N   . TRP B 1 266 ? 16.065  -3.154  51.407  1.00 75.13  ? 285 TRP M N   1 
ATOM   4222  C CA  . TRP B 1 266 ? 15.090  -2.320  52.094  1.00 77.83  ? 285 TRP M CA  1 
ATOM   4223  C C   . TRP B 1 266 ? 15.160  -2.572  53.594  1.00 80.66  ? 285 TRP M C   1 
ATOM   4224  O O   . TRP B 1 266 ? 15.171  -3.722  54.041  1.00 82.91  ? 285 TRP M O   1 
ATOM   4225  C CB  . TRP B 1 266 ? 13.682  -2.610  51.577  1.00 78.78  ? 285 TRP M CB  1 
ATOM   4226  C CG  . TRP B 1 266 ? 13.363  -1.961  50.267  1.00 79.14  ? 285 TRP M CG  1 
ATOM   4227  C CD1 . TRP B 1 266 ? 13.368  -2.552  49.037  1.00 81.20  ? 285 TRP M CD1 1 
ATOM   4228  C CD2 . TRP B 1 266 ? 12.968  -0.600  50.057  1.00 79.94  ? 285 TRP M CD2 1 
ATOM   4229  N NE1 . TRP B 1 266 ? 13.013  -1.641  48.072  1.00 79.94  ? 285 TRP M NE1 1 
ATOM   4230  C CE2 . TRP B 1 266 ? 12.761  -0.435  48.672  1.00 79.87  ? 285 TRP M CE2 1 
ATOM   4231  C CE3 . TRP B 1 266 ? 12.774  0.496   50.904  1.00 81.78  ? 285 TRP M CE3 1 
ATOM   4232  C CZ2 . TRP B 1 266 ? 12.368  0.781   48.116  1.00 83.11  ? 285 TRP M CZ2 1 
ATOM   4233  C CZ3 . TRP B 1 266 ? 12.385  1.704   50.350  1.00 83.11  ? 285 TRP M CZ3 1 
ATOM   4234  C CH2 . TRP B 1 266 ? 12.187  1.836   48.969  1.00 86.66  ? 285 TRP M CH2 1 
ATOM   4235  N N   . SER B 1 267 ? 15.225  -1.494  54.372  1.00 83.44  ? 286 SER M N   1 
ATOM   4236  C CA  . SER B 1 267 ? 15.204  -1.630  55.821  1.00 84.91  ? 286 SER M CA  1 
ATOM   4237  C C   . SER B 1 267 ? 13.919  -2.321  56.262  1.00 88.51  ? 286 SER M C   1 
ATOM   4238  O O   . SER B 1 267 ? 12.867  -2.185  55.630  1.00 82.61  ? 286 SER M O   1 
ATOM   4239  C CB  . SER B 1 267 ? 15.325  -0.259  56.491  1.00 86.77  ? 286 SER M CB  1 
ATOM   4240  O OG  . SER B 1 267 ? 14.054  0.345   56.669  1.00 86.48  ? 286 SER M OG  1 
ATOM   4241  N N   . THR B 1 268 ? 14.016  -3.087  57.345  1.00 93.25  ? 287 THR M N   1 
ATOM   4242  C CA  . THR B 1 268 ? 12.842  -3.772  57.865  1.00 89.06  ? 287 THR M CA  1 
ATOM   4243  C C   . THR B 1 268 ? 11.780  -2.745  58.252  1.00 87.02  ? 287 THR M C   1 
ATOM   4244  O O   . THR B 1 268 ? 12.110  -1.699  58.825  1.00 83.25  ? 287 THR M O   1 
ATOM   4245  C CB  . THR B 1 268 ? 13.203  -4.646  59.069  1.00 88.36  ? 287 THR M CB  1 
ATOM   4246  O OG1 . THR B 1 268 ? 13.937  -3.873  60.027  1.00 91.67  ? 287 THR M OG1 1 
ATOM   4247  C CG2 . THR B 1 268 ? 14.040  -5.842  58.630  1.00 85.20  ? 287 THR M CG2 1 
ATOM   4248  N N   . PRO B 1 269 ? 10.507  -3.005  57.949  1.00 87.18  ? 288 PRO M N   1 
ATOM   4249  C CA  . PRO B 1 269 ? 9.479   -1.970  58.115  1.00 88.88  ? 288 PRO M CA  1 
ATOM   4250  C C   . PRO B 1 269 ? 9.389   -1.481  59.551  1.00 90.23  ? 288 PRO M C   1 
ATOM   4251  O O   . PRO B 1 269 ? 9.632   -2.225  60.503  1.00 98.38  ? 288 PRO M O   1 
ATOM   4252  C CB  . PRO B 1 269 ? 8.187   -2.678  57.688  1.00 85.16  ? 288 PRO M CB  1 
ATOM   4253  C CG  . PRO B 1 269 ? 8.636   -3.832  56.854  1.00 84.81  ? 288 PRO M CG  1 
ATOM   4254  C CD  . PRO B 1 269 ? 9.947   -4.264  57.431  1.00 84.47  ? 288 PRO M CD  1 
ATOM   4255  N N   . GLN B 1 270 ? 9.048   -0.204  59.697  1.00 93.79  ? 289 GLN M N   1 
ATOM   4256  C CA  . GLN B 1 270 ? 8.875   0.406   61.009  1.00 95.72  ? 289 GLN M CA  1 
ATOM   4257  C C   . GLN B 1 270 ? 7.503   1.057   61.061  1.00 97.80  ? 289 GLN M C   1 
ATOM   4258  O O   . GLN B 1 270 ? 7.184   1.905   60.221  1.00 103.26 ? 289 GLN M O   1 
ATOM   4259  C CB  . GLN B 1 270 ? 9.985   1.422   61.293  1.00 94.35  ? 289 GLN M CB  1 
ATOM   4260  C CG  . GLN B 1 270 ? 11.379  0.881   61.002  1.00 95.19  ? 289 GLN M CG  1 
ATOM   4261  C CD  . GLN B 1 270 ? 12.483  1.822   61.434  1.00 98.57  ? 289 GLN M CD  1 
ATOM   4262  O OE1 . GLN B 1 270 ? 13.577  1.816   60.866  1.00 99.51  ? 289 GLN M OE1 1 
ATOM   4263  N NE2 . GLN B 1 270 ? 12.207  2.634   62.450  1.00 95.21  ? 289 GLN M NE2 1 
ATOM   4264  N N   . ARG B 1 271 ? 6.688   0.637   62.028  1.00 108.00 ? 290 ARG M N   1 
ATOM   4265  C CA  . ARG B 1 271 ? 5.337   1.151   62.199  1.00 105.87 ? 290 ARG M CA  1 
ATOM   4266  C C   . ARG B 1 271 ? 5.346   2.352   63.133  1.00 103.38 ? 290 ARG M C   1 
ATOM   4267  O O   . ARG B 1 271 ? 6.115   2.400   64.097  1.00 102.72 ? 290 ARG M O   1 
ATOM   4268  C CB  . ARG B 1 271 ? 4.417   0.064   62.759  1.00 109.22 ? 290 ARG M CB  1 
ATOM   4269  C CG  . ARG B 1 271 ? 2.940   0.422   62.750  1.00 114.58 ? 290 ARG M CG  1 
ATOM   4270  C CD  . ARG B 1 271 ? 2.105   -0.702  63.344  1.00 119.96 ? 290 ARG M CD  1 
ATOM   4271  N NE  . ARG B 1 271 ? 0.683   -0.370  63.389  1.00 123.84 ? 290 ARG M NE  1 
ATOM   4272  C CZ  . ARG B 1 271 ? -0.172  -0.595  62.395  1.00 122.91 ? 290 ARG M CZ  1 
ATOM   4273  N NH1 . ARG B 1 271 ? 0.248   -1.162  61.270  1.00 119.51 ? 290 ARG M NH1 1 
ATOM   4274  N NH2 . ARG B 1 271 ? -1.448  -0.257  62.528  1.00 119.68 ? 290 ARG M NH2 1 
ATOM   4275  N N   . PHE B 1 272 ? 4.480   3.321   62.847  1.00 101.25 ? 291 PHE M N   1 
ATOM   4276  C CA  . PHE B 1 272 ? 4.388   4.536   63.648  1.00 107.05 ? 291 PHE M CA  1 
ATOM   4277  C C   . PHE B 1 272 ? 2.925   4.944   63.725  1.00 121.00 ? 291 PHE M C   1 
ATOM   4278  O O   . PHE B 1 272 ? 2.336   5.363   62.719  1.00 121.26 ? 291 PHE M O   1 
ATOM   4279  C CB  . PHE B 1 272 ? 5.245   5.656   63.056  1.00 104.89 ? 291 PHE M CB  1 
ATOM   4280  C CG  . PHE B 1 272 ? 6.724   5.415   63.180  1.00 104.28 ? 291 PHE M CG  1 
ATOM   4281  C CD1 . PHE B 1 272 ? 7.405   5.774   64.331  1.00 108.62 ? 291 PHE M CD1 1 
ATOM   4282  C CD2 . PHE B 1 272 ? 7.434   4.828   62.146  1.00 101.77 ? 291 PHE M CD2 1 
ATOM   4283  C CE1 . PHE B 1 272 ? 8.765   5.552   64.447  1.00 108.70 ? 291 PHE M CE1 1 
ATOM   4284  C CE2 . PHE B 1 272 ? 8.793   4.604   62.256  1.00 99.19  ? 291 PHE M CE2 1 
ATOM   4285  C CZ  . PHE B 1 272 ? 9.459   4.965   63.408  1.00 103.67 ? 291 PHE M CZ  1 
ATOM   4286  N N   . GLU B 1 273 ? 2.339   4.784   64.909  1.00 134.84 ? 292 GLU M N   1 
ATOM   4287  C CA  . GLU B 1 273 ? 1.029   5.333   65.221  1.00 129.56 ? 292 GLU M CA  1 
ATOM   4288  C C   . GLU B 1 273 ? 1.216   6.672   65.916  1.00 127.10 ? 292 GLU M C   1 
ATOM   4289  O O   . GLU B 1 273 ? 2.070   6.814   66.796  1.00 126.49 ? 292 GLU M O   1 
ATOM   4290  C CB  . GLU B 1 273 ? 0.232   4.387   66.119  1.00 127.85 ? 292 GLU M CB  1 
ATOM   4291  C CG  . GLU B 1 273 ? 0.050   2.988   65.564  1.00 127.78 ? 292 GLU M CG  1 
ATOM   4292  C CD  . GLU B 1 273 ? -0.714  2.087   66.514  1.00 126.63 ? 292 GLU M CD  1 
ATOM   4293  O OE1 . GLU B 1 273 ? -0.554  2.244   67.744  1.00 124.32 ? 292 GLU M OE1 1 
ATOM   4294  O OE2 . GLU B 1 273 ? -1.474  1.221   66.030  1.00 123.12 ? 292 GLU M OE2 1 
ATOM   4295  N N   . CYS B 1 274 ? 0.422   7.660   65.507  1.00 132.44 ? 293 CYS M N   1 
ATOM   4296  C CA  . CYS B 1 274 ? 0.580   9.020   66.005  1.00 131.11 ? 293 CYS M CA  1 
ATOM   4297  C C   . CYS B 1 274 ? -0.759  9.610   66.430  1.00 131.18 ? 293 CYS M C   1 
ATOM   4298  O O   . CYS B 1 274 ? -0.995  10.813  66.287  1.00 121.76 ? 293 CYS M O   1 
ATOM   4299  C CB  . CYS B 1 274 ? 1.268   9.890   64.956  1.00 132.85 ? 293 CYS M CB  1 
ATOM   4300  S SG  . CYS B 1 274 ? 2.600   8.987   64.112  1.00 133.58 ? 293 CYS M SG  1 
ATOM   4301  N N   . ASP B 1 275 ? -1.645  8.761   66.954  1.00 145.81 ? 294 ASP M N   1 
ATOM   4302  C CA  . ASP B 1 275 ? -2.899  9.189   67.553  1.00 143.74 ? 294 ASP M CA  1 
ATOM   4303  C C   . ASP B 1 275 ? -2.891  9.094   69.071  1.00 144.64 ? 294 ASP M C   1 
ATOM   4304  O O   . ASP B 1 275 ? -3.846  9.551   69.710  1.00 146.08 ? 294 ASP M O   1 
ATOM   4305  C CB  . ASP B 1 275 ? -4.065  8.348   67.008  1.00 138.72 ? 294 ASP M CB  1 
ATOM   4306  C CG  . ASP B 1 275 ? -4.003  8.162   65.502  1.00 132.63 ? 294 ASP M CG  1 
ATOM   4307  O OD1 . ASP B 1 275 ? -3.782  9.159   64.783  1.00 126.33 ? 294 ASP M OD1 1 
ATOM   4308  O OD2 . ASP B 1 275 ? -4.179  7.015   65.039  1.00 125.13 ? 294 ASP M OD2 1 
ATOM   4309  N N   . GLN B 1 276 ? -1.848  8.516   69.660  1.00 147.98 ? 295 GLN M N   1 
ATOM   4310  C CA  . GLN B 1 276 ? -1.791  8.290   71.099  1.00 143.35 ? 295 GLN M CA  1 
ATOM   4311  C C   . GLN B 1 276 ? -1.432  9.566   71.854  1.00 138.37 ? 295 GLN M C   1 
ATOM   4312  O O   . GLN B 1 276 ? -1.937  9.810   72.951  1.00 136.53 ? 295 GLN M O   1 
ATOM   4313  C CB  . GLN B 1 276 ? -0.779  7.186   71.420  1.00 140.73 ? 295 GLN M CB  1 
ATOM   4314  C CG  . GLN B 1 276 ? -0.718  6.070   70.381  1.00 138.16 ? 295 GLN M CG  1 
ATOM   4315  C CD  . GLN B 1 276 ? -2.073  5.444   70.092  1.00 136.87 ? 295 GLN M CD  1 
ATOM   4316  O OE1 . GLN B 1 276 ? -2.948  5.391   70.959  1.00 139.56 ? 295 GLN M OE1 1 
ATOM   4317  N NE2 . GLN B 1 276 ? -2.256  4.979   68.862  1.00 130.10 ? 295 GLN M NE2 1 
ATOM   4318  N N   . GLU C 2 1   ? 16.701  -41.016 21.457  1.00 108.10 ? 25  GLU A N   1 
ATOM   4319  C CA  . GLU C 2 1   ? 17.122  -40.354 20.228  1.00 110.05 ? 25  GLU A CA  1 
ATOM   4320  C C   . GLU C 2 1   ? 18.055  -39.193 20.552  1.00 110.18 ? 25  GLU A C   1 
ATOM   4321  O O   . GLU C 2 1   ? 19.276  -39.352 20.544  1.00 115.54 ? 25  GLU A O   1 
ATOM   4322  C CB  . GLU C 2 1   ? 15.907  -39.871 19.438  1.00 113.60 ? 25  GLU A CB  1 
ATOM   4323  C CG  . GLU C 2 1   ? 14.848  -40.945 19.252  1.00 118.68 ? 25  GLU A CG  1 
ATOM   4324  C CD  . GLU C 2 1   ? 14.153  -40.861 17.908  1.00 120.97 ? 25  GLU A CD  1 
ATOM   4325  O OE1 . GLU C 2 1   ? 14.467  -41.691 17.027  1.00 122.35 ? 25  GLU A OE1 1 
ATOM   4326  O OE2 . GLU C 2 1   ? 13.295  -39.970 17.733  1.00 122.46 ? 25  GLU A OE2 1 
ATOM   4327  N N   . GLU C 2 2   ? 17.483  -38.026 20.835  1.00 99.12  ? 26  GLU A N   1 
ATOM   4328  C CA  . GLU C 2 2   ? 18.275  -36.921 21.349  1.00 96.80  ? 26  GLU A CA  1 
ATOM   4329  C C   . GLU C 2 2   ? 18.526  -37.121 22.838  1.00 92.07  ? 26  GLU A C   1 
ATOM   4330  O O   . GLU C 2 2   ? 17.707  -37.708 23.552  1.00 90.51  ? 26  GLU A O   1 
ATOM   4331  C CB  . GLU C 2 2   ? 17.579  -35.584 21.093  1.00 101.95 ? 26  GLU A CB  1 
ATOM   4332  C CG  . GLU C 2 2   ? 16.124  -35.532 21.521  1.00 104.40 ? 26  GLU A CG  1 
ATOM   4333  C CD  . GLU C 2 2   ? 15.504  -34.163 21.294  1.00 107.27 ? 26  GLU A CD  1 
ATOM   4334  O OE1 . GLU C 2 2   ? 16.006  -33.170 21.866  1.00 101.79 ? 26  GLU A OE1 1 
ATOM   4335  O OE2 . GLU C 2 2   ? 14.517  -34.081 20.533  1.00 109.33 ? 26  GLU A OE2 1 
ATOM   4336  N N   . THR C 2 3   ? 19.675  -36.633 23.300  1.00 82.09  ? 27  THR A N   1 
ATOM   4337  C CA  . THR C 2 3   ? 20.137  -36.921 24.650  1.00 81.04  ? 27  THR A CA  1 
ATOM   4338  C C   . THR C 2 3   ? 19.173  -36.361 25.697  1.00 81.93  ? 27  THR A C   1 
ATOM   4339  O O   . THR C 2 3   ? 18.302  -35.537 25.412  1.00 86.43  ? 27  THR A O   1 
ATOM   4340  C CB  . THR C 2 3   ? 21.536  -36.348 24.870  1.00 82.15  ? 27  THR A CB  1 
ATOM   4341  O OG1 . THR C 2 3   ? 21.449  -34.935 25.090  1.00 81.07  ? 27  THR A OG1 1 
ATOM   4342  C CG2 . THR C 2 3   ? 22.408  -36.610 23.662  1.00 84.19  ? 27  THR A CG2 1 
ATOM   4343  N N   . ILE C 2 4   ? 19.341  -36.841 26.934  1.00 81.07  ? 28  ILE A N   1 
ATOM   4344  C CA  . ILE C 2 4   ? 18.501  -36.361 28.035  1.00 80.69  ? 28  ILE A CA  1 
ATOM   4345  C C   . ILE C 2 4   ? 18.693  -34.872 28.284  1.00 78.69  ? 28  ILE A C   1 
ATOM   4346  O O   . ILE C 2 4   ? 17.690  -34.166 28.475  1.00 83.86  ? 28  ILE A O   1 
ATOM   4347  C CB  . ILE C 2 4   ? 18.729  -37.219 29.287  1.00 84.59  ? 28  ILE A CB  1 
ATOM   4348  C CG1 . ILE C 2 4   ? 18.245  -38.651 29.057  1.00 86.82  ? 28  ILE A CG1 1 
ATOM   4349  C CG2 . ILE C 2 4   ? 18.031  -36.615 30.494  1.00 85.68  ? 28  ILE A CG2 1 
ATOM   4350  C CD1 . ILE C 2 4   ? 18.512  -39.561 30.229  1.00 89.32  ? 28  ILE A CD1 1 
ATOM   4351  N N   . PRO C 2 5   ? 19.917  -34.322 28.315  1.00 78.68  ? 29  PRO A N   1 
ATOM   4352  C CA  . PRO C 2 5   ? 20.043  -32.861 28.465  1.00 78.17  ? 29  PRO A CA  1 
ATOM   4353  C C   . PRO C 2 5   ? 19.378  -32.074 27.345  1.00 77.81  ? 29  PRO A C   1 
ATOM   4354  O O   . PRO C 2 5   ? 18.711  -31.070 27.617  1.00 77.60  ? 29  PRO A O   1 
ATOM   4355  C CB  . PRO C 2 5   ? 21.564  -32.652 28.487  1.00 77.94  ? 29  PRO A CB  1 
ATOM   4356  C CG  . PRO C 2 5   ? 22.098  -33.910 29.018  1.00 78.42  ? 29  PRO A CG  1 
ATOM   4357  C CD  . PRO C 2 5   ? 21.230  -34.983 28.434  1.00 78.79  ? 29  PRO A CD  1 
ATOM   4358  N N   . LEU C 2 6   ? 19.537  -32.502 26.089  1.00 80.27  ? 30  LEU A N   1 
ATOM   4359  C CA  . LEU C 2 6   ? 18.860  -31.843 24.975  1.00 81.65  ? 30  LEU A CA  1 
ATOM   4360  C C   . LEU C 2 6   ? 17.346  -31.989 25.037  1.00 82.03  ? 30  LEU A C   1 
ATOM   4361  O O   . LEU C 2 6   ? 16.635  -31.148 24.479  1.00 81.63  ? 30  LEU A O   1 
ATOM   4362  C CB  . LEU C 2 6   ? 19.375  -32.392 23.643  1.00 85.63  ? 30  LEU A CB  1 
ATOM   4363  C CG  . LEU C 2 6   ? 20.841  -32.077 23.328  1.00 88.36  ? 30  LEU A CG  1 
ATOM   4364  C CD1 . LEU C 2 6   ? 21.372  -33.035 22.277  1.00 93.02  ? 30  LEU A CD1 1 
ATOM   4365  C CD2 . LEU C 2 6   ? 21.030  -30.618 22.909  1.00 87.61  ? 30  LEU A CD2 1 
ATOM   4366  N N   . GLN C 2 7   ? 16.838  -33.047 25.671  1.00 82.41  ? 31  GLN A N   1 
ATOM   4367  C CA  . GLN C 2 7   ? 15.397  -33.191 25.851  1.00 84.39  ? 31  GLN A CA  1 
ATOM   4368  C C   . GLN C 2 7   ? 14.877  -32.282 26.955  1.00 81.22  ? 31  GLN A C   1 
ATOM   4369  O O   . GLN C 2 7   ? 13.787  -31.712 26.831  1.00 86.40  ? 31  GLN A O   1 
ATOM   4370  C CB  . GLN C 2 7   ? 15.046  -34.647 26.169  1.00 88.67  ? 31  GLN A CB  1 
ATOM   4371  C CG  . GLN C 2 7   ? 14.156  -35.332 25.143  1.00 90.14  ? 31  GLN A CG  1 
ATOM   4372  C CD  . GLN C 2 7   ? 13.786  -36.747 25.546  1.00 88.30  ? 31  GLN A CD  1 
ATOM   4373  O OE1 . GLN C 2 7   ? 14.573  -37.451 26.177  1.00 86.17  ? 31  GLN A OE1 1 
ATOM   4374  N NE2 . GLN C 2 7   ? 12.581  -37.172 25.180  1.00 86.27  ? 31  GLN A NE2 1 
ATOM   4375  N N   . THR C 2 8   ? 15.638  -32.139 28.037  1.00 80.15  ? 32  THR A N   1 
ATOM   4376  C CA  . THR C 2 8   ? 15.189  -31.382 29.195  1.00 82.63  ? 32  THR A CA  1 
ATOM   4377  C C   . THR C 2 8   ? 15.480  -29.890 29.098  1.00 84.69  ? 32  THR A C   1 
ATOM   4378  O O   . THR C 2 8   ? 14.932  -29.120 29.894  1.00 91.19  ? 32  THR A O   1 
ATOM   4379  C CB  . THR C 2 8   ? 15.829  -31.938 30.473  1.00 81.08  ? 32  THR A CB  1 
ATOM   4380  O OG1 . THR C 2 8   ? 17.252  -32.009 30.313  1.00 80.20  ? 32  THR A OG1 1 
ATOM   4381  C CG2 . THR C 2 8   ? 15.286  -33.320 30.781  1.00 82.25  ? 32  THR A CG2 1 
ATOM   4382  N N   . LEU C 2 9   ? 16.311  -29.461 28.150  1.00 83.04  ? 33  LEU A N   1 
ATOM   4383  C CA  . LEU C 2 9   ? 16.731  -28.066 28.085  1.00 79.33  ? 33  LEU A CA  1 
ATOM   4384  C C   . LEU C 2 9   ? 15.567  -27.172 27.678  1.00 79.22  ? 33  LEU A C   1 
ATOM   4385  O O   . LEU C 2 9   ? 14.976  -27.354 26.608  1.00 79.23  ? 33  LEU A O   1 
ATOM   4386  C CB  . LEU C 2 9   ? 17.885  -27.906 27.102  1.00 79.07  ? 33  LEU A CB  1 
ATOM   4387  C CG  . LEU C 2 9   ? 18.484  -26.502 27.009  1.00 78.38  ? 33  LEU A CG  1 
ATOM   4388  C CD1 . LEU C 2 9   ? 19.262  -26.156 28.269  1.00 78.35  ? 33  LEU A CD1 1 
ATOM   4389  C CD2 . LEU C 2 9   ? 19.366  -26.391 25.785  1.00 78.07  ? 33  LEU A CD2 1 
ATOM   4390  N N   . ARG C 2 10  ? 15.245  -26.204 28.533  1.00 84.67  ? 34  ARG A N   1 
ATOM   4391  C CA  . ARG C 2 10  ? 14.278  -25.156 28.233  1.00 83.99  ? 34  ARG A CA  1 
ATOM   4392  C C   . ARG C 2 10  ? 14.873  -23.829 28.676  1.00 84.31  ? 34  ARG A C   1 
ATOM   4393  O O   . ARG C 2 10  ? 15.315  -23.701 29.822  1.00 77.60  ? 34  ARG A O   1 
ATOM   4394  C CB  . ARG C 2 10  ? 12.941  -25.399 28.941  1.00 83.99  ? 34  ARG A CB  1 
ATOM   4395  C CG  . ARG C 2 10  ? 12.219  -26.659 28.506  1.00 84.15  ? 34  ARG A CG  1 
ATOM   4396  C CD  . ARG C 2 10  ? 11.937  -26.640 27.018  1.00 85.88  ? 34  ARG A CD  1 
ATOM   4397  N NE  . ARG C 2 10  ? 10.894  -27.593 26.653  1.00 90.84  ? 34  ARG A NE  1 
ATOM   4398  C CZ  . ARG C 2 10  ? 11.106  -28.889 26.456  1.00 88.65  ? 34  ARG A CZ  1 
ATOM   4399  N NH1 . ARG C 2 10  ? 12.327  -29.389 26.592  1.00 85.10  ? 34  ARG A NH1 1 
ATOM   4400  N NH2 . ARG C 2 10  ? 10.099  -29.687 26.126  1.00 90.76  ? 34  ARG A NH2 1 
ATOM   4401  N N   . CYS C 2 11  ? 14.892  -22.850 27.775  1.00 85.14  ? 35  CYS A N   1 
ATOM   4402  C CA  . CYS C 2 11  ? 15.509  -21.556 28.040  1.00 84.45  ? 35  CYS A CA  1 
ATOM   4403  C C   . CYS C 2 11  ? 14.476  -20.457 27.858  1.00 85.05  ? 35  CYS A C   1 
ATOM   4404  O O   . CYS C 2 11  ? 13.926  -20.291 26.764  1.00 85.15  ? 35  CYS A O   1 
ATOM   4405  C CB  . CYS C 2 11  ? 16.707  -21.322 27.122  1.00 82.29  ? 35  CYS A CB  1 
ATOM   4406  S SG  . CYS C 2 11  ? 18.075  -22.449 27.430  1.00 84.71  ? 35  CYS A SG  1 
ATOM   4407  N N   . TYR C 2 12  ? 14.226  -19.703 28.924  1.00 80.56  ? 36  TYR A N   1 
ATOM   4408  C CA  . TYR C 2 12  ? 13.262  -18.615 28.915  1.00 78.32  ? 36  TYR A CA  1 
ATOM   4409  C C   . TYR C 2 12  ? 13.944  -17.329 29.357  1.00 78.20  ? 36  TYR A C   1 
ATOM   4410  O O   . TYR C 2 12  ? 14.790  -17.341 30.255  1.00 78.00  ? 36  TYR A O   1 
ATOM   4411  C CB  . TYR C 2 12  ? 12.079  -18.921 29.837  1.00 79.64  ? 36  TYR A CB  1 
ATOM   4412  C CG  . TYR C 2 12  ? 11.139  -19.984 29.316  1.00 79.31  ? 36  TYR A CG  1 
ATOM   4413  C CD1 . TYR C 2 12  ? 10.423  -19.789 28.145  1.00 78.51  ? 36  TYR A CD1 1 
ATOM   4414  C CD2 . TYR C 2 12  ? 10.955  -21.177 30.005  1.00 77.56  ? 36  TYR A CD2 1 
ATOM   4415  C CE1 . TYR C 2 12  ? 9.556   -20.750 27.670  1.00 77.79  ? 36  TYR A CE1 1 
ATOM   4416  C CE2 . TYR C 2 12  ? 10.087  -22.145 29.535  1.00 76.47  ? 36  TYR A CE2 1 
ATOM   4417  C CZ  . TYR C 2 12  ? 9.391   -21.923 28.367  1.00 75.70  ? 36  TYR A CZ  1 
ATOM   4418  O OH  . TYR C 2 12  ? 8.526   -22.877 27.888  1.00 77.50  ? 36  TYR A OH  1 
ATOM   4419  N N   . ASN C 2 13  ? 13.566  -16.218 28.734  1.00 78.52  ? 37  ASN A N   1 
ATOM   4420  C CA  . ASN C 2 13  ? 14.164  -14.927 29.032  1.00 75.04  ? 37  ASN A CA  1 
ATOM   4421  C C   . ASN C 2 13  ? 13.072  -13.904 29.306  1.00 74.38  ? 37  ASN A C   1 
ATOM   4422  O O   . ASN C 2 13  ? 11.933  -14.046 28.857  1.00 69.90  ? 37  ASN A O   1 
ATOM   4423  C CB  . ASN C 2 13  ? 15.047  -14.454 27.878  1.00 74.15  ? 37  ASN A CB  1 
ATOM   4424  C CG  . ASN C 2 13  ? 14.356  -14.580 26.542  1.00 75.77  ? 37  ASN A CG  1 
ATOM   4425  O OD1 . ASN C 2 13  ? 14.158  -15.684 26.038  1.00 78.77  ? 37  ASN A OD1 1 
ATOM   4426  N ND2 . ASN C 2 13  ? 13.993  -13.448 25.952  1.00 73.13  ? 37  ASN A ND2 1 
ATOM   4427  N N   . ASP C 2 14  ? 13.436  -12.865 30.060  1.00 75.22  ? 38  ASP A N   1 
ATOM   4428  C CA  . ASP C 2 14  ? 12.540  -11.737 30.282  1.00 76.16  ? 38  ASP A CA  1 
ATOM   4429  C C   . ASP C 2 14  ? 12.572  -10.734 29.138  1.00 75.09  ? 38  ASP A C   1 
ATOM   4430  O O   . ASP C 2 14  ? 11.933  -9.681  29.240  1.00 76.90  ? 38  ASP A O   1 
ATOM   4431  C CB  . ASP C 2 14  ? 12.872  -11.036 31.609  1.00 74.74  ? 38  ASP A CB  1 
ATOM   4432  C CG  . ASP C 2 14  ? 14.303  -10.520 31.674  1.00 72.41  ? 38  ASP A CG  1 
ATOM   4433  O OD1 . ASP C 2 14  ? 14.985  -10.457 30.631  1.00 74.36  ? 38  ASP A OD1 1 
ATOM   4434  O OD2 . ASP C 2 14  ? 14.747  -10.161 32.784  1.00 70.06  ? 38  ASP A OD2 1 
ATOM   4435  N N   . TYR C 2 15  ? 13.307  -11.036 28.066  1.00 71.14  ? 39  TYR A N   1 
ATOM   4436  C CA  . TYR C 2 15  ? 13.411  -10.204 26.870  1.00 70.04  ? 39  TYR A CA  1 
ATOM   4437  C C   . TYR C 2 15  ? 14.033  -8.847  27.156  1.00 69.70  ? 39  TYR A C   1 
ATOM   4438  O O   . TYR C 2 15  ? 13.849  -7.906  26.378  1.00 70.68  ? 39  TYR A O   1 
ATOM   4439  C CB  . TYR C 2 15  ? 12.047  -10.012 26.203  1.00 71.42  ? 39  TYR A CB  1 
ATOM   4440  C CG  . TYR C 2 15  ? 12.112  -9.809  24.711  1.00 73.97  ? 39  TYR A CG  1 
ATOM   4441  C CD1 . TYR C 2 15  ? 12.940  -10.590 23.922  1.00 75.55  ? 39  TYR A CD1 1 
ATOM   4442  C CD2 . TYR C 2 15  ? 11.343  -8.837  24.092  1.00 76.70  ? 39  TYR A CD2 1 
ATOM   4443  C CE1 . TYR C 2 15  ? 12.999  -10.413 22.556  1.00 76.69  ? 39  TYR A CE1 1 
ATOM   4444  C CE2 . TYR C 2 15  ? 11.397  -8.651  22.729  1.00 76.78  ? 39  TYR A CE2 1 
ATOM   4445  C CZ  . TYR C 2 15  ? 12.225  -9.442  21.964  1.00 76.71  ? 39  TYR A CZ  1 
ATOM   4446  O OH  . TYR C 2 15  ? 12.277  -9.257  20.601  1.00 74.44  ? 39  TYR A OH  1 
ATOM   4447  N N   . THR C 2 16  ? 14.768  -8.716  28.262  1.00 72.70  ? 40  THR A N   1 
ATOM   4448  C CA  . THR C 2 16  ? 15.343  -7.422  28.608  1.00 73.42  ? 40  THR A CA  1 
ATOM   4449  C C   . THR C 2 16  ? 16.642  -7.527  29.406  1.00 71.57  ? 40  THR A C   1 
ATOM   4450  O O   . THR C 2 16  ? 17.562  -6.734  29.186  1.00 74.91  ? 40  THR A O   1 
ATOM   4451  C CB  . THR C 2 16  ? 14.320  -6.574  29.378  1.00 75.67  ? 40  THR A CB  1 
ATOM   4452  O OG1 . THR C 2 16  ? 14.959  -5.400  29.890  1.00 85.11  ? 40  THR A OG1 1 
ATOM   4453  C CG2 . THR C 2 16  ? 13.719  -7.351  30.532  1.00 78.10  ? 40  THR A CG2 1 
ATOM   4454  N N   . SER C 2 17  ? 16.750  -8.486  30.316  1.00 71.51  ? 41  SER A N   1 
ATOM   4455  C CA  . SER C 2 17  ? 17.913  -8.449  31.200  1.00 75.28  ? 41  SER A CA  1 
ATOM   4456  C C   . SER C 2 17  ? 18.724  -9.738  31.222  1.00 81.16  ? 41  SER A C   1 
ATOM   4457  O O   . SER C 2 17  ? 19.956  -9.676  31.198  1.00 88.27  ? 41  SER A O   1 
ATOM   4458  C CB  . SER C 2 17  ? 17.463  -8.101  32.624  1.00 76.25  ? 41  SER A CB  1 
ATOM   4459  O OG  . SER C 2 17  ? 17.121  -9.272  33.341  1.00 78.25  ? 41  SER A OG  1 
ATOM   4460  N N   . HIS C 2 18  ? 18.076  -10.897 31.284  1.00 79.52  ? 42  HIS A N   1 
ATOM   4461  C CA  . HIS C 2 18  ? 18.805  -12.149 31.436  1.00 79.40  ? 42  HIS A CA  1 
ATOM   4462  C C   . HIS C 2 18  ? 17.967  -13.288 30.877  1.00 81.12  ? 42  HIS A C   1 
ATOM   4463  O O   . HIS C 2 18  ? 16.782  -13.127 30.575  1.00 80.98  ? 42  HIS A O   1 
ATOM   4464  C CB  . HIS C 2 18  ? 19.161  -12.407 32.903  1.00 82.02  ? 42  HIS A CB  1 
ATOM   4465  C CG  . HIS C 2 18  ? 17.969  -12.502 33.804  1.00 84.32  ? 42  HIS A CG  1 
ATOM   4466  N ND1 . HIS C 2 18  ? 17.668  -11.538 34.742  1.00 83.27  ? 42  HIS A ND1 1 
ATOM   4467  C CD2 . HIS C 2 18  ? 17.004  -13.446 33.914  1.00 84.50  ? 42  HIS A CD2 1 
ATOM   4468  C CE1 . HIS C 2 18  ? 16.570  -11.884 35.390  1.00 82.14  ? 42  HIS A CE1 1 
ATOM   4469  N NE2 . HIS C 2 18  ? 16.147  -13.038 34.907  1.00 87.19  ? 42  HIS A NE2 1 
ATOM   4470  N N   . ILE C 2 19  ? 18.602  -14.452 30.753  1.00 83.56  ? 43  ILE A N   1 
ATOM   4471  C CA  . ILE C 2 19  ? 17.945  -15.660 30.268  1.00 82.28  ? 43  ILE A CA  1 
ATOM   4472  C C   . ILE C 2 19  ? 18.333  -16.828 31.169  1.00 80.57  ? 43  ILE A C   1 
ATOM   4473  O O   . ILE C 2 19  ? 19.514  -17.015 31.489  1.00 77.81  ? 43  ILE A O   1 
ATOM   4474  C CB  . ILE C 2 19  ? 18.285  -15.940 28.786  1.00 81.03  ? 43  ILE A CB  1 
ATOM   4475  C CG1 . ILE C 2 19  ? 17.517  -17.152 28.256  1.00 82.85  ? 43  ILE A CG1 1 
ATOM   4476  C CG2 . ILE C 2 19  ? 19.776  -16.091 28.556  1.00 80.98  ? 43  ILE A CG2 1 
ATOM   4477  C CD1 . ILE C 2 19  ? 17.616  -17.302 26.752  1.00 82.21  ? 43  ILE A CD1 1 
ATOM   4478  N N   . THR C 2 20  ? 17.332  -17.598 31.594  1.00 81.78  ? 44  THR A N   1 
ATOM   4479  C CA  . THR C 2 20  ? 17.511  -18.729 32.493  1.00 80.97  ? 44  THR A CA  1 
ATOM   4480  C C   . THR C 2 20  ? 17.155  -20.015 31.762  1.00 84.41  ? 44  THR A C   1 
ATOM   4481  O O   . THR C 2 20  ? 16.088  -20.112 31.144  1.00 84.65  ? 44  THR A O   1 
ATOM   4482  C CB  . THR C 2 20  ? 16.645  -18.587 33.747  1.00 81.26  ? 44  THR A CB  1 
ATOM   4483  O OG1 . THR C 2 20  ? 15.263  -18.530 33.371  1.00 85.36  ? 44  THR A OG1 1 
ATOM   4484  C CG2 . THR C 2 20  ? 17.005  -17.320 34.500  1.00 83.88  ? 44  THR A CG2 1 
ATOM   4485  N N   . CYS C 2 21  ? 18.050  -20.991 31.838  1.00 86.55  ? 45  CYS A N   1 
ATOM   4486  C CA  . CYS C 2 21  ? 17.865  -22.303 31.247  1.00 82.45  ? 45  CYS A CA  1 
ATOM   4487  C C   . CYS C 2 21  ? 17.771  -23.354 32.343  1.00 81.67  ? 45  CYS A C   1 
ATOM   4488  O O   . CYS C 2 21  ? 18.378  -23.224 33.412  1.00 81.21  ? 45  CYS A O   1 
ATOM   4489  C CB  . CYS C 2 21  ? 19.018  -22.649 30.305  1.00 83.76  ? 45  CYS A CB  1 
ATOM   4490  S SG  . CYS C 2 21  ? 19.167  -21.550 28.888  1.00 88.90  ? 45  CYS A SG  1 
ATOM   4491  N N   . ARG C 2 22  ? 17.003  -24.399 32.057  1.00 85.38  ? 46  ARG A N   1 
ATOM   4492  C CA  . ARG C 2 22  ? 16.830  -25.516 32.972  1.00 88.46  ? 46  ARG A CA  1 
ATOM   4493  C C   . ARG C 2 22  ? 16.921  -26.815 32.188  1.00 87.87  ? 46  ARG A C   1 
ATOM   4494  O O   . ARG C 2 22  ? 16.265  -26.972 31.153  1.00 88.36  ? 46  ARG A O   1 
ATOM   4495  C CB  . ARG C 2 22  ? 15.496  -25.421 33.719  1.00 94.09  ? 46  ARG A CB  1 
ATOM   4496  C CG  . ARG C 2 22  ? 15.516  -24.407 34.855  1.00 95.10  ? 46  ARG A CG  1 
ATOM   4497  C CD  . ARG C 2 22  ? 14.166  -24.301 35.538  1.00 96.54  ? 46  ARG A CD  1 
ATOM   4498  N NE  . ARG C 2 22  ? 14.278  -24.406 36.989  1.00 97.05  ? 46  ARG A NE  1 
ATOM   4499  C CZ  . ARG C 2 22  ? 14.234  -23.367 37.817  1.00 96.85  ? 46  ARG A CZ  1 
ATOM   4500  N NH1 . ARG C 2 22  ? 14.081  -22.142 37.334  1.00 98.38  ? 46  ARG A NH1 1 
ATOM   4501  N NH2 . ARG C 2 22  ? 14.343  -23.551 39.128  1.00 99.50  ? 46  ARG A NH2 1 
ATOM   4502  N N   . TRP C 2 23  ? 17.743  -27.733 32.684  1.00 87.23  ? 47  TRP A N   1 
ATOM   4503  C CA  . TRP C 2 23  ? 18.034  -28.982 31.997  1.00 87.24  ? 47  TRP A CA  1 
ATOM   4504  C C   . TRP C 2 23  ? 18.539  -29.978 33.027  1.00 89.60  ? 47  TRP A C   1 
ATOM   4505  O O   . TRP C 2 23  ? 19.082  -29.596 34.065  1.00 86.59  ? 47  TRP A O   1 
ATOM   4506  C CB  . TRP C 2 23  ? 19.068  -28.776 30.887  1.00 85.83  ? 47  TRP A CB  1 
ATOM   4507  C CG  . TRP C 2 23  ? 20.390  -28.301 31.409  1.00 85.27  ? 47  TRP A CG  1 
ATOM   4508  C CD1 . TRP C 2 23  ? 20.753  -27.012 31.664  1.00 83.53  ? 47  TRP A CD1 1 
ATOM   4509  C CD2 . TRP C 2 23  ? 21.522  -29.111 31.749  1.00 88.04  ? 47  TRP A CD2 1 
ATOM   4510  N NE1 . TRP C 2 23  ? 22.040  -26.968 32.139  1.00 83.12  ? 47  TRP A NE1 1 
ATOM   4511  C CE2 . TRP C 2 23  ? 22.535  -28.243 32.200  1.00 84.82  ? 47  TRP A CE2 1 
ATOM   4512  C CE3 . TRP C 2 23  ? 21.777  -30.485 31.714  1.00 92.31  ? 47  TRP A CE3 1 
ATOM   4513  C CZ2 . TRP C 2 23  ? 23.785  -28.703 32.612  1.00 84.65  ? 47  TRP A CZ2 1 
ATOM   4514  C CZ3 . TRP C 2 23  ? 23.019  -30.940 32.123  1.00 92.04  ? 47  TRP A CZ3 1 
ATOM   4515  C CH2 . TRP C 2 23  ? 24.006  -30.051 32.567  1.00 87.34  ? 47  TRP A CH2 1 
ATOM   4516  N N   . ALA C 2 24  ? 18.371  -31.262 32.728  1.00 89.71  ? 48  ALA A N   1 
ATOM   4517  C CA  . ALA C 2 24  ? 18.646  -32.319 33.691  1.00 90.92  ? 48  ALA A CA  1 
ATOM   4518  C C   . ALA C 2 24  ? 19.671  -33.301 33.142  1.00 90.56  ? 48  ALA A C   1 
ATOM   4519  O O   . ALA C 2 24  ? 19.545  -33.769 32.006  1.00 85.67  ? 48  ALA A O   1 
ATOM   4520  C CB  . ALA C 2 24  ? 17.363  -33.065 34.063  1.00 96.50  ? 48  ALA A CB  1 
ATOM   4521  N N   . ASP C 2 25  ? 20.679  -33.606 33.956  1.00 94.17  ? 49  ASP A N   1 
ATOM   4522  C CA  . ASP C 2 25  ? 21.532  -34.761 33.739  1.00 93.22  ? 49  ASP A CA  1 
ATOM   4523  C C   . ASP C 2 25  ? 20.868  -35.975 34.386  1.00 96.89  ? 49  ASP A C   1 
ATOM   4524  O O   . ASP C 2 25  ? 19.818  -35.867 35.023  1.00 96.94  ? 49  ASP A O   1 
ATOM   4525  C CB  . ASP C 2 25  ? 22.924  -34.510 34.320  1.00 88.67  ? 49  ASP A CB  1 
ATOM   4526  C CG  . ASP C 2 25  ? 24.029  -35.105 33.478  1.00 93.45  ? 49  ASP A CG  1 
ATOM   4527  O OD1 . ASP C 2 25  ? 23.720  -35.863 32.535  1.00 99.32  ? 49  ASP A OD1 1 
ATOM   4528  O OD2 . ASP C 2 25  ? 25.209  -34.817 33.767  1.00 96.18  ? 49  ASP A OD2 1 
ATOM   4529  N N   . THR C 2 26  ? 21.483  -37.145 34.250  1.00 98.03  ? 50  THR A N   1 
ATOM   4530  C CA  . THR C 2 26  ? 21.038  -38.325 34.976  1.00 93.26  ? 50  THR A CA  1 
ATOM   4531  C C   . THR C 2 26  ? 22.146  -38.797 35.909  1.00 89.74  ? 50  THR A C   1 
ATOM   4532  O O   . THR C 2 26  ? 23.332  -38.741 35.565  1.00 89.08  ? 50  THR A O   1 
ATOM   4533  C CB  . THR C 2 26  ? 20.601  -39.450 34.022  1.00 95.74  ? 50  THR A CB  1 
ATOM   4534  O OG1 . THR C 2 26  ? 20.131  -40.569 34.784  1.00 98.46  ? 50  THR A OG1 1 
ATOM   4535  C CG2 . THR C 2 26  ? 21.737  -39.885 33.124  1.00 97.60  ? 50  THR A CG2 1 
ATOM   4536  N N   . GLN C 2 27  ? 21.748  -39.238 37.108  1.00 92.47  ? 51  GLN A N   1 
ATOM   4537  C CA  . GLN C 2 27  ? 22.720  -39.599 38.137  1.00 96.06  ? 51  GLN A CA  1 
ATOM   4538  C C   . GLN C 2 27  ? 23.628  -40.733 37.684  1.00 97.07  ? 51  GLN A C   1 
ATOM   4539  O O   . GLN C 2 27  ? 24.806  -40.773 38.059  1.00 92.03  ? 51  GLN A O   1 
ATOM   4540  C CB  . GLN C 2 27  ? 21.996  -39.991 39.425  1.00 98.35  ? 51  GLN A CB  1 
ATOM   4541  C CG  . GLN C 2 27  ? 21.163  -38.878 40.035  1.00 99.23  ? 51  GLN A CG  1 
ATOM   4542  C CD  . GLN C 2 27  ? 20.081  -39.405 40.954  1.00 100.29 ? 51  GLN A CD  1 
ATOM   4543  O OE1 . GLN C 2 27  ? 20.210  -40.488 41.528  1.00 99.17  ? 51  GLN A OE1 1 
ATOM   4544  N NE2 . GLN C 2 27  ? 18.999  -38.645 41.091  1.00 99.81  ? 51  GLN A NE2 1 
ATOM   4545  N N   . ASP C 2 28  ? 23.099  -41.658 36.880  1.00 95.38  ? 52  ASP A N   1 
ATOM   4546  C CA  . ASP C 2 28  ? 23.888  -42.794 36.418  1.00 96.08  ? 52  ASP A CA  1 
ATOM   4547  C C   . ASP C 2 28  ? 25.031  -42.339 35.519  1.00 97.95  ? 52  ASP A C   1 
ATOM   4548  O O   . ASP C 2 28  ? 26.185  -42.742 35.709  1.00 97.24  ? 52  ASP A O   1 
ATOM   4549  C CB  . ASP C 2 28  ? 22.983  -43.786 35.684  1.00 95.80  ? 52  ASP A CB  1 
ATOM   4550  C CG  . ASP C 2 28  ? 21.695  -44.070 36.438  1.00 95.55  ? 52  ASP A CG  1 
ATOM   4551  O OD1 . ASP C 2 28  ? 21.672  -43.868 37.670  1.00 97.47  ? 52  ASP A OD1 1 
ATOM   4552  O OD2 . ASP C 2 28  ? 20.704  -44.488 35.800  1.00 91.66  ? 52  ASP A OD2 1 
ATOM   4553  N N   . ALA C 2 29  ? 24.729  -41.491 34.532  1.00 93.95  ? 53  ALA A N   1 
ATOM   4554  C CA  . ALA C 2 29  ? 25.759  -41.056 33.597  1.00 90.65  ? 53  ALA A CA  1 
ATOM   4555  C C   . ALA C 2 29  ? 26.812  -40.192 34.273  1.00 89.35  ? 53  ALA A C   1 
ATOM   4556  O O   . ALA C 2 29  ? 27.959  -40.151 33.816  1.00 92.98  ? 53  ALA A O   1 
ATOM   4557  C CB  . ALA C 2 29  ? 25.131  -40.301 32.428  1.00 91.30  ? 53  ALA A CB  1 
ATOM   4558  N N   . GLN C 2 30  ? 26.453  -39.502 35.357  1.00 92.84  ? 54  GLN A N   1 
ATOM   4559  C CA  . GLN C 2 30  ? 27.424  -38.652 36.031  1.00 99.07  ? 54  GLN A CA  1 
ATOM   4560  C C   . GLN C 2 30  ? 28.568  -39.449 36.645  1.00 98.64  ? 54  GLN A C   1 
ATOM   4561  O O   . GLN C 2 30  ? 29.629  -38.875 36.911  1.00 97.70  ? 54  GLN A O   1 
ATOM   4562  C CB  . GLN C 2 30  ? 26.738  -37.806 37.105  1.00 102.83 ? 54  GLN A CB  1 
ATOM   4563  C CG  . GLN C 2 30  ? 26.053  -36.565 36.558  1.00 100.60 ? 54  GLN A CG  1 
ATOM   4564  C CD  . GLN C 2 30  ? 25.540  -35.654 37.651  1.00 99.10  ? 54  GLN A CD  1 
ATOM   4565  O OE1 . GLN C 2 30  ? 24.833  -36.089 38.558  1.00 99.91  ? 54  GLN A OE1 1 
ATOM   4566  N NE2 . GLN C 2 30  ? 25.900  -34.379 37.572  1.00 101.22 ? 54  GLN A NE2 1 
ATOM   4567  N N   . ARG C 2 31  ? 28.383  -40.752 36.870  1.00 95.42  ? 55  ARG A N   1 
ATOM   4568  C CA  . ARG C 2 31  ? 29.483  -41.570 37.372  1.00 98.30  ? 55  ARG A CA  1 
ATOM   4569  C C   . ARG C 2 31  ? 30.609  -41.672 36.353  1.00 95.56  ? 55  ARG A C   1 
ATOM   4570  O O   . ARG C 2 31  ? 31.782  -41.781 36.730  1.00 99.36  ? 55  ARG A O   1 
ATOM   4571  C CB  . ARG C 2 31  ? 28.980  -42.963 37.744  1.00 101.26 ? 55  ARG A CB  1 
ATOM   4572  C CG  . ARG C 2 31  ? 28.002  -42.980 38.902  1.00 105.39 ? 55  ARG A CG  1 
ATOM   4573  C CD  . ARG C 2 31  ? 27.741  -44.398 39.383  1.00 107.15 ? 55  ARG A CD  1 
ATOM   4574  N NE  . ARG C 2 31  ? 26.700  -44.439 40.405  1.00 107.87 ? 55  ARG A NE  1 
ATOM   4575  C CZ  . ARG C 2 31  ? 26.906  -44.168 41.689  1.00 107.65 ? 55  ARG A CZ  1 
ATOM   4576  N NH1 . ARG C 2 31  ? 28.120  -43.843 42.113  1.00 109.66 ? 55  ARG A NH1 1 
ATOM   4577  N NH2 . ARG C 2 31  ? 25.901  -44.226 42.552  1.00 106.64 ? 55  ARG A NH2 1 
ATOM   4578  N N   . LEU C 2 32  ? 30.277  -41.633 35.065  1.00 90.83  ? 56  LEU A N   1 
ATOM   4579  C CA  . LEU C 2 32  ? 31.264  -41.737 33.999  1.00 90.83  ? 56  LEU A CA  1 
ATOM   4580  C C   . LEU C 2 32  ? 31.607  -40.394 33.366  1.00 94.34  ? 56  LEU A C   1 
ATOM   4581  O O   . LEU C 2 32  ? 32.778  -40.144 33.062  1.00 94.44  ? 56  LEU A O   1 
ATOM   4582  C CB  . LEU C 2 32  ? 30.768  -42.702 32.920  1.00 91.80  ? 56  LEU A CB  1 
ATOM   4583  C CG  . LEU C 2 32  ? 30.411  -44.094 33.437  1.00 98.22  ? 56  LEU A CG  1 
ATOM   4584  C CD1 . LEU C 2 32  ? 29.769  -44.927 32.338  1.00 99.91  ? 56  LEU A CD1 1 
ATOM   4585  C CD2 . LEU C 2 32  ? 31.643  -44.785 33.999  1.00 100.91 ? 56  LEU A CD2 1 
ATOM   4586  N N   . VAL C 2 33  ? 30.620  -39.522 33.166  1.00 97.32  ? 57  VAL A N   1 
ATOM   4587  C CA  . VAL C 2 33  ? 30.861  -38.211 32.577  1.00 91.94  ? 57  VAL A CA  1 
ATOM   4588  C C   . VAL C 2 33  ? 29.677  -37.294 32.854  1.00 91.83  ? 57  VAL A C   1 
ATOM   4589  O O   . VAL C 2 33  ? 28.518  -37.670 32.638  1.00 88.29  ? 57  VAL A O   1 
ATOM   4590  C CB  . VAL C 2 33  ? 31.138  -38.329 31.065  1.00 90.72  ? 57  VAL A CB  1 
ATOM   4591  C CG1 . VAL C 2 33  ? 29.979  -39.004 30.350  1.00 88.66  ? 57  VAL A CG1 1 
ATOM   4592  C CG2 . VAL C 2 33  ? 31.405  -36.973 30.462  1.00 89.46  ? 57  VAL A CG2 1 
ATOM   4593  N N   . ASN C 2 34  ? 29.956  -36.096 33.359  1.00 97.29  ? 58  ASN A N   1 
ATOM   4594  C CA  . ASN C 2 34  ? 28.991  -35.008 33.351  1.00 97.02  ? 58  ASN A CA  1 
ATOM   4595  C C   . ASN C 2 34  ? 29.365  -33.928 32.338  1.00 95.00  ? 58  ASN A C   1 
ATOM   4596  O O   . ASN C 2 34  ? 30.522  -33.780 31.931  1.00 91.87  ? 58  ASN A O   1 
ATOM   4597  C CB  . ASN C 2 34  ? 28.807  -34.402 34.749  1.00 98.01  ? 58  ASN A CB  1 
ATOM   4598  C CG  . ASN C 2 34  ? 30.079  -34.377 35.558  1.00 99.91  ? 58  ASN A CG  1 
ATOM   4599  O OD1 . ASN C 2 34  ? 31.188  -34.327 35.022  1.00 96.74  ? 58  ASN A OD1 1 
ATOM   4600  N ND2 . ASN C 2 34  ? 29.911  -34.395 36.871  1.00 107.06 ? 58  ASN A ND2 1 
ATOM   4601  N N   . VAL C 2 35  ? 28.346  -33.183 31.919  1.00 87.55  ? 59  VAL A N   1 
ATOM   4602  C CA  . VAL C 2 35  ? 28.447  -32.292 30.776  1.00 89.22  ? 59  VAL A CA  1 
ATOM   4603  C C   . VAL C 2 35  ? 28.233  -30.852 31.223  1.00 90.57  ? 59  VAL A C   1 
ATOM   4604  O O   . VAL C 2 35  ? 27.722  -30.572 32.311  1.00 89.30  ? 59  VAL A O   1 
ATOM   4605  C CB  . VAL C 2 35  ? 27.441  -32.671 29.674  1.00 90.46  ? 59  VAL A CB  1 
ATOM   4606  C CG1 . VAL C 2 35  ? 27.705  -34.086 29.201  1.00 94.62  ? 59  VAL A CG1 1 
ATOM   4607  C CG2 . VAL C 2 35  ? 26.026  -32.544 30.198  1.00 89.88  ? 59  VAL A CG2 1 
ATOM   4608  N N   . THR C 2 36  ? 28.640  -29.932 30.352  1.00 90.53  ? 60  THR A N   1 
ATOM   4609  C CA  . THR C 2 36  ? 28.480  -28.500 30.548  1.00 88.12  ? 60  THR A CA  1 
ATOM   4610  C C   . THR C 2 36  ? 27.630  -27.932 29.420  1.00 88.98  ? 60  THR A C   1 
ATOM   4611  O O   . THR C 2 36  ? 27.780  -28.326 28.256  1.00 86.76  ? 60  THR A O   1 
ATOM   4612  C CB  . THR C 2 36  ? 29.841  -27.792 30.584  1.00 85.18  ? 60  THR A CB  1 
ATOM   4613  O OG1 . THR C 2 36  ? 30.735  -28.516 31.438  1.00 85.29  ? 60  THR A OG1 1 
ATOM   4614  C CG2 . THR C 2 36  ? 29.693  -26.370 31.111  1.00 85.18  ? 60  THR A CG2 1 
ATOM   4615  N N   . LEU C 2 37  ? 26.728  -27.022 29.776  1.00 84.88  ? 61  LEU A N   1 
ATOM   4616  C CA  . LEU C 2 37  ? 25.962  -26.290 28.778  1.00 83.33  ? 61  LEU A CA  1 
ATOM   4617  C C   . LEU C 2 37  ? 26.856  -25.259 28.102  1.00 80.63  ? 61  LEU A C   1 
ATOM   4618  O O   . LEU C 2 37  ? 27.680  -24.611 28.752  1.00 79.47  ? 61  LEU A O   1 
ATOM   4619  C CB  . LEU C 2 37  ? 24.758  -25.610 29.433  1.00 85.01  ? 61  LEU A CB  1 
ATOM   4620  C CG  . LEU C 2 37  ? 23.750  -24.880 28.541  1.00 87.53  ? 61  LEU A CG  1 
ATOM   4621  C CD1 . LEU C 2 37  ? 23.147  -25.809 27.499  1.00 86.22  ? 61  LEU A CD1 1 
ATOM   4622  C CD2 . LEU C 2 37  ? 22.655  -24.255 29.390  1.00 88.85  ? 61  LEU A CD2 1 
ATOM   4623  N N   . ILE C 2 38  ? 26.705  -25.115 26.787  1.00 83.81  ? 62  ILE A N   1 
ATOM   4624  C CA  . ILE C 2 38  ? 27.491  -24.155 26.024  1.00 85.19  ? 62  ILE A CA  1 
ATOM   4625  C C   . ILE C 2 38  ? 26.573  -23.421 25.059  1.00 86.07  ? 62  ILE A C   1 
ATOM   4626  O O   . ILE C 2 38  ? 25.599  -23.980 24.544  1.00 86.72  ? 62  ILE A O   1 
ATOM   4627  C CB  . ILE C 2 38  ? 28.654  -24.826 25.259  1.00 85.19  ? 62  ILE A CB  1 
ATOM   4628  C CG1 . ILE C 2 38  ? 28.181  -26.113 24.587  1.00 90.31  ? 62  ILE A CG1 1 
ATOM   4629  C CG2 . ILE C 2 38  ? 29.819  -25.108 26.196  1.00 82.79  ? 62  ILE A CG2 1 
ATOM   4630  C CD1 . ILE C 2 38  ? 29.207  -26.731 23.672  1.00 96.32  ? 62  ILE A CD1 1 
ATOM   4631  N N   . ARG C 2 39  ? 26.891  -22.153 24.820  1.00 88.98  ? 63  ARG A N   1 
ATOM   4632  C CA  . ARG C 2 39  ? 26.131  -21.300 23.918  1.00 90.61  ? 63  ARG A CA  1 
ATOM   4633  C C   . ARG C 2 39  ? 27.057  -20.751 22.845  1.00 88.85  ? 63  ARG A C   1 
ATOM   4634  O O   . ARG C 2 39  ? 28.143  -20.249 23.152  1.00 82.60  ? 63  ARG A O   1 
ATOM   4635  C CB  . ARG C 2 39  ? 25.460  -20.150 24.672  1.00 91.97  ? 63  ARG A CB  1 
ATOM   4636  C CG  . ARG C 2 39  ? 24.426  -19.394 23.847  1.00 93.00  ? 63  ARG A CG  1 
ATOM   4637  C CD  . ARG C 2 39  ? 23.714  -18.348 24.687  1.00 90.20  ? 63  ARG A CD  1 
ATOM   4638  N NE  . ARG C 2 39  ? 24.660  -17.462 25.358  1.00 87.91  ? 63  ARG A NE  1 
ATOM   4639  C CZ  . ARG C 2 39  ? 24.981  -16.246 24.930  1.00 85.35  ? 63  ARG A CZ  1 
ATOM   4640  N NH1 . ARG C 2 39  ? 24.425  -15.758 23.829  1.00 79.30  ? 63  ARG A NH1 1 
ATOM   4641  N NH2 . ARG C 2 39  ? 25.857  -15.517 25.607  1.00 85.94  ? 63  ARG A NH2 1 
ATOM   4642  N N   . ARG C 2 40  ? 26.630  -20.853 21.589  1.00 94.69  ? 64  ARG A N   1 
ATOM   4643  C CA  . ARG C 2 40  ? 27.363  -20.215 20.504  1.00 96.45  ? 64  ARG A CA  1 
ATOM   4644  C C   . ARG C 2 40  ? 27.090  -18.716 20.532  1.00 95.73  ? 64  ARG A C   1 
ATOM   4645  O O   . ARG C 2 40  ? 25.941  -18.284 20.393  1.00 91.66  ? 64  ARG A O   1 
ATOM   4646  C CB  . ARG C 2 40  ? 26.969  -20.812 19.154  1.00 96.30  ? 64  ARG A CB  1 
ATOM   4647  C CG  . ARG C 2 40  ? 27.861  -21.965 18.700  1.00 93.72  ? 64  ARG A CG  1 
ATOM   4648  C CD  . ARG C 2 40  ? 28.277  -21.824 17.240  1.00 92.95  ? 64  ARG A CD  1 
ATOM   4649  N NE  . ARG C 2 40  ? 27.123  -21.742 16.349  1.00 96.43  ? 64  ARG A NE  1 
ATOM   4650  C CZ  . ARG C 2 40  ? 26.630  -22.766 15.660  1.00 97.29  ? 64  ARG A CZ  1 
ATOM   4651  N NH1 . ARG C 2 40  ? 25.573  -22.593 14.879  1.00 92.83  ? 64  ARG A NH1 1 
ATOM   4652  N NH2 . ARG C 2 40  ? 27.193  -23.964 15.752  1.00 100.97 ? 64  ARG A NH2 1 
ATOM   4653  N N   . VAL C 2 41  ? 28.143  -17.923 20.721  1.00 102.25 ? 65  VAL A N   1 
ATOM   4654  C CA  . VAL C 2 41  ? 27.996  -16.478 20.836  1.00 100.70 ? 65  VAL A CA  1 
ATOM   4655  C C   . VAL C 2 41  ? 28.429  -15.803 19.541  1.00 102.41 ? 65  VAL A C   1 
ATOM   4656  O O   . VAL C 2 41  ? 27.872  -14.769 19.156  1.00 110.84 ? 65  VAL A O   1 
ATOM   4657  C CB  . VAL C 2 41  ? 28.784  -15.934 22.042  1.00 99.98  ? 65  VAL A CB  1 
ATOM   4658  C CG1 . VAL C 2 41  ? 28.263  -16.562 23.323  1.00 102.84 ? 65  VAL A CG1 1 
ATOM   4659  C CG2 . VAL C 2 41  ? 30.285  -16.179 21.877  1.00 100.84 ? 65  VAL A CG2 1 
ATOM   4660  N N   . ASN C 2 42  ? 29.420  -16.375 18.865  1.00 112.01 ? 66  ASN A N   1 
ATOM   4661  C CA  . ASN C 2 42  ? 29.910  -15.883 17.585  1.00 114.44 ? 66  ASN A CA  1 
ATOM   4662  C C   . ASN C 2 42  ? 29.787  -16.988 16.545  1.00 118.10 ? 66  ASN A C   1 
ATOM   4663  O O   . ASN C 2 42  ? 29.289  -18.082 16.821  1.00 116.99 ? 66  ASN A O   1 
ATOM   4664  C CB  . ASN C 2 42  ? 31.364  -15.412 17.688  1.00 115.13 ? 66  ASN A CB  1 
ATOM   4665  C CG  . ASN C 2 42  ? 31.512  -14.145 18.500  1.00 117.98 ? 66  ASN A CG  1 
ATOM   4666  O OD1 . ASN C 2 42  ? 30.752  -13.192 18.327  1.00 114.77 ? 66  ASN A OD1 1 
ATOM   4667  N ND2 . ASN C 2 42  ? 32.489  -14.129 19.400  1.00 124.05 ? 66  ASN A ND2 1 
ATOM   4668  N N   . GLU C 2 43  ? 30.252  -16.687 15.331  1.00 125.27 ? 67  GLU A N   1 
ATOM   4669  C CA  . GLU C 2 43  ? 30.436  -17.740 14.340  1.00 127.95 ? 67  GLU A CA  1 
ATOM   4670  C C   . GLU C 2 43  ? 31.447  -18.771 14.824  1.00 123.62 ? 67  GLU A C   1 
ATOM   4671  O O   . GLU C 2 43  ? 31.320  -19.962 14.518  1.00 116.46 ? 67  GLU A O   1 
ATOM   4672  C CB  . GLU C 2 43  ? 30.888  -17.132 13.011  1.00 131.36 ? 67  GLU A CB  1 
ATOM   4673  C CG  . GLU C 2 43  ? 30.651  -18.010 11.792  1.00 131.67 ? 67  GLU A CG  1 
ATOM   4674  C CD  . GLU C 2 43  ? 29.193  -18.039 11.377  1.00 135.20 ? 67  GLU A CD  1 
ATOM   4675  O OE1 . GLU C 2 43  ? 28.690  -17.003 10.889  1.00 131.21 ? 67  GLU A OE1 1 
ATOM   4676  O OE2 . GLU C 2 43  ? 28.547  -19.093 11.553  1.00 144.47 ? 67  GLU A OE2 1 
ATOM   4677  N N   . ASP C 2 44  ? 32.445  -18.333 15.593  1.00 120.35 ? 68  ASP A N   1 
ATOM   4678  C CA  . ASP C 2 44  ? 33.517  -19.199 16.073  1.00 121.64 ? 68  ASP A CA  1 
ATOM   4679  C C   . ASP C 2 44  ? 33.370  -19.534 17.554  1.00 120.09 ? 68  ASP A C   1 
ATOM   4680  O O   . ASP C 2 44  ? 33.261  -20.708 17.920  1.00 121.03 ? 68  ASP A O   1 
ATOM   4681  C CB  . ASP C 2 44  ? 34.882  -18.537 15.823  1.00 123.54 ? 68  ASP A CB  1 
ATOM   4682  C CG  . ASP C 2 44  ? 35.264  -18.513 14.355  1.00 125.53 ? 68  ASP A CG  1 
ATOM   4683  O OD1 . ASP C 2 44  ? 34.375  -18.290 13.508  1.00 128.67 ? 68  ASP A OD1 1 
ATOM   4684  O OD2 . ASP C 2 44  ? 36.460  -18.713 14.050  1.00 124.66 ? 68  ASP A OD2 1 
ATOM   4685  N N   . LEU C 2 45  ? 33.358  -18.515 18.410  1.00 113.83 ? 69  LEU A N   1 
ATOM   4686  C CA  . LEU C 2 45  ? 33.524  -18.720 19.843  1.00 114.59 ? 69  LEU A CA  1 
ATOM   4687  C C   . LEU C 2 45  ? 32.342  -19.472 20.449  1.00 112.52 ? 69  LEU A C   1 
ATOM   4688  O O   . LEU C 2 45  ? 31.211  -19.407 19.959  1.00 104.22 ? 69  LEU A O   1 
ATOM   4689  C CB  . LEU C 2 45  ? 33.709  -17.377 20.552  1.00 115.08 ? 69  LEU A CB  1 
ATOM   4690  C CG  . LEU C 2 45  ? 34.238  -17.436 21.988  1.00 118.29 ? 69  LEU A CG  1 
ATOM   4691  C CD1 . LEU C 2 45  ? 35.595  -18.127 22.031  1.00 117.82 ? 69  LEU A CD1 1 
ATOM   4692  C CD2 . LEU C 2 45  ? 34.315  -16.046 22.604  1.00 112.35 ? 69  LEU A CD2 1 
ATOM   4693  N N   . LEU C 2 46  ? 32.625  -20.196 21.531  1.00 104.91 ? 70  LEU A N   1 
ATOM   4694  C CA  . LEU C 2 46  ? 31.637  -20.977 22.269  1.00 100.17 ? 70  LEU A CA  1 
ATOM   4695  C C   . LEU C 2 46  ? 31.794  -20.665 23.750  1.00 98.23  ? 70  LEU A C   1 
ATOM   4696  O O   . LEU C 2 46  ? 32.818  -21.002 24.351  1.00 98.89  ? 70  LEU A O   1 
ATOM   4697  C CB  . LEU C 2 46  ? 31.815  -22.472 22.012  1.00 99.61  ? 70  LEU A CB  1 
ATOM   4698  C CG  . LEU C 2 46  ? 31.220  -23.060 20.736  1.00 100.94 ? 70  LEU A CG  1 
ATOM   4699  C CD1 . LEU C 2 46  ? 32.156  -24.104 20.162  1.00 104.54 ? 70  LEU A CD1 1 
ATOM   4700  C CD2 . LEU C 2 46  ? 29.872  -23.673 21.050  1.00 101.24 ? 70  LEU A CD2 1 
ATOM   4701  N N   . GLU C 2 47  ? 30.787  -20.021 24.339  1.00 100.44 ? 71  GLU A N   1 
ATOM   4702  C CA  . GLU C 2 47  ? 30.922  -19.770 25.768  1.00 100.66 ? 71  GLU A CA  1 
ATOM   4703  C C   . GLU C 2 47  ? 30.361  -20.939 26.570  1.00 95.51  ? 71  GLU A C   1 
ATOM   4704  O O   . GLU C 2 47  ? 29.334  -21.511 26.197  1.00 91.57  ? 71  GLU A O   1 
ATOM   4705  C CB  . GLU C 2 47  ? 30.184  -18.497 26.173  1.00 108.13 ? 71  GLU A CB  1 
ATOM   4706  C CG  . GLU C 2 47  ? 30.931  -17.199 25.923  1.00 107.41 ? 71  GLU A CG  1 
ATOM   4707  C CD  . GLU C 2 47  ? 30.310  -16.031 26.672  1.00 112.32 ? 71  GLU A CD  1 
ATOM   4708  O OE1 . GLU C 2 47  ? 29.135  -16.143 27.090  1.00 107.93 ? 71  GLU A OE1 1 
ATOM   4709  O OE2 . GLU C 2 47  ? 31.001  -15.005 26.851  1.00 117.98 ? 71  GLU A OE2 1 
ATOM   4710  N N   . PRO C 2 48  ? 31.014  -21.323 27.665  1.00 86.66  ? 72  PRO A N   1 
ATOM   4711  C CA  . PRO C 2 48  ? 30.374  -22.233 28.620  1.00 87.41  ? 72  PRO A CA  1 
ATOM   4712  C C   . PRO C 2 48  ? 29.522  -21.464 29.618  1.00 85.56  ? 72  PRO A C   1 
ATOM   4713  O O   . PRO C 2 48  ? 29.887  -20.386 30.091  1.00 86.52  ? 72  PRO A O   1 
ATOM   4714  C CB  . PRO C 2 48  ? 31.571  -22.907 29.304  1.00 84.89  ? 72  PRO A CB  1 
ATOM   4715  C CG  . PRO C 2 48  ? 32.643  -21.880 29.251  1.00 82.56  ? 72  PRO A CG  1 
ATOM   4716  C CD  . PRO C 2 48  ? 32.437  -21.103 27.973  1.00 83.91  ? 72  PRO A CD  1 
ATOM   4717  N N   . VAL C 2 49  ? 28.360  -22.028 29.932  1.00 84.00  ? 73  VAL A N   1 
ATOM   4718  C CA  . VAL C 2 49  ? 27.394  -21.401 30.827  1.00 85.33  ? 73  VAL A CA  1 
ATOM   4719  C C   . VAL C 2 49  ? 27.563  -21.983 32.222  1.00 87.77  ? 73  VAL A C   1 
ATOM   4720  O O   . VAL C 2 49  ? 27.607  -23.208 32.391  1.00 91.72  ? 73  VAL A O   1 
ATOM   4721  C CB  . VAL C 2 49  ? 25.955  -21.602 30.323  1.00 85.68  ? 73  VAL A CB  1 
ATOM   4722  C CG1 . VAL C 2 49  ? 24.971  -20.909 31.249  1.00 87.13  ? 73  VAL A CG1 1 
ATOM   4723  C CG2 . VAL C 2 49  ? 25.817  -21.080 28.905  1.00 86.96  ? 73  VAL A CG2 1 
ATOM   4724  N N   . SER C 2 50  ? 27.656  -21.109 33.222  1.00 95.04  ? 74  SER A N   1 
ATOM   4725  C CA  . SER C 2 50  ? 27.734  -21.551 34.607  1.00 97.02  ? 74  SER A CA  1 
ATOM   4726  C C   . SER C 2 50  ? 26.348  -21.932 35.111  1.00 96.73  ? 74  SER A C   1 
ATOM   4727  O O   . SER C 2 50  ? 25.355  -21.268 34.798  1.00 89.80  ? 74  SER A O   1 
ATOM   4728  C CB  . SER C 2 50  ? 28.332  -20.456 35.490  1.00 94.38  ? 74  SER A CB  1 
ATOM   4729  O OG  . SER C 2 50  ? 27.575  -19.262 35.401  1.00 99.04  ? 74  SER A OG  1 
ATOM   4730  N N   . CYS C 2 51  ? 26.284  -23.007 35.896  1.00 99.39  ? 75  CYS A N   1 
ATOM   4731  C CA  . CYS C 2 51  ? 25.010  -23.562 36.323  1.00 101.87 ? 75  CYS A CA  1 
ATOM   4732  C C   . CYS C 2 51  ? 25.066  -23.911 37.802  1.00 102.88 ? 75  CYS A C   1 
ATOM   4733  O O   . CYS C 2 51  ? 26.141  -24.146 38.363  1.00 109.72 ? 75  CYS A O   1 
ATOM   4734  C CB  . CYS C 2 51  ? 24.651  -24.813 35.514  1.00 100.70 ? 75  CYS A CB  1 
ATOM   4735  S SG  . CYS C 2 51  ? 24.490  -24.528 33.742  1.00 109.33 ? 75  CYS A SG  1 
ATOM   4736  N N   . ASP C 2 52  ? 23.891  -23.946 38.423  1.00 103.19 ? 76  ASP A N   1 
ATOM   4737  C CA  . ASP C 2 52  ? 23.732  -24.352 39.809  1.00 102.39 ? 76  ASP A CA  1 
ATOM   4738  C C   . ASP C 2 52  ? 22.751  -25.512 39.892  1.00 101.58 ? 76  ASP A C   1 
ATOM   4739  O O   . ASP C 2 52  ? 21.814  -25.619 39.094  1.00 101.30 ? 76  ASP A O   1 
ATOM   4740  C CB  . ASP C 2 52  ? 23.245  -23.188 40.686  1.00 104.47 ? 76  ASP A CB  1 
ATOM   4741  C CG  . ASP C 2 52  ? 24.372  -22.251 41.088  1.00 107.99 ? 76  ASP A CG  1 
ATOM   4742  O OD1 . ASP C 2 52  ? 25.467  -22.748 41.427  1.00 110.82 ? 76  ASP A OD1 1 
ATOM   4743  O OD2 . ASP C 2 52  ? 24.163  -21.019 41.060  1.00 113.93 ? 76  ASP A OD2 1 
ATOM   4744  N N   . LEU C 2 53  ? 22.980  -26.388 40.866  1.00 92.37  ? 77  LEU A N   1 
ATOM   4745  C CA  . LEU C 2 53  ? 22.151  -27.574 41.035  1.00 94.13  ? 77  LEU A CA  1 
ATOM   4746  C C   . LEU C 2 53  ? 20.767  -27.157 41.522  1.00 92.08  ? 77  LEU A C   1 
ATOM   4747  O O   . LEU C 2 53  ? 20.619  -26.637 42.632  1.00 87.50  ? 77  LEU A O   1 
ATOM   4748  C CB  . LEU C 2 53  ? 22.827  -28.540 42.004  1.00 96.42  ? 77  LEU A CB  1 
ATOM   4749  C CG  . LEU C 2 53  ? 22.026  -29.752 42.488  1.00 103.39 ? 77  LEU A CG  1 
ATOM   4750  C CD1 . LEU C 2 53  ? 21.482  -30.542 41.320  1.00 104.93 ? 77  LEU A CD1 1 
ATOM   4751  C CD2 . LEU C 2 53  ? 22.885  -30.642 43.371  1.00 101.26 ? 77  LEU A CD2 1 
ATOM   4752  N N   . SER C 2 54  ? 19.752  -27.385 40.693  1.00 94.89  ? 78  SER A N   1 
ATOM   4753  C CA  . SER C 2 54  ? 18.379  -27.039 41.031  1.00 95.57  ? 78  SER A CA  1 
ATOM   4754  C C   . SER C 2 54  ? 17.688  -28.212 41.717  1.00 94.47  ? 78  SER A C   1 
ATOM   4755  O O   . SER C 2 54  ? 18.194  -29.337 41.750  1.00 96.22  ? 78  SER A O   1 
ATOM   4756  C CB  . SER C 2 54  ? 17.600  -26.620 39.782  1.00 100.17 ? 78  SER A CB  1 
ATOM   4757  O OG  . SER C 2 54  ? 16.199  -26.623 40.026  1.00 95.75  ? 78  SER A OG  1 
ATOM   4758  N N   . ASP C 2 55  ? 16.507  -27.936 42.270  1.00 99.37  ? 79  ASP A N   1 
ATOM   4759  C CA  . ASP C 2 55  ? 15.748  -28.930 43.020  1.00 100.53 ? 79  ASP A CA  1 
ATOM   4760  C C   . ASP C 2 55  ? 14.405  -29.267 42.381  1.00 98.27  ? 79  ASP A C   1 
ATOM   4761  O O   . ASP C 2 55  ? 13.604  -29.980 42.998  1.00 102.17 ? 79  ASP A O   1 
ATOM   4762  C CB  . ASP C 2 55  ? 15.529  -28.460 44.463  1.00 104.78 ? 79  ASP A CB  1 
ATOM   4763  C CG  . ASP C 2 55  ? 16.790  -28.546 45.309  1.00 105.36 ? 79  ASP A CG  1 
ATOM   4764  O OD1 . ASP C 2 55  ? 17.902  -28.438 44.748  1.00 104.90 ? 79  ASP A OD1 1 
ATOM   4765  O OD2 . ASP C 2 55  ? 16.666  -28.717 46.541  1.00 105.64 ? 79  ASP A OD2 1 
ATOM   4766  N N   . ASP C 2 56  ? 14.132  -28.783 41.170  1.00 97.51  ? 80  ASP A N   1 
ATOM   4767  C CA  . ASP C 2 56  ? 12.882  -29.124 40.502  1.00 100.10 ? 80  ASP A CA  1 
ATOM   4768  C C   . ASP C 2 56  ? 13.007  -28.847 39.011  1.00 98.29  ? 80  ASP A C   1 
ATOM   4769  O O   . ASP C 2 56  ? 13.839  -28.050 38.571  1.00 93.21  ? 80  ASP A O   1 
ATOM   4770  C CB  . ASP C 2 56  ? 11.696  -28.353 41.093  1.00 100.97 ? 80  ASP A CB  1 
ATOM   4771  C CG  . ASP C 2 56  ? 12.008  -26.890 41.315  1.00 103.75 ? 80  ASP A CG  1 
ATOM   4772  O OD1 . ASP C 2 56  ? 12.934  -26.592 42.099  1.00 105.94 ? 80  ASP A OD1 1 
ATOM   4773  O OD2 . ASP C 2 56  ? 11.328  -26.038 40.704  1.00 111.50 ? 80  ASP A OD2 1 
ATOM   4774  N N   . MET C 2 57  ? 12.162  -29.534 38.242  1.00 95.55  ? 81  MET A N   1 
ATOM   4775  C CA  . MET C 2 57  ? 12.036  -29.375 36.800  1.00 99.91  ? 81  MET A CA  1 
ATOM   4776  C C   . MET C 2 57  ? 10.675  -28.766 36.488  1.00 98.74  ? 81  MET A C   1 
ATOM   4777  O O   . MET C 2 57  ? 9.717   -29.497 36.204  1.00 98.23  ? 81  MET A O   1 
ATOM   4778  C CB  . MET C 2 57  ? 12.191  -30.720 36.085  1.00 103.14 ? 81  MET A CB  1 
ATOM   4779  C CG  . MET C 2 57  ? 13.617  -31.231 35.983  1.00 103.24 ? 81  MET A CG  1 
ATOM   4780  S SD  . MET C 2 57  ? 14.671  -30.115 35.047  1.00 101.84 ? 81  MET A SD  1 
ATOM   4781  C CE  . MET C 2 57  ? 13.717  -29.925 33.544  1.00 105.67 ? 81  MET A CE  1 
ATOM   4782  N N   . PRO C 2 58  ? 10.545  -27.440 36.538  1.00 97.92  ? 82  PRO A N   1 
ATOM   4783  C CA  . PRO C 2 58  ? 9.225   -26.819 36.363  1.00 97.50  ? 82  PRO A CA  1 
ATOM   4784  C C   . PRO C 2 58  ? 8.795   -26.694 34.908  1.00 96.73  ? 82  PRO A C   1 
ATOM   4785  O O   . PRO C 2 58  ? 7.596   -26.720 34.611  1.00 94.88  ? 82  PRO A O   1 
ATOM   4786  C CB  . PRO C 2 58  ? 9.406   -25.442 37.009  1.00 96.98  ? 82  PRO A CB  1 
ATOM   4787  C CG  . PRO C 2 58  ? 10.855  -25.139 36.814  1.00 95.51  ? 82  PRO A CG  1 
ATOM   4788  C CD  . PRO C 2 58  ? 11.579  -26.456 36.904  1.00 96.55  ? 82  PRO A CD  1 
ATOM   4789  N N   . TRP C 2 59  ? 9.756   -26.556 33.993  1.00 91.86  ? 83  TRP A N   1 
ATOM   4790  C CA  . TRP C 2 59  ? 9.426   -26.307 32.595  1.00 91.20  ? 83  TRP A CA  1 
ATOM   4791  C C   . TRP C 2 59  ? 9.374   -27.574 31.757  1.00 95.21  ? 83  TRP A C   1 
ATOM   4792  O O   . TRP C 2 59  ? 8.561   -27.659 30.830  1.00 99.37  ? 83  TRP A O   1 
ATOM   4793  C CB  . TRP C 2 59  ? 10.439  -25.345 31.968  1.00 90.85  ? 83  TRP A CB  1 
ATOM   4794  C CG  . TRP C 2 59  ? 10.528  -24.023 32.658  1.00 89.12  ? 83  TRP A CG  1 
ATOM   4795  C CD1 . TRP C 2 59  ? 9.527   -23.371 33.314  1.00 88.01  ? 83  TRP A CD1 1 
ATOM   4796  C CD2 . TRP C 2 59  ? 11.684  -23.183 32.751  1.00 86.32  ? 83  TRP A CD2 1 
ATOM   4797  N NE1 . TRP C 2 59  ? 9.990   -22.180 33.819  1.00 87.80  ? 83  TRP A NE1 1 
ATOM   4798  C CE2 . TRP C 2 59  ? 11.312  -22.041 33.485  1.00 85.14  ? 83  TRP A CE2 1 
ATOM   4799  C CE3 . TRP C 2 59  ? 12.999  -23.287 32.287  1.00 87.00  ? 83  TRP A CE3 1 
ATOM   4800  C CZ2 . TRP C 2 59  ? 12.206  -21.011 33.766  1.00 87.16  ? 83  TRP A CZ2 1 
ATOM   4801  C CZ3 . TRP C 2 59  ? 13.885  -22.264 32.566  1.00 87.17  ? 83  TRP A CZ3 1 
ATOM   4802  C CH2 . TRP C 2 59  ? 13.485  -21.141 33.299  1.00 86.83  ? 83  TRP A CH2 1 
ATOM   4803  N N   . SER C 2 60  ? 10.219  -28.556 32.051  1.00 96.55  ? 84  SER A N   1 
ATOM   4804  C CA  . SER C 2 60  ? 10.352  -29.740 31.215  1.00 95.49  ? 84  SER A CA  1 
ATOM   4805  C C   . SER C 2 60  ? 10.156  -30.999 32.045  1.00 95.58  ? 84  SER A C   1 
ATOM   4806  O O   . SER C 2 60  ? 10.682  -31.108 33.157  1.00 96.03  ? 84  SER A O   1 
ATOM   4807  C CB  . SER C 2 60  ? 11.724  -29.770 30.530  1.00 96.18  ? 84  SER A CB  1 
ATOM   4808  O OG  . SER C 2 60  ? 11.671  -30.481 29.307  1.00 102.06 ? 84  SER A OG  1 
ATOM   4809  N N   . ALA C 2 61  ? 9.394   -31.946 31.498  1.00 98.42  ? 85  ALA A N   1 
ATOM   4810  C CA  . ALA C 2 61  ? 9.242   -33.248 32.138  1.00 99.05  ? 85  ALA A CA  1 
ATOM   4811  C C   . ALA C 2 61  ? 10.514  -34.070 31.951  1.00 96.51  ? 85  ALA A C   1 
ATOM   4812  O O   . ALA C 2 61  ? 11.173  -33.992 30.912  1.00 92.74  ? 85  ALA A O   1 
ATOM   4813  C CB  . ALA C 2 61  ? 8.042   -33.993 31.556  1.00 99.02  ? 85  ALA A CB  1 
ATOM   4814  N N   . CYS C 2 62  ? 10.878  -34.857 32.974  1.00 100.48 ? 86  CYS A N   1 
ATOM   4815  C CA  . CYS C 2 62  ? 12.179  -35.481 32.802  1.00 98.35  ? 86  CYS A CA  1 
ATOM   4816  C C   . CYS C 2 62  ? 12.009  -36.966 32.500  1.00 97.67  ? 86  CYS A C   1 
ATOM   4817  O O   . CYS C 2 62  ? 11.215  -37.647 33.155  1.00 97.79  ? 86  CYS A O   1 
ATOM   4818  C CB  . CYS C 2 62  ? 13.063  -35.301 34.041  1.00 97.39  ? 86  CYS A CB  1 
ATOM   4819  S SG  . CYS C 2 62  ? 14.827  -35.555 33.722  1.00 105.24 ? 86  CYS A SG  1 
ATOM   4820  N N   . PRO C 2 63  ? 12.698  -37.482 31.482  1.00 96.60  ? 87  PRO A N   1 
ATOM   4821  C CA  . PRO C 2 63  ? 12.349  -38.810 30.967  1.00 99.74  ? 87  PRO A CA  1 
ATOM   4822  C C   . PRO C 2 63  ? 13.110  -39.952 31.623  1.00 98.19  ? 87  PRO A C   1 
ATOM   4823  O O   . PRO C 2 63  ? 13.192  -41.046 31.059  1.00 94.70  ? 87  PRO A O   1 
ATOM   4824  C CB  . PRO C 2 63  ? 12.700  -38.690 29.482  1.00 98.15  ? 87  PRO A CB  1 
ATOM   4825  C CG  . PRO C 2 63  ? 13.911  -37.796 29.497  1.00 99.34  ? 87  PRO A CG  1 
ATOM   4826  C CD  . PRO C 2 63  ? 13.745  -36.841 30.669  1.00 96.28  ? 87  PRO A CD  1 
ATOM   4827  N N   . HIS C 2 64  ? 13.670  -39.728 32.810  1.00 97.83  ? 88  HIS A N   1 
ATOM   4828  C CA  . HIS C 2 64  ? 14.469  -40.741 33.481  1.00 99.67  ? 88  HIS A CA  1 
ATOM   4829  C C   . HIS C 2 64  ? 14.191  -40.632 34.973  1.00 104.45 ? 88  HIS A C   1 
ATOM   4830  O O   . HIS C 2 64  ? 14.071  -39.515 35.497  1.00 109.46 ? 88  HIS A O   1 
ATOM   4831  C CB  . HIS C 2 64  ? 15.962  -40.541 33.179  1.00 98.78  ? 88  HIS A CB  1 
ATOM   4832  C CG  . HIS C 2 64  ? 16.849  -41.635 33.683  1.00 98.48  ? 88  HIS A CG  1 
ATOM   4833  N ND1 . HIS C 2 64  ? 17.086  -41.847 35.024  1.00 95.22  ? 88  HIS A ND1 1 
ATOM   4834  C CD2 . HIS C 2 64  ? 17.560  -42.578 33.021  1.00 98.76  ? 88  HIS A CD2 1 
ATOM   4835  C CE1 . HIS C 2 64  ? 17.903  -42.874 35.169  1.00 98.25  ? 88  HIS A CE1 1 
ATOM   4836  N NE2 . HIS C 2 64  ? 18.206  -43.336 33.969  1.00 100.71 ? 88  HIS A NE2 1 
ATOM   4837  N N   . PRO C 2 65  ? 14.047  -41.754 35.684  1.00 103.58 ? 89  PRO A N   1 
ATOM   4838  C CA  . PRO C 2 65  ? 13.608  -41.661 37.083  1.00 100.15 ? 89  PRO A CA  1 
ATOM   4839  C C   . PRO C 2 65  ? 14.692  -41.211 38.054  1.00 92.96  ? 89  PRO A C   1 
ATOM   4840  O O   . PRO C 2 65  ? 14.429  -41.160 39.259  1.00 95.75  ? 89  PRO A O   1 
ATOM   4841  C CB  . PRO C 2 65  ? 13.117  -43.084 37.386  1.00 103.44 ? 89  PRO A CB  1 
ATOM   4842  C CG  . PRO C 2 65  ? 13.915  -43.941 36.481  1.00 104.12 ? 89  PRO A CG  1 
ATOM   4843  C CD  . PRO C 2 65  ? 14.094  -43.155 35.215  1.00 104.22 ? 89  PRO A CD  1 
ATOM   4844  N N   . ARG C 2 66  ? 15.889  -40.867 37.582  1.00 92.42  ? 90  ARG A N   1 
ATOM   4845  C CA  . ARG C 2 66  ? 16.973  -40.424 38.454  1.00 96.14  ? 90  ARG A CA  1 
ATOM   4846  C C   . ARG C 2 66  ? 17.590  -39.140 37.930  1.00 98.11  ? 90  ARG A C   1 
ATOM   4847  O O   . ARG C 2 66  ? 18.803  -39.038 37.727  1.00 103.41 ? 90  ARG A O   1 
ATOM   4848  C CB  . ARG C 2 66  ? 18.065  -41.478 38.595  1.00 100.82 ? 90  ARG A CB  1 
ATOM   4849  C CG  . ARG C 2 66  ? 17.608  -42.837 39.077  1.00 101.47 ? 90  ARG A CG  1 
ATOM   4850  C CD  . ARG C 2 66  ? 18.781  -43.806 39.048  1.00 98.45  ? 90  ARG A CD  1 
ATOM   4851  N NE  . ARG C 2 66  ? 18.367  -45.180 39.295  1.00 100.82 ? 90  ARG A NE  1 
ATOM   4852  C CZ  . ARG C 2 66  ? 17.876  -45.985 38.362  1.00 102.29 ? 90  ARG A CZ  1 
ATOM   4853  N NH1 . ARG C 2 66  ? 17.748  -45.549 37.116  1.00 97.48  ? 90  ARG A NH1 1 
ATOM   4854  N NH2 . ARG C 2 66  ? 17.521  -47.223 38.670  1.00 107.19 ? 90  ARG A NH2 1 
ATOM   4855  N N   . CYS C 2 67  ? 16.758  -38.129 37.711  1.00 102.82 ? 91  CYS A N   1 
ATOM   4856  C CA  . CYS C 2 67  ? 17.227  -36.892 37.105  1.00 97.63  ? 91  CYS A CA  1 
ATOM   4857  C C   . CYS C 2 67  ? 17.897  -36.007 38.144  1.00 92.11  ? 91  CYS A C   1 
ATOM   4858  O O   . CYS C 2 67  ? 17.480  -35.957 39.301  1.00 92.28  ? 91  CYS A O   1 
ATOM   4859  C CB  . CYS C 2 67  ? 16.062  -36.155 36.446  1.00 100.91 ? 91  CYS A CB  1 
ATOM   4860  S SG  . CYS C 2 67  ? 15.432  -37.009 34.992  1.00 111.85 ? 91  CYS A SG  1 
ATOM   4861  N N   . VAL C 2 68  ? 18.962  -35.339 37.729  1.00 87.28  ? 92  VAL A N   1 
ATOM   4862  C CA  . VAL C 2 68  ? 19.618  -34.306 38.515  1.00 89.78  ? 92  VAL A CA  1 
ATOM   4863  C C   . VAL C 2 68  ? 19.518  -32.995 37.742  1.00 91.93  ? 92  VAL A C   1 
ATOM   4864  O O   . VAL C 2 68  ? 20.188  -32.804 36.726  1.00 96.54  ? 92  VAL A O   1 
ATOM   4865  C CB  . VAL C 2 68  ? 21.078  -34.679 38.841  1.00 91.01  ? 92  VAL A CB  1 
ATOM   4866  C CG1 . VAL C 2 68  ? 21.812  -35.184 37.613  1.00 96.08  ? 92  VAL A CG1 1 
ATOM   4867  C CG2 . VAL C 2 68  ? 21.813  -33.498 39.432  1.00 88.10  ? 92  VAL A CG2 1 
ATOM   4868  N N   . PRO C 2 69  ? 18.628  -32.095 38.154  1.00 92.95  ? 93  PRO A N   1 
ATOM   4869  C CA  . PRO C 2 69  ? 18.347  -30.896 37.362  1.00 94.41  ? 93  PRO A CA  1 
ATOM   4870  C C   . PRO C 2 69  ? 19.272  -29.735 37.703  1.00 95.86  ? 93  PRO A C   1 
ATOM   4871  O O   . PRO C 2 69  ? 19.917  -29.698 38.752  1.00 87.49  ? 93  PRO A O   1 
ATOM   4872  C CB  . PRO C 2 69  ? 16.900  -30.565 37.747  1.00 91.51  ? 93  PRO A CB  1 
ATOM   4873  C CG  . PRO C 2 69  ? 16.777  -31.055 39.139  1.00 90.79  ? 93  PRO A CG  1 
ATOM   4874  C CD  . PRO C 2 69  ? 17.656  -32.275 39.247  1.00 93.11  ? 93  PRO A CD  1 
ATOM   4875  N N   . ARG C 2 70  ? 19.306  -28.770 36.785  1.00 96.48  ? 94  ARG A N   1 
ATOM   4876  C CA  . ARG C 2 70  ? 20.129  -27.577 36.894  1.00 95.40  ? 94  ARG A CA  1 
ATOM   4877  C C   . ARG C 2 70  ? 19.255  -26.347 36.689  1.00 94.34  ? 94  ARG A C   1 
ATOM   4878  O O   . ARG C 2 70  ? 18.102  -26.439 36.255  1.00 90.64  ? 94  ARG A O   1 
ATOM   4879  C CB  . ARG C 2 70  ? 21.265  -27.581 35.859  1.00 93.71  ? 94  ARG A CB  1 
ATOM   4880  C CG  . ARG C 2 70  ? 21.970  -28.917 35.681  1.00 93.70  ? 94  ARG A CG  1 
ATOM   4881  C CD  . ARG C 2 70  ? 23.065  -29.118 36.716  1.00 94.46  ? 94  ARG A CD  1 
ATOM   4882  N NE  . ARG C 2 70  ? 24.120  -30.004 36.231  1.00 94.46  ? 94  ARG A NE  1 
ATOM   4883  C CZ  . ARG C 2 70  ? 24.022  -31.329 36.176  1.00 95.70  ? 94  ARG A CZ  1 
ATOM   4884  N NH1 . ARG C 2 70  ? 22.913  -31.935 36.579  1.00 92.72  ? 94  ARG A NH1 1 
ATOM   4885  N NH2 . ARG C 2 70  ? 25.036  -32.050 35.717  1.00 97.75  ? 94  ARG A NH2 1 
ATOM   4886  N N   . ARG C 2 71  ? 19.827  -25.182 37.006  1.00 95.94  ? 95  ARG A N   1 
ATOM   4887  C CA  . ARG C 2 71  ? 19.174  -23.896 36.753  1.00 95.78  ? 95  ARG A CA  1 
ATOM   4888  C C   . ARG C 2 71  ? 20.284  -22.876 36.491  1.00 95.02  ? 95  ARG A C   1 
ATOM   4889  O O   . ARG C 2 71  ? 20.810  -22.256 37.420  1.00 93.06  ? 95  ARG A O   1 
ATOM   4890  C CB  . ARG C 2 71  ? 18.285  -23.468 37.909  1.00 95.06  ? 95  ARG A CB  1 
ATOM   4891  C CG  . ARG C 2 71  ? 17.663  -22.098 37.723  1.00 96.84  ? 95  ARG A CG  1 
ATOM   4892  C CD  . ARG C 2 71  ? 17.104  -21.548 39.020  1.00 100.54 ? 95  ARG A CD  1 
ATOM   4893  N NE  . ARG C 2 71  ? 16.954  -20.097 38.952  1.00 101.60 ? 95  ARG A NE  1 
ATOM   4894  C CZ  . ARG C 2 71  ? 17.870  -19.227 39.369  1.00 102.61 ? 95  ARG A CZ  1 
ATOM   4895  N NH1 . ARG C 2 71  ? 19.020  -19.659 39.871  1.00 106.00 ? 95  ARG A NH1 1 
ATOM   4896  N NH2 . ARG C 2 71  ? 17.646  -17.925 39.266  1.00 101.11 ? 95  ARG A NH2 1 
ATOM   4897  N N   . CYS C 2 72  ? 20.630  -22.725 35.214  1.00 95.02  ? 96  CYS A N   1 
ATOM   4898  C CA  . CYS C 2 72  ? 21.653  -21.781 34.779  1.00 98.04  ? 96  CYS A CA  1 
ATOM   4899  C C   . CYS C 2 72  ? 20.962  -20.464 34.451  1.00 97.64  ? 96  CYS A C   1 
ATOM   4900  O O   . CYS C 2 72  ? 19.826  -20.464 33.981  1.00 93.10  ? 96  CYS A O   1 
ATOM   4901  C CB  . CYS C 2 72  ? 22.397  -22.315 33.552  1.00 102.38 ? 96  CYS A CB  1 
ATOM   4902  S SG  . CYS C 2 72  ? 22.518  -24.114 33.503  1.00 109.94 ? 96  CYS A SG  1 
ATOM   4903  N N   . VAL C 2 73  ? 21.638  -19.348 34.727  1.00 92.97  ? 97  VAL A N   1 
ATOM   4904  C CA  . VAL C 2 73  ? 21.115  -17.999 34.499  1.00 88.65  ? 97  VAL A CA  1 
ATOM   4905  C C   . VAL C 2 73  ? 22.255  -17.192 33.899  1.00 82.32  ? 97  VAL A C   1 
ATOM   4906  O O   . VAL C 2 73  ? 23.145  -16.726 34.617  1.00 73.38  ? 97  VAL A O   1 
ATOM   4907  C CB  . VAL C 2 73  ? 20.564  -17.344 35.778  1.00 90.93  ? 97  VAL A CB  1 
ATOM   4908  C CG1 . VAL C 2 73  ? 21.547  -17.482 36.966  1.00 92.15  ? 97  VAL A CG1 1 
ATOM   4909  C CG2 . VAL C 2 73  ? 20.214  -15.880 35.523  1.00 90.23  ? 97  VAL A CG2 1 
ATOM   4910  N N   . ILE C 2 74  ? 22.233  -17.019 32.588  1.00 83.44  ? 98  ILE A N   1 
ATOM   4911  C CA  . ILE C 2 74  ? 23.246  -16.261 31.859  1.00 83.26  ? 98  ILE A CA  1 
ATOM   4912  C C   . ILE C 2 74  ? 22.615  -14.946 31.422  1.00 79.18  ? 98  ILE A C   1 
ATOM   4913  O O   . ILE C 2 74  ? 21.478  -14.951 30.938  1.00 76.69  ? 98  ILE A O   1 
ATOM   4914  C CB  . ILE C 2 74  ? 23.782  -17.054 30.648  1.00 85.31  ? 98  ILE A CB  1 
ATOM   4915  C CG1 . ILE C 2 74  ? 25.001  -16.363 30.029  1.00 89.45  ? 98  ILE A CG1 1 
ATOM   4916  C CG2 . ILE C 2 74  ? 22.689  -17.326 29.625  1.00 79.19  ? 98  ILE A CG2 1 
ATOM   4917  C CD1 . ILE C 2 74  ? 26.315  -16.869 30.506  1.00 91.48  ? 98  ILE A CD1 1 
ATOM   4918  N N   . PRO C 2 75  ? 23.279  -13.811 31.624  1.00 79.25  ? 99  PRO A N   1 
ATOM   4919  C CA  . PRO C 2 75  ? 22.646  -12.525 31.315  1.00 82.54  ? 99  PRO A CA  1 
ATOM   4920  C C   . PRO C 2 75  ? 23.026  -11.962 29.953  1.00 85.32  ? 99  PRO A C   1 
ATOM   4921  O O   . PRO C 2 75  ? 24.122  -11.418 29.782  1.00 81.84  ? 99  PRO A O   1 
ATOM   4922  C CB  . PRO C 2 75  ? 23.146  -11.624 32.451  1.00 79.71  ? 99  PRO A CB  1 
ATOM   4923  C CG  . PRO C 2 75  ? 24.513  -12.179 32.770  1.00 76.41  ? 99  PRO A CG  1 
ATOM   4924  C CD  . PRO C 2 75  ? 24.503  -13.649 32.429  1.00 76.16  ? 99  PRO A CD  1 
ATOM   4925  N N   . CYS C 2 76  ? 22.133  -12.096 28.973  1.00 87.92  ? 100 CYS A N   1 
ATOM   4926  C CA  . CYS C 2 76  ? 22.278  -11.372 27.717  1.00 87.26  ? 100 CYS A CA  1 
ATOM   4927  C C   . CYS C 2 76  ? 21.826  -9.932  27.917  1.00 89.62  ? 100 CYS A C   1 
ATOM   4928  O O   . CYS C 2 76  ? 20.882  -9.663  28.664  1.00 83.31  ? 100 CYS A O   1 
ATOM   4929  C CB  . CYS C 2 76  ? 21.465  -12.039 26.607  1.00 84.26  ? 100 CYS A CB  1 
ATOM   4930  S SG  . CYS C 2 76  ? 22.056  -11.691 24.926  1.00 82.24  ? 100 CYS A SG  1 
ATOM   4931  N N   . GLN C 2 77  ? 22.505  -9.001  27.247  1.00 94.80  ? 101 GLN A N   1 
ATOM   4932  C CA  . GLN C 2 77  ? 22.302  -7.584  27.518  1.00 93.30  ? 101 GLN A CA  1 
ATOM   4933  C C   . GLN C 2 77  ? 21.327  -6.902  26.565  1.00 91.36  ? 101 GLN A C   1 
ATOM   4934  O O   . GLN C 2 77  ? 20.862  -5.799  26.873  1.00 94.80  ? 101 GLN A O   1 
ATOM   4935  C CB  . GLN C 2 77  ? 23.643  -6.841  27.489  1.00 93.72  ? 101 GLN A CB  1 
ATOM   4936  C CG  . GLN C 2 77  ? 24.308  -6.795  26.128  1.00 96.32  ? 101 GLN A CG  1 
ATOM   4937  C CD  . GLN C 2 77  ? 25.612  -6.022  26.151  1.00 98.98  ? 101 GLN A CD  1 
ATOM   4938  O OE1 . GLN C 2 77  ? 25.789  -5.105  26.954  1.00 101.20 ? 101 GLN A OE1 1 
ATOM   4939  N NE2 . GLN C 2 77  ? 26.536  -6.392  25.269  1.00 98.65  ? 101 GLN A NE2 1 
ATOM   4940  N N   . SER C 2 78  ? 21.004  -7.516  25.428  1.00 86.10  ? 102 SER A N   1 
ATOM   4941  C CA  . SER C 2 78  ? 20.000  -6.961  24.532  1.00 86.44  ? 102 SER A CA  1 
ATOM   4942  C C   . SER C 2 78  ? 19.303  -8.095  23.791  1.00 85.73  ? 102 SER A C   1 
ATOM   4943  O O   . SER C 2 78  ? 19.895  -9.148  23.538  1.00 93.35  ? 102 SER A O   1 
ATOM   4944  C CB  . SER C 2 78  ? 20.612  -5.971  23.537  1.00 84.67  ? 102 SER A CB  1 
ATOM   4945  O OG  . SER C 2 78  ? 21.514  -6.623  22.664  1.00 86.73  ? 102 SER A OG  1 
ATOM   4946  N N   . PHE C 2 79  ? 18.037  -7.866  23.446  1.00 77.34  ? 103 PHE A N   1 
ATOM   4947  C CA  . PHE C 2 79  ? 17.207  -8.859  22.781  1.00 77.08  ? 103 PHE A CA  1 
ATOM   4948  C C   . PHE C 2 79  ? 16.457  -8.211  21.628  1.00 76.67  ? 103 PHE A C   1 
ATOM   4949  O O   . PHE C 2 79  ? 16.013  -7.064  21.734  1.00 83.18  ? 103 PHE A O   1 
ATOM   4950  C CB  . PHE C 2 79  ? 16.195  -9.485  23.748  1.00 77.35  ? 103 PHE A CB  1 
ATOM   4951  C CG  . PHE C 2 79  ? 16.813  -10.314 24.836  1.00 78.32  ? 103 PHE A CG  1 
ATOM   4952  C CD1 . PHE C 2 79  ? 17.099  -11.652 24.629  1.00 80.92  ? 103 PHE A CD1 1 
ATOM   4953  C CD2 . PHE C 2 79  ? 17.084  -9.763  26.077  1.00 77.02  ? 103 PHE A CD2 1 
ATOM   4954  C CE1 . PHE C 2 79  ? 17.659  -12.420 25.633  1.00 80.97  ? 103 PHE A CE1 1 
ATOM   4955  C CE2 . PHE C 2 79  ? 17.642  -10.526 27.085  1.00 76.43  ? 103 PHE A CE2 1 
ATOM   4956  C CZ  . PHE C 2 79  ? 17.930  -11.856 26.862  1.00 79.73  ? 103 PHE A CZ  1 
ATOM   4957  N N   . VAL C 2 80  ? 16.313  -8.950  20.526  1.00 73.98  ? 104 VAL A N   1 
ATOM   4958  C CA  . VAL C 2 80  ? 15.484  -8.544  19.396  1.00 74.97  ? 104 VAL A CA  1 
ATOM   4959  C C   . VAL C 2 80  ? 14.737  -9.771  18.889  1.00 74.75  ? 104 VAL A C   1 
ATOM   4960  O O   . VAL C 2 80  ? 15.031  -10.906 19.267  1.00 78.53  ? 104 VAL A O   1 
ATOM   4961  C CB  . VAL C 2 80  ? 16.303  -7.909  18.252  1.00 77.62  ? 104 VAL A CB  1 
ATOM   4962  C CG1 . VAL C 2 80  ? 16.964  -6.619  18.710  1.00 76.83  ? 104 VAL A CG1 1 
ATOM   4963  C CG2 . VAL C 2 80  ? 17.336  -8.893  17.731  1.00 80.01  ? 104 VAL A CG2 1 
ATOM   4964  N N   . VAL C 2 81  ? 13.753  -9.528  18.019  1.00 70.62  ? 105 VAL A N   1 
ATOM   4965  C CA  . VAL C 2 81  ? 13.002  -10.633 17.425  1.00 77.31  ? 105 VAL A CA  1 
ATOM   4966  C C   . VAL C 2 81  ? 13.934  -11.565 16.662  1.00 78.64  ? 105 VAL A C   1 
ATOM   4967  O O   . VAL C 2 81  ? 13.797  -12.793 16.724  1.00 82.74  ? 105 VAL A O   1 
ATOM   4968  C CB  . VAL C 2 81  ? 11.878  -10.095 16.522  1.00 82.26  ? 105 VAL A CB  1 
ATOM   4969  C CG1 . VAL C 2 81  ? 11.302  -11.212 15.669  1.00 86.40  ? 105 VAL A CG1 1 
ATOM   4970  C CG2 . VAL C 2 81  ? 10.786  -9.485  17.365  1.00 84.27  ? 105 VAL A CG2 1 
ATOM   4971  N N   . THR C 2 82  ? 14.908  -10.996 15.949  1.00 75.65  ? 106 THR A N   1 
ATOM   4972  C CA  . THR C 2 82  ? 15.829  -11.796 15.147  1.00 80.26  ? 106 THR A CA  1 
ATOM   4973  C C   . THR C 2 82  ? 16.655  -12.754 16.000  1.00 81.88  ? 106 THR A C   1 
ATOM   4974  O O   . THR C 2 82  ? 16.953  -13.874 15.563  1.00 78.31  ? 106 THR A O   1 
ATOM   4975  C CB  . THR C 2 82  ? 16.738  -10.858 14.347  1.00 85.91  ? 106 THR A CB  1 
ATOM   4976  O OG1 . THR C 2 82  ? 16.038  -10.385 13.189  1.00 85.13  ? 106 THR A OG1 1 
ATOM   4977  C CG2 . THR C 2 82  ? 18.027  -11.554 13.922  1.00 90.06  ? 106 THR A CG2 1 
ATOM   4978  N N   . ASP C 2 83  ? 17.007  -12.350 17.220  1.00 86.94  ? 107 ASP A N   1 
ATOM   4979  C CA  . ASP C 2 83  ? 17.955  -13.102 18.037  1.00 87.14  ? 107 ASP A CA  1 
ATOM   4980  C C   . ASP C 2 83  ? 17.486  -14.534 18.274  1.00 89.62  ? 107 ASP A C   1 
ATOM   4981  O O   . ASP C 2 83  ? 16.394  -14.765 18.804  1.00 85.76  ? 107 ASP A O   1 
ATOM   4982  C CB  . ASP C 2 83  ? 18.172  -12.388 19.371  1.00 85.71  ? 107 ASP A CB  1 
ATOM   4983  C CG  . ASP C 2 83  ? 19.249  -11.322 19.292  1.00 88.10  ? 107 ASP A CG  1 
ATOM   4984  O OD1 . ASP C 2 83  ? 20.053  -11.357 18.336  1.00 91.35  ? 107 ASP A OD1 1 
ATOM   4985  O OD2 . ASP C 2 83  ? 19.289  -10.446 20.183  1.00 89.04  ? 107 ASP A OD2 1 
ATOM   4986  N N   . VAL C 2 84  ? 18.323  -15.491 17.875  1.00 92.44  ? 108 VAL A N   1 
ATOM   4987  C CA  . VAL C 2 84  ? 18.104  -16.914 18.112  1.00 87.63  ? 108 VAL A CA  1 
ATOM   4988  C C   . VAL C 2 84  ? 19.388  -17.493 18.691  1.00 86.18  ? 108 VAL A C   1 
ATOM   4989  O O   . VAL C 2 84  ? 20.473  -17.277 18.139  1.00 83.98  ? 108 VAL A O   1 
ATOM   4990  C CB  . VAL C 2 84  ? 17.711  -17.658 16.823  1.00 84.26  ? 108 VAL A CB  1 
ATOM   4991  C CG1 . VAL C 2 84  ? 17.820  -19.157 17.021  1.00 83.14  ? 108 VAL A CG1 1 
ATOM   4992  C CG2 . VAL C 2 84  ? 16.309  -17.276 16.399  1.00 87.51  ? 108 VAL A CG2 1 
ATOM   4993  N N   . ASP C 2 85  ? 19.269  -18.220 19.798  1.00 86.75  ? 109 ASP A N   1 
ATOM   4994  C CA  . ASP C 2 85  ? 20.425  -18.764 20.493  1.00 87.81  ? 109 ASP A CA  1 
ATOM   4995  C C   . ASP C 2 85  ? 20.675  -20.213 20.092  1.00 89.29  ? 109 ASP A C   1 
ATOM   4996  O O   . ASP C 2 85  ? 19.762  -20.934 19.681  1.00 88.26  ? 109 ASP A O   1 
ATOM   4997  C CB  . ASP C 2 85  ? 20.244  -18.670 22.007  1.00 86.90  ? 109 ASP A CB  1 
ATOM   4998  C CG  . ASP C 2 85  ? 20.785  -17.374 22.577  1.00 86.95  ? 109 ASP A CG  1 
ATOM   4999  O OD1 . ASP C 2 85  ? 21.865  -16.927 22.127  1.00 79.53  ? 109 ASP A OD1 1 
ATOM   5000  O OD2 . ASP C 2 85  ? 20.122  -16.800 23.468  1.00 87.20  ? 109 ASP A OD2 1 
ATOM   5001  N N   . TYR C 2 86  ? 21.931  -20.634 20.229  1.00 90.28  ? 110 TYR A N   1 
ATOM   5002  C CA  . TYR C 2 86  ? 22.374  -21.975 19.855  1.00 88.05  ? 110 TYR A CA  1 
ATOM   5003  C C   . TYR C 2 86  ? 22.991  -22.635 21.084  1.00 86.09  ? 110 TYR A C   1 
ATOM   5004  O O   . TYR C 2 86  ? 24.133  -22.339 21.451  1.00 81.77  ? 110 TYR A O   1 
ATOM   5005  C CB  . TYR C 2 86  ? 23.362  -21.918 18.697  1.00 89.50  ? 110 TYR A CB  1 
ATOM   5006  C CG  . TYR C 2 86  ? 22.782  -21.316 17.443  1.00 88.27  ? 110 TYR A CG  1 
ATOM   5007  C CD1 . TYR C 2 86  ? 21.722  -21.923 16.787  1.00 88.83  ? 110 TYR A CD1 1 
ATOM   5008  C CD2 . TYR C 2 86  ? 23.295  -20.141 16.913  1.00 90.19  ? 110 TYR A CD2 1 
ATOM   5009  C CE1 . TYR C 2 86  ? 21.185  -21.376 15.638  1.00 89.96  ? 110 TYR A CE1 1 
ATOM   5010  C CE2 . TYR C 2 86  ? 22.767  -19.586 15.765  1.00 93.98  ? 110 TYR A CE2 1 
ATOM   5011  C CZ  . TYR C 2 86  ? 21.712  -20.207 15.131  1.00 92.18  ? 110 TYR A CZ  1 
ATOM   5012  O OH  . TYR C 2 86  ? 21.183  -19.656 13.987  1.00 94.22  ? 110 TYR A OH  1 
ATOM   5013  N N   . PHE C 2 87  ? 22.235  -23.533 21.711  1.00 84.92  ? 111 PHE A N   1 
ATOM   5014  C CA  . PHE C 2 87  ? 22.661  -24.226 22.918  1.00 83.19  ? 111 PHE A CA  1 
ATOM   5015  C C   . PHE C 2 87  ? 23.054  -25.662 22.596  1.00 83.54  ? 111 PHE A C   1 
ATOM   5016  O O   . PHE C 2 87  ? 22.382  -26.341 21.817  1.00 78.95  ? 111 PHE A O   1 
ATOM   5017  C CB  . PHE C 2 87  ? 21.547  -24.226 23.965  1.00 84.80  ? 111 PHE A CB  1 
ATOM   5018  C CG  . PHE C 2 87  ? 21.381  -22.918 24.679  1.00 85.14  ? 111 PHE A CG  1 
ATOM   5019  C CD1 . PHE C 2 87  ? 22.328  -22.488 25.593  1.00 83.68  ? 111 PHE A CD1 1 
ATOM   5020  C CD2 . PHE C 2 87  ? 20.269  -22.126 24.450  1.00 82.63  ? 111 PHE A CD2 1 
ATOM   5021  C CE1 . PHE C 2 87  ? 22.174  -21.289 26.257  1.00 81.41  ? 111 PHE A CE1 1 
ATOM   5022  C CE2 . PHE C 2 87  ? 20.112  -20.925 25.111  1.00 82.11  ? 111 PHE A CE2 1 
ATOM   5023  C CZ  . PHE C 2 87  ? 21.065  -20.507 26.016  1.00 80.68  ? 111 PHE A CZ  1 
ATOM   5024  N N   . SER C 2 88  ? 24.140  -26.119 23.213  1.00 85.31  ? 112 SER A N   1 
ATOM   5025  C CA  . SER C 2 88  ? 24.620  -27.483 23.046  1.00 87.25  ? 112 SER A CA  1 
ATOM   5026  C C   . SER C 2 88  ? 25.234  -27.940 24.363  1.00 86.94  ? 112 SER A C   1 
ATOM   5027  O O   . SER C 2 88  ? 25.296  -27.184 25.337  1.00 90.37  ? 112 SER A O   1 
ATOM   5028  C CB  . SER C 2 88  ? 25.617  -27.579 21.888  1.00 88.74  ? 112 SER A CB  1 
ATOM   5029  O OG  . SER C 2 88  ? 26.437  -26.426 21.823  1.00 90.85  ? 112 SER A OG  1 
ATOM   5030  N N   . PHE C 2 89  ? 25.692  -29.188 24.388  1.00 78.66  ? 113 PHE A N   1 
ATOM   5031  C CA  . PHE C 2 89  ? 26.283  -29.768 25.583  1.00 78.96  ? 113 PHE A CA  1 
ATOM   5032  C C   . PHE C 2 89  ? 27.648  -30.350 25.254  1.00 79.14  ? 113 PHE A C   1 
ATOM   5033  O O   . PHE C 2 89  ? 27.889  -30.814 24.137  1.00 79.21  ? 113 PHE A O   1 
ATOM   5034  C CB  . PHE C 2 89  ? 25.379  -30.841 26.179  1.00 79.39  ? 113 PHE A CB  1 
ATOM   5035  C CG  . PHE C 2 89  ? 24.188  -30.287 26.890  1.00 79.32  ? 113 PHE A CG  1 
ATOM   5036  C CD1 . PHE C 2 89  ? 24.288  -29.866 28.202  1.00 79.37  ? 113 PHE A CD1 1 
ATOM   5037  C CD2 . PHE C 2 89  ? 22.973  -30.162 26.239  1.00 79.26  ? 113 PHE A CD2 1 
ATOM   5038  C CE1 . PHE C 2 89  ? 23.199  -29.350 28.860  1.00 79.36  ? 113 PHE A CE1 1 
ATOM   5039  C CE2 . PHE C 2 89  ? 21.877  -29.643 26.892  1.00 79.25  ? 113 PHE A CE2 1 
ATOM   5040  C CZ  . PHE C 2 89  ? 21.991  -29.236 28.206  1.00 79.29  ? 113 PHE A CZ  1 
ATOM   5041  N N   . GLN C 2 90  ? 28.545  -30.318 26.242  1.00 85.09  ? 114 GLN A N   1 
ATOM   5042  C CA  . GLN C 2 90  ? 29.938  -30.684 26.022  1.00 89.38  ? 114 GLN A CA  1 
ATOM   5043  C C   . GLN C 2 90  ? 30.485  -31.467 27.212  1.00 88.02  ? 114 GLN A C   1 
ATOM   5044  O O   . GLN C 2 90  ? 30.416  -30.980 28.356  1.00 85.87  ? 114 GLN A O   1 
ATOM   5045  C CB  . GLN C 2 90  ? 30.764  -29.420 25.778  1.00 91.76  ? 114 GLN A CB  1 
ATOM   5046  C CG  . GLN C 2 90  ? 32.200  -29.659 25.360  1.00 94.75  ? 114 GLN A CG  1 
ATOM   5047  C CD  . GLN C 2 90  ? 33.121  -28.547 25.820  1.00 91.67  ? 114 GLN A CD  1 
ATOM   5048  O OE1 . GLN C 2 90  ? 33.710  -27.836 25.008  1.00 94.43  ? 114 GLN A OE1 1 
ATOM   5049  N NE2 . GLN C 2 90  ? 33.248  -28.390 27.136  1.00 88.30  ? 114 GLN A NE2 1 
ATOM   5050  N N   . PRO C 2 91  ? 31.010  -32.671 26.994  1.00 87.44  ? 115 PRO A N   1 
ATOM   5051  C CA  . PRO C 2 91  ? 31.543  -33.460 28.113  1.00 86.18  ? 115 PRO A CA  1 
ATOM   5052  C C   . PRO C 2 91  ? 32.771  -32.814 28.737  1.00 83.53  ? 115 PRO A C   1 
ATOM   5053  O O   . PRO C 2 91  ? 33.504  -32.061 28.095  1.00 81.07  ? 115 PRO A O   1 
ATOM   5054  C CB  . PRO C 2 91  ? 31.896  -34.803 27.468  1.00 90.29  ? 115 PRO A CB  1 
ATOM   5055  C CG  . PRO C 2 91  ? 32.075  -34.485 26.018  1.00 90.77  ? 115 PRO A CG  1 
ATOM   5056  C CD  . PRO C 2 91  ? 31.112  -33.382 25.709  1.00 87.56  ? 115 PRO A CD  1 
ATOM   5057  N N   . ASP C 2 92  ? 33.003  -33.151 30.010  1.00 80.57  ? 116 ASP A N   1 
ATOM   5058  C CA  . ASP C 2 92  ? 34.056  -32.503 30.786  1.00 87.09  ? 116 ASP A CA  1 
ATOM   5059  C C   . ASP C 2 92  ? 35.454  -32.795 30.252  1.00 88.55  ? 116 ASP A C   1 
ATOM   5060  O O   . ASP C 2 92  ? 36.387  -32.040 30.547  1.00 92.67  ? 116 ASP A O   1 
ATOM   5061  C CB  . ASP C 2 92  ? 33.963  -32.931 32.253  1.00 91.22  ? 116 ASP A CB  1 
ATOM   5062  C CG  . ASP C 2 92  ? 34.060  -34.440 32.438  1.00 95.12  ? 116 ASP A CG  1 
ATOM   5063  O OD1 . ASP C 2 92  ? 35.174  -34.992 32.311  1.00 94.92  ? 116 ASP A OD1 1 
ATOM   5064  O OD2 . ASP C 2 92  ? 33.020  -35.075 32.714  1.00 98.25  ? 116 ASP A OD2 1 
ATOM   5065  N N   . ARG C 2 93  ? 35.622  -33.862 29.486  1.00 88.34  ? 117 ARG A N   1 
ATOM   5066  C CA  . ARG C 2 93  ? 36.906  -34.261 28.936  1.00 89.22  ? 117 ARG A CA  1 
ATOM   5067  C C   . ARG C 2 93  ? 36.661  -34.841 27.553  1.00 90.14  ? 117 ARG A C   1 
ATOM   5068  O O   . ARG C 2 93  ? 35.551  -35.298 27.258  1.00 92.15  ? 117 ARG A O   1 
ATOM   5069  C CB  . ARG C 2 93  ? 37.605  -35.283 29.846  1.00 91.61  ? 117 ARG A CB  1 
ATOM   5070  C CG  . ARG C 2 93  ? 36.885  -36.609 29.954  1.00 92.04  ? 117 ARG A CG  1 
ATOM   5071  C CD  . ARG C 2 93  ? 37.206  -37.290 31.269  1.00 93.13  ? 117 ARG A CD  1 
ATOM   5072  N NE  . ARG C 2 93  ? 36.122  -38.161 31.709  1.00 88.55  ? 117 ARG A NE  1 
ATOM   5073  C CZ  . ARG C 2 93  ? 36.017  -39.443 31.377  1.00 91.38  ? 117 ARG A CZ  1 
ATOM   5074  N NH1 . ARG C 2 93  ? 34.998  -40.162 31.825  1.00 91.87  ? 117 ARG A NH1 1 
ATOM   5075  N NH2 . ARG C 2 93  ? 36.929  -40.003 30.595  1.00 95.43  ? 117 ARG A NH2 1 
ATOM   5076  N N   . PRO C 2 94  ? 37.668  -34.831 26.676  1.00 86.50  ? 118 PRO A N   1 
ATOM   5077  C CA  . PRO C 2 94  ? 37.417  -35.248 25.291  1.00 83.98  ? 118 PRO A CA  1 
ATOM   5078  C C   . PRO C 2 94  ? 37.149  -36.742 25.196  1.00 81.20  ? 118 PRO A C   1 
ATOM   5079  O O   . PRO C 2 94  ? 37.792  -37.555 25.865  1.00 83.46  ? 118 PRO A O   1 
ATOM   5080  C CB  . PRO C 2 94  ? 38.698  -34.850 24.547  1.00 86.81  ? 118 PRO A CB  1 
ATOM   5081  C CG  . PRO C 2 94  ? 39.726  -34.583 25.588  1.00 89.45  ? 118 PRO A CG  1 
ATOM   5082  C CD  . PRO C 2 94  ? 39.104  -34.628 26.946  1.00 87.29  ? 118 PRO A CD  1 
ATOM   5083  N N   . LEU C 2 95  ? 36.173  -37.092 24.363  1.00 81.32  ? 119 LEU A N   1 
ATOM   5084  C CA  . LEU C 2 95  ? 35.740  -38.466 24.167  1.00 83.57  ? 119 LEU A CA  1 
ATOM   5085  C C   . LEU C 2 95  ? 35.836  -38.830 22.692  1.00 86.74  ? 119 LEU A C   1 
ATOM   5086  O O   . LEU C 2 95  ? 35.744  -37.966 21.816  1.00 97.11  ? 119 LEU A O   1 
ATOM   5087  C CB  . LEU C 2 95  ? 34.299  -38.666 24.656  1.00 84.60  ? 119 LEU A CB  1 
ATOM   5088  C CG  . LEU C 2 95  ? 34.084  -39.272 26.043  1.00 83.87  ? 119 LEU A CG  1 
ATOM   5089  C CD1 . LEU C 2 95  ? 34.871  -38.522 27.102  1.00 81.65  ? 119 LEU A CD1 1 
ATOM   5090  C CD2 . LEU C 2 95  ? 32.604  -39.280 26.382  1.00 84.43  ? 119 LEU A CD2 1 
ATOM   5091  N N   . GLY C 2 96  ? 36.022  -40.118 22.422  1.00 90.22  ? 120 GLY A N   1 
ATOM   5092  C CA  . GLY C 2 96  ? 36.041  -40.593 21.053  1.00 90.24  ? 120 GLY A CA  1 
ATOM   5093  C C   . GLY C 2 96  ? 37.348  -41.234 20.639  1.00 91.42  ? 120 GLY A C   1 
ATOM   5094  O O   . GLY C 2 96  ? 38.401  -40.943 21.215  1.00 94.67  ? 120 GLY A O   1 
ATOM   5095  N N   . THR C 2 97  ? 37.292  -42.109 19.638  1.00 91.90  ? 121 THR A N   1 
ATOM   5096  C CA  . THR C 2 97  ? 38.469  -42.794 19.125  1.00 95.25  ? 121 THR A CA  1 
ATOM   5097  C C   . THR C 2 97  ? 38.493  -42.707 17.605  1.00 96.75  ? 121 THR A C   1 
ATOM   5098  O O   . THR C 2 97  ? 37.461  -42.528 16.954  1.00 93.49  ? 121 THR A O   1 
ATOM   5099  C CB  . THR C 2 97  ? 38.507  -44.268 19.557  1.00 96.25  ? 121 THR A CB  1 
ATOM   5100  O OG1 . THR C 2 97  ? 37.273  -44.904 19.198  1.00 93.73  ? 121 THR A OG1 1 
ATOM   5101  C CG2 . THR C 2 97  ? 38.725  -44.386 21.062  1.00 93.91  ? 121 THR A CG2 1 
ATOM   5102  N N   . ARG C 2 98  ? 39.692  -42.832 17.048  1.00 101.35 ? 122 ARG A N   1 
ATOM   5103  C CA  . ARG C 2 98  ? 39.898  -42.888 15.609  1.00 104.40 ? 122 ARG A CA  1 
ATOM   5104  C C   . ARG C 2 98  ? 40.317  -44.293 15.195  1.00 102.75 ? 122 ARG A C   1 
ATOM   5105  O O   . ARG C 2 98  ? 40.695  -45.129 16.021  1.00 101.57 ? 122 ARG A O   1 
ATOM   5106  C CB  . ARG C 2 98  ? 40.956  -41.873 15.160  1.00 112.02 ? 122 ARG A CB  1 
ATOM   5107  C CG  . ARG C 2 98  ? 40.660  -40.427 15.510  1.00 110.33 ? 122 ARG A CG  1 
ATOM   5108  C CD  . ARG C 2 98  ? 41.140  -39.516 14.390  1.00 109.32 ? 122 ARG A CD  1 
ATOM   5109  N NE  . ARG C 2 98  ? 41.814  -38.320 14.884  1.00 107.32 ? 122 ARG A NE  1 
ATOM   5110  C CZ  . ARG C 2 98  ? 42.276  -37.351 14.099  1.00 107.07 ? 122 ARG A CZ  1 
ATOM   5111  N NH1 . ARG C 2 98  ? 42.136  -37.440 12.782  1.00 106.35 ? 122 ARG A NH1 1 
ATOM   5112  N NH2 . ARG C 2 98  ? 42.878  -36.294 14.628  1.00 104.45 ? 122 ARG A NH2 1 
ATOM   5113  N N   . LEU C 2 99  ? 40.245  -44.539 13.888  1.00 99.65  ? 123 LEU A N   1 
ATOM   5114  C CA  . LEU C 2 99  ? 40.696  -45.796 13.310  1.00 100.32 ? 123 LEU A CA  1 
ATOM   5115  C C   . LEU C 2 99  ? 40.876  -45.591 11.815  1.00 99.53  ? 123 LEU A C   1 
ATOM   5116  O O   . LEU C 2 99  ? 40.062  -44.922 11.175  1.00 96.35  ? 123 LEU A O   1 
ATOM   5117  C CB  . LEU C 2 99  ? 39.704  -46.932 13.586  1.00 104.59 ? 123 LEU A CB  1 
ATOM   5118  C CG  . LEU C 2 99  ? 40.163  -48.351 13.249  1.00 104.57 ? 123 LEU A CG  1 
ATOM   5119  C CD1 . LEU C 2 99  ? 39.823  -49.295 14.387  1.00 106.92 ? 123 LEU A CD1 1 
ATOM   5120  C CD2 . LEU C 2 99  ? 39.524  -48.824 11.959  1.00 103.98 ? 123 LEU A CD2 1 
ATOM   5121  N N   . THR C 2 100 ? 41.947  -46.156 11.268  1.00 103.62 ? 124 THR A N   1 
ATOM   5122  C CA  . THR C 2 100 ? 42.277  -46.007 9.858   1.00 103.45 ? 124 THR A CA  1 
ATOM   5123  C C   . THR C 2 100 ? 41.952  -47.300 9.121   1.00 102.71 ? 124 THR A C   1 
ATOM   5124  O O   . THR C 2 100 ? 42.339  -48.389 9.561   1.00 108.48 ? 124 THR A O   1 
ATOM   5125  C CB  . THR C 2 100 ? 43.750  -45.629 9.680   1.00 102.40 ? 124 THR A CB  1 
ATOM   5126  O OG1 . THR C 2 100 ? 44.128  -45.787 8.306   1.00 103.19 ? 124 THR A OG1 1 
ATOM   5127  C CG2 . THR C 2 100 ? 44.646  -46.482 10.575  1.00 98.19  ? 124 THR A CG2 1 
ATOM   5128  N N   . VAL C 2 101 ? 41.237  -47.178 8.005   1.00 104.46 ? 125 VAL A N   1 
ATOM   5129  C CA  . VAL C 2 101 ? 40.706  -48.325 7.276   1.00 107.75 ? 125 VAL A CA  1 
ATOM   5130  C C   . VAL C 2 101 ? 41.326  -48.340 5.887   1.00 108.19 ? 125 VAL A C   1 
ATOM   5131  O O   . VAL C 2 101 ? 41.022  -47.475 5.055   1.00 111.71 ? 125 VAL A O   1 
ATOM   5132  C CB  . VAL C 2 101 ? 39.175  -48.287 7.183   1.00 112.25 ? 125 VAL A CB  1 
ATOM   5133  C CG1 . VAL C 2 101 ? 38.662  -49.478 6.384   1.00 114.11 ? 125 VAL A CG1 1 
ATOM   5134  C CG2 . VAL C 2 101 ? 38.555  -48.256 8.567   1.00 115.19 ? 125 VAL A CG2 1 
ATOM   5135  N N   . THR C 2 102 ? 42.187  -49.321 5.630   1.00 111.47 ? 126 THR A N   1 
ATOM   5136  C CA  . THR C 2 102 ? 42.637  -49.618 4.274   1.00 111.81 ? 126 THR A CA  1 
ATOM   5137  C C   . THR C 2 102 ? 41.629  -50.585 3.663   1.00 111.43 ? 126 THR A C   1 
ATOM   5138  O O   . THR C 2 102 ? 41.502  -51.727 4.117   1.00 112.61 ? 126 THR A O   1 
ATOM   5139  C CB  . THR C 2 102 ? 44.046  -50.205 4.274   1.00 112.96 ? 126 THR A CB  1 
ATOM   5140  O OG1 . THR C 2 102 ? 44.885  -49.443 5.150   1.00 107.69 ? 126 THR A OG1 1 
ATOM   5141  C CG2 . THR C 2 102 ? 44.628  -50.171 2.870   1.00 115.89 ? 126 THR A CG2 1 
ATOM   5142  N N   . LEU C 2 103 ? 40.914  -50.126 2.631   1.00 108.42 ? 127 LEU A N   1 
ATOM   5143  C CA  . LEU C 2 103 ? 39.749  -50.853 2.134   1.00 112.11 ? 127 LEU A CA  1 
ATOM   5144  C C   . LEU C 2 103 ? 40.090  -52.239 1.601   1.00 117.10 ? 127 LEU A C   1 
ATOM   5145  O O   . LEU C 2 103 ? 39.190  -53.074 1.467   1.00 110.91 ? 127 LEU A O   1 
ATOM   5146  C CB  . LEU C 2 103 ? 39.047  -50.030 1.052   1.00 112.22 ? 127 LEU A CB  1 
ATOM   5147  C CG  . LEU C 2 103 ? 37.875  -49.175 1.535   1.00 115.14 ? 127 LEU A CG  1 
ATOM   5148  C CD1 . LEU C 2 103 ? 38.343  -48.152 2.551   1.00 116.22 ? 127 LEU A CD1 1 
ATOM   5149  C CD2 . LEU C 2 103 ? 37.197  -48.484 0.363   1.00 116.26 ? 127 LEU A CD2 1 
ATOM   5150  N N   . THR C 2 104 ? 41.361  -52.510 1.304   1.00 121.54 ? 128 THR A N   1 
ATOM   5151  C CA  . THR C 2 104 ? 41.749  -53.833 0.835   1.00 118.98 ? 128 THR A CA  1 
ATOM   5152  C C   . THR C 2 104 ? 41.934  -54.833 1.970   1.00 116.20 ? 128 THR A C   1 
ATOM   5153  O O   . THR C 2 104 ? 41.998  -56.039 1.710   1.00 119.09 ? 128 THR A O   1 
ATOM   5154  C CB  . THR C 2 104 ? 43.043  -53.748 0.022   1.00 121.64 ? 128 THR A CB  1 
ATOM   5155  O OG1 . THR C 2 104 ? 44.107  -53.297 0.869   1.00 126.33 ? 128 THR A OG1 1 
ATOM   5156  C CG2 . THR C 2 104 ? 42.880  -52.774 -1.136  1.00 119.07 ? 128 THR A CG2 1 
ATOM   5157  N N   . GLN C 2 105 ? 42.019  -54.366 3.215   1.00 117.64 ? 129 GLN A N   1 
ATOM   5158  C CA  . GLN C 2 105 ? 42.294  -55.229 4.357   1.00 118.41 ? 129 GLN A CA  1 
ATOM   5159  C C   . GLN C 2 105 ? 41.127  -55.313 5.334   1.00 118.02 ? 129 GLN A C   1 
ATOM   5160  O O   . GLN C 2 105 ? 41.292  -55.848 6.436   1.00 118.03 ? 129 GLN A O   1 
ATOM   5161  C CB  . GLN C 2 105 ? 43.554  -54.746 5.083   1.00 117.76 ? 129 GLN A CB  1 
ATOM   5162  C CG  . GLN C 2 105 ? 44.779  -54.631 4.186   1.00 117.25 ? 129 GLN A CG  1 
ATOM   5163  C CD  . GLN C 2 105 ? 46.022  -54.194 4.940   1.00 117.09 ? 129 GLN A CD  1 
ATOM   5164  O OE1 . GLN C 2 105 ? 46.099  -53.068 5.436   1.00 112.18 ? 129 GLN A OE1 1 
ATOM   5165  N NE2 . GLN C 2 105 ? 47.003  -55.086 5.033   1.00 118.19 ? 129 GLN A NE2 1 
ATOM   5166  N N   . HIS C 2 106 ? 39.954  -54.799 4.962   1.00 115.40 ? 130 HIS A N   1 
ATOM   5167  C CA  . HIS C 2 106 ? 38.775  -54.813 5.822   1.00 108.89 ? 130 HIS A CA  1 
ATOM   5168  C C   . HIS C 2 106 ? 37.548  -55.164 4.975   1.00 107.84 ? 130 HIS A C   1 
ATOM   5169  O O   . HIS C 2 106 ? 36.593  -54.401 4.862   1.00 101.21 ? 130 HIS A O   1 
ATOM   5170  C CB  . HIS C 2 106 ? 38.573  -53.469 6.525   1.00 107.13 ? 130 HIS A CB  1 
ATOM   5171  C CG  . HIS C 2 106 ? 39.578  -53.177 7.597   1.00 107.02 ? 130 HIS A CG  1 
ATOM   5172  N ND1 . HIS C 2 106 ? 40.733  -52.462 7.361   1.00 106.68 ? 130 HIS A ND1 1 
ATOM   5173  C CD2 . HIS C 2 106 ? 39.601  -53.504 8.911   1.00 110.00 ? 130 HIS A CD2 1 
ATOM   5174  C CE1 . HIS C 2 106 ? 41.421  -52.356 8.484   1.00 106.22 ? 130 HIS A CE1 1 
ATOM   5175  N NE2 . HIS C 2 106 ? 40.757  -52.983 9.439   1.00 107.56 ? 130 HIS A NE2 1 
ATOM   5176  N N   . VAL C 2 107 ? 37.567  -56.344 4.361   1.00 104.19 ? 131 VAL A N   1 
ATOM   5177  C CA  . VAL C 2 107 ? 36.539  -56.752 3.409   1.00 106.41 ? 131 VAL A CA  1 
ATOM   5178  C C   . VAL C 2 107 ? 35.707  -57.873 4.014   1.00 104.46 ? 131 VAL A C   1 
ATOM   5179  O O   . VAL C 2 107 ? 36.253  -58.869 4.504   1.00 102.00 ? 131 VAL A O   1 
ATOM   5180  C CB  . VAL C 2 107 ? 37.150  -57.194 2.069   1.00 111.30 ? 131 VAL A CB  1 
ATOM   5181  C CG1 . VAL C 2 107 ? 36.048  -57.548 1.083   1.00 110.22 ? 131 VAL A CG1 1 
ATOM   5182  C CG2 . VAL C 2 107 ? 38.047  -56.104 1.510   1.00 116.39 ? 131 VAL A CG2 1 
ATOM   5183  N N   . GLN C 2 108 ? 34.387  -57.708 3.972   1.00 102.91 ? 132 GLN A N   1 
ATOM   5184  C CA  . GLN C 2 108 ? 33.436  -58.740 4.387   1.00 105.29 ? 132 GLN A CA  1 
ATOM   5185  C C   . GLN C 2 108 ? 32.493  -59.007 3.225   1.00 103.50 ? 132 GLN A C   1 
ATOM   5186  O O   . GLN C 2 108 ? 31.581  -58.202 2.962   1.00 107.65 ? 132 GLN A O   1 
ATOM   5187  C CB  . GLN C 2 108 ? 32.658  -58.313 5.631   1.00 108.61 ? 132 GLN A CB  1 
ATOM   5188  C CG  . GLN C 2 108 ? 31.623  -59.331 6.097   1.00 107.21 ? 132 GLN A CG  1 
ATOM   5189  C CD  . GLN C 2 108 ? 31.149  -59.081 7.517   1.00 104.45 ? 132 GLN A CD  1 
ATOM   5190  O OE1 . GLN C 2 108 ? 31.950  -59.027 8.451   1.00 100.88 ? 132 GLN A OE1 1 
ATOM   5191  N NE2 . GLN C 2 108 ? 29.840  -58.934 7.688   1.00 105.49 ? 132 GLN A NE2 1 
ATOM   5192  N N   . PRO C 2 109 ? 32.676  -60.107 2.501   1.00 103.45 ? 133 PRO A N   1 
ATOM   5193  C CA  . PRO C 2 109 ? 31.877  -60.371 1.296   1.00 105.50 ? 133 PRO A CA  1 
ATOM   5194  C C   . PRO C 2 109 ? 30.397  -60.477 1.618   1.00 106.70 ? 133 PRO A C   1 
ATOM   5195  O O   . PRO C 2 109 ? 30.015  -60.623 2.789   1.00 106.18 ? 133 PRO A O   1 
ATOM   5196  C CB  . PRO C 2 109 ? 32.436  -61.712 0.798   1.00 107.09 ? 133 PRO A CB  1 
ATOM   5197  C CG  . PRO C 2 109 ? 33.823  -61.761 1.339   1.00 109.54 ? 133 PRO A CG  1 
ATOM   5198  C CD  . PRO C 2 109 ? 33.764  -61.083 2.673   1.00 106.73 ? 133 PRO A CD  1 
ATOM   5199  N N   . PRO C 2 110 ? 29.531  -60.405 0.606   1.00 109.44 ? 134 PRO A N   1 
ATOM   5200  C CA  . PRO C 2 110 ? 28.087  -60.449 0.871   1.00 113.93 ? 134 PRO A CA  1 
ATOM   5201  C C   . PRO C 2 110 ? 27.633  -61.820 1.348   1.00 116.73 ? 134 PRO A C   1 
ATOM   5202  O O   . PRO C 2 110 ? 28.094  -62.856 0.862   1.00 118.66 ? 134 PRO A O   1 
ATOM   5203  C CB  . PRO C 2 110 ? 27.463  -60.099 -0.487  1.00 114.70 ? 134 PRO A CB  1 
ATOM   5204  C CG  . PRO C 2 110 ? 28.566  -59.455 -1.272  1.00 114.48 ? 134 PRO A CG  1 
ATOM   5205  C CD  . PRO C 2 110 ? 29.818  -60.124 -0.810  1.00 111.49 ? 134 PRO A CD  1 
ATOM   5206  N N   . GLU C 2 111 ? 26.709  -61.811 2.300   1.00 116.34 ? 135 GLU A N   1 
ATOM   5207  C CA  . GLU C 2 111 ? 26.174  -63.051 2.850   1.00 113.31 ? 135 GLU A CA  1 
ATOM   5208  C C   . GLU C 2 111 ? 25.338  -63.780 1.802   1.00 112.52 ? 135 GLU A C   1 
ATOM   5209  O O   . GLU C 2 111 ? 24.482  -63.161 1.161   1.00 114.63 ? 135 GLU A O   1 
ATOM   5210  C CB  . GLU C 2 111 ? 25.330  -62.746 4.086   1.00 113.93 ? 135 GLU A CB  1 
ATOM   5211  C CG  . GLU C 2 111 ? 24.297  -63.805 4.421   1.00 117.74 ? 135 GLU A CG  1 
ATOM   5212  C CD  . GLU C 2 111 ? 23.220  -63.288 5.357   1.00 120.10 ? 135 GLU A CD  1 
ATOM   5213  O OE1 . GLU C 2 111 ? 23.563  -62.602 6.342   1.00 118.72 ? 135 GLU A OE1 1 
ATOM   5214  O OE2 . GLU C 2 111 ? 22.029  -63.569 5.104   1.00 120.40 ? 135 GLU A OE2 1 
ATOM   5215  N N   . PRO C 2 112 ? 25.554  -65.080 1.595   1.00 115.14 ? 136 PRO A N   1 
ATOM   5216  C CA  . PRO C 2 112 ? 24.724  -65.821 0.637   1.00 115.62 ? 136 PRO A CA  1 
ATOM   5217  C C   . PRO C 2 112 ? 23.290  -65.949 1.121   1.00 118.01 ? 136 PRO A C   1 
ATOM   5218  O O   . PRO C 2 112 ? 23.012  -65.964 2.323   1.00 125.23 ? 136 PRO A O   1 
ATOM   5219  C CB  . PRO C 2 112 ? 25.401  -67.196 0.562   1.00 113.82 ? 136 PRO A CB  1 
ATOM   5220  C CG  . PRO C 2 112 ? 26.766  -66.997 1.123   1.00 115.00 ? 136 PRO A CG  1 
ATOM   5221  C CD  . PRO C 2 112 ? 26.643  -65.907 2.139   1.00 114.71 ? 136 PRO A CD  1 
ATOM   5222  N N   . ARG C 2 113 ? 22.373  -66.051 0.163   1.00 123.32 ? 137 ARG A N   1 
ATOM   5223  C CA  . ARG C 2 113 ? 20.958  -66.213 0.467   1.00 126.36 ? 137 ARG A CA  1 
ATOM   5224  C C   . ARG C 2 113 ? 20.320  -67.060 -0.628  1.00 128.95 ? 137 ARG A C   1 
ATOM   5225  O O   . ARG C 2 113 ? 20.976  -67.453 -1.598  1.00 129.82 ? 137 ARG A O   1 
ATOM   5226  C CB  . ARG C 2 113 ? 20.272  -64.852 0.625   1.00 127.00 ? 137 ARG A CB  1 
ATOM   5227  C CG  . ARG C 2 113 ? 20.014  -64.466 2.076   1.00 125.24 ? 137 ARG A CG  1 
ATOM   5228  C CD  . ARG C 2 113 ? 19.979  -62.955 2.270   1.00 128.53 ? 137 ARG A CD  1 
ATOM   5229  N NE  . ARG C 2 113 ? 19.067  -62.283 1.347   1.00 132.77 ? 137 ARG A NE  1 
ATOM   5230  C CZ  . ARG C 2 113 ? 18.731  -60.998 1.432   1.00 128.57 ? 137 ARG A CZ  1 
ATOM   5231  N NH1 . ARG C 2 113 ? 19.228  -60.240 2.401   1.00 125.43 ? 137 ARG A NH1 1 
ATOM   5232  N NH2 . ARG C 2 113 ? 17.897  -60.469 0.548   1.00 121.69 ? 137 ARG A NH2 1 
ATOM   5233  N N   . ASP C 2 114 ? 19.026  -67.344 -0.455  1.00 127.29 ? 138 ASP A N   1 
ATOM   5234  C CA  . ASP C 2 114 ? 18.272  -68.243 -1.332  1.00 132.08 ? 138 ASP A CA  1 
ATOM   5235  C C   . ASP C 2 114 ? 18.946  -69.617 -1.386  1.00 132.92 ? 138 ASP A C   1 
ATOM   5236  O O   . ASP C 2 114 ? 19.375  -70.094 -2.437  1.00 127.47 ? 138 ASP A O   1 
ATOM   5237  C CB  . ASP C 2 114 ? 18.112  -67.637 -2.733  1.00 138.32 ? 138 ASP A CB  1 
ATOM   5238  C CG  . ASP C 2 114 ? 17.065  -68.355 -3.579  1.00 142.18 ? 138 ASP A CG  1 
ATOM   5239  O OD1 . ASP C 2 114 ? 16.886  -69.584 -3.434  1.00 142.14 ? 138 ASP A OD1 1 
ATOM   5240  O OD2 . ASP C 2 114 ? 16.419  -67.677 -4.407  1.00 139.13 ? 138 ASP A OD2 1 
ATOM   5241  N N   . LEU C 2 115 ? 19.043  -70.244 -0.217  1.00 125.57 ? 139 LEU A N   1 
ATOM   5242  C CA  . LEU C 2 115 ? 19.719  -71.525 -0.067  1.00 123.06 ? 139 LEU A CA  1 
ATOM   5243  C C   . LEU C 2 115 ? 18.686  -72.643 -0.104  1.00 121.99 ? 139 LEU A C   1 
ATOM   5244  O O   . LEU C 2 115 ? 17.753  -72.658 0.706   1.00 117.68 ? 139 LEU A O   1 
ATOM   5245  C CB  . LEU C 2 115 ? 20.516  -71.569 1.236   1.00 122.45 ? 139 LEU A CB  1 
ATOM   5246  C CG  . LEU C 2 115 ? 21.290  -72.858 1.512   1.00 124.50 ? 139 LEU A CG  1 
ATOM   5247  C CD1 . LEU C 2 115 ? 22.168  -73.213 0.323   1.00 125.02 ? 139 LEU A CD1 1 
ATOM   5248  C CD2 . LEU C 2 115 ? 22.121  -72.723 2.778   1.00 121.97 ? 139 LEU A CD2 1 
ATOM   5249  N N   . GLN C 2 116 ? 18.854  -73.576 -1.039  1.00 127.65 ? 140 GLN A N   1 
ATOM   5250  C CA  . GLN C 2 116 ? 17.923  -74.683 -1.183  1.00 129.22 ? 140 GLN A CA  1 
ATOM   5251  C C   . GLN C 2 116 ? 18.688  -75.929 -1.606  1.00 131.08 ? 140 GLN A C   1 
ATOM   5252  O O   . GLN C 2 116 ? 19.811  -75.854 -2.115  1.00 125.70 ? 140 GLN A O   1 
ATOM   5253  C CB  . GLN C 2 116 ? 16.819  -74.363 -2.198  1.00 128.61 ? 140 GLN A CB  1 
ATOM   5254  C CG  . GLN C 2 116 ? 17.336  -74.155 -3.610  1.00 127.30 ? 140 GLN A CG  1 
ATOM   5255  C CD  . GLN C 2 116 ? 16.266  -73.652 -4.553  1.00 124.58 ? 140 GLN A CD  1 
ATOM   5256  O OE1 . GLN C 2 116 ? 15.920  -72.469 -4.542  1.00 124.15 ? 140 GLN A OE1 1 
ATOM   5257  N NE2 . GLN C 2 116 ? 15.727  -74.550 -5.372  1.00 120.79 ? 140 GLN A NE2 1 
ATOM   5258  N N   . ILE C 2 117 ? 18.067  -77.081 -1.376  1.00 125.05 ? 141 ILE A N   1 
ATOM   5259  C CA  . ILE C 2 117 ? 18.660  -78.366 -1.703  1.00 127.52 ? 141 ILE A CA  1 
ATOM   5260  C C   . ILE C 2 117 ? 17.943  -78.949 -2.918  1.00 127.91 ? 141 ILE A C   1 
ATOM   5261  O O   . ILE C 2 117 ? 16.876  -78.489 -3.325  1.00 133.65 ? 141 ILE A O   1 
ATOM   5262  C CB  . ILE C 2 117 ? 18.624  -79.344 -0.509  1.00 131.25 ? 141 ILE A CB  1 
ATOM   5263  C CG1 . ILE C 2 117 ? 17.183  -79.706 -0.138  1.00 135.83 ? 141 ILE A CG1 1 
ATOM   5264  C CG2 . ILE C 2 117 ? 19.348  -78.751 0.688   1.00 132.26 ? 141 ILE A CG2 1 
ATOM   5265  C CD1 . ILE C 2 117 ? 16.718  -81.061 -0.663  1.00 137.21 ? 141 ILE A CD1 1 
ATOM   5266  N N   . SER C 2 118 ? 18.551  -79.980 -3.498  1.00 130.91 ? 142 SER A N   1 
ATOM   5267  C CA  . SER C 2 118 ? 17.988  -80.662 -4.657  1.00 133.40 ? 142 SER A CA  1 
ATOM   5268  C C   . SER C 2 118 ? 18.366  -82.131 -4.574  1.00 138.39 ? 142 SER A C   1 
ATOM   5269  O O   . SER C 2 118 ? 19.556  -82.461 -4.534  1.00 139.34 ? 142 SER A O   1 
ATOM   5270  C CB  . SER C 2 118 ? 18.497  -80.046 -5.961  1.00 134.68 ? 142 SER A CB  1 
ATOM   5271  O OG  . SER C 2 118 ? 18.089  -80.814 -7.080  1.00 140.86 ? 142 SER A OG  1 
ATOM   5272  N N   . THR C 2 119 ? 17.362  -83.004 -4.551  1.00 146.17 ? 143 THR A N   1 
ATOM   5273  C CA  . THR C 2 119 ? 17.582  -84.439 -4.432  1.00 144.71 ? 143 THR A CA  1 
ATOM   5274  C C   . THR C 2 119 ? 17.773  -85.052 -5.814  1.00 142.03 ? 143 THR A C   1 
ATOM   5275  O O   . THR C 2 119 ? 16.950  -84.846 -6.712  1.00 136.34 ? 143 THR A O   1 
ATOM   5276  C CB  . THR C 2 119 ? 16.407  -85.110 -3.719  1.00 142.70 ? 143 THR A CB  1 
ATOM   5277  O OG1 . THR C 2 119 ? 15.179  -84.723 -4.349  1.00 144.89 ? 143 THR A OG1 1 
ATOM   5278  C CG2 . THR C 2 119 ? 16.366  -84.695 -2.256  1.00 139.32 ? 143 THR A CG2 1 
ATOM   5279  N N   . ASP C 2 120 ? 18.856  -85.802 -5.979  1.00 147.30 ? 144 ASP A N   1 
ATOM   5280  C CA  . ASP C 2 120 ? 19.173  -86.489 -7.223  1.00 151.49 ? 144 ASP A CA  1 
ATOM   5281  C C   . ASP C 2 120 ? 19.284  -87.990 -6.965  1.00 152.71 ? 144 ASP A C   1 
ATOM   5282  O O   . ASP C 2 120 ? 19.025  -88.479 -5.861  1.00 149.66 ? 144 ASP A O   1 
ATOM   5283  C CB  . ASP C 2 120 ? 20.464  -85.938 -7.840  1.00 150.14 ? 144 ASP A CB  1 
ATOM   5284  C CG  . ASP C 2 120 ? 20.249  -84.627 -8.580  1.00 142.15 ? 144 ASP A CG  1 
ATOM   5285  O OD1 . ASP C 2 120 ? 19.315  -83.881 -8.217  1.00 137.14 ? 144 ASP A OD1 1 
ATOM   5286  O OD2 . ASP C 2 120 ? 21.015  -84.341 -9.526  1.00 130.75 ? 144 ASP A OD2 1 
ATOM   5287  N N   . GLN C 2 121 ? 19.672  -88.723 -8.008  1.00 150.19 ? 145 GLN A N   1 
ATOM   5288  C CA  . GLN C 2 121 ? 19.792  -90.174 -7.928  1.00 152.87 ? 145 GLN A CA  1 
ATOM   5289  C C   . GLN C 2 121 ? 20.871  -90.587 -6.936  1.00 156.87 ? 145 GLN A C   1 
ATOM   5290  O O   . GLN C 2 121 ? 20.575  -91.202 -5.906  1.00 156.34 ? 145 GLN A O   1 
ATOM   5291  C CB  . GLN C 2 121 ? 20.091  -90.765 -9.310  1.00 148.50 ? 145 GLN A CB  1 
ATOM   5292  C CG  . GLN C 2 121 ? 20.569  -92.216 -9.282  1.00 145.90 ? 145 GLN A CG  1 
ATOM   5293  C CD  . GLN C 2 121 ? 19.433  -93.221 -9.338  1.00 140.38 ? 145 GLN A CD  1 
ATOM   5294  O OE1 . GLN C 2 121 ? 18.650  -93.241 -10.288 1.00 138.75 ? 145 GLN A OE1 1 
ATOM   5295  N NE2 . GLN C 2 121 ? 19.342  -94.068 -8.319  1.00 132.94 ? 145 GLN A NE2 1 
ATOM   5296  N N   . ASP C 2 122 ? 22.125  -90.247 -7.232  1.00 157.69 ? 146 ASP A N   1 
ATOM   5297  C CA  . ASP C 2 122 ? 23.264  -90.712 -6.453  1.00 151.41 ? 146 ASP A CA  1 
ATOM   5298  C C   . ASP C 2 122 ? 23.972  -89.576 -5.719  1.00 146.94 ? 146 ASP A C   1 
ATOM   5299  O O   . ASP C 2 122 ? 25.172  -89.666 -5.453  1.00 146.64 ? 146 ASP A O   1 
ATOM   5300  C CB  . ASP C 2 122 ? 24.253  -91.453 -7.355  1.00 148.32 ? 146 ASP A CB  1 
ATOM   5301  C CG  . ASP C 2 122 ? 23.941  -92.937 -7.479  1.00 142.68 ? 146 ASP A CG  1 
ATOM   5302  O OD1 . ASP C 2 122 ? 23.599  -93.568 -6.457  1.00 140.29 ? 146 ASP A OD1 1 
ATOM   5303  O OD2 . ASP C 2 122 ? 24.040  -93.473 -8.604  1.00 138.36 ? 146 ASP A OD2 1 
ATOM   5304  N N   . HIS C 2 123 ? 23.251  -88.509 -5.381  1.00 140.97 ? 147 HIS A N   1 
ATOM   5305  C CA  . HIS C 2 123 ? 23.846  -87.361 -4.704  1.00 141.55 ? 147 HIS A CA  1 
ATOM   5306  C C   . HIS C 2 123 ? 22.745  -86.347 -4.414  1.00 140.98 ? 147 HIS A C   1 
ATOM   5307  O O   . HIS C 2 123 ? 21.591  -86.517 -4.819  1.00 144.28 ? 147 HIS A O   1 
ATOM   5308  C CB  . HIS C 2 123 ? 24.964  -86.712 -5.531  1.00 139.78 ? 147 HIS A CB  1 
ATOM   5309  C CG  . HIS C 2 123 ? 24.535  -86.294 -6.903  1.00 141.68 ? 147 HIS A CG  1 
ATOM   5310  N ND1 . HIS C 2 123 ? 24.162  -87.201 -7.872  1.00 142.65 ? 147 HIS A ND1 1 
ATOM   5311  C CD2 . HIS C 2 123 ? 24.406  -85.069 -7.464  1.00 140.28 ? 147 HIS A CD2 1 
ATOM   5312  C CE1 . HIS C 2 123 ? 23.825  -86.552 -8.972  1.00 145.80 ? 147 HIS A CE1 1 
ATOM   5313  N NE2 . HIS C 2 123 ? 23.963  -85.257 -8.751  1.00 144.07 ? 147 HIS A NE2 1 
ATOM   5314  N N   . PHE C 2 124 ? 23.122  -85.299 -3.684  1.00 128.62 ? 148 PHE A N   1 
ATOM   5315  C CA  . PHE C 2 124 ? 22.313  -84.119 -3.438  1.00 126.37 ? 148 PHE A CA  1 
ATOM   5316  C C   . PHE C 2 124 ? 23.089  -82.903 -3.928  1.00 131.14 ? 148 PHE A C   1 
ATOM   5317  O O   . PHE C 2 124 ? 24.318  -82.936 -4.039  1.00 131.29 ? 148 PHE A O   1 
ATOM   5318  C CB  . PHE C 2 124 ? 21.982  -83.957 -1.944  1.00 123.81 ? 148 PHE A CB  1 
ATOM   5319  C CG  . PHE C 2 124 ? 21.235  -85.118 -1.349  1.00 123.03 ? 148 PHE A CG  1 
ATOM   5320  C CD1 . PHE C 2 124 ? 21.897  -86.284 -0.998  1.00 128.54 ? 148 PHE A CD1 1 
ATOM   5321  C CD2 . PHE C 2 124 ? 19.870  -85.038 -1.131  1.00 120.37 ? 148 PHE A CD2 1 
ATOM   5322  C CE1 . PHE C 2 124 ? 21.208  -87.353 -0.448  1.00 128.78 ? 148 PHE A CE1 1 
ATOM   5323  C CE2 . PHE C 2 124 ? 19.176  -86.101 -0.582  1.00 121.35 ? 148 PHE A CE2 1 
ATOM   5324  C CZ  . PHE C 2 124 ? 19.846  -87.260 -0.240  1.00 122.56 ? 148 PHE A CZ  1 
ATOM   5325  N N   . LEU C 2 125 ? 22.368  -81.820 -4.207  1.00 132.39 ? 149 LEU A N   1 
ATOM   5326  C CA  . LEU C 2 125 ? 22.968  -80.603 -4.733  1.00 129.97 ? 149 LEU A CA  1 
ATOM   5327  C C   . LEU C 2 125 ? 22.460  -79.403 -3.943  1.00 128.60 ? 149 LEU A C   1 
ATOM   5328  O O   . LEU C 2 125 ? 21.364  -79.437 -3.381  1.00 121.53 ? 149 LEU A O   1 
ATOM   5329  C CB  . LEU C 2 125 ? 22.655  -80.454 -6.234  1.00 130.94 ? 149 LEU A CB  1 
ATOM   5330  C CG  . LEU C 2 125 ? 22.977  -79.156 -6.974  1.00 133.65 ? 149 LEU A CG  1 
ATOM   5331  C CD1 . LEU C 2 125 ? 23.581  -79.469 -8.331  1.00 134.00 ? 149 LEU A CD1 1 
ATOM   5332  C CD2 . LEU C 2 125 ? 21.725  -78.302 -7.125  1.00 131.12 ? 149 LEU A CD2 1 
ATOM   5333  N N   . LEU C 2 126 ? 23.267  -78.343 -3.893  1.00 130.04 ? 150 LEU A N   1 
ATOM   5334  C CA  . LEU C 2 126 ? 22.921  -77.127 -3.171  1.00 128.40 ? 150 LEU A CA  1 
ATOM   5335  C C   . LEU C 2 126 ? 22.916  -75.935 -4.117  1.00 126.01 ? 150 LEU A C   1 
ATOM   5336  O O   . LEU C 2 126 ? 23.771  -75.829 -5.002  1.00 113.96 ? 150 LEU A O   1 
ATOM   5337  C CB  . LEU C 2 126 ? 23.903  -76.870 -2.022  1.00 127.63 ? 150 LEU A CB  1 
ATOM   5338  C CG  . LEU C 2 126 ? 23.762  -77.759 -0.786  1.00 125.72 ? 150 LEU A CG  1 
ATOM   5339  C CD1 . LEU C 2 126 ? 25.064  -77.794 -0.007  1.00 125.07 ? 150 LEU A CD1 1 
ATOM   5340  C CD2 . LEU C 2 126 ? 22.629  -77.266 0.096   1.00 123.94 ? 150 LEU A CD2 1 
ATOM   5341  N N   . THR C 2 127 ? 21.953  -75.036 -3.921  1.00 131.44 ? 151 THR A N   1 
ATOM   5342  C CA  . THR C 2 127 ? 21.842  -73.814 -4.704  1.00 132.63 ? 151 THR A CA  1 
ATOM   5343  C C   . THR C 2 127 ? 21.721  -72.626 -3.762  1.00 129.75 ? 151 THR A C   1 
ATOM   5344  O O   . THR C 2 127 ? 20.972  -72.676 -2.782  1.00 120.43 ? 151 THR A O   1 
ATOM   5345  C CB  . THR C 2 127 ? 20.629  -73.859 -5.649  1.00 132.29 ? 151 THR A CB  1 
ATOM   5346  O OG1 . THR C 2 127 ? 20.773  -74.950 -6.567  1.00 127.68 ? 151 THR A OG1 1 
ATOM   5347  C CG2 . THR C 2 127 ? 20.501  -72.555 -6.432  1.00 127.71 ? 151 THR A CG2 1 
ATOM   5348  N N   . TRP C 2 128 ? 22.467  -71.563 -4.056  1.00 128.30 ? 152 TRP A N   1 
ATOM   5349  C CA  . TRP C 2 128 ? 22.397  -70.345 -3.263  1.00 125.38 ? 152 TRP A CA  1 
ATOM   5350  C C   . TRP C 2 128 ? 22.751  -69.154 -4.141  1.00 128.61 ? 152 TRP A C   1 
ATOM   5351  O O   . TRP C 2 128 ? 23.397  -69.293 -5.183  1.00 130.07 ? 152 TRP A O   1 
ATOM   5352  C CB  . TRP C 2 128 ? 23.315  -70.414 -2.036  1.00 125.41 ? 152 TRP A CB  1 
ATOM   5353  C CG  . TRP C 2 128 ? 24.776  -70.486 -2.362  1.00 124.10 ? 152 TRP A CG  1 
ATOM   5354  C CD1 . TRP C 2 128 ? 25.587  -69.452 -2.727  1.00 124.77 ? 152 TRP A CD1 1 
ATOM   5355  C CD2 . TRP C 2 128 ? 25.603  -71.655 -2.333  1.00 121.68 ? 152 TRP A CD2 1 
ATOM   5356  N NE1 . TRP C 2 128 ? 26.865  -69.906 -2.938  1.00 119.59 ? 152 TRP A NE1 1 
ATOM   5357  C CE2 . TRP C 2 128 ? 26.902  -71.254 -2.700  1.00 120.15 ? 152 TRP A CE2 1 
ATOM   5358  C CE3 . TRP C 2 128 ? 25.370  -73.000 -2.036  1.00 122.86 ? 152 TRP A CE3 1 
ATOM   5359  C CZ2 . TRP C 2 128 ? 27.966  -72.150 -2.779  1.00 121.25 ? 152 TRP A CZ2 1 
ATOM   5360  C CZ3 . TRP C 2 128 ? 26.427  -73.889 -2.114  1.00 127.57 ? 152 TRP A CZ3 1 
ATOM   5361  C CH2 . TRP C 2 128 ? 27.709  -73.460 -2.483  1.00 125.82 ? 152 TRP A CH2 1 
ATOM   5362  N N   . SER C 2 129 ? 22.319  -67.977 -3.702  1.00 133.36 ? 153 SER A N   1 
ATOM   5363  C CA  . SER C 2 129 ? 22.533  -66.735 -4.429  1.00 131.69 ? 153 SER A CA  1 
ATOM   5364  C C   . SER C 2 129 ? 23.629  -65.903 -3.768  1.00 129.12 ? 153 SER A C   1 
ATOM   5365  O O   . SER C 2 129 ? 24.042  -66.151 -2.633  1.00 130.46 ? 153 SER A O   1 
ATOM   5366  C CB  . SER C 2 129 ? 21.231  -65.933 -4.513  1.00 132.84 ? 153 SER A CB  1 
ATOM   5367  O OG  . SER C 2 129 ? 21.494  -64.543 -4.582  1.00 133.98 ? 153 SER A OG  1 
ATOM   5368  N N   . VAL C 2 130 ? 24.094  -64.894 -4.504  1.00 130.74 ? 154 VAL A N   1 
ATOM   5369  C CA  . VAL C 2 130 ? 25.155  -64.006 -4.040  1.00 127.91 ? 154 VAL A CA  1 
ATOM   5370  C C   . VAL C 2 130 ? 24.861  -62.611 -4.589  1.00 130.77 ? 154 VAL A C   1 
ATOM   5371  O O   . VAL C 2 130 ? 23.758  -62.357 -5.086  1.00 141.29 ? 154 VAL A O   1 
ATOM   5372  C CB  . VAL C 2 130 ? 26.539  -64.544 -4.466  1.00 122.17 ? 154 VAL A CB  1 
ATOM   5373  C CG1 . VAL C 2 130 ? 26.795  -64.314 -5.959  1.00 120.33 ? 154 VAL A CG1 1 
ATOM   5374  C CG2 . VAL C 2 130 ? 27.664  -63.995 -3.579  1.00 121.85 ? 154 VAL A CG2 1 
ATOM   5375  N N   . ALA C 2 131 ? 25.822  -61.693 -4.492  1.00 136.54 ? 155 ALA A N   1 
ATOM   5376  C CA  . ALA C 2 131 ? 25.627  -60.328 -4.955  1.00 136.13 ? 155 ALA A CA  1 
ATOM   5377  C C   . ALA C 2 131 ? 26.852  -59.858 -5.725  1.00 141.19 ? 155 ALA A C   1 
ATOM   5378  O O   . ALA C 2 131 ? 27.986  -60.236 -5.413  1.00 135.12 ? 155 ALA A O   1 
ATOM   5379  C CB  . ALA C 2 131 ? 25.345  -59.370 -3.789  1.00 131.53 ? 155 ALA A CB  1 
ATOM   5380  N N   . LEU C 2 132 ? 26.606  -59.029 -6.741  1.00 150.98 ? 156 LEU A N   1 
ATOM   5381  C CA  . LEU C 2 132 ? 27.667  -58.391 -7.508  1.00 153.14 ? 156 LEU A CA  1 
ATOM   5382  C C   . LEU C 2 132 ? 27.467  -56.879 -7.519  1.00 151.23 ? 156 LEU A C   1 
ATOM   5383  O O   . LEU C 2 132 ? 28.391  -56.119 -7.198  1.00 144.20 ? 156 LEU A O   1 
ATOM   5384  C CB  . LEU C 2 132 ? 27.699  -58.920 -8.948  1.00 152.60 ? 156 LEU A CB  1 
ATOM   5385  C CG  . LEU C 2 132 ? 28.745  -59.969 -9.349  1.00 145.89 ? 156 LEU A CG  1 
ATOM   5386  C CD1 . LEU C 2 132 ? 30.122  -59.330 -9.465  1.00 141.17 ? 156 LEU A CD1 1 
ATOM   5387  C CD2 . LEU C 2 132 ? 28.768  -61.146 -8.387  1.00 139.49 ? 156 LEU A CD2 1 
ATOM   5388  N N   . GLY C 2 133 ? 26.262  -56.436 -7.885  1.00 160.35 ? 157 GLY A N   1 
ATOM   5389  C CA  . GLY C 2 133 ? 25.976  -55.027 -8.044  1.00 157.05 ? 157 GLY A CA  1 
ATOM   5390  C C   . GLY C 2 133 ? 25.926  -54.594 -9.498  1.00 156.57 ? 157 GLY A C   1 
ATOM   5391  O O   . GLY C 2 133 ? 25.240  -55.219 -10.314 1.00 151.19 ? 157 GLY A O   1 
ATOM   5392  N N   . SER C 2 134 ? 26.647  -53.536 -9.827  1.00 161.71 ? 158 SER A N   1 
ATOM   5393  C CA  . SER C 2 134 ? 26.753  -53.166 -11.232 1.00 162.07 ? 158 SER A CA  1 
ATOM   5394  C C   . SER C 2 134 ? 27.833  -54.012 -11.908 1.00 165.60 ? 158 SER A C   1 
ATOM   5395  O O   . SER C 2 134 ? 28.853  -54.325 -11.288 1.00 158.65 ? 158 SER A O   1 
ATOM   5396  C CB  . SER C 2 134 ? 27.085  -51.681 -11.375 1.00 156.69 ? 158 SER A CB  1 
ATOM   5397  O OG  . SER C 2 134 ? 27.897  -51.440 -12.512 1.00 152.98 ? 158 SER A OG  1 
ATOM   5398  N N   . PRO C 2 135 ? 27.631  -54.411 -13.169 1.00 165.84 ? 159 PRO A N   1 
ATOM   5399  C CA  . PRO C 2 135 ? 28.702  -55.142 -13.872 1.00 167.10 ? 159 PRO A CA  1 
ATOM   5400  C C   . PRO C 2 135 ? 29.960  -54.311 -14.041 1.00 166.61 ? 159 PRO A C   1 
ATOM   5401  O O   . PRO C 2 135 ? 31.073  -54.854 -14.005 1.00 165.73 ? 159 PRO A O   1 
ATOM   5402  C CB  . PRO C 2 135 ? 28.057  -55.495 -15.220 1.00 164.91 ? 159 PRO A CB  1 
ATOM   5403  C CG  . PRO C 2 135 ? 27.012  -54.443 -15.417 1.00 164.22 ? 159 PRO A CG  1 
ATOM   5404  C CD  . PRO C 2 135 ? 26.472  -54.152 -14.042 1.00 163.89 ? 159 PRO A CD  1 
ATOM   5405  N N   . GLN C 2 136 ? 29.807  -52.996 -14.225 1.00 164.45 ? 160 GLN A N   1 
ATOM   5406  C CA  . GLN C 2 136 ? 30.958  -52.100 -14.224 1.00 161.08 ? 160 GLN A CA  1 
ATOM   5407  C C   . GLN C 2 136 ? 31.615  -52.048 -12.849 1.00 165.81 ? 160 GLN A C   1 
ATOM   5408  O O   . GLN C 2 136 ? 32.847  -52.064 -12.741 1.00 165.50 ? 160 GLN A O   1 
ATOM   5409  C CB  . GLN C 2 136 ? 30.529  -50.701 -14.661 1.00 158.24 ? 160 GLN A CB  1 
ATOM   5410  C CG  . GLN C 2 136 ? 31.486  -50.021 -15.620 1.00 158.91 ? 160 GLN A CG  1 
ATOM   5411  C CD  . GLN C 2 136 ? 31.202  -48.540 -15.757 1.00 154.56 ? 160 GLN A CD  1 
ATOM   5412  O OE1 . GLN C 2 136 ? 30.299  -48.135 -16.488 1.00 151.16 ? 160 GLN A OE1 1 
ATOM   5413  N NE2 . GLN C 2 136 ? 31.970  -47.721 -15.045 1.00 147.51 ? 160 GLN A NE2 1 
ATOM   5414  N N   . SER C 2 137 ? 30.809  -51.971 -11.787 1.00 168.95 ? 161 SER A N   1 
ATOM   5415  C CA  . SER C 2 137 ? 31.325  -51.987 -10.421 1.00 162.45 ? 161 SER A CA  1 
ATOM   5416  C C   . SER C 2 137 ? 32.035  -53.306 -10.139 1.00 161.32 ? 161 SER A C   1 
ATOM   5417  O O   . SER C 2 137 ? 31.404  -54.282 -9.720  1.00 157.53 ? 161 SER A O   1 
ATOM   5418  C CB  . SER C 2 137 ? 30.195  -51.758 -9.411  1.00 153.66 ? 161 SER A CB  1 
ATOM   5419  O OG  . SER C 2 137 ? 29.580  -52.980 -9.039  1.00 149.83 ? 161 SER A OG  1 
ATOM   5420  N N   . HIS C 2 138 ? 33.348  -53.341 -10.359 1.00 153.18 ? 162 HIS A N   1 
ATOM   5421  C CA  . HIS C 2 138 ? 34.129  -54.574 -10.330 1.00 151.02 ? 162 HIS A CA  1 
ATOM   5422  C C   . HIS C 2 138 ? 35.381  -54.410 -9.475  1.00 150.29 ? 162 HIS A C   1 
ATOM   5423  O O   . HIS C 2 138 ? 36.477  -54.845 -9.838  1.00 147.04 ? 162 HIS A O   1 
ATOM   5424  C CB  . HIS C 2 138 ? 34.488  -55.007 -11.750 1.00 154.69 ? 162 HIS A CB  1 
ATOM   5425  C CG  . HIS C 2 138 ? 35.418  -54.067 -12.454 1.00 163.01 ? 162 HIS A CG  1 
ATOM   5426  N ND1 . HIS C 2 138 ? 35.014  -52.840 -12.934 1.00 166.68 ? 162 HIS A ND1 1 
ATOM   5427  C CD2 . HIS C 2 138 ? 36.734  -54.175 -12.756 1.00 161.66 ? 162 HIS A CD2 1 
ATOM   5428  C CE1 . HIS C 2 138 ? 36.040  -52.232 -13.503 1.00 160.44 ? 162 HIS A CE1 1 
ATOM   5429  N NE2 . HIS C 2 138 ? 37.096  -53.021 -13.408 1.00 160.55 ? 162 HIS A NE2 1 
ATOM   5430  N N   . TRP C 2 139 ? 35.236  -53.780 -8.307  1.00 136.68 ? 163 TRP A N   1 
ATOM   5431  C CA  . TRP C 2 139 ? 36.356  -53.763 -7.373  1.00 133.98 ? 163 TRP A CA  1 
ATOM   5432  C C   . TRP C 2 139 ? 36.630  -55.157 -6.832  1.00 137.19 ? 163 TRP A C   1 
ATOM   5433  O O   . TRP C 2 139 ? 37.787  -55.512 -6.580  1.00 135.18 ? 163 TRP A O   1 
ATOM   5434  C CB  . TRP C 2 139 ? 36.093  -52.815 -6.204  1.00 128.54 ? 163 TRP A CB  1 
ATOM   5435  C CG  . TRP C 2 139 ? 37.332  -52.559 -5.397  1.00 129.72 ? 163 TRP A CG  1 
ATOM   5436  C CD1 . TRP C 2 139 ? 38.466  -51.933 -5.820  1.00 130.74 ? 163 TRP A CD1 1 
ATOM   5437  C CD2 . TRP C 2 139 ? 37.599  -53.005 -4.059  1.00 133.35 ? 163 TRP A CD2 1 
ATOM   5438  N NE1 . TRP C 2 139 ? 39.402  -51.914 -4.817  1.00 127.42 ? 163 TRP A NE1 1 
ATOM   5439  C CE2 . TRP C 2 139 ? 38.898  -52.572 -3.727  1.00 131.00 ? 163 TRP A CE2 1 
ATOM   5440  C CE3 . TRP C 2 139 ? 36.859  -53.711 -3.105  1.00 136.48 ? 163 TRP A CE3 1 
ATOM   5441  C CZ2 . TRP C 2 139 ? 39.474  -52.821 -2.484  1.00 131.66 ? 163 TRP A CZ2 1 
ATOM   5442  C CZ3 . TRP C 2 139 ? 37.435  -53.958 -1.870  1.00 135.58 ? 163 TRP A CZ3 1 
ATOM   5443  C CH2 . TRP C 2 139 ? 38.729  -53.513 -1.571  1.00 129.68 ? 163 TRP A CH2 1 
ATOM   5444  N N   . LEU C 2 140 ? 35.583  -55.954 -6.656  1.00 134.04 ? 164 LEU A N   1 
ATOM   5445  C CA  . LEU C 2 140 ? 35.678  -57.305 -6.113  1.00 133.81 ? 164 LEU A CA  1 
ATOM   5446  C C   . LEU C 2 140 ? 35.419  -58.280 -7.258  1.00 140.13 ? 164 LEU A C   1 
ATOM   5447  O O   . LEU C 2 140 ? 34.266  -58.546 -7.610  1.00 139.34 ? 164 LEU A O   1 
ATOM   5448  C CB  . LEU C 2 140 ? 34.686  -57.487 -4.966  1.00 130.43 ? 164 LEU A CB  1 
ATOM   5449  C CG  . LEU C 2 140 ? 34.938  -58.597 -3.945  1.00 129.60 ? 164 LEU A CG  1 
ATOM   5450  C CD1 . LEU C 2 140 ? 34.550  -59.943 -4.521  1.00 130.16 ? 164 LEU A CD1 1 
ATOM   5451  C CD2 . LEU C 2 140 ? 36.391  -58.597 -3.503  1.00 122.49 ? 164 LEU A CD2 1 
ATOM   5452  N N   . SER C 2 141 ? 36.493  -58.803 -7.840  1.00 140.64 ? 165 SER A N   1 
ATOM   5453  C CA  . SER C 2 141 ? 36.350  -59.787 -8.902  1.00 142.88 ? 165 SER A CA  1 
ATOM   5454  C C   . SER C 2 141 ? 35.750  -61.073 -8.338  1.00 140.25 ? 165 SER A C   1 
ATOM   5455  O O   . SER C 2 141 ? 36.146  -61.521 -7.258  1.00 134.80 ? 165 SER A O   1 
ATOM   5456  C CB  . SER C 2 141 ? 37.702  -60.079 -9.552  1.00 141.32 ? 165 SER A CB  1 
ATOM   5457  O OG  . SER C 2 141 ? 37.782  -61.429 -9.978  1.00 143.96 ? 165 SER A OG  1 
ATOM   5458  N N   . PRO C 2 142 ? 34.794  -61.689 -9.041  1.00 145.54 ? 166 PRO A N   1 
ATOM   5459  C CA  . PRO C 2 142 ? 34.135  -62.888 -8.497  1.00 143.13 ? 166 PRO A CA  1 
ATOM   5460  C C   . PRO C 2 142 ? 35.061  -64.084 -8.338  1.00 138.72 ? 166 PRO A C   1 
ATOM   5461  O O   . PRO C 2 142 ? 34.643  -65.087 -7.746  1.00 128.68 ? 166 PRO A O   1 
ATOM   5462  C CB  . PRO C 2 142 ? 33.022  -63.177 -9.518  1.00 144.95 ? 166 PRO A CB  1 
ATOM   5463  C CG  . PRO C 2 142 ? 32.903  -61.922 -10.345 1.00 142.70 ? 166 PRO A CG  1 
ATOM   5464  C CD  . PRO C 2 142 ? 34.268  -61.322 -10.364 1.00 142.40 ? 166 PRO A CD  1 
ATOM   5465  N N   . GLY C 2 143 ? 36.292  -64.014 -8.839  1.00 139.13 ? 167 GLY A N   1 
ATOM   5466  C CA  . GLY C 2 143 ? 37.284  -65.038 -8.603  1.00 133.51 ? 167 GLY A CA  1 
ATOM   5467  C C   . GLY C 2 143 ? 38.074  -64.870 -7.327  1.00 131.60 ? 167 GLY A C   1 
ATOM   5468  O O   . GLY C 2 143 ? 38.910  -65.720 -7.007  1.00 130.89 ? 167 GLY A O   1 
ATOM   5469  N N   . ASP C 2 144 ? 37.835  -63.787 -6.587  1.00 134.50 ? 168 ASP A N   1 
ATOM   5470  C CA  . ASP C 2 144 ? 38.498  -63.537 -5.314  1.00 133.91 ? 168 ASP A CA  1 
ATOM   5471  C C   . ASP C 2 144 ? 37.754  -64.127 -4.126  1.00 131.68 ? 168 ASP A C   1 
ATOM   5472  O O   . ASP C 2 144 ? 38.303  -64.146 -3.019  1.00 130.71 ? 168 ASP A O   1 
ATOM   5473  C CB  . ASP C 2 144 ? 38.675  -62.030 -5.093  1.00 130.86 ? 168 ASP A CB  1 
ATOM   5474  C CG  . ASP C 2 144 ? 39.318  -61.340 -6.276  1.00 130.76 ? 168 ASP A CG  1 
ATOM   5475  O OD1 . ASP C 2 144 ? 39.310  -61.918 -7.384  1.00 134.20 ? 168 ASP A OD1 1 
ATOM   5476  O OD2 . ASP C 2 144 ? 39.831  -60.216 -6.096  1.00 127.93 ? 168 ASP A OD2 1 
ATOM   5477  N N   . LEU C 2 145 ? 36.528  -64.603 -4.324  1.00 123.98 ? 169 LEU A N   1 
ATOM   5478  C CA  . LEU C 2 145 ? 35.727  -65.194 -3.264  1.00 122.72 ? 169 LEU A CA  1 
ATOM   5479  C C   . LEU C 2 145 ? 35.622  -66.698 -3.462  1.00 120.99 ? 169 LEU A C   1 
ATOM   5480  O O   . LEU C 2 145 ? 35.544  -67.180 -4.596  1.00 123.38 ? 169 LEU A O   1 
ATOM   5481  C CB  . LEU C 2 145 ? 34.319  -64.595 -3.232  1.00 124.54 ? 169 LEU A CB  1 
ATOM   5482  C CG  . LEU C 2 145 ? 34.214  -63.090 -3.011  1.00 125.85 ? 169 LEU A CG  1 
ATOM   5483  C CD1 . LEU C 2 145 ? 32.769  -62.685 -2.755  1.00 124.68 ? 169 LEU A CD1 1 
ATOM   5484  C CD2 . LEU C 2 145 ? 35.120  -62.648 -1.871  1.00 128.48 ? 169 LEU A CD2 1 
ATOM   5485  N N   . GLU C 2 146 ? 35.621  -67.431 -2.355  1.00 120.78 ? 170 GLU A N   1 
ATOM   5486  C CA  . GLU C 2 146 ? 35.252  -68.838 -2.357  1.00 120.89 ? 170 GLU A CA  1 
ATOM   5487  C C   . GLU C 2 146 ? 34.119  -69.043 -1.361  1.00 116.45 ? 170 GLU A C   1 
ATOM   5488  O O   . GLU C 2 146 ? 33.758  -68.141 -0.600  1.00 118.78 ? 170 GLU A O   1 
ATOM   5489  C CB  . GLU C 2 146 ? 36.452  -69.738 -2.033  1.00 122.38 ? 170 GLU A CB  1 
ATOM   5490  C CG  . GLU C 2 146 ? 37.016  -69.582 -0.635  1.00 122.20 ? 170 GLU A CG  1 
ATOM   5491  C CD  . GLU C 2 146 ? 38.233  -70.458 -0.407  1.00 123.69 ? 170 GLU A CD  1 
ATOM   5492  O OE1 . GLU C 2 146 ? 38.739  -71.041 -1.389  1.00 128.24 ? 170 GLU A OE1 1 
ATOM   5493  O OE2 . GLU C 2 146 ? 38.684  -70.565 0.752   1.00 122.79 ? 170 GLU A OE2 1 
ATOM   5494  N N   . PHE C 2 147 ? 33.528  -70.231 -1.382  1.00 108.31 ? 171 PHE A N   1 
ATOM   5495  C CA  . PHE C 2 147 ? 32.376  -70.517 -0.544  1.00 109.39 ? 171 PHE A CA  1 
ATOM   5496  C C   . PHE C 2 147 ? 32.703  -71.649 0.414   1.00 113.28 ? 171 PHE A C   1 
ATOM   5497  O O   . PHE C 2 147 ? 33.371  -72.620 0.043   1.00 117.32 ? 171 PHE A O   1 
ATOM   5498  C CB  . PHE C 2 147 ? 31.154  -70.876 -1.388  1.00 110.47 ? 171 PHE A CB  1 
ATOM   5499  C CG  . PHE C 2 147 ? 30.687  -69.762 -2.278  1.00 113.53 ? 171 PHE A CG  1 
ATOM   5500  C CD1 . PHE C 2 147 ? 31.277  -69.546 -3.512  1.00 117.26 ? 171 PHE A CD1 1 
ATOM   5501  C CD2 . PHE C 2 147 ? 29.662  -68.924 -1.877  1.00 114.11 ? 171 PHE A CD2 1 
ATOM   5502  C CE1 . PHE C 2 147 ? 30.847  -68.522 -4.332  1.00 118.06 ? 171 PHE A CE1 1 
ATOM   5503  C CE2 . PHE C 2 147 ? 29.229  -67.900 -2.694  1.00 116.83 ? 171 PHE A CE2 1 
ATOM   5504  C CZ  . PHE C 2 147 ? 29.823  -67.697 -3.921  1.00 116.99 ? 171 PHE A CZ  1 
ATOM   5505  N N   . GLU C 2 148 ? 32.228  -71.513 1.647   1.00 108.76 ? 172 GLU A N   1 
ATOM   5506  C CA  . GLU C 2 148 ? 32.420  -72.504 2.696   1.00 106.37 ? 172 GLU A CA  1 
ATOM   5507  C C   . GLU C 2 148 ? 31.045  -73.041 3.068   1.00 106.31 ? 172 GLU A C   1 
ATOM   5508  O O   . GLU C 2 148 ? 30.209  -72.299 3.596   1.00 104.86 ? 172 GLU A O   1 
ATOM   5509  C CB  . GLU C 2 148 ? 33.125  -71.886 3.902   1.00 106.06 ? 172 GLU A CB  1 
ATOM   5510  C CG  . GLU C 2 148 ? 33.576  -72.880 4.958   1.00 107.20 ? 172 GLU A CG  1 
ATOM   5511  C CD  . GLU C 2 148 ? 34.313  -72.208 6.100   1.00 109.17 ? 172 GLU A CD  1 
ATOM   5512  O OE1 . GLU C 2 148 ? 34.463  -72.839 7.168   1.00 107.76 ? 172 GLU A OE1 1 
ATOM   5513  O OE2 . GLU C 2 148 ? 34.738  -71.044 5.929   1.00 109.46 ? 172 GLU A OE2 1 
ATOM   5514  N N   . VAL C 2 149 ? 30.803  -74.313 2.759   1.00 103.42 ? 173 VAL A N   1 
ATOM   5515  C CA  . VAL C 2 149 ? 29.578  -75.011 3.120   1.00 103.66 ? 173 VAL A CA  1 
ATOM   5516  C C   . VAL C 2 149 ? 29.857  -75.848 4.356   1.00 102.60 ? 173 VAL A C   1 
ATOM   5517  O O   . VAL C 2 149 ? 30.886  -76.527 4.445   1.00 106.33 ? 173 VAL A O   1 
ATOM   5518  C CB  . VAL C 2 149 ? 29.074  -75.895 1.962   1.00 104.59 ? 173 VAL A CB  1 
ATOM   5519  C CG1 . VAL C 2 149 ? 27.739  -76.537 2.318   1.00 103.53 ? 173 VAL A CG1 1 
ATOM   5520  C CG2 . VAL C 2 149 ? 28.965  -75.085 0.683   1.00 107.00 ? 173 VAL A CG2 1 
ATOM   5521  N N   . VAL C 2 150 ? 28.942  -75.796 5.316   1.00 101.42 ? 174 VAL A N   1 
ATOM   5522  C CA  . VAL C 2 150 ? 29.046  -76.542 6.558   1.00 101.25 ? 174 VAL A CA  1 
ATOM   5523  C C   . VAL C 2 150 ? 27.764  -77.344 6.709   1.00 101.47 ? 174 VAL A C   1 
ATOM   5524  O O   . VAL C 2 150 ? 26.669  -76.767 6.768   1.00 97.74  ? 174 VAL A O   1 
ATOM   5525  C CB  . VAL C 2 150 ? 29.266  -75.616 7.764   1.00 99.98  ? 174 VAL A CB  1 
ATOM   5526  C CG1 . VAL C 2 150 ? 29.109  -76.381 9.051   1.00 102.55 ? 174 VAL A CG1 1 
ATOM   5527  C CG2 . VAL C 2 150 ? 30.645  -74.989 7.692   1.00 100.03 ? 174 VAL A CG2 1 
ATOM   5528  N N   . TYR C 2 151 ? 27.896  -78.668 6.738   1.00 99.36  ? 175 TYR A N   1 
ATOM   5529  C CA  . TYR C 2 151 ? 26.751  -79.559 6.853   1.00 98.00  ? 175 TYR A CA  1 
ATOM   5530  C C   . TYR C 2 151 ? 26.902  -80.446 8.081   1.00 96.96  ? 175 TYR A C   1 
ATOM   5531  O O   . TYR C 2 151 ? 28.016  -80.762 8.508   1.00 97.61  ? 175 TYR A O   1 
ATOM   5532  C CB  . TYR C 2 151 ? 26.558  -80.419 5.587   1.00 100.26 ? 175 TYR A CB  1 
ATOM   5533  C CG  . TYR C 2 151 ? 27.768  -81.204 5.115   1.00 101.92 ? 175 TYR A CG  1 
ATOM   5534  C CD1 . TYR C 2 151 ? 28.834  -80.572 4.486   1.00 102.72 ? 175 TYR A CD1 1 
ATOM   5535  C CD2 . TYR C 2 151 ? 27.826  -82.584 5.268   1.00 100.92 ? 175 TYR A CD2 1 
ATOM   5536  C CE1 . TYR C 2 151 ? 29.931  -81.288 4.045   1.00 102.31 ? 175 TYR A CE1 1 
ATOM   5537  C CE2 . TYR C 2 151 ? 28.918  -83.307 4.827   1.00 100.74 ? 175 TYR A CE2 1 
ATOM   5538  C CZ  . TYR C 2 151 ? 29.966  -82.654 4.215   1.00 101.95 ? 175 TYR A CZ  1 
ATOM   5539  O OH  . TYR C 2 151 ? 31.059  -83.365 3.777   1.00 106.89 ? 175 TYR A OH  1 
ATOM   5540  N N   . LYS C 2 152 ? 25.765  -80.844 8.647   1.00 95.36  ? 176 LYS A N   1 
ATOM   5541  C CA  . LYS C 2 152 ? 25.768  -81.460 9.967   1.00 95.38  ? 176 LYS A CA  1 
ATOM   5542  C C   . LYS C 2 152 ? 24.430  -82.141 10.215  1.00 95.84  ? 176 LYS A C   1 
ATOM   5543  O O   . LYS C 2 152 ? 23.386  -81.591 9.868   1.00 95.68  ? 176 LYS A O   1 
ATOM   5544  C CB  . LYS C 2 152 ? 26.034  -80.395 11.039  1.00 94.43  ? 176 LYS A CB  1 
ATOM   5545  C CG  . LYS C 2 152 ? 25.706  -80.808 12.454  1.00 94.38  ? 176 LYS A CG  1 
ATOM   5546  C CD  . LYS C 2 152 ? 25.495  -79.590 13.333  1.00 93.45  ? 176 LYS A CD  1 
ATOM   5547  C CE  . LYS C 2 152 ? 24.184  -78.893 13.013  1.00 93.18  ? 176 LYS A CE  1 
ATOM   5548  N NZ  . LYS C 2 152 ? 22.988  -79.726 13.308  1.00 93.75  ? 176 LYS A NZ  1 
ATOM   5549  N N   . ARG C 2 153 ? 24.460  -83.326 10.822  1.00 96.45  ? 177 ARG A N   1 
ATOM   5550  C CA  . ARG C 2 153 ? 23.213  -83.967 11.223  1.00 96.89  ? 177 ARG A CA  1 
ATOM   5551  C C   . ARG C 2 153 ? 22.447  -83.073 12.195  1.00 96.18  ? 177 ARG A C   1 
ATOM   5552  O O   . ARG C 2 153 ? 23.040  -82.338 12.987  1.00 95.47  ? 177 ARG A O   1 
ATOM   5553  C CB  . ARG C 2 153 ? 23.483  -85.328 11.866  1.00 97.61  ? 177 ARG A CB  1 
ATOM   5554  C CG  . ARG C 2 153 ? 24.332  -86.254 11.021  1.00 98.34  ? 177 ARG A CG  1 
ATOM   5555  C CD  . ARG C 2 153 ? 24.372  -87.658 11.595  1.00 99.14  ? 177 ARG A CD  1 
ATOM   5556  N NE  . ARG C 2 153 ? 24.498  -87.661 13.047  1.00 98.81  ? 177 ARG A NE  1 
ATOM   5557  C CZ  . ARG C 2 153 ? 25.047  -88.650 13.743  1.00 99.29  ? 177 ARG A CZ  1 
ATOM   5558  N NH1 . ARG C 2 153 ? 25.519  -89.720 13.118  1.00 100.11 ? 177 ARG A NH1 1 
ATOM   5559  N NH2 . ARG C 2 153 ? 25.120  -88.572 15.065  1.00 99.00  ? 177 ARG A NH2 1 
ATOM   5560  N N   . LEU C 2 154 ? 21.112  -83.143 12.130  1.00 97.27  ? 178 LEU A N   1 
ATOM   5561  C CA  . LEU C 2 154 ? 20.271  -82.258 12.935  1.00 98.50  ? 178 LEU A CA  1 
ATOM   5562  C C   . LEU C 2 154 ? 20.617  -82.306 14.419  1.00 97.24  ? 178 LEU A C   1 
ATOM   5563  O O   . LEU C 2 154 ? 20.537  -81.281 15.106  1.00 94.74  ? 178 LEU A O   1 
ATOM   5564  C CB  . LEU C 2 154 ? 18.795  -82.617 12.736  1.00 103.86 ? 178 LEU A CB  1 
ATOM   5565  C CG  . LEU C 2 154 ? 17.769  -81.609 13.259  1.00 107.67 ? 178 LEU A CG  1 
ATOM   5566  C CD1 . LEU C 2 154 ? 17.626  -80.442 12.303  1.00 111.97 ? 178 LEU A CD1 1 
ATOM   5567  C CD2 . LEU C 2 154 ? 16.421  -82.284 13.496  1.00 108.09 ? 178 LEU A CD2 1 
ATOM   5568  N N   . GLN C 2 155 ? 21.008  -83.476 14.930  1.00 100.60 ? 179 GLN A N   1 
ATOM   5569  C CA  . GLN C 2 155 ? 21.281  -83.619 16.355  1.00 102.66 ? 179 GLN A CA  1 
ATOM   5570  C C   . GLN C 2 155 ? 22.653  -83.080 16.745  1.00 100.65 ? 179 GLN A C   1 
ATOM   5571  O O   . GLN C 2 155 ? 22.815  -82.566 17.857  1.00 98.12  ? 179 GLN A O   1 
ATOM   5572  C CB  . GLN C 2 155 ? 21.171  -85.091 16.763  1.00 104.59 ? 179 GLN A CB  1 
ATOM   5573  C CG  . GLN C 2 155 ? 22.121  -86.027 16.015  1.00 105.31 ? 179 GLN A CG  1 
ATOM   5574  C CD  . GLN C 2 155 ? 21.418  -86.863 14.962  1.00 106.11 ? 179 GLN A CD  1 
ATOM   5575  O OE1 . GLN C 2 155 ? 20.760  -86.329 14.068  1.00 99.93  ? 179 GLN A OE1 1 
ATOM   5576  N NE2 . GLN C 2 155 ? 21.549  -88.184 15.065  1.00 106.51 ? 179 GLN A NE2 1 
ATOM   5577  N N   . ASP C 2 156 ? 23.640  -83.181 15.857  1.00 97.99  ? 180 ASP A N   1 
ATOM   5578  C CA  . ASP C 2 156 ? 25.016  -82.870 16.215  1.00 98.98  ? 180 ASP A CA  1 
ATOM   5579  C C   . ASP C 2 156 ? 25.193  -81.376 16.488  1.00 97.97  ? 180 ASP A C   1 
ATOM   5580  O O   . ASP C 2 156 ? 24.300  -80.555 16.261  1.00 95.29  ? 180 ASP A O   1 
ATOM   5581  C CB  . ASP C 2 156 ? 25.974  -83.311 15.108  1.00 99.09  ? 180 ASP A CB  1 
ATOM   5582  C CG  . ASP C 2 156 ? 26.025  -84.815 14.947  1.00 100.73 ? 180 ASP A CG  1 
ATOM   5583  O OD1 . ASP C 2 156 ? 25.974  -85.526 15.973  1.00 103.72 ? 180 ASP A OD1 1 
ATOM   5584  O OD2 . ASP C 2 156 ? 26.126  -85.287 13.794  1.00 97.58  ? 180 ASP A OD2 1 
ATOM   5585  N N   . SER C 2 157 ? 26.376  -81.036 16.991  1.00 101.98 ? 181 SER A N   1 
ATOM   5586  C CA  . SER C 2 157 ? 26.758  -79.654 17.230  1.00 101.72 ? 181 SER A CA  1 
ATOM   5587  C C   . SER C 2 157 ? 27.525  -79.111 16.031  1.00 98.77  ? 181 SER A C   1 
ATOM   5588  O O   . SER C 2 157 ? 28.170  -79.860 15.292  1.00 97.21  ? 181 SER A O   1 
ATOM   5589  C CB  . SER C 2 157 ? 27.610  -79.539 18.494  1.00 104.19 ? 181 SER A CB  1 
ATOM   5590  O OG  . SER C 2 157 ? 28.488  -78.430 18.411  1.00 113.46 ? 181 SER A OG  1 
ATOM   5591  N N   . TRP C 2 158 ? 27.451  -77.791 15.845  1.00 97.51  ? 182 TRP A N   1 
ATOM   5592  C CA  . TRP C 2 158 ? 28.083  -77.171 14.687  1.00 99.54  ? 182 TRP A CA  1 
ATOM   5593  C C   . TRP C 2 158 ? 29.603  -77.252 14.732  1.00 101.95 ? 182 TRP A C   1 
ATOM   5594  O O   . TRP C 2 158 ? 30.248  -77.099 13.690  1.00 98.92  ? 182 TRP A O   1 
ATOM   5595  C CB  . TRP C 2 158 ? 27.638  -75.715 14.564  1.00 100.12 ? 182 TRP A CB  1 
ATOM   5596  C CG  . TRP C 2 158 ? 26.253  -75.576 14.027  1.00 99.57  ? 182 TRP A CG  1 
ATOM   5597  C CD1 . TRP C 2 158 ? 25.133  -75.236 14.725  1.00 101.47 ? 182 TRP A CD1 1 
ATOM   5598  C CD2 . TRP C 2 158 ? 25.836  -75.780 12.672  1.00 97.81  ? 182 TRP A CD2 1 
ATOM   5599  N NE1 . TRP C 2 158 ? 24.043  -75.213 13.889  1.00 102.36 ? 182 TRP A NE1 1 
ATOM   5600  C CE2 . TRP C 2 158 ? 24.449  -75.543 12.622  1.00 98.39  ? 182 TRP A CE2 1 
ATOM   5601  C CE3 . TRP C 2 158 ? 26.502  -76.139 11.497  1.00 98.18  ? 182 TRP A CE3 1 
ATOM   5602  C CZ2 . TRP C 2 158 ? 23.715  -75.655 11.444  1.00 98.68  ? 182 TRP A CZ2 1 
ATOM   5603  C CZ3 . TRP C 2 158 ? 25.771  -76.248 10.329  1.00 99.76  ? 182 TRP A CZ3 1 
ATOM   5604  C CH2 . TRP C 2 158 ? 24.393  -76.007 10.311  1.00 100.91 ? 182 TRP A CH2 1 
ATOM   5605  N N   . GLU C 2 159 ? 30.189  -77.487 15.908  1.00 105.09 ? 183 GLU A N   1 
ATOM   5606  C CA  . GLU C 2 159 ? 31.637  -77.650 15.987  1.00 104.09 ? 183 GLU A CA  1 
ATOM   5607  C C   . GLU C 2 159 ? 32.080  -78.950 15.327  1.00 103.07 ? 183 GLU A C   1 
ATOM   5608  O O   . GLU C 2 159 ? 33.120  -78.992 14.660  1.00 102.54 ? 183 GLU A O   1 
ATOM   5609  C CB  . GLU C 2 159 ? 32.093  -77.598 17.446  1.00 105.85 ? 183 GLU A CB  1 
ATOM   5610  C CG  . GLU C 2 159 ? 32.046  -76.205 18.062  1.00 108.30 ? 183 GLU A CG  1 
ATOM   5611  C CD  . GLU C 2 159 ? 32.361  -76.204 19.547  1.00 109.67 ? 183 GLU A CD  1 
ATOM   5612  O OE1 . GLU C 2 159 ? 32.407  -77.298 20.150  1.00 111.65 ? 183 GLU A OE1 1 
ATOM   5613  O OE2 . GLU C 2 159 ? 32.564  -75.106 20.110  1.00 109.95 ? 183 GLU A OE2 1 
ATOM   5614  N N   . ASP C 2 160 ? 31.298  -80.016 15.491  1.00 105.38 ? 184 ASP A N   1 
ATOM   5615  C CA  . ASP C 2 160 ? 31.603  -81.321 14.918  1.00 105.56 ? 184 ASP A CA  1 
ATOM   5616  C C   . ASP C 2 160 ? 31.226  -81.428 13.445  1.00 104.14 ? 184 ASP A C   1 
ATOM   5617  O O   . ASP C 2 160 ? 31.334  -82.517 12.871  1.00 105.80 ? 184 ASP A O   1 
ATOM   5618  C CB  . ASP C 2 160 ? 30.879  -82.418 15.703  1.00 106.23 ? 184 ASP A CB  1 
ATOM   5619  C CG  . ASP C 2 160 ? 31.294  -82.468 17.157  1.00 107.22 ? 184 ASP A CG  1 
ATOM   5620  O OD1 . ASP C 2 160 ? 32.481  -82.749 17.430  1.00 109.26 ? 184 ASP A OD1 1 
ATOM   5621  O OD2 . ASP C 2 160 ? 30.431  -82.226 18.028  1.00 109.42 ? 184 ASP A OD2 1 
ATOM   5622  N N   . ALA C 2 161 ? 30.797  -80.332 12.824  1.00 100.22 ? 185 ALA A N   1 
ATOM   5623  C CA  . ALA C 2 161 ? 30.211  -80.393 11.495  1.00 99.41  ? 185 ALA A CA  1 
ATOM   5624  C C   . ALA C 2 161 ? 31.284  -80.651 10.437  1.00 99.09  ? 185 ALA A C   1 
ATOM   5625  O O   . ALA C 2 161 ? 32.480  -80.760 10.726  1.00 98.69  ? 185 ALA A O   1 
ATOM   5626  C CB  . ALA C 2 161 ? 29.448  -79.107 11.199  1.00 99.97  ? 185 ALA A CB  1 
ATOM   5627  N N   . ALA C 2 162 ? 30.839  -80.748 9.186   1.00 96.58  ? 186 ALA A N   1 
ATOM   5628  C CA  . ALA C 2 162 ? 31.699  -81.077 8.061   1.00 97.16  ? 186 ALA A CA  1 
ATOM   5629  C C   . ALA C 2 162 ? 31.805  -79.890 7.113   1.00 96.71  ? 186 ALA A C   1 
ATOM   5630  O O   . ALA C 2 162 ? 30.816  -79.187 6.869   1.00 96.30  ? 186 ALA A O   1 
ATOM   5631  C CB  . ALA C 2 162 ? 31.174  -82.301 7.312   1.00 98.14  ? 186 ALA A CB  1 
ATOM   5632  N N   . ILE C 2 163 ? 33.006  -79.701 6.564   1.00 98.26  ? 187 ILE A N   1 
ATOM   5633  C CA  . ILE C 2 163 ? 33.380  -78.516 5.798   1.00 103.75 ? 187 ILE A CA  1 
ATOM   5634  C C   . ILE C 2 163 ? 33.560  -78.902 4.335   1.00 101.46 ? 187 ILE A C   1 
ATOM   5635  O O   . ILE C 2 163 ? 34.068  -79.987 4.027   1.00 104.34 ? 187 ILE A O   1 
ATOM   5636  C CB  . ILE C 2 163 ? 34.671  -77.892 6.371   1.00 108.07 ? 187 ILE A CB  1 
ATOM   5637  C CG1 . ILE C 2 163 ? 34.402  -77.263 7.738   1.00 111.68 ? 187 ILE A CG1 1 
ATOM   5638  C CG2 . ILE C 2 163 ? 35.262  -76.857 5.423   1.00 106.00 ? 187 ILE A CG2 1 
ATOM   5639  C CD1 . ILE C 2 163 ? 35.652  -77.058 8.566   1.00 112.88 ? 187 ILE A CD1 1 
ATOM   5640  N N   . LEU C 2 164 ? 33.143  -78.011 3.435   1.00 103.25 ? 188 LEU A N   1 
ATOM   5641  C CA  . LEU C 2 164 ? 33.297  -78.225 1.999   1.00 106.26 ? 188 LEU A CA  1 
ATOM   5642  C C   . LEU C 2 164 ? 33.543  -76.883 1.326   1.00 107.64 ? 188 LEU A C   1 
ATOM   5643  O O   . LEU C 2 164 ? 32.705  -75.983 1.415   1.00 106.94 ? 188 LEU A O   1 
ATOM   5644  C CB  . LEU C 2 164 ? 32.057  -78.903 1.413   1.00 108.26 ? 188 LEU A CB  1 
ATOM   5645  C CG  . LEU C 2 164 ? 32.125  -79.348 -0.048  1.00 110.75 ? 188 LEU A CG  1 
ATOM   5646  C CD1 . LEU C 2 164 ? 33.098  -80.505 -0.204  1.00 112.04 ? 188 LEU A CD1 1 
ATOM   5647  C CD2 . LEU C 2 164 ? 30.741  -79.730 -0.552  1.00 109.46 ? 188 LEU A CD2 1 
ATOM   5648  N N   . LEU C 2 165 ? 34.680  -76.743 0.655   1.00 111.45 ? 189 LEU A N   1 
ATOM   5649  C CA  . LEU C 2 165 ? 34.992  -75.510 -0.052  1.00 112.62 ? 189 LEU A CA  1 
ATOM   5650  C C   . LEU C 2 165 ? 34.555  -75.607 -1.509  1.00 112.49 ? 189 LEU A C   1 
ATOM   5651  O O   . LEU C 2 165 ? 34.577  -76.681 -2.116  1.00 117.33 ? 189 LEU A O   1 
ATOM   5652  C CB  . LEU C 2 165 ? 36.487  -75.198 0.036   1.00 116.45 ? 189 LEU A CB  1 
ATOM   5653  C CG  . LEU C 2 165 ? 37.027  -74.997 1.454   1.00 118.70 ? 189 LEU A CG  1 
ATOM   5654  C CD1 . LEU C 2 165 ? 38.112  -76.015 1.770   1.00 115.24 ? 189 LEU A CD1 1 
ATOM   5655  C CD2 . LEU C 2 165 ? 37.548  -73.578 1.635   1.00 121.55 ? 189 LEU A CD2 1 
ATOM   5656  N N   . SER C 2 166 ? 34.148  -74.467 -2.066  1.00 116.37 ? 190 SER A N   1 
ATOM   5657  C CA  . SER C 2 166 ? 33.597  -74.430 -3.413  1.00 120.03 ? 190 SER A CA  1 
ATOM   5658  C C   . SER C 2 166 ? 34.051  -73.173 -4.142  1.00 121.56 ? 190 SER A C   1 
ATOM   5659  O O   . SER C 2 166 ? 34.077  -72.080 -3.566  1.00 120.72 ? 190 SER A O   1 
ATOM   5660  C CB  . SER C 2 166 ? 32.063  -74.490 -3.386  1.00 118.47 ? 190 SER A CB  1 
ATOM   5661  O OG  . SER C 2 166 ? 31.514  -74.241 -4.668  1.00 109.38 ? 190 SER A OG  1 
ATOM   5662  N N   . ASN C 2 167 ? 34.405  -73.340 -5.416  1.00 123.27 ? 191 ASN A N   1 
ATOM   5663  C CA  . ASN C 2 167 ? 34.765  -72.227 -6.284  1.00 121.00 ? 191 ASN A CA  1 
ATOM   5664  C C   . ASN C 2 167 ? 33.570  -71.637 -7.020  1.00 120.29 ? 191 ASN A C   1 
ATOM   5665  O O   . ASN C 2 167 ? 33.725  -70.616 -7.698  1.00 120.60 ? 191 ASN A O   1 
ATOM   5666  C CB  . ASN C 2 167 ? 35.816  -72.675 -7.311  1.00 122.78 ? 191 ASN A CB  1 
ATOM   5667  C CG  . ASN C 2 167 ? 37.155  -73.000 -6.678  1.00 122.23 ? 191 ASN A CG  1 
ATOM   5668  O OD1 . ASN C 2 167 ? 37.494  -72.484 -5.615  1.00 120.73 ? 191 ASN A OD1 1 
ATOM   5669  N ND2 . ASN C 2 167 ? 37.924  -73.865 -7.332  1.00 125.65 ? 191 ASN A ND2 1 
ATOM   5670  N N   . THR C 2 168 ? 32.392  -72.250 -6.908  1.00 118.46 ? 192 THR A N   1 
ATOM   5671  C CA  . THR C 2 168 ? 31.203  -71.851 -7.651  1.00 121.81 ? 192 THR A CA  1 
ATOM   5672  C C   . THR C 2 168 ? 30.056  -71.596 -6.682  1.00 123.92 ? 192 THR A C   1 
ATOM   5673  O O   . THR C 2 168 ? 30.197  -71.732 -5.461  1.00 126.49 ? 192 THR A O   1 
ATOM   5674  C CB  . THR C 2 168 ? 30.795  -72.918 -8.676  1.00 121.97 ? 192 THR A CB  1 
ATOM   5675  O OG1 . THR C 2 168 ? 30.296  -74.072 -7.991  1.00 125.15 ? 192 THR A OG1 1 
ATOM   5676  C CG2 . THR C 2 168 ? 31.984  -73.324 -9.529  1.00 120.16 ? 192 THR A CG2 1 
ATOM   5677  N N   . SER C 2 169 ? 28.897  -71.241 -7.247  1.00 123.18 ? 193 SER A N   1 
ATOM   5678  C CA  . SER C 2 169 ? 27.728  -70.870 -6.457  1.00 124.16 ? 193 SER A CA  1 
ATOM   5679  C C   . SER C 2 169 ? 26.922  -72.121 -6.141  1.00 125.23 ? 193 SER A C   1 
ATOM   5680  O O   . SER C 2 169 ? 25.705  -72.059 -5.935  1.00 126.30 ? 193 SER A O   1 
ATOM   5681  C CB  . SER C 2 169 ? 26.859  -69.846 -7.201  1.00 125.16 ? 193 SER A CB  1 
ATOM   5682  O OG  . SER C 2 169 ? 25.771  -69.428 -6.388  1.00 123.51 ? 193 SER A OG  1 
ATOM   5683  N N   . GLN C 2 170 ? 27.589  -73.267 -6.097  1.00 125.93 ? 194 GLN A N   1 
ATOM   5684  C CA  . GLN C 2 170 ? 26.892  -74.514 -5.832  1.00 127.22 ? 194 GLN A CA  1 
ATOM   5685  C C   . GLN C 2 170 ? 27.893  -75.558 -5.370  1.00 126.65 ? 194 GLN A C   1 
ATOM   5686  O O   . GLN C 2 170 ? 29.100  -75.434 -5.596  1.00 116.80 ? 194 GLN A O   1 
ATOM   5687  C CB  . GLN C 2 170 ? 26.129  -75.004 -7.068  1.00 126.18 ? 194 GLN A CB  1 
ATOM   5688  C CG  . GLN C 2 170 ? 26.971  -75.040 -8.332  1.00 127.41 ? 194 GLN A CG  1 
ATOM   5689  C CD  . GLN C 2 170 ? 26.401  -75.969 -9.386  1.00 126.16 ? 194 GLN A CD  1 
ATOM   5690  O OE1 . GLN C 2 170 ? 26.137  -75.558 -10.517 1.00 125.93 ? 194 GLN A OE1 1 
ATOM   5691  N NE2 . GLN C 2 170 ? 26.213  -77.231 -9.021  1.00 125.96 ? 194 GLN A NE2 1 
ATOM   5692  N N   . ALA C 2 171 ? 27.367  -76.590 -4.713  1.00 126.15 ? 195 ALA A N   1 
ATOM   5693  C CA  . ALA C 2 171 ? 28.176  -77.702 -4.245  1.00 121.85 ? 195 ALA A CA  1 
ATOM   5694  C C   . ALA C 2 171 ? 27.316  -78.955 -4.148  1.00 123.22 ? 195 ALA A C   1 
ATOM   5695  O O   . ALA C 2 171 ? 26.119  -78.888 -3.852  1.00 117.58 ? 195 ALA A O   1 
ATOM   5696  C CB  . ALA C 2 171 ? 28.817  -77.388 -2.892  1.00 121.04 ? 195 ALA A CB  1 
ATOM   5697  N N   . THR C 2 172 ? 27.949  -80.105 -4.370  1.00 123.05 ? 196 THR A N   1 
ATOM   5698  C CA  . THR C 2 172 ? 27.262  -81.389 -4.395  1.00 124.78 ? 196 THR A CA  1 
ATOM   5699  C C   . THR C 2 172 ? 27.790  -82.304 -3.297  1.00 119.79 ? 196 THR A C   1 
ATOM   5700  O O   . THR C 2 172 ? 28.990  -82.315 -3.005  1.00 111.41 ? 196 THR A O   1 
ATOM   5701  C CB  . THR C 2 172 ? 27.417  -82.068 -5.758  1.00 125.38 ? 196 THR A CB  1 
ATOM   5702  O OG1 . THR C 2 172 ? 28.743  -81.847 -6.255  1.00 122.82 ? 196 THR A OG1 1 
ATOM   5703  C CG2 . THR C 2 172 ? 26.413  -81.493 -6.748  1.00 123.74 ? 196 THR A CG2 1 
ATOM   5704  N N   . LEU C 2 173 ? 26.884  -83.082 -2.704  1.00 117.14 ? 197 LEU A N   1 
ATOM   5705  C CA  . LEU C 2 173 ? 27.199  -83.980 -1.595  1.00 120.14 ? 197 LEU A CA  1 
ATOM   5706  C C   . LEU C 2 173 ? 26.629  -85.357 -1.909  1.00 125.42 ? 197 LEU A C   1 
ATOM   5707  O O   . LEU C 2 173 ? 25.407  -85.530 -1.954  1.00 121.33 ? 197 LEU A O   1 
ATOM   5708  C CB  . LEU C 2 173 ? 26.630  -83.452 -0.278  1.00 118.75 ? 197 LEU A CB  1 
ATOM   5709  C CG  . LEU C 2 173 ? 27.413  -82.366 0.460   1.00 116.45 ? 197 LEU A CG  1 
ATOM   5710  C CD1 . LEU C 2 173 ? 26.646  -81.914 1.695   1.00 114.57 ? 197 LEU A CD1 1 
ATOM   5711  C CD2 . LEU C 2 173 ? 28.803  -82.861 0.830   1.00 117.58 ? 197 LEU A CD2 1 
ATOM   5712  N N   . GLY C 2 174 ? 27.503  -86.331 -2.129  1.00 123.94 ? 198 GLY A N   1 
ATOM   5713  C CA  . GLY C 2 174 ? 27.066  -87.683 -2.390  1.00 124.49 ? 198 GLY A CA  1 
ATOM   5714  C C   . GLY C 2 174 ? 26.778  -88.434 -1.112  1.00 123.56 ? 198 GLY A C   1 
ATOM   5715  O O   . GLY C 2 174 ? 27.042  -87.967 0.007   1.00 128.48 ? 198 GLY A O   1 
ATOM   5716  N N   . PRO C 2 175 ? 26.214  -89.636 -1.260  1.00 123.62 ? 199 PRO A N   1 
ATOM   5717  C CA  . PRO C 2 175 ? 26.048  -90.510 -0.089  1.00 120.36 ? 199 PRO A CA  1 
ATOM   5718  C C   . PRO C 2 175 ? 27.369  -90.903 0.534   1.00 117.74 ? 199 PRO A C   1 
ATOM   5719  O O   . PRO C 2 175 ? 27.395  -91.335 1.692   1.00 118.18 ? 199 PRO A O   1 
ATOM   5720  C CB  . PRO C 2 175 ? 25.307  -91.726 -0.660  1.00 123.97 ? 199 PRO A CB  1 
ATOM   5721  C CG  . PRO C 2 175 ? 25.677  -91.740 -2.102  1.00 123.69 ? 199 PRO A CG  1 
ATOM   5722  C CD  . PRO C 2 175 ? 25.789  -90.296 -2.505  1.00 125.65 ? 199 PRO A CD  1 
ATOM   5723  N N   . GLU C 2 176 ? 28.469  -90.767 -0.209  1.00 119.35 ? 200 GLU A N   1 
ATOM   5724  C CA  . GLU C 2 176 ? 29.803  -90.917 0.355   1.00 122.36 ? 200 GLU A CA  1 
ATOM   5725  C C   . GLU C 2 176 ? 30.067  -89.930 1.485   1.00 119.78 ? 200 GLU A C   1 
ATOM   5726  O O   . GLU C 2 176 ? 30.965  -90.165 2.302   1.00 114.93 ? 200 GLU A O   1 
ATOM   5727  C CB  . GLU C 2 176 ? 30.838  -90.732 -0.755  1.00 127.88 ? 200 GLU A CB  1 
ATOM   5728  C CG  . GLU C 2 176 ? 30.696  -89.399 -1.487  1.00 130.62 ? 200 GLU A CG  1 
ATOM   5729  C CD  . GLU C 2 176 ? 31.178  -89.452 -2.925  1.00 132.68 ? 200 GLU A CD  1 
ATOM   5730  O OE1 . GLU C 2 176 ? 30.391  -89.867 -3.802  1.00 134.61 ? 200 GLU A OE1 1 
ATOM   5731  O OE2 . GLU C 2 176 ? 32.340  -89.071 -3.178  1.00 130.41 ? 200 GLU A OE2 1 
ATOM   5732  N N   . HIS C 2 177 ? 29.306  -88.835 1.553   1.00 121.58 ? 201 HIS A N   1 
ATOM   5733  C CA  . HIS C 2 177 ? 29.511  -87.789 2.547   1.00 120.51 ? 201 HIS A CA  1 
ATOM   5734  C C   . HIS C 2 177 ? 28.492  -87.814 3.679   1.00 117.29 ? 201 HIS A C   1 
ATOM   5735  O O   . HIS C 2 177 ? 28.707  -87.138 4.691   1.00 116.70 ? 201 HIS A O   1 
ATOM   5736  C CB  . HIS C 2 177 ? 29.465  -86.406 1.881   1.00 122.58 ? 201 HIS A CB  1 
ATOM   5737  C CG  . HIS C 2 177 ? 30.522  -86.194 0.844   1.00 125.60 ? 201 HIS A CG  1 
ATOM   5738  N ND1 . HIS C 2 177 ? 30.224  -85.939 -0.478  1.00 126.36 ? 201 HIS A ND1 1 
ATOM   5739  C CD2 . HIS C 2 177 ? 31.873  -86.195 0.932   1.00 122.10 ? 201 HIS A CD2 1 
ATOM   5740  C CE1 . HIS C 2 177 ? 31.346  -85.794 -1.160  1.00 124.65 ? 201 HIS A CE1 1 
ATOM   5741  N NE2 . HIS C 2 177 ? 32.361  -85.945 -0.328  1.00 123.08 ? 201 HIS A NE2 1 
ATOM   5742  N N   . LEU C 2 178 ? 27.397  -88.558 3.541   1.00 112.26 ? 202 LEU A N   1 
ATOM   5743  C CA  . LEU C 2 178 ? 26.302  -88.502 4.497   1.00 110.65 ? 202 LEU A CA  1 
ATOM   5744  C C   . LEU C 2 178 ? 26.057  -89.863 5.139   1.00 109.99 ? 202 LEU A C   1 
ATOM   5745  O O   . LEU C 2 178 ? 26.487  -90.905 4.636   1.00 109.03 ? 202 LEU A O   1 
ATOM   5746  C CB  . LEU C 2 178 ? 25.010  -88.012 3.832   1.00 109.33 ? 202 LEU A CB  1 
ATOM   5747  C CG  . LEU C 2 178 ? 25.042  -86.604 3.237   1.00 110.66 ? 202 LEU A CG  1 
ATOM   5748  C CD1 . LEU C 2 178 ? 23.698  -86.259 2.618   1.00 113.58 ? 202 LEU A CD1 1 
ATOM   5749  C CD2 . LEU C 2 178 ? 25.437  -85.573 4.282   1.00 108.50 ? 202 LEU A CD2 1 
ATOM   5750  N N   . MET C 2 179 ? 25.346  -89.828 6.276   1.00 108.98 ? 203 MET A N   1 
ATOM   5751  C CA  . MET C 2 179 ? 24.875  -90.996 7.009   1.00 109.26 ? 203 MET A CA  1 
ATOM   5752  C C   . MET C 2 179 ? 23.428  -91.273 6.642   1.00 108.50 ? 203 MET A C   1 
ATOM   5753  O O   . MET C 2 179 ? 22.617  -90.336 6.606   1.00 106.62 ? 203 MET A O   1 
ATOM   5754  C CB  . MET C 2 179 ? 24.992  -90.772 8.516   1.00 109.52 ? 203 MET A CB  1 
ATOM   5755  C CG  . MET C 2 179 ? 26.414  -90.562 9.026   1.00 110.84 ? 203 MET A CG  1 
ATOM   5756  S SD  . MET C 2 179 ? 27.469  -92.015 8.852   1.00 114.51 ? 203 MET A SD  1 
ATOM   5757  C CE  . MET C 2 179 ? 28.428  -91.594 7.392   1.00 116.38 ? 203 MET A CE  1 
ATOM   5758  N N   . PRO C 2 180 ? 23.060  -92.520 6.363   1.00 104.14 ? 204 PRO A N   1 
ATOM   5759  C CA  . PRO C 2 180 ? 21.688  -92.802 5.932   1.00 104.67 ? 204 PRO A CA  1 
ATOM   5760  C C   . PRO C 2 180 ? 20.690  -92.666 7.072   1.00 104.34 ? 204 PRO A C   1 
ATOM   5761  O O   . PRO C 2 180 ? 21.039  -92.673 8.254   1.00 103.91 ? 204 PRO A O   1 
ATOM   5762  C CB  . PRO C 2 180 ? 21.765  -94.249 5.437   1.00 105.87 ? 204 PRO A CB  1 
ATOM   5763  C CG  . PRO C 2 180 ? 22.900  -94.838 6.200   1.00 105.87 ? 204 PRO A CG  1 
ATOM   5764  C CD  . PRO C 2 180 ? 23.898  -93.730 6.380   1.00 104.90 ? 204 PRO A CD  1 
ATOM   5765  N N   . SER C 2 181 ? 19.419  -92.535 6.684   1.00 104.60 ? 205 SER A N   1 
ATOM   5766  C CA  . SER C 2 181 ? 18.291  -92.479 7.615   1.00 104.48 ? 205 SER A CA  1 
ATOM   5767  C C   . SER C 2 181 ? 18.425  -91.331 8.609   1.00 103.33 ? 205 SER A C   1 
ATOM   5768  O O   . SER C 2 181 ? 18.003  -91.443 9.762   1.00 103.17 ? 205 SER A O   1 
ATOM   5769  C CB  . SER C 2 181 ? 18.118  -93.808 8.361   1.00 105.23 ? 205 SER A CB  1 
ATOM   5770  O OG  . SER C 2 181 ? 17.748  -94.853 7.477   1.00 106.34 ? 205 SER A OG  1 
ATOM   5771  N N   . SER C 2 182 ? 18.999  -90.216 8.176   1.00 102.57 ? 206 SER A N   1 
ATOM   5772  C CA  . SER C 2 182 ? 19.282  -89.091 9.055   1.00 101.48 ? 206 SER A CA  1 
ATOM   5773  C C   . SER C 2 182 ? 18.593  -87.832 8.539   1.00 100.90 ? 206 SER A C   1 
ATOM   5774  O O   . SER C 2 182 ? 17.916  -87.841 7.508   1.00 101.37 ? 206 SER A O   1 
ATOM   5775  C CB  . SER C 2 182 ? 20.791  -88.871 9.179   1.00 101.03 ? 206 SER A CB  1 
ATOM   5776  O OG  . SER C 2 182 ? 21.433  -90.048 9.631   1.00 101.61 ? 206 SER A OG  1 
ATOM   5777  N N   . THR C 2 183 ? 18.778  -86.738 9.279   1.00 102.51 ? 207 THR A N   1 
ATOM   5778  C CA  . THR C 2 183 ? 18.257  -85.423 8.912   1.00 104.16 ? 207 THR A CA  1 
ATOM   5779  C C   . THR C 2 183 ? 19.403  -84.425 8.997   1.00 103.10 ? 207 THR A C   1 
ATOM   5780  O O   . THR C 2 183 ? 19.863  -84.095 10.095  1.00 108.14 ? 207 THR A O   1 
ATOM   5781  C CB  . THR C 2 183 ? 17.106  -85.004 9.827   1.00 104.85 ? 207 THR A CB  1 
ATOM   5782  O OG1 . THR C 2 183 ? 16.002  -85.900 9.650   1.00 111.29 ? 207 THR A OG1 1 
ATOM   5783  C CG2 . THR C 2 183 ? 16.659  -83.582 9.504   1.00 103.79 ? 207 THR A CG2 1 
ATOM   5784  N N   . TYR C 2 184 ? 19.865  -83.945 7.849   1.00 101.63 ? 208 TYR A N   1 
ATOM   5785  C CA  . TYR C 2 184 ? 21.001  -83.042 7.785   1.00 100.88 ? 208 TYR A CA  1 
ATOM   5786  C C   . TYR C 2 184 ? 20.540  -81.605 7.581   1.00 100.08 ? 208 TYR A C   1 
ATOM   5787  O O   . TYR C 2 184 ? 19.546  -81.339 6.901   1.00 103.36 ? 208 TYR A O   1 
ATOM   5788  C CB  . TYR C 2 184 ? 21.944  -83.436 6.649   1.00 101.37 ? 208 TYR A CB  1 
ATOM   5789  C CG  . TYR C 2 184 ? 22.943  -84.512 6.995   1.00 101.84 ? 208 TYR A CG  1 
ATOM   5790  C CD1 . TYR C 2 184 ? 22.634  -85.855 6.825   1.00 102.82 ? 208 TYR A CD1 1 
ATOM   5791  C CD2 . TYR C 2 184 ? 24.202  -84.185 7.475   1.00 101.34 ? 208 TYR A CD2 1 
ATOM   5792  C CE1 . TYR C 2 184 ? 23.550  -86.843 7.133   1.00 103.28 ? 208 TYR A CE1 1 
ATOM   5793  C CE2 . TYR C 2 184 ? 25.123  -85.163 7.785   1.00 101.81 ? 208 TYR A CE2 1 
ATOM   5794  C CZ  . TYR C 2 184 ? 24.794  -86.490 7.613   1.00 102.77 ? 208 TYR A CZ  1 
ATOM   5795  O OH  . TYR C 2 184 ? 25.715  -87.462 7.923   1.00 103.26 ? 208 TYR A OH  1 
ATOM   5796  N N   . VAL C 2 185 ? 21.283  -80.676 8.177   1.00 101.27 ? 209 VAL A N   1 
ATOM   5797  C CA  . VAL C 2 185 ? 21.146  -79.254 7.908   1.00 100.47 ? 209 VAL A CA  1 
ATOM   5798  C C   . VAL C 2 185 ? 22.451  -78.765 7.297   1.00 100.18 ? 209 VAL A C   1 
ATOM   5799  O O   . VAL C 2 185 ? 23.515  -79.373 7.456   1.00 100.40 ? 209 VAL A O   1 
ATOM   5800  C CB  . VAL C 2 185 ? 20.798  -78.438 9.170   1.00 99.64  ? 209 VAL A CB  1 
ATOM   5801  C CG1 . VAL C 2 185 ? 19.426  -78.818 9.681   1.00 100.60 ? 209 VAL A CG1 1 
ATOM   5802  C CG2 . VAL C 2 185 ? 21.848  -78.650 10.246  1.00 99.53  ? 209 VAL A CG2 1 
ATOM   5803  N N   . ALA C 2 186 ? 22.351  -77.653 6.577   1.00 102.87 ? 210 ALA A N   1 
ATOM   5804  C CA  . ALA C 2 186 ? 23.510  -77.089 5.901   1.00 102.62 ? 210 ALA A CA  1 
ATOM   5805  C C   . ALA C 2 186 ? 23.405  -75.573 5.881   1.00 101.71 ? 210 ALA A C   1 
ATOM   5806  O O   . ALA C 2 186 ? 22.305  -75.011 5.893   1.00 101.48 ? 210 ALA A O   1 
ATOM   5807  C CB  . ALA C 2 186 ? 23.649  -77.627 4.473   1.00 103.45 ? 210 ALA A CB  1 
ATOM   5808  N N   . ARG C 2 187 ? 24.566  -74.919 5.855   1.00 102.19 ? 211 ARG A N   1 
ATOM   5809  C CA  . ARG C 2 187 ? 24.633  -73.467 5.741   1.00 103.80 ? 211 ARG A CA  1 
ATOM   5810  C C   . ARG C 2 187 ? 25.956  -73.079 5.096   1.00 103.37 ? 211 ARG A C   1 
ATOM   5811  O O   . ARG C 2 187 ? 26.979  -73.729 5.311   1.00 107.09 ? 211 ARG A O   1 
ATOM   5812  C CB  . ARG C 2 187 ? 24.473  -72.782 7.105   1.00 102.07 ? 211 ARG A CB  1 
ATOM   5813  C CG  . ARG C 2 187 ? 25.618  -73.032 8.065   1.00 101.07 ? 211 ARG A CG  1 
ATOM   5814  C CD  . ARG C 2 187 ? 25.314  -72.489 9.446   1.00 98.97  ? 211 ARG A CD  1 
ATOM   5815  N NE  . ARG C 2 187 ? 26.482  -72.566 10.316  1.00 97.83  ? 211 ARG A NE  1 
ATOM   5816  C CZ  . ARG C 2 187 ? 26.439  -72.413 11.634  1.00 97.97  ? 211 ARG A CZ  1 
ATOM   5817  N NH1 . ARG C 2 187 ? 25.281  -72.172 12.233  1.00 98.41  ? 211 ARG A NH1 1 
ATOM   5818  N NH2 . ARG C 2 187 ? 27.550  -72.502 12.352  1.00 99.84  ? 211 ARG A NH2 1 
ATOM   5819  N N   . VAL C 2 188 ? 25.934  -72.005 4.310   1.00 103.91 ? 212 VAL A N   1 
ATOM   5820  C CA  . VAL C 2 188 ? 27.081  -71.626 3.496   1.00 104.98 ? 212 VAL A CA  1 
ATOM   5821  C C   . VAL C 2 188 ? 27.396  -70.150 3.707   1.00 104.40 ? 212 VAL A C   1 
ATOM   5822  O O   . VAL C 2 188 ? 26.504  -69.335 3.957   1.00 105.04 ? 212 VAL A O   1 
ATOM   5823  C CB  . VAL C 2 188 ? 26.823  -71.939 2.001   1.00 109.74 ? 212 VAL A CB  1 
ATOM   5824  C CG1 . VAL C 2 188 ? 25.576  -71.219 1.511   1.00 113.03 ? 212 VAL A CG1 1 
ATOM   5825  C CG2 . VAL C 2 188 ? 28.033  -71.589 1.144   1.00 114.41 ? 212 VAL A CG2 1 
ATOM   5826  N N   . ARG C 2 189 ? 28.683  -69.810 3.621   1.00 103.26 ? 213 ARG A N   1 
ATOM   5827  C CA  . ARG C 2 189 ? 29.113  -68.420 3.712   1.00 105.05 ? 213 ARG A CA  1 
ATOM   5828  C C   . ARG C 2 189 ? 30.176  -68.128 2.661   1.00 108.74 ? 213 ARG A C   1 
ATOM   5829  O O   . ARG C 2 189 ? 30.979  -68.994 2.306   1.00 113.23 ? 213 ARG A O   1 
ATOM   5830  C CB  . ARG C 2 189 ? 29.657  -68.077 5.109   1.00 102.07 ? 213 ARG A CB  1 
ATOM   5831  C CG  . ARG C 2 189 ? 30.980  -68.742 5.456   1.00 99.65  ? 213 ARG A CG  1 
ATOM   5832  C CD  . ARG C 2 189 ? 31.419  -68.397 6.869   1.00 98.52  ? 213 ARG A CD  1 
ATOM   5833  N NE  . ARG C 2 189 ? 32.684  -69.036 7.218   1.00 97.82  ? 213 ARG A NE  1 
ATOM   5834  C CZ  . ARG C 2 189 ? 33.281  -68.913 8.398   1.00 97.53  ? 213 ARG A CZ  1 
ATOM   5835  N NH1 . ARG C 2 189 ? 32.728  -68.168 9.344   1.00 100.62 ? 213 ARG A NH1 1 
ATOM   5836  N NH2 . ARG C 2 189 ? 34.433  -69.528 8.631   1.00 94.29  ? 213 ARG A NH2 1 
ATOM   5837  N N   . THR C 2 190 ? 30.170  -66.893 2.161   1.00 108.93 ? 214 THR A N   1 
ATOM   5838  C CA  . THR C 2 190 ? 31.243  -66.420 1.299   1.00 107.23 ? 214 THR A CA  1 
ATOM   5839  C C   . THR C 2 190 ? 32.462  -66.071 2.139   1.00 102.42 ? 214 THR A C   1 
ATOM   5840  O O   . THR C 2 190 ? 32.345  -65.706 3.311   1.00 102.22 ? 214 THR A O   1 
ATOM   5841  C CB  . THR C 2 190 ? 30.810  -65.186 0.506   1.00 110.24 ? 214 THR A CB  1 
ATOM   5842  O OG1 . THR C 2 190 ? 30.475  -64.132 1.416   1.00 111.21 ? 214 THR A OG1 1 
ATOM   5843  C CG2 . THR C 2 190 ? 29.606  -65.491 -0.355  1.00 112.53 ? 214 THR A CG2 1 
ATOM   5844  N N   . ARG C 2 191 ? 33.642  -66.174 1.532   1.00 107.29 ? 215 ARG A N   1 
ATOM   5845  C CA  . ARG C 2 191 ? 34.848  -65.815 2.263   1.00 115.14 ? 215 ARG A CA  1 
ATOM   5846  C C   . ARG C 2 191 ? 35.964  -65.473 1.290   1.00 119.70 ? 215 ARG A C   1 
ATOM   5847  O O   . ARG C 2 191 ? 35.916  -65.811 0.101   1.00 119.34 ? 215 ARG A O   1 
ATOM   5848  C CB  . ARG C 2 191 ? 35.290  -66.935 3.210   1.00 118.50 ? 215 ARG A CB  1 
ATOM   5849  C CG  . ARG C 2 191 ? 35.556  -68.268 2.539   1.00 119.08 ? 215 ARG A CG  1 
ATOM   5850  C CD  . ARG C 2 191 ? 36.109  -69.266 3.543   1.00 117.35 ? 215 ARG A CD  1 
ATOM   5851  N NE  . ARG C 2 191 ? 37.344  -68.788 4.157   1.00 118.27 ? 215 ARG A NE  1 
ATOM   5852  C CZ  . ARG C 2 191 ? 38.530  -69.369 4.005   1.00 121.36 ? 215 ARG A CZ  1 
ATOM   5853  N NH1 . ARG C 2 191 ? 38.646  -70.462 3.262   1.00 117.69 ? 215 ARG A NH1 1 
ATOM   5854  N NH2 . ARG C 2 191 ? 39.600  -68.860 4.600   1.00 124.50 ? 215 ARG A NH2 1 
ATOM   5855  N N   . LEU C 2 192 ? 36.971  -64.787 1.828   1.00 127.67 ? 216 LEU A N   1 
ATOM   5856  C CA  . LEU C 2 192 ? 38.159  -64.430 1.069   1.00 125.08 ? 216 LEU A CA  1 
ATOM   5857  C C   . LEU C 2 192 ? 38.860  -65.679 0.551   1.00 125.39 ? 216 LEU A C   1 
ATOM   5858  O O   . LEU C 2 192 ? 39.152  -66.606 1.312   1.00 125.77 ? 216 LEU A O   1 
ATOM   5859  C CB  . LEU C 2 192 ? 39.112  -63.609 1.949   1.00 126.39 ? 216 LEU A CB  1 
ATOM   5860  C CG  . LEU C 2 192 ? 39.610  -64.209 3.276   1.00 123.58 ? 216 LEU A CG  1 
ATOM   5861  C CD1 . LEU C 2 192 ? 40.924  -63.566 3.689   1.00 122.28 ? 216 LEU A CD1 1 
ATOM   5862  C CD2 . LEU C 2 192 ? 38.588  -64.079 4.410   1.00 111.99 ? 216 LEU A CD2 1 
ATOM   5863  N N   . ALA C 2 193 ? 39.115  -65.711 -0.752  1.00 125.43 ? 217 ALA A N   1 
ATOM   5864  C CA  . ALA C 2 193 ? 39.903  -66.808 -1.285  1.00 127.41 ? 217 ALA A CA  1 
ATOM   5865  C C   . ALA C 2 193 ? 41.390  -66.506 -1.119  1.00 126.55 ? 217 ALA A C   1 
ATOM   5866  O O   . ALA C 2 193 ? 41.811  -65.350 -1.222  1.00 127.61 ? 217 ALA A O   1 
ATOM   5867  C CB  . ALA C 2 193 ? 39.580  -67.041 -2.757  1.00 128.41 ? 217 ALA A CB  1 
ATOM   5868  N N   . PRO C 2 194 ? 42.207  -67.529 -0.851  1.00 124.94 ? 218 PRO A N   1 
ATOM   5869  C CA  . PRO C 2 194 ? 43.639  -67.278 -0.624  1.00 124.79 ? 218 PRO A CA  1 
ATOM   5870  C C   . PRO C 2 194 ? 44.369  -66.756 -1.849  1.00 128.57 ? 218 PRO A C   1 
ATOM   5871  O O   . PRO C 2 194 ? 45.461  -66.194 -1.699  1.00 123.78 ? 218 PRO A O   1 
ATOM   5872  C CB  . PRO C 2 194 ? 44.172  -68.652 -0.199  1.00 123.92 ? 218 PRO A CB  1 
ATOM   5873  C CG  . PRO C 2 194 ? 43.229  -69.622 -0.825  1.00 126.83 ? 218 PRO A CG  1 
ATOM   5874  C CD  . PRO C 2 194 ? 41.879  -68.963 -0.788  1.00 126.75 ? 218 PRO A CD  1 
ATOM   5875  N N   . GLY C 2 195 ? 43.805  -66.914 -3.045  1.00 132.18 ? 219 GLY A N   1 
ATOM   5876  C CA  . GLY C 2 195 ? 44.439  -66.436 -4.259  1.00 134.36 ? 219 GLY A CA  1 
ATOM   5877  C C   . GLY C 2 195 ? 44.663  -64.937 -4.275  1.00 137.98 ? 219 GLY A C   1 
ATOM   5878  O O   . GLY C 2 195 ? 45.807  -64.475 -4.316  1.00 137.06 ? 219 GLY A O   1 
ATOM   5879  N N   . SER C 2 196 ? 43.578  -64.166 -4.243  1.00 137.71 ? 220 SER A N   1 
ATOM   5880  C CA  . SER C 2 196 ? 43.693  -62.717 -4.213  1.00 133.16 ? 220 SER A CA  1 
ATOM   5881  C C   . SER C 2 196 ? 44.339  -62.264 -2.904  1.00 136.24 ? 220 SER A C   1 
ATOM   5882  O O   . SER C 2 196 ? 44.493  -63.034 -1.950  1.00 131.15 ? 220 SER A O   1 
ATOM   5883  C CB  . SER C 2 196 ? 42.321  -62.067 -4.387  1.00 127.20 ? 220 SER A CB  1 
ATOM   5884  O OG  . SER C 2 196 ? 41.537  -62.205 -3.216  1.00 116.72 ? 220 SER A OG  1 
ATOM   5885  N N   . ARG C 2 197 ? 44.723  -60.989 -2.865  1.00 136.44 ? 221 ARG A N   1 
ATOM   5886  C CA  . ARG C 2 197 ? 45.386  -60.451 -1.685  1.00 134.98 ? 221 ARG A CA  1 
ATOM   5887  C C   . ARG C 2 197 ? 44.505  -59.430 -0.975  1.00 130.14 ? 221 ARG A C   1 
ATOM   5888  O O   . ARG C 2 197 ? 44.913  -58.284 -0.759  1.00 131.67 ? 221 ARG A O   1 
ATOM   5889  C CB  . ARG C 2 197 ? 46.737  -59.840 -2.062  1.00 134.35 ? 221 ARG A CB  1 
ATOM   5890  C CG  . ARG C 2 197 ? 47.798  -60.890 -2.359  1.00 137.12 ? 221 ARG A CG  1 
ATOM   5891  C CD  . ARG C 2 197 ? 47.792  -61.977 -1.290  1.00 136.80 ? 221 ARG A CD  1 
ATOM   5892  N NE  . ARG C 2 197 ? 48.954  -62.858 -1.372  1.00 137.34 ? 221 ARG A NE  1 
ATOM   5893  C CZ  . ARG C 2 197 ? 50.157  -62.561 -0.891  1.00 134.56 ? 221 ARG A CZ  1 
ATOM   5894  N NH1 . ARG C 2 197 ? 50.364  -61.397 -0.290  1.00 135.55 ? 221 ARG A NH1 1 
ATOM   5895  N NH2 . ARG C 2 197 ? 51.153  -63.429 -1.010  1.00 130.75 ? 221 ARG A NH2 1 
ATOM   5896  N N   . LEU C 2 198 ? 43.294  -59.844 -0.613  1.00 127.69 ? 222 LEU A N   1 
ATOM   5897  C CA  . LEU C 2 198 ? 42.382  -59.058 0.202   1.00 123.02 ? 222 LEU A CA  1 
ATOM   5898  C C   . LEU C 2 198 ? 42.210  -59.734 1.556   1.00 120.44 ? 222 LEU A C   1 
ATOM   5899  O O   . LEU C 2 198 ? 42.408  -60.943 1.699   1.00 131.52 ? 222 LEU A O   1 
ATOM   5900  C CB  . LEU C 2 198 ? 41.019  -58.893 -0.484  1.00 119.89 ? 222 LEU A CB  1 
ATOM   5901  C CG  . LEU C 2 198 ? 40.936  -58.031 -1.750  1.00 120.35 ? 222 LEU A CG  1 
ATOM   5902  C CD1 . LEU C 2 198 ? 41.502  -58.744 -2.979  1.00 119.57 ? 222 LEU A CD1 1 
ATOM   5903  C CD2 . LEU C 2 198 ? 39.505  -57.580 -1.996  1.00 119.05 ? 222 LEU A CD2 1 
ATOM   5904  N N   . SER C 2 199 ? 41.839  -58.940 2.557   1.00 118.28 ? 223 SER A N   1 
ATOM   5905  C CA  . SER C 2 199 ? 41.750  -59.421 3.927   1.00 121.55 ? 223 SER A CA  1 
ATOM   5906  C C   . SER C 2 199 ? 40.425  -58.989 4.542   1.00 120.68 ? 223 SER A C   1 
ATOM   5907  O O   . SER C 2 199 ? 39.698  -58.155 3.993   1.00 119.27 ? 223 SER A O   1 
ATOM   5908  C CB  . SER C 2 199 ? 42.924  -58.905 4.773   1.00 121.36 ? 223 SER A CB  1 
ATOM   5909  O OG  . SER C 2 199 ? 44.166  -59.324 4.232   1.00 122.52 ? 223 SER A OG  1 
ATOM   5910  N N   . GLY C 2 200 ? 40.115  -59.573 5.699   1.00 114.96 ? 224 GLY A N   1 
ATOM   5911  C CA  . GLY C 2 200 ? 38.926  -59.250 6.453   1.00 109.70 ? 224 GLY A CA  1 
ATOM   5912  C C   . GLY C 2 200 ? 38.228  -60.497 6.938   1.00 108.39 ? 224 GLY A C   1 
ATOM   5913  O O   . GLY C 2 200 ? 38.743  -61.616 6.832   1.00 111.38 ? 224 GLY A O   1 
ATOM   5914  N N   . ARG C 2 201 ? 37.029  -60.301 7.475   1.00 107.32 ? 225 ARG A N   1 
ATOM   5915  C CA  . ARG C 2 201 ? 36.198  -61.382 7.979   1.00 111.47 ? 225 ARG A CA  1 
ATOM   5916  C C   . ARG C 2 201 ? 35.563  -62.170 6.841   1.00 105.90 ? 225 ARG A C   1 
ATOM   5917  O O   . ARG C 2 201 ? 35.421  -61.668 5.724   1.00 101.20 ? 225 ARG A O   1 
ATOM   5918  C CB  . ARG C 2 201 ? 35.083  -60.829 8.862   1.00 117.00 ? 225 ARG A CB  1 
ATOM   5919  C CG  . ARG C 2 201 ? 35.475  -60.409 10.265  1.00 119.41 ? 225 ARG A CG  1 
ATOM   5920  C CD  . ARG C 2 201 ? 34.257  -59.811 10.953  1.00 119.42 ? 225 ARG A CD  1 
ATOM   5921  N NE  . ARG C 2 201 ? 34.361  -59.788 12.409  1.00 122.82 ? 225 ARG A NE  1 
ATOM   5922  C CZ  . ARG C 2 201 ? 33.380  -59.388 13.215  1.00 119.81 ? 225 ARG A CZ  1 
ATOM   5923  N NH1 . ARG C 2 201 ? 32.224  -58.982 12.704  1.00 116.00 ? 225 ARG A NH1 1 
ATOM   5924  N NH2 . ARG C 2 201 ? 33.551  -59.397 14.530  1.00 113.55 ? 225 ARG A NH2 1 
ATOM   5925  N N   . PRO C 2 202 ? 35.170  -63.415 7.103   1.00 100.77 ? 226 PRO A N   1 
ATOM   5926  C CA  . PRO C 2 202 ? 34.172  -64.063 6.244   1.00 100.21 ? 226 PRO A CA  1 
ATOM   5927  C C   . PRO C 2 202 ? 32.801  -63.447 6.472   1.00 99.50  ? 226 PRO A C   1 
ATOM   5928  O O   . PRO C 2 202 ? 32.641  -62.595 7.351   1.00 98.77  ? 226 PRO A O   1 
ATOM   5929  C CB  . PRO C 2 202 ? 34.222  -65.532 6.684   1.00 101.54 ? 226 PRO A CB  1 
ATOM   5930  C CG  . PRO C 2 202 ? 35.536  -65.680 7.392   1.00 101.66 ? 226 PRO A CG  1 
ATOM   5931  C CD  . PRO C 2 202 ? 35.784  -64.360 8.047   1.00 99.90  ? 226 PRO A CD  1 
ATOM   5932  N N   . SER C 2 203 ? 31.804  -63.861 5.699   1.00 98.75  ? 227 SER A N   1 
ATOM   5933  C CA  . SER C 2 203 ? 30.493  -63.242 5.795   1.00 98.30  ? 227 SER A CA  1 
ATOM   5934  C C   . SER C 2 203 ? 29.689  -63.857 6.937   1.00 98.22  ? 227 SER A C   1 
ATOM   5935  O O   . SER C 2 203 ? 30.153  -64.741 7.661   1.00 98.50  ? 227 SER A O   1 
ATOM   5936  C CB  . SER C 2 203 ? 29.743  -63.384 4.476   1.00 98.80  ? 227 SER A CB  1 
ATOM   5937  O OG  . SER C 2 203 ? 29.164  -64.671 4.367   1.00 99.51  ? 227 SER A OG  1 
ATOM   5938  N N   . LYS C 2 204 ? 28.461  -63.371 7.100   1.00 101.36 ? 228 LYS A N   1 
ATOM   5939  C CA  . LYS C 2 204 ? 27.519  -64.000 8.008   1.00 104.67 ? 228 LYS A CA  1 
ATOM   5940  C C   . LYS C 2 204 ? 27.127  -65.375 7.481   1.00 103.31 ? 228 LYS A C   1 
ATOM   5941  O O   . LYS C 2 204 ? 27.257  -65.674 6.290   1.00 99.13  ? 228 LYS A O   1 
ATOM   5942  C CB  . LYS C 2 204 ? 26.263  -63.139 8.170   1.00 108.91 ? 228 LYS A CB  1 
ATOM   5943  C CG  . LYS C 2 204 ? 26.491  -61.761 8.773   1.00 111.32 ? 228 LYS A CG  1 
ATOM   5944  C CD  . LYS C 2 204 ? 26.550  -61.816 10.290  1.00 114.25 ? 228 LYS A CD  1 
ATOM   5945  C CE  . LYS C 2 204 ? 26.797  -60.436 10.879  1.00 113.35 ? 228 LYS A CE  1 
ATOM   5946  N NZ  . LYS C 2 204 ? 28.059  -59.826 10.373  1.00 112.02 ? 228 LYS A NZ  1 
ATOM   5947  N N   . TRP C 2 205 ? 26.632  -66.219 8.381   1.00 103.75 ? 229 TRP A N   1 
ATOM   5948  C CA  . TRP C 2 205 ? 26.123  -67.516 7.963   1.00 106.31 ? 229 TRP A CA  1 
ATOM   5949  C C   . TRP C 2 205 ? 24.768  -67.357 7.283   1.00 101.82 ? 229 TRP A C   1 
ATOM   5950  O O   . TRP C 2 205 ? 23.916  -66.584 7.728   1.00 97.51  ? 229 TRP A O   1 
ATOM   5951  C CB  . TRP C 2 205 ? 26.005  -68.466 9.156   1.00 106.51 ? 229 TRP A CB  1 
ATOM   5952  C CG  . TRP C 2 205 ? 27.314  -69.046 9.611   1.00 104.71 ? 229 TRP A CG  1 
ATOM   5953  C CD1 . TRP C 2 205 ? 27.907  -68.871 10.827  1.00 104.64 ? 229 TRP A CD1 1 
ATOM   5954  C CD2 . TRP C 2 205 ? 28.189  -69.897 8.857   1.00 103.15 ? 229 TRP A CD2 1 
ATOM   5955  N NE1 . TRP C 2 205 ? 29.097  -69.557 10.878  1.00 104.10 ? 229 TRP A NE1 1 
ATOM   5956  C CE2 . TRP C 2 205 ? 29.293  -70.195 9.681   1.00 104.12 ? 229 TRP A CE2 1 
ATOM   5957  C CE3 . TRP C 2 205 ? 28.147  -70.433 7.567   1.00 104.09 ? 229 TRP A CE3 1 
ATOM   5958  C CZ2 . TRP C 2 205 ? 30.345  -71.005 9.257   1.00 105.88 ? 229 TRP A CZ2 1 
ATOM   5959  C CZ3 . TRP C 2 205 ? 29.192  -71.239 7.148   1.00 108.27 ? 229 TRP A CZ3 1 
ATOM   5960  C CH2 . TRP C 2 205 ? 30.276  -71.515 7.991   1.00 108.45 ? 229 TRP A CH2 1 
ATOM   5961  N N   . SER C 2 206 ? 24.579  -68.091 6.189   1.00 105.12 ? 230 SER A N   1 
ATOM   5962  C CA  . SER C 2 206 ? 23.315  -68.072 5.480   1.00 107.55 ? 230 SER A CA  1 
ATOM   5963  C C   . SER C 2 206 ? 22.236  -68.762 6.311   1.00 110.21 ? 230 SER A C   1 
ATOM   5964  O O   . SER C 2 206 ? 22.541  -69.497 7.253   1.00 110.82 ? 230 SER A O   1 
ATOM   5965  C CB  . SER C 2 206 ? 23.459  -68.767 4.128   1.00 110.00 ? 230 SER A CB  1 
ATOM   5966  O OG  . SER C 2 206 ? 23.464  -70.175 4.281   1.00 109.21 ? 230 SER A OG  1 
ATOM   5967  N N   . PRO C 2 207 ? 20.963  -68.532 5.991   1.00 110.82 ? 231 PRO A N   1 
ATOM   5968  C CA  . PRO C 2 207 ? 19.900  -69.313 6.636   1.00 111.27 ? 231 PRO A CA  1 
ATOM   5969  C C   . PRO C 2 207 ? 20.039  -70.789 6.297   1.00 110.25 ? 231 PRO A C   1 
ATOM   5970  O O   . PRO C 2 207 ? 20.123  -71.173 5.128   1.00 103.47 ? 231 PRO A O   1 
ATOM   5971  C CB  . PRO C 2 207 ? 18.614  -68.707 6.061   1.00 114.14 ? 231 PRO A CB  1 
ATOM   5972  C CG  . PRO C 2 207 ? 19.038  -68.045 4.791   1.00 117.07 ? 231 PRO A CG  1 
ATOM   5973  C CD  . PRO C 2 207 ? 20.416  -67.527 5.063   1.00 113.98 ? 231 PRO A CD  1 
ATOM   5974  N N   . GLU C 2 208 ? 20.077  -71.617 7.336   1.00 111.59 ? 232 GLU A N   1 
ATOM   5975  C CA  . GLU C 2 208 ? 20.342  -73.034 7.159   1.00 110.99 ? 232 GLU A CA  1 
ATOM   5976  C C   . GLU C 2 208 ? 19.122  -73.746 6.582   1.00 111.69 ? 232 GLU A C   1 
ATOM   5977  O O   . GLU C 2 208 ? 17.985  -73.279 6.692   1.00 109.26 ? 232 GLU A O   1 
ATOM   5978  C CB  . GLU C 2 208 ? 20.757  -73.674 8.484   1.00 111.06 ? 232 GLU A CB  1 
ATOM   5979  C CG  . GLU C 2 208 ? 19.729  -73.548 9.599   1.00 110.39 ? 232 GLU A CG  1 
ATOM   5980  C CD  . GLU C 2 208 ? 20.310  -73.886 10.961  1.00 111.44 ? 232 GLU A CD  1 
ATOM   5981  O OE1 . GLU C 2 208 ? 21.409  -73.380 11.277  1.00 111.15 ? 232 GLU A OE1 1 
ATOM   5982  O OE2 . GLU C 2 208 ? 19.681  -74.667 11.709  1.00 109.74 ? 232 GLU A OE2 1 
ATOM   5983  N N   . VAL C 2 209 ? 19.376  -74.895 5.955   1.00 112.15 ? 233 VAL A N   1 
ATOM   5984  C CA  . VAL C 2 209 ? 18.348  -75.677 5.280   1.00 108.28 ? 233 VAL A CA  1 
ATOM   5985  C C   . VAL C 2 209 ? 18.395  -77.110 5.795   1.00 109.58 ? 233 VAL A C   1 
ATOM   5986  O O   . VAL C 2 209 ? 19.479  -77.668 6.003   1.00 109.76 ? 233 VAL A O   1 
ATOM   5987  C CB  . VAL C 2 209 ? 18.526  -75.634 3.746   1.00 107.52 ? 233 VAL A CB  1 
ATOM   5988  C CG1 . VAL C 2 209 ? 19.956  -75.995 3.358   1.00 102.72 ? 233 VAL A CG1 1 
ATOM   5989  C CG2 . VAL C 2 209 ? 17.532  -76.557 3.061   1.00 114.41 ? 233 VAL A CG2 1 
ATOM   5990  N N   . CYS C 2 210 ? 17.217  -77.696 6.012   1.00 108.05 ? 234 CYS A N   1 
ATOM   5991  C CA  . CYS C 2 210 ? 17.069  -79.073 6.463   1.00 110.99 ? 234 CYS A CA  1 
ATOM   5992  C C   . CYS C 2 210 ? 16.678  -79.973 5.295   1.00 111.86 ? 234 CYS A C   1 
ATOM   5993  O O   . CYS C 2 210 ? 16.035  -79.532 4.339   1.00 114.97 ? 234 CYS A O   1 
ATOM   5994  C CB  . CYS C 2 210 ? 16.006  -79.183 7.561   1.00 109.71 ? 234 CYS A CB  1 
ATOM   5995  S SG  . CYS C 2 210 ? 16.119  -77.967 8.894   1.00 112.47 ? 234 CYS A SG  1 
ATOM   5996  N N   . TRP C 2 211 ? 17.068  -81.244 5.385   1.00 108.52 ? 235 TRP A N   1 
ATOM   5997  C CA  . TRP C 2 211 ? 16.680  -82.240 4.392   1.00 103.76 ? 235 TRP A CA  1 
ATOM   5998  C C   . TRP C 2 211 ? 17.024  -83.629 4.914   1.00 104.54 ? 235 TRP A C   1 
ATOM   5999  O O   . TRP C 2 211 ? 17.993  -83.802 5.658   1.00 109.40 ? 235 TRP A O   1 
ATOM   6000  C CB  . TRP C 2 211 ? 17.362  -81.992 3.038   1.00 101.60 ? 235 TRP A CB  1 
ATOM   6001  C CG  . TRP C 2 211 ? 18.703  -82.645 2.881   1.00 101.82 ? 235 TRP A CG  1 
ATOM   6002  C CD1 . TRP C 2 211 ? 18.957  -83.888 2.376   1.00 102.80 ? 235 TRP A CD1 1 
ATOM   6003  C CD2 . TRP C 2 211 ? 19.976  -82.077 3.206   1.00 102.59 ? 235 TRP A CD2 1 
ATOM   6004  N NE1 . TRP C 2 211 ? 20.308  -84.134 2.380   1.00 102.72 ? 235 TRP A NE1 1 
ATOM   6005  C CE2 . TRP C 2 211 ? 20.957  -83.038 2.884   1.00 103.19 ? 235 TRP A CE2 1 
ATOM   6006  C CE3 . TRP C 2 211 ? 20.383  -80.852 3.743   1.00 105.59 ? 235 TRP A CE3 1 
ATOM   6007  C CZ2 . TRP C 2 211 ? 22.317  -82.811 3.082   1.00 105.62 ? 235 TRP A CZ2 1 
ATOM   6008  C CZ3 . TRP C 2 211 ? 21.734  -80.629 3.939   1.00 106.76 ? 235 TRP A CZ3 1 
ATOM   6009  C CH2 . TRP C 2 211 ? 22.684  -81.603 3.609   1.00 106.05 ? 235 TRP A CH2 1 
ATOM   6010  N N   . ASP C 2 212 ? 16.230  -84.614 4.502   1.00 101.55 ? 236 ASP A N   1 
ATOM   6011  C CA  . ASP C 2 212 ? 16.423  -85.992 4.925   1.00 102.98 ? 236 ASP A CA  1 
ATOM   6012  C C   . ASP C 2 212 ? 17.361  -86.725 3.974   1.00 101.99 ? 236 ASP A C   1 
ATOM   6013  O O   . ASP C 2 212 ? 17.405  -86.445 2.774   1.00 103.92 ? 236 ASP A O   1 
ATOM   6014  C CB  . ASP C 2 212 ? 15.085  -86.730 5.000   1.00 105.73 ? 236 ASP A CB  1 
ATOM   6015  C CG  . ASP C 2 212 ? 14.338  -86.451 6.288   1.00 107.64 ? 236 ASP A CG  1 
ATOM   6016  O OD1 . ASP C 2 212 ? 14.982  -86.015 7.266   1.00 109.47 ? 236 ASP A OD1 1 
ATOM   6017  O OD2 . ASP C 2 212 ? 13.109  -86.676 6.327   1.00 108.32 ? 236 ASP A OD2 1 
ATOM   6018  N N   . SER C 2 213 ? 18.109  -87.678 4.524   1.00 102.26 ? 237 SER A N   1 
ATOM   6019  C CA  . SER C 2 213 ? 19.091  -88.429 3.762   1.00 102.88 ? 237 SER A CA  1 
ATOM   6020  C C   . SER C 2 213 ? 18.461  -89.694 3.182   1.00 104.11 ? 237 SER A C   1 
ATOM   6021  O O   . SER C 2 213 ? 17.282  -89.985 3.393   1.00 104.49 ? 237 SER A O   1 
ATOM   6022  C CB  . SER C 2 213 ? 20.293  -88.765 4.642   1.00 102.55 ? 237 SER A CB  1 
ATOM   6023  O OG  . SER C 2 213 ? 21.315  -89.381 3.883   1.00 103.10 ? 237 SER A OG  1 
ATOM   6024  N N   . GLN C 2 214 ? 19.263  -90.461 2.436   1.00 104.80 ? 238 GLN A N   1 
ATOM   6025  C CA  . GLN C 2 214 ? 18.784  -91.706 1.855   1.00 106.02 ? 238 GLN A CA  1 
ATOM   6026  C C   . GLN C 2 214 ? 18.402  -92.686 2.966   1.00 106.32 ? 238 GLN A C   1 
ATOM   6027  O O   . GLN C 2 214 ? 18.909  -92.592 4.086   1.00 105.70 ? 238 GLN A O   1 
ATOM   6028  C CB  . GLN C 2 214 ? 19.853  -92.315 0.946   1.00 106.66 ? 238 GLN A CB  1 
ATOM   6029  C CG  . GLN C 2 214 ? 21.105  -92.794 1.660   1.00 106.47 ? 238 GLN A CG  1 
ATOM   6030  C CD  . GLN C 2 214 ? 22.196  -91.745 1.689   1.00 105.55 ? 238 GLN A CD  1 
ATOM   6031  O OE1 . GLN C 2 214 ? 21.991  -90.606 1.268   1.00 104.97 ? 238 GLN A OE1 1 
ATOM   6032  N NE2 . GLN C 2 214 ? 23.372  -92.129 2.174   1.00 105.46 ? 238 GLN A NE2 1 
ATOM   6033  N N   . PRO C 2 215 ? 17.501  -93.645 2.681   1.00 107.33 ? 239 PRO A N   1 
ATOM   6034  C CA  . PRO C 2 215 ? 17.013  -94.530 3.746   1.00 107.64 ? 239 PRO A CA  1 
ATOM   6035  C C   . PRO C 2 215 ? 18.012  -95.604 4.173   1.00 108.02 ? 239 PRO A C   1 
ATOM   6036  O O   . PRO C 2 215 ? 19.053  -95.750 3.536   1.00 108.17 ? 239 PRO A O   1 
ATOM   6037  C CB  . PRO C 2 215 ? 15.778  -95.168 3.113   1.00 108.68 ? 239 PRO A CB  1 
ATOM   6038  C CG  . PRO C 2 215 ? 16.120  -95.246 1.668   1.00 109.27 ? 239 PRO A CG  1 
ATOM   6039  C CD  . PRO C 2 215 ? 16.931  -94.005 1.369   1.00 108.30 ? 239 PRO A CD  1 
ATOM   6040  N N   . GLU D 2 1   ? 24.803  53.967  31.149  1.00 118.46 ? 25  GLU C N   1 
ATOM   6041  C CA  . GLU D 2 1   ? 24.309  52.655  31.549  1.00 112.12 ? 25  GLU C CA  1 
ATOM   6042  C C   . GLU D 2 1   ? 23.938  51.812  30.332  1.00 108.35 ? 25  GLU C C   1 
ATOM   6043  O O   . GLU D 2 1   ? 24.029  52.273  29.193  1.00 100.05 ? 25  GLU C O   1 
ATOM   6044  C CB  . GLU D 2 1   ? 23.102  52.796  32.481  1.00 112.09 ? 25  GLU C CB  1 
ATOM   6045  C CG  . GLU D 2 1   ? 21.795  53.111  31.766  1.00 111.37 ? 25  GLU C CG  1 
ATOM   6046  C CD  . GLU D 2 1   ? 20.858  53.958  32.606  1.00 110.78 ? 25  GLU C CD  1 
ATOM   6047  O OE1 . GLU D 2 1   ? 20.680  55.150  32.276  1.00 108.50 ? 25  GLU C OE1 1 
ATOM   6048  O OE2 . GLU D 2 1   ? 20.298  53.433  33.593  1.00 112.15 ? 25  GLU C OE2 1 
ATOM   6049  N N   . GLU D 2 2   ? 23.519  50.575  30.585  1.00 103.22 ? 26  GLU C N   1 
ATOM   6050  C CA  . GLU D 2 2   ? 23.132  49.671  29.515  1.00 94.30  ? 26  GLU C CA  1 
ATOM   6051  C C   . GLU D 2 2   ? 21.824  50.125  28.869  1.00 88.63  ? 26  GLU C C   1 
ATOM   6052  O O   . GLU D 2 2   ? 21.064  50.923  29.426  1.00 86.55  ? 26  GLU C O   1 
ATOM   6053  C CB  . GLU D 2 2   ? 22.992  48.246  30.051  1.00 91.38  ? 26  GLU C CB  1 
ATOM   6054  C CG  . GLU D 2 2   ? 22.215  48.156  31.356  1.00 92.41  ? 26  GLU C CG  1 
ATOM   6055  C CD  . GLU D 2 2   ? 22.461  46.857  32.101  1.00 93.08  ? 26  GLU C CD  1 
ATOM   6056  O OE1 . GLU D 2 2   ? 21.685  46.547  33.030  1.00 92.21  ? 26  GLU C OE1 1 
ATOM   6057  O OE2 . GLU D 2 2   ? 23.429  46.145  31.757  1.00 95.16  ? 26  GLU C OE2 1 
ATOM   6058  N N   . THR D 2 3   ? 21.566  49.597  27.673  1.00 74.71  ? 27  THR C N   1 
ATOM   6059  C CA  . THR D 2 3   ? 20.369  49.947  26.924  1.00 72.77  ? 27  THR C CA  1 
ATOM   6060  C C   . THR D 2 3   ? 19.124  49.408  27.627  1.00 72.12  ? 27  THR C C   1 
ATOM   6061  O O   . THR D 2 3   ? 19.196  48.710  28.644  1.00 73.27  ? 27  THR C O   1 
ATOM   6062  C CB  . THR D 2 3   ? 20.461  49.410  25.498  1.00 74.04  ? 27  THR C CB  1 
ATOM   6063  O OG1 . THR D 2 3   ? 20.138  48.015  25.488  1.00 73.44  ? 27  THR C OG1 1 
ATOM   6064  C CG2 . THR D 2 3   ? 21.866  49.593  24.961  1.00 77.55  ? 27  THR C CG2 1 
ATOM   6065  N N   . ILE D 2 4   ? 17.962  49.739  27.073  1.00 68.51  ? 28  ILE C N   1 
ATOM   6066  C CA  . ILE D 2 4   ? 16.686  49.329  27.656  1.00 68.71  ? 28  ILE C CA  1 
ATOM   6067  C C   . ILE D 2 4   ? 16.514  47.817  27.535  1.00 68.53  ? 28  ILE C C   1 
ATOM   6068  O O   . ILE D 2 4   ? 16.144  47.170  28.527  1.00 68.73  ? 28  ILE C O   1 
ATOM   6069  C CB  . ILE D 2 4   ? 15.507  50.083  27.016  1.00 72.98  ? 28  ILE C CB  1 
ATOM   6070  C CG1 . ILE D 2 4   ? 15.643  51.590  27.245  1.00 80.00  ? 28  ILE C CG1 1 
ATOM   6071  C CG2 . ILE D 2 4   ? 14.186  49.575  27.571  1.00 73.00  ? 28  ILE C CG2 1 
ATOM   6072  C CD1 . ILE D 2 4   ? 15.426  52.015  28.681  1.00 82.15  ? 28  ILE C CD1 1 
ATOM   6073  N N   . PRO D 2 5   ? 16.751  47.200  26.366  1.00 68.35  ? 29  PRO C N   1 
ATOM   6074  C CA  . PRO D 2 5   ? 16.657  45.732  26.316  1.00 68.73  ? 29  PRO C CA  1 
ATOM   6075  C C   . PRO D 2 5   ? 17.633  45.031  27.244  1.00 67.46  ? 29  PRO C C   1 
ATOM   6076  O O   . PRO D 2 5   ? 17.289  43.994  27.822  1.00 70.97  ? 29  PRO C O   1 
ATOM   6077  C CB  . PRO D 2 5   ? 16.943  45.420  24.841  1.00 67.47  ? 29  PRO C CB  1 
ATOM   6078  C CG  . PRO D 2 5   ? 16.510  46.624  24.122  1.00 66.38  ? 29  PRO C CG  1 
ATOM   6079  C CD  . PRO D 2 5   ? 16.913  47.761  25.011  1.00 68.45  ? 29  PRO C CD  1 
ATOM   6080  N N   . LEU D 2 6   ? 18.842  45.569  27.412  1.00 67.98  ? 30  LEU C N   1 
ATOM   6081  C CA  . LEU D 2 6   ? 19.803  44.934  28.307  1.00 72.57  ? 30  LEU C CA  1 
ATOM   6082  C C   . LEU D 2 6   ? 19.407  45.102  29.768  1.00 74.25  ? 30  LEU C C   1 
ATOM   6083  O O   . LEU D 2 6   ? 19.753  44.257  30.603  1.00 75.29  ? 30  LEU C O   1 
ATOM   6084  C CB  . LEU D 2 6   ? 21.201  45.495  28.060  1.00 76.50  ? 30  LEU C CB  1 
ATOM   6085  C CG  . LEU D 2 6   ? 21.879  45.003  26.782  1.00 78.44  ? 30  LEU C CG  1 
ATOM   6086  C CD1 . LEU D 2 6   ? 22.951  45.984  26.332  1.00 84.24  ? 30  LEU C CD1 1 
ATOM   6087  C CD2 . LEU D 2 6   ? 22.466  43.621  27.002  1.00 75.24  ? 30  LEU C CD2 1 
ATOM   6088  N N   . GLN D 2 7   ? 18.687  46.176  30.100  1.00 76.73  ? 31  GLN C N   1 
ATOM   6089  C CA  . GLN D 2 7   ? 18.177  46.320  31.459  1.00 79.16  ? 31  GLN C CA  1 
ATOM   6090  C C   . GLN D 2 7   ? 17.001  45.385  31.708  1.00 75.69  ? 31  GLN C C   1 
ATOM   6091  O O   . GLN D 2 7   ? 16.895  44.784  32.783  1.00 78.76  ? 31  GLN C O   1 
ATOM   6092  C CB  . GLN D 2 7   ? 17.769  47.767  31.722  1.00 83.08  ? 31  GLN C CB  1 
ATOM   6093  C CG  . GLN D 2 7   ? 18.840  48.601  32.394  1.00 85.79  ? 31  GLN C CG  1 
ATOM   6094  C CD  . GLN D 2 7   ? 18.468  50.064  32.474  1.00 85.81  ? 31  GLN C CD  1 
ATOM   6095  O OE1 . GLN D 2 7   ? 17.295  50.424  32.371  1.00 87.75  ? 31  GLN C OE1 1 
ATOM   6096  N NE2 . GLN D 2 7   ? 19.467  50.920  32.652  1.00 86.07  ? 31  GLN C NE2 1 
ATOM   6097  N N   . THR D 2 8   ? 16.112  45.243  30.725  1.00 71.02  ? 32  THR C N   1 
ATOM   6098  C CA  . THR D 2 8   ? 14.910  44.438  30.909  1.00 72.10  ? 32  THR C CA  1 
ATOM   6099  C C   . THR D 2 8   ? 15.151  42.941  30.751  1.00 72.45  ? 32  THR C C   1 
ATOM   6100  O O   . THR D 2 8   ? 14.304  42.146  31.175  1.00 73.36  ? 32  THR C O   1 
ATOM   6101  C CB  . THR D 2 8   ? 13.828  44.879  29.922  1.00 71.31  ? 32  THR C CB  1 
ATOM   6102  O OG1 . THR D 2 8   ? 14.351  44.833  28.591  1.00 70.70  ? 32  THR C OG1 1 
ATOM   6103  C CG2 . THR D 2 8   ? 13.383  46.294  30.228  1.00 73.90  ? 32  THR C CG2 1 
ATOM   6104  N N   . LEU D 2 9   ? 16.274  42.535  30.162  1.00 69.16  ? 33  LEU C N   1 
ATOM   6105  C CA  . LEU D 2 9   ? 16.488  41.128  29.840  1.00 68.94  ? 33  LEU C CA  1 
ATOM   6106  C C   . LEU D 2 9   ? 16.636  40.296  31.107  1.00 69.53  ? 33  LEU C C   1 
ATOM   6107  O O   . LEU D 2 9   ? 17.524  40.549  31.928  1.00 71.75  ? 33  LEU C O   1 
ATOM   6108  C CB  . LEU D 2 9   ? 17.722  40.964  28.959  1.00 68.58  ? 33  LEU C CB  1 
ATOM   6109  C CG  . LEU D 2 9   ? 17.992  39.522  28.535  1.00 68.36  ? 33  LEU C CG  1 
ATOM   6110  C CD1 . LEU D 2 9   ? 16.916  39.048  27.578  1.00 68.24  ? 33  LEU C CD1 1 
ATOM   6111  C CD2 . LEU D 2 9   ? 19.363  39.404  27.908  1.00 68.11  ? 33  LEU C CD2 1 
ATOM   6112  N N   . ARG D 2 10  ? 15.768  39.298  31.256  1.00 71.35  ? 34  ARG C N   1 
ATOM   6113  C CA  . ARG D 2 10  ? 15.880  38.300  32.311  1.00 70.73  ? 34  ARG C CA  1 
ATOM   6114  C C   . ARG D 2 10  ? 15.612  36.938  31.692  1.00 70.02  ? 34  ARG C C   1 
ATOM   6115  O O   . ARG D 2 10  ? 14.620  36.773  30.979  1.00 67.55  ? 34  ARG C O   1 
ATOM   6116  C CB  . ARG D 2 10  ? 14.891  38.568  33.452  1.00 72.43  ? 34  ARG C CB  1 
ATOM   6117  C CG  . ARG D 2 10  ? 15.107  39.871  34.200  1.00 75.66  ? 34  ARG C CG  1 
ATOM   6118  C CD  . ARG D 2 10  ? 16.471  39.902  34.865  1.00 80.25  ? 34  ARG C CD  1 
ATOM   6119  N NE  . ARG D 2 10  ? 16.503  40.822  35.997  1.00 82.58  ? 34  ARG C NE  1 
ATOM   6120  C CZ  . ARG D 2 10  ? 16.659  42.137  35.889  1.00 85.11  ? 34  ARG C CZ  1 
ATOM   6121  N NH1 . ARG D 2 10  ? 16.802  42.696  34.695  1.00 88.42  ? 34  ARG C NH1 1 
ATOM   6122  N NH2 . ARG D 2 10  ? 16.673  42.895  36.977  1.00 88.55  ? 34  ARG C NH2 1 
ATOM   6123  N N   . CYS D 2 11  ? 16.484  35.967  31.960  1.00 68.73  ? 35  CYS C N   1 
ATOM   6124  C CA  . CYS D 2 11  ? 16.377  34.643  31.356  1.00 69.05  ? 35  CYS C CA  1 
ATOM   6125  C C   . CYS D 2 11  ? 16.385  33.583  32.444  1.00 72.56  ? 35  CYS C C   1 
ATOM   6126  O O   . CYS D 2 11  ? 17.341  33.499  33.223  1.00 78.09  ? 35  CYS C O   1 
ATOM   6127  C CB  . CYS D 2 11  ? 17.520  34.393  30.375  1.00 69.00  ? 35  CYS C CB  1 
ATOM   6128  S SG  . CYS D 2 11  ? 17.537  35.539  28.997  1.00 73.62  ? 35  CYS C SG  1 
ATOM   6129  N N   . TYR D 2 12  ? 15.338  32.761  32.478  1.00 71.61  ? 36  TYR C N   1 
ATOM   6130  C CA  . TYR D 2 12  ? 15.216  31.669  33.432  1.00 70.48  ? 36  TYR C CA  1 
ATOM   6131  C C   . TYR D 2 12  ? 15.025  30.356  32.683  1.00 70.63  ? 36  TYR C C   1 
ATOM   6132  O O   . TYR D 2 12  ? 14.385  30.314  31.632  1.00 72.98  ? 36  TYR C O   1 
ATOM   6133  C CB  . TYR D 2 12  ? 14.042  31.902  34.385  1.00 69.74  ? 36  TYR C CB  1 
ATOM   6134  C CG  . TYR D 2 12  ? 14.241  33.062  35.331  1.00 69.79  ? 36  TYR C CG  1 
ATOM   6135  C CD1 . TYR D 2 12  ? 15.179  32.996  36.351  1.00 71.74  ? 36  TYR C CD1 1 
ATOM   6136  C CD2 . TYR D 2 12  ? 13.490  34.224  35.204  1.00 69.37  ? 36  TYR C CD2 1 
ATOM   6137  C CE1 . TYR D 2 12  ? 15.365  34.053  37.220  1.00 73.84  ? 36  TYR C CE1 1 
ATOM   6138  C CE2 . TYR D 2 12  ? 13.669  35.287  36.070  1.00 70.11  ? 36  TYR C CE2 1 
ATOM   6139  C CZ  . TYR D 2 12  ? 14.609  35.194  37.075  1.00 72.34  ? 36  TYR C CZ  1 
ATOM   6140  O OH  . TYR D 2 12  ? 14.797  36.245  37.942  1.00 75.77  ? 36  TYR C OH  1 
ATOM   6141  N N   . ASN D 2 13  ? 15.568  29.275  33.231  1.00 68.80  ? 37  ASN C N   1 
ATOM   6142  C CA  . ASN D 2 13  ? 15.526  27.986  32.558  1.00 68.24  ? 37  ASN C CA  1 
ATOM   6143  C C   . ASN D 2 13  ? 15.034  26.906  33.510  1.00 67.60  ? 37  ASN C C   1 
ATOM   6144  O O   . ASN D 2 13  ? 15.172  27.026  34.729  1.00 69.74  ? 37  ASN C O   1 
ATOM   6145  C CB  . ASN D 2 13  ? 16.903  27.607  32.007  1.00 68.24  ? 37  ASN C CB  1 
ATOM   6146  C CG  . ASN D 2 13  ? 17.990  27.694  33.054  1.00 68.70  ? 37  ASN C CG  1 
ATOM   6147  O OD1 . ASN D 2 13  ? 18.368  26.689  33.646  1.00 67.08  ? 37  ASN C OD1 1 
ATOM   6148  N ND2 . ASN D 2 13  ? 18.504  28.898  33.284  1.00 68.86  ? 37  ASN C ND2 1 
ATOM   6149  N N   . ASP D 2 14  ? 14.454  25.847  32.941  1.00 64.84  ? 38  ASP C N   1 
ATOM   6150  C CA  . ASP D 2 14  ? 14.042  24.681  33.710  1.00 66.61  ? 38  ASP C CA  1 
ATOM   6151  C C   . ASP D 2 14  ? 15.176  23.684  33.918  1.00 68.57  ? 38  ASP C C   1 
ATOM   6152  O O   . ASP D 2 14  ? 14.932  22.579  34.415  1.00 70.95  ? 38  ASP C O   1 
ATOM   6153  C CB  . ASP D 2 14  ? 12.838  23.997  33.045  1.00 68.56  ? 38  ASP C CB  1 
ATOM   6154  C CG  . ASP D 2 14  ? 13.159  23.411  31.673  1.00 70.97  ? 38  ASP C CG  1 
ATOM   6155  O OD1 . ASP D 2 14  ? 14.344  23.343  31.284  1.00 73.87  ? 38  ASP C OD1 1 
ATOM   6156  O OD2 . ASP D 2 14  ? 12.206  23.002  30.975  1.00 71.10  ? 38  ASP C OD2 1 
ATOM   6157  N N   . TYR D 2 15  ? 16.401  24.048  33.534  1.00 66.42  ? 39  TYR C N   1 
ATOM   6158  C CA  . TYR D 2 15  ? 17.597  23.233  33.726  1.00 66.34  ? 39  TYR C CA  1 
ATOM   6159  C C   . TYR D 2 15  ? 17.471  21.861  33.075  1.00 66.20  ? 39  TYR C C   1 
ATOM   6160  O O   . TYR D 2 15  ? 18.122  20.902  33.504  1.00 66.29  ? 39  TYR C O   1 
ATOM   6161  C CB  . TYR D 2 15  ? 17.929  23.089  35.215  1.00 66.81  ? 39  TYR C CB  1 
ATOM   6162  C CG  . TYR D 2 15  ? 19.402  22.948  35.500  1.00 66.77  ? 39  TYR C CG  1 
ATOM   6163  C CD1 . TYR D 2 15  ? 20.292  23.952  35.151  1.00 66.56  ? 39  TYR C CD1 1 
ATOM   6164  C CD2 . TYR D 2 15  ? 19.904  21.811  36.116  1.00 66.98  ? 39  TYR C CD2 1 
ATOM   6165  C CE1 . TYR D 2 15  ? 21.642  23.830  35.407  1.00 66.58  ? 39  TYR C CE1 1 
ATOM   6166  C CE2 . TYR D 2 15  ? 21.254  21.679  36.377  1.00 67.00  ? 39  TYR C CE2 1 
ATOM   6167  C CZ  . TYR D 2 15  ? 22.119  22.691  36.020  1.00 66.81  ? 39  TYR C CZ  1 
ATOM   6168  O OH  . TYR D 2 15  ? 23.463  22.561  36.281  1.00 66.89  ? 39  TYR C OH  1 
ATOM   6169  N N   . THR D 2 16  ? 16.649  21.749  32.032  1.00 72.57  ? 40  THR C N   1 
ATOM   6170  C CA  . THR D 2 16  ? 16.390  20.453  31.421  1.00 72.54  ? 40  THR C CA  1 
ATOM   6171  C C   . THR D 2 16  ? 16.152  20.563  29.920  1.00 71.07  ? 40  THR C C   1 
ATOM   6172  O O   . THR D 2 16  ? 16.810  19.872  29.134  1.00 73.35  ? 40  THR C O   1 
ATOM   6173  C CB  . THR D 2 16  ? 15.184  19.789  32.086  1.00 72.73  ? 40  THR C CB  1 
ATOM   6174  O OG1 . THR D 2 16  ? 15.559  19.308  33.381  1.00 79.83  ? 40  THR C OG1 1 
ATOM   6175  C CG2 . THR D 2 16  ? 14.686  18.623  31.245  1.00 74.98  ? 40  THR C CG2 1 
ATOM   6176  N N   . SER D 2 17  ? 15.222  21.422  29.512  1.00 69.14  ? 41  SER C N   1 
ATOM   6177  C CA  . SER D 2 17  ? 14.726  21.408  28.140  1.00 74.13  ? 41  SER C CA  1 
ATOM   6178  C C   . SER D 2 17  ? 14.873  22.731  27.407  1.00 77.39  ? 41  SER C C   1 
ATOM   6179  O O   . SER D 2 17  ? 15.166  22.728  26.209  1.00 80.99  ? 41  SER C O   1 
ATOM   6180  C CB  . SER D 2 17  ? 13.247  20.992  28.120  1.00 77.12  ? 41  SER C CB  1 
ATOM   6181  O OG  . SER D 2 17  ? 12.392  22.119  28.216  1.00 76.51  ? 41  SER C OG  1 
ATOM   6182  N N   . HIS D 2 18  ? 14.657  23.863  28.071  1.00 74.94  ? 42  HIS C N   1 
ATOM   6183  C CA  . HIS D 2 18  ? 14.657  25.134  27.362  1.00 73.62  ? 42  HIS C CA  1 
ATOM   6184  C C   . HIS D 2 18  ? 14.962  26.268  28.328  1.00 69.46  ? 42  HIS C C   1 
ATOM   6185  O O   . HIS D 2 18  ? 14.991  26.089  29.547  1.00 71.65  ? 42  HIS C O   1 
ATOM   6186  C CB  . HIS D 2 18  ? 13.320  25.370  26.644  1.00 77.96  ? 42  HIS C CB  1 
ATOM   6187  C CG  . HIS D 2 18  ? 12.128  25.387  27.554  1.00 80.51  ? 42  HIS C CG  1 
ATOM   6188  N ND1 . HIS D 2 18  ? 12.060  26.166  28.689  1.00 76.70  ? 42  HIS C ND1 1 
ATOM   6189  C CD2 . HIS D 2 18  ? 10.949  24.724  27.485  1.00 83.51  ? 42  HIS C CD2 1 
ATOM   6190  C CE1 . HIS D 2 18  ? 10.895  25.978  29.283  1.00 78.63  ? 42  HIS C CE1 1 
ATOM   6191  N NE2 . HIS D 2 18  ? 10.202  25.108  28.572  1.00 84.33  ? 42  HIS C NE2 1 
ATOM   6192  N N   . ILE D 2 19  ? 15.191  27.444  27.751  1.00 70.47  ? 43  ILE C N   1 
ATOM   6193  C CA  . ILE D 2 19  ? 15.345  28.697  28.476  1.00 69.19  ? 43  ILE C CA  1 
ATOM   6194  C C   . ILE D 2 19  ? 14.286  29.661  27.964  1.00 68.54  ? 43  ILE C C   1 
ATOM   6195  O O   . ILE D 2 19  ? 13.939  29.643  26.777  1.00 69.22  ? 43  ILE C O   1 
ATOM   6196  C CB  . ILE D 2 19  ? 16.757  29.296  28.298  1.00 69.64  ? 43  ILE C CB  1 
ATOM   6197  C CG1 . ILE D 2 19  ? 17.828  28.220  28.468  1.00 71.38  ? 43  ILE C CG1 1 
ATOM   6198  C CG2 . ILE D 2 19  ? 16.989  30.421  29.287  1.00 72.90  ? 43  ILE C CG2 1 
ATOM   6199  C CD1 . ILE D 2 19  ? 19.195  28.638  27.977  1.00 71.84  ? 43  ILE C CD1 1 
ATOM   6200  N N   . THR D 2 20  ? 13.765  30.493  28.861  1.00 69.15  ? 44  THR C N   1 
ATOM   6201  C CA  . THR D 2 20  ? 12.776  31.509  28.533  1.00 70.55  ? 44  THR C CA  1 
ATOM   6202  C C   . THR D 2 20  ? 13.330  32.863  28.949  1.00 70.00  ? 44  THR C C   1 
ATOM   6203  O O   . THR D 2 20  ? 13.614  33.085  30.132  1.00 69.34  ? 44  THR C O   1 
ATOM   6204  C CB  . THR D 2 20  ? 11.446  31.230  29.236  1.00 72.78  ? 44  THR C CB  1 
ATOM   6205  O OG1 . THR D 2 20  ? 11.068  29.864  29.020  1.00 76.48  ? 44  THR C OG1 1 
ATOM   6206  C CG2 . THR D 2 20  ? 10.356  32.140  28.699  1.00 74.51  ? 44  THR C CG2 1 
ATOM   6207  N N   . CYS D 2 21  ? 13.501  33.752  27.975  1.00 70.87  ? 45  CYS C N   1 
ATOM   6208  C CA  . CYS D 2 21  ? 13.959  35.111  28.198  1.00 70.68  ? 45  CYS C CA  1 
ATOM   6209  C C   . CYS D 2 21  ? 12.803  36.084  28.017  1.00 72.54  ? 45  CYS C C   1 
ATOM   6210  O O   . CYS D 2 21  ? 11.884  35.845  27.231  1.00 72.20  ? 45  CYS C O   1 
ATOM   6211  C CB  . CYS D 2 21  ? 15.086  35.477  27.232  1.00 70.07  ? 45  CYS C CB  1 
ATOM   6212  S SG  . CYS D 2 21  ? 16.596  34.547  27.496  1.00 74.14  ? 45  CYS C SG  1 
ATOM   6213  N N   . ARG D 2 22  ? 12.858  37.186  28.755  1.00 71.23  ? 46  ARG C N   1 
ATOM   6214  C CA  . ARG D 2 22  ? 11.869  38.244  28.642  1.00 74.17  ? 46  ARG C CA  1 
ATOM   6215  C C   . ARG D 2 22  ? 12.586  39.582  28.669  1.00 73.84  ? 46  ARG C C   1 
ATOM   6216  O O   . ARG D 2 22  ? 13.488  39.795  29.487  1.00 73.11  ? 46  ARG C O   1 
ATOM   6217  C CB  . ARG D 2 22  ? 10.830  38.163  29.765  1.00 78.84  ? 46  ARG C CB  1 
ATOM   6218  C CG  . ARG D 2 22  ? 9.789   37.083  29.553  1.00 77.37  ? 46  ARG C CG  1 
ATOM   6219  C CD  . ARG D 2 22  ? 8.772   37.069  30.677  1.00 78.84  ? 46  ARG C CD  1 
ATOM   6220  N NE  . ARG D 2 22  ? 7.407   37.146  30.167  1.00 82.58  ? 46  ARG C NE  1 
ATOM   6221  C CZ  . ARG D 2 22  ? 6.601   36.098  30.024  1.00 85.14  ? 46  ARG C CZ  1 
ATOM   6222  N NH1 . ARG D 2 22  ? 5.372   36.264  29.550  1.00 85.47  ? 46  ARG C NH1 1 
ATOM   6223  N NH2 . ARG D 2 22  ? 7.021   34.883  30.354  1.00 81.80  ? 46  ARG C NH2 1 
ATOM   6224  N N   . TRP D 2 23  ? 12.189  40.475  27.767  1.00 72.23  ? 47  TRP C N   1 
ATOM   6225  C CA  . TRP D 2 23  ? 12.878  41.754  27.635  1.00 73.04  ? 47  TRP C CA  1 
ATOM   6226  C C   . TRP D 2 23  ? 12.001  42.714  26.848  1.00 75.83  ? 47  TRP C C   1 
ATOM   6227  O O   . TRP D 2 23  ? 11.029  42.312  26.213  1.00 77.30  ? 47  TRP C O   1 
ATOM   6228  C CB  . TRP D 2 23  ? 14.238  41.584  26.954  1.00 71.23  ? 47  TRP C CB  1 
ATOM   6229  C CG  . TRP D 2 23  ? 14.134  41.114  25.538  1.00 69.26  ? 47  TRP C CG  1 
ATOM   6230  C CD1 . TRP D 2 23  ? 14.077  39.823  25.107  1.00 69.68  ? 47  TRP C CD1 1 
ATOM   6231  C CD2 . TRP D 2 23  ? 14.070  41.932  24.364  1.00 67.55  ? 47  TRP C CD2 1 
ATOM   6232  N NE1 . TRP D 2 23  ? 13.984  39.785  23.738  1.00 67.92  ? 47  TRP C NE1 1 
ATOM   6233  C CE2 . TRP D 2 23  ? 13.978  41.067  23.258  1.00 66.58  ? 47  TRP C CE2 1 
ATOM   6234  C CE3 . TRP D 2 23  ? 14.085  43.311  24.142  1.00 69.54  ? 47  TRP C CE3 1 
ATOM   6235  C CZ2 . TRP D 2 23  ? 13.903  41.534  21.951  1.00 69.39  ? 47  TRP C CZ2 1 
ATOM   6236  C CZ3 . TRP D 2 23  ? 14.008  43.774  22.842  1.00 70.86  ? 47  TRP C CZ3 1 
ATOM   6237  C CH2 . TRP D 2 23  ? 13.918  42.888  21.763  1.00 71.11  ? 47  TRP C CH2 1 
ATOM   6238  N N   . ALA D 2 24  ? 12.376  43.991  26.865  1.00 76.79  ? 48  ALA C N   1 
ATOM   6239  C CA  . ALA D 2 24  ? 11.567  44.993  26.186  1.00 76.54  ? 48  ALA C CA  1 
ATOM   6240  C C   . ALA D 2 24  ? 12.435  46.129  25.667  1.00 76.03  ? 48  ALA C C   1 
ATOM   6241  O O   . ALA D 2 24  ? 13.285  46.648  26.396  1.00 71.41  ? 48  ALA C O   1 
ATOM   6242  C CB  . ALA D 2 24  ? 10.490  45.549  27.124  1.00 77.69  ? 48  ALA C CB  1 
ATOM   6243  N N   . ASP D 2 25  ? 12.219  46.503  24.408  1.00 78.26  ? 49  ASP C N   1 
ATOM   6244  C CA  . ASP D 2 25  ? 12.625  47.806  23.913  1.00 78.75  ? 49  ASP C CA  1 
ATOM   6245  C C   . ASP D 2 25  ? 11.436  48.762  24.024  1.00 78.80  ? 49  ASP C C   1 
ATOM   6246  O O   . ASP D 2 25  ? 10.373  48.415  24.546  1.00 80.73  ? 49  ASP C O   1 
ATOM   6247  C CB  . ASP D 2 25  ? 13.179  47.716  22.483  1.00 79.78  ? 49  ASP C CB  1 
ATOM   6248  C CG  . ASP D 2 25  ? 12.139  47.294  21.456  1.00 79.55  ? 49  ASP C CG  1 
ATOM   6249  O OD1 . ASP D 2 25  ? 10.976  47.029  21.827  1.00 79.92  ? 49  ASP C OD1 1 
ATOM   6250  O OD2 . ASP D 2 25  ? 12.491  47.238  20.258  1.00 79.58  ? 49  ASP C OD2 1 
ATOM   6251  N N   . THR D 2 26  ? 11.617  49.983  23.537  1.00 81.32  ? 50  THR C N   1 
ATOM   6252  C CA  . THR D 2 26  ? 10.623  51.027  23.720  1.00 82.21  ? 50  THR C CA  1 
ATOM   6253  C C   . THR D 2 26  ? 9.909   51.335  22.409  1.00 80.65  ? 50  THR C C   1 
ATOM   6254  O O   . THR D 2 26  ? 10.449  51.132  21.318  1.00 80.17  ? 50  THR C O   1 
ATOM   6255  C CB  . THR D 2 26  ? 11.261  52.296  24.298  1.00 83.17  ? 50  THR C CB  1 
ATOM   6256  O OG1 . THR D 2 26  ? 10.256  53.300  24.476  1.00 88.90  ? 50  THR C OG1 1 
ATOM   6257  C CG2 . THR D 2 26  ? 12.354  52.823  23.387  1.00 84.73  ? 50  THR C CG2 1 
ATOM   6258  N N   . GLN D 2 27  ? 8.670   51.819  22.540  1.00 86.29  ? 51  GLN C N   1 
ATOM   6259  C CA  . GLN D 2 27  ? 7.830   52.085  21.376  1.00 88.77  ? 51  GLN C CA  1 
ATOM   6260  C C   . GLN D 2 27  ? 8.437   53.159  20.483  1.00 87.12  ? 51  GLN C C   1 
ATOM   6261  O O   . GLN D 2 27  ? 8.310   53.099  19.254  1.00 82.78  ? 51  GLN C O   1 
ATOM   6262  C CB  . GLN D 2 27  ? 6.434   52.503  21.835  1.00 92.83  ? 51  GLN C CB  1 
ATOM   6263  C CG  . GLN D 2 27  ? 5.293   51.970  20.988  1.00 91.43  ? 51  GLN C CG  1 
ATOM   6264  C CD  . GLN D 2 27  ? 3.947   52.154  21.662  1.00 93.00  ? 51  GLN C CD  1 
ATOM   6265  O OE1 . GLN D 2 27  ? 3.800   52.984  22.560  1.00 89.21  ? 51  GLN C OE1 1 
ATOM   6266  N NE2 . GLN D 2 27  ? 2.957   51.381  21.232  1.00 94.81  ? 51  GLN C NE2 1 
ATOM   6267  N N   . ASP D 2 28  ? 9.089   54.156  21.084  1.00 83.38  ? 52  ASP C N   1 
ATOM   6268  C CA  . ASP D 2 28  ? 9.686   55.235  20.305  1.00 86.75  ? 52  ASP C CA  1 
ATOM   6269  C C   . ASP D 2 28  ? 10.821  54.718  19.430  1.00 85.32  ? 52  ASP C C   1 
ATOM   6270  O O   . ASP D 2 28  ? 10.887  55.026  18.234  1.00 84.58  ? 52  ASP C O   1 
ATOM   6271  C CB  . ASP D 2 28  ? 10.185  56.341  21.237  1.00 89.74  ? 52  ASP C CB  1 
ATOM   6272  C CG  . ASP D 2 28  ? 9.142   56.766  22.254  1.00 89.95  ? 52  ASP C CG  1 
ATOM   6273  O OD1 . ASP D 2 28  ? 7.936   56.584  21.985  1.00 91.78  ? 52  ASP C OD1 1 
ATOM   6274  O OD2 . ASP D 2 28  ? 9.531   57.282  23.323  1.00 86.76  ? 52  ASP C OD2 1 
ATOM   6275  N N   . ALA D 2 29  ? 11.722  53.922  20.011  1.00 79.49  ? 53  ALA C N   1 
ATOM   6276  C CA  . ALA D 2 29  ? 12.877  53.433  19.269  1.00 81.38  ? 53  ALA C CA  1 
ATOM   6277  C C   . ALA D 2 29  ? 12.494  52.480  18.147  1.00 78.71  ? 53  ALA C C   1 
ATOM   6278  O O   . ALA D 2 29  ? 13.273  52.310  17.205  1.00 81.17  ? 53  ALA C O   1 
ATOM   6279  C CB  . ALA D 2 29  ? 13.863  52.746  20.212  1.00 84.41  ? 53  ALA C CB  1 
ATOM   6280  N N   . GLN D 2 30  ? 11.320  51.852  18.222  1.00 81.59  ? 54  GLN C N   1 
ATOM   6281  C CA  . GLN D 2 30  ? 10.909  50.961  17.147  1.00 85.69  ? 54  GLN C CA  1 
ATOM   6282  C C   . GLN D 2 30  ? 10.581  51.717  15.868  1.00 84.20  ? 54  GLN C C   1 
ATOM   6283  O O   . GLN D 2 30  ? 10.529  51.103  14.797  1.00 83.15  ? 54  GLN C O   1 
ATOM   6284  C CB  . GLN D 2 30  ? 9.709   50.120  17.582  1.00 90.35  ? 54  GLN C CB  1 
ATOM   6285  C CG  . GLN D 2 30  ? 10.069  48.957  18.487  1.00 89.90  ? 54  GLN C CG  1 
ATOM   6286  C CD  . GLN D 2 30  ? 9.063   47.831  18.408  1.00 86.09  ? 54  GLN C CD  1 
ATOM   6287  O OE1 . GLN D 2 30  ? 7.948   47.942  18.915  1.00 84.40  ? 54  GLN C OE1 1 
ATOM   6288  N NE2 . GLN D 2 30  ? 9.450   46.741  17.759  1.00 86.08  ? 54  GLN C NE2 1 
ATOM   6289  N N   . ARG D 2 31  ? 10.365  53.031  15.954  1.00 85.98  ? 55  ARG C N   1 
ATOM   6290  C CA  . ARG D 2 31  ? 10.141  53.822  14.749  1.00 89.65  ? 55  ARG C CA  1 
ATOM   6291  C C   . ARG D 2 31  ? 11.386  53.866  13.872  1.00 89.65  ? 55  ARG C C   1 
ATOM   6292  O O   . ARG D 2 31  ? 11.281  53.952  12.642  1.00 87.88  ? 55  ARG C O   1 
ATOM   6293  C CB  . ARG D 2 31  ? 9.702   55.237  15.131  1.00 92.76  ? 55  ARG C CB  1 
ATOM   6294  C CG  . ARG D 2 31  ? 9.489   56.171  13.950  1.00 99.47  ? 55  ARG C CG  1 
ATOM   6295  C CD  . ARG D 2 31  ? 8.650   57.379  14.338  1.00 101.85 ? 55  ARG C CD  1 
ATOM   6296  N NE  . ARG D 2 31  ? 7.347   56.998  14.878  1.00 104.04 ? 55  ARG C NE  1 
ATOM   6297  C CZ  . ARG D 2 31  ? 6.244   57.732  14.758  1.00 104.36 ? 55  ARG C CZ  1 
ATOM   6298  N NH1 . ARG D 2 31  ? 6.283   58.890  14.110  1.00 105.52 ? 55  ARG C NH1 1 
ATOM   6299  N NH2 . ARG D 2 31  ? 5.101   57.309  15.282  1.00 101.14 ? 55  ARG C NH2 1 
ATOM   6300  N N   . LEU D 2 32  ? 12.570  53.789  14.478  1.00 80.01  ? 56  LEU C N   1 
ATOM   6301  C CA  . LEU D 2 32  ? 13.822  53.923  13.745  1.00 78.63  ? 56  LEU C CA  1 
ATOM   6302  C C   . LEU D 2 32  ? 14.559  52.604  13.561  1.00 77.61  ? 56  LEU C C   1 
ATOM   6303  O O   . LEU D 2 32  ? 15.136  52.374  12.494  1.00 79.72  ? 56  LEU C O   1 
ATOM   6304  C CB  . LEU D 2 32  ? 14.739  54.925  14.449  1.00 79.19  ? 56  LEU C CB  1 
ATOM   6305  C CG  . LEU D 2 32  ? 14.166  56.334  14.601  1.00 83.43  ? 56  LEU C CG  1 
ATOM   6306  C CD1 . LEU D 2 32  ? 15.104  57.213  15.412  1.00 84.36  ? 56  LEU C CD1 1 
ATOM   6307  C CD2 . LEU D 2 32  ? 13.912  56.944  13.233  1.00 86.49  ? 56  LEU C CD2 1 
ATOM   6308  N N   . VAL D 2 33  ? 14.560  51.728  14.563  1.00 74.26  ? 57  VAL C N   1 
ATOM   6309  C CA  . VAL D 2 33  ? 15.327  50.490  14.477  1.00 74.51  ? 57  VAL C CA  1 
ATOM   6310  C C   . VAL D 2 33  ? 14.763  49.485  15.473  1.00 75.68  ? 57  VAL C C   1 
ATOM   6311  O O   . VAL D 2 33  ? 14.395  49.840  16.595  1.00 78.75  ? 57  VAL C O   1 
ATOM   6312  C CB  . VAL D 2 33  ? 16.832  50.754  14.720  1.00 74.68  ? 57  VAL C CB  1 
ATOM   6313  C CG1 . VAL D 2 33  ? 17.074  51.316  16.123  1.00 73.58  ? 57  VAL C CG1 1 
ATOM   6314  C CG2 . VAL D 2 33  ? 17.634  49.490  14.497  1.00 77.08  ? 57  VAL C CG2 1 
ATOM   6315  N N   . ASN D 2 34  ? 14.693  48.224  15.049  1.00 76.93  ? 58  ASN C N   1 
ATOM   6316  C CA  . ASN D 2 34  ? 14.359  47.116  15.930  1.00 78.70  ? 58  ASN C CA  1 
ATOM   6317  C C   . ASN D 2 34  ? 15.624  46.317  16.211  1.00 77.06  ? 58  ASN C C   1 
ATOM   6318  O O   . ASN D 2 34  ? 16.559  46.310  15.407  1.00 76.47  ? 58  ASN C O   1 
ATOM   6319  C CB  . ASN D 2 34  ? 13.307  46.188  15.313  1.00 79.52  ? 58  ASN C CB  1 
ATOM   6320  C CG  . ASN D 2 34  ? 11.979  46.878  15.058  1.00 83.14  ? 58  ASN C CG  1 
ATOM   6321  O OD1 . ASN D 2 34  ? 11.409  47.510  15.945  1.00 80.11  ? 58  ASN C OD1 1 
ATOM   6322  N ND2 . ASN D 2 34  ? 11.477  46.732  13.828  1.00 88.19  ? 58  ASN C ND2 1 
ATOM   6323  N N   . VAL D 2 35  ? 15.651  45.633  17.353  1.00 69.99  ? 59  VAL C N   1 
ATOM   6324  C CA  . VAL D 2 35  ? 16.779  44.783  17.699  1.00 68.22  ? 59  VAL C CA  1 
ATOM   6325  C C   . VAL D 2 35  ? 16.289  43.349  17.859  1.00 67.38  ? 59  VAL C C   1 
ATOM   6326  O O   . VAL D 2 35  ? 15.094  43.083  18.007  1.00 68.92  ? 59  VAL C O   1 
ATOM   6327  C CB  . VAL D 2 35  ? 17.500  45.258  18.977  1.00 69.34  ? 59  VAL C CB  1 
ATOM   6328  C CG1 . VAL D 2 35  ? 17.992  46.689  18.807  1.00 72.74  ? 59  VAL C CG1 1 
ATOM   6329  C CG2 . VAL D 2 35  ? 16.580  45.135  20.178  1.00 72.54  ? 59  VAL C CG2 1 
ATOM   6330  N N   . THR D 2 36  ? 17.240  42.420  17.816  1.00 68.49  ? 60  THR C N   1 
ATOM   6331  C CA  . THR D 2 36  ? 16.984  41.005  18.026  1.00 68.73  ? 60  THR C CA  1 
ATOM   6332  C C   . THR D 2 36  ? 17.925  40.486  19.103  1.00 68.33  ? 60  THR C C   1 
ATOM   6333  O O   . THR D 2 36  ? 19.061  40.956  19.240  1.00 67.25  ? 60  THR C O   1 
ATOM   6334  C CB  . THR D 2 36  ? 17.172  40.192  16.733  1.00 71.84  ? 60  THR C CB  1 
ATOM   6335  O OG1 . THR D 2 36  ? 16.590  40.898  15.630  1.00 73.06  ? 60  THR C OG1 1 
ATOM   6336  C CG2 . THR D 2 36  ? 16.507  38.828  16.853  1.00 71.86  ? 60  THR C CG2 1 
ATOM   6337  N N   . LEU D 2 37  ? 17.432  39.518  19.872  1.00 67.57  ? 61  LEU C N   1 
ATOM   6338  C CA  . LEU D 2 37  ? 18.231  38.866  20.898  1.00 66.60  ? 61  LEU C CA  1 
ATOM   6339  C C   . LEU D 2 37  ? 19.194  37.875  20.257  1.00 65.76  ? 61  LEU C C   1 
ATOM   6340  O O   . LEU D 2 37  ? 18.823  37.126  19.350  1.00 66.87  ? 61  LEU C O   1 
ATOM   6341  C CB  . LEU D 2 37  ? 17.321  38.152  21.897  1.00 66.92  ? 61  LEU C CB  1 
ATOM   6342  C CG  . LEU D 2 37  ? 17.950  37.551  23.152  1.00 67.60  ? 61  LEU C CG  1 
ATOM   6343  C CD1 . LEU D 2 37  ? 18.752  38.593  23.902  1.00 70.02  ? 61  LEU C CD1 1 
ATOM   6344  C CD2 . LEU D 2 37  ? 16.866  36.972  24.044  1.00 69.79  ? 61  LEU C CD2 1 
ATOM   6345  N N   . ILE D 2 38  ? 20.439  37.880  20.724  1.00 66.39  ? 62  ILE C N   1 
ATOM   6346  C CA  . ILE D 2 38  ? 21.492  37.023  20.195  1.00 69.08  ? 62  ILE C CA  1 
ATOM   6347  C C   . ILE D 2 38  ? 22.112  36.254  21.350  1.00 67.52  ? 62  ILE C C   1 
ATOM   6348  O O   . ILE D 2 38  ? 22.279  36.796  22.447  1.00 69.77  ? 62  ILE C O   1 
ATOM   6349  C CB  . ILE D 2 38  ? 22.574  37.833  19.447  1.00 72.06  ? 62  ILE C CB  1 
ATOM   6350  C CG1 . ILE D 2 38  ? 21.959  39.027  18.716  1.00 74.99  ? 62  ILE C CG1 1 
ATOM   6351  C CG2 . ILE D 2 38  ? 23.326  36.948  18.470  1.00 75.84  ? 62  ILE C CG2 1 
ATOM   6352  C CD1 . ILE D 2 38  ? 21.113  38.645  17.516  1.00 75.93  ? 62  ILE C CD1 1 
ATOM   6353  N N   . ARG D 2 39  ? 22.463  34.995  21.104  1.00 75.77  ? 63  ARG C N   1 
ATOM   6354  C CA  . ARG D 2 39  ? 23.116  34.150  22.094  1.00 78.80  ? 63  ARG C CA  1 
ATOM   6355  C C   . ARG D 2 39  ? 24.426  33.647  21.510  1.00 77.52  ? 63  ARG C C   1 
ATOM   6356  O O   . ARG D 2 39  ? 24.434  33.028  20.440  1.00 75.96  ? 63  ARG C O   1 
ATOM   6357  C CB  . ARG D 2 39  ? 22.219  32.977  22.495  1.00 81.05  ? 63  ARG C CB  1 
ATOM   6358  C CG  . ARG D 2 39  ? 22.712  32.209  23.711  1.00 83.69  ? 63  ARG C CG  1 
ATOM   6359  C CD  . ARG D 2 39  ? 21.746  31.103  24.091  1.00 84.34  ? 63  ARG C CD  1 
ATOM   6360  N NE  . ARG D 2 39  ? 21.584  30.126  23.017  1.00 82.88  ? 63  ARG C NE  1 
ATOM   6361  C CZ  . ARG D 2 39  ? 22.170  28.933  22.998  1.00 81.75  ? 63  ARG C CZ  1 
ATOM   6362  N NH1 . ARG D 2 39  ? 22.958  28.560  23.997  1.00 77.83  ? 63  ARG C NH1 1 
ATOM   6363  N NH2 . ARG D 2 39  ? 21.966  28.109  21.979  1.00 85.62  ? 63  ARG C NH2 1 
ATOM   6364  N N   . ARG D 2 40  ? 25.530  33.921  22.200  1.00 82.27  ? 64  ARG C N   1 
ATOM   6365  C CA  . ARG D 2 40  ? 26.816  33.382  21.780  1.00 85.42  ? 64  ARG C CA  1 
ATOM   6366  C C   . ARG D 2 40  ? 26.845  31.886  22.075  1.00 83.46  ? 64  ARG C C   1 
ATOM   6367  O O   . ARG D 2 40  ? 26.750  31.475  23.236  1.00 87.27  ? 64  ARG C O   1 
ATOM   6368  C CB  . ARG D 2 40  ? 27.955  34.108  22.495  1.00 88.46  ? 64  ARG C CB  1 
ATOM   6369  C CG  . ARG D 2 40  ? 29.303  34.005  21.795  1.00 88.23  ? 64  ARG C CG  1 
ATOM   6370  C CD  . ARG D 2 40  ? 30.081  35.316  21.865  1.00 89.53  ? 64  ARG C CD  1 
ATOM   6371  N NE  . ARG D 2 40  ? 30.383  35.717  23.237  1.00 91.55  ? 64  ARG C NE  1 
ATOM   6372  C CZ  . ARG D 2 40  ? 31.533  35.467  23.855  1.00 97.10  ? 64  ARG C CZ  1 
ATOM   6373  N NH1 . ARG D 2 40  ? 32.502  34.816  23.224  1.00 100.30 ? 64  ARG C NH1 1 
ATOM   6374  N NH2 . ARG D 2 40  ? 31.719  35.872  25.106  1.00 95.57  ? 64  ARG C NH2 1 
ATOM   6375  N N   . VAL D 2 41  ? 26.954  31.072  21.029  1.00 86.75  ? 65  VAL C N   1 
ATOM   6376  C CA  . VAL D 2 41  ? 26.888  29.622  21.166  1.00 90.42  ? 65  VAL C CA  1 
ATOM   6377  C C   . VAL D 2 41  ? 28.273  28.985  21.121  1.00 90.43  ? 65  VAL C C   1 
ATOM   6378  O O   . VAL D 2 41  ? 28.529  28.007  21.823  1.00 96.58  ? 65  VAL C O   1 
ATOM   6379  C CB  . VAL D 2 41  ? 25.951  29.023  20.093  1.00 93.43  ? 65  VAL C CB  1 
ATOM   6380  C CG1 . VAL D 2 41  ? 26.468  29.308  18.693  1.00 94.44  ? 65  VAL C CG1 1 
ATOM   6381  C CG2 . VAL D 2 41  ? 25.762  27.528  20.316  1.00 93.68  ? 65  VAL C CG2 1 
ATOM   6382  N N   . ASN D 2 42  ? 29.178  29.523  20.310  1.00 98.57  ? 66  ASN C N   1 
ATOM   6383  C CA  . ASN D 2 42  ? 30.581  29.143  20.314  1.00 100.28 ? 66  ASN C CA  1 
ATOM   6384  C C   . ASN D 2 42  ? 31.411  30.335  20.777  1.00 100.81 ? 66  ASN C C   1 
ATOM   6385  O O   . ASN D 2 42  ? 30.877  31.358  21.218  1.00 99.43  ? 66  ASN C O   1 
ATOM   6386  C CB  . ASN D 2 42  ? 31.024  28.672  18.925  1.00 100.39 ? 66  ASN C CB  1 
ATOM   6387  C CG  . ASN D 2 42  ? 30.380  27.365  18.511  1.00 104.01 ? 66  ASN C CG  1 
ATOM   6388  O OD1 . ASN D 2 42  ? 30.272  26.429  19.305  1.00 102.05 ? 66  ASN C OD1 1 
ATOM   6389  N ND2 . ASN D 2 42  ? 29.955  27.290  17.254  1.00 108.30 ? 66  ASN C ND2 1 
ATOM   6390  N N   . GLU D 2 43  ? 32.734  30.203  20.680  1.00 104.94 ? 67  GLU C N   1 
ATOM   6391  C CA  . GLU D 2 43  ? 33.569  31.396  20.718  1.00 111.99 ? 67  GLU C CA  1 
ATOM   6392  C C   . GLU D 2 43  ? 33.319  32.269  19.496  1.00 111.50 ? 67  GLU C C   1 
ATOM   6393  O O   . GLU D 2 43  ? 33.467  33.495  19.566  1.00 106.89 ? 67  GLU C O   1 
ATOM   6394  C CB  . GLU D 2 43  ? 35.046  31.009  20.806  1.00 118.59 ? 67  GLU C CB  1 
ATOM   6395  C CG  . GLU D 2 43  ? 35.966  32.163  21.173  1.00 123.71 ? 67  GLU C CG  1 
ATOM   6396  C CD  . GLU D 2 43  ? 35.867  32.548  22.635  1.00 132.87 ? 67  GLU C CD  1 
ATOM   6397  O OE1 . GLU D 2 43  ? 36.295  31.744  23.491  1.00 141.14 ? 67  GLU C OE1 1 
ATOM   6398  O OE2 . GLU D 2 43  ? 35.365  33.657  22.925  1.00 131.93 ? 67  GLU C OE2 1 
ATOM   6399  N N   . ASP D 2 44  ? 32.915  31.655  18.382  1.00 111.29 ? 68  ASP C N   1 
ATOM   6400  C CA  . ASP D 2 44  ? 32.724  32.344  17.110  1.00 112.74 ? 68  ASP C CA  1 
ATOM   6401  C C   . ASP D 2 44  ? 31.252  32.625  16.823  1.00 112.20 ? 68  ASP C C   1 
ATOM   6402  O O   . ASP D 2 44  ? 30.845  33.787  16.729  1.00 115.14 ? 68  ASP C O   1 
ATOM   6403  C CB  . ASP D 2 44  ? 33.330  31.510  15.969  1.00 118.02 ? 68  ASP C CB  1 
ATOM   6404  C CG  . ASP D 2 44  ? 34.819  31.260  16.148  1.00 121.45 ? 68  ASP C CG  1 
ATOM   6405  O OD1 . ASP D 2 44  ? 35.254  31.054  17.300  1.00 119.57 ? 68  ASP C OD1 1 
ATOM   6406  O OD2 . ASP D 2 44  ? 35.552  31.259  15.134  1.00 127.10 ? 68  ASP C OD2 1 
ATOM   6407  N N   . LEU D 2 45  ? 30.444  31.574  16.688  1.00 101.07 ? 69  LEU C N   1 
ATOM   6408  C CA  . LEU D 2 45  ? 29.084  31.716  16.183  1.00 97.60  ? 69  LEU C CA  1 
ATOM   6409  C C   . LEU D 2 45  ? 28.184  32.448  17.175  1.00 92.28  ? 69  LEU C C   1 
ATOM   6410  O O   . LEU D 2 45  ? 28.344  32.347  18.394  1.00 90.02  ? 69  LEU C O   1 
ATOM   6411  C CB  . LEU D 2 45  ? 28.495  30.343  15.857  1.00 96.80  ? 69  LEU C CB  1 
ATOM   6412  C CG  . LEU D 2 45  ? 27.132  30.337  15.158  1.00 101.19 ? 69  LEU C CG  1 
ATOM   6413  C CD1 . LEU D 2 45  ? 27.204  31.062  13.820  1.00 101.52 ? 69  LEU C CD1 1 
ATOM   6414  C CD2 . LEU D 2 45  ? 26.624  28.914  14.975  1.00 100.17 ? 69  LEU C CD2 1 
ATOM   6415  N N   . LEU D 2 46  ? 27.226  33.195  16.627  1.00 84.43  ? 70  LEU C N   1 
ATOM   6416  C CA  . LEU D 2 46  ? 26.241  33.945  17.402  1.00 82.72  ? 70  LEU C CA  1 
ATOM   6417  C C   . LEU D 2 46  ? 24.864  33.630  16.836  1.00 83.13  ? 70  LEU C C   1 
ATOM   6418  O O   . LEU D 2 46  ? 24.510  34.120  15.759  1.00 84.89  ? 70  LEU C O   1 
ATOM   6419  C CB  . LEU D 2 46  ? 26.521  35.448  17.344  1.00 83.18  ? 70  LEU C CB  1 
ATOM   6420  C CG  . LEU D 2 46  ? 27.778  35.966  18.043  1.00 86.69  ? 70  LEU C CG  1 
ATOM   6421  C CD1 . LEU D 2 46  ? 28.316  37.185  17.320  1.00 89.38  ? 70  LEU C CD1 1 
ATOM   6422  C CD2 . LEU D 2 46  ? 27.479  36.302  19.489  1.00 89.36  ? 70  LEU C CD2 1 
ATOM   6423  N N   . GLU D 2 47  ? 24.087  32.818  17.553  1.00 79.86  ? 71  GLU C N   1 
ATOM   6424  C CA  . GLU D 2 47  ? 22.811  32.515  16.914  1.00 80.26  ? 71  GLU C CA  1 
ATOM   6425  C C   . GLU D 2 47  ? 21.730  33.492  17.374  1.00 75.64  ? 71  GLU C C   1 
ATOM   6426  O O   . GLU D 2 47  ? 21.721  33.911  18.534  1.00 72.61  ? 71  GLU C O   1 
ATOM   6427  C CB  . GLU D 2 47  ? 22.375  31.083  17.224  1.00 85.62  ? 71  GLU C CB  1 
ATOM   6428  C CG  . GLU D 2 47  ? 21.999  30.838  18.681  1.00 93.61  ? 71  GLU C CG  1 
ATOM   6429  C CD  . GLU D 2 47  ? 21.290  29.513  18.898  1.00 95.10  ? 71  GLU C CD  1 
ATOM   6430  O OE1 . GLU D 2 47  ? 21.786  28.483  18.393  1.00 97.52  ? 71  GLU C OE1 1 
ATOM   6431  O OE2 . GLU D 2 47  ? 20.242  29.504  19.584  1.00 85.05  ? 71  GLU C OE2 1 
ATOM   6432  N N   . PRO D 2 48  ? 20.812  33.875  16.494  1.00 69.86  ? 72  PRO C N   1 
ATOM   6433  C CA  . PRO D 2 48  ? 19.697  34.725  16.916  1.00 71.58  ? 72  PRO C CA  1 
ATOM   6434  C C   . PRO D 2 48  ? 18.579  33.910  17.547  1.00 71.06  ? 72  PRO C C   1 
ATOM   6435  O O   . PRO D 2 48  ? 18.357  32.744  17.214  1.00 71.01  ? 72  PRO C O   1 
ATOM   6436  C CB  . PRO D 2 48  ? 19.239  35.375  15.607  1.00 74.05  ? 72  PRO C CB  1 
ATOM   6437  C CG  . PRO D 2 48  ? 19.564  34.356  14.572  1.00 74.38  ? 72  PRO C CG  1 
ATOM   6438  C CD  . PRO D 2 48  ? 20.816  33.650  15.038  1.00 73.13  ? 72  PRO C CD  1 
ATOM   6439  N N   . VAL D 2 49  ? 17.869  34.549  18.472  1.00 70.18  ? 73  VAL C N   1 
ATOM   6440  C CA  . VAL D 2 49  ? 16.800  33.914  19.233  1.00 71.90  ? 73  VAL C CA  1 
ATOM   6441  C C   . VAL D 2 49  ? 15.465  34.406  18.700  1.00 73.22  ? 73  VAL C C   1 
ATOM   6442  O O   . VAL D 2 49  ? 15.263  35.615  18.530  1.00 71.99  ? 73  VAL C O   1 
ATOM   6443  C CB  . VAL D 2 49  ? 16.932  34.216  20.735  1.00 73.73  ? 73  VAL C CB  1 
ATOM   6444  C CG1 . VAL D 2 49  ? 15.825  33.528  21.512  1.00 74.38  ? 73  VAL C CG1 1 
ATOM   6445  C CG2 . VAL D 2 49  ? 18.296  33.783  21.245  1.00 78.35  ? 73  VAL C CG2 1 
ATOM   6446  N N   . SER D 2 50  ? 14.554  33.475  18.435  1.00 78.22  ? 74  SER C N   1 
ATOM   6447  C CA  . SER D 2 50  ? 13.213  33.831  17.998  1.00 77.87  ? 74  SER C CA  1 
ATOM   6448  C C   . SER D 2 50  ? 12.389  34.304  19.186  1.00 76.69  ? 74  SER C C   1 
ATOM   6449  O O   . SER D 2 50  ? 12.478  33.744  20.282  1.00 77.79  ? 74  SER C O   1 
ATOM   6450  C CB  . SER D 2 50  ? 12.535  32.638  17.328  1.00 78.89  ? 74  SER C CB  1 
ATOM   6451  O OG  . SER D 2 50  ? 13.323  32.148  16.258  1.00 88.25  ? 74  SER C OG  1 
ATOM   6452  N N   . CYS D 2 51  ? 11.582  35.340  18.966  1.00 81.95  ? 75  CYS C N   1 
ATOM   6453  C CA  . CYS D 2 51  ? 10.839  35.974  20.044  1.00 82.80  ? 75  CYS C CA  1 
ATOM   6454  C C   . CYS D 2 51  ? 9.402   36.221  19.615  1.00 85.93  ? 75  CYS C C   1 
ATOM   6455  O O   . CYS D 2 51  ? 9.086   36.284  18.424  1.00 95.95  ? 75  CYS C O   1 
ATOM   6456  C CB  . CYS D 2 51  ? 11.484  37.297  20.470  1.00 82.32  ? 75  CYS C CB  1 
ATOM   6457  S SG  . CYS D 2 51  ? 13.152  37.115  21.117  1.00 84.92  ? 75  CYS C SG  1 
ATOM   6458  N N   . ASP D 2 52  ? 8.534   36.368  20.613  1.00 87.42  ? 76  ASP C N   1 
ATOM   6459  C CA  . ASP D 2 52  ? 7.137   36.717  20.407  1.00 90.91  ? 76  ASP C CA  1 
ATOM   6460  C C   . ASP D 2 52  ? 6.789   37.914  21.277  1.00 90.95  ? 76  ASP C C   1 
ATOM   6461  O O   . ASP D 2 52  ? 7.393   38.133  22.332  1.00 90.71  ? 76  ASP C O   1 
ATOM   6462  C CB  . ASP D 2 52  ? 6.205   35.542  20.735  1.00 93.63  ? 76  ASP C CB  1 
ATOM   6463  C CG  . ASP D 2 52  ? 6.399   34.365  19.800  1.00 97.77  ? 76  ASP C CG  1 
ATOM   6464  O OD1 . ASP D 2 52  ? 6.414   34.576  18.568  1.00 97.06  ? 76  ASP C OD1 1 
ATOM   6465  O OD2 . ASP D 2 52  ? 6.535   33.227  20.297  1.00 110.02 ? 76  ASP C OD2 1 
ATOM   6466  N N   . LEU D 2 53  ? 5.816   38.697  20.822  1.00 90.86  ? 77  LEU C N   1 
ATOM   6467  C CA  . LEU D 2 53  ? 5.393   39.874  21.569  1.00 91.63  ? 77  LEU C CA  1 
ATOM   6468  C C   . LEU D 2 53  ? 4.581   39.441  22.784  1.00 89.60  ? 77  LEU C C   1 
ATOM   6469  O O   . LEU D 2 53  ? 3.528   38.810  22.642  1.00 88.83  ? 77  LEU C O   1 
ATOM   6470  C CB  . LEU D 2 53  ? 4.574   40.808  20.681  1.00 91.62  ? 77  LEU C CB  1 
ATOM   6471  C CG  . LEU D 2 53  ? 5.192   41.284  19.363  1.00 92.31  ? 77  LEU C CG  1 
ATOM   6472  C CD1 . LEU D 2 53  ? 4.875   40.329  18.214  1.00 92.16  ? 77  LEU C CD1 1 
ATOM   6473  C CD2 . LEU D 2 53  ? 4.725   42.692  19.043  1.00 91.29  ? 77  LEU C CD2 1 
ATOM   6474  N N   . SER D 2 54  ? 5.068   39.774  23.973  1.00 91.46  ? 78  SER C N   1 
ATOM   6475  C CA  . SER D 2 54  ? 4.423   39.395  25.221  1.00 92.03  ? 78  SER C CA  1 
ATOM   6476  C C   . SER D 2 54  ? 3.534   40.522  25.733  1.00 90.28  ? 78  SER C C   1 
ATOM   6477  O O   . SER D 2 54  ? 3.627   41.672  25.297  1.00 88.77  ? 78  SER C O   1 
ATOM   6478  C CB  . SER D 2 54  ? 5.464   39.027  26.283  1.00 95.87  ? 78  SER C CB  1 
ATOM   6479  O OG  . SER D 2 54  ? 4.876   38.942  27.571  1.00 97.75  ? 78  SER C OG  1 
ATOM   6480  N N   . ASP D 2 55  ? 2.660   40.169  26.674  1.00 96.97  ? 79  ASP C N   1 
ATOM   6481  C CA  . ASP D 2 55  ? 1.733   41.113  27.280  1.00 96.86  ? 79  ASP C CA  1 
ATOM   6482  C C   . ASP D 2 55  ? 2.090   41.456  28.718  1.00 93.98  ? 79  ASP C C   1 
ATOM   6483  O O   . ASP D 2 55  ? 1.381   42.253  29.341  1.00 98.64  ? 79  ASP C O   1 
ATOM   6484  C CB  . ASP D 2 55  ? 0.302   40.561  27.226  1.00 99.79  ? 79  ASP C CB  1 
ATOM   6485  C CG  . ASP D 2 55  ? -0.264  40.532  25.817  1.00 104.30 ? 79  ASP C CG  1 
ATOM   6486  O OD1 . ASP D 2 55  ? 0.482   40.847  24.865  1.00 111.40 ? 79  ASP C OD1 1 
ATOM   6487  O OD2 . ASP D 2 55  ? -1.458  40.195  25.662  1.00 104.63 ? 79  ASP C OD2 1 
ATOM   6488  N N   . ASP D 2 56  ? 3.164   40.887  29.261  1.00 92.15  ? 80  ASP C N   1 
ATOM   6489  C CA  . ASP D 2 56  ? 3.519   41.093  30.657  1.00 94.80  ? 80  ASP C CA  1 
ATOM   6490  C C   . ASP D 2 56  ? 5.023   41.268  30.795  1.00 91.86  ? 80  ASP C C   1 
ATOM   6491  O O   . ASP D 2 56  ? 5.807   40.727  30.010  1.00 91.66  ? 80  ASP C O   1 
ATOM   6492  C CB  . ASP D 2 56  ? 3.064   39.920  31.539  1.00 98.22  ? 80  ASP C CB  1 
ATOM   6493  C CG  . ASP D 2 56  ? 1.560   39.875  31.729  1.00 99.83  ? 80  ASP C CG  1 
ATOM   6494  O OD1 . ASP D 2 56  ? 0.934   40.954  31.807  1.00 104.91 ? 80  ASP C OD1 1 
ATOM   6495  O OD2 . ASP D 2 56  ? 1.006   38.757  31.806  1.00 96.62  ? 80  ASP C OD2 1 
ATOM   6496  N N   . MET D 2 57  ? 5.415   42.029  31.818  1.00 84.70  ? 81  MET C N   1 
ATOM   6497  C CA  . MET D 2 57  ? 6.804   42.148  32.257  1.00 86.85  ? 81  MET C CA  1 
ATOM   6498  C C   . MET D 2 57  ? 6.866   41.626  33.688  1.00 85.59  ? 81  MET C C   1 
ATOM   6499  O O   . MET D 2 57  ? 6.949   42.412  34.645  1.00 86.94  ? 81  MET C O   1 
ATOM   6500  C CB  . MET D 2 57  ? 7.304   43.589  32.166  1.00 88.46  ? 81  MET C CB  1 
ATOM   6501  C CG  . MET D 2 57  ? 7.729   44.026  30.774  1.00 87.61  ? 81  MET C CG  1 
ATOM   6502  S SD  . MET D 2 57  ? 8.991   42.958  30.050  1.00 92.97  ? 81  MET C SD  1 
ATOM   6503  C CE  . MET D 2 57  ? 10.245  42.954  31.329  1.00 93.97  ? 81  MET C CE  1 
ATOM   6504  N N   . PRO D 2 58  ? 6.818   40.303  33.876  1.00 79.96  ? 82  PRO C N   1 
ATOM   6505  C CA  . PRO D 2 58  ? 6.740   39.757  35.237  1.00 80.06  ? 82  PRO C CA  1 
ATOM   6506  C C   . PRO D 2 58  ? 8.072   39.761  35.967  1.00 81.12  ? 82  PRO C C   1 
ATOM   6507  O O   . PRO D 2 58  ? 8.117   39.965  37.184  1.00 84.56  ? 82  PRO C O   1 
ATOM   6508  C CB  . PRO D 2 58  ? 6.239   38.328  35.004  1.00 78.26  ? 82  PRO C CB  1 
ATOM   6509  C CG  . PRO D 2 58  ? 6.762   37.974  33.658  1.00 78.87  ? 82  PRO C CG  1 
ATOM   6510  C CD  . PRO D 2 58  ? 6.759   39.246  32.851  1.00 79.81  ? 82  PRO C CD  1 
ATOM   6511  N N   . TRP D 2 59  ? 9.163   39.541  35.236  1.00 79.99  ? 83  TRP C N   1 
ATOM   6512  C CA  . TRP D 2 59  ? 10.471  39.376  35.859  1.00 81.63  ? 83  TRP C CA  1 
ATOM   6513  C C   . TRP D 2 59  ? 11.227  40.684  36.041  1.00 82.38  ? 83  TRP C C   1 
ATOM   6514  O O   . TRP D 2 59  ? 11.947  40.838  37.035  1.00 81.01  ? 83  TRP C O   1 
ATOM   6515  C CB  . TRP D 2 59  ? 11.332  38.420  35.031  1.00 81.73  ? 83  TRP C CB  1 
ATOM   6516  C CG  . TRP D 2 59  ? 10.777  37.039  34.920  1.00 79.13  ? 83  TRP C CG  1 
ATOM   6517  C CD1 . TRP D 2 59  ? 9.989   36.398  35.827  1.00 79.76  ? 83  TRP C CD1 1 
ATOM   6518  C CD2 . TRP D 2 59  ? 10.982  36.118  33.844  1.00 78.57  ? 83  TRP C CD2 1 
ATOM   6519  N NE1 . TRP D 2 59  ? 9.685   35.135  35.380  1.00 81.86  ? 83  TRP C NE1 1 
ATOM   6520  C CE2 . TRP D 2 59  ? 10.284  34.939  34.164  1.00 78.78  ? 83  TRP C CE2 1 
ATOM   6521  C CE3 . TRP D 2 59  ? 11.687  36.177  32.639  1.00 82.13  ? 83  TRP C CE3 1 
ATOM   6522  C CZ2 . TRP D 2 59  ? 10.270  33.828  33.324  1.00 80.59  ? 83  TRP C CZ2 1 
ATOM   6523  C CZ3 . TRP D 2 59  ? 11.673  35.074  31.808  1.00 81.02  ? 83  TRP C CZ3 1 
ATOM   6524  C CH2 . TRP D 2 59  ? 10.969  33.916  32.153  1.00 80.40  ? 83  TRP C CH2 1 
ATOM   6525  N N   . SER D 2 60  ? 11.094  41.625  35.111  1.00 84.62  ? 84  SER C N   1 
ATOM   6526  C CA  . SER D 2 60  ? 11.929  42.816  35.099  1.00 85.98  ? 84  SER C CA  1 
ATOM   6527  C C   . SER D 2 60  ? 11.061  44.063  35.052  1.00 86.25  ? 84  SER C C   1 
ATOM   6528  O O   . SER D 2 60  ? 10.109  44.133  34.269  1.00 87.80  ? 84  SER C O   1 
ATOM   6529  C CB  . SER D 2 60  ? 12.887  42.795  33.905  1.00 88.86  ? 84  SER C CB  1 
ATOM   6530  O OG  . SER D 2 60  ? 14.076  43.510  34.190  1.00 90.67  ? 84  SER C OG  1 
ATOM   6531  N N   . ALA D 2 61  ? 11.395  45.041  35.889  1.00 90.67  ? 85  ALA C N   1 
ATOM   6532  C CA  . ALA D 2 61  ? 10.699  46.319  35.859  1.00 91.29  ? 85  ALA C CA  1 
ATOM   6533  C C   . ALA D 2 61  ? 11.121  47.107  34.627  1.00 90.37  ? 85  ALA C C   1 
ATOM   6534  O O   . ALA D 2 61  ? 12.311  47.196  34.309  1.00 90.03  ? 85  ALA C O   1 
ATOM   6535  C CB  . ALA D 2 61  ? 10.991  47.117  37.128  1.00 91.40  ? 85  ALA C CB  1 
ATOM   6536  N N   . CYS D 2 62  ? 10.145  47.674  33.931  1.00 92.42  ? 86  CYS C N   1 
ATOM   6537  C CA  . CYS D 2 62  ? 10.527  48.432  32.749  1.00 91.68  ? 86  CYS C CA  1 
ATOM   6538  C C   . CYS D 2 62  ? 10.707  49.908  33.107  1.00 94.93  ? 86  CYS C C   1 
ATOM   6539  O O   . CYS D 2 62  ? 9.882   50.476  33.831  1.00 101.72 ? 86  CYS C O   1 
ATOM   6540  C CB  . CYS D 2 62  ? 9.473   48.286  31.662  1.00 92.56  ? 86  CYS C CB  1 
ATOM   6541  S SG  . CYS D 2 62  ? 10.054  48.674  30.002  1.00 100.24 ? 86  CYS C SG  1 
ATOM   6542  N N   . PRO D 2 63  ? 11.778  50.548  32.636  1.00 96.27  ? 87  PRO C N   1 
ATOM   6543  C CA  . PRO D 2 63  ? 12.102  51.917  33.080  1.00 99.64  ? 87  PRO C CA  1 
ATOM   6544  C C   . PRO D 2 63  ? 11.603  53.039  32.173  1.00 100.51 ? 87  PRO C C   1 
ATOM   6545  O O   . PRO D 2 63  ? 12.028  54.183  32.368  1.00 107.42 ? 87  PRO C O   1 
ATOM   6546  C CB  . PRO D 2 63  ? 13.633  51.883  33.085  1.00 94.87  ? 87  PRO C CB  1 
ATOM   6547  C CG  . PRO D 2 63  ? 13.965  51.009  31.910  1.00 94.93  ? 87  PRO C CG  1 
ATOM   6548  C CD  . PRO D 2 63  ? 12.845  49.987  31.790  1.00 94.76  ? 87  PRO C CD  1 
ATOM   6549  N N   . HIS D 2 64  ? 10.725  52.754  31.214  1.00 93.72  ? 88  HIS C N   1 
ATOM   6550  C CA  . HIS D 2 64  ? 10.244  53.745  30.269  1.00 95.04  ? 88  HIS C CA  1 
ATOM   6551  C C   . HIS D 2 64  ? 8.753   53.495  30.086  1.00 97.88  ? 88  HIS C C   1 
ATOM   6552  O O   . HIS D 2 64  ? 8.329   52.336  30.025  1.00 99.36  ? 88  HIS C O   1 
ATOM   6553  C CB  . HIS D 2 64  ? 10.994  53.626  28.935  1.00 94.22  ? 88  HIS C CB  1 
ATOM   6554  C CG  . HIS D 2 64  ? 10.632  54.671  27.928  1.00 96.21  ? 88  HIS C CG  1 
ATOM   6555  N ND1 . HIS D 2 64  ? 9.383   54.752  27.350  1.00 96.10  ? 88  HIS C ND1 1 
ATOM   6556  C CD2 . HIS D 2 64  ? 11.364  55.671  27.382  1.00 98.34  ? 88  HIS C CD2 1 
ATOM   6557  C CE1 . HIS D 2 64  ? 9.358   55.762  26.500  1.00 97.43  ? 88  HIS C CE1 1 
ATOM   6558  N NE2 . HIS D 2 64  ? 10.548  56.336  26.500  1.00 99.76  ? 88  HIS C NE2 1 
ATOM   6559  N N   . PRO D 2 65  ? 7.930   54.540  30.021  1.00 99.63  ? 89  PRO C N   1 
ATOM   6560  C CA  . PRO D 2 65  ? 6.477   54.317  30.047  1.00 98.10  ? 89  PRO C CA  1 
ATOM   6561  C C   . PRO D 2 65  ? 5.861   53.913  28.713  1.00 93.91  ? 89  PRO C C   1 
ATOM   6562  O O   . PRO D 2 65  ? 4.650   54.075  28.531  1.00 97.38  ? 89  PRO C O   1 
ATOM   6563  C CB  . PRO D 2 65  ? 5.933   55.670  30.519  1.00 102.63 ? 89  PRO C CB  1 
ATOM   6564  C CG  . PRO D 2 65  ? 6.923   56.650  30.009  1.00 104.33 ? 89  PRO C CG  1 
ATOM   6565  C CD  . PRO D 2 65  ? 8.268   55.973  30.100  1.00 104.17 ? 89  PRO C CD  1 
ATOM   6566  N N   . ARG D 2 66  ? 6.650   53.382  27.780  1.00 91.16  ? 90  ARG C N   1 
ATOM   6567  C CA  . ARG D 2 66  ? 6.116   52.921  26.497  1.00 96.97  ? 90  ARG C CA  1 
ATOM   6568  C C   . ARG D 2 66  ? 6.853   51.667  26.026  1.00 96.19  ? 90  ARG C C   1 
ATOM   6569  O O   . ARG D 2 66  ? 7.363   51.608  24.907  1.00 97.39  ? 90  ARG C O   1 
ATOM   6570  C CB  . ARG D 2 66  ? 6.220   54.000  25.418  1.00 100.45 ? 90  ARG C CB  1 
ATOM   6571  C CG  . ARG D 2 66  ? 5.585   55.348  25.727  1.00 100.38 ? 90  ARG C CG  1 
ATOM   6572  C CD  . ARG D 2 66  ? 5.833   56.303  24.564  1.00 97.81  ? 90  ARG C CD  1 
ATOM   6573  N NE  . ARG D 2 66  ? 5.488   57.685  24.877  1.00 97.00  ? 90  ARG C NE  1 
ATOM   6574  C CZ  . ARG D 2 66  ? 6.308   58.546  25.470  1.00 92.83  ? 90  ARG C CZ  1 
ATOM   6575  N NH1 . ARG D 2 66  ? 7.535   58.176  25.812  1.00 89.10  ? 90  ARG C NH1 1 
ATOM   6576  N NH2 . ARG D 2 66  ? 5.907   59.785  25.713  1.00 94.82  ? 90  ARG C NH2 1 
ATOM   6577  N N   . CYS D 2 67  ? 6.913   50.638  26.871  1.00 96.47  ? 91  CYS C N   1 
ATOM   6578  C CA  . CYS D 2 67  ? 7.645   49.433  26.496  1.00 93.23  ? 91  CYS C CA  1 
ATOM   6579  C C   . CYS D 2 67  ? 6.834   48.574  25.533  1.00 90.10  ? 91  CYS C C   1 
ATOM   6580  O O   . CYS D 2 67  ? 5.604   48.644  25.473  1.00 92.58  ? 91  CYS C O   1 
ATOM   6581  C CB  . CYS D 2 67  ? 8.005   48.594  27.722  1.00 94.02  ? 91  CYS C CB  1 
ATOM   6582  S SG  . CYS D 2 67  ? 8.446   49.572  29.150  1.00 105.32 ? 91  CYS C SG  1 
ATOM   6583  N N   . VAL D 2 68  ? 7.550   47.749  24.779  1.00 82.46  ? 92  VAL C N   1 
ATOM   6584  C CA  . VAL D 2 68  ? 6.941   46.707  23.961  1.00 84.08  ? 92  VAL C CA  1 
ATOM   6585  C C   . VAL D 2 68  ? 7.573   45.386  24.381  1.00 85.10  ? 92  VAL C C   1 
ATOM   6586  O O   . VAL D 2 68  ? 8.584   44.967  23.799  1.00 86.19  ? 92  VAL C O   1 
ATOM   6587  C CB  . VAL D 2 68  ? 7.131   46.983  22.463  1.00 87.00  ? 92  VAL C CB  1 
ATOM   6588  C CG1 . VAL D 2 68  ? 6.525   45.860  21.636  1.00 89.76  ? 92  VAL C CG1 1 
ATOM   6589  C CG2 . VAL D 2 68  ? 6.513   48.321  22.095  1.00 90.13  ? 92  VAL C CG2 1 
ATOM   6590  N N   . PRO D 2 69  ? 7.026   44.708  25.386  1.00 84.88  ? 93  PRO C N   1 
ATOM   6591  C CA  . PRO D 2 69  ? 7.705   43.533  25.939  1.00 85.55  ? 93  PRO C CA  1 
ATOM   6592  C C   . PRO D 2 69  ? 7.675   42.350  24.985  1.00 84.27  ? 93  PRO C C   1 
ATOM   6593  O O   . PRO D 2 69  ? 6.898   42.295  24.028  1.00 82.05  ? 93  PRO C O   1 
ATOM   6594  C CB  . PRO D 2 69  ? 6.916   43.242  27.219  1.00 87.37  ? 93  PRO C CB  1 
ATOM   6595  C CG  . PRO D 2 69  ? 5.555   43.771  26.937  1.00 88.20  ? 93  PRO C CG  1 
ATOM   6596  C CD  . PRO D 2 69  ? 5.740   44.974  26.053  1.00 86.26  ? 93  PRO C CD  1 
ATOM   6597  N N   . ARG D 2 70  ? 8.551   41.388  25.270  1.00 80.64  ? 94  ARG C N   1 
ATOM   6598  C CA  . ARG D 2 70  ? 8.751   40.216  24.436  1.00 79.30  ? 94  ARG C CA  1 
ATOM   6599  C C   . ARG D 2 70  ? 9.158   39.043  25.312  1.00 80.50  ? 94  ARG C C   1 
ATOM   6600  O O   . ARG D 2 70  ? 9.910   39.207  26.282  1.00 81.45  ? 94  ARG C O   1 
ATOM   6601  C CB  . ARG D 2 70  ? 9.832   40.443  23.375  1.00 79.71  ? 94  ARG C CB  1 
ATOM   6602  C CG  . ARG D 2 70  ? 9.429   41.346  22.233  1.00 82.99  ? 94  ARG C CG  1 
ATOM   6603  C CD  . ARG D 2 70  ? 10.554  41.419  21.219  1.00 85.21  ? 94  ARG C CD  1 
ATOM   6604  N NE  . ARG D 2 70  ? 10.380  42.502  20.259  1.00 84.03  ? 94  ARG C NE  1 
ATOM   6605  C CZ  . ARG D 2 70  ? 10.568  43.786  20.544  1.00 82.53  ? 94  ARG C CZ  1 
ATOM   6606  N NH1 . ARG D 2 70  ? 10.936  44.150  21.765  1.00 79.83  ? 94  ARG C NH1 1 
ATOM   6607  N NH2 . ARG D 2 70  ? 10.393  44.706  19.608  1.00 87.79  ? 94  ARG C NH2 1 
ATOM   6608  N N   . ARG D 2 71  ? 8.674   37.859  24.933  1.00 81.16  ? 95  ARG C N   1 
ATOM   6609  C CA  . ARG D 2 71  ? 8.942   36.599  25.624  1.00 81.15  ? 95  ARG C CA  1 
ATOM   6610  C C   . ARG D 2 71  ? 9.492   35.607  24.603  1.00 79.84  ? 95  ARG C C   1 
ATOM   6611  O O   . ARG D 2 71  ? 8.733   35.024  23.822  1.00 80.10  ? 95  ARG C O   1 
ATOM   6612  C CB  . ARG D 2 71  ? 7.677   36.066  26.288  1.00 85.52  ? 95  ARG C CB  1 
ATOM   6613  C CG  . ARG D 2 71  ? 7.831   34.714  26.965  1.00 86.02  ? 95  ARG C CG  1 
ATOM   6614  C CD  . ARG D 2 71  ? 6.477   34.043  27.135  1.00 86.22  ? 95  ARG C CD  1 
ATOM   6615  N NE  . ARG D 2 71  ? 6.228   33.051  26.092  1.00 85.76  ? 95  ARG C NE  1 
ATOM   6616  C CZ  . ARG D 2 71  ? 6.259   31.738  26.292  1.00 86.03  ? 95  ARG C CZ  1 
ATOM   6617  N NH1 . ARG D 2 71  ? 6.524   31.259  27.501  1.00 88.62  ? 95  ARG C NH1 1 
ATOM   6618  N NH2 . ARG D 2 71  ? 6.024   30.906  25.287  1.00 83.70  ? 95  ARG C NH2 1 
ATOM   6619  N N   . CYS D 2 72  ? 10.807  35.421  24.608  1.00 78.32  ? 96  CYS C N   1 
ATOM   6620  C CA  . CYS D 2 72  ? 11.458  34.447  23.746  1.00 78.03  ? 96  CYS C CA  1 
ATOM   6621  C C   . CYS D 2 72  ? 11.641  33.146  24.512  1.00 76.31  ? 96  CYS C C   1 
ATOM   6622  O O   . CYS D 2 72  ? 11.844  33.148  25.727  1.00 75.48  ? 96  CYS C O   1 
ATOM   6623  C CB  . CYS D 2 72  ? 12.818  34.963  23.277  1.00 79.72  ? 96  CYS C CB  1 
ATOM   6624  S SG  . CYS D 2 72  ? 12.889  36.761  23.101  1.00 88.64  ? 96  CYS C SG  1 
ATOM   6625  N N   . VAL D 2 73  ? 11.566  32.028  23.799  1.00 71.42  ? 97  VAL C N   1 
ATOM   6626  C CA  . VAL D 2 73  ? 11.767  30.708  24.391  1.00 71.99  ? 97  VAL C CA  1 
ATOM   6627  C C   . VAL D 2 73  ? 12.711  29.930  23.479  1.00 71.65  ? 97  VAL C C   1 
ATOM   6628  O O   . VAL D 2 73  ? 12.301  29.414  22.432  1.00 72.75  ? 97  VAL C O   1 
ATOM   6629  C CB  . VAL D 2 73  ? 10.447  29.960  24.632  1.00 75.18  ? 97  VAL C CB  1 
ATOM   6630  C CG1 . VAL D 2 73  ? 9.537   30.009  23.409  1.00 82.88  ? 97  VAL C CG1 1 
ATOM   6631  C CG2 . VAL D 2 73  ? 10.722  28.523  25.037  1.00 77.35  ? 97  VAL C CG2 1 
ATOM   6632  N N   . ILE D 2 74  ? 13.976  29.854  23.866  1.00 72.94  ? 98  ILE C N   1 
ATOM   6633  C CA  . ILE D 2 74  ? 15.012  29.196  23.072  1.00 73.90  ? 98  ILE C CA  1 
ATOM   6634  C C   . ILE D 2 74  ? 15.332  27.858  23.726  1.00 67.40  ? 98  ILE C C   1 
ATOM   6635  O O   . ILE D 2 74  ? 15.562  27.820  24.940  1.00 63.87  ? 98  ILE C O   1 
ATOM   6636  C CB  . ILE D 2 74  ? 16.278  30.069  22.939  1.00 81.70  ? 98  ILE C CB  1 
ATOM   6637  C CG1 . ILE D 2 74  ? 17.379  29.315  22.181  1.00 92.17  ? 98  ILE C CG1 1 
ATOM   6638  C CG2 . ILE D 2 74  ? 16.768  30.577  24.300  1.00 75.13  ? 98  ILE C CG2 1 
ATOM   6639  C CD1 . ILE D 2 74  ? 17.216  29.346  20.666  1.00 94.60  ? 98  ILE C CD1 1 
ATOM   6640  N N   . PRO D 2 75  ? 15.324  26.754  22.985  1.00 73.43  ? 99  PRO C N   1 
ATOM   6641  C CA  . PRO D 2 75  ? 15.553  25.449  23.617  1.00 75.50  ? 99  PRO C CA  1 
ATOM   6642  C C   . PRO D 2 75  ? 17.016  25.033  23.654  1.00 77.64  ? 99  PRO C C   1 
ATOM   6643  O O   . PRO D 2 75  ? 17.558  24.555  22.653  1.00 80.62  ? 99  PRO C O   1 
ATOM   6644  C CB  . PRO D 2 75  ? 14.726  24.501  22.743  1.00 73.47  ? 99  PRO C CB  1 
ATOM   6645  C CG  . PRO D 2 75  ? 14.775  25.126  21.385  1.00 73.56  ? 99  PRO C CG  1 
ATOM   6646  C CD  . PRO D 2 75  ? 14.899  26.622  21.581  1.00 73.80  ? 99  PRO C CD  1 
ATOM   6647  N N   . CYS D 2 76  ? 17.666  25.213  24.801  1.00 83.20  ? 100 CYS C N   1 
ATOM   6648  C CA  . CYS D 2 76  ? 18.983  24.630  24.994  1.00 85.50  ? 100 CYS C CA  1 
ATOM   6649  C C   . CYS D 2 76  ? 18.846  23.123  25.187  1.00 85.41  ? 100 CYS C C   1 
ATOM   6650  O O   . CYS D 2 76  ? 17.801  22.618  25.603  1.00 78.88  ? 100 CYS C O   1 
ATOM   6651  C CB  . CYS D 2 76  ? 19.690  25.266  26.192  1.00 84.64  ? 100 CYS C CB  1 
ATOM   6652  S SG  . CYS D 2 76  ? 21.503  25.313  26.074  1.00 85.53  ? 100 CYS C SG  1 
ATOM   6653  N N   . GLN D 2 77  ? 19.912  22.394  24.861  1.00 89.41  ? 101 GLN C N   1 
ATOM   6654  C CA  . GLN D 2 77  ? 19.827  20.939  24.846  1.00 88.37  ? 101 GLN C CA  1 
ATOM   6655  C C   . GLN D 2 77  ? 20.374  20.278  26.104  1.00 83.33  ? 101 GLN C C   1 
ATOM   6656  O O   . GLN D 2 77  ? 19.869  19.222  26.499  1.00 83.09  ? 101 GLN C O   1 
ATOM   6657  C CB  . GLN D 2 77  ? 20.551  20.374  23.621  1.00 91.65  ? 101 GLN C CB  1 
ATOM   6658  C CG  . GLN D 2 77  ? 20.048  18.998  23.217  1.00 91.80  ? 101 GLN C CG  1 
ATOM   6659  C CD  . GLN D 2 77  ? 20.964  18.302  22.235  1.00 92.89  ? 101 GLN C CD  1 
ATOM   6660  O OE1 . GLN D 2 77  ? 21.140  17.085  22.288  1.00 96.54  ? 101 GLN C OE1 1 
ATOM   6661  N NE2 . GLN D 2 77  ? 21.548  19.072  21.322  1.00 95.23  ? 101 GLN C NE2 1 
ATOM   6662  N N   . SER D 2 78  ? 21.381  20.864  26.750  1.00 82.71  ? 102 SER C N   1 
ATOM   6663  C CA  . SER D 2 78  ? 21.907  20.311  27.991  1.00 82.54  ? 102 SER C CA  1 
ATOM   6664  C C   . SER D 2 78  ? 22.374  21.446  28.891  1.00 80.26  ? 102 SER C C   1 
ATOM   6665  O O   . SER D 2 78  ? 22.768  22.514  28.416  1.00 76.80  ? 102 SER C O   1 
ATOM   6666  C CB  . SER D 2 78  ? 23.058  19.330  27.736  1.00 79.47  ? 102 SER C CB  1 
ATOM   6667  O OG  . SER D 2 78  ? 24.315  19.972  27.868  1.00 76.62  ? 102 SER C OG  1 
ATOM   6668  N N   . PHE D 2 79  ? 22.328  21.198  30.200  1.00 74.20  ? 103 PHE C N   1 
ATOM   6669  C CA  . PHE D 2 79  ? 22.680  22.194  31.200  1.00 71.22  ? 103 PHE C CA  1 
ATOM   6670  C C   . PHE D 2 79  ? 23.706  21.626  32.170  1.00 70.57  ? 103 PHE C C   1 
ATOM   6671  O O   . PHE D 2 79  ? 23.695  20.434  32.491  1.00 73.23  ? 103 PHE C O   1 
ATOM   6672  C CB  . PHE D 2 79  ? 21.449  22.670  31.980  1.00 71.01  ? 103 PHE C CB  1 
ATOM   6673  C CG  . PHE D 2 79  ? 20.501  23.497  31.167  1.00 70.66  ? 103 PHE C CG  1 
ATOM   6674  C CD1 . PHE D 2 79  ? 20.680  24.863  31.049  1.00 72.17  ? 103 PHE C CD1 1 
ATOM   6675  C CD2 . PHE D 2 79  ? 19.425  22.909  30.525  1.00 71.87  ? 103 PHE C CD2 1 
ATOM   6676  C CE1 . PHE D 2 79  ? 19.806  25.628  30.302  1.00 73.88  ? 103 PHE C CE1 1 
ATOM   6677  C CE2 . PHE D 2 79  ? 18.547  23.669  29.777  1.00 73.68  ? 103 PHE C CE2 1 
ATOM   6678  C CZ  . PHE D 2 79  ? 18.738  25.029  29.665  1.00 75.17  ? 103 PHE C CZ  1 
ATOM   6679  N N   . VAL D 2 80  ? 24.588  22.506  32.640  1.00 70.93  ? 104 VAL C N   1 
ATOM   6680  C CA  . VAL D 2 80  ? 25.662  22.154  33.561  1.00 71.32  ? 104 VAL C CA  1 
ATOM   6681  C C   . VAL D 2 80  ? 25.861  23.335  34.505  1.00 72.82  ? 104 VAL C C   1 
ATOM   6682  O O   . VAL D 2 80  ? 25.609  24.487  34.141  1.00 73.70  ? 104 VAL C O   1 
ATOM   6683  C CB  . VAL D 2 80  ? 26.960  21.796  32.790  1.00 69.22  ? 104 VAL C CB  1 
ATOM   6684  C CG1 . VAL D 2 80  ? 28.176  21.874  33.680  1.00 72.61  ? 104 VAL C CG1 1 
ATOM   6685  C CG2 . VAL D 2 80  ? 26.858  20.406  32.187  1.00 67.31  ? 104 VAL C CG2 1 
ATOM   6686  N N   . VAL D 2 81  ? 26.276  23.040  35.743  1.00 65.21  ? 105 VAL C N   1 
ATOM   6687  C CA  . VAL D 2 81  ? 26.594  24.102  36.699  1.00 71.78  ? 105 VAL C CA  1 
ATOM   6688  C C   . VAL D 2 81  ? 27.571  25.101  36.089  1.00 73.49  ? 105 VAL C C   1 
ATOM   6689  O O   . VAL D 2 81  ? 27.430  26.318  36.260  1.00 76.90  ? 105 VAL C O   1 
ATOM   6690  C CB  . VAL D 2 81  ? 27.147  23.498  38.003  1.00 78.32  ? 105 VAL C CB  1 
ATOM   6691  C CG1 . VAL D 2 81  ? 27.775  24.582  38.869  1.00 85.25  ? 105 VAL C CG1 1 
ATOM   6692  C CG2 . VAL D 2 81  ? 26.043  22.797  38.762  1.00 76.61  ? 105 VAL C CG2 1 
ATOM   6693  N N   . THR D 2 82  ? 28.571  24.599  35.361  1.00 74.69  ? 106 THR C N   1 
ATOM   6694  C CA  . THR D 2 82  ? 29.527  25.471  34.685  1.00 72.70  ? 106 THR C CA  1 
ATOM   6695  C C   . THR D 2 82  ? 28.839  26.398  33.689  1.00 73.55  ? 106 THR C C   1 
ATOM   6696  O O   . THR D 2 82  ? 29.189  27.580  33.587  1.00 73.50  ? 106 THR C O   1 
ATOM   6697  C CB  . THR D 2 82  ? 30.580  24.621  33.972  1.00 72.71  ? 106 THR C CB  1 
ATOM   6698  O OG1 . THR D 2 82  ? 31.432  23.996  34.939  1.00 72.35  ? 106 THR C OG1 1 
ATOM   6699  C CG2 . THR D 2 82  ? 31.413  25.470  33.017  1.00 73.21  ? 106 THR C CG2 1 
ATOM   6700  N N   . ASP D 2 83  ? 27.848  25.882  32.962  1.00 74.57  ? 107 ASP C N   1 
ATOM   6701  C CA  . ASP D 2 83  ? 27.271  26.586  31.821  1.00 72.56  ? 107 ASP C CA  1 
ATOM   6702  C C   . ASP D 2 83  ? 26.766  27.970  32.205  1.00 70.28  ? 107 ASP C C   1 
ATOM   6703  O O   . ASP D 2 83  ? 25.951  28.117  33.121  1.00 71.94  ? 107 ASP C O   1 
ATOM   6704  C CB  . ASP D 2 83  ? 26.136  25.758  31.220  1.00 75.35  ? 107 ASP C CB  1 
ATOM   6705  C CG  . ASP D 2 83  ? 26.638  24.682  30.275  1.00 79.92  ? 107 ASP C CG  1 
ATOM   6706  O OD1 . ASP D 2 83  ? 27.787  24.798  29.797  1.00 84.02  ? 107 ASP C OD1 1 
ATOM   6707  O OD2 . ASP D 2 83  ? 25.886  23.718  30.014  1.00 86.08  ? 107 ASP C OD2 1 
ATOM   6708  N N   . VAL D 2 84  ? 27.262  28.981  31.496  1.00 71.32  ? 108 VAL C N   1 
ATOM   6709  C CA  . VAL D 2 84  ? 26.784  30.352  31.598  1.00 69.72  ? 108 VAL C CA  1 
ATOM   6710  C C   . VAL D 2 84  ? 26.526  30.864  30.187  1.00 70.04  ? 108 VAL C C   1 
ATOM   6711  O O   . VAL D 2 84  ? 27.311  30.602  29.268  1.00 71.26  ? 108 VAL C O   1 
ATOM   6712  C CB  . VAL D 2 84  ? 27.789  31.252  32.349  1.00 69.81  ? 108 VAL C CB  1 
ATOM   6713  C CG1 . VAL D 2 84  ? 29.166  31.184  31.704  1.00 72.50  ? 108 VAL C CG1 1 
ATOM   6714  C CG2 . VAL D 2 84  ? 27.285  32.684  32.407  1.00 69.97  ? 108 VAL C CG2 1 
ATOM   6715  N N   . ASP D 2 85  ? 25.416  31.573  30.009  1.00 72.86  ? 109 ASP C N   1 
ATOM   6716  C CA  . ASP D 2 85  ? 24.988  32.039  28.698  1.00 76.16  ? 109 ASP C CA  1 
ATOM   6717  C C   . ASP D 2 85  ? 25.396  33.491  28.478  1.00 78.15  ? 109 ASP C C   1 
ATOM   6718  O O   . ASP D 2 85  ? 25.498  34.277  29.423  1.00 85.75  ? 109 ASP C O   1 
ATOM   6719  C CB  . ASP D 2 85  ? 23.475  31.896  28.542  1.00 78.85  ? 109 ASP C CB  1 
ATOM   6720  C CG  . ASP D 2 85  ? 23.069  30.509  28.099  1.00 83.77  ? 109 ASP C CG  1 
ATOM   6721  O OD1 . ASP D 2 85  ? 23.572  30.048  27.051  1.00 86.57  ? 109 ASP C OD1 1 
ATOM   6722  O OD2 . ASP D 2 85  ? 22.258  29.873  28.806  1.00 89.91  ? 109 ASP C OD2 1 
ATOM   6723  N N   . TYR D 2 86  ? 25.619  33.842  27.212  1.00 76.90  ? 110 TYR C N   1 
ATOM   6724  C CA  . TYR D 2 86  ? 26.086  35.174  26.828  1.00 75.51  ? 110 TYR C CA  1 
ATOM   6725  C C   . TYR D 2 86  ? 25.080  35.780  25.853  1.00 73.07  ? 110 TYR C C   1 
ATOM   6726  O O   . TYR D 2 86  ? 25.094  35.471  24.656  1.00 72.71  ? 110 TYR C O   1 
ATOM   6727  C CB  . TYR D 2 86  ? 27.489  35.101  26.233  1.00 78.89  ? 110 TYR C CB  1 
ATOM   6728  C CG  . TYR D 2 86  ? 28.517  34.608  27.227  1.00 80.29  ? 110 TYR C CG  1 
ATOM   6729  C CD1 . TYR D 2 86  ? 28.783  35.321  28.387  1.00 80.21  ? 110 TYR C CD1 1 
ATOM   6730  C CD2 . TYR D 2 86  ? 29.209  33.423  27.014  1.00 84.41  ? 110 TYR C CD2 1 
ATOM   6731  C CE1 . TYR D 2 86  ? 29.712  34.874  29.304  1.00 83.59  ? 110 TYR C CE1 1 
ATOM   6732  C CE2 . TYR D 2 86  ? 30.144  32.968  27.928  1.00 86.17  ? 110 TYR C CE2 1 
ATOM   6733  C CZ  . TYR D 2 86  ? 30.391  33.699  29.071  1.00 88.34  ? 110 TYR C CZ  1 
ATOM   6734  O OH  . TYR D 2 86  ? 31.318  33.257  29.989  1.00 97.73  ? 110 TYR C OH  1 
ATOM   6735  N N   . PHE D 2 87  ? 24.219  36.651  26.374  1.00 66.85  ? 111 PHE C N   1 
ATOM   6736  C CA  . PHE D 2 87  ? 23.130  37.252  25.617  1.00 67.23  ? 111 PHE C CA  1 
ATOM   6737  C C   . PHE D 2 87  ? 23.467  38.690  25.248  1.00 67.65  ? 111 PHE C C   1 
ATOM   6738  O O   . PHE D 2 87  ? 24.008  39.438  26.065  1.00 74.78  ? 111 PHE C O   1 
ATOM   6739  C CB  . PHE D 2 87  ? 21.837  37.231  26.428  1.00 67.21  ? 111 PHE C CB  1 
ATOM   6740  C CG  . PHE D 2 87  ? 21.189  35.886  26.500  1.00 67.36  ? 111 PHE C CG  1 
ATOM   6741  C CD1 . PHE D 2 87  ? 20.449  35.402  25.437  1.00 67.81  ? 111 PHE C CD1 1 
ATOM   6742  C CD2 . PHE D 2 87  ? 21.320  35.103  27.633  1.00 67.04  ? 111 PHE C CD2 1 
ATOM   6743  C CE1 . PHE D 2 87  ? 19.848  34.165  25.505  1.00 68.95  ? 111 PHE C CE1 1 
ATOM   6744  C CE2 . PHE D 2 87  ? 20.723  33.867  27.707  1.00 67.03  ? 111 PHE C CE2 1 
ATOM   6745  C CZ  . PHE D 2 87  ? 19.986  33.396  26.641  1.00 69.53  ? 111 PHE C CZ  1 
ATOM   6746  N N   . SER D 2 88  ? 23.118  39.076  24.024  1.00 67.55  ? 112 SER C N   1 
ATOM   6747  C CA  . SER D 2 88  ? 23.368  40.420  23.520  1.00 68.02  ? 112 SER C CA  1 
ATOM   6748  C C   . SER D 2 88  ? 22.201  40.831  22.631  1.00 69.07  ? 112 SER C C   1 
ATOM   6749  O O   . SER D 2 88  ? 21.277  40.052  22.389  1.00 70.05  ? 112 SER C O   1 
ATOM   6750  C CB  . SER D 2 88  ? 24.700  40.481  22.764  1.00 69.24  ? 112 SER C CB  1 
ATOM   6751  O OG  . SER D 2 88  ? 24.924  39.288  22.029  1.00 67.39  ? 112 SER C OG  1 
ATOM   6752  N N   . PHE D 2 89  ? 22.239  42.064  22.136  1.00 62.90  ? 113 PHE C N   1 
ATOM   6753  C CA  . PHE D 2 89  ? 21.213  42.557  21.229  1.00 62.88  ? 113 PHE C CA  1 
ATOM   6754  C C   . PHE D 2 89  ? 21.863  43.108  19.971  1.00 62.82  ? 113 PHE C C   1 
ATOM   6755  O O   . PHE D 2 89  ? 22.995  43.598  20.000  1.00 62.86  ? 113 PHE C O   1 
ATOM   6756  C CB  . PHE D 2 89  ? 20.344  43.618  21.900  1.00 63.05  ? 113 PHE C CB  1 
ATOM   6757  C CG  . PHE D 2 89  ? 19.354  43.051  22.873  1.00 63.16  ? 113 PHE C CG  1 
ATOM   6758  C CD1 . PHE D 2 89  ? 18.130  42.581  22.434  1.00 63.17  ? 113 PHE C CD1 1 
ATOM   6759  C CD2 . PHE D 2 89  ? 19.658  42.958  24.221  1.00 63.30  ? 113 PHE C CD2 1 
ATOM   6760  C CE1 . PHE D 2 89  ? 17.219  42.052  23.322  1.00 63.32  ? 113 PHE C CE1 1 
ATOM   6761  C CE2 . PHE D 2 89  ? 18.748  42.425  25.115  1.00 63.45  ? 113 PHE C CE2 1 
ATOM   6762  C CZ  . PHE D 2 89  ? 17.528  41.972  24.663  1.00 63.46  ? 113 PHE C CZ  1 
ATOM   6763  N N   . GLN D 2 90  ? 21.139  43.008  18.854  1.00 69.80  ? 114 GLN C N   1 
ATOM   6764  C CA  . GLN D 2 90  ? 21.717  43.378  17.568  1.00 69.64  ? 114 GLN C CA  1 
ATOM   6765  C C   . GLN D 2 90  ? 20.655  43.995  16.669  1.00 67.81  ? 114 GLN C C   1 
ATOM   6766  O O   . GLN D 2 90  ? 19.590  43.388  16.489  1.00 71.05  ? 114 GLN C O   1 
ATOM   6767  C CB  . GLN D 2 90  ? 22.334  42.155  16.890  1.00 71.65  ? 114 GLN C CB  1 
ATOM   6768  C CG  . GLN D 2 90  ? 22.966  42.410  15.541  1.00 71.07  ? 114 GLN C CG  1 
ATOM   6769  C CD  . GLN D 2 90  ? 22.862  41.199  14.640  1.00 71.07  ? 114 GLN C CD  1 
ATOM   6770  O OE1 . GLN D 2 90  ? 23.846  40.496  14.408  1.00 68.82  ? 114 GLN C OE1 1 
ATOM   6771  N NE2 . GLN D 2 90  ? 21.662  40.944  14.128  1.00 70.64  ? 114 GLN C NE2 1 
ATOM   6772  N N   . PRO D 2 91  ? 20.903  45.175  16.105  1.00 66.44  ? 115 PRO C N   1 
ATOM   6773  C CA  . PRO D 2 91  ? 19.882  45.834  15.286  1.00 67.72  ? 115 PRO C CA  1 
ATOM   6774  C C   . PRO D 2 91  ? 19.564  45.056  14.018  1.00 67.96  ? 115 PRO C C   1 
ATOM   6775  O O   . PRO D 2 91  ? 20.307  44.174  13.580  1.00 70.82  ? 115 PRO C O   1 
ATOM   6776  C CB  . PRO D 2 91  ? 20.508  47.194  14.958  1.00 67.08  ? 115 PRO C CB  1 
ATOM   6777  C CG  . PRO D 2 91  ? 21.969  46.998  15.142  1.00 67.62  ? 115 PRO C CG  1 
ATOM   6778  C CD  . PRO D 2 91  ? 22.111  46.001  16.251  1.00 65.99  ? 115 PRO C CD  1 
ATOM   6779  N N   . ASP D 2 92  ? 18.422  45.409  13.425  1.00 69.06  ? 116 ASP C N   1 
ATOM   6780  C CA  . ASP D 2 92  ? 17.925  44.679  12.264  1.00 74.10  ? 116 ASP C CA  1 
ATOM   6781  C C   . ASP D 2 92  ? 18.754  44.956  11.016  1.00 75.27  ? 116 ASP C C   1 
ATOM   6782  O O   . ASP D 2 92  ? 18.807  44.117  10.109  1.00 77.15  ? 116 ASP C O   1 
ATOM   6783  C CB  . ASP D 2 92  ? 16.458  45.032  12.014  1.00 77.82  ? 116 ASP C CB  1 
ATOM   6784  C CG  . ASP D 2 92  ? 16.226  46.531  11.911  1.00 79.47  ? 116 ASP C CG  1 
ATOM   6785  O OD1 . ASP D 2 92  ? 16.655  47.136  10.904  1.00 77.31  ? 116 ASP C OD1 1 
ATOM   6786  O OD2 . ASP D 2 92  ? 15.595  47.102  12.828  1.00 78.61  ? 116 ASP C OD2 1 
ATOM   6787  N N   . ARG D 2 93  ? 19.397  46.115  10.944  1.00 73.47  ? 117 ARG C N   1 
ATOM   6788  C CA  . ARG D 2 93  ? 20.196  46.502  9.794   1.00 72.80  ? 117 ARG C CA  1 
ATOM   6789  C C   . ARG D 2 93  ? 21.489  47.130  10.290  1.00 73.05  ? 117 ARG C C   1 
ATOM   6790  O O   . ARG D 2 93  ? 21.526  47.677  11.399  1.00 75.17  ? 117 ARG C O   1 
ATOM   6791  C CB  . ARG D 2 93  ? 19.428  47.478  8.886   1.00 72.83  ? 117 ARG C CB  1 
ATOM   6792  C CG  . ARG D 2 93  ? 19.215  48.859  9.466   1.00 73.16  ? 117 ARG C CG  1 
ATOM   6793  C CD  . ARG D 2 93  ? 18.001  49.515  8.826   1.00 76.26  ? 117 ARG C CD  1 
ATOM   6794  N NE  . ARG D 2 93  ? 18.109  50.970  8.773   1.00 77.27  ? 117 ARG C NE  1 
ATOM   6795  C CZ  . ARG D 2 93  ? 17.659  51.786  9.720   1.00 75.88  ? 117 ARG C CZ  1 
ATOM   6796  N NH1 . ARG D 2 93  ? 17.065  51.291  10.797  1.00 73.37  ? 117 ARG C NH1 1 
ATOM   6797  N NH2 . ARG D 2 93  ? 17.800  53.098  9.588   1.00 72.03  ? 117 ARG C NH2 1 
ATOM   6798  N N   . PRO D 2 94  ? 22.566  47.059  9.505   1.00 71.79  ? 118 PRO C N   1 
ATOM   6799  C CA  . PRO D 2 94  ? 23.874  47.469  10.031  1.00 70.18  ? 118 PRO C CA  1 
ATOM   6800  C C   . PRO D 2 94  ? 23.945  48.973  10.251  1.00 70.29  ? 118 PRO C C   1 
ATOM   6801  O O   . PRO D 2 94  ? 23.463  49.766  9.439   1.00 69.59  ? 118 PRO C O   1 
ATOM   6802  C CB  . PRO D 2 94  ? 24.855  47.008  8.948   1.00 67.59  ? 118 PRO C CB  1 
ATOM   6803  C CG  . PRO D 2 94  ? 24.061  47.013  7.695   1.00 70.07  ? 118 PRO C CG  1 
ATOM   6804  C CD  . PRO D 2 94  ? 22.623  46.751  8.063   1.00 72.46  ? 118 PRO C CD  1 
ATOM   6805  N N   . LEU D 2 95  ? 24.544  49.356  11.376  1.00 65.73  ? 119 LEU C N   1 
ATOM   6806  C CA  . LEU D 2 95  ? 24.673  50.751  11.763  1.00 65.83  ? 119 LEU C CA  1 
ATOM   6807  C C   . LEU D 2 95  ? 26.132  51.058  12.064  1.00 65.84  ? 119 LEU C C   1 
ATOM   6808  O O   . LEU D 2 95  ? 26.907  50.170  12.429  1.00 66.83  ? 119 LEU C O   1 
ATOM   6809  C CB  . LEU D 2 95  ? 23.815  51.073  12.993  1.00 67.99  ? 119 LEU C CB  1 
ATOM   6810  C CG  . LEU D 2 95  ? 22.322  50.769  12.878  1.00 67.43  ? 119 LEU C CG  1 
ATOM   6811  C CD1 . LEU D 2 95  ? 21.644  50.902  14.229  1.00 65.54  ? 119 LEU C CD1 1 
ATOM   6812  C CD2 . LEU D 2 95  ? 21.668  51.676  11.856  1.00 68.15  ? 119 LEU C CD2 1 
ATOM   6813  N N   . GLY D 2 96  ? 26.498  52.327  11.907  1.00 67.64  ? 120 GLY C N   1 
ATOM   6814  C CA  . GLY D 2 96  ? 27.842  52.768  12.227  1.00 66.69  ? 120 GLY C CA  1 
ATOM   6815  C C   . GLY D 2 96  ? 28.556  53.459  11.086  1.00 65.51  ? 120 GLY C C   1 
ATOM   6816  O O   . GLY D 2 96  ? 28.211  53.264  9.917   1.00 64.41  ? 120 GLY C O   1 
ATOM   6817  N N   . THR D 2 97  ? 29.556  54.273  11.413  1.00 66.32  ? 121 THR C N   1 
ATOM   6818  C CA  . THR D 2 97  ? 30.354  54.969  10.415  1.00 69.09  ? 121 THR C CA  1 
ATOM   6819  C C   . THR D 2 97  ? 31.834  54.721  10.668  1.00 69.67  ? 121 THR C C   1 
ATOM   6820  O O   . THR D 2 97  ? 32.263  54.498  11.803  1.00 69.12  ? 121 THR C O   1 
ATOM   6821  C CB  . THR D 2 97  ? 30.079  56.483  10.405  1.00 70.58  ? 121 THR C CB  1 
ATOM   6822  O OG1 . THR D 2 97  ? 30.289  57.026  11.715  1.00 68.85  ? 121 THR C OG1 1 
ATOM   6823  C CG2 . THR D 2 97  ? 28.652  56.764  9.960   1.00 72.14  ? 121 THR C CG2 1 
ATOM   6824  N N   . ARG D 2 98  ? 32.607  54.764  9.591   1.00 73.68  ? 122 ARG C N   1 
ATOM   6825  C CA  . ARG D 2 98  ? 34.043  54.548  9.617   1.00 74.04  ? 122 ARG C CA  1 
ATOM   6826  C C   . ARG D 2 98  ? 34.746  55.851  9.264   1.00 72.53  ? 122 ARG C C   1 
ATOM   6827  O O   . ARG D 2 98  ? 34.252  56.637  8.451   1.00 70.48  ? 122 ARG C O   1 
ATOM   6828  C CB  . ARG D 2 98  ? 34.433  53.434  8.631   1.00 78.91  ? 122 ARG C CB  1 
ATOM   6829  C CG  . ARG D 2 98  ? 35.911  53.353  8.267   1.00 84.12  ? 122 ARG C CG  1 
ATOM   6830  C CD  . ARG D 2 98  ? 36.284  51.954  7.779   1.00 81.39  ? 122 ARG C CD  1 
ATOM   6831  N NE  . ARG D 2 98  ? 36.783  51.114  8.865   1.00 81.70  ? 122 ARG C NE  1 
ATOM   6832  C CZ  . ARG D 2 98  ? 36.013  50.366  9.652   1.00 80.95  ? 122 ARG C CZ  1 
ATOM   6833  N NH1 . ARG D 2 98  ? 34.699  50.352  9.474   1.00 76.50  ? 122 ARG C NH1 1 
ATOM   6834  N NH2 . ARG D 2 98  ? 36.557  49.632  10.617  1.00 77.51  ? 122 ARG C NH2 1 
ATOM   6835  N N   . LEU D 2 99  ? 35.896  56.085  9.890   1.00 67.00  ? 123 LEU C N   1 
ATOM   6836  C CA  . LEU D 2 99  ? 36.650  57.301  9.632   1.00 66.28  ? 123 LEU C CA  1 
ATOM   6837  C C   . LEU D 2 99  ? 38.134  57.002  9.777   1.00 64.25  ? 123 LEU C C   1 
ATOM   6838  O O   . LEU D 2 99  ? 38.539  56.265  10.678  1.00 66.73  ? 123 LEU C O   1 
ATOM   6839  C CB  . LEU D 2 99  ? 36.230  58.424  10.582  1.00 66.81  ? 123 LEU C CB  1 
ATOM   6840  C CG  . LEU D 2 99  ? 36.464  59.848  10.089  1.00 66.01  ? 123 LEU C CG  1 
ATOM   6841  C CD1 . LEU D 2 99  ? 35.327  60.752  10.545  1.00 67.97  ? 123 LEU C CD1 1 
ATOM   6842  C CD2 . LEU D 2 99  ? 37.796  60.369  10.566  1.00 64.62  ? 123 LEU C CD2 1 
ATOM   6843  N N   . THR D 2 100 ? 38.937  57.572  8.884   1.00 65.06  ? 124 THR C N   1 
ATOM   6844  C CA  . THR D 2 100 ? 40.382  57.388  8.887   1.00 65.21  ? 124 THR C CA  1 
ATOM   6845  C C   . THR D 2 100 ? 41.049  58.730  9.156   1.00 65.65  ? 124 THR C C   1 
ATOM   6846  O O   . THR D 2 100 ? 40.919  59.668  8.359   1.00 68.55  ? 124 THR C O   1 
ATOM   6847  C CB  . THR D 2 100 ? 40.857  56.782  7.564   1.00 66.20  ? 124 THR C CB  1 
ATOM   6848  O OG1 . THR D 2 100 ? 42.283  56.883  7.467   1.00 66.10  ? 124 THR C OG1 1 
ATOM   6849  C CG2 . THR D 2 100 ? 40.186  57.465  6.373   1.00 67.49  ? 124 THR C CG2 1 
ATOM   6850  N N   . VAL D 2 101 ? 41.762  58.820  10.273  1.00 65.77  ? 125 VAL C N   1 
ATOM   6851  C CA  . VAL D 2 101 ? 42.310  60.080  10.763  1.00 66.15  ? 125 VAL C CA  1 
ATOM   6852  C C   . VAL D 2 101 ? 43.794  60.139  10.437  1.00 66.82  ? 125 VAL C C   1 
ATOM   6853  O O   . VAL D 2 101 ? 44.573  59.300  10.903  1.00 66.94  ? 125 VAL C O   1 
ATOM   6854  C CB  . VAL D 2 101 ? 42.090  60.233  12.274  1.00 65.93  ? 125 VAL C CB  1 
ATOM   6855  C CG1 . VAL D 2 101 ? 42.665  61.547  12.753  1.00 66.37  ? 125 VAL C CG1 1 
ATOM   6856  C CG2 . VAL D 2 101 ? 40.624  60.141  12.609  1.00 65.32  ? 125 VAL C CG2 1 
ATOM   6857  N N   . THR D 2 102 ? 44.194  61.132  9.651   1.00 67.29  ? 126 THR C N   1 
ATOM   6858  C CA  . THR D 2 102 ? 45.602  61.486  9.533   1.00 68.01  ? 126 THR C CA  1 
ATOM   6859  C C   . THR D 2 102 ? 45.930  62.469  10.651  1.00 68.21  ? 126 THR C C   1 
ATOM   6860  O O   . THR D 2 102 ? 45.323  63.541  10.736  1.00 68.13  ? 126 THR C O   1 
ATOM   6861  C CB  . THR D 2 102 ? 45.917  62.085  8.162   1.00 68.50  ? 126 THR C CB  1 
ATOM   6862  O OG1 . THR D 2 102 ? 45.325  61.279  7.136   1.00 68.25  ? 126 THR C OG1 1 
ATOM   6863  C CG2 . THR D 2 102 ? 47.423  62.163  7.948   1.00 69.28  ? 126 THR C CG2 1 
ATOM   6864  N N   . LEU D 2 103 ? 46.877  62.097  11.515  1.00 68.49  ? 127 LEU C N   1 
ATOM   6865  C CA  . LEU D 2 103 ? 47.113  62.887  12.719  1.00 68.66  ? 127 LEU C CA  1 
ATOM   6866  C C   . LEU D 2 103 ? 47.591  64.295  12.395  1.00 69.22  ? 127 LEU C C   1 
ATOM   6867  O O   . LEU D 2 103 ? 47.276  65.237  13.129  1.00 69.21  ? 127 LEU C O   1 
ATOM   6868  C CB  . LEU D 2 103 ? 48.114  62.176  13.626  1.00 68.95  ? 127 LEU C CB  1 
ATOM   6869  C CG  . LEU D 2 103 ? 47.492  61.427  14.805  1.00 68.42  ? 127 LEU C CG  1 
ATOM   6870  C CD1 . LEU D 2 103 ? 46.344  60.542  14.351  1.00 67.70  ? 127 LEU C CD1 1 
ATOM   6871  C CD2 . LEU D 2 103 ? 48.553  60.605  15.511  1.00 68.78  ? 127 LEU C CD2 1 
ATOM   6872  N N   . THR D 2 104 ? 48.335  64.467  11.303  1.00 69.75  ? 128 THR C N   1 
ATOM   6873  C CA  . THR D 2 104 ? 48.836  65.790  10.952  1.00 70.34  ? 128 THR C CA  1 
ATOM   6874  C C   . THR D 2 104 ? 47.749  66.713  10.422  1.00 70.05  ? 128 THR C C   1 
ATOM   6875  O O   . THR D 2 104 ? 47.961  67.928  10.370  1.00 70.45  ? 128 THR C O   1 
ATOM   6876  C CB  . THR D 2 104 ? 49.946  65.669  9.912   1.00 71.05  ? 128 THR C CB  1 
ATOM   6877  O OG1 . THR D 2 104 ? 49.414  65.074  8.721   1.00 70.80  ? 128 THR C OG1 1 
ATOM   6878  C CG2 . THR D 2 104 ? 51.075  64.813  10.445  1.00 71.43  ? 128 THR C CG2 1 
ATOM   6879  N N   . GLN D 2 105 ? 46.597  66.172  10.029  1.00 69.40  ? 129 GLN C N   1 
ATOM   6880  C CA  . GLN D 2 105 ? 45.535  66.957  9.414   1.00 69.15  ? 129 GLN C CA  1 
ATOM   6881  C C   . GLN D 2 105 ? 44.316  67.112  10.318  1.00 68.51  ? 129 GLN C C   1 
ATOM   6882  O O   . GLN D 2 105 ? 43.265  67.563  9.851   1.00 68.21  ? 129 GLN C O   1 
ATOM   6883  C CB  . GLN D 2 105 ? 45.122  66.323  8.084   1.00 69.03  ? 129 GLN C CB  1 
ATOM   6884  C CG  . GLN D 2 105 ? 46.265  66.131  7.094   1.00 69.71  ? 129 GLN C CG  1 
ATOM   6885  C CD  . GLN D 2 105 ? 46.632  67.408  6.364   1.00 70.32  ? 129 GLN C CD  1 
ATOM   6886  O OE1 . GLN D 2 105 ? 45.872  67.895  5.528   1.00 70.24  ? 129 GLN C OE1 1 
ATOM   6887  N NE2 . GLN D 2 105 ? 47.804  67.954  6.672   1.00 70.97  ? 129 GLN C NE2 1 
ATOM   6888  N N   . HIS D 2 106 ? 44.429  66.753  11.594  1.00 68.33  ? 130 HIS C N   1 
ATOM   6889  C CA  . HIS D 2 106 ? 43.313  66.813  12.535  1.00 67.77  ? 130 HIS C CA  1 
ATOM   6890  C C   . HIS D 2 106 ? 43.805  67.279  13.902  1.00 68.00  ? 130 HIS C C   1 
ATOM   6891  O O   . HIS D 2 106 ? 43.548  66.648  14.928  1.00 70.59  ? 130 HIS C O   1 
ATOM   6892  C CB  . HIS D 2 106 ? 42.624  65.454  12.657  1.00 67.17  ? 130 HIS C CB  1 
ATOM   6893  C CG  . HIS D 2 106 ? 41.711  65.125  11.517  1.00 66.84  ? 130 HIS C CG  1 
ATOM   6894  N ND1 . HIS D 2 106 ? 42.154  64.530  10.355  1.00 69.38  ? 130 HIS C ND1 1 
ATOM   6895  C CD2 . HIS D 2 106 ? 40.374  65.279  11.375  1.00 69.02  ? 130 HIS C CD2 1 
ATOM   6896  C CE1 . HIS D 2 106 ? 41.131  64.346  9.539   1.00 69.42  ? 130 HIS C CE1 1 
ATOM   6897  N NE2 . HIS D 2 106 ? 40.039  64.791  10.134  1.00 75.28  ? 130 HIS C NE2 1 
ATOM   6898  N N   . VAL D 2 107 ? 44.517  68.401  13.936  1.00 68.58  ? 131 VAL C N   1 
ATOM   6899  C CA  . VAL D 2 107 ? 45.150  68.880  15.160  1.00 68.94  ? 131 VAL C CA  1 
ATOM   6900  C C   . VAL D 2 107 ? 44.308  70.001  15.755  1.00 68.82  ? 131 VAL C C   1 
ATOM   6901  O O   . VAL D 2 107 ? 44.044  71.011  15.093  1.00 68.96  ? 131 VAL C O   1 
ATOM   6902  C CB  . VAL D 2 107 ? 46.586  69.356  14.901  1.00 69.75  ? 131 VAL C CB  1 
ATOM   6903  C CG1 . VAL D 2 107 ? 47.206  69.869  16.184  1.00 70.16  ? 131 VAL C CG1 1 
ATOM   6904  C CG2 . VAL D 2 107 ? 47.412  68.229  14.337  1.00 69.90  ? 131 VAL C CG2 1 
ATOM   6905  N N   . GLN D 2 108 ? 43.888  69.823  17.006  1.00 68.59  ? 132 GLN C N   1 
ATOM   6906  C CA  . GLN D 2 108 ? 43.270  70.887  17.799  1.00 68.60  ? 132 GLN C CA  1 
ATOM   6907  C C   . GLN D 2 108 ? 44.142  71.116  19.022  1.00 69.10  ? 132 GLN C C   1 
ATOM   6908  O O   . GLN D 2 108 ? 44.079  70.332  19.986  1.00 68.93  ? 132 GLN C O   1 
ATOM   6909  C CB  . GLN D 2 108 ? 41.845  70.528  18.213  1.00 67.94  ? 132 GLN C CB  1 
ATOM   6910  C CG  . GLN D 2 108 ? 41.178  71.569  19.104  1.00 67.98  ? 132 GLN C CG  1 
ATOM   6911  C CD  . GLN D 2 108 ? 39.677  71.363  19.224  1.00 67.37  ? 132 GLN C CD  1 
ATOM   6912  O OE1 . GLN D 2 108 ? 38.950  71.412  18.233  1.00 67.08  ? 132 GLN C OE1 1 
ATOM   6913  N NE2 . GLN D 2 108 ? 39.207  71.136  20.446  1.00 67.24  ? 132 GLN C NE2 1 
ATOM   6914  N N   . PRO D 2 109 ? 44.967  72.159  19.032  1.00 69.75  ? 133 PRO C N   1 
ATOM   6915  C CA  . PRO D 2 109 ? 45.929  72.359  20.124  1.00 70.33  ? 133 PRO C CA  1 
ATOM   6916  C C   . PRO D 2 109 ? 45.231  72.521  21.462  1.00 70.17  ? 133 PRO C C   1 
ATOM   6917  O O   . PRO D 2 109 ? 44.010  72.733  21.515  1.00 69.67  ? 133 PRO C O   1 
ATOM   6918  C CB  . PRO D 2 109 ? 46.654  73.648  19.712  1.00 71.00  ? 133 PRO C CB  1 
ATOM   6919  C CG  . PRO D 2 109 ? 46.521  73.684  18.233  1.00 70.86  ? 133 PRO C CG  1 
ATOM   6920  C CD  . PRO D 2 109 ? 45.164  73.123  17.939  1.00 70.04  ? 133 PRO C CD  1 
ATOM   6921  N N   . PRO D 2 110 ? 45.967  72.419  22.570  1.00 74.20  ? 134 PRO C N   1 
ATOM   6922  C CA  . PRO D 2 110 ? 45.319  72.465  23.885  1.00 74.10  ? 134 PRO C CA  1 
ATOM   6923  C C   . PRO D 2 110 ? 44.787  73.851  24.218  1.00 74.28  ? 134 PRO C C   1 
ATOM   6924  O O   . PRO D 2 110 ? 45.426  74.871  23.949  1.00 74.82  ? 134 PRO C O   1 
ATOM   6925  C CB  . PRO D 2 110 ? 46.440  72.053  24.850  1.00 74.69  ? 134 PRO C CB  1 
ATOM   6926  C CG  . PRO D 2 110 ? 47.476  71.399  23.993  1.00 74.89  ? 134 PRO C CG  1 
ATOM   6927  C CD  . PRO D 2 110 ? 47.401  72.104  22.682  1.00 74.84  ? 134 PRO C CD  1 
ATOM   6928  N N   . GLU D 2 111 ? 43.606  73.871  24.820  1.00 86.33  ? 135 GLU C N   1 
ATOM   6929  C CA  . GLU D 2 111 ? 42.981  75.121  25.236  1.00 84.23  ? 135 GLU C CA  1 
ATOM   6930  C C   . GLU D 2 111 ? 43.796  75.775  26.348  1.00 81.83  ? 135 GLU C C   1 
ATOM   6931  O O   . GLU D 2 111 ? 44.158  75.102  27.319  1.00 82.57  ? 135 GLU C O   1 
ATOM   6932  C CB  . GLU D 2 111 ? 41.556  74.841  25.709  1.00 87.46  ? 135 GLU C CB  1 
ATOM   6933  C CG  . GLU D 2 111 ? 40.988  75.858  26.675  1.00 91.65  ? 135 GLU C CG  1 
ATOM   6934  C CD  . GLU D 2 111 ? 39.784  75.321  27.426  1.00 96.60  ? 135 GLU C CD  1 
ATOM   6935  O OE1 . GLU D 2 111 ? 38.941  74.641  26.800  1.00 91.31  ? 135 GLU C OE1 1 
ATOM   6936  O OE2 . GLU D 2 111 ? 39.687  75.575  28.646  1.00 103.58 ? 135 GLU C OE2 1 
ATOM   6937  N N   . PRO D 2 112 ? 44.113  77.065  26.241  1.00 85.58  ? 136 PRO C N   1 
ATOM   6938  C CA  . PRO D 2 112 ? 44.826  77.743  27.331  1.00 85.13  ? 136 PRO C CA  1 
ATOM   6939  C C   . PRO D 2 112 ? 43.939  77.916  28.554  1.00 88.00  ? 136 PRO C C   1 
ATOM   6940  O O   . PRO D 2 112 ? 42.709  77.900  28.476  1.00 82.94  ? 136 PRO C O   1 
ATOM   6941  C CB  . PRO D 2 112 ? 45.198  79.104  26.730  1.00 83.70  ? 136 PRO C CB  1 
ATOM   6942  C CG  . PRO D 2 112 ? 45.042  78.943  25.256  1.00 84.83  ? 136 PRO C CG  1 
ATOM   6943  C CD  . PRO D 2 112 ? 43.959  77.929  25.061  1.00 85.40  ? 136 PRO C CD  1 
ATOM   6944  N N   . ARG D 2 113 ? 44.589  78.094  29.701  1.00 100.14 ? 137 ARG C N   1 
ATOM   6945  C CA  . ARG D 2 113 ? 43.880  78.293  30.957  1.00 104.40 ? 137 ARG C CA  1 
ATOM   6946  C C   . ARG D 2 113 ? 44.741  79.139  31.884  1.00 103.54 ? 137 ARG C C   1 
ATOM   6947  O O   . ARG D 2 113 ? 45.844  79.562  31.528  1.00 98.53  ? 137 ARG C O   1 
ATOM   6948  C CB  . ARG D 2 113 ? 43.515  76.957  31.608  1.00 109.28 ? 137 ARG C CB  1 
ATOM   6949  C CG  . ARG D 2 113 ? 42.102  76.482  31.311  1.00 113.42 ? 137 ARG C CG  1 
ATOM   6950  C CD  . ARG D 2 113 ? 41.697  75.381  32.274  1.00 114.86 ? 137 ARG C CD  1 
ATOM   6951  N NE  . ARG D 2 113 ? 42.758  74.391  32.426  1.00 113.98 ? 137 ARG C NE  1 
ATOM   6952  C CZ  . ARG D 2 113 ? 42.768  73.440  33.353  1.00 109.76 ? 137 ARG C CZ  1 
ATOM   6953  N NH1 . ARG D 2 113 ? 41.770  73.345  34.222  1.00 107.50 ? 137 ARG C NH1 1 
ATOM   6954  N NH2 . ARG D 2 113 ? 43.780  72.584  33.413  1.00 107.76 ? 137 ARG C NH2 1 
ATOM   6955  N N   . ASP D 2 114 ? 44.221  79.375  33.089  1.00 108.54 ? 138 ASP C N   1 
ATOM   6956  C CA  . ASP D 2 114 ? 44.873  80.209  34.097  1.00 109.23 ? 138 ASP C CA  1 
ATOM   6957  C C   . ASP D 2 114 ? 45.223  81.578  33.516  1.00 103.78 ? 138 ASP C C   1 
ATOM   6958  O O   . ASP D 2 114 ? 46.388  81.959  33.393  1.00 102.94 ? 138 ASP C O   1 
ATOM   6959  C CB  . ASP D 2 114 ? 46.110  79.510  34.668  1.00 117.16 ? 138 ASP C CB  1 
ATOM   6960  C CG  . ASP D 2 114 ? 45.756  78.366  35.604  1.00 121.98 ? 138 ASP C CG  1 
ATOM   6961  O OD1 . ASP D 2 114 ? 44.810  78.526  36.406  1.00 120.80 ? 138 ASP C OD1 1 
ATOM   6962  O OD2 . ASP D 2 114 ? 46.421  77.308  35.540  1.00 119.73 ? 138 ASP C OD2 1 
ATOM   6963  N N   . LEU D 2 115 ? 44.178  82.317  33.154  1.00 92.54  ? 139 LEU C N   1 
ATOM   6964  C CA  . LEU D 2 115 ? 44.312  83.592  32.462  1.00 92.79  ? 139 LEU C CA  1 
ATOM   6965  C C   . LEU D 2 115 ? 44.264  84.726  33.480  1.00 96.66  ? 139 LEU C C   1 
ATOM   6966  O O   . LEU D 2 115 ? 43.276  84.871  34.207  1.00 95.34  ? 139 LEU C O   1 
ATOM   6967  C CB  . LEU D 2 115 ? 43.211  83.749  31.414  1.00 91.99  ? 139 LEU C CB  1 
ATOM   6968  C CG  . LEU D 2 115 ? 43.287  84.972  30.503  1.00 92.16  ? 139 LEU C CG  1 
ATOM   6969  C CD1 . LEU D 2 115 ? 44.693  85.137  29.951  1.00 92.69  ? 139 LEU C CD1 1 
ATOM   6970  C CD2 . LEU D 2 115 ? 42.276  84.856  29.377  1.00 91.35  ? 139 LEU C CD2 1 
ATOM   6971  N N   . GLN D 2 116 ? 45.330  85.525  33.526  1.00 104.14 ? 140 GLN C N   1 
ATOM   6972  C CA  . GLN D 2 116 ? 45.480  86.603  34.493  1.00 103.96 ? 140 GLN C CA  1 
ATOM   6973  C C   . GLN D 2 116 ? 45.914  87.878  33.783  1.00 104.64 ? 140 GLN C C   1 
ATOM   6974  O O   . GLN D 2 116 ? 46.615  87.833  32.769  1.00 103.68 ? 140 GLN C O   1 
ATOM   6975  C CB  . GLN D 2 116 ? 46.517  86.251  35.573  1.00 103.81 ? 140 GLN C CB  1 
ATOM   6976  C CG  . GLN D 2 116 ? 46.377  84.853  36.155  1.00 105.84 ? 140 GLN C CG  1 
ATOM   6977  C CD  . GLN D 2 116 ? 47.719  84.217  36.466  1.00 107.63 ? 140 GLN C CD  1 
ATOM   6978  O OE1 . GLN D 2 116 ? 48.426  84.645  37.378  1.00 112.56 ? 140 GLN C OE1 1 
ATOM   6979  N NE2 . GLN D 2 116 ? 48.078  83.190  35.703  1.00 107.95 ? 140 GLN C NE2 1 
ATOM   6980  N N   . ILE D 2 117 ? 45.497  89.017  34.332  1.00 103.91 ? 141 ILE C N   1 
ATOM   6981  C CA  . ILE D 2 117 ? 45.948  90.321  33.867  1.00 106.91 ? 141 ILE C CA  1 
ATOM   6982  C C   . ILE D 2 117 ? 46.827  90.945  34.943  1.00 107.86 ? 141 ILE C C   1 
ATOM   6983  O O   . ILE D 2 117 ? 46.721  90.634  36.134  1.00 107.92 ? 141 ILE C O   1 
ATOM   6984  C CB  . ILE D 2 117 ? 44.775  91.257  33.507  1.00 112.11 ? 141 ILE C CB  1 
ATOM   6985  C CG1 . ILE D 2 117 ? 43.951  91.597  34.752  1.00 121.99 ? 141 ILE C CG1 1 
ATOM   6986  C CG2 . ILE D 2 117 ? 43.907  90.635  32.433  1.00 113.57 ? 141 ILE C CG2 1 
ATOM   6987  C CD1 . ILE D 2 117 ? 44.244  92.969  35.343  1.00 125.45 ? 141 ILE C CD1 1 
ATOM   6988  N N   . SER D 2 118 ? 47.710  91.843  34.510  1.00 117.41 ? 142 SER C N   1 
ATOM   6989  C CA  . SER D 2 118 ? 48.569  92.556  35.447  1.00 121.18 ? 142 SER C CA  1 
ATOM   6990  C C   . SER D 2 118 ? 48.856  93.950  34.912  1.00 122.82 ? 142 SER C C   1 
ATOM   6991  O O   . SER D 2 118 ? 49.273  94.100  33.760  1.00 122.84 ? 142 SER C O   1 
ATOM   6992  C CB  . SER D 2 118 ? 49.880  91.801  35.685  1.00 125.45 ? 142 SER C CB  1 
ATOM   6993  O OG  . SER D 2 118 ? 50.730  92.530  36.554  1.00 132.92 ? 142 SER C OG  1 
ATOM   6994  N N   . THR D 2 119 ? 48.634  94.959  35.750  1.00 131.10 ? 143 THR C N   1 
ATOM   6995  C CA  . THR D 2 119 ? 48.934  96.339  35.386  1.00 135.56 ? 143 THR C CA  1 
ATOM   6996  C C   . THR D 2 119 ? 50.427  96.593  35.558  1.00 136.81 ? 143 THR C C   1 
ATOM   6997  O O   . THR D 2 119 ? 50.982  96.358  36.638  1.00 130.84 ? 143 THR C O   1 
ATOM   6998  C CB  . THR D 2 119 ? 48.120  97.309  36.240  1.00 135.10 ? 143 THR C CB  1 
ATOM   6999  O OG1 . THR D 2 119 ? 46.783  96.813  36.392  1.00 133.03 ? 143 THR C OG1 1 
ATOM   7000  C CG2 . THR D 2 119 ? 48.082  98.686  35.592  1.00 134.37 ? 143 THR C CG2 1 
ATOM   7001  N N   . ASP D 2 120 ? 51.078  97.070  34.497  1.00 141.80 ? 144 ASP C N   1 
ATOM   7002  C CA  . ASP D 2 120 ? 52.521  97.301  34.500  1.00 146.28 ? 144 ASP C CA  1 
ATOM   7003  C C   . ASP D 2 120 ? 52.815  98.709  33.978  1.00 148.68 ? 144 ASP C C   1 
ATOM   7004  O O   . ASP D 2 120 ? 53.492  98.899  32.968  1.00 145.61 ? 144 ASP C O   1 
ATOM   7005  C CB  . ASP D 2 120 ? 53.245  96.234  33.676  1.00 142.98 ? 144 ASP C CB  1 
ATOM   7006  C CG  . ASP D 2 120 ? 54.671  96.000  34.144  1.00 138.80 ? 144 ASP C CG  1 
ATOM   7007  O OD1 . ASP D 2 120 ? 55.264  96.923  34.741  1.00 136.00 ? 144 ASP C OD1 1 
ATOM   7008  O OD2 . ASP D 2 120 ? 55.196  94.887  33.923  1.00 134.20 ? 144 ASP C OD2 1 
ATOM   7009  N N   . GLN D 2 121 ? 52.283  99.710  34.685  1.00 148.54 ? 145 GLN C N   1 
ATOM   7010  C CA  . GLN D 2 121 ? 52.540  101.127 34.415  1.00 145.61 ? 145 GLN C CA  1 
ATOM   7011  C C   . GLN D 2 121 ? 52.084  101.510 33.002  1.00 149.43 ? 145 GLN C C   1 
ATOM   7012  O O   . GLN D 2 121 ? 52.885  101.750 32.096  1.00 148.43 ? 145 GLN C O   1 
ATOM   7013  C CB  . GLN D 2 121 ? 54.023  101.455 34.626  1.00 140.06 ? 145 GLN C CB  1 
ATOM   7014  C CG  . GLN D 2 121 ? 54.501  101.221 36.046  1.00 140.30 ? 145 GLN C CG  1 
ATOM   7015  C CD  . GLN D 2 121 ? 55.862  100.558 36.105  1.00 139.39 ? 145 GLN C CD  1 
ATOM   7016  O OE1 . GLN D 2 121 ? 56.086  99.515  35.493  1.00 139.36 ? 145 GLN C OE1 1 
ATOM   7017  N NE2 . GLN D 2 121 ? 56.781  101.165 36.847  1.00 137.37 ? 145 GLN C NE2 1 
ATOM   7018  N N   . ASP D 2 122 ? 50.759  101.578 32.853  1.00 147.37 ? 146 ASP C N   1 
ATOM   7019  C CA  . ASP D 2 122 ? 50.113  101.844 31.564  1.00 141.54 ? 146 ASP C CA  1 
ATOM   7020  C C   . ASP D 2 122 ? 50.652  100.916 30.479  1.00 143.58 ? 146 ASP C C   1 
ATOM   7021  O O   . ASP D 2 122 ? 51.034  101.340 29.387  1.00 147.14 ? 146 ASP C O   1 
ATOM   7022  C CB  . ASP D 2 122 ? 50.260  103.312 31.159  1.00 136.15 ? 146 ASP C CB  1 
ATOM   7023  C CG  . ASP D 2 122 ? 49.026  104.131 31.489  1.00 133.52 ? 146 ASP C CG  1 
ATOM   7024  O OD1 . ASP D 2 122 ? 47.904  103.591 31.371  1.00 128.63 ? 146 ASP C OD1 1 
ATOM   7025  O OD2 . ASP D 2 122 ? 49.176  105.312 31.869  1.00 132.53 ? 146 ASP C OD2 1 
ATOM   7026  N N   . HIS D 2 123 ? 50.686  99.627  30.805  1.00 143.23 ? 147 HIS C N   1 
ATOM   7027  C CA  . HIS D 2 123 ? 51.125  98.577  29.896  1.00 133.78 ? 147 HIS C CA  1 
ATOM   7028  C C   . HIS D 2 123 ? 50.651  97.235  30.431  1.00 133.96 ? 147 HIS C C   1 
ATOM   7029  O O   . HIS D 2 123 ? 51.442  96.475  31.000  1.00 138.00 ? 147 HIS C O   1 
ATOM   7030  C CB  . HIS D 2 123 ? 52.648  98.584  29.734  1.00 128.36 ? 147 HIS C CB  1 
ATOM   7031  C CG  . HIS D 2 123 ? 53.127  99.297  28.507  1.00 125.40 ? 147 HIS C CG  1 
ATOM   7032  N ND1 . HIS D 2 123 ? 52.963  100.653 28.318  1.00 122.26 ? 147 HIS C ND1 1 
ATOM   7033  C CD2 . HIS D 2 123 ? 53.768  98.839  27.406  1.00 122.77 ? 147 HIS C CD2 1 
ATOM   7034  C CE1 . HIS D 2 123 ? 53.481  100.999 27.153  1.00 118.66 ? 147 HIS C CE1 1 
ATOM   7035  N NE2 . HIS D 2 123 ? 53.976  99.917  26.580  1.00 120.17 ? 147 HIS C NE2 1 
ATOM   7036  N N   . PHE D 2 124 ? 49.362  96.946  30.268  1.00 120.23 ? 148 PHE C N   1 
ATOM   7037  C CA  . PHE D 2 124 ? 48.795  95.723  30.815  1.00 118.87 ? 148 PHE C CA  1 
ATOM   7038  C C   . PHE D 2 124 ? 49.445  94.506  30.169  1.00 116.97 ? 148 PHE C C   1 
ATOM   7039  O O   . PHE D 2 124 ? 49.800  94.517  28.989  1.00 112.24 ? 148 PHE C O   1 
ATOM   7040  C CB  . PHE D 2 124 ? 47.283  95.687  30.580  1.00 117.07 ? 148 PHE C CB  1 
ATOM   7041  C CG  . PHE D 2 124 ? 46.555  96.900  31.088  1.00 111.56 ? 148 PHE C CG  1 
ATOM   7042  C CD1 . PHE D 2 124 ? 46.458  98.042  30.311  1.00 113.67 ? 148 PHE C CD1 1 
ATOM   7043  C CD2 . PHE D 2 124 ? 45.965  96.895  32.340  1.00 109.95 ? 148 PHE C CD2 1 
ATOM   7044  C CE1 . PHE D 2 124 ? 45.789  99.156  30.772  1.00 118.03 ? 148 PHE C CE1 1 
ATOM   7045  C CE2 . PHE D 2 124 ? 45.294  98.007  32.808  1.00 114.13 ? 148 PHE C CE2 1 
ATOM   7046  C CZ  . PHE D 2 124 ? 45.206  99.140  32.022  1.00 118.07 ? 148 PHE C CZ  1 
ATOM   7047  N N   . LEU D 2 125 ? 49.604  93.447  30.956  1.00 113.65 ? 149 LEU C N   1 
ATOM   7048  C CA  . LEU D 2 125 ? 50.184  92.207  30.465  1.00 113.81 ? 149 LEU C CA  1 
ATOM   7049  C C   . LEU D 2 125 ? 49.271  91.044  30.823  1.00 112.10 ? 149 LEU C C   1 
ATOM   7050  O O   . LEU D 2 125 ? 48.559  91.074  31.831  1.00 102.75 ? 149 LEU C O   1 
ATOM   7051  C CB  . LEU D 2 125 ? 51.600  91.982  31.026  1.00 117.10 ? 149 LEU C CB  1 
ATOM   7052  C CG  . LEU D 2 125 ? 51.794  91.750  32.528  1.00 122.90 ? 149 LEU C CG  1 
ATOM   7053  C CD1 . LEU D 2 125 ? 51.779  90.263  32.884  1.00 120.23 ? 149 LEU C CD1 1 
ATOM   7054  C CD2 . LEU D 2 125 ? 53.081  92.415  33.003  1.00 125.75 ? 149 LEU C CD2 1 
ATOM   7055  N N   . LEU D 2 126 ? 49.304  90.015  29.979  1.00 106.13 ? 150 LEU C N   1 
ATOM   7056  C CA  . LEU D 2 126 ? 48.438  88.853  30.100  1.00 104.73 ? 150 LEU C CA  1 
ATOM   7057  C C   . LEU D 2 126 ? 49.289  87.612  30.331  1.00 107.24 ? 150 LEU C C   1 
ATOM   7058  O O   . LEU D 2 126 ? 50.294  87.405  29.642  1.00 99.70  ? 150 LEU C O   1 
ATOM   7059  C CB  . LEU D 2 126 ? 47.584  88.686  28.841  1.00 103.29 ? 150 LEU C CB  1 
ATOM   7060  C CG  . LEU D 2 126 ? 46.469  89.711  28.639  1.00 104.00 ? 150 LEU C CG  1 
ATOM   7061  C CD1 . LEU D 2 126 ? 46.172  89.883  27.162  1.00 102.09 ? 150 LEU C CD1 1 
ATOM   7062  C CD2 . LEU D 2 126 ? 45.218  89.286  29.382  1.00 103.60 ? 150 LEU C CD2 1 
ATOM   7063  N N   . THR D 2 127 ? 48.885  86.796  31.297  1.00 106.62 ? 151 THR C N   1 
ATOM   7064  C CA  . THR D 2 127 ? 49.545  85.538  31.603  1.00 109.61 ? 151 THR C CA  1 
ATOM   7065  C C   . THR D 2 127 ? 48.553  84.401  31.417  1.00 111.37 ? 151 THR C C   1 
ATOM   7066  O O   . THR D 2 127 ? 47.383  84.520  31.794  1.00 112.33 ? 151 THR C O   1 
ATOM   7067  C CB  . THR D 2 127 ? 50.089  85.529  33.038  1.00 113.32 ? 151 THR C CB  1 
ATOM   7068  O OG1 . THR D 2 127 ? 50.932  86.670  33.239  1.00 116.62 ? 151 THR C OG1 1 
ATOM   7069  C CG2 . THR D 2 127 ? 50.887  84.260  33.308  1.00 115.50 ? 151 THR C CG2 1 
ATOM   7070  N N   . TRP D 2 128 ? 49.016  83.303  30.824  1.00 113.16 ? 152 TRP C N   1 
ATOM   7071  C CA  . TRP D 2 128 ? 48.164  82.136  30.651  1.00 106.74 ? 152 TRP C CA  1 
ATOM   7072  C C   . TRP D 2 128 ? 49.041  80.915  30.432  1.00 106.43 ? 152 TRP C C   1 
ATOM   7073  O O   . TRP D 2 128 ? 50.107  81.009  29.819  1.00 100.18 ? 152 TRP C O   1 
ATOM   7074  C CB  . TRP D 2 128 ? 47.186  82.322  29.484  1.00 102.90 ? 152 TRP C CB  1 
ATOM   7075  C CG  . TRP D 2 128 ? 47.828  82.303  28.133  1.00 98.94  ? 152 TRP C CG  1 
ATOM   7076  C CD1 . TRP D 2 128 ? 48.247  81.208  27.437  1.00 98.84  ? 152 TRP C CD1 1 
ATOM   7077  C CD2 . TRP D 2 128 ? 48.138  83.439  27.317  1.00 96.49  ? 152 TRP C CD2 1 
ATOM   7078  N NE1 . TRP D 2 128 ? 48.795  81.589  26.240  1.00 94.68  ? 152 TRP C NE1 1 
ATOM   7079  C CE2 . TRP D 2 128 ? 48.739  82.954  26.139  1.00 94.90  ? 152 TRP C CE2 1 
ATOM   7080  C CE3 . TRP D 2 128 ? 47.964  84.816  27.466  1.00 99.11  ? 152 TRP C CE3 1 
ATOM   7081  C CZ2 . TRP D 2 128 ? 49.166  83.797  25.117  1.00 94.34  ? 152 TRP C CZ2 1 
ATOM   7082  C CZ3 . TRP D 2 128 ? 48.388  85.652  26.450  1.00 100.92 ? 152 TRP C CZ3 1 
ATOM   7083  C CH2 . TRP D 2 128 ? 48.982  85.140  25.291  1.00 95.39  ? 152 TRP C CH2 1 
ATOM   7084  N N   . SER D 2 129 ? 48.593  79.780  30.953  1.00 110.22 ? 153 SER C N   1 
ATOM   7085  C CA  . SER D 2 129 ? 49.283  78.518  30.769  1.00 107.04 ? 153 SER C CA  1 
ATOM   7086  C C   . SER D 2 129 ? 48.468  77.633  29.835  1.00 109.29 ? 153 SER C C   1 
ATOM   7087  O O   . SER D 2 129 ? 47.242  77.754  29.750  1.00 111.26 ? 153 SER C O   1 
ATOM   7088  C CB  . SER D 2 129 ? 49.510  77.805  32.107  1.00 106.78 ? 153 SER C CB  1 
ATOM   7089  O OG  . SER D 2 129 ? 48.295  77.337  32.666  1.00 111.92 ? 153 SER C OG  1 
ATOM   7090  N N   . VAL D 2 130 ? 49.160  76.744  29.123  1.00 116.09 ? 154 VAL C N   1 
ATOM   7091  C CA  . VAL D 2 130 ? 48.489  75.803  28.233  1.00 116.51 ? 154 VAL C CA  1 
ATOM   7092  C C   . VAL D 2 130 ? 48.373  74.413  28.866  1.00 114.12 ? 154 VAL C C   1 
ATOM   7093  O O   . VAL D 2 130 ? 47.628  73.563  28.348  1.00 108.90 ? 154 VAL C O   1 
ATOM   7094  C CB  . VAL D 2 130 ? 49.212  75.776  26.865  1.00 122.25 ? 154 VAL C CB  1 
ATOM   7095  C CG1 . VAL D 2 130 ? 50.708  75.650  27.077  1.00 125.27 ? 154 VAL C CG1 1 
ATOM   7096  C CG2 . VAL D 2 130 ? 48.653  74.720  25.903  1.00 118.19 ? 154 VAL C CG2 1 
ATOM   7097  N N   . ALA D 2 131 ? 49.057  74.172  29.990  1.00 126.35 ? 155 ALA C N   1 
ATOM   7098  C CA  . ALA D 2 131 ? 48.853  72.989  30.823  1.00 121.59 ? 155 ALA C CA  1 
ATOM   7099  C C   . ALA D 2 131 ? 49.082  71.697  30.037  1.00 127.79 ? 155 ALA C C   1 
ATOM   7100  O O   . ALA D 2 131 ? 48.190  70.862  29.882  1.00 121.66 ? 155 ALA C O   1 
ATOM   7101  C CB  . ALA D 2 131 ? 47.458  73.005  31.459  1.00 109.29 ? 155 ALA C CB  1 
ATOM   7102  N N   . LEU D 2 132 ? 50.316  71.534  29.567  1.00 131.43 ? 156 LEU C N   1 
ATOM   7103  C CA  . LEU D 2 132 ? 50.698  70.345  28.816  1.00 134.72 ? 156 LEU C CA  1 
ATOM   7104  C C   . LEU D 2 132 ? 50.759  69.118  29.719  1.00 135.19 ? 156 LEU C C   1 
ATOM   7105  O O   . LEU D 2 132 ? 49.987  68.169  29.544  1.00 137.35 ? 156 LEU C O   1 
ATOM   7106  C CB  . LEU D 2 132 ? 52.045  70.568  28.127  1.00 133.63 ? 156 LEU C CB  1 
ATOM   7107  C CG  . LEU D 2 132 ? 51.989  70.963  26.652  1.00 126.91 ? 156 LEU C CG  1 
ATOM   7108  C CD1 . LEU D 2 132 ? 51.452  69.814  25.815  1.00 122.67 ? 156 LEU C CD1 1 
ATOM   7109  C CD2 . LEU D 2 132 ? 51.140  72.205  26.462  1.00 118.76 ? 156 LEU C CD2 1 
ATOM   7110  N N   . GLY D 2 133 ? 51.673  69.126  30.685  1.00 139.31 ? 157 GLY C N   1 
ATOM   7111  C CA  . GLY D 2 133 ? 51.828  67.995  31.577  1.00 137.39 ? 157 GLY C CA  1 
ATOM   7112  C C   . GLY D 2 133 ? 52.618  66.860  30.960  1.00 137.45 ? 157 GLY C C   1 
ATOM   7113  O O   . GLY D 2 133 ? 52.194  66.269  29.961  1.00 126.92 ? 157 GLY C O   1 
ATOM   7114  N N   . SER D 2 134 ? 53.773  66.548  31.558  1.00 141.19 ? 158 SER C N   1 
ATOM   7115  C CA  . SER D 2 134 ? 54.690  65.509  31.099  1.00 136.79 ? 158 SER C CA  1 
ATOM   7116  C C   . SER D 2 134 ? 54.999  65.670  29.614  1.00 139.09 ? 158 SER C C   1 
ATOM   7117  O O   . SER D 2 134 ? 54.571  64.842  28.799  1.00 135.14 ? 158 SER C O   1 
ATOM   7118  C CB  . SER D 2 134 ? 54.108  64.120  31.371  1.00 131.65 ? 158 SER C CB  1 
ATOM   7119  O OG  . SER D 2 134 ? 53.852  63.932  32.753  1.00 127.17 ? 158 SER C OG  1 
ATOM   7120  N N   . PRO D 2 135 ? 55.736  66.716  29.218  1.00 133.76 ? 159 PRO C N   1 
ATOM   7121  C CA  . PRO D 2 135 ? 55.992  66.958  27.786  1.00 129.69 ? 159 PRO C CA  1 
ATOM   7122  C C   . PRO D 2 135 ? 57.075  66.049  27.209  1.00 129.74 ? 159 PRO C C   1 
ATOM   7123  O O   . PRO D 2 135 ? 58.065  66.501  26.628  1.00 128.57 ? 159 PRO C O   1 
ATOM   7124  C CB  . PRO D 2 135 ? 56.397  68.438  27.773  1.00 128.33 ? 159 PRO C CB  1 
ATOM   7125  C CG  . PRO D 2 135 ? 56.999  68.671  29.100  1.00 127.79 ? 159 PRO C CG  1 
ATOM   7126  C CD  . PRO D 2 135 ? 56.252  67.805  30.066  1.00 133.06 ? 159 PRO C CD  1 
ATOM   7127  N N   . GLN D 2 136 ? 56.887  64.741  27.371  1.00 129.86 ? 160 GLN C N   1 
ATOM   7128  C CA  . GLN D 2 136 ? 57.665  63.741  26.639  1.00 132.60 ? 160 GLN C CA  1 
ATOM   7129  C C   . GLN D 2 136 ? 57.065  63.484  25.268  1.00 132.76 ? 160 GLN C C   1 
ATOM   7130  O O   . GLN D 2 136 ? 57.106  62.368  24.738  1.00 129.30 ? 160 GLN C O   1 
ATOM   7131  C CB  . GLN D 2 136 ? 57.752  62.452  27.450  1.00 134.45 ? 160 GLN C CB  1 
ATOM   7132  C CG  . GLN D 2 136 ? 56.458  62.088  28.164  1.00 133.23 ? 160 GLN C CG  1 
ATOM   7133  C CD  . GLN D 2 136 ? 56.561  62.225  29.670  1.00 133.29 ? 160 GLN C CD  1 
ATOM   7134  O OE1 . GLN D 2 136 ? 57.060  63.228  30.182  1.00 139.29 ? 160 GLN C OE1 1 
ATOM   7135  N NE2 . GLN D 2 136 ? 56.087  61.214  30.391  1.00 129.36 ? 160 GLN C NE2 1 
ATOM   7136  N N   . SER D 2 137 ? 56.485  64.537  24.674  1.00 128.22 ? 161 SER C N   1 
ATOM   7137  C CA  . SER D 2 137 ? 55.726  64.461  23.428  1.00 119.08 ? 161 SER C CA  1 
ATOM   7138  C C   . SER D 2 137 ? 56.136  65.660  22.575  1.00 109.61 ? 161 SER C C   1 
ATOM   7139  O O   . SER D 2 137 ? 55.495  66.714  22.590  1.00 96.75  ? 161 SER C O   1 
ATOM   7140  C CB  . SER D 2 137 ? 54.224  64.446  23.703  1.00 119.23 ? 161 SER C CB  1 
ATOM   7141  O OG  . SER D 2 137 ? 53.823  65.658  24.320  1.00 120.69 ? 161 SER C OG  1 
ATOM   7142  N N   . HIS D 2 138 ? 57.230  65.501  21.830  1.00 101.06 ? 162 HIS C N   1 
ATOM   7143  C CA  . HIS D 2 138 ? 57.747  66.560  20.973  1.00 98.30  ? 162 HIS C CA  1 
ATOM   7144  C C   . HIS D 2 138 ? 57.219  66.464  19.550  1.00 94.07  ? 162 HIS C C   1 
ATOM   7145  O O   . HIS D 2 138 ? 57.913  66.850  18.601  1.00 96.26  ? 162 HIS C O   1 
ATOM   7146  C CB  . HIS D 2 138 ? 59.274  66.544  21.005  1.00 101.17 ? 162 HIS C CB  1 
ATOM   7147  C CG  . HIS D 2 138 ? 59.834  66.705  22.383  1.00 106.61 ? 162 HIS C CG  1 
ATOM   7148  N ND1 . HIS D 2 138 ? 60.051  65.635  23.224  1.00 110.77 ? 162 HIS C ND1 1 
ATOM   7149  C CD2 . HIS D 2 138 ? 60.201  67.809  23.076  1.00 110.63 ? 162 HIS C CD2 1 
ATOM   7150  C CE1 . HIS D 2 138 ? 60.535  66.072  24.372  1.00 114.80 ? 162 HIS C CE1 1 
ATOM   7151  N NE2 . HIS D 2 138 ? 60.637  67.387  24.308  1.00 114.80 ? 162 HIS C NE2 1 
ATOM   7152  N N   . TRP D 2 139 ? 55.999  65.949  19.386  1.00 78.31  ? 163 TRP C N   1 
ATOM   7153  C CA  . TRP D 2 139 ? 55.347  65.958  18.082  1.00 77.78  ? 163 TRP C CA  1 
ATOM   7154  C C   . TRP D 2 139 ? 55.073  67.376  17.604  1.00 78.77  ? 163 TRP C C   1 
ATOM   7155  O O   . TRP D 2 139 ? 55.116  67.643  16.398  1.00 82.07  ? 163 TRP C O   1 
ATOM   7156  C CB  . TRP D 2 139 ? 54.046  65.161  18.155  1.00 76.50  ? 163 TRP C CB  1 
ATOM   7157  C CG  . TRP D 2 139 ? 53.566  64.653  16.842  1.00 72.57  ? 163 TRP C CG  1 
ATOM   7158  C CD1 . TRP D 2 139 ? 54.080  63.616  16.123  1.00 73.58  ? 163 TRP C CD1 1 
ATOM   7159  C CD2 . TRP D 2 139 ? 52.450  65.147  16.096  1.00 72.20  ? 163 TRP C CD2 1 
ATOM   7160  N NE1 . TRP D 2 139 ? 53.360  63.441  14.966  1.00 72.40  ? 163 TRP C NE1 1 
ATOM   7161  C CE2 . TRP D 2 139 ? 52.352  64.369  14.928  1.00 71.94  ? 163 TRP C CE2 1 
ATOM   7162  C CE3 . TRP D 2 139 ? 51.528  66.177  16.300  1.00 72.22  ? 163 TRP C CE3 1 
ATOM   7163  C CZ2 . TRP D 2 139 ? 51.368  64.587  13.967  1.00 73.28  ? 163 TRP C CZ2 1 
ATOM   7164  C CZ3 . TRP D 2 139 ? 50.552  66.392  15.347  1.00 72.18  ? 163 TRP C CZ3 1 
ATOM   7165  C CH2 . TRP D 2 139 ? 50.479  65.602  14.195  1.00 72.27  ? 163 TRP C CH2 1 
ATOM   7166  N N   . LEU D 2 140 ? 54.787  68.289  18.527  1.00 81.24  ? 164 LEU C N   1 
ATOM   7167  C CA  . LEU D 2 140 ? 54.560  69.692  18.197  1.00 81.43  ? 164 LEU C CA  1 
ATOM   7168  C C   . LEU D 2 140 ? 55.898  70.414  18.291  1.00 82.51  ? 164 LEU C C   1 
ATOM   7169  O O   . LEU D 2 140 ? 56.404  70.671  19.387  1.00 83.40  ? 164 LEU C O   1 
ATOM   7170  C CB  . LEU D 2 140 ? 53.520  70.298  19.130  1.00 80.97  ? 164 LEU C CB  1 
ATOM   7171  C CG  . LEU D 2 140 ? 52.067  69.963  18.802  1.00 79.97  ? 164 LEU C CG  1 
ATOM   7172  C CD1 . LEU D 2 140 ? 51.130  70.972  19.431  1.00 79.72  ? 164 LEU C CD1 1 
ATOM   7173  C CD2 . LEU D 2 140 ? 51.869  69.920  17.301  1.00 79.79  ? 164 LEU C CD2 1 
ATOM   7174  N N   . SER D 2 141 ? 56.479  70.729  17.137  1.00 90.88  ? 165 SER C N   1 
ATOM   7175  C CA  . SER D 2 141 ? 57.747  71.440  17.117  1.00 95.23  ? 165 SER C CA  1 
ATOM   7176  C C   . SER D 2 141 ? 57.585  72.807  17.777  1.00 102.76 ? 165 SER C C   1 
ATOM   7177  O O   . SER D 2 141 ? 56.535  73.447  17.631  1.00 105.45 ? 165 SER C O   1 
ATOM   7178  C CB  . SER D 2 141 ? 58.253  71.606  15.683  1.00 93.32  ? 165 SER C CB  1 
ATOM   7179  O OG  . SER D 2 141 ? 58.408  70.349  15.047  1.00 93.75  ? 165 SER C OG  1 
ATOM   7180  N N   . PRO D 2 142 ? 58.584  73.272  18.528  1.00 112.93 ? 166 PRO C N   1 
ATOM   7181  C CA  . PRO D 2 142 ? 58.490  74.605  19.143  1.00 106.82 ? 166 PRO C CA  1 
ATOM   7182  C C   . PRO D 2 142 ? 58.266  75.672  18.083  1.00 99.86  ? 166 PRO C C   1 
ATOM   7183  O O   . PRO D 2 142 ? 59.110  75.900  17.211  1.00 92.16  ? 166 PRO C O   1 
ATOM   7184  C CB  . PRO D 2 142 ? 59.844  74.767  19.844  1.00 107.40 ? 166 PRO C CB  1 
ATOM   7185  C CG  . PRO D 2 142 ? 60.295  73.365  20.107  1.00 108.77 ? 166 PRO C CG  1 
ATOM   7186  C CD  . PRO D 2 142 ? 59.804  72.556  18.939  1.00 111.09 ? 166 PRO C CD  1 
ATOM   7187  N N   . GLY D 2 143 ? 57.109  76.316  18.155  1.00 90.90  ? 167 GLY C N   1 
ATOM   7188  C CA  . GLY D 2 143 ? 56.723  77.292  17.166  1.00 87.16  ? 167 GLY C CA  1 
ATOM   7189  C C   . GLY D 2 143 ? 55.726  76.803  16.145  1.00 86.56  ? 167 GLY C C   1 
ATOM   7190  O O   . GLY D 2 143 ? 55.545  77.466  15.118  1.00 85.91  ? 167 GLY C O   1 
ATOM   7191  N N   . ASP D 2 144 ? 55.091  75.656  16.379  1.00 86.73  ? 168 ASP C N   1 
ATOM   7192  C CA  . ASP D 2 144 ? 53.989  75.213  15.537  1.00 84.03  ? 168 ASP C CA  1 
ATOM   7193  C C   . ASP D 2 144 ? 52.660  75.814  15.962  1.00 83.01  ? 168 ASP C C   1 
ATOM   7194  O O   . ASP D 2 144 ? 51.700  75.776  15.183  1.00 84.08  ? 168 ASP C O   1 
ATOM   7195  C CB  . ASP D 2 144 ? 53.882  73.685  15.554  1.00 82.80  ? 168 ASP C CB  1 
ATOM   7196  C CG  . ASP D 2 144 ? 54.864  73.020  14.610  1.00 85.74  ? 168 ASP C CG  1 
ATOM   7197  O OD1 . ASP D 2 144 ? 55.786  73.707  14.122  1.00 97.64  ? 168 ASP C OD1 1 
ATOM   7198  O OD2 . ASP D 2 144 ? 54.711  71.809  14.348  1.00 85.85  ? 168 ASP C OD2 1 
ATOM   7199  N N   . LEU D 2 145 ? 52.584  76.365  17.170  1.00 77.47  ? 169 LEU C N   1 
ATOM   7200  C CA  . LEU D 2 145 ? 51.374  76.979  17.690  1.00 76.93  ? 169 LEU C CA  1 
ATOM   7201  C C   . LEU D 2 145 ? 51.607  78.465  17.910  1.00 77.52  ? 169 LEU C C   1 
ATOM   7202  O O   . LEU D 2 145 ? 52.691  78.877  18.336  1.00 78.33  ? 169 LEU C O   1 
ATOM   7203  C CB  . LEU D 2 145 ? 50.950  76.339  19.014  1.00 76.56  ? 169 LEU C CB  1 
ATOM   7204  C CG  . LEU D 2 145 ? 50.948  74.816  19.119  1.00 76.12  ? 169 LEU C CG  1 
ATOM   7205  C CD1 . LEU D 2 145 ? 50.410  74.396  20.476  1.00 75.79  ? 169 LEU C CD1 1 
ATOM   7206  C CD2 . LEU D 2 145 ? 50.136  74.198  17.996  1.00 75.42  ? 169 LEU C CD2 1 
ATOM   7207  N N   . GLU D 2 146 ? 50.591  79.266  17.613  1.00 80.82  ? 170 GLU C N   1 
ATOM   7208  C CA  . GLU D 2 146 ? 50.559  80.667  17.999  1.00 81.83  ? 170 GLU C CA  1 
ATOM   7209  C C   . GLU D 2 146 ? 49.301  80.911  18.820  1.00 79.81  ? 170 GLU C C   1 
ATOM   7210  O O   . GLU D 2 146 ? 48.435  80.038  18.945  1.00 80.57  ? 170 GLU C O   1 
ATOM   7211  C CB  . GLU D 2 146 ? 50.608  81.595  16.778  1.00 82.35  ? 170 GLU C CB  1 
ATOM   7212  C CG  . GLU D 2 146 ? 49.368  81.551  15.906  1.00 85.90  ? 170 GLU C CG  1 
ATOM   7213  C CD  . GLU D 2 146 ? 49.458  82.485  14.715  1.00 89.44  ? 170 GLU C CD  1 
ATOM   7214  O OE1 . GLU D 2 146 ? 48.535  82.468  13.871  1.00 89.08  ? 170 GLU C OE1 1 
ATOM   7215  O OE2 . GLU D 2 146 ? 50.451  83.238  14.625  1.00 95.50  ? 170 GLU C OE2 1 
ATOM   7216  N N   . PHE D 2 147 ? 49.200  82.101  19.400  1.00 81.26  ? 171 PHE C N   1 
ATOM   7217  C CA  . PHE D 2 147 ? 48.079  82.413  20.274  1.00 82.62  ? 171 PHE C CA  1 
ATOM   7218  C C   . PHE D 2 147 ? 47.278  83.577  19.710  1.00 84.08  ? 171 PHE C C   1 
ATOM   7219  O O   . PHE D 2 147 ? 47.845  84.541  19.192  1.00 91.49  ? 171 PHE C O   1 
ATOM   7220  C CB  . PHE D 2 147 ? 48.559  82.734  21.689  1.00 81.34  ? 171 PHE C CB  1 
ATOM   7221  C CG  . PHE D 2 147 ? 49.267  81.591  22.360  1.00 82.64  ? 171 PHE C CG  1 
ATOM   7222  C CD1 . PHE D 2 147 ? 50.606  81.347  22.114  1.00 83.67  ? 171 PHE C CD1 1 
ATOM   7223  C CD2 . PHE D 2 147 ? 48.591  80.752  23.229  1.00 84.74  ? 171 PHE C CD2 1 
ATOM   7224  C CE1 . PHE D 2 147 ? 51.261  80.296  22.729  1.00 86.58  ? 171 PHE C CE1 1 
ATOM   7225  C CE2 . PHE D 2 147 ? 49.245  79.700  23.847  1.00 84.01  ? 171 PHE C CE2 1 
ATOM   7226  C CZ  . PHE D 2 147 ? 50.578  79.471  23.595  1.00 83.61  ? 171 PHE C CZ  1 
ATOM   7227  N N   . GLU D 2 148 ? 45.956  83.472  19.808  1.00 75.55  ? 172 GLU C N   1 
ATOM   7228  C CA  . GLU D 2 148 ? 45.037  84.506  19.353  1.00 75.33  ? 172 GLU C CA  1 
ATOM   7229  C C   . GLU D 2 148 ? 44.339  85.066  20.583  1.00 76.96  ? 172 GLU C C   1 
ATOM   7230  O O   . GLU D 2 148 ? 43.576  84.353  21.246  1.00 75.32  ? 172 GLU C O   1 
ATOM   7231  C CB  . GLU D 2 148 ? 44.029  83.945  18.353  1.00 74.93  ? 172 GLU C CB  1 
ATOM   7232  C CG  . GLU D 2 148 ? 43.082  84.978  17.765  1.00 74.74  ? 172 GLU C CG  1 
ATOM   7233  C CD  . GLU D 2 148 ? 42.101  84.372  16.776  1.00 76.71  ? 172 GLU C CD  1 
ATOM   7234  O OE1 . GLU D 2 148 ? 41.079  85.026  16.477  1.00 75.49  ? 172 GLU C OE1 1 
ATOM   7235  O OE2 . GLU D 2 148 ? 42.347  83.241  16.300  1.00 77.61  ? 172 GLU C OE2 1 
ATOM   7236  N N   . VAL D 2 149 ? 44.629  86.330  20.901  1.00 75.65  ? 173 VAL C N   1 
ATOM   7237  C CA  . VAL D 2 149 ? 43.989  87.062  21.986  1.00 75.73  ? 173 VAL C CA  1 
ATOM   7238  C C   . VAL D 2 149 ? 42.900  87.932  21.386  1.00 75.48  ? 173 VAL C C   1 
ATOM   7239  O O   . VAL D 2 149 ? 43.110  88.598  20.366  1.00 75.69  ? 173 VAL C O   1 
ATOM   7240  C CB  . VAL D 2 149 ? 45.006  87.921  22.761  1.00 76.62  ? 173 VAL C CB  1 
ATOM   7241  C CG1 . VAL D 2 149 ? 44.364  88.512  24.008  1.00 76.73  ? 173 VAL C CG1 1 
ATOM   7242  C CG2 . VAL D 2 149 ? 46.243  87.109  23.106  1.00 76.99  ? 173 VAL C CG2 1 
ATOM   7243  N N   . VAL D 2 150 ? 41.735  87.931  22.016  1.00 73.48  ? 174 VAL C N   1 
ATOM   7244  C CA  . VAL D 2 150 ? 40.591  88.697  21.560  1.00 73.24  ? 174 VAL C CA  1 
ATOM   7245  C C   . VAL D 2 150 ? 40.132  89.530  22.746  1.00 73.52  ? 174 VAL C C   1 
ATOM   7246  O O   . VAL D 2 150 ? 39.712  88.977  23.774  1.00 73.32  ? 174 VAL C O   1 
ATOM   7247  C CB  . VAL D 2 150 ? 39.469  87.792  21.037  1.00 72.43  ? 174 VAL C CB  1 
ATOM   7248  C CG1 . VAL D 2 150 ? 38.209  88.566  20.857  1.00 72.23  ? 174 VAL C CG1 1 
ATOM   7249  C CG2 . VAL D 2 150 ? 39.876  87.189  19.711  1.00 72.24  ? 174 VAL C CG2 1 
ATOM   7250  N N   . TYR D 2 151 ? 40.258  90.852  22.628  1.00 77.18  ? 175 TYR C N   1 
ATOM   7251  C CA  . TYR D 2 151 ? 39.876  91.770  23.693  1.00 77.55  ? 175 TYR C CA  1 
ATOM   7252  C C   . TYR D 2 151 ? 38.795  92.721  23.201  1.00 77.42  ? 175 TYR C C   1 
ATOM   7253  O O   . TYR D 2 151 ? 38.746  93.081  22.023  1.00 77.36  ? 175 TYR C O   1 
ATOM   7254  C CB  . TYR D 2 151 ? 41.075  92.563  24.240  1.00 78.42  ? 175 TYR C CB  1 
ATOM   7255  C CG  . TYR D 2 151 ? 41.902  93.322  23.225  1.00 78.87  ? 175 TYR C CG  1 
ATOM   7256  C CD1 . TYR D 2 151 ? 42.773  92.660  22.372  1.00 80.70  ? 175 TYR C CD1 1 
ATOM   7257  C CD2 . TYR D 2 151 ? 41.845  94.706  23.151  1.00 79.38  ? 175 TYR C CD2 1 
ATOM   7258  C CE1 . TYR D 2 151 ? 43.542  93.353  21.455  1.00 84.64  ? 175 TYR C CE1 1 
ATOM   7259  C CE2 . TYR D 2 151 ? 42.610  95.408  22.240  1.00 80.66  ? 175 TYR C CE2 1 
ATOM   7260  C CZ  . TYR D 2 151 ? 43.458  94.727  21.394  1.00 81.91  ? 175 TYR C CZ  1 
ATOM   7261  O OH  . TYR D 2 151 ? 44.223  95.419  20.483  1.00 80.95  ? 175 TYR C OH  1 
ATOM   7262  N N   . LYS D 2 152 ? 37.929  93.127  24.124  1.00 79.65  ? 176 LYS C N   1 
ATOM   7263  C CA  . LYS D 2 152 ? 36.686  93.789  23.757  1.00 79.43  ? 176 LYS C CA  1 
ATOM   7264  C C   . LYS D 2 152 ? 36.110  94.498  24.974  1.00 79.75  ? 176 LYS C C   1 
ATOM   7265  O O   . LYS D 2 152 ? 36.133  93.953  26.076  1.00 79.77  ? 176 LYS C O   1 
ATOM   7266  C CB  . LYS D 2 152 ? 35.687  92.764  23.212  1.00 78.64  ? 176 LYS C CB  1 
ATOM   7267  C CG  . LYS D 2 152 ? 34.256  93.235  23.146  1.00 78.39  ? 176 LYS C CG  1 
ATOM   7268  C CD  . LYS D 2 152 ? 33.309  92.054  23.097  1.00 77.69  ? 176 LYS C CD  1 
ATOM   7269  C CE  . LYS D 2 152 ? 33.171  91.394  24.453  1.00 77.65  ? 176 LYS C CE  1 
ATOM   7270  N NZ  . LYS D 2 152 ? 32.606  92.317  25.472  1.00 78.05  ? 176 LYS C NZ  1 
ATOM   7271  N N   . ARG D 2 153 ? 35.589  95.706  24.769  1.00 86.26  ? 177 ARG C N   1 
ATOM   7272  C CA  . ARG D 2 153 ? 34.902  96.399  25.851  1.00 89.11  ? 177 ARG C CA  1 
ATOM   7273  C C   . ARG D 2 153 ? 33.707  95.581  26.328  1.00 88.09  ? 177 ARG C C   1 
ATOM   7274  O O   . ARG D 2 153 ? 33.084  94.845  25.559  1.00 88.64  ? 177 ARG C O   1 
ATOM   7275  C CB  . ARG D 2 153 ? 34.436  97.783  25.397  1.00 93.91  ? 177 ARG C CB  1 
ATOM   7276  C CG  . ARG D 2 153 ? 35.534  98.680  24.857  1.00 95.41  ? 177 ARG C CG  1 
ATOM   7277  C CD  . ARG D 2 153 ? 35.001  100.073 24.583  1.00 95.66  ? 177 ARG C CD  1 
ATOM   7278  N NE  . ARG D 2 153 ? 33.726  100.027 23.876  1.00 93.04  ? 177 ARG C NE  1 
ATOM   7279  C CZ  . ARG D 2 153 ? 33.018  101.101 23.545  1.00 91.02  ? 177 ARG C CZ  1 
ATOM   7280  N NH1 . ARG D 2 153 ? 33.462  102.310 23.857  1.00 94.11  ? 177 ARG C NH1 1 
ATOM   7281  N NH2 . ARG D 2 153 ? 31.866  100.965 22.904  1.00 92.93  ? 177 ARG C NH2 1 
ATOM   7282  N N   . LEU D 2 154 ? 33.388  95.715  27.619  1.00 86.88  ? 178 LEU C N   1 
ATOM   7283  C CA  . LEU D 2 154 ? 32.265  94.973  28.185  1.00 86.45  ? 178 LEU C CA  1 
ATOM   7284  C C   . LEU D 2 154 ? 30.969  95.251  27.436  1.00 85.26  ? 178 LEU C C   1 
ATOM   7285  O O   . LEU D 2 154 ? 30.078  94.395  27.399  1.00 83.30  ? 178 LEU C O   1 
ATOM   7286  C CB  . LEU D 2 154 ? 32.103  95.316  29.666  1.00 92.06  ? 178 LEU C CB  1 
ATOM   7287  C CG  . LEU D 2 154 ? 31.370  94.295  30.539  1.00 94.52  ? 178 LEU C CG  1 
ATOM   7288  C CD1 . LEU D 2 154 ? 32.277  93.127  30.872  1.00 97.74  ? 178 LEU C CD1 1 
ATOM   7289  C CD2 . LEU D 2 154 ? 30.848  94.947  31.809  1.00 94.42  ? 178 LEU C CD2 1 
ATOM   7290  N N   . GLN D 2 155 ? 30.849  96.432  26.827  1.00 90.81  ? 179 GLN C N   1 
ATOM   7291  C CA  . GLN D 2 155 ? 29.635  96.777  26.095  1.00 96.03  ? 179 GLN C CA  1 
ATOM   7292  C C   . GLN D 2 155 ? 29.557  96.027  24.769  1.00 94.45  ? 179 GLN C C   1 
ATOM   7293  O O   . GLN D 2 155 ? 28.521  95.439  24.436  1.00 97.50  ? 179 GLN C O   1 
ATOM   7294  C CB  . GLN D 2 155 ? 29.585  98.286  25.848  1.00 99.29  ? 179 GLN C CB  1 
ATOM   7295  C CG  . GLN D 2 155 ? 29.710  99.142  27.094  1.00 101.97 ? 179 GLN C CG  1 
ATOM   7296  C CD  . GLN D 2 155 ? 31.096  99.745  27.240  1.00 102.98 ? 179 GLN C CD  1 
ATOM   7297  O OE1 . GLN D 2 155 ? 32.047  99.057  27.609  1.00 100.02 ? 179 GLN C OE1 1 
ATOM   7298  N NE2 . GLN D 2 155 ? 31.218  101.034 26.936  1.00 102.64 ? 179 GLN C NE2 1 
ATOM   7299  N N   . ASP D 2 156 ? 30.648  96.033  24.006  1.00 92.22  ? 180 ASP C N   1 
ATOM   7300  C CA  . ASP D 2 156 ? 30.627  95.605  22.616  1.00 92.41  ? 180 ASP C CA  1 
ATOM   7301  C C   . ASP D 2 156 ? 30.375  94.101  22.503  1.00 93.75  ? 180 ASP C C   1 
ATOM   7302  O O   . ASP D 2 156 ? 30.357  93.363  23.493  1.00 93.98  ? 180 ASP C O   1 
ATOM   7303  C CB  . ASP D 2 156 ? 31.946  95.965  21.933  1.00 95.02  ? 180 ASP C CB  1 
ATOM   7304  C CG  . ASP D 2 156 ? 32.222  97.455  21.946  1.00 95.08  ? 180 ASP C CG  1 
ATOM   7305  O OD1 . ASP D 2 156 ? 31.290  98.237  21.664  1.00 97.61  ? 180 ASP C OD1 1 
ATOM   7306  O OD2 . ASP D 2 156 ? 33.374  97.843  22.238  1.00 87.57  ? 180 ASP C OD2 1 
ATOM   7307  N N   . SER D 2 157 ? 30.182  93.654  21.264  1.00 95.32  ? 181 SER C N   1 
ATOM   7308  C CA  . SER D 2 157 ? 30.010  92.247  20.933  1.00 90.98  ? 181 SER C CA  1 
ATOM   7309  C C   . SER D 2 157 ? 31.334  91.649  20.471  1.00 87.69  ? 181 SER C C   1 
ATOM   7310  O O   . SER D 2 157 ? 32.216  92.355  19.973  1.00 84.67  ? 181 SER C O   1 
ATOM   7311  C CB  . SER D 2 157 ? 28.951  92.067  19.843  1.00 92.37  ? 181 SER C CB  1 
ATOM   7312  O OG  . SER D 2 157 ? 29.207  90.912  19.060  1.00 88.82  ? 181 SER C OG  1 
ATOM   7313  N N   . TRP D 2 158 ? 31.467  90.331  20.644  1.00 83.22  ? 182 TRP C N   1 
ATOM   7314  C CA  . TRP D 2 158 ? 32.715  89.659  20.297  1.00 82.17  ? 182 TRP C CA  1 
ATOM   7315  C C   . TRP D 2 158 ? 33.021  89.729  18.807  1.00 85.84  ? 182 TRP C C   1 
ATOM   7316  O O   . TRP D 2 158 ? 34.174  89.520  18.413  1.00 87.07  ? 182 TRP C O   1 
ATOM   7317  C CB  . TRP D 2 158 ? 32.678  88.200  20.748  1.00 81.32  ? 182 TRP C CB  1 
ATOM   7318  C CG  . TRP D 2 158 ? 32.817  88.021  22.224  1.00 78.16  ? 182 TRP C CG  1 
ATOM   7319  C CD1 . TRP D 2 158 ? 31.845  87.640  23.101  1.00 81.36  ? 182 TRP C CD1 1 
ATOM   7320  C CD2 . TRP D 2 158 ? 33.999  88.231  23.002  1.00 74.97  ? 182 TRP C CD2 1 
ATOM   7321  N NE1 . TRP D 2 158 ? 32.352  87.586  24.377  1.00 80.56  ? 182 TRP C NE1 1 
ATOM   7322  C CE2 . TRP D 2 158 ? 33.673  87.947  24.342  1.00 76.95  ? 182 TRP C CE2 1 
ATOM   7323  C CE3 . TRP D 2 158 ? 35.302  88.626  22.695  1.00 74.86  ? 182 TRP C CE3 1 
ATOM   7324  C CZ2 . TRP D 2 158 ? 34.603  88.048  25.373  1.00 78.02  ? 182 TRP C CZ2 1 
ATOM   7325  C CZ3 . TRP D 2 158 ? 36.224  88.726  23.719  1.00 75.16  ? 182 TRP C CZ3 1 
ATOM   7326  C CH2 . TRP D 2 158 ? 35.871  88.438  25.041  1.00 78.20  ? 182 TRP C CH2 1 
ATOM   7327  N N   . GLU D 2 159 ? 32.019  90.007  17.971  1.00 93.76  ? 183 GLU C N   1 
ATOM   7328  C CA  . GLU D 2 159 ? 32.286  90.229  16.554  1.00 94.42  ? 183 GLU C CA  1 
ATOM   7329  C C   . GLU D 2 159 ? 33.092  91.504  16.342  1.00 91.36  ? 183 GLU C C   1 
ATOM   7330  O O   . GLU D 2 159 ? 33.999  91.540  15.502  1.00 89.62  ? 183 GLU C O   1 
ATOM   7331  C CB  . GLU D 2 159 ? 30.972  90.284  15.776  1.00 96.18  ? 183 GLU C CB  1 
ATOM   7332  C CG  . GLU D 2 159 ? 30.260  88.944  15.678  1.00 98.62  ? 183 GLU C CG  1 
ATOM   7333  C CD  . GLU D 2 159 ? 29.330  88.862  14.481  1.00 97.73  ? 183 GLU C CD  1 
ATOM   7334  O OE1 . GLU D 2 159 ? 28.589  89.837  14.232  1.00 99.27  ? 183 GLU C OE1 1 
ATOM   7335  O OE2 . GLU D 2 159 ? 29.345  87.822  13.788  1.00 97.75  ? 183 GLU C OE2 1 
ATOM   7336  N N   . ASP D 2 160 ? 32.782  92.555  17.101  1.00 93.36  ? 184 ASP C N   1 
ATOM   7337  C CA  . ASP D 2 160 ? 33.476  93.834  17.019  1.00 93.71  ? 184 ASP C CA  1 
ATOM   7338  C C   . ASP D 2 160 ? 34.795  93.846  17.780  1.00 90.86  ? 184 ASP C C   1 
ATOM   7339  O O   . ASP D 2 160 ? 35.386  94.918  17.948  1.00 98.39  ? 184 ASP C O   1 
ATOM   7340  C CB  . ASP D 2 160 ? 32.579  94.954  17.556  1.00 95.33  ? 184 ASP C CB  1 
ATOM   7341  C CG  . ASP D 2 160 ? 31.346  95.178  16.705  1.00 96.99  ? 184 ASP C CG  1 
ATOM   7342  O OD1 . ASP D 2 160 ? 31.495  95.601  15.539  1.00 96.25  ? 184 ASP C OD1 1 
ATOM   7343  O OD2 . ASP D 2 160 ? 30.228  94.935  17.208  1.00 99.07  ? 184 ASP C OD2 1 
ATOM   7344  N N   . ALA D 2 161 ? 35.268  92.694  18.241  1.00 81.88  ? 185 ALA C N   1 
ATOM   7345  C CA  . ALA D 2 161 ? 36.406  92.667  19.142  1.00 82.68  ? 185 ALA C CA  1 
ATOM   7346  C C   . ALA D 2 161 ? 37.716  92.869  18.383  1.00 79.79  ? 185 ALA C C   1 
ATOM   7347  O O   . ALA D 2 161 ? 37.763  92.891  17.151  1.00 80.05  ? 185 ALA C O   1 
ATOM   7348  C CB  . ALA D 2 161 ? 36.433  91.357  19.918  1.00 86.29  ? 185 ALA C CB  1 
ATOM   7349  N N   . ALA D 2 162 ? 38.793  93.018  19.148  1.00 76.54  ? 186 ALA C N   1 
ATOM   7350  C CA  . ALA D 2 162 ? 40.124  93.268  18.615  1.00 77.63  ? 186 ALA C CA  1 
ATOM   7351  C C   . ALA D 2 162 ? 40.991  92.027  18.770  1.00 78.73  ? 186 ALA C C   1 
ATOM   7352  O O   . ALA D 2 162 ? 40.935  91.341  19.798  1.00 77.57  ? 186 ALA C O   1 
ATOM   7353  C CB  . ALA D 2 162 ? 40.783  94.455  19.317  1.00 77.53  ? 186 ALA C CB  1 
ATOM   7354  N N   . ILE D 2 163 ? 41.809  91.768  17.750  1.00 77.12  ? 187 ILE C N   1 
ATOM   7355  C CA  . ILE D 2 163 ? 42.584  90.540  17.618  1.00 76.53  ? 187 ILE C CA  1 
ATOM   7356  C C   . ILE D 2 163 ? 44.061  90.866  17.802  1.00 76.52  ? 187 ILE C C   1 
ATOM   7357  O O   . ILE D 2 163 ? 44.537  91.912  17.348  1.00 80.22  ? 187 ILE C O   1 
ATOM   7358  C CB  . ILE D 2 163 ? 42.325  89.885  16.247  1.00 79.15  ? 187 ILE C CB  1 
ATOM   7359  C CG1 . ILE D 2 163 ? 40.899  89.333  16.188  1.00 84.04  ? 187 ILE C CG1 1 
ATOM   7360  C CG2 . ILE D 2 163 ? 43.338  88.784  15.968  1.00 78.65  ? 187 ILE C CG2 1 
ATOM   7361  C CD1 . ILE D 2 163 ? 40.359  89.157  14.779  1.00 86.04  ? 187 ILE C CD1 1 
ATOM   7362  N N   . LEU D 2 164 ? 44.782  89.967  18.471  1.00 80.83  ? 188 LEU C N   1 
ATOM   7363  C CA  . LEU D 2 164 ? 46.205  90.149  18.737  1.00 83.13  ? 188 LEU C CA  1 
ATOM   7364  C C   . LEU D 2 164 ? 46.886  88.789  18.687  1.00 83.84  ? 188 LEU C C   1 
ATOM   7365  O O   . LEU D 2 164 ? 46.581  87.916  19.503  1.00 80.67  ? 188 LEU C O   1 
ATOM   7366  C CB  . LEU D 2 164 ? 46.419  90.815  20.098  1.00 83.75  ? 188 LEU C CB  1 
ATOM   7367  C CG  . LEU D 2 164 ? 47.849  91.191  20.481  1.00 84.97  ? 188 LEU C CG  1 
ATOM   7368  C CD1 . LEU D 2 164 ? 48.304  92.424  19.715  1.00 87.62  ? 188 LEU C CD1 1 
ATOM   7369  C CD2 . LEU D 2 164 ? 47.954  91.414  21.982  1.00 81.44  ? 188 LEU C CD2 1 
ATOM   7370  N N   . LEU D 2 165 ? 47.797  88.602  17.734  1.00 89.34  ? 189 LEU C N   1 
ATOM   7371  C CA  . LEU D 2 165 ? 48.507  87.337  17.591  1.00 87.32  ? 189 LEU C CA  1 
ATOM   7372  C C   . LEU D 2 165 ? 49.814  87.376  18.371  1.00 83.46  ? 189 LEU C C   1 
ATOM   7373  O O   . LEU D 2 165 ? 50.492  88.406  18.418  1.00 84.77  ? 189 LEU C O   1 
ATOM   7374  C CB  . LEU D 2 165 ? 48.774  87.030  16.117  1.00 87.19  ? 189 LEU C CB  1 
ATOM   7375  C CG  . LEU D 2 165 ? 47.512  86.965  15.252  1.00 90.05  ? 189 LEU C CG  1 
ATOM   7376  C CD1 . LEU D 2 165 ? 47.586  87.958  14.104  1.00 90.81  ? 189 LEU C CD1 1 
ATOM   7377  C CD2 . LEU D 2 165 ? 47.280  85.552  14.734  1.00 88.94  ? 189 LEU C CD2 1 
ATOM   7378  N N   . SER D 2 166 ? 50.163  86.247  18.985  1.00 89.86  ? 190 SER C N   1 
ATOM   7379  C CA  . SER D 2 166 ? 51.294  86.197  19.901  1.00 90.46  ? 190 SER C CA  1 
ATOM   7380  C C   . SER D 2 166 ? 52.138  84.955  19.655  1.00 92.78  ? 190 SER C C   1 
ATOM   7381  O O   . SER D 2 166 ? 51.607  83.859  19.432  1.00 94.34  ? 190 SER C O   1 
ATOM   7382  C CB  . SER D 2 166 ? 50.827  86.223  21.361  1.00 88.61  ? 190 SER C CB  1 
ATOM   7383  O OG  . SER D 2 166 ? 51.911  85.998  22.245  1.00 87.76  ? 190 SER C OG  1 
ATOM   7384  N N   . ASN D 2 167 ? 53.459  85.149  19.715  1.00 103.34 ? 191 ASN C N   1 
ATOM   7385  C CA  . ASN D 2 167 ? 54.466  84.108  19.553  1.00 100.48 ? 191 ASN C CA  1 
ATOM   7386  C C   . ASN D 2 167 ? 54.878  83.468  20.878  1.00 96.20  ? 191 ASN C C   1 
ATOM   7387  O O   . ASN D 2 167 ? 55.809  82.657  20.891  1.00 99.28  ? 191 ASN C O   1 
ATOM   7388  C CB  . ASN D 2 167 ? 55.709  84.684  18.844  1.00 104.75 ? 191 ASN C CB  1 
ATOM   7389  C CG  . ASN D 2 167 ? 55.576  84.674  17.325  1.00 110.80 ? 191 ASN C CG  1 
ATOM   7390  O OD1 . ASN D 2 167 ? 54.764  83.920  16.788  1.00 109.61 ? 191 ASN C OD1 1 
ATOM   7391  N ND2 . ASN D 2 167 ? 56.368  85.499  16.619  1.00 116.50 ? 191 ASN C ND2 1 
ATOM   7392  N N   . THR D 2 168 ? 54.215  83.807  21.984  1.00 91.51  ? 192 THR C N   1 
ATOM   7393  C CA  . THR D 2 168 ? 54.623  83.336  23.304  1.00 99.00  ? 192 THR C CA  1 
ATOM   7394  C C   . THR D 2 168 ? 53.373  83.161  24.162  1.00 97.49  ? 192 THR C C   1 
ATOM   7395  O O   . THR D 2 168 ? 52.246  83.378  23.705  1.00 95.75  ? 192 THR C O   1 
ATOM   7396  C CB  . THR D 2 168 ? 55.617  84.310  23.957  1.00 106.89 ? 192 THR C CB  1 
ATOM   7397  O OG1 . THR D 2 168 ? 56.468  84.868  22.952  1.00 109.81 ? 192 THR C OG1 1 
ATOM   7398  C CG2 . THR D 2 168 ? 56.507  83.586  24.970  1.00 105.93 ? 192 THR C CG2 1 
ATOM   7399  N N   . SER D 2 169 ? 53.583  82.769  25.422  1.00 96.77  ? 193 SER C N   1 
ATOM   7400  C CA  . SER D 2 169 ? 52.498  82.494  26.356  1.00 101.00 ? 193 SER C CA  1 
ATOM   7401  C C   . SER D 2 169 ? 52.096  83.770  27.080  1.00 102.97 ? 193 SER C C   1 
ATOM   7402  O O   . SER D 2 169 ? 51.599  83.727  28.212  1.00 101.14 ? 193 SER C O   1 
ATOM   7403  C CB  . SER D 2 169 ? 52.912  81.420  27.370  1.00 104.86 ? 193 SER C CB  1 
ATOM   7404  O OG  . SER D 2 169 ? 51.840  81.130  28.255  1.00 105.39 ? 193 SER C OG  1 
ATOM   7405  N N   . GLN D 2 170 ? 52.301  84.914  26.438  1.00 107.10 ? 194 GLN C N   1 
ATOM   7406  C CA  . GLN D 2 170 ? 51.990  86.192  27.063  1.00 108.61 ? 194 GLN C CA  1 
ATOM   7407  C C   . GLN D 2 170 ? 51.873  87.259  25.987  1.00 105.45 ? 194 GLN C C   1 
ATOM   7408  O O   . GLN D 2 170 ? 52.440  87.135  24.898  1.00 103.11 ? 194 GLN C O   1 
ATOM   7409  C CB  . GLN D 2 170 ? 53.050  86.584  28.096  1.00 109.60 ? 194 GLN C CB  1 
ATOM   7410  C CG  . GLN D 2 170 ? 54.467  86.569  27.555  1.00 111.56 ? 194 GLN C CG  1 
ATOM   7411  C CD  . GLN D 2 170 ? 55.385  87.505  28.313  1.00 112.08 ? 194 GLN C CD  1 
ATOM   7412  O OE1 . GLN D 2 170 ? 56.268  87.065  29.052  1.00 111.59 ? 194 GLN C OE1 1 
ATOM   7413  N NE2 . GLN D 2 170 ? 55.185  88.805  28.130  1.00 113.22 ? 194 GLN C NE2 1 
ATOM   7414  N N   . ALA D 2 171 ? 51.127  88.314  26.314  1.00 105.23 ? 195 ALA C N   1 
ATOM   7415  C CA  . ALA D 2 171 ? 50.931  89.435  25.409  1.00 108.04 ? 195 ALA C CA  1 
ATOM   7416  C C   . ALA D 2 171 ? 50.664  90.701  26.210  1.00 108.78 ? 195 ALA C C   1 
ATOM   7417  O O   . ALA D 2 171 ? 50.049  90.661  27.279  1.00 101.66 ? 195 ALA C O   1 
ATOM   7418  C CB  . ALA D 2 171 ? 49.776  89.175  24.439  1.00 108.84 ? 195 ALA C CB  1 
ATOM   7419  N N   . THR D 2 172 ? 51.104  91.834  25.664  1.00 110.24 ? 196 THR C N   1 
ATOM   7420  C CA  . THR D 2 172 ? 50.996  93.123  26.337  1.00 109.75 ? 196 THR C CA  1 
ATOM   7421  C C   . THR D 2 172 ? 50.132  94.076  25.522  1.00 107.05 ? 196 THR C C   1 
ATOM   7422  O O   . THR D 2 172 ? 50.317  94.211  24.306  1.00 101.70 ? 196 THR C O   1 
ATOM   7423  C CB  . THR D 2 172 ? 52.376  93.742  26.572  1.00 110.06 ? 196 THR C CB  1 
ATOM   7424  O OG1 . THR D 2 172 ? 53.200  93.541  25.417  1.00 114.41 ? 196 THR C OG1 1 
ATOM   7425  C CG2 . THR D 2 172 ? 53.044  93.094  27.775  1.00 107.21 ? 196 THR C CG2 1 
ATOM   7426  N N   . LEU D 2 173 ? 49.199  94.740  26.202  1.00 105.15 ? 197 LEU C N   1 
ATOM   7427  C CA  . LEU D 2 173 ? 48.331  95.754  25.617  1.00 105.00 ? 197 LEU C CA  1 
ATOM   7428  C C   . LEU D 2 173 ? 48.619  97.087  26.294  1.00 109.35 ? 197 LEU C C   1 
ATOM   7429  O O   . LEU D 2 173 ? 48.513  97.200  27.520  1.00 111.23 ? 197 LEU C O   1 
ATOM   7430  C CB  . LEU D 2 173 ? 46.855  95.382  25.787  1.00 99.98  ? 197 LEU C CB  1 
ATOM   7431  C CG  . LEU D 2 173 ? 46.237  94.400  24.792  1.00 99.97  ? 197 LEU C CG  1 
ATOM   7432  C CD1 . LEU D 2 173 ? 44.804  94.072  25.185  1.00 95.37  ? 197 LEU C CD1 1 
ATOM   7433  C CD2 . LEU D 2 173 ? 46.296  94.958  23.379  1.00 101.85 ? 197 LEU C CD2 1 
ATOM   7434  N N   . GLY D 2 174 ? 48.981  98.091  25.504  1.00 114.27 ? 198 GLY C N   1 
ATOM   7435  C CA  . GLY D 2 174 ? 49.179  99.421  26.027  1.00 118.57 ? 198 GLY C CA  1 
ATOM   7436  C C   . GLY D 2 174 ? 47.935  100.269 25.859  1.00 120.08 ? 198 GLY C C   1 
ATOM   7437  O O   . GLY D 2 174 ? 46.940  99.839  25.265  1.00 115.79 ? 198 GLY C O   1 
ATOM   7438  N N   . PRO D 2 175 ? 47.962  101.497 26.385  1.00 120.25 ? 199 PRO C N   1 
ATOM   7439  C CA  . PRO D 2 175 ? 46.863  102.437 26.108  1.00 115.96 ? 199 PRO C CA  1 
ATOM   7440  C C   . PRO D 2 175 ? 46.727  102.770 24.633  1.00 110.53 ? 199 PRO C C   1 
ATOM   7441  O O   . PRO D 2 175 ? 45.700  103.335 24.231  1.00 108.46 ? 199 PRO C O   1 
ATOM   7442  C CB  . PRO D 2 175 ? 47.245  103.675 26.927  1.00 116.93 ? 199 PRO C CB  1 
ATOM   7443  C CG  . PRO D 2 175 ? 48.723  103.583 27.081  1.00 119.98 ? 199 PRO C CG  1 
ATOM   7444  C CD  . PRO D 2 175 ? 49.031  102.118 27.182  1.00 118.34 ? 199 PRO C CD  1 
ATOM   7445  N N   . GLU D 2 176 ? 47.742  102.449 23.827  1.00 111.59 ? 200 GLU C N   1 
ATOM   7446  C CA  . GLU D 2 176 ? 47.640  102.581 22.380  1.00 114.56 ? 200 GLU C CA  1 
ATOM   7447  C C   . GLU D 2 176 ? 46.478  101.769 21.825  1.00 109.77 ? 200 GLU C C   1 
ATOM   7448  O O   . GLU D 2 176 ? 45.923  102.113 20.775  1.00 104.67 ? 200 GLU C O   1 
ATOM   7449  C CB  . GLU D 2 176 ? 48.948  102.119 21.739  1.00 120.90 ? 200 GLU C CB  1 
ATOM   7450  C CG  . GLU D 2 176 ? 50.194  102.740 22.349  1.00 122.59 ? 200 GLU C CG  1 
ATOM   7451  C CD  . GLU D 2 176 ? 51.288  101.714 22.594  1.00 122.16 ? 200 GLU C CD  1 
ATOM   7452  O OE1 . GLU D 2 176 ? 52.138  101.515 21.701  1.00 123.96 ? 200 GLU C OE1 1 
ATOM   7453  O OE2 . GLU D 2 176 ? 51.290  101.097 23.681  1.00 117.95 ? 200 GLU C OE2 1 
ATOM   7454  N N   . HIS D 2 177 ? 46.104  100.688 22.511  1.00 105.95 ? 201 HIS C N   1 
ATOM   7455  C CA  . HIS D 2 177 ? 45.092  99.765  22.023  1.00 107.06 ? 201 HIS C CA  1 
ATOM   7456  C C   . HIS D 2 177 ? 43.742  99.923  22.709  1.00 105.07 ? 201 HIS C C   1 
ATOM   7457  O O   . HIS D 2 177 ? 42.739  99.433  22.179  1.00 99.56  ? 201 HIS C O   1 
ATOM   7458  C CB  . HIS D 2 177 ? 45.563  98.317  22.211  1.00 112.13 ? 201 HIS C CB  1 
ATOM   7459  C CG  . HIS D 2 177 ? 46.884  98.017  21.570  1.00 114.77 ? 201 HIS C CG  1 
ATOM   7460  N ND1 . HIS D 2 177 ? 48.008  97.698  22.300  1.00 121.44 ? 201 HIS C ND1 1 
ATOM   7461  C CD2 . HIS D 2 177 ? 47.258  97.980  20.269  1.00 110.00 ? 201 HIS C CD2 1 
ATOM   7462  C CE1 . HIS D 2 177 ? 49.019  97.480  21.478  1.00 115.02 ? 201 HIS C CE1 1 
ATOM   7463  N NE2 . HIS D 2 177 ? 48.590  97.645  20.239  1.00 114.07 ? 201 HIS C NE2 1 
ATOM   7464  N N   . LEU D 2 178 ? 43.689  100.586 23.862  1.00 102.43 ? 202 LEU C N   1 
ATOM   7465  C CA  . LEU D 2 178 ? 42.487  100.639 24.679  1.00 100.80 ? 202 LEU C CA  1 
ATOM   7466  C C   . LEU D 2 178 ? 41.946  102.061 24.762  1.00 101.88 ? 202 LEU C C   1 
ATOM   7467  O O   . LEU D 2 178 ? 42.646  103.039 24.482  1.00 107.95 ? 202 LEU C O   1 
ATOM   7468  C CB  . LEU D 2 178 ? 42.758  100.117 26.095  1.00 98.70  ? 202 LEU C CB  1 
ATOM   7469  C CG  . LEU D 2 178 ? 43.289  98.691  26.227  1.00 97.54  ? 202 LEU C CG  1 
ATOM   7470  C CD1 . LEU D 2 178 ? 43.542  98.356  27.689  1.00 94.63  ? 202 LEU C CD1 1 
ATOM   7471  C CD2 . LEU D 2 178 ? 42.322  97.701  25.598  1.00 98.04  ? 202 LEU C CD2 1 
ATOM   7472  N N   . MET D 2 179 ? 40.679  102.160 25.165  1.00 96.53  ? 203 MET C N   1 
ATOM   7473  C CA  . MET D 2 179 ? 39.915  103.359 25.478  1.00 94.32  ? 203 MET C CA  1 
ATOM   7474  C C   . MET D 2 179 ? 39.891  103.591 26.982  1.00 94.37  ? 203 MET C C   1 
ATOM   7475  O O   . MET D 2 179 ? 39.697  102.643 27.752  1.00 93.13  ? 203 MET C O   1 
ATOM   7476  C CB  . MET D 2 179 ? 38.479  103.245 24.965  1.00 92.74  ? 203 MET C CB  1 
ATOM   7477  C CG  . MET D 2 179 ? 38.320  103.520 23.485  1.00 92.37  ? 203 MET C CG  1 
ATOM   7478  S SD  . MET D 2 179 ? 36.684  103.057 22.891  1.00 91.47  ? 203 MET C SD  1 
ATOM   7479  C CE  . MET D 2 179 ? 37.095  102.379 21.289  1.00 94.32  ? 203 MET C CE  1 
ATOM   7480  N N   . PRO D 2 180 ? 40.084  104.828 27.429  1.00 95.41  ? 204 PRO C N   1 
ATOM   7481  C CA  . PRO D 2 180 ? 40.130  105.093 28.870  1.00 95.61  ? 204 PRO C CA  1 
ATOM   7482  C C   . PRO D 2 180 ? 38.758  104.982 29.518  1.00 95.09  ? 204 PRO C C   1 
ATOM   7483  O O   . PRO D 2 180 ? 37.716  105.030 28.860  1.00 89.51  ? 204 PRO C O   1 
ATOM   7484  C CB  . PRO D 2 180 ? 40.664  106.526 28.951  1.00 96.14  ? 204 PRO C CB  1 
ATOM   7485  C CG  . PRO D 2 180 ? 40.285  107.138 27.648  1.00 98.26  ? 204 PRO C CG  1 
ATOM   7486  C CD  . PRO D 2 180 ? 40.363  106.034 26.633  1.00 96.88  ? 204 PRO C CD  1 
ATOM   7487  N N   . SER D 2 181 ? 38.783  104.830 30.846  1.00 93.79  ? 205 SER C N   1 
ATOM   7488  C CA  . SER D 2 181 ? 37.579  104.730 31.675  1.00 95.66  ? 205 SER C CA  1 
ATOM   7489  C C   . SER D 2 181 ? 36.652  103.613 31.206  1.00 94.76  ? 205 SER C C   1 
ATOM   7490  O O   . SER D 2 181 ? 35.427  103.734 31.292  1.00 99.89  ? 205 SER C O   1 
ATOM   7491  C CB  . SER D 2 181 ? 36.821  106.061 31.723  1.00 95.02  ? 205 SER C CB  1 
ATOM   7492  O OG  . SER D 2 181 ? 37.551  107.046 32.433  1.00 98.24  ? 205 SER C OG  1 
ATOM   7493  N N   . SER D 2 182 ? 37.223  102.516 30.719  1.00 95.18  ? 206 SER C N   1 
ATOM   7494  C CA  . SER D 2 182 ? 36.460  101.419 30.146  1.00 94.60  ? 206 SER C CA  1 
ATOM   7495  C C   . SER D 2 182 ? 36.765  100.118 30.879  1.00 95.89  ? 206 SER C C   1 
ATOM   7496  O O   . SER D 2 182 ? 37.745  100.002 31.620  1.00 98.73  ? 206 SER C O   1 
ATOM   7497  C CB  . SER D 2 182 ? 36.762  101.264 28.650  1.00 95.13  ? 206 SER C CB  1 
ATOM   7498  O OG  . SER D 2 182 ? 36.473  102.460 27.949  1.00 97.17  ? 206 SER C OG  1 
ATOM   7499  N N   . THR D 2 183 ? 35.900  99.131  30.657  1.00 91.68  ? 207 THR C N   1 
ATOM   7500  C CA  . THR D 2 183 ? 36.050  97.790  31.213  1.00 93.60  ? 207 THR C CA  1 
ATOM   7501  C C   . THR D 2 183 ? 36.198  96.814  30.053  1.00 96.49  ? 207 THR C C   1 
ATOM   7502  O O   . THR D 2 183 ? 35.248  96.597  29.293  1.00 93.95  ? 207 THR C O   1 
ATOM   7503  C CB  . THR D 2 183 ? 34.857  97.420  32.094  1.00 95.50  ? 207 THR C CB  1 
ATOM   7504  O OG1 . THR D 2 183 ? 34.835  98.261  33.254  1.00 97.93  ? 207 THR C OG1 1 
ATOM   7505  C CG2 . THR D 2 183 ? 34.941  95.962  32.527  1.00 93.76  ? 207 THR C CG2 1 
ATOM   7506  N N   . TYR D 2 184 ? 37.386  96.232  29.913  1.00 95.24  ? 208 TYR C N   1 
ATOM   7507  C CA  . TYR D 2 184 ? 37.695  95.317  28.826  1.00 90.25  ? 208 TYR C CA  1 
ATOM   7508  C C   . TYR D 2 184 ? 37.727  93.883  29.335  1.00 87.47  ? 208 TYR C C   1 
ATOM   7509  O O   . TYR D 2 184 ? 38.219  93.614  30.436  1.00 87.11  ? 208 TYR C O   1 
ATOM   7510  C CB  . TYR D 2 184 ? 39.046  95.655  28.189  1.00 90.06  ? 208 TYR C CB  1 
ATOM   7511  C CG  . TYR D 2 184 ? 39.021  96.777  27.176  1.00 90.73  ? 208 TYR C CG  1 
ATOM   7512  C CD1 . TYR D 2 184 ? 39.219  98.096  27.564  1.00 92.83  ? 208 TYR C CD1 1 
ATOM   7513  C CD2 . TYR D 2 184 ? 38.820  96.513  25.828  1.00 91.73  ? 208 TYR C CD2 1 
ATOM   7514  C CE1 . TYR D 2 184 ? 39.207  99.122  26.637  1.00 94.48  ? 208 TYR C CE1 1 
ATOM   7515  C CE2 . TYR D 2 184 ? 38.808  97.531  24.895  1.00 94.75  ? 208 TYR C CE2 1 
ATOM   7516  C CZ  . TYR D 2 184 ? 39.000  98.833  25.305  1.00 95.27  ? 208 TYR C CZ  1 
ATOM   7517  O OH  . TYR D 2 184 ? 38.986  99.848  24.376  1.00 95.34  ? 208 TYR C OH  1 
ATOM   7518  N N   . VAL D 2 185 ? 37.205  92.967  28.524  1.00 85.03  ? 209 VAL C N   1 
ATOM   7519  C CA  . VAL D 2 185 ? 37.362  91.537  28.734  1.00 84.43  ? 209 VAL C CA  1 
ATOM   7520  C C   . VAL D 2 185 ? 38.276  90.998  27.643  1.00 82.69  ? 209 VAL C C   1 
ATOM   7521  O O   . VAL D 2 185 ? 38.404  91.568  26.553  1.00 84.58  ? 209 VAL C O   1 
ATOM   7522  C CB  . VAL D 2 185 ? 36.015  90.781  28.740  1.00 81.89  ? 209 VAL C CB  1 
ATOM   7523  C CG1 . VAL D 2 185 ? 35.166  91.218  29.916  1.00 85.36  ? 209 VAL C CG1 1 
ATOM   7524  C CG2 . VAL D 2 185 ? 35.272  90.994  27.434  1.00 80.13  ? 209 VAL C CG2 1 
ATOM   7525  N N   . ALA D 2 186 ? 38.934  89.887  27.953  1.00 78.74  ? 210 ALA C N   1 
ATOM   7526  C CA  . ALA D 2 186 ? 39.871  89.270  27.027  1.00 80.01  ? 210 ALA C CA  1 
ATOM   7527  C C   . ALA D 2 186 ? 39.787  87.757  27.142  1.00 80.10  ? 210 ALA C C   1 
ATOM   7528  O O   . ALA D 2 186 ? 39.499  87.213  28.213  1.00 81.80  ? 210 ALA C O   1 
ATOM   7529  C CB  . ALA D 2 186 ? 41.312  89.730  27.284  1.00 79.50  ? 210 ALA C CB  1 
ATOM   7530  N N   . ARG D 2 187 ? 40.039  87.084  26.021  1.00 76.22  ? 211 ARG C N   1 
ATOM   7531  C CA  . ARG D 2 187 ? 40.115  85.629  26.006  1.00 74.02  ? 211 ARG C CA  1 
ATOM   7532  C C   . ARG D 2 187 ? 41.092  85.191  24.924  1.00 74.03  ? 211 ARG C C   1 
ATOM   7533  O O   . ARG D 2 187 ? 41.155  85.798  23.855  1.00 77.60  ? 211 ARG C O   1 
ATOM   7534  C CB  . ARG D 2 187 ? 38.739  84.996  25.777  1.00 73.25  ? 211 ARG C CB  1 
ATOM   7535  C CG  . ARG D 2 187 ? 38.127  85.298  24.429  1.00 72.88  ? 211 ARG C CG  1 
ATOM   7536  C CD  . ARG D 2 187 ? 36.698  84.804  24.360  1.00 72.24  ? 211 ARG C CD  1 
ATOM   7537  N NE  . ARG D 2 187 ? 36.181  84.836  22.997  1.00 71.90  ? 211 ARG C NE  1 
ATOM   7538  C CZ  . ARG D 2 187 ? 34.898  84.691  22.686  1.00 73.66  ? 211 ARG C CZ  1 
ATOM   7539  N NH1 . ARG D 2 187 ? 34.002  84.500  23.645  1.00 76.84  ? 211 ARG C NH1 1 
ATOM   7540  N NH2 . ARG D 2 187 ? 34.510  84.735  21.417  1.00 71.68  ? 211 ARG C NH2 1 
ATOM   7541  N N   . VAL D 2 188 ? 41.857  84.139  25.206  1.00 74.98  ? 212 VAL C N   1 
ATOM   7542  C CA  . VAL D 2 188 ? 42.879  83.677  24.278  1.00 75.08  ? 212 VAL C CA  1 
ATOM   7543  C C   . VAL D 2 188 ? 42.568  82.250  23.850  1.00 74.41  ? 212 VAL C C   1 
ATOM   7544  O O   . VAL D 2 188 ? 41.804  81.527  24.494  1.00 73.97  ? 212 VAL C O   1 
ATOM   7545  C CB  . VAL D 2 188 ? 44.296  83.758  24.881  1.00 75.85  ? 212 VAL C CB  1 
ATOM   7546  C CG1 . VAL D 2 188 ? 44.525  85.115  25.508  1.00 76.54  ? 212 VAL C CG1 1 
ATOM   7547  C CG2 . VAL D 2 188 ? 44.503  82.652  25.899  1.00 75.78  ? 212 VAL C CG2 1 
ATOM   7548  N N   . ARG D 2 189 ? 43.168  81.854  22.731  1.00 74.22  ? 213 ARG C N   1 
ATOM   7549  C CA  . ARG D 2 189 ? 43.098  80.470  22.286  1.00 73.34  ? 213 ARG C CA  1 
ATOM   7550  C C   . ARG D 2 189 ? 44.383  80.115  21.551  1.00 73.30  ? 213 ARG C C   1 
ATOM   7551  O O   . ARG D 2 189 ? 45.046  80.981  20.974  1.00 79.54  ? 213 ARG C O   1 
ATOM   7552  C CB  . ARG D 2 189 ? 41.884  80.211  21.382  1.00 71.21  ? 213 ARG C CB  1 
ATOM   7553  C CG  . ARG D 2 189 ? 41.947  80.882  20.021  1.00 71.19  ? 213 ARG C CG  1 
ATOM   7554  C CD  . ARG D 2 189 ? 40.683  80.606  19.221  1.00 72.16  ? 213 ARG C CD  1 
ATOM   7555  N NE  . ARG D 2 189 ? 40.709  81.254  17.913  1.00 71.32  ? 213 ARG C NE  1 
ATOM   7556  C CZ  . ARG D 2 189 ? 39.732  81.168  17.017  1.00 70.58  ? 213 ARG C CZ  1 
ATOM   7557  N NH1 . ARG D 2 189 ? 39.844  81.789  15.850  1.00 70.67  ? 213 ARG C NH1 1 
ATOM   7558  N NH2 . ARG D 2 189 ? 38.643  80.461  17.287  1.00 71.11  ? 213 ARG C NH2 1 
ATOM   7559  N N   . THR D 2 190 ? 44.740  78.835  21.595  1.00 73.12  ? 214 THR C N   1 
ATOM   7560  C CA  . THR D 2 190 ? 45.844  78.347  20.784  1.00 73.41  ? 214 THR C CA  1 
ATOM   7561  C C   . THR D 2 190 ? 45.348  78.011  19.388  1.00 72.95  ? 214 THR C C   1 
ATOM   7562  O O   . THR D 2 190 ? 44.202  77.596  19.195  1.00 72.28  ? 214 THR C O   1 
ATOM   7563  C CB  . THR D 2 190 ? 46.489  77.105  21.399  1.00 73.42  ? 214 THR C CB  1 
ATOM   7564  O OG1 . THR D 2 190 ? 45.507  76.072  21.524  1.00 75.72  ? 214 THR C OG1 1 
ATOM   7565  C CG2 . THR D 2 190 ? 47.066  77.409  22.760  1.00 75.41  ? 214 THR C CG2 1 
ATOM   7566  N N   . ARG D 2 191 ? 46.226  78.191  18.408  1.00 73.44  ? 215 ARG C N   1 
ATOM   7567  C CA  . ARG D 2 191 ? 45.873  77.878  17.037  1.00 74.57  ? 215 ARG C CA  1 
ATOM   7568  C C   . ARG D 2 191 ? 47.127  77.452  16.298  1.00 75.12  ? 215 ARG C C   1 
ATOM   7569  O O   . ARG D 2 191 ? 48.251  77.756  16.708  1.00 75.74  ? 215 ARG C O   1 
ATOM   7570  C CB  . ARG D 2 191 ? 45.212  79.069  16.337  1.00 79.86  ? 215 ARG C CB  1 
ATOM   7571  C CG  . ARG D 2 191 ? 46.115  80.280  16.197  1.00 81.57  ? 215 ARG C CG  1 
ATOM   7572  C CD  . ARG D 2 191 ? 45.423  81.384  15.422  1.00 85.76  ? 215 ARG C CD  1 
ATOM   7573  N NE  . ARG D 2 191 ? 44.586  80.842  14.356  1.00 84.45  ? 215 ARG C NE  1 
ATOM   7574  C CZ  . ARG D 2 191 ? 43.852  81.581  13.532  1.00 84.70  ? 215 ARG C CZ  1 
ATOM   7575  N NH1 . ARG D 2 191 ? 43.117  80.996  12.595  1.00 82.86  ? 215 ARG C NH1 1 
ATOM   7576  N NH2 . ARG D 2 191 ? 43.853  82.904  13.645  1.00 84.74  ? 215 ARG C NH2 1 
ATOM   7577  N N   . LEU D 2 192 ? 46.917  76.731  15.203  1.00 76.48  ? 216 LEU C N   1 
ATOM   7578  C CA  . LEU D 2 192 ? 48.027  76.271  14.385  1.00 76.84  ? 216 LEU C CA  1 
ATOM   7579  C C   . LEU D 2 192 ? 48.667  77.461  13.684  1.00 76.88  ? 216 LEU C C   1 
ATOM   7580  O O   . LEU D 2 192 ? 47.997  78.187  12.940  1.00 74.77  ? 216 LEU C O   1 
ATOM   7581  C CB  . LEU D 2 192 ? 47.539  75.240  13.374  1.00 79.32  ? 216 LEU C CB  1 
ATOM   7582  C CG  . LEU D 2 192 ? 47.028  73.938  13.990  1.00 78.98  ? 216 LEU C CG  1 
ATOM   7583  C CD1 . LEU D 2 192 ? 46.470  73.018  12.920  1.00 81.10  ? 216 LEU C CD1 1 
ATOM   7584  C CD2 . LEU D 2 192 ? 48.138  73.255  14.762  1.00 78.07  ? 216 LEU C CD2 1 
ATOM   7585  N N   . ALA D 2 193 ? 49.956  77.672  13.936  1.00 85.25  ? 217 ALA C N   1 
ATOM   7586  C CA  . ALA D 2 193 ? 50.668  78.773  13.313  1.00 88.30  ? 217 ALA C CA  1 
ATOM   7587  C C   . ALA D 2 193 ? 50.782  78.542  11.807  1.00 90.88  ? 217 ALA C C   1 
ATOM   7588  O O   . ALA D 2 193 ? 50.840  77.397  11.349  1.00 91.81  ? 217 ALA C O   1 
ATOM   7589  C CB  . ALA D 2 193 ? 52.057  78.924  13.926  1.00 88.75  ? 217 ALA C CB  1 
ATOM   7590  N N   . PRO D 2 194 ? 50.810  79.617  11.013  1.00 92.25  ? 218 PRO C N   1 
ATOM   7591  C CA  . PRO D 2 194 ? 50.916  79.443  9.555   1.00 91.97  ? 218 PRO C CA  1 
ATOM   7592  C C   . PRO D 2 194 ? 52.226  78.818  9.115   1.00 89.64  ? 218 PRO C C   1 
ATOM   7593  O O   . PRO D 2 194 ? 52.287  78.270  8.008   1.00 86.70  ? 218 PRO C O   1 
ATOM   7594  C CB  . PRO D 2 194 ? 50.761  80.873  9.018   1.00 91.55  ? 218 PRO C CB  1 
ATOM   7595  C CG  . PRO D 2 194 ? 51.203  81.746  10.151  1.00 91.23  ? 218 PRO C CG  1 
ATOM   7596  C CD  . PRO D 2 194 ? 50.756  81.038  11.399  1.00 89.69  ? 218 PRO C CD  1 
ATOM   7597  N N   . GLY D 2 195 ? 53.267  78.867  9.944   1.00 91.12  ? 219 GLY C N   1 
ATOM   7598  C CA  . GLY D 2 195 ? 54.550  78.290  9.595   1.00 91.78  ? 219 GLY C CA  1 
ATOM   7599  C C   . GLY D 2 195 ? 54.498  76.794  9.359   1.00 90.84  ? 219 GLY C C   1 
ATOM   7600  O O   . GLY D 2 195 ? 54.918  76.315  8.301   1.00 91.49  ? 219 GLY C O   1 
ATOM   7601  N N   . SER D 2 196 ? 53.984  76.048  10.335  1.00 97.35  ? 220 SER C N   1 
ATOM   7602  C CA  . SER D 2 196 ? 53.898  74.600  10.216  1.00 94.79  ? 220 SER C CA  1 
ATOM   7603  C C   . SER D 2 196 ? 52.807  74.211  9.223   1.00 95.45  ? 220 SER C C   1 
ATOM   7604  O O   . SER D 2 196 ? 51.950  75.016  8.842   1.00 92.65  ? 220 SER C O   1 
ATOM   7605  C CB  . SER D 2 196 ? 53.617  73.955  11.573  1.00 89.85  ? 220 SER C CB  1 
ATOM   7606  O OG  . SER D 2 196 ? 52.254  74.097  11.941  1.00 83.77  ? 220 SER C OG  1 
ATOM   7607  N N   . ARG D 2 197 ? 52.844  72.946  8.809   1.00 86.12  ? 221 ARG C N   1 
ATOM   7608  C CA  . ARG D 2 197 ? 51.874  72.446  7.846   1.00 90.03  ? 221 ARG C CA  1 
ATOM   7609  C C   . ARG D 2 197 ? 50.958  71.410  8.481   1.00 85.81  ? 221 ARG C C   1 
ATOM   7610  O O   . ARG D 2 197 ? 50.716  70.341  7.911   1.00 91.88  ? 221 ARG C O   1 
ATOM   7611  C CB  . ARG D 2 197 ? 52.592  71.885  6.618   1.00 94.71  ? 221 ARG C CB  1 
ATOM   7612  C CG  . ARG D 2 197 ? 53.264  72.973  5.799   1.00 98.67  ? 221 ARG C CG  1 
ATOM   7613  C CD  . ARG D 2 197 ? 54.146  72.420  4.707   1.00 98.51  ? 221 ARG C CD  1 
ATOM   7614  N NE  . ARG D 2 197 ? 55.090  73.427  4.232   1.00 101.60 ? 221 ARG C NE  1 
ATOM   7615  C CZ  . ARG D 2 197 ? 56.270  73.668  4.796   1.00 100.11 ? 221 ARG C CZ  1 
ATOM   7616  N NH1 . ARG D 2 197 ? 56.651  72.969  5.858   1.00 96.80  ? 221 ARG C NH1 1 
ATOM   7617  N NH2 . ARG D 2 197 ? 57.066  74.607  4.301   1.00 96.62  ? 221 ARG C NH2 1 
ATOM   7618  N N   . LEU D 2 198 ? 50.449  71.730  9.666   1.00 74.65  ? 222 LEU C N   1 
ATOM   7619  C CA  . LEU D 2 198 ? 49.393  70.974  10.316  1.00 73.78  ? 222 LEU C CA  1 
ATOM   7620  C C   . LEU D 2 198 ? 48.050  71.639  10.040  1.00 73.26  ? 222 LEU C C   1 
ATOM   7621  O O   . LEU D 2 198 ? 47.966  72.838  9.766   1.00 73.57  ? 222 LEU C O   1 
ATOM   7622  C CB  . LEU D 2 198 ? 49.638  70.879  11.825  1.00 73.73  ? 222 LEU C CB  1 
ATOM   7623  C CG  . LEU D 2 198 ? 50.951  70.223  12.259  1.00 74.27  ? 222 LEU C CG  1 
ATOM   7624  C CD1 . LEU D 2 198 ? 51.194  70.431  13.742  1.00 74.36  ? 222 LEU C CD1 1 
ATOM   7625  C CD2 . LEU D 2 198 ? 50.948  68.742  11.920  1.00 73.93  ? 222 LEU C CD2 1 
ATOM   7626  N N   . SER D 2 199 ? 46.992  70.842  10.110  1.00 70.69  ? 223 SER C N   1 
ATOM   7627  C CA  . SER D 2 199 ? 45.658  71.310  9.776   1.00 70.28  ? 223 SER C CA  1 
ATOM   7628  C C   . SER D 2 199 ? 44.689  70.933  10.884  1.00 70.24  ? 223 SER C C   1 
ATOM   7629  O O   . SER D 2 199 ? 44.892  69.948  11.600  1.00 69.29  ? 223 SER C O   1 
ATOM   7630  C CB  . SER D 2 199 ? 45.181  70.723  8.440   1.00 71.26  ? 223 SER C CB  1 
ATOM   7631  O OG  . SER D 2 199 ? 46.184  70.838  7.443   1.00 73.77  ? 223 SER C OG  1 
ATOM   7632  N N   . GLY D 2 200 ? 43.638  71.729  11.021  1.00 72.87  ? 224 GLY C N   1 
ATOM   7633  C CA  . GLY D 2 200 ? 42.589  71.472  11.978  1.00 71.76  ? 224 GLY C CA  1 
ATOM   7634  C C   . GLY D 2 200 ? 42.078  72.762  12.579  1.00 72.26  ? 224 GLY C C   1 
ATOM   7635  O O   . GLY D 2 200 ? 42.419  73.860  12.139  1.00 74.74  ? 224 GLY C O   1 
ATOM   7636  N N   . ARG D 2 201 ? 41.249  72.614  13.606  1.00 68.87  ? 225 ARG C N   1 
ATOM   7637  C CA  . ARG D 2 201 ? 40.631  73.738  14.287  1.00 71.56  ? 225 ARG C CA  1 
ATOM   7638  C C   . ARG D 2 201 ? 41.622  74.449  15.198  1.00 69.48  ? 225 ARG C C   1 
ATOM   7639  O O   . ARG D 2 201 ? 42.664  73.898  15.556  1.00 69.11  ? 225 ARG C O   1 
ATOM   7640  C CB  . ARG D 2 201 ? 39.460  73.258  15.134  1.00 77.52  ? 225 ARG C CB  1 
ATOM   7641  C CG  . ARG D 2 201 ? 38.212  72.857  14.387  1.00 79.99  ? 225 ARG C CG  1 
ATOM   7642  C CD  . ARG D 2 201 ? 37.270  72.164  15.357  1.00 80.03  ? 225 ARG C CD  1 
ATOM   7643  N NE  . ARG D 2 201 ? 35.859  72.405  15.077  1.00 82.21  ? 225 ARG C NE  1 
ATOM   7644  C CZ  . ARG D 2 201 ? 34.866  71.889  15.793  1.00 83.48  ? 225 ARG C CZ  1 
ATOM   7645  N NH1 . ARG D 2 201 ? 35.133  71.100  16.827  1.00 80.82  ? 225 ARG C NH1 1 
ATOM   7646  N NH2 . ARG D 2 201 ? 33.606  72.156  15.475  1.00 87.06  ? 225 ARG C NH2 1 
ATOM   7647  N N   . PRO D 2 202 ? 41.319  75.682  15.587  1.00 69.05  ? 226 PRO C N   1 
ATOM   7648  C CA  . PRO D 2 202 ? 41.927  76.253  16.790  1.00 69.46  ? 226 PRO C CA  1 
ATOM   7649  C C   . PRO D 2 202 ? 41.256  75.681  18.033  1.00 69.06  ? 226 PRO C C   1 
ATOM   7650  O O   . PRO D 2 202 ? 40.238  74.992  17.967  1.00 68.48  ? 226 PRO C O   1 
ATOM   7651  C CB  . PRO D 2 202 ? 41.660  77.758  16.655  1.00 69.78  ? 226 PRO C CB  1 
ATOM   7652  C CG  . PRO D 2 202 ? 41.289  77.964  15.218  1.00 69.69  ? 226 PRO C CG  1 
ATOM   7653  C CD  . PRO D 2 202 ? 40.601  76.701  14.805  1.00 69.07  ? 226 PRO C CD  1 
ATOM   7654  N N   . SER D 2 203 ? 41.844  75.989  19.182  1.00 69.45  ? 227 SER C N   1 
ATOM   7655  C CA  . SER D 2 203 ? 41.371  75.416  20.431  1.00 69.19  ? 227 SER C CA  1 
ATOM   7656  C C   . SER D 2 203 ? 40.079  76.090  20.880  1.00 68.93  ? 227 SER C C   1 
ATOM   7657  O O   . SER D 2 203 ? 39.570  77.019  20.246  1.00 68.95  ? 227 SER C O   1 
ATOM   7658  C CB  . SER D 2 203 ? 42.437  75.544  21.511  1.00 69.77  ? 227 SER C CB  1 
ATOM   7659  O OG  . SER D 2 203 ? 42.448  76.854  22.044  1.00 70.21  ? 227 SER C OG  1 
ATOM   7660  N N   . LYS D 2 204 ? 39.538  75.602  21.993  1.00 74.38  ? 228 LYS C N   1 
ATOM   7661  C CA  . LYS D 2 204 ? 38.438  76.284  22.653  1.00 77.73  ? 228 LYS C CA  1 
ATOM   7662  C C   . LYS D 2 204 ? 38.902  77.642  23.174  1.00 76.91  ? 228 LYS C C   1 
ATOM   7663  O O   . LYS D 2 204 ? 40.092  77.880  23.394  1.00 73.33  ? 228 LYS C O   1 
ATOM   7664  C CB  . LYS D 2 204 ? 37.907  75.444  23.815  1.00 81.70  ? 228 LYS C CB  1 
ATOM   7665  C CG  . LYS D 2 204 ? 37.291  74.107  23.433  1.00 84.25  ? 228 LYS C CG  1 
ATOM   7666  C CD  . LYS D 2 204 ? 35.807  74.246  23.131  1.00 85.96  ? 228 LYS C CD  1 
ATOM   7667  C CE  . LYS D 2 204 ? 35.048  73.004  23.575  1.00 86.14  ? 228 LYS C CE  1 
ATOM   7668  N NZ  . LYS D 2 204 ? 33.581  73.125  23.368  1.00 89.32  ? 228 LYS C NZ  1 
ATOM   7669  N N   . TRP D 2 205 ? 37.945  78.544  23.373  1.00 69.27  ? 229 TRP C N   1 
ATOM   7670  C CA  . TRP D 2 205 ? 38.268  79.821  23.990  1.00 69.86  ? 229 TRP C CA  1 
ATOM   7671  C C   . TRP D 2 205 ? 38.584  79.619  25.465  1.00 70.17  ? 229 TRP C C   1 
ATOM   7672  O O   . TRP D 2 205 ? 37.942  78.820  26.151  1.00 69.85  ? 229 TRP C O   1 
ATOM   7673  C CB  . TRP D 2 205 ? 37.117  80.815  23.829  1.00 69.76  ? 229 TRP C CB  1 
ATOM   7674  C CG  . TRP D 2 205 ? 37.021  81.432  22.463  1.00 69.72  ? 229 TRP C CG  1 
ATOM   7675  C CD1 . TRP D 2 205 ? 35.976  81.333  21.592  1.00 69.26  ? 229 TRP C CD1 1 
ATOM   7676  C CD2 . TRP D 2 205 ? 38.008  82.244  21.813  1.00 70.21  ? 229 TRP C CD2 1 
ATOM   7677  N NE1 . TRP D 2 205 ? 36.251  82.031  20.441  1.00 69.43  ? 229 TRP C NE1 1 
ATOM   7678  C CE2 . TRP D 2 205 ? 37.493  82.598  20.552  1.00 70.01  ? 229 TRP C CE2 1 
ATOM   7679  C CE3 . TRP D 2 205 ? 39.278  82.701  22.175  1.00 70.85  ? 229 TRP C CE3 1 
ATOM   7680  C CZ2 . TRP D 2 205 ? 38.201  83.389  19.653  1.00 70.42  ? 229 TRP C CZ2 1 
ATOM   7681  C CZ3 . TRP D 2 205 ? 39.978  83.486  21.282  1.00 71.25  ? 229 TRP C CZ3 1 
ATOM   7682  C CH2 . TRP D 2 205 ? 39.439  83.820  20.035  1.00 71.03  ? 229 TRP C CH2 1 
ATOM   7683  N N   . SER D 2 206 ? 39.593  80.337  25.948  1.00 73.70  ? 230 SER C N   1 
ATOM   7684  C CA  . SER D 2 206 ? 39.939  80.289  27.354  1.00 74.12  ? 230 SER C CA  1 
ATOM   7685  C C   . SER D 2 206 ? 38.879  81.022  28.172  1.00 74.29  ? 230 SER C C   1 
ATOM   7686  O O   . SER D 2 206 ? 38.083  81.788  27.626  1.00 74.00  ? 230 SER C O   1 
ATOM   7687  C CB  . SER D 2 206 ? 41.309  80.921  27.582  1.00 74.91  ? 230 SER C CB  1 
ATOM   7688  O OG  . SER D 2 206 ? 41.207  82.332  27.638  1.00 75.33  ? 230 SER C OG  1 
ATOM   7689  N N   . PRO D 2 207 ? 38.836  80.795  29.485  1.00 76.50  ? 231 PRO C N   1 
ATOM   7690  C CA  . PRO D 2 207 ? 37.942  81.597  30.328  1.00 79.29  ? 231 PRO C CA  1 
ATOM   7691  C C   . PRO D 2 207 ? 38.342  83.064  30.284  1.00 82.21  ? 231 PRO C C   1 
ATOM   7692  O O   . PRO D 2 207 ? 39.515  83.411  30.440  1.00 86.78  ? 231 PRO C O   1 
ATOM   7693  C CB  . PRO D 2 207 ? 38.128  80.990  31.724  1.00 81.37  ? 231 PRO C CB  1 
ATOM   7694  C CG  . PRO D 2 207 ? 39.459  80.315  31.672  1.00 80.35  ? 231 PRO C CG  1 
ATOM   7695  C CD  . PRO D 2 207 ? 39.573  79.791  30.272  1.00 81.10  ? 231 PRO C CD  1 
ATOM   7696  N N   . GLU D 2 208 ? 37.355  83.928  30.058  1.00 79.73  ? 232 GLU C N   1 
ATOM   7697  C CA  . GLU D 2 208 ? 37.628  85.338  29.835  1.00 78.16  ? 232 GLU C CA  1 
ATOM   7698  C C   . GLU D 2 208 ? 37.948  86.050  31.144  1.00 76.70  ? 232 GLU C C   1 
ATOM   7699  O O   . GLU D 2 208 ? 37.524  85.632  32.226  1.00 75.94  ? 232 GLU C O   1 
ATOM   7700  C CB  . GLU D 2 208 ? 36.443  86.011  29.142  1.00 79.76  ? 232 GLU C CB  1 
ATOM   7701  C CG  . GLU D 2 208 ? 35.123  85.900  29.883  1.00 80.18  ? 232 GLU C CG  1 
ATOM   7702  C CD  . GLU D 2 208 ? 33.941  86.296  29.017  1.00 83.31  ? 232 GLU C CD  1 
ATOM   7703  O OE1 . GLU D 2 208 ? 33.917  85.909  27.828  1.00 84.27  ? 232 GLU C OE1 1 
ATOM   7704  O OE2 . GLU D 2 208 ? 33.046  87.008  29.519  1.00 82.42  ? 232 GLU C OE2 1 
ATOM   7705  N N   . VAL D 2 209 ? 38.711  87.137  31.033  1.00 79.42  ? 233 VAL C N   1 
ATOM   7706  C CA  . VAL D 2 209 ? 39.139  87.929  32.180  1.00 83.52  ? 233 VAL C CA  1 
ATOM   7707  C C   . VAL D 2 209 ? 38.715  89.378  31.967  1.00 87.25  ? 233 VAL C C   1 
ATOM   7708  O O   . VAL D 2 209 ? 38.850  89.917  30.862  1.00 87.99  ? 233 VAL C O   1 
ATOM   7709  C CB  . VAL D 2 209 ? 40.664  87.827  32.397  1.00 80.22  ? 233 VAL C CB  1 
ATOM   7710  C CG1 . VAL D 2 209 ? 41.414  88.213  31.131  1.00 81.15  ? 233 VAL C CG1 1 
ATOM   7711  C CG2 . VAL D 2 209 ? 41.097  88.689  33.570  1.00 82.43  ? 233 VAL C CG2 1 
ATOM   7712  N N   . CYS D 2 210 ? 38.194  90.000  33.025  1.00 87.52  ? 234 CYS C N   1 
ATOM   7713  C CA  . CYS D 2 210 ? 37.764  91.391  33.008  1.00 85.91  ? 234 CYS C CA  1 
ATOM   7714  C C   . CYS D 2 210 ? 38.799  92.267  33.704  1.00 85.00  ? 234 CYS C C   1 
ATOM   7715  O O   . CYS D 2 210 ? 39.490  91.825  34.625  1.00 85.32  ? 234 CYS C O   1 
ATOM   7716  C CB  . CYS D 2 210 ? 36.410  91.556  33.704  1.00 87.72  ? 234 CYS C CB  1 
ATOM   7717  S SG  . CYS D 2 210 ? 35.180  90.296  33.305  1.00 89.82  ? 234 CYS C SG  1 
ATOM   7718  N N   . TRP D 2 211 ? 38.900  93.519  33.259  1.00 90.19  ? 235 TRP C N   1 
ATOM   7719  C CA  . TRP D 2 211 ? 39.806  94.467  33.897  1.00 92.05  ? 235 TRP C CA  1 
ATOM   7720  C C   . TRP D 2 211 ? 39.494  95.875  33.409  1.00 94.84  ? 235 TRP C C   1 
ATOM   7721  O O   . TRP D 2 211 ? 39.060  96.069  32.270  1.00 95.29  ? 235 TRP C O   1 
ATOM   7722  C CB  . TRP D 2 211 ? 41.278  94.114  33.629  1.00 90.30  ? 235 TRP C CB  1 
ATOM   7723  C CG  . TRP D 2 211 ? 41.860  94.712  32.383  1.00 91.88  ? 235 TRP C CG  1 
ATOM   7724  C CD1 . TRP D 2 211 ? 42.557  95.883  32.282  1.00 95.59  ? 235 TRP C CD1 1 
ATOM   7725  C CD2 . TRP D 2 211 ? 41.817  94.158  31.062  1.00 90.28  ? 235 TRP C CD2 1 
ATOM   7726  N NE1 . TRP D 2 211 ? 42.940  96.095  30.980  1.00 94.21  ? 235 TRP C NE1 1 
ATOM   7727  C CE2 . TRP D 2 211 ? 42.498  95.050  30.211  1.00 91.51  ? 235 TRP C CE2 1 
ATOM   7728  C CE3 . TRP D 2 211 ? 41.264  92.995  30.517  1.00 87.66  ? 235 TRP C CE3 1 
ATOM   7729  C CZ2 . TRP D 2 211 ? 42.640  94.818  28.846  1.00 87.75  ? 235 TRP C CZ2 1 
ATOM   7730  C CZ3 . TRP D 2 211 ? 41.404  92.768  29.161  1.00 87.15  ? 235 TRP C CZ3 1 
ATOM   7731  C CH2 . TRP D 2 211 ? 42.088  93.674  28.341  1.00 86.00  ? 235 TRP C CH2 1 
ATOM   7732  N N   . ASP D 2 212 ? 39.732  96.849  34.284  1.00 97.62  ? 236 ASP C N   1 
ATOM   7733  C CA  . ASP D 2 212 ? 39.443  98.246  33.995  1.00 96.91  ? 236 ASP C CA  1 
ATOM   7734  C C   . ASP D 2 212 ? 40.650  98.934  33.370  1.00 96.03  ? 236 ASP C C   1 
ATOM   7735  O O   . ASP D 2 212 ? 41.802  98.621  33.683  1.00 98.63  ? 236 ASP C O   1 
ATOM   7736  C CB  . ASP D 2 212 ? 39.030  98.987  35.267  1.00 100.05 ? 236 ASP C CB  1 
ATOM   7737  C CG  . ASP D 2 212 ? 37.578  98.754  35.629  1.00 103.91 ? 236 ASP C CG  1 
ATOM   7738  O OD1 . ASP D 2 212 ? 36.781  98.437  34.720  1.00 101.94 ? 236 ASP C OD1 1 
ATOM   7739  O OD2 . ASP D 2 212 ? 37.235  98.888  36.824  1.00 111.68 ? 236 ASP C OD2 1 
ATOM   7740  N N   . SER D 2 213 ? 40.370  99.889  32.488  1.00 95.23  ? 237 SER C N   1 
ATOM   7741  C CA  . SER D 2 213 ? 41.402  100.612 31.767  1.00 95.23  ? 237 SER C CA  1 
ATOM   7742  C C   . SER D 2 213 ? 41.867  101.827 32.566  1.00 99.72  ? 237 SER C C   1 
ATOM   7743  O O   . SER D 2 213 ? 41.445  102.057 33.702  1.00 109.02 ? 237 SER C O   1 
ATOM   7744  C CB  . SER D 2 213 ? 40.889  101.028 30.390  1.00 95.93  ? 237 SER C CB  1 
ATOM   7745  O OG  . SER D 2 213 ? 41.909  101.672 29.648  1.00 102.46 ? 237 SER C OG  1 
ATOM   7746  N N   . GLN D 2 214 ? 42.754  102.618 31.963  1.00 99.12  ? 238 GLN C N   1 
ATOM   7747  C CA  . GLN D 2 214 ? 43.225  103.845 32.585  1.00 104.02 ? 238 GLN C CA  1 
ATOM   7748  C C   . GLN D 2 214 ? 42.078  104.851 32.715  1.00 106.27 ? 238 GLN C C   1 
ATOM   7749  O O   . GLN D 2 214 ? 41.097  104.787 31.970  1.00 106.92 ? 238 GLN C O   1 
ATOM   7750  C CB  . GLN D 2 214 ? 44.379  104.436 31.775  1.00 106.76 ? 238 GLN C CB  1 
ATOM   7751  C CG  . GLN D 2 214 ? 44.021  104.837 30.358  1.00 107.60 ? 238 GLN C CG  1 
ATOM   7752  C CD  . GLN D 2 214 ? 44.271  103.720 29.363  1.00 107.03 ? 238 GLN C CD  1 
ATOM   7753  O OE1 . GLN D 2 214 ? 44.679  102.620 29.738  1.00 108.78 ? 238 GLN C OE1 1 
ATOM   7754  N NE2 . GLN D 2 214 ? 44.022  103.995 28.087  1.00 104.08 ? 238 GLN C NE2 1 
ATOM   7755  N N   . PRO D 2 215 ? 42.176  105.799 33.667  1.00 111.05 ? 239 PRO C N   1 
ATOM   7756  C CA  . PRO D 2 215 ? 41.047  106.704 33.924  1.00 110.37 ? 239 PRO C CA  1 
ATOM   7757  C C   . PRO D 2 215 ? 40.852  107.791 32.866  1.00 106.24 ? 239 PRO C C   1 
ATOM   7758  O O   . PRO D 2 215 ? 41.598  107.846 31.889  1.00 96.32  ? 239 PRO C O   1 
ATOM   7759  C CB  . PRO D 2 215 ? 41.416  107.328 35.270  1.00 112.44 ? 239 PRO C CB  1 
ATOM   7760  C CG  . PRO D 2 215 ? 42.903  107.376 35.246  1.00 111.69 ? 239 PRO C CG  1 
ATOM   7761  C CD  . PRO D 2 215 ? 43.336  106.121 34.522  1.00 110.35 ? 239 PRO C CD  1 
ATOM   7762  N N   . TYR E 3 6   ? 33.582  25.269  46.807  1.00 113.85 ? 13  TYR I N   1 
ATOM   7763  C CA  . TYR E 3 6   ? 34.464  24.202  47.268  1.00 114.94 ? 13  TYR I CA  1 
ATOM   7764  C C   . TYR E 3 6   ? 33.812  22.841  47.095  1.00 114.11 ? 13  TYR I C   1 
ATOM   7765  O O   . TYR E 3 6   ? 34.423  21.914  46.562  1.00 106.40 ? 13  TYR I O   1 
ATOM   7766  C CB  . TYR E 3 6   ? 34.848  24.415  48.732  1.00 122.52 ? 13  TYR I CB  1 
ATOM   7767  C CG  . TYR E 3 6   ? 35.806  25.561  48.945  1.00 128.89 ? 13  TYR I CG  1 
ATOM   7768  C CD1 . TYR E 3 6   ? 36.974  25.660  48.200  1.00 125.71 ? 13  TYR I CD1 1 
ATOM   7769  C CD2 . TYR E 3 6   ? 35.546  26.543  49.892  1.00 129.56 ? 13  TYR I CD2 1 
ATOM   7770  C CE1 . TYR E 3 6   ? 37.855  26.706  48.390  1.00 121.24 ? 13  TYR I CE1 1 
ATOM   7771  C CE2 . TYR E 3 6   ? 36.421  27.591  50.089  1.00 126.73 ? 13  TYR I CE2 1 
ATOM   7772  C CZ  . TYR E 3 6   ? 37.574  27.668  49.337  1.00 124.46 ? 13  TYR I CZ  1 
ATOM   7773  O OH  . TYR E 3 6   ? 38.446  28.712  49.534  1.00 135.13 ? 13  TYR I OH  1 
ATOM   7774  N N   . VAL E 3 7   ? 32.569  22.720  47.557  1.00 115.21 ? 14  VAL I N   1 
ATOM   7775  C CA  . VAL E 3 7   ? 31.809  21.492  47.366  1.00 109.72 ? 14  VAL I CA  1 
ATOM   7776  C C   . VAL E 3 7   ? 30.776  21.737  46.270  1.00 104.20 ? 14  VAL I C   1 
ATOM   7777  O O   . VAL E 3 7   ? 29.676  21.173  46.290  1.00 88.60  ? 14  VAL I O   1 
ATOM   7778  C CB  . VAL E 3 7   ? 31.162  21.013  48.678  1.00 105.51 ? 14  VAL I CB  1 
ATOM   7779  C CG1 . VAL E 3 7   ? 30.814  19.529  48.589  1.00 103.16 ? 14  VAL I CG1 1 
ATOM   7780  C CG2 . VAL E 3 7   ? 32.098  21.266  49.852  1.00 103.72 ? 14  VAL I CG2 1 
ATOM   7781  N N   . ASN E 3 8   ? 31.123  22.608  45.317  1.00 98.54  ? 15  ASN I N   1 
ATOM   7782  C CA  . ASN E 3 8   ? 30.514  22.540  43.994  1.00 91.89  ? 15  ASN I CA  1 
ATOM   7783  C C   . ASN E 3 8   ? 30.922  21.266  43.272  1.00 90.66  ? 15  ASN I C   1 
ATOM   7784  O O   . ASN E 3 8   ? 30.280  20.885  42.289  1.00 92.19  ? 15  ASN I O   1 
ATOM   7785  C CB  . ASN E 3 8   ? 30.912  23.758  43.155  1.00 89.20  ? 15  ASN I CB  1 
ATOM   7786  C CG  . ASN E 3 8   ? 29.833  24.823  43.115  1.00 91.41  ? 15  ASN I CG  1 
ATOM   7787  O OD1 . ASN E 3 8   ? 28.668  24.534  42.839  1.00 92.61  ? 15  ASN I OD1 1 
ATOM   7788  N ND2 . ASN E 3 8   ? 30.218  26.067  43.385  1.00 90.80  ? 15  ASN I ND2 1 
ATOM   7789  N N   . CYS E 3 9   ? 31.981  20.607  43.750  1.00 89.71  ? 16  CYS I N   1 
ATOM   7790  C CA  . CYS E 3 9   ? 32.453  19.373  43.132  1.00 91.88  ? 16  CYS I CA  1 
ATOM   7791  C C   . CYS E 3 9   ? 31.429  18.255  43.263  1.00 91.75  ? 16  CYS I C   1 
ATOM   7792  O O   . CYS E 3 9   ? 31.307  17.411  42.368  1.00 87.70  ? 16  CYS I O   1 
ATOM   7793  C CB  . CYS E 3 9   ? 33.777  18.960  43.767  1.00 95.17  ? 16  CYS I CB  1 
ATOM   7794  S SG  . CYS E 3 9   ? 35.065  20.190  43.541  1.00 102.55 ? 16  CYS I SG  1 
ATOM   7795  N N   . SER E 3 10  ? 30.700  18.219  44.379  1.00 87.35  ? 17  SER I N   1 
ATOM   7796  C CA  . SER E 3 10  ? 29.637  17.231  44.530  1.00 86.60  ? 17  SER I CA  1 
ATOM   7797  C C   . SER E 3 10  ? 28.627  17.352  43.396  1.00 83.68  ? 17  SER I C   1 
ATOM   7798  O O   . SER E 3 10  ? 28.258  16.355  42.765  1.00 80.87  ? 17  SER I O   1 
ATOM   7799  C CB  . SER E 3 10  ? 28.958  17.399  45.891  1.00 86.63  ? 17  SER I CB  1 
ATOM   7800  O OG  . SER E 3 10  ? 28.012  16.371  46.127  1.00 85.46  ? 17  SER I OG  1 
ATOM   7801  N N   . ASN E 3 11  ? 28.203  18.581  43.095  1.00 83.72  ? 18  ASN I N   1 
ATOM   7802  C CA  . ASN E 3 11  ? 27.237  18.795  42.023  1.00 80.80  ? 18  ASN I CA  1 
ATOM   7803  C C   . ASN E 3 11  ? 27.836  18.459  40.662  1.00 76.76  ? 18  ASN I C   1 
ATOM   7804  O O   . ASN E 3 11  ? 27.166  17.857  39.811  1.00 74.79  ? 18  ASN I O   1 
ATOM   7805  C CB  . ASN E 3 11  ? 26.750  20.243  42.052  1.00 80.05  ? 18  ASN I CB  1 
ATOM   7806  C CG  . ASN E 3 11  ? 26.037  20.593  43.343  1.00 76.20  ? 18  ASN I CG  1 
ATOM   7807  O OD1 . ASN E 3 11  ? 25.511  19.721  44.035  1.00 73.84  ? 18  ASN I OD1 1 
ATOM   7808  N ND2 . ASN E 3 11  ? 26.023  21.877  43.678  1.00 72.77  ? 18  ASN I ND2 1 
ATOM   7809  N N   . MET E 3 12  ? 29.095  18.842  40.437  1.00 75.90  ? 19  MET I N   1 
ATOM   7810  C CA  . MET E 3 12  ? 29.744  18.553  39.164  1.00 74.70  ? 19  MET I CA  1 
ATOM   7811  C C   . MET E 3 12  ? 29.820  17.052  38.918  1.00 74.25  ? 19  MET I C   1 
ATOM   7812  O O   . MET E 3 12  ? 29.517  16.575  37.817  1.00 76.23  ? 19  MET I O   1 
ATOM   7813  C CB  . MET E 3 12  ? 31.142  19.169  39.132  1.00 75.31  ? 19  MET I CB  1 
ATOM   7814  C CG  . MET E 3 12  ? 31.158  20.680  39.106  1.00 76.96  ? 19  MET I CG  1 
ATOM   7815  S SD  . MET E 3 12  ? 32.793  21.313  38.697  1.00 80.89  ? 19  MET I SD  1 
ATOM   7816  C CE  . MET E 3 12  ? 32.439  23.062  38.531  1.00 83.72  ? 19  MET I CE  1 
ATOM   7817  N N   . ILE E 3 13  ? 30.230  16.291  39.935  1.00 72.56  ? 20  ILE I N   1 
ATOM   7818  C CA  . ILE E 3 13  ? 30.305  14.842  39.795  1.00 74.20  ? 20  ILE I CA  1 
ATOM   7819  C C   . ILE E 3 13  ? 28.914  14.250  39.608  1.00 72.61  ? 20  ILE I C   1 
ATOM   7820  O O   . ILE E 3 13  ? 28.717  13.352  38.781  1.00 69.47  ? 20  ILE I O   1 
ATOM   7821  C CB  . ILE E 3 13  ? 31.033  14.224  41.003  1.00 79.45  ? 20  ILE I CB  1 
ATOM   7822  C CG1 . ILE E 3 13  ? 32.466  14.753  41.088  1.00 84.05  ? 20  ILE I CG1 1 
ATOM   7823  C CG2 . ILE E 3 13  ? 31.029  12.709  40.914  1.00 78.50  ? 20  ILE I CG2 1 
ATOM   7824  C CD1 . ILE E 3 13  ? 33.146  14.456  42.404  1.00 88.51  ? 20  ILE I CD1 1 
ATOM   7825  N N   . ASP E 3 14  ? 27.926  14.750  40.359  1.00 76.35  ? 21  ASP I N   1 
ATOM   7826  C CA  . ASP E 3 14  ? 26.555  14.267  40.215  1.00 76.78  ? 21  ASP I CA  1 
ATOM   7827  C C   . ASP E 3 14  ? 26.024  14.476  38.803  1.00 73.69  ? 21  ASP I C   1 
ATOM   7828  O O   . ASP E 3 14  ? 25.225  13.669  38.316  1.00 72.39  ? 21  ASP I O   1 
ATOM   7829  C CB  . ASP E 3 14  ? 25.649  14.966  41.229  1.00 77.42  ? 21  ASP I CB  1 
ATOM   7830  C CG  . ASP E 3 14  ? 25.441  14.147  42.487  1.00 79.19  ? 21  ASP I CG  1 
ATOM   7831  O OD1 . ASP E 3 14  ? 25.087  12.956  42.360  1.00 77.94  ? 21  ASP I OD1 1 
ATOM   7832  O OD2 . ASP E 3 14  ? 25.638  14.688  43.598  1.00 77.88  ? 21  ASP I OD2 1 
ATOM   7833  N N   . GLU E 3 15  ? 26.444  15.551  38.136  1.00 72.28  ? 22  GLU I N   1 
ATOM   7834  C CA  . GLU E 3 15  ? 25.978  15.800  36.773  1.00 70.06  ? 22  GLU I CA  1 
ATOM   7835  C C   . GLU E 3 15  ? 26.749  14.960  35.760  1.00 67.95  ? 22  GLU I C   1 
ATOM   7836  O O   . GLU E 3 15  ? 26.159  14.358  34.850  1.00 70.18  ? 22  GLU I O   1 
ATOM   7837  C CB  . GLU E 3 15  ? 26.107  17.287  36.445  1.00 68.79  ? 22  GLU I CB  1 
ATOM   7838  C CG  . GLU E 3 15  ? 25.145  18.169  37.215  1.00 69.83  ? 22  GLU I CG  1 
ATOM   7839  C CD  . GLU E 3 15  ? 25.288  19.629  36.860  1.00 72.44  ? 22  GLU I CD  1 
ATOM   7840  O OE1 . GLU E 3 15  ? 26.362  20.201  37.132  1.00 73.30  ? 22  GLU I OE1 1 
ATOM   7841  O OE2 . GLU E 3 15  ? 24.326  20.209  36.319  1.00 78.52  ? 22  GLU I OE2 1 
ATOM   7842  N N   . ILE E 3 16  ? 28.073  14.910  35.904  1.00 66.24  ? 23  ILE I N   1 
ATOM   7843  C CA  . ILE E 3 16  ? 28.885  14.185  34.938  1.00 68.70  ? 23  ILE I CA  1 
ATOM   7844  C C   . ILE E 3 16  ? 28.583  12.689  34.984  1.00 67.73  ? 23  ILE I C   1 
ATOM   7845  O O   . ILE E 3 16  ? 28.641  12.013  33.949  1.00 65.31  ? 23  ILE I O   1 
ATOM   7846  C CB  . ILE E 3 16  ? 30.376  14.497  35.171  1.00 71.59  ? 23  ILE I CB  1 
ATOM   7847  C CG1 . ILE E 3 16  ? 31.202  14.160  33.933  1.00 75.26  ? 23  ILE I CG1 1 
ATOM   7848  C CG2 . ILE E 3 16  ? 30.908  13.773  36.388  1.00 74.20  ? 23  ILE I CG2 1 
ATOM   7849  C CD1 . ILE E 3 16  ? 32.627  14.653  34.018  1.00 77.76  ? 23  ILE I CD1 1 
ATOM   7850  N N   . ILE E 3 17  ? 28.214  12.148  36.152  1.00 67.57  ? 24  ILE I N   1 
ATOM   7851  C CA  . ILE E 3 17  ? 27.916  10.719  36.222  1.00 67.92  ? 24  ILE I CA  1 
ATOM   7852  C C   . ILE E 3 17  ? 26.575  10.414  35.565  1.00 67.40  ? 24  ILE I C   1 
ATOM   7853  O O   . ILE E 3 17  ? 26.411  9.369   34.924  1.00 67.28  ? 24  ILE I O   1 
ATOM   7854  C CB  . ILE E 3 17  ? 27.970  10.209  37.677  1.00 70.74  ? 24  ILE I CB  1 
ATOM   7855  C CG1 . ILE E 3 17  ? 26.916  10.895  38.553  1.00 77.31  ? 24  ILE I CG1 1 
ATOM   7856  C CG2 . ILE E 3 17  ? 29.369  10.364  38.248  1.00 69.60  ? 24  ILE I CG2 1 
ATOM   7857  C CD1 . ILE E 3 17  ? 25.723  10.025  38.886  1.00 84.96  ? 24  ILE I CD1 1 
ATOM   7858  N N   . THR E 3 18  ? 25.594  11.313  35.703  1.00 70.95  ? 25  THR I N   1 
ATOM   7859  C CA  . THR E 3 18  ? 24.339  11.120  34.984  1.00 69.86  ? 25  THR I CA  1 
ATOM   7860  C C   . THR E 3 18  ? 24.547  11.213  33.481  1.00 66.94  ? 25  THR I C   1 
ATOM   7861  O O   . THR E 3 18  ? 23.863  10.524  32.715  1.00 66.76  ? 25  THR I O   1 
ATOM   7862  C CB  . THR E 3 18  ? 23.289  12.138  35.434  1.00 69.36  ? 25  THR I CB  1 
ATOM   7863  O OG1 . THR E 3 18  ? 23.781  13.465  35.224  1.00 73.23  ? 25  THR I OG1 1 
ATOM   7864  C CG2 . THR E 3 18  ? 22.944  11.950  36.904  1.00 70.99  ? 25  THR I CG2 1 
ATOM   7865  N N   . HIS E 3 19  ? 25.484  12.058  33.038  1.00 68.53  ? 26  HIS I N   1 
ATOM   7866  C CA  . HIS E 3 19  ? 25.803  12.085  31.612  1.00 68.06  ? 26  HIS I CA  1 
ATOM   7867  C C   . HIS E 3 19  ? 26.569  10.840  31.176  1.00 68.00  ? 26  HIS I C   1 
ATOM   7868  O O   . HIS E 3 19  ? 26.500  10.450  30.004  1.00 70.01  ? 26  HIS I O   1 
ATOM   7869  C CB  . HIS E 3 19  ? 26.584  13.347  31.254  1.00 69.04  ? 26  HIS I CB  1 
ATOM   7870  C CG  . HIS E 3 19  ? 25.734  14.571  31.160  1.00 68.48  ? 26  HIS I CG  1 
ATOM   7871  N ND1 . HIS E 3 19  ? 24.980  14.867  30.046  1.00 70.47  ? 26  HIS I ND1 1 
ATOM   7872  C CD2 . HIS E 3 19  ? 25.523  15.577  32.040  1.00 68.49  ? 26  HIS I CD2 1 
ATOM   7873  C CE1 . HIS E 3 19  ? 24.337  16.003  30.247  1.00 72.24  ? 26  HIS I CE1 1 
ATOM   7874  N NE2 . HIS E 3 19  ? 24.650  16.455  31.448  1.00 69.81  ? 26  HIS I NE2 1 
ATOM   7875  N N   . LEU E 3 20  ? 27.293  10.195  32.090  1.00 67.46  ? 27  LEU I N   1 
ATOM   7876  C CA  . LEU E 3 20  ? 28.086  9.019   31.754  1.00 68.15  ? 27  LEU I CA  1 
ATOM   7877  C C   . LEU E 3 20  ? 27.281  7.719   31.796  1.00 69.80  ? 27  LEU I C   1 
ATOM   7878  O O   . LEU E 3 20  ? 27.877  6.638   31.851  1.00 69.76  ? 27  LEU I O   1 
ATOM   7879  C CB  . LEU E 3 20  ? 29.296  8.916   32.685  1.00 69.53  ? 27  LEU I CB  1 
ATOM   7880  C CG  . LEU E 3 20  ? 30.452  9.885   32.426  1.00 71.60  ? 27  LEU I CG  1 
ATOM   7881  C CD1 . LEU E 3 20  ? 31.251  10.138  33.698  1.00 70.91  ? 27  LEU I CD1 1 
ATOM   7882  C CD2 . LEU E 3 20  ? 31.352  9.357   31.328  1.00 72.19  ? 27  LEU I CD2 1 
ATOM   7883  N N   . LYS E 3 21  ? 25.950  7.792   31.757  1.00 74.02  ? 28  LYS I N   1 
ATOM   7884  C CA  . LYS E 3 21  ? 25.085  6.614   31.836  1.00 78.59  ? 28  LYS I CA  1 
ATOM   7885  C C   . LYS E 3 21  ? 23.980  6.678   30.785  1.00 82.23  ? 28  LYS I C   1 
ATOM   7886  O O   . LYS E 3 21  ? 22.805  6.443   31.077  1.00 90.81  ? 28  LYS I O   1 
ATOM   7887  C CB  . LYS E 3 21  ? 24.448  6.485   33.217  1.00 81.91  ? 28  LYS I CB  1 
ATOM   7888  C CG  . LYS E 3 21  ? 25.411  6.382   34.389  1.00 87.61  ? 28  LYS I CG  1 
ATOM   7889  C CD  . LYS E 3 21  ? 24.640  6.434   35.705  1.00 90.51  ? 28  LYS I CD  1 
ATOM   7890  C CE  . LYS E 3 21  ? 25.539  6.233   36.911  1.00 88.77  ? 28  LYS I CE  1 
ATOM   7891  N NZ  . LYS E 3 21  ? 24.774  6.426   38.175  1.00 91.65  ? 28  LYS I NZ  1 
ATOM   7892  N N   . GLN E 3 22  ? 24.329  6.993   29.538  1.00 90.79  ? 29  GLN I N   1 
ATOM   7893  C CA  . GLN E 3 22  ? 23.247  7.247   28.593  1.00 94.67  ? 29  GLN I CA  1 
ATOM   7894  C C   . GLN E 3 22  ? 22.752  5.944   27.957  1.00 100.15 ? 29  GLN I C   1 
ATOM   7895  O O   . GLN E 3 22  ? 21.563  5.630   28.104  1.00 104.58 ? 29  GLN I O   1 
ATOM   7896  C CB  . GLN E 3 22  ? 23.668  8.295   27.556  1.00 100.42 ? 29  GLN I CB  1 
ATOM   7897  C CG  . GLN E 3 22  ? 23.861  9.687   28.137  1.00 102.06 ? 29  GLN I CG  1 
ATOM   7898  C CD  . GLN E 3 22  ? 22.573  10.274  28.689  1.00 98.94  ? 29  GLN I CD  1 
ATOM   7899  O OE1 . GLN E 3 22  ? 22.296  10.181  29.885  1.00 98.70  ? 29  GLN I OE1 1 
ATOM   7900  N NE2 . GLN E 3 22  ? 21.780  10.889  27.816  1.00 96.48  ? 29  GLN I NE2 1 
ATOM   7901  N N   . PRO E 3 23  ? 23.575  5.152   27.264  1.00 104.31 ? 30  PRO I N   1 
ATOM   7902  C CA  . PRO E 3 23  ? 23.177  3.763   27.000  1.00 99.93  ? 30  PRO I CA  1 
ATOM   7903  C C   . PRO E 3 23  ? 23.759  2.839   28.055  1.00 100.15 ? 30  PRO I C   1 
ATOM   7904  O O   . PRO E 3 23  ? 24.939  2.464   27.984  1.00 97.53  ? 30  PRO I O   1 
ATOM   7905  C CB  . PRO E 3 23  ? 23.765  3.481   25.612  1.00 96.09  ? 30  PRO I CB  1 
ATOM   7906  C CG  . PRO E 3 23  ? 24.982  4.321   25.557  1.00 98.37  ? 30  PRO I CG  1 
ATOM   7907  C CD  . PRO E 3 23  ? 24.751  5.522   26.445  1.00 98.99  ? 30  PRO I CD  1 
ATOM   7908  N N   . PRO E 3 24  ? 22.962  2.449   29.051  1.00 106.88 ? 31  PRO I N   1 
ATOM   7909  C CA  . PRO E 3 24  ? 23.528  1.796   30.242  1.00 106.48 ? 31  PRO I CA  1 
ATOM   7910  C C   . PRO E 3 24  ? 24.156  0.448   29.914  1.00 104.27 ? 31  PRO I C   1 
ATOM   7911  O O   . PRO E 3 24  ? 23.513  -0.432  29.338  1.00 104.80 ? 31  PRO I O   1 
ATOM   7912  C CB  . PRO E 3 24  ? 22.317  1.642   31.169  1.00 106.29 ? 31  PRO I CB  1 
ATOM   7913  C CG  . PRO E 3 24  ? 21.148  1.592   30.241  1.00 102.63 ? 31  PRO I CG  1 
ATOM   7914  C CD  . PRO E 3 24  ? 21.489  2.505   29.095  1.00 104.40 ? 31  PRO I CD  1 
ATOM   7915  N N   . LEU E 3 25  ? 25.420  0.295   30.296  1.00 101.21 ? 32  LEU I N   1 
ATOM   7916  C CA  . LEU E 3 25  ? 26.142  -0.954  30.138  1.00 107.05 ? 32  LEU I CA  1 
ATOM   7917  C C   . LEU E 3 25  ? 25.715  -1.947  31.219  1.00 107.98 ? 32  LEU I C   1 
ATOM   7918  O O   . LEU E 3 25  ? 25.120  -1.557  32.226  1.00 103.70 ? 32  LEU I O   1 
ATOM   7919  C CB  . LEU E 3 25  ? 27.644  -0.686  30.202  1.00 113.54 ? 32  LEU I CB  1 
ATOM   7920  C CG  . LEU E 3 25  ? 28.262  -0.188  28.894  1.00 118.99 ? 32  LEU I CG  1 
ATOM   7921  C CD1 . LEU E 3 25  ? 29.746  0.101   29.068  1.00 124.12 ? 32  LEU I CD1 1 
ATOM   7922  C CD2 . LEU E 3 25  ? 28.030  -1.191  27.770  1.00 114.87 ? 32  LEU I CD2 1 
ATOM   7923  N N   . PRO E 3 26  ? 25.992  -3.242  31.033  1.00 117.61 ? 33  PRO I N   1 
ATOM   7924  C CA  . PRO E 3 26  ? 25.563  -4.227  32.034  1.00 116.77 ? 33  PRO I CA  1 
ATOM   7925  C C   . PRO E 3 26  ? 26.228  -3.993  33.383  1.00 119.04 ? 33  PRO I C   1 
ATOM   7926  O O   . PRO E 3 26  ? 27.300  -3.393  33.487  1.00 117.31 ? 33  PRO I O   1 
ATOM   7927  C CB  . PRO E 3 26  ? 25.992  -5.568  31.422  1.00 114.68 ? 33  PRO I CB  1 
ATOM   7928  C CG  . PRO E 3 26  ? 27.113  -5.216  30.506  1.00 112.02 ? 33  PRO I CG  1 
ATOM   7929  C CD  . PRO E 3 26  ? 26.716  -3.889  29.922  1.00 116.94 ? 33  PRO I CD  1 
ATOM   7930  N N   . LEU E 3 27  ? 25.558  -4.471  34.430  1.00 123.06 ? 34  LEU I N   1 
ATOM   7931  C CA  . LEU E 3 27  ? 26.092  -4.355  35.779  1.00 124.15 ? 34  LEU I CA  1 
ATOM   7932  C C   . LEU E 3 27  ? 27.425  -5.088  35.885  1.00 127.98 ? 34  LEU I C   1 
ATOM   7933  O O   . LEU E 3 27  ? 27.670  -6.081  35.194  1.00 131.30 ? 34  LEU I O   1 
ATOM   7934  C CB  . LEU E 3 27  ? 25.093  -4.910  36.796  1.00 121.94 ? 34  LEU I CB  1 
ATOM   7935  C CG  . LEU E 3 27  ? 23.902  -3.998  37.105  1.00 117.48 ? 34  LEU I CG  1 
ATOM   7936  C CD1 . LEU E 3 27  ? 22.765  -4.782  37.744  1.00 114.18 ? 34  LEU I CD1 1 
ATOM   7937  C CD2 . LEU E 3 27  ? 24.330  -2.842  37.998  1.00 111.92 ? 34  LEU I CD2 1 
ATOM   7938  N N   . LEU E 3 28  ? 28.291  -4.578  36.764  1.00 128.76 ? 35  LEU I N   1 
ATOM   7939  C CA  . LEU E 3 28  ? 29.685  -5.011  36.869  1.00 125.25 ? 35  LEU I CA  1 
ATOM   7940  C C   . LEU E 3 28  ? 30.426  -4.763  35.552  1.00 116.66 ? 35  LEU I C   1 
ATOM   7941  O O   . LEU E 3 28  ? 31.025  -5.663  34.958  1.00 112.47 ? 35  LEU I O   1 
ATOM   7942  C CB  . LEU E 3 28  ? 29.789  -6.481  37.296  1.00 129.65 ? 35  LEU I CB  1 
ATOM   7943  C CG  . LEU E 3 28  ? 29.245  -6.870  38.672  1.00 128.92 ? 35  LEU I CG  1 
ATOM   7944  C CD1 . LEU E 3 28  ? 29.499  -8.346  38.944  1.00 124.67 ? 35  LEU I CD1 1 
ATOM   7945  C CD2 . LEU E 3 28  ? 29.853  -6.006  39.766  1.00 124.65 ? 35  LEU I CD2 1 
ATOM   7946  N N   . ASP E 3 29  ? 30.364  -3.509  35.096  1.00 109.52 ? 36  ASP I N   1 
ATOM   7947  C CA  . ASP E 3 29  ? 31.122  -3.115  33.913  1.00 109.11 ? 36  ASP I CA  1 
ATOM   7948  C C   . ASP E 3 29  ? 32.564  -2.775  34.257  1.00 110.81 ? 36  ASP I C   1 
ATOM   7949  O O   . ASP E 3 29  ? 33.454  -2.952  33.417  1.00 120.47 ? 36  ASP I O   1 
ATOM   7950  C CB  . ASP E 3 29  ? 30.459  -1.925  33.217  1.00 111.68 ? 36  ASP I CB  1 
ATOM   7951  C CG  . ASP E 3 29  ? 31.202  -1.497  31.960  1.00 109.81 ? 36  ASP I CG  1 
ATOM   7952  O OD1 . ASP E 3 29  ? 31.582  -2.378  31.156  1.00 96.29  ? 36  ASP I OD1 1 
ATOM   7953  O OD2 . ASP E 3 29  ? 31.414  -0.279  31.780  1.00 113.17 ? 36  ASP I OD2 1 
ATOM   7954  N N   . PHE E 3 30  ? 32.818  -2.292  35.477  1.00 104.05 ? 37  PHE I N   1 
ATOM   7955  C CA  . PHE E 3 30  ? 34.189  -2.091  35.927  1.00 104.19 ? 37  PHE I CA  1 
ATOM   7956  C C   . PHE E 3 30  ? 34.976  -3.394  35.982  1.00 102.86 ? 37  PHE I C   1 
ATOM   7957  O O   . PHE E 3 30  ? 36.204  -3.353  36.114  1.00 104.70 ? 37  PHE I O   1 
ATOM   7958  C CB  . PHE E 3 30  ? 34.199  -1.401  37.296  1.00 103.22 ? 37  PHE I CB  1 
ATOM   7959  C CG  . PHE E 3 30  ? 33.597  -2.226  38.398  1.00 113.01 ? 37  PHE I CG  1 
ATOM   7960  C CD1 . PHE E 3 30  ? 32.231  -2.196  38.637  1.00 118.04 ? 37  PHE I CD1 1 
ATOM   7961  C CD2 . PHE E 3 30  ? 34.395  -3.026  39.201  1.00 118.47 ? 37  PHE I CD2 1 
ATOM   7962  C CE1 . PHE E 3 30  ? 31.670  -2.950  39.653  1.00 117.76 ? 37  PHE I CE1 1 
ATOM   7963  C CE2 . PHE E 3 30  ? 33.839  -3.787  40.217  1.00 124.99 ? 37  PHE I CE2 1 
ATOM   7964  C CZ  . PHE E 3 30  ? 32.475  -3.746  40.445  1.00 122.74 ? 37  PHE I CZ  1 
ATOM   7965  N N   . ASN E 3 31  ? 34.300  -4.544  35.883  1.00 107.56 ? 38  ASN I N   1 
ATOM   7966  C CA  . ASN E 3 31  ? 35.006  -5.810  35.730  1.00 106.86 ? 38  ASN I CA  1 
ATOM   7967  C C   . ASN E 3 31  ? 35.770  -5.857  34.412  1.00 103.26 ? 38  ASN I C   1 
ATOM   7968  O O   . ASN E 3 31  ? 36.782  -6.560  34.305  1.00 109.14 ? 38  ASN I O   1 
ATOM   7969  C CB  . ASN E 3 31  ? 34.019  -6.976  35.821  1.00 109.03 ? 38  ASN I CB  1 
ATOM   7970  C CG  . ASN E 3 31  ? 33.940  -7.573  37.217  1.00 110.03 ? 38  ASN I CG  1 
ATOM   7971  O OD1 . ASN E 3 31  ? 33.427  -6.944  38.145  1.00 110.90 ? 38  ASN I OD1 1 
ATOM   7972  N ND2 . ASN E 3 31  ? 34.449  -8.791  37.373  1.00 109.66 ? 38  ASN I ND2 1 
ATOM   7973  N N   . ASN E 3 32  ? 35.306  -5.120  33.401  1.00 97.85  ? 39  ASN I N   1 
ATOM   7974  C CA  . ASN E 3 32  ? 36.050  -5.000  32.154  1.00 97.39  ? 39  ASN I CA  1 
ATOM   7975  C C   . ASN E 3 32  ? 37.255  -4.078  32.281  1.00 93.84  ? 39  ASN I C   1 
ATOM   7976  O O   . ASN E 3 32  ? 38.119  -4.088  31.398  1.00 92.19  ? 39  ASN I O   1 
ATOM   7977  C CB  . ASN E 3 32  ? 35.129  -4.498  31.041  1.00 97.05  ? 39  ASN I CB  1 
ATOM   7978  C CG  . ASN E 3 32  ? 34.030  -5.484  30.710  1.00 95.53  ? 39  ASN I CG  1 
ATOM   7979  O OD1 . ASN E 3 32  ? 34.234  -6.424  29.942  1.00 97.30  ? 39  ASN I OD1 1 
ATOM   7980  N ND2 . ASN E 3 32  ? 32.858  -5.279  31.296  1.00 100.23 ? 39  ASN I ND2 1 
ATOM   7981  N N   . LEU E 3 33  ? 37.332  -3.288  33.347  1.00 90.62  ? 40  LEU I N   1 
ATOM   7982  C CA  . LEU E 3 33  ? 38.467  -2.403  33.561  1.00 91.84  ? 40  LEU I CA  1 
ATOM   7983  C C   . LEU E 3 33  ? 39.640  -3.216  34.092  1.00 95.39  ? 40  LEU I C   1 
ATOM   7984  O O   . LEU E 3 33  ? 39.565  -3.779  35.189  1.00 94.53  ? 40  LEU I O   1 
ATOM   7985  C CB  . LEU E 3 33  ? 38.092  -1.286  34.531  1.00 91.90  ? 40  LEU I CB  1 
ATOM   7986  C CG  . LEU E 3 33  ? 38.995  -0.052  34.535  1.00 95.15  ? 40  LEU I CG  1 
ATOM   7987  C CD1 . LEU E 3 33  ? 39.106  0.547   33.141  1.00 95.53  ? 40  LEU I CD1 1 
ATOM   7988  C CD2 . LEU E 3 33  ? 38.483  0.977   35.523  1.00 95.30  ? 40  LEU I CD2 1 
ATOM   7989  N N   . ASN E 3 34  ? 40.715  -3.288  33.311  1.00 103.07 ? 41  ASN I N   1 
ATOM   7990  C CA  . ASN E 3 34  ? 41.894  -4.031  33.734  1.00 104.66 ? 41  ASN I CA  1 
ATOM   7991  C C   . ASN E 3 34  ? 42.486  -3.411  34.994  1.00 101.18 ? 41  ASN I C   1 
ATOM   7992  O O   . ASN E 3 34  ? 42.479  -2.189  35.166  1.00 96.09  ? 41  ASN I O   1 
ATOM   7993  C CB  . ASN E 3 34  ? 42.934  -4.058  32.613  1.00 107.39 ? 41  ASN I CB  1 
ATOM   7994  C CG  . ASN E 3 34  ? 44.124  -4.939  32.942  1.00 108.06 ? 41  ASN I CG  1 
ATOM   7995  O OD1 . ASN E 3 34  ? 43.981  -5.985  33.575  1.00 110.73 ? 41  ASN I OD1 1 
ATOM   7996  N ND2 . ASN E 3 34  ? 45.308  -4.514  32.518  1.00 107.66 ? 41  ASN I ND2 1 
ATOM   7997  N N   . GLY E 3 35  ? 42.998  -4.269  35.881  1.00 99.41  ? 42  GLY I N   1 
ATOM   7998  C CA  . GLY E 3 35  ? 43.520  -3.792  37.152  1.00 99.26  ? 42  GLY I CA  1 
ATOM   7999  C C   . GLY E 3 35  ? 44.644  -2.787  37.005  1.00 101.06 ? 42  GLY I C   1 
ATOM   8000  O O   . GLY E 3 35  ? 44.841  -1.938  37.879  1.00 102.03 ? 42  GLY I O   1 
ATOM   8001  N N   . GLU E 3 36  ? 45.397  -2.867  35.908  1.00 104.63 ? 43  GLU I N   1 
ATOM   8002  C CA  . GLU E 3 36  ? 46.449  -1.888  35.663  1.00 105.12 ? 43  GLU I CA  1 
ATOM   8003  C C   . GLU E 3 36  ? 45.857  -0.497  35.471  1.00 105.69 ? 43  GLU I C   1 
ATOM   8004  O O   . GLU E 3 36  ? 46.332  0.481   36.060  1.00 105.45 ? 43  GLU I O   1 
ATOM   8005  C CB  . GLU E 3 36  ? 47.271  -2.303  34.443  1.00 107.02 ? 43  GLU I CB  1 
ATOM   8006  C CG  . GLU E 3 36  ? 48.051  -3.598  34.622  1.00 110.39 ? 43  GLU I CG  1 
ATOM   8007  C CD  . GLU E 3 36  ? 49.139  -3.500  35.677  1.00 114.18 ? 43  GLU I CD  1 
ATOM   8008  O OE1 . GLU E 3 36  ? 49.483  -2.369  36.087  1.00 117.55 ? 43  GLU I OE1 1 
ATOM   8009  O OE2 . GLU E 3 36  ? 49.653  -4.559  36.096  1.00 111.95 ? 43  GLU I OE2 1 
ATOM   8010  N N   . ASP E 3 37  ? 44.817  -0.393  34.638  1.00 102.92 ? 44  ASP I N   1 
ATOM   8011  C CA  . ASP E 3 37  ? 44.119  0.877   34.481  1.00 103.44 ? 44  ASP I CA  1 
ATOM   8012  C C   . ASP E 3 37  ? 43.560  1.357   35.814  1.00 102.58 ? 44  ASP I C   1 
ATOM   8013  O O   . ASP E 3 37  ? 43.573  2.559   36.107  1.00 103.26 ? 44  ASP I O   1 
ATOM   8014  C CB  . ASP E 3 37  ? 42.997  0.737   33.450  1.00 104.00 ? 44  ASP I CB  1 
ATOM   8015  C CG  . ASP E 3 37  ? 43.519  0.550   32.035  1.00 103.72 ? 44  ASP I CG  1 
ATOM   8016  O OD1 . ASP E 3 37  ? 44.612  1.068   31.720  1.00 103.03 ? 44  ASP I OD1 1 
ATOM   8017  O OD2 . ASP E 3 37  ? 42.828  -0.117  31.236  1.00 101.55 ? 44  ASP I OD2 1 
ATOM   8018  N N   . GLN E 3 38  ? 43.076  0.426   36.639  1.00 97.51  ? 45  GLN I N   1 
ATOM   8019  C CA  . GLN E 3 38  ? 42.556  0.789   37.953  1.00 97.08  ? 45  GLN I CA  1 
ATOM   8020  C C   . GLN E 3 38  ? 43.643  1.416   38.815  1.00 98.25  ? 45  GLN I C   1 
ATOM   8021  O O   . GLN E 3 38  ? 43.432  2.462   39.440  1.00 98.13  ? 45  GLN I O   1 
ATOM   8022  C CB  . GLN E 3 38  ? 41.971  -0.444  38.640  1.00 93.73  ? 45  GLN I CB  1 
ATOM   8023  C CG  . GLN E 3 38  ? 40.875  -1.136  37.851  1.00 94.09  ? 45  GLN I CG  1 
ATOM   8024  C CD  . GLN E 3 38  ? 40.095  -2.120  38.695  1.00 95.51  ? 45  GLN I CD  1 
ATOM   8025  O OE1 . GLN E 3 38  ? 40.153  -2.079  39.923  1.00 99.68  ? 45  GLN I OE1 1 
ATOM   8026  N NE2 . GLN E 3 38  ? 39.369  -3.020  38.041  1.00 95.28  ? 45  GLN I NE2 1 
ATOM   8027  N N   . ASP E 3 39  ? 44.820  0.788   38.857  1.00 97.34  ? 46  ASP I N   1 
ATOM   8028  C CA  . ASP E 3 39  ? 45.910  1.320   39.668  1.00 104.18 ? 46  ASP I CA  1 
ATOM   8029  C C   . ASP E 3 39  ? 46.388  2.665   39.134  1.00 104.67 ? 46  ASP I C   1 
ATOM   8030  O O   . ASP E 3 39  ? 46.736  3.561   39.913  1.00 100.40 ? 46  ASP I O   1 
ATOM   8031  C CB  . ASP E 3 39  ? 47.064  0.317   39.722  1.00 104.01 ? 46  ASP I CB  1 
ATOM   8032  C CG  . ASP E 3 39  ? 48.098  0.674   40.776  1.00 105.40 ? 46  ASP I CG  1 
ATOM   8033  O OD1 . ASP E 3 39  ? 47.860  0.384   41.967  1.00 105.00 ? 46  ASP I OD1 1 
ATOM   8034  O OD2 . ASP E 3 39  ? 49.151  1.240   40.414  1.00 110.30 ? 46  ASP I OD2 1 
ATOM   8035  N N   . ILE E 3 40  ? 46.403  2.829   37.809  1.00 100.48 ? 47  ILE I N   1 
ATOM   8036  C CA  . ILE E 3 40  ? 46.826  4.101   37.228  1.00 101.24 ? 47  ILE I CA  1 
ATOM   8037  C C   . ILE E 3 40  ? 45.838  5.209   37.580  1.00 102.43 ? 47  ILE I C   1 
ATOM   8038  O O   . ILE E 3 40  ? 46.237  6.331   37.915  1.00 100.21 ? 47  ILE I O   1 
ATOM   8039  C CB  . ILE E 3 40  ? 47.013  3.964   35.704  1.00 100.67 ? 47  ILE I CB  1 
ATOM   8040  C CG1 . ILE E 3 40  ? 48.461  3.600   35.358  1.00 104.13 ? 47  ILE I CG1 1 
ATOM   8041  C CG2 . ILE E 3 40  ? 46.618  5.247   34.989  1.00 101.87 ? 47  ILE I CG2 1 
ATOM   8042  C CD1 . ILE E 3 40  ? 48.892  2.224   35.795  1.00 105.62 ? 47  ILE I CD1 1 
ATOM   8043  N N   . LEU E 3 41  ? 44.537  4.913   37.525  1.00 97.74  ? 48  LEU I N   1 
ATOM   8044  C CA  . LEU E 3 41  ? 43.538  5.933   37.837  1.00 98.32  ? 48  LEU I CA  1 
ATOM   8045  C C   . LEU E 3 41  ? 43.482  6.234   39.331  1.00 98.73  ? 48  LEU I C   1 
ATOM   8046  O O   . LEU E 3 41  ? 43.169  7.366   39.721  1.00 89.77  ? 48  LEU I O   1 
ATOM   8047  C CB  . LEU E 3 41  ? 42.165  5.494   37.329  1.00 96.48  ? 48  LEU I CB  1 
ATOM   8048  C CG  . LEU E 3 41  ? 42.035  5.326   35.815  1.00 95.05  ? 48  LEU I CG  1 
ATOM   8049  C CD1 . LEU E 3 41  ? 40.787  4.533   35.466  1.00 92.93  ? 48  LEU I CD1 1 
ATOM   8050  C CD2 . LEU E 3 41  ? 42.026  6.682   35.125  1.00 95.56  ? 48  LEU I CD2 1 
ATOM   8051  N N   . MET E 3 42  ? 43.782  5.243   40.177  1.00 96.98  ? 49  MET I N   1 
ATOM   8052  C CA  . MET E 3 42  ? 43.729  5.459   41.620  1.00 97.23  ? 49  MET I CA  1 
ATOM   8053  C C   . MET E 3 42  ? 44.909  6.281   42.121  1.00 101.38 ? 49  MET I C   1 
ATOM   8054  O O   . MET E 3 42  ? 44.784  6.977   43.136  1.00 100.88 ? 49  MET I O   1 
ATOM   8055  C CB  . MET E 3 42  ? 43.680  4.119   42.356  1.00 94.97  ? 49  MET I CB  1 
ATOM   8056  C CG  . MET E 3 42  ? 42.279  3.656   42.722  1.00 97.30  ? 49  MET I CG  1 
ATOM   8057  S SD  . MET E 3 42  ? 42.254  2.057   43.563  1.00 93.92  ? 49  MET I SD  1 
ATOM   8058  C CE  . MET E 3 42  ? 42.281  0.932   42.171  1.00 95.59  ? 49  MET I CE  1 
ATOM   8059  N N   . GLU E 3 43  ? 46.052  6.210   41.437  1.00 104.66 ? 50  GLU I N   1 
ATOM   8060  C CA  . GLU E 3 43  ? 47.263  6.894   41.880  1.00 105.78 ? 50  GLU I CA  1 
ATOM   8061  C C   . GLU E 3 43  ? 47.009  8.388   42.035  1.00 102.50 ? 50  GLU I C   1 
ATOM   8062  O O   . GLU E 3 43  ? 46.606  9.061   41.081  1.00 105.59 ? 50  GLU I O   1 
ATOM   8063  C CB  . GLU E 3 43  ? 48.395  6.645   40.885  1.00 109.78 ? 50  GLU I CB  1 
ATOM   8064  C CG  . GLU E 3 43  ? 49.637  7.505   41.092  1.00 114.40 ? 50  GLU I CG  1 
ATOM   8065  C CD  . GLU E 3 43  ? 50.593  6.926   42.124  1.00 119.99 ? 50  GLU I CD  1 
ATOM   8066  O OE1 . GLU E 3 43  ? 50.140  6.565   43.232  1.00 122.66 ? 50  GLU I OE1 1 
ATOM   8067  O OE2 . GLU E 3 43  ? 51.803  6.829   41.824  1.00 123.48 ? 50  GLU I OE2 1 
ATOM   8068  N N   . ASN E 3 44  ? 47.244  8.903   43.244  1.00 101.63 ? 51  ASN I N   1 
ATOM   8069  C CA  . ASN E 3 44  ? 46.961  10.307  43.529  1.00 103.82 ? 51  ASN I CA  1 
ATOM   8070  C C   . ASN E 3 44  ? 47.874  11.230  42.731  1.00 107.63 ? 51  ASN I C   1 
ATOM   8071  O O   . ASN E 3 44  ? 47.414  12.212  42.135  1.00 113.76 ? 51  ASN I O   1 
ATOM   8072  C CB  . ASN E 3 44  ? 47.104  10.574  45.027  1.00 106.14 ? 51  ASN I CB  1 
ATOM   8073  C CG  . ASN E 3 44  ? 47.236  12.052  45.346  1.00 110.37 ? 51  ASN I CG  1 
ATOM   8074  O OD1 . ASN E 3 44  ? 48.339  12.599  45.382  1.00 114.01 ? 51  ASN I OD1 1 
ATOM   8075  N ND2 . ASN E 3 44  ? 46.106  12.706  45.581  1.00 110.45 ? 51  ASN I ND2 1 
ATOM   8076  N N   . ASN E 3 45  ? 49.176  10.930  42.708  1.00 109.34 ? 52  ASN I N   1 
ATOM   8077  C CA  . ASN E 3 45  ? 50.129  11.774  41.996  1.00 113.26 ? 52  ASN I CA  1 
ATOM   8078  C C   . ASN E 3 45  ? 49.803  11.894  40.513  1.00 114.49 ? 52  ASN I C   1 
ATOM   8079  O O   . ASN E 3 45  ? 50.285  12.824  39.856  1.00 115.07 ? 52  ASN I O   1 
ATOM   8080  C CB  . ASN E 3 45  ? 51.549  11.230  42.170  1.00 115.19 ? 52  ASN I CB  1 
ATOM   8081  C CG  . ASN E 3 45  ? 52.109  11.471  43.563  1.00 116.41 ? 52  ASN I CG  1 
ATOM   8082  O OD1 . ASN E 3 45  ? 53.287  11.215  43.818  1.00 117.16 ? 52  ASN I OD1 1 
ATOM   8083  N ND2 . ASN E 3 45  ? 51.274  11.975  44.466  1.00 115.31 ? 52  ASN I ND2 1 
ATOM   8084  N N   . LEU E 3 46  ? 48.992  10.983  39.976  1.00 108.00 ? 53  LEU I N   1 
ATOM   8085  C CA  . LEU E 3 46  ? 48.624  10.981  38.569  1.00 104.85 ? 53  LEU I CA  1 
ATOM   8086  C C   . LEU E 3 46  ? 47.255  11.599  38.311  1.00 104.31 ? 53  LEU I C   1 
ATOM   8087  O O   . LEU E 3 46  ? 46.735  11.471  37.198  1.00 103.79 ? 53  LEU I O   1 
ATOM   8088  C CB  . LEU E 3 46  ? 48.655  9.553   38.023  1.00 103.89 ? 53  LEU I CB  1 
ATOM   8089  C CG  . LEU E 3 46  ? 49.874  9.181   37.180  1.00 108.65 ? 53  LEU I CG  1 
ATOM   8090  C CD1 . LEU E 3 46  ? 51.144  9.262   38.015  1.00 112.16 ? 53  LEU I CD1 1 
ATOM   8091  C CD2 . LEU E 3 46  ? 49.705  7.793   36.579  1.00 111.23 ? 53  LEU I CD2 1 
ATOM   8092  N N   . ARG E 3 47  ? 46.657  12.263  39.304  1.00 101.85 ? 54  ARG I N   1 
ATOM   8093  C CA  . ARG E 3 47  ? 45.308  12.790  39.120  1.00 97.56  ? 54  ARG I CA  1 
ATOM   8094  C C   . ARG E 3 47  ? 45.276  13.873  38.046  1.00 96.70  ? 54  ARG I C   1 
ATOM   8095  O O   . ARG E 3 47  ? 44.488  13.794  37.096  1.00 97.04  ? 54  ARG I O   1 
ATOM   8096  C CB  . ARG E 3 47  ? 44.757  13.323  40.443  1.00 96.76  ? 54  ARG I CB  1 
ATOM   8097  C CG  . ARG E 3 47  ? 44.353  12.233  41.420  1.00 95.26  ? 54  ARG I CG  1 
ATOM   8098  C CD  . ARG E 3 47  ? 43.092  11.515  40.971  1.00 93.35  ? 54  ARG I CD  1 
ATOM   8099  N NE  . ARG E 3 47  ? 42.811  10.350  41.806  1.00 94.72  ? 54  ARG I NE  1 
ATOM   8100  C CZ  . ARG E 3 47  ? 41.620  9.767   41.901  1.00 92.79  ? 54  ARG I CZ  1 
ATOM   8101  N NH1 . ARG E 3 47  ? 40.589  10.244  41.219  1.00 95.19  ? 54  ARG I NH1 1 
ATOM   8102  N NH2 . ARG E 3 47  ? 41.459  8.712   42.687  1.00 90.86  ? 54  ARG I NH2 1 
ATOM   8103  N N   . ARG E 3 48  ? 46.126  14.890  38.177  1.00 98.92  ? 55  ARG I N   1 
ATOM   8104  C CA  . ARG E 3 48  ? 46.104  15.982  37.207  1.00 100.96 ? 55  ARG I CA  1 
ATOM   8105  C C   . ARG E 3 48  ? 46.478  15.548  35.793  1.00 101.54 ? 55  ARG I C   1 
ATOM   8106  O O   . ARG E 3 48  ? 45.789  15.977  34.852  1.00 111.57 ? 55  ARG I O   1 
ATOM   8107  C CB  . ARG E 3 48  ? 47.005  17.131  37.680  1.00 101.28 ? 55  ARG I CB  1 
ATOM   8108  C CG  . ARG E 3 48  ? 46.951  18.354  36.772  1.00 102.23 ? 55  ARG I CG  1 
ATOM   8109  C CD  . ARG E 3 48  ? 47.744  19.521  37.341  1.00 108.63 ? 55  ARG I CD  1 
ATOM   8110  N NE  . ARG E 3 48  ? 46.984  20.272  38.340  1.00 111.47 ? 55  ARG I NE  1 
ATOM   8111  C CZ  . ARG E 3 48  ? 47.035  20.053  39.652  1.00 114.04 ? 55  ARG I CZ  1 
ATOM   8112  N NH1 . ARG E 3 48  ? 47.818  19.102  40.147  1.00 119.04 ? 55  ARG I NH1 1 
ATOM   8113  N NH2 . ARG E 3 48  ? 46.302  20.792  40.473  1.00 109.27 ? 55  ARG I NH2 1 
ATOM   8114  N N   . PRO E 3 49  ? 47.517  14.735  35.558  1.00 98.62  ? 56  PRO I N   1 
ATOM   8115  C CA  . PRO E 3 49  ? 47.739  14.259  34.180  1.00 98.89  ? 56  PRO I CA  1 
ATOM   8116  C C   . PRO E 3 49  ? 46.571  13.451  33.641  1.00 95.96  ? 56  PRO I C   1 
ATOM   8117  O O   . PRO E 3 49  ? 46.123  13.692  32.511  1.00 95.60  ? 56  PRO I O   1 
ATOM   8118  C CB  . PRO E 3 49  ? 49.024  13.422  34.298  1.00 99.80  ? 56  PRO I CB  1 
ATOM   8119  C CG  . PRO E 3 49  ? 49.168  13.120  35.742  1.00 99.93  ? 56  PRO I CG  1 
ATOM   8120  C CD  . PRO E 3 49  ? 48.595  14.294  36.461  1.00 100.79 ? 56  PRO I CD  1 
ATOM   8121  N N   . ASN E 3 50  ? 46.052  12.508  34.434  1.00 92.15  ? 57  ASN I N   1 
ATOM   8122  C CA  . ASN E 3 50  ? 44.907  11.710  34.007  1.00 93.32  ? 57  ASN I CA  1 
ATOM   8123  C C   . ASN E 3 50  ? 43.762  12.597  33.534  1.00 92.31  ? 57  ASN I C   1 
ATOM   8124  O O   . ASN E 3 50  ? 43.178  12.366  32.468  1.00 95.60  ? 57  ASN I O   1 
ATOM   8125  C CB  . ASN E 3 50  ? 44.443  10.804  35.149  1.00 95.80  ? 57  ASN I CB  1 
ATOM   8126  C CG  . ASN E 3 50  ? 45.290  9.557   35.285  1.00 95.38  ? 57  ASN I CG  1 
ATOM   8127  O OD1 . ASN E 3 50  ? 45.962  9.143   34.339  1.00 90.62  ? 57  ASN I OD1 1 
ATOM   8128  N ND2 . ASN E 3 50  ? 45.263  8.948   36.465  1.00 96.58  ? 57  ASN I ND2 1 
ATOM   8129  N N   . LEU E 3 51  ? 43.437  13.630  34.315  1.00 87.55  ? 58  LEU I N   1 
ATOM   8130  C CA  . LEU E 3 51  ? 42.393  14.566  33.911  1.00 88.29  ? 58  LEU I CA  1 
ATOM   8131  C C   . LEU E 3 51  ? 42.697  15.162  32.542  1.00 89.05  ? 58  LEU I C   1 
ATOM   8132  O O   . LEU E 3 51  ? 41.841  15.165  31.649  1.00 86.56  ? 58  LEU I O   1 
ATOM   8133  C CB  . LEU E 3 51  ? 42.241  15.667  34.961  1.00 89.79  ? 58  LEU I CB  1 
ATOM   8134  C CG  . LEU E 3 51  ? 41.234  16.774  34.647  1.00 91.39  ? 58  LEU I CG  1 
ATOM   8135  C CD1 . LEU E 3 51  ? 39.877  16.182  34.300  1.00 91.74  ? 58  LEU I CD1 1 
ATOM   8136  C CD2 . LEU E 3 51  ? 41.116  17.743  35.813  1.00 92.50  ? 58  LEU I CD2 1 
ATOM   8137  N N   . GLU E 3 52  ? 43.929  15.645  32.347  1.00 93.50  ? 59  GLU I N   1 
ATOM   8138  C CA  . GLU E 3 52  ? 44.295  16.212  31.054  1.00 96.81  ? 59  GLU I CA  1 
ATOM   8139  C C   . GLU E 3 52  ? 44.198  15.189  29.934  1.00 90.96  ? 59  GLU I C   1 
ATOM   8140  O O   . GLU E 3 52  ? 44.029  15.573  28.772  1.00 94.44  ? 59  GLU I O   1 
ATOM   8141  C CB  . GLU E 3 52  ? 45.708  16.801  31.099  1.00 105.82 ? 59  GLU I CB  1 
ATOM   8142  C CG  . GLU E 3 52  ? 45.978  17.712  32.286  1.00 111.86 ? 59  GLU I CG  1 
ATOM   8143  C CD  . GLU E 3 52  ? 44.993  18.864  32.389  1.00 113.65 ? 59  GLU I CD  1 
ATOM   8144  O OE1 . GLU E 3 52  ? 44.597  19.415  31.338  1.00 114.73 ? 59  GLU I OE1 1 
ATOM   8145  O OE2 . GLU E 3 52  ? 44.613  19.218  33.525  1.00 114.13 ? 59  GLU I OE2 1 
ATOM   8146  N N   . ALA E 3 53  ? 44.301  13.897  30.252  1.00 85.32  ? 60  ALA I N   1 
ATOM   8147  C CA  . ALA E 3 53  ? 44.060  12.877  29.240  1.00 86.68  ? 60  ALA I CA  1 
ATOM   8148  C C   . ALA E 3 53  ? 42.592  12.858  28.839  1.00 83.46  ? 60  ALA I C   1 
ATOM   8149  O O   . ALA E 3 53  ? 42.264  12.857  27.646  1.00 85.21  ? 60  ALA I O   1 
ATOM   8150  C CB  . ALA E 3 53  ? 44.500  11.507  29.755  1.00 93.96  ? 60  ALA I CB  1 
ATOM   8151  N N   . PHE E 3 54  ? 41.693  12.868  29.826  1.00 82.87  ? 61  PHE I N   1 
ATOM   8152  C CA  . PHE E 3 54  ? 40.264  12.871  29.528  1.00 82.25  ? 61  PHE I CA  1 
ATOM   8153  C C   . PHE E 3 54  ? 39.885  14.093  28.702  1.00 81.80  ? 61  PHE I C   1 
ATOM   8154  O O   . PHE E 3 54  ? 39.204  13.979  27.674  1.00 80.94  ? 61  PHE I O   1 
ATOM   8155  C CB  . PHE E 3 54  ? 39.460  12.824  30.827  1.00 82.86  ? 61  PHE I CB  1 
ATOM   8156  C CG  . PHE E 3 54  ? 39.492  11.488  31.511  1.00 82.25  ? 61  PHE I CG  1 
ATOM   8157  C CD1 . PHE E 3 54  ? 38.884  10.386  30.937  1.00 82.41  ? 61  PHE I CD1 1 
ATOM   8158  C CD2 . PHE E 3 54  ? 40.131  11.334  32.729  1.00 82.74  ? 61  PHE I CD2 1 
ATOM   8159  C CE1 . PHE E 3 54  ? 38.910  9.157   31.566  1.00 82.52  ? 61  PHE I CE1 1 
ATOM   8160  C CE2 . PHE E 3 54  ? 40.161  10.107  33.362  1.00 84.27  ? 61  PHE I CE2 1 
ATOM   8161  C CZ  . PHE E 3 54  ? 39.549  9.018   32.779  1.00 82.54  ? 61  PHE I CZ  1 
ATOM   8162  N N   . ASN E 3 55  ? 40.353  15.273  29.120  1.00 80.04  ? 62  ASN I N   1 
ATOM   8163  C CA  . ASN E 3 55  ? 40.101  16.500  28.374  1.00 80.59  ? 62  ASN I CA  1 
ATOM   8164  C C   . ASN E 3 55  ? 40.529  16.398  26.917  1.00 79.57  ? 62  ASN I C   1 
ATOM   8165  O O   . ASN E 3 55  ? 40.040  17.169  26.085  1.00 79.38  ? 62  ASN I O   1 
ATOM   8166  C CB  . ASN E 3 55  ? 40.816  17.675  29.040  1.00 81.14  ? 62  ASN I CB  1 
ATOM   8167  C CG  . ASN E 3 55  ? 40.087  18.175  30.263  1.00 80.06  ? 62  ASN I CG  1 
ATOM   8168  O OD1 . ASN E 3 55  ? 38.995  18.736  30.160  1.00 78.28  ? 62  ASN I OD1 1 
ATOM   8169  N ND2 . ASN E 3 55  ? 40.687  17.980  31.432  1.00 79.37  ? 62  ASN I ND2 1 
ATOM   8170  N N   . ARG E 3 56  ? 41.431  15.473  26.585  1.00 80.63  ? 63  ARG I N   1 
ATOM   8171  C CA  . ARG E 3 56  ? 41.767  15.258  25.183  1.00 82.09  ? 63  ARG I CA  1 
ATOM   8172  C C   . ARG E 3 56  ? 40.771  14.313  24.525  1.00 78.19  ? 63  ARG I C   1 
ATOM   8173  O O   . ARG E 3 56  ? 40.220  14.621  23.461  1.00 79.37  ? 63  ARG I O   1 
ATOM   8174  C CB  . ARG E 3 56  ? 43.192  14.715  25.056  1.00 87.69  ? 63  ARG I CB  1 
ATOM   8175  C CG  . ARG E 3 56  ? 44.165  15.679  24.394  1.00 90.59  ? 63  ARG I CG  1 
ATOM   8176  C CD  . ARG E 3 56  ? 45.559  15.080  24.267  1.00 94.19  ? 63  ARG I CD  1 
ATOM   8177  N NE  . ARG E 3 56  ? 46.177  14.824  25.566  1.00 94.31  ? 63  ARG I NE  1 
ATOM   8178  C CZ  . ARG E 3 56  ? 46.294  13.617  26.111  1.00 91.38  ? 63  ARG I CZ  1 
ATOM   8179  N NH1 . ARG E 3 56  ? 45.836  12.552  25.467  1.00 86.74  ? 63  ARG I NH1 1 
ATOM   8180  N NH2 . ARG E 3 56  ? 46.871  13.474  27.298  1.00 86.18  ? 63  ARG I NH2 1 
ATOM   8181  N N   . ALA E 3 57  ? 40.510  13.167  25.159  1.00 76.70  ? 64  ALA I N   1 
ATOM   8182  C CA  . ALA E 3 57  ? 39.650  12.162  24.541  1.00 78.87  ? 64  ALA I CA  1 
ATOM   8183  C C   . ALA E 3 57  ? 38.228  12.678  24.382  1.00 80.23  ? 64  ALA I C   1 
ATOM   8184  O O   . ALA E 3 57  ? 37.562  12.385  23.381  1.00 79.63  ? 64  ALA I O   1 
ATOM   8185  C CB  . ALA E 3 57  ? 39.669  10.874  25.363  1.00 80.16  ? 64  ALA I CB  1 
ATOM   8186  N N   . VAL E 3 58  ? 37.753  13.470  25.347  1.00 81.24  ? 65  VAL I N   1 
ATOM   8187  C CA  . VAL E 3 58  ? 36.416  14.038  25.262  1.00 80.53  ? 65  VAL I CA  1 
ATOM   8188  C C   . VAL E 3 58  ? 36.282  14.968  24.063  1.00 81.69  ? 65  VAL I C   1 
ATOM   8189  O O   . VAL E 3 58  ? 35.162  15.280  23.643  1.00 80.88  ? 65  VAL I O   1 
ATOM   8190  C CB  . VAL E 3 58  ? 36.067  14.766  26.576  1.00 76.91  ? 65  VAL I CB  1 
ATOM   8191  C CG1 . VAL E 3 58  ? 36.769  16.112  26.642  1.00 77.68  ? 65  VAL I CG1 1 
ATOM   8192  C CG2 . VAL E 3 58  ? 34.561  14.925  26.722  1.00 76.21  ? 65  VAL I CG2 1 
ATOM   8193  N N   . LYS E 3 59  ? 37.403  15.415  23.489  1.00 82.66  ? 66  LYS I N   1 
ATOM   8194  C CA  . LYS E 3 59  ? 37.330  16.252  22.299  1.00 81.21  ? 66  LYS I CA  1 
ATOM   8195  C C   . LYS E 3 59  ? 36.981  15.455  21.050  1.00 76.54  ? 66  LYS I C   1 
ATOM   8196  O O   . LYS E 3 59  ? 36.561  16.050  20.051  1.00 78.11  ? 66  LYS I O   1 
ATOM   8197  C CB  . LYS E 3 59  ? 38.649  16.999  22.092  1.00 84.00  ? 66  LYS I CB  1 
ATOM   8198  C CG  . LYS E 3 59  ? 38.999  17.951  23.224  1.00 87.04  ? 66  LYS I CG  1 
ATOM   8199  C CD  . LYS E 3 59  ? 39.614  19.241  22.705  1.00 88.64  ? 66  LYS I CD  1 
ATOM   8200  C CE  . LYS E 3 59  ? 38.564  20.149  22.084  1.00 91.88  ? 66  LYS I CE  1 
ATOM   8201  N NZ  . LYS E 3 59  ? 39.136  21.467  21.687  1.00 94.72  ? 66  LYS I NZ  1 
ATOM   8202  N N   . SER E 3 60  ? 37.135  14.133  21.079  1.00 75.62  ? 67  SER I N   1 
ATOM   8203  C CA  . SER E 3 60  ? 36.824  13.282  19.936  1.00 76.26  ? 67  SER I CA  1 
ATOM   8204  C C   . SER E 3 60  ? 35.605  12.406  20.210  1.00 76.25  ? 67  SER I C   1 
ATOM   8205  O O   . SER E 3 60  ? 35.542  11.250  19.790  1.00 74.07  ? 67  SER I O   1 
ATOM   8206  C CB  . SER E 3 60  ? 38.027  12.424  19.554  1.00 77.40  ? 67  SER I CB  1 
ATOM   8207  O OG  . SER E 3 60  ? 38.503  11.696  20.670  1.00 80.11  ? 67  SER I OG  1 
ATOM   8208  N N   . LEU E 3 61  ? 34.624  12.955  20.930  1.00 75.72  ? 68  LEU I N   1 
ATOM   8209  C CA  . LEU E 3 61  ? 33.347  12.296  21.176  1.00 75.40  ? 68  LEU I CA  1 
ATOM   8210  C C   . LEU E 3 61  ? 32.212  13.271  20.900  1.00 75.03  ? 68  LEU I C   1 
ATOM   8211  O O   . LEU E 3 61  ? 32.288  14.445  21.279  1.00 76.80  ? 68  LEU I O   1 
ATOM   8212  C CB  . LEU E 3 61  ? 33.237  11.784  22.619  1.00 74.86  ? 68  LEU I CB  1 
ATOM   8213  C CG  . LEU E 3 61  ? 34.261  10.765  23.120  1.00 76.33  ? 68  LEU I CG  1 
ATOM   8214  C CD1 . LEU E 3 61  ? 34.314  10.784  24.637  1.00 75.54  ? 68  LEU I CD1 1 
ATOM   8215  C CD2 . LEU E 3 61  ? 33.941  9.366   22.609  1.00 77.00  ? 68  LEU I CD2 1 
ATOM   8216  N N   . GLN E 3 62  ? 31.162  12.785  20.248  1.00 71.45  ? 69  GLN I N   1 
ATOM   8217  C CA  . GLN E 3 62  ? 29.997  13.621  20.007  1.00 73.80  ? 69  GLN I CA  1 
ATOM   8218  C C   . GLN E 3 62  ? 28.968  13.414  21.113  1.00 73.55  ? 69  GLN I C   1 
ATOM   8219  O O   . GLN E 3 62  ? 28.980  12.404  21.822  1.00 74.13  ? 69  GLN I O   1 
ATOM   8220  C CB  . GLN E 3 62  ? 29.395  13.329  18.633  1.00 78.83  ? 69  GLN I CB  1 
ATOM   8221  C CG  . GLN E 3 62  ? 28.706  11.988  18.516  1.00 81.76  ? 69  GLN I CG  1 
ATOM   8222  C CD  . GLN E 3 62  ? 28.313  11.664  17.087  1.00 81.88  ? 69  GLN I CD  1 
ATOM   8223  O OE1 . GLN E 3 62  ? 28.459  10.528  16.634  1.00 86.02  ? 69  GLN I OE1 1 
ATOM   8224  N NE2 . GLN E 3 62  ? 27.811  12.664  16.369  1.00 78.81  ? 69  GLN I NE2 1 
ATOM   8225  N N   . ASN E 3 63  ? 28.080  14.404  21.260  1.00 76.16  ? 70  ASN I N   1 
ATOM   8226  C CA  . ASN E 3 63  ? 27.156  14.494  22.395  1.00 78.29  ? 70  ASN I CA  1 
ATOM   8227  C C   . ASN E 3 63  ? 27.907  14.592  23.721  1.00 80.64  ? 70  ASN I C   1 
ATOM   8228  O O   . ASN E 3 63  ? 27.428  14.121  24.755  1.00 85.24  ? 70  ASN I O   1 
ATOM   8229  C CB  . ASN E 3 63  ? 26.173  13.316  22.432  1.00 78.38  ? 70  ASN I CB  1 
ATOM   8230  C CG  . ASN E 3 63  ? 25.367  13.174  21.152  1.00 77.93  ? 70  ASN I CG  1 
ATOM   8231  O OD1 . ASN E 3 63  ? 25.113  14.152  20.449  1.00 72.27  ? 70  ASN I OD1 1 
ATOM   8232  N ND2 . ASN E 3 63  ? 24.953  11.947  20.850  1.00 77.71  ? 70  ASN I ND2 1 
ATOM   8233  N N   . ALA E 3 64  ? 29.090  15.206  23.702  1.00 79.18  ? 71  ALA I N   1 
ATOM   8234  C CA  . ALA E 3 64  ? 29.974  15.235  24.860  1.00 74.25  ? 71  ALA I CA  1 
ATOM   8235  C C   . ALA E 3 64  ? 30.126  16.626  25.453  1.00 73.47  ? 71  ALA I C   1 
ATOM   8236  O O   . ALA E 3 64  ? 30.991  16.828  26.312  1.00 74.09  ? 71  ALA I O   1 
ATOM   8237  C CB  . ALA E 3 64  ? 31.349  14.683  24.483  1.00 75.08  ? 71  ALA I CB  1 
ATOM   8238  N N   . SER E 3 65  ? 29.306  17.585  25.019  1.00 73.76  ? 72  SER I N   1 
ATOM   8239  C CA  . SER E 3 65  ? 29.499  18.972  25.432  1.00 76.70  ? 72  SER I CA  1 
ATOM   8240  C C   . SER E 3 65  ? 29.450  19.117  26.949  1.00 76.30  ? 72  SER I C   1 
ATOM   8241  O O   . SER E 3 65  ? 30.278  19.823  27.538  1.00 74.21  ? 72  SER I O   1 
ATOM   8242  C CB  . SER E 3 65  ? 28.449  19.862  24.769  1.00 80.10  ? 72  SER I CB  1 
ATOM   8243  O OG  . SER E 3 65  ? 27.198  19.199  24.695  1.00 83.36  ? 72  SER I OG  1 
ATOM   8244  N N   . ALA E 3 66  ? 28.499  18.446  27.600  1.00 71.29  ? 73  ALA I N   1 
ATOM   8245  C CA  . ALA E 3 66  ? 28.364  18.572  29.048  1.00 70.50  ? 73  ALA I CA  1 
ATOM   8246  C C   . ALA E 3 66  ? 29.578  18.000  29.766  1.00 67.62  ? 73  ALA I C   1 
ATOM   8247  O O   . ALA E 3 66  ? 30.140  18.635  30.668  1.00 66.06  ? 73  ALA I O   1 
ATOM   8248  C CB  . ALA E 3 66  ? 27.088  17.877  29.516  1.00 73.09  ? 73  ALA I CB  1 
ATOM   8249  N N   . ILE E 3 67  ? 29.987  16.788  29.385  1.00 69.59  ? 74  ILE I N   1 
ATOM   8250  C CA  . ILE E 3 67  ? 31.148  16.161  30.008  1.00 67.69  ? 74  ILE I CA  1 
ATOM   8251  C C   . ILE E 3 67  ? 32.391  17.011  29.783  1.00 68.55  ? 74  ILE I C   1 
ATOM   8252  O O   . ILE E 3 67  ? 33.208  17.197  30.693  1.00 69.45  ? 74  ILE I O   1 
ATOM   8253  C CB  . ILE E 3 67  ? 31.335  14.725  29.477  1.00 68.84  ? 74  ILE I CB  1 
ATOM   8254  C CG1 . ILE E 3 67  ? 30.109  13.859  29.785  1.00 71.17  ? 74  ILE I CG1 1 
ATOM   8255  C CG2 . ILE E 3 67  ? 32.588  14.090  30.056  1.00 68.51  ? 74  ILE I CG2 1 
ATOM   8256  C CD1 . ILE E 3 67  ? 29.101  13.788  28.658  1.00 74.00  ? 74  ILE I CD1 1 
ATOM   8257  N N   . GLU E 3 68  ? 32.546  17.553  28.574  1.00 73.11  ? 75  GLU I N   1 
ATOM   8258  C CA  . GLU E 3 68  ? 33.706  18.387  28.274  1.00 76.22  ? 75  GLU I CA  1 
ATOM   8259  C C   . GLU E 3 68  ? 33.717  19.638  29.145  1.00 75.18  ? 75  GLU I C   1 
ATOM   8260  O O   . GLU E 3 68  ? 34.741  19.980  29.753  1.00 75.18  ? 75  GLU I O   1 
ATOM   8261  C CB  . GLU E 3 68  ? 33.702  18.756  26.790  1.00 78.08  ? 75  GLU I CB  1 
ATOM   8262  C CG  . GLU E 3 68  ? 34.907  19.550  26.328  1.00 80.33  ? 75  GLU I CG  1 
ATOM   8263  C CD  . GLU E 3 68  ? 34.807  19.950  24.868  1.00 80.40  ? 75  GLU I CD  1 
ATOM   8264  O OE1 . GLU E 3 68  ? 35.760  19.680  24.103  1.00 77.56  ? 75  GLU I OE1 1 
ATOM   8265  O OE2 . GLU E 3 68  ? 33.772  20.538  24.487  1.00 81.96  ? 75  GLU I OE2 1 
ATOM   8266  N N   . SER E 3 69  ? 32.576  20.326  29.222  1.00 71.46  ? 76  SER I N   1 
ATOM   8267  C CA  . SER E 3 69  ? 32.489  21.543  30.020  1.00 70.92  ? 76  SER I CA  1 
ATOM   8268  C C   . SER E 3 69  ? 32.779  21.263  31.490  1.00 71.37  ? 76  SER I C   1 
ATOM   8269  O O   . SER E 3 69  ? 33.440  22.064  32.161  1.00 73.18  ? 76  SER I O   1 
ATOM   8270  C CB  . SER E 3 69  ? 31.108  22.178  29.849  1.00 71.43  ? 76  SER I CB  1 
ATOM   8271  O OG  . SER E 3 69  ? 31.050  23.464  30.442  1.00 72.43  ? 76  SER I OG  1 
ATOM   8272  N N   . ILE E 3 70  ? 32.302  20.129  32.010  1.00 69.58  ? 77  ILE I N   1 
ATOM   8273  C CA  . ILE E 3 70  ? 32.561  19.805  33.412  1.00 69.89  ? 77  ILE I CA  1 
ATOM   8274  C C   . ILE E 3 70  ? 34.037  19.494  33.626  1.00 70.61  ? 77  ILE I C   1 
ATOM   8275  O O   . ILE E 3 70  ? 34.662  20.002  34.564  1.00 73.95  ? 77  ILE I O   1 
ATOM   8276  C CB  . ILE E 3 70  ? 31.668  18.642  33.880  1.00 70.27  ? 77  ILE I CB  1 
ATOM   8277  C CG1 . ILE E 3 70  ? 30.198  19.050  33.842  1.00 67.80  ? 77  ILE I CG1 1 
ATOM   8278  C CG2 . ILE E 3 70  ? 32.064  18.192  35.280  1.00 71.84  ? 77  ILE I CG2 1 
ATOM   8279  C CD1 . ILE E 3 70  ? 29.253  17.957  34.260  1.00 67.96  ? 77  ILE I CD1 1 
ATOM   8280  N N   . LEU E 3 71  ? 34.613  18.654  32.762  1.00 69.20  ? 78  LEU I N   1 
ATOM   8281  C CA  . LEU E 3 71  ? 36.016  18.281  32.907  1.00 70.86  ? 78  LEU I CA  1 
ATOM   8282  C C   . LEU E 3 71  ? 36.936  19.487  32.776  1.00 74.83  ? 78  LEU I C   1 
ATOM   8283  O O   . LEU E 3 71  ? 38.055  19.469  33.299  1.00 80.43  ? 78  LEU I O   1 
ATOM   8284  C CB  . LEU E 3 71  ? 36.383  17.218  31.872  1.00 70.56  ? 78  LEU I CB  1 
ATOM   8285  C CG  . LEU E 3 71  ? 35.791  15.822  32.082  1.00 71.58  ? 78  LEU I CG  1 
ATOM   8286  C CD1 . LEU E 3 71  ? 36.169  14.884  30.944  1.00 72.18  ? 78  LEU I CD1 1 
ATOM   8287  C CD2 . LEU E 3 71  ? 36.245  15.258  33.408  1.00 74.39  ? 78  LEU I CD2 1 
ATOM   8288  N N   . LYS E 3 72  ? 36.493  20.537  32.076  1.00 76.28  ? 79  LYS I N   1 
ATOM   8289  C CA  . LYS E 3 72  ? 37.298  21.753  32.005  1.00 77.67  ? 79  LYS I CA  1 
ATOM   8290  C C   . LYS E 3 72  ? 37.469  22.381  33.383  1.00 77.55  ? 79  LYS I C   1 
ATOM   8291  O O   . LYS E 3 72  ? 38.576  22.780  33.763  1.00 84.70  ? 79  LYS I O   1 
ATOM   8292  C CB  . LYS E 3 72  ? 36.673  22.754  31.032  1.00 76.62  ? 79  LYS I CB  1 
ATOM   8293  C CG  . LYS E 3 72  ? 36.745  22.326  29.579  1.00 80.06  ? 79  LYS I CG  1 
ATOM   8294  C CD  . LYS E 3 72  ? 38.152  22.478  29.018  1.00 83.03  ? 79  LYS I CD  1 
ATOM   8295  C CE  . LYS E 3 72  ? 38.173  23.420  27.825  1.00 84.65  ? 79  LYS I CE  1 
ATOM   8296  N NZ  . LYS E 3 72  ? 37.373  22.881  26.687  1.00 82.31  ? 79  LYS I NZ  1 
ATOM   8297  N N   . ASN E 3 73  ? 36.386  22.467  34.152  1.00 76.52  ? 80  ASN I N   1 
ATOM   8298  C CA  . ASN E 3 73  ? 36.407  23.109  35.461  1.00 78.12  ? 80  ASN I CA  1 
ATOM   8299  C C   . ASN E 3 73  ? 36.667  22.143  36.608  1.00 80.30  ? 80  ASN I C   1 
ATOM   8300  O O   . ASN E 3 73  ? 36.710  22.578  37.761  1.00 82.26  ? 80  ASN I O   1 
ATOM   8301  C CB  . ASN E 3 73  ? 35.085  23.838  35.706  1.00 77.76  ? 80  ASN I CB  1 
ATOM   8302  C CG  . ASN E 3 73  ? 34.894  25.010  34.777  1.00 79.12  ? 80  ASN I CG  1 
ATOM   8303  O OD1 . ASN E 3 73  ? 35.096  26.162  35.165  1.00 82.83  ? 80  ASN I OD1 1 
ATOM   8304  N ND2 . ASN E 3 73  ? 34.525  24.727  33.534  1.00 81.08  ? 80  ASN I ND2 1 
ATOM   8305  N N   . LEU E 3 74  ? 36.821  20.849  36.327  1.00 79.40  ? 81  LEU I N   1 
ATOM   8306  C CA  . LEU E 3 74  ? 37.038  19.870  37.389  1.00 80.54  ? 81  LEU I CA  1 
ATOM   8307  C C   . LEU E 3 74  ? 38.411  19.977  38.053  1.00 85.17  ? 81  LEU I C   1 
ATOM   8308  O O   . LEU E 3 74  ? 38.720  19.144  38.912  1.00 90.90  ? 81  LEU I O   1 
ATOM   8309  C CB  . LEU E 3 74  ? 36.849  18.456  36.831  1.00 79.85  ? 81  LEU I CB  1 
ATOM   8310  C CG  . LEU E 3 74  ? 36.508  17.336  37.817  1.00 82.14  ? 81  LEU I CG  1 
ATOM   8311  C CD1 . LEU E 3 74  ? 35.140  17.581  38.425  1.00 84.21  ? 81  LEU I CD1 1 
ATOM   8312  C CD2 . LEU E 3 74  ? 36.578  15.970  37.151  1.00 79.55  ? 81  LEU I CD2 1 
ATOM   8313  N N   . LEU E 3 75  ? 39.237  20.965  37.702  1.00 93.03  ? 82  LEU I N   1 
ATOM   8314  C CA  . LEU E 3 75  ? 40.593  21.022  38.248  1.00 94.45  ? 82  LEU I CA  1 
ATOM   8315  C C   . LEU E 3 75  ? 40.637  21.221  39.761  1.00 91.66  ? 82  LEU I C   1 
ATOM   8316  O O   . LEU E 3 75  ? 41.374  20.478  40.432  1.00 85.78  ? 82  LEU I O   1 
ATOM   8317  C CB  . LEU E 3 75  ? 41.400  22.106  37.523  1.00 96.22  ? 82  LEU I CB  1 
ATOM   8318  C CG  . LEU E 3 75  ? 42.843  22.270  38.005  1.00 93.81  ? 82  LEU I CG  1 
ATOM   8319  C CD1 . LEU E 3 75  ? 43.609  20.963  37.858  1.00 91.31  ? 82  LEU I CD1 1 
ATOM   8320  C CD2 . LEU E 3 75  ? 43.540  23.395  37.256  1.00 94.07  ? 82  LEU I CD2 1 
ATOM   8321  N N   . PRO E 3 76  ? 39.917  22.179  40.362  1.00 88.04  ? 83  PRO I N   1 
ATOM   8322  C CA  . PRO E 3 76  ? 40.002  22.334  41.826  1.00 86.68  ? 83  PRO I CA  1 
ATOM   8323  C C   . PRO E 3 76  ? 39.512  21.125  42.605  1.00 85.16  ? 83  PRO I C   1 
ATOM   8324  O O   . PRO E 3 76  ? 39.824  21.008  43.796  1.00 90.42  ? 83  PRO I O   1 
ATOM   8325  C CB  . PRO E 3 76  ? 39.126  23.565  42.105  1.00 84.71  ? 83  PRO I CB  1 
ATOM   8326  C CG  . PRO E 3 76  ? 39.071  24.294  40.815  1.00 85.39  ? 83  PRO I CG  1 
ATOM   8327  C CD  . PRO E 3 76  ? 39.080  23.235  39.763  1.00 84.42  ? 83  PRO I CD  1 
ATOM   8328  N N   . CYS E 3 77  ? 38.764  20.222  41.977  1.00 89.02  ? 84  CYS I N   1 
ATOM   8329  C CA  . CYS E 3 77  ? 38.188  19.075  42.664  1.00 89.94  ? 84  CYS I CA  1 
ATOM   8330  C C   . CYS E 3 77  ? 39.178  17.938  42.866  1.00 89.15  ? 84  CYS I C   1 
ATOM   8331  O O   . CYS E 3 77  ? 38.810  16.916  43.455  1.00 94.38  ? 84  CYS I O   1 
ATOM   8332  C CB  . CYS E 3 77  ? 36.975  18.569  41.884  1.00 91.81  ? 84  CYS I CB  1 
ATOM   8333  S SG  . CYS E 3 77  ? 35.715  19.834  41.650  1.00 95.44  ? 84  CYS I SG  1 
ATOM   8334  N N   . LEU E 3 78  ? 40.411  18.087  42.399  1.00 89.14  ? 85  LEU I N   1 
ATOM   8335  C CA  . LEU E 3 78  ? 41.411  17.037  42.535  1.00 93.76  ? 85  LEU I CA  1 
ATOM   8336  C C   . LEU E 3 78  ? 42.256  17.258  43.786  1.00 94.96  ? 85  LEU I C   1 
ATOM   8337  O O   . LEU E 3 78  ? 42.543  18.403  44.148  1.00 99.86  ? 85  LEU I O   1 
ATOM   8338  C CB  . LEU E 3 78  ? 42.323  16.999  41.311  1.00 96.46  ? 85  LEU I CB  1 
ATOM   8339  C CG  . LEU E 3 78  ? 41.909  16.164  40.098  1.00 95.87  ? 85  LEU I CG  1 
ATOM   8340  C CD1 . LEU E 3 78  ? 40.540  16.562  39.573  1.00 97.61  ? 85  LEU I CD1 1 
ATOM   8341  C CD2 . LEU E 3 78  ? 42.954  16.308  39.007  1.00 95.93  ? 85  LEU I CD2 1 
ATOM   8342  N N   . PRO E 3 79  ? 42.659  16.185  44.459  1.00 100.50 ? 86  PRO I N   1 
ATOM   8343  C CA  . PRO E 3 79  ? 43.610  16.332  45.564  1.00 105.77 ? 86  PRO I CA  1 
ATOM   8344  C C   . PRO E 3 79  ? 44.991  16.700  45.045  1.00 108.78 ? 86  PRO I C   1 
ATOM   8345  O O   . PRO E 3 79  ? 45.381  16.332  43.934  1.00 111.23 ? 86  PRO I O   1 
ATOM   8346  C CB  . PRO E 3 79  ? 43.610  14.947  46.221  1.00 107.97 ? 86  PRO I CB  1 
ATOM   8347  C CG  . PRO E 3 79  ? 43.204  14.019  45.130  1.00 102.72 ? 86  PRO I CG  1 
ATOM   8348  C CD  . PRO E 3 79  ? 42.244  14.785  44.264  1.00 100.86 ? 86  PRO I CD  1 
ATOM   8349  N N   . LEU E 3 80  ? 45.731  17.438  45.867  1.00 115.68 ? 87  LEU I N   1 
ATOM   8350  C CA  . LEU E 3 80  ? 47.054  17.892  45.468  1.00 114.93 ? 87  LEU I CA  1 
ATOM   8351  C C   . LEU E 3 80  ? 48.037  16.730  45.436  1.00 115.07 ? 87  LEU I C   1 
ATOM   8352  O O   . LEU E 3 80  ? 48.070  15.894  46.345  1.00 111.71 ? 87  LEU I O   1 
ATOM   8353  C CB  . LEU E 3 80  ? 47.560  18.977  46.420  1.00 114.52 ? 87  LEU I CB  1 
ATOM   8354  C CG  . LEU E 3 80  ? 47.040  20.399  46.189  1.00 117.56 ? 87  LEU I CG  1 
ATOM   8355  C CD1 . LEU E 3 80  ? 47.124  20.779  44.706  1.00 114.99 ? 87  LEU I CD1 1 
ATOM   8356  C CD2 . LEU E 3 80  ? 45.622  20.576  46.716  1.00 118.35 ? 87  LEU I CD2 1 
ATOM   8357  N N   . ALA E 3 81  ? 48.837  16.678  44.375  1.00 120.60 ? 88  ALA I N   1 
ATOM   8358  C CA  . ALA E 3 81  ? 49.833  15.627  44.222  1.00 119.05 ? 88  ALA I CA  1 
ATOM   8359  C C   . ALA E 3 81  ? 51.056  15.928  45.077  1.00 118.93 ? 88  ALA I C   1 
ATOM   8360  O O   . ALA E 3 81  ? 51.492  17.078  45.184  1.00 115.65 ? 88  ALA I O   1 
ATOM   8361  C CB  . ALA E 3 81  ? 50.240  15.483  42.756  1.00 118.82 ? 88  ALA I CB  1 
ATOM   8362  N N   . THR E 3 82  ? 51.608  14.883  45.693  1.00 120.72 ? 89  THR I N   1 
ATOM   8363  C CA  . THR E 3 82  ? 52.779  15.053  46.553  1.00 122.43 ? 89  THR I CA  1 
ATOM   8364  C C   . THR E 3 82  ? 54.037  15.287  45.720  1.00 124.69 ? 89  THR I C   1 
ATOM   8365  O O   . THR E 3 82  ? 54.613  16.380  45.735  1.00 117.01 ? 89  THR I O   1 
ATOM   8366  C CB  . THR E 3 82  ? 52.942  13.834  47.470  1.00 117.28 ? 89  THR I CB  1 
ATOM   8367  O OG1 . THR E 3 82  ? 52.732  12.631  46.720  1.00 116.50 ? 89  THR I OG1 1 
ATOM   8368  C CG2 . THR E 3 82  ? 51.945  13.894  48.617  1.00 112.89 ? 89  THR I CG2 1 
ATOM   8369  N N   . ALA E 3 83  ? 54.472  14.270  44.984  1.00 125.85 ? 90  ALA I N   1 
ATOM   8370  C CA  . ALA E 3 83  ? 55.673  14.353  44.171  1.00 121.07 ? 90  ALA I CA  1 
ATOM   8371  C C   . ALA E 3 83  ? 55.306  14.507  42.696  1.00 120.52 ? 90  ALA I C   1 
ATOM   8372  O O   . ALA E 3 83  ? 54.137  14.613  42.320  1.00 120.36 ? 90  ALA I O   1 
ATOM   8373  C CB  . ALA E 3 83  ? 56.554  13.121  44.392  1.00 119.63 ? 90  ALA I CB  1 
ATOM   8374  N N   . ALA E 3 84  ? 56.334  14.527  41.852  1.00 123.52 ? 91  ALA I N   1 
ATOM   8375  C CA  . ALA E 3 84  ? 56.141  14.578  40.416  1.00 117.31 ? 91  ALA I CA  1 
ATOM   8376  C C   . ALA E 3 84  ? 55.654  13.218  39.911  1.00 116.67 ? 91  ALA I C   1 
ATOM   8377  O O   . ALA E 3 84  ? 55.809  12.204  40.596  1.00 109.52 ? 91  ALA I O   1 
ATOM   8378  C CB  . ALA E 3 84  ? 57.448  14.985  39.736  1.00 113.15 ? 91  ALA I CB  1 
ATOM   8379  N N   . PRO E 3 85  ? 55.055  13.165  38.717  1.00 117.69 ? 92  PRO I N   1 
ATOM   8380  C CA  . PRO E 3 85  ? 54.554  11.878  38.216  1.00 117.59 ? 92  PRO I CA  1 
ATOM   8381  C C   . PRO E 3 85  ? 55.681  10.885  37.974  1.00 114.87 ? 92  PRO I C   1 
ATOM   8382  O O   . PRO E 3 85  ? 56.716  11.214  37.388  1.00 112.01 ? 92  PRO I O   1 
ATOM   8383  C CB  . PRO E 3 85  ? 53.834  12.247  36.912  1.00 120.33 ? 92  PRO I CB  1 
ATOM   8384  C CG  . PRO E 3 85  ? 53.754  13.732  36.884  1.00 120.13 ? 92  PRO I CG  1 
ATOM   8385  C CD  . PRO E 3 85  ? 54.852  14.248  37.741  1.00 120.21 ? 92  PRO I CD  1 
ATOM   8386  N N   . THR E 3 86  ? 55.460  9.653   38.430  1.00 117.56 ? 93  THR I N   1 
ATOM   8387  C CA  . THR E 3 86  ? 56.443  8.583   38.345  1.00 123.30 ? 93  THR I CA  1 
ATOM   8388  C C   . THR E 3 86  ? 56.028  7.490   37.368  1.00 127.61 ? 93  THR I C   1 
ATOM   8389  O O   . THR E 3 86  ? 56.731  6.481   37.247  1.00 132.15 ? 93  THR I O   1 
ATOM   8390  C CB  . THR E 3 86  ? 56.671  7.976   39.737  1.00 123.90 ? 93  THR I CB  1 
ATOM   8391  O OG1 . THR E 3 86  ? 56.575  9.008   40.725  1.00 127.83 ? 93  THR I OG1 1 
ATOM   8392  C CG2 . THR E 3 86  ? 58.057  7.352   39.836  1.00 121.90 ? 93  THR I CG2 1 
ATOM   8393  N N   . ARG E 3 87  ? 54.910  7.664   36.666  1.00 129.26 ? 94  ARG I N   1 
ATOM   8394  C CA  . ARG E 3 87  ? 54.400  6.643   35.766  1.00 128.02 ? 94  ARG I CA  1 
ATOM   8395  C C   . ARG E 3 87  ? 53.692  7.321   34.603  1.00 125.78 ? 94  ARG I C   1 
ATOM   8396  O O   . ARG E 3 87  ? 53.252  8.468   34.704  1.00 117.01 ? 94  ARG I O   1 
ATOM   8397  C CB  . ARG E 3 87  ? 53.449  5.685   36.494  1.00 126.18 ? 94  ARG I CB  1 
ATOM   8398  C CG  . ARG E 3 87  ? 53.323  4.312   35.863  1.00 124.78 ? 94  ARG I CG  1 
ATOM   8399  C CD  . ARG E 3 87  ? 52.175  3.542   36.489  1.00 122.07 ? 94  ARG I CD  1 
ATOM   8400  N NE  . ARG E 3 87  ? 51.945  3.941   37.874  1.00 117.40 ? 94  ARG I NE  1 
ATOM   8401  C CZ  . ARG E 3 87  ? 51.308  3.195   38.770  1.00 116.16 ? 94  ARG I CZ  1 
ATOM   8402  N NH1 . ARG E 3 87  ? 50.845  2.000   38.431  1.00 113.95 ? 94  ARG I NH1 1 
ATOM   8403  N NH2 . ARG E 3 87  ? 51.140  3.641   40.008  1.00 115.22 ? 94  ARG I NH2 1 
ATOM   8404  N N   . HIS E 3 88  ? 53.588  6.598   33.494  1.00 128.70 ? 95  HIS I N   1 
ATOM   8405  C CA  . HIS E 3 88  ? 52.907  7.141   32.325  1.00 128.10 ? 95  HIS I CA  1 
ATOM   8406  C C   . HIS E 3 88  ? 51.397  7.085   32.536  1.00 122.84 ? 95  HIS I C   1 
ATOM   8407  O O   . HIS E 3 88  ? 50.870  6.037   32.925  1.00 116.03 ? 95  HIS I O   1 
ATOM   8408  C CB  . HIS E 3 88  ? 53.304  6.379   31.063  1.00 132.15 ? 95  HIS I CB  1 
ATOM   8409  C CG  . HIS E 3 88  ? 54.585  6.858   30.450  1.00 133.47 ? 95  HIS I CG  1 
ATOM   8410  N ND1 . HIS E 3 88  ? 54.739  8.133   29.946  1.00 131.01 ? 95  HIS I ND1 1 
ATOM   8411  C CD2 . HIS E 3 88  ? 55.775  6.236   30.267  1.00 131.21 ? 95  HIS I CD2 1 
ATOM   8412  C CE1 . HIS E 3 88  ? 55.966  8.274   29.476  1.00 127.87 ? 95  HIS I CE1 1 
ATOM   8413  N NE2 . HIS E 3 88  ? 56.615  7.138   29.659  1.00 129.32 ? 95  HIS I NE2 1 
ATOM   8414  N N   . PRO E 3 89  ? 50.675  8.183   32.294  1.00 113.08 ? 96  PRO I N   1 
ATOM   8415  C CA  . PRO E 3 89  ? 49.254  8.235   32.665  1.00 107.18 ? 96  PRO I CA  1 
ATOM   8416  C C   . PRO E 3 89  ? 48.359  7.372   31.787  1.00 102.70 ? 96  PRO I C   1 
ATOM   8417  O O   . PRO E 3 89  ? 48.843  6.575   30.979  1.00 101.05 ? 96  PRO I O   1 
ATOM   8418  C CB  . PRO E 3 89  ? 48.914  9.722   32.519  1.00 107.37 ? 96  PRO I CB  1 
ATOM   8419  C CG  . PRO E 3 89  ? 49.855  10.211  31.471  1.00 109.52 ? 96  PRO I CG  1 
ATOM   8420  C CD  . PRO E 3 89  ? 51.133  9.437   31.670  1.00 112.98 ? 96  PRO I CD  1 
ATOM   8421  N N   . ILE E 3 90  ? 47.052  7.540   31.944  1.00 96.09  ? 97  ILE I N   1 
ATOM   8422  C CA  . ILE E 3 90  ? 46.068  6.680   31.298  1.00 96.80  ? 97  ILE I CA  1 
ATOM   8423  C C   . ILE E 3 90  ? 45.972  7.023   29.816  1.00 100.50 ? 97  ILE I C   1 
ATOM   8424  O O   . ILE E 3 90  ? 46.089  8.189   29.414  1.00 100.01 ? 97  ILE I O   1 
ATOM   8425  C CB  . ILE E 3 90  ? 44.701  6.804   32.004  1.00 93.77  ? 97  ILE I CB  1 
ATOM   8426  C CG1 . ILE E 3 90  ? 43.729  5.734   31.490  1.00 95.82  ? 97  ILE I CG1 1 
ATOM   8427  C CG2 . ILE E 3 90  ? 44.107  8.196   31.826  1.00 91.30  ? 97  ILE I CG2 1 
ATOM   8428  C CD1 . ILE E 3 90  ? 44.181  4.326   31.766  1.00 97.78  ? 97  ILE I CD1 1 
ATOM   8429  N N   . HIS E 3 91  ? 45.777  5.993   28.996  1.00 99.15  ? 98  HIS I N   1 
ATOM   8430  C CA  . HIS E 3 91  ? 45.576  6.140   27.561  1.00 101.34 ? 98  HIS I CA  1 
ATOM   8431  C C   . HIS E 3 91  ? 44.152  5.732   27.215  1.00 100.73 ? 98  HIS I C   1 
ATOM   8432  O O   . HIS E 3 91  ? 43.672  4.689   27.672  1.00 97.29  ? 98  HIS I O   1 
ATOM   8433  C CB  . HIS E 3 91  ? 46.575  5.290   26.770  1.00 105.81 ? 98  HIS I CB  1 
ATOM   8434  C CG  . HIS E 3 91  ? 46.384  5.362   25.285  1.00 108.77 ? 98  HIS I CG  1 
ATOM   8435  N ND1 . HIS E 3 91  ? 45.650  4.430   24.582  1.00 105.70 ? 98  HIS I ND1 1 
ATOM   8436  C CD2 . HIS E 3 91  ? 46.829  6.257   24.371  1.00 107.15 ? 98  HIS I CD2 1 
ATOM   8437  C CE1 . HIS E 3 91  ? 45.651  4.747   23.300  1.00 99.72  ? 98  HIS I CE1 1 
ATOM   8438  N NE2 . HIS E 3 91  ? 46.359  5.851   23.145  1.00 103.20 ? 98  HIS I NE2 1 
ATOM   8439  N N   . ILE E 3 92  ? 43.480  6.556   26.416  1.00 99.49  ? 99  ILE I N   1 
ATOM   8440  C CA  . ILE E 3 92  ? 42.102  6.320   26.001  1.00 94.08  ? 99  ILE I CA  1 
ATOM   8441  C C   . ILE E 3 92  ? 42.062  6.331   24.480  1.00 91.61  ? 99  ILE I C   1 
ATOM   8442  O O   . ILE E 3 92  ? 42.571  7.265   23.851  1.00 91.78  ? 99  ILE I O   1 
ATOM   8443  C CB  . ILE E 3 92  ? 41.148  7.383   26.575  1.00 92.49  ? 99  ILE I CB  1 
ATOM   8444  C CG1 . ILE E 3 92  ? 41.425  7.600   28.064  1.00 92.01  ? 99  ILE I CG1 1 
ATOM   8445  C CG2 . ILE E 3 92  ? 39.703  6.968   26.353  1.00 91.53  ? 99  ILE I CG2 1 
ATOM   8446  C CD1 . ILE E 3 92  ? 41.089  8.993   28.557  1.00 89.12  ? 99  ILE I CD1 1 
ATOM   8447  N N   . LYS E 3 93  ? 41.465  5.294   23.894  1.00 91.75  ? 100 LYS I N   1 
ATOM   8448  C CA  . LYS E 3 93  ? 41.301  5.254   22.447  1.00 92.84  ? 100 LYS I CA  1 
ATOM   8449  C C   . LYS E 3 93  ? 40.465  6.439   21.978  1.00 92.53  ? 100 LYS I C   1 
ATOM   8450  O O   . LYS E 3 93  ? 39.573  6.916   22.685  1.00 98.00  ? 100 LYS I O   1 
ATOM   8451  C CB  . LYS E 3 93  ? 40.656  3.937   22.014  1.00 94.28  ? 100 LYS I CB  1 
ATOM   8452  C CG  . LYS E 3 93  ? 41.660  2.813   21.808  1.00 98.98  ? 100 LYS I CG  1 
ATOM   8453  C CD  . LYS E 3 93  ? 41.224  1.523   22.489  1.00 104.47 ? 100 LYS I CD  1 
ATOM   8454  C CE  . LYS E 3 93  ? 39.913  1.005   21.919  1.00 108.19 ? 100 LYS I CE  1 
ATOM   8455  N NZ  . LYS E 3 93  ? 40.032  0.645   20.478  1.00 109.59 ? 100 LYS I NZ  1 
ATOM   8456  N N   . ASP E 3 94  ? 40.763  6.911   20.765  1.00 89.20  ? 101 ASP I N   1 
ATOM   8457  C CA  . ASP E 3 94  ? 40.261  8.207   20.319  1.00 91.62  ? 101 ASP I CA  1 
ATOM   8458  C C   . ASP E 3 94  ? 38.736  8.233   20.271  1.00 92.28  ? 101 ASP I C   1 
ATOM   8459  O O   . ASP E 3 94  ? 38.093  9.050   20.941  1.00 94.66  ? 101 ASP I O   1 
ATOM   8460  C CB  . ASP E 3 94  ? 40.858  8.551   18.953  1.00 93.76  ? 101 ASP I CB  1 
ATOM   8461  C CG  . ASP E 3 94  ? 41.053  10.044  18.761  1.00 98.71  ? 101 ASP I CG  1 
ATOM   8462  O OD1 . ASP E 3 94  ? 41.517  10.712  19.711  1.00 99.01  ? 101 ASP I OD1 1 
ATOM   8463  O OD2 . ASP E 3 94  ? 40.751  10.549  17.658  1.00 100.70 ? 101 ASP I OD2 1 
ATOM   8464  N N   . GLY E 3 95  ? 38.137  7.342   19.489  1.00 90.79  ? 102 GLY I N   1 
ATOM   8465  C CA  . GLY E 3 95  ? 36.701  7.365   19.316  1.00 91.25  ? 102 GLY I CA  1 
ATOM   8466  C C   . GLY E 3 95  ? 35.898  6.494   20.255  1.00 88.24  ? 102 GLY I C   1 
ATOM   8467  O O   . GLY E 3 95  ? 34.666  6.484   20.168  1.00 86.29  ? 102 GLY I O   1 
ATOM   8468  N N   . ASP E 3 96  ? 36.549  5.769   21.160  1.00 89.23  ? 103 ASP I N   1 
ATOM   8469  C CA  . ASP E 3 96  ? 35.847  4.805   21.998  1.00 85.57  ? 103 ASP I CA  1 
ATOM   8470  C C   . ASP E 3 96  ? 35.043  5.522   23.076  1.00 83.98  ? 103 ASP I C   1 
ATOM   8471  O O   . ASP E 3 96  ? 35.608  6.231   23.916  1.00 81.81  ? 103 ASP I O   1 
ATOM   8472  C CB  . ASP E 3 96  ? 36.841  3.833   22.627  1.00 83.32  ? 103 ASP I CB  1 
ATOM   8473  C CG  . ASP E 3 96  ? 36.187  2.542   23.077  1.00 83.87  ? 103 ASP I CG  1 
ATOM   8474  O OD1 . ASP E 3 96  ? 35.066  2.602   23.623  1.00 83.89  ? 103 ASP I OD1 1 
ATOM   8475  O OD2 . ASP E 3 96  ? 36.793  1.465   22.887  1.00 87.37  ? 103 ASP I OD2 1 
ATOM   8476  N N   . TRP E 3 97  ? 33.721  5.331   23.056  1.00 77.04  ? 104 TRP I N   1 
ATOM   8477  C CA  . TRP E 3 97  ? 32.867  5.894   24.097  1.00 77.50  ? 104 TRP I CA  1 
ATOM   8478  C C   . TRP E 3 97  ? 32.879  5.037   25.355  1.00 79.18  ? 104 TRP I C   1 
ATOM   8479  O O   . TRP E 3 97  ? 33.020  5.559   26.465  1.00 79.46  ? 104 TRP I O   1 
ATOM   8480  C CB  . TRP E 3 97  ? 31.434  6.057   23.586  1.00 76.97  ? 104 TRP I CB  1 
ATOM   8481  C CG  . TRP E 3 97  ? 30.436  6.283   24.693  1.00 77.36  ? 104 TRP I CG  1 
ATOM   8482  C CD1 . TRP E 3 97  ? 29.442  5.433   25.084  1.00 78.44  ? 104 TRP I CD1 1 
ATOM   8483  C CD2 . TRP E 3 97  ? 30.343  7.426   25.556  1.00 74.58  ? 104 TRP I CD2 1 
ATOM   8484  N NE1 . TRP E 3 97  ? 28.736  5.974   26.131  1.00 78.87  ? 104 TRP I NE1 1 
ATOM   8485  C CE2 . TRP E 3 97  ? 29.269  7.197   26.440  1.00 76.08  ? 104 TRP I CE2 1 
ATOM   8486  C CE3 . TRP E 3 97  ? 31.061  8.621   25.665  1.00 73.09  ? 104 TRP I CE3 1 
ATOM   8487  C CZ2 . TRP E 3 97  ? 28.897  8.115   27.417  1.00 77.16  ? 104 TRP I CZ2 1 
ATOM   8488  C CZ3 . TRP E 3 97  ? 30.690  9.531   26.638  1.00 76.15  ? 104 TRP I CZ3 1 
ATOM   8489  C CH2 . TRP E 3 97  ? 29.618  9.273   27.501  1.00 77.26  ? 104 TRP I CH2 1 
ATOM   8490  N N   . ASN E 3 98  ? 32.715  3.719   25.204  1.00 79.36  ? 105 ASN I N   1 
ATOM   8491  C CA  . ASN E 3 98  ? 32.607  2.848   26.372  1.00 79.15  ? 105 ASN I CA  1 
ATOM   8492  C C   . ASN E 3 98  ? 33.875  2.883   27.215  1.00 81.61  ? 105 ASN I C   1 
ATOM   8493  O O   . ASN E 3 98  ? 33.807  2.870   28.447  1.00 87.75  ? 105 ASN I O   1 
ATOM   8494  C CB  . ASN E 3 98  ? 32.290  1.418   25.937  1.00 77.17  ? 105 ASN I CB  1 
ATOM   8495  C CG  . ASN E 3 98  ? 30.902  1.284   25.347  1.00 78.57  ? 105 ASN I CG  1 
ATOM   8496  O OD1 . ASN E 3 98  ? 29.901  1.436   26.048  1.00 79.19  ? 105 ASN I OD1 1 
ATOM   8497  N ND2 . ASN E 3 98  ? 30.833  1.002   24.051  1.00 84.07  ? 105 ASN I ND2 1 
ATOM   8498  N N   . GLU E 3 99  ? 35.041  2.950   26.571  1.00 83.42  ? 106 GLU I N   1 
ATOM   8499  C CA  . GLU E 3 99  ? 36.299  2.945   27.312  1.00 82.54  ? 106 GLU I CA  1 
ATOM   8500  C C   . GLU E 3 99  ? 36.479  4.236   28.106  1.00 77.40  ? 106 GLU I C   1 
ATOM   8501  O O   . GLU E 3 99  ? 36.778  4.204   29.308  1.00 79.65  ? 106 GLU I O   1 
ATOM   8502  C CB  . GLU E 3 99  ? 37.463  2.738   26.344  1.00 88.17  ? 106 GLU I CB  1 
ATOM   8503  C CG  . GLU E 3 99  ? 38.794  2.459   27.007  1.00 90.95  ? 106 GLU I CG  1 
ATOM   8504  C CD  . GLU E 3 99  ? 39.857  2.057   26.005  1.00 89.92  ? 106 GLU I CD  1 
ATOM   8505  O OE1 . GLU E 3 99  ? 40.797  2.850   25.788  1.00 89.89  ? 106 GLU I OE1 1 
ATOM   8506  O OE2 . GLU E 3 99  ? 39.745  0.954   25.427  1.00 85.77  ? 106 GLU I OE2 1 
ATOM   8507  N N   . PHE E 3 100 ? 36.334  5.382   27.436  1.00 74.76  ? 107 PHE I N   1 
ATOM   8508  C CA  . PHE E 3 100 ? 36.382  6.671   28.118  1.00 75.34  ? 107 PHE I CA  1 
ATOM   8509  C C   . PHE E 3 100 ? 35.385  6.709   29.266  1.00 75.96  ? 107 PHE I C   1 
ATOM   8510  O O   . PHE E 3 100 ? 35.709  7.135   30.380  1.00 79.86  ? 107 PHE I O   1 
ATOM   8511  C CB  . PHE E 3 100 ? 36.103  7.789   27.107  1.00 74.92  ? 107 PHE I CB  1 
ATOM   8512  C CG  . PHE E 3 100 ? 35.781  9.123   27.727  1.00 72.07  ? 107 PHE I CG  1 
ATOM   8513  C CD1 . PHE E 3 100 ? 34.476  9.459   28.050  1.00 71.59  ? 107 PHE I CD1 1 
ATOM   8514  C CD2 . PHE E 3 100 ? 36.781  10.049  27.965  1.00 72.43  ? 107 PHE I CD2 1 
ATOM   8515  C CE1 . PHE E 3 100 ? 34.178  10.680  28.611  1.00 73.28  ? 107 PHE I CE1 1 
ATOM   8516  C CE2 . PHE E 3 100 ? 36.487  11.276  28.524  1.00 72.65  ? 107 PHE I CE2 1 
ATOM   8517  C CZ  . PHE E 3 100 ? 35.184  11.591  28.847  1.00 74.37  ? 107 PHE I CZ  1 
ATOM   8518  N N   . ARG E 3 101 ? 34.162  6.255   29.001  1.00 78.07  ? 108 ARG I N   1 
ATOM   8519  C CA  . ARG E 3 101 ? 33.104  6.243   30.003  1.00 78.85  ? 108 ARG I CA  1 
ATOM   8520  C C   . ARG E 3 101 ? 33.498  5.419   31.222  1.00 76.32  ? 108 ARG I C   1 
ATOM   8521  O O   . ARG E 3 101 ? 33.403  5.890   32.361  1.00 75.37  ? 108 ARG I O   1 
ATOM   8522  C CB  . ARG E 3 101 ? 31.832  5.706   29.352  1.00 80.45  ? 108 ARG I CB  1 
ATOM   8523  C CG  . ARG E 3 101 ? 30.676  5.451   30.269  1.00 81.74  ? 108 ARG I CG  1 
ATOM   8524  C CD  . ARG E 3 101 ? 29.883  4.302   29.701  1.00 84.02  ? 108 ARG I CD  1 
ATOM   8525  N NE  . ARG E 3 101 ? 28.463  4.596   29.608  1.00 85.85  ? 108 ARG I NE  1 
ATOM   8526  C CZ  . ARG E 3 101 ? 27.619  3.948   28.814  1.00 86.66  ? 108 ARG I CZ  1 
ATOM   8527  N NH1 . ARG E 3 101 ? 28.061  2.983   28.016  1.00 81.00  ? 108 ARG I NH1 1 
ATOM   8528  N NH2 . ARG E 3 101 ? 26.335  4.277   28.807  1.00 87.83  ? 108 ARG I NH2 1 
ATOM   8529  N N   . ARG E 3 102 ? 33.954  4.185   30.997  1.00 78.52  ? 109 ARG I N   1 
ATOM   8530  C CA  . ARG E 3 102 ? 34.331  3.296   32.092  1.00 80.20  ? 109 ARG I CA  1 
ATOM   8531  C C   . ARG E 3 102 ? 35.463  3.889   32.923  1.00 79.01  ? 109 ARG I C   1 
ATOM   8532  O O   . ARG E 3 102 ? 35.385  3.948   34.160  1.00 79.21  ? 109 ARG I O   1 
ATOM   8533  C CB  . ARG E 3 102 ? 34.734  1.939   31.513  1.00 81.53  ? 109 ARG I CB  1 
ATOM   8534  C CG  . ARG E 3 102 ? 34.970  0.851   32.528  1.00 83.33  ? 109 ARG I CG  1 
ATOM   8535  C CD  . ARG E 3 102 ? 35.421  -0.436  31.845  1.00 87.39  ? 109 ARG I CD  1 
ATOM   8536  N NE  . ARG E 3 102 ? 34.468  -0.907  30.841  1.00 87.34  ? 109 ARG I NE  1 
ATOM   8537  C CZ  . ARG E 3 102 ? 34.754  -1.073  29.554  1.00 86.04  ? 109 ARG I CZ  1 
ATOM   8538  N NH1 . ARG E 3 102 ? 35.974  -0.810  29.101  1.00 84.66  ? 109 ARG I NH1 1 
ATOM   8539  N NH2 . ARG E 3 102 ? 33.821  -1.508  28.718  1.00 84.08  ? 109 ARG I NH2 1 
ATOM   8540  N N   . LYS E 3 103 ? 36.526  4.344   32.254  1.00 71.78  ? 110 LYS I N   1 
ATOM   8541  C CA  . LYS E 3 103 ? 37.680  4.863   32.979  1.00 74.77  ? 110 LYS I CA  1 
ATOM   8542  C C   . LYS E 3 103 ? 37.336  6.132   33.751  1.00 73.23  ? 110 LYS I C   1 
ATOM   8543  O O   . LYS E 3 103 ? 37.759  6.291   34.901  1.00 83.82  ? 110 LYS I O   1 
ATOM   8544  C CB  . LYS E 3 103 ? 38.841  5.105   32.015  1.00 79.61  ? 110 LYS I CB  1 
ATOM   8545  C CG  . LYS E 3 103 ? 39.486  3.820   31.525  1.00 83.55  ? 110 LYS I CG  1 
ATOM   8546  C CD  . LYS E 3 103 ? 40.475  4.070   30.400  1.00 85.44  ? 110 LYS I CD  1 
ATOM   8547  C CE  . LYS E 3 103 ? 40.990  2.758   29.829  1.00 86.49  ? 110 LYS I CE  1 
ATOM   8548  N NZ  . LYS E 3 103 ? 41.935  2.970   28.700  1.00 87.46  ? 110 LYS I NZ  1 
ATOM   8549  N N   . LEU E 3 104 ? 36.557  7.038   33.154  1.00 72.62  ? 111 LEU I N   1 
ATOM   8550  C CA  . LEU E 3 104 ? 36.207  8.266   33.859  1.00 72.63  ? 111 LEU I CA  1 
ATOM   8551  C C   . LEU E 3 104 ? 35.266  7.986   35.025  1.00 72.82  ? 111 LEU I C   1 
ATOM   8552  O O   . LEU E 3 104 ? 35.381  8.614   36.085  1.00 73.15  ? 111 LEU I O   1 
ATOM   8553  C CB  . LEU E 3 104 ? 35.582  9.272   32.895  1.00 72.11  ? 111 LEU I CB  1 
ATOM   8554  C CG  . LEU E 3 104 ? 35.396  10.668  33.487  1.00 72.12  ? 111 LEU I CG  1 
ATOM   8555  C CD1 . LEU E 3 104 ? 36.730  11.199  33.976  1.00 72.54  ? 111 LEU I CD1 1 
ATOM   8556  C CD2 . LEU E 3 104 ? 34.774  11.612  32.475  1.00 71.61  ? 111 LEU I CD2 1 
ATOM   8557  N N   . THR E 3 105 ? 34.333  7.045   34.852  1.00 72.13  ? 112 THR I N   1 
ATOM   8558  C CA  . THR E 3 105 ? 33.450  6.670   35.950  1.00 73.99  ? 112 THR I CA  1 
ATOM   8559  C C   . THR E 3 105 ? 34.252  6.136   37.128  1.00 74.51  ? 112 THR I C   1 
ATOM   8560  O O   . THR E 3 105 ? 34.031  6.534   38.279  1.00 73.92  ? 112 THR I O   1 
ATOM   8561  C CB  . THR E 3 105 ? 32.430  5.632   35.476  1.00 75.11  ? 112 THR I CB  1 
ATOM   8562  O OG1 . THR E 3 105 ? 31.612  6.193   34.441  1.00 75.39  ? 112 THR I OG1 1 
ATOM   8563  C CG2 . THR E 3 105 ? 31.543  5.190   36.625  1.00 75.67  ? 112 THR I CG2 1 
ATOM   8564  N N   . PHE E 3 106 ? 35.210  5.243   36.855  1.00 78.78  ? 113 PHE I N   1 
ATOM   8565  C CA  . PHE E 3 106 ? 36.011  4.686   37.942  1.00 81.31  ? 113 PHE I CA  1 
ATOM   8566  C C   . PHE E 3 106 ? 36.897  5.749   38.586  1.00 78.59  ? 113 PHE I C   1 
ATOM   8567  O O   . PHE E 3 106 ? 37.069  5.761   39.810  1.00 80.56  ? 113 PHE I O   1 
ATOM   8568  C CB  . PHE E 3 106 ? 36.852  3.519   37.428  1.00 86.40  ? 113 PHE I CB  1 
ATOM   8569  C CG  . PHE E 3 106 ? 37.631  2.815   38.503  1.00 89.62  ? 113 PHE I CG  1 
ATOM   8570  C CD1 . PHE E 3 106 ? 37.010  1.899   39.336  1.00 89.52  ? 113 PHE I CD1 1 
ATOM   8571  C CD2 . PHE E 3 106 ? 38.983  3.064   38.679  1.00 91.24  ? 113 PHE I CD2 1 
ATOM   8572  C CE1 . PHE E 3 106 ? 37.718  1.247   40.325  1.00 88.62  ? 113 PHE I CE1 1 
ATOM   8573  C CE2 . PHE E 3 106 ? 39.698  2.412   39.669  1.00 92.55  ? 113 PHE I CE2 1 
ATOM   8574  C CZ  . PHE E 3 106 ? 39.063  1.503   40.492  1.00 90.68  ? 113 PHE I CZ  1 
ATOM   8575  N N   . TYR E 3 107 ? 37.471  6.643   37.778  1.00 75.66  ? 114 TYR I N   1 
ATOM   8576  C CA  . TYR E 3 107 ? 38.263  7.753   38.303  1.00 76.17  ? 114 TYR I CA  1 
ATOM   8577  C C   . TYR E 3 107 ? 37.446  8.597   39.277  1.00 76.06  ? 114 TYR I C   1 
ATOM   8578  O O   . TYR E 3 107 ? 37.870  8.860   40.414  1.00 79.14  ? 114 TYR I O   1 
ATOM   8579  C CB  . TYR E 3 107 ? 38.766  8.580   37.115  1.00 78.50  ? 114 TYR I CB  1 
ATOM   8580  C CG  . TYR E 3 107 ? 39.476  9.885   37.400  1.00 79.01  ? 114 TYR I CG  1 
ATOM   8581  C CD1 . TYR E 3 107 ? 38.761  11.056  37.618  1.00 78.42  ? 114 TYR I CD1 1 
ATOM   8582  C CD2 . TYR E 3 107 ? 40.861  9.961   37.374  1.00 80.66  ? 114 TYR I CD2 1 
ATOM   8583  C CE1 . TYR E 3 107 ? 39.408  12.253  37.850  1.00 81.18  ? 114 TYR I CE1 1 
ATOM   8584  C CE2 . TYR E 3 107 ? 41.516  11.153  37.603  1.00 80.91  ? 114 TYR I CE2 1 
ATOM   8585  C CZ  . TYR E 3 107 ? 40.785  12.296  37.841  1.00 80.60  ? 114 TYR I CZ  1 
ATOM   8586  O OH  . TYR E 3 107 ? 41.432  13.486  38.070  1.00 79.37  ? 114 TYR I OH  1 
ATOM   8587  N N   . LEU E 3 108 ? 36.248  9.004   38.854  1.00 72.82  ? 115 LEU I N   1 
ATOM   8588  C CA  . LEU E 3 108 ? 35.393  9.823   39.703  1.00 76.84  ? 115 LEU I CA  1 
ATOM   8589  C C   . LEU E 3 108 ? 34.935  9.072   40.950  1.00 78.88  ? 115 LEU I C   1 
ATOM   8590  O O   . LEU E 3 108 ? 34.776  9.684   42.012  1.00 78.67  ? 115 LEU I O   1 
ATOM   8591  C CB  . LEU E 3 108 ? 34.195  10.314  38.895  1.00 76.41  ? 115 LEU I CB  1 
ATOM   8592  C CG  . LEU E 3 108 ? 34.585  11.241  37.745  1.00 77.98  ? 115 LEU I CG  1 
ATOM   8593  C CD1 . LEU E 3 108 ? 33.473  11.307  36.723  1.00 79.08  ? 115 LEU I CD1 1 
ATOM   8594  C CD2 . LEU E 3 108 ? 34.935  12.630  38.262  1.00 77.88  ? 115 LEU I CD2 1 
ATOM   8595  N N   . LYS E 3 109 ? 34.721  7.757   40.849  1.00 80.80  ? 116 LYS I N   1 
ATOM   8596  C CA  . LYS E 3 109 ? 34.335  6.994   42.034  1.00 78.50  ? 116 LYS I CA  1 
ATOM   8597  C C   . LYS E 3 109 ? 35.487  6.886   43.023  1.00 79.35  ? 116 LYS I C   1 
ATOM   8598  O O   . LYS E 3 109 ? 35.273  6.932   44.238  1.00 86.32  ? 116 LYS I O   1 
ATOM   8599  C CB  . LYS E 3 109 ? 33.841  5.602   41.638  1.00 80.04  ? 116 LYS I CB  1 
ATOM   8600  C CG  . LYS E 3 109 ? 33.583  4.671   42.820  1.00 80.78  ? 116 LYS I CG  1 
ATOM   8601  C CD  . LYS E 3 109 ? 32.606  5.279   43.815  1.00 84.52  ? 116 LYS I CD  1 
ATOM   8602  C CE  . LYS E 3 109 ? 32.240  4.288   44.904  1.00 88.18  ? 116 LYS I CE  1 
ATOM   8603  N NZ  . LYS E 3 109 ? 31.427  4.934   45.971  1.00 93.25  ? 116 LYS I NZ  1 
ATOM   8604  N N   . THR E 3 110 ? 36.717  6.734   42.528  1.00 83.28  ? 117 THR I N   1 
ATOM   8605  C CA  . THR E 3 110 ? 37.858  6.654   43.433  1.00 83.95  ? 117 THR I CA  1 
ATOM   8606  C C   . THR E 3 110 ? 38.225  8.007   44.024  1.00 84.48  ? 117 THR I C   1 
ATOM   8607  O O   . THR E 3 110 ? 38.950  8.053   45.023  1.00 89.09  ? 117 THR I O   1 
ATOM   8608  C CB  . THR E 3 110 ? 39.076  6.056   42.728  1.00 82.96  ? 117 THR I CB  1 
ATOM   8609  O OG1 . THR E 3 110 ? 39.473  6.909   41.647  1.00 85.38  ? 117 THR I OG1 1 
ATOM   8610  C CG2 . THR E 3 110 ? 38.764  4.661   42.206  1.00 79.22  ? 117 THR I CG2 1 
ATOM   8611  N N   . LEU E 3 111 ? 37.746  9.108   43.437  1.00 85.74  ? 118 LEU I N   1 
ATOM   8612  C CA  . LEU E 3 111 ? 37.974  10.413  44.055  1.00 88.83  ? 118 LEU I CA  1 
ATOM   8613  C C   . LEU E 3 111 ? 37.332  10.540  45.441  1.00 90.53  ? 118 LEU I C   1 
ATOM   8614  O O   . LEU E 3 111 ? 37.726  11.422  46.211  1.00 95.60  ? 118 LEU I O   1 
ATOM   8615  C CB  . LEU E 3 111 ? 37.466  11.525  43.133  1.00 91.12  ? 118 LEU I CB  1 
ATOM   8616  C CG  . LEU E 3 111 ? 38.048  12.926  43.351  1.00 96.14  ? 118 LEU I CG  1 
ATOM   8617  C CD1 . LEU E 3 111 ? 38.312  13.601  42.023  1.00 96.63  ? 118 LEU I CD1 1 
ATOM   8618  C CD2 . LEU E 3 111 ? 37.122  13.791  44.202  1.00 99.51  ? 118 LEU I CD2 1 
ATOM   8619  N N   . GLU E 3 112 ? 36.372  9.678   45.787  1.00 92.90  ? 119 GLU I N   1 
ATOM   8620  C CA  . GLU E 3 112 ? 35.663  9.784   47.064  1.00 100.78 ? 119 GLU I CA  1 
ATOM   8621  C C   . GLU E 3 112 ? 36.553  9.329   48.218  1.00 100.86 ? 119 GLU I C   1 
ATOM   8622  O O   . GLU E 3 112 ? 36.831  8.133   48.360  1.00 95.49  ? 119 GLU I O   1 
ATOM   8623  C CB  . GLU E 3 112 ? 34.382  8.953   47.041  1.00 108.07 ? 119 GLU I CB  1 
ATOM   8624  C CG  . GLU E 3 112 ? 33.598  8.973   45.740  1.00 107.95 ? 119 GLU I CG  1 
ATOM   8625  C CD  . GLU E 3 112 ? 32.668  10.163  45.625  1.00 108.15 ? 119 GLU I CD  1 
ATOM   8626  O OE1 . GLU E 3 112 ? 32.660  11.014  46.542  1.00 117.82 ? 119 GLU I OE1 1 
ATOM   8627  O OE2 . GLU E 3 112 ? 31.939  10.243  44.612  1.00 98.89  ? 119 GLU I OE2 1 
ATOM   8628  N N   . ASN E 3 113 ? 36.978  10.280  49.053  1.00 107.64 ? 120 ASN I N   1 
ATOM   8629  C CA  . ASN E 3 113 ? 37.577  9.998   50.364  1.00 110.99 ? 120 ASN I CA  1 
ATOM   8630  C C   . ASN E 3 113 ? 37.820  11.294  51.138  1.00 111.82 ? 120 ASN I C   1 
ATOM   8631  O O   . ASN E 3 113 ? 38.314  12.280  50.589  1.00 103.82 ? 120 ASN I O   1 
ATOM   8632  C CB  . ASN E 3 113 ? 38.890  9.214   50.236  1.00 113.39 ? 120 ASN I CB  1 
ATOM   8633  C CG  . ASN E 3 113 ? 39.778  9.724   49.118  1.00 114.64 ? 120 ASN I CG  1 
ATOM   8634  O OD1 . ASN E 3 113 ? 40.279  10.849  49.167  1.00 111.12 ? 120 ASN I OD1 1 
ATOM   8635  N ND2 . ASN E 3 113 ? 39.986  8.889   48.106  1.00 103.61 ? 120 ASN I ND2 1 
ATOM   8636  N N   . TYR F 3 6   ? 6.788   -11.464 6.789   1.00 109.70 ? 13  TYR J N   1 
ATOM   8637  C CA  . TYR F 3 6   ? 5.381   -11.093 6.863   1.00 112.61 ? 13  TYR J CA  1 
ATOM   8638  C C   . TYR F 3 6   ? 5.220   -9.725  7.510   1.00 110.61 ? 13  TYR J C   1 
ATOM   8639  O O   . TYR F 3 6   ? 5.839   -8.752  7.078   1.00 110.00 ? 13  TYR J O   1 
ATOM   8640  C CB  . TYR F 3 6   ? 4.588   -12.145 7.639   1.00 117.09 ? 13  TYR J CB  1 
ATOM   8641  C CG  . TYR F 3 6   ? 3.908   -13.159 6.748   1.00 125.94 ? 13  TYR J CG  1 
ATOM   8642  C CD1 . TYR F 3 6   ? 3.305   -12.772 5.555   1.00 124.30 ? 13  TYR J CD1 1 
ATOM   8643  C CD2 . TYR F 3 6   ? 3.878   -14.505 7.092   1.00 129.92 ? 13  TYR J CD2 1 
ATOM   8644  C CE1 . TYR F 3 6   ? 2.686   -13.701 4.733   1.00 128.27 ? 13  TYR J CE1 1 
ATOM   8645  C CE2 . TYR F 3 6   ? 3.261   -15.439 6.278   1.00 131.35 ? 13  TYR J CE2 1 
ATOM   8646  C CZ  . TYR F 3 6   ? 2.667   -15.034 5.102   1.00 132.33 ? 13  TYR J CZ  1 
ATOM   8647  O OH  . TYR F 3 6   ? 2.055   -15.970 4.297   1.00 129.39 ? 13  TYR J OH  1 
ATOM   8648  N N   . VAL F 3 7   ? 4.386   -9.642  8.546   1.00 106.66 ? 14  VAL J N   1 
ATOM   8649  C CA  . VAL F 3 7   ? 4.219   -8.386  9.266   1.00 101.67 ? 14  VAL J CA  1 
ATOM   8650  C C   . VAL F 3 7   ? 4.673   -8.604  10.707  1.00 98.22  ? 14  VAL J C   1 
ATOM   8651  O O   . VAL F 3 7   ? 3.924   -8.376  11.665  1.00 90.83  ? 14  VAL J O   1 
ATOM   8652  C CB  . VAL F 3 7   ? 2.770   -7.866  9.169   1.00 99.24  ? 14  VAL J CB  1 
ATOM   8653  C CG1 . VAL F 3 7   ? 2.619   -6.486  9.829   1.00 100.08 ? 14  VAL J CG1 1 
ATOM   8654  C CG2 . VAL F 3 7   ? 2.321   -7.810  7.710   1.00 93.83  ? 14  VAL J CG2 1 
ATOM   8655  N N   . ASN F 3 8   ? 5.891   -9.118  10.860  1.00 91.97  ? 15  ASN J N   1 
ATOM   8656  C CA  . ASN F 3 8   ? 6.694   -8.830  12.037  1.00 93.44  ? 15  ASN J CA  1 
ATOM   8657  C C   . ASN F 3 8   ? 7.511   -7.568  11.842  1.00 91.98  ? 15  ASN J C   1 
ATOM   8658  O O   . ASN F 3 8   ? 8.147   -7.101  12.793  1.00 92.85  ? 15  ASN J O   1 
ATOM   8659  C CB  . ASN F 3 8   ? 7.634   -9.993  12.360  1.00 95.89  ? 15  ASN J CB  1 
ATOM   8660  C CG  . ASN F 3 8   ? 6.940   -11.327 12.310  1.00 101.02 ? 15  ASN J CG  1 
ATOM   8661  O OD1 . ASN F 3 8   ? 5.731   -11.399 12.097  1.00 112.52 ? 15  ASN J OD1 1 
ATOM   8662  N ND2 . ASN F 3 8   ? 7.699   -12.397 12.517  1.00 101.78 ? 15  ASN J ND2 1 
ATOM   8663  N N   . CYS F 3 9   ? 7.501   -7.025  10.619  1.00 89.20  ? 16  CYS J N   1 
ATOM   8664  C CA  . CYS F 3 9   ? 8.204   -5.784  10.321  1.00 86.95  ? 16  CYS J CA  1 
ATOM   8665  C C   . CYS F 3 9   ? 7.785   -4.670  11.264  1.00 85.21  ? 16  CYS J C   1 
ATOM   8666  O O   . CYS F 3 9   ? 8.599   -3.817  11.625  1.00 80.75  ? 16  CYS J O   1 
ATOM   8667  C CB  . CYS F 3 9   ? 7.940   -5.378  8.872   1.00 90.11  ? 16  CYS J CB  1 
ATOM   8668  S SG  . CYS F 3 9   ? 8.555   -6.566  7.666   1.00 95.44  ? 16  CYS J SG  1 
ATOM   8669  N N   . SER F 3 10  ? 6.514   -4.656  11.665  1.00 81.94  ? 17  SER J N   1 
ATOM   8670  C CA  . SER F 3 10  ? 6.075   -3.688  12.661  1.00 83.74  ? 17  SER J CA  1 
ATOM   8671  C C   . SER F 3 10  ? 6.861   -3.841  13.957  1.00 79.06  ? 17  SER J C   1 
ATOM   8672  O O   . SER F 3 10  ? 7.323   -2.849  14.535  1.00 78.13  ? 17  SER J O   1 
ATOM   8673  C CB  . SER F 3 10  ? 4.578   -3.847  12.914  1.00 87.71  ? 17  SER J CB  1 
ATOM   8674  O OG  . SER F 3 10  ? 4.078   -2.749  13.653  1.00 91.30  ? 17  SER J OG  1 
ATOM   8675  N N   . ASN F 3 11  ? 7.051   -5.080  14.413  1.00 77.55  ? 18  ASN J N   1 
ATOM   8676  C CA  . ASN F 3 11  ? 7.791   -5.305  15.649  1.00 75.61  ? 18  ASN J CA  1 
ATOM   8677  C C   . ASN F 3 11  ? 9.263   -4.954  15.484  1.00 72.78  ? 18  ASN J C   1 
ATOM   8678  O O   . ASN F 3 11  ? 9.881   -4.389  16.396  1.00 73.48  ? 18  ASN J O   1 
ATOM   8679  C CB  . ASN F 3 11  ? 7.629   -6.756  16.090  1.00 73.81  ? 18  ASN J CB  1 
ATOM   8680  C CG  . ASN F 3 11  ? 6.193   -7.104  16.405  1.00 74.66  ? 18  ASN J CG  1 
ATOM   8681  O OD1 . ASN F 3 11  ? 5.414   -6.250  16.830  1.00 78.79  ? 18  ASN J OD1 1 
ATOM   8682  N ND2 . ASN F 3 11  ? 5.828   -8.360  16.184  1.00 78.59  ? 18  ASN J ND2 1 
ATOM   8683  N N   . MET F 3 12  ? 9.842   -5.274  14.324  1.00 73.23  ? 19  MET J N   1 
ATOM   8684  C CA  . MET F 3 12  ? 11.246  -4.954  14.095  1.00 75.65  ? 19  MET J CA  1 
ATOM   8685  C C   . MET F 3 12  ? 11.463  -3.448  14.061  1.00 77.34  ? 19  MET J C   1 
ATOM   8686  O O   . MET F 3 12  ? 12.443  -2.940  14.619  1.00 77.12  ? 19  MET J O   1 
ATOM   8687  C CB  . MET F 3 12  ? 11.730  -5.595  12.797  1.00 75.52  ? 19  MET J CB  1 
ATOM   8688  C CG  . MET F 3 12  ? 11.502  -7.091  12.725  1.00 75.20  ? 19  MET J CG  1 
ATOM   8689  S SD  . MET F 3 12  ? 11.826  -7.772  11.088  1.00 78.76  ? 19  MET J SD  1 
ATOM   8690  C CE  . MET F 3 12  ? 13.614  -7.689  11.023  1.00 73.68  ? 19  MET J CE  1 
ATOM   8691  N N   . ILE F 3 13  ? 10.555  -2.718  13.411  1.00 69.39  ? 20  ILE J N   1 
ATOM   8692  C CA  . ILE F 3 13  ? 10.635  -1.261  13.391  1.00 69.08  ? 20  ILE J CA  1 
ATOM   8693  C C   . ILE F 3 13  ? 10.490  -0.702  14.800  1.00 68.86  ? 20  ILE J C   1 
ATOM   8694  O O   . ILE F 3 13  ? 11.237  0.194   15.208  1.00 68.46  ? 20  ILE J O   1 
ATOM   8695  C CB  . ILE F 3 13  ? 9.578   -0.674  12.439  1.00 69.40  ? 20  ILE J CB  1 
ATOM   8696  C CG1 . ILE F 3 13  ? 9.864   -1.082  10.994  1.00 69.63  ? 20  ILE J CG1 1 
ATOM   8697  C CG2 . ILE F 3 13  ? 9.514   0.837   12.572  1.00 69.12  ? 20  ILE J CG2 1 
ATOM   8698  C CD1 . ILE F 3 13  ? 8.712   -0.817  10.055  1.00 70.10  ? 20  ILE J CD1 1 
ATOM   8699  N N   . ASP F 3 14  ? 9.519   -1.215  15.561  1.00 70.65  ? 21  ASP J N   1 
ATOM   8700  C CA  . ASP F 3 14  ? 9.349   -0.790  16.948  1.00 69.56  ? 21  ASP J CA  1 
ATOM   8701  C C   . ASP F 3 14  ? 10.646  -0.946  17.731  1.00 66.57  ? 21  ASP J C   1 
ATOM   8702  O O   . ASP F 3 14  ? 11.105  -0.012  18.401  1.00 66.14  ? 21  ASP J O   1 
ATOM   8703  C CB  . ASP F 3 14  ? 8.225   -1.596  17.601  1.00 71.92  ? 21  ASP J CB  1 
ATOM   8704  C CG  . ASP F 3 14  ? 6.875   -0.913  17.489  1.00 74.31  ? 21  ASP J CG  1 
ATOM   8705  O OD1 . ASP F 3 14  ? 6.756   0.232   17.970  1.00 77.85  ? 21  ASP J OD1 1 
ATOM   8706  O OD2 . ASP F 3 14  ? 5.937   -1.515  16.921  1.00 74.92  ? 21  ASP J OD2 1 
ATOM   8707  N N   . GLU F 3 15  ? 11.268  -2.121  17.629  1.00 67.57  ? 22  GLU J N   1 
ATOM   8708  C CA  . GLU F 3 15  ? 12.481  -2.385  18.396  1.00 68.60  ? 22  GLU J CA  1 
ATOM   8709  C C   . GLU F 3 15  ? 13.637  -1.503  17.936  1.00 68.53  ? 22  GLU J C   1 
ATOM   8710  O O   . GLU F 3 15  ? 14.378  -0.949  18.761  1.00 66.71  ? 22  GLU J O   1 
ATOM   8711  C CB  . GLU F 3 15  ? 12.850  -3.861  18.276  1.00 71.32  ? 22  GLU J CB  1 
ATOM   8712  C CG  . GLU F 3 15  ? 11.856  -4.804  18.930  1.00 73.28  ? 22  GLU J CG  1 
ATOM   8713  C CD  . GLU F 3 15  ? 12.318  -6.243  18.888  1.00 76.40  ? 22  GLU J CD  1 
ATOM   8714  O OE1 . GLU F 3 15  ? 12.334  -6.825  17.785  1.00 78.90  ? 22  GLU J OE1 1 
ATOM   8715  O OE2 . GLU F 3 15  ? 12.661  -6.795  19.954  1.00 78.39  ? 22  GLU J OE2 1 
ATOM   8716  N N   . ILE F 3 16  ? 13.799  -1.343  16.624  1.00 65.16  ? 23  ILE J N   1 
ATOM   8717  C CA  . ILE F 3 16  ? 14.952  -0.602  16.129  1.00 65.91  ? 23  ILE J CA  1 
ATOM   8718  C C   . ILE F 3 16  ? 14.808  0.890   16.427  1.00 64.28  ? 23  ILE J C   1 
ATOM   8719  O O   . ILE F 3 16  ? 15.797  1.566   16.737  1.00 62.14  ? 23  ILE J O   1 
ATOM   8720  C CB  . ILE F 3 16  ? 15.169  -0.895  14.633  1.00 64.08  ? 23  ILE J CB  1 
ATOM   8721  C CG1 . ILE F 3 16  ? 16.580  -0.495  14.215  1.00 63.15  ? 23  ILE J CG1 1 
ATOM   8722  C CG2 . ILE F 3 16  ? 14.124  -0.216  13.778  1.00 66.79  ? 23  ILE J CG2 1 
ATOM   8723  C CD1 . ILE F 3 16  ? 16.962  -1.006  12.858  1.00 66.71  ? 23  ILE J CD1 1 
ATOM   8724  N N   . ILE F 3 17  ? 13.583  1.427   16.385  1.00 63.14  ? 24  ILE J N   1 
ATOM   8725  C CA  . ILE F 3 17  ? 13.421  2.828   16.758  1.00 62.93  ? 24  ILE J CA  1 
ATOM   8726  C C   . ILE F 3 17  ? 13.574  2.992   18.264  1.00 62.81  ? 24  ILE J C   1 
ATOM   8727  O O   . ILE F 3 17  ? 14.065  4.027   18.729  1.00 62.54  ? 24  ILE J O   1 
ATOM   8728  C CB  . ILE F 3 17  ? 12.083  3.412   16.253  1.00 63.17  ? 24  ILE J CB  1 
ATOM   8729  C CG1 . ILE F 3 17  ? 10.886  2.779   16.961  1.00 63.54  ? 24  ILE J CG1 1 
ATOM   8730  C CG2 . ILE F 3 17  ? 11.956  3.261   14.747  1.00 63.34  ? 24  ILE J CG2 1 
ATOM   8731  C CD1 . ILE F 3 17  ? 10.262  3.649   18.035  1.00 63.54  ? 24  ILE J CD1 1 
ATOM   8732  N N   . THR F 3 18  ? 13.181  1.986   19.052  1.00 63.64  ? 25  THR J N   1 
ATOM   8733  C CA  . THR F 3 18  ? 13.473  2.038   20.480  1.00 63.58  ? 25  THR J CA  1 
ATOM   8734  C C   . THR F 3 18  ? 14.973  2.123   20.720  1.00 63.27  ? 25  THR J C   1 
ATOM   8735  O O   . THR F 3 18  ? 15.430  2.835   21.622  1.00 63.10  ? 25  THR J O   1 
ATOM   8736  C CB  . THR F 3 18  ? 12.886  0.817   21.189  1.00 63.94  ? 25  THR J CB  1 
ATOM   8737  O OG1 . THR F 3 18  ? 11.474  0.762   20.956  1.00 64.28  ? 25  THR J OG1 1 
ATOM   8738  C CG2 . THR F 3 18  ? 13.142  0.893   22.685  1.00 63.95  ? 25  THR J CG2 1 
ATOM   8739  N N   . HIS F 3 19  ? 15.757  1.413   19.915  1.00 67.61  ? 26  HIS J N   1 
ATOM   8740  C CA  . HIS F 3 19  ? 17.205  1.495   20.058  1.00 69.33  ? 26  HIS J CA  1 
ATOM   8741  C C   . HIS F 3 19  ? 17.806  2.746   19.428  1.00 68.04  ? 26  HIS J C   1 
ATOM   8742  O O   . HIS F 3 19  ? 18.963  3.068   19.719  1.00 66.97  ? 26  HIS J O   1 
ATOM   8743  C CB  . HIS F 3 19  ? 17.868  0.248   19.470  1.00 70.24  ? 26  HIS J CB  1 
ATOM   8744  C CG  . HIS F 3 19  ? 17.782  -0.949  20.361  1.00 69.25  ? 26  HIS J CG  1 
ATOM   8745  N ND1 . HIS F 3 19  ? 18.712  -1.210  21.343  1.00 69.29  ? 26  HIS J ND1 1 
ATOM   8746  C CD2 . HIS F 3 19  ? 16.872  -1.949  20.428  1.00 69.31  ? 26  HIS J CD2 1 
ATOM   8747  C CE1 . HIS F 3 19  ? 18.382  -2.322  21.974  1.00 73.28  ? 26  HIS J CE1 1 
ATOM   8748  N NE2 . HIS F 3 19  ? 17.269  -2.791  21.438  1.00 70.87  ? 26  HIS J NE2 1 
ATOM   8749  N N   . LEU F 3 20  ? 17.065  3.458   18.580  1.00 63.06  ? 27  LEU J N   1 
ATOM   8750  C CA  . LEU F 3 20  ? 17.569  4.679   17.962  1.00 62.82  ? 27  LEU J CA  1 
ATOM   8751  C C   . LEU F 3 20  ? 17.239  5.934   18.770  1.00 62.67  ? 27  LEU J C   1 
ATOM   8752  O O   . LEU F 3 20  ? 17.229  7.036   18.210  1.00 63.80  ? 27  LEU J O   1 
ATOM   8753  C CB  . LEU F 3 20  ? 17.024  4.815   16.537  1.00 63.29  ? 27  LEU J CB  1 
ATOM   8754  C CG  . LEU F 3 20  ? 17.584  3.864   15.475  1.00 63.06  ? 27  LEU J CG  1 
ATOM   8755  C CD1 . LEU F 3 20  ? 16.603  3.703   14.326  1.00 63.48  ? 27  LEU J CD1 1 
ATOM   8756  C CD2 . LEU F 3 20  ? 18.926  4.347   14.965  1.00 62.86  ? 27  LEU J CD2 1 
ATOM   8757  N N   . LYS F 3 21  ? 16.976  5.795   20.067  1.00 65.63  ? 28  LYS J N   1 
ATOM   8758  C CA  . LYS F 3 21  ? 16.590  6.909   20.930  1.00 65.57  ? 28  LYS J CA  1 
ATOM   8759  C C   . LYS F 3 21  ? 17.361  6.863   22.246  1.00 67.88  ? 28  LYS J C   1 
ATOM   8760  O O   . LYS F 3 21  ? 16.784  6.973   23.330  1.00 68.00  ? 28  LYS J O   1 
ATOM   8761  C CB  . LYS F 3 21  ? 15.090  6.881   21.214  1.00 65.83  ? 28  LYS J CB  1 
ATOM   8762  C CG  . LYS F 3 21  ? 14.185  6.942   19.997  1.00 65.96  ? 28  LYS J CG  1 
ATOM   8763  C CD  . LYS F 3 21  ? 12.731  6.737   20.413  1.00 67.44  ? 28  LYS J CD  1 
ATOM   8764  C CE  . LYS F 3 21  ? 11.761  7.112   19.304  1.00 69.10  ? 28  LYS J CE  1 
ATOM   8765  N NZ  . LYS F 3 21  ? 10.349  6.805   19.668  1.00 70.20  ? 28  LYS J NZ  1 
ATOM   8766  N N   . GLN F 3 22  ? 18.684  6.703   22.183  1.00 82.58  ? 29  GLN J N   1 
ATOM   8767  C CA  . GLN F 3 22  ? 19.380  6.422   23.436  1.00 88.48  ? 29  GLN J CA  1 
ATOM   8768  C C   . GLN F 3 22  ? 19.806  7.714   24.140  1.00 87.87  ? 29  GLN J C   1 
ATOM   8769  O O   . GLN F 3 22  ? 19.380  7.935   25.281  1.00 79.44  ? 29  GLN J O   1 
ATOM   8770  C CB  . GLN F 3 22  ? 20.556  5.464   23.196  1.00 96.54  ? 29  GLN J CB  1 
ATOM   8771  C CG  . GLN F 3 22  ? 20.137  4.050   22.822  1.00 103.26 ? 29  GLN J CG  1 
ATOM   8772  C CD  . GLN F 3 22  ? 19.464  3.317   23.969  1.00 105.23 ? 29  GLN J CD  1 
ATOM   8773  O OE1 . GLN F 3 22  ? 18.267  3.487   24.214  1.00 103.51 ? 29  GLN J OE1 1 
ATOM   8774  N NE2 . GLN F 3 22  ? 20.232  2.498   24.680  1.00 98.98  ? 29  GLN J NE2 1 
ATOM   8775  N N   . PRO F 3 23  ? 20.620  8.588   23.541  1.00 94.44  ? 30  PRO J N   1 
ATOM   8776  C CA  . PRO F 3 23  ? 20.775  9.932   24.103  1.00 89.81  ? 30  PRO J CA  1 
ATOM   8777  C C   . PRO F 3 23  ? 19.990  10.933  23.279  1.00 88.33  ? 30  PRO J C   1 
ATOM   8778  O O   . PRO F 3 23  ? 20.529  11.541  22.343  1.00 89.36  ? 30  PRO J O   1 
ATOM   8779  C CB  . PRO F 3 23  ? 22.286  10.176  24.003  1.00 90.31  ? 30  PRO J CB  1 
ATOM   8780  C CG  . PRO F 3 23  ? 22.687  9.417   22.755  1.00 94.80  ? 30  PRO J CG  1 
ATOM   8781  C CD  . PRO F 3 23  ? 21.609  8.376   22.466  1.00 95.52  ? 30  PRO J CD  1 
ATOM   8782  N N   . PRO F 3 24  ? 18.717  11.140  23.605  1.00 91.69  ? 31  PRO J N   1 
ATOM   8783  C CA  . PRO F 3 24  ? 17.791  11.742  22.636  1.00 92.33  ? 31  PRO J CA  1 
ATOM   8784  C C   . PRO F 3 24  ? 18.171  13.167  22.261  1.00 88.91  ? 31  PRO J C   1 
ATOM   8785  O O   . PRO F 3 24  ? 18.325  14.040  23.117  1.00 95.03  ? 31  PRO J O   1 
ATOM   8786  C CB  . PRO F 3 24  ? 16.441  11.689  23.363  1.00 93.28  ? 31  PRO J CB  1 
ATOM   8787  C CG  . PRO F 3 24  ? 16.801  11.716  24.812  1.00 93.62  ? 31  PRO J CG  1 
ATOM   8788  C CD  . PRO F 3 24  ? 18.096  10.954  24.929  1.00 93.73  ? 31  PRO J CD  1 
ATOM   8789  N N   . LEU F 3 25  ? 18.331  13.388  20.959  1.00 88.64  ? 32  LEU J N   1 
ATOM   8790  C CA  . LEU F 3 25  ? 18.469  14.731  20.439  1.00 92.47  ? 32  LEU J CA  1 
ATOM   8791  C C   . LEU F 3 25  ? 17.124  15.449  20.554  1.00 93.29  ? 32  LEU J C   1 
ATOM   8792  O O   . LEU F 3 25  ? 16.074  14.804  20.616  1.00 86.44  ? 32  LEU J O   1 
ATOM   8793  C CB  . LEU F 3 25  ? 18.954  14.681  18.991  1.00 97.23  ? 32  LEU J CB  1 
ATOM   8794  C CG  . LEU F 3 25  ? 20.414  14.255  18.801  1.00 100.83 ? 32  LEU J CG  1 
ATOM   8795  C CD1 . LEU F 3 25  ? 20.972  14.816  17.500  1.00 103.43 ? 32  LEU J CD1 1 
ATOM   8796  C CD2 . LEU F 3 25  ? 21.280  14.675  19.988  1.00 96.91  ? 32  LEU J CD2 1 
ATOM   8797  N N   . PRO F 3 26  ? 17.125  16.781  20.604  1.00 104.22 ? 33  PRO J N   1 
ATOM   8798  C CA  . PRO F 3 26  ? 15.890  17.504  20.930  1.00 102.73 ? 33  PRO J CA  1 
ATOM   8799  C C   . PRO F 3 26  ? 14.844  17.366  19.833  1.00 104.04 ? 33  PRO J C   1 
ATOM   8800  O O   . PRO F 3 26  ? 15.100  16.868  18.733  1.00 94.01  ? 33  PRO J O   1 
ATOM   8801  C CB  . PRO F 3 26  ? 16.360  18.953  21.084  1.00 98.18  ? 33  PRO J CB  1 
ATOM   8802  C CG  . PRO F 3 26  ? 17.537  19.046  20.184  1.00 101.53 ? 33  PRO J CG  1 
ATOM   8803  C CD  . PRO F 3 26  ? 18.225  17.710  20.279  1.00 103.98 ? 33  PRO J CD  1 
ATOM   8804  N N   . LEU F 3 27  ? 13.634  17.815  20.166  1.00 106.34 ? 34  LEU J N   1 
ATOM   8805  C CA  . LEU F 3 27  ? 12.513  17.745  19.239  1.00 109.25 ? 34  LEU J CA  1 
ATOM   8806  C C   . LEU F 3 27  ? 12.830  18.507  17.957  1.00 114.82 ? 34  LEU J C   1 
ATOM   8807  O O   . LEU F 3 27  ? 13.596  19.476  17.955  1.00 108.78 ? 34  LEU J O   1 
ATOM   8808  C CB  . LEU F 3 27  ? 11.249  18.309  19.893  1.00 108.27 ? 34  LEU J CB  1 
ATOM   8809  C CG  . LEU F 3 27  ? 9.896   17.854  19.339  1.00 108.15 ? 34  LEU J CG  1 
ATOM   8810  C CD1 . LEU F 3 27  ? 9.674   16.374  19.612  1.00 109.49 ? 34  LEU J CD1 1 
ATOM   8811  C CD2 . LEU F 3 27  ? 8.767   18.686  19.932  1.00 103.38 ? 34  LEU J CD2 1 
ATOM   8812  N N   . LEU F 3 28  ? 12.229  18.050  16.856  1.00 112.62 ? 35  LEU J N   1 
ATOM   8813  C CA  . LEU F 3 28  ? 12.514  18.553  15.511  1.00 109.85 ? 35  LEU J CA  1 
ATOM   8814  C C   . LEU F 3 28  ? 13.993  18.371  15.164  1.00 99.07  ? 35  LEU J C   1 
ATOM   8815  O O   . LEU F 3 28  ? 14.701  19.316  14.807  1.00 89.40  ? 35  LEU J O   1 
ATOM   8816  C CB  . LEU F 3 28  ? 12.089  20.020  15.356  1.00 111.54 ? 35  LEU J CB  1 
ATOM   8817  C CG  . LEU F 3 28  ? 10.608  20.373  15.497  1.00 110.80 ? 35  LEU J CG  1 
ATOM   8818  C CD1 . LEU F 3 28  ? 10.384  21.847  15.190  1.00 103.90 ? 35  LEU J CD1 1 
ATOM   8819  C CD2 . LEU F 3 28  ? 9.750   19.498  14.598  1.00 113.46 ? 35  LEU J CD2 1 
ATOM   8820  N N   . ASP F 3 29  ? 14.457  17.123  15.288  1.00 93.97  ? 36  ASP J N   1 
ATOM   8821  C CA  . ASP F 3 29  ? 15.805  16.800  14.835  1.00 88.86  ? 36  ASP J CA  1 
ATOM   8822  C C   . ASP F 3 29  ? 15.847  16.536  13.339  1.00 86.66  ? 36  ASP J C   1 
ATOM   8823  O O   . ASP F 3 29  ? 16.860  16.824  12.693  1.00 81.22  ? 36  ASP J O   1 
ATOM   8824  C CB  . ASP F 3 29  ? 16.361  15.592  15.586  1.00 87.72  ? 36  ASP J CB  1 
ATOM   8825  C CG  . ASP F 3 29  ? 17.773  15.243  15.150  1.00 85.08  ? 36  ASP J CG  1 
ATOM   8826  O OD1 . ASP F 3 29  ? 18.583  16.177  14.951  1.00 76.81  ? 36  ASP J OD1 1 
ATOM   8827  O OD2 . ASP F 3 29  ? 18.073  14.040  15.004  1.00 86.01  ? 36  ASP J OD2 1 
ATOM   8828  N N   . PHE F 3 30  ? 14.764  15.998  12.773  1.00 78.83  ? 37  PHE J N   1 
ATOM   8829  C CA  . PHE F 3 30  ? 14.676  15.866  11.325  1.00 80.80  ? 37  PHE J CA  1 
ATOM   8830  C C   . PHE F 3 30  ? 14.749  17.213  10.620  1.00 81.31  ? 37  PHE J C   1 
ATOM   8831  O O   . PHE F 3 30  ? 14.903  17.244  9.394   1.00 88.94  ? 37  PHE J O   1 
ATOM   8832  C CB  . PHE F 3 30  ? 13.391  15.126  10.938  1.00 79.78  ? 37  PHE J CB  1 
ATOM   8833  C CG  . PHE F 3 30  ? 12.133  15.887  11.241  1.00 81.73  ? 37  PHE J CG  1 
ATOM   8834  C CD1 . PHE F 3 30  ? 11.569  15.842  12.507  1.00 83.50  ? 37  PHE J CD1 1 
ATOM   8835  C CD2 . PHE F 3 30  ? 11.500  16.630  10.256  1.00 83.78  ? 37  PHE J CD2 1 
ATOM   8836  C CE1 . PHE F 3 30  ? 10.405  16.533  12.790  1.00 87.82  ? 37  PHE J CE1 1 
ATOM   8837  C CE2 . PHE F 3 30  ? 10.336  17.326  10.532  1.00 92.90  ? 37  PHE J CE2 1 
ATOM   8838  C CZ  . PHE F 3 30  ? 9.787   17.277  11.802  1.00 92.40  ? 37  PHE J CZ  1 
ATOM   8839  N N   . ASN F 3 31  ? 14.640  18.319  11.362  1.00 87.45  ? 38  ASN J N   1 
ATOM   8840  C CA  . ASN F 3 31  ? 14.918  19.630  10.791  1.00 84.71  ? 38  ASN J CA  1 
ATOM   8841  C C   . ASN F 3 31  ? 16.382  19.757  10.393  1.00 81.51  ? 38  ASN J C   1 
ATOM   8842  O O   . ASN F 3 31  ? 16.714  20.532  9.489   1.00 83.92  ? 38  ASN J O   1 
ATOM   8843  C CB  . ASN F 3 31  ? 14.542  20.727  11.787  1.00 87.13  ? 38  ASN J CB  1 
ATOM   8844  C CG  . ASN F 3 31  ? 13.123  21.230  11.593  1.00 93.76  ? 38  ASN J CG  1 
ATOM   8845  O OD1 . ASN F 3 31  ? 12.158  20.492  11.796  1.00 92.12  ? 38  ASN J OD1 1 
ATOM   8846  N ND2 . ASN F 3 31  ? 12.990  22.493  11.201  1.00 101.18 ? 38  ASN J ND2 1 
ATOM   8847  N N   . ASN F 3 32  ? 17.268  19.012  11.058  1.00 77.53  ? 39  ASN J N   1 
ATOM   8848  C CA  . ASN F 3 32  ? 18.669  18.964  10.666  1.00 76.39  ? 39  ASN J CA  1 
ATOM   8849  C C   . ASN F 3 32  ? 18.909  18.084  9.452   1.00 73.68  ? 39  ASN J C   1 
ATOM   8850  O O   . ASN F 3 32  ? 20.006  18.126  8.884   1.00 73.75  ? 39  ASN J O   1 
ATOM   8851  C CB  . ASN F 3 32  ? 19.531  18.464  11.823  1.00 75.87  ? 39  ASN J CB  1 
ATOM   8852  C CG  . ASN F 3 32  ? 19.514  19.401  13.003  1.00 78.36  ? 39  ASN J CG  1 
ATOM   8853  O OD1 . ASN F 3 32  ? 20.195  20.426  13.001  1.00 80.26  ? 39  ASN J OD1 1 
ATOM   8854  N ND2 . ASN F 3 32  ? 18.744  19.051  14.030  1.00 79.12  ? 39  ASN J ND2 1 
ATOM   8855  N N   . LEU F 3 33  ? 17.921  17.294  9.048   1.00 64.93  ? 40  LEU J N   1 
ATOM   8856  C CA  . LEU F 3 33  ? 18.051  16.435  7.880   1.00 65.75  ? 40  LEU J CA  1 
ATOM   8857  C C   . LEU F 3 33  ? 17.816  17.256  6.618   1.00 65.63  ? 40  LEU J C   1 
ATOM   8858  O O   . LEU F 3 33  ? 16.716  17.779  6.408   1.00 65.64  ? 40  LEU J O   1 
ATOM   8859  C CB  . LEU F 3 33  ? 17.064  15.274  7.965   1.00 66.73  ? 40  LEU J CB  1 
ATOM   8860  C CG  . LEU F 3 33  ? 17.350  14.090  7.044   1.00 69.85  ? 40  LEU J CG  1 
ATOM   8861  C CD1 . LEU F 3 33  ? 18.769  13.594  7.244   1.00 71.96  ? 40  LEU J CD1 1 
ATOM   8862  C CD2 . LEU F 3 33  ? 16.353  12.975  7.285   1.00 70.97  ? 40  LEU J CD2 1 
ATOM   8863  N N   . ASN F 3 34  ? 18.847  17.371  5.785   1.00 65.16  ? 41  ASN J N   1 
ATOM   8864  C CA  . ASN F 3 34  ? 18.729  18.130  4.548   1.00 65.80  ? 41  ASN J CA  1 
ATOM   8865  C C   . ASN F 3 34  ? 17.654  17.525  3.655   1.00 65.16  ? 41  ASN J C   1 
ATOM   8866  O O   . ASN F 3 34  ? 17.488  16.305  3.597   1.00 68.96  ? 41  ASN J O   1 
ATOM   8867  C CB  . ASN F 3 34  ? 20.071  18.155  3.819   1.00 66.24  ? 41  ASN J CB  1 
ATOM   8868  C CG  . ASN F 3 34  ? 20.050  19.043  2.595   1.00 69.09  ? 41  ASN J CG  1 
ATOM   8869  O OD1 . ASN F 3 34  ? 19.434  20.110  2.594   1.00 70.89  ? 41  ASN J OD1 1 
ATOM   8870  N ND2 . ASN F 3 34  ? 20.710  18.597  1.534   1.00 74.01  ? 41  ASN J ND2 1 
ATOM   8871  N N   . GLY F 3 35  ? 16.916  18.391  2.956   1.00 65.90  ? 42  GLY J N   1 
ATOM   8872  C CA  . GLY F 3 35  ? 15.812  17.922  2.133   1.00 66.78  ? 42  GLY J CA  1 
ATOM   8873  C C   . GLY F 3 35  ? 16.239  16.978  1.027   1.00 65.18  ? 42  GLY J C   1 
ATOM   8874  O O   . GLY F 3 35  ? 15.461  16.115  0.606   1.00 63.64  ? 42  GLY J O   1 
ATOM   8875  N N   . GLU F 3 36  ? 17.473  17.122  0.541   1.00 64.33  ? 43  GLU J N   1 
ATOM   8876  C CA  . GLU F 3 36  ? 17.983  16.182  -0.451  1.00 68.52  ? 43  GLU J CA  1 
ATOM   8877  C C   . GLU F 3 36  ? 18.135  14.784  0.139   1.00 70.20  ? 43  GLU J C   1 
ATOM   8878  O O   . GLU F 3 36  ? 17.779  13.789  -0.506  1.00 71.14  ? 43  GLU J O   1 
ATOM   8879  C CB  . GLU F 3 36  ? 19.314  16.682  -1.009  1.00 69.83  ? 43  GLU J CB  1 
ATOM   8880  C CG  . GLU F 3 36  ? 19.245  18.065  -1.628  1.00 72.57  ? 43  GLU J CG  1 
ATOM   8881  C CD  . GLU F 3 36  ? 18.429  18.098  -2.908  1.00 74.80  ? 43  GLU J CD  1 
ATOM   8882  O OE1 . GLU F 3 36  ? 18.095  17.018  -3.443  1.00 76.86  ? 43  GLU J OE1 1 
ATOM   8883  O OE2 . GLU F 3 36  ? 18.125  19.212  -3.386  1.00 73.43  ? 43  GLU J OE2 1 
ATOM   8884  N N   . ASP F 3 37  ? 18.663  14.688  1.364   1.00 70.99  ? 44  ASP J N   1 
ATOM   8885  C CA  . ASP F 3 37  ? 18.726  13.399  2.045   1.00 66.80  ? 44  ASP J CA  1 
ATOM   8886  C C   . ASP F 3 37  ? 17.331  12.830  2.269   1.00 66.16  ? 44  ASP J C   1 
ATOM   8887  O O   . ASP F 3 37  ? 17.120  11.617  2.150   1.00 70.75  ? 44  ASP J O   1 
ATOM   8888  C CB  . ASP F 3 37  ? 19.463  13.540  3.377   1.00 66.67  ? 44  ASP J CB  1 
ATOM   8889  C CG  . ASP F 3 37  ? 20.953  13.766  3.201   1.00 68.71  ? 44  ASP J CG  1 
ATOM   8890  O OD1 . ASP F 3 37  ? 21.512  13.309  2.180   1.00 66.36  ? 44  ASP J OD1 1 
ATOM   8891  O OD2 . ASP F 3 37  ? 21.567  14.400  4.086   1.00 69.94  ? 44  ASP J OD2 1 
ATOM   8892  N N   . GLN F 3 38  ? 16.366  13.692  2.592   1.00 63.05  ? 45  GLN J N   1 
ATOM   8893  C CA  . GLN F 3 38  ? 14.990  13.238  2.762   1.00 63.27  ? 45  GLN J CA  1 
ATOM   8894  C C   . GLN F 3 38  ? 14.453  12.629  1.474   1.00 63.88  ? 45  GLN J C   1 
ATOM   8895  O O   . GLN F 3 38  ? 13.871  11.538  1.484   1.00 64.13  ? 45  GLN J O   1 
ATOM   8896  C CB  . GLN F 3 38  ? 14.110  14.401  3.216   1.00 63.57  ? 45  GLN J CB  1 
ATOM   8897  C CG  . GLN F 3 38  ? 14.575  15.068  4.497   1.00 63.60  ? 45  GLN J CG  1 
ATOM   8898  C CD  . GLN F 3 38  ? 13.539  16.015  5.065   1.00 63.55  ? 45  GLN J CD  1 
ATOM   8899  O OE1 . GLN F 3 38  ? 12.369  15.968  4.689   1.00 69.04  ? 45  GLN J OE1 1 
ATOM   8900  N NE2 . GLN F 3 38  ? 13.964  16.885  5.973   1.00 63.36  ? 45  GLN J NE2 1 
ATOM   8901  N N   . ASP F 3 39  ? 14.645  13.323  0.349   1.00 66.15  ? 46  ASP J N   1 
ATOM   8902  C CA  . ASP F 3 39  ? 14.159  12.801  -0.924  1.00 67.59  ? 46  ASP J CA  1 
ATOM   8903  C C   . ASP F 3 39  ? 14.886  11.525  -1.323  1.00 68.45  ? 46  ASP J C   1 
ATOM   8904  O O   . ASP F 3 39  ? 14.284  10.639  -1.939  1.00 74.40  ? 46  ASP J O   1 
ATOM   8905  C CB  . ASP F 3 39  ? 14.300  13.853  -2.021  1.00 67.22  ? 46  ASP J CB  1 
ATOM   8906  C CG  . ASP F 3 39  ? 13.619  13.441  -3.311  1.00 69.01  ? 46  ASP J CG  1 
ATOM   8907  O OD1 . ASP F 3 39  ? 12.382  13.586  -3.403  1.00 74.62  ? 46  ASP J OD1 1 
ATOM   8908  O OD2 . ASP F 3 39  ? 14.318  12.965  -4.230  1.00 68.85  ? 46  ASP J OD2 1 
ATOM   8909  N N   . ILE F 3 40  ? 16.170  11.411  -0.985  1.00 65.45  ? 47  ILE J N   1 
ATOM   8910  C CA  . ILE F 3 40  ? 16.903  10.184  -1.279  1.00 65.62  ? 47  ILE J CA  1 
ATOM   8911  C C   . ILE F 3 40  ? 16.337  9.018   -0.479  1.00 65.54  ? 47  ILE J C   1 
ATOM   8912  O O   . ILE F 3 40  ? 16.099  7.933   -1.019  1.00 65.95  ? 47  ILE J O   1 
ATOM   8913  C CB  . ILE F 3 40  ? 18.405  10.376  -1.013  1.00 65.29  ? 47  ILE J CB  1 
ATOM   8914  C CG1 . ILE F 3 40  ? 19.036  11.243  -2.102  1.00 65.57  ? 47  ILE J CG1 1 
ATOM   8915  C CG2 . ILE F 3 40  ? 19.105  9.040   -0.922  1.00 65.35  ? 47  ILE J CG2 1 
ATOM   8916  C CD1 . ILE F 3 40  ? 20.457  11.638  -1.802  1.00 65.27  ? 47  ILE J CD1 1 
ATOM   8917  N N   . LEU F 3 41  ? 16.104  9.225   0.819   1.00 65.08  ? 48  LEU J N   1 
ATOM   8918  C CA  . LEU F 3 41  ? 15.589  8.143   1.655   1.00 65.82  ? 48  LEU J CA  1 
ATOM   8919  C C   . LEU F 3 41  ? 14.151  7.789   1.300   1.00 67.74  ? 48  LEU J C   1 
ATOM   8920  O O   . LEU F 3 41  ? 13.733  6.641   1.495   1.00 72.65  ? 48  LEU J O   1 
ATOM   8921  C CB  . LEU F 3 41  ? 15.697  8.522   3.131   1.00 63.69  ? 48  LEU J CB  1 
ATOM   8922  C CG  . LEU F 3 41  ? 17.115  8.821   3.625   1.00 64.11  ? 48  LEU J CG  1 
ATOM   8923  C CD1 . LEU F 3 41  ? 17.091  9.474   4.996   1.00 63.87  ? 48  LEU J CD1 1 
ATOM   8924  C CD2 . LEU F 3 41  ? 17.960  7.561   3.643   1.00 64.20  ? 48  LEU J CD2 1 
ATOM   8925  N N   . MET F 3 42  ? 13.383  8.749   0.779   1.00 65.80  ? 49  MET J N   1 
ATOM   8926  C CA  . MET F 3 42  ? 12.002  8.470   0.398   1.00 68.27  ? 49  MET J CA  1 
ATOM   8927  C C   . MET F 3 42  ? 11.896  7.706   -0.916  1.00 72.27  ? 49  MET J C   1 
ATOM   8928  O O   . MET F 3 42  ? 10.930  6.956   -1.108  1.00 71.35  ? 49  MET J O   1 
ATOM   8929  C CB  . MET F 3 42  ? 11.206  9.769   0.295   1.00 67.75  ? 49  MET J CB  1 
ATOM   8930  C CG  . MET F 3 42  ? 10.469  10.147  1.558   1.00 67.20  ? 49  MET J CG  1 
ATOM   8931  S SD  . MET F 3 42  ? 9.605   11.717  1.380   1.00 67.55  ? 49  MET J SD  1 
ATOM   8932  C CE  . MET F 3 42  ? 10.904  12.868  1.810   1.00 67.97  ? 49  MET J CE  1 
ATOM   8933  N N   . GLU F 3 43  ? 12.854  7.890   -1.826  1.00 79.02  ? 50  GLU J N   1 
ATOM   8934  C CA  . GLU F 3 43  ? 12.812  7.253   -3.140  1.00 81.39  ? 50  GLU J CA  1 
ATOM   8935  C C   . GLU F 3 43  ? 12.667  5.745   -3.004  1.00 81.08  ? 50  GLU J C   1 
ATOM   8936  O O   . GLU F 3 43  ? 13.475  5.089   -2.340  1.00 79.53  ? 50  GLU J O   1 
ATOM   8937  C CB  . GLU F 3 43  ? 14.079  7.599   -3.927  1.00 82.03  ? 50  GLU J CB  1 
ATOM   8938  C CG  . GLU F 3 43  ? 14.313  6.752   -5.174  1.00 85.27  ? 50  GLU J CG  1 
ATOM   8939  C CD  . GLU F 3 43  ? 13.553  7.256   -6.394  1.00 89.72  ? 50  GLU J CD  1 
ATOM   8940  O OE1 . GLU F 3 43  ? 12.345  7.557   -6.276  1.00 95.57  ? 50  GLU J OE1 1 
ATOM   8941  O OE2 . GLU F 3 43  ? 14.169  7.352   -7.478  1.00 89.27  ? 50  GLU J OE2 1 
ATOM   8942  N N   . ASN F 3 44  ? 11.625  5.202   -3.637  1.00 84.79  ? 51  ASN J N   1 
ATOM   8943  C CA  . ASN F 3 44  ? 11.292  3.791   -3.465  1.00 84.75  ? 51  ASN J CA  1 
ATOM   8944  C C   . ASN F 3 44  ? 12.352  2.888   -4.085  1.00 80.11  ? 51  ASN J C   1 
ATOM   8945  O O   . ASN F 3 44  ? 12.837  1.947   -3.446  1.00 74.45  ? 51  ASN J O   1 
ATOM   8946  C CB  . ASN F 3 44  ? 9.918   3.511   -4.075  1.00 84.90  ? 51  ASN J CB  1 
ATOM   8947  C CG  . ASN F 3 44  ? 9.701   2.046   -4.373  1.00 83.95  ? 51  ASN J CG  1 
ATOM   8948  O OD1 . ASN F 3 44  ? 9.907   1.591   -5.500  1.00 85.33  ? 51  ASN J OD1 1 
ATOM   8949  N ND2 . ASN F 3 44  ? 9.281   1.294   -3.364  1.00 81.69  ? 51  ASN J ND2 1 
ATOM   8950  N N   . ASN F 3 45  ? 12.731  3.166   -5.331  1.00 81.94  ? 52  ASN J N   1 
ATOM   8951  C CA  . ASN F 3 45  ? 13.698  2.327   -6.024  1.00 85.02  ? 52  ASN J CA  1 
ATOM   8952  C C   . ASN F 3 45  ? 15.078  2.363   -5.386  1.00 84.21  ? 52  ASN J C   1 
ATOM   8953  O O   . ASN F 3 45  ? 15.965  1.625   -5.828  1.00 90.04  ? 52  ASN J O   1 
ATOM   8954  C CB  . ASN F 3 45  ? 13.792  2.749   -7.487  1.00 86.58  ? 52  ASN J CB  1 
ATOM   8955  C CG  . ASN F 3 45  ? 12.547  2.393   -8.269  1.00 87.54  ? 52  ASN J CG  1 
ATOM   8956  O OD1 . ASN F 3 45  ? 12.586  1.554   -9.165  1.00 82.17  ? 52  ASN J OD1 1 
ATOM   8957  N ND2 . ASN F 3 45  ? 11.433  3.037   -7.939  1.00 88.59  ? 52  ASN J ND2 1 
ATOM   8958  N N   . LEU F 3 46  ? 15.283  3.197   -4.369  1.00 75.17  ? 53  LEU J N   1 
ATOM   8959  C CA  . LEU F 3 46  ? 16.537  3.249   -3.638  1.00 74.00  ? 53  LEU J CA  1 
ATOM   8960  C C   . LEU F 3 46  ? 16.451  2.587   -2.270  1.00 73.03  ? 53  LEU J C   1 
ATOM   8961  O O   . LEU F 3 46  ? 17.392  2.709   -1.483  1.00 76.94  ? 53  LEU J O   1 
ATOM   8962  C CB  . LEU F 3 46  ? 17.000  4.699   -3.481  1.00 75.79  ? 53  LEU J CB  1 
ATOM   8963  C CG  . LEU F 3 46  ? 18.102  5.173   -4.429  1.00 79.07  ? 53  LEU J CG  1 
ATOM   8964  C CD1 . LEU F 3 46  ? 17.624  5.129   -5.868  1.00 87.17  ? 53  LEU J CD1 1 
ATOM   8965  C CD2 . LEU F 3 46  ? 18.566  6.571   -4.057  1.00 79.06  ? 53  LEU J CD2 1 
ATOM   8966  N N   . ARG F 3 47  ? 15.355  1.886   -1.968  1.00 69.67  ? 54  ARG J N   1 
ATOM   8967  C CA  . ARG F 3 47  ? 15.207  1.291   -0.641  1.00 69.93  ? 54  ARG J CA  1 
ATOM   8968  C C   . ARG F 3 47  ? 16.278  0.236   -0.386  1.00 70.13  ? 54  ARG J C   1 
ATOM   8969  O O   . ARG F 3 47  ? 16.907  0.216   0.679   1.00 68.41  ? 54  ARG J O   1 
ATOM   8970  C CB  . ARG F 3 47  ? 13.812  0.686   -0.485  1.00 70.43  ? 54  ARG J CB  1 
ATOM   8971  C CG  . ARG F 3 47  ? 12.701  1.707   -0.352  1.00 73.04  ? 54  ARG J CG  1 
ATOM   8972  C CD  . ARG F 3 47  ? 12.747  2.430   0.980   1.00 74.27  ? 54  ARG J CD  1 
ATOM   8973  N NE  . ARG F 3 47  ? 11.780  3.524   1.025   1.00 74.21  ? 54  ARG J NE  1 
ATOM   8974  C CZ  . ARG F 3 47  ? 11.383  4.130   2.139   1.00 72.15  ? 54  ARG J CZ  1 
ATOM   8975  N NH1 . ARG F 3 47  ? 11.867  3.753   3.314   1.00 68.79  ? 54  ARG J NH1 1 
ATOM   8976  N NH2 . ARG F 3 47  ? 10.499  5.116   2.077   1.00 72.44  ? 54  ARG J NH2 1 
ATOM   8977  N N   . ARG F 3 48  ? 16.502  -0.653  -1.361  1.00 74.61  ? 55  ARG J N   1 
ATOM   8978  C CA  . ARG F 3 48  ? 17.478  -1.723  -1.160  1.00 76.29  ? 55  ARG J CA  1 
ATOM   8979  C C   . ARG F 3 48  ? 18.908  -1.199  -1.094  1.00 74.71  ? 55  ARG J C   1 
ATOM   8980  O O   . ARG F 3 48  ? 19.656  -1.630  -0.198  1.00 73.64  ? 55  ARG J O   1 
ATOM   8981  C CB  . ARG F 3 48  ? 17.308  -2.796  -2.241  1.00 83.29  ? 55  ARG J CB  1 
ATOM   8982  C CG  . ARG F 3 48  ? 15.920  -3.423  -2.266  1.00 91.99  ? 55  ARG J CG  1 
ATOM   8983  C CD  . ARG F 3 48  ? 15.818  -4.574  -3.264  1.00 96.44  ? 55  ARG J CD  1 
ATOM   8984  N NE  . ARG F 3 48  ? 16.472  -5.790  -2.781  1.00 97.49  ? 55  ARG J NE  1 
ATOM   8985  C CZ  . ARG F 3 48  ? 17.705  -6.162  -3.113  1.00 95.19  ? 55  ARG J CZ  1 
ATOM   8986  N NH1 . ARG F 3 48  ? 18.428  -5.418  -3.941  1.00 94.49  ? 55  ARG J NH1 1 
ATOM   8987  N NH2 . ARG F 3 48  ? 18.215  -7.282  -2.619  1.00 95.00  ? 55  ARG J NH2 1 
ATOM   8988  N N   . PRO F 3 49  ? 19.364  -0.299  -1.978  1.00 72.83  ? 56  PRO J N   1 
ATOM   8989  C CA  . PRO F 3 49  ? 20.720  0.252   -1.789  1.00 74.28  ? 56  PRO J CA  1 
ATOM   8990  C C   . PRO F 3 49  ? 20.862  1.063   -0.512  1.00 71.47  ? 56  PRO J C   1 
ATOM   8991  O O   . PRO F 3 49  ? 21.833  0.867   0.235   1.00 66.47  ? 56  PRO J O   1 
ATOM   8992  C CB  . PRO F 3 49  ? 20.931  1.107   -3.048  1.00 73.45  ? 56  PRO J CB  1 
ATOM   8993  C CG  . PRO F 3 49  ? 19.574  1.371   -3.571  1.00 75.36  ? 56  PRO J CG  1 
ATOM   8994  C CD  . PRO F 3 49  ? 18.773  0.155   -3.249  1.00 73.58  ? 56  PRO J CD  1 
ATOM   8995  N N   . ASN F 3 50  ? 19.918  1.972   -0.241  1.00 68.37  ? 57  ASN J N   1 
ATOM   8996  C CA  . ASN F 3 50  ? 19.931  2.720   1.014   1.00 67.75  ? 57  ASN J CA  1 
ATOM   8997  C C   . ASN F 3 50  ? 20.134  1.791   2.202   1.00 67.46  ? 57  ASN J C   1 
ATOM   8998  O O   . ASN F 3 50  ? 21.006  2.022   3.048   1.00 67.06  ? 57  ASN J O   1 
ATOM   8999  C CB  . ASN F 3 50  ? 18.626  3.501   1.183   1.00 67.69  ? 57  ASN J CB  1 
ATOM   9000  C CG  . ASN F 3 50  ? 18.651  4.843   0.490   1.00 67.73  ? 57  ASN J CG  1 
ATOM   9001  O OD1 . ASN F 3 50  ? 19.714  5.389   0.201   1.00 67.64  ? 57  ASN J OD1 1 
ATOM   9002  N ND2 . ASN F 3 50  ? 17.469  5.387   0.222   1.00 67.90  ? 57  ASN J ND2 1 
ATOM   9003  N N   . LEU F 3 51  ? 19.333  0.723   2.272   1.00 69.60  ? 58  LEU J N   1 
ATOM   9004  C CA  . LEU F 3 51  ? 19.478  -0.257  3.341   1.00 68.45  ? 58  LEU J CA  1 
ATOM   9005  C C   . LEU F 3 51  ? 20.909  -0.770  3.423   1.00 68.38  ? 58  LEU J C   1 
ATOM   9006  O O   . LEU F 3 51  ? 21.532  -0.742  4.491   1.00 68.00  ? 58  LEU J O   1 
ATOM   9007  C CB  . LEU F 3 51  ? 18.501  -1.412  3.125   1.00 68.85  ? 58  LEU J CB  1 
ATOM   9008  C CG  . LEU F 3 51  ? 18.603  -2.577  4.109   1.00 68.74  ? 58  LEU J CG  1 
ATOM   9009  C CD1 . LEU F 3 51  ? 18.569  -2.078  5.542   1.00 71.51  ? 58  LEU J CD1 1 
ATOM   9010  C CD2 . LEU F 3 51  ? 17.487  -3.576  3.865   1.00 70.93  ? 58  LEU J CD2 1 
ATOM   9011  N N   . GLU F 3 52  ? 21.464  -1.213  2.291   1.00 73.04  ? 59  GLU J N   1 
ATOM   9012  C CA  . GLU F 3 52  ? 22.819  -1.747  2.321   1.00 78.91  ? 59  GLU J CA  1 
ATOM   9013  C C   . GLU F 3 52  ? 23.849  -0.676  2.646   1.00 76.60  ? 59  GLU J C   1 
ATOM   9014  O O   . GLU F 3 52  ? 24.978  -1.012  3.022   1.00 75.48  ? 59  GLU J O   1 
ATOM   9015  C CB  . GLU F 3 52  ? 23.155  -2.430  0.996   1.00 84.78  ? 59  GLU J CB  1 
ATOM   9016  C CG  . GLU F 3 52  ? 24.019  -3.667  1.177   1.00 89.60  ? 59  GLU J CG  1 
ATOM   9017  C CD  . GLU F 3 52  ? 23.354  -4.715  2.055   1.00 91.41  ? 59  GLU J CD  1 
ATOM   9018  O OE1 . GLU F 3 52  ? 22.176  -5.052  1.803   1.00 92.25  ? 59  GLU J OE1 1 
ATOM   9019  O OE2 . GLU F 3 52  ? 24.007  -5.191  3.008   1.00 87.78  ? 59  GLU J OE2 1 
ATOM   9020  N N   . ALA F 3 53  ? 23.486  0.601   2.518   1.00 73.54  ? 60  ALA J N   1 
ATOM   9021  C CA  . ALA F 3 53  ? 24.350  1.662   3.021   1.00 74.45  ? 60  ALA J CA  1 
ATOM   9022  C C   . ALA F 3 53  ? 24.379  1.653   4.543   1.00 70.94  ? 60  ALA J C   1 
ATOM   9023  O O   . ALA F 3 53  ? 25.454  1.692   5.156   1.00 68.70  ? 60  ALA J O   1 
ATOM   9024  C CB  . ALA F 3 53  ? 23.880  3.017   2.494   1.00 75.55  ? 60  ALA J CB  1 
ATOM   9025  N N   . PHE F 3 54  ? 23.202  1.576   5.170   1.00 68.89  ? 61  PHE J N   1 
ATOM   9026  C CA  . PHE F 3 54  ? 23.132  1.547   6.628   1.00 69.10  ? 61  PHE J CA  1 
ATOM   9027  C C   . PHE F 3 54  ? 23.921  0.370   7.187   1.00 68.67  ? 61  PHE J C   1 
ATOM   9028  O O   . PHE F 3 54  ? 24.718  0.526   8.120   1.00 66.67  ? 61  PHE J O   1 
ATOM   9029  C CB  . PHE F 3 54  ? 21.672  1.483   7.081   1.00 68.02  ? 61  PHE J CB  1 
ATOM   9030  C CG  . PHE F 3 54  ? 20.929  2.778   6.918   1.00 66.95  ? 61  PHE J CG  1 
ATOM   9031  C CD1 . PHE F 3 54  ? 21.249  3.876   7.697   1.00 66.72  ? 61  PHE J CD1 1 
ATOM   9032  C CD2 . PHE F 3 54  ? 19.909  2.897   5.990   1.00 65.05  ? 61  PHE J CD2 1 
ATOM   9033  C CE1 . PHE F 3 54  ? 20.571  5.069   7.551   1.00 65.74  ? 61  PHE J CE1 1 
ATOM   9034  C CE2 . PHE F 3 54  ? 19.226  4.087   5.841   1.00 65.68  ? 61  PHE J CE2 1 
ATOM   9035  C CZ  . PHE F 3 54  ? 19.558  5.174   6.622   1.00 65.09  ? 61  PHE J CZ  1 
ATOM   9036  N N   . ASN F 3 55  ? 23.732  -0.817  6.602   1.00 72.01  ? 62  ASN J N   1 
ATOM   9037  C CA  . ASN F 3 55  ? 24.459  -2.000  7.043   1.00 70.13  ? 62  ASN J CA  1 
ATOM   9038  C C   . ASN F 3 55  ? 25.967  -1.805  6.992   1.00 72.81  ? 62  ASN J C   1 
ATOM   9039  O O   . ASN F 3 55  ? 26.693  -2.493  7.718   1.00 76.94  ? 62  ASN J O   1 
ATOM   9040  C CB  . ASN F 3 55  ? 24.059  -3.206  6.196   1.00 69.86  ? 62  ASN J CB  1 
ATOM   9041  C CG  . ASN F 3 55  ? 22.696  -3.747  6.569   1.00 70.78  ? 62  ASN J CG  1 
ATOM   9042  O OD1 . ASN F 3 55  ? 22.516  -4.315  7.646   1.00 71.80  ? 62  ASN J OD1 1 
ATOM   9043  N ND2 . ASN F 3 55  ? 21.726  -3.574  5.678   1.00 72.26  ? 62  ASN J ND2 1 
ATOM   9044  N N   . ARG F 3 56  ? 26.456  -0.884  6.159   1.00 70.63  ? 63  ARG J N   1 
ATOM   9045  C CA  . ARG F 3 56  ? 27.875  -0.558  6.193   1.00 69.49  ? 63  ARG J CA  1 
ATOM   9046  C C   . ARG F 3 56  ? 28.193  0.363   7.364   1.00 66.81  ? 63  ARG J C   1 
ATOM   9047  O O   . ARG F 3 56  ? 29.096  0.078   8.160   1.00 73.59  ? 63  ARG J O   1 
ATOM   9048  C CB  . ARG F 3 56  ? 28.304  0.080   4.870   1.00 73.01  ? 63  ARG J CB  1 
ATOM   9049  C CG  . ARG F 3 56  ? 29.322  -0.744  4.098   1.00 78.07  ? 63  ARG J CG  1 
ATOM   9050  C CD  . ARG F 3 56  ? 29.704  -0.087  2.779   1.00 80.59  ? 63  ARG J CD  1 
ATOM   9051  N NE  . ARG F 3 56  ? 28.574  0.015   1.858   1.00 82.04  ? 63  ARG J NE  1 
ATOM   9052  C CZ  . ARG F 3 56  ? 27.959  1.152   1.546   1.00 80.54  ? 63  ARG J CZ  1 
ATOM   9053  N NH1 . ARG F 3 56  ? 28.364  2.299   2.077   1.00 86.49  ? 63  ARG J NH1 1 
ATOM   9054  N NH2 . ARG F 3 56  ? 26.940  1.144   0.697   1.00 73.28  ? 63  ARG J NH2 1 
ATOM   9055  N N   . ALA F 3 57  ? 27.436  1.456   7.502   1.00 67.45  ? 64  ALA J N   1 
ATOM   9056  C CA  . ALA F 3 57  ? 27.739  2.440   8.537   1.00 69.89  ? 64  ALA J CA  1 
ATOM   9057  C C   . ALA F 3 57  ? 27.614  1.839   9.932   1.00 69.58  ? 64  ALA J C   1 
ATOM   9058  O O   . ALA F 3 57  ? 28.434  2.121   10.815  1.00 68.15  ? 64  ALA J O   1 
ATOM   9059  C CB  . ALA F 3 57  ? 26.823  3.654   8.391   1.00 72.06  ? 64  ALA J CB  1 
ATOM   9060  N N   . VAL F 3 58  ? 26.604  0.991   10.144  1.00 69.27  ? 65  VAL J N   1 
ATOM   9061  C CA  . VAL F 3 58  ? 26.405  0.372   11.447  1.00 70.00  ? 65  VAL J CA  1 
ATOM   9062  C C   . VAL F 3 58  ? 27.583  -0.515  11.829  1.00 71.69  ? 65  VAL J C   1 
ATOM   9063  O O   . VAL F 3 58  ? 27.744  -0.856  13.006  1.00 73.25  ? 65  VAL J O   1 
ATOM   9064  C CB  . VAL F 3 58  ? 25.080  -0.420  11.459  1.00 69.85  ? 65  VAL J CB  1 
ATOM   9065  C CG1 . VAL F 3 58  ? 25.242  -1.741  10.729  1.00 74.25  ? 65  VAL J CG1 1 
ATOM   9066  C CG2 . VAL F 3 58  ? 24.594  -0.641  12.884  1.00 68.13  ? 65  VAL J CG2 1 
ATOM   9067  N N   . LYS F 3 59  ? 28.425  -0.890  10.861  1.00 75.53  ? 66  LYS J N   1 
ATOM   9068  C CA  . LYS F 3 59  ? 29.600  -1.684  11.192  1.00 78.41  ? 66  LYS J CA  1 
ATOM   9069  C C   . LYS F 3 59  ? 30.635  -0.876  11.967  1.00 73.70  ? 66  LYS J C   1 
ATOM   9070  O O   . LYS F 3 59  ? 31.482  -1.464  12.649  1.00 72.24  ? 66  LYS J O   1 
ATOM   9071  C CB  . LYS F 3 59  ? 30.216  -2.273  9.917   1.00 82.22  ? 66  LYS J CB  1 
ATOM   9072  C CG  . LYS F 3 59  ? 31.307  -3.308  10.173  1.00 89.41  ? 66  LYS J CG  1 
ATOM   9073  C CD  . LYS F 3 59  ? 31.324  -4.414  9.126   1.00 92.19  ? 66  LYS J CD  1 
ATOM   9074  C CE  . LYS F 3 59  ? 32.066  -5.646  9.642   1.00 91.40  ? 66  LYS J CE  1 
ATOM   9075  N NZ  . LYS F 3 59  ? 32.294  -6.666  8.581   1.00 92.33  ? 66  LYS J NZ  1 
ATOM   9076  N N   . SER F 3 60  ? 30.565  0.455   11.913  1.00 70.89  ? 67  SER J N   1 
ATOM   9077  C CA  . SER F 3 60  ? 31.551  1.313   12.558  1.00 72.87  ? 67  SER J CA  1 
ATOM   9078  C C   . SER F 3 60  ? 30.971  2.074   13.748  1.00 69.78  ? 67  SER J C   1 
ATOM   9079  O O   . SER F 3 60  ? 31.460  3.149   14.102  1.00 73.47  ? 67  SER J O   1 
ATOM   9080  C CB  . SER F 3 60  ? 32.156  2.281   11.542  1.00 74.89  ? 67  SER J CB  1 
ATOM   9081  O OG  . SER F 3 60  ? 31.145  2.966   10.824  1.00 77.41  ? 67  SER J OG  1 
ATOM   9082  N N   . LEU F 3 61  ? 29.935  1.527   14.378  1.00 68.18  ? 68  LEU J N   1 
ATOM   9083  C CA  . LEU F 3 61  ? 29.351  2.095   15.586  1.00 69.79  ? 68  LEU J CA  1 
ATOM   9084  C C   . LEU F 3 61  ? 29.426  1.075   16.712  1.00 72.52  ? 68  LEU J C   1 
ATOM   9085  O O   . LEU F 3 61  ? 29.193  -0.118  16.496  1.00 82.56  ? 68  LEU J O   1 
ATOM   9086  C CB  . LEU F 3 61  ? 27.890  2.507   15.364  1.00 69.50  ? 68  LEU J CB  1 
ATOM   9087  C CG  . LEU F 3 61  ? 27.583  3.610   14.351  1.00 71.53  ? 68  LEU J CG  1 
ATOM   9088  C CD1 . LEU F 3 61  ? 26.134  3.530   13.902  1.00 68.67  ? 68  LEU J CD1 1 
ATOM   9089  C CD2 . LEU F 3 61  ? 27.881  4.975   14.940  1.00 70.98  ? 68  LEU J CD2 1 
ATOM   9090  N N   . GLN F 3 62  ? 29.750  1.542   17.914  1.00 79.53  ? 69  GLN J N   1 
ATOM   9091  C CA  . GLN F 3 62  ? 29.759  0.667   19.076  1.00 80.47  ? 69  GLN J CA  1 
ATOM   9092  C C   . GLN F 3 62  ? 28.410  0.727   19.780  1.00 79.51  ? 69  GLN J C   1 
ATOM   9093  O O   . GLN F 3 62  ? 27.678  1.715   19.674  1.00 85.22  ? 69  GLN J O   1 
ATOM   9094  C CB  . GLN F 3 62  ? 30.886  1.040   20.042  1.00 82.40  ? 69  GLN J CB  1 
ATOM   9095  C CG  . GLN F 3 62  ? 30.654  2.293   20.858  1.00 83.24  ? 69  GLN J CG  1 
ATOM   9096  C CD  . GLN F 3 62  ? 31.926  2.782   21.525  1.00 84.78  ? 69  GLN J CD  1 
ATOM   9097  O OE1 . GLN F 3 62  ? 32.095  2.656   22.739  1.00 83.20  ? 69  GLN J OE1 1 
ATOM   9098  N NE2 . GLN F 3 62  ? 32.826  3.354   20.732  1.00 87.19  ? 69  GLN J NE2 1 
ATOM   9099  N N   . ASN F 3 63  ? 28.086  -0.355  20.494  1.00 81.17  ? 70  ASN J N   1 
ATOM   9100  C CA  . ASN F 3 63  ? 26.769  -0.542  21.108  1.00 80.44  ? 70  ASN J CA  1 
ATOM   9101  C C   . ASN F 3 63  ? 25.673  -0.561  20.047  1.00 78.55  ? 70  ASN J C   1 
ATOM   9102  O O   . ASN F 3 63  ? 24.579  -0.029  20.245  1.00 78.71  ? 70  ASN J O   1 
ATOM   9103  C CB  . ASN F 3 63  ? 26.478  0.528   22.161  1.00 83.08  ? 70  ASN J CB  1 
ATOM   9104  C CG  . ASN F 3 63  ? 27.678  0.828   23.037  1.00 86.55  ? 70  ASN J CG  1 
ATOM   9105  O OD1 . ASN F 3 63  ? 28.538  -0.028  23.249  1.00 94.53  ? 70  ASN J OD1 1 
ATOM   9106  N ND2 . ASN F 3 63  ? 27.737  2.049   23.558  1.00 86.24  ? 70  ASN J ND2 1 
ATOM   9107  N N   . ALA F 3 64  ? 25.974  -1.178  18.906  1.00 77.67  ? 71  ALA J N   1 
ATOM   9108  C CA  . ALA F 3 64  ? 25.082  -1.194  17.755  1.00 76.81  ? 71  ALA J CA  1 
ATOM   9109  C C   . ALA F 3 64  ? 24.525  -2.578  17.461  1.00 75.58  ? 71  ALA J C   1 
ATOM   9110  O O   . ALA F 3 64  ? 23.863  -2.762  16.434  1.00 72.62  ? 71  ALA J O   1 
ATOM   9111  C CB  . ALA F 3 64  ? 25.802  -0.656  16.521  1.00 78.99  ? 71  ALA J CB  1 
ATOM   9112  N N   . SER F 3 65  ? 24.762  -3.547  18.351  1.00 76.54  ? 72  SER J N   1 
ATOM   9113  C CA  . SER F 3 65  ? 24.470  -4.945  18.045  1.00 76.26  ? 72  SER J CA  1 
ATOM   9114  C C   . SER F 3 65  ? 22.997  -5.157  17.707  1.00 73.79  ? 72  SER J C   1 
ATOM   9115  O O   . SER F 3 65  ? 22.670  -5.895  16.771  1.00 71.35  ? 72  SER J O   1 
ATOM   9116  C CB  . SER F 3 65  ? 24.888  -5.832  19.217  1.00 80.04  ? 72  SER J CB  1 
ATOM   9117  O OG  . SER F 3 65  ? 26.152  -5.437  19.730  1.00 82.50  ? 72  SER J OG  1 
ATOM   9118  N N   . ALA F 3 66  ? 22.094  -4.506  18.444  1.00 67.82  ? 73  ALA J N   1 
ATOM   9119  C CA  . ALA F 3 66  ? 20.668  -4.694  18.191  1.00 68.98  ? 73  ALA J CA  1 
ATOM   9120  C C   . ALA F 3 66  ? 20.265  -4.114  16.841  1.00 67.37  ? 73  ALA J C   1 
ATOM   9121  O O   . ALA F 3 66  ? 19.564  -4.766  16.054  1.00 67.41  ? 73  ALA J O   1 
ATOM   9122  C CB  . ALA F 3 66  ? 19.845  -4.063  19.314  1.00 70.57  ? 73  ALA J CB  1 
ATOM   9123  N N   . ILE F 3 67  ? 20.696  -2.882  16.560  1.00 66.98  ? 74  ILE J N   1 
ATOM   9124  C CA  . ILE F 3 67  ? 20.350  -2.237  15.298  1.00 66.91  ? 74  ILE J CA  1 
ATOM   9125  C C   . ILE F 3 67  ? 20.946  -3.007  14.128  1.00 68.34  ? 74  ILE J C   1 
ATOM   9126  O O   . ILE F 3 67  ? 20.292  -3.208  13.099  1.00 67.98  ? 74  ILE J O   1 
ATOM   9127  C CB  . ILE F 3 67  ? 20.809  -0.767  15.301  1.00 67.94  ? 74  ILE J CB  1 
ATOM   9128  C CG1 . ILE F 3 67  ? 20.175  -0.002  16.469  1.00 68.77  ? 74  ILE J CG1 1 
ATOM   9129  C CG2 . ILE F 3 67  ? 20.479  -0.103  13.974  1.00 69.31  ? 74  ILE J CG2 1 
ATOM   9130  C CD1 . ILE F 3 67  ? 21.045  0.077   17.712  1.00 69.40  ? 74  ILE J CD1 1 
ATOM   9131  N N   . GLU F 3 68  ? 22.196  -3.451  14.271  1.00 71.31  ? 75  GLU J N   1 
ATOM   9132  C CA  . GLU F 3 68  ? 22.836  -4.258  13.237  1.00 72.81  ? 75  GLU J CA  1 
ATOM   9133  C C   . GLU F 3 68  ? 22.054  -5.542  12.986  1.00 72.62  ? 75  GLU J C   1 
ATOM   9134  O O   . GLU F 3 68  ? 21.759  -5.894  11.834  1.00 73.38  ? 75  GLU J O   1 
ATOM   9135  C CB  . GLU F 3 68  ? 24.272  -4.572  13.658  1.00 76.50  ? 75  GLU J CB  1 
ATOM   9136  C CG  . GLU F 3 68  ? 25.134  -5.240  12.604  1.00 78.44  ? 75  GLU J CG  1 
ATOM   9137  C CD  . GLU F 3 68  ? 26.596  -5.308  13.018  1.00 80.11  ? 75  GLU J CD  1 
ATOM   9138  O OE1 . GLU F 3 68  ? 26.903  -4.968  14.182  1.00 80.10  ? 75  GLU J OE1 1 
ATOM   9139  O OE2 . GLU F 3 68  ? 27.437  -5.700  12.181  1.00 79.71  ? 75  GLU J OE2 1 
ATOM   9140  N N   . SER F 3 69  ? 21.704  -6.249  14.063  1.00 69.32  ? 76  SER J N   1 
ATOM   9141  C CA  . SER F 3 69  ? 21.007  -7.522  13.929  1.00 70.87  ? 76  SER J CA  1 
ATOM   9142  C C   . SER F 3 69  ? 19.654  -7.345  13.254  1.00 68.89  ? 76  SER J C   1 
ATOM   9143  O O   . SER F 3 69  ? 19.258  -8.171  12.424  1.00 70.90  ? 76  SER J O   1 
ATOM   9144  C CB  . SER F 3 69  ? 20.847  -8.174  15.304  1.00 72.54  ? 76  SER J CB  1 
ATOM   9145  O OG  . SER F 3 69  ? 20.478  -9.540  15.195  1.00 76.03  ? 76  SER J OG  1 
ATOM   9146  N N   . ILE F 3 70  ? 18.930  -6.274  13.586  1.00 66.25  ? 77  ILE J N   1 
ATOM   9147  C CA  . ILE F 3 70  ? 17.627  -6.073  12.956  1.00 68.55  ? 77  ILE J CA  1 
ATOM   9148  C C   . ILE F 3 70  ? 17.791  -5.648  11.500  1.00 70.16  ? 77  ILE J C   1 
ATOM   9149  O O   . ILE F 3 70  ? 17.060  -6.118  10.619  1.00 71.48  ? 77  ILE J O   1 
ATOM   9150  C CB  . ILE F 3 70  ? 16.777  -5.064  13.746  1.00 68.31  ? 77  ILE J CB  1 
ATOM   9151  C CG1 . ILE F 3 70  ? 16.548  -5.554  15.171  1.00 68.37  ? 77  ILE J CG1 1 
ATOM   9152  C CG2 . ILE F 3 70  ? 15.435  -4.858  13.069  1.00 70.48  ? 77  ILE J CG2 1 
ATOM   9153  C CD1 . ILE F 3 70  ? 15.734  -4.592  16.000  1.00 70.37  ? 77  ILE J CD1 1 
ATOM   9154  N N   . LEU F 3 71  ? 18.749  -4.762  11.215  1.00 67.69  ? 78  LEU J N   1 
ATOM   9155  C CA  . LEU F 3 71  ? 18.944  -4.313  9.841   1.00 70.07  ? 78  LEU J CA  1 
ATOM   9156  C C   . LEU F 3 71  ? 19.360  -5.457  8.927   1.00 73.25  ? 78  LEU J C   1 
ATOM   9157  O O   . LEU F 3 71  ? 19.076  -5.422  7.724   1.00 77.09  ? 78  LEU J O   1 
ATOM   9158  C CB  . LEU F 3 71  ? 19.985  -3.195  9.788   1.00 69.41  ? 78  LEU J CB  1 
ATOM   9159  C CG  . LEU F 3 71  ? 19.547  -1.811  10.263  1.00 69.00  ? 78  LEU J CG  1 
ATOM   9160  C CD1 . LEU F 3 71  ? 20.702  -0.831  10.175  1.00 70.30  ? 78  LEU J CD1 1 
ATOM   9161  C CD2 . LEU F 3 71  ? 18.367  -1.323  9.448   1.00 70.55  ? 78  LEU J CD2 1 
ATOM   9162  N N   . LYS F 3 72  ? 20.036  -6.474  9.470   1.00 75.33  ? 79  LYS J N   1 
ATOM   9163  C CA  . LYS F 3 72  ? 20.418  -7.612  8.637   1.00 76.71  ? 79  LYS J CA  1 
ATOM   9164  C C   . LYS F 3 72  ? 19.194  -8.333  8.078   1.00 75.48  ? 79  LYS J C   1 
ATOM   9165  O O   . LYS F 3 72  ? 19.215  -8.811  6.938   1.00 80.94  ? 79  LYS J O   1 
ATOM   9166  C CB  . LYS F 3 72  ? 21.297  -8.582  9.427   1.00 80.25  ? 79  LYS J CB  1 
ATOM   9167  C CG  . LYS F 3 72  ? 22.690  -8.051  9.730   1.00 83.93  ? 79  LYS J CG  1 
ATOM   9168  C CD  . LYS F 3 72  ? 23.578  -8.073  8.494   1.00 88.16  ? 79  LYS J CD  1 
ATOM   9169  C CE  . LYS F 3 72  ? 24.639  -9.156  8.601   1.00 89.84  ? 79  LYS J CE  1 
ATOM   9170  N NZ  . LYS F 3 72  ? 25.576  -8.885  9.727   1.00 90.13  ? 79  LYS J NZ  1 
ATOM   9171  N N   . ASN F 3 73  ? 18.114  -8.410  8.858   1.00 74.24  ? 80  ASN J N   1 
ATOM   9172  C CA  . ASN F 3 73  ? 16.924  -9.167  8.489   1.00 75.65  ? 80  ASN J CA  1 
ATOM   9173  C C   . ASN F 3 73  ? 15.765  -8.278  8.052   1.00 77.21  ? 80  ASN J C   1 
ATOM   9174  O O   . ASN F 3 73  ? 14.612  -8.720  8.073   1.00 80.79  ? 80  ASN J O   1 
ATOM   9175  C CB  . ASN F 3 73  ? 16.485  -10.055 9.654   1.00 76.04  ? 80  ASN J CB  1 
ATOM   9176  C CG  . ASN F 3 73  ? 17.527  -11.086 10.023  1.00 75.69  ? 80  ASN J CG  1 
ATOM   9177  O OD1 . ASN F 3 73  ? 17.464  -12.233 9.579   1.00 81.55  ? 80  ASN J OD1 1 
ATOM   9178  N ND2 . ASN F 3 73  ? 18.502  -10.681 10.827  1.00 71.96  ? 80  ASN J ND2 1 
ATOM   9179  N N   . LEU F 3 74  ? 16.041  -7.042  7.650   1.00 77.51  ? 81  LEU J N   1 
ATOM   9180  C CA  . LEU F 3 74  ? 14.991  -6.092  7.309   1.00 78.07  ? 81  LEU J CA  1 
ATOM   9181  C C   . LEU F 3 74  ? 14.590  -6.142  5.838   1.00 77.71  ? 81  LEU J C   1 
ATOM   9182  O O   . LEU F 3 74  ? 13.646  -5.448  5.447   1.00 74.20  ? 81  LEU J O   1 
ATOM   9183  C CB  . LEU F 3 74  ? 15.438  -4.670  7.680   1.00 75.18  ? 81  LEU J CB  1 
ATOM   9184  C CG  . LEU F 3 74  ? 14.372  -3.580  7.813   1.00 72.77  ? 81  LEU J CG  1 
ATOM   9185  C CD1 . LEU F 3 74  ? 13.400  -3.918  8.929   1.00 72.59  ? 81  LEU J CD1 1 
ATOM   9186  C CD2 . LEU F 3 74  ? 15.018  -2.230  8.055   1.00 70.02  ? 81  LEU J CD2 1 
ATOM   9187  N N   . LEU F 3 75  ? 15.264  -6.953  5.023   1.00 78.26  ? 82  LEU J N   1 
ATOM   9188  C CA  . LEU F 3 75  ? 15.042  -6.891  3.580   1.00 79.98  ? 82  LEU J CA  1 
ATOM   9189  C C   . LEU F 3 75  ? 13.620  -7.247  3.154   1.00 79.79  ? 82  LEU J C   1 
ATOM   9190  O O   . LEU F 3 75  ? 13.100  -6.576  2.245   1.00 76.08  ? 82  LEU J O   1 
ATOM   9191  C CB  . LEU F 3 75  ? 16.066  -7.777  2.857   1.00 81.20  ? 82  LEU J CB  1 
ATOM   9192  C CG  . LEU F 3 75  ? 16.337  -7.384  1.400   1.00 84.01  ? 82  LEU J CG  1 
ATOM   9193  C CD1 . LEU F 3 75  ? 17.801  -7.598  1.051   1.00 85.11  ? 82  LEU J CD1 1 
ATOM   9194  C CD2 . LEU F 3 75  ? 15.436  -8.139  0.426   1.00 82.31  ? 82  LEU J CD2 1 
ATOM   9195  N N   . PRO F 3 76  ? 12.944  -8.255  3.723   1.00 79.44  ? 83  PRO J N   1 
ATOM   9196  C CA  . PRO F 3 76  ? 11.554  -8.520  3.310   1.00 79.64  ? 83  PRO J CA  1 
ATOM   9197  C C   . PRO F 3 76  ? 10.570  -7.431  3.709   1.00 80.05  ? 83  PRO J C   1 
ATOM   9198  O O   . PRO F 3 76  ? 9.400   -7.509  3.312   1.00 81.95  ? 83  PRO J O   1 
ATOM   9199  C CB  . PRO F 3 76  ? 11.220  -9.843  4.013   1.00 79.60  ? 83  PRO J CB  1 
ATOM   9200  C CG  . PRO F 3 76  ? 12.539  -10.456 4.319   1.00 81.94  ? 83  PRO J CG  1 
ATOM   9201  C CD  . PRO F 3 76  ? 13.441  -9.309  4.623   1.00 79.73  ? 83  PRO J CD  1 
ATOM   9202  N N   . CYS F 3 77  ? 10.998  -6.431  4.474   1.00 80.50  ? 84  CYS J N   1 
ATOM   9203  C CA  . CYS F 3 77  ? 10.140  -5.326  4.877   1.00 81.69  ? 84  CYS J CA  1 
ATOM   9204  C C   . CYS F 3 77  ? 10.153  -4.173  3.884   1.00 79.05  ? 84  CYS J C   1 
ATOM   9205  O O   . CYS F 3 77  ? 9.419   -3.199  4.078   1.00 75.31  ? 84  CYS J O   1 
ATOM   9206  C CB  . CYS F 3 77  ? 10.559  -4.821  6.258   1.00 86.23  ? 84  CYS J CB  1 
ATOM   9207  S SG  . CYS F 3 77  ? 10.528  -6.105  7.521   1.00 89.35  ? 84  CYS J SG  1 
ATOM   9208  N N   . LEU F 3 78  ? 10.964  -4.259  2.837   1.00 71.77  ? 85  LEU J N   1 
ATOM   9209  C CA  . LEU F 3 78  ? 11.048  -3.204  1.843   1.00 71.87  ? 85  LEU J CA  1 
ATOM   9210  C C   . LEU F 3 78  ? 10.085  -3.482  0.696   1.00 72.64  ? 85  LEU J C   1 
ATOM   9211  O O   . LEU F 3 78  ? 9.858   -4.640  0.335   1.00 73.10  ? 85  LEU J O   1 
ATOM   9212  C CB  . LEU F 3 78  ? 12.467  -3.096  1.294   1.00 71.69  ? 85  LEU J CB  1 
ATOM   9213  C CG  . LEU F 3 78  ? 13.629  -2.954  2.279   1.00 71.02  ? 85  LEU J CG  1 
ATOM   9214  C CD1 . LEU F 3 78  ? 14.858  -2.426  1.565   1.00 70.92  ? 85  LEU J CD1 1 
ATOM   9215  C CD2 . LEU F 3 78  ? 13.262  -2.048  3.434   1.00 71.31  ? 85  LEU J CD2 1 
ATOM   9216  N N   . PRO F 3 79  ? 9.500   -2.443  0.113   1.00 75.51  ? 86  PRO J N   1 
ATOM   9217  C CA  . PRO F 3 79  ? 8.648   -2.644  -1.061  1.00 75.63  ? 86  PRO J CA  1 
ATOM   9218  C C   . PRO F 3 79  ? 9.475   -2.969  -2.296  1.00 74.34  ? 86  PRO J C   1 
ATOM   9219  O O   . PRO F 3 79  ? 10.660  -2.642  -2.395  1.00 71.08  ? 86  PRO J O   1 
ATOM   9220  C CB  . PRO F 3 79  ? 7.926   -1.301  -1.211  1.00 78.25  ? 86  PRO J CB  1 
ATOM   9221  C CG  . PRO F 3 79  ? 8.853   -0.313  -0.581  1.00 78.26  ? 86  PRO J CG  1 
ATOM   9222  C CD  . PRO F 3 79  ? 9.534   -1.035  0.546   1.00 77.91  ? 86  PRO J CD  1 
ATOM   9223  N N   . LEU F 3 80  ? 8.824   -3.633  -3.249  1.00 77.35  ? 87  LEU J N   1 
ATOM   9224  C CA  . LEU F 3 80  ? 9.490   -4.015  -4.487  1.00 78.92  ? 87  LEU J CA  1 
ATOM   9225  C C   . LEU F 3 80  ? 9.843   -2.777  -5.300  1.00 74.15  ? 87  LEU J C   1 
ATOM   9226  O O   . LEU F 3 80  ? 9.021   -1.869  -5.455  1.00 74.23  ? 87  LEU J O   1 
ATOM   9227  C CB  . LEU F 3 80  ? 8.596   -4.944  -5.307  1.00 81.92  ? 87  LEU J CB  1 
ATOM   9228  C CG  . LEU F 3 80  ? 8.154   -6.251  -4.648  1.00 84.52  ? 87  LEU J CG  1 
ATOM   9229  C CD1 . LEU F 3 80  ? 6.878   -6.765  -5.294  1.00 83.84  ? 87  LEU J CD1 1 
ATOM   9230  C CD2 . LEU F 3 80  ? 9.260   -7.296  -4.726  1.00 82.49  ? 87  LEU J CD2 1 
ATOM   9231  N N   . ALA F 3 81  ? 11.068  -2.740  -5.817  1.00 77.34  ? 88  ALA J N   1 
ATOM   9232  C CA  . ALA F 3 81  ? 11.493  -1.639  -6.669  1.00 79.69  ? 88  ALA J CA  1 
ATOM   9233  C C   . ALA F 3 81  ? 10.912  -1.801  -8.066  1.00 78.81  ? 88  ALA J C   1 
ATOM   9234  O O   . ALA F 3 81  ? 10.820  -2.913  -8.591  1.00 78.82  ? 88  ALA J O   1 
ATOM   9235  C CB  . ALA F 3 81  ? 13.017  -1.572  -6.741  1.00 80.57  ? 88  ALA J CB  1 
ATOM   9236  N N   . THR F 3 82  ? 10.513  -0.681  -8.669  1.00 83.23  ? 89  THR J N   1 
ATOM   9237  C CA  . THR F 3 82  ? 9.986   -0.724  -10.033 1.00 81.18  ? 89  THR J CA  1 
ATOM   9238  C C   . THR F 3 82  ? 11.119  -0.859  -11.047 1.00 79.83  ? 89  THR J C   1 
ATOM   9239  O O   . THR F 3 82  ? 11.306  -1.919  -11.650 1.00 85.47  ? 89  THR J O   1 
ATOM   9240  C CB  . THR F 3 82  ? 9.134   0.519   -10.312 1.00 80.99  ? 89  THR J CB  1 
ATOM   9241  O OG1 . THR F 3 82  ? 9.802   1.688   -9.818  1.00 77.62  ? 89  THR J OG1 1 
ATOM   9242  C CG2 . THR F 3 82  ? 7.785   0.385   -9.635  1.00 80.25  ? 89  THR J CG2 1 
ATOM   9243  N N   . ALA F 3 83  ? 11.887  0.209   -11.240 1.00 80.42  ? 90  ALA J N   1 
ATOM   9244  C CA  . ALA F 3 83  ? 13.031  0.192   -12.136 1.00 85.16  ? 90  ALA J CA  1 
ATOM   9245  C C   . ALA F 3 83  ? 14.307  -0.099  -11.344 1.00 82.64  ? 90  ALA J C   1 
ATOM   9246  O O   . ALA F 3 83  ? 14.271  -0.530  -10.189 1.00 81.93  ? 90  ALA J O   1 
ATOM   9247  C CB  . ALA F 3 83  ? 13.127  1.514   -12.895 1.00 86.70  ? 90  ALA J CB  1 
ATOM   9248  N N   . ALA F 3 84  ? 15.446  0.126   -11.971 1.00 85.46  ? 91  ALA J N   1 
ATOM   9249  C CA  . ALA F 3 84  ? 16.748  0.049   -11.335 1.00 86.80  ? 91  ALA J CA  1 
ATOM   9250  C C   . ALA F 3 84  ? 17.093  1.398   -10.718 1.00 87.66  ? 91  ALA J C   1 
ATOM   9251  O O   . ALA F 3 84  ? 16.482  2.416   -11.058 1.00 83.96  ? 91  ALA J O   1 
ATOM   9252  C CB  . ALA F 3 84  ? 17.801  -0.363  -12.363 1.00 89.57  ? 91  ALA J CB  1 
ATOM   9253  N N   . PRO F 3 85  ? 18.051  1.454   -9.790  1.00 92.47  ? 92  PRO J N   1 
ATOM   9254  C CA  . PRO F 3 85  ? 18.414  2.753   -9.205  1.00 90.61  ? 92  PRO J CA  1 
ATOM   9255  C C   . PRO F 3 85  ? 19.009  3.685   -10.251 1.00 88.97  ? 92  PRO J C   1 
ATOM   9256  O O   . PRO F 3 85  ? 19.939  3.324   -10.976 1.00 87.61  ? 92  PRO J O   1 
ATOM   9257  C CB  . PRO F 3 85  ? 19.431  2.390   -8.114  1.00 88.46  ? 92  PRO J CB  1 
ATOM   9258  C CG  . PRO F 3 85  ? 19.347  0.912   -7.944  1.00 87.01  ? 92  PRO J CG  1 
ATOM   9259  C CD  . PRO F 3 85  ? 18.864  0.358   -9.238  1.00 91.72  ? 92  PRO J CD  1 
ATOM   9260  N N   . THR F 3 86  ? 18.449  4.894   -10.335 1.00 88.74  ? 93  THR J N   1 
ATOM   9261  C CA  . THR F 3 86  ? 18.923  5.930   -11.245 1.00 89.64  ? 93  THR J CA  1 
ATOM   9262  C C   . THR F 3 86  ? 19.437  7.144   -10.477 1.00 90.49  ? 93  THR J C   1 
ATOM   9263  O O   . THR F 3 86  ? 19.391  8.271   -10.974 1.00 85.33  ? 93  THR J O   1 
ATOM   9264  C CB  . THR F 3 86  ? 17.823  6.345   -12.222 1.00 91.56  ? 93  THR J CB  1 
ATOM   9265  O OG1 . THR F 3 86  ? 16.909  7.239   -11.573 1.00 92.66  ? 93  THR J OG1 1 
ATOM   9266  C CG2 . THR F 3 86  ? 17.065  5.125   -12.723 1.00 94.05  ? 93  THR J CG2 1 
ATOM   9267  N N   . ARG F 3 87  ? 19.927  6.922   -9.260  1.00 93.86  ? 94  ARG J N   1 
ATOM   9268  C CA  . ARG F 3 87  ? 20.456  7.989   -8.422  1.00 89.43  ? 94  ARG J CA  1 
ATOM   9269  C C   . ARG F 3 87  ? 21.384  7.375   -7.385  1.00 87.19  ? 94  ARG J C   1 
ATOM   9270  O O   . ARG F 3 87  ? 21.192  6.231   -6.965  1.00 90.86  ? 94  ARG J O   1 
ATOM   9271  C CB  . ARG F 3 87  ? 19.335  8.777   -7.734  1.00 87.99  ? 94  ARG J CB  1 
ATOM   9272  C CG  . ARG F 3 87  ? 19.764  10.135  -7.211  1.00 90.03  ? 94  ARG J CG  1 
ATOM   9273  C CD  . ARG F 3 87  ? 18.855  10.604  -6.088  1.00 89.40  ? 94  ARG J CD  1 
ATOM   9274  N NE  . ARG F 3 87  ? 17.443  10.414  -6.405  1.00 84.25  ? 94  ARG J NE  1 
ATOM   9275  C CZ  . ARG F 3 87  ? 16.458  11.131  -5.874  1.00 82.33  ? 94  ARG J CZ  1 
ATOM   9276  N NH1 . ARG F 3 87  ? 16.732  12.090  -5.000  1.00 79.31  ? 94  ARG J NH1 1 
ATOM   9277  N NH2 . ARG F 3 87  ? 15.198  10.891  -6.215  1.00 83.47  ? 94  ARG J NH2 1 
ATOM   9278  N N   . HIS F 3 88  ? 22.386  8.145   -6.977  1.00 84.67  ? 95  HIS J N   1 
ATOM   9279  C CA  . HIS F 3 88  ? 23.328  7.649   -5.988  1.00 84.26  ? 95  HIS J CA  1 
ATOM   9280  C C   . HIS F 3 88  ? 22.648  7.533   -4.624  1.00 84.08  ? 95  HIS J C   1 
ATOM   9281  O O   . HIS F 3 88  ? 21.882  8.420   -4.233  1.00 87.28  ? 95  HIS J O   1 
ATOM   9282  C CB  . HIS F 3 88  ? 24.544  8.568   -5.899  1.00 85.90  ? 95  HIS J CB  1 
ATOM   9283  C CG  . HIS F 3 88  ? 25.634  8.216   -6.862  1.00 86.47  ? 95  HIS J CG  1 
ATOM   9284  N ND1 . HIS F 3 88  ? 26.358  7.046   -6.771  1.00 87.71  ? 95  HIS J ND1 1 
ATOM   9285  C CD2 . HIS F 3 88  ? 26.122  8.877   -7.938  1.00 87.74  ? 95  HIS J CD2 1 
ATOM   9286  C CE1 . HIS F 3 88  ? 27.246  7.003   -7.748  1.00 89.47  ? 95  HIS J CE1 1 
ATOM   9287  N NE2 . HIS F 3 88  ? 27.123  8.102   -8.471  1.00 88.97  ? 95  HIS J NE2 1 
ATOM   9288  N N   . PRO F 3 89  ? 22.908  6.451   -3.878  1.00 77.71  ? 96  PRO J N   1 
ATOM   9289  C CA  . PRO F 3 89  ? 22.232  6.254   -2.587  1.00 76.30  ? 96  PRO J CA  1 
ATOM   9290  C C   . PRO F 3 89  ? 22.746  7.164   -1.481  1.00 74.18  ? 96  PRO J C   1 
ATOM   9291  O O   . PRO F 3 89  ? 23.589  8.036   -1.712  1.00 77.15  ? 96  PRO J O   1 
ATOM   9292  C CB  . PRO F 3 89  ? 22.524  4.785   -2.267  1.00 79.20  ? 96  PRO J CB  1 
ATOM   9293  C CG  . PRO F 3 89  ? 23.823  4.518   -2.946  1.00 79.44  ? 96  PRO J CG  1 
ATOM   9294  C CD  . PRO F 3 89  ? 23.797  5.327   -4.216  1.00 78.14  ? 96  PRO J CD  1 
ATOM   9295  N N   . ILE F 3 90  ? 22.245  6.950   -0.264  1.00 70.65  ? 97  ILE J N   1 
ATOM   9296  C CA  . ILE F 3 90  ? 22.586  7.818   0.854   1.00 70.70  ? 97  ILE J CA  1 
ATOM   9297  C C   . ILE F 3 90  ? 24.030  7.577   1.281   1.00 68.47  ? 97  ILE J C   1 
ATOM   9298  O O   . ILE F 3 90  ? 24.571  6.472   1.147   1.00 70.27  ? 97  ILE J O   1 
ATOM   9299  C CB  . ILE F 3 90  ? 21.606  7.590   2.020   1.00 70.57  ? 97  ILE J CB  1 
ATOM   9300  C CG1 . ILE F 3 90  ? 21.776  8.661   3.099   1.00 73.08  ? 97  ILE J CG1 1 
ATOM   9301  C CG2 . ILE F 3 90  ? 21.784  6.203   2.604   1.00 71.16  ? 97  ILE J CG2 1 
ATOM   9302  C CD1 . ILE F 3 90  ? 21.419  10.054  2.637   1.00 75.88  ? 97  ILE J CD1 1 
ATOM   9303  N N   . HIS F 3 91  ? 24.670  8.632   1.780   1.00 73.36  ? 98  HIS J N   1 
ATOM   9304  C CA  . HIS F 3 91  ? 26.024  8.559   2.309   1.00 76.50  ? 98  HIS J CA  1 
ATOM   9305  C C   . HIS F 3 91  ? 25.989  8.880   3.795   1.00 78.32  ? 98  HIS J C   1 
ATOM   9306  O O   . HIS F 3 91  ? 25.348  9.851   4.209   1.00 83.08  ? 98  HIS J O   1 
ATOM   9307  C CB  . HIS F 3 91  ? 26.963  9.525   1.580   1.00 82.15  ? 98  HIS J CB  1 
ATOM   9308  C CG  . HIS F 3 91  ? 28.317  9.640   2.210   1.00 86.11  ? 98  HIS J CG  1 
ATOM   9309  N ND1 . HIS F 3 91  ? 29.254  8.630   2.152   1.00 88.92  ? 98  HIS J ND1 1 
ATOM   9310  C CD2 . HIS F 3 91  ? 28.892  10.646  2.910   1.00 84.02  ? 98  HIS J CD2 1 
ATOM   9311  C CE1 . HIS F 3 91  ? 30.348  9.009   2.789   1.00 84.54  ? 98  HIS J CE1 1 
ATOM   9312  N NE2 . HIS F 3 91  ? 30.154  10.229  3.258   1.00 87.21  ? 98  HIS J NE2 1 
ATOM   9313  N N   . ILE F 3 92  ? 26.671  8.062   4.591   1.00 74.86  ? 99  ILE J N   1 
ATOM   9314  C CA  . ILE F 3 92  ? 26.715  8.226   6.038   1.00 72.83  ? 99  ILE J CA  1 
ATOM   9315  C C   . ILE F 3 92  ? 28.171  8.275   6.476   1.00 75.72  ? 99  ILE J C   1 
ATOM   9316  O O   . ILE F 3 92  ? 28.965  7.408   6.093   1.00 77.41  ? 99  ILE J O   1 
ATOM   9317  C CB  . ILE F 3 92  ? 25.968  7.092   6.766   1.00 73.75  ? 99  ILE J CB  1 
ATOM   9318  C CG1 . ILE F 3 92  ? 24.559  6.932   6.196   1.00 73.70  ? 99  ILE J CG1 1 
ATOM   9319  C CG2 . ILE F 3 92  ? 25.914  7.360   8.262   1.00 76.23  ? 99  ILE J CG2 1 
ATOM   9320  C CD1 . ILE F 3 92  ? 23.988  5.553   6.377   1.00 74.85  ? 99  ILE J CD1 1 
ATOM   9321  N N   . LYS F 3 93  ? 28.521  9.293   7.266   1.00 77.37  ? 100 LYS J N   1 
ATOM   9322  C CA  . LYS F 3 93  ? 29.862  9.377   7.827   1.00 76.58  ? 100 LYS J CA  1 
ATOM   9323  C C   . LYS F 3 93  ? 30.133  8.165   8.708   1.00 75.42  ? 100 LYS J C   1 
ATOM   9324  O O   . LYS F 3 93  ? 29.237  7.645   9.379   1.00 80.38  ? 100 LYS J O   1 
ATOM   9325  C CB  . LYS F 3 93  ? 30.033  10.666  8.629   1.00 80.10  ? 100 LYS J CB  1 
ATOM   9326  C CG  . LYS F 3 93  ? 30.797  11.750  7.886   1.00 89.07  ? 100 LYS J CG  1 
ATOM   9327  C CD  . LYS F 3 93  ? 30.563  13.127  8.492   1.00 94.52  ? 100 LYS J CD  1 
ATOM   9328  C CE  . LYS F 3 93  ? 30.955  13.163  9.965   1.00 94.38  ? 100 LYS J CE  1 
ATOM   9329  N NZ  . LYS F 3 93  ? 32.416  12.953  10.166  1.00 90.76  ? 100 LYS J NZ  1 
ATOM   9330  N N   . ASP F 3 94  ? 31.392  7.719   8.704   1.00 76.23  ? 101 ASP J N   1 
ATOM   9331  C CA  . ASP F 3 94  ? 31.736  6.435   9.308   1.00 78.39  ? 101 ASP J CA  1 
ATOM   9332  C C   . ASP F 3 94  ? 31.437  6.420   10.805  1.00 79.12  ? 101 ASP J C   1 
ATOM   9333  O O   . ASP F 3 94  ? 30.623  5.622   11.282  1.00 78.15  ? 101 ASP J O   1 
ATOM   9334  C CB  . ASP F 3 94  ? 33.205  6.105   9.039   1.00 79.85  ? 101 ASP J CB  1 
ATOM   9335  C CG  . ASP F 3 94  ? 33.372  5.019   7.991   1.00 84.16  ? 101 ASP J CG  1 
ATOM   9336  O OD1 . ASP F 3 94  ? 32.454  4.180   7.860   1.00 84.16  ? 101 ASP J OD1 1 
ATOM   9337  O OD2 . ASP F 3 94  ? 34.407  5.008   7.294   1.00 85.29  ? 101 ASP J OD2 1 
ATOM   9338  N N   . GLY F 3 95  ? 32.079  7.301   11.564  1.00 76.33  ? 102 GLY J N   1 
ATOM   9339  C CA  . GLY F 3 95  ? 31.923  7.296   13.001  1.00 75.95  ? 102 GLY J CA  1 
ATOM   9340  C C   . GLY F 3 95  ? 30.730  8.041   13.555  1.00 76.28  ? 102 GLY J C   1 
ATOM   9341  O O   . GLY F 3 95  ? 30.511  8.011   14.770  1.00 80.27  ? 102 GLY J O   1 
ATOM   9342  N N   . ASP F 3 96  ? 29.936  8.696   12.711  1.00 78.60  ? 103 ASP J N   1 
ATOM   9343  C CA  . ASP F 3 96  ? 28.890  9.596   13.185  1.00 76.19  ? 103 ASP J CA  1 
ATOM   9344  C C   . ASP F 3 96  ? 27.665  8.805   13.634  1.00 75.08  ? 103 ASP J C   1 
ATOM   9345  O O   . ASP F 3 96  ? 27.020  8.133   12.822  1.00 75.80  ? 103 ASP J O   1 
ATOM   9346  C CB  . ASP F 3 96  ? 28.517  10.588  12.085  1.00 76.22  ? 103 ASP J CB  1 
ATOM   9347  C CG  . ASP F 3 96  ? 27.876  11.851  12.627  1.00 76.55  ? 103 ASP J CG  1 
ATOM   9348  O OD1 . ASP F 3 96  ? 26.967  11.750  13.480  1.00 77.66  ? 103 ASP J OD1 1 
ATOM   9349  O OD2 . ASP F 3 96  ? 28.285  12.951  12.197  1.00 75.52  ? 103 ASP J OD2 1 
ATOM   9350  N N   . TRP F 3 97  ? 27.337  8.898   14.927  1.00 71.48  ? 104 TRP J N   1 
ATOM   9351  C CA  . TRP F 3 97  ? 26.118  8.275   15.436  1.00 69.57  ? 104 TRP J CA  1 
ATOM   9352  C C   . TRP F 3 97  ? 24.884  9.110   15.118  1.00 68.65  ? 104 TRP J C   1 
ATOM   9353  O O   . TRP F 3 97  ? 23.890  8.578   14.618  1.00 70.57  ? 104 TRP J O   1 
ATOM   9354  C CB  . TRP F 3 97  ? 26.216  8.044   16.947  1.00 68.07  ? 104 TRP J CB  1 
ATOM   9355  C CG  . TRP F 3 97  ? 24.870  7.785   17.594  1.00 68.62  ? 104 TRP J CG  1 
ATOM   9356  C CD1 . TRP F 3 97  ? 24.200  8.620   18.439  1.00 73.02  ? 104 TRP J CD1 1 
ATOM   9357  C CD2 . TRP F 3 97  ? 24.041  6.619   17.449  1.00 65.68  ? 104 TRP J CD2 1 
ATOM   9358  N NE1 . TRP F 3 97  ? 23.010  8.053   18.826  1.00 73.10  ? 104 TRP J NE1 1 
ATOM   9359  C CE2 . TRP F 3 97  ? 22.888  6.826   18.233  1.00 68.51  ? 104 TRP J CE2 1 
ATOM   9360  C CE3 . TRP F 3 97  ? 24.161  5.424   16.735  1.00 66.79  ? 104 TRP J CE3 1 
ATOM   9361  C CZ2 . TRP F 3 97  ? 21.864  5.886   18.322  1.00 71.48  ? 104 TRP J CZ2 1 
ATOM   9362  C CZ3 . TRP F 3 97  ? 23.139  4.490   16.825  1.00 68.15  ? 104 TRP J CZ3 1 
ATOM   9363  C CH2 . TRP F 3 97  ? 22.007  4.727   17.611  1.00 69.50  ? 104 TRP J CH2 1 
ATOM   9364  N N   . ASN F 3 98  ? 24.919  10.414  15.425  1.00 68.87  ? 105 ASN J N   1 
ATOM   9365  C CA  . ASN F 3 98  ? 23.738  11.262  15.253  1.00 70.45  ? 105 ASN J CA  1 
ATOM   9366  C C   . ASN F 3 98  ? 23.235  11.250  13.815  1.00 70.18  ? 105 ASN J C   1 
ATOM   9367  O O   . ASN F 3 98  ? 22.025  11.174  13.570  1.00 70.62  ? 105 ASN J O   1 
ATOM   9368  C CB  . ASN F 3 98  ? 24.051  12.696  15.687  1.00 71.78  ? 105 ASN J CB  1 
ATOM   9369  C CG  . ASN F 3 98  ? 24.098  12.854  17.190  1.00 73.25  ? 105 ASN J CG  1 
ATOM   9370  O OD1 . ASN F 3 98  ? 23.194  12.412  17.897  1.00 77.50  ? 105 ASN J OD1 1 
ATOM   9371  N ND2 . ASN F 3 98  ? 25.152  13.493  17.689  1.00 73.39  ? 105 ASN J ND2 1 
ATOM   9372  N N   . GLU F 3 99  ? 24.152  11.333  12.852  1.00 65.24  ? 106 GLU J N   1 
ATOM   9373  C CA  . GLU F 3 99  ? 23.769  11.327  11.444  1.00 67.04  ? 106 GLU J CA  1 
ATOM   9374  C C   . GLU F 3 99  ? 23.060  10.027  11.072  1.00 66.56  ? 106 GLU J C   1 
ATOM   9375  O O   . GLU F 3 99  ? 21.982  10.040  10.459  1.00 66.41  ? 106 GLU J O   1 
ATOM   9376  C CB  . GLU F 3 99  ? 25.020  11.537  10.592  1.00 69.54  ? 106 GLU J CB  1 
ATOM   9377  C CG  . GLU F 3 99  ? 24.795  11.578  9.105   1.00 73.23  ? 106 GLU J CG  1 
ATOM   9378  C CD  . GLU F 3 99  ? 26.082  11.838  8.347   1.00 77.22  ? 106 GLU J CD  1 
ATOM   9379  O OE1 . GLU F 3 99  ? 26.798  12.798  8.705   1.00 84.68  ? 106 GLU J OE1 1 
ATOM   9380  O OE2 . GLU F 3 99  ? 26.375  11.089  7.392   1.00 78.66  ? 106 GLU J OE2 1 
ATOM   9381  N N   . PHE F 3 100 ? 23.666  8.892   11.432  1.00 60.83  ? 107 PHE J N   1 
ATOM   9382  C CA  . PHE F 3 100 ? 23.070  7.585   11.176  1.00 61.05  ? 107 PHE J CA  1 
ATOM   9383  C C   . PHE F 3 100 ? 21.699  7.472   11.832  1.00 61.02  ? 107 PHE J C   1 
ATOM   9384  O O   . PHE F 3 100 ? 20.728  7.038   11.203  1.00 61.24  ? 107 PHE J O   1 
ATOM   9385  C CB  . PHE F 3 100 ? 24.026  6.501   11.683  1.00 61.10  ? 107 PHE J CB  1 
ATOM   9386  C CG  . PHE F 3 100 ? 23.446  5.113   11.705  1.00 61.30  ? 107 PHE J CG  1 
ATOM   9387  C CD1 . PHE F 3 100 ? 22.753  4.650   12.809  1.00 61.23  ? 107 PHE J CD1 1 
ATOM   9388  C CD2 . PHE F 3 100 ? 23.625  4.260   10.631  1.00 61.60  ? 107 PHE J CD2 1 
ATOM   9389  C CE1 . PHE F 3 100 ? 22.230  3.377   12.830  1.00 61.44  ? 107 PHE J CE1 1 
ATOM   9390  C CE2 . PHE F 3 100 ? 23.104  2.986   10.649  1.00 61.80  ? 107 PHE J CE2 1 
ATOM   9391  C CZ  . PHE F 3 100 ? 22.407  2.544   11.750  1.00 61.72  ? 107 PHE J CZ  1 
ATOM   9392  N N   . ARG F 3 101 ? 21.614  7.857   13.106  1.00 61.65  ? 108 ARG J N   1 
ATOM   9393  C CA  . ARG F 3 101 ? 20.360  7.842   13.852  1.00 62.40  ? 108 ARG J CA  1 
ATOM   9394  C C   . ARG F 3 101 ? 19.269  8.612   13.120  1.00 62.31  ? 108 ARG J C   1 
ATOM   9395  O O   . ARG F 3 101 ? 18.172  8.094   12.886  1.00 62.85  ? 108 ARG J O   1 
ATOM   9396  C CB  . ARG F 3 101 ? 20.608  8.442   15.238  1.00 65.00  ? 108 ARG J CB  1 
ATOM   9397  C CG  . ARG F 3 101 ? 19.544  8.170   16.276  1.00 68.52  ? 108 ARG J CG  1 
ATOM   9398  C CD  . ARG F 3 101 ? 19.176  9.450   17.017  1.00 72.15  ? 108 ARG J CD  1 
ATOM   9399  N NE  . ARG F 3 101 ? 20.286  9.995   17.798  1.00 71.74  ? 108 ARG J NE  1 
ATOM   9400  C CZ  . ARG F 3 101 ? 20.410  9.880   19.117  1.00 74.00  ? 108 ARG J CZ  1 
ATOM   9401  N NH1 . ARG F 3 101 ? 19.497  9.227   19.827  1.00 73.65  ? 108 ARG J NH1 1 
ATOM   9402  N NH2 . ARG F 3 101 ? 21.456  10.421  19.729  1.00 75.50  ? 108 ARG J NH2 1 
ATOM   9403  N N   . ARG F 3 102 ? 19.567  9.855   12.740  1.00 63.19  ? 109 ARG J N   1 
ATOM   9404  C CA  . ARG F 3 102 ? 18.577  10.716  12.103  1.00 65.48  ? 109 ARG J CA  1 
ATOM   9405  C C   . ARG F 3 102 ? 18.121  10.143  10.767  1.00 64.24  ? 109 ARG J C   1 
ATOM   9406  O O   . ARG F 3 102 ? 16.914  10.038  10.496  1.00 62.85  ? 109 ARG J O   1 
ATOM   9407  C CB  . ARG F 3 102 ? 19.175  12.110  11.919  1.00 67.03  ? 109 ARG J CB  1 
ATOM   9408  C CG  . ARG F 3 102 ? 18.207  13.177  11.470  1.00 67.16  ? 109 ARG J CG  1 
ATOM   9409  C CD  . ARG F 3 102 ? 18.924  14.512  11.330  1.00 67.07  ? 109 ARG J CD  1 
ATOM   9410  N NE  . ARG F 3 102 ? 19.727  14.831  12.509  1.00 63.80  ? 109 ARG J NE  1 
ATOM   9411  C CZ  . ARG F 3 102 ? 21.046  14.996  12.495  1.00 64.65  ? 109 ARG J CZ  1 
ATOM   9412  N NH1 . ARG F 3 102 ? 21.721  14.880  11.358  1.00 64.75  ? 109 ARG J NH1 1 
ATOM   9413  N NH2 . ARG F 3 102 ? 21.689  15.284  13.617  1.00 66.44  ? 109 ARG J NH2 1 
ATOM   9414  N N   . LYS F 3 103 ? 19.080  9.766   9.916   1.00 61.25  ? 110 LYS J N   1 
ATOM   9415  C CA  . LYS F 3 103 ? 18.732  9.276   8.587   1.00 61.61  ? 110 LYS J CA  1 
ATOM   9416  C C   . LYS F 3 103 ? 17.941  7.974   8.663   1.00 61.86  ? 110 LYS J C   1 
ATOM   9417  O O   . LYS F 3 103 ? 16.929  7.813   7.971   1.00 62.18  ? 110 LYS J O   1 
ATOM   9418  C CB  . LYS F 3 103 ? 19.993  9.108   7.740   1.00 61.70  ? 110 LYS J CB  1 
ATOM   9419  C CG  . LYS F 3 103 ? 20.573  10.427  7.273   1.00 61.60  ? 110 LYS J CG  1 
ATOM   9420  C CD  . LYS F 3 103 ? 21.908  10.254  6.578   1.00 61.71  ? 110 LYS J CD  1 
ATOM   9421  C CE  . LYS F 3 103 ? 22.489  11.609  6.200   1.00 61.63  ? 110 LYS J CE  1 
ATOM   9422  N NZ  . LYS F 3 103 ? 23.827  11.520  5.552   1.00 61.79  ? 110 LYS J NZ  1 
ATOM   9423  N N   . LEU F 3 104 ? 18.376  7.033   9.508   1.00 61.76  ? 111 LEU J N   1 
ATOM   9424  C CA  . LEU F 3 104 ? 17.650  5.773   9.624   1.00 62.01  ? 111 LEU J CA  1 
ATOM   9425  C C   . LEU F 3 104 ? 16.263  5.980   10.218  1.00 62.08  ? 111 LEU J C   1 
ATOM   9426  O O   . LEU F 3 104 ? 15.302  5.325   9.797   1.00 62.42  ? 111 LEU J O   1 
ATOM   9427  C CB  . LEU F 3 104 ? 18.449  4.779   10.463  1.00 61.90  ? 111 LEU J CB  1 
ATOM   9428  C CG  . LEU F 3 104 ? 17.818  3.390   10.567  1.00 62.18  ? 111 LEU J CG  1 
ATOM   9429  C CD1 . LEU F 3 104 ? 17.619  2.786   9.185   1.00 62.57  ? 111 LEU J CD1 1 
ATOM   9430  C CD2 . LEU F 3 104 ? 18.665  2.480   11.442  1.00 62.08  ? 111 LEU J CD2 1 
ATOM   9431  N N   . THR F 3 105 ? 16.136  6.881   11.199  1.00 61.80  ? 112 THR J N   1 
ATOM   9432  C CA  . THR F 3 105 ? 14.830  7.161   11.781  1.00 61.90  ? 112 THR J CA  1 
ATOM   9433  C C   . THR F 3 105 ? 13.867  7.669   10.719  1.00 62.19  ? 112 THR J C   1 
ATOM   9434  O O   . THR F 3 105 ? 12.719  7.212   10.632  1.00 62.52  ? 112 THR J O   1 
ATOM   9435  C CB  . THR F 3 105 ? 14.971  8.184   12.906  1.00 61.57  ? 112 THR J CB  1 
ATOM   9436  O OG1 . THR F 3 105 ? 15.941  7.722   13.850  1.00 61.36  ? 112 THR J OG1 1 
ATOM   9437  C CG2 . THR F 3 105 ? 13.650  8.375   13.620  1.00 61.73  ? 112 THR J CG2 1 
ATOM   9438  N N   . PHE F 3 106 ? 14.328  8.603   9.879   1.00 62.12  ? 113 PHE J N   1 
ATOM   9439  C CA  . PHE F 3 106 ? 13.448  9.133   8.840   1.00 62.43  ? 113 PHE J CA  1 
ATOM   9440  C C   . PHE F 3 106 ? 13.140  8.084   7.776   1.00 62.88  ? 113 PHE J C   1 
ATOM   9441  O O   . PHE F 3 106 ? 12.014  8.024   7.266   1.00 63.27  ? 113 PHE J O   1 
ATOM   9442  C CB  . PHE F 3 106 ? 14.062  10.376  8.202   1.00 62.28  ? 113 PHE J CB  1 
ATOM   9443  C CG  . PHE F 3 106 ? 13.174  11.021  7.180   1.00 62.63  ? 113 PHE J CG  1 
ATOM   9444  C CD1 . PHE F 3 106 ? 12.069  11.755  7.576   1.00 62.69  ? 113 PHE J CD1 1 
ATOM   9445  C CD2 . PHE F 3 106 ? 13.439  10.895  5.828   1.00 62.93  ? 113 PHE J CD2 1 
ATOM   9446  C CE1 . PHE F 3 106 ? 11.241  12.348  6.642   1.00 63.05  ? 113 PHE J CE1 1 
ATOM   9447  C CE2 . PHE F 3 106 ? 12.616  11.491  4.887   1.00 63.30  ? 113 PHE J CE2 1 
ATOM   9448  C CZ  . PHE F 3 106 ? 11.516  12.219  5.296   1.00 63.36  ? 113 PHE J CZ  1 
ATOM   9449  N N   . TYR F 3 107 ? 14.130  7.264   7.420   1.00 62.87  ? 114 TYR J N   1 
ATOM   9450  C CA  . TYR F 3 107 ? 13.919  6.177   6.467   1.00 63.31  ? 114 TYR J CA  1 
ATOM   9451  C C   . TYR F 3 107 ? 12.817  5.236   6.943   1.00 63.58  ? 114 TYR J C   1 
ATOM   9452  O O   . TYR F 3 107 ? 11.870  4.931   6.201   1.00 64.04  ? 114 TYR J O   1 
ATOM   9453  C CB  . TYR F 3 107 ? 15.246  5.440   6.272   1.00 63.22  ? 114 TYR J CB  1 
ATOM   9454  C CG  . TYR F 3 107 ? 15.221  4.166   5.458   1.00 63.65  ? 114 TYR J CG  1 
ATOM   9455  C CD1 . TYR F 3 107 ? 14.943  2.940   6.052   1.00 63.74  ? 114 TYR J CD1 1 
ATOM   9456  C CD2 . TYR F 3 107 ? 15.530  4.182   4.106   1.00 63.99  ? 114 TYR J CD2 1 
ATOM   9457  C CE1 . TYR F 3 107 ? 14.944  1.770   5.314   1.00 64.15  ? 114 TYR J CE1 1 
ATOM   9458  C CE2 . TYR F 3 107 ? 15.534  3.020   3.361   1.00 64.42  ? 114 TYR J CE2 1 
ATOM   9459  C CZ  . TYR F 3 107 ? 15.240  1.817   3.970   1.00 64.49  ? 114 TYR J CZ  1 
ATOM   9460  O OH  . TYR F 3 107 ? 15.245  0.660   3.227   1.00 64.94  ? 114 TYR J OH  1 
ATOM   9461  N N   . LEU F 3 108 ? 12.914  4.787   8.198   1.00 63.32  ? 115 LEU J N   1 
ATOM   9462  C CA  . LEU F 3 108 ? 11.900  3.906   8.766   1.00 63.58  ? 115 LEU J CA  1 
ATOM   9463  C C   . LEU F 3 108 ? 10.545  4.592   8.891   1.00 63.80  ? 115 LEU J C   1 
ATOM   9464  O O   . LEU F 3 108 ? 9.512   3.935   8.728   1.00 64.24  ? 115 LEU J O   1 
ATOM   9465  C CB  . LEU F 3 108 ? 12.369  3.398   10.128  1.00 63.28  ? 115 LEU J CB  1 
ATOM   9466  C CG  . LEU F 3 108 ? 13.621  2.527   10.033  1.00 63.16  ? 115 LEU J CG  1 
ATOM   9467  C CD1 . LEU F 3 108 ? 14.290  2.425   11.383  1.00 62.79  ? 115 LEU J CD1 1 
ATOM   9468  C CD2 . LEU F 3 108 ? 13.286  1.151   9.470   1.00 63.58  ? 115 LEU J CD2 1 
ATOM   9469  N N   . LYS F 3 109 ? 10.517  5.894   9.186   1.00 63.54  ? 116 LYS J N   1 
ATOM   9470  C CA  . LYS F 3 109 ? 9.238   6.592   9.228   1.00 63.79  ? 116 LYS J CA  1 
ATOM   9471  C C   . LYS F 3 109 ? 8.580   6.620   7.857   1.00 64.29  ? 116 LYS J C   1 
ATOM   9472  O O   . LYS F 3 109 ? 7.375   6.374   7.735   1.00 64.74  ? 116 LYS J O   1 
ATOM   9473  C CB  . LYS F 3 109 ? 9.421   8.016   9.755   1.00 63.42  ? 116 LYS J CB  1 
ATOM   9474  C CG  . LYS F 3 109 ? 8.162   8.884   9.683   1.00 63.70  ? 116 LYS J CG  1 
ATOM   9475  C CD  . LYS F 3 109 ? 6.990   8.249   10.401  1.00 64.04  ? 116 LYS J CD  1 
ATOM   9476  C CE  . LYS F 3 109 ? 5.867   9.248   10.595  1.00 64.26  ? 116 LYS J CE  1 
ATOM   9477  N NZ  . LYS F 3 109 ? 4.616   8.574   11.034  1.00 64.75  ? 116 LYS J NZ  1 
ATOM   9478  N N   . THR F 3 110 ? 9.351   6.925   6.811   1.00 64.26  ? 117 THR J N   1 
ATOM   9479  C CA  . THR F 3 110 ? 8.773   6.992   5.473   1.00 64.78  ? 117 THR J CA  1 
ATOM   9480  C C   . THR F 3 110 ? 8.407   5.620   4.925   1.00 65.27  ? 117 THR J C   1 
ATOM   9481  O O   . THR F 3 110 ? 7.596   5.539   3.996   1.00 67.80  ? 117 THR J O   1 
ATOM   9482  C CB  . THR F 3 110 ? 9.728   7.686   4.504   1.00 65.01  ? 117 THR J CB  1 
ATOM   9483  O OG1 . THR F 3 110 ? 10.927  6.913   4.371   1.00 64.50  ? 117 THR J OG1 1 
ATOM   9484  C CG2 . THR F 3 110 ? 10.067  9.070   5.005   1.00 66.09  ? 117 THR J CG2 1 
ATOM   9485  N N   . LEU F 3 111 ? 8.989   4.546   5.466   1.00 67.93  ? 118 LEU J N   1 
ATOM   9486  C CA  . LEU F 3 111 ? 8.600   3.208   5.028   1.00 68.84  ? 118 LEU J CA  1 
ATOM   9487  C C   . LEU F 3 111 ? 7.129   2.906   5.298   1.00 69.44  ? 118 LEU J C   1 
ATOM   9488  O O   . LEU F 3 111 ? 6.552   2.045   4.622   1.00 66.60  ? 118 LEU J O   1 
ATOM   9489  C CB  . LEU F 3 111 ? 9.472   2.156   5.713   1.00 68.80  ? 118 LEU J CB  1 
ATOM   9490  C CG  . LEU F 3 111 ? 9.547   0.780   5.052   1.00 71.61  ? 118 LEU J CG  1 
ATOM   9491  C CD1 . LEU F 3 111 ? 10.970  0.264   5.088   1.00 69.24  ? 118 LEU J CD1 1 
ATOM   9492  C CD2 . LEU F 3 111 ? 8.607   -0.200  5.737   1.00 81.02  ? 118 LEU J CD2 1 
ATOM   9493  N N   . GLU F 3 112 ? 6.510   3.594   6.260   1.00 69.54  ? 119 GLU J N   1 
ATOM   9494  C CA  . GLU F 3 112 ? 5.148   3.259   6.668   1.00 74.09  ? 119 GLU J CA  1 
ATOM   9495  C C   . GLU F 3 112 ? 4.162   3.450   5.520   1.00 78.49  ? 119 GLU J C   1 
ATOM   9496  O O   . GLU F 3 112 ? 3.564   2.483   5.033   1.00 86.79  ? 119 GLU J O   1 
ATOM   9497  C CB  . GLU F 3 112 ? 4.749   4.101   7.883   1.00 76.54  ? 119 GLU J CB  1 
ATOM   9498  C CG  . GLU F 3 112 ? 5.698   3.949   9.070   1.00 77.91  ? 119 GLU J CG  1 
ATOM   9499  C CD  . GLU F 3 112 ? 5.133   4.511   10.367  1.00 78.16  ? 119 GLU J CD  1 
ATOM   9500  O OE1 . GLU F 3 112 ? 4.283   5.430   10.308  1.00 74.01  ? 119 GLU J OE1 1 
ATOM   9501  O OE2 . GLU F 3 112 ? 5.543   4.028   11.447  1.00 71.68  ? 119 GLU J OE2 1 
ATOM   9502  N N   . ASN F 3 113 ? 3.990   4.695   5.074   1.00 88.47  ? 120 ASN J N   1 
ATOM   9503  C CA  . ASN F 3 113 ? 3.061   5.075   3.998   1.00 92.22  ? 120 ASN J CA  1 
ATOM   9504  C C   . ASN F 3 113 ? 1.718   4.336   4.059   1.00 95.28  ? 120 ASN J C   1 
ATOM   9505  O O   . ASN F 3 113 ? 0.658   4.956   4.174   1.00 88.21  ? 120 ASN J O   1 
ATOM   9506  C CB  . ASN F 3 113 ? 3.721   4.870   2.621   1.00 91.40  ? 120 ASN J CB  1 
ATOM   9507  C CG  . ASN F 3 113 ? 3.838   3.403   2.223   1.00 92.70  ? 120 ASN J CG  1 
ATOM   9508  O OD1 . ASN F 3 113 ? 2.853   2.764   1.844   1.00 89.45  ? 120 ASN J OD1 1 
ATOM   9509  N ND2 . ASN F 3 113 ? 5.051   2.866   2.303   1.00 97.21  ? 120 ASN J ND2 1 
ATOM   9510  N N   . ASP G 4 1   ? 39.069  -46.183 31.315  1.00 96.21  ? 241 ASP B N   1 
ATOM   9511  C CA  . ASP G 4 1   ? 38.157  -45.093 30.980  1.00 102.23 ? 241 ASP B CA  1 
ATOM   9512  C C   . ASP G 4 1   ? 36.936  -45.640 30.252  1.00 100.17 ? 241 ASP B C   1 
ATOM   9513  O O   . ASP G 4 1   ? 36.953  -45.804 29.031  1.00 94.37  ? 241 ASP B O   1 
ATOM   9514  C CB  . ASP G 4 1   ? 38.865  -44.033 30.124  1.00 106.86 ? 241 ASP B CB  1 
ATOM   9515  C CG  . ASP G 4 1   ? 37.991  -42.807 29.851  1.00 103.96 ? 241 ASP B CG  1 
ATOM   9516  O OD1 . ASP G 4 1   ? 36.902  -42.687 30.453  1.00 100.90 ? 241 ASP B OD1 1 
ATOM   9517  O OD2 . ASP G 4 1   ? 38.402  -41.951 29.036  1.00 96.84  ? 241 ASP B OD2 1 
ATOM   9518  N N   . GLU G 4 2   ? 35.871  -45.911 31.011  1.00 98.53  ? 242 GLU B N   1 
ATOM   9519  C CA  . GLU G 4 2   ? 34.673  -46.533 30.461  1.00 98.62  ? 242 GLU B CA  1 
ATOM   9520  C C   . GLU G 4 2   ? 33.827  -45.579 29.627  1.00 95.90  ? 242 GLU B C   1 
ATOM   9521  O O   . GLU G 4 2   ? 32.933  -46.042 28.912  1.00 98.87  ? 242 GLU B O   1 
ATOM   9522  C CB  . GLU G 4 2   ? 33.821  -47.116 31.591  1.00 100.16 ? 242 GLU B CB  1 
ATOM   9523  C CG  . GLU G 4 2   ? 34.550  -48.143 32.442  1.00 103.98 ? 242 GLU B CG  1 
ATOM   9524  C CD  . GLU G 4 2   ? 33.719  -48.630 33.614  1.00 104.59 ? 242 GLU B CD  1 
ATOM   9525  O OE1 . GLU G 4 2   ? 33.257  -49.790 33.579  1.00 100.68 ? 242 GLU B OE1 1 
ATOM   9526  O OE2 . GLU G 4 2   ? 33.526  -47.848 34.570  1.00 106.20 ? 242 GLU B OE2 1 
ATOM   9527  N N   . ALA G 4 3   ? 34.082  -44.272 29.693  1.00 92.89  ? 243 ALA B N   1 
ATOM   9528  C CA  . ALA G 4 3   ? 33.261  -43.326 28.943  1.00 93.12  ? 243 ALA B CA  1 
ATOM   9529  C C   . ALA G 4 3   ? 33.592  -43.326 27.458  1.00 91.30  ? 243 ALA B C   1 
ATOM   9530  O O   . ALA G 4 3   ? 32.700  -43.106 26.630  1.00 90.64  ? 243 ALA B O   1 
ATOM   9531  C CB  . ALA G 4 3   ? 33.425  -41.917 29.511  1.00 91.28  ? 243 ALA B CB  1 
ATOM   9532  N N   . GLN G 4 4   ? 34.849  -43.564 27.105  1.00 88.19  ? 244 GLN B N   1 
ATOM   9533  C CA  . GLN G 4 4   ? 35.249  -43.524 25.708  1.00 87.33  ? 244 GLN B CA  1 
ATOM   9534  C C   . GLN G 4 4   ? 34.538  -44.625 24.925  1.00 87.14  ? 244 GLN B C   1 
ATOM   9535  O O   . GLN G 4 4   ? 34.354  -45.734 25.440  1.00 98.40  ? 244 GLN B O   1 
ATOM   9536  C CB  . GLN G 4 4   ? 36.764  -43.692 25.590  1.00 89.91  ? 244 GLN B CB  1 
ATOM   9537  C CG  . GLN G 4 4   ? 37.565  -42.470 25.997  1.00 89.73  ? 244 GLN B CG  1 
ATOM   9538  C CD  . GLN G 4 4   ? 37.892  -41.581 24.819  1.00 92.59  ? 244 GLN B CD  1 
ATOM   9539  O OE1 . GLN G 4 4   ? 37.569  -41.906 23.677  1.00 94.13  ? 244 GLN B OE1 1 
ATOM   9540  N NE2 . GLN G 4 4   ? 38.545  -40.455 25.087  1.00 94.48  ? 244 GLN B NE2 1 
ATOM   9541  N N   . PRO G 4 5   ? 34.117  -44.357 23.690  1.00 83.43  ? 245 PRO B N   1 
ATOM   9542  C CA  . PRO G 4 5   ? 33.560  -45.428 22.859  1.00 85.15  ? 245 PRO B CA  1 
ATOM   9543  C C   . PRO G 4 5   ? 34.648  -46.401 22.437  1.00 86.49  ? 245 PRO B C   1 
ATOM   9544  O O   . PRO G 4 5   ? 35.801  -46.024 22.217  1.00 88.78  ? 245 PRO B O   1 
ATOM   9545  C CB  . PRO G 4 5   ? 32.979  -44.678 21.657  1.00 84.40  ? 245 PRO B CB  1 
ATOM   9546  C CG  . PRO G 4 5   ? 33.811  -43.449 21.559  1.00 86.21  ? 245 PRO B CG  1 
ATOM   9547  C CD  . PRO G 4 5   ? 34.168  -43.071 22.975  1.00 84.32  ? 245 PRO B CD  1 
ATOM   9548  N N   . GLN G 4 6   ? 34.270  -47.674 22.327  1.00 89.98  ? 246 GLN B N   1 
ATOM   9549  C CA  . GLN G 4 6   ? 35.238  -48.735 22.090  1.00 92.41  ? 246 GLN B CA  1 
ATOM   9550  C C   . GLN G 4 6   ? 34.726  -49.681 21.012  1.00 90.20  ? 246 GLN B C   1 
ATOM   9551  O O   . GLN G 4 6   ? 33.554  -49.645 20.622  1.00 84.99  ? 246 GLN B O   1 
ATOM   9552  C CB  . GLN G 4 6   ? 35.537  -49.506 23.380  1.00 91.86  ? 246 GLN B CB  1 
ATOM   9553  C CG  . GLN G 4 6   ? 34.322  -50.181 23.986  1.00 95.61  ? 246 GLN B CG  1 
ATOM   9554  C CD  . GLN G 4 6   ? 34.353  -50.175 25.498  1.00 100.02 ? 246 GLN B CD  1 
ATOM   9555  O OE1 . GLN G 4 6   ? 35.327  -49.733 26.107  1.00 95.17  ? 246 GLN B OE1 1 
ATOM   9556  N NE2 . GLN G 4 6   ? 33.288  -50.677 26.115  1.00 99.50  ? 246 GLN B NE2 1 
ATOM   9557  N N   . ASN G 4 7   ? 35.640  -50.529 20.530  1.00 88.20  ? 247 ASN B N   1 
ATOM   9558  C CA  . ASN G 4 7   ? 35.338  -51.596 19.572  1.00 89.72  ? 247 ASN B CA  1 
ATOM   9559  C C   . ASN G 4 7   ? 34.836  -51.029 18.243  1.00 88.09  ? 247 ASN B C   1 
ATOM   9560  O O   . ASN G 4 7   ? 33.790  -51.424 17.724  1.00 86.59  ? 247 ASN B O   1 
ATOM   9561  C CB  . ASN G 4 7   ? 34.338  -52.596 20.163  1.00 92.35  ? 247 ASN B CB  1 
ATOM   9562  C CG  . ASN G 4 7   ? 34.197  -53.852 19.323  1.00 92.58  ? 247 ASN B CG  1 
ATOM   9563  O OD1 . ASN G 4 7   ? 35.181  -54.406 18.836  1.00 95.10  ? 247 ASN B OD1 1 
ATOM   9564  N ND2 . ASN G 4 7   ? 32.962  -54.308 19.152  1.00 93.98  ? 247 ASN B ND2 1 
ATOM   9565  N N   . LEU G 4 8   ? 35.603  -50.098 17.683  1.00 85.21  ? 248 LEU B N   1 
ATOM   9566  C CA  . LEU G 4 8   ? 35.281  -49.540 16.375  1.00 85.03  ? 248 LEU B CA  1 
ATOM   9567  C C   . LEU G 4 8   ? 35.766  -50.510 15.306  1.00 85.66  ? 248 LEU B C   1 
ATOM   9568  O O   . LEU G 4 8   ? 36.972  -50.731 15.159  1.00 86.00  ? 248 LEU B O   1 
ATOM   9569  C CB  . LEU G 4 8   ? 35.915  -48.165 16.200  1.00 84.55  ? 248 LEU B CB  1 
ATOM   9570  C CG  . LEU G 4 8   ? 35.679  -47.491 14.844  1.00 84.38  ? 248 LEU B CG  1 
ATOM   9571  C CD1 . LEU G 4 8   ? 34.220  -47.592 14.421  1.00 84.25  ? 248 LEU B CD1 1 
ATOM   9572  C CD2 . LEU G 4 8   ? 36.127  -46.042 14.876  1.00 83.84  ? 248 LEU B CD2 1 
ATOM   9573  N N   . GLU G 4 9   ? 34.828  -51.099 14.571  1.00 89.83  ? 249 GLU B N   1 
ATOM   9574  C CA  . GLU G 4 9   ? 35.126  -52.002 13.470  1.00 94.70  ? 249 GLU B CA  1 
ATOM   9575  C C   . GLU G 4 9   ? 34.514  -51.444 12.194  1.00 92.86  ? 249 GLU B C   1 
ATOM   9576  O O   . GLU G 4 9   ? 33.445  -50.829 12.227  1.00 88.36  ? 249 GLU B O   1 
ATOM   9577  C CB  . GLU G 4 9   ? 34.582  -53.410 13.736  1.00 101.60 ? 249 GLU B CB  1 
ATOM   9578  C CG  . GLU G 4 9   ? 34.740  -53.886 15.172  1.00 103.57 ? 249 GLU B CG  1 
ATOM   9579  C CD  . GLU G 4 9   ? 34.596  -55.392 15.309  1.00 106.14 ? 249 GLU B CD  1 
ATOM   9580  O OE1 . GLU G 4 9   ? 34.170  -56.042 14.331  1.00 104.22 ? 249 GLU B OE1 1 
ATOM   9581  O OE2 . GLU G 4 9   ? 34.912  -55.926 16.395  1.00 111.83 ? 249 GLU B OE2 1 
ATOM   9582  N N   . CYS G 4 10  ? 35.196  -51.648 11.071  1.00 98.17  ? 250 CYS B N   1 
ATOM   9583  C CA  . CYS G 4 10  ? 34.704  -51.177 9.783   1.00 101.14 ? 250 CYS B CA  1 
ATOM   9584  C C   . CYS G 4 10  ? 35.059  -52.195 8.712   1.00 100.64 ? 250 CYS B C   1 
ATOM   9585  O O   . CYS G 4 10  ? 36.214  -52.620 8.617   1.00 100.62 ? 250 CYS B O   1 
ATOM   9586  C CB  . CYS G 4 10  ? 35.291  -49.806 9.431   1.00 104.23 ? 250 CYS B CB  1 
ATOM   9587  S SG  . CYS G 4 10  ? 34.719  -48.454 10.487  1.00 109.42 ? 250 CYS B SG  1 
ATOM   9588  N N   . PHE G 4 11  ? 34.069  -52.579 7.908   1.00 95.54  ? 251 PHE B N   1 
ATOM   9589  C CA  . PHE G 4 11  ? 34.242  -53.619 6.903   1.00 97.18  ? 251 PHE B CA  1 
ATOM   9590  C C   . PHE G 4 11  ? 33.622  -53.177 5.587   1.00 99.31  ? 251 PHE B C   1 
ATOM   9591  O O   . PHE G 4 11  ? 32.508  -52.646 5.566   1.00 98.90  ? 251 PHE B O   1 
ATOM   9592  C CB  . PHE G 4 11  ? 33.622  -54.937 7.378   1.00 98.93  ? 251 PHE B CB  1 
ATOM   9593  C CG  . PHE G 4 11  ? 34.287  -55.508 8.596   1.00 103.74 ? 251 PHE B CG  1 
ATOM   9594  C CD1 . PHE G 4 11  ? 35.657  -55.716 8.616   1.00 108.68 ? 251 PHE B CD1 1 
ATOM   9595  C CD2 . PHE G 4 11  ? 33.550  -55.820 9.726   1.00 104.58 ? 251 PHE B CD2 1 
ATOM   9596  C CE1 . PHE G 4 11  ? 36.279  -56.233 9.736   1.00 110.06 ? 251 PHE B CE1 1 
ATOM   9597  C CE2 . PHE G 4 11  ? 34.168  -56.337 10.851  1.00 108.36 ? 251 PHE B CE2 1 
ATOM   9598  C CZ  . PHE G 4 11  ? 35.535  -56.544 10.854  1.00 109.78 ? 251 PHE B CZ  1 
ATOM   9599  N N   . PHE G 4 12  ? 34.347  -53.401 4.495   1.00 106.25 ? 252 PHE B N   1 
ATOM   9600  C CA  . PHE G 4 12  ? 33.931  -52.984 3.162   1.00 110.90 ? 252 PHE B CA  1 
ATOM   9601  C C   . PHE G 4 12  ? 33.335  -54.182 2.436   1.00 110.09 ? 252 PHE B C   1 
ATOM   9602  O O   . PHE G 4 12  ? 33.962  -55.243 2.367   1.00 105.31 ? 252 PHE B O   1 
ATOM   9603  C CB  . PHE G 4 12  ? 35.123  -52.418 2.383   1.00 113.68 ? 252 PHE B CB  1 
ATOM   9604  C CG  . PHE G 4 12  ? 34.781  -51.888 1.009   1.00 116.03 ? 252 PHE B CG  1 
ATOM   9605  C CD1 . PHE G 4 12  ? 33.485  -51.537 0.673   1.00 119.39 ? 252 PHE B CD1 1 
ATOM   9606  C CD2 . PHE G 4 12  ? 35.772  -51.742 0.052   1.00 113.94 ? 252 PHE B CD2 1 
ATOM   9607  C CE1 . PHE G 4 12  ? 33.182  -51.055 -0.586  1.00 117.45 ? 252 PHE B CE1 1 
ATOM   9608  C CE2 . PHE G 4 12  ? 35.474  -51.259 -1.209  1.00 115.52 ? 252 PHE B CE2 1 
ATOM   9609  C CZ  . PHE G 4 12  ? 34.177  -50.916 -1.527  1.00 114.46 ? 252 PHE B CZ  1 
ATOM   9610  N N   . ASP G 4 13  ? 32.125  -54.013 1.904   1.00 110.37 ? 253 ASP B N   1 
ATOM   9611  C CA  . ASP G 4 13  ? 31.436  -55.075 1.180   1.00 115.52 ? 253 ASP B CA  1 
ATOM   9612  C C   . ASP G 4 13  ? 31.899  -55.217 -0.269  1.00 120.28 ? 253 ASP B C   1 
ATOM   9613  O O   . ASP G 4 13  ? 31.249  -55.928 -1.044  1.00 117.64 ? 253 ASP B O   1 
ATOM   9614  C CB  . ASP G 4 13  ? 29.921  -54.843 1.226   1.00 113.02 ? 253 ASP B CB  1 
ATOM   9615  C CG  . ASP G 4 13  ? 29.489  -53.615 0.444   1.00 112.74 ? 253 ASP B CG  1 
ATOM   9616  O OD1 . ASP G 4 13  ? 30.355  -52.800 0.060   1.00 116.37 ? 253 ASP B OD1 1 
ATOM   9617  O OD2 . ASP G 4 13  ? 28.272  -53.464 0.211   1.00 114.85 ? 253 ASP B OD2 1 
ATOM   9618  N N   . GLY G 4 14  ? 32.993  -54.559 -0.648  1.00 123.11 ? 254 GLY B N   1 
ATOM   9619  C CA  . GLY G 4 14  ? 33.527  -54.650 -1.990  1.00 121.42 ? 254 GLY B CA  1 
ATOM   9620  C C   . GLY G 4 14  ? 32.772  -53.875 -3.047  1.00 123.45 ? 254 GLY B C   1 
ATOM   9621  O O   . GLY G 4 14  ? 33.154  -53.940 -4.223  1.00 122.07 ? 254 GLY B O   1 
ATOM   9622  N N   . ALA G 4 15  ? 31.719  -53.145 -2.677  1.00 125.52 ? 255 ALA B N   1 
ATOM   9623  C CA  . ALA G 4 15  ? 30.933  -52.404 -3.657  1.00 121.83 ? 255 ALA B CA  1 
ATOM   9624  C C   . ALA G 4 15  ? 30.201  -51.218 -3.035  1.00 124.13 ? 255 ALA B C   1 
ATOM   9625  O O   . ALA G 4 15  ? 28.990  -51.282 -2.798  1.00 125.84 ? 255 ALA B O   1 
ATOM   9626  C CB  . ALA G 4 15  ? 29.933  -53.333 -4.349  1.00 116.49 ? 255 ALA B CB  1 
ATOM   9627  N N   . ALA G 4 16  ? 30.941  -50.145 -2.749  1.00 120.58 ? 256 ALA B N   1 
ATOM   9628  C CA  . ALA G 4 16  ? 30.408  -48.815 -2.459  1.00 119.09 ? 256 ALA B CA  1 
ATOM   9629  C C   . ALA G 4 16  ? 29.716  -48.699 -1.104  1.00 117.90 ? 256 ALA B C   1 
ATOM   9630  O O   . ALA G 4 16  ? 28.954  -47.751 -0.887  1.00 118.47 ? 256 ALA B O   1 
ATOM   9631  C CB  . ALA G 4 16  ? 29.453  -48.348 -3.565  1.00 118.35 ? 256 ALA B CB  1 
ATOM   9632  N N   . VAL G 4 17  ? 29.956  -49.623 -0.173  1.00 117.01 ? 257 VAL B N   1 
ATOM   9633  C CA  . VAL G 4 17  ? 29.375  -49.541 1.167   1.00 109.21 ? 257 VAL B CA  1 
ATOM   9634  C C   . VAL G 4 17  ? 30.418  -49.979 2.186   1.00 105.23 ? 257 VAL B C   1 
ATOM   9635  O O   . VAL G 4 17  ? 30.865  -51.131 2.166   1.00 101.94 ? 257 VAL B O   1 
ATOM   9636  C CB  . VAL G 4 17  ? 28.106  -50.399 1.322   1.00 110.01 ? 257 VAL B CB  1 
ATOM   9637  C CG1 . VAL G 4 17  ? 27.574  -50.279 2.738   1.00 107.82 ? 257 VAL B CG1 1 
ATOM   9638  C CG2 . VAL G 4 17  ? 27.034  -49.984 0.326   1.00 110.64 ? 257 VAL B CG2 1 
ATOM   9639  N N   . LEU G 4 18  ? 30.793  -49.072 3.086   1.00 97.07  ? 258 LEU B N   1 
ATOM   9640  C CA  . LEU G 4 18  ? 31.659  -49.376 4.219   1.00 95.93  ? 258 LEU B CA  1 
ATOM   9641  C C   . LEU G 4 18  ? 30.787  -49.363 5.468   1.00 98.92  ? 258 LEU B C   1 
ATOM   9642  O O   . LEU G 4 18  ? 30.316  -48.302 5.892   1.00 99.37  ? 258 LEU B O   1 
ATOM   9643  C CB  . LEU G 4 18  ? 32.799  -48.366 4.327   1.00 94.49  ? 258 LEU B CB  1 
ATOM   9644  C CG  . LEU G 4 18  ? 33.740  -48.496 5.525   1.00 96.05  ? 258 LEU B CG  1 
ATOM   9645  C CD1 . LEU G 4 18  ? 34.437  -49.838 5.503   1.00 103.86 ? 258 LEU B CD1 1 
ATOM   9646  C CD2 . LEU G 4 18  ? 34.759  -47.374 5.533   1.00 96.59  ? 258 LEU B CD2 1 
ATOM   9647  N N   . SER G 4 19  ? 30.545  -50.542 6.036   1.00 103.22 ? 259 SER B N   1 
ATOM   9648  C CA  . SER G 4 19  ? 29.718  -50.668 7.229   1.00 98.43  ? 259 SER B CA  1 
ATOM   9649  C C   . SER G 4 19  ? 30.610  -50.562 8.458   1.00 97.50  ? 259 SER B C   1 
ATOM   9650  O O   . SER G 4 19  ? 31.522  -51.376 8.642   1.00 91.85  ? 259 SER B O   1 
ATOM   9651  C CB  . SER G 4 19  ? 28.953  -51.991 7.230   1.00 95.99  ? 259 SER B CB  1 
ATOM   9652  O OG  . SER G 4 19  ? 27.918  -51.981 6.265   1.00 95.67  ? 259 SER B OG  1 
ATOM   9653  N N   . CYS G 4 20  ? 30.360  -49.553 9.283   1.00 96.75  ? 260 CYS B N   1 
ATOM   9654  C CA  . CYS G 4 20  ? 31.094  -49.375 10.523  1.00 96.69  ? 260 CYS B CA  1 
ATOM   9655  C C   . CYS G 4 20  ? 30.168  -49.613 11.706  1.00 99.05  ? 260 CYS B C   1 
ATOM   9656  O O   . CYS G 4 20  ? 28.942  -49.514 11.598  1.00 99.22  ? 260 CYS B O   1 
ATOM   9657  C CB  . CYS G 4 20  ? 31.711  -47.975 10.608  1.00 97.86  ? 260 CYS B CB  1 
ATOM   9658  S SG  . CYS G 4 20  ? 33.113  -47.690 9.502   1.00 102.48 ? 260 CYS B SG  1 
ATOM   9659  N N   . SER G 4 21  ? 30.782  -49.917 12.845  1.00 100.32 ? 261 SER B N   1 
ATOM   9660  C CA  . SER G 4 21  ? 30.054  -50.329 14.033  1.00 95.32  ? 261 SER B CA  1 
ATOM   9661  C C   . SER G 4 21  ? 30.920  -50.078 15.258  1.00 89.80  ? 261 SER B C   1 
ATOM   9662  O O   . SER G 4 21  ? 32.118  -50.369 15.242  1.00 88.70  ? 261 SER B O   1 
ATOM   9663  C CB  . SER G 4 21  ? 29.667  -51.808 13.942  1.00 95.29  ? 261 SER B CB  1 
ATOM   9664  O OG  . SER G 4 21  ? 29.646  -52.405 15.223  1.00 96.10  ? 261 SER B OG  1 
ATOM   9665  N N   . TRP G 4 22  ? 30.307  -49.543 16.313  1.00 86.78  ? 262 TRP B N   1 
ATOM   9666  C CA  . TRP G 4 22  ? 31.043  -49.298 17.551  1.00 89.79  ? 262 TRP B CA  1 
ATOM   9667  C C   . TRP G 4 22  ? 30.093  -49.263 18.739  1.00 86.49  ? 262 TRP B C   1 
ATOM   9668  O O   . TRP G 4 22  ? 28.912  -48.952 18.594  1.00 85.69  ? 262 TRP B O   1 
ATOM   9669  C CB  . TRP G 4 22  ? 31.850  -47.996 17.477  1.00 90.48  ? 262 TRP B CB  1 
ATOM   9670  C CG  . TRP G 4 22  ? 31.045  -46.753 17.693  1.00 91.60  ? 262 TRP B CG  1 
ATOM   9671  C CD1 . TRP G 4 22  ? 30.992  -46.001 18.829  1.00 92.84  ? 262 TRP B CD1 1 
ATOM   9672  C CD2 . TRP G 4 22  ? 30.195  -46.101 16.741  1.00 92.32  ? 262 TRP B CD2 1 
ATOM   9673  N NE1 . TRP G 4 22  ? 30.154  -44.928 18.648  1.00 91.90  ? 262 TRP B NE1 1 
ATOM   9674  C CE2 . TRP G 4 22  ? 29.653  -44.966 17.375  1.00 91.91  ? 262 TRP B CE2 1 
ATOM   9675  C CE3 . TRP G 4 22  ? 29.837  -46.369 15.416  1.00 93.10  ? 262 TRP B CE3 1 
ATOM   9676  C CZ2 . TRP G 4 22  ? 28.771  -44.102 16.731  1.00 89.06  ? 262 TRP B CZ2 1 
ATOM   9677  C CZ3 . TRP G 4 22  ? 28.962  -45.508 14.778  1.00 90.70  ? 262 TRP B CZ3 1 
ATOM   9678  C CH2 . TRP G 4 22  ? 28.440  -44.389 15.437  1.00 88.86  ? 262 TRP B CH2 1 
ATOM   9679  N N   . GLU G 4 23  ? 30.626  -49.580 19.917  1.00 82.98  ? 263 GLU B N   1 
ATOM   9680  C CA  . GLU G 4 23  ? 29.841  -49.674 21.140  1.00 87.69  ? 263 GLU B CA  1 
ATOM   9681  C C   . GLU G 4 23  ? 30.164  -48.512 22.067  1.00 85.39  ? 263 GLU B C   1 
ATOM   9682  O O   . GLU G 4 23  ? 31.314  -48.069 22.140  1.00 86.00  ? 263 GLU B O   1 
ATOM   9683  C CB  . GLU G 4 23  ? 30.120  -50.991 21.868  1.00 95.80  ? 263 GLU B CB  1 
ATOM   9684  C CG  . GLU G 4 23  ? 29.932  -52.238 21.029  1.00 96.73  ? 263 GLU B CG  1 
ATOM   9685  C CD  . GLU G 4 23  ? 30.579  -53.451 21.662  1.00 92.54  ? 263 GLU B CD  1 
ATOM   9686  O OE1 . GLU G 4 23  ? 30.892  -54.411 20.927  1.00 91.48  ? 263 GLU B OE1 1 
ATOM   9687  O OE2 . GLU G 4 23  ? 30.775  -53.442 22.896  1.00 86.09  ? 263 GLU B OE2 1 
ATOM   9688  N N   . VAL G 4 24  ? 29.151  -48.030 22.791  1.00 84.93  ? 264 VAL B N   1 
ATOM   9689  C CA  . VAL G 4 24  ? 29.358  -46.988 23.792  1.00 87.15  ? 264 VAL B CA  1 
ATOM   9690  C C   . VAL G 4 24  ? 28.423  -47.245 24.968  1.00 85.80  ? 264 VAL B C   1 
ATOM   9691  O O   . VAL G 4 24  ? 27.325  -47.782 24.802  1.00 84.02  ? 264 VAL B O   1 
ATOM   9692  C CB  . VAL G 4 24  ? 29.142  -45.570 23.209  1.00 88.92  ? 264 VAL B CB  1 
ATOM   9693  C CG1 . VAL G 4 24  ? 27.683  -45.342 22.857  1.00 87.32  ? 264 VAL B CG1 1 
ATOM   9694  C CG2 . VAL G 4 24  ? 29.641  -44.506 24.175  1.00 89.34  ? 264 VAL B CG2 1 
ATOM   9695  N N   . ARG G 4 25  ? 28.871  -46.867 26.166  1.00 83.82  ? 265 ARG B N   1 
ATOM   9696  C CA  . ARG G 4 25  ? 28.070  -47.062 27.370  1.00 86.41  ? 265 ARG B CA  1 
ATOM   9697  C C   . ARG G 4 25  ? 26.696  -46.418 27.219  1.00 89.14  ? 265 ARG B C   1 
ATOM   9698  O O   . ARG G 4 25  ? 26.540  -45.380 26.572  1.00 91.42  ? 265 ARG B O   1 
ATOM   9699  C CB  . ARG G 4 25  ? 28.789  -46.479 28.587  1.00 87.27  ? 265 ARG B CB  1 
ATOM   9700  C CG  . ARG G 4 25  ? 29.981  -47.290 29.051  1.00 90.93  ? 265 ARG B CG  1 
ATOM   9701  C CD  . ARG G 4 25  ? 29.545  -48.610 29.661  1.00 93.55  ? 265 ARG B CD  1 
ATOM   9702  N NE  . ARG G 4 25  ? 28.769  -48.418 30.882  1.00 88.41  ? 265 ARG B NE  1 
ATOM   9703  C CZ  . ARG G 4 25  ? 29.269  -48.524 32.109  1.00 87.93  ? 265 ARG B CZ  1 
ATOM   9704  N NH1 . ARG G 4 25  ? 30.548  -48.826 32.280  1.00 86.86  ? 265 ARG B NH1 1 
ATOM   9705  N NH2 . ARG G 4 25  ? 28.491  -48.331 33.166  1.00 86.43  ? 265 ARG B NH2 1 
ATOM   9706  N N   . LYS G 4 26  ? 25.690  -47.050 27.828  1.00 90.90  ? 266 LYS B N   1 
ATOM   9707  C CA  . LYS G 4 26  ? 24.324  -46.549 27.713  1.00 89.15  ? 266 LYS B CA  1 
ATOM   9708  C C   . LYS G 4 26  ? 24.150  -45.242 28.477  1.00 84.34  ? 266 LYS B C   1 
ATOM   9709  O O   . LYS G 4 26  ? 23.444  -44.336 28.017  1.00 86.13  ? 266 LYS B O   1 
ATOM   9710  C CB  . LYS G 4 26  ? 23.341  -47.611 28.208  1.00 94.42  ? 266 LYS B CB  1 
ATOM   9711  C CG  . LYS G 4 26  ? 21.973  -47.556 27.548  1.00 100.29 ? 266 LYS B CG  1 
ATOM   9712  C CD  . LYS G 4 26  ? 21.372  -48.951 27.405  1.00 103.34 ? 266 LYS B CD  1 
ATOM   9713  C CE  . LYS G 4 26  ? 21.061  -49.585 28.754  1.00 104.16 ? 266 LYS B CE  1 
ATOM   9714  N NZ  . LYS G 4 26  ? 20.537  -50.977 28.613  1.00 100.99 ? 266 LYS B NZ  1 
ATOM   9715  N N   . GLU G 4 27  ? 24.795  -45.122 29.639  1.00 80.38  ? 267 GLU B N   1 
ATOM   9716  C CA  . GLU G 4 27  ? 24.735  -43.880 30.403  1.00 84.08  ? 267 GLU B CA  1 
ATOM   9717  C C   . GLU G 4 27  ? 25.355  -42.729 29.619  1.00 81.71  ? 267 GLU B C   1 
ATOM   9718  O O   . GLU G 4 27  ? 24.759  -41.651 29.482  1.00 83.15  ? 267 GLU B O   1 
ATOM   9719  C CB  . GLU G 4 27  ? 25.454  -44.065 31.739  1.00 88.09  ? 267 GLU B CB  1 
ATOM   9720  C CG  . GLU G 4 27  ? 24.891  -45.165 32.633  1.00 92.61  ? 267 GLU B CG  1 
ATOM   9721  C CD  . GLU G 4 27  ? 25.485  -46.534 32.334  1.00 95.21  ? 267 GLU B CD  1 
ATOM   9722  O OE1 . GLU G 4 27  ? 25.865  -46.783 31.170  1.00 98.18  ? 267 GLU B OE1 1 
ATOM   9723  O OE2 . GLU G 4 27  ? 25.577  -47.359 33.270  1.00 93.64  ? 267 GLU B OE2 1 
ATOM   9724  N N   . VAL G 4 28  ? 26.563  -42.947 29.096  1.00 79.39  ? 268 VAL B N   1 
ATOM   9725  C CA  . VAL G 4 28  ? 27.236  -41.922 28.307  1.00 78.86  ? 268 VAL B CA  1 
ATOM   9726  C C   . VAL G 4 28  ? 26.389  -41.540 27.101  1.00 78.54  ? 268 VAL B C   1 
ATOM   9727  O O   . VAL G 4 28  ? 26.274  -40.358 26.753  1.00 78.03  ? 268 VAL B O   1 
ATOM   9728  C CB  . VAL G 4 28  ? 28.636  -42.413 27.893  1.00 79.03  ? 268 VAL B CB  1 
ATOM   9729  C CG1 . VAL G 4 28  ? 29.222  -41.525 26.809  1.00 78.56  ? 268 VAL B CG1 1 
ATOM   9730  C CG2 . VAL G 4 28  ? 29.553  -42.470 29.102  1.00 79.28  ? 268 VAL B CG2 1 
ATOM   9731  N N   . ALA G 4 29  ? 25.767  -42.529 26.455  1.00 78.86  ? 269 ALA B N   1 
ATOM   9732  C CA  . ALA G 4 29  ? 24.875  -42.233 25.340  1.00 78.65  ? 269 ALA B CA  1 
ATOM   9733  C C   . ALA G 4 29  ? 23.669  -41.419 25.790  1.00 79.21  ? 269 ALA B C   1 
ATOM   9734  O O   . ALA G 4 29  ? 23.117  -40.642 25.002  1.00 81.58  ? 269 ALA B O   1 
ATOM   9735  C CB  . ALA G 4 29  ? 24.420  -43.528 24.669  1.00 82.85  ? 269 ALA B CB  1 
ATOM   9736  N N   . SER G 4 30  ? 23.241  -41.589 27.044  1.00 82.27  ? 270 SER B N   1 
ATOM   9737  C CA  . SER G 4 30  ? 22.163  -40.757 27.568  1.00 80.96  ? 270 SER B CA  1 
ATOM   9738  C C   . SER G 4 30  ? 22.621  -39.320 27.788  1.00 79.59  ? 270 SER B C   1 
ATOM   9739  O O   . SER G 4 30  ? 21.829  -38.387 27.610  1.00 82.21  ? 270 SER B O   1 
ATOM   9740  C CB  . SER G 4 30  ? 21.621  -41.347 28.871  1.00 81.01  ? 270 SER B CB  1 
ATOM   9741  O OG  . SER G 4 30  ? 22.262  -40.776 29.999  1.00 84.78  ? 270 SER B OG  1 
ATOM   9742  N N   . SER G 4 31  ? 23.883  -39.118 28.171  1.00 81.15  ? 271 SER B N   1 
ATOM   9743  C CA  . SER G 4 31  ? 24.377  -37.754 28.352  1.00 77.57  ? 271 SER B CA  1 
ATOM   9744  C C   . SER G 4 31  ? 24.812  -37.133 27.028  1.00 77.29  ? 271 SER B C   1 
ATOM   9745  O O   . SER G 4 31  ? 24.291  -36.090 26.622  1.00 78.64  ? 271 SER B O   1 
ATOM   9746  C CB  . SER G 4 31  ? 25.528  -37.727 29.362  1.00 77.69  ? 271 SER B CB  1 
ATOM   9747  O OG  . SER G 4 31  ? 25.043  -37.558 30.684  1.00 77.89  ? 271 SER B OG  1 
ATOM   9748  N N   . VAL G 4 32  ? 25.769  -37.752 26.337  1.00 78.84  ? 272 VAL B N   1 
ATOM   9749  C CA  . VAL G 4 32  ? 26.314  -37.188 25.106  1.00 79.48  ? 272 VAL B CA  1 
ATOM   9750  C C   . VAL G 4 32  ? 25.914  -38.060 23.924  1.00 78.69  ? 272 VAL B C   1 
ATOM   9751  O O   . VAL G 4 32  ? 25.741  -39.278 24.047  1.00 81.68  ? 272 VAL B O   1 
ATOM   9752  C CB  . VAL G 4 32  ? 27.848  -37.024 25.172  1.00 78.31  ? 272 VAL B CB  1 
ATOM   9753  C CG1 . VAL G 4 32  ? 28.257  -36.400 26.492  1.00 79.67  ? 272 VAL B CG1 1 
ATOM   9754  C CG2 . VAL G 4 32  ? 28.542  -38.351 24.979  1.00 77.94  ? 272 VAL B CG2 1 
ATOM   9755  N N   . SER G 4 33  ? 25.751  -37.421 22.770  1.00 84.60  ? 273 SER B N   1 
ATOM   9756  C CA  . SER G 4 33  ? 25.441  -38.105 21.523  1.00 84.58  ? 273 SER B CA  1 
ATOM   9757  C C   . SER G 4 33  ? 26.702  -38.214 20.679  1.00 85.40  ? 273 SER B C   1 
ATOM   9758  O O   . SER G 4 33  ? 27.490  -37.267 20.601  1.00 88.14  ? 273 SER B O   1 
ATOM   9759  C CB  . SER G 4 33  ? 24.354  -37.361 20.747  1.00 86.08  ? 273 SER B CB  1 
ATOM   9760  O OG  . SER G 4 33  ? 24.226  -37.876 19.436  1.00 88.53  ? 273 SER B OG  1 
ATOM   9761  N N   . PHE G 4 34  ? 26.886  -39.369 20.045  1.00 79.67  ? 274 PHE B N   1 
ATOM   9762  C CA  . PHE G 4 34  ? 28.089  -39.659 19.279  1.00 79.82  ? 274 PHE B CA  1 
ATOM   9763  C C   . PHE G 4 34  ? 27.775  -39.757 17.791  1.00 79.92  ? 274 PHE B C   1 
ATOM   9764  O O   . PHE G 4 34  ? 26.648  -40.064 17.392  1.00 80.06  ? 274 PHE B O   1 
ATOM   9765  C CB  . PHE G 4 34  ? 28.732  -40.962 19.749  1.00 80.34  ? 274 PHE B CB  1 
ATOM   9766  C CG  . PHE G 4 34  ? 29.647  -40.793 20.923  1.00 80.30  ? 274 PHE B CG  1 
ATOM   9767  C CD1 . PHE G 4 34  ? 30.934  -40.321 20.753  1.00 80.21  ? 274 PHE B CD1 1 
ATOM   9768  C CD2 . PHE G 4 34  ? 29.221  -41.118 22.197  1.00 80.42  ? 274 PHE B CD2 1 
ATOM   9769  C CE1 . PHE G 4 34  ? 31.777  -40.169 21.832  1.00 80.24  ? 274 PHE B CE1 1 
ATOM   9770  C CE2 . PHE G 4 34  ? 30.059  -40.971 23.279  1.00 80.45  ? 274 PHE B CE2 1 
ATOM   9771  C CZ  . PHE G 4 34  ? 31.340  -40.495 23.098  1.00 80.36  ? 274 PHE B CZ  1 
ATOM   9772  N N   . GLY G 4 35  ? 28.794  -39.507 16.971  1.00 86.47  ? 275 GLY B N   1 
ATOM   9773  C CA  . GLY G 4 35  ? 28.638  -39.577 15.531  1.00 86.64  ? 275 GLY B CA  1 
ATOM   9774  C C   . GLY G 4 35  ? 29.920  -40.039 14.874  1.00 87.91  ? 275 GLY B C   1 
ATOM   9775  O O   . GLY G 4 35  ? 31.000  -40.025 15.479  1.00 84.88  ? 275 GLY B O   1 
ATOM   9776  N N   . LEU G 4 36  ? 29.785  -40.441 13.613  1.00 90.66  ? 276 LEU B N   1 
ATOM   9777  C CA  . LEU G 4 36  ? 30.875  -41.013 12.834  1.00 94.06  ? 276 LEU B CA  1 
ATOM   9778  C C   . LEU G 4 36  ? 31.249  -40.055 11.711  1.00 96.12  ? 276 LEU B C   1 
ATOM   9779  O O   . LEU G 4 36  ? 30.386  -39.645 10.929  1.00 92.56  ? 276 LEU B O   1 
ATOM   9780  C CB  . LEU G 4 36  ? 30.470  -42.372 12.261  1.00 96.35  ? 276 LEU B CB  1 
ATOM   9781  C CG  . LEU G 4 36  ? 31.516  -43.465 12.033  1.00 93.81  ? 276 LEU B CG  1 
ATOM   9782  C CD1 . LEU G 4 36  ? 30.798  -44.735 11.639  1.00 93.64  ? 276 LEU B CD1 1 
ATOM   9783  C CD2 . LEU G 4 36  ? 32.530  -43.075 10.972  1.00 95.97  ? 276 LEU B CD2 1 
ATOM   9784  N N   . PHE G 4 37  ? 32.535  -39.713 11.627  1.00 96.70  ? 277 PHE B N   1 
ATOM   9785  C CA  . PHE G 4 37  ? 33.045  -38.764 10.645  1.00 100.38 ? 277 PHE B CA  1 
ATOM   9786  C C   . PHE G 4 37  ? 34.184  -39.418 9.878   1.00 101.26 ? 277 PHE B C   1 
ATOM   9787  O O   . PHE G 4 37  ? 35.064  -40.041 10.483  1.00 94.31  ? 277 PHE B O   1 
ATOM   9788  C CB  . PHE G 4 37  ? 33.524  -37.477 11.326  1.00 102.57 ? 277 PHE B CB  1 
ATOM   9789  C CG  . PHE G 4 37  ? 32.479  -36.819 12.182  1.00 98.16  ? 277 PHE B CG  1 
ATOM   9790  C CD1 . PHE G 4 37  ? 31.572  -35.930 11.631  1.00 96.95  ? 277 PHE B CD1 1 
ATOM   9791  C CD2 . PHE G 4 37  ? 32.393  -37.100 13.534  1.00 95.90  ? 277 PHE B CD2 1 
ATOM   9792  C CE1 . PHE G 4 37  ? 30.606  -35.326 12.419  1.00 95.58  ? 277 PHE B CE1 1 
ATOM   9793  C CE2 . PHE G 4 37  ? 31.429  -36.501 14.323  1.00 97.09  ? 277 PHE B CE2 1 
ATOM   9794  C CZ  . PHE G 4 37  ? 30.536  -35.613 13.765  1.00 95.07  ? 277 PHE B CZ  1 
ATOM   9795  N N   . TYR G 4 38  ? 34.175  -39.267 8.552   1.00 105.60 ? 278 TYR B N   1 
ATOM   9796  C CA  . TYR G 4 38  ? 35.102  -39.983 7.688   1.00 103.29 ? 278 TYR B CA  1 
ATOM   9797  C C   . TYR G 4 38  ? 35.713  -39.062 6.641   1.00 105.87 ? 278 TYR B C   1 
ATOM   9798  O O   . TYR G 4 38  ? 35.055  -38.146 6.138   1.00 102.52 ? 278 TYR B O   1 
ATOM   9799  C CB  . TYR G 4 38  ? 34.407  -41.160 6.992   1.00 100.51 ? 278 TYR B CB  1 
ATOM   9800  C CG  . TYR G 4 38  ? 33.235  -40.774 6.117   1.00 97.15  ? 278 TYR B CG  1 
ATOM   9801  C CD1 . TYR G 4 38  ? 31.961  -40.647 6.652   1.00 99.76  ? 278 TYR B CD1 1 
ATOM   9802  C CD2 . TYR G 4 38  ? 33.397  -40.561 4.755   1.00 98.28  ? 278 TYR B CD2 1 
ATOM   9803  C CE1 . TYR G 4 38  ? 30.884  -40.306 5.859   1.00 101.94 ? 278 TYR B CE1 1 
ATOM   9804  C CE2 . TYR G 4 38  ? 32.325  -40.220 3.954   1.00 102.53 ? 278 TYR B CE2 1 
ATOM   9805  C CZ  . TYR G 4 38  ? 31.070  -40.094 4.512   1.00 102.91 ? 278 TYR B CZ  1 
ATOM   9806  O OH  . TYR G 4 38  ? 29.993  -39.755 3.724   1.00 104.00 ? 278 TYR B OH  1 
ATOM   9807  N N   . LYS G 4 39  ? 36.980  -39.326 6.324   1.00 114.97 ? 279 LYS B N   1 
ATOM   9808  C CA  . LYS G 4 39  ? 37.709  -38.689 5.231   1.00 113.78 ? 279 LYS B CA  1 
ATOM   9809  C C   . LYS G 4 39  ? 38.096  -39.753 4.212   1.00 110.98 ? 279 LYS B C   1 
ATOM   9810  O O   . LYS G 4 39  ? 38.851  -40.683 4.553   1.00 106.40 ? 279 LYS B O   1 
ATOM   9811  C CB  . LYS G 4 39  ? 38.964  -37.969 5.735   1.00 113.19 ? 279 LYS B CB  1 
ATOM   9812  C CG  . LYS G 4 39  ? 38.722  -36.661 6.468   1.00 114.14 ? 279 LYS B CG  1 
ATOM   9813  C CD  . LYS G 4 39  ? 40.051  -35.998 6.807   1.00 114.33 ? 279 LYS B CD  1 
ATOM   9814  C CE  . LYS G 4 39  ? 39.961  -35.149 8.064   1.00 113.29 ? 279 LYS B CE  1 
ATOM   9815  N NZ  . LYS G 4 39  ? 41.296  -34.987 8.708   1.00 109.40 ? 279 LYS B NZ  1 
ATOM   9816  N N   . PRO G 4 40  ? 37.606  -39.676 2.972   1.00 107.01 ? 280 PRO B N   1 
ATOM   9817  C CA  . PRO G 4 40  ? 38.052  -40.639 1.951   1.00 112.81 ? 280 PRO B CA  1 
ATOM   9818  C C   . PRO G 4 40  ? 39.532  -40.525 1.621   1.00 118.34 ? 280 PRO B C   1 
ATOM   9819  O O   . PRO G 4 40  ? 40.147  -41.521 1.218   1.00 124.75 ? 280 PRO B O   1 
ATOM   9820  C CB  . PRO G 4 40  ? 37.172  -40.295 0.741   1.00 111.59 ? 280 PRO B CB  1 
ATOM   9821  C CG  . PRO G 4 40  ? 35.960  -39.643 1.329   1.00 104.71 ? 280 PRO B CG  1 
ATOM   9822  C CD  . PRO G 4 40  ? 36.464  -38.869 2.512   1.00 105.37 ? 280 PRO B CD  1 
ATOM   9823  N N   . SER G 4 41  ? 40.121  -39.338 1.773   1.00 125.43 ? 281 SER B N   1 
ATOM   9824  C CA  . SER G 4 41  ? 41.543  -39.122 1.568   1.00 124.53 ? 281 SER B CA  1 
ATOM   9825  C C   . SER G 4 41  ? 41.952  -37.974 2.478   1.00 122.44 ? 281 SER B C   1 
ATOM   9826  O O   . SER G 4 41  ? 41.168  -37.030 2.656   1.00 126.09 ? 281 SER B O   1 
ATOM   9827  C CB  . SER G 4 41  ? 41.882  -38.800 0.108   1.00 127.14 ? 281 SER B CB  1 
ATOM   9828  O OG  . SER G 4 41  ? 41.306  -37.572 -0.296  1.00 130.00 ? 281 SER B OG  1 
ATOM   9829  N N   . PRO G 4 42  ? 43.164  -38.016 3.056   1.00 127.38 ? 282 PRO B N   1 
ATOM   9830  C CA  . PRO G 4 42  ? 43.515  -37.075 4.133   1.00 127.38 ? 282 PRO B CA  1 
ATOM   9831  C C   . PRO G 4 42  ? 43.475  -35.599 3.751   1.00 126.41 ? 282 PRO B C   1 
ATOM   9832  O O   . PRO G 4 42  ? 43.791  -34.740 4.579   1.00 125.35 ? 282 PRO B O   1 
ATOM   9833  C CB  . PRO G 4 42  ? 44.941  -37.499 4.520   1.00 124.29 ? 282 PRO B CB  1 
ATOM   9834  C CG  . PRO G 4 42  ? 45.420  -38.382 3.401   1.00 125.15 ? 282 PRO B CG  1 
ATOM   9835  C CD  . PRO G 4 42  ? 44.202  -39.038 2.853   1.00 125.47 ? 282 PRO B CD  1 
ATOM   9836  N N   . ASP G 4 43  ? 43.089  -35.284 2.514   1.00 128.19 ? 283 ASP B N   1 
ATOM   9837  C CA  . ASP G 4 43  ? 42.942  -33.897 2.096   1.00 126.75 ? 283 ASP B CA  1 
ATOM   9838  C C   . ASP G 4 43  ? 41.490  -33.457 1.976   1.00 126.54 ? 283 ASP B C   1 
ATOM   9839  O O   . ASP G 4 43  ? 41.221  -32.251 2.020   1.00 123.85 ? 283 ASP B O   1 
ATOM   9840  C CB  . ASP G 4 43  ? 43.642  -33.665 0.751   1.00 126.22 ? 283 ASP B CB  1 
ATOM   9841  C CG  . ASP G 4 43  ? 42.972  -34.405 -0.392  1.00 126.02 ? 283 ASP B CG  1 
ATOM   9842  O OD1 . ASP G 4 43  ? 42.490  -35.536 -0.171  1.00 132.93 ? 283 ASP B OD1 1 
ATOM   9843  O OD2 . ASP G 4 43  ? 42.918  -33.850 -1.510  1.00 125.46 ? 283 ASP B OD2 1 
ATOM   9844  N N   . ALA G 4 44  ? 40.557  -34.395 1.829   1.00 128.21 ? 284 ALA B N   1 
ATOM   9845  C CA  . ALA G 4 44  ? 39.166  -34.049 1.596   1.00 120.45 ? 284 ALA B CA  1 
ATOM   9846  C C   . ALA G 4 44  ? 38.508  -33.558 2.883   1.00 120.18 ? 284 ALA B C   1 
ATOM   9847  O O   . ALA G 4 44  ? 39.019  -33.748 3.990   1.00 113.18 ? 284 ALA B O   1 
ATOM   9848  C CB  . ALA G 4 44  ? 38.400  -35.249 1.036   1.00 113.91 ? 284 ALA B CB  1 
ATOM   9849  N N   . GLY G 4 45  ? 37.356  -32.913 2.717   1.00 115.86 ? 285 GLY B N   1 
ATOM   9850  C CA  . GLY G 4 45  ? 36.646  -32.366 3.859   1.00 115.36 ? 285 GLY B CA  1 
ATOM   9851  C C   . GLY G 4 45  ? 35.951  -33.456 4.657   1.00 113.57 ? 285 GLY B C   1 
ATOM   9852  O O   . GLY G 4 45  ? 35.355  -34.381 4.104   1.00 110.43 ? 285 GLY B O   1 
ATOM   9853  N N   . GLU G 4 46  ? 36.044  -33.342 5.981   1.00 112.98 ? 286 GLU B N   1 
ATOM   9854  C CA  . GLU G 4 46  ? 35.456  -34.315 6.894   1.00 111.87 ? 286 GLU B CA  1 
ATOM   9855  C C   . GLU G 4 46  ? 33.940  -34.375 6.755   1.00 106.50 ? 286 GLU B C   1 
ATOM   9856  O O   . GLU G 4 46  ? 33.238  -33.443 7.159   1.00 112.85 ? 286 GLU B O   1 
ATOM   9857  C CB  . GLU G 4 46  ? 35.841  -33.974 8.336   1.00 110.56 ? 286 GLU B CB  1 
ATOM   9858  C CG  . GLU G 4 46  ? 35.280  -34.919 9.383   1.00 107.54 ? 286 GLU B CG  1 
ATOM   9859  C CD  . GLU G 4 46  ? 35.723  -34.550 10.787  1.00 108.24 ? 286 GLU B CD  1 
ATOM   9860  O OE1 . GLU G 4 46  ? 35.063  -33.697 11.417  1.00 111.85 ? 286 GLU B OE1 1 
ATOM   9861  O OE2 . GLU G 4 46  ? 36.737  -35.107 11.257  1.00 108.90 ? 286 GLU B OE2 1 
ATOM   9862  N N   . GLU G 4 47  ? 33.428  -35.464 6.192   1.00 101.55 ? 287 GLU B N   1 
ATOM   9863  C CA  . GLU G 4 47  ? 31.997  -35.690 6.072   1.00 103.66 ? 287 GLU B CA  1 
ATOM   9864  C C   . GLU G 4 47  ? 31.517  -36.600 7.197   1.00 107.06 ? 287 GLU B C   1 
ATOM   9865  O O   . GLU G 4 47  ? 32.302  -37.319 7.822   1.00 108.52 ? 287 GLU B O   1 
ATOM   9866  C CB  . GLU G 4 47  ? 31.659  -36.308 4.713   1.00 105.75 ? 287 GLU B CB  1 
ATOM   9867  C CG  . GLU G 4 47  ? 30.188  -36.245 4.330   1.00 108.28 ? 287 GLU B CG  1 
ATOM   9868  C CD  . GLU G 4 47  ? 29.974  -35.696 2.935   1.00 112.88 ? 287 GLU B CD  1 
ATOM   9869  O OE1 . GLU G 4 47  ? 30.936  -35.143 2.362   1.00 116.09 ? 287 GLU B OE1 1 
ATOM   9870  O OE2 . GLU G 4 47  ? 28.846  -35.815 2.412   1.00 116.87 ? 287 GLU B OE2 1 
ATOM   9871  N N   . GLU G 4 48  ? 30.209  -36.557 7.451   1.00 104.97 ? 288 GLU B N   1 
ATOM   9872  C CA  . GLU G 4 48  ? 29.593  -37.350 8.507   1.00 100.28 ? 288 GLU B CA  1 
ATOM   9873  C C   . GLU G 4 48  ? 28.653  -38.397 7.926   1.00 106.31 ? 288 GLU B C   1 
ATOM   9874  O O   . GLU G 4 48  ? 27.889  -38.125 6.988   1.00 105.08 ? 288 GLU B O   1 
ATOM   9875  C CB  . GLU G 4 48  ? 28.831  -36.471 9.502   1.00 95.56  ? 288 GLU B CB  1 
ATOM   9876  C CG  . GLU G 4 48  ? 28.228  -37.233 10.679  1.00 99.82  ? 288 GLU B CG  1 
ATOM   9877  C CD  . GLU G 4 48  ? 27.438  -36.337 11.613  1.00 101.85 ? 288 GLU B CD  1 
ATOM   9878  O OE1 . GLU G 4 48  ? 26.706  -36.869 12.470  1.00 107.54 ? 288 GLU B OE1 1 
ATOM   9879  O OE2 . GLU G 4 48  ? 27.549  -35.101 11.493  1.00 102.71 ? 288 GLU B OE2 1 
ATOM   9880  N N   . CYS G 4 49  ? 28.731  -39.595 8.508   1.00 107.42 ? 289 CYS B N   1 
ATOM   9881  C CA  . CYS G 4 49  ? 27.924  -40.733 8.100   1.00 105.85 ? 289 CYS B CA  1 
ATOM   9882  C C   . CYS G 4 49  ? 26.563  -40.630 8.781   1.00 102.67 ? 289 CYS B C   1 
ATOM   9883  O O   . CYS G 4 49  ? 26.475  -40.282 9.961   1.00 103.91 ? 289 CYS B O   1 
ATOM   9884  C CB  . CYS G 4 49  ? 28.629  -42.048 8.484   1.00 112.12 ? 289 CYS B CB  1 
ATOM   9885  S SG  . CYS G 4 49  ? 27.685  -43.594 8.238   1.00 121.01 ? 289 CYS B SG  1 
ATOM   9886  N N   . SER G 4 50  ? 25.495  -40.938 8.032   1.00 105.83 ? 290 SER B N   1 
ATOM   9887  C CA  . SER G 4 50  ? 24.120  -40.880 8.539   1.00 109.36 ? 290 SER B CA  1 
ATOM   9888  C C   . SER G 4 50  ? 23.233  -41.759 7.673   1.00 111.21 ? 290 SER B C   1 
ATOM   9889  O O   . SER G 4 50  ? 23.435  -41.791 6.452   1.00 116.75 ? 290 SER B O   1 
ATOM   9890  C CB  . SER G 4 50  ? 23.582  -39.441 8.548   1.00 108.05 ? 290 SER B CB  1 
ATOM   9891  O OG  . SER G 4 50  ? 22.273  -39.351 9.104   1.00 109.70 ? 290 SER B OG  1 
ATOM   9892  N N   . PRO G 4 51  ? 22.241  -42.474 8.245   1.00 109.77 ? 291 PRO B N   1 
ATOM   9893  C CA  . PRO G 4 51  ? 21.819  -42.477 9.651   1.00 109.17 ? 291 PRO B CA  1 
ATOM   9894  C C   . PRO G 4 51  ? 22.710  -43.320 10.559  1.00 109.29 ? 291 PRO B C   1 
ATOM   9895  O O   . PRO G 4 51  ? 23.490  -44.141 10.077  1.00 124.32 ? 291 PRO B O   1 
ATOM   9896  C CB  . PRO G 4 51  ? 20.410  -43.071 9.583   1.00 109.68 ? 291 PRO B CB  1 
ATOM   9897  C CG  . PRO G 4 51  ? 20.492  -44.043 8.460   1.00 108.29 ? 291 PRO B CG  1 
ATOM   9898  C CD  . PRO G 4 51  ? 21.436  -43.416 7.442   1.00 107.30 ? 291 PRO B CD  1 
ATOM   9899  N N   . VAL G 4 52  ? 22.588  -43.108 11.867  1.00 106.06 ? 292 VAL B N   1 
ATOM   9900  C CA  . VAL G 4 52  ? 23.334  -43.888 12.848  1.00 105.40 ? 292 VAL B CA  1 
ATOM   9901  C C   . VAL G 4 52  ? 22.349  -44.761 13.622  1.00 105.41 ? 292 VAL B C   1 
ATOM   9902  O O   . VAL G 4 52  ? 21.868  -44.389 14.698  1.00 106.69 ? 292 VAL B O   1 
ATOM   9903  C CB  . VAL G 4 52  ? 24.171  -42.964 13.761  1.00 103.98 ? 292 VAL B CB  1 
ATOM   9904  C CG1 . VAL G 4 52  ? 23.334  -41.801 14.303  1.00 107.03 ? 292 VAL B CG1 1 
ATOM   9905  C CG2 . VAL G 4 52  ? 24.839  -43.749 14.887  1.00 100.58 ? 292 VAL B CG2 1 
ATOM   9906  N N   . LEU G 4 53  ? 22.024  -45.926 13.063  1.00 101.66 ? 293 LEU B N   1 
ATOM   9907  C CA  . LEU G 4 53  ? 21.053  -46.815 13.691  1.00 105.31 ? 293 LEU B CA  1 
ATOM   9908  C C   . LEU G 4 53  ? 21.629  -47.434 14.960  1.00 107.93 ? 293 LEU B C   1 
ATOM   9909  O O   . LEU G 4 53  ? 22.780  -47.880 14.988  1.00 108.21 ? 293 LEU B O   1 
ATOM   9910  C CB  . LEU G 4 53  ? 20.623  -47.913 12.717  1.00 106.96 ? 293 LEU B CB  1 
ATOM   9911  C CG  . LEU G 4 53  ? 19.395  -47.660 11.836  1.00 110.20 ? 293 LEU B CG  1 
ATOM   9912  C CD1 . LEU G 4 53  ? 19.328  -46.215 11.355  1.00 112.63 ? 293 LEU B CD1 1 
ATOM   9913  C CD2 . LEU G 4 53  ? 19.379  -48.625 10.659  1.00 108.97 ? 293 LEU B CD2 1 
ATOM   9914  N N   . ARG G 4 54  ? 20.814  -47.471 16.011  1.00 110.23 ? 294 ARG B N   1 
ATOM   9915  C CA  . ARG G 4 54  ? 21.262  -47.864 17.336  1.00 111.12 ? 294 ARG B CA  1 
ATOM   9916  C C   . ARG G 4 54  ? 20.557  -49.133 17.801  1.00 111.34 ? 294 ARG B C   1 
ATOM   9917  O O   . ARG G 4 54  ? 19.522  -49.539 17.262  1.00 103.34 ? 294 ARG B O   1 
ATOM   9918  C CB  . ARG G 4 54  ? 21.033  -46.732 18.345  1.00 110.56 ? 294 ARG B CB  1 
ATOM   9919  C CG  . ARG G 4 54  ? 21.946  -45.541 18.115  1.00 114.34 ? 294 ARG B CG  1 
ATOM   9920  C CD  . ARG G 4 54  ? 21.716  -44.406 19.103  1.00 121.83 ? 294 ARG B CD  1 
ATOM   9921  N NE  . ARG G 4 54  ? 21.872  -43.104 18.457  1.00 126.23 ? 294 ARG B NE  1 
ATOM   9922  C CZ  . ARG G 4 54  ? 22.417  -42.037 19.035  1.00 122.86 ? 294 ARG B CZ  1 
ATOM   9923  N NH1 . ARG G 4 54  ? 22.517  -40.896 18.365  1.00 115.94 ? 294 ARG B NH1 1 
ATOM   9924  N NH2 . ARG G 4 54  ? 22.872  -42.109 20.280  1.00 119.77 ? 294 ARG B NH2 1 
ATOM   9925  N N   . GLU G 4 55  ? 21.146  -49.756 18.820  1.00 115.03 ? 295 GLU B N   1 
ATOM   9926  C CA  . GLU G 4 55  ? 20.631  -50.967 19.444  1.00 113.40 ? 295 GLU B CA  1 
ATOM   9927  C C   . GLU G 4 55  ? 21.424  -51.213 20.719  1.00 108.83 ? 295 GLU B C   1 
ATOM   9928  O O   . GLU G 4 55  ? 22.584  -50.805 20.827  1.00 99.27  ? 295 GLU B O   1 
ATOM   9929  C CB  . GLU G 4 55  ? 20.728  -52.179 18.505  1.00 110.71 ? 295 GLU B CB  1 
ATOM   9930  C CG  . GLU G 4 55  ? 22.062  -52.917 18.561  1.00 113.30 ? 295 GLU B CG  1 
ATOM   9931  C CD  . GLU G 4 55  ? 22.021  -54.262 17.859  1.00 116.94 ? 295 GLU B CD  1 
ATOM   9932  O OE1 . GLU G 4 55  ? 22.846  -55.139 18.197  1.00 120.76 ? 295 GLU B OE1 1 
ATOM   9933  O OE2 . GLU G 4 55  ? 21.166  -54.442 16.967  1.00 115.16 ? 295 GLU B OE2 1 
ATOM   9934  N N   . GLY G 4 56  ? 20.788  -51.879 21.677  1.00 106.10 ? 296 GLY B N   1 
ATOM   9935  C CA  . GLY G 4 56  ? 21.422  -52.121 22.957  1.00 103.74 ? 296 GLY B CA  1 
ATOM   9936  C C   . GLY G 4 56  ? 22.132  -53.456 23.044  1.00 104.85 ? 296 GLY B C   1 
ATOM   9937  O O   . GLY G 4 56  ? 21.501  -54.511 22.919  1.00 109.90 ? 296 GLY B O   1 
ATOM   9938  N N   . LEU G 4 57  ? 23.446  -53.425 23.253  1.00 100.97 ? 297 LEU B N   1 
ATOM   9939  C CA  . LEU G 4 57  ? 24.239  -54.631 23.444  1.00 97.73  ? 297 LEU B CA  1 
ATOM   9940  C C   . LEU G 4 57  ? 24.496  -54.824 24.931  1.00 98.13  ? 297 LEU B C   1 
ATOM   9941  O O   . LEU G 4 57  ? 24.923  -53.890 25.619  1.00 98.46  ? 297 LEU B O   1 
ATOM   9942  C CB  . LEU G 4 57  ? 25.561  -54.552 22.674  1.00 97.78  ? 297 LEU B CB  1 
ATOM   9943  C CG  . LEU G 4 57  ? 26.612  -55.653 22.867  1.00 100.89 ? 297 LEU B CG  1 
ATOM   9944  C CD1 . LEU G 4 57  ? 27.395  -55.852 21.584  1.00 100.58 ? 297 LEU B CD1 1 
ATOM   9945  C CD2 . LEU G 4 57  ? 27.574  -55.345 24.014  1.00 99.85  ? 297 LEU B CD2 1 
ATOM   9946  N N   . GLY G 4 58  ? 24.245  -56.036 25.418  1.00 103.18 ? 298 GLY B N   1 
ATOM   9947  C CA  . GLY G 4 58  ? 24.454  -56.313 26.820  1.00 103.27 ? 298 GLY B CA  1 
ATOM   9948  C C   . GLY G 4 58  ? 23.563  -55.451 27.694  1.00 101.83 ? 298 GLY B C   1 
ATOM   9949  O O   . GLY G 4 58  ? 22.498  -54.978 27.281  1.00 94.63  ? 298 GLY B O   1 
ATOM   9950  N N   . SER G 4 59  ? 24.017  -55.232 28.928  1.00 102.20 ? 299 SER B N   1 
ATOM   9951  C CA  . SER G 4 59  ? 23.261  -54.458 29.904  1.00 106.72 ? 299 SER B CA  1 
ATOM   9952  C C   . SER G 4 59  ? 23.745  -53.024 30.042  1.00 105.87 ? 299 SER B C   1 
ATOM   9953  O O   . SER G 4 59  ? 22.944  -52.141 30.368  1.00 105.62 ? 299 SER B O   1 
ATOM   9954  C CB  . SER G 4 59  ? 23.322  -55.136 31.278  1.00 107.11 ? 299 SER B CB  1 
ATOM   9955  O OG  . SER G 4 59  ? 24.655  -55.473 31.622  1.00 103.90 ? 299 SER B OG  1 
ATOM   9956  N N   . LEU G 4 60  ? 25.028  -52.768 29.795  1.00 100.06 ? 300 LEU B N   1 
ATOM   9957  C CA  . LEU G 4 60  ? 25.622  -51.461 30.031  1.00 98.07  ? 300 LEU B CA  1 
ATOM   9958  C C   . LEU G 4 60  ? 26.027  -50.735 28.757  1.00 95.04  ? 300 LEU B C   1 
ATOM   9959  O O   . LEU G 4 60  ? 26.599  -49.644 28.843  1.00 101.62 ? 300 LEU B O   1 
ATOM   9960  C CB  . LEU G 4 60  ? 26.845  -51.600 30.944  1.00 93.41  ? 300 LEU B CB  1 
ATOM   9961  C CG  . LEU G 4 60  ? 26.618  -52.265 32.301  1.00 90.83  ? 300 LEU B CG  1 
ATOM   9962  C CD1 . LEU G 4 60  ? 27.851  -52.108 33.171  1.00 91.44  ? 300 LEU B CD1 1 
ATOM   9963  C CD2 . LEU G 4 60  ? 25.393  -51.683 32.989  1.00 89.99  ? 300 LEU B CD2 1 
ATOM   9964  N N   . HIS G 4 61  ? 25.749  -51.293 27.582  1.00 89.55  ? 301 HIS B N   1 
ATOM   9965  C CA  . HIS G 4 61  ? 26.256  -50.728 26.342  1.00 91.68  ? 301 HIS B CA  1 
ATOM   9966  C C   . HIS G 4 61  ? 25.149  -50.610 25.303  1.00 91.26  ? 301 HIS B C   1 
ATOM   9967  O O   . HIS G 4 61  ? 24.049  -51.148 25.453  1.00 88.73  ? 301 HIS B O   1 
ATOM   9968  C CB  . HIS G 4 61  ? 27.414  -51.567 25.789  1.00 93.55  ? 301 HIS B CB  1 
ATOM   9969  C CG  . HIS G 4 61  ? 28.630  -51.558 26.659  1.00 93.76  ? 301 HIS B CG  1 
ATOM   9970  N ND1 . HIS G 4 61  ? 28.753  -52.359 27.773  1.00 93.44  ? 301 HIS B ND1 1 
ATOM   9971  C CD2 . HIS G 4 61  ? 29.779  -50.846 26.577  1.00 96.44  ? 301 HIS B CD2 1 
ATOM   9972  C CE1 . HIS G 4 61  ? 29.925  -52.139 28.343  1.00 95.54  ? 301 HIS B CE1 1 
ATOM   9973  N NE2 . HIS G 4 61  ? 30.567  -51.226 27.636  1.00 94.85  ? 301 HIS B NE2 1 
ATOM   9974  N N   . THR G 4 62  ? 25.471  -49.875 24.241  1.00 92.35  ? 302 THR B N   1 
ATOM   9975  C CA  . THR G 4 62  ? 24.622  -49.716 23.071  1.00 93.61  ? 302 THR B CA  1 
ATOM   9976  C C   . THR G 4 62  ? 25.511  -49.742 21.839  1.00 88.66  ? 302 THR B C   1 
ATOM   9977  O O   . THR G 4 62  ? 26.553  -49.076 21.806  1.00 85.64  ? 302 THR B O   1 
ATOM   9978  C CB  . THR G 4 62  ? 23.825  -48.408 23.123  1.00 99.46  ? 302 THR B CB  1 
ATOM   9979  O OG1 . THR G 4 62  ? 24.650  -47.364 23.655  1.00 102.33 ? 302 THR B OG1 1 
ATOM   9980  C CG2 . THR G 4 62  ? 22.583  -48.569 23.988  1.00 99.82  ? 302 THR B CG2 1 
ATOM   9981  N N   . ARG G 4 63  ? 25.100  -50.519 20.843  1.00 89.52  ? 303 ARG B N   1 
ATOM   9982  C CA  . ARG G 4 63  ? 25.839  -50.671 19.601  1.00 94.40  ? 303 ARG B CA  1 
ATOM   9983  C C   . ARG G 4 63  ? 25.356  -49.658 18.572  1.00 97.65  ? 303 ARG B C   1 
ATOM   9984  O O   . ARG G 4 63  ? 24.207  -49.210 18.605  1.00 106.74 ? 303 ARG B O   1 
ATOM   9985  C CB  . ARG G 4 63  ? 25.673  -52.090 19.058  1.00 98.29  ? 303 ARG B CB  1 
ATOM   9986  C CG  . ARG G 4 63  ? 26.789  -52.551 18.139  1.00 103.88 ? 303 ARG B CG  1 
ATOM   9987  C CD  . ARG G 4 63  ? 26.649  -54.028 17.810  1.00 105.90 ? 303 ARG B CD  1 
ATOM   9988  N NE  . ARG G 4 63  ? 26.800  -54.285 16.381  1.00 107.35 ? 303 ARG B NE  1 
ATOM   9989  C CZ  . ARG G 4 63  ? 27.213  -55.439 15.869  1.00 111.51 ? 303 ARG B CZ  1 
ATOM   9990  N NH1 . ARG G 4 63  ? 27.520  -56.453 16.669  1.00 107.25 ? 303 ARG B NH1 1 
ATOM   9991  N NH2 . ARG G 4 63  ? 27.317  -55.581 14.553  1.00 111.46 ? 303 ARG B NH2 1 
ATOM   9992  N N   . HIS G 4 64  ? 26.246  -49.302 17.648  1.00 97.48  ? 304 HIS B N   1 
ATOM   9993  C CA  . HIS G 4 64  ? 25.945  -48.306 16.631  1.00 97.76  ? 304 HIS B CA  1 
ATOM   9994  C C   . HIS G 4 64  ? 26.438  -48.825 15.293  1.00 98.27  ? 304 HIS B C   1 
ATOM   9995  O O   . HIS G 4 64  ? 27.629  -49.121 15.145  1.00 97.98  ? 304 HIS B O   1 
ATOM   9996  C CB  . HIS G 4 64  ? 26.607  -46.960 16.940  1.00 97.24  ? 304 HIS B CB  1 
ATOM   9997  C CG  . HIS G 4 64  ? 26.181  -46.350 18.238  1.00 98.25  ? 304 HIS B CG  1 
ATOM   9998  N ND1 . HIS G 4 64  ? 24.904  -46.476 18.742  1.00 99.54  ? 304 HIS B ND1 1 
ATOM   9999  C CD2 . HIS G 4 64  ? 26.864  -45.595 19.130  1.00 97.97  ? 304 HIS B CD2 1 
ATOM   10000 C CE1 . HIS G 4 64  ? 24.823  -45.833 19.893  1.00 100.97 ? 304 HIS B CE1 1 
ATOM   10001 N NE2 . HIS G 4 64  ? 25.997  -45.287 20.149  1.00 97.19  ? 304 HIS B NE2 1 
ATOM   10002 N N   . HIS G 4 65  ? 25.521  -48.946 14.337  1.00 97.74  ? 305 HIS B N   1 
ATOM   10003 C CA  . HIS G 4 65  ? 25.840  -49.229 12.946  1.00 99.12  ? 305 HIS B CA  1 
ATOM   10004 C C   . HIS G 4 65  ? 25.838  -47.922 12.162  1.00 100.70 ? 305 HIS B C   1 
ATOM   10005 O O   . HIS G 4 65  ? 25.169  -46.959 12.539  1.00 102.25 ? 305 HIS B O   1 
ATOM   10006 C CB  . HIS G 4 65  ? 24.819  -50.190 12.329  1.00 103.00 ? 305 HIS B CB  1 
ATOM   10007 C CG  . HIS G 4 65  ? 25.118  -51.639 12.549  1.00 113.18 ? 305 HIS B CG  1 
ATOM   10008 N ND1 . HIS G 4 65  ? 24.341  -52.436 13.363  1.00 116.33 ? 305 HIS B ND1 1 
ATOM   10009 C CD2 . HIS G 4 65  ? 26.087  -52.441 12.050  1.00 119.82 ? 305 HIS B CD2 1 
ATOM   10010 C CE1 . HIS G 4 65  ? 24.829  -53.664 13.367  1.00 117.30 ? 305 HIS B CE1 1 
ATOM   10011 N NE2 . HIS G 4 65  ? 25.888  -53.695 12.577  1.00 121.32 ? 305 HIS B NE2 1 
ATOM   10012 N N   . CYS G 4 66  ? 26.597  -47.895 11.062  1.00 101.54 ? 306 CYS B N   1 
ATOM   10013 C CA  . CYS G 4 66  ? 26.528  -46.739 10.173  1.00 100.39 ? 306 CYS B CA  1 
ATOM   10014 C C   . CYS G 4 66  ? 27.067  -47.161 8.813   1.00 100.93 ? 306 CYS B C   1 
ATOM   10015 O O   . CYS G 4 66  ? 27.920  -48.045 8.724   1.00 107.29 ? 306 CYS B O   1 
ATOM   10016 C CB  . CYS G 4 66  ? 27.306  -45.542 10.723  1.00 101.50 ? 306 CYS B CB  1 
ATOM   10017 S SG  . CYS G 4 66  ? 26.793  -43.952 10.021  1.00 118.82 ? 306 CYS B SG  1 
ATOM   10018 N N   . GLN G 4 67  ? 26.518  -46.555 7.754   1.00 99.51  ? 307 GLN B N   1 
ATOM   10019 C CA  . GLN G 4 67  ? 26.742  -46.989 6.363   1.00 101.12 ? 307 GLN B CA  1 
ATOM   10020 C C   . GLN G 4 67  ? 27.419  -45.866 5.564   1.00 98.61  ? 307 GLN B C   1 
ATOM   10021 O O   . GLN G 4 67  ? 26.742  -45.006 4.996   1.00 97.85  ? 307 GLN B O   1 
ATOM   10022 C CB  . GLN G 4 67  ? 25.404  -47.391 5.714   1.00 103.92 ? 307 GLN B CB  1 
ATOM   10023 C CG  . GLN G 4 67  ? 24.626  -48.453 6.482   1.00 101.89 ? 307 GLN B CG  1 
ATOM   10024 C CD  . GLN G 4 67  ? 25.165  -49.841 6.287   1.00 99.55  ? 307 GLN B CD  1 
ATOM   10025 O OE1 . GLN G 4 67  ? 25.485  -50.552 7.241   1.00 94.72  ? 307 GLN B OE1 1 
ATOM   10026 N NE2 . GLN G 4 67  ? 25.248  -50.247 5.039   1.00 100.44 ? 307 GLN B NE2 1 
ATOM   10027 N N   . ILE G 4 68  ? 28.749  -45.878 5.508   1.00 98.72  ? 308 ILE B N   1 
ATOM   10028 C CA  . ILE G 4 68  ? 29.493  -44.890 4.729   1.00 99.23  ? 308 ILE B CA  1 
ATOM   10029 C C   . ILE G 4 68  ? 29.392  -45.268 3.256   1.00 106.77 ? 308 ILE B C   1 
ATOM   10030 O O   . ILE G 4 68  ? 29.742  -46.398 2.884   1.00 115.14 ? 308 ILE B O   1 
ATOM   10031 C CB  . ILE G 4 68  ? 30.961  -44.814 5.176   1.00 93.95  ? 308 ILE B CB  1 
ATOM   10032 C CG1 . ILE G 4 68  ? 31.059  -44.483 6.665   1.00 91.81  ? 308 ILE B CG1 1 
ATOM   10033 C CG2 . ILE G 4 68  ? 31.718  -43.809 4.339   1.00 93.66  ? 308 ILE B CG2 1 
ATOM   10034 C CD1 . ILE G 4 68  ? 32.457  -44.597 7.221   1.00 88.37  ? 308 ILE B CD1 1 
ATOM   10035 N N   . PRO G 4 69  ? 28.909  -44.379 2.389   1.00 111.88 ? 309 PRO B N   1 
ATOM   10036 C CA  . PRO G 4 69  ? 28.905  -44.683 0.952   1.00 108.59 ? 309 PRO B CA  1 
ATOM   10037 C C   . PRO G 4 69  ? 30.271  -44.378 0.353   1.00 111.03 ? 309 PRO B C   1 
ATOM   10038 O O   . PRO G 4 69  ? 30.865  -43.333 0.631   1.00 106.16 ? 309 PRO B O   1 
ATOM   10039 C CB  . PRO G 4 69  ? 27.820  -43.753 0.399   1.00 105.89 ? 309 PRO B CB  1 
ATOM   10040 C CG  . PRO G 4 69  ? 27.860  -42.572 1.336   1.00 109.13 ? 309 PRO B CG  1 
ATOM   10041 C CD  . PRO G 4 69  ? 28.264  -43.088 2.693   1.00 110.25 ? 309 PRO B CD  1 
ATOM   10042 N N   . VAL G 4 70  ? 30.770  -45.302 -0.464  1.00 118.20 ? 310 VAL B N   1 
ATOM   10043 C CA  . VAL G 4 70  ? 32.079  -45.166 -1.101  1.00 119.98 ? 310 VAL B CA  1 
ATOM   10044 C C   . VAL G 4 70  ? 31.887  -45.202 -2.613  1.00 126.75 ? 310 VAL B C   1 
ATOM   10045 O O   . VAL G 4 70  ? 31.918  -46.286 -3.211  1.00 131.14 ? 310 VAL B O   1 
ATOM   10046 C CB  . VAL G 4 70  ? 33.046  -46.269 -0.635  1.00 113.83 ? 310 VAL B CB  1 
ATOM   10047 C CG1 . VAL G 4 70  ? 34.437  -46.087 -1.262  1.00 111.80 ? 310 VAL B CG1 1 
ATOM   10048 C CG2 . VAL G 4 70  ? 33.156  -46.288 0.877   1.00 111.62 ? 310 VAL B CG2 1 
ATOM   10049 N N   . PRO G 4 71  ? 31.698  -44.050 -3.273  1.00 134.00 ? 311 PRO B N   1 
ATOM   10050 C CA  . PRO G 4 71  ? 31.410  -44.058 -4.717  1.00 131.41 ? 311 PRO B CA  1 
ATOM   10051 C C   . PRO G 4 71  ? 32.440  -44.826 -5.532  1.00 129.35 ? 311 PRO B C   1 
ATOM   10052 O O   . PRO G 4 71  ? 32.115  -45.842 -6.155  1.00 125.29 ? 311 PRO B O   1 
ATOM   10053 C CB  . PRO G 4 71  ? 31.402  -42.567 -5.079  1.00 132.89 ? 311 PRO B CB  1 
ATOM   10054 C CG  . PRO G 4 71  ? 31.069  -41.870 -3.796  1.00 131.93 ? 311 PRO B CG  1 
ATOM   10055 C CD  . PRO G 4 71  ? 31.716  -42.686 -2.715  1.00 132.94 ? 311 PRO B CD  1 
ATOM   10056 N N   . ASP G 4 72  ? 33.682  -44.361 -5.520  1.00 134.13 ? 312 ASP B N   1 
ATOM   10057 C CA  . ASP G 4 72  ? 34.769  -45.018 -6.245  1.00 132.50 ? 312 ASP B CA  1 
ATOM   10058 C C   . ASP G 4 72  ? 35.876  -45.376 -5.266  1.00 128.52 ? 312 ASP B C   1 
ATOM   10059 O O   . ASP G 4 72  ? 36.608  -44.478 -4.806  1.00 123.99 ? 312 ASP B O   1 
ATOM   10060 C CB  . ASP G 4 72  ? 35.296  -44.114 -7.360  1.00 134.43 ? 312 ASP B CB  1 
ATOM   10061 C CG  . ASP G 4 72  ? 34.207  -43.697 -8.333  1.00 135.08 ? 312 ASP B CG  1 
ATOM   10062 O OD1 . ASP G 4 72  ? 33.315  -44.526 -8.617  1.00 133.16 ? 312 ASP B OD1 1 
ATOM   10063 O OD2 . ASP G 4 72  ? 34.238  -42.542 -8.810  1.00 130.69 ? 312 ASP B OD2 1 
ATOM   10064 N N   . PRO G 4 73  ? 36.036  -46.651 -4.910  1.00 124.63 ? 313 PRO B N   1 
ATOM   10065 C CA  . PRO G 4 73  ? 37.013  -47.014 -3.875  1.00 124.96 ? 313 PRO B CA  1 
ATOM   10066 C C   . PRO G 4 73  ? 38.436  -47.140 -4.394  1.00 130.10 ? 313 PRO B C   1 
ATOM   10067 O O   . PRO G 4 73  ? 39.385  -46.834 -3.667  1.00 132.26 ? 313 PRO B O   1 
ATOM   10068 C CB  . PRO G 4 73  ? 36.485  -48.360 -3.365  1.00 123.50 ? 313 PRO B CB  1 
ATOM   10069 C CG  . PRO G 4 73  ? 35.800  -48.953 -4.549  1.00 121.10 ? 313 PRO B CG  1 
ATOM   10070 C CD  . PRO G 4 73  ? 35.218  -47.801 -5.332  1.00 121.81 ? 313 PRO B CD  1 
ATOM   10071 N N   . ALA G 4 74  ? 38.604  -47.593 -5.640  1.00 131.71 ? 314 ALA B N   1 
ATOM   10072 C CA  . ALA G 4 74  ? 39.949  -47.782 -6.177  1.00 129.76 ? 314 ALA B CA  1 
ATOM   10073 C C   . ALA G 4 74  ? 40.709  -46.465 -6.268  1.00 132.53 ? 314 ALA B C   1 
ATOM   10074 O O   . ALA G 4 74  ? 41.945  -46.455 -6.218  1.00 130.20 ? 314 ALA B O   1 
ATOM   10075 C CB  . ALA G 4 74  ? 39.881  -48.458 -7.546  1.00 125.58 ? 314 ALA B CB  1 
ATOM   10076 N N   . THR G 4 75  ? 39.994  -45.346 -6.395  1.00 136.62 ? 315 THR B N   1 
ATOM   10077 C CA  . THR G 4 75  ? 40.644  -44.041 -6.429  1.00 133.05 ? 315 THR B CA  1 
ATOM   10078 C C   . THR G 4 75  ? 40.961  -43.545 -5.022  1.00 128.92 ? 315 THR B C   1 
ATOM   10079 O O   . THR G 4 75  ? 42.087  -43.117 -4.745  1.00 122.55 ? 315 THR B O   1 
ATOM   10080 C CB  . THR G 4 75  ? 39.760  -43.037 -7.169  1.00 131.81 ? 315 THR B CB  1 
ATOM   10081 O OG1 . THR G 4 75  ? 38.390  -43.244 -6.801  1.00 126.26 ? 315 THR B OG1 1 
ATOM   10082 C CG2 . THR G 4 75  ? 39.901  -43.216 -8.672  1.00 131.96 ? 315 THR B CG2 1 
ATOM   10083 N N   . HIS G 4 76  ? 39.981  -43.596 -4.123  1.00 129.80 ? 316 HIS B N   1 
ATOM   10084 C CA  . HIS G 4 76  ? 40.155  -43.228 -2.720  1.00 129.98 ? 316 HIS B CA  1 
ATOM   10085 C C   . HIS G 4 76  ? 40.123  -44.517 -1.904  1.00 129.51 ? 316 HIS B C   1 
ATOM   10086 O O   . HIS G 4 76  ? 39.097  -44.897 -1.339  1.00 128.63 ? 316 HIS B O   1 
ATOM   10087 C CB  . HIS G 4 76  ? 39.067  -42.245 -2.275  1.00 130.36 ? 316 HIS B CB  1 
ATOM   10088 C CG  . HIS G 4 76  ? 39.064  -40.958 -3.040  1.00 131.86 ? 316 HIS B CG  1 
ATOM   10089 N ND1 . HIS G 4 76  ? 38.036  -40.597 -3.885  1.00 131.36 ? 316 HIS B ND1 1 
ATOM   10090 C CD2 . HIS G 4 76  ? 39.959  -39.943 -3.083  1.00 131.44 ? 316 HIS B CD2 1 
ATOM   10091 C CE1 . HIS G 4 76  ? 38.300  -39.418 -4.419  1.00 129.44 ? 316 HIS B CE1 1 
ATOM   10092 N NE2 . HIS G 4 76  ? 39.461  -38.999 -3.948  1.00 132.70 ? 316 HIS B NE2 1 
ATOM   10093 N N   . GLY G 4 77  ? 41.265  -45.194 -1.846  1.00 123.31 ? 317 GLY B N   1 
ATOM   10094 C CA  . GLY G 4 77  ? 41.348  -46.521 -1.274  1.00 119.04 ? 317 GLY B CA  1 
ATOM   10095 C C   . GLY G 4 77  ? 41.696  -46.606 0.195   1.00 114.15 ? 317 GLY B C   1 
ATOM   10096 O O   . GLY G 4 77  ? 41.941  -47.710 0.691   1.00 116.70 ? 317 GLY B O   1 
ATOM   10097 N N   . GLN G 4 78  ? 41.722  -45.489 0.916   1.00 109.53 ? 318 GLN B N   1 
ATOM   10098 C CA  . GLN G 4 78  ? 42.087  -45.525 2.330   1.00 111.06 ? 318 GLN B CA  1 
ATOM   10099 C C   . GLN G 4 78  ? 41.278  -44.464 3.063   1.00 115.74 ? 318 GLN B C   1 
ATOM   10100 O O   . GLN G 4 78  ? 41.552  -43.269 2.924   1.00 127.38 ? 318 GLN B O   1 
ATOM   10101 C CB  . GLN G 4 78  ? 43.586  -45.307 2.510   1.00 108.82 ? 318 GLN B CB  1 
ATOM   10102 C CG  . GLN G 4 78  ? 44.105  -45.679 3.890   1.00 113.30 ? 318 GLN B CG  1 
ATOM   10103 C CD  . GLN G 4 78  ? 44.644  -44.486 4.654   1.00 114.16 ? 318 GLN B CD  1 
ATOM   10104 O OE1 . GLN G 4 78  ? 44.134  -43.373 4.530   1.00 115.71 ? 318 GLN B OE1 1 
ATOM   10105 N NE2 . GLN G 4 78  ? 45.680  -44.714 5.454   1.00 111.25 ? 318 GLN B NE2 1 
ATOM   10106 N N   . TYR G 4 79  ? 40.291  -44.903 3.839   1.00 110.68 ? 319 TYR B N   1 
ATOM   10107 C CA  . TYR G 4 79  ? 39.437  -44.000 4.595   1.00 103.96 ? 319 TYR B CA  1 
ATOM   10108 C C   . TYR G 4 79  ? 39.963  -43.819 6.012   1.00 104.19 ? 319 TYR B C   1 
ATOM   10109 O O   . TYR G 4 79  ? 40.588  -44.717 6.583   1.00 105.23 ? 319 TYR B O   1 
ATOM   10110 C CB  . TYR G 4 79  ? 38.005  -44.531 4.651   1.00 99.66  ? 319 TYR B CB  1 
ATOM   10111 C CG  . TYR G 4 79  ? 37.149  -44.184 3.457   1.00 99.14  ? 319 TYR B CG  1 
ATOM   10112 C CD1 . TYR G 4 79  ? 37.371  -44.769 2.220   1.00 100.88 ? 319 TYR B CD1 1 
ATOM   10113 C CD2 . TYR G 4 79  ? 36.099  -43.286 3.576   1.00 102.62 ? 319 TYR B CD2 1 
ATOM   10114 C CE1 . TYR G 4 79  ? 36.579  -44.458 1.131   1.00 104.94 ? 319 TYR B CE1 1 
ATOM   10115 C CE2 . TYR G 4 79  ? 35.302  -42.969 2.496   1.00 104.17 ? 319 TYR B CE2 1 
ATOM   10116 C CZ  . TYR G 4 79  ? 35.545  -43.557 1.275   1.00 104.84 ? 319 TYR B CZ  1 
ATOM   10117 O OH  . TYR G 4 79  ? 34.751  -43.240 0.197   1.00 104.48 ? 319 TYR B OH  1 
ATOM   10118 N N   . ILE G 4 80  ? 39.704  -42.642 6.577   1.00 98.25  ? 320 ILE B N   1 
ATOM   10119 C CA  . ILE G 4 80  ? 39.978  -42.361 7.984   1.00 98.65  ? 320 ILE B CA  1 
ATOM   10120 C C   . ILE G 4 80  ? 38.641  -42.119 8.669   1.00 100.30 ? 320 ILE B C   1 
ATOM   10121 O O   . ILE G 4 80  ? 37.899  -41.210 8.282   1.00 102.55 ? 320 ILE B O   1 
ATOM   10122 C CB  . ILE G 4 80  ? 40.909  -41.152 8.157   1.00 101.97 ? 320 ILE B CB  1 
ATOM   10123 C CG1 . ILE G 4 80  ? 42.299  -41.457 7.597   1.00 106.74 ? 320 ILE B CG1 1 
ATOM   10124 C CG2 . ILE G 4 80  ? 40.991  -40.755 9.626   1.00 101.94 ? 320 ILE B CG2 1 
ATOM   10125 C CD1 . ILE G 4 80  ? 43.203  -42.197 8.559   1.00 108.52 ? 320 ILE B CD1 1 
ATOM   10126 N N   . VAL G 4 81  ? 38.330  -42.924 9.682   1.00 99.91  ? 321 VAL B N   1 
ATOM   10127 C CA  . VAL G 4 81  ? 37.049  -42.822 10.370  1.00 97.56  ? 321 VAL B CA  1 
ATOM   10128 C C   . VAL G 4 81  ? 37.289  -42.532 11.844  1.00 100.95 ? 321 VAL B C   1 
ATOM   10129 O O   . VAL G 4 81  ? 38.270  -42.989 12.441  1.00 92.27  ? 321 VAL B O   1 
ATOM   10130 C CB  . VAL G 4 81  ? 36.193  -44.097 10.200  1.00 95.41  ? 321 VAL B CB  1 
ATOM   10131 C CG1 . VAL G 4 81  ? 35.698  -44.212 8.771   1.00 94.15  ? 321 VAL B CG1 1 
ATOM   10132 C CG2 . VAL G 4 81  ? 36.983  -45.327 10.598  1.00 102.97 ? 321 VAL B CG2 1 
ATOM   10133 N N   . SER G 4 82  ? 36.373  -41.762 12.431  1.00 104.81 ? 322 SER B N   1 
ATOM   10134 C CA  . SER G 4 82  ? 36.480  -41.372 13.831  1.00 101.86 ? 322 SER B CA  1 
ATOM   10135 C C   . SER G 4 82  ? 35.086  -41.180 14.407  1.00 97.77  ? 322 SER B C   1 
ATOM   10136 O O   . SER G 4 82  ? 34.258  -40.487 13.809  1.00 95.67  ? 322 SER B O   1 
ATOM   10137 C CB  . SER G 4 82  ? 37.295  -40.083 13.982  1.00 100.38 ? 322 SER B CB  1 
ATOM   10138 O OG  . SER G 4 82  ? 37.158  -39.543 15.284  1.00 98.08  ? 322 SER B OG  1 
ATOM   10139 N N   . VAL G 4 83  ? 34.829  -41.792 15.560  1.00 92.61  ? 323 VAL B N   1 
ATOM   10140 C CA  . VAL G 4 83  ? 33.613  -41.546 16.324  1.00 91.90  ? 323 VAL B CA  1 
ATOM   10141 C C   . VAL G 4 83  ? 33.929  -40.519 17.401  1.00 91.56  ? 323 VAL B C   1 
ATOM   10142 O O   . VAL G 4 83  ? 34.917  -40.654 18.134  1.00 87.88  ? 323 VAL B O   1 
ATOM   10143 C CB  . VAL G 4 83  ? 33.043  -42.845 16.925  1.00 90.43  ? 323 VAL B CB  1 
ATOM   10144 C CG1 . VAL G 4 83  ? 32.656  -43.808 15.818  1.00 92.78  ? 323 VAL B CG1 1 
ATOM   10145 C CG2 . VAL G 4 83  ? 34.041  -43.505 17.858  1.00 90.51  ? 323 VAL B CG2 1 
ATOM   10146 N N   . GLN G 4 84  ? 33.115  -39.473 17.470  1.00 97.17  ? 324 GLN B N   1 
ATOM   10147 C CA  . GLN G 4 84  ? 33.324  -38.411 18.445  1.00 94.46  ? 324 GLN B CA  1 
ATOM   10148 C C   . GLN G 4 84  ? 31.980  -37.777 18.756  1.00 90.57  ? 324 GLN B C   1 
ATOM   10149 O O   . GLN G 4 84  ? 31.022  -37.937 17.990  1.00 82.18  ? 324 GLN B O   1 
ATOM   10150 C CB  . GLN G 4 84  ? 34.321  -37.357 17.937  1.00 96.64  ? 324 GLN B CB  1 
ATOM   10151 C CG  . GLN G 4 84  ? 33.953  -36.687 16.628  1.00 99.59  ? 324 GLN B CG  1 
ATOM   10152 C CD  . GLN G 4 84  ? 35.092  -35.851 16.063  1.00 98.83  ? 324 GLN B CD  1 
ATOM   10153 O OE1 . GLN G 4 84  ? 35.988  -35.430 16.795  1.00 101.09 ? 324 GLN B OE1 1 
ATOM   10154 N NE2 . GLN G 4 84  ? 35.051  -35.593 14.759  1.00 94.22  ? 324 GLN B NE2 1 
ATOM   10155 N N   . PRO G 4 85  ? 31.864  -37.070 19.888  1.00 88.16  ? 325 PRO B N   1 
ATOM   10156 C CA  . PRO G 4 85  ? 30.578  -36.452 20.229  1.00 86.93  ? 325 PRO B CA  1 
ATOM   10157 C C   . PRO G 4 85  ? 30.154  -35.408 19.214  1.00 87.08  ? 325 PRO B C   1 
ATOM   10158 O O   . PRO G 4 85  ? 30.812  -34.373 19.067  1.00 85.85  ? 325 PRO B O   1 
ATOM   10159 C CB  . PRO G 4 85  ? 30.840  -35.824 21.606  1.00 84.96  ? 325 PRO B CB  1 
ATOM   10160 C CG  . PRO G 4 85  ? 32.323  -35.700 21.698  1.00 85.17  ? 325 PRO B CG  1 
ATOM   10161 C CD  . PRO G 4 85  ? 32.856  -36.881 20.960  1.00 86.29  ? 325 PRO B CD  1 
ATOM   10162 N N   . ARG G 4 86  ? 29.072  -35.682 18.490  1.00 90.71  ? 326 ARG B N   1 
ATOM   10163 C CA  . ARG G 4 86  ? 28.451  -34.651 17.674  1.00 93.31  ? 326 ARG B CA  1 
ATOM   10164 C C   . ARG G 4 86  ? 27.826  -33.597 18.578  1.00 96.53  ? 326 ARG B C   1 
ATOM   10165 O O   . ARG G 4 86  ? 27.231  -33.914 19.612  1.00 111.82 ? 326 ARG B O   1 
ATOM   10166 C CB  . ARG G 4 86  ? 27.399  -35.259 16.743  1.00 90.58  ? 326 ARG B CB  1 
ATOM   10167 C CG  . ARG G 4 86  ? 26.196  -35.862 17.453  1.00 90.93  ? 326 ARG B CG  1 
ATOM   10168 C CD  . ARG G 4 86  ? 25.251  -36.518 16.466  1.00 92.41  ? 326 ARG B CD  1 
ATOM   10169 N NE  . ARG G 4 86  ? 24.921  -35.618 15.365  1.00 95.45  ? 326 ARG B NE  1 
ATOM   10170 C CZ  . ARG G 4 86  ? 24.422  -36.014 14.199  1.00 100.69 ? 326 ARG B CZ  1 
ATOM   10171 N NH1 . ARG G 4 86  ? 24.197  -37.304 13.975  1.00 105.45 ? 326 ARG B NH1 1 
ATOM   10172 N NH2 . ARG G 4 86  ? 24.152  -35.122 13.253  1.00 94.84  ? 326 ARG B NH2 1 
ATOM   10173 N N   . ARG G 4 87  ? 27.984  -32.331 18.200  1.00 98.33  ? 327 ARG B N   1 
ATOM   10174 C CA  . ARG G 4 87  ? 27.497  -31.225 19.019  1.00 100.45 ? 327 ARG B CA  1 
ATOM   10175 C C   . ARG G 4 87  ? 26.125  -30.806 18.495  1.00 100.44 ? 327 ARG B C   1 
ATOM   10176 O O   . ARG G 4 87  ? 25.977  -29.848 17.736  1.00 105.72 ? 327 ARG B O   1 
ATOM   10177 C CB  . ARG G 4 87  ? 28.496  -30.073 19.015  1.00 106.14 ? 327 ARG B CB  1 
ATOM   10178 C CG  . ARG G 4 87  ? 28.357  -29.130 20.199  1.00 107.10 ? 327 ARG B CG  1 
ATOM   10179 C CD  . ARG G 4 87  ? 29.671  -28.431 20.515  1.00 110.18 ? 327 ARG B CD  1 
ATOM   10180 N NE  . ARG G 4 87  ? 30.610  -29.315 21.203  1.00 114.08 ? 327 ARG B NE  1 
ATOM   10181 C CZ  . ARG G 4 87  ? 31.864  -28.989 21.503  1.00 112.37 ? 327 ARG B CZ  1 
ATOM   10182 N NH1 . ARG G 4 87  ? 32.645  -29.858 22.129  1.00 110.24 ? 327 ARG B NH1 1 
ATOM   10183 N NH2 . ARG G 4 87  ? 32.339  -27.793 21.176  1.00 111.74 ? 327 ARG B NH2 1 
ATOM   10184 N N   . ALA G 4 88  ? 25.106  -31.555 18.909  1.00 95.95  ? 328 ALA B N   1 
ATOM   10185 C CA  . ALA G 4 88  ? 23.737  -31.210 18.557  1.00 95.87  ? 328 ALA B CA  1 
ATOM   10186 C C   . ALA G 4 88  ? 23.328  -29.923 19.259  1.00 97.04  ? 328 ALA B C   1 
ATOM   10187 O O   . ALA G 4 88  ? 23.676  -29.693 20.421  1.00 95.00  ? 328 ALA B O   1 
ATOM   10188 C CB  . ALA G 4 88  ? 22.785  -32.344 18.934  1.00 98.97  ? 328 ALA B CB  1 
ATOM   10189 N N   . GLU G 4 89  ? 22.586  -29.079 18.546  1.00 97.71  ? 329 GLU B N   1 
ATOM   10190 C CA  . GLU G 4 89  ? 22.228  -27.753 19.027  1.00 91.38  ? 329 GLU B CA  1 
ATOM   10191 C C   . GLU G 4 89  ? 20.718  -27.566 19.009  1.00 94.08  ? 329 GLU B C   1 
ATOM   10192 O O   . GLU G 4 89  ? 20.048  -27.930 18.037  1.00 95.03  ? 329 GLU B O   1 
ATOM   10193 C CB  . GLU G 4 89  ? 22.897  -26.667 18.182  1.00 87.60  ? 329 GLU B CB  1 
ATOM   10194 C CG  . GLU G 4 89  ? 24.301  -26.317 18.635  1.00 86.60  ? 329 GLU B CG  1 
ATOM   10195 C CD  . GLU G 4 89  ? 24.997  -25.375 17.678  1.00 86.33  ? 329 GLU B CD  1 
ATOM   10196 O OE1 . GLU G 4 89  ? 24.527  -25.250 16.527  1.00 84.41  ? 329 GLU B OE1 1 
ATOM   10197 O OE2 . GLU G 4 89  ? 26.018  -24.771 18.069  1.00 83.95  ? 329 GLU B OE2 1 
ATOM   10198 N N   . LYS G 4 90  ? 20.192  -26.994 20.090  1.00 87.67  ? 330 LYS B N   1 
ATOM   10199 C CA  . LYS G 4 90  ? 18.782  -26.639 20.191  1.00 83.97  ? 330 LYS B CA  1 
ATOM   10200 C C   . LYS G 4 90  ? 18.631  -25.148 19.912  1.00 85.00  ? 330 LYS B C   1 
ATOM   10201 O O   . LYS G 4 90  ? 19.244  -24.320 20.596  1.00 79.12  ? 330 LYS B O   1 
ATOM   10202 C CB  . LYS G 4 90  ? 18.224  -26.984 21.570  1.00 83.16  ? 330 LYS B CB  1 
ATOM   10203 C CG  . LYS G 4 90  ? 16.740  -27.309 21.566  1.00 85.10  ? 330 LYS B CG  1 
ATOM   10204 C CD  . LYS G 4 90  ? 16.244  -27.689 22.954  1.00 84.47  ? 330 LYS B CD  1 
ATOM   10205 C CE  . LYS G 4 90  ? 14.906  -28.412 22.884  1.00 83.64  ? 330 LYS B CE  1 
ATOM   10206 N NZ  . LYS G 4 90  ? 14.270  -28.528 24.224  1.00 82.99  ? 330 LYS B NZ  1 
ATOM   10207 N N   . HIS G 4 91  ? 17.818  -24.811 18.913  1.00 87.42  ? 331 HIS B N   1 
ATOM   10208 C CA  . HIS G 4 91  ? 17.562  -23.421 18.555  1.00 84.22  ? 331 HIS B CA  1 
ATOM   10209 C C   . HIS G 4 91  ? 16.401  -22.911 19.398  1.00 81.36  ? 331 HIS B C   1 
ATOM   10210 O O   . HIS G 4 91  ? 15.253  -23.314 19.189  1.00 82.70  ? 331 HIS B O   1 
ATOM   10211 C CB  . HIS G 4 91  ? 17.239  -23.281 17.070  1.00 88.14  ? 331 HIS B CB  1 
ATOM   10212 C CG  . HIS G 4 91  ? 18.321  -23.772 16.161  1.00 92.29  ? 331 HIS B CG  1 
ATOM   10213 N ND1 . HIS G 4 91  ? 19.524  -24.259 16.626  1.00 93.11  ? 331 HIS B ND1 1 
ATOM   10214 C CD2 . HIS G 4 91  ? 18.387  -23.835 14.810  1.00 94.00  ? 331 HIS B CD2 1 
ATOM   10215 C CE1 . HIS G 4 91  ? 20.277  -24.616 15.601  1.00 93.88  ? 331 HIS B CE1 1 
ATOM   10216 N NE2 . HIS G 4 91  ? 19.612  -24.365 14.488  1.00 97.26  ? 331 HIS B NE2 1 
ATOM   10217 N N   . ILE G 4 92  ? 16.695  -22.030 20.348  1.00 81.93  ? 332 ILE B N   1 
ATOM   10218 C CA  . ILE G 4 92  ? 15.670  -21.340 21.124  1.00 83.49  ? 332 ILE B CA  1 
ATOM   10219 C C   . ILE G 4 92  ? 15.629  -19.888 20.660  1.00 81.89  ? 332 ILE B C   1 
ATOM   10220 O O   . ILE G 4 92  ? 16.659  -19.201 20.629  1.00 81.87  ? 332 ILE B O   1 
ATOM   10221 C CB  . ILE G 4 92  ? 15.914  -21.462 22.639  1.00 86.02  ? 332 ILE B CB  1 
ATOM   10222 C CG1 . ILE G 4 92  ? 17.250  -20.844 23.053  1.00 93.56  ? 332 ILE B CG1 1 
ATOM   10223 C CG2 . ILE G 4 92  ? 15.857  -22.917 23.075  1.00 87.16  ? 332 ILE B CG2 1 
ATOM   10224 C CD1 . ILE G 4 92  ? 17.111  -19.517 23.776  1.00 101.23 ? 332 ILE B CD1 1 
ATOM   10225 N N   . LYS G 4 93  ? 14.444  -19.433 20.260  1.00 78.17  ? 333 LYS B N   1 
ATOM   10226 C CA  . LYS G 4 93  ? 14.259  -18.071 19.777  1.00 79.16  ? 333 LYS B CA  1 
ATOM   10227 C C   . LYS G 4 93  ? 13.802  -17.204 20.943  1.00 78.38  ? 333 LYS B C   1 
ATOM   10228 O O   . LYS G 4 93  ? 12.778  -17.492 21.571  1.00 82.02  ? 333 LYS B O   1 
ATOM   10229 C CB  . LYS G 4 93  ? 13.245  -18.039 18.633  1.00 83.34  ? 333 LYS B CB  1 
ATOM   10230 C CG  . LYS G 4 93  ? 13.157  -16.715 17.892  1.00 85.99  ? 333 LYS B CG  1 
ATOM   10231 C CD  . LYS G 4 93  ? 12.337  -16.865 16.617  1.00 88.37  ? 333 LYS B CD  1 
ATOM   10232 C CE  . LYS G 4 93  ? 12.355  -15.592 15.787  1.00 95.51  ? 333 LYS B CE  1 
ATOM   10233 N NZ  . LYS G 4 93  ? 11.254  -15.544 14.785  1.00 98.93  ? 333 LYS B NZ  1 
ATOM   10234 N N   . SER G 4 94  ? 14.576  -16.157 21.243  1.00 78.38  ? 334 SER B N   1 
ATOM   10235 C CA  . SER G 4 94  ? 14.292  -15.339 22.418  1.00 73.60  ? 334 SER B CA  1 
ATOM   10236 C C   . SER G 4 94  ? 12.899  -14.731 22.346  1.00 71.87  ? 334 SER B C   1 
ATOM   10237 O O   . SER G 4 94  ? 12.165  -14.728 23.340  1.00 72.11  ? 334 SER B O   1 
ATOM   10238 C CB  . SER G 4 94  ? 15.347  -14.244 22.560  1.00 72.47  ? 334 SER B CB  1 
ATOM   10239 O OG  . SER G 4 94  ? 16.630  -14.805 22.769  1.00 76.68  ? 334 SER B OG  1 
ATOM   10240 N N   . SER G 4 95  ? 12.511  -14.232 21.171  1.00 71.62  ? 335 SER B N   1 
ATOM   10241 C CA  . SER G 4 95  ? 11.221  -13.571 21.011  1.00 74.17  ? 335 SER B CA  1 
ATOM   10242 C C   . SER G 4 95  ? 10.040  -14.519 21.173  1.00 73.19  ? 335 SER B C   1 
ATOM   10243 O O   . SER G 4 95  ? 8.899   -14.051 21.228  1.00 72.37  ? 335 SER B O   1 
ATOM   10244 C CB  . SER G 4 95  ? 11.145  -12.883 19.644  1.00 76.74  ? 335 SER B CB  1 
ATOM   10245 O OG  . SER G 4 95  ? 10.482  -13.687 18.682  1.00 75.46  ? 335 SER B OG  1 
ATOM   10246 N N   . VAL G 4 96  ? 10.278  -15.827 21.250  1.00 72.26  ? 336 VAL B N   1 
ATOM   10247 C CA  . VAL G 4 96  ? 9.214   -16.806 21.414  1.00 74.31  ? 336 VAL B CA  1 
ATOM   10248 C C   . VAL G 4 96  ? 9.305   -17.539 22.743  1.00 75.63  ? 336 VAL B C   1 
ATOM   10249 O O   . VAL G 4 96  ? 8.451   -18.383 23.033  1.00 77.93  ? 336 VAL B O   1 
ATOM   10250 C CB  . VAL G 4 96  ? 9.197   -17.811 20.241  1.00 76.37  ? 336 VAL B CB  1 
ATOM   10251 C CG1 . VAL G 4 96  ? 7.836   -18.481 20.108  1.00 79.50  ? 336 VAL B CG1 1 
ATOM   10252 C CG2 . VAL G 4 96  ? 9.586   -17.126 18.940  1.00 78.23  ? 336 VAL B CG2 1 
ATOM   10253 N N   . ASN G 4 97  ? 10.309  -17.241 23.563  1.00 75.58  ? 337 ASN B N   1 
ATOM   10254 C CA  . ASN G 4 97  ? 10.502  -17.877 24.863  1.00 77.86  ? 337 ASN B CA  1 
ATOM   10255 C C   . ASN G 4 97  ? 10.601  -16.819 25.958  1.00 76.89  ? 337 ASN B C   1 
ATOM   10256 O O   . ASN G 4 97  ? 11.559  -16.771 26.731  1.00 79.91  ? 337 ASN B O   1 
ATOM   10257 C CB  . ASN G 4 97  ? 11.751  -18.761 24.859  1.00 80.86  ? 337 ASN B CB  1 
ATOM   10258 C CG  . ASN G 4 97  ? 11.544  -20.071 24.117  1.00 78.72  ? 337 ASN B CG  1 
ATOM   10259 O OD1 . ASN G 4 97  ? 10.867  -20.119 23.092  1.00 79.77  ? 337 ASN B OD1 1 
ATOM   10260 N ND2 . ASN G 4 97  ? 12.127  -21.145 24.640  1.00 81.28  ? 337 ASN B ND2 1 
ATOM   10261 N N   . ILE G 4 98  ? 9.598   -15.952 26.039  1.00 72.85  ? 338 ILE B N   1 
ATOM   10262 C CA  . ILE G 4 98  ? 9.619   -14.813 26.951  1.00 72.40  ? 338 ILE B CA  1 
ATOM   10263 C C   . ILE G 4 98  ? 8.822   -15.174 28.197  1.00 70.82  ? 338 ILE B C   1 
ATOM   10264 O O   . ILE G 4 98  ? 7.598   -15.326 28.140  1.00 69.40  ? 338 ILE B O   1 
ATOM   10265 C CB  . ILE G 4 98  ? 9.063   -13.545 26.290  1.00 74.80  ? 338 ILE B CB  1 
ATOM   10266 C CG1 . ILE G 4 98  ? 9.779   -13.268 24.967  1.00 77.26  ? 338 ILE B CG1 1 
ATOM   10267 C CG2 . ILE G 4 98  ? 9.206   -12.356 27.224  1.00 73.62  ? 338 ILE B CG2 1 
ATOM   10268 C CD1 . ILE G 4 98  ? 9.271   -12.044 24.243  1.00 74.69  ? 338 ILE B CD1 1 
ATOM   10269 N N   . GLN G 4 99  ? 9.509   -15.303 29.331  1.00 71.19  ? 339 GLN B N   1 
ATOM   10270 C CA  . GLN G 4 99  ? 8.861   -15.416 30.634  1.00 72.34  ? 339 GLN B CA  1 
ATOM   10271 C C   . GLN G 4 99  ? 9.237   -14.190 31.452  1.00 69.75  ? 339 GLN B C   1 
ATOM   10272 O O   . GLN G 4 99  ? 10.399  -14.032 31.841  1.00 68.04  ? 339 GLN B O   1 
ATOM   10273 C CB  . GLN G 4 99  ? 9.261   -16.688 31.375  1.00 75.04  ? 339 GLN B CB  1 
ATOM   10274 C CG  . GLN G 4 99  ? 8.435   -16.895 32.639  1.00 75.64  ? 339 GLN B CG  1 
ATOM   10275 C CD  . GLN G 4 99  ? 9.214   -17.536 33.765  1.00 72.74  ? 339 GLN B CD  1 
ATOM   10276 O OE1 . GLN G 4 99  ? 10.342  -17.987 33.578  1.00 73.94  ? 339 GLN B OE1 1 
ATOM   10277 N NE2 . GLN G 4 99  ? 8.611   -17.580 34.947  1.00 70.71  ? 339 GLN B NE2 1 
ATOM   10278 N N   . MET G 4 100 ? 8.258   -13.336 31.720  1.00 68.51  ? 340 MET B N   1 
ATOM   10279 C CA  . MET G 4 100 ? 8.511   -12.136 32.493  1.00 68.94  ? 340 MET B CA  1 
ATOM   10280 C C   . MET G 4 100 ? 8.662   -12.471 33.972  1.00 68.77  ? 340 MET B C   1 
ATOM   10281 O O   . MET G 4 100 ? 8.323   -13.565 34.431  1.00 69.28  ? 340 MET B O   1 
ATOM   10282 C CB  . MET G 4 100 ? 7.386   -11.122 32.292  1.00 73.08  ? 340 MET B CB  1 
ATOM   10283 C CG  . MET G 4 100 ? 7.157   -10.742 30.840  1.00 76.30  ? 340 MET B CG  1 
ATOM   10284 S SD  . MET G 4 100 ? 5.581   -9.912  30.582  1.00 76.10  ? 340 MET B SD  1 
ATOM   10285 C CE  . MET G 4 100 ? 5.836   -8.420  31.536  1.00 78.62  ? 340 MET B CE  1 
ATOM   10286 N N   . ALA G 4 101 ? 9.193   -11.510 34.718  1.00 68.60  ? 341 ALA B N   1 
ATOM   10287 C CA  . ALA G 4 101 ? 9.301   -11.667 36.155  1.00 69.06  ? 341 ALA B CA  1 
ATOM   10288 C C   . ALA G 4 101 ? 7.924   -11.514 36.799  1.00 69.70  ? 341 ALA B C   1 
ATOM   10289 O O   . ALA G 4 101 ? 7.038   -10.861 36.239  1.00 69.66  ? 341 ALA B O   1 
ATOM   10290 C CB  . ALA G 4 101 ? 10.272  -10.640 36.731  1.00 68.73  ? 341 ALA B CB  1 
ATOM   10291 N N   . PRO G 4 102 ? 7.714   -12.117 37.967  1.00 70.33  ? 342 PRO B N   1 
ATOM   10292 C CA  . PRO G 4 102 ? 6.423   -11.992 38.654  1.00 71.03  ? 342 PRO B CA  1 
ATOM   10293 C C   . PRO G 4 102 ? 6.094   -10.542 38.955  1.00 70.93  ? 342 PRO B C   1 
ATOM   10294 O O   . PRO G 4 102 ? 6.954   -9.784  39.430  1.00 70.64  ? 342 PRO B O   1 
ATOM   10295 C CB  . PRO G 4 102 ? 6.632   -12.789 39.952  1.00 71.72  ? 342 PRO B CB  1 
ATOM   10296 C CG  . PRO G 4 102 ? 8.111   -12.902 40.102  1.00 74.79  ? 342 PRO B CG  1 
ATOM   10297 C CD  . PRO G 4 102 ? 8.638   -12.990 38.708  1.00 70.51  ? 342 PRO B CD  1 
ATOM   10298 N N   . PRO G 4 103 ? 4.858   -10.121 38.699  1.00 71.21  ? 343 PRO B N   1 
ATOM   10299 C CA  . PRO G 4 103 ? 4.459   -8.745  39.011  1.00 71.19  ? 343 PRO B CA  1 
ATOM   10300 C C   . PRO G 4 103 ? 4.498   -8.483  40.507  1.00 71.74  ? 343 PRO B C   1 
ATOM   10301 O O   . PRO G 4 103 ? 4.610   -9.390  41.333  1.00 74.32  ? 343 PRO B O   1 
ATOM   10302 C CB  . PRO G 4 103 ? 3.029   -8.653  38.468  1.00 71.56  ? 343 PRO B CB  1 
ATOM   10303 C CG  . PRO G 4 103 ? 2.903   -9.782  37.499  1.00 71.50  ? 343 PRO B CG  1 
ATOM   10304 C CD  . PRO G 4 103 ? 3.789   -10.868 38.017  1.00 71.56  ? 343 PRO B CD  1 
ATOM   10305 N N   . SER G 4 104 ? 4.405   -7.205  40.853  1.00 71.66  ? 344 SER B N   1 
ATOM   10306 C CA  . SER G 4 104 ? 4.336   -6.755  42.237  1.00 73.83  ? 344 SER B CA  1 
ATOM   10307 C C   . SER G 4 104 ? 2.916   -6.283  42.515  1.00 76.25  ? 344 SER B C   1 
ATOM   10308 O O   . SER G 4 104 ? 2.427   -5.363  41.849  1.00 80.27  ? 344 SER B O   1 
ATOM   10309 C CB  . SER G 4 104 ? 5.340   -5.635  42.501  1.00 73.58  ? 344 SER B CB  1 
ATOM   10310 O OG  . SER G 4 104 ? 5.144   -5.077  43.788  1.00 74.63  ? 344 SER B OG  1 
ATOM   10311 N N   . LEU G 4 105 ? 2.267   -6.908  43.495  1.00 77.06  ? 345 LEU B N   1 
ATOM   10312 C CA  . LEU G 4 105 ? 0.853   -6.703  43.775  1.00 77.42  ? 345 LEU B CA  1 
ATOM   10313 C C   . LEU G 4 105 ? 0.660   -5.868  45.034  1.00 77.99  ? 345 LEU B C   1 
ATOM   10314 O O   . LEU G 4 105 ? 1.499   -5.865  45.939  1.00 78.08  ? 345 LEU B O   1 
ATOM   10315 C CB  . LEU G 4 105 ? 0.129   -8.044  43.938  1.00 78.13  ? 345 LEU B CB  1 
ATOM   10316 C CG  . LEU G 4 105 ? -1.364  -7.998  44.275  1.00 79.04  ? 345 LEU B CG  1 
ATOM   10317 C CD1 . LEU G 4 105 ? -2.171  -7.460  43.104  1.00 78.77  ? 345 LEU B CD1 1 
ATOM   10318 C CD2 . LEU G 4 105 ? -1.863  -9.355  44.706  1.00 82.34  ? 345 LEU B CD2 1 
ATOM   10319 N N   . GLN G 4 106 ? -0.473  -5.172  45.084  1.00 77.26  ? 346 GLN B N   1 
ATOM   10320 C CA  . GLN G 4 106 ? -0.844  -4.326  46.204  1.00 80.66  ? 346 GLN B CA  1 
ATOM   10321 C C   . GLN G 4 106 ? -2.361  -4.235  46.230  1.00 81.86  ? 346 GLN B C   1 
ATOM   10322 O O   . GLN G 4 106 ? -3.001  -4.222  45.176  1.00 86.75  ? 346 GLN B O   1 
ATOM   10323 C CB  . GLN G 4 106 ? -0.214  -2.938  46.059  1.00 80.84  ? 346 GLN B CB  1 
ATOM   10324 C CG  . GLN G 4 106 ? -0.317  -2.054  47.278  1.00 82.72  ? 346 GLN B CG  1 
ATOM   10325 C CD  . GLN G 4 106 ? -0.005  -0.609  46.952  1.00 84.97  ? 346 GLN B CD  1 
ATOM   10326 O OE1 . GLN G 4 106 ? 0.115   0.228   47.845  1.00 88.87  ? 346 GLN B OE1 1 
ATOM   10327 N NE2 . GLN G 4 106 ? 0.136   -0.309  45.665  1.00 87.97  ? 346 GLN B NE2 1 
ATOM   10328 N N   . VAL G 4 107 ? -2.935  -4.195  47.426  1.00 83.89  ? 347 VAL B N   1 
ATOM   10329 C CA  . VAL G 4 107 ? -4.377  -4.079  47.591  1.00 84.77  ? 347 VAL B CA  1 
ATOM   10330 C C   . VAL G 4 107 ? -4.667  -2.797  48.355  1.00 85.15  ? 347 VAL B C   1 
ATOM   10331 O O   . VAL G 4 107 ? -3.960  -2.459  49.311  1.00 85.26  ? 347 VAL B O   1 
ATOM   10332 C CB  . VAL G 4 107 ? -4.974  -5.313  48.302  1.00 85.78  ? 347 VAL B CB  1 
ATOM   10333 C CG1 . VAL G 4 107 ? -4.392  -5.478  49.698  1.00 86.32  ? 347 VAL B CG1 1 
ATOM   10334 C CG2 . VAL G 4 107 ? -6.488  -5.213  48.355  1.00 86.70  ? 347 VAL B CG2 1 
ATOM   10335 N N   . THR G 4 108 ? -5.690  -2.066  47.916  1.00 92.63  ? 348 THR B N   1 
ATOM   10336 C CA  . THR G 4 108 ? -5.953  -0.747  48.466  1.00 94.27  ? 348 THR B CA  1 
ATOM   10337 C C   . THR G 4 108 ? -7.449  -0.550  48.677  1.00 98.92  ? 348 THR B C   1 
ATOM   10338 O O   . THR G 4 108 ? -8.280  -1.130  47.972  1.00 91.60  ? 348 THR B O   1 
ATOM   10339 C CB  . THR G 4 108 ? -5.373  0.355   47.562  1.00 90.64  ? 348 THR B CB  1 
ATOM   10340 O OG1 . THR G 4 108 ? -5.195  1.555   48.322  1.00 92.44  ? 348 THR B OG1 1 
ATOM   10341 C CG2 . THR G 4 108 ? -6.285  0.635   46.385  1.00 90.45  ? 348 THR B CG2 1 
ATOM   10342 N N   . LYS G 4 109 ? -7.779  0.261   49.681  1.00 103.08 ? 349 LYS B N   1 
ATOM   10343 C CA  . LYS G 4 109 ? -9.156  0.542   50.077  1.00 103.64 ? 349 LYS B CA  1 
ATOM   10344 C C   . LYS G 4 109 ? -9.471  1.989   49.724  1.00 102.89 ? 349 LYS B C   1 
ATOM   10345 O O   . LYS G 4 109 ? -8.904  2.914   50.316  1.00 97.42  ? 349 LYS B O   1 
ATOM   10346 C CB  . LYS G 4 109 ? -9.356  0.293   51.570  1.00 108.18 ? 349 LYS B CB  1 
ATOM   10347 C CG  . LYS G 4 109 ? -10.730 0.689   52.093  1.00 112.69 ? 349 LYS B CG  1 
ATOM   10348 C CD  . LYS G 4 109 ? -10.748 0.747   53.614  1.00 113.90 ? 349 LYS B CD  1 
ATOM   10349 C CE  . LYS G 4 109 ? -12.072 1.276   54.139  1.00 110.62 ? 349 LYS B CE  1 
ATOM   10350 N NZ  . LYS G 4 109 ? -13.183 0.302   53.957  1.00 111.59 ? 349 LYS B NZ  1 
ATOM   10351 N N   . ASP G 4 110 ? -10.371 2.184   48.768  1.00 108.42 ? 350 ASP B N   1 
ATOM   10352 C CA  . ASP G 4 110 ? -10.735 3.521   48.303  1.00 112.34 ? 350 ASP B CA  1 
ATOM   10353 C C   . ASP G 4 110 ? -12.019 3.995   48.969  1.00 111.13 ? 350 ASP B C   1 
ATOM   10354 O O   . ASP G 4 110 ? -12.969 4.429   48.318  1.00 102.02 ? 350 ASP B O   1 
ATOM   10355 C CB  . ASP G 4 110 ? -10.864 3.517   46.787  1.00 114.81 ? 350 ASP B CB  1 
ATOM   10356 C CG  . ASP G 4 110 ? -9.717  2.782   46.114  1.00 116.09 ? 350 ASP B CG  1 
ATOM   10357 O OD1 . ASP G 4 110 ? -8.557  2.964   46.545  1.00 103.87 ? 350 ASP B OD1 1 
ATOM   10358 O OD2 . ASP G 4 110 ? -9.975  2.022   45.156  1.00 126.29 ? 350 ASP B OD2 1 
ATOM   10359 N N   . GLY G 4 111 ? -12.052 3.896   50.296  1.00 118.73 ? 351 GLY B N   1 
ATOM   10360 C CA  . GLY G 4 111 ? -13.231 4.250   51.058  1.00 122.51 ? 351 GLY B CA  1 
ATOM   10361 C C   . GLY G 4 111 ? -14.264 3.144   51.081  1.00 123.30 ? 351 GLY B C   1 
ATOM   10362 O O   . GLY G 4 111 ? -14.226 2.263   51.946  1.00 117.47 ? 351 GLY B O   1 
ATOM   10363 N N   . ASP G 4 112 ? -15.193 3.173   50.125  1.00 127.47 ? 352 ASP B N   1 
ATOM   10364 C CA  . ASP G 4 112 ? -16.257 2.174   50.097  1.00 126.61 ? 352 ASP B CA  1 
ATOM   10365 C C   . ASP G 4 112 ? -15.739 0.826   49.613  1.00 121.70 ? 352 ASP B C   1 
ATOM   10366 O O   . ASP G 4 112 ? -15.913 -0.196  50.289  1.00 112.74 ? 352 ASP B O   1 
ATOM   10367 C CB  . ASP G 4 112 ? -17.400 2.655   49.204  1.00 131.22 ? 352 ASP B CB  1 
ATOM   10368 C CG  . ASP G 4 112 ? -17.896 4.035   49.580  1.00 132.73 ? 352 ASP B CG  1 
ATOM   10369 O OD1 . ASP G 4 112 ? -17.939 4.343   50.792  1.00 135.04 ? 352 ASP B OD1 1 
ATOM   10370 O OD2 . ASP G 4 112 ? -18.235 4.813   48.662  1.00 124.69 ? 352 ASP B OD2 1 
ATOM   10371 N N   . SER G 4 113 ? -15.094 0.807   48.451  1.00 120.81 ? 353 SER B N   1 
ATOM   10372 C CA  . SER G 4 113 ? -14.733 -0.424  47.767  1.00 115.61 ? 353 SER B CA  1 
ATOM   10373 C C   . SER G 4 113 ? -13.225 -0.647  47.780  1.00 110.62 ? 353 SER B C   1 
ATOM   10374 O O   . SER G 4 113 ? -12.427 0.284   47.932  1.00 108.15 ? 353 SER B O   1 
ATOM   10375 C CB  . SER G 4 113 ? -15.245 -0.408  46.321  1.00 110.35 ? 353 SER B CB  1 
ATOM   10376 O OG  . SER G 4 113 ? -16.661 -0.322  46.281  1.00 105.74 ? 353 SER B OG  1 
ATOM   10377 N N   . TYR G 4 114 ? -12.849 -1.909  47.610  1.00 101.00 ? 354 TYR B N   1 
ATOM   10378 C CA  . TYR G 4 114 ? -11.460 -2.329  47.544  1.00 101.54 ? 354 TYR B CA  1 
ATOM   10379 C C   . TYR G 4 114 ? -11.046 -2.512  46.089  1.00 101.09 ? 354 TYR B C   1 
ATOM   10380 O O   . TYR G 4 114 ? -11.878 -2.726  45.205  1.00 97.48  ? 354 TYR B O   1 
ATOM   10381 C CB  . TYR G 4 114 ? -11.256 -3.633  48.321  1.00 104.17 ? 354 TYR B CB  1 
ATOM   10382 C CG  . TYR G 4 114 ? -11.419 -3.482  49.819  1.00 102.78 ? 354 TYR B CG  1 
ATOM   10383 C CD1 . TYR G 4 114 ? -10.367 -3.051  50.614  1.00 101.69 ? 354 TYR B CD1 1 
ATOM   10384 C CD2 . TYR G 4 114 ? -12.634 -3.755  50.433  1.00 102.04 ? 354 TYR B CD2 1 
ATOM   10385 C CE1 . TYR G 4 114 ? -10.517 -2.909  51.983  1.00 101.58 ? 354 TYR B CE1 1 
ATOM   10386 C CE2 . TYR G 4 114 ? -12.794 -3.613  51.800  1.00 102.80 ? 354 TYR B CE2 1 
ATOM   10387 C CZ  . TYR G 4 114 ? -11.732 -3.189  52.570  1.00 102.49 ? 354 TYR B CZ  1 
ATOM   10388 O OH  . TYR G 4 114 ? -11.881 -3.046  53.931  1.00 100.98 ? 354 TYR B OH  1 
ATOM   10389 N N   . SER G 4 115 ? -9.741  -2.420  45.846  1.00 94.66  ? 355 SER B N   1 
ATOM   10390 C CA  . SER G 4 115 ? -9.213  -2.571  44.499  1.00 90.74  ? 355 SER B CA  1 
ATOM   10391 C C   . SER G 4 115 ? -7.796  -3.122  44.570  1.00 90.83  ? 355 SER B C   1 
ATOM   10392 O O   . SER G 4 115 ? -7.154  -3.121  45.625  1.00 87.15  ? 355 SER B O   1 
ATOM   10393 C CB  . SER G 4 115 ? -9.245  -1.244  43.729  1.00 89.69  ? 355 SER B CB  1 
ATOM   10394 O OG  . SER G 4 115 ? -8.814  -0.166  44.539  1.00 89.97  ? 355 SER B OG  1 
ATOM   10395 N N   . LEU G 4 116 ? -7.323  -3.603  43.423  1.00 83.37  ? 356 LEU B N   1 
ATOM   10396 C CA  . LEU G 4 116 ? -6.005  -4.203  43.285  1.00 82.90  ? 356 LEU B CA  1 
ATOM   10397 C C   . LEU G 4 116 ? -5.181  -3.377  42.310  1.00 81.53  ? 356 LEU B C   1 
ATOM   10398 O O   . LEU G 4 116 ? -5.690  -2.935  41.276  1.00 79.94  ? 356 LEU B O   1 
ATOM   10399 C CB  . LEU G 4 116 ? -6.114  -5.648  42.790  1.00 81.43  ? 356 LEU B CB  1 
ATOM   10400 C CG  . LEU G 4 116 ? -6.990  -6.559  43.652  1.00 83.64  ? 356 LEU B CG  1 
ATOM   10401 C CD1 . LEU G 4 116 ? -7.235  -7.889  42.964  1.00 83.06  ? 356 LEU B CD1 1 
ATOM   10402 C CD2 . LEU G 4 116 ? -6.364  -6.774  45.022  1.00 83.67  ? 356 LEU B CD2 1 
ATOM   10403 N N   . ARG G 4 117 ? -3.912  -3.160  42.647  1.00 83.75  ? 357 ARG B N   1 
ATOM   10404 C CA  . ARG G 4 117 ? -2.986  -2.399  41.820  1.00 83.81  ? 357 ARG B CA  1 
ATOM   10405 C C   . ARG G 4 117 ? -1.671  -3.158  41.742  1.00 82.63  ? 357 ARG B C   1 
ATOM   10406 O O   . ARG G 4 117 ? -1.149  -3.606  42.766  1.00 85.91  ? 357 ARG B O   1 
ATOM   10407 C CB  . ARG G 4 117 ? -2.760  -0.995  42.392  1.00 86.25  ? 357 ARG B CB  1 
ATOM   10408 C CG  . ARG G 4 117 ? -4.021  -0.148  42.488  1.00 88.60  ? 357 ARG B CG  1 
ATOM   10409 C CD  . ARG G 4 117 ? -3.833  1.022   43.446  1.00 90.37  ? 357 ARG B CD  1 
ATOM   10410 N NE  . ARG G 4 117 ? -4.337  2.279   42.897  1.00 85.93  ? 357 ARG B NE  1 
ATOM   10411 C CZ  . ARG G 4 117 ? -5.620  2.631   42.880  1.00 83.89  ? 357 ARG B CZ  1 
ATOM   10412 N NH1 . ARG G 4 117 ? -5.984  3.797   42.359  1.00 84.56  ? 357 ARG B NH1 1 
ATOM   10413 N NH2 . ARG G 4 117 ? -6.541  1.819   43.380  1.00 83.96  ? 357 ARG B NH2 1 
ATOM   10414 N N   . TRP G 4 118 ? -1.129  -3.294  40.535  1.00 78.74  ? 358 TRP B N   1 
ATOM   10415 C CA  . TRP G 4 118 ? 0.093   -4.061  40.348  1.00 75.77  ? 358 TRP B CA  1 
ATOM   10416 C C   . TRP G 4 118 ? 1.005   -3.362  39.349  1.00 76.53  ? 358 TRP B C   1 
ATOM   10417 O O   . TRP G 4 118 ? 0.566   -2.545  38.535  1.00 77.61  ? 358 TRP B O   1 
ATOM   10418 C CB  . TRP G 4 118 ? -0.218  -5.486  39.888  1.00 72.96  ? 358 TRP B CB  1 
ATOM   10419 C CG  . TRP G 4 118 ? -1.048  -5.539  38.657  1.00 72.89  ? 358 TRP B CG  1 
ATOM   10420 C CD1 . TRP G 4 118 ? -0.602  -5.572  37.372  1.00 73.30  ? 358 TRP B CD1 1 
ATOM   10421 C CD2 . TRP G 4 118 ? -2.476  -5.565  38.589  1.00 73.62  ? 358 TRP B CD2 1 
ATOM   10422 N NE1 . TRP G 4 118 ? -1.664  -5.621  36.504  1.00 73.15  ? 358 TRP B NE1 1 
ATOM   10423 C CE2 . TRP G 4 118 ? -2.827  -5.617  37.227  1.00 73.78  ? 358 TRP B CE2 1 
ATOM   10424 C CE3 . TRP G 4 118 ? -3.492  -5.551  39.548  1.00 75.21  ? 358 TRP B CE3 1 
ATOM   10425 C CZ2 . TRP G 4 118 ? -4.151  -5.656  36.798  1.00 78.14  ? 358 TRP B CZ2 1 
ATOM   10426 C CZ3 . TRP G 4 118 ? -4.807  -5.590  39.121  1.00 79.20  ? 358 TRP B CZ3 1 
ATOM   10427 C CH2 . TRP G 4 118 ? -5.125  -5.641  37.758  1.00 78.91  ? 358 TRP B CH2 1 
ATOM   10428 N N   . GLU G 4 119 ? 2.291   -3.695  39.434  1.00 80.60  ? 359 GLU B N   1 
ATOM   10429 C CA  . GLU G 4 119 ? 3.304   -3.120  38.558  1.00 83.56  ? 359 GLU B CA  1 
ATOM   10430 C C   . GLU G 4 119 ? 4.263   -4.204  38.088  1.00 82.31  ? 359 GLU B C   1 
ATOM   10431 O O   . GLU G 4 119 ? 4.534   -5.170  38.804  1.00 84.01  ? 359 GLU B O   1 
ATOM   10432 C CB  . GLU G 4 119 ? 4.094   -2.003  39.253  1.00 86.21  ? 359 GLU B CB  1 
ATOM   10433 C CG  . GLU G 4 119 ? 3.284   -0.753  39.551  1.00 90.27  ? 359 GLU B CG  1 
ATOM   10434 C CD  . GLU G 4 119 ? 4.086   0.289   40.307  1.00 93.10  ? 359 GLU B CD  1 
ATOM   10435 O OE1 . GLU G 4 119 ? 5.128   -0.073  40.897  1.00 90.37  ? 359 GLU B OE1 1 
ATOM   10436 O OE2 . GLU G 4 119 ? 3.680   1.471   40.302  1.00 92.45  ? 359 GLU B OE2 1 
ATOM   10437 N N   . THR G 4 120 ? 4.781   -4.027  36.876  1.00 81.88  ? 360 THR B N   1 
ATOM   10438 C CA  . THR G 4 120 ? 5.745   -4.941  36.285  1.00 78.07  ? 360 THR B CA  1 
ATOM   10439 C C   . THR G 4 120 ? 7.126   -4.304  36.248  1.00 78.54  ? 360 THR B C   1 
ATOM   10440 O O   . THR G 4 120 ? 7.281   -3.086  36.373  1.00 78.92  ? 360 THR B O   1 
ATOM   10441 C CB  . THR G 4 120 ? 5.332   -5.341  34.865  1.00 78.77  ? 360 THR B CB  1 
ATOM   10442 O OG1 . THR G 4 120 ? 4.833   -4.192  34.168  1.00 81.79  ? 360 THR B OG1 1 
ATOM   10443 C CG2 . THR G 4 120 ? 4.265   -6.418  34.904  1.00 79.30  ? 360 THR B CG2 1 
ATOM   10444 N N   . MET G 4 121 ? 8.135   -5.151  36.071  1.00 85.12  ? 361 MET B N   1 
ATOM   10445 C CA  . MET G 4 121 ? 9.496   -4.667  35.908  1.00 87.11  ? 361 MET B CA  1 
ATOM   10446 C C   . MET G 4 121 ? 9.619   -3.878  34.609  1.00 88.34  ? 361 MET B C   1 
ATOM   10447 O O   . MET G 4 121 ? 8.889   -4.112  33.642  1.00 88.36  ? 361 MET B O   1 
ATOM   10448 C CB  . MET G 4 121 ? 10.480  -5.836  35.912  1.00 89.95  ? 361 MET B CB  1 
ATOM   10449 C CG  . MET G 4 121 ? 11.879  -5.465  36.365  1.00 91.76  ? 361 MET B CG  1 
ATOM   10450 S SD  . MET G 4 121 ? 11.933  -5.004  38.105  1.00 98.37  ? 361 MET B SD  1 
ATOM   10451 C CE  . MET G 4 121 ? 11.509  -6.561  38.879  1.00 96.92  ? 361 MET B CE  1 
ATOM   10452 N N   . LYS G 4 122 ? 10.553  -2.930  34.593  1.00 88.68  ? 362 LYS B N   1 
ATOM   10453 C CA  . LYS G 4 122 ? 10.734  -2.046  33.441  1.00 89.13  ? 362 LYS B CA  1 
ATOM   10454 C C   . LYS G 4 122 ? 11.253  -2.861  32.263  1.00 87.67  ? 362 LYS B C   1 
ATOM   10455 O O   . LYS G 4 122 ? 12.433  -3.213  32.207  1.00 83.64  ? 362 LYS B O   1 
ATOM   10456 C CB  . LYS G 4 122 ? 11.690  -0.910  33.789  1.00 90.40  ? 362 LYS B CB  1 
ATOM   10457 C CG  . LYS G 4 122 ? 12.020  0.014   32.625  1.00 91.37  ? 362 LYS B CG  1 
ATOM   10458 C CD  . LYS G 4 122 ? 10.787  0.755   32.138  1.00 90.61  ? 362 LYS B CD  1 
ATOM   10459 C CE  . LYS G 4 122 ? 11.094  1.575   30.897  1.00 91.35  ? 362 LYS B CE  1 
ATOM   10460 N NZ  . LYS G 4 122 ? 9.853   2.007   30.198  1.00 92.59  ? 362 LYS B NZ  1 
ATOM   10461 N N   . MET G 4 123 ? 10.368  -3.169  31.317  1.00 87.29  ? 363 MET B N   1 
ATOM   10462 C CA  . MET G 4 123 ? 10.760  -3.907  30.126  1.00 89.13  ? 363 MET B CA  1 
ATOM   10463 C C   . MET G 4 123 ? 11.466  -2.981  29.140  1.00 86.79  ? 363 MET B C   1 
ATOM   10464 O O   . MET G 4 123 ? 11.234  -1.769  29.118  1.00 85.35  ? 363 MET B O   1 
ATOM   10465 C CB  . MET G 4 123 ? 9.542   -4.563  29.463  1.00 91.22  ? 363 MET B CB  1 
ATOM   10466 C CG  . MET G 4 123 ? 9.886   -5.556  28.342  1.00 93.29  ? 363 MET B CG  1 
ATOM   10467 S SD  . MET G 4 123 ? 8.514   -6.602  27.800  1.00 85.40  ? 363 MET B SD  1 
ATOM   10468 C CE  . MET G 4 123 ? 8.608   -7.912  29.015  1.00 87.10  ? 363 MET B CE  1 
ATOM   10469 N N   . ARG G 4 124 ? 12.346  -3.570  28.328  1.00 83.51  ? 364 ARG B N   1 
ATOM   10470 C CA  . ARG G 4 124 ? 13.126  -2.790  27.373  1.00 84.25  ? 364 ARG B CA  1 
ATOM   10471 C C   . ARG G 4 124 ? 12.225  -2.056  26.388  1.00 80.36  ? 364 ARG B C   1 
ATOM   10472 O O   . ARG G 4 124 ? 12.366  -0.845  26.179  1.00 74.77  ? 364 ARG B O   1 
ATOM   10473 C CB  . ARG G 4 124 ? 14.100  -3.708  26.632  1.00 89.90  ? 364 ARG B CB  1 
ATOM   10474 C CG  . ARG G 4 124 ? 15.064  -2.992  25.704  1.00 90.62  ? 364 ARG B CG  1 
ATOM   10475 C CD  . ARG G 4 124 ? 16.344  -2.609  26.423  1.00 89.68  ? 364 ARG B CD  1 
ATOM   10476 N NE  . ARG G 4 124 ? 17.106  -1.605  25.682  1.00 97.20  ? 364 ARG B NE  1 
ATOM   10477 C CZ  . ARG G 4 124 ? 16.842  -0.301  25.692  1.00 93.53  ? 364 ARG B CZ  1 
ATOM   10478 N NH1 . ARG G 4 124 ? 15.829  0.171   26.408  1.00 92.10  ? 364 ARG B NH1 1 
ATOM   10479 N NH2 . ARG G 4 124 ? 17.593  0.534   24.986  1.00 82.34  ? 364 ARG B NH2 1 
ATOM   10480 N N   . TYR G 4 125 ? 11.286  -2.771  25.777  1.00 75.82  ? 365 TYR B N   1 
ATOM   10481 C CA  . TYR G 4 125 ? 10.450  -2.224  24.721  1.00 76.71  ? 365 TYR B CA  1 
ATOM   10482 C C   . TYR G 4 125 ? 9.077   -1.858  25.267  1.00 77.09  ? 365 TYR B C   1 
ATOM   10483 O O   . TYR G 4 125 ? 8.541   -2.545  26.142  1.00 73.84  ? 365 TYR B O   1 
ATOM   10484 C CB  . TYR G 4 125 ? 10.318  -3.225  23.572  1.00 77.53  ? 365 TYR B CB  1 
ATOM   10485 C CG  . TYR G 4 125 ? 11.654  -3.617  22.991  1.00 76.45  ? 365 TYR B CG  1 
ATOM   10486 C CD1 . TYR G 4 125 ? 12.342  -2.757  22.150  1.00 77.68  ? 365 TYR B CD1 1 
ATOM   10487 C CD2 . TYR G 4 125 ? 12.239  -4.835  23.302  1.00 78.99  ? 365 TYR B CD2 1 
ATOM   10488 C CE1 . TYR G 4 125 ? 13.568  -3.102  21.626  1.00 79.66  ? 365 TYR B CE1 1 
ATOM   10489 C CE2 . TYR G 4 125 ? 13.467  -5.190  22.779  1.00 80.49  ? 365 TYR B CE2 1 
ATOM   10490 C CZ  . TYR G 4 125 ? 14.125  -4.317  21.939  1.00 78.45  ? 365 TYR B CZ  1 
ATOM   10491 O OH  . TYR G 4 125 ? 15.348  -4.650  21.409  1.00 78.11  ? 365 TYR B OH  1 
ATOM   10492 N N   . GLU G 4 126 ? 8.514   -0.770  24.744  1.00 77.79  ? 366 GLU B N   1 
ATOM   10493 C CA  . GLU G 4 126 ? 7.236   -0.254  25.214  1.00 79.25  ? 366 GLU B CA  1 
ATOM   10494 C C   . GLU G 4 126 ? 6.047   -0.763  24.411  1.00 74.18  ? 366 GLU B C   1 
ATOM   10495 O O   . GLU G 4 126 ? 4.903   -0.536  24.820  1.00 75.14  ? 366 GLU B O   1 
ATOM   10496 C CB  . GLU G 4 126 ? 7.239   1.280   25.171  1.00 87.28  ? 366 GLU B CB  1 
ATOM   10497 C CG  . GLU G 4 126 ? 8.124   1.952   26.212  1.00 90.74  ? 366 GLU B CG  1 
ATOM   10498 C CD  . GLU G 4 126 ? 8.068   3.470   26.131  1.00 93.87  ? 366 GLU B CD  1 
ATOM   10499 O OE1 . GLU G 4 126 ? 7.002   4.011   25.757  1.00 97.53  ? 366 GLU B OE1 1 
ATOM   10500 O OE2 . GLU G 4 126 ? 9.093   4.120   26.429  1.00 94.04  ? 366 GLU B OE2 1 
ATOM   10501 N N   . HIS G 4 127 ? 6.281   -1.440  23.290  1.00 66.68  ? 367 HIS B N   1 
ATOM   10502 C CA  . HIS G 4 127 ? 5.213   -1.777  22.359  1.00 70.25  ? 367 HIS B CA  1 
ATOM   10503 C C   . HIS G 4 127 ? 4.640   -3.174  22.556  1.00 68.92  ? 367 HIS B C   1 
ATOM   10504 O O   . HIS G 4 127 ? 3.640   -3.508  21.914  1.00 67.57  ? 367 HIS B O   1 
ATOM   10505 C CB  . HIS G 4 127 ? 5.717   -1.631  20.918  1.00 72.98  ? 367 HIS B CB  1 
ATOM   10506 C CG  . HIS G 4 127 ? 6.643   -2.725  20.491  1.00 71.34  ? 367 HIS B CG  1 
ATOM   10507 N ND1 . HIS G 4 127 ? 7.963   -2.773  20.881  1.00 68.68  ? 367 HIS B ND1 1 
ATOM   10508 C CD2 . HIS G 4 127 ? 6.443   -3.808  19.704  1.00 71.17  ? 367 HIS B CD2 1 
ATOM   10509 C CE1 . HIS G 4 127 ? 8.536   -3.842  20.357  1.00 73.39  ? 367 HIS B CE1 1 
ATOM   10510 N NE2 . HIS G 4 127 ? 7.635   -4.486  19.637  1.00 73.33  ? 367 HIS B NE2 1 
ATOM   10511 N N   . ILE G 4 128 ? 5.232   -3.988  23.421  1.00 69.21  ? 368 ILE B N   1 
ATOM   10512 C CA  . ILE G 4 128 ? 4.795   -5.366  23.613  1.00 71.06  ? 368 ILE B CA  1 
ATOM   10513 C C   . ILE G 4 128 ? 3.664   -5.385  24.633  1.00 70.45  ? 368 ILE B C   1 
ATOM   10514 O O   . ILE G 4 128 ? 3.849   -4.980  25.786  1.00 70.50  ? 368 ILE B O   1 
ATOM   10515 C CB  . ILE G 4 128 ? 5.959   -6.260  24.063  1.00 72.87  ? 368 ILE B CB  1 
ATOM   10516 C CG1 . ILE G 4 128 ? 7.004   -6.363  22.951  1.00 75.16  ? 368 ILE B CG1 1 
ATOM   10517 C CG2 . ILE G 4 128 ? 5.449   -7.636  24.448  1.00 73.16  ? 368 ILE B CG2 1 
ATOM   10518 C CD1 . ILE G 4 128 ? 8.220   -7.182  23.322  1.00 73.11  ? 368 ILE B CD1 1 
ATOM   10519 N N   . ASP G 4 129 ? 2.495   -5.858  24.212  1.00 67.75  ? 369 ASP B N   1 
ATOM   10520 C CA  . ASP G 4 129 ? 1.342   -5.901  25.098  1.00 68.37  ? 369 ASP B CA  1 
ATOM   10521 C C   . ASP G 4 129 ? 1.551   -6.926  26.206  1.00 68.63  ? 369 ASP B C   1 
ATOM   10522 O O   . ASP G 4 129 ? 2.218   -7.947  26.020  1.00 71.60  ? 369 ASP B O   1 
ATOM   10523 C CB  . ASP G 4 129 ? 0.076   -6.243  24.312  1.00 70.56  ? 369 ASP B CB  1 
ATOM   10524 C CG  . ASP G 4 129 ? -0.145  -5.324  23.128  1.00 72.65  ? 369 ASP B CG  1 
ATOM   10525 O OD1 . ASP G 4 129 ? 0.464   -5.565  22.062  1.00 71.92  ? 369 ASP B OD1 1 
ATOM   10526 O OD2 . ASP G 4 129 ? -0.937  -4.366  23.260  1.00 73.80  ? 369 ASP B OD2 1 
ATOM   10527 N N   . HIS G 4 130 ? 0.972   -6.645  27.370  1.00 69.01  ? 370 HIS B N   1 
ATOM   10528 C CA  . HIS G 4 130 ? 1.004   -7.556  28.504  1.00 69.39  ? 370 HIS B CA  1 
ATOM   10529 C C   . HIS G 4 130 ? -0.414  -7.951  28.887  1.00 70.24  ? 370 HIS B C   1 
ATOM   10530 O O   . HIS G 4 130 ? -1.359  -7.176  28.720  1.00 70.52  ? 370 HIS B O   1 
ATOM   10531 C CB  . HIS G 4 130 ? 1.706   -6.930  29.717  1.00 69.17  ? 370 HIS B CB  1 
ATOM   10532 C CG  . HIS G 4 130 ? 3.123   -6.520  29.459  1.00 68.40  ? 370 HIS B CG  1 
ATOM   10533 N ND1 . HIS G 4 130 ? 3.853   -5.769  30.355  1.00 68.12  ? 370 HIS B ND1 1 
ATOM   10534 C CD2 . HIS G 4 130 ? 3.947   -6.760  28.411  1.00 67.90  ? 370 HIS B CD2 1 
ATOM   10535 C CE1 . HIS G 4 130 ? 5.063   -5.559  29.868  1.00 67.49  ? 370 HIS B CE1 1 
ATOM   10536 N NE2 . HIS G 4 130 ? 5.146   -6.152  28.690  1.00 67.34  ? 370 HIS B NE2 1 
ATOM   10537 N N   . THR G 4 131 ? -0.556  -9.168  29.407  1.00 73.42  ? 371 THR B N   1 
ATOM   10538 C CA  . THR G 4 131 ? -1.829  -9.676  29.896  1.00 72.85  ? 371 THR B CA  1 
ATOM   10539 C C   . THR G 4 131 ? -1.622  -10.235 31.294  1.00 72.95  ? 371 THR B C   1 
ATOM   10540 O O   . THR G 4 131 ? -0.683  -11.002 31.530  1.00 72.70  ? 371 THR B O   1 
ATOM   10541 C CB  . THR G 4 131 ? -2.405  -10.754 28.967  1.00 74.91  ? 371 THR B CB  1 
ATOM   10542 O OG1 . THR G 4 131 ? -2.899  -10.143 27.771  1.00 77.06  ? 371 THR B OG1 1 
ATOM   10543 C CG2 . THR G 4 131 ? -3.545  -11.494 29.644  1.00 77.65  ? 371 THR B CG2 1 
ATOM   10544 N N   . PHE G 4 132 ? -2.496  -9.840  32.211  1.00 74.30  ? 372 PHE B N   1 
ATOM   10545 C CA  . PHE G 4 132 ? -2.434  -10.246 33.603  1.00 74.74  ? 372 PHE B CA  1 
ATOM   10546 C C   . PHE G 4 132 ? -3.607  -11.157 33.941  1.00 78.73  ? 372 PHE B C   1 
ATOM   10547 O O   . PHE G 4 132 ? -4.751  -10.900 33.543  1.00 76.80  ? 372 PHE B O   1 
ATOM   10548 C CB  . PHE G 4 132 ? -2.443  -9.030  34.534  1.00 74.73  ? 372 PHE B CB  1 
ATOM   10549 C CG  . PHE G 4 132 ? -1.344  -8.044  34.264  1.00 73.85  ? 372 PHE B CG  1 
ATOM   10550 C CD1 . PHE G 4 132 ? -1.462  -7.110  33.248  1.00 73.57  ? 372 PHE B CD1 1 
ATOM   10551 C CD2 . PHE G 4 132 ? -0.197  -8.044  35.036  1.00 73.51  ? 372 PHE B CD2 1 
ATOM   10552 C CE1 . PHE G 4 132 ? -0.450  -6.202  33.003  1.00 74.03  ? 372 PHE B CE1 1 
ATOM   10553 C CE2 . PHE G 4 132 ? 0.814   -7.137  34.799  1.00 72.74  ? 372 PHE B CE2 1 
ATOM   10554 C CZ  . PHE G 4 132 ? 0.689   -6.216  33.779  1.00 73.69  ? 372 PHE B CZ  1 
ATOM   10555 N N   . GLU G 4 133 ? -3.299  -12.228 34.665  1.00 84.28  ? 373 GLU B N   1 
ATOM   10556 C CA  . GLU G 4 133 ? -4.287  -13.069 35.321  1.00 83.93  ? 373 GLU B CA  1 
ATOM   10557 C C   . GLU G 4 133 ? -4.323  -12.696 36.796  1.00 79.10  ? 373 GLU B C   1 
ATOM   10558 O O   . GLU G 4 133 ? -3.284  -12.704 37.468  1.00 75.26  ? 373 GLU B O   1 
ATOM   10559 C CB  . GLU G 4 133 ? -3.952  -14.551 35.150  1.00 87.53  ? 373 GLU B CB  1 
ATOM   10560 C CG  . GLU G 4 133 ? -5.156  -15.431 34.845  1.00 88.01  ? 373 GLU B CG  1 
ATOM   10561 C CD  . GLU G 4 133 ? -4.760  -16.801 34.329  1.00 89.06  ? 373 GLU B CD  1 
ATOM   10562 O OE1 . GLU G 4 133 ? -4.612  -17.734 35.150  1.00 88.10  ? 373 GLU B OE1 1 
ATOM   10563 O OE2 . GLU G 4 133 ? -4.590  -16.942 33.100  1.00 87.49  ? 373 GLU B OE2 1 
ATOM   10564 N N   . ILE G 4 134 ? -5.513  -12.355 37.284  1.00 79.75  ? 374 ILE B N   1 
ATOM   10565 C CA  . ILE G 4 134 ? -5.722  -11.880 38.646  1.00 83.48  ? 374 ILE B CA  1 
ATOM   10566 C C   . ILE G 4 134 ? -6.672  -12.838 39.345  1.00 84.47  ? 374 ILE B C   1 
ATOM   10567 O O   . ILE G 4 134 ? -7.772  -13.095 38.846  1.00 84.64  ? 374 ILE B O   1 
ATOM   10568 C CB  . ILE G 4 134 ? -6.301  -10.452 38.667  1.00 84.68  ? 374 ILE B CB  1 
ATOM   10569 C CG1 . ILE G 4 134 ? -5.526  -9.529  37.723  1.00 88.97  ? 374 ILE B CG1 1 
ATOM   10570 C CG2 . ILE G 4 134 ? -6.345  -9.912  40.087  1.00 81.37  ? 374 ILE B CG2 1 
ATOM   10571 C CD1 . ILE G 4 134 ? -6.182  -9.334  36.371  1.00 91.80  ? 374 ILE B CD1 1 
ATOM   10572 N N   . GLN G 4 135 ? -6.265  -13.355 40.502  1.00 87.96  ? 375 GLN B N   1 
ATOM   10573 C CA  . GLN G 4 135 ? -7.133  -14.225 41.279  1.00 89.47  ? 375 GLN B CA  1 
ATOM   10574 C C   . GLN G 4 135 ? -7.288  -13.689 42.692  1.00 90.08  ? 375 GLN B C   1 
ATOM   10575 O O   . GLN G 4 135 ? -6.389  -13.039 43.234  1.00 82.19  ? 375 GLN B O   1 
ATOM   10576 C CB  . GLN G 4 135 ? -6.612  -15.669 41.343  1.00 91.80  ? 375 GLN B CB  1 
ATOM   10577 C CG  . GLN G 4 135 ? -6.156  -16.242 40.018  1.00 93.71  ? 375 GLN B CG  1 
ATOM   10578 C CD  . GLN G 4 135 ? -5.644  -17.660 40.157  1.00 93.11  ? 375 GLN B CD  1 
ATOM   10579 O OE1 . GLN G 4 135 ? -5.284  -18.097 41.250  1.00 92.83  ? 375 GLN B OE1 1 
ATOM   10580 N NE2 . GLN G 4 135 ? -5.607  -18.387 39.047  1.00 87.04  ? 375 GLN B NE2 1 
ATOM   10581 N N   . TYR G 4 136 ? -8.449  -13.969 43.278  1.00 92.47  ? 376 TYR B N   1 
ATOM   10582 C CA  . TYR G 4 136 ? -8.662  -13.691 44.689  1.00 93.47  ? 376 TYR B CA  1 
ATOM   10583 C C   . TYR G 4 136 ? -9.603  -14.731 45.286  1.00 95.60  ? 376 TYR B C   1 
ATOM   10584 O O   . TYR G 4 136 ? -10.382 -15.388 44.583  1.00 90.93  ? 376 TYR B O   1 
ATOM   10585 C CB  . TYR G 4 136 ? -9.181  -12.265 44.929  1.00 94.87  ? 376 TYR B CB  1 
ATOM   10586 C CG  . TYR G 4 136 ? -10.454 -11.888 44.209  1.00 95.03  ? 376 TYR B CG  1 
ATOM   10587 C CD1 . TYR G 4 136 ? -10.474 -11.706 42.834  1.00 92.42  ? 376 TYR B CD1 1 
ATOM   10588 C CD2 . TYR G 4 136 ? -11.629 -11.672 44.916  1.00 93.57  ? 376 TYR B CD2 1 
ATOM   10589 C CE1 . TYR G 4 136 ? -11.635 -11.348 42.181  1.00 93.39  ? 376 TYR B CE1 1 
ATOM   10590 C CE2 . TYR G 4 136 ? -12.792 -11.314 44.273  1.00 94.44  ? 376 TYR B CE2 1 
ATOM   10591 C CZ  . TYR G 4 136 ? -12.791 -11.153 42.906  1.00 94.29  ? 376 TYR B CZ  1 
ATOM   10592 O OH  . TYR G 4 136 ? -13.954 -10.794 42.266  1.00 96.79  ? 376 TYR B OH  1 
ATOM   10593 N N   . ARG G 4 137 ? -9.502  -14.861 46.608  1.00 101.59 ? 377 ARG B N   1 
ATOM   10594 C CA  . ARG G 4 137 ? -10.173 -15.894 47.382  1.00 102.10 ? 377 ARG B CA  1 
ATOM   10595 C C   . ARG G 4 137 ? -10.362 -15.384 48.804  1.00 105.18 ? 377 ARG B C   1 
ATOM   10596 O O   . ARG G 4 137 ? -9.810  -14.351 49.193  1.00 97.38  ? 377 ARG B O   1 
ATOM   10597 C CB  . ARG G 4 137 ? -9.357  -17.189 47.407  1.00 106.43 ? 377 ARG B CB  1 
ATOM   10598 C CG  . ARG G 4 137 ? -8.011  -16.998 48.094  1.00 109.99 ? 377 ARG B CG  1 
ATOM   10599 C CD  . ARG G 4 137 ? -7.310  -18.301 48.433  1.00 108.39 ? 377 ARG B CD  1 
ATOM   10600 N NE  . ARG G 4 137 ? -5.964  -18.043 48.938  1.00 106.79 ? 377 ARG B NE  1 
ATOM   10601 C CZ  . ARG G 4 137 ? -5.652  -17.960 50.228  1.00 102.86 ? 377 ARG B CZ  1 
ATOM   10602 N NH1 . ARG G 4 137 ? -6.592  -18.112 51.151  1.00 96.68  ? 377 ARG B NH1 1 
ATOM   10603 N NH2 . ARG G 4 137 ? -4.400  -17.718 50.595  1.00 97.81  ? 377 ARG B NH2 1 
ATOM   10604 N N   . LYS G 4 138 ? -11.131 -16.133 49.588  1.00 106.01 ? 378 LYS B N   1 
ATOM   10605 C CA  . LYS G 4 138 ? -11.249 -15.866 51.014  1.00 107.27 ? 378 LYS B CA  1 
ATOM   10606 C C   . LYS G 4 138 ? -10.237 -16.701 51.789  1.00 101.85 ? 378 LYS B C   1 
ATOM   10607 O O   . LYS G 4 138 ? -9.793  -17.756 51.329  1.00 103.55 ? 378 LYS B O   1 
ATOM   10608 C CB  . LYS G 4 138 ? -12.665 -16.159 51.517  1.00 113.19 ? 378 LYS B CB  1 
ATOM   10609 C CG  . LYS G 4 138 ? -13.684 -15.080 51.174  1.00 111.22 ? 378 LYS B CG  1 
ATOM   10610 C CD  . LYS G 4 138 ? -15.112 -15.600 51.251  1.00 109.84 ? 378 LYS B CD  1 
ATOM   10611 C CE  . LYS G 4 138 ? -15.412 -16.565 50.117  1.00 108.02 ? 378 LYS B CE  1 
ATOM   10612 N NZ  . LYS G 4 138 ? -16.850 -16.952 50.095  1.00 104.79 ? 378 LYS B NZ  1 
ATOM   10613 N N   . ASP G 4 139 ? -9.867  -16.207 52.976  1.00 102.39 ? 379 ASP B N   1 
ATOM   10614 C CA  . ASP G 4 139 ? -8.906  -16.928 53.807  1.00 107.02 ? 379 ASP B CA  1 
ATOM   10615 C C   . ASP G 4 139 ? -9.402  -18.333 54.118  1.00 108.18 ? 379 ASP B C   1 
ATOM   10616 O O   . ASP G 4 139 ? -8.625  -19.294 54.092  1.00 103.52 ? 379 ASP B O   1 
ATOM   10617 C CB  . ASP G 4 139 ? -8.629  -16.145 55.093  1.00 107.37 ? 379 ASP B CB  1 
ATOM   10618 C CG  . ASP G 4 139 ? -7.548  -16.786 55.960  1.00 108.51 ? 379 ASP B CG  1 
ATOM   10619 O OD1 . ASP G 4 139 ? -7.730  -17.939 56.410  1.00 107.55 ? 379 ASP B OD1 1 
ATOM   10620 O OD2 . ASP G 4 139 ? -6.508  -16.132 56.192  1.00 103.23 ? 379 ASP B OD2 1 
ATOM   10621 N N   . THR G 4 140 ? -10.697 -18.473 54.398  1.00 107.06 ? 380 THR B N   1 
ATOM   10622 C CA  . THR G 4 140 ? -11.320 -19.768 54.634  1.00 111.73 ? 380 THR B CA  1 
ATOM   10623 C C   . THR G 4 140 ? -11.673 -20.503 53.339  1.00 106.21 ? 380 THR B C   1 
ATOM   10624 O O   . THR G 4 140 ? -12.469 -21.450 53.364  1.00 103.86 ? 380 THR B O   1 
ATOM   10625 C CB  . THR G 4 140 ? -12.568 -19.595 55.503  1.00 115.57 ? 380 THR B CB  1 
ATOM   10626 O OG1 . THR G 4 140 ? -13.404 -18.573 54.944  1.00 116.33 ? 380 THR B OG1 1 
ATOM   10627 C CG2 . THR G 4 140 ? -12.176 -19.211 56.926  1.00 109.27 ? 380 THR B CG2 1 
ATOM   10628 N N   . ALA G 4 141 ? -11.103 -20.087 52.213  1.00 104.72 ? 381 ALA B N   1 
ATOM   10629 C CA  . ALA G 4 141 ? -11.263 -20.770 50.941  1.00 106.13 ? 381 ALA B CA  1 
ATOM   10630 C C   . ALA G 4 141 ? -9.880  -21.052 50.370  1.00 111.65 ? 381 ALA B C   1 
ATOM   10631 O O   . ALA G 4 141 ? -8.855  -20.697 50.961  1.00 107.79 ? 381 ALA B O   1 
ATOM   10632 C CB  . ALA G 4 141 ? -12.109 -19.943 49.966  1.00 108.39 ? 381 ALA B CB  1 
ATOM   10633 N N   . THR G 4 142 ? -9.853  -21.700 49.210  1.00 115.60 ? 382 THR B N   1 
ATOM   10634 C CA  . THR G 4 142 ? -8.612  -22.010 48.518  1.00 113.11 ? 382 THR B CA  1 
ATOM   10635 C C   . THR G 4 142 ? -8.733  -21.600 47.057  1.00 108.50 ? 382 THR B C   1 
ATOM   10636 O O   . THR G 4 142 ? -9.834  -21.413 46.533  1.00 106.58 ? 382 THR B O   1 
ATOM   10637 C CB  . THR G 4 142 ? -8.267  -23.501 48.621  1.00 111.43 ? 382 THR B CB  1 
ATOM   10638 O OG1 . THR G 4 142 ? -7.157  -23.798 47.763  1.00 112.62 ? 382 THR B OG1 1 
ATOM   10639 C CG2 . THR G 4 142 ? -9.464  -24.346 48.223  1.00 111.31 ? 382 THR B CG2 1 
ATOM   10640 N N   . TRP G 4 143 ? -7.578  -21.467 46.399  1.00 106.19 ? 383 TRP B N   1 
ATOM   10641 C CA  . TRP G 4 143 ? -7.559  -21.065 44.996  1.00 105.51 ? 383 TRP B CA  1 
ATOM   10642 C C   . TRP G 4 143 ? -8.269  -22.063 44.092  1.00 101.20 ? 383 TRP B C   1 
ATOM   10643 O O   . TRP G 4 143 ? -8.533  -21.743 42.927  1.00 94.26  ? 383 TRP B O   1 
ATOM   10644 C CB  . TRP G 4 143 ? -6.114  -20.844 44.537  1.00 104.43 ? 383 TRP B CB  1 
ATOM   10645 C CG  . TRP G 4 143 ? -5.568  -19.519 44.995  1.00 103.14 ? 383 TRP B CG  1 
ATOM   10646 C CD1 . TRP G 4 143 ? -6.018  -18.278 44.639  1.00 100.51 ? 383 TRP B CD1 1 
ATOM   10647 C CD2 . TRP G 4 143 ? -4.493  -19.303 45.919  1.00 104.45 ? 383 TRP B CD2 1 
ATOM   10648 N NE1 . TRP G 4 143 ? -5.282  -17.306 45.273  1.00 98.53  ? 383 TRP B NE1 1 
ATOM   10649 C CE2 . TRP G 4 143 ? -4.340  -17.909 46.065  1.00 102.19 ? 383 TRP B CE2 1 
ATOM   10650 C CE3 . TRP G 4 143 ? -3.641  -20.153 46.632  1.00 108.03 ? 383 TRP B CE3 1 
ATOM   10651 C CZ2 . TRP G 4 143 ? -3.372  -17.346 46.894  1.00 101.16 ? 383 TRP B CZ2 1 
ATOM   10652 C CZ3 . TRP G 4 143 ? -2.679  -19.591 47.455  1.00 103.50 ? 383 TRP B CZ3 1 
ATOM   10653 C CH2 . TRP G 4 143 ? -2.553  -18.202 47.579  1.00 99.10  ? 383 TRP B CH2 1 
ATOM   10654 N N   . LYS G 4 144 ? -8.580  -23.257 44.594  1.00 103.72 ? 384 LYS B N   1 
ATOM   10655 C CA  . LYS G 4 144 ? -9.548  -24.125 43.941  1.00 113.29 ? 384 LYS B CA  1 
ATOM   10656 C C   . LYS G 4 144 ? -10.871 -23.378 43.832  1.00 118.29 ? 384 LYS B C   1 
ATOM   10657 O O   . LYS G 4 144 ? -11.498 -23.074 44.854  1.00 122.93 ? 384 LYS B O   1 
ATOM   10658 C CB  . LYS G 4 144 ? -9.717  -25.435 44.721  1.00 118.53 ? 384 LYS B CB  1 
ATOM   10659 C CG  . LYS G 4 144 ? -10.945 -26.264 44.345  1.00 120.14 ? 384 LYS B CG  1 
ATOM   10660 C CD  . LYS G 4 144 ? -12.084 -26.100 45.350  1.00 116.98 ? 384 LYS B CD  1 
ATOM   10661 C CE  . LYS G 4 144 ? -11.745 -26.711 46.702  1.00 115.44 ? 384 LYS B CE  1 
ATOM   10662 N NZ  . LYS G 4 144 ? -11.642 -28.194 46.656  1.00 112.86 ? 384 LYS B NZ  1 
ATOM   10663 N N   . ASP G 4 145 ? -11.281 -23.052 42.605  1.00 123.99 ? 385 ASP B N   1 
ATOM   10664 C CA  . ASP G 4 145 ? -12.554 -22.375 42.349  1.00 124.63 ? 385 ASP B CA  1 
ATOM   10665 C C   . ASP G 4 145 ? -12.607 -21.019 43.061  1.00 121.74 ? 385 ASP B C   1 
ATOM   10666 O O   . ASP G 4 145 ? -13.557 -20.698 43.778  1.00 117.68 ? 385 ASP B O   1 
ATOM   10667 C CB  . ASP G 4 145 ? -13.736 -23.270 42.748  1.00 129.76 ? 385 ASP B CB  1 
ATOM   10668 C CG  . ASP G 4 145 ? -15.082 -22.687 42.344  1.00 131.65 ? 385 ASP B CG  1 
ATOM   10669 O OD1 . ASP G 4 145 ? -15.328 -22.542 41.128  1.00 134.09 ? 385 ASP B OD1 1 
ATOM   10670 O OD2 . ASP G 4 145 ? -15.891 -22.373 43.245  1.00 126.71 ? 385 ASP B OD2 1 
ATOM   10671 N N   . SER G 4 146 ? -11.556 -20.229 42.873  1.00 115.68 ? 386 SER B N   1 
ATOM   10672 C CA  . SER G 4 146 ? -11.520 -18.841 43.308  1.00 109.91 ? 386 SER B CA  1 
ATOM   10673 C C   . SER G 4 146 ? -11.669 -17.934 42.092  1.00 112.10 ? 386 SER B C   1 
ATOM   10674 O O   . SER G 4 146 ? -11.573 -18.377 40.944  1.00 106.54 ? 386 SER B O   1 
ATOM   10675 C CB  . SER G 4 146 ? -10.224 -18.530 44.064  1.00 104.58 ? 386 SER B CB  1 
ATOM   10676 O OG  . SER G 4 146 ? -9.086  -18.797 43.264  1.00 106.33 ? 386 SER B OG  1 
ATOM   10677 N N   . LYS G 4 147 ? -11.901 -16.648 42.347  1.00 105.53 ? 387 LYS B N   1 
ATOM   10678 C CA  . LYS G 4 147 ? -12.275 -15.740 41.268  1.00 104.97 ? 387 LYS B CA  1 
ATOM   10679 C C   . LYS G 4 147 ? -11.044 -15.338 40.463  1.00 99.70  ? 387 LYS B C   1 
ATOM   10680 O O   . LYS G 4 147 ? -10.067 -14.828 41.023  1.00 95.33  ? 387 LYS B O   1 
ATOM   10681 C CB  . LYS G 4 147 ? -12.999 -14.515 41.823  1.00 107.38 ? 387 LYS B CB  1 
ATOM   10682 C CG  . LYS G 4 147 ? -14.254 -14.868 42.607  1.00 111.25 ? 387 LYS B CG  1 
ATOM   10683 C CD  . LYS G 4 147 ? -15.236 -13.709 42.659  1.00 111.37 ? 387 LYS B CD  1 
ATOM   10684 C CE  . LYS G 4 147 ? -16.547 -14.125 43.314  1.00 108.27 ? 387 LYS B CE  1 
ATOM   10685 N NZ  . LYS G 4 147 ? -17.599 -13.079 43.168  1.00 106.07 ? 387 LYS B NZ  1 
ATOM   10686 N N   . THR G 4 148 ? -11.097 -15.569 39.147  1.00 96.80  ? 388 THR B N   1 
ATOM   10687 C CA  . THR G 4 148 ? -9.976  -15.329 38.244  1.00 95.42  ? 388 THR B CA  1 
ATOM   10688 C C   . THR G 4 148 ? -10.441 -14.499 37.054  1.00 95.67  ? 388 THR B C   1 
ATOM   10689 O O   . THR G 4 148 ? -11.433 -14.841 36.402  1.00 94.38  ? 388 THR B O   1 
ATOM   10690 C CB  . THR G 4 148 ? -9.365  -16.650 37.754  1.00 92.04  ? 388 THR B CB  1 
ATOM   10691 O OG1 . THR G 4 148 ? -8.932  -17.425 38.878  1.00 92.32  ? 388 THR B OG1 1 
ATOM   10692 C CG2 . THR G 4 148 ? -8.175  -16.389 36.836  1.00 87.52  ? 388 THR B CG2 1 
ATOM   10693 N N   . GLU G 4 149 ? -9.716  -13.418 36.774  1.00 91.29  ? 389 GLU B N   1 
ATOM   10694 C CA  . GLU G 4 149 ? -10.008 -12.511 35.675  1.00 87.44  ? 389 GLU B CA  1 
ATOM   10695 C C   . GLU G 4 149 ? -8.753  -12.314 34.835  1.00 86.48  ? 389 GLU B C   1 
ATOM   10696 O O   . GLU G 4 149 ? -7.629  -12.487 35.312  1.00 88.14  ? 389 GLU B O   1 
ATOM   10697 C CB  . GLU G 4 149 ? -10.510 -11.152 36.185  1.00 86.11  ? 389 GLU B CB  1 
ATOM   10698 C CG  . GLU G 4 149 ? -11.642 -11.234 37.202  1.00 86.13  ? 389 GLU B CG  1 
ATOM   10699 C CD  . GLU G 4 149 ? -13.014 -11.371 36.564  1.00 89.51  ? 389 GLU B CD  1 
ATOM   10700 O OE1 . GLU G 4 149 ? -13.999 -10.908 37.179  1.00 89.64  ? 389 GLU B OE1 1 
ATOM   10701 O OE2 . GLU G 4 149 ? -13.112 -11.934 35.451  1.00 89.37  ? 389 GLU B OE2 1 
ATOM   10702 N N   . THR G 4 150 ? -8.955  -11.942 33.573  1.00 81.68  ? 390 THR B N   1 
ATOM   10703 C CA  . THR G 4 150 ? -7.862  -11.734 32.631  1.00 82.84  ? 390 THR B CA  1 
ATOM   10704 C C   . THR G 4 150 ? -8.001  -10.356 32.000  1.00 83.32  ? 390 THR B C   1 
ATOM   10705 O O   . THR G 4 150 ? -9.054  -10.032 31.442  1.00 83.68  ? 390 THR B O   1 
ATOM   10706 C CB  . THR G 4 150 ? -7.853  -12.818 31.546  1.00 84.59  ? 390 THR B CB  1 
ATOM   10707 O OG1 . THR G 4 150 ? -7.275  -14.018 32.072  1.00 88.68  ? 390 THR B OG1 1 
ATOM   10708 C CG2 . THR G 4 150 ? -7.050  -12.363 30.337  1.00 83.92  ? 390 THR B CG2 1 
ATOM   10709 N N   . LEU G 4 151 ? -6.939  -9.551  32.089  1.00 81.54  ? 391 LEU B N   1 
ATOM   10710 C CA  . LEU G 4 151 ? -6.947  -8.184  31.582  1.00 78.03  ? 391 LEU B CA  1 
ATOM   10711 C C   . LEU G 4 151 ? -5.733  -7.957  30.694  1.00 77.77  ? 391 LEU B C   1 
ATOM   10712 O O   . LEU G 4 151 ? -4.668  -8.531  30.924  1.00 80.94  ? 391 LEU B O   1 
ATOM   10713 C CB  . LEU G 4 151 ? -6.941  -7.159  32.728  1.00 77.71  ? 391 LEU B CB  1 
ATOM   10714 C CG  . LEU G 4 151 ? -8.179  -7.085  33.626  1.00 78.61  ? 391 LEU B CG  1 
ATOM   10715 C CD1 . LEU G 4 151 ? -7.874  -6.309  34.898  1.00 79.00  ? 391 LEU B CD1 1 
ATOM   10716 C CD2 . LEU G 4 151 ? -9.353  -6.466  32.889  1.00 78.77  ? 391 LEU B CD2 1 
ATOM   10717 N N   . GLN G 4 152 ? -5.889  -7.117  29.675  1.00 76.61  ? 392 GLN B N   1 
ATOM   10718 C CA  . GLN G 4 152 ? -4.776  -6.734  28.815  1.00 75.23  ? 392 GLN B CA  1 
ATOM   10719 C C   . GLN G 4 152 ? -4.436  -5.265  29.028  1.00 76.38  ? 392 GLN B C   1 
ATOM   10720 O O   . GLN G 4 152 ? -5.325  -4.406  29.004  1.00 78.10  ? 392 GLN B O   1 
ATOM   10721 C CB  . GLN G 4 152 ? -5.083  -6.989  27.336  1.00 73.72  ? 392 GLN B CB  1 
ATOM   10722 C CG  . GLN G 4 152 ? -3.846  -6.852  26.449  1.00 75.61  ? 392 GLN B CG  1 
ATOM   10723 C CD  . GLN G 4 152 ? -4.112  -7.136  24.981  1.00 80.33  ? 392 GLN B CD  1 
ATOM   10724 O OE1 . GLN G 4 152 ? -5.055  -6.605  24.393  1.00 84.25  ? 392 GLN B OE1 1 
ATOM   10725 N NE2 . GLN G 4 152 ? -3.258  -7.953  24.373  1.00 79.45  ? 392 GLN B NE2 1 
ATOM   10726 N N   . ASN G 4 153 ? -3.150  -4.988  29.246  1.00 73.19  ? 393 ASN B N   1 
ATOM   10727 C CA  . ASN G 4 153 ? -2.608  -3.634  29.323  1.00 71.19  ? 393 ASN B CA  1 
ATOM   10728 C C   . ASN G 4 153 ? -3.183  -2.828  30.484  1.00 71.82  ? 393 ASN B C   1 
ATOM   10729 O O   . ASN G 4 153 ? -3.158  -1.595  30.457  1.00 71.33  ? 393 ASN B O   1 
ATOM   10730 C CB  . ASN G 4 153 ? -2.820  -2.884  28.004  1.00 71.77  ? 393 ASN B CB  1 
ATOM   10731 C CG  . ASN G 4 153 ? -2.095  -3.535  26.847  1.00 72.31  ? 393 ASN B CG  1 
ATOM   10732 O OD1 . ASN G 4 153 ? -0.983  -4.038  27.005  1.00 70.01  ? 393 ASN B OD1 1 
ATOM   10733 N ND2 . ASN G 4 153 ? -2.720  -3.529  25.675  1.00 74.22  ? 393 ASN B ND2 1 
ATOM   10734 N N   . ALA G 4 154 ? -3.693  -3.494  31.513  1.00 71.60  ? 394 ALA B N   1 
ATOM   10735 C CA  . ALA G 4 154 ? -4.203  -2.826  32.700  1.00 72.06  ? 394 ALA B CA  1 
ATOM   10736 C C   . ALA G 4 154 ? -3.318  -3.149  33.896  1.00 71.97  ? 394 ALA B C   1 
ATOM   10737 O O   . ALA G 4 154 ? -2.774  -4.250  34.007  1.00 71.93  ? 394 ALA B O   1 
ATOM   10738 C CB  . ALA G 4 154 ? -5.647  -3.241  32.991  1.00 73.07  ? 394 ALA B CB  1 
ATOM   10739 N N   . HIS G 4 155 ? -3.170  -2.172  34.791  1.00 71.98  ? 395 HIS B N   1 
ATOM   10740 C CA  . HIS G 4 155 ? -2.368  -2.338  35.998  1.00 72.35  ? 395 HIS B CA  1 
ATOM   10741 C C   . HIS G 4 155 ? -3.194  -2.139  37.265  1.00 72.83  ? 395 HIS B C   1 
ATOM   10742 O O   . HIS G 4 155 ? -2.628  -1.957  38.348  1.00 74.45  ? 395 HIS B O   1 
ATOM   10743 C CB  . HIS G 4 155 ? -1.174  -1.380  35.989  1.00 73.54  ? 395 HIS B CB  1 
ATOM   10744 C CG  . HIS G 4 155 ? -0.101  -1.758  35.015  1.00 74.79  ? 395 HIS B CG  1 
ATOM   10745 N ND1 . HIS G 4 155 ? -0.369  -2.108  33.709  1.00 81.31  ? 395 HIS B ND1 1 
ATOM   10746 C CD2 . HIS G 4 155 ? 1.243   -1.840  35.158  1.00 73.29  ? 395 HIS B CD2 1 
ATOM   10747 C CE1 . HIS G 4 155 ? 0.763   -2.389  33.089  1.00 83.01  ? 395 HIS B CE1 1 
ATOM   10748 N NE2 . HIS G 4 155 ? 1.757   -2.235  33.946  1.00 80.42  ? 395 HIS B NE2 1 
ATOM   10749 N N   . SER G 4 156 ? -4.520  -2.173  37.154  1.00 74.66  ? 396 SER B N   1 
ATOM   10750 C CA  . SER G 4 156 ? -5.396  -1.968  38.297  1.00 75.35  ? 396 SER B CA  1 
ATOM   10751 C C   . SER G 4 156 ? -6.772  -2.531  37.973  1.00 77.97  ? 396 SER B C   1 
ATOM   10752 O O   . SER G 4 156 ? -7.179  -2.577  36.809  1.00 82.14  ? 396 SER B O   1 
ATOM   10753 C CB  . SER G 4 156 ? -5.496  -0.483  38.669  1.00 74.38  ? 396 SER B CB  1 
ATOM   10754 O OG  . SER G 4 156 ? -6.007  0.280   37.589  1.00 77.79  ? 396 SER B OG  1 
ATOM   10755 N N   . MET G 4 157 ? -7.480  -2.956  39.016  1.00 78.02  ? 397 MET B N   1 
ATOM   10756 C CA  . MET G 4 157 ? -8.803  -3.545  38.864  1.00 77.93  ? 397 MET B CA  1 
ATOM   10757 C C   . MET G 4 157 ? -9.647  -3.243  40.092  1.00 78.94  ? 397 MET B C   1 
ATOM   10758 O O   . MET G 4 157 ? -9.181  -3.386  41.224  1.00 79.15  ? 397 MET B O   1 
ATOM   10759 C CB  . MET G 4 157 ? -8.724  -5.060  38.657  1.00 79.84  ? 397 MET B CB  1 
ATOM   10760 C CG  . MET G 4 157 ? -10.065 -5.700  38.353  1.00 81.93  ? 397 MET B CG  1 
ATOM   10761 S SD  . MET G 4 157 ? -9.995  -7.499  38.360  1.00 87.27  ? 397 MET B SD  1 
ATOM   10762 C CE  . MET G 4 157 ? -9.862  -7.837  40.112  1.00 86.95  ? 397 MET B CE  1 
ATOM   10763 N N   . ALA G 4 158 ? -10.895 -2.844  39.861  1.00 82.30  ? 398 ALA B N   1 
ATOM   10764 C CA  . ALA G 4 158 ? -11.836 -2.594  40.943  1.00 86.78  ? 398 ALA B CA  1 
ATOM   10765 C C   . ALA G 4 158 ? -12.529 -3.889  41.350  1.00 88.66  ? 398 ALA B C   1 
ATOM   10766 O O   . ALA G 4 158 ? -12.954 -4.675  40.498  1.00 89.18  ? 398 ALA B O   1 
ATOM   10767 C CB  . ALA G 4 158 ? -12.874 -1.551  40.526  1.00 88.20  ? 398 ALA B CB  1 
ATOM   10768 N N   . LEU G 4 159 ? -12.645 -4.107  42.679  1.00 89.67  ? 399 LEU B N   1 
ATOM   10769 C CA  . LEU G 4 159 ? -13.232 -5.341  43.181  1.00 90.56  ? 399 LEU B CA  1 
ATOM   10770 C C   . LEU G 4 159 ? -14.721 -5.167  43.468  1.00 91.22  ? 399 LEU B C   1 
ATOM   10771 O O   . LEU G 4 159 ? -15.175 -4.063  43.787  1.00 92.59  ? 399 LEU B O   1 
ATOM   10772 C CB  . LEU G 4 159 ? -12.523 -5.788  44.457  1.00 90.15  ? 399 LEU B CB  1 
ATOM   10773 C CG  . LEU G 4 159 ? -11.065 -6.231  44.337  1.00 89.15  ? 399 LEU B CG  1 
ATOM   10774 C CD1 . LEU G 4 159 ? -10.438 -6.353  45.714  1.00 87.23  ? 399 LEU B CD1 1 
ATOM   10775 C CD2 . LEU G 4 159 ? -10.968 -7.548  43.587  1.00 88.47  ? 399 LEU B CD2 1 
ATOM   10776 N N   . PRO G 4 160 ? -15.502 -6.249  43.358  1.00 93.37  ? 400 PRO B N   1 
ATOM   10777 C CA  . PRO G 4 160 ? -16.919 -6.176  43.742  1.00 95.18  ? 400 PRO B CA  1 
ATOM   10778 C C   . PRO G 4 160 ? -17.091 -6.019  45.244  1.00 99.06  ? 400 PRO B C   1 
ATOM   10779 O O   . PRO G 4 160 ? -16.105 -6.013  45.988  1.00 98.27  ? 400 PRO B O   1 
ATOM   10780 C CB  . PRO G 4 160 ? -17.490 -7.514  43.249  1.00 94.60  ? 400 PRO B CB  1 
ATOM   10781 C CG  . PRO G 4 160 ? -16.480 -8.049  42.280  1.00 90.70  ? 400 PRO B CG  1 
ATOM   10782 C CD  . PRO G 4 160 ? -15.158 -7.551  42.764  1.00 92.18  ? 400 PRO B CD  1 
ATOM   10783 N N   . ALA G 4 161 ? -18.335 -5.890  45.700  1.00 101.82 ? 401 ALA B N   1 
ATOM   10784 C CA  . ALA G 4 161 ? -18.588 -5.785  47.129  1.00 100.41 ? 401 ALA B CA  1 
ATOM   10785 C C   . ALA G 4 161 ? -18.190 -7.078  47.826  1.00 98.66  ? 401 ALA B C   1 
ATOM   10786 O O   . ALA G 4 161 ? -18.396 -8.178  47.303  1.00 96.16  ? 401 ALA B O   1 
ATOM   10787 C CB  . ALA G 4 161 ? -20.060 -5.469  47.388  1.00 104.74 ? 401 ALA B CB  1 
ATOM   10788 N N   . LEU G 4 162 ? -17.608 -6.939  49.011  1.00 100.60 ? 402 LEU B N   1 
ATOM   10789 C CA  . LEU G 4 162 ? -17.042 -8.064  49.735  1.00 106.34 ? 402 LEU B CA  1 
ATOM   10790 C C   . LEU G 4 162 ? -17.733 -8.228  51.080  1.00 105.48 ? 402 LEU B C   1 
ATOM   10791 O O   . LEU G 4 162 ? -18.330 -7.290  51.619  1.00 102.49 ? 402 LEU B O   1 
ATOM   10792 C CB  . LEU G 4 162 ? -15.532 -7.890  49.936  1.00 110.43 ? 402 LEU B CB  1 
ATOM   10793 C CG  . LEU G 4 162 ? -14.759 -7.579  48.653  1.00 106.00 ? 402 LEU B CG  1 
ATOM   10794 C CD1 . LEU G 4 162 ? -13.293 -7.297  48.945  1.00 108.68 ? 402 LEU B CD1 1 
ATOM   10795 C CD2 . LEU G 4 162 ? -14.899 -8.711  47.645  1.00 100.35 ? 402 LEU B CD2 1 
ATOM   10796 N N   . GLU G 4 163 ? -17.645 -9.447  51.608  1.00 114.12 ? 403 GLU B N   1 
ATOM   10797 C CA  . GLU G 4 163 ? -18.313 -9.774  52.864  1.00 112.42 ? 403 GLU B CA  1 
ATOM   10798 C C   . GLU G 4 163 ? -17.739 -8.926  53.996  1.00 113.49 ? 403 GLU B C   1 
ATOM   10799 O O   . GLU G 4 163 ? -16.517 -8.880  54.161  1.00 116.01 ? 403 GLU B O   1 
ATOM   10800 C CB  . GLU G 4 163 ? -18.178 -11.264 53.173  1.00 113.30 ? 403 GLU B CB  1 
ATOM   10801 C CG  . GLU G 4 163 ? -18.813 -12.118 52.099  1.00 114.60 ? 403 GLU B CG  1 
ATOM   10802 C CD  . GLU G 4 163 ? -18.685 -13.612 52.337  1.00 118.81 ? 403 GLU B CD  1 
ATOM   10803 O OE1 . GLU G 4 163 ? -17.698 -14.035 52.969  1.00 116.62 ? 403 GLU B OE1 1 
ATOM   10804 O OE2 . GLU G 4 163 ? -19.577 -14.368 51.890  1.00 125.13 ? 403 GLU B OE2 1 
ATOM   10805 N N   . PRO G 4 164 ? -18.572 -8.246  54.789  1.00 114.13 ? 404 PRO B N   1 
ATOM   10806 C CA  . PRO G 4 164 ? -18.092 -7.063  55.524  1.00 116.66 ? 404 PRO B CA  1 
ATOM   10807 C C   . PRO G 4 164 ? -17.094 -7.321  56.660  1.00 112.88 ? 404 PRO B C   1 
ATOM   10808 O O   . PRO G 4 164 ? -16.745 -6.365  57.369  1.00 110.93 ? 404 PRO B O   1 
ATOM   10809 C CB  . PRO G 4 164 ? -19.385 -6.463  56.082  1.00 123.07 ? 404 PRO B CB  1 
ATOM   10810 C CG  . PRO G 4 164 ? -20.340 -7.598  56.149  1.00 123.24 ? 404 PRO B CG  1 
ATOM   10811 C CD  . PRO G 4 164 ? -20.017 -8.472  54.979  1.00 117.66 ? 404 PRO B CD  1 
ATOM   10812 N N   . SER G 4 165 ? -16.629 -