data_6PAU
# 
_entry.id   6PAU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.323 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6PAU         
WWPDB D_1000242201 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6PAU 
_pdbx_database_status.recvd_initial_deposition_date   2019-06-11 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Price, I.R.' 1 0000-0002-9596-1036 
'Lin, H.'     2 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            11 
_citation.language                  ? 
_citation.page_first                1067 
_citation.page_last                 1067 
_citation.title                     'NMT1 and NMT2 are lysine myristoyltransferases regulating the ARF6 GTPase cycle.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-020-14893-x 
_citation.pdbx_database_id_PubMed   32103017 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Kosciuk, T.'            1  0000-0001-8509-973X 
primary 'Price, I.R.'            2  0000-0002-9596-1036 
primary 'Zhang, X.'              3  ?                   
primary 'Zhu, C.'                4  ?                   
primary 'Johnson, K.N.'          5  ?                   
primary 'Zhang, S.'              6  ?                   
primary 'Halaby, S.L.'           7  ?                   
primary 'Komaniecki, G.P.'       8  ?                   
primary 'Yang, M.'               9  ?                   
primary 'DeHart, C.J.'           10 ?                   
primary 'Thomas, P.M.'           11 0000-0003-2887-4765 
primary 'Kelleher, N.L.'         12 0000-0002-8815-3372 
primary 'Christopher Fromme, J.' 13 0000-0002-8837-0473 
primary 'Lin, H.'                14 0000-0002-0255-2701 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   114.25 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6PAU 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     63.162 
_cell.length_a_esd                 ? 
_cell.length_b                     46.350 
_cell.length_b_esd                 ? 
_cell.length_c                     74.395 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        2 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6PAU 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Glycylpeptide N-tetradecanoyltransferase 2' 44656.508 1   2.3.1.97 ? ? ? 
2 polymer     syn 'Arf6 peptide'                               836.073   1   ?        ? ? ? 
3 non-polymer syn 'MAGNESIUM ION'                              24.305    1   ?        ? ? ? 
4 non-polymer syn GLYCEROL                                     92.094    9   ?        ? ? ? 
5 non-polymer syn 
;4'-diphospho pantetheine
;
438.328   1   ?        ? ? ? 
6 non-polymer nat 'SULFATE ION'                                96.063    1   ?        ? ? ? 
7 non-polymer syn 'MYRISTIC ACID'                              228.371   1   ?        ? ? ? 
8 water       nat water                                        18.015    176 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Myristoyl-CoA:protein N-myristoyltransferase 2,NMT 2,Peptide N-myristoyltransferase 2,Type II N-myristoyltransferase' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;KHRYQFWDTQPVPKLDEVITSHGAIEPDKDNVRQEPYSLPQGFMWDTLDLSDAEVLKELYTLLNENYVEDDDNMFRFDYS
PEFLLWALRPPGWLLQWHCGVRVSSNKKLVGFISAIPANIRIYDSVKKMVEINFLCVHKKLRSKRVAPVLIREITRRVNL
EGIFQAVYTAGVVLPKPIATCRYWHRSLNPRKLVEVKFSHLSRNMTLQRTMKLYRLPDVTKTSGLRPMEPKDIKSVRELI
NTYLKQFHLAPVMDEEEVAHWFLPREHIIDTFVVESPNGKLTDFLSFYTLPSTVMHHPAHKSLKAAYSFYNIHTETPLLD
LMSDALILAKSKGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWRCPGTDSEKVGLVLQ
;
;KHRYQFWDTQPVPKLDEVITSHGAIEPDKDNVRQEPYSLPQGFMWDTLDLSDAEVLKELYTLLNENYVEDDDNMFRFDYS
PEFLLWALRPPGWLLQWHCGVRVSSNKKLVGFISAIPANIRIYDSVKKMVEINFLCVHKKLRSKRVAPVLIREITRRVNL
EGIFQAVYTAGVVLPKPIATCRYWHRSLNPRKLVEVKFSHLSRNMTLQRTMKLYRLPDVTKTSGLRPMEPKDIKSVRELI
NTYLKQFHLAPVMDEEEVAHWFLPREHIIDTFVVESPNGKLTDFLSFYTLPSTVMHHPAHKSLKAAYSFYNIHTETPLLD
LMSDALILAKSKGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWRCPGTDSEKVGLVLQ
;
A ? 
2 'polypeptide(L)' no no KVLSKIF KVLSKIF C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LYS n 
1 2   HIS n 
1 3   ARG n 
1 4   TYR n 
1 5   GLN n 
1 6   PHE n 
1 7   TRP n 
1 8   ASP n 
1 9   THR n 
1 10  GLN n 
1 11  PRO n 
1 12  VAL n 
1 13  PRO n 
1 14  LYS n 
1 15  LEU n 
1 16  ASP n 
1 17  GLU n 
1 18  VAL n 
1 19  ILE n 
1 20  THR n 
1 21  SER n 
1 22  HIS n 
1 23  GLY n 
1 24  ALA n 
1 25  ILE n 
1 26  GLU n 
1 27  PRO n 
1 28  ASP n 
1 29  LYS n 
1 30  ASP n 
1 31  ASN n 
1 32  VAL n 
1 33  ARG n 
1 34  GLN n 
1 35  GLU n 
1 36  PRO n 
1 37  TYR n 
1 38  SER n 
1 39  LEU n 
1 40  PRO n 
1 41  GLN n 
1 42  GLY n 
1 43  PHE n 
1 44  MET n 
1 45  TRP n 
1 46  ASP n 
1 47  THR n 
1 48  LEU n 
1 49  ASP n 
1 50  LEU n 
1 51  SER n 
1 52  ASP n 
1 53  ALA n 
1 54  GLU n 
1 55  VAL n 
1 56  LEU n 
1 57  LYS n 
1 58  GLU n 
1 59  LEU n 
1 60  TYR n 
1 61  THR n 
1 62  LEU n 
1 63  LEU n 
1 64  ASN n 
1 65  GLU n 
1 66  ASN n 
1 67  TYR n 
1 68  VAL n 
1 69  GLU n 
1 70  ASP n 
1 71  ASP n 
1 72  ASP n 
1 73  ASN n 
1 74  MET n 
1 75  PHE n 
1 76  ARG n 
1 77  PHE n 
1 78  ASP n 
1 79  TYR n 
1 80  SER n 
1 81  PRO n 
1 82  GLU n 
1 83  PHE n 
1 84  LEU n 
1 85  LEU n 
1 86  TRP n 
1 87  ALA n 
1 88  LEU n 
1 89  ARG n 
1 90  PRO n 
1 91  PRO n 
1 92  GLY n 
1 93  TRP n 
1 94  LEU n 
1 95  LEU n 
1 96  GLN n 
1 97  TRP n 
1 98  HIS n 
1 99  CYS n 
1 100 GLY n 
1 101 VAL n 
1 102 ARG n 
1 103 VAL n 
1 104 SER n 
1 105 SER n 
1 106 ASN n 
1 107 LYS n 
1 108 LYS n 
1 109 LEU n 
1 110 VAL n 
1 111 GLY n 
1 112 PHE n 
1 113 ILE n 
1 114 SER n 
1 115 ALA n 
1 116 ILE n 
1 117 PRO n 
1 118 ALA n 
1 119 ASN n 
1 120 ILE n 
1 121 ARG n 
1 122 ILE n 
1 123 TYR n 
1 124 ASP n 
1 125 SER n 
1 126 VAL n 
1 127 LYS n 
1 128 LYS n 
1 129 MET n 
1 130 VAL n 
1 131 GLU n 
1 132 ILE n 
1 133 ASN n 
1 134 PHE n 
1 135 LEU n 
1 136 CYS n 
1 137 VAL n 
1 138 HIS n 
1 139 LYS n 
1 140 LYS n 
1 141 LEU n 
1 142 ARG n 
1 143 SER n 
1 144 LYS n 
1 145 ARG n 
1 146 VAL n 
1 147 ALA n 
1 148 PRO n 
1 149 VAL n 
1 150 LEU n 
1 151 ILE n 
1 152 ARG n 
1 153 GLU n 
1 154 ILE n 
1 155 THR n 
1 156 ARG n 
1 157 ARG n 
1 158 VAL n 
1 159 ASN n 
1 160 LEU n 
1 161 GLU n 
1 162 GLY n 
1 163 ILE n 
1 164 PHE n 
1 165 GLN n 
1 166 ALA n 
1 167 VAL n 
1 168 TYR n 
1 169 THR n 
1 170 ALA n 
1 171 GLY n 
1 172 VAL n 
1 173 VAL n 
1 174 LEU n 
1 175 PRO n 
1 176 LYS n 
1 177 PRO n 
1 178 ILE n 
1 179 ALA n 
1 180 THR n 
1 181 CYS n 
1 182 ARG n 
1 183 TYR n 
1 184 TRP n 
1 185 HIS n 
1 186 ARG n 
1 187 SER n 
1 188 LEU n 
1 189 ASN n 
1 190 PRO n 
1 191 ARG n 
1 192 LYS n 
1 193 LEU n 
1 194 VAL n 
1 195 GLU n 
1 196 VAL n 
1 197 LYS n 
1 198 PHE n 
1 199 SER n 
1 200 HIS n 
1 201 LEU n 
1 202 SER n 
1 203 ARG n 
1 204 ASN n 
1 205 MET n 
1 206 THR n 
1 207 LEU n 
1 208 GLN n 
1 209 ARG n 
1 210 THR n 
1 211 MET n 
1 212 LYS n 
1 213 LEU n 
1 214 TYR n 
1 215 ARG n 
1 216 LEU n 
1 217 PRO n 
1 218 ASP n 
1 219 VAL n 
1 220 THR n 
1 221 LYS n 
1 222 THR n 
1 223 SER n 
1 224 GLY n 
1 225 LEU n 
1 226 ARG n 
1 227 PRO n 
1 228 MET n 
1 229 GLU n 
1 230 PRO n 
1 231 LYS n 
1 232 ASP n 
1 233 ILE n 
1 234 LYS n 
1 235 SER n 
1 236 VAL n 
1 237 ARG n 
1 238 GLU n 
1 239 LEU n 
1 240 ILE n 
1 241 ASN n 
1 242 THR n 
1 243 TYR n 
1 244 LEU n 
1 245 LYS n 
1 246 GLN n 
1 247 PHE n 
1 248 HIS n 
1 249 LEU n 
1 250 ALA n 
1 251 PRO n 
1 252 VAL n 
1 253 MET n 
1 254 ASP n 
1 255 GLU n 
1 256 GLU n 
1 257 GLU n 
1 258 VAL n 
1 259 ALA n 
1 260 HIS n 
1 261 TRP n 
1 262 PHE n 
1 263 LEU n 
1 264 PRO n 
1 265 ARG n 
1 266 GLU n 
1 267 HIS n 
1 268 ILE n 
1 269 ILE n 
1 270 ASP n 
1 271 THR n 
1 272 PHE n 
1 273 VAL n 
1 274 VAL n 
1 275 GLU n 
1 276 SER n 
1 277 PRO n 
1 278 ASN n 
1 279 GLY n 
1 280 LYS n 
1 281 LEU n 
1 282 THR n 
1 283 ASP n 
1 284 PHE n 
1 285 LEU n 
1 286 SER n 
1 287 PHE n 
1 288 TYR n 
1 289 THR n 
1 290 LEU n 
1 291 PRO n 
1 292 SER n 
1 293 THR n 
1 294 VAL n 
1 295 MET n 
1 296 HIS n 
1 297 HIS n 
1 298 PRO n 
1 299 ALA n 
1 300 HIS n 
1 301 LYS n 
1 302 SER n 
1 303 LEU n 
1 304 LYS n 
1 305 ALA n 
1 306 ALA n 
1 307 TYR n 
1 308 SER n 
1 309 PHE n 
1 310 TYR n 
1 311 ASN n 
1 312 ILE n 
1 313 HIS n 
1 314 THR n 
1 315 GLU n 
1 316 THR n 
1 317 PRO n 
1 318 LEU n 
1 319 LEU n 
1 320 ASP n 
1 321 LEU n 
1 322 MET n 
1 323 SER n 
1 324 ASP n 
1 325 ALA n 
1 326 LEU n 
1 327 ILE n 
1 328 LEU n 
1 329 ALA n 
1 330 LYS n 
1 331 SER n 
1 332 LYS n 
1 333 GLY n 
1 334 PHE n 
1 335 ASP n 
1 336 VAL n 
1 337 PHE n 
1 338 ASN n 
1 339 ALA n 
1 340 LEU n 
1 341 ASP n 
1 342 LEU n 
1 343 MET n 
1 344 GLU n 
1 345 ASN n 
1 346 LYS n 
1 347 THR n 
1 348 PHE n 
1 349 LEU n 
1 350 GLU n 
1 351 LYS n 
1 352 LEU n 
1 353 LYS n 
1 354 PHE n 
1 355 GLY n 
1 356 ILE n 
1 357 GLY n 
1 358 ASP n 
1 359 GLY n 
1 360 ASN n 
1 361 LEU n 
1 362 GLN n 
1 363 TYR n 
1 364 TYR n 
1 365 LEU n 
1 366 TYR n 
1 367 ASN n 
1 368 TRP n 
1 369 ARG n 
1 370 CYS n 
1 371 PRO n 
1 372 GLY n 
1 373 THR n 
1 374 ASP n 
1 375 SER n 
1 376 GLU n 
1 377 LYS n 
1 378 VAL n 
1 379 GLY n 
1 380 LEU n 
1 381 VAL n 
1 382 LEU n 
1 383 GLN n 
2 1   LYS n 
2 2   VAL n 
2 3   LEU n 
2 4   SER n 
2 5   LYS n 
2 6   ILE n 
2 7   PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   383 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 NMT2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       7 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP NMT2_HUMAN O60551 ? 1 
;KHRYQFWDTQPVPKLDEVITSHGAIEPDKDNVRQEPYSLPQGFMWDTLDLSDAEVLKELYTLLNENYVEDDDNMFRFDYS
PEFLLWALRPPGWLLQWHCGVRVSSNKKLVGFISAIPANIRIYDSVKKMVEINFLCVHKKLRSKRVAPVLIREITRRVNL
EGIFQAVYTAGVVLPKPIATCRYWHRSLNPRKLVEVKFSHLSRNMTLQRTMKLYRLPDVTKTSGLRPMEPKDIKSVRELI
NTYLKQFHLAPVMDEEEVAHWFLPREHIIDTFVVESPNGKLTDFLSFYTLPSTVMHHPAHKSLKAAYSFYNIHTETPLLD
LMSDALILAKSKGFDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWRCPGTDSEKVGLVLQ
;
116 
2 PDB 6PAU       6PAU   ? 2 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6PAU A 1 ? 383 ? O60551 116 ? 498 ? 114 496 
2 2 6PAU C 1 ? 7   ? 6PAU   3   ? 9   ? 3   9   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
4PS non-polymer         . 
;4'-diphospho pantetheine
;
'N~3~-[(2R)-2-hydroxy-4-{[(S)-hydroxy(phosphonooxy)phosphoryl]oxy}-3,3-dimethylbutanoyl]-N-(2-sulfanylethyl)-beta-alaninamide' 
'C11 H24 N2 O10 P2 S' 438.328 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'          89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'      175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'         132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'          133.103 
CYS 'L-peptide linking' y CYSTEINE                   ? 'C3 H7 N O2 S'        121.158 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'        146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'          147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'          75.067  
GOL non-polymer         . GLYCEROL                   'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'            92.094  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'      156.162 
HOH non-polymer         . WATER                      ? 'H2 O'                18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'         131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'         131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'      147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'       149.211 
MG  non-polymer         . 'MAGNESIUM ION'            ? 'Mg 2'                24.305  
MYR non-polymer         . 'MYRISTIC ACID'            ? 'C14 H28 O2'          228.371 
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'         165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'          115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'          105.093 
SO4 non-polymer         . 'SULFATE ION'              ? 'O4 S -2'             96.063  
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'          119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'       204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'         181.189 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'         117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6PAU 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.18 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         43.64 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;8 mg/mL protein in a buffer of 25 mM Tris-HCl pH 7.5, 120 mM NaCl, 1 mM DTT, 1 mM MgCl2, mixed 1:1 with well solution of 22% PEG 8000, 0.1 M Bis-Tris pH 6.5
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 16M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2019-03-21 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97918 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 24-ID-E' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97918 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-E 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            29.29 
_reflns.entry_id                         6PAU 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.93 
_reflns.d_resolution_low                 57.59 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       154166 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.49 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.2 
_reflns.pdbx_Rmerge_I_obs                0.1007 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            11.35 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.1123 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.998 
_reflns.pdbx_R_split                     0.04867 
# 
_reflns_shell.d_res_high                  1.93 
_reflns_shell.d_res_low                   1.999 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.54 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           15911 
_reflns_shell.percent_possible_all        99.56 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.066 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             5.3 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.646 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6PAU 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.930 
_refine.ls_d_res_low                             67.831 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     29688 
_refine.ls_number_reflns_R_free                  1530 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.50 
_refine.ls_percent_reflns_R_free                 5.15 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1984 
_refine.ls_R_factor_R_free                       0.2177 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1973 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4C2X 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 28.88 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.26 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       1.930 
_refine_hist.d_res_low                        67.831 
_refine_hist.number_atoms_solvent             176 
_refine_hist.number_atoms_total               3292 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        3015 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         101 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007  ? 3213 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.877  ? 4342 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 16.049 ? 1928 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.048  ? 469  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 540  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.9300 1.9923  . . 148 2519 100.00 . . . 0.4203 . 0.3765 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9923 2.0636  . . 117 2566 100.00 . . . 0.3453 . 0.3121 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0636 2.1462  . . 116 2562 100.00 . . . 0.2905 . 0.2779 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1462 2.2439  . . 128 2584 100.00 . . . 0.2814 . 0.2478 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2439 2.3622  . . 128 2545 100.00 . . . 0.2528 . 0.2318 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3622 2.5102  . . 151 2539 100.00 . . . 0.2418 . 0.2106 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5102 2.7040  . . 139 2524 98.00  . . . 0.2316 . 0.1947 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7040 2.9761  . . 143 2554 100.00 . . . 0.2296 . 0.1856 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9761 3.4067  . . 153 2569 100.00 . . . 0.2043 . 0.1675 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4067 4.2921  . . 162 2550 100.00 . . . 0.1496 . 0.1556 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2921 67.8730 . . 145 2646 99.00  . . . 0.2084 . 0.1788 . . . . . . . . . . 
# 
_struct.entry_id                     6PAU 
_struct.title                        'Structure of Human NMT2 with myristoyl-lysine peptide and CoA products' 
_struct.pdbx_descriptor              'NAD-dependent protein deacetylase sirtuin-2 (E.C.3.5.1.-)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6PAU 
_struct_keywords.text            'lysine, myristoyl, myristoylation, n-myristoyl transferase, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
M N N 5 ? 
N N N 6 ? 
O N N 7 ? 
P N N 8 ? 
Q N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 52  ? TYR A 67  ? ASP A 165 TYR A 180 1 ? 16 
HELX_P HELX_P2  AA2 SER A 80  ? ARG A 89  ? SER A 193 ARG A 202 1 ? 10 
HELX_P HELX_P3  AA3 LEU A 94  ? GLN A 96  ? LEU A 207 GLN A 209 5 ? 3  
HELX_P HELX_P4  AA4 LYS A 139 ? ARG A 142 ? LYS A 252 ARG A 255 5 ? 4  
HELX_P HELX_P5  AA5 ARG A 145 ? LEU A 160 ? ARG A 258 LEU A 273 1 ? 16 
HELX_P HELX_P6  AA6 ASN A 189 ? VAL A 196 ? ASN A 302 VAL A 309 1 ? 8  
HELX_P HELX_P7  AA7 THR A 206 ? TYR A 214 ? THR A 319 TYR A 327 1 ? 9  
HELX_P HELX_P8  AA8 GLU A 229 ? LYS A 231 ? GLU A 342 LYS A 344 5 ? 3  
HELX_P HELX_P9  AA9 ASP A 232 ? LEU A 244 ? ASP A 345 LEU A 357 1 ? 13 
HELX_P HELX_P10 AB1 LYS A 245 ? PHE A 247 ? LYS A 358 PHE A 360 5 ? 3  
HELX_P HELX_P11 AB2 ASP A 254 ? LEU A 263 ? ASP A 367 LEU A 376 1 ? 10 
HELX_P HELX_P12 AB3 PRO A 317 ? LYS A 332 ? PRO A 430 LYS A 445 1 ? 16 
HELX_P HELX_P13 AB4 GLU A 344 ? PHE A 348 ? GLU A 457 PHE A 461 5 ? 5  
HELX_P HELX_P14 AB5 ASP A 374 ? VAL A 378 ? ASP A 487 VAL A 491 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ?    ? A LEU 141 O  ? ? ? 1_555 C MG  . MG  ? ? A LEU 254 A MG  501  1_555 ? ? ? ? ? ? ? 2.951 ? 
metalc2 metalc both ? A LYS 144 N  ? ? ? 1_555 C MG  . MG  ? ? A LYS 257 A MG  501  1_555 ? ? ? ? ? ? ? 2.620 ? 
covale1 covale one  ? B LYS 1   NZ ? ? ? 1_555 O MYR . C1  ? ? C LYS 3   C MYR 1000 1_555 ? ? ? ? ? ? ? 1.298 ? 
metalc3 metalc ?    ? C MG  .   MG ? ? ? 1_555 M 4PS . O25 ? ? A MG  501 A 4PS 511  1_555 ? ? ? ? ? ? ? 2.551 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 11 ? 
AA2 ? 11 ? 
AA3 ? 3  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2  ? anti-parallel 
AA1 2 3  ? anti-parallel 
AA1 3 4  ? anti-parallel 
AA1 4 5  ? parallel      
AA1 5 6  ? anti-parallel 
AA1 6 7  ? anti-parallel 
AA1 7 8  ? anti-parallel 
AA1 8 9  ? parallel      
AA1 9 10 ? anti-parallel 
AA2 1 2  ? anti-parallel 
AA2 2 3  ? anti-parallel 
AA2 3 4  ? anti-parallel 
AA2 4 5  ? parallel      
AA2 5 6  ? anti-parallel 
AA2 6 7  ? anti-parallel 
AA2 7 8  ? anti-parallel 
AA2 8 9  ? parallel      
AA2 9 10 ? anti-parallel 
AA3 1 2  ? anti-parallel 
AA3 2 3  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  PHE A 43  ? THR A 47  ? PHE A 156 THR A 160 
AA1 2  HIS A 98  ? VAL A 103 ? HIS A 211 VAL A 216 
AA1 3  LEU A 109 ? ILE A 122 ? LEU A 222 ILE A 235 
AA1 4  SER A 125 ? VAL A 137 ? SER A 238 VAL A 250 
AA1 5  ALA A 166 ? ALA A 170 ? ALA A 279 ALA A 283 
AA1 6  GLY A 355 ? TYR A 366 ? GLY A 468 TYR A 479 
AA1 7  ALA A 179 ? SER A 187 ? ALA A 292 SER A 300 
AA1 8  VAL A 336 ? LEU A 340 ? VAL A 449 LEU A 453 
AA1 9  ALA A 305 ? SER A 308 ? ALA A 418 SER A 421 
AA1 10 LEU A 281 ? THR A 289 ? LEU A 394 THR A 402 
AA1 11 LEU A 249 ? PRO A 251 ? LEU A 362 PRO A 364 
AA2 1  LEU A 225 ? PRO A 227 ? LEU A 338 PRO A 340 
AA2 2  ILE A 269 ? GLU A 275 ? ILE A 382 GLU A 388 
AA2 3  LEU A 281 ? THR A 289 ? LEU A 394 THR A 402 
AA2 4  ALA A 305 ? SER A 308 ? ALA A 418 SER A 421 
AA2 5  VAL A 336 ? LEU A 340 ? VAL A 449 LEU A 453 
AA2 6  ALA A 179 ? SER A 187 ? ALA A 292 SER A 300 
AA2 7  GLY A 355 ? TYR A 366 ? GLY A 468 TYR A 479 
AA2 8  ALA A 166 ? ALA A 170 ? ALA A 279 ALA A 283 
AA2 9  SER A 125 ? VAL A 137 ? SER A 238 VAL A 250 
AA2 10 LEU A 109 ? ILE A 122 ? LEU A 222 ILE A 235 
AA2 11 ILE A 312 ? HIS A 313 ? ILE A 425 HIS A 426 
AA3 1  PHE A 75  ? PHE A 77  ? PHE A 188 PHE A 190 
AA3 2  SER A 292 ? VAL A 294 ? SER A 405 VAL A 407 
AA3 3  SER A 302 ? LEU A 303 ? SER A 415 LEU A 416 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2  N MET A 44  ? N MET A 157 O ARG A 102 ? O ARG A 215 
AA1 2 3  N VAL A 101 ? N VAL A 214 O VAL A 110 ? O VAL A 223 
AA1 3 4  N ALA A 118 ? N ALA A 231 O MET A 129 ? O MET A 242 
AA1 4 5  N VAL A 130 ? N VAL A 243 O VAL A 167 ? O VAL A 280 
AA1 5 6  N TYR A 168 ? N TYR A 281 O TYR A 364 ? O TYR A 477 
AA1 6 7  O GLY A 357 ? O GLY A 470 N TYR A 183 ? N TYR A 296 
AA1 7 8  N ARG A 186 ? N ARG A 299 O PHE A 337 ? O PHE A 450 
AA1 8 9  O ASN A 338 ? O ASN A 451 N ALA A 306 ? N ALA A 419 
AA1 9 10 O TYR A 307 ? O TYR A 420 N TYR A 288 ? N TYR A 401 
AA2 1 2  N ARG A 226 ? N ARG A 339 O VAL A 273 ? O VAL A 386 
AA2 2 3  N VAL A 274 ? N VAL A 387 O ASP A 283 ? O ASP A 396 
AA2 3 4  N TYR A 288 ? N TYR A 401 O TYR A 307 ? O TYR A 420 
AA2 4 5  N ALA A 306 ? N ALA A 419 O ASN A 338 ? O ASN A 451 
AA2 5 6  O PHE A 337 ? O PHE A 450 N ARG A 186 ? N ARG A 299 
AA2 6 7  N TYR A 183 ? N TYR A 296 O GLY A 357 ? O GLY A 470 
AA2 7 8  O TYR A 364 ? O TYR A 477 N TYR A 168 ? N TYR A 281 
AA2 8 9  O VAL A 167 ? O VAL A 280 N VAL A 130 ? N VAL A 243 
AA2 9 10 O MET A 129 ? O MET A 242 N ALA A 118 ? N ALA A 231 
AA3 1 2  N ARG A 76  ? N ARG A 189 O THR A 293 ? O THR A 406 
AA3 2 3  N SER A 292 ? N SER A 405 O LEU A 303 ? O LEU A 416 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG  501  ? 7  'binding site for residue MG A 501'   
AC2 Software A GOL 502  ? 5  'binding site for residue GOL A 502'  
AC3 Software A GOL 503  ? 9  'binding site for residue GOL A 503'  
AC4 Software A GOL 504  ? 6  'binding site for residue GOL A 504'  
AC5 Software A GOL 505  ? 4  'binding site for residue GOL A 505'  
AC6 Software A GOL 506  ? 8  'binding site for residue GOL A 506'  
AC7 Software A GOL 507  ? 4  'binding site for residue GOL A 507'  
AC8 Software A GOL 508  ? 3  'binding site for residue GOL A 508'  
AC9 Software A GOL 509  ? 5  'binding site for residue GOL A 509'  
AD1 Software A GOL 510  ? 3  'binding site for residue GOL A 510'  
AD2 Software A 4PS 511  ? 15 'binding site for residue 4PS A 511'  
AD3 Software A SO4 512  ? 2  'binding site for residue SO4 A 512'  
AD4 Software C MYR 1000 ? 9  'binding site for residue MYR C 1000' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7  LEU A 141 ? LEU A 254 . ? 1_555 ? 
2  AC1 7  ARG A 142 ? ARG A 255 . ? 1_555 ? 
3  AC1 7  SER A 143 ? SER A 256 . ? 1_555 ? 
4  AC1 7  LYS A 144 ? LYS A 257 . ? 1_555 ? 
5  AC1 7  ARG A 145 ? ARG A 258 . ? 1_555 ? 
6  AC1 7  VAL A 146 ? VAL A 259 . ? 1_555 ? 
7  AC1 7  4PS M .   ? 4PS A 511 . ? 1_555 ? 
8  AC2 5  ASN A 66  ? ASN A 179 . ? 1_555 ? 
9  AC2 5  TYR A 67  ? TYR A 180 . ? 1_555 ? 
10 AC2 5  GLU A 69  ? GLU A 182 . ? 1_555 ? 
11 AC2 5  ARG A 142 ? ARG A 255 . ? 1_555 ? 
12 AC2 5  4PS M .   ? 4PS A 511 . ? 1_555 ? 
13 AC3 9  TYR A 183 ? TYR A 296 . ? 1_555 ? 
14 AC3 9  TYR A 288 ? TYR A 401 . ? 1_555 ? 
15 AC3 9  LEU A 290 ? LEU A 403 . ? 1_555 ? 
16 AC3 9  LEU A 361 ? LEU A 474 . ? 1_555 ? 
17 AC3 9  LEU A 382 ? LEU A 495 . ? 1_555 ? 
18 AC3 9  GLN A 383 ? GLN A 496 . ? 1_555 ? 
19 AC3 9  HOH P .   ? HOH A 629 . ? 1_555 ? 
20 AC3 9  LYS B 1   ? LYS C 3   . ? 1_555 ? 
21 AC3 9  VAL B 2   ? VAL C 4   . ? 1_555 ? 
22 AC4 6  LYS A 176 ? LYS A 289 . ? 1_555 ? 
23 AC4 6  TYR A 364 ? TYR A 477 . ? 1_555 ? 
24 AC4 6  LEU A 365 ? LEU A 478 . ? 1_555 ? 
25 AC4 6  TRP A 368 ? TRP A 481 . ? 1_555 ? 
26 AC4 6  ARG A 369 ? ARG A 482 . ? 1_555 ? 
27 AC4 6  CYS A 370 ? CYS A 483 . ? 1_555 ? 
28 AC5 4  TRP A 93  ? TRP A 206 . ? 1_555 ? 
29 AC5 4  LEU A 94  ? LEU A 207 . ? 1_555 ? 
30 AC5 4  LEU A 95  ? LEU A 208 . ? 1_555 ? 
31 AC5 4  GLN A 96  ? GLN A 209 . ? 1_555 ? 
32 AC6 8  GLU A 131 ? GLU A 244 . ? 1_555 ? 
33 AC6 8  MET A 253 ? MET A 366 . ? 1_555 ? 
34 AC6 8  TRP A 261 ? TRP A 374 . ? 1_555 ? 
35 AC6 8  TYR A 310 ? TYR A 423 . ? 1_555 ? 
36 AC6 8  VAL A 381 ? VAL A 494 . ? 1_555 ? 
37 AC6 8  LEU A 382 ? LEU A 495 . ? 1_555 ? 
38 AC6 8  GLN A 383 ? GLN A 496 . ? 1_555 ? 
39 AC6 8  HOH P .   ? HOH A 602 . ? 1_555 ? 
40 AC7 4  ASN A 64  ? ASN A 177 . ? 1_555 ? 
41 AC7 4  ASP A 78  ? ASP A 191 . ? 1_555 ? 
42 AC7 4  THR A 293 ? THR A 406 . ? 1_555 ? 
43 AC7 4  LYS A 301 ? LYS A 414 . ? 1_555 ? 
44 AC8 3  ASP A 49  ? ASP A 162 . ? 1_555 ? 
45 AC8 3  SER A 51  ? SER A 164 . ? 1_555 ? 
46 AC8 3  HOH P .   ? HOH A 601 . ? 1_555 ? 
47 AC9 5  PRO A 91  ? PRO A 204 . ? 1_555 ? 
48 AC9 5  ALA A 118 ? ALA A 231 . ? 1_555 ? 
49 AC9 5  ASN A 119 ? ASN A 232 . ? 1_555 ? 
50 AC9 5  ASP A 254 ? ASP A 367 . ? 1_555 ? 
51 AC9 5  GLU A 257 ? GLU A 370 . ? 1_555 ? 
52 AD1 3  GLY A 92  ? GLY A 205 . ? 1_555 ? 
53 AD1 3  LYS A 128 ? LYS A 241 . ? 1_555 ? 
54 AD1 3  ILE A 163 ? ILE A 276 . ? 1_555 ? 
55 AD2 15 VAL A 68  ? VAL A 181 . ? 1_555 ? 
56 AD2 15 LEU A 135 ? LEU A 248 . ? 1_555 ? 
57 AD2 15 CYS A 136 ? CYS A 249 . ? 1_555 ? 
58 AD2 15 VAL A 137 ? VAL A 250 . ? 1_555 ? 
59 AD2 15 ARG A 142 ? ARG A 255 . ? 1_555 ? 
60 AD2 15 SER A 143 ? SER A 256 . ? 1_555 ? 
61 AD2 15 LYS A 144 ? LYS A 257 . ? 1_555 ? 
62 AD2 15 ARG A 145 ? ARG A 258 . ? 1_555 ? 
63 AD2 15 VAL A 146 ? VAL A 259 . ? 1_555 ? 
64 AD2 15 ALA A 147 ? ALA A 260 . ? 1_555 ? 
65 AD2 15 PRO A 148 ? PRO A 261 . ? 1_555 ? 
66 AD2 15 MG  C .   ? MG  A 501 . ? 1_555 ? 
67 AD2 15 GOL D .   ? GOL A 502 . ? 1_555 ? 
68 AD2 15 HOH P .   ? HOH A 689 . ? 1_555 ? 
69 AD2 15 HOH P .   ? HOH A 767 . ? 1_555 ? 
70 AD3 2  ARG A 209 ? ARG A 322 . ? 1_555 ? 
71 AD3 2  LYS A 212 ? LYS A 325 . ? 1_555 ? 
72 AD4 9  ILE A 132 ? ILE A 245 . ? 1_555 ? 
73 AD4 9  ASN A 133 ? ASN A 246 . ? 1_555 ? 
74 AD4 9  PHE A 134 ? PHE A 247 . ? 1_555 ? 
75 AD4 9  LEU A 135 ? LEU A 248 . ? 1_555 ? 
76 AD4 9  THR A 155 ? THR A 268 . ? 1_555 ? 
77 AD4 9  VAL A 158 ? VAL A 271 . ? 1_555 ? 
78 AD4 9  ASN A 159 ? ASN A 272 . ? 1_555 ? 
79 AD4 9  TYR A 168 ? TYR A 281 . ? 1_555 ? 
80 AD4 9  LYS B 1   ? LYS C 3   . ? 1_555 ? 
# 
_atom_sites.entry_id                    6PAU 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.015832 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.007132 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021575 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014743 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
H  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N    . GLY A 1 23  ? 33.823  19.043  21.767  1.00 44.36  ?  136  GLY A N    1 
ATOM   2    C  CA   . GLY A 1 23  ? 34.798  18.163  21.167  1.00 44.04  ?  136  GLY A CA   1 
ATOM   3    C  C    . GLY A 1 23  ? 35.210  17.039  22.098  1.00 44.10  ?  136  GLY A C    1 
ATOM   4    O  O    . GLY A 1 23  ? 34.492  16.702  23.031  1.00 41.87  ?  136  GLY A O    1 
ATOM   5    H  HA2  . GLY A 1 23  ? 34.425  17.772  20.362  1.00 52.84  ?  136  GLY A HA2  1 
ATOM   6    H  HA3  . GLY A 1 23  ? 35.590  18.673  20.933  1.00 52.84  ?  136  GLY A HA3  1 
ATOM   7    N  N    . ALA A 1 24  ? 36.380  16.457  21.839  1.00 48.66  ?  137  ALA A N    1 
ATOM   8    C  CA   . ALA A 1 24  ? 36.874  15.375  22.676  1.00 48.48  ?  137  ALA A CA   1 
ATOM   9    C  C    . ALA A 1 24  ? 37.087  15.863  24.100  1.00 47.77  ?  137  ALA A C    1 
ATOM   10   O  O    . ALA A 1 24  ? 37.513  16.995  24.330  1.00 49.46  ?  137  ALA A O    1 
ATOM   11   C  CB   . ALA A 1 24  ? 38.182  14.820  22.109  1.00 51.22  ?  137  ALA A CB   1 
ATOM   12   H  H    . ALA A 1 24  ? 36.902  16.669  21.189  1.00 58.37  ?  137  ALA A H    1 
ATOM   13   H  HA   . ALA A 1 24  ? 36.223  14.656  22.692  1.00 58.16  ?  137  ALA A HA   1 
ATOM   14   H  HB1  . ALA A 1 24  ? 38.494  14.101  22.680  1.00 61.45  ?  137  ALA A HB1  1 
ATOM   15   H  HB2  . ALA A 1 24  ? 38.020  14.485  21.213  1.00 61.45  ?  137  ALA A HB2  1 
ATOM   16   H  HB3  . ALA A 1 24  ? 38.841  15.531  22.082  1.00 61.45  ?  137  ALA A HB3  1 
ATOM   17   N  N    . ILE A 1 25  ? 36.777  15.002  25.060  1.00 46.94  ?  138  ILE A N    1 
ATOM   18   C  CA   . ILE A 1 25  ? 37.009  15.334  26.461  1.00 51.59  ?  138  ILE A CA   1 
ATOM   19   C  C    . ILE A 1 25  ? 38.473  15.123  26.816  1.00 56.92  ?  138  ILE A C    1 
ATOM   20   O  O    . ILE A 1 25  ? 39.157  16.041  27.284  1.00 56.34  ?  138  ILE A O    1 
ATOM   21   C  CB   . ILE A 1 25  ? 36.073  14.517  27.368  1.00 53.46  ?  138  ILE A CB   1 
ATOM   22   C  CG1  . ILE A 1 25  ? 34.615  14.842  27.030  1.00 50.92  ?  138  ILE A CG1  1 
ATOM   23   C  CG2  . ILE A 1 25  ? 36.339  14.814  28.827  1.00 54.52  ?  138  ILE A CG2  1 
ATOM   24   C  CD1  . ILE A 1 25  ? 33.618  14.356  28.063  1.00 55.09  ?  138  ILE A CD1  1 
ATOM   25   H  H    . ILE A 1 25  ? 36.434  14.224  24.932  1.00 56.32  ?  138  ILE A H    1 
ATOM   26   H  HA   . ILE A 1 25  ? 36.803  16.272  26.599  1.00 61.90  ?  138  ILE A HA   1 
ATOM   27   H  HB   . ILE A 1 25  ? 36.242  13.575  27.211  1.00 64.14  ?  138  ILE A HB   1 
ATOM   28   H  HG12 . ILE A 1 25  ? 34.520  15.804  26.958  1.00 61.09  ?  138  ILE A HG12 1 
ATOM   29   H  HG13 . ILE A 1 25  ? 34.391  14.422  26.185  1.00 61.09  ?  138  ILE A HG13 1 
ATOM   30   H  HG21 . ILE A 1 25  ? 35.834  14.192  29.373  1.00 65.40  ?  138  ILE A HG21 1 
ATOM   31   H  HG22 . ILE A 1 25  ? 37.288  14.714  29.001  1.00 65.40  ?  138  ILE A HG22 1 
ATOM   32   H  HG23 . ILE A 1 25  ? 36.061  15.724  29.020  1.00 65.40  ?  138  ILE A HG23 1 
ATOM   33   H  HD11 . ILE A 1 25  ? 32.731  14.356  27.670  1.00 66.09  ?  138  ILE A HD11 1 
ATOM   34   H  HD12 . ILE A 1 25  ? 33.859  13.457  28.336  1.00 66.09  ?  138  ILE A HD12 1 
ATOM   35   H  HD13 . ILE A 1 25  ? 33.641  14.951  28.829  1.00 66.09  ?  138  ILE A HD13 1 
ATOM   36   N  N    . GLU A 1 26  ? 38.976  13.909  26.590  1.00 56.38  ?  139  GLU A N    1 
ATOM   37   C  CA   . GLU A 1 26  ? 40.384  13.604  26.789  1.00 57.68  ?  139  GLU A CA   1 
ATOM   38   C  C    . GLU A 1 26  ? 41.058  13.389  25.439  1.00 54.86  ?  139  GLU A C    1 
ATOM   39   O  O    . GLU A 1 26  ? 40.476  12.761  24.546  1.00 53.27  ?  139  GLU A O    1 
ATOM   40   C  CB   . GLU A 1 26  ? 40.559  12.352  27.657  1.00 60.85  ?  139  GLU A CB   1 
ATOM   41   C  CG   . GLU A 1 26  ? 41.963  12.182  28.224  1.00 69.63  ?  139  GLU A CG   1 
ATOM   42   C  CD   . GLU A 1 26  ? 42.154  10.853  28.944  1.00 75.13  ?  139  GLU A CD   1 
ATOM   43   O  OE1  . GLU A 1 26  ? 41.321  10.511  29.814  1.00 76.01  ?  139  GLU A OE1  1 
ATOM   44   O  OE2  . GLU A 1 26  ? 43.136  10.146  28.632  1.00 75.44  ?  139  GLU A OE2  1 
ATOM   45   H  H    . GLU A 1 26  ? 38.512  13.238  26.317  1.00 67.64  ?  139  GLU A H    1 
ATOM   46   H  HA   . GLU A 1 26  ? 40.823  14.339  27.244  1.00 69.20  ?  139  GLU A HA   1 
ATOM   47   H  HB2  . GLU A 1 26  ? 39.944  12.404  28.405  1.00 73.01  ?  139  GLU A HB2  1 
ATOM   48   H  HB3  . GLU A 1 26  ? 40.362  11.570  27.118  1.00 73.01  ?  139  GLU A HB3  1 
ATOM   49   H  HG2  . GLU A 1 26  ? 42.604  12.223  27.497  1.00 83.54  ?  139  GLU A HG2  1 
ATOM   50   H  HG3  . GLU A 1 26  ? 42.135  12.894  28.859  1.00 83.54  ?  139  GLU A HG3  1 
ATOM   51   N  N    . PRO A 1 27  ? 42.272  13.902  25.248  1.00 58.20  ?  140  PRO A N    1 
ATOM   52   C  CA   . PRO A 1 27  ? 42.962  13.684  23.969  1.00 57.89  ?  140  PRO A CA   1 
ATOM   53   C  C    . PRO A 1 27  ? 43.256  12.207  23.748  1.00 55.58  ?  140  PRO A C    1 
ATOM   54   O  O    . PRO A 1 27  ? 43.217  11.394  24.674  1.00 55.21  ?  140  PRO A O    1 
ATOM   55   C  CB   . PRO A 1 27  ? 44.259  14.495  24.112  1.00 58.24  ?  140  PRO A CB   1 
ATOM   56   C  CG   . PRO A 1 27  ? 44.025  15.422  25.277  1.00 57.28  ?  140  PRO A CG   1 
ATOM   57   C  CD   . PRO A 1 27  ? 43.080  14.700  26.186  1.00 57.56  ?  140  PRO A CD   1 
ATOM   58   H  HA   . PRO A 1 27  ? 42.440  14.033  23.230  1.00 69.45  ?  140  PRO A HA   1 
ATOM   59   H  HB2  . PRO A 1 27  ? 45.002  13.898  24.290  1.00 69.87  ?  140  PRO A HB2  1 
ATOM   60   H  HB3  . PRO A 1 27  ? 44.423  14.997  23.299  1.00 69.87  ?  140  PRO A HB3  1 
ATOM   61   H  HG2  . PRO A 1 27  ? 44.865  15.602  25.727  1.00 68.73  ?  140  PRO A HG2  1 
ATOM   62   H  HG3  . PRO A 1 27  ? 43.633  16.252  24.962  1.00 68.73  ?  140  PRO A HG3  1 
ATOM   63   H  HD2  . PRO A 1 27  ? 43.562  14.127  26.803  1.00 69.05  ?  140  PRO A HD2  1 
ATOM   64   H  HD3  . PRO A 1 27  ? 42.525  15.325  26.678  1.00 69.05  ?  140  PRO A HD3  1 
ATOM   65   N  N    . ASP A 1 28  ? 43.542  11.862  22.492  1.00 54.93  ?  141  ASP A N    1 
ATOM   66   C  CA   . ASP A 1 28  ? 44.003  10.517  22.175  1.00 54.37  ?  141  ASP A CA   1 
ATOM   67   C  C    . ASP A 1 28  ? 45.131  10.130  23.120  1.00 55.18  ?  141  ASP A C    1 
ATOM   68   O  O    . ASP A 1 28  ? 46.053  10.913  23.357  1.00 54.24  ?  141  ASP A O    1 
ATOM   69   C  CB   . ASP A 1 28  ? 44.474  10.437  20.725  1.00 51.16  ?  141  ASP A CB   1 
ATOM   70   C  CG   . ASP A 1 28  ? 43.354  10.680  19.736  1.00 54.24  ?  141  ASP A CG   1 
ATOM   71   O  OD1  . ASP A 1 28  ? 42.203  10.916  20.169  1.00 48.22  ?  141  ASP A OD1  1 
ATOM   72   O  OD2  . ASP A 1 28  ? 43.631  10.641  18.516  1.00 54.86  ?  141  ASP A OD2  1 
ATOM   73   H  H    . ASP A 1 28  ? 43.478  12.385  21.813  1.00 65.90  ?  141  ASP A H    1 
ATOM   74   H  HA   . ASP A 1 28  ? 43.270  9.889   22.276  1.00 65.23  ?  141  ASP A HA   1 
ATOM   75   H  HB2  . ASP A 1 28  ? 45.157  11.108  20.577  1.00 61.38  ?  141  ASP A HB2  1 
ATOM   76   H  HB3  . ASP A 1 28  ? 44.835  9.552   20.558  1.00 61.38  ?  141  ASP A HB3  1 
ATOM   77   N  N    . LYS A 1 29  ? 45.048  8.926   23.676  1.00 56.16  ?  142  LYS A N    1 
ATOM   78   C  CA   . LYS A 1 29  ? 45.954  8.551   24.747  1.00 59.05  ?  142  LYS A CA   1 
ATOM   79   C  C    . LYS A 1 29  ? 47.368  8.347   24.218  1.00 61.64  ?  142  LYS A C    1 
ATOM   80   O  O    . LYS A 1 29  ? 47.574  7.919   23.077  1.00 61.14  ?  142  LYS A O    1 
ATOM   81   C  CB   . LYS A 1 29  ? 45.478  7.268   25.427  1.00 61.03  ?  142  LYS A CB   1 
ATOM   82   C  CG   . LYS A 1 29  ? 44.002  7.239   25.764  1.00 58.60  ?  142  LYS A CG   1 
ATOM   83   C  CD   . LYS A 1 29  ? 43.747  6.382   26.994  1.00 59.52  ?  142  LYS A CD   1 
ATOM   84   C  CE   . LYS A 1 29  ? 43.489  7.255   28.216  1.00 64.53  ?  142  LYS A CE   1 
ATOM   85   N  NZ   . LYS A 1 29  ? 43.523  6.489   29.491  1.00 64.44  ?  142  LYS A NZ   1 
ATOM   86   H  H    . LYS A 1 29  ? 44.483  8.317   23.453  1.00 67.38  ?  142  LYS A H    1 
ATOM   87   H  HA   . LYS A 1 29  ? 45.973  9.261   25.407  1.00 70.84  ?  142  LYS A HA   1 
ATOM   88   H  HB2  . LYS A 1 29  ? 45.658  6.521   24.835  1.00 73.22  ?  142  LYS A HB2  1 
ATOM   89   H  HB3  . LYS A 1 29  ? 45.969  7.160   26.257  1.00 73.22  ?  142  LYS A HB3  1 
ATOM   90   H  HG2  . LYS A 1 29  ? 43.693  8.140   25.947  1.00 70.30  ?  142  LYS A HG2  1 
ATOM   91   H  HG3  . LYS A 1 29  ? 43.507  6.863   25.019  1.00 70.30  ?  142  LYS A HG3  1 
ATOM   92   H  HD2  . LYS A 1 29  ? 42.968  5.823   26.844  1.00 71.41  ?  142  LYS A HD2  1 
ATOM   93   H  HD3  . LYS A 1 29  ? 44.523  5.828   27.170  1.00 71.41  ?  142  LYS A HD3  1 
ATOM   94   H  HE2  . LYS A 1 29  ? 44.170  7.943   28.261  1.00 77.42  ?  142  LYS A HE2  1 
ATOM   95   H  HE3  . LYS A 1 29  ? 42.611  7.661   28.134  1.00 77.42  ?  142  LYS A HE3  1 
ATOM   96   H  HZ1  . LYS A 1 29  ? 43.369  7.034   30.178  1.00 77.31  ?  142  LYS A HZ1  1 
ATOM   97   H  HZ2  . LYS A 1 29  ? 42.901  5.853   29.482  1.00 77.31  ?  142  LYS A HZ2  1 
ATOM   98   H  HZ3  . LYS A 1 29  ? 44.321  6.110   29.597  1.00 77.31  ?  142  LYS A HZ3  1 
ATOM   99   N  N    . ASP A 1 30  ? 48.351  8.618   25.081  1.00 63.00  ?  143  ASP A N    1 
ATOM   100  C  CA   . ASP A 1 30  ? 49.743  8.271   24.819  1.00 68.78  ?  143  ASP A CA   1 
ATOM   101  C  C    . ASP A 1 30  ? 50.139  6.937   25.444  1.00 64.46  ?  143  ASP A C    1 
ATOM   102  O  O    . ASP A 1 30  ? 51.193  6.396   25.105  1.00 61.86  ?  143  ASP A O    1 
ATOM   103  C  CB   . ASP A 1 30  ? 50.684  9.363   25.339  1.00 72.76  ?  143  ASP A CB   1 
ATOM   104  C  CG   . ASP A 1 30  ? 50.357  10.731  24.777  1.00 77.12  ?  143  ASP A CG   1 
ATOM   105  O  OD1  . ASP A 1 30  ? 50.181  10.854  23.545  1.00 76.61  ?  143  ASP A OD1  1 
ATOM   106  O  OD2  . ASP A 1 30  ? 50.271  11.682  25.579  1.00 80.55  ?  143  ASP A OD2  1 
ATOM   107  H  H    . ASP A 1 30  ? 48.230  9.009   25.838  1.00 75.58  ?  143  ASP A H    1 
ATOM   108  H  HA   . ASP A 1 30  ? 49.870  8.212   23.859  1.00 82.52  ?  143  ASP A HA   1 
ATOM   109  H  HB2  . ASP A 1 30  ? 50.611  9.409   26.305  1.00 87.30  ?  143  ASP A HB2  1 
ATOM   110  H  HB3  . ASP A 1 30  ? 51.594  9.144   25.085  1.00 87.30  ?  143  ASP A HB3  1 
ATOM   111  N  N    . ASN A 1 31  ? 49.303  6.377   26.312  1.00 61.31  ?  144  ASN A N    1 
ATOM   112  C  CA   . ASN A 1 31  ? 49.569  5.078   26.911  1.00 57.60  ?  144  ASN A CA   1 
ATOM   113  C  C    . ASN A 1 31  ? 48.258  4.333   27.095  1.00 52.68  ?  144  ASN A C    1 
ATOM   114  O  O    . ASN A 1 31  ? 47.304  4.878   27.649  1.00 51.90  ?  144  ASN A O    1 
ATOM   115  C  CB   . ASN A 1 31  ? 50.304  5.228   28.239  1.00 56.82  ?  144  ASN A CB   1 
ATOM   116  C  CG   . ASN A 1 31  ? 51.684  5.817   28.063  1.00 58.99  ?  144  ASN A CG   1 
ATOM   117  O  OD1  . ASN A 1 31  ? 51.879  7.021   28.223  1.00 61.41  ?  144  ASN A OD1  1 
ATOM   118  N  ND2  . ASN A 1 31  ? 52.643  4.978   27.708  1.00 58.64  ?  144  ASN A ND2  1 
ATOM   119  H  H    . ASN A 1 31  ? 48.567  6.738   26.573  1.00 73.56  ?  144  ASN A H    1 
ATOM   120  H  HA   . ASN A 1 31  ? 50.125  4.549   26.317  1.00 69.10  ?  144  ASN A HA   1 
ATOM   121  H  HB2  . ASN A 1 31  ? 49.796  5.815   28.820  1.00 68.17  ?  144  ASN A HB2  1 
ATOM   122  H  HB3  . ASN A 1 31  ? 50.399  4.355   28.651  1.00 68.17  ?  144  ASN A HB3  1 
ATOM   123  H  HD21 . ASN A 1 31  ? 53.446  5.266   27.595  1.00 70.35  ?  144  ASN A HD21 1 
ATOM   124  H  HD22 . ASN A 1 31  ? 52.464  4.145   27.590  1.00 70.35  ?  144  ASN A HD22 1 
ATOM   125  N  N    . VAL A 1 32  ? 48.215  3.108   26.581  1.00 48.31  ?  145  VAL A N    1 
ATOM   126  C  CA   . VAL A 1 32  ? 47.057  2.231   26.686  1.00 46.43  ?  145  VAL A CA   1 
ATOM   127  C  C    . VAL A 1 32  ? 47.539  0.895   27.224  1.00 43.15  ?  145  VAL A C    1 
ATOM   128  O  O    . VAL A 1 32  ? 48.608  0.410   26.836  1.00 43.51  ?  145  VAL A O    1 
ATOM   129  C  CB   . VAL A 1 32  ? 46.346  2.050   25.327  1.00 46.50  ?  145  VAL A CB   1 
ATOM   130  C  CG1  . VAL A 1 32  ? 45.163  1.088   25.471  1.00 39.24  ?  145  VAL A CG1  1 
ATOM   131  C  CG2  . VAL A 1 32  ? 45.893  3.402   24.771  1.00 46.17  ?  145  VAL A CG2  1 
ATOM   132  H  H    . VAL A 1 32  ? 48.870  2.753   26.151  1.00 57.96  ?  145  VAL A H    1 
ATOM   133  H  HA   . VAL A 1 32  ? 46.415  2.609   27.307  1.00 55.70  ?  145  VAL A HA   1 
ATOM   134  H  HB   . VAL A 1 32  ? 46.969  1.665   24.692  1.00 55.78  ?  145  VAL A HB   1 
ATOM   135  H  HG11 . VAL A 1 32  ? 44.617  1.138   24.670  1.00 47.07  ?  145  VAL A HG11 1 
ATOM   136  H  HG12 . VAL A 1 32  ? 45.502  0.186   25.585  1.00 47.07  ?  145  VAL A HG12 1 
ATOM   137  H  HG13 . VAL A 1 32  ? 44.639  1.345   26.245  1.00 47.07  ?  145  VAL A HG13 1 
ATOM   138  H  HG21 . VAL A 1 32  ? 45.860  3.350   23.802  1.00 55.38  ?  145  VAL A HG21 1 
ATOM   139  H  HG22 . VAL A 1 32  ? 45.013  3.609   25.121  1.00 55.38  ?  145  VAL A HG22 1 
ATOM   140  H  HG23 . VAL A 1 32  ? 46.527  4.084   25.043  1.00 55.38  ?  145  VAL A HG23 1 
ATOM   141  N  N    . ARG A 1 33  ? 46.752  0.299   28.111  1.00 40.98  ?  146  ARG A N    1 
ATOM   142  C  CA   . ARG A 1 33  ? 47.135  -0.964  28.727  1.00 41.64  ?  146  ARG A CA   1 
ATOM   143  C  C    . ARG A 1 33  ? 47.224  -2.070  27.686  1.00 40.55  ?  146  ARG A C    1 
ATOM   144  O  O    . ARG A 1 33  ? 46.331  -2.226  26.849  1.00 41.86  ?  146  ARG A O    1 
ATOM   145  C  CB   . ARG A 1 33  ? 46.122  -1.336  29.814  1.00 43.71  ?  146  ARG A CB   1 
ATOM   146  C  CG   . ARG A 1 33  ? 46.255  -2.763  30.312  1.00 46.68  ?  146  ARG A CG   1 
ATOM   147  C  CD   . ARG A 1 33  ? 45.742  -2.884  31.737  1.00 51.96  ?  146  ARG A CD   1 
ATOM   148  N  NE   . ARG A 1 33  ? 45.524  -4.275  32.140  1.00 46.68  ?  146  ARG A NE   1 
ATOM   149  C  CZ   . ARG A 1 33  ? 45.476  -4.674  33.404  1.00 53.31  ?  146  ARG A CZ   1 
ATOM   150  N  NH1  . ARG A 1 33  ? 45.645  -3.794  34.384  1.00 57.62  ?  146  ARG A NH1  1 
ATOM   151  N  NH2  . ARG A 1 33  ? 45.262  -5.953  33.694  1.00 52.84  ?  146  ARG A NH2  1 
ATOM   152  H  H    . ARG A 1 33  ? 45.991  0.603   28.374  1.00 49.16  ?  146  ARG A H    1 
ATOM   153  H  HA   . ARG A 1 33  ? 48.009  -0.869  29.136  1.00 49.95  ?  146  ARG A HA   1 
ATOM   154  H  HB2  . ARG A 1 33  ? 46.248  -0.745  30.572  1.00 52.44  ?  146  ARG A HB2  1 
ATOM   155  H  HB3  . ARG A 1 33  ? 45.227  -1.230  29.455  1.00 52.44  ?  146  ARG A HB3  1 
ATOM   156  H  HG2  . ARG A 1 33  ? 45.735  -3.354  29.745  1.00 56.00  ?  146  ARG A HG2  1 
ATOM   157  H  HG3  . ARG A 1 33  ? 47.189  -3.026  30.297  1.00 56.00  ?  146  ARG A HG3  1 
ATOM   158  H  HD2  . ARG A 1 33  ? 46.392  -2.494  32.342  1.00 62.33  ?  146  ARG A HD2  1 
ATOM   159  H  HD3  . ARG A 1 33  ? 44.897  -2.413  31.811  1.00 62.33  ?  146  ARG A HD3  1 
ATOM   160  H  HE   . ARG A 1 33  ? 45.421  -4.865  31.523  1.00 56.00  ?  146  ARG A HE   1 
ATOM   161  H  HH11 . ARG A 1 33  ? 45.785  -2.966  34.199  1.00 69.13  ?  146  ARG A HH11 1 
ATOM   162  H  HH12 . ARG A 1 33  ? 45.614  -4.053  35.203  1.00 69.13  ?  146  ARG A HH12 1 
ATOM   163  H  HH21 . ARG A 1 33  ? 45.153  -6.525  33.061  1.00 63.39  ?  146  ARG A HH21 1 
ATOM   164  H  HH22 . ARG A 1 33  ? 45.231  -6.209  34.514  1.00 63.39  ?  146  ARG A HH22 1 
ATOM   165  N  N    . GLN A 1 34  ? 48.302  -2.849  27.753  1.00 41.79  ?  147  GLN A N    1 
ATOM   166  C  CA   . GLN A 1 34  ? 48.551  -3.910  26.783  1.00 41.63  ?  147  GLN A CA   1 
ATOM   167  C  C    . GLN A 1 34  ? 48.029  -5.274  27.229  1.00 45.00  ?  147  GLN A C    1 
ATOM   168  O  O    . GLN A 1 34  ? 47.739  -6.119  26.380  1.00 42.85  ?  147  GLN A O    1 
ATOM   169  C  CB   . GLN A 1 34  ? 50.062  -4.005  26.496  1.00 46.68  ?  147  GLN A CB   1 
ATOM   170  C  CG   . GLN A 1 34  ? 50.606  -2.875  25.620  1.00 49.10  ?  147  GLN A CG   1 
ATOM   171  C  CD   . GLN A 1 34  ? 50.072  -2.944  24.202  1.00 49.81  ?  147  GLN A CD   1 
ATOM   172  O  OE1  . GLN A 1 34  ? 49.283  -3.841  23.878  1.00 51.91  ?  147  GLN A OE1  1 
ATOM   173  N  NE2  . GLN A 1 34  ? 50.493  -2.016  23.351  1.00 48.19  ?  147  GLN A NE2  1 
ATOM   174  H  H    . GLN A 1 34  ? 48.911  -2.782  28.357  1.00 50.13  ?  147  GLN A H    1 
ATOM   175  H  HA   . GLN A 1 34  ? 48.097  -3.686  25.955  1.00 49.93  ?  147  GLN A HA   1 
ATOM   176  H  HB2  . GLN A 1 34  ? 50.540  -3.979  27.340  1.00 55.99  ?  147  GLN A HB2  1 
ATOM   177  H  HB3  . GLN A 1 34  ? 50.239  -4.842  26.040  1.00 55.99  ?  147  GLN A HB3  1 
ATOM   178  H  HG2  . GLN A 1 34  ? 50.344  -2.022  26.001  1.00 58.90  ?  147  GLN A HG2  1 
ATOM   179  H  HG3  . GLN A 1 34  ? 51.573  -2.938  25.583  1.00 58.90  ?  147  GLN A HG3  1 
ATOM   180  H  HE21 . GLN A 1 34  ? 50.214  -2.020  22.538  1.00 57.81  ?  147  GLN A HE21 1 
ATOM   181  H  HE22 . GLN A 1 34  ? 51.044  -1.410  23.614  1.00 57.81  ?  147  GLN A HE22 1 
ATOM   182  N  N    . GLU A 1 35  ? 47.889  -5.519  28.549  1.00 45.14  ?  148  GLU A N    1 
ATOM   183  C  CA   . GLU A 1 35  ? 47.369  -6.784  29.060  1.00 45.89  ?  148  GLU A CA   1 
ATOM   184  C  C    . GLU A 1 35  ? 45.876  -6.647  29.368  1.00 43.02  ?  148  GLU A C    1 
ATOM   185  O  O    . GLU A 1 35  ? 45.415  -5.575  29.759  1.00 39.15  ?  148  GLU A O    1 
ATOM   186  C  CB   . GLU A 1 35  ? 48.142  -7.221  30.320  1.00 50.27  ?  148  GLU A CB   1 
ATOM   187  C  CG   . GLU A 1 35  ? 48.678  -6.053  31.178  1.00 59.73  ?  148  GLU A CG   1 
ATOM   188  C  CD   . GLU A 1 35  ? 49.644  -6.455  32.305  1.00 66.60  ?  148  GLU A CD   1 
ATOM   189  O  OE1  . GLU A 1 35  ? 50.081  -7.624  32.371  1.00 68.05  ?  148  GLU A OE1  1 
ATOM   190  O  OE2  . GLU A 1 35  ? 49.968  -5.570  33.133  1.00 69.44  ?  148  GLU A OE2  1 
ATOM   191  H  H    . GLU A 1 35  ? 48.092  -4.957  29.168  1.00 54.16  ?  148  GLU A H    1 
ATOM   192  H  HA   . GLU A 1 35  ? 47.479  -7.488  28.402  1.00 55.05  ?  148  GLU A HA   1 
ATOM   193  H  HB2  . GLU A 1 35  ? 47.550  -7.747  30.879  1.00 60.30  ?  148  GLU A HB2  1 
ATOM   194  H  HB3  . GLU A 1 35  ? 48.903  -7.756  30.046  1.00 60.30  ?  148  GLU A HB3  1 
ATOM   195  H  HG2  . GLU A 1 35  ? 49.153  -5.438  30.596  1.00 71.66  ?  148  GLU A HG2  1 
ATOM   196  H  HG3  . GLU A 1 35  ? 47.924  -5.604  31.590  1.00 71.66  ?  148  GLU A HG3  1 
ATOM   197  N  N    . PRO A 1 36  ? 45.066  -7.693  29.167  1.00 41.02  ?  149  PRO A N    1 
ATOM   198  C  CA   . PRO A 1 36  ? 43.622  -7.567  29.442  1.00 38.73  ?  149  PRO A CA   1 
ATOM   199  C  C    . PRO A 1 36  ? 43.346  -7.195  30.894  1.00 39.60  ?  149  PRO A C    1 
ATOM   200  O  O    . PRO A 1 36  ? 44.120  -7.528  31.790  1.00 40.18  ?  149  PRO A O    1 
ATOM   201  C  CB   . PRO A 1 36  ? 43.064  -8.959  29.112  1.00 39.54  ?  149  PRO A CB   1 
ATOM   202  C  CG   . PRO A 1 36  ? 44.100  -9.618  28.247  1.00 41.84  ?  149  PRO A CG   1 
ATOM   203  C  CD   . PRO A 1 36  ? 45.425  -8.998  28.578  1.00 40.11  ?  149  PRO A CD   1 
ATOM   204  H  HA   . PRO A 1 36  ? 43.228  -6.903  28.855  1.00 46.46  ?  149  PRO A HA   1 
ATOM   205  H  HB2  . PRO A 1 36  ? 42.929  -9.461  29.931  1.00 47.43  ?  149  PRO A HB2  1 
ATOM   206  H  HB3  . PRO A 1 36  ? 42.223  -8.870  28.636  1.00 47.43  ?  149  PRO A HB3  1 
ATOM   207  H  HG2  . PRO A 1 36  ? 44.116  -10.569 28.435  1.00 50.19  ?  149  PRO A HG2  1 
ATOM   208  H  HG3  . PRO A 1 36  ? 43.881  -9.468  27.314  1.00 50.19  ?  149  PRO A HG3  1 
ATOM   209  H  HD2  . PRO A 1 36  ? 45.908  -9.543  29.219  1.00 48.11  ?  149  PRO A HD2  1 
ATOM   210  H  HD3  . PRO A 1 36  ? 45.957  -8.879  27.776  1.00 48.11  ?  149  PRO A HD3  1 
ATOM   211  N  N    . TYR A 1 37  ? 42.224  -6.507  31.129  1.00 35.07  ?  150  TYR A N    1 
ATOM   212  C  CA   . TYR A 1 37  ? 41.834  -6.206  32.495  1.00 38.32  ?  150  TYR A CA   1 
ATOM   213  C  C    . TYR A 1 37  ? 41.465  -7.489  33.229  1.00 37.17  ?  150  TYR A C    1 
ATOM   214  O  O    . TYR A 1 37  ? 41.045  -8.476  32.625  1.00 37.19  ?  150  TYR A O    1 
ATOM   215  C  CB   . TYR A 1 37  ? 40.658  -5.230  32.538  1.00 37.07  ?  150  TYR A CB   1 
ATOM   216  C  CG   . TYR A 1 37  ? 41.045  -3.793  32.264  1.00 37.12  ?  150  TYR A CG   1 
ATOM   217  C  CD1  . TYR A 1 37  ? 41.572  -2.989  33.265  1.00 41.04  ?  150  TYR A CD1  1 
ATOM   218  C  CD2  . TYR A 1 37  ? 40.895  -3.249  30.998  1.00 36.94  ?  150  TYR A CD2  1 
ATOM   219  C  CE1  . TYR A 1 37  ? 41.931  -1.677  33.011  1.00 41.70  ?  150  TYR A CE1  1 
ATOM   220  C  CE2  . TYR A 1 37  ? 41.248  -1.939  30.734  1.00 38.26  ?  150  TYR A CE2  1 
ATOM   221  C  CZ   . TYR A 1 37  ? 41.766  -1.160  31.745  1.00 39.68  ?  150  TYR A CZ   1 
ATOM   222  O  OH   . TYR A 1 37  ? 42.122  0.141   31.490  1.00 45.89  ?  150  TYR A OH   1 
ATOM   223  H  H    . TYR A 1 37  ? 41.687  -6.213  30.525  1.00 42.07  ?  150  TYR A H    1 
ATOM   224  H  HA   . TYR A 1 37  ? 42.578  -5.783  32.951  1.00 45.96  ?  150  TYR A HA   1 
ATOM   225  H  HB2  . TYR A 1 37  ? 40.009  -5.495  31.866  1.00 44.47  ?  150  TYR A HB2  1 
ATOM   226  H  HB3  . TYR A 1 37  ? 40.255  -5.266  33.419  1.00 44.47  ?  150  TYR A HB3  1 
ATOM   227  H  HD1  . TYR A 1 37  ? 41.685  -3.337  34.119  1.00 49.24  ?  150  TYR A HD1  1 
ATOM   228  H  HD2  . TYR A 1 37  ? 40.550  -3.775  30.313  1.00 44.32  ?  150  TYR A HD2  1 
ATOM   229  H  HE1  . TYR A 1 37  ? 42.282  -1.147  33.690  1.00 50.03  ?  150  TYR A HE1  1 
ATOM   230  H  HE2  . TYR A 1 37  ? 41.138  -1.587  29.881  1.00 45.90  ?  150  TYR A HE2  1 
ATOM   231  H  HH   . TYR A 1 37  ? 41.972  0.328   30.685  1.00 55.05  ?  150  TYR A HH   1 
ATOM   232  N  N    . SER A 1 38  ? 41.621  -7.467  34.551  1.00 38.66  ?  151  SER A N    1 
ATOM   233  C  CA   . SER A 1 38  ? 41.340  -8.647  35.364  1.00 37.91  ?  151  SER A CA   1 
ATOM   234  C  C    . SER A 1 38  ? 39.840  -8.812  35.564  1.00 36.06  ?  151  SER A C    1 
ATOM   235  O  O    . SER A 1 38  ? 39.142  -7.858  35.916  1.00 34.99  ?  151  SER A O    1 
ATOM   236  C  CB   . SER A 1 38  ? 42.034  -8.544  36.721  1.00 41.78  ?  151  SER A CB   1 
ATOM   237  O  OG   . SER A 1 38  ? 43.443  -8.459  36.564  1.00 48.17  ?  151  SER A OG   1 
ATOM   238  H  H    . SER A 1 38  ? 41.889  -6.784  34.999  1.00 46.38  ?  151  SER A H    1 
ATOM   239  H  HA   . SER A 1 38  ? 41.676  -9.431  34.903  1.00 45.48  ?  151  SER A HA   1 
ATOM   240  H  HB2  . SER A 1 38  ? 41.719  -7.749  37.178  1.00 50.11  ?  151  SER A HB2  1 
ATOM   241  H  HB3  . SER A 1 38  ? 41.823  -9.333  37.245  1.00 50.11  ?  151  SER A HB3  1 
ATOM   242  H  HG   . SER A 1 38  ? 43.813  -8.403  37.317  1.00 57.79  ?  151  SER A HG   1 
ATOM   243  N  N    . LEU A 1 39  ? 39.349  -10.019 35.333  1.00 36.12  ?  152  LEU A N    1 
ATOM   244  C  CA   . LEU A 1 39  ? 37.989  -10.389 35.666  1.00 36.49  ?  152  LEU A CA   1 
ATOM   245  C  C    . LEU A 1 39  ? 37.922  -10.874 37.107  1.00 35.27  ?  152  LEU A C    1 
ATOM   246  O  O    . LEU A 1 39  ? 38.950  -11.163 37.722  1.00 35.35  ?  152  LEU A O    1 
ATOM   247  C  CB   . LEU A 1 39  ? 37.499  -11.486 34.724  1.00 34.42  ?  152  LEU A CB   1 
ATOM   248  C  CG   . LEU A 1 39  ? 37.136  -11.059 33.304  1.00 34.59  ?  152  LEU A CG   1 
ATOM   249  C  CD1  . LEU A 1 39  ? 37.051  -12.275 32.398  1.00 36.18  ?  152  LEU A CD1  1 
ATOM   250  C  CD2  . LEU A 1 39  ? 35.824  -10.292 33.301  1.00 34.96  ?  152  LEU A CD2  1 
ATOM   251  H  H    . LEU A 1 39  ? 39.800  -10.658 34.975  1.00 43.33  ?  152  LEU A H    1 
ATOM   252  H  HA   . LEU A 1 39  ? 37.401  -9.623  35.566  1.00 43.77  ?  152  LEU A HA   1 
ATOM   253  H  HB2  . LEU A 1 39  ? 38.200  -12.152 34.650  1.00 41.28  ?  152  LEU A HB2  1 
ATOM   254  H  HB3  . LEU A 1 39  ? 36.704  -11.882 35.114  1.00 41.28  ?  152  LEU A HB3  1 
ATOM   255  H  HG   . LEU A 1 39  ? 37.826  -10.472 32.958  1.00 41.49  ?  152  LEU A HG   1 
ATOM   256  H  HD11 . LEU A 1 39  ? 36.809  -11.985 31.504  1.00 43.40  ?  152  LEU A HD11 1 
ATOM   257  H  HD12 . LEU A 1 39  ? 37.914  -12.717 32.381  1.00 43.40  ?  152  LEU A HD12 1 
ATOM   258  H  HD13 . LEU A 1 39  ? 36.376  -12.880 32.743  1.00 43.40  ?  152  LEU A HD13 1 
ATOM   259  H  HD21 . LEU A 1 39  ? 35.631  -10.001 32.396  1.00 41.94  ?  152  LEU A HD21 1 
ATOM   260  H  HD22 . LEU A 1 39  ? 35.117  -10.875 33.619  1.00 41.94  ?  152  LEU A HD22 1 
ATOM   261  H  HD23 . LEU A 1 39  ? 35.907  -9.523  33.885  1.00 41.94  ?  152  LEU A HD23 1 
ATOM   262  N  N    . PRO A 1 40  ? 36.725  -10.959 37.686  1.00 33.62  ?  153  PRO A N    1 
ATOM   263  C  CA   . PRO A 1 40  ? 36.597  -11.600 38.999  1.00 34.67  ?  153  PRO A CA   1 
ATOM   264  C  C    . PRO A 1 40  ? 36.993  -13.064 38.909  1.00 34.74  ?  153  PRO A C    1 
ATOM   265  O  O    . PRO A 1 40  ? 36.978  -13.673 37.837  1.00 30.77  ?  153  PRO A O    1 
ATOM   266  C  CB   . PRO A 1 40  ? 35.104  -11.436 39.345  1.00 36.73  ?  153  PRO A CB   1 
ATOM   267  C  CG   . PRO A 1 40  ? 34.613  -10.318 38.438  1.00 34.92  ?  153  PRO A CG   1 
ATOM   268  C  CD   . PRO A 1 40  ? 35.435  -10.459 37.183  1.00 34.09  ?  153  PRO A CD   1 
ATOM   269  H  HA   . PRO A 1 40  ? 37.127  -11.146 39.671  1.00 41.59  ?  153  PRO A HA   1 
ATOM   270  H  HB2  . PRO A 1 40  ? 34.630  -12.263 39.166  1.00 44.06  ?  153  PRO A HB2  1 
ATOM   271  H  HB3  . PRO A 1 40  ? 35.007  -11.194 40.279  1.00 44.06  ?  153  PRO A HB3  1 
ATOM   272  H  HG2  . PRO A 1 40  ? 33.668  -10.434 38.250  1.00 41.89  ?  153  PRO A HG2  1 
ATOM   273  H  HG3  . PRO A 1 40  ? 34.764  -9.457  38.859  1.00 41.89  ?  153  PRO A HG3  1 
ATOM   274  H  HD2  . PRO A 1 40  ? 35.031  -11.096 36.573  1.00 40.89  ?  153  PRO A HD2  1 
ATOM   275  H  HD3  . PRO A 1 40  ? 35.544  -9.601  36.742  1.00 40.89  ?  153  PRO A HD3  1 
ATOM   276  N  N    . GLN A 1 41  ? 37.364  -13.628 40.057  1.00 38.90  ?  154  GLN A N    1 
ATOM   277  C  CA   . GLN A 1 41  ? 37.713  -15.044 40.109  1.00 36.00  ?  154  GLN A CA   1 
ATOM   278  C  C    . GLN A 1 41  ? 36.572  -15.898 39.566  1.00 36.82  ?  154  GLN A C    1 
ATOM   279  O  O    . GLN A 1 41  ? 35.397  -15.659 39.865  1.00 36.52  ?  154  GLN A O    1 
ATOM   280  C  CB   . GLN A 1 41  ? 38.026  -15.464 41.548  1.00 39.31  ?  154  GLN A CB   1 
ATOM   281  C  CG   . GLN A 1 41  ? 39.320  -14.892 42.083  1.00 41.14  ?  154  GLN A CG   1 
ATOM   282  C  CD   . GLN A 1 41  ? 40.539  -15.446 41.356  1.00 48.54  ?  154  GLN A CD   1 
ATOM   283  O  OE1  . GLN A 1 41  ? 40.531  -16.583 40.869  1.00 47.29  ?  154  GLN A OE1  1 
ATOM   284  N  NE2  . GLN A 1 41  ? 41.587  -14.642 41.273  1.00 52.18  ?  154  GLN A NE2  1 
ATOM   285  H  H    . GLN A 1 41  ? 37.422  -13.219 40.811  1.00 46.67  ?  154  GLN A H    1 
ATOM   286  H  HA   . GLN A 1 41  ? 38.502  -15.194 39.566  1.00 43.19  ?  154  GLN A HA   1 
ATOM   287  H  HB2  . GLN A 1 41  ? 37.308  -15.161 42.125  1.00 47.15  ?  154  GLN A HB2  1 
ATOM   288  H  HB3  . GLN A 1 41  ? 38.094  -16.431 41.583  1.00 47.15  ?  154  GLN A HB3  1 
ATOM   289  H  HG2  . GLN A 1 41  ? 39.313  -13.929 41.970  1.00 49.35  ?  154  GLN A HG2  1 
ATOM   290  H  HG3  . GLN A 1 41  ? 39.401  -15.115 43.024  1.00 49.35  ?  154  GLN A HG3  1 
ATOM   291  H  HE21 . GLN A 1 41  ? 41.554  -13.855 41.618  1.00 62.60  ?  154  GLN A HE21 1 
ATOM   292  H  HE22 . GLN A 1 41  ? 42.301  -14.906 40.873  1.00 62.60  ?  154  GLN A HE22 1 
ATOM   293  N  N    . GLY A 1 42  ? 36.929  -16.906 38.774  1.00 34.59  ?  155  GLY A N    1 
ATOM   294  C  CA   . GLY A 1 42  ? 35.962  -17.805 38.186  1.00 31.24  ?  155  GLY A CA   1 
ATOM   295  C  C    . GLY A 1 42  ? 35.578  -17.487 36.761  1.00 32.93  ?  155  GLY A C    1 
ATOM   296  O  O    . GLY A 1 42  ? 34.822  -18.257 36.155  1.00 30.26  ?  155  GLY A O    1 
ATOM   297  H  H    . GLY A 1 42  ? 37.743  -17.087 38.564  1.00 41.50  ?  155  GLY A H    1 
ATOM   298  H  HA2  . GLY A 1 42  ? 36.326  -18.704 38.200  1.00 37.47  ?  155  GLY A HA2  1 
ATOM   299  H  HA3  . GLY A 1 42  ? 35.153  -17.783 38.722  1.00 37.47  ?  155  GLY A HA3  1 
ATOM   300  N  N    . PHE A 1 43  ? 36.077  -16.384 36.202  1.00 32.55  ?  156  PHE A N    1 
ATOM   301  C  CA   . PHE A 1 43  ? 35.753  -15.985 34.843  1.00 32.05  ?  156  PHE A CA   1 
ATOM   302  C  C    . PHE A 1 43  ? 37.028  -15.907 34.010  1.00 32.43  ?  156  PHE A C    1 
ATOM   303  O  O    . PHE A 1 43  ? 38.132  -15.750 34.538  1.00 34.70  ?  156  PHE A O    1 
ATOM   304  C  CB   . PHE A 1 43  ? 35.034  -14.636 34.820  1.00 31.51  ?  156  PHE A CB   1 
ATOM   305  C  CG   . PHE A 1 43  ? 33.749  -14.615 35.585  1.00 33.16  ?  156  PHE A CG   1 
ATOM   306  C  CD1  . PHE A 1 43  ? 32.561  -15.011 34.982  1.00 31.74  ?  156  PHE A CD1  1 
ATOM   307  C  CD2  . PHE A 1 43  ? 33.719  -14.204 36.907  1.00 36.19  ?  156  PHE A CD2  1 
ATOM   308  C  CE1  . PHE A 1 43  ? 31.374  -14.981 35.684  1.00 34.57  ?  156  PHE A CE1  1 
ATOM   309  C  CE2  . PHE A 1 43  ? 32.532  -14.180 37.616  1.00 37.00  ?  156  PHE A CE2  1 
ATOM   310  C  CZ   . PHE A 1 43  ? 31.360  -14.570 37.004  1.00 37.42  ?  156  PHE A CZ   1 
ATOM   311  H  H    . PHE A 1 43  ? 36.614  -15.846 36.604  1.00 39.04  ?  156  PHE A H    1 
ATOM   312  H  HA   . PHE A 1 43  ? 35.169  -16.648 34.443  1.00 38.45  ?  156  PHE A HA   1 
ATOM   313  H  HB2  . PHE A 1 43  ? 35.619  -13.966 35.208  1.00 37.80  ?  156  PHE A HB2  1 
ATOM   314  H  HB3  . PHE A 1 43  ? 34.832  -14.408 33.899  1.00 37.80  ?  156  PHE A HB3  1 
ATOM   315  H  HD1  . PHE A 1 43  ? 32.566  -15.298 34.098  1.00 38.07  ?  156  PHE A HD1  1 
ATOM   316  H  HD2  . PHE A 1 43  ? 34.507  -13.940 37.323  1.00 43.42  ?  156  PHE A HD2  1 
ATOM   317  H  HE1  . PHE A 1 43  ? 30.583  -15.238 35.269  1.00 41.47  ?  156  PHE A HE1  1 
ATOM   318  H  HE2  . PHE A 1 43  ? 32.525  -13.901 38.504  1.00 44.38  ?  156  PHE A HE2  1 
ATOM   319  H  HZ   . PHE A 1 43  ? 30.560  -14.556 37.479  1.00 44.89  ?  156  PHE A HZ   1 
ATOM   320  N  N    . MET A 1 44  ? 36.857  -16.017 32.694  1.00 29.59  ?  157  MET A N    1 
ATOM   321  C  CA   . MET A 1 44  ? 37.962  -15.901 31.761  1.00 31.93  ?  157  MET A CA   1 
ATOM   322  C  C    . MET A 1 44  ? 37.495  -15.195 30.498  1.00 30.60  ?  157  MET A C    1 
ATOM   323  O  O    . MET A 1 44  ? 36.332  -15.299 30.099  1.00 27.12  ?  157  MET A O    1 
ATOM   324  C  CB   . MET A 1 44  ? 38.545  -17.278 31.390  1.00 32.23  ?  157  MET A CB   1 
ATOM   325  C  CG   . MET A 1 44  ? 37.506  -18.252 30.853  1.00 37.32  ?  157  MET A CG   1 
ATOM   326  S  SD   . MET A 1 44  ? 38.172  -19.864 30.402  1.00 42.11  ?  157  MET A SD   1 
ATOM   327  C  CE   . MET A 1 44  ? 38.543  -19.605 28.664  1.00 38.84  ?  157  MET A CE   1 
ATOM   328  H  H    . MET A 1 44  ? 36.097  -16.161 32.317  1.00 35.50  ?  157  MET A H    1 
ATOM   329  H  HA   . MET A 1 44  ? 38.663  -15.375 32.177  1.00 38.30  ?  157  MET A HA   1 
ATOM   330  H  HB2  . MET A 1 44  ? 39.221  -17.157 30.705  1.00 38.66  ?  157  MET A HB2  1 
ATOM   331  H  HB3  . MET A 1 44  ? 38.941  -17.673 32.182  1.00 38.66  ?  157  MET A HB3  1 
ATOM   332  H  HG2  . MET A 1 44  ? 36.831  -18.394 31.535  1.00 44.77  ?  157  MET A HG2  1 
ATOM   333  H  HG3  . MET A 1 44  ? 37.101  -17.868 30.060  1.00 44.77  ?  157  MET A HG3  1 
ATOM   334  H  HE1  . MET A 1 44  ? 38.917  -20.421 28.296  1.00 46.59  ?  157  MET A HE1  1 
ATOM   335  H  HE2  . MET A 1 44  ? 37.725  -19.377 28.197  1.00 46.59  ?  157  MET A HE2  1 
ATOM   336  H  HE3  . MET A 1 44  ? 39.184  -18.881 28.582  1.00 46.59  ?  157  MET A HE3  1 
ATOM   337  N  N    . TRP A 1 45  ? 38.428  -14.482 29.865  1.00 31.10  ?  158  TRP A N    1 
ATOM   338  C  CA   . TRP A 1 45  ? 38.154  -13.861 28.579  1.00 29.91  ?  158  TRP A CA   1 
ATOM   339  C  C    . TRP A 1 45  ? 38.131  -14.909 27.471  1.00 32.28  ?  158  TRP A C    1 
ATOM   340  O  O    . TRP A 1 45  ? 38.838  -15.918 27.523  1.00 31.76  ?  158  TRP A O    1 
ATOM   341  C  CB   . TRP A 1 45  ? 39.211  -12.812 28.254  1.00 29.64  ?  158  TRP A CB   1 
ATOM   342  C  CG   . TRP A 1 45  ? 39.232  -11.635 29.157  1.00 30.50  ?  158  TRP A CG   1 
ATOM   343  C  CD1  . TRP A 1 45  ? 40.221  -11.293 30.036  1.00 30.21  ?  158  TRP A CD1  1 
ATOM   344  C  CD2  . TRP A 1 45  ? 38.223  -10.622 29.272  1.00 30.04  ?  158  TRP A CD2  1 
ATOM   345  N  NE1  . TRP A 1 45  ? 39.892  -10.131 30.688  1.00 31.13  ?  158  TRP A NE1  1 
ATOM   346  C  CE2  . TRP A 1 45  ? 38.665  -9.702  30.245  1.00 31.67  ?  158  TRP A CE2  1 
ATOM   347  C  CE3  . TRP A 1 45  ? 36.991  -10.409 28.651  1.00 31.97  ?  158  TRP A CE3  1 
ATOM   348  C  CZ2  . TRP A 1 45  ? 37.920  -8.592  30.610  1.00 31.07  ?  158  TRP A CZ2  1 
ATOM   349  C  CZ3  . TRP A 1 45  ? 36.240  -9.302  29.017  1.00 28.90  ?  158  TRP A CZ3  1 
ATOM   350  C  CH2  . TRP A 1 45  ? 36.710  -8.404  29.989  1.00 33.22  ?  158  TRP A CH2  1 
ATOM   351  H  H    . TRP A 1 45  ? 39.224  -14.346 30.160  1.00 37.30  ?  158  TRP A H    1 
ATOM   352  H  HA   . TRP A 1 45  ? 37.289  -13.424 28.616  1.00 35.88  ?  158  TRP A HA   1 
ATOM   353  H  HB2  . TRP A 1 45  ? 40.084  -13.232 28.304  1.00 35.56  ?  158  TRP A HB2  1 
ATOM   354  H  HB3  . TRP A 1 45  ? 39.051  -12.485 27.354  1.00 35.56  ?  158  TRP A HB3  1 
ATOM   355  H  HD1  . TRP A 1 45  ? 41.003  -11.778 30.173  1.00 36.24  ?  158  TRP A HD1  1 
ATOM   356  H  HE1  . TRP A 1 45  ? 40.376  -9.735  31.279  1.00 37.34  ?  158  TRP A HE1  1 
ATOM   357  H  HE3  . TRP A 1 45  ? 36.679  -10.999 28.003  1.00 38.34  ?  158  TRP A HE3  1 
ATOM   358  H  HZ2  . TRP A 1 45  ? 38.228  -7.995  31.254  1.00 37.27  ?  158  TRP A HZ2  1 
ATOM   359  H  HZ3  . TRP A 1 45  ? 35.416  -9.153  28.614  1.00 34.67  ?  158  TRP A HZ3  1 
ATOM   360  H  HH2  . TRP A 1 45  ? 36.191  -7.666  30.216  1.00 39.85  ?  158  TRP A HH2  1 
ATOM   361  N  N    . ASP A 1 46  ? 37.324  -14.655 26.447  1.00 32.46  ?  159  ASP A N    1 
ATOM   362  C  CA   . ASP A 1 46  ? 37.370  -15.456 25.229  1.00 29.46  ?  159  ASP A CA   1 
ATOM   363  C  C    . ASP A 1 46  ? 36.937  -14.579 24.065  1.00 33.12  ?  159  ASP A C    1 
ATOM   364  O  O    . ASP A 1 46  ? 35.834  -14.026 24.081  1.00 36.00  ?  159  ASP A O    1 
ATOM   365  C  CB   . ASP A 1 46  ? 36.473  -16.686 25.344  1.00 31.38  ?  159  ASP A CB   1 
ATOM   366  C  CG   . ASP A 1 46  ? 36.758  -17.721 24.267  1.00 32.69  ?  159  ASP A CG   1 
ATOM   367  O  OD1  . ASP A 1 46  ? 37.805  -17.605 23.604  1.00 34.02  ?  159  ASP A OD1  1 
ATOM   368  O  OD2  . ASP A 1 46  ? 35.942  -18.631 24.076  1.00 35.01  ?  159  ASP A OD2  1 
ATOM   369  H  H    . ASP A 1 46  ? 36.741  -14.024 26.433  1.00 38.93  ?  159  ASP A H    1 
ATOM   370  H  HA   . ASP A 1 46  ? 38.279  -15.756 25.071  1.00 35.33  ?  159  ASP A HA   1 
ATOM   371  H  HB2  . ASP A 1 46  ? 36.617  -17.104 26.207  1.00 37.64  ?  159  ASP A HB2  1 
ATOM   372  H  HB3  . ASP A 1 46  ? 35.546  -16.411 25.258  1.00 37.64  ?  159  ASP A HB3  1 
ATOM   373  N  N    . THR A 1 47  ? 37.789  -14.443 23.060  1.00 29.80  ?  160  THR A N    1 
ATOM   374  C  CA   . THR A 1 47  ? 37.402  -13.743 21.847  1.00 31.17  ?  160  THR A CA   1 
ATOM   375  C  C    . THR A 1 47  ? 36.578  -14.684 20.981  1.00 33.03  ?  160  THR A C    1 
ATOM   376  O  O    . THR A 1 47  ? 37.041  -15.774 20.627  1.00 34.12  ?  160  THR A O    1 
ATOM   377  C  CB   . THR A 1 47  ? 38.638  -13.238 21.106  1.00 32.70  ?  160  THR A CB   1 
ATOM   378  O  OG1  . THR A 1 47  ? 39.307  -12.299 21.945  1.00 30.50  ?  160  THR A OG1  1 
ATOM   379  C  CG2  . THR A 1 47  ? 38.237  -12.571 19.805  1.00 33.03  ?  160  THR A CG2  1 
ATOM   380  H  H    . THR A 1 47  ? 38.593  -14.747 23.057  1.00 35.75  ?  160  THR A H    1 
ATOM   381  H  HA   . THR A 1 47  ? 36.858  -12.969 22.065  1.00 37.39  ?  160  THR A HA   1 
ATOM   382  H  HB   . THR A 1 47  ? 39.233  -13.973 20.889  1.00 39.22  ?  160  THR A HB   1 
ATOM   383  H  HG1  . THR A 1 47  ? 39.992  -12.005 21.559  1.00 36.58  ?  160  THR A HG1  1 
ATOM   384  H  HG21 . THR A 1 47  ? 38.991  -12.088 19.433  1.00 39.62  ?  160  THR A HG21 1 
ATOM   385  H  HG22 . THR A 1 47  ? 37.945  -13.240 19.165  1.00 39.62  ?  160  THR A HG22 1 
ATOM   386  H  HG23 . THR A 1 47  ? 37.510  -11.948 19.961  1.00 39.62  ?  160  THR A HG23 1 
ATOM   387  N  N    . LEU A 1 48  ? 35.352  -14.276 20.659  1.00 28.15  ?  161  LEU A N    1 
ATOM   388  C  CA   . LEU A 1 48  ? 34.408  -15.154 19.983  1.00 29.42  ?  161  LEU A CA   1 
ATOM   389  C  C    . LEU A 1 48  ? 34.619  -15.065 18.473  1.00 32.81  ?  161  LEU A C    1 
ATOM   390  O  O    . LEU A 1 48  ? 34.550  -13.975 17.890  1.00 33.65  ?  161  LEU A O    1 
ATOM   391  C  CB   . LEU A 1 48  ? 32.971  -14.797 20.359  1.00 29.21  ?  161  LEU A CB   1 
ATOM   392  C  CG   . LEU A 1 48  ? 32.611  -14.917 21.840  1.00 26.61  ?  161  LEU A CG   1 
ATOM   393  C  CD1  . LEU A 1 48  ? 31.101  -14.896 22.052  1.00 29.21  ?  161  LEU A CD1  1 
ATOM   394  C  CD2  . LEU A 1 48  ? 33.224  -16.184 22.441  1.00 30.54  ?  161  LEU A CD2  1 
ATOM   395  H  H    . LEU A 1 48  ? 35.045  -13.490 20.824  1.00 33.77  ?  161  LEU A H    1 
ATOM   396  H  HA   . LEU A 1 48  ? 34.571  -16.071 20.256  1.00 35.29  ?  161  LEU A HA   1 
ATOM   397  H  HB2  . LEU A 1 48  ? 32.811  -13.876 20.100  1.00 35.04  ?  161  LEU A HB2  1 
ATOM   398  H  HB3  . LEU A 1 48  ? 32.376  -15.388 19.872  1.00 35.04  ?  161  LEU A HB3  1 
ATOM   399  H  HG   . LEU A 1 48  ? 32.978  -14.150 22.307  1.00 31.91  ?  161  LEU A HG   1 
ATOM   400  H  HD11 . LEU A 1 48  ? 30.914  -14.959 23.001  1.00 35.03  ?  161  LEU A HD11 1 
ATOM   401  H  HD12 . LEU A 1 48  ? 30.744  -14.067 21.698  1.00 35.03  ?  161  LEU A HD12 1 
ATOM   402  H  HD13 . LEU A 1 48  ? 30.707  -15.651 21.587  1.00 35.03  ?  161  LEU A HD13 1 
ATOM   403  H  HD21 . LEU A 1 48  ? 32.816  -16.354 23.305  1.00 36.63  ?  161  LEU A HD21 1 
ATOM   404  H  HD22 . LEU A 1 48  ? 33.057  -16.930 21.844  1.00 36.63  ?  161  LEU A HD22 1 
ATOM   405  H  HD23 . LEU A 1 48  ? 34.180  -16.054 22.547  1.00 36.63  ?  161  LEU A HD23 1 
ATOM   406  N  N    . ASP A 1 49  ? 34.875  -16.212 17.844  1.00 29.59  ?  162  ASP A N    1 
ATOM   407  C  CA   . ASP A 1 49  ? 34.950  -16.319 16.391  1.00 29.34  ?  162  ASP A CA   1 
ATOM   408  C  C    . ASP A 1 49  ? 33.603  -16.830 15.894  1.00 29.16  ?  162  ASP A C    1 
ATOM   409  O  O    . ASP A 1 49  ? 33.332  -18.031 15.918  1.00 30.82  ?  162  ASP A O    1 
ATOM   410  C  CB   . ASP A 1 49  ? 36.093  -17.239 15.968  1.00 33.17  ?  162  ASP A CB   1 
ATOM   411  C  CG   . ASP A 1 49  ? 36.247  -17.315 14.458  1.00 36.66  ?  162  ASP A CG   1 
ATOM   412  O  OD1  . ASP A 1 49  ? 35.404  -16.737 13.740  1.00 38.62  ?  162  ASP A OD1  1 
ATOM   413  O  OD2  . ASP A 1 49  ? 37.203  -17.952 13.991  1.00 41.58  ?  162  ASP A OD2  1 
ATOM   414  H  H    . ASP A 1 49  ? 35.010  -16.958 18.250  1.00 35.49  ?  162  ASP A H    1 
ATOM   415  H  HA   . ASP A 1 49  ? 35.113  -15.442 16.010  1.00 35.20  ?  162  ASP A HA   1 
ATOM   416  H  HB2  . ASP A 1 49  ? 36.924  -16.904 16.338  1.00 39.79  ?  162  ASP A HB2  1 
ATOM   417  H  HB3  . ASP A 1 49  ? 35.919  -18.134 16.298  1.00 39.79  ?  162  ASP A HB3  1 
ATOM   418  N  N    . LEU A 1 50  ? 32.752  -15.911 15.454  1.00 29.24  ?  163  LEU A N    1 
ATOM   419  C  CA   . LEU A 1 50  ? 31.408  -16.252 15.011  1.00 30.08  ?  163  LEU A CA   1 
ATOM   420  C  C    . LEU A 1 50  ? 31.395  -17.089 13.742  1.00 29.86  ?  163  LEU A C    1 
ATOM   421  O  O    . LEU A 1 50  ? 30.326  -17.579 13.355  1.00 28.11  ?  163  LEU A O    1 
ATOM   422  C  CB   . LEU A 1 50  ? 30.599  -14.966 14.796  1.00 29.74  ?  163  LEU A CB   1 
ATOM   423  C  CG   . LEU A 1 50  ? 30.550  -14.067 16.027  1.00 31.33  ?  163  LEU A CG   1 
ATOM   424  C  CD1  . LEU A 1 50  ? 29.597  -12.900 15.816  1.00 32.87  ?  163  LEU A CD1  1 
ATOM   425  C  CD2  . LEU A 1 50  ? 30.139  -14.865 17.265  1.00 31.57  ?  163  LEU A CD2  1 
ATOM   426  H  H    . LEU A 1 50  ? 32.931  -15.072 15.402  1.00 35.08  ?  163  LEU A H    1 
ATOM   427  H  HA   . LEU A 1 50  ? 30.973  -16.772 15.704  1.00 36.08  ?  163  LEU A HA   1 
ATOM   428  H  HB2  . LEU A 1 50  ? 31.003  -14.460 14.073  1.00 35.67  ?  163  LEU A HB2  1 
ATOM   429  H  HB3  . LEU A 1 50  ? 29.688  -15.205 14.565  1.00 35.67  ?  163  LEU A HB3  1 
ATOM   430  H  HG   . LEU A 1 50  ? 31.438  -13.707 16.176  1.00 37.58  ?  163  LEU A HG   1 
ATOM   431  H  HD11 . LEU A 1 50  ? 29.597  -12.345 16.612  1.00 39.43  ?  163  LEU A HD11 1 
ATOM   432  H  HD12 . LEU A 1 50  ? 29.896  -12.383 15.052  1.00 39.43  ?  163  LEU A HD12 1 
ATOM   433  H  HD13 . LEU A 1 50  ? 28.706  -13.246 15.654  1.00 39.43  ?  163  LEU A HD13 1 
ATOM   434  H  HD21 . LEU A 1 50  ? 29.884  -14.248 17.968  1.00 37.87  ?  163  LEU A HD21 1 
ATOM   435  H  HD22 . LEU A 1 50  ? 29.388  -15.436 17.037  1.00 37.87  ?  163  LEU A HD22 1 
ATOM   436  H  HD23 . LEU A 1 50  ? 30.890  -15.407 17.555  1.00 37.87  ?  163  LEU A HD23 1 
ATOM   437  N  N    . SER A 1 51  ? 32.542  -17.260 13.081  1.00 31.31  ?  164  SER A N    1 
ATOM   438  C  CA   . SER A 1 51  ? 32.596  -18.185 11.955  1.00 36.18  ?  164  SER A CA   1 
ATOM   439  C  C    . SER A 1 51  ? 32.465  -19.635 12.396  1.00 35.82  ?  164  SER A C    1 
ATOM   440  O  O    . SER A 1 51  ? 32.149  -20.494 11.570  1.00 35.33  ?  164  SER A O    1 
ATOM   441  C  CB   . SER A 1 51  ? 33.913  -18.007 11.203  1.00 38.56  ?  164  SER A CB   1 
ATOM   442  O  OG   . SER A 1 51  ? 34.101  -16.679 10.772  1.00 39.22  ?  164  SER A OG   1 
ATOM   443  H  H    . SER A 1 51  ? 33.282  -16.862 13.260  1.00 37.55  ?  164  SER A H    1 
ATOM   444  H  HA   . SER A 1 51  ? 31.865  -17.983 11.351  1.00 43.40  ?  164  SER A HA   1 
ATOM   445  H  HB2  . SER A 1 51  ? 34.643  -18.249 11.794  1.00 46.25  ?  164  SER A HB2  1 
ATOM   446  H  HB3  . SER A 1 51  ? 33.909  -18.589 10.427  1.00 46.25  ?  164  SER A HB3  1 
ATOM   447  H  HG   . SER A 1 51  ? 34.106  -16.647 9.933   1.00 47.05  ?  164  SER A HG   1 
ATOM   448  N  N    . ASP A 1 52  ? 32.720  -19.919 13.670  1.00 34.12  ?  165  ASP A N    1 
ATOM   449  C  CA   . ASP A 1 52  ? 32.506  -21.246 14.240  1.00 35.20  ?  165  ASP A CA   1 
ATOM   450  C  C    . ASP A 1 52  ? 31.038  -21.364 14.625  1.00 33.32  ?  165  ASP A C    1 
ATOM   451  O  O    . ASP A 1 52  ? 30.584  -20.690 15.562  1.00 31.21  ?  165  ASP A O    1 
ATOM   452  C  CB   . ASP A 1 52  ? 33.418  -21.441 15.447  1.00 38.51  ?  165  ASP A CB   1 
ATOM   453  C  CG   . ASP A 1 52  ? 33.361  -22.845 16.004  1.00 40.30  ?  165  ASP A CG   1 
ATOM   454  O  OD1  . ASP A 1 52  ? 32.306  -23.498 15.871  1.00 38.74  ?  165  ASP A OD1  1 
ATOM   455  O  OD2  . ASP A 1 52  ? 34.378  -23.285 16.579  1.00 41.94  ?  165  ASP A OD2  1 
ATOM   456  H  H    . ASP A 1 52  ? 33.024  -19.348 14.236  1.00 40.93  ?  165  ASP A H    1 
ATOM   457  H  HA   . ASP A 1 52  ? 32.712  -21.934 13.589  1.00 42.23  ?  165  ASP A HA   1 
ATOM   458  H  HB2  . ASP A 1 52  ? 34.334  -21.260 15.183  1.00 46.20  ?  165  ASP A HB2  1 
ATOM   459  H  HB3  . ASP A 1 52  ? 33.148  -20.828 16.149  1.00 46.20  ?  165  ASP A HB3  1 
ATOM   460  N  N    . ALA A 1 53  ? 30.287  -22.208 13.898  1.00 31.80  ?  166  ALA A N    1 
ATOM   461  C  CA   . ALA A 1 53  ? 28.851  -22.320 14.146  1.00 32.82  ?  166  ALA A CA   1 
ATOM   462  C  C    . ALA A 1 53  ? 28.555  -22.604 15.611  1.00 30.58  ?  166  ALA A C    1 
ATOM   463  O  O    . ALA A 1 53  ? 27.550  -22.133 16.152  1.00 29.58  ?  166  ALA A O    1 
ATOM   464  C  CB   . ALA A 1 53  ? 28.249  -23.407 13.258  1.00 35.94  ?  166  ALA A CB   1 
ATOM   465  H  H    . ALA A 1 53  ? 30.581  -22.715 13.269  1.00 38.15  ?  166  ALA A H    1 
ATOM   466  H  HA   . ALA A 1 53  ? 28.425  -21.480 13.914  1.00 39.37  ?  166  ALA A HA   1 
ATOM   467  H  HB1  . ALA A 1 53  ? 27.302  -23.485 13.452  1.00 43.11  ?  166  ALA A HB1  1 
ATOM   468  H  HB2  . ALA A 1 53  ? 28.378  -23.162 12.328  1.00 43.11  ?  166  ALA A HB2  1 
ATOM   469  H  HB3  . ALA A 1 53  ? 28.695  -24.248 13.443  1.00 43.11  ?  166  ALA A HB3  1 
ATOM   470  N  N    . GLU A 1 54  ? 29.426  -23.360 16.270  1.00 31.02  ?  167  GLU A N    1 
ATOM   471  C  CA   . GLU A 1 54  ? 29.260  -23.658 17.691  1.00 34.51  ?  167  GLU A CA   1 
ATOM   472  C  C    . GLU A 1 54  ? 29.246  -22.383 18.521  1.00 31.26  ?  167  GLU A C    1 
ATOM   473  O  O    . GLU A 1 54  ? 28.350  -22.172 19.349  1.00 30.37  ?  167  GLU A O    1 
ATOM   474  C  CB   . GLU A 1 54  ? 30.410  -24.572 18.147  1.00 36.73  ?  167  GLU A CB   1 
ATOM   475  C  CG   . GLU A 1 54  ? 30.007  -25.797 18.875  1.00 43.91  ?  167  GLU A CG   1 
ATOM   476  C  CD   . GLU A 1 54  ? 31.181  -26.734 19.088  1.00 46.74  ?  167  GLU A CD   1 
ATOM   477  O  OE1  . GLU A 1 54  ? 32.030  -26.425 19.952  1.00 48.11  ?  167  GLU A OE1  1 
ATOM   478  O  OE2  . GLU A 1 54  ? 31.255  -27.769 18.378  1.00 45.56  ?  167  GLU A OE2  1 
ATOM   479  H  H    . GLU A 1 54  ? 30.126  -23.716 15.920  1.00 37.21  ?  167  GLU A H    1 
ATOM   480  H  HA   . GLU A 1 54  ? 28.416  -24.116 17.827  1.00 41.39  ?  167  GLU A HA   1 
ATOM   481  H  HB2  . GLU A 1 54  ? 30.905  -24.853 17.362  1.00 44.06  ?  167  GLU A HB2  1 
ATOM   482  H  HB3  . GLU A 1 54  ? 30.987  -24.063 18.738  1.00 44.06  ?  167  GLU A HB3  1 
ATOM   483  H  HG2  . GLU A 1 54  ? 29.652  -25.551 19.743  1.00 52.67  ?  167  GLU A HG2  1 
ATOM   484  H  HG3  . GLU A 1 54  ? 29.332  -26.267 18.361  1.00 52.67  ?  167  GLU A HG3  1 
ATOM   485  N  N    . VAL A 1 55  ? 30.253  -21.528 18.322  1.00 30.84  ?  168  VAL A N    1 
ATOM   486  C  CA   . VAL A 1 55  ? 30.357  -20.303 19.108  1.00 32.01  ?  168  VAL A CA   1 
ATOM   487  C  C    . VAL A 1 55  ? 29.218  -19.353 18.767  1.00 28.39  ?  168  VAL A C    1 
ATOM   488  O  O    . VAL A 1 55  ? 28.672  -18.676 19.649  1.00 30.65  ?  168  VAL A O    1 
ATOM   489  C  CB   . VAL A 1 55  ? 31.730  -19.645 18.881  1.00 31.56  ?  168  VAL A CB   1 
ATOM   490  C  CG1  . VAL A 1 55  ? 31.877  -18.388 19.730  1.00 28.92  ?  168  VAL A CG1  1 
ATOM   491  C  CG2  . VAL A 1 55  ? 32.860  -20.634 19.175  1.00 36.08  ?  168  VAL A CG2  1 
ATOM   492  H  H    . VAL A 1 55  ? 30.882  -21.634 17.745  1.00 36.99  ?  168  VAL A H    1 
ATOM   493  H  HA   . VAL A 1 55  ? 30.283  -20.532 20.047  1.00 38.40  ?  168  VAL A HA   1 
ATOM   494  H  HB   . VAL A 1 55  ? 31.796  -19.383 17.949  1.00 37.85  ?  168  VAL A HB   1 
ATOM   495  H  HG11 . VAL A 1 55  ? 32.798  -18.086 19.690  1.00 34.69  ?  168  VAL A HG11 1 
ATOM   496  H  HG12 . VAL A 1 55  ? 31.288  -17.701 19.380  1.00 34.69  ?  168  VAL A HG12 1 
ATOM   497  H  HG13 . VAL A 1 55  ? 31.636  -18.596 20.646  1.00 34.69  ?  168  VAL A HG13 1 
ATOM   498  H  HG21 . VAL A 1 55  ? 33.709  -20.165 19.137  1.00 43.29  ?  168  VAL A HG21 1 
ATOM   499  H  HG22 . VAL A 1 55  ? 32.729  -21.010 20.060  1.00 43.29  ?  168  VAL A HG22 1 
ATOM   500  H  HG23 . VAL A 1 55  ? 32.843  -21.341 18.510  1.00 43.29  ?  168  VAL A HG23 1 
ATOM   501  N  N    . LEU A 1 56  ? 28.860  -19.262 17.485  1.00 26.22  ?  169  LEU A N    1 
ATOM   502  C  CA   . LEU A 1 56  ? 27.751  -18.398 17.101  1.00 29.68  ?  169  LEU A CA   1 
ATOM   503  C  C    . LEU A 1 56  ? 26.463  -18.845 17.773  1.00 27.68  ?  169  LEU A C    1 
ATOM   504  O  O    . LEU A 1 56  ? 25.661  -18.011 18.222  1.00 28.56  ?  169  LEU A O    1 
ATOM   505  C  CB   . LEU A 1 56  ? 27.588  -18.383 15.580  1.00 31.08  ?  169  LEU A CB   1 
ATOM   506  C  CG   . LEU A 1 56  ? 26.416  -17.565 15.041  1.00 30.27  ?  169  LEU A CG   1 
ATOM   507  C  CD1  . LEU A 1 56  ? 26.502  -16.099 15.504  1.00 29.32  ?  169  LEU A CD1  1 
ATOM   508  C  CD2  . LEU A 1 56  ? 26.365  -17.655 13.518  1.00 27.17  ?  169  LEU A CD2  1 
ATOM   509  H  H    . LEU A 1 56  ? 29.234  -19.680 16.833  1.00 31.45  ?  169  LEU A H    1 
ATOM   510  H  HA   . LEU A 1 56  ? 27.946  -17.490 17.383  1.00 35.60  ?  169  LEU A HA   1 
ATOM   511  H  HB2  . LEU A 1 56  ? 28.398  -18.015 15.193  1.00 37.28  ?  169  LEU A HB2  1 
ATOM   512  H  HB3  . LEU A 1 56  ? 27.463  -19.297 15.280  1.00 37.28  ?  169  LEU A HB3  1 
ATOM   513  H  HG   . LEU A 1 56  ? 25.590  -17.930 15.394  1.00 36.31  ?  169  LEU A HG   1 
ATOM   514  H  HD11 . LEU A 1 56  ? 25.810  -15.586 15.058  1.00 35.17  ?  169  LEU A HD11 1 
ATOM   515  H  HD12 . LEU A 1 56  ? 26.373  -16.063 16.464  1.00 35.17  ?  169  LEU A HD12 1 
ATOM   516  H  HD13 . LEU A 1 56  ? 27.375  -15.746 15.273  1.00 35.17  ?  169  LEU A HD13 1 
ATOM   517  H  HD21 . LEU A 1 56  ? 25.616  -17.131 13.195  1.00 32.59  ?  169  LEU A HD21 1 
ATOM   518  H  HD22 . LEU A 1 56  ? 27.194  -17.307 13.153  1.00 32.59  ?  169  LEU A HD22 1 
ATOM   519  H  HD23 . LEU A 1 56  ? 26.255  -18.584 13.260  1.00 32.59  ?  169  LEU A HD23 1 
ATOM   520  N  N    . LYS A 1 57  ? 26.256  -20.163 17.878  1.00 27.23  ?  170  LYS A N    1 
ATOM   521  C  CA   . LYS A 1 57  ? 25.078  -20.660 18.579  1.00 28.95  ?  170  LYS A CA   1 
ATOM   522  C  C    . LYS A 1 57  ? 25.142  -20.333 20.066  1.00 25.71  ?  170  LYS A C    1 
ATOM   523  O  O    . LYS A 1 57  ? 24.118  -20.025 20.681  1.00 27.50  ?  170  LYS A O    1 
ATOM   524  C  CB   . LYS A 1 57  ? 24.939  -22.169 18.371  1.00 31.98  ?  170  LYS A CB   1 
ATOM   525  C  CG   . LYS A 1 57  ? 23.816  -22.773 19.211  1.00 32.62  ?  170  LYS A CG   1 
ATOM   526  C  CD   . LYS A 1 57  ? 22.855  -23.568 18.366  1.00 38.47  ?  170  LYS A CD   1 
ATOM   527  C  CE   . LYS A 1 57  ? 21.675  -24.047 19.204  1.00 39.45  ?  170  LYS A CE   1 
ATOM   528  N  NZ   . LYS A 1 57  ? 21.234  -25.401 18.770  1.00 42.38  ?  170  LYS A NZ   1 
ATOM   529  H  H    . LYS A 1 57  ? 26.771  -20.774 17.559  1.00 32.66  ?  170  LYS A H    1 
ATOM   530  H  HA   . LYS A 1 57  ? 24.292  -20.231 18.208  1.00 34.72  ?  170  LYS A HA   1 
ATOM   531  H  HB2  . LYS A 1 57  ? 24.743  -22.343 17.437  1.00 38.36  ?  170  LYS A HB2  1 
ATOM   532  H  HB3  . LYS A 1 57  ? 25.769  -22.602 18.623  1.00 38.36  ?  170  LYS A HB3  1 
ATOM   533  H  HG2  . LYS A 1 57  ? 24.198  -23.366 19.877  1.00 39.13  ?  170  LYS A HG2  1 
ATOM   534  H  HG3  . LYS A 1 57  ? 23.322  -22.061 19.646  1.00 39.13  ?  170  LYS A HG3  1 
ATOM   535  H  HD2  . LYS A 1 57  ? 22.518  -23.011 17.647  1.00 46.15  ?  170  LYS A HD2  1 
ATOM   536  H  HD3  . LYS A 1 57  ? 23.309  -24.344 18.000  1.00 46.15  ?  170  LYS A HD3  1 
ATOM   537  H  HE2  . LYS A 1 57  ? 21.938  -24.093 20.137  1.00 47.32  ?  170  LYS A HE2  1 
ATOM   538  H  HE3  . LYS A 1 57  ? 20.932  -23.432 19.098  1.00 47.32  ?  170  LYS A HE3  1 
ATOM   539  H  HZ1  . LYS A 1 57  ? 20.377  -25.522 18.978  1.00 50.84  ?  170  LYS A HZ1  1 
ATOM   540  H  HZ2  . LYS A 1 57  ? 21.332  -25.485 17.890  1.00 50.84  ?  170  LYS A HZ2  1 
ATOM   541  H  HZ3  . LYS A 1 57  ? 21.721  -26.024 19.177  1.00 50.84  ?  170  LYS A HZ3  1 
ATOM   542  N  N    . GLU A 1 58  ? 26.330  -20.408 20.663  1.00 26.93  ?  171  GLU A N    1 
ATOM   543  C  CA   . GLU A 1 58  ? 26.465  -20.016 22.063  1.00 27.82  ?  171  GLU A CA   1 
ATOM   544  C  C    . GLU A 1 58  ? 26.060  -18.559 22.267  1.00 28.89  ?  171  GLU A C    1 
ATOM   545  O  O    . GLU A 1 58  ? 25.367  -18.219 23.237  1.00 26.85  ?  171  GLU A O    1 
ATOM   546  C  CB   . GLU A 1 58  ? 27.901  -20.225 22.539  1.00 30.19  ?  171  GLU A CB   1 
ATOM   547  C  CG   . GLU A 1 58  ? 28.304  -21.688 22.769  1.00 32.04  ?  171  GLU A CG   1 
ATOM   548  C  CD   . GLU A 1 58  ? 29.711  -21.797 23.325  1.00 35.96  ?  171  GLU A CD   1 
ATOM   549  O  OE1  . GLU A 1 58  ? 30.670  -21.571 22.563  1.00 35.77  ?  171  GLU A OE1  1 
ATOM   550  O  OE2  . GLU A 1 58  ? 29.861  -22.079 24.531  1.00 38.83  ?  171  GLU A OE2  1 
ATOM   551  H  H    . GLU A 1 58  ? 27.058  -20.676 20.291  1.00 32.30  ?  171  GLU A H    1 
ATOM   552  H  HA   . GLU A 1 58  ? 25.882  -20.580 22.595  1.00 33.37  ?  171  GLU A HA   1 
ATOM   553  H  HB2  . GLU A 1 58  ? 28.501  -19.860 21.871  1.00 36.21  ?  171  GLU A HB2  1 
ATOM   554  H  HB3  . GLU A 1 58  ? 28.016  -19.757 23.381  1.00 36.21  ?  171  GLU A HB3  1 
ATOM   555  H  HG2  . GLU A 1 58  ? 27.693  -22.093 23.404  1.00 38.44  ?  171  GLU A HG2  1 
ATOM   556  H  HG3  . GLU A 1 58  ? 28.271  -22.166 21.926  1.00 38.44  ?  171  GLU A HG3  1 
ATOM   557  N  N    . LEU A 1 59  ? 26.497  -17.676 21.369  1.00 26.42  ?  172  LEU A N    1 
ATOM   558  C  CA   . LEU A 1 59  ? 26.150  -16.264 21.512  1.00 27.08  ?  172  LEU A CA   1 
ATOM   559  C  C    . LEU A 1 59  ? 24.655  -16.046 21.305  1.00 26.25  ?  172  LEU A C    1 
ATOM   560  O  O    . LEU A 1 59  ? 24.010  -15.291 22.055  1.00 24.98  ?  172  LEU A O    1 
ATOM   561  C  CB   . LEU A 1 59  ? 26.963  -15.419 20.519  1.00 23.62  ?  172  LEU A CB   1 
ATOM   562  C  CG   . LEU A 1 59  ? 26.643  -13.930 20.459  1.00 23.97  ?  172  LEU A CG   1 
ATOM   563  C  CD1  . LEU A 1 59  ? 26.860  -13.262 21.818  1.00 25.78  ?  172  LEU A CD1  1 
ATOM   564  C  CD2  . LEU A 1 59  ? 27.459  -13.246 19.403  1.00 25.77  ?  172  LEU A CD2  1 
ATOM   565  H  H    . LEU A 1 59  ? 26.984  -17.861 20.685  1.00 31.69  ?  172  LEU A H    1 
ATOM   566  H  HA   . LEU A 1 59  ? 26.377  -15.971 22.409  1.00 32.49  ?  172  LEU A HA   1 
ATOM   567  H  HB2  . LEU A 1 59  ? 27.900  -15.499 20.756  1.00 28.33  ?  172  LEU A HB2  1 
ATOM   568  H  HB3  . LEU A 1 59  ? 26.814  -15.778 19.630  1.00 28.33  ?  172  LEU A HB3  1 
ATOM   569  H  HG   . LEU A 1 59  ? 25.707  -13.831 20.225  1.00 28.75  ?  172  LEU A HG   1 
ATOM   570  H  HD11 . LEU A 1 59  ? 26.706  -12.309 21.730  1.00 30.92  ?  172  LEU A HD11 1 
ATOM   571  H  HD12 . LEU A 1 59  ? 26.237  -13.640 22.459  1.00 30.92  ?  172  LEU A HD12 1 
ATOM   572  H  HD13 . LEU A 1 59  ? 27.771  -13.425 22.108  1.00 30.92  ?  172  LEU A HD13 1 
ATOM   573  H  HD21 . LEU A 1 59  ? 27.230  -12.304 19.387  1.00 30.90  ?  172  LEU A HD21 1 
ATOM   574  H  HD22 . LEU A 1 59  ? 28.400  -13.354 19.612  1.00 30.90  ?  172  LEU A HD22 1 
ATOM   575  H  HD23 . LEU A 1 59  ? 27.264  -13.649 18.542  1.00 30.90  ?  172  LEU A HD23 1 
ATOM   576  N  N    . TYR A 1 60  ? 24.094  -16.681 20.272  1.00 25.74  ?  173  TYR A N    1 
ATOM   577  C  CA   . TYR A 1 60  ? 22.654  -16.637 20.060  1.00 28.81  ?  173  TYR A CA   1 
ATOM   578  C  C    . TYR A 1 60  ? 21.906  -17.064 21.319  1.00 27.73  ?  173  TYR A C    1 
ATOM   579  O  O    . TYR A 1 60  ? 20.934  -16.425 21.720  1.00 27.29  ?  173  TYR A O    1 
ATOM   580  C  CB   . TYR A 1 60  ? 22.238  -17.542 18.901  1.00 27.14  ?  173  TYR A CB   1 
ATOM   581  C  CG   . TYR A 1 60  ? 20.747  -17.769 18.869  1.00 30.91  ?  173  TYR A CG   1 
ATOM   582  C  CD1  . TYR A 1 60  ? 19.896  -16.810 18.362  1.00 30.33  ?  173  TYR A CD1  1 
ATOM   583  C  CD2  . TYR A 1 60  ? 20.180  -18.942 19.375  1.00 32.23  ?  173  TYR A CD2  1 
ATOM   584  C  CE1  . TYR A 1 60  ? 18.539  -16.996 18.339  1.00 29.87  ?  173  TYR A CE1  1 
ATOM   585  C  CE2  . TYR A 1 60  ? 18.808  -19.134 19.359  1.00 32.40  ?  173  TYR A CE2  1 
ATOM   586  C  CZ   . TYR A 1 60  ? 17.995  -18.151 18.837  1.00 32.27  ?  173  TYR A CZ   1 
ATOM   587  O  OH   . TYR A 1 60  ? 16.628  -18.307 18.813  1.00 31.38  ?  173  TYR A OH   1 
ATOM   588  H  H    . TYR A 1 60  ? 24.524  -17.141 19.685  1.00 30.87  ?  173  TYR A H    1 
ATOM   589  H  HA   . TYR A 1 60  ? 22.418  -15.724 19.833  1.00 34.55  ?  173  TYR A HA   1 
ATOM   590  H  HB2  . TYR A 1 60  ? 22.500  -17.129 18.064  1.00 32.55  ?  173  TYR A HB2  1 
ATOM   591  H  HB3  . TYR A 1 60  ? 22.673  -18.404 18.997  1.00 32.55  ?  173  TYR A HB3  1 
ATOM   592  H  HD1  . TYR A 1 60  ? 20.251  -16.019 18.028  1.00 36.38  ?  173  TYR A HD1  1 
ATOM   593  H  HD2  . TYR A 1 60  ? 20.731  -19.603 19.727  1.00 38.66  ?  173  TYR A HD2  1 
ATOM   594  H  HE1  . TYR A 1 60  ? 17.987  -16.338 17.985  1.00 35.83  ?  173  TYR A HE1  1 
ATOM   595  H  HE2  . TYR A 1 60  ? 18.439  -19.919 19.696  1.00 38.86  ?  173  TYR A HE2  1 
ATOM   596  H  HH   . TYR A 1 60  ? 16.268  -17.629 18.473  1.00 37.64  ?  173  TYR A HH   1 
ATOM   597  N  N    . THR A 1 61  ? 22.338  -18.159 21.943  1.00 27.61  ?  174  THR A N    1 
ATOM   598  C  CA   . THR A 1 61  ? 21.652  -18.649 23.133  1.00 27.99  ?  174  THR A CA   1 
ATOM   599  C  C    . THR A 1 61  ? 21.772  -17.660 24.281  1.00 27.55  ?  174  THR A C    1 
ATOM   600  O  O    . THR A 1 61  ? 20.779  -17.373 24.971  1.00 29.33  ?  174  THR A O    1 
ATOM   601  C  CB   . THR A 1 61  ? 22.212  -20.014 23.526  1.00 31.33  ?  174  THR A CB   1 
ATOM   602  O  OG1  . THR A 1 61  ? 22.016  -20.934 22.450  1.00 33.40  ?  174  THR A OG1  1 
ATOM   603  C  CG2  . THR A 1 61  ? 21.548  -20.538 24.776  1.00 27.61  ?  174  THR A CG2  1 
ATOM   604  H  H    . THR A 1 61  ? 23.016  -18.630 21.703  1.00 33.11  ?  174  THR A H    1 
ATOM   605  H  HA   . THR A 1 61  ? 20.709  -18.759 22.934  1.00 33.57  ?  174  THR A HA   1 
ATOM   606  H  HB   . THR A 1 61  ? 23.160  -19.931 23.713  1.00 37.58  ?  174  THR A HB   1 
ATOM   607  H  HG1  . THR A 1 61  ? 22.417  -20.663 21.764  1.00 40.06  ?  174  THR A HG1  1 
ATOM   608  H  HG21 . THR A 1 61  ? 21.750  -21.479 24.890  1.00 33.11  ?  174  THR A HG21 1 
ATOM   609  H  HG22 . THR A 1 61  ? 21.868  -20.051 25.551  1.00 33.11  ?  174  THR A HG22 1 
ATOM   610  H  HG23 . THR A 1 61  ? 20.586  -20.428 24.711  1.00 33.11  ?  174  THR A HG23 1 
ATOM   611  N  N    . LEU A 1 62  ? 22.978  -17.134 24.500  1.00 28.27  ?  175  LEU A N    1 
ATOM   612  C  CA   . LEU A 1 62  ? 23.175  -16.134 25.543  1.00 27.79  ?  175  LEU A CA   1 
ATOM   613  C  C    . LEU A 1 62  ? 22.179  -14.991 25.391  1.00 28.98  ?  175  LEU A C    1 
ATOM   614  O  O    . LEU A 1 62  ? 21.465  -14.634 26.339  1.00 27.01  ?  175  LEU A O    1 
ATOM   615  C  CB   . LEU A 1 62  ? 24.608  -15.599 25.499  1.00 27.21  ?  175  LEU A CB   1 
ATOM   616  C  CG   . LEU A 1 62  ? 24.892  -14.449 26.472  1.00 26.63  ?  175  LEU A CG   1 
ATOM   617  C  CD1  . LEU A 1 62  ? 24.894  -14.965 27.907  1.00 29.75  ?  175  LEU A CD1  1 
ATOM   618  C  CD2  . LEU A 1 62  ? 26.206  -13.772 26.157  1.00 28.29  ?  175  LEU A CD2  1 
ATOM   619  H  H    . LEU A 1 62  ? 23.691  -17.336 24.064  1.00 33.91  ?  175  LEU A H    1 
ATOM   620  H  HA   . LEU A 1 62  ? 23.038  -16.554 26.406  1.00 33.33  ?  175  LEU A HA   1 
ATOM   621  H  HB2  . LEU A 1 62  ? 25.214  -16.324 25.718  1.00 32.64  ?  175  LEU A HB2  1 
ATOM   622  H  HB3  . LEU A 1 62  ? 24.789  -15.275 24.603  1.00 32.64  ?  175  LEU A HB3  1 
ATOM   623  H  HG   . LEU A 1 62  ? 24.192  -13.784 26.378  1.00 31.94  ?  175  LEU A HG   1 
ATOM   624  H  HD11 . LEU A 1 62  ? 25.114  -14.235 28.505  1.00 35.69  ?  175  LEU A HD11 1 
ATOM   625  H  HD12 . LEU A 1 62  ? 24.013  -15.312 28.118  1.00 35.69  ?  175  LEU A HD12 1 
ATOM   626  H  HD13 . LEU A 1 62  ? 25.555  -15.670 27.988  1.00 35.69  ?  175  LEU A HD13 1 
ATOM   627  H  HD21 . LEU A 1 62  ? 26.352  -13.054 26.792  1.00 33.93  ?  175  LEU A HD21 1 
ATOM   628  H  HD22 . LEU A 1 62  ? 26.921  -14.424 26.226  1.00 33.93  ?  175  LEU A HD22 1 
ATOM   629  H  HD23 . LEU A 1 62  ? 26.170  -13.416 25.256  1.00 33.93  ?  175  LEU A HD23 1 
ATOM   630  N  N    . LEU A 1 63  ? 22.104  -14.417 24.190  1.00 26.93  ?  176  LEU A N    1 
ATOM   631  C  CA   . LEU A 1 63  ? 21.235  -13.263 23.989  1.00 28.49  ?  176  LEU A CA   1 
ATOM   632  C  C    . LEU A 1 63  ? 19.761  -13.669 24.046  1.00 29.25  ?  176  LEU A C    1 
ATOM   633  O  O    . LEU A 1 63  ? 18.935  -12.965 24.642  1.00 25.84  ?  176  LEU A O    1 
ATOM   634  C  CB   . LEU A 1 63  ? 21.553  -12.590 22.655  1.00 26.90  ?  176  LEU A CB   1 
ATOM   635  C  CG   . LEU A 1 63  ? 22.950  -12.001 22.513  1.00 27.64  ?  176  LEU A CG   1 
ATOM   636  C  CD1  . LEU A 1 63  ? 23.174  -11.553 21.069  1.00 28.91  ?  176  LEU A CD1  1 
ATOM   637  C  CD2  . LEU A 1 63  ? 23.167  -10.834 23.466  1.00 29.24  ?  176  LEU A CD2  1 
ATOM   638  H  H    . LEU A 1 63  ? 22.535  -14.670 23.491  1.00 32.30  ?  176  LEU A H    1 
ATOM   639  H  HA   . LEU A 1 63  ? 21.401  -12.619 24.695  1.00 34.18  ?  176  LEU A HA   1 
ATOM   640  H  HB2  . LEU A 1 63  ? 21.449  -13.251 21.952  1.00 32.26  ?  176  LEU A HB2  1 
ATOM   641  H  HB3  . LEU A 1 63  ? 20.923  -11.865 22.526  1.00 32.26  ?  176  LEU A HB3  1 
ATOM   642  H  HG   . LEU A 1 63  ? 23.601  -12.683 22.743  1.00 33.15  ?  176  LEU A HG   1 
ATOM   643  H  HD11 . LEU A 1 63  ? 24.063  -11.175 20.989  1.00 34.68  ?  176  LEU A HD11 1 
ATOM   644  H  HD12 . LEU A 1 63  ? 23.087  -12.321 20.483  1.00 34.68  ?  176  LEU A HD12 1 
ATOM   645  H  HD13 . LEU A 1 63  ? 22.509  -10.885 20.839  1.00 34.68  ?  176  LEU A HD13 1 
ATOM   646  H  HD21 . LEU A 1 63  ? 24.038  -10.444 23.294  1.00 35.08  ?  176  LEU A HD21 1 
ATOM   647  H  HD22 . LEU A 1 63  ? 22.473  -10.172 23.317  1.00 35.08  ?  176  LEU A HD22 1 
ATOM   648  H  HD23 . LEU A 1 63  ? 23.125  -11.159 24.379  1.00 35.08  ?  176  LEU A HD23 1 
ATOM   649  N  N    . ASN A 1 64  ? 19.414  -14.804 23.435  1.00 27.13  ?  177  ASN A N    1 
ATOM   650  C  CA   . ASN A 1 64  ? 18.025  -15.243 23.392  1.00 29.39  ?  177  ASN A CA   1 
ATOM   651  C  C    . ASN A 1 64  ? 17.480  -15.519 24.784  1.00 29.01  ?  177  ASN A C    1 
ATOM   652  O  O    . ASN A 1 64  ? 16.273  -15.396 25.005  1.00 29.58  ?  177  ASN A O    1 
ATOM   653  C  CB   . ASN A 1 64  ? 17.903  -16.485 22.514  1.00 30.40  ?  177  ASN A CB   1 
ATOM   654  C  CG   . ASN A 1 64  ? 16.568  -17.200 22.687  1.00 34.22  ?  177  ASN A CG   1 
ATOM   655  O  OD1  . ASN A 1 64  ? 16.411  -18.018 23.588  1.00 32.53  ?  177  ASN A OD1  1 
ATOM   656  N  ND2  . ASN A 1 64  ? 15.607  -16.891 21.819  1.00 35.53  ?  177  ASN A ND2  1 
ATOM   657  H  H    . ASN A 1 64  ? 19.962  -15.336 23.039  1.00 32.54  ?  177  ASN A H    1 
ATOM   658  H  HA   . ASN A 1 64  ? 17.484  -14.540 22.999  1.00 35.26  ?  177  ASN A HA   1 
ATOM   659  H  HB2  . ASN A 1 64  ? 17.985  -16.224 21.583  1.00 36.46  ?  177  ASN A HB2  1 
ATOM   660  H  HB3  . ASN A 1 64  ? 18.609  -17.108 22.747  1.00 36.46  ?  177  ASN A HB3  1 
ATOM   661  H  HD21 . ASN A 1 64  ? 14.837  -17.269 21.877  1.00 42.62  ?  177  ASN A HD21 1 
ATOM   662  H  HD22 . ASN A 1 64  ? 15.756  -16.313 21.199  1.00 42.62  ?  177  ASN A HD22 1 
ATOM   663  N  N    . GLU A 1 65  ? 18.345  -15.875 25.729  1.00 28.84  ?  178  GLU A N    1 
ATOM   664  C  CA   . GLU A 1 65  ? 17.904  -16.174 27.078  1.00 29.17  ?  178  GLU A CA   1 
ATOM   665  C  C    . GLU A 1 65  ? 18.173  -15.060 28.081  1.00 32.07  ?  178  GLU A C    1 
ATOM   666  O  O    . GLU A 1 65  ? 17.582  -15.083 29.172  1.00 32.12  ?  178  GLU A O    1 
ATOM   667  C  CB   . GLU A 1 65  ? 18.559  -17.467 27.562  1.00 32.45  ?  178  GLU A CB   1 
ATOM   668  C  CG   . GLU A 1 65  ? 18.212  -18.661 26.677  1.00 33.29  ?  178  GLU A CG   1 
ATOM   669  C  CD   . GLU A 1 65  ? 18.820  -19.970 27.152  1.00 38.81  ?  178  GLU A CD   1 
ATOM   670  O  OE1  . GLU A 1 65  ? 19.671  -19.949 28.071  1.00 41.65  ?  178  GLU A OE1  1 
ATOM   671  O  OE2  . GLU A 1 65  ? 18.447  -21.019 26.596  1.00 38.41  ?  178  GLU A OE2  1 
ATOM   672  H  H    . GLU A 1 65  ? 19.193  -15.948 25.608  1.00 34.60  ?  178  GLU A H    1 
ATOM   673  H  HA   . GLU A 1 65  ? 16.943  -16.308 27.061  1.00 34.98  ?  178  GLU A HA   1 
ATOM   674  H  HB2  . GLU A 1 65  ? 19.523  -17.356 27.554  1.00 38.92  ?  178  GLU A HB2  1 
ATOM   675  H  HB3  . GLU A 1 65  ? 18.254  -17.659 28.462  1.00 38.92  ?  178  GLU A HB3  1 
ATOM   676  H  HG2  . GLU A 1 65  ? 17.248  -18.769 26.664  1.00 39.93  ?  178  GLU A HG2  1 
ATOM   677  H  HG3  . GLU A 1 65  ? 18.539  -18.490 25.780  1.00 39.93  ?  178  GLU A HG3  1 
ATOM   678  N  N    . ASN A 1 66  ? 19.015  -14.075 27.751  1.00 28.01  ?  179  ASN A N    1 
ATOM   679  C  CA   . ASN A 1 66  ? 19.403  -13.089 28.746  1.00 30.04  ?  179  ASN A CA   1 
ATOM   680  C  C    . ASN A 1 66  ? 19.415  -11.643 28.261  1.00 28.52  ?  179  ASN A C    1 
ATOM   681  O  O    . ASN A 1 66  ? 19.773  -10.765 29.049  1.00 29.38  ?  179  ASN A O    1 
ATOM   682  C  CB   . ASN A 1 66  ? 20.806  -13.418 29.297  1.00 31.39  ?  179  ASN A CB   1 
ATOM   683  C  CG   . ASN A 1 66  ? 20.910  -14.819 29.846  1.00 32.89  ?  179  ASN A CG   1 
ATOM   684  O  OD1  . ASN A 1 66  ? 20.567  -15.065 31.009  1.00 32.37  ?  179  ASN A OD1  1 
ATOM   685  N  ND2  . ASN A 1 66  ? 21.390  -15.746 29.025  1.00 29.55  ?  179  ASN A ND2  1 
ATOM   686  H  H    . ASN A 1 66  ? 19.364  -13.963 26.973  1.00 33.60  ?  179  ASN A H    1 
ATOM   687  H  HA   . ASN A 1 66  ? 18.754  -13.141 29.465  1.00 36.04  ?  179  ASN A HA   1 
ATOM   688  H  HB2  . ASN A 1 66  ? 21.455  -13.329 28.582  1.00 37.65  ?  179  ASN A HB2  1 
ATOM   689  H  HB3  . ASN A 1 66  ? 21.016  -12.800 30.015  1.00 37.65  ?  179  ASN A HB3  1 
ATOM   690  H  HD21 . ASN A 1 66  ? 21.468  -16.559 29.293  1.00 35.45  ?  179  ASN A HD21 1 
ATOM   691  H  HD22 . ASN A 1 66  ? 21.623  -15.533 28.226  1.00 35.45  ?  179  ASN A HD22 1 
ATOM   692  N  N    . TYR A 1 67  ? 19.033  -11.356 27.023  1.00 29.28  ?  180  TYR A N    1 
ATOM   693  C  CA   . TYR A 1 67  ? 19.176  -10.002 26.495  1.00 28.91  ?  180  TYR A CA   1 
ATOM   694  C  C    . TYR A 1 67  ? 17.938  -9.177  26.869  1.00 31.38  ?  180  TYR A C    1 
ATOM   695  O  O    . TYR A 1 67  ? 17.169  -9.556  27.757  1.00 27.97  ?  180  TYR A O    1 
ATOM   696  C  CB   . TYR A 1 67  ? 19.446  -10.054 24.980  1.00 27.36  ?  180  TYR A CB   1 
ATOM   697  C  CG   . TYR A 1 67  ? 20.087  -8.795  24.427  1.00 27.95  ?  180  TYR A CG   1 
ATOM   698  C  CD1  . TYR A 1 67  ? 21.123  -8.161  25.107  1.00 26.44  ?  180  TYR A CD1  1 
ATOM   699  C  CD2  . TYR A 1 67  ? 19.660  -8.238  23.229  1.00 28.05  ?  180  TYR A CD2  1 
ATOM   700  C  CE1  . TYR A 1 67  ? 21.720  -7.027  24.604  1.00 29.04  ?  180  TYR A CE1  1 
ATOM   701  C  CE2  . TYR A 1 67  ? 20.247  -7.092  22.721  1.00 27.82  ?  180  TYR A CE2  1 
ATOM   702  C  CZ   . TYR A 1 67  ? 21.277  -6.493  23.411  1.00 30.55  ?  180  TYR A CZ   1 
ATOM   703  O  OH   . TYR A 1 67  ? 21.880  -5.352  22.915  1.00 27.24  ?  180  TYR A OH   1 
ATOM   704  H  H    . TYR A 1 67  ? 18.692  -11.923 26.474  1.00 35.12  ?  180  TYR A H    1 
ATOM   705  H  HA   . TYR A 1 67  ? 19.946  -9.593  26.920  1.00 34.67  ?  180  TYR A HA   1 
ATOM   706  H  HB2  . TYR A 1 67  ? 20.043  -10.795 24.795  1.00 32.82  ?  180  TYR A HB2  1 
ATOM   707  H  HB3  . TYR A 1 67  ? 18.603  -10.183 24.517  1.00 32.82  ?  180  TYR A HB3  1 
ATOM   708  H  HD1  . TYR A 1 67  ? 21.417  -8.511  25.916  1.00 31.71  ?  180  TYR A HD1  1 
ATOM   709  H  HD2  . TYR A 1 67  ? 18.966  -8.643  22.760  1.00 33.64  ?  180  TYR A HD2  1 
ATOM   710  H  HE1  . TYR A 1 67  ? 22.419  -6.623  25.066  1.00 34.83  ?  180  TYR A HE1  1 
ATOM   711  H  HE2  . TYR A 1 67  ? 19.947  -6.729  21.918  1.00 33.37  ?  180  TYR A HE2  1 
ATOM   712  H  HH   . TYR A 1 67  ? 21.524  -5.132  22.187  1.00 32.67  ?  180  TYR A HH   1 
ATOM   713  N  N    . VAL A 1 68  ? 17.722  -8.055  26.182  1.00 29.10  ?  181  VAL A N    1 
ATOM   714  C  CA   . VAL A 1 68  ? 16.788  -7.034  26.659  1.00 31.96  ?  181  VAL A CA   1 
ATOM   715  C  C    . VAL A 1 68  ? 15.343  -7.510  26.548  1.00 30.71  ?  181  VAL A C    1 
ATOM   716  O  O    . VAL A 1 68  ? 14.935  -8.126  25.553  1.00 29.31  ?  181  VAL A O    1 
ATOM   717  C  CB   . VAL A 1 68  ? 17.001  -5.727  25.877  1.00 34.35  ?  181  VAL A CB   1 
ATOM   718  C  CG1  . VAL A 1 68  ? 15.937  -4.698  26.225  1.00 34.04  ?  181  VAL A CG1  1 
ATOM   719  C  CG2  . VAL A 1 68  ? 18.405  -5.162  26.143  1.00 32.96  ?  181  VAL A CG2  1 
ATOM   720  H  H    . VAL A 1 68  ? 18.103  -7.858  25.436  1.00 34.90  ?  181  VAL A H    1 
ATOM   721  H  HA   . VAL A 1 68  ? 16.965  -6.876  27.599  1.00 38.34  ?  181  VAL A HA   1 
ATOM   722  H  HB   . VAL A 1 68  ? 16.925  -5.922  24.930  1.00 41.20  ?  181  VAL A HB   1 
ATOM   723  H  HG11 . VAL A 1 68  ? 16.212  -3.831  25.887  1.00 40.83  ?  181  VAL A HG11 1 
ATOM   724  H  HG12 . VAL A 1 68  ? 15.097  -4.961  25.815  1.00 40.83  ?  181  VAL A HG12 1 
ATOM   725  H  HG13 . VAL A 1 68  ? 15.837  -4.660  27.189  1.00 40.83  ?  181  VAL A HG13 1 
ATOM   726  H  HG21 . VAL A 1 68  ? 18.508  -4.329  25.656  1.00 39.54  ?  181  VAL A HG21 1 
ATOM   727  H  HG22 . VAL A 1 68  ? 18.507  -5.003  27.094  1.00 39.54  ?  181  VAL A HG22 1 
ATOM   728  H  HG23 . VAL A 1 68  ? 19.066  -5.804  25.842  1.00 39.54  ?  181  VAL A HG23 1 
ATOM   729  N  N    . GLU A 1 69  ? 14.557  -7.216  27.581  1.00 30.89  ?  182  GLU A N    1 
ATOM   730  C  CA   . GLU A 1 69  ? 13.131  -7.498  27.599  1.00 32.22  ?  182  GLU A CA   1 
ATOM   731  C  C    . GLU A 1 69  ? 12.342  -6.198  27.734  1.00 34.29  ?  182  GLU A C    1 
ATOM   732  O  O    . GLU A 1 69  ? 12.880  -5.156  28.128  1.00 32.21  ?  182  GLU A O    1 
ATOM   733  C  CB   . GLU A 1 69  ? 12.765  -8.447  28.752  1.00 33.28  ?  182  GLU A CB   1 
ATOM   734  C  CG   . GLU A 1 69  ? 13.522  -9.759  28.758  1.00 32.62  ?  182  GLU A CG   1 
ATOM   735  C  CD   . GLU A 1 69  ? 13.280  -10.570 30.018  1.00 36.78  ?  182  GLU A CD   1 
ATOM   736  O  OE1  . GLU A 1 69  ? 12.447  -10.139 30.845  1.00 36.39  ?  182  GLU A OE1  1 
ATOM   737  O  OE2  . GLU A 1 69  ? 13.914  -11.633 30.184  1.00 35.25  ?  182  GLU A OE2  1 
ATOM   738  H  H    . GLU A 1 69  ? 14.840  -6.843  28.302  1.00 37.05  ?  182  GLU A H    1 
ATOM   739  H  HA   . GLU A 1 69  ? 12.880  -7.921  26.763  1.00 38.65  ?  182  GLU A HA   1 
ATOM   740  H  HB2  . GLU A 1 69  ? 12.952  -7.998  29.591  1.00 39.92  ?  182  GLU A HB2  1 
ATOM   741  H  HB3  . GLU A 1 69  ? 11.820  -8.656  28.691  1.00 39.92  ?  182  GLU A HB3  1 
ATOM   742  H  HG2  . GLU A 1 69  ? 13.238  -10.291 27.999  1.00 39.12  ?  182  GLU A HG2  1 
ATOM   743  H  HG3  . GLU A 1 69  ? 14.473  -9.575  28.698  1.00 39.12  ?  182  GLU A HG3  1 
ATOM   744  N  N    . ASP A 1 70  ? 11.050  -6.266  27.409  1.00 32.33  ?  183  ASP A N    1 
ATOM   745  C  CA   . ASP A 1 70  ? 10.187  -5.109  27.574  1.00 34.98  ?  183  ASP A CA   1 
ATOM   746  C  C    . ASP A 1 70  ? 10.033  -4.777  29.059  1.00 35.82  ?  183  ASP A C    1 
ATOM   747  O  O    . ASP A 1 70  ? 10.456  -5.525  29.948  1.00 33.93  ?  183  ASP A O    1 
ATOM   748  C  CB   . ASP A 1 70  ? 8.814   -5.352  26.964  1.00 35.76  ?  183  ASP A CB   1 
ATOM   749  C  CG   . ASP A 1 70  ? 7.965   -6.262  27.815  1.00 36.36  ?  183  ASP A CG   1 
ATOM   750  O  OD1  . ASP A 1 70  ? 8.348   -7.434  27.980  1.00 32.90  ?  183  ASP A OD1  1 
ATOM   751  O  OD2  . ASP A 1 70  ? 6.921   -5.787  28.345  1.00 38.68  ?  183  ASP A OD2  1 
ATOM   752  H  H    . ASP A 1 70  ? 10.658  -6.963  27.095  1.00 38.78  ?  183  ASP A H    1 
ATOM   753  H  HA   . ASP A 1 70  ? 10.591  -4.355  27.116  1.00 41.96  ?  183  ASP A HA   1 
ATOM   754  H  HB2  . ASP A 1 70  ? 8.351   -4.504  26.874  1.00 42.90  ?  183  ASP A HB2  1 
ATOM   755  H  HB3  . ASP A 1 70  ? 8.921   -5.765  26.094  1.00 42.90  ?  183  ASP A HB3  1 
ATOM   756  N  N    . ASP A 1 71  ? 9.391   -3.640  29.326  1.00 38.22  ?  184  ASP A N    1 
ATOM   757  C  CA   . ASP A 1 71  ? 9.332   -3.137  30.695  1.00 42.88  ?  184  ASP A CA   1 
ATOM   758  C  C    . ASP A 1 71  ? 8.559   -4.060  31.621  1.00 40.11  ?  184  ASP A C    1 
ATOM   759  O  O    . ASP A 1 71  ? 8.771   -4.014  32.835  1.00 43.48  ?  184  ASP A O    1 
ATOM   760  C  CB   . ASP A 1 71  ? 8.720   -1.740  30.705  1.00 50.23  ?  184  ASP A CB   1 
ATOM   761  C  CG   . ASP A 1 71  ? 8.941   -1.020  32.014  1.00 58.49  ?  184  ASP A CG   1 
ATOM   762  O  OD1  . ASP A 1 71  ? 7.969   -0.881  32.795  1.00 59.63  ?  184  ASP A OD1  1 
ATOM   763  O  OD2  . ASP A 1 71  ? 10.093  -0.610  32.272  1.00 60.33  ?  184  ASP A OD2  1 
ATOM   764  H  H    . ASP A 1 71  ? 8.988   -3.150  28.745  1.00 45.85  ?  184  ASP A H    1 
ATOM   765  H  HA   . ASP A 1 71  ? 10.235  -3.070  31.043  1.00 51.44  ?  184  ASP A HA   1 
ATOM   766  H  HB2  . ASP A 1 71  ? 9.124   -1.211  29.999  1.00 60.26  ?  184  ASP A HB2  1 
ATOM   767  H  HB3  . ASP A 1 71  ? 7.763   -1.812  30.559  1.00 60.26  ?  184  ASP A HB3  1 
ATOM   768  N  N    . ASP A 1 72  ? 7.687   -4.909  31.082  1.00 39.37  ?  185  ASP A N    1 
ATOM   769  C  CA   . ASP A 1 72  ? 6.868   -5.804  31.892  1.00 40.30  ?  185  ASP A CA   1 
ATOM   770  C  C    . ASP A 1 72  ? 7.274   -7.262  31.755  1.00 37.12  ?  185  ASP A C    1 
ATOM   771  O  O    . ASP A 1 72  ? 6.539   -8.136  32.207  1.00 35.64  ?  185  ASP A O    1 
ATOM   772  C  CB   . ASP A 1 72  ? 5.391   -5.624  31.530  1.00 41.30  ?  185  ASP A CB   1 
ATOM   773  C  CG   . ASP A 1 72  ? 4.853   -4.276  31.967  1.00 44.53  ?  185  ASP A CG   1 
ATOM   774  O  OD1  . ASP A 1 72  ? 4.790   -4.036  33.190  1.00 44.64  ?  185  ASP A OD1  1 
ATOM   775  O  OD2  . ASP A 1 72  ? 4.532   -3.447  31.087  1.00 41.11  ?  185  ASP A OD2  1 
ATOM   776  H  H    . ASP A 1 72  ? 7.551   -4.984  30.236  1.00 47.22  ?  185  ASP A H    1 
ATOM   777  H  HA   . ASP A 1 72  ? 6.979   -5.565  32.825  1.00 48.34  ?  185  ASP A HA   1 
ATOM   778  H  HB2  . ASP A 1 72  ? 5.289   -5.693  30.568  1.00 49.55  ?  185  ASP A HB2  1 
ATOM   779  H  HB3  . ASP A 1 72  ? 4.870   -6.314  31.970  1.00 49.55  ?  185  ASP A HB3  1 
ATOM   780  N  N    . ASN A 1 73  ? 8.422   -7.540  31.133  1.00 35.32  ?  186  ASN A N    1 
ATOM   781  C  CA   . ASN A 1 73  ? 9.015   -8.883  31.104  1.00 35.46  ?  186  ASN A CA   1 
ATOM   782  C  C    . ASN A 1 73  ? 8.095   -9.893  30.433  1.00 36.51  ?  186  ASN A C    1 
ATOM   783  O  O    . ASN A 1 73  ? 7.971   -11.038 30.876  1.00 35.70  ?  186  ASN A O    1 
ATOM   784  C  CB   . ASN A 1 73  ? 9.384   -9.351  32.509  1.00 39.21  ?  186  ASN A CB   1 
ATOM   785  C  CG   . ASN A 1 73  ? 10.251  -8.354  33.236  1.00 43.10  ?  186  ASN A CG   1 
ATOM   786  O  OD1  . ASN A 1 73  ? 9.864   -7.812  34.271  1.00 46.13  ?  186  ASN A OD1  1 
ATOM   787  N  ND2  . ASN A 1 73  ? 11.433  -8.102  32.694  1.00 43.20  ?  186  ASN A ND2  1 
ATOM   788  H  H    . ASN A 1 73  ? 8.889   -6.954  30.710  1.00 42.37  ?  186  ASN A H    1 
ATOM   789  H  HA   . ASN A 1 73  ? 9.825   -8.836  30.574  1.00 42.53  ?  186  ASN A HA   1 
ATOM   790  H  HB2  . ASN A 1 73  ? 8.573   -9.479  33.025  1.00 47.04  ?  186  ASN A HB2  1 
ATOM   791  H  HB3  . ASN A 1 73  ? 9.873   -10.187 32.447  1.00 47.04  ?  186  ASN A HB3  1 
ATOM   792  H  HD21 . ASN A 1 73  ? 11.967  -7.540  33.068  1.00 51.82  ?  186  ASN A HD21 1 
ATOM   793  H  HD22 . ASN A 1 73  ? 11.667  -8.499  31.968  1.00 51.82  ?  186  ASN A HD22 1 
ATOM   794  N  N    . MET A 1 74  ? 7.451   -9.470  29.346  1.00 34.76  ?  187  MET A N    1 
ATOM   795  C  CA   . MET A 1 74  ? 6.652   -10.379 28.543  1.00 35.29  ?  187  MET A CA   1 
ATOM   796  C  C    . MET A 1 74  ? 7.303   -10.744 27.220  1.00 33.96  ?  187  MET A C    1 
ATOM   797  O  O    . MET A 1 74  ? 6.989   -11.801 26.672  1.00 31.58  ?  187  MET A O    1 
ATOM   798  C  CB   . MET A 1 74  ? 5.280   -9.764  28.264  1.00 35.72  ?  187  MET A CB   1 
ATOM   799  C  CG   . MET A 1 74  ? 4.539   -9.386  29.537  1.00 41.21  ?  187  MET A CG   1 
ATOM   800  S  SD   . MET A 1 74  ? 2.915   -8.697  29.198  1.00 43.65  ?  187  MET A SD   1 
ATOM   801  C  CE   . MET A 1 74  ? 3.287   -7.171  28.392  1.00 41.25  ?  187  MET A CE   1 
ATOM   802  H  H    . MET A 1 74  ? 7.465   -8.660  29.057  1.00 41.70  ?  187  MET A H    1 
ATOM   803  H  HA   . MET A 1 74  ? 6.508   -11.195 29.047  1.00 42.33  ?  187  MET A HA   1 
ATOM   804  H  HB2  . MET A 1 74  ? 5.396   -8.960  27.733  1.00 42.85  ?  187  MET A HB2  1 
ATOM   805  H  HB3  . MET A 1 74  ? 4.738   -10.406 27.780  1.00 42.85  ?  187  MET A HB3  1 
ATOM   806  H  HG2  . MET A 1 74  ? 4.424   -10.178 30.085  1.00 49.44  ?  187  MET A HG2  1 
ATOM   807  H  HG3  . MET A 1 74  ? 5.055   -8.721  30.020  1.00 49.44  ?  187  MET A HG3  1 
ATOM   808  H  HE1  . MET A 1 74  ? 2.883   -7.173  27.510  1.00 49.48  ?  187  MET A HE1  1 
ATOM   809  H  HE2  . MET A 1 74  ? 2.928   -6.440  28.919  1.00 49.48  ?  187  MET A HE2  1 
ATOM   810  H  HE3  . MET A 1 74  ? 4.250   -7.081  28.314  1.00 49.48  ?  187  MET A HE3  1 
ATOM   811  N  N    . PHE A 1 75  ? 8.210   -9.905  26.716  1.00 31.92  ?  188  PHE A N    1 
ATOM   812  C  CA   . PHE A 1 75  ? 8.880   -10.117 25.445  1.00 33.97  ?  188  PHE A CA   1 
ATOM   813  C  C    . PHE A 1 75  ? 10.382  -9.977  25.637  1.00 30.49  ?  188  PHE A C    1 
ATOM   814  O  O    . PHE A 1 75  ? 10.847  -9.238  26.512  1.00 30.56  ?  188  PHE A O    1 
ATOM   815  C  CB   . PHE A 1 75  ? 8.377   -9.125  24.393  1.00 30.20  ?  188  PHE A CB   1 
ATOM   816  C  CG   . PHE A 1 75  ? 6.886   -8.951  24.405  1.00 31.57  ?  188  PHE A CG   1 
ATOM   817  C  CD1  . PHE A 1 75  ? 6.051   -9.921  23.890  1.00 36.17  ?  188  PHE A CD1  1 
ATOM   818  C  CD2  . PHE A 1 75  ? 6.315   -7.808  24.947  1.00 34.62  ?  188  PHE A CD2  1 
ATOM   819  C  CE1  . PHE A 1 75  ? 4.670   -9.761  23.913  1.00 36.07  ?  188  PHE A CE1  1 
ATOM   820  C  CE2  . PHE A 1 75  ? 4.948   -7.640  24.961  1.00 36.11  ?  188  PHE A CE2  1 
ATOM   821  C  CZ   . PHE A 1 75  ? 4.123   -8.620  24.449  1.00 34.81  ?  188  PHE A CZ   1 
ATOM   822  H  H    . PHE A 1 75  ? 8.457   -9.182  27.111  1.00 38.29  ?  188  PHE A H    1 
ATOM   823  H  HA   . PHE A 1 75  ? 8.710   -11.014 25.117  1.00 40.75  ?  188  PHE A HA   1 
ATOM   824  H  HB2  . PHE A 1 75  ? 8.780   -8.259  24.561  1.00 36.23  ?  188  PHE A HB2  1 
ATOM   825  H  HB3  . PHE A 1 75  ? 8.632   -9.445  23.513  1.00 36.23  ?  188  PHE A HB3  1 
ATOM   826  H  HD1  . PHE A 1 75  ? 6.417   -10.693 23.523  1.00 43.39  ?  188  PHE A HD1  1 
ATOM   827  H  HD2  . PHE A 1 75  ? 6.863   -7.147  25.305  1.00 41.53  ?  188  PHE A HD2  1 
ATOM   828  H  HE1  . PHE A 1 75  ? 4.118   -10.425 23.566  1.00 43.27  ?  188  PHE A HE1  1 
ATOM   829  H  HE2  . PHE A 1 75  ? 4.580   -6.864  25.318  1.00 43.32  ?  188  PHE A HE2  1 
ATOM   830  H  HZ   . PHE A 1 75  ? 3.200   -8.508  24.465  1.00 41.76  ?  188  PHE A HZ   1 
ATOM   831  N  N    A ARG A 1 76  ? 11.131  -10.716 24.818  0.27 31.76  ?  189  ARG A N    1 
ATOM   832  N  N    B ARG A 1 76  ? 11.140  -10.696 24.815  0.73 31.77  ?  189  ARG A N    1 
ATOM   833  C  CA   A ARG A 1 76  ? 12.592  -10.651 24.852  0.27 32.36  ?  189  ARG A CA   1 
ATOM   834  C  CA   B ARG A 1 76  ? 12.601  -10.635 24.860  0.73 31.16  ?  189  ARG A CA   1 
ATOM   835  C  C    A ARG A 1 76  ? 13.146  -10.736 23.438  0.27 31.00  ?  189  ARG A C    1 
ATOM   836  C  C    B ARG A 1 76  ? 13.155  -10.737 23.449  0.73 31.19  ?  189  ARG A C    1 
ATOM   837  O  O    A ARG A 1 76  ? 12.751  -11.618 22.677  0.27 31.51  ?  189  ARG A O    1 
ATOM   838  O  O    B ARG A 1 76  ? 12.754  -11.623 22.695  0.73 31.60  ?  189  ARG A O    1 
ATOM   839  C  CB   A ARG A 1 76  ? 13.179  -11.784 25.707  0.27 31.09  ?  189  ARG A CB   1 
ATOM   840  C  CB   B ARG A 1 76  ? 13.177  -11.755 25.737  0.73 30.80  ?  189  ARG A CB   1 
ATOM   841  C  CG   A ARG A 1 76  ? 14.697  -11.718 25.850  0.27 31.13  ?  189  ARG A CG   1 
ATOM   842  C  CG   B ARG A 1 76  ? 14.700  -11.741 25.846  0.73 30.96  ?  189  ARG A CG   1 
ATOM   843  C  CD   A ARG A 1 76  ? 15.294  -12.970 26.486  0.27 31.14  ?  189  ARG A CD   1 
ATOM   844  C  CD   B ARG A 1 76  ? 15.211  -12.459 27.097  0.73 30.36  ?  189  ARG A CD   1 
ATOM   845  N  NE   A ARG A 1 76  ? 14.892  -13.159 27.879  0.27 32.11  ?  189  ARG A NE   1 
ATOM   846  N  NE   B ARG A 1 76  ? 14.965  -13.902 27.058  0.73 32.80  ?  189  ARG A NE   1 
ATOM   847  C  CZ   A ARG A 1 76  ? 14.269  -14.238 28.346  0.27 33.41  ?  189  ARG A CZ   1 
ATOM   848  C  CZ   B ARG A 1 76  ? 14.310  -14.587 27.987  0.73 33.18  ?  189  ARG A CZ   1 
ATOM   849  N  NH1  A ARG A 1 76  ? 13.972  -15.250 27.540  0.27 33.26  ?  189  ARG A NH1  1 
ATOM   850  N  NH1  B ARG A 1 76  ? 14.149  -15.897 27.847  0.73 33.21  ?  189  ARG A NH1  1 
ATOM   851  N  NH2  A ARG A 1 76  ? 13.949  -14.308 29.631  0.27 34.64  ?  189  ARG A NH2  1 
ATOM   852  N  NH2  B ARG A 1 76  ? 13.826  -13.979 29.062  0.73 34.85  ?  189  ARG A NH2  1 
ATOM   853  H  H    A ARG A 1 76  ? 10.815  -11.263 24.234  0.27 38.10  ?  189  ARG A H    1 
ATOM   854  H  H    B ARG A 1 76  ? 10.830  -11.231 24.217  0.73 38.11  ?  189  ARG A H    1 
ATOM   855  H  HA   A ARG A 1 76  ? 12.858  -9.799  25.231  0.27 38.82  ?  189  ARG A HA   1 
ATOM   856  H  HA   B ARG A 1 76  ? 12.875  -9.782  25.231  0.73 37.38  ?  189  ARG A HA   1 
ATOM   857  H  HB2  A ARG A 1 76  ? 12.795  -11.735 26.596  0.27 37.29  ?  189  ARG A HB2  1 
ATOM   858  H  HB2  B ARG A 1 76  ? 12.816  -11.665 26.632  0.73 36.94  ?  189  ARG A HB2  1 
ATOM   859  H  HB3  A ARG A 1 76  ? 12.957  -12.633 25.295  0.27 37.29  ?  189  ARG A HB3  1 
ATOM   860  H  HB3  B ARG A 1 76  ? 12.917  -12.610 25.359  0.73 36.94  ?  189  ARG A HB3  1 
ATOM   861  H  HG2  A ARG A 1 76  ? 15.092  -11.614 24.970  0.27 37.34  ?  189  ARG A HG2  1 
ATOM   862  H  HG2  B ARG A 1 76  ? 15.078  -12.185 25.071  0.73 37.14  ?  189  ARG A HG2  1 
ATOM   863  H  HG3  A ARG A 1 76  ? 14.928  -10.961 26.410  0.27 37.34  ?  189  ARG A HG3  1 
ATOM   864  H  HG3  B ARG A 1 76  ? 15.006  -10.821 25.883  0.73 37.14  ?  189  ARG A HG3  1 
ATOM   865  H  HD2  A ARG A 1 76  ? 15.003  -13.748 25.985  0.27 37.36  ?  189  ARG A HD2  1 
ATOM   866  H  HD2  B ARG A 1 76  ? 16.168  -12.320 27.174  0.73 36.41  ?  189  ARG A HD2  1 
ATOM   867  H  HD3  A ARG A 1 76  ? 16.262  -12.904 26.462  0.27 37.36  ?  189  ARG A HD3  1 
ATOM   868  H  HD3  B ARG A 1 76  ? 14.760  -12.098 27.876  0.73 36.41  ?  189  ARG A HD3  1 
ATOM   869  H  HE   A ARG A 1 76  ? 15.071  -12.528 28.435  0.27 38.51  ?  189  ARG A HE   1 
ATOM   870  H  HE   B ARG A 1 76  ? 15.267  -14.339 26.382  0.73 39.35  ?  189  ARG A HE   1 
ATOM   871  H  HH11 A ARG A 1 76  ? 14.183  -15.212 26.707  0.27 39.89  ?  189  ARG A HH11 1 
ATOM   872  H  HH11 B ARG A 1 76  ? 14.469  -16.299 27.157  0.73 39.83  ?  189  ARG A HH11 1 
ATOM   873  H  HH12 A ARG A 1 76  ? 13.570  -15.943 27.851  0.27 39.89  ?  189  ARG A HH12 1 
ATOM   874  H  HH12 B ARG A 1 76  ? 13.726  -16.344 28.447  0.73 39.83  ?  189  ARG A HH12 1 
ATOM   875  H  HH21 A ARG A 1 76  ? 14.143  -13.658 30.159  0.27 41.55  ?  189  ARG A HH21 1 
ATOM   876  H  HH21 B ARG A 1 76  ? 13.935  -13.132 29.162  0.73 41.81  ?  189  ARG A HH21 1 
ATOM   877  H  HH22 A ARG A 1 76  ? 13.546  -15.004 29.936  0.27 41.55  ?  189  ARG A HH22 1 
ATOM   878  H  HH22 B ARG A 1 76  ? 13.403  -14.432 29.658  0.73 41.81  ?  189  ARG A HH22 1 
ATOM   879  N  N    . PHE A 1 77  ? 14.079  -9.844  23.097  1.00 30.19  ?  190  PHE A N    1 
ATOM   880  C  CA   . PHE A 1 77  ? 14.658  -9.856  21.757  1.00 31.44  ?  190  PHE A CA   1 
ATOM   881  C  C    . PHE A 1 77  ? 15.083  -11.275 21.388  1.00 29.66  ?  190  PHE A C    1 
ATOM   882  O  O    . PHE A 1 77  ? 15.569  -12.030 22.229  1.00 27.74  ?  190  PHE A O    1 
ATOM   883  C  CB   . PHE A 1 77  ? 15.869  -8.921  21.682  1.00 31.60  ?  190  PHE A CB   1 
ATOM   884  C  CG   . PHE A 1 77  ? 15.515  -7.474  21.511  1.00 29.44  ?  190  PHE A CG   1 
ATOM   885  C  CD1  . PHE A 1 77  ? 14.616  -7.073  20.533  1.00 31.77  ?  190  PHE A CD1  1 
ATOM   886  C  CD2  . PHE A 1 77  ? 16.076  -6.513  22.325  1.00 35.42  ?  190  PHE A CD2  1 
ATOM   887  C  CE1  . PHE A 1 77  ? 14.293  -5.741  20.375  1.00 33.76  ?  190  PHE A CE1  1 
ATOM   888  C  CE2  . PHE A 1 77  ? 15.754  -5.178  22.171  1.00 34.34  ?  190  PHE A CE2  1 
ATOM   889  C  CZ   . PHE A 1 77  ? 14.860  -4.797  21.196  1.00 34.80  ?  190  PHE A CZ   1 
ATOM   890  H  H    A PHE A 1 77  ? 14.388  -9.232  23.616  0.27 36.22  ?  190  PHE A H    1 
ATOM   891  H  H    B PHE A 1 77  ? 14.385  -9.227  23.611  0.73 36.22  ?  190  PHE A H    1 
ATOM   892  H  HA   . PHE A 1 77  ? 13.998  -9.541  21.120  1.00 37.72  ?  190  PHE A HA   1 
ATOM   893  H  HB2  . PHE A 1 77  ? 16.377  -9.004  22.504  1.00 37.90  ?  190  PHE A HB2  1 
ATOM   894  H  HB3  . PHE A 1 77  ? 16.417  -9.182  20.926  1.00 37.90  ?  190  PHE A HB3  1 
ATOM   895  H  HD1  . PHE A 1 77  ? 14.226  -7.710  19.979  1.00 38.10  ?  190  PHE A HD1  1 
ATOM   896  H  HD2  . PHE A 1 77  ? 16.679  -6.767  22.986  1.00 42.49  ?  190  PHE A HD2  1 
ATOM   897  H  HE1  . PHE A 1 77  ? 13.693  -5.483  19.714  1.00 40.50  ?  190  PHE A HE1  1 
ATOM   898  H  HE2  . PHE A 1 77  ? 16.140  -4.539  22.726  1.00 41.19  ?  190  PHE A HE2  1 
ATOM   899  H  HZ   . PHE A 1 77  ? 14.640  -3.899  21.093  1.00 41.75  ?  190  PHE A HZ   1 
ATOM   900  N  N    . ASP A 1 78  ? 14.907  -11.638 20.117  1.00 30.50  ?  191  ASP A N    1 
ATOM   901  C  CA   . ASP A 1 78  ? 15.348  -12.920 19.593  1.00 28.61  ?  191  ASP A CA   1 
ATOM   902  C  C    . ASP A 1 78  ? 16.173  -12.693 18.326  1.00 29.45  ?  191  ASP A C    1 
ATOM   903  O  O    . ASP A 1 78  ? 15.751  -13.029 17.220  1.00 26.43  ?  191  ASP A O    1 
ATOM   904  C  CB   . ASP A 1 78  ? 14.140  -13.830 19.323  1.00 31.70  ?  191  ASP A CB   1 
ATOM   905  C  CG   . ASP A 1 78  ? 14.554  -15.240 18.932  1.00 33.79  ?  191  ASP A CG   1 
ATOM   906  O  OD1  . ASP A 1 78  ? 15.675  -15.658 19.306  1.00 29.68  ?  191  ASP A OD1  1 
ATOM   907  O  OD2  . ASP A 1 78  ? 13.765  -15.912 18.237  1.00 35.40  ?  191  ASP A OD2  1 
ATOM   908  H  H    . ASP A 1 78  ? 14.524  -11.140 19.529  1.00 36.58  ?  191  ASP A H    1 
ATOM   909  H  HA   . ASP A 1 78  ? 15.927  -13.343 20.246  1.00 34.32  ?  191  ASP A HA   1 
ATOM   910  H  HB2  . ASP A 1 78  ? 13.599  -13.886 20.126  1.00 38.03  ?  191  ASP A HB2  1 
ATOM   911  H  HB3  . ASP A 1 78  ? 13.618  -13.457 18.596  1.00 38.03  ?  191  ASP A HB3  1 
ATOM   912  N  N    . TYR A 1 79  ? 17.355  -12.100 18.494  1.00 30.52  ?  192  TYR A N    1 
ATOM   913  C  CA   . TYR A 1 79  ? 18.265  -11.923 17.367  1.00 28.48  ?  192  TYR A CA   1 
ATOM   914  C  C    . TYR A 1 79  ? 18.659  -13.287 16.813  1.00 27.97  ?  192  TYR A C    1 
ATOM   915  O  O    . TYR A 1 79  ? 19.092  -14.168 17.561  1.00 30.17  ?  192  TYR A O    1 
ATOM   916  C  CB   . TYR A 1 79  ? 19.520  -11.160 17.799  1.00 29.11  ?  192  TYR A CB   1 
ATOM   917  C  CG   . TYR A 1 79  ? 19.317  -9.693  18.122  1.00 28.75  ?  192  TYR A CG   1 
ATOM   918  C  CD1  . TYR A 1 79  ? 19.474  -8.720  17.145  1.00 30.28  ?  192  TYR A CD1  1 
ATOM   919  C  CD2  . TYR A 1 79  ? 19.004  -9.280  19.410  1.00 28.76  ?  192  TYR A CD2  1 
ATOM   920  C  CE1  . TYR A 1 79  ? 19.307  -7.374  17.436  1.00 27.60  ?  192  TYR A CE1  1 
ATOM   921  C  CE2  . TYR A 1 79  ? 18.842  -7.941  19.714  1.00 29.28  ?  192  TYR A CE2  1 
ATOM   922  C  CZ   . TYR A 1 79  ? 18.993  -6.991  18.720  1.00 30.25  ?  192  TYR A CZ   1 
ATOM   923  O  OH   . TYR A 1 79  ? 18.835  -5.659  19.011  1.00 31.13  ?  192  TYR A OH   1 
ATOM   924  H  H    . TYR A 1 79  ? 17.651  -11.795 19.241  1.00 36.61  ?  192  TYR A H    1 
ATOM   925  H  HA   . TYR A 1 79  ? 17.823  -11.405 16.676  1.00 34.16  ?  192  TYR A HA   1 
ATOM   926  H  HB2  . TYR A 1 79  ? 19.874  -11.584 18.596  1.00 34.92  ?  192  TYR A HB2  1 
ATOM   927  H  HB3  . TYR A 1 79  ? 20.169  -11.210 17.080  1.00 34.92  ?  192  TYR A HB3  1 
ATOM   928  H  HD1  . TYR A 1 79  ? 19.695  -8.976  16.278  1.00 36.32  ?  192  TYR A HD1  1 
ATOM   929  H  HD2  . TYR A 1 79  ? 18.902  -9.916  20.081  1.00 34.49  ?  192  TYR A HD2  1 
ATOM   930  H  HE1  . TYR A 1 79  ? 19.407  -6.735  16.768  1.00 33.10  ?  192  TYR A HE1  1 
ATOM   931  H  HE2  . TYR A 1 79  ? 18.632  -7.680  20.582  1.00 35.12  ?  192  TYR A HE2  1 
ATOM   932  H  HH   . TYR A 1 79  ? 18.934  -5.199  18.315  1.00 37.35  ?  192  TYR A HH   1 
ATOM   933  N  N    . SER A 1 80  ? 18.517  -13.463 15.507  1.00 26.31  ?  193  SER A N    1 
ATOM   934  C  CA   . SER A 1 80  ? 18.876  -14.732 14.900  1.00 29.31  ?  193  SER A CA   1 
ATOM   935  C  C    . SER A 1 80  ? 20.383  -14.822 14.687  1.00 28.03  ?  193  SER A C    1 
ATOM   936  O  O    . SER A 1 80  ? 21.078  -13.806 14.648  1.00 25.90  ?  193  SER A O    1 
ATOM   937  C  CB   . SER A 1 80  ? 18.158  -14.913 13.569  1.00 30.75  ?  193  SER A CB   1 
ATOM   938  O  OG   . SER A 1 80  ? 18.783  -14.143 12.560  1.00 30.21  ?  193  SER A OG   1 
ATOM   939  H  H    . SER A 1 80  ? 18.218  -12.871 14.959  1.00 31.56  ?  193  SER A H    1 
ATOM   940  H  HA   . SER A 1 80  ? 18.603  -15.452 15.490  1.00 35.15  ?  193  SER A HA   1 
ATOM   941  H  HB2  . SER A 1 80  ? 18.188  -15.849 13.317  1.00 36.88  ?  193  SER A HB2  1 
ATOM   942  H  HB3  . SER A 1 80  ? 17.237  -14.624 13.663  1.00 36.88  ?  193  SER A HB3  1 
ATOM   943  H  HG   . SER A 1 80  ? 18.383  -14.247 11.829  1.00 36.24  ?  193  SER A HG   1 
ATOM   944  N  N    . PRO A 1 81  ? 20.914  -16.044 14.551  1.00 28.23  ?  194  PRO A N    1 
ATOM   945  C  CA   . PRO A 1 81  ? 22.361  -16.180 14.277  1.00 25.34  ?  194  PRO A CA   1 
ATOM   946  C  C    . PRO A 1 81  ? 22.798  -15.435 13.027  1.00 26.46  ?  194  PRO A C    1 
ATOM   947  O  O    . PRO A 1 81  ? 23.833  -14.745 13.031  1.00 26.81  ?  194  PRO A O    1 
ATOM   948  C  CB   . PRO A 1 81  ? 22.549  -17.708 14.139  1.00 28.02  ?  194  PRO A CB   1 
ATOM   949  C  CG   . PRO A 1 81  ? 21.378  -18.309 14.898  1.00 31.66  ?  194  PRO A CG   1 
ATOM   950  C  CD   . PRO A 1 81  ? 20.238  -17.345 14.733  1.00 27.54  ?  194  PRO A CD   1 
ATOM   951  H  HA   . PRO A 1 81  ? 22.871  -15.863 15.039  1.00 30.39  ?  194  PRO A HA   1 
ATOM   952  H  HB2  . PRO A 1 81  ? 22.525  -17.962 13.203  1.00 33.61  ?  194  PRO A HB2  1 
ATOM   953  H  HB3  . PRO A 1 81  ? 23.394  -17.976 14.533  1.00 33.61  ?  194  PRO A HB3  1 
ATOM   954  H  HG2  . PRO A 1 81  ? 21.153  -19.173 14.520  1.00 37.98  ?  194  PRO A HG2  1 
ATOM   955  H  HG3  . PRO A 1 81  ? 21.612  -18.406 15.834  1.00 37.98  ?  194  PRO A HG3  1 
ATOM   956  H  HD2  . PRO A 1 81  ? 19.707  -17.569 13.953  1.00 33.03  ?  194  PRO A HD2  1 
ATOM   957  H  HD3  . PRO A 1 81  ? 19.678  -17.335 15.524  1.00 33.03  ?  194  PRO A HD3  1 
ATOM   958  N  N    . GLU A 1 82  ? 22.032  -15.562 11.942  1.00 27.46  ?  195  GLU A N    1 
ATOM   959  C  CA   . GLU A 1 82  ? 22.363  -14.845 10.715  1.00 28.13  ?  195  GLU A CA   1 
ATOM   960  C  C    . GLU A 1 82  ? 22.309  -13.335 10.942  1.00 29.64  ?  195  GLU A C    1 
ATOM   961  O  O    . GLU A 1 82  ? 23.140  -12.582 10.414  1.00 27.03  ?  195  GLU A O    1 
ATOM   962  C  CB   . GLU A 1 82  ? 21.394  -15.242 9.597   1.00 34.11  ?  195  GLU A CB   1 
ATOM   963  C  CG   . GLU A 1 82  ? 20.942  -16.696 9.599   1.00 46.89  ?  195  GLU A CG   1 
ATOM   964  C  CD   . GLU A 1 82  ? 19.685  -16.932 10.438  1.00 47.25  ?  195  GLU A CD   1 
ATOM   965  O  OE1  . GLU A 1 82  ? 18.568  -16.563 9.991   1.00 49.66  ?  195  GLU A OE1  1 
ATOM   966  O  OE2  . GLU A 1 82  ? 19.824  -17.478 11.550  1.00 47.03  ?  195  GLU A OE2  1 
ATOM   967  H  H    . GLU A 1 82  ? 21.325  -16.049 11.890  1.00 32.94  ?  195  GLU A H    1 
ATOM   968  H  HA   . GLU A 1 82  ? 23.261  -15.088 10.439  1.00 33.74  ?  195  GLU A HA   1 
ATOM   969  H  HB2  . GLU A 1 82  ? 20.598  -14.693 9.675   1.00 40.91  ?  195  GLU A HB2  1 
ATOM   970  H  HB3  . GLU A 1 82  ? 21.827  -15.077 8.745   1.00 40.91  ?  195  GLU A HB3  1 
ATOM   971  H  HG2  . GLU A 1 82  ? 20.748  -16.967 8.688   1.00 56.25  ?  195  GLU A HG2  1 
ATOM   972  H  HG3  . GLU A 1 82  ? 21.652  -17.246 9.965   1.00 56.25  ?  195  GLU A HG3  1 
ATOM   973  N  N    . PHE A 1 83  ? 21.318  -12.871 11.721  1.00 27.20  ?  196  PHE A N    1 
ATOM   974  C  CA   . PHE A 1 83  ? 21.234  -11.446 12.021  1.00 27.58  ?  196  PHE A CA   1 
ATOM   975  C  C    . PHE A 1 83  ? 22.466  -10.981 12.783  1.00 27.43  ?  196  PHE A C    1 
ATOM   976  O  O    . PHE A 1 83  ? 22.985  -9.890  12.520  1.00 28.95  ?  196  PHE A O    1 
ATOM   977  C  CB   . PHE A 1 83  ? 19.981  -11.138 12.825  1.00 26.52  ?  196  PHE A CB   1 
ATOM   978  C  CG   . PHE A 1 83  ? 19.698  -9.673  12.980  1.00 26.00  ?  196  PHE A CG   1 
ATOM   979  C  CD1  . PHE A 1 83  ? 20.470  -8.881  13.819  1.00 28.61  ?  196  PHE A CD1  1 
ATOM   980  C  CD2  . PHE A 1 83  ? 18.643  -9.081  12.305  1.00 30.49  ?  196  PHE A CD2  1 
ATOM   981  C  CE1  . PHE A 1 83  ? 20.209  -7.528  13.971  1.00 28.73  ?  196  PHE A CE1  1 
ATOM   982  C  CE2  . PHE A 1 83  ? 18.367  -7.728  12.456  1.00 28.80  ?  196  PHE A CE2  1 
ATOM   983  C  CZ   . PHE A 1 83  ? 19.155  -6.954  13.290  1.00 30.92  ?  196  PHE A CZ   1 
ATOM   984  H  H    . PHE A 1 83  ? 20.699  -13.350 12.076  1.00 32.62  ?  196  PHE A H    1 
ATOM   985  H  HA   . PHE A 1 83  ? 21.178  -10.959 11.184  1.00 33.09  ?  196  PHE A HA   1 
ATOM   986  H  HB2  . PHE A 1 83  ? 19.219  -11.540 12.379  1.00 31.81  ?  196  PHE A HB2  1 
ATOM   987  H  HB3  . PHE A 1 83  ? 20.082  -11.514 13.714  1.00 31.81  ?  196  PHE A HB3  1 
ATOM   988  H  HD1  . PHE A 1 83  ? 21.176  -9.266  14.288  1.00 34.32  ?  196  PHE A HD1  1 
ATOM   989  H  HD2  . PHE A 1 83  ? 18.111  -9.597  11.743  1.00 36.58  ?  196  PHE A HD2  1 
ATOM   990  H  HE1  . PHE A 1 83  ? 20.741  -7.009  14.530  1.00 34.46  ?  196  PHE A HE1  1 
ATOM   991  H  HE2  . PHE A 1 83  ? 17.655  -7.344  11.998  1.00 34.55  ?  196  PHE A HE2  1 
ATOM   992  H  HZ   . PHE A 1 83  ? 18.974  -6.048  13.392  1.00 37.09  ?  196  PHE A HZ   1 
ATOM   993  N  N    . LEU A 1 84  ? 22.921  -11.776 13.759  1.00 24.58  ?  197  LEU A N    1 
ATOM   994  C  CA   . LEU A 1 84  ? 24.102  -11.404 14.512  1.00 26.38  ?  197  LEU A CA   1 
ATOM   995  C  C    . LEU A 1 84  ? 25.312  -11.314 13.593  1.00 27.73  ?  197  LEU A C    1 
ATOM   996  O  O    . LEU A 1 84  ? 26.140  -10.408 13.736  1.00 28.62  ?  197  LEU A O    1 
ATOM   997  C  CB   . LEU A 1 84  ? 24.353  -12.388 15.641  1.00 24.79  ?  197  LEU A CB   1 
ATOM   998  C  CG   . LEU A 1 84  ? 23.319  -12.360 16.763  1.00 28.18  ?  197  LEU A CG   1 
ATOM   999  C  CD1  . LEU A 1 84  ? 23.610  -13.460 17.778  1.00 28.62  ?  197  LEU A CD1  1 
ATOM   1000 C  CD2  . LEU A 1 84  ? 23.289  -11.002 17.451  1.00 27.27  ?  197  LEU A CD2  1 
ATOM   1001 H  H    . LEU A 1 84  ? 22.565  -12.522 13.997  1.00 29.48  ?  197  LEU A H    1 
ATOM   1002 H  HA   . LEU A 1 84  ? 23.956  -10.535 14.917  1.00 31.64  ?  197  LEU A HA   1 
ATOM   1003 H  HB2  . LEU A 1 84  ? 24.357  -13.284 15.270  1.00 29.73  ?  197  LEU A HB2  1 
ATOM   1004 H  HB3  . LEU A 1 84  ? 25.217  -12.188 16.035  1.00 29.73  ?  197  LEU A HB3  1 
ATOM   1005 H  HG   . LEU A 1 84  ? 22.442  -12.515 16.379  1.00 33.80  ?  197  LEU A HG   1 
ATOM   1006 H  HD11 . LEU A 1 84  ? 22.918  -13.453 18.459  1.00 34.33  ?  197  LEU A HD11 1 
ATOM   1007 H  HD12 . LEU A 1 84  ? 23.616  -14.316 17.322  1.00 34.33  ?  197  LEU A HD12 1 
ATOM   1008 H  HD13 . LEU A 1 84  ? 24.475  -13.295 18.184  1.00 34.33  ?  197  LEU A HD13 1 
ATOM   1009 H  HD21 . LEU A 1 84  ? 22.773  -11.074 18.269  1.00 32.71  ?  197  LEU A HD21 1 
ATOM   1010 H  HD22 . LEU A 1 84  ? 24.198  -10.732 17.655  1.00 32.71  ?  197  LEU A HD22 1 
ATOM   1011 H  HD23 . LEU A 1 84  ? 22.878  -10.356 16.856  1.00 32.71  ?  197  LEU A HD23 1 
ATOM   1012 N  N    . LEU A 1 85  ? 25.423  -12.232 12.630  1.00 27.33  ?  198  LEU A N    1 
ATOM   1013 C  CA   . LEU A 1 85  ? 26.518  -12.141 11.665  1.00 29.20  ?  198  LEU A CA   1 
ATOM   1014 C  C    . LEU A 1 85  ? 26.444  -10.849 10.858  1.00 30.67  ?  198  LEU A C    1 
ATOM   1015 O  O    . LEU A 1 85  ? 27.478  -10.225 10.569  1.00 29.76  ?  198  LEU A O    1 
ATOM   1016 C  CB   . LEU A 1 85  ? 26.504  -13.336 10.716  1.00 28.48  ?  198  LEU A CB   1 
ATOM   1017 C  CG   . LEU A 1 85  ? 27.103  -14.652 11.204  1.00 29.84  ?  198  LEU A CG   1 
ATOM   1018 C  CD1  . LEU A 1 85  ? 27.012  -15.656 10.064  1.00 28.29  ?  198  LEU A CD1  1 
ATOM   1019 C  CD2  . LEU A 1 85  ? 28.541  -14.491 11.677  1.00 29.15  ?  198  LEU A CD2  1 
ATOM   1020 H  H    . LEU A 1 85  ? 24.892  -12.899 12.514  1.00 32.79  ?  198  LEU A H    1 
ATOM   1021 H  HA   . LEU A 1 85  ? 27.351  -12.154 12.161  1.00 35.02  ?  198  LEU A HA   1 
ATOM   1022 H  HB2  . LEU A 1 85  ? 25.579  -13.520 10.489  1.00 34.16  ?  198  LEU A HB2  1 
ATOM   1023 H  HB3  . LEU A 1 85  ? 26.998  -13.085 9.921   1.00 34.16  ?  198  LEU A HB3  1 
ATOM   1024 H  HG   . LEU A 1 85  ? 26.609  -14.972 11.975  1.00 35.79  ?  198  LEU A HG   1 
ATOM   1025 H  HD11 . LEU A 1 85  ? 27.383  -16.502 10.358  1.00 33.93  ?  198  LEU A HD11 1 
ATOM   1026 H  HD12 . LEU A 1 85  ? 26.080  -15.771 9.818   1.00 33.93  ?  198  LEU A HD12 1 
ATOM   1027 H  HD13 . LEU A 1 85  ? 27.515  -15.320 9.306   1.00 33.93  ?  198  LEU A HD13 1 
ATOM   1028 H  HD21 . LEU A 1 85  ? 28.936  -15.370 11.790  1.00 34.96  ?  198  LEU A HD21 1 
ATOM   1029 H  HD22 . LEU A 1 85  ? 29.038  -13.988 11.013  1.00 34.96  ?  198  LEU A HD22 1 
ATOM   1030 H  HD23 . LEU A 1 85  ? 28.544  -14.016 12.523  1.00 34.96  ?  198  LEU A HD23 1 
ATOM   1031 N  N    . TRP A 1 86  ? 25.233  -10.453 10.457  1.00 29.61  ?  199  TRP A N    1 
ATOM   1032 C  CA   . TRP A 1 86  ? 25.066  -9.217  9.696   1.00 27.78  ?  199  TRP A CA   1 
ATOM   1033 C  C    . TRP A 1 86  ? 25.396  -7.982  10.539  1.00 31.82  ?  199  TRP A C    1 
ATOM   1034 O  O    . TRP A 1 86  ? 26.060  -7.039  10.064  1.00 31.36  ?  199  TRP A O    1 
ATOM   1035 C  CB   . TRP A 1 86  ? 23.638  -9.136  9.162   1.00 29.05  ?  199  TRP A CB   1 
ATOM   1036 C  CG   . TRP A 1 86  ? 23.272  -7.858  8.485   1.00 29.32  ?  199  TRP A CG   1 
ATOM   1037 C  CD1  . TRP A 1 86  ? 23.762  -7.385  7.296   1.00 31.45  ?  199  TRP A CD1  1 
ATOM   1038 C  CD2  . TRP A 1 86  ? 22.319  -6.890  8.935   1.00 27.89  ?  199  TRP A CD2  1 
ATOM   1039 N  NE1  . TRP A 1 86  ? 23.175  -6.188  6.984   1.00 29.84  ?  199  TRP A NE1  1 
ATOM   1040 C  CE2  . TRP A 1 86  ? 22.290  -5.857  7.977   1.00 29.17  ?  199  TRP A CE2  1 
ATOM   1041 C  CE3  . TRP A 1 86  ? 21.486  -6.796  10.058  1.00 27.69  ?  199  TRP A CE3  1 
ATOM   1042 C  CZ2  . TRP A 1 86  ? 21.462  -4.746  8.104   1.00 30.06  ?  199  TRP A CZ2  1 
ATOM   1043 C  CZ3  . TRP A 1 86  ? 20.672  -5.699  10.189  1.00 29.00  ?  199  TRP A CZ3  1 
ATOM   1044 C  CH2  . TRP A 1 86  ? 20.659  -4.679  9.221   1.00 32.00  ?  199  TRP A CH2  1 
ATOM   1045 H  H    . TRP A 1 86  ? 24.500  -10.876 10.611  1.00 35.51  ?  199  TRP A H    1 
ATOM   1046 H  HA   . TRP A 1 86  ? 25.678  -9.229  8.943   1.00 33.32  ?  199  TRP A HA   1 
ATOM   1047 H  HB2  . TRP A 1 86  ? 23.513  -9.850  8.517   1.00 34.85  ?  199  TRP A HB2  1 
ATOM   1048 H  HB3  . TRP A 1 86  ? 23.028  -9.252  9.907   1.00 34.85  ?  199  TRP A HB3  1 
ATOM   1049 H  HD1  . TRP A 1 86  ? 24.401  -7.816  6.775   1.00 37.72  ?  199  TRP A HD1  1 
ATOM   1050 H  HE1  . TRP A 1 86  ? 23.336  -5.720  6.280   1.00 35.79  ?  199  TRP A HE1  1 
ATOM   1051 H  HE3  . TRP A 1 86  ? 21.484  -7.466  10.704  1.00 33.21  ?  199  TRP A HE3  1 
ATOM   1052 H  HZ2  . TRP A 1 86  ? 21.450  -4.075  7.460   1.00 36.06  ?  199  TRP A HZ2  1 
ATOM   1053 H  HZ3  . TRP A 1 86  ? 20.118  -5.628  10.933  1.00 34.79  ?  199  TRP A HZ3  1 
ATOM   1054 H  HH2  . TRP A 1 86  ? 20.099  -3.946  9.337   1.00 38.39  ?  199  TRP A HH2  1 
ATOM   1055 N  N    . ALA A 1 87  ? 24.974  -7.972  11.799  1.00 26.97  ?  200  ALA A N    1 
ATOM   1056 C  CA   . ALA A 1 87  ? 25.171  -6.795  12.631  1.00 27.18  ?  200  ALA A CA   1 
ATOM   1057 C  C    . ALA A 1 87  ? 26.599  -6.665  13.132  1.00 28.75  ?  200  ALA A C    1 
ATOM   1058 O  O    . ALA A 1 87  ? 27.063  -5.544  13.372  1.00 24.95  ?  200  ALA A O    1 
ATOM   1059 C  CB   . ALA A 1 87  ? 24.209  -6.826  13.828  1.00 27.27  ?  200  ALA A CB   1 
ATOM   1060 H  H    . ALA A 1 87  ? 24.576  -8.625  12.192  1.00 32.34  ?  200  ALA A H    1 
ATOM   1061 H  HA   . ALA A 1 87  ? 24.971  -6.012  12.094  1.00 32.60  ?  200  ALA A HA   1 
ATOM   1062 H  HB1  . ALA A 1 87  ? 24.354  -6.035  14.370  1.00 32.71  ?  200  ALA A HB1  1 
ATOM   1063 H  HB2  . ALA A 1 87  ? 23.297  -6.839  13.499  1.00 32.71  ?  200  ALA A HB2  1 
ATOM   1064 H  HB3  . ALA A 1 87  ? 24.383  -7.623  14.352  1.00 32.71  ?  200  ALA A HB3  1 
ATOM   1065 N  N    . LEU A 1 88  ? 27.317  -7.777  13.289  1.00 27.34  ?  201  LEU A N    1 
ATOM   1066 C  CA   . LEU A 1 88  ? 28.592  -7.757  13.992  1.00 26.63  ?  201  LEU A CA   1 
ATOM   1067 C  C    . LEU A 1 88  ? 29.764  -7.832  13.057  1.00 27.72  ?  201  LEU A C    1 
ATOM   1068 O  O    . LEU A 1 88  ? 30.922  -7.710  13.504  1.00 26.07  ?  201  LEU A O    1 
ATOM   1069 C  CB   . LEU A 1 88  ? 28.671  -8.926  14.967  1.00 28.74  ?  201  LEU A CB   1 
ATOM   1070 C  CG   . LEU A 1 88  ? 27.782  -8.790  16.204  1.00 29.67  ?  201  LEU A CG   1 
ATOM   1071 C  CD1  . LEU A 1 88  ? 27.691  -10.119 16.946  1.00 30.86  ?  201  LEU A CD1  1 
ATOM   1072 C  CD2  . LEU A 1 88  ? 28.329  -7.694  17.108  1.00 30.49  ?  201  LEU A CD2  1 
ATOM   1073 H  H    . LEU A 1 88  ? 27.084  -8.551  12.996  1.00 32.79  ?  201  LEU A H    1 
ATOM   1074 H  HA   . LEU A 1 88  ? 28.655  -6.934  14.501  1.00 31.94  ?  201  LEU A HA   1 
ATOM   1075 H  HB2  . LEU A 1 88  ? 28.403  -9.733  14.501  1.00 34.47  ?  201  LEU A HB2  1 
ATOM   1076 H  HB3  . LEU A 1 88  ? 29.588  -9.009  15.273  1.00 34.47  ?  201  LEU A HB3  1 
ATOM   1077 H  HG   . LEU A 1 88  ? 26.882  -8.545  15.938  1.00 35.59  ?  201  LEU A HG   1 
ATOM   1078 H  HD11 . LEU A 1 88  ? 27.094  -10.017 17.703  1.00 37.02  ?  201  LEU A HD11 1 
ATOM   1079 H  HD12 . LEU A 1 88  ? 27.347  -10.795 16.341  1.00 37.02  ?  201  LEU A HD12 1 
ATOM   1080 H  HD13 . LEU A 1 88  ? 28.576  -10.370 17.254  1.00 37.02  ?  201  LEU A HD13 1 
ATOM   1081 H  HD21 . LEU A 1 88  ? 27.840  -7.701  17.946  1.00 36.58  ?  201  LEU A HD21 1 
ATOM   1082 H  HD22 . LEU A 1 88  ? 29.270  -7.861  17.274  1.00 36.58  ?  201  LEU A HD22 1 
ATOM   1083 H  HD23 . LEU A 1 88  ? 28.218  -6.837  16.668  1.00 36.58  ?  201  LEU A HD23 1 
ATOM   1084 N  N    . ARG A 1 89  ? 29.546  -8.035  11.752  1.00 28.34  ?  202  ARG A N    1 
ATOM   1085 C  CA   . ARG A 1 89  ? 30.671  -8.091  10.803  1.00 25.64  ?  202  ARG A CA   1 
ATOM   1086 C  C    . ARG A 1 89  ? 30.415  -7.231  9.553   1.00 30.41  ?  202  ARG A C    1 
ATOM   1087 O  O    . ARG A 1 89  ? 30.493  -7.731  8.403   1.00 29.64  ?  202  ARG A O    1 
ATOM   1088 C  CB   . ARG A 1 89  ? 30.900  -9.554  10.389  1.00 28.13  ?  202  ARG A CB   1 
ATOM   1089 C  CG   . ARG A 1 89  ? 31.324  -10.460 11.589  1.00 27.18  ?  202  ARG A CG   1 
ATOM   1090 C  CD   . ARG A 1 89  ? 31.799  -11.870 11.201  1.00 28.17  ?  202  ARG A CD   1 
ATOM   1091 N  NE   . ARG A 1 89  ? 32.695  -12.569 12.160  1.00 31.04  ?  202  ARG A NE   1 
ATOM   1092 C  CZ   . ARG A 1 89  ? 33.239  -13.756 11.916  1.00 31.84  ?  202  ARG A CZ   1 
ATOM   1093 N  NH1  . ARG A 1 89  ? 32.966  -14.354 10.773  1.00 33.63  ?  202  ARG A NH1  1 
ATOM   1094 N  NH2  . ARG A 1 89  ? 34.062  -14.323 12.806  1.00 33.38  ?  202  ARG A NH2  1 
ATOM   1095 H  H    . ARG A 1 89  ? 28.769  -8.141  11.398  1.00 33.99  ?  202  ARG A H    1 
ATOM   1096 H  HA   . ARG A 1 89  ? 31.456  -7.725  11.241  1.00 30.75  ?  202  ARG A HA   1 
ATOM   1097 H  HB2  . ARG A 1 89  ? 30.076  -9.910  10.019  1.00 33.74  ?  202  ARG A HB2  1 
ATOM   1098 H  HB3  . ARG A 1 89  ? 31.604  -9.587  9.723   1.00 33.74  ?  202  ARG A HB3  1 
ATOM   1099 H  HG2  . ARG A 1 89  ? 32.054  -10.028 12.059  1.00 32.60  ?  202  ARG A HG2  1 
ATOM   1100 H  HG3  . ARG A 1 89  ? 30.563  -10.564 12.181  1.00 32.60  ?  202  ARG A HG3  1 
ATOM   1101 H  HD2  . ARG A 1 89  ? 31.015  -12.430 11.089  1.00 33.79  ?  202  ARG A HD2  1 
ATOM   1102 H  HD3  . ARG A 1 89  ? 32.282  -11.804 10.362  1.00 33.79  ?  202  ARG A HD3  1 
ATOM   1103 H  HE   . ARG A 1 89  ? 32.869  -12.185 12.910  1.00 37.23  ?  202  ARG A HE   1 
ATOM   1104 H  HH11 . ARG A 1 89  ? 32.445  -13.975 10.203  1.00 40.34  ?  202  ARG A HH11 1 
ATOM   1105 H  HH12 . ARG A 1 89  ? 33.309  -15.123 10.597  1.00 40.34  ?  202  ARG A HH12 1 
ATOM   1106 H  HH21 . ARG A 1 89  ? 34.242  -13.919 13.543  1.00 40.03  ?  202  ARG A HH21 1 
ATOM   1107 H  HH22 . ARG A 1 89  ? 34.410  -15.092 12.641  1.00 40.03  ?  202  ARG A HH22 1 
ATOM   1108 N  N    . PRO A 1 90  ? 30.278  -5.916  9.740   1.00 31.44  ?  203  PRO A N    1 
ATOM   1109 C  CA   . PRO A 1 90  ? 30.384  -5.000  8.598   1.00 30.67  ?  203  PRO A CA   1 
ATOM   1110 C  C    . PRO A 1 90  ? 31.840  -4.812  8.157   1.00 30.88  ?  203  PRO A C    1 
ATOM   1111 O  O    . PRO A 1 90  ? 32.747  -5.259  8.872   1.00 30.65  ?  203  PRO A O    1 
ATOM   1112 C  CB   . PRO A 1 90  ? 29.818  -3.678  9.157   1.00 32.65  ?  203  PRO A CB   1 
ATOM   1113 C  CG   . PRO A 1 90  ? 30.307  -3.734  10.579  1.00 31.14  ?  203  PRO A CG   1 
ATOM   1114 C  CD   . PRO A 1 90  ? 30.164  -5.194  11.002  1.00 30.13  ?  203  PRO A CD   1 
ATOM   1115 H  HA   . PRO A 1 90  ? 29.850  -5.319  7.854   1.00 36.79  ?  203  PRO A HA   1 
ATOM   1116 H  HB2  . PRO A 1 90  ? 30.182  -2.916  8.679   1.00 39.17  ?  203  PRO A HB2  1 
ATOM   1117 H  HB3  . PRO A 1 90  ? 28.849  -3.668  9.107   1.00 39.17  ?  203  PRO A HB3  1 
ATOM   1118 H  HG2  . PRO A 1 90  ? 31.234  -3.453  10.619  1.00 37.35  ?  203  PRO A HG2  1 
ATOM   1119 H  HG3  . PRO A 1 90  ? 29.761  -3.159  11.137  1.00 37.35  ?  203  PRO A HG3  1 
ATOM   1120 H  HD2  . PRO A 1 90  ? 30.873  -5.448  11.612  1.00 36.14  ?  203  PRO A HD2  1 
ATOM   1121 H  HD3  . PRO A 1 90  ? 29.300  -5.351  11.414  1.00 36.14  ?  203  PRO A HD3  1 
ATOM   1122 N  N    . PRO A 1 91  ? 32.059  -4.149  7.033   1.00 33.33  ?  204  PRO A N    1 
ATOM   1123 C  CA   . PRO A 1 91  ? 33.446  -3.966  6.582   1.00 32.70  ?  204  PRO A CA   1 
ATOM   1124 C  C    . PRO A 1 91  ? 34.334  -3.397  7.682   1.00 33.67  ?  204  PRO A C    1 
ATOM   1125 O  O    . PRO A 1 91  ? 33.959  -2.463  8.383   1.00 33.74  ?  204  PRO A O    1 
ATOM   1126 C  CB   . PRO A 1 91  ? 33.287  -2.997  5.416   1.00 35.79  ?  204  PRO A CB   1 
ATOM   1127 C  CG   . PRO A 1 91  ? 31.858  -3.208  4.944   1.00 33.52  ?  204  PRO A CG   1 
ATOM   1128 C  CD   . PRO A 1 91  ? 31.067  -3.534  6.164   1.00 32.33  ?  204  PRO A CD   1 
ATOM   1129 H  HA   . PRO A 1 91  ? 33.826  -4.803  6.273   1.00 39.23  ?  204  PRO A HA   1 
ATOM   1130 H  HB2  . PRO A 1 91  ? 33.424  -2.086  5.719   1.00 42.93  ?  204  PRO A HB2  1 
ATOM   1131 H  HB3  . PRO A 1 91  ? 33.922  -3.212  4.715   1.00 42.93  ?  204  PRO A HB3  1 
ATOM   1132 H  HG2  . PRO A 1 91  ? 31.528  -2.396  4.527   1.00 40.21  ?  204  PRO A HG2  1 
ATOM   1133 H  HG3  . PRO A 1 91  ? 31.829  -3.942  4.310   1.00 40.21  ?  204  PRO A HG3  1 
ATOM   1134 H  HD2  . PRO A 1 91  ? 30.703  -2.730  6.567   1.00 38.78  ?  204  PRO A HD2  1 
ATOM   1135 H  HD3  . PRO A 1 91  ? 30.352  -4.155  5.959   1.00 38.78  ?  204  PRO A HD3  1 
ATOM   1136 N  N    . GLY A 1 92  ? 35.510  -3.988  7.851   1.00 31.33  ?  205  GLY A N    1 
ATOM   1137 C  CA   . GLY A 1 92  ? 36.447  -3.547  8.860   1.00 30.74  ?  205  GLY A CA   1 
ATOM   1138 C  C    . GLY A 1 92  ? 36.236  -4.128  10.239  1.00 30.02  ?  205  GLY A C    1 
ATOM   1139 O  O    . GLY A 1 92  ? 36.943  -3.730  11.173  1.00 28.86  ?  205  GLY A O    1 
ATOM   1140 H  H    . GLY A 1 92  ? 35.787  -4.656  7.385   1.00 37.58  ?  205  GLY A H    1 
ATOM   1141 H  HA2  . GLY A 1 92  ? 37.343  -3.786  8.575   1.00 36.87  ?  205  GLY A HA2  1 
ATOM   1142 H  HA3  . GLY A 1 92  ? 36.386  -2.582  8.936   1.00 36.87  ?  205  GLY A HA3  1 
ATOM   1143 N  N    . TRP A 1 93  ? 35.283  -5.046  10.403  1.00 31.60  ?  206  TRP A N    1 
ATOM   1144 C  CA   . TRP A 1 93  ? 35.071  -5.696  11.693  1.00 28.66  ?  206  TRP A CA   1 
ATOM   1145 C  C    . TRP A 1 93  ? 36.351  -6.395  12.146  1.00 28.67  ?  206  TRP A C    1 
ATOM   1146 O  O    . TRP A 1 93  ? 37.170  -6.829  11.328  1.00 29.32  ?  206  TRP A O    1 
ATOM   1147 C  CB   . TRP A 1 93  ? 33.927  -6.697  11.597  1.00 28.22  ?  206  TRP A CB   1 
ATOM   1148 C  CG   . TRP A 1 93  ? 34.249  -7.932  10.820  1.00 28.38  ?  206  TRP A CG   1 
ATOM   1149 C  CD1  . TRP A 1 93  ? 34.131  -8.106  9.469   1.00 30.27  ?  206  TRP A CD1  1 
ATOM   1150 C  CD2  . TRP A 1 93  ? 34.752  -9.167  11.340  1.00 28.25  ?  206  TRP A CD2  1 
ATOM   1151 N  NE1  . TRP A 1 93  ? 34.540  -9.368  9.117   1.00 27.83  ?  206  TRP A NE1  1 
ATOM   1152 C  CE2  . TRP A 1 93  ? 34.930  -10.041 10.243  1.00 29.24  ?  206  TRP A CE2  1 
ATOM   1153 C  CE3  . TRP A 1 93  ? 35.080  -9.615  12.621  1.00 29.24  ?  206  TRP A CE3  1 
ATOM   1154 C  CZ2  . TRP A 1 93  ? 35.409  -11.350 10.394  1.00 31.53  ?  206  TRP A CZ2  1 
ATOM   1155 C  CZ3  . TRP A 1 93  ? 35.576  -10.925 12.767  1.00 31.91  ?  206  TRP A CZ3  1 
ATOM   1156 C  CH2  . TRP A 1 93  ? 35.737  -11.763 11.652  1.00 30.37  ?  206  TRP A CH2  1 
ATOM   1157 H  H    . TRP A 1 93  ? 34.747  -5.310  9.785   1.00 37.91  ?  206  TRP A H    1 
ATOM   1158 H  HA   . TRP A 1 93  ? 34.832  -5.034  12.361  1.00 34.37  ?  206  TRP A HA   1 
ATOM   1159 H  HB2  . TRP A 1 93  ? 33.680  -6.972  12.494  1.00 33.85  ?  206  TRP A HB2  1 
ATOM   1160 H  HB3  . TRP A 1 93  ? 33.175  -6.266  11.163  1.00 33.85  ?  206  TRP A HB3  1 
ATOM   1161 H  HD1  . TRP A 1 93  ? 33.818  -7.462  8.875   1.00 36.30  ?  206  TRP A HD1  1 
ATOM   1162 H  HE1  . TRP A 1 93  ? 34.549  -9.684  8.317   1.00 33.39  ?  206  TRP A HE1  1 
ATOM   1163 H  HE3  . TRP A 1 93  ? 34.973  -9.061  13.361  1.00 35.08  ?  206  TRP A HE3  1 
ATOM   1164 H  HZ2  . TRP A 1 93  ? 35.499  -11.917 9.662   1.00 37.82  ?  206  TRP A HZ2  1 
ATOM   1165 H  HZ3  . TRP A 1 93  ? 35.800  -11.239 13.613  1.00 38.27  ?  206  TRP A HZ3  1 
ATOM   1166 H  HH2  . TRP A 1 93  ? 36.076  -12.620 11.774  1.00 36.43  ?  206  TRP A HH2  1 
ATOM   1167 N  N    . LEU A 1 94  ? 36.523  -6.497  13.463  1.00 25.80  ?  207  LEU A N    1 
ATOM   1168 C  CA   . LEU A 1 94  ? 37.701  -7.122  14.043  1.00 27.88  ?  207  LEU A CA   1 
ATOM   1169 C  C    . LEU A 1 94  ? 37.294  -8.214  15.021  1.00 28.18  ?  207  LEU A C    1 
ATOM   1170 O  O    . LEU A 1 94  ? 36.426  -8.006  15.868  1.00 28.06  ?  207  LEU A O    1 
ATOM   1171 C  CB   . LEU A 1 94  ? 38.587  -6.097  14.759  1.00 27.66  ?  207  LEU A CB   1 
ATOM   1172 C  CG   . LEU A 1 94  ? 39.143  -4.948  13.917  1.00 30.21  ?  207  LEU A CG   1 
ATOM   1173 C  CD1  . LEU A 1 94  ? 39.962  -4.010  14.798  1.00 29.87  ?  207  LEU A CD1  1 
ATOM   1174 C  CD2  . LEU A 1 94  ? 39.961  -5.475  12.756  1.00 33.46  ?  207  LEU A CD2  1 
ATOM   1175 H  H    . LEU A 1 94  ? 35.960  -6.205  14.044  1.00 30.95  ?  207  LEU A H    1 
ATOM   1176 H  HA   . LEU A 1 94  ? 38.209  -7.533  13.327  1.00 33.44  ?  207  LEU A HA   1 
ATOM   1177 H  HB2  . LEU A 1 94  ? 38.064  -5.698  15.472  1.00 33.18  ?  207  LEU A HB2  1 
ATOM   1178 H  HB3  . LEU A 1 94  ? 39.348  -6.570  15.131  1.00 33.18  ?  207  LEU A HB3  1 
ATOM   1179 H  HG   . LEU A 1 94  ? 38.410  -4.439  13.536  1.00 36.23  ?  207  LEU A HG   1 
ATOM   1180 H  HD11 . LEU A 1 94  ? 40.168  -3.205  14.298  1.00 35.83  ?  207  LEU A HD11 1 
ATOM   1181 H  HD12 . LEU A 1 94  ? 39.444  -3.786  15.587  1.00 35.83  ?  207  LEU A HD12 1 
ATOM   1182 H  HD13 . LEU A 1 94  ? 40.783  -4.457  15.058  1.00 35.83  ?  207  LEU A HD13 1 
ATOM   1183 H  HD21 . LEU A 1 94  ? 40.388  -4.730  12.305  1.00 40.14  ?  207  LEU A HD21 1 
ATOM   1184 H  HD22 . LEU A 1 94  ? 40.634  -6.085  13.096  1.00 40.14  ?  207  LEU A HD22 1 
ATOM   1185 H  HD23 . LEU A 1 94  ? 39.373  -5.941  12.141  1.00 40.14  ?  207  LEU A HD23 1 
ATOM   1186 N  N    . LEU A 1 95  ? 37.954  -9.362  14.916  1.00 27.31  ?  208  LEU A N    1 
ATOM   1187 C  CA   . LEU A 1 95  ? 37.679  -10.484 15.804  1.00 28.79  ?  208  LEU A CA   1 
ATOM   1188 C  C    . LEU A 1 95  ? 37.847  -10.097 17.269  1.00 28.66  ?  208  LEU A C    1 
ATOM   1189 O  O    . LEU A 1 95  ? 37.030  -10.481 18.118  1.00 28.03  ?  208  LEU A O    1 
ATOM   1190 C  CB   . LEU A 1 95  ? 38.603  -11.656 15.435  1.00 31.91  ?  208  LEU A CB   1 
ATOM   1191 C  CG   . LEU A 1 95  ? 38.312  -13.045 15.975  1.00 38.55  ?  208  LEU A CG   1 
ATOM   1192 C  CD1  . LEU A 1 95  ? 36.891  -13.470 15.686  1.00 39.27  ?  208  LEU A CD1  1 
ATOM   1193 C  CD2  . LEU A 1 95  ? 39.302  -14.030 15.356  1.00 43.20  ?  208  LEU A CD2  1 
ATOM   1194 H  H    . LEU A 1 95  ? 38.570  -9.521  14.337  1.00 32.75  ?  208  LEU A H    1 
ATOM   1195 H  HA   . LEU A 1 95  ? 36.758  -10.767 15.687  1.00 34.54  ?  208  LEU A HA   1 
ATOM   1196 H  HB2  . LEU A 1 95  ? 38.596  -11.735 14.468  1.00 38.28  ?  208  LEU A HB2  1 
ATOM   1197 H  HB3  . LEU A 1 95  ? 39.495  -11.428 15.742  1.00 38.28  ?  208  LEU A HB3  1 
ATOM   1198 H  HG   . LEU A 1 95  ? 38.412  -13.042 16.940  1.00 46.24  ?  208  LEU A HG   1 
ATOM   1199 H  HD11 . LEU A 1 95  ? 36.878  -14.422 15.498  1.00 47.10  ?  208  LEU A HD11 1 
ATOM   1200 H  HD12 . LEU A 1 95  ? 36.340  -13.278 16.460  1.00 47.10  ?  208  LEU A HD12 1 
ATOM   1201 H  HD13 . LEU A 1 95  ? 36.564  -12.977 14.917  1.00 47.10  ?  208  LEU A HD13 1 
ATOM   1202 H  HD21 . LEU A 1 95  ? 39.144  -14.912 15.728  1.00 51.83  ?  208  LEU A HD21 1 
ATOM   1203 H  HD22 . LEU A 1 95  ? 39.170  -14.048 14.395  1.00 51.83  ?  208  LEU A HD22 1 
ATOM   1204 H  HD23 . LEU A 1 95  ? 40.205  -13.742 15.561  1.00 51.83  ?  208  LEU A HD23 1 
ATOM   1205 N  N    . GLN A 1 96  ? 38.885  -9.327  17.586  1.00 26.97  ?  209  GLN A N    1 
ATOM   1206 C  CA   . GLN A 1 96  ? 39.144  -8.971  18.976  1.00 28.59  ?  209  GLN A CA   1 
ATOM   1207 C  C    . GLN A 1 96  ? 38.082  -8.045  19.561  1.00 27.97  ?  209  GLN A C    1 
ATOM   1208 O  O    . GLN A 1 96  ? 38.072  -7.828  20.780  1.00 28.95  ?  209  GLN A O    1 
ATOM   1209 C  CB   . GLN A 1 96  ? 40.526  -8.308  19.107  1.00 29.34  ?  209  GLN A CB   1 
ATOM   1210 C  CG   . GLN A 1 96  ? 40.742  -7.082  18.233  1.00 29.55  ?  209  GLN A CG   1 
ATOM   1211 C  CD   . GLN A 1 96  ? 41.415  -7.419  16.914  1.00 32.61  ?  209  GLN A CD   1 
ATOM   1212 O  OE1  . GLN A 1 96  ? 41.150  -8.456  16.317  1.00 30.37  ?  209  GLN A OE1  1 
ATOM   1213 N  NE2  . GLN A 1 96  ? 42.297  -6.533  16.456  1.00 33.37  ?  209  GLN A NE2  1 
ATOM   1214 H  H    . GLN A 1 96  ? 39.447  -9.001  17.022  1.00 32.35  ?  209  GLN A H    1 
ATOM   1215 H  HA   . GLN A 1 96  ? 39.150  -9.787  19.500  1.00 34.30  ?  209  GLN A HA   1 
ATOM   1216 H  HB2  . GLN A 1 96  ? 40.648  -8.032  20.029  1.00 35.19  ?  209  GLN A HB2  1 
ATOM   1217 H  HB3  . GLN A 1 96  ? 41.203  -8.960  18.865  1.00 35.19  ?  209  GLN A HB3  1 
ATOM   1218 H  HG2  . GLN A 1 96  ? 39.882  -6.677  18.037  1.00 35.44  ?  209  GLN A HG2  1 
ATOM   1219 H  HG3  . GLN A 1 96  ? 41.306  -6.451  18.706  1.00 35.44  ?  209  GLN A HG3  1 
ATOM   1220 H  HE21 . GLN A 1 96  ? 42.458  -5.817  16.903  1.00 40.03  ?  209  GLN A HE21 1 
ATOM   1221 H  HE22 . GLN A 1 96  ? 42.705  -6.678  15.713  1.00 40.03  ?  209  GLN A HE22 1 
ATOM   1222 N  N    . TRP A 1 97  ? 37.195  -7.500  18.738  1.00 26.86  ?  210  TRP A N    1 
ATOM   1223 C  CA   . TRP A 1 97  ? 36.125  -6.644  19.228  1.00 26.77  ?  210  TRP A CA   1 
ATOM   1224 C  C    . TRP A 1 97  ? 34.833  -7.402  19.494  1.00 27.11  ?  210  TRP A C    1 
ATOM   1225 O  O    . TRP A 1 97  ? 33.806  -6.777  19.778  1.00 26.04  ?  210  TRP A O    1 
ATOM   1226 C  CB   . TRP A 1 97  ? 35.858  -5.511  18.227  1.00 26.77  ?  210  TRP A CB   1 
ATOM   1227 C  CG   . TRP A 1 97  ? 36.925  -4.455  18.207  1.00 28.62  ?  210  TRP A CG   1 
ATOM   1228 C  CD1  . TRP A 1 97  ? 37.980  -4.326  19.075  1.00 27.10  ?  210  TRP A CD1  1 
ATOM   1229 C  CD2  . TRP A 1 97  ? 37.028  -3.372  17.281  1.00 25.61  ?  210  TRP A CD2  1 
ATOM   1230 N  NE1  . TRP A 1 97  ? 38.726  -3.225  18.743  1.00 28.68  ?  210  TRP A NE1  1 
ATOM   1231 C  CE2  . TRP A 1 97  ? 38.164  -2.617  17.647  1.00 27.49  ?  210  TRP A CE2  1 
ATOM   1232 C  CE3  . TRP A 1 97  ? 36.270  -2.968  16.185  1.00 25.99  ?  210  TRP A CE3  1 
ATOM   1233 C  CZ2  . TRP A 1 97  ? 38.557  -1.483  16.951  1.00 25.82  ?  210  TRP A CZ2  1 
ATOM   1234 C  CZ3  . TRP A 1 97  ? 36.665  -1.837  15.489  1.00 28.71  ?  210  TRP A CZ3  1 
ATOM   1235 C  CH2  . TRP A 1 97  ? 37.802  -1.112  15.874  1.00 28.44  ?  210  TRP A CH2  1 
ATOM   1236 H  H    . TRP A 1 97  ? 37.193  -7.614  17.886  1.00 32.22  ?  210  TRP A H    1 
ATOM   1237 H  HA   . TRP A 1 97  ? 36.413  -6.247  20.064  1.00 32.11  ?  210  TRP A HA   1 
ATOM   1238 H  HB2  . TRP A 1 97  ? 35.800  -5.889  17.336  1.00 32.11  ?  210  TRP A HB2  1 
ATOM   1239 H  HB3  . TRP A 1 97  ? 35.020  -5.080  18.460  1.00 32.11  ?  210  TRP A HB3  1 
ATOM   1240 H  HD1  . TRP A 1 97  ? 38.162  -4.900  19.784  1.00 32.51  ?  210  TRP A HD1  1 
ATOM   1241 H  HE1  . TRP A 1 97  ? 39.432  -2.958  19.154  1.00 34.41  ?  210  TRP A HE1  1 
ATOM   1242 H  HE3  . TRP A 1 97  ? 35.516  -3.447  15.926  1.00 31.17  ?  210  TRP A HE3  1 
ATOM   1243 H  HZ2  . TRP A 1 97  ? 39.305  -0.995  17.207  1.00 30.97  ?  210  TRP A HZ2  1 
ATOM   1244 H  HZ3  . TRP A 1 97  ? 36.168  -1.554  14.755  1.00 34.43  ?  210  TRP A HZ3  1 
ATOM   1245 H  HH2  . TRP A 1 97  ? 38.048  -0.361  15.384  1.00 34.11  ?  210  TRP A HH2  1 
ATOM   1246 N  N    . HIS A 1 98  ? 34.850  -8.723  19.374  1.00 27.35  ?  211  HIS A N    1 
ATOM   1247 C  CA   . HIS A 1 98  ? 33.730  -9.581  19.758  1.00 27.60  ?  211  HIS A CA   1 
ATOM   1248 C  C    . HIS A 1 98  ? 34.152  -10.253 21.064  1.00 27.24  ?  211  HIS A C    1 
ATOM   1249 O  O    . HIS A 1 98  ? 34.671  -11.369 21.074  1.00 26.57  ?  211  HIS A O    1 
ATOM   1250 C  CB   . HIS A 1 98  ? 33.407  -10.578 18.667  1.00 26.68  ?  211  HIS A CB   1 
ATOM   1251 C  CG   . HIS A 1 98  ? 32.952  -9.942  17.390  1.00 30.30  ?  211  HIS A CG   1 
ATOM   1252 N  ND1  . HIS A 1 98  ? 32.881  -10.631 16.195  1.00 28.39  ?  211  HIS A ND1  1 
ATOM   1253 C  CD2  . HIS A 1 98  ? 32.549  -8.675  17.122  1.00 29.20  ?  211  HIS A CD2  1 
ATOM   1254 C  CE1  . HIS A 1 98  ? 32.459  -9.810  15.246  1.00 28.62  ?  211  HIS A CE1  1 
ATOM   1255 N  NE2  . HIS A 1 98  ? 32.242  -8.622  15.783  1.00 29.68  ?  211  HIS A NE2  1 
ATOM   1256 H  H    . HIS A 1 98  ? 35.522  -9.160  19.063  1.00 32.80  ?  211  HIS A H    1 
ATOM   1257 H  HA   . HIS A 1 98  ? 32.928  -9.055  19.905  1.00 33.10  ?  211  HIS A HA   1 
ATOM   1258 H  HB2  . HIS A 1 98  ? 34.203  -11.098 18.473  1.00 31.99  ?  211  HIS A HB2  1 
ATOM   1259 H  HB3  . HIS A 1 98  ? 32.697  -11.162 18.977  1.00 31.99  ?  211  HIS A HB3  1 
ATOM   1260 H  HD2  . HIS A 1 98  ? 32.491  -7.973  17.729  1.00 35.03  ?  211  HIS A HD2  1 
ATOM   1261 H  HE1  . HIS A 1 98  ? 32.336  -10.033 14.351  1.00 34.33  ?  211  HIS A HE1  1 
ATOM   1262 H  HE2  . HIS A 1 98  ? 31.955  -7.928  15.363  1.00 35.60  ?  211  HIS A HE2  1 
ATOM   1263 N  N    . CYS A 1 99  ? 33.974  -9.530  22.170  1.00 27.29  ?  212  CYS A N    1 
ATOM   1264 C  CA   . CYS A 1 99  ? 34.617  -9.849  23.436  1.00 28.90  ?  212  CYS A CA   1 
ATOM   1265 C  C    . CYS A 1 99  ? 33.640  -10.618 24.319  1.00 28.94  ?  212  CYS A C    1 
ATOM   1266 O  O    . CYS A 1 99  ? 32.619  -10.070 24.754  1.00 26.20  ?  212  CYS A O    1 
ATOM   1267 C  CB   . CYS A 1 99  ? 35.075  -8.554  24.111  1.00 28.30  ?  212  CYS A CB   1 
ATOM   1268 S  SG   . CYS A 1 99  ? 35.940  -8.736  25.666  1.00 36.87  ?  212  CYS A SG   1 
ATOM   1269 H  H    . CYS A 1 99  ? 33.471  -8.834  22.207  1.00 32.73  ?  212  CYS A H    1 
ATOM   1270 H  HA   . CYS A 1 99  ? 35.383  -10.423 23.282  1.00 34.67  ?  212  CYS A HA   1 
ATOM   1271 H  HB2  . CYS A 1 99  ? 35.675  -8.092  23.504  1.00 33.95  ?  212  CYS A HB2  1 
ATOM   1272 H  HB3  . CYS A 1 99  ? 34.292  -8.009  24.282  1.00 33.95  ?  212  CYS A HB3  1 
ATOM   1273 H  HG   . CYS A 1 99  ? 35.225  -9.301  26.447  1.00 44.22  ?  212  CYS A HG   1 
ATOM   1274 N  N    . GLY A 1 100 ? 33.951  -11.891 24.593  1.00 30.14  ?  213  GLY A N    1 
ATOM   1275 C  CA   . GLY A 1 100 ? 33.102  -12.691 25.430  1.00 29.27  ?  213  GLY A CA   1 
ATOM   1276 C  C    . GLY A 1 100 ? 33.769  -13.071 26.731  1.00 28.29  ?  213  GLY A C    1 
ATOM   1277 O  O    . GLY A 1 100 ? 34.990  -12.984 26.863  1.00 26.60  ?  213  GLY A O    1 
ATOM   1278 H  H    . GLY A 1 100 ? 34.650  -12.299 24.300  1.00 36.15  ?  213  GLY A H    1 
ATOM   1279 H  HA2  . GLY A 1 100 ? 32.293  -12.196 25.634  1.00 35.10  ?  213  GLY A HA2  1 
ATOM   1280 H  HA3  . GLY A 1 100 ? 32.863  -13.506 24.960  1.00 35.10  ?  213  GLY A HA3  1 
ATOM   1281 N  N    . VAL A 1 101 ? 32.955  -13.506 27.689  1.00 27.33  ?  214  VAL A N    1 
ATOM   1282 C  CA   . VAL A 1 101 ? 33.399  -13.910 29.017  1.00 27.72  ?  214  VAL A CA   1 
ATOM   1283 C  C    . VAL A 1 101 ? 32.764  -15.261 29.314  1.00 27.44  ?  214  VAL A C    1 
ATOM   1284 O  O    . VAL A 1 101 ? 31.542  -15.418 29.163  1.00 29.20  ?  214  VAL A O    1 
ATOM   1285 C  CB   . VAL A 1 101 ? 32.998  -12.883 30.094  1.00 30.61  ?  214  VAL A CB   1 
ATOM   1286 C  CG1  . VAL A 1 101 ? 33.393  -13.384 31.477  1.00 30.78  ?  214  VAL A CG1  1 
ATOM   1287 C  CG2  . VAL A 1 101 ? 33.630  -11.526 29.798  1.00 29.58  ?  214  VAL A CG2  1 
ATOM   1288 H  H    . VAL A 1 101 ? 32.104  -13.578 27.586  1.00 32.78  ?  214  VAL A H    1 
ATOM   1289 H  HA   . VAL A 1 101 ? 34.365  -14.000 29.029  1.00 33.25  ?  214  VAL A HA   1 
ATOM   1290 H  HB   . VAL A 1 101 ? 32.035  -12.770 30.083  1.00 36.72  ?  214  VAL A HB   1 
ATOM   1291 H  HG11 . VAL A 1 101 ? 33.342  -12.647 32.106  1.00 36.92  ?  214  VAL A HG11 1 
ATOM   1292 H  HG12 . VAL A 1 101 ? 32.783  -14.089 31.743  1.00 36.92  ?  214  VAL A HG12 1 
ATOM   1293 H  HG13 . VAL A 1 101 ? 34.300  -13.727 31.442  1.00 36.92  ?  214  VAL A HG13 1 
ATOM   1294 H  HG21 . VAL A 1 101 ? 33.363  -10.897 30.486  1.00 35.48  ?  214  VAL A HG21 1 
ATOM   1295 H  HG22 . VAL A 1 101 ? 34.596  -11.621 29.794  1.00 35.48  ?  214  VAL A HG22 1 
ATOM   1296 H  HG23 . VAL A 1 101 ? 33.325  -11.218 28.931  1.00 35.48  ?  214  VAL A HG23 1 
ATOM   1297 N  N    . ARG A 1 102 ? 33.589  -16.227 29.734  1.00 25.78  ?  215  ARG A N    1 
ATOM   1298 C  CA   . ARG A 1 102 ? 33.134  -17.571 30.052  1.00 28.06  ?  215  ARG A CA   1 
ATOM   1299 C  C    . ARG A 1 102 ? 33.427  -17.902 31.509  1.00 30.30  ?  215  ARG A C    1 
ATOM   1300 O  O    . ARG A 1 102 ? 34.366  -17.366 32.111  1.00 30.58  ?  215  ARG A O    1 
ATOM   1301 C  CB   . ARG A 1 102 ? 33.829  -18.629 29.160  1.00 29.22  ?  215  ARG A CB   1 
ATOM   1302 C  CG   . ARG A 1 102 ? 33.540  -18.490 27.673  1.00 29.75  ?  215  ARG A CG   1 
ATOM   1303 C  CD   . ARG A 1 102 ? 34.313  -19.515 26.887  1.00 29.97  ?  215  ARG A CD   1 
ATOM   1304 N  NE   . ARG A 1 102 ? 34.015  -19.473 25.459  1.00 31.28  ?  215  ARG A NE   1 
ATOM   1305 C  CZ   . ARG A 1 102 ? 32.965  -20.053 24.896  1.00 32.83  ?  215  ARG A CZ   1 
ATOM   1306 N  NH1  . ARG A 1 102 ? 32.090  -20.725 25.639  1.00 31.27  ?  215  ARG A NH1  1 
ATOM   1307 N  NH2  . ARG A 1 102 ? 32.782  -19.962 23.588  1.00 32.52  ?  215  ARG A NH2  1 
ATOM   1308 H  H    . ARG A 1 102 ? 34.435  -16.117 29.842  1.00 30.92  ?  215  ARG A H    1 
ATOM   1309 H  HA   . ARG A 1 102 ? 32.175  -17.613 29.908  1.00 33.65  ?  215  ARG A HA   1 
ATOM   1310 H  HB2  . ARG A 1 102 ? 34.788  -18.552 29.281  1.00 35.05  ?  215  ARG A HB2  1 
ATOM   1311 H  HB3  . ARG A 1 102 ? 33.529  -19.510 29.436  1.00 35.05  ?  215  ARG A HB3  1 
ATOM   1312 H  HG2  . ARG A 1 102 ? 32.594  -18.626 27.511  1.00 35.69  ?  215  ARG A HG2  1 
ATOM   1313 H  HG3  . ARG A 1 102 ? 33.805  -17.607 27.372  1.00 35.69  ?  215  ARG A HG3  1 
ATOM   1314 H  HD2  . ARG A 1 102 ? 35.262  -19.351 27.000  1.00 35.95  ?  215  ARG A HD2  1 
ATOM   1315 H  HD3  . ARG A 1 102 ? 34.087  -20.400 27.214  1.00 35.95  ?  215  ARG A HD3  1 
ATOM   1316 H  HE   . ARG A 1 102 ? 34.557  -19.043 24.949  1.00 37.52  ?  215  ARG A HE   1 
ATOM   1317 H  HH11 . ARG A 1 102 ? 32.204  -20.784 26.490  1.00 37.51  ?  215  ARG A HH11 1 
ATOM   1318 H  HH12 . ARG A 1 102 ? 31.410  -21.100 25.269  1.00 37.51  ?  215  ARG A HH12 1 
ATOM   1319 H  HH21 . ARG A 1 102 ? 33.344  -19.527 23.104  1.00 39.01  ?  215  ARG A HH21 1 
ATOM   1320 H  HH22 . ARG A 1 102 ? 32.101  -20.339 23.222  1.00 39.01  ?  215  ARG A HH22 1 
ATOM   1321 N  N    . VAL A 1 103 ? 32.607  -18.787 32.077  1.00 29.22  ?  216  VAL A N    1 
ATOM   1322 C  CA   . VAL A 1 103 ? 32.927  -19.376 33.372  1.00 34.20  ?  216  VAL A CA   1 
ATOM   1323 C  C    . VAL A 1 103 ? 34.104  -20.324 33.191  1.00 32.18  ?  216  VAL A C    1 
ATOM   1324 O  O    . VAL A 1 103 ? 34.103  -21.169 32.290  1.00 33.53  ?  216  VAL A O    1 
ATOM   1325 C  CB   . VAL A 1 103 ? 31.711  -20.113 33.956  1.00 32.14  ?  216  VAL A CB   1 
ATOM   1326 C  CG1  . VAL A 1 103 ? 32.055  -20.690 35.333  1.00 33.21  ?  216  VAL A CG1  1 
ATOM   1327 C  CG2  . VAL A 1 103 ? 30.495  -19.185 34.043  1.00 31.25  ?  216  VAL A CG2  1 
ATOM   1328 H  H    . VAL A 1 103 ? 31.866  -19.060 31.735  1.00 35.05  ?  216  VAL A H    1 
ATOM   1329 H  HA   . VAL A 1 103 ? 33.173  -18.672 33.992  1.00 41.03  ?  216  VAL A HA   1 
ATOM   1330 H  HB   . VAL A 1 103 ? 31.477  -20.847 33.366  1.00 38.56  ?  216  VAL A HB   1 
ATOM   1331 H  HG11 . VAL A 1 103 ? 31.242  -21.012 35.752  1.00 39.84  ?  216  VAL A HG11 1 
ATOM   1332 H  HG12 . VAL A 1 103 ? 32.682  -21.421 35.221  1.00 39.84  ?  216  VAL A HG12 1 
ATOM   1333 H  HG13 . VAL A 1 103 ? 32.453  -19.992 35.877  1.00 39.84  ?  216  VAL A HG13 1 
ATOM   1334 H  HG21 . VAL A 1 103 ? 29.772  -19.653 34.489  1.00 37.49  ?  216  VAL A HG21 1 
ATOM   1335 H  HG22 . VAL A 1 103 ? 30.738  -18.393 34.548  1.00 37.49  ?  216  VAL A HG22 1 
ATOM   1336 H  HG23 . VAL A 1 103 ? 30.225  -18.935 33.146  1.00 37.49  ?  216  VAL A HG23 1 
ATOM   1337 N  N    . SER A 1 104 ? 35.118  -20.182 34.040  1.00 31.24  ?  217  SER A N    1 
ATOM   1338 C  CA   . SER A 1 104 ? 36.338  -20.963 33.868  1.00 34.53  ?  217  SER A CA   1 
ATOM   1339 C  C    . SER A 1 104 ? 36.081  -22.455 34.059  1.00 36.09  ?  217  SER A C    1 
ATOM   1340 O  O    . SER A 1 104 ? 36.597  -23.277 33.302  1.00 40.29  ?  217  SER A O    1 
ATOM   1341 C  CB   . SER A 1 104 ? 37.407  -20.483 34.848  1.00 32.85  ?  217  SER A CB   1 
ATOM   1342 O  OG   . SER A 1 104 ? 37.710  -19.123 34.635  1.00 40.24  ?  217  SER A OG   1 
ATOM   1343 H  H    . SER A 1 104 ? 35.128  -19.649 34.715  1.00 37.47  ?  217  SER A H    1 
ATOM   1344 H  HA   . SER A 1 104 ? 36.664  -20.829 32.964  1.00 41.42  ?  217  SER A HA   1 
ATOM   1345 H  HB2  . SER A 1 104 ? 37.078  -20.596 35.753  1.00 39.41  ?  217  SER A HB2  1 
ATOM   1346 H  HB3  . SER A 1 104 ? 38.212  -21.009 34.719  1.00 39.41  ?  217  SER A HB3  1 
ATOM   1347 H  HG   . SER A 1 104 ? 38.297  -18.871 35.180  1.00 48.27  ?  217  SER A HG   1 
ATOM   1348 N  N    . SER A 1 105 ? 35.271  -22.823 35.049  1.00 34.84  ?  218  SER A N    1 
ATOM   1349 C  CA   . SER A 1 105 ? 35.153  -24.232 35.424  1.00 37.35  ?  218  SER A CA   1 
ATOM   1350 C  C    . SER A 1 105 ? 34.473  -25.054 34.336  1.00 38.30  ?  218  SER A C    1 
ATOM   1351 O  O    . SER A 1 105 ? 34.888  -26.186 34.066  1.00 37.68  ?  218  SER A O    1 
ATOM   1352 C  CB   . SER A 1 105 ? 34.396  -24.361 36.746  1.00 34.66  ?  218  SER A CB   1 
ATOM   1353 O  OG   . SER A 1 105 ? 33.062  -23.902 36.624  1.00 34.41  ?  218  SER A OG   1 
ATOM   1354 H  H    . SER A 1 105 ? 34.785  -22.288 35.515  1.00 41.79  ?  218  SER A H    1 
ATOM   1355 H  HA   . SER A 1 105 ? 36.046  -24.591 35.548  1.00 44.81  ?  218  SER A HA   1 
ATOM   1356 H  HB2  . SER A 1 105 ? 34.384  -25.294 37.011  1.00 41.58  ?  218  SER A HB2  1 
ATOM   1357 H  HB3  . SER A 1 105 ? 34.849  -23.830 37.420  1.00 41.58  ?  218  SER A HB3  1 
ATOM   1358 H  HG   . SER A 1 105 ? 32.662  -23.981 37.359  1.00 41.27  ?  218  SER A HG   1 
ATOM   1359 N  N    . ASN A 1 106 ? 33.418  -24.527 33.707  1.00 36.64  ?  219  ASN A N    1 
ATOM   1360 C  CA   . ASN A 1 106 ? 32.700  -25.288 32.688  1.00 38.50  ?  219  ASN A CA   1 
ATOM   1361 C  C    . ASN A 1 106 ? 32.674  -24.614 31.318  1.00 39.10  ?  219  ASN A C    1 
ATOM   1362 O  O    . ASN A 1 106 ? 32.012  -25.126 30.406  1.00 38.92  ?  219  ASN A O    1 
ATOM   1363 C  CB   . ASN A 1 106 ? 31.254  -25.566 33.154  1.00 37.07  ?  219  ASN A CB   1 
ATOM   1364 C  CG   . ASN A 1 106 ? 30.463  -24.297 33.421  1.00 35.35  ?  219  ASN A CG   1 
ATOM   1365 O  OD1  . ASN A 1 106 ? 30.887  -23.198 33.054  1.00 37.69  ?  219  ASN A OD1  1 
ATOM   1366 N  ND2  . ASN A 1 106 ? 29.311  -24.441 34.054  1.00 36.98  ?  219  ASN A ND2  1 
ATOM   1367 H  H    . ASN A 1 106 ? 33.106  -23.739 33.854  1.00 43.96  ?  219  ASN A H    1 
ATOM   1368 H  HA   . ASN A 1 106 ? 33.148  -26.140 32.575  1.00 46.18  ?  219  ASN A HA   1 
ATOM   1369 H  HB2  . ASN A 1 106 ? 30.791  -26.068 32.465  1.00 44.46  ?  219  ASN A HB2  1 
ATOM   1370 H  HB3  . ASN A 1 106 ? 31.281  -26.080 33.976  1.00 44.46  ?  219  ASN A HB3  1 
ATOM   1371 H  HD21 . ASN A 1 106 ? 28.827  -23.752 34.229  1.00 44.36  ?  219  ASN A HD21 1 
ATOM   1372 H  HD22 . ASN A 1 106 ? 29.046  -25.224 34.291  1.00 44.36  ?  219  ASN A HD22 1 
ATOM   1373 N  N    . LYS A 1 107 ? 33.371  -23.493 31.147  1.00 34.88  ?  220  LYS A N    1 
ATOM   1374 C  CA   . LYS A 1 107 ? 33.518  -22.799 29.873  1.00 33.97  ?  220  LYS A CA   1 
ATOM   1375 C  C    . LYS A 1 107 ? 32.218  -22.218 29.338  1.00 32.41  ?  220  LYS A C    1 
ATOM   1376 O  O    . LYS A 1 107 ? 32.154  -21.835 28.161  1.00 31.71  ?  220  LYS A O    1 
ATOM   1377 C  CB   . LYS A 1 107 ? 34.121  -23.719 28.800  1.00 38.01  ?  220  LYS A CB   1 
ATOM   1378 C  CG   . LYS A 1 107 ? 35.451  -24.322 29.191  1.00 40.36  ?  220  LYS A CG   1 
ATOM   1379 C  CD   . LYS A 1 107 ? 36.496  -23.242 29.367  1.00 39.64  ?  220  LYS A CD   1 
ATOM   1380 C  CE   . LYS A 1 107 ? 37.801  -23.821 29.897  1.00 45.09  ?  220  LYS A CE   1 
ATOM   1381 N  NZ   . LYS A 1 107 ? 37.596  -24.619 31.135  1.00 41.98  ?  220  LYS A NZ   1 
ATOM   1382 H  H    . LYS A 1 107 ? 33.786  -23.102 31.790  1.00 41.84  ?  220  LYS A H    1 
ATOM   1383 H  HA   . LYS A 1 107 ? 34.119  -22.054 30.026  1.00 40.75  ?  220  LYS A HA   1 
ATOM   1384 H  HB2  . LYS A 1 107 ? 33.503  -24.448 28.632  1.00 45.60  ?  220  LYS A HB2  1 
ATOM   1385 H  HB3  . LYS A 1 107 ? 34.256  -23.205 27.989  1.00 45.60  ?  220  LYS A HB3  1 
ATOM   1386 H  HG2  . LYS A 1 107 ? 35.357  -24.799 30.030  1.00 48.41  ?  220  LYS A HG2  1 
ATOM   1387 H  HG3  . LYS A 1 107 ? 35.749  -24.929 28.496  1.00 48.41  ?  220  LYS A HG3  1 
ATOM   1388 H  HD2  . LYS A 1 107 ? 36.673  -22.822 28.511  1.00 47.55  ?  220  LYS A HD2  1 
ATOM   1389 H  HD3  . LYS A 1 107 ? 36.174  -22.582 30.000  1.00 47.55  ?  220  LYS A HD3  1 
ATOM   1390 H  HE2  . LYS A 1 107 ? 38.190  -24.401 29.224  1.00 54.10  ?  220  LYS A HE2  1 
ATOM   1391 H  HE3  . LYS A 1 107 ? 38.412  -23.095 30.103  1.00 54.10  ?  220  LYS A HE3  1 
ATOM   1392 H  HZ1  . LYS A 1 107 ? 37.130  -24.147 31.729  1.00 50.37  ?  220  LYS A HZ1  1 
ATOM   1393 H  HZ2  . LYS A 1 107 ? 37.150  -25.366 30.946  1.00 50.37  ?  220  LYS A HZ2  1 
ATOM   1394 H  HZ3  . LYS A 1 107 ? 38.383  -24.835 31.492  1.00 50.37  ?  220  LYS A HZ3  1 
ATOM   1395 N  N    . LYS A 1 108 ? 31.182  -22.128 30.161  1.00 31.32  ?  221  LYS A N    1 
ATOM   1396 C  CA   . LYS A 1 108 ? 29.911  -21.573 29.725  1.00 32.90  ?  221  LYS A CA   1 
ATOM   1397 C  C    . LYS A 1 108 ? 30.053  -20.086 29.392  1.00 29.49  ?  221  LYS A C    1 
ATOM   1398 O  O    . LYS A 1 108 ? 30.678  -19.323 30.130  1.00 28.44  ?  221  LYS A O    1 
ATOM   1399 C  CB   . LYS A 1 108 ? 28.876  -21.779 30.825  1.00 31.99  ?  221  LYS A CB   1 
ATOM   1400 C  CG   . LYS A 1 108 ? 27.513  -21.193 30.571  1.00 38.62  ?  221  LYS A CG   1 
ATOM   1401 C  CD   . LYS A 1 108 ? 26.571  -21.594 31.699  1.00 46.59  ?  221  LYS A CD   1 
ATOM   1402 C  CE   . LYS A 1 108 ? 25.376  -20.669 31.780  1.00 50.34  ?  221  LYS A CE   1 
ATOM   1403 N  NZ   . LYS A 1 108 ? 24.107  -21.424 31.970  1.00 55.18  ?  221  LYS A NZ   1 
ATOM   1404 H  H    . LYS A 1 108 ? 31.188  -22.383 30.982  1.00 37.57  ?  221  LYS A H    1 
ATOM   1405 H  HA   . LYS A 1 108 ? 29.608  -22.022 28.921  1.00 39.46  ?  221  LYS A HA   1 
ATOM   1406 H  HB2  . LYS A 1 108 ? 28.758  -22.733 30.955  1.00 38.37  ?  221  LYS A HB2  1 
ATOM   1407 H  HB3  . LYS A 1 108 ? 29.215  -21.373 31.639  1.00 38.37  ?  221  LYS A HB3  1 
ATOM   1408 H  HG2  . LYS A 1 108 ? 27.571  -20.225 30.540  1.00 46.32  ?  221  LYS A HG2  1 
ATOM   1409 H  HG3  . LYS A 1 108 ? 27.161  -21.531 29.733  1.00 46.32  ?  221  LYS A HG3  1 
ATOM   1410 H  HD2  . LYS A 1 108 ? 26.248  -22.496 31.542  1.00 55.89  ?  221  LYS A HD2  1 
ATOM   1411 H  HD3  . LYS A 1 108 ? 27.045  -21.554 32.544  1.00 55.89  ?  221  LYS A HD3  1 
ATOM   1412 H  HE2  . LYS A 1 108 ? 25.487  -20.067 32.532  1.00 60.39  ?  221  LYS A HE2  1 
ATOM   1413 H  HE3  . LYS A 1 108 ? 25.307  -20.162 30.956  1.00 60.39  ?  221  LYS A HE3  1 
ATOM   1414 H  HZ1  . LYS A 1 108 ? 23.420  -20.859 32.015  1.00 66.20  ?  221  LYS A HZ1  1 
ATOM   1415 H  HZ2  . LYS A 1 108 ? 23.979  -21.981 31.288  1.00 66.20  ?  221  LYS A HZ2  1 
ATOM   1416 H  HZ3  . LYS A 1 108 ? 24.143  -21.895 32.724  1.00 66.20  ?  221  LYS A HZ3  1 
ATOM   1417 N  N    . LEU A 1 109 ? 29.471  -19.683 28.267  1.00 29.50  ?  222  LEU A N    1 
ATOM   1418 C  CA   . LEU A 1 109 ? 29.474  -18.276 27.869  1.00 30.24  ?  222  LEU A CA   1 
ATOM   1419 C  C    . LEU A 1 109 ? 28.486  -17.508 28.736  1.00 29.26  ?  222  LEU A C    1 
ATOM   1420 O  O    . LEU A 1 109 ? 27.299  -17.848 28.775  1.00 29.52  ?  222  LEU A O    1 
ATOM   1421 C  CB   . LEU A 1 109 ? 29.100  -18.133 26.396  1.00 28.24  ?  222  LEU A CB   1 
ATOM   1422 C  CG   . LEU A 1 109 ? 29.135  -16.689 25.859  1.00 28.71  ?  222  LEU A CG   1 
ATOM   1423 C  CD1  . LEU A 1 109 ? 30.576  -16.174 25.887  1.00 28.25  ?  222  LEU A CD1  1 
ATOM   1424 C  CD2  . LEU A 1 109 ? 28.568  -16.630 24.446  1.00 27.07  ?  222  LEU A CD2  1 
ATOM   1425 H  H    . LEU A 1 109 ? 29.066  -20.203 27.714  1.00 35.39  ?  222  LEU A H    1 
ATOM   1426 H  HA   . LEU A 1 109 ? 30.364  -17.911 27.991  1.00 36.27  ?  222  LEU A HA   1 
ATOM   1427 H  HB2  . LEU A 1 109 ? 29.724  -18.656 25.868  1.00 33.87  ?  222  LEU A HB2  1 
ATOM   1428 H  HB3  . LEU A 1 109 ? 28.199  -18.468 26.273  1.00 33.87  ?  222  LEU A HB3  1 
ATOM   1429 H  HG   . LEU A 1 109 ? 28.587  -16.115 26.417  1.00 34.44  ?  222  LEU A HG   1 
ATOM   1430 H  HD11 . LEU A 1 109 ? 30.618  -15.325 25.420  1.00 33.89  ?  222  LEU A HD11 1 
ATOM   1431 H  HD12 . LEU A 1 109 ? 30.852  -16.057 26.810  1.00 33.89  ?  222  LEU A HD12 1 
ATOM   1432 H  HD13 . LEU A 1 109 ? 31.152  -16.821 25.450  1.00 33.89  ?  222  LEU A HD13 1 
ATOM   1433 H  HD21 . LEU A 1 109 ? 28.600  -15.714 24.130  1.00 32.47  ?  222  LEU A HD21 1 
ATOM   1434 H  HD22 . LEU A 1 109 ? 29.102  -17.198 23.868  1.00 32.47  ?  222  LEU A HD22 1 
ATOM   1435 H  HD23 . LEU A 1 109 ? 27.650  -16.943 24.461  1.00 32.47  ?  222  LEU A HD23 1 
ATOM   1436 N  N    . VAL A 1 110 ? 28.961  -16.464 29.414  1.00 27.39  ?  223  VAL A N    1 
ATOM   1437 C  CA   . VAL A 1 110 ? 28.100  -15.749 30.342  1.00 28.91  ?  223  VAL A CA   1 
ATOM   1438 C  C    . VAL A 1 110 ? 28.178  -14.237 30.172  1.00 28.47  ?  223  VAL A C    1 
ATOM   1439 O  O    . VAL A 1 110 ? 27.402  -13.510 30.799  1.00 28.78  ?  223  VAL A O    1 
ATOM   1440 C  CB   . VAL A 1 110 ? 28.433  -16.128 31.794  1.00 29.81  ?  223  VAL A CB   1 
ATOM   1441 C  CG1  . VAL A 1 110 ? 27.942  -17.548 32.103  1.00 32.42  ?  223  VAL A CG1  1 
ATOM   1442 C  CG2  . VAL A 1 110 ? 29.929  -16.002 32.053  1.00 29.34  ?  223  VAL A CG2  1 
ATOM   1443 H  H    . VAL A 1 110 ? 29.763  -16.160 29.352  1.00 32.85  ?  223  VAL A H    1 
ATOM   1444 H  HA   . VAL A 1 110 ? 27.190  -16.003 30.123  1.00 34.67  ?  223  VAL A HA   1 
ATOM   1445 H  HB   . VAL A 1 110 ? 27.975  -15.516 32.391  1.00 35.76  ?  223  VAL A HB   1 
ATOM   1446 H  HG11 . VAL A 1 110 ? 28.185  -17.776 33.014  1.00 38.89  ?  223  VAL A HG11 1 
ATOM   1447 H  HG12 . VAL A 1 110 ? 26.978  -17.579 32.000  1.00 38.89  ?  223  VAL A HG12 1 
ATOM   1448 H  HG13 . VAL A 1 110 ? 28.360  -18.168 31.484  1.00 38.89  ?  223  VAL A HG13 1 
ATOM   1449 H  HG21 . VAL A 1 110 ? 30.098  -16.135 32.999  1.00 35.19  ?  223  VAL A HG21 1 
ATOM   1450 H  HG22 . VAL A 1 110 ? 30.397  -16.676 31.535  1.00 35.19  ?  223  VAL A HG22 1 
ATOM   1451 H  HG23 . VAL A 1 110 ? 30.222  -15.117 31.785  1.00 35.19  ?  223  VAL A HG23 1 
ATOM   1452 N  N    . GLY A 1 111 ? 29.097  -13.742 29.343  1.00 29.52  ?  224  GLY A N    1 
ATOM   1453 C  CA   . GLY A 1 111 ? 29.165  -12.313 29.077  1.00 25.38  ?  224  GLY A CA   1 
ATOM   1454 C  C    . GLY A 1 111 ? 29.554  -12.034 27.640  1.00 25.76  ?  224  GLY A C    1 
ATOM   1455 O  O    . GLY A 1 111 ? 30.230  -12.833 26.995  1.00 27.29  ?  224  GLY A O    1 
ATOM   1456 H  H    . GLY A 1 111 ? 29.685  -14.212 28.927  1.00 35.41  ?  224  GLY A H    1 
ATOM   1457 H  HA2  . GLY A 1 111 ? 28.300  -11.909 29.248  1.00 30.44  ?  224  GLY A HA2  1 
ATOM   1458 H  HA3  . GLY A 1 111 ? 29.825  -11.905 29.660  1.00 30.44  ?  224  GLY A HA3  1 
ATOM   1459 N  N    . PHE A 1 112 ? 29.139  -10.873 27.151  1.00 24.73  ?  225  PHE A N    1 
ATOM   1460 C  CA   . PHE A 1 112 ? 29.517  -10.439 25.815  1.00 26.51  ?  225  PHE A CA   1 
ATOM   1461 C  C    . PHE A 1 112 ? 29.393  -8.927  25.666  1.00 27.30  ?  225  PHE A C    1 
ATOM   1462 O  O    . PHE A 1 112 ? 28.567  -8.282  26.327  1.00 28.48  ?  225  PHE A O    1 
ATOM   1463 C  CB   . PHE A 1 112 ? 28.658  -11.125 24.754  1.00 25.13  ?  225  PHE A CB   1 
ATOM   1464 C  CG   . PHE A 1 112 ? 29.090  -10.842 23.336  1.00 24.97  ?  225  PHE A CG   1 
ATOM   1465 C  CD1  . PHE A 1 112 ? 30.217  -11.417 22.816  1.00 27.01  ?  225  PHE A CD1  1 
ATOM   1466 C  CD2  . PHE A 1 112 ? 28.333  -10.013 22.521  1.00 27.62  ?  225  PHE A CD2  1 
ATOM   1467 C  CE1  . PHE A 1 112 ? 30.603  -11.184 21.508  1.00 25.75  ?  225  PHE A CE1  1 
ATOM   1468 C  CE2  . PHE A 1 112 ? 28.700  -9.771  21.224  1.00 24.99  ?  225  PHE A CE2  1 
ATOM   1469 C  CZ   . PHE A 1 112 ? 29.849  -10.354 20.711  1.00 26.77  ?  225  PHE A CZ   1 
ATOM   1470 H  H    . PHE A 1 112 ? 28.637  -10.318 27.575  1.00 29.66  ?  225  PHE A H    1 
ATOM   1471 H  HA   . PHE A 1 112 ? 30.452  -10.661 25.684  1.00 31.80  ?  225  PHE A HA   1 
ATOM   1472 H  HB2  . PHE A 1 112 ? 28.703  -12.084 24.891  1.00 30.14  ?  225  PHE A HB2  1 
ATOM   1473 H  HB3  . PHE A 1 112 ? 27.743  -10.819 24.851  1.00 30.14  ?  225  PHE A HB3  1 
ATOM   1474 H  HD1  . PHE A 1 112 ? 30.733  -11.976 23.351  1.00 32.39  ?  225  PHE A HD1  1 
ATOM   1475 H  HD2  . PHE A 1 112 ? 27.564  -9.616  22.861  1.00 33.13  ?  225  PHE A HD2  1 
ATOM   1476 H  HE1  . PHE A 1 112 ? 31.370  -11.588 21.169  1.00 30.89  ?  225  PHE A HE1  1 
ATOM   1477 H  HE2  . PHE A 1 112 ? 28.179  -9.216  20.689  1.00 29.98  ?  225  PHE A HE2  1 
ATOM   1478 H  HZ   . PHE A 1 112 ? 30.109  -10.184 19.834  1.00 32.11  ?  225  PHE A HZ   1 
ATOM   1479 N  N    . ILE A 1 113 ? 30.241  -8.375  24.791  1.00 25.11  ?  226  ILE A N    1 
ATOM   1480 C  CA   . ILE A 1 113 ? 30.110  -7.003  24.316  1.00 25.78  ?  226  ILE A CA   1 
ATOM   1481 C  C    . ILE A 1 113 ? 30.784  -6.929  22.946  1.00 26.45  ?  226  ILE A C    1 
ATOM   1482 O  O    . ILE A 1 113 ? 31.660  -7.740  22.622  1.00 25.97  ?  226  ILE A O    1 
ATOM   1483 C  CB   . ILE A 1 113 ? 30.730  -5.977  25.302  1.00 25.32  ?  226  ILE A CB   1 
ATOM   1484 C  CG1  . ILE A 1 113 ? 30.251  -4.569  24.968  1.00 25.27  ?  226  ILE A CG1  1 
ATOM   1485 C  CG2  . ILE A 1 113 ? 32.251  -6.029  25.256  1.00 28.23  ?  226  ILE A CG2  1 
ATOM   1486 C  CD1  . ILE A 1 113 ? 30.628  -3.537  26.014  1.00 26.05  ?  226  ILE A CD1  1 
ATOM   1487 H  H    . ILE A 1 113 ? 30.914  -8.789  24.453  1.00 30.12  ?  226  ILE A H    1 
ATOM   1488 H  HA   . ILE A 1 113 ? 29.170  -6.782  24.222  1.00 30.91  ?  226  ILE A HA   1 
ATOM   1489 H  HB   . ILE A 1 113 ? 30.439  -6.211  26.197  1.00 30.37  ?  226  ILE A HB   1 
ATOM   1490 H  HG12 . ILE A 1 113 ? 30.646  -4.296  24.125  1.00 30.30  ?  226  ILE A HG12 1 
ATOM   1491 H  HG13 . ILE A 1 113 ? 29.284  -4.577  24.894  1.00 30.30  ?  226  ILE A HG13 1 
ATOM   1492 H  HG21 . ILE A 1 113 ? 32.607  -5.592  26.045  1.00 33.86  ?  226  ILE A HG21 1 
ATOM   1493 H  HG22 . ILE A 1 113 ? 32.535  -6.957  25.235  1.00 33.86  ?  226  ILE A HG22 1 
ATOM   1494 H  HG23 . ILE A 1 113 ? 32.559  -5.571  24.458  1.00 33.86  ?  226  ILE A HG23 1 
ATOM   1495 H  HD11 . ILE A 1 113 ? 30.327  -2.663  25.719  1.00 31.25  ?  226  ILE A HD11 1 
ATOM   1496 H  HD12 . ILE A 1 113 ? 30.201  -3.767  26.854  1.00 31.25  ?  226  ILE A HD12 1 
ATOM   1497 H  HD13 . ILE A 1 113 ? 31.592  -3.535  26.123  1.00 31.25  ?  226  ILE A HD13 1 
ATOM   1498 N  N    . SER A 1 114 ? 30.343  -5.988  22.117  1.00 24.82  ?  227  SER A N    1 
ATOM   1499 C  CA   . SER A 1 114 ? 30.892  -5.883  20.782  1.00 25.18  ?  227  SER A CA   1 
ATOM   1500 C  C    . SER A 1 114 ? 31.098  -4.428  20.387  1.00 26.10  ?  227  SER A C    1 
ATOM   1501 O  O    . SER A 1 114 ? 30.353  -3.528  20.789  1.00 25.26  ?  227  SER A O    1 
ATOM   1502 C  CB   . SER A 1 114 ? 29.989  -6.567  19.744  1.00 28.01  ?  227  SER A CB   1 
ATOM   1503 O  OG   . SER A 1 114 ? 28.781  -5.852  19.565  1.00 27.57  ?  227  SER A OG   1 
ATOM   1504 H  H    . SER A 1 114 ? 29.736  -5.410  22.308  1.00 29.77  ?  227  SER A H    1 
ATOM   1505 H  HA   . SER A 1 114 ? 31.763  -6.310  20.780  1.00 30.19  ?  227  SER A HA   1 
ATOM   1506 H  HB2  . SER A 1 114 ? 30.460  -6.607  18.896  1.00 33.60  ?  227  SER A HB2  1 
ATOM   1507 H  HB3  . SER A 1 114 ? 29.782  -7.464  20.050  1.00 33.60  ?  227  SER A HB3  1 
ATOM   1508 H  HG   . SER A 1 114 ? 28.362  -5.809  20.292  1.00 33.07  ?  227  SER A HG   1 
ATOM   1509 N  N    . ALA A 1 115 ? 32.136  -4.218  19.580  1.00 25.13  ?  228  ALA A N    1 
ATOM   1510 C  CA   . ALA A 1 115 ? 32.380  -2.956  18.903  1.00 26.72  ?  228  ALA A CA   1 
ATOM   1511 C  C    . ALA A 1 115 ? 32.499  -3.229  17.410  1.00 28.03  ?  228  ALA A C    1 
ATOM   1512 O  O    . ALA A 1 115 ? 33.091  -4.238  16.999  1.00 27.62  ?  228  ALA A O    1 
ATOM   1513 C  CB   . ALA A 1 115 ? 33.653  -2.294  19.415  1.00 26.49  ?  228  ALA A CB   1 
ATOM   1514 H  H    . ALA A 1 115 ? 32.729  -4.816  19.407  1.00 30.14  ?  228  ALA A H    1 
ATOM   1515 H  HA   . ALA A 1 115 ? 31.645  -2.342  19.057  1.00 32.05  ?  228  ALA A HA   1 
ATOM   1516 H  HB1  . ALA A 1 115 ? 33.788  -1.460  18.939  1.00 31.77  ?  228  ALA A HB1  1 
ATOM   1517 H  HB2  . ALA A 1 115 ? 33.560  -2.122  20.365  1.00 31.77  ?  228  ALA A HB2  1 
ATOM   1518 H  HB3  . ALA A 1 115 ? 34.403  -2.889  19.259  1.00 31.77  ?  228  ALA A HB3  1 
ATOM   1519 N  N    . ILE A 1 116 ? 31.898  -2.358  16.606  1.00 24.94  ?  229  ILE A N    1 
ATOM   1520 C  CA   . ILE A 1 116 ? 32.109  -2.407  15.159  1.00 24.16  ?  229  ILE A CA   1 
ATOM   1521 C  C    . ILE A 1 116 ? 32.574  -1.030  14.698  1.00 26.36  ?  229  ILE A C    1 
ATOM   1522 O  O    . ILE A 1 116 ? 32.116  -0.021  15.237  1.00 26.85  ?  229  ILE A O    1 
ATOM   1523 C  CB   . ILE A 1 116 ? 30.848  -2.843  14.402  1.00 27.59  ?  229  ILE A CB   1 
ATOM   1524 C  CG1  . ILE A 1 116 ? 29.653  -1.950  14.792  1.00 27.04  ?  229  ILE A CG1  1 
ATOM   1525 C  CG2  . ILE A 1 116 ? 30.552  -4.319  14.676  1.00 26.05  ?  229  ILE A CG2  1 
ATOM   1526 C  CD1  . ILE A 1 116 ? 28.450  -2.098  13.866  1.00 27.38  ?  229  ILE A CD1  1 
ATOM   1527 H  H    . ILE A 1 116 ? 31.368  -1.735  16.871  1.00 29.91  ?  229  ILE A H    1 
ATOM   1528 H  HA   . ILE A 1 116 ? 32.802  -3.059  14.968  1.00 28.97  ?  229  ILE A HA   1 
ATOM   1529 H  HB   . ILE A 1 116 ? 31.001  -2.736  13.450  1.00 33.09  ?  229  ILE A HB   1 
ATOM   1530 H  HG12 . ILE A 1 116 ? 29.367  -2.185  15.688  1.00 32.43  ?  229  ILE A HG12 1 
ATOM   1531 H  HG13 . ILE A 1 116 ? 29.935  -1.022  14.766  1.00 32.43  ?  229  ILE A HG13 1 
ATOM   1532 H  HG21 . ILE A 1 116 ? 29.784  -4.590  14.149  1.00 31.25  ?  229  ILE A HG21 1 
ATOM   1533 H  HG22 . ILE A 1 116 ? 31.327  -4.847  14.428  1.00 31.25  ?  229  ILE A HG22 1 
ATOM   1534 H  HG23 . ILE A 1 116 ? 30.362  -4.433  15.620  1.00 31.25  ?  229  ILE A HG23 1 
ATOM   1535 H  HD11 . ILE A 1 116 ? 27.756  -1.482  14.150  1.00 32.84  ?  229  ILE A HD11 1 
ATOM   1536 H  HD12 . ILE A 1 116 ? 28.723  -1.893  12.958  1.00 32.84  ?  229  ILE A HD12 1 
ATOM   1537 H  HD13 . ILE A 1 116 ? 28.124  -3.010  13.915  1.00 32.84  ?  229  ILE A HD13 1 
ATOM   1538 N  N    . PRO A 1 117 ? 33.473  -0.934  13.719  1.00 28.42  ?  230  PRO A N    1 
ATOM   1539 C  CA   . PRO A 1 117 ? 33.937  0.389   13.278  1.00 30.06  ?  230  PRO A CA   1 
ATOM   1540 C  C    . PRO A 1 117 ? 32.872  1.130   12.488  1.00 29.54  ?  230  PRO A C    1 
ATOM   1541 O  O    . PRO A 1 117 ? 32.036  0.527   11.811  1.00 28.91  ?  230  PRO A O    1 
ATOM   1542 C  CB   . PRO A 1 117 ? 35.148  0.063   12.393  1.00 33.56  ?  230  PRO A CB   1 
ATOM   1543 C  CG   . PRO A 1 117 ? 34.802  -1.282  11.807  1.00 32.30  ?  230  PRO A CG   1 
ATOM   1544 C  CD   . PRO A 1 117 ? 34.063  -2.023  12.920  1.00 28.32  ?  230  PRO A CD   1 
ATOM   1545 H  HA   . PRO A 1 117 ? 34.213  0.925   14.038  1.00 36.05  ?  230  PRO A HA   1 
ATOM   1546 H  HB2  . PRO A 1 117 ? 35.248  0.735   11.700  1.00 40.26  ?  230  PRO A HB2  1 
ATOM   1547 H  HB3  . PRO A 1 117 ? 35.954  0.017   12.930  1.00 40.26  ?  230  PRO A HB3  1 
ATOM   1548 H  HG2  . PRO A 1 117 ? 34.232  -1.168  11.030  1.00 38.74  ?  230  PRO A HG2  1 
ATOM   1549 H  HG3  . PRO A 1 117 ? 35.613  -1.752  11.557  1.00 38.74  ?  230  PRO A HG3  1 
ATOM   1550 H  HD2  . PRO A 1 117 ? 33.372  -2.596  12.554  1.00 33.97  ?  230  PRO A HD2  1 
ATOM   1551 H  HD3  . PRO A 1 117 ? 34.681  -2.547  13.455  1.00 33.97  ?  230  PRO A HD3  1 
ATOM   1552 N  N    . ALA A 1 118 ? 32.930  2.462   12.554  1.00 29.81  ?  231  ALA A N    1 
ATOM   1553 C  CA   . ALA A 1 118 ? 32.017  3.283   11.773  1.00 30.75  ?  231  ALA A CA   1 
ATOM   1554 C  C    . ALA A 1 118 ? 32.588  4.688   11.645  1.00 33.51  ?  231  ALA A C    1 
ATOM   1555 O  O    . ALA A 1 118 ? 33.238  5.199   12.560  1.00 31.71  ?  231  ALA A O    1 
ATOM   1556 C  CB   . ALA A 1 118 ? 30.620  3.340   12.417  1.00 32.38  ?  231  ALA A CB   1 
ATOM   1557 H  H    . ALA A 1 118 ? 33.484  2.904   13.039  1.00 35.76  ?  231  ALA A H    1 
ATOM   1558 H  HA   . ALA A 1 118 ? 31.935  2.905   10.884  1.00 36.88  ?  231  ALA A HA   1 
ATOM   1559 H  HB1  . ALA A 1 118 ? 30.042  3.894   11.870  1.00 38.84  ?  231  ALA A HB1  1 
ATOM   1560 H  HB2  . ALA A 1 118 ? 30.260  2.440   12.472  1.00 38.84  ?  231  ALA A HB2  1 
ATOM   1561 H  HB3  . ALA A 1 118 ? 30.697  3.719   13.306  1.00 38.84  ?  231  ALA A HB3  1 
ATOM   1562 N  N    . ASN A 1 119 ? 32.342  5.304   10.499  1.00 34.60  ?  232  ASN A N    1 
ATOM   1563 C  CA   . ASN A 1 119 ? 32.583  6.736   10.329  1.00 35.85  ?  232  ASN A CA   1 
ATOM   1564 C  C    . ASN A 1 119 ? 31.312  7.467   10.739  1.00 30.86  ?  232  ASN A C    1 
ATOM   1565 O  O    . ASN A 1 119 ? 30.282  7.349   10.070  1.00 31.99  ?  232  ASN A O    1 
ATOM   1566 C  CB   . ASN A 1 119 ? 32.985  7.047   8.892   1.00 36.07  ?  232  ASN A CB   1 
ATOM   1567 C  CG   . ASN A 1 119 ? 34.361  6.507   8.558   1.00 43.61  ?  232  ASN A CG   1 
ATOM   1568 O  OD1  . ASN A 1 119 ? 35.352  6.947   9.121   1.00 42.08  ?  232  ASN A OD1  1 
ATOM   1569 N  ND2  . ASN A 1 119 ? 34.418  5.541   7.649   1.00 45.91  ?  232  ASN A ND2  1 
ATOM   1570 H  H    . ASN A 1 119 ? 32.032  4.914   9.798   1.00 41.51  ?  232  ASN A H    1 
ATOM   1571 H  HA   . ASN A 1 119 ? 33.309  7.028   10.902  1.00 43.00  ?  232  ASN A HA   1 
ATOM   1572 H  HB2  . ASN A 1 119 ? 32.344  6.641   8.287   1.00 43.27  ?  232  ASN A HB2  1 
ATOM   1573 H  HB3  . ASN A 1 119 ? 32.997  8.008   8.765   1.00 43.27  ?  232  ASN A HB3  1 
ATOM   1574 H  HD21 . ASN A 1 119 ? 35.178  5.203   7.427   1.00 55.07  ?  232  ASN A HD21 1 
ATOM   1575 H  HD22 . ASN A 1 119 ? 33.696  5.253   7.281   1.00 55.07  ?  232  ASN A HD22 1 
ATOM   1576 N  N    . ILE A 1 120 ? 31.381  8.199   11.847  1.00 28.43  ?  233  ILE A N    1 
ATOM   1577 C  CA   . ILE A 1 120 ? 30.223  8.866   12.440  1.00 31.67  ?  233  ILE A CA   1 
ATOM   1578 C  C    . ILE A 1 120 ? 30.452  10.373  12.361  1.00 33.33  ?  233  ILE A C    1 
ATOM   1579 O  O    . ILE A 1 120 ? 31.486  10.870  12.830  1.00 30.29  ?  233  ILE A O    1 
ATOM   1580 C  CB   . ILE A 1 120 ? 30.013  8.434   13.904  1.00 31.62  ?  233  ILE A CB   1 
ATOM   1581 C  CG1  . ILE A 1 120 ? 29.762  6.914   13.994  1.00 29.13  ?  233  ILE A CG1  1 
ATOM   1582 C  CG2  . ILE A 1 120 ? 28.873  9.214   14.535  1.00 32.59  ?  233  ILE A CG2  1 
ATOM   1583 C  CD1  . ILE A 1 120 ? 28.495  6.464   13.340  1.00 29.16  ?  233  ILE A CD1  1 
ATOM   1584 H  H    . ILE A 1 120 ? 32.109  8.326   12.285  1.00 34.09  ?  233  ILE A H    1 
ATOM   1585 H  HA   . ILE A 1 120 ? 29.430  8.647   11.927  1.00 37.99  ?  233  ILE A HA   1 
ATOM   1586 H  HB   . ILE A 1 120 ? 30.824  8.632   14.397  1.00 37.93  ?  233  ILE A HB   1 
ATOM   1587 H  HG12 . ILE A 1 120 ? 30.496  6.451   13.561  1.00 34.93  ?  233  ILE A HG12 1 
ATOM   1588 H  HG13 . ILE A 1 120 ? 29.715  6.662   14.929  1.00 34.93  ?  233  ILE A HG13 1 
ATOM   1589 H  HG21 . ILE A 1 120 ? 28.604  8.773   15.356  1.00 39.09  ?  233  ILE A HG21 1 
ATOM   1590 H  HG22 . ILE A 1 120 ? 29.175  10.115  14.727  1.00 39.09  ?  233  ILE A HG22 1 
ATOM   1591 H  HG23 . ILE A 1 120 ? 28.127  9.240   13.915  1.00 39.09  ?  233  ILE A HG23 1 
ATOM   1592 H  HD11 . ILE A 1 120 ? 28.408  5.504   13.447  1.00 34.97  ?  233  ILE A HD11 1 
ATOM   1593 H  HD12 . ILE A 1 120 ? 27.745  6.914   13.760  1.00 34.97  ?  233  ILE A HD12 1 
ATOM   1594 H  HD13 . ILE A 1 120 ? 28.529  6.689   12.397  1.00 34.97  ?  233  ILE A HD13 1 
ATOM   1595 N  N    . ARG A 1 121 ? 29.501  11.092  11.766  1.00 30.38  ?  234  ARG A N    1 
ATOM   1596 C  CA   . ARG A 1 121 ? 29.527  12.541  11.739  1.00 33.91  ?  234  ARG A CA   1 
ATOM   1597 C  C    . ARG A 1 121 ? 28.681  13.058  12.897  1.00 33.75  ?  234  ARG A C    1 
ATOM   1598 O  O    . ARG A 1 121 ? 27.492  12.726  13.008  1.00 30.16  ?  234  ARG A O    1 
ATOM   1599 C  CB   . ARG A 1 121 ? 29.016  13.101  10.416  1.00 32.67  ?  234  ARG A CB   1 
ATOM   1600 C  CG   . ARG A 1 121 ? 29.104  14.641  10.359  1.00 34.65  ?  234  ARG A CG   1 
ATOM   1601 C  CD   . ARG A 1 121 ? 28.564  15.192  9.056   1.00 33.68  ?  234  ARG A CD   1 
ATOM   1602 N  NE   . ARG A 1 121 ? 27.252  14.650  8.743   1.00 39.07  ?  234  ARG A NE   1 
ATOM   1603 C  CZ   . ARG A 1 121 ? 26.106  15.087  9.256   1.00 36.79  ?  234  ARG A CZ   1 
ATOM   1604 N  NH1  . ARG A 1 121 ? 24.972  14.516  8.901   1.00 38.34  ?  234  ARG A NH1  1 
ATOM   1605 N  NH2  . ARG A 1 121 ? 26.096  16.094  10.121  1.00 35.74  ?  234  ARG A NH2  1 
ATOM   1606 H  H    . ARG A 1 121 ? 28.821  10.749  11.367  1.00 36.44  ?  234  ARG A H    1 
ATOM   1607 H  HA   . ARG A 1 121 ? 30.443  12.843  11.846  1.00 40.68  ?  234  ARG A HA   1 
ATOM   1608 H  HB2  . ARG A 1 121 ? 29.551  12.741  9.691   1.00 39.19  ?  234  ARG A HB2  1 
ATOM   1609 H  HB3  . ARG A 1 121 ? 28.087  12.847  10.301  1.00 39.19  ?  234  ARG A HB3  1 
ATOM   1610 H  HG2  . ARG A 1 121 ? 28.584  15.018  11.086  1.00 41.57  ?  234  ARG A HG2  1 
ATOM   1611 H  HG3  . ARG A 1 121 ? 30.032  14.912  10.440  1.00 41.57  ?  234  ARG A HG3  1 
ATOM   1612 H  HD2  . ARG A 1 121 ? 28.485  16.157  9.125   1.00 40.41  ?  234  ARG A HD2  1 
ATOM   1613 H  HD3  . ARG A 1 121 ? 29.169  14.959  8.335   1.00 40.41  ?  234  ARG A HD3  1 
ATOM   1614 H  HE   . ARG A 1 121 ? 27.214  13.997  8.185   1.00 46.86  ?  234  ARG A HE   1 
ATOM   1615 H  HH11 . ARG A 1 121 ? 24.976  13.865  8.340   1.00 46.00  ?  234  ARG A HH11 1 
ATOM   1616 H  HH12 . ARG A 1 121 ? 24.228  14.796  9.230   1.00 46.00  ?  234  ARG A HH12 1 
ATOM   1617 H  HH21 . ARG A 1 121 ? 26.835  16.469  10.353  1.00 42.87  ?  234  ARG A HH21 1 
ATOM   1618 H  HH22 . ARG A 1 121 ? 25.351  16.373  10.449  1.00 42.87  ?  234  ARG A HH22 1 
ATOM   1619 N  N    . ILE A 1 122 ? 29.304  13.851  13.765  1.00 33.16  ?  235  ILE A N    1 
ATOM   1620 C  CA   . ILE A 1 122 ? 28.652  14.556  14.864  1.00 31.50  ?  235  ILE A CA   1 
ATOM   1621 C  C    . ILE A 1 122 ? 28.776  16.042  14.539  1.00 38.08  ?  235  ILE A C    1 
ATOM   1622 O  O    . ILE A 1 122 ? 29.898  16.598  14.455  1.00 34.12  ?  235  ILE A O    1 
ATOM   1623 C  CB   . ILE A 1 122 ? 29.325  14.165  16.202  1.00 33.94  ?  235  ILE A CB   1 
ATOM   1624 C  CG1  . ILE A 1 122 ? 28.941  15.094  17.349  1.00 34.74  ?  235  ILE A CG1  1 
ATOM   1625 C  CG2  . ILE A 1 122 ? 30.858  14.054  16.058  1.00 38.75  ?  235  ILE A CG2  1 
ATOM   1626 C  CD1  . ILE A 1 122 ? 27.504  15.046  17.725  1.00 42.34  ?  235  ILE A CD1  1 
ATOM   1627 H  H    . ILE A 1 122 ? 30.150  14.002  13.733  1.00 39.78  ?  235  ILE A H    1 
ATOM   1628 H  HA   . ILE A 1 122 ? 27.707  14.351  14.929  1.00 37.79  ?  235  ILE A HA   1 
ATOM   1629 H  HB   . ILE A 1 122 ? 28.981  13.287  16.428  1.00 40.71  ?  235  ILE A HB   1 
ATOM   1630 H  HG12 . ILE A 1 122 ? 29.457  14.847  18.132  1.00 41.67  ?  235  ILE A HG12 1 
ATOM   1631 H  HG13 . ILE A 1 122 ? 29.147  16.006  17.091  1.00 41.67  ?  235  ILE A HG13 1 
ATOM   1632 H  HG21 . ILE A 1 122 ? 31.253  13.980  16.941  1.00 46.49  ?  235  ILE A HG21 1 
ATOM   1633 H  HG22 . ILE A 1 122 ? 31.069  13.266  15.534  1.00 46.49  ?  235  ILE A HG22 1 
ATOM   1634 H  HG23 . ILE A 1 122 ? 31.192  14.848  15.612  1.00 46.49  ?  235  ILE A HG23 1 
ATOM   1635 H  HD11 . ILE A 1 122 ? 27.308  15.786  18.319  1.00 50.79  ?  235  ILE A HD11 1 
ATOM   1636 H  HD12 . ILE A 1 122 ? 26.965  15.116  16.921  1.00 50.79  ?  235  ILE A HD12 1 
ATOM   1637 H  HD13 . ILE A 1 122 ? 27.322  14.205  18.172  1.00 50.79  ?  235  ILE A HD13 1 
ATOM   1638 N  N    . TYR A 1 123 ? 27.616  16.712  14.292  1.00 32.92  ?  236  TYR A N    1 
ATOM   1639 C  CA   . TYR A 1 123 ? 27.610  18.126  13.754  1.00 37.52  ?  236  TYR A CA   1 
ATOM   1640 C  C    . TYR A 1 123 ? 28.538  18.138  12.540  1.00 38.10  ?  236  TYR A C    1 
ATOM   1641 O  O    . TYR A 1 123 ? 28.202  17.432  11.549  1.00 37.74  ?  236  TYR A O    1 
ATOM   1642 C  CB   . TYR A 1 123 ? 27.919  19.102  14.931  1.00 36.02  ?  236  TYR A CB   1 
ATOM   1643 C  CG   . TYR A 1 123 ? 26.833  19.119  16.052  1.00 35.38  ?  236  TYR A CG   1 
ATOM   1644 C  CD1  . TYR A 1 123 ? 27.107  18.567  17.306  1.00 36.11  ?  236  TYR A CD1  1 
ATOM   1645 C  CD2  . TYR A 1 123 ? 25.573  19.689  15.846  1.00 36.37  ?  236  TYR A CD2  1 
ATOM   1646 C  CE1  . TYR A 1 123 ? 26.163  18.579  18.303  1.00 35.53  ?  236  TYR A CE1  1 
ATOM   1647 C  CE2  . TYR A 1 123 ? 24.629  19.693  16.842  1.00 34.84  ?  236  TYR A CE2  1 
ATOM   1648 C  CZ   . TYR A 1 123 ? 24.939  19.137  18.056  1.00 37.26  ?  236  TYR A CZ   1 
ATOM   1649 O  OH   . TYR A 1 123 ? 23.995  19.138  19.066  1.00 31.77  ?  236  TYR A OH   1 
ATOM   1650 H  H    . TYR A 1 123 ? 26.831  16.385  14.421  1.00 39.49  ?  236  TYR A H    1 
ATOM   1651 H  HA   . TYR A 1 123 ? 26.761  18.457  13.422  1.00 45.01  ?  236  TYR A HA   1 
ATOM   1652 H  HB2  . TYR A 1 123 ? 28.759  18.839  15.339  1.00 43.21  ?  236  TYR A HB2  1 
ATOM   1653 H  HB3  . TYR A 1 123 ? 27.990  20.003  14.577  1.00 43.21  ?  236  TYR A HB3  1 
ATOM   1654 H  HD1  . TYR A 1 123 ? 27.940  18.186  17.467  1.00 43.31  ?  236  TYR A HD1  1 
ATOM   1655 H  HD2  . TYR A 1 123 ? 25.372  20.072  15.023  1.00 43.63  ?  236  TYR A HD2  1 
ATOM   1656 H  HE1  . TYR A 1 123 ? 26.353  18.213  19.137  1.00 42.62  ?  236  TYR A HE1  1 
ATOM   1657 H  HE2  . TYR A 1 123 ? 23.790  20.067  16.695  1.00 41.80  ?  236  TYR A HE2  1 
ATOM   1658 H  HH   . TYR A 1 123 ? 23.254  19.398  18.767  1.00 38.10  ?  236  TYR A HH   1 
ATOM   1659 N  N    . ASP A 1 124 ? 29.665  18.908  12.506  1.00 35.80  ?  237  ASP A N    1 
ATOM   1660 C  CA   . ASP A 1 124 ? 30.583  19.012  11.355  1.00 40.87  ?  237  ASP A CA   1 
ATOM   1661 C  C    . ASP A 1 124 ? 31.721  18.005  11.391  1.00 41.29  ?  237  ASP A C    1 
ATOM   1662 O  O    . ASP A 1 124 ? 32.517  17.927  10.425  1.00 39.28  ?  237  ASP A O    1 
ATOM   1663 C  CB   . ASP A 1 124 ? 31.233  20.438  11.272  1.00 40.03  ?  237  ASP A CB   1 
ATOM   1664 C  CG   . ASP A 1 124 ? 30.287  21.569  10.818  1.00 44.02  ?  237  ASP A CG   1 
ATOM   1665 O  OD1  . ASP A 1 124 ? 29.336  21.290  10.075  1.00 41.41  ?  237  ASP A OD1  1 
ATOM   1666 O  OD2  . ASP A 1 124 ? 30.524  22.775  11.168  1.00 41.48  ?  237  ASP A OD2  1 
ATOM   1667 H  H    . ASP A 1 124 ? 29.919  19.393  13.169  1.00 42.94  ?  237  ASP A H    1 
ATOM   1668 H  HA   . ASP A 1 124 ? 30.049  18.865  10.559  1.00 49.02  ?  237  ASP A HA   1 
ATOM   1669 H  HB2  . ASP A 1 124 ? 31.566  20.675  12.152  1.00 48.02  ?  237  ASP A HB2  1 
ATOM   1670 H  HB3  . ASP A 1 124 ? 31.967  20.404  10.638  1.00 48.02  ?  237  ASP A HB3  1 
ATOM   1671 N  N    . SER A 1 125 ? 31.903  17.269  12.474  1.00 39.64  ?  238  SER A N    1 
ATOM   1672 C  CA   . SER A 1 125 ? 33.102  16.449  12.607  1.00 41.09  ?  238  SER A CA   1 
ATOM   1673 C  C    . SER A 1 125 ? 32.798  15.016  12.203  1.00 38.24  ?  238  SER A C    1 
ATOM   1674 O  O    . SER A 1 125 ? 31.977  14.357  12.835  1.00 33.26  ?  238  SER A O    1 
ATOM   1675 C  CB   . SER A 1 125 ? 33.664  16.499  14.021  1.00 43.32  ?  238  SER A CB   1 
ATOM   1676 O  OG   . SER A 1 125 ? 33.851  17.830  14.440  1.00 50.82  ?  238  SER A OG   1 
ATOM   1677 H  H    . SER A 1 125 ? 31.356  17.227  13.136  1.00 47.56  ?  238  SER A H    1 
ATOM   1678 H  HA   . SER A 1 125 ? 33.777  16.796  12.003  1.00 49.29  ?  238  SER A HA   1 
ATOM   1679 H  HB2  . SER A 1 125 ? 33.040  16.063  14.623  1.00 51.96  ?  238  SER A HB2  1 
ATOM   1680 H  HB3  . SER A 1 125 ? 34.518  16.039  14.038  1.00 51.96  ?  238  SER A HB3  1 
ATOM   1681 H  HG   . SER A 1 125 ? 34.161  17.844  15.221  1.00 60.97  ?  238  SER A HG   1 
ATOM   1682 N  N    . VAL A 1 126 ? 33.479  14.535  11.162  1.00 35.85  ?  239  VAL A N    1 
ATOM   1683 C  CA   . VAL A 1 126 ? 33.445  13.123  10.803  1.00 34.59  ?  239  VAL A CA   1 
ATOM   1684 C  C    . VAL A 1 126 ? 34.590  12.435  11.532  1.00 35.77  ?  239  VAL A C    1 
ATOM   1685 O  O    . VAL A 1 126 ? 35.765  12.741  11.291  1.00 33.97  ?  239  VAL A O    1 
ATOM   1686 C  CB   . VAL A 1 126 ? 33.554  12.925  9.286   1.00 33.64  ?  239  VAL A CB   1 
ATOM   1687 C  CG1  . VAL A 1 126 ? 33.477  11.446  8.946   1.00 35.49  ?  239  VAL A CG1  1 
ATOM   1688 C  CG2  . VAL A 1 126 ? 32.456  13.709  8.572   1.00 34.06  ?  239  VAL A CG2  1 
ATOM   1689 H  H    . VAL A 1 126 ? 33.973  15.015  10.646  1.00 43.01  ?  239  VAL A H    1 
ATOM   1690 H  HA   . VAL A 1 126 ? 32.606  12.732  11.093  1.00 41.50  ?  239  VAL A HA   1 
ATOM   1691 H  HB   . VAL A 1 126 ? 34.410  13.260  8.977   1.00 40.35  ?  239  VAL A HB   1 
ATOM   1692 H  HG11 . VAL A 1 126 ? 33.380  11.347  7.986   1.00 42.57  ?  239  VAL A HG11 1 
ATOM   1693 H  HG12 . VAL A 1 126 ? 34.291  11.010  9.244   1.00 42.57  ?  239  VAL A HG12 1 
ATOM   1694 H  HG13 . VAL A 1 126 ? 32.711  11.057  9.397   1.00 42.57  ?  239  VAL A HG13 1 
ATOM   1695 H  HG21 . VAL A 1 126 ? 32.491  13.509  7.624   1.00 40.86  ?  239  VAL A HG21 1 
ATOM   1696 H  HG22 . VAL A 1 126 ? 31.595  13.447  8.934   1.00 40.86  ?  239  VAL A HG22 1 
ATOM   1697 H  HG23 . VAL A 1 126 ? 32.601  14.657  8.716   1.00 40.86  ?  239  VAL A HG23 1 
ATOM   1698 N  N    . LYS A 1 127 ? 34.252  11.517  12.436  1.00 33.06  ?  240  LYS A N    1 
ATOM   1699 C  CA   . LYS A 1 127 ? 35.227  10.814  13.256  1.00 35.22  ?  240  LYS A CA   1 
ATOM   1700 C  C    . LYS A 1 127 ? 35.132  9.311   13.027  1.00 36.28  ?  240  LYS A C    1 
ATOM   1701 O  O    . LYS A 1 127 ? 34.036  8.755   12.901  1.00 34.20  ?  240  LYS A O    1 
ATOM   1702 C  CB   . LYS A 1 127 ? 35.003  11.114  14.746  1.00 35.00  ?  240  LYS A CB   1 
ATOM   1703 C  CG   . LYS A 1 127 ? 35.229  12.563  15.151  1.00 44.03  ?  240  LYS A CG   1 
ATOM   1704 C  CD   . LYS A 1 127 ? 36.716  12.918  15.172  1.00 47.68  ?  240  LYS A CD   1 
ATOM   1705 C  CE   . LYS A 1 127 ? 37.458  12.143  16.259  1.00 50.57  ?  240  LYS A CE   1 
ATOM   1706 N  NZ   . LYS A 1 127 ? 38.918  12.442  16.266  1.00 52.80  ?  240  LYS A NZ   1 
ATOM   1707 H  H    . LYS A 1 127 ? 33.440  11.281  12.593  1.00 39.66  ?  240  LYS A H    1 
ATOM   1708 H  HA   . LYS A 1 127 ? 36.119  11.101  13.003  1.00 42.25  ?  240  LYS A HA   1 
ATOM   1709 H  HB2  . LYS A 1 127 ? 34.086  10.890  14.970  1.00 41.98  ?  240  LYS A HB2  1 
ATOM   1710 H  HB3  . LYS A 1 127 ? 35.614  10.568  15.265  1.00 41.98  ?  240  LYS A HB3  1 
ATOM   1711 H  HG2  . LYS A 1 127 ? 34.786  13.147  14.515  1.00 52.82  ?  240  LYS A HG2  1 
ATOM   1712 H  HG3  . LYS A 1 127 ? 34.869  12.707  16.040  1.00 52.82  ?  240  LYS A HG3  1 
ATOM   1713 H  HD2  . LYS A 1 127 ? 37.113  12.697  14.315  1.00 57.20  ?  240  LYS A HD2  1 
ATOM   1714 H  HD3  . LYS A 1 127 ? 36.818  13.866  15.350  1.00 57.20  ?  240  LYS A HD3  1 
ATOM   1715 H  HE2  . LYS A 1 127 ? 37.096  12.384  17.126  1.00 60.66  ?  240  LYS A HE2  1 
ATOM   1716 H  HE3  . LYS A 1 127 ? 37.345  11.192  16.105  1.00 60.66  ?  240  LYS A HE3  1 
ATOM   1717 H  HZ1  . LYS A 1 127 ? 39.321  11.976  16.908  1.00 63.34  ?  240  LYS A HZ1  1 
ATOM   1718 H  HZ2  . LYS A 1 127 ? 39.278  12.224  15.482  1.00 63.34  ?  240  LYS A HZ2  1 
ATOM   1719 H  HZ3  . LYS A 1 127 ? 39.050  13.310  16.413  1.00 63.34  ?  240  LYS A HZ3  1 
ATOM   1720 N  N    . LYS A 1 128 ? 36.279  8.650   12.982  1.00 35.16  ?  241  LYS A N    1 
ATOM   1721 C  CA   . LYS A 1 128 ? 36.300  7.195   13.061  1.00 37.33  ?  241  LYS A CA   1 
ATOM   1722 C  C    . LYS A 1 128 ? 36.007  6.798   14.501  1.00 37.26  ?  241  LYS A C    1 
ATOM   1723 O  O    . LYS A 1 128 ? 36.731  7.193   15.426  1.00 34.52  ?  241  LYS A O    1 
ATOM   1724 C  CB   . LYS A 1 128 ? 37.645  6.637   12.603  1.00 40.18  ?  241  LYS A CB   1 
ATOM   1725 C  CG   . LYS A 1 128 ? 37.776  5.128   12.762  1.00 45.69  ?  241  LYS A CG   1 
ATOM   1726 C  CD   . LYS A 1 128 ? 36.683  4.353   12.013  1.00 50.69  ?  241  LYS A CD   1 
ATOM   1727 C  CE   . LYS A 1 128 ? 36.772  4.555   10.506  1.00 56.07  ?  241  LYS A CE   1 
ATOM   1728 N  NZ   . LYS A 1 128 ? 38.069  4.068   9.953   1.00 61.95  ?  241  LYS A NZ   1 
ATOM   1729 H  H    . LYS A 1 128 ? 37.054  9.015   12.907  1.00 42.18  ?  241  LYS A H    1 
ATOM   1730 H  HA   . LYS A 1 128 ? 35.626  6.820   12.472  1.00 44.78  ?  241  LYS A HA   1 
ATOM   1731 H  HB2  . LYS A 1 128 ? 37.764  6.846   11.663  1.00 48.20  ?  241  LYS A HB2  1 
ATOM   1732 H  HB3  . LYS A 1 128 ? 38.348  7.051   13.127  1.00 48.20  ?  241  LYS A HB3  1 
ATOM   1733 H  HG2  . LYS A 1 128 ? 38.636  4.846   12.412  1.00 54.81  ?  241  LYS A HG2  1 
ATOM   1734 H  HG3  . LYS A 1 128 ? 37.711  4.902   13.703  1.00 54.81  ?  241  LYS A HG3  1 
ATOM   1735 H  HD2  . LYS A 1 128 ? 36.780  3.406   12.198  1.00 60.82  ?  241  LYS A HD2  1 
ATOM   1736 H  HD3  . LYS A 1 128 ? 35.813  4.662   12.309  1.00 60.82  ?  241  LYS A HD3  1 
ATOM   1737 H  HE2  . LYS A 1 128 ? 36.055  4.064   10.075  1.00 67.27  ?  241  LYS A HE2  1 
ATOM   1738 H  HE3  . LYS A 1 128 ? 36.693  5.501   10.306  1.00 67.27  ?  241  LYS A HE3  1 
ATOM   1739 H  HZ1  . LYS A 1 128 ? 38.181  3.208   10.152  1.00 74.33  ?  241  LYS A HZ1  1 
ATOM   1740 H  HZ2  . LYS A 1 128 ? 38.077  4.163   9.068   1.00 74.33  ?  241  LYS A HZ2  1 
ATOM   1741 H  HZ3  . LYS A 1 128 ? 38.743  4.535   10.299  1.00 74.33  ?  241  LYS A HZ3  1 
ATOM   1742 N  N    . MET A 1 129 ? 34.923  6.054   14.696  1.00 34.57  ?  242  MET A N    1 
ATOM   1743 C  CA   . MET A 1 129 ? 34.476  5.637   16.010  1.00 34.56  ?  242  MET A CA   1 
ATOM   1744 C  C    . MET A 1 129 ? 34.178  4.142   15.967  1.00 30.77  ?  242  MET A C    1 
ATOM   1745 O  O    . MET A 1 129 ? 34.296  3.490   14.921  1.00 27.91  ?  242  MET A O    1 
ATOM   1746 C  CB   . MET A 1 129 ? 33.209  6.375   16.452  1.00 33.64  ?  242  MET A CB   1 
ATOM   1747 C  CG   . MET A 1 129 ? 33.254  7.895   16.466  1.00 34.22  ?  242  MET A CG   1 
ATOM   1748 S  SD   . MET A 1 129 ? 31.690  8.486   17.177  1.00 38.24  ?  242  MET A SD   1 
ATOM   1749 C  CE   . MET A 1 129 ? 31.873  10.267  16.913  1.00 38.79  ?  242  MET A CE   1 
ATOM   1750 H  H    . MET A 1 129 ? 34.418  5.774   14.058  1.00 41.46  ?  242  MET A H    1 
ATOM   1751 H  HA   . MET A 1 129 ? 35.187  5.835   16.641  1.00 41.45  ?  242  MET A HA   1 
ATOM   1752 H  HB2  . MET A 1 129 ? 32.492  6.121   15.850  1.00 40.35  ?  242  MET A HB2  1 
ATOM   1753 H  HB3  . MET A 1 129 ? 32.999  6.092   17.356  1.00 40.35  ?  242  MET A HB3  1 
ATOM   1754 H  HG2  . MET A 1 129 ? 33.993  8.204   17.014  1.00 41.05  ?  242  MET A HG2  1 
ATOM   1755 H  HG3  . MET A 1 129 ? 33.345  8.236   15.563  1.00 41.05  ?  242  MET A HG3  1 
ATOM   1756 H  HE1  . MET A 1 129 ? 31.088  10.720  17.260  1.00 46.54  ?  242  MET A HE1  1 
ATOM   1757 H  HE2  . MET A 1 129 ? 32.666  10.576  17.379  1.00 46.54  ?  242  MET A HE2  1 
ATOM   1758 H  HE3  . MET A 1 129 ? 31.960  10.438  15.962  1.00 46.54  ?  242  MET A HE3  1 
ATOM   1759 N  N    . VAL A 1 130 ? 33.769  3.612   17.111  1.00 27.90  ?  243  VAL A N    1 
ATOM   1760 C  CA   . VAL A 1 130 ? 33.133  2.306   17.172  1.00 27.66  ?  243  VAL A CA   1 
ATOM   1761 C  C    . VAL A 1 130 ? 31.705  2.498   17.649  1.00 27.42  ?  243  VAL A C    1 
ATOM   1762 O  O    . VAL A 1 130 ? 31.380  3.456   18.359  1.00 28.73  ?  243  VAL A O    1 
ATOM   1763 C  CB   . VAL A 1 130 ? 33.883  1.312   18.092  1.00 29.15  ?  243  VAL A CB   1 
ATOM   1764 C  CG1  . VAL A 1 130 ? 35.240  0.973   17.496  1.00 28.31  ?  243  VAL A CG1  1 
ATOM   1765 C  CG2  . VAL A 1 130 ? 34.027  1.881   19.497  1.00 27.88  ?  243  VAL A CG2  1 
ATOM   1766 H  H    . VAL A 1 130 ? 33.852  3.997   17.875  1.00 33.46  ?  243  VAL A H    1 
ATOM   1767 H  HA   . VAL A 1 130 ? 33.123  1.923   16.281  1.00 33.18  ?  243  VAL A HA   1 
ATOM   1768 H  HB   . VAL A 1 130 ? 33.370  0.492   18.160  1.00 34.97  ?  243  VAL A HB   1 
ATOM   1769 H  HG11 . VAL A 1 130 ? 35.693  0.345   18.080  1.00 33.96  ?  243  VAL A HG11 1 
ATOM   1770 H  HG12 . VAL A 1 130 ? 35.111  0.576   16.621  1.00 33.96  ?  243  VAL A HG12 1 
ATOM   1771 H  HG13 . VAL A 1 130 ? 35.763  1.786   17.417  1.00 33.96  ?  243  VAL A HG13 1 
ATOM   1772 H  HG21 . VAL A 1 130 ? 34.531  1.255   20.041  1.00 33.45  ?  243  VAL A HG21 1 
ATOM   1773 H  HG22 . VAL A 1 130 ? 34.495  2.729   19.449  1.00 33.45  ?  243  VAL A HG22 1 
ATOM   1774 H  HG23 . VAL A 1 130 ? 33.144  2.012   19.877  1.00 33.45  ?  243  VAL A HG23 1 
ATOM   1775 N  N    . GLU A 1 131 ? 30.845  1.591   17.223  1.00 27.59  ?  244  GLU A N    1 
ATOM   1776 C  CA   . GLU A 1 131 ? 29.509  1.437   17.775  1.00 28.96  ?  244  GLU A CA   1 
ATOM   1777 C  C    . GLU A 1 131 ? 29.552  0.248   18.722  1.00 26.96  ?  244  GLU A C    1 
ATOM   1778 O  O    . GLU A 1 131 ? 29.975  -0.846  18.327  1.00 26.11  ?  244  GLU A O    1 
ATOM   1779 C  CB   . GLU A 1 131 ? 28.485  1.231   16.667  1.00 28.76  ?  244  GLU A CB   1 
ATOM   1780 C  CG   . GLU A 1 131 ? 28.576  2.282   15.590  1.00 31.24  ?  244  GLU A CG   1 
ATOM   1781 C  CD   . GLU A 1 131 ? 27.630  2.028   14.455  1.00 36.76  ?  244  GLU A CD   1 
ATOM   1782 O  OE1  . GLU A 1 131 ? 27.031  0.931   14.437  1.00 44.80  ?  244  GLU A OE1  1 
ATOM   1783 O  OE2  . GLU A 1 131 ? 27.467  2.919   13.597  1.00 36.92  ?  244  GLU A OE2  1 
ATOM   1784 H  H    . GLU A 1 131 ? 31.019  1.034   16.592  1.00 33.09  ?  244  GLU A H    1 
ATOM   1785 H  HA   . GLU A 1 131 ? 29.242  2.229   18.268  1.00 34.74  ?  244  GLU A HA   1 
ATOM   1786 H  HB2  . GLU A 1 131 ? 28.633  0.365   16.256  1.00 34.50  ?  244  GLU A HB2  1 
ATOM   1787 H  HB3  . GLU A 1 131 ? 27.594  1.269   17.049  1.00 34.50  ?  244  GLU A HB3  1 
ATOM   1788 H  HG2  . GLU A 1 131 ? 28.362  3.147   15.972  1.00 37.47  ?  244  GLU A HG2  1 
ATOM   1789 H  HG3  . GLU A 1 131 ? 29.478  2.291   15.233  1.00 37.47  ?  244  GLU A HG3  1 
ATOM   1790 N  N    . ILE A 1 132 ? 29.142  0.481   19.974  1.00 26.30  ?  245  ILE A N    1 
ATOM   1791 C  CA   . ILE A 1 132 ? 29.128  -0.531  21.021  1.00 26.28  ?  245  ILE A CA   1 
ATOM   1792 C  C    . ILE A 1 132 ? 27.727  -1.118  21.096  1.00 28.94  ?  245  ILE A C    1 
ATOM   1793 O  O    . ILE A 1 132 ? 26.729  -0.380  21.077  1.00 29.25  ?  245  ILE A O    1 
ATOM   1794 C  CB   . ILE A 1 132 ? 29.548  0.057   22.381  1.00 27.67  ?  245  ILE A CB   1 
ATOM   1795 C  CG1  . ILE A 1 132 ? 30.988  0.582   22.321  1.00 26.50  ?  245  ILE A CG1  1 
ATOM   1796 C  CG2  . ILE A 1 132 ? 29.382  -1.005  23.489  1.00 28.03  ?  245  ILE A CG2  1 
ATOM   1797 C  CD1  . ILE A 1 132 ? 32.026  -0.442  21.923  1.00 28.87  ?  245  ILE A CD1  1 
ATOM   1798 H  H    . ILE A 1 132 ? 28.859  1.248   20.242  1.00 31.55  ?  245  ILE A H    1 
ATOM   1799 H  HA   . ILE A 1 132 ? 29.755  -1.234  20.793  1.00 31.52  ?  245  ILE A HA   1 
ATOM   1800 H  HB   . ILE A 1 132 ? 28.971  0.808   22.590  1.00 33.19  ?  245  ILE A HB   1 
ATOM   1801 H  HG12 . ILE A 1 132 ? 31.025  1.301   21.671  1.00 31.78  ?  245  ILE A HG12 1 
ATOM   1802 H  HG13 . ILE A 1 132 ? 31.230  0.916   23.199  1.00 31.78  ?  245  ILE A HG13 1 
ATOM   1803 H  HG21 . ILE A 1 132 ? 29.874  -0.721  24.275  1.00 33.62  ?  245  ILE A HG21 1 
ATOM   1804 H  HG22 . ILE A 1 132 ? 28.440  -1.093  23.703  1.00 33.62  ?  245  ILE A HG22 1 
ATOM   1805 H  HG23 . ILE A 1 132 ? 29.729  -1.852  23.169  1.00 33.62  ?  245  ILE A HG23 1 
ATOM   1806 H  HD11 . ILE A 1 132 ? 32.909  -0.065  22.060  1.00 34.63  ?  245  ILE A HD11 1 
ATOM   1807 H  HD12 . ILE A 1 132 ? 31.915  -1.234  22.471  1.00 34.63  ?  245  ILE A HD12 1 
ATOM   1808 H  HD13 . ILE A 1 132 ? 31.905  -0.668  20.987  1.00 34.63  ?  245  ILE A HD13 1 
ATOM   1809 N  N    . ASN A 1 133 ? 27.644  -2.442  21.189  1.00 29.03  ?  246  ASN A N    1 
ATOM   1810 C  CA   . ASN A 1 133 ? 26.344  -3.087  21.190  1.00 28.77  ?  246  ASN A CA   1 
ATOM   1811 C  C    . ASN A 1 133 ? 26.435  -4.452  21.858  1.00 29.20  ?  246  ASN A C    1 
ATOM   1812 O  O    . ASN A 1 133 ? 27.521  -4.978  22.129  1.00 27.17  ?  246  ASN A O    1 
ATOM   1813 C  CB   . ASN A 1 133 ? 25.807  -3.224  19.757  1.00 29.98  ?  246  ASN A CB   1 
ATOM   1814 C  CG   . ASN A 1 133 ? 24.279  -3.282  19.702  1.00 33.36  ?  246  ASN A CG   1 
ATOM   1815 O  OD1  . ASN A 1 133 ? 23.612  -3.525  20.709  1.00 32.15  ?  246  ASN A OD1  1 
ATOM   1816 N  ND2  . ASN A 1 133 ? 23.724  -3.057  18.516  1.00 33.82  ?  246  ASN A ND2  1 
ATOM   1817 H  H    . ASN A 1 133 ? 28.316  -2.975  21.252  1.00 34.82  ?  246  ASN A H    1 
ATOM   1818 H  HA   . ASN A 1 133 ? 25.734  -2.549  21.719  1.00 34.51  ?  246  ASN A HA   1 
ATOM   1819 H  HB2  . ASN A 1 133 ? 26.098  -2.460  19.236  1.00 35.96  ?  246  ASN A HB2  1 
ATOM   1820 H  HB3  . ASN A 1 133 ? 26.153  -4.042  19.366  1.00 35.96  ?  246  ASN A HB3  1 
ATOM   1821 H  HD21 . ASN A 1 133 ? 22.868  -3.078  18.431  1.00 40.57  ?  246  ASN A HD21 1 
ATOM   1822 H  HD22 . ASN A 1 133 ? 24.220  -2.891  17.834  1.00 40.57  ?  246  ASN A HD22 1 
ATOM   1823 N  N    . PHE A 1 134 ? 25.250  -4.998  22.146  1.00 29.80  ?  247  PHE A N    1 
ATOM   1824 C  CA   . PHE A 1 134 ? 25.084  -6.371  22.619  1.00 27.56  ?  247  PHE A CA   1 
ATOM   1825 C  C    . PHE A 1 134 ? 25.788  -6.615  23.950  1.00 28.09  ?  247  PHE A C    1 
ATOM   1826 O  O    . PHE A 1 134 ? 26.211  -7.736  24.243  1.00 28.60  ?  247  PHE A O    1 
ATOM   1827 C  CB   . PHE A 1 134 ? 25.554  -7.370  21.559  1.00 26.61  ?  247  PHE A CB   1 
ATOM   1828 C  CG   . PHE A 1 134 ? 24.737  -7.318  20.296  1.00 26.15  ?  247  PHE A CG   1 
ATOM   1829 C  CD1  . PHE A 1 134 ? 23.428  -7.752  20.292  1.00 26.95  ?  247  PHE A CD1  1 
ATOM   1830 C  CD2  . PHE A 1 134 ? 25.277  -6.816  19.122  1.00 27.63  ?  247  PHE A CD2  1 
ATOM   1831 C  CE1  . PHE A 1 134 ? 22.669  -7.709  19.141  1.00 27.07  ?  247  PHE A CE1  1 
ATOM   1832 C  CE2  . PHE A 1 134 ? 24.521  -6.766  17.964  1.00 32.47  ?  247  PHE A CE2  1 
ATOM   1833 C  CZ   . PHE A 1 134 ? 23.203  -7.219  17.980  1.00 28.57  ?  247  PHE A CZ   1 
ATOM   1834 H  H    . PHE A 1 134 ? 24.504  -4.576  22.072  1.00 35.75  ?  247  PHE A H    1 
ATOM   1835 H  HA   . PHE A 1 134 ? 24.139  -6.523  22.778  1.00 33.05  ?  247  PHE A HA   1 
ATOM   1836 H  HB2  . PHE A 1 134 ? 26.475  -7.173  21.327  1.00 31.92  ?  247  PHE A HB2  1 
ATOM   1837 H  HB3  . PHE A 1 134 ? 25.487  -8.267  21.921  1.00 31.92  ?  247  PHE A HB3  1 
ATOM   1838 H  HD1  . PHE A 1 134 ? 23.051  -8.078  21.077  1.00 32.33  ?  247  PHE A HD1  1 
ATOM   1839 H  HD2  . PHE A 1 134 ? 26.156  -6.510  19.113  1.00 33.13  ?  247  PHE A HD2  1 
ATOM   1840 H  HE1  . PHE A 1 134 ? 21.790  -8.014  19.153  1.00 32.47  ?  247  PHE A HE1  1 
ATOM   1841 H  HE2  . PHE A 1 134 ? 24.890  -6.431  17.179  1.00 38.94  ?  247  PHE A HE2  1 
ATOM   1842 H  HZ   . PHE A 1 134 ? 22.690  -7.188  17.205  1.00 34.27  ?  247  PHE A HZ   1 
ATOM   1843 N  N    . LEU A 1 135 ? 25.896  -5.581  24.784  1.00 28.00  ?  248  LEU A N    1 
ATOM   1844 C  CA   . LEU A 1 135 ? 26.374  -5.789  26.145  1.00 27.99  ?  248  LEU A CA   1 
ATOM   1845 C  C    . LEU A 1 135 ? 25.352  -6.639  26.885  1.00 28.52  ?  248  LEU A C    1 
ATOM   1846 O  O    . LEU A 1 135 ? 24.205  -6.225  27.071  1.00 27.72  ?  248  LEU A O    1 
ATOM   1847 C  CB   . LEU A 1 135 ? 26.606  -4.465  26.851  1.00 25.84  ?  248  LEU A CB   1 
ATOM   1848 C  CG   . LEU A 1 135 ? 26.842  -4.555  28.356  1.00 27.53  ?  248  LEU A CG   1 
ATOM   1849 C  CD1  . LEU A 1 135 ? 27.987  -5.484  28.696  1.00 27.81  ?  248  LEU A CD1  1 
ATOM   1850 C  CD2  . LEU A 1 135 ? 27.088  -3.178  28.954  1.00 29.34  ?  248  LEU A CD2  1 
ATOM   1851 H  H    . LEU A 1 135 ? 25.703  -4.767  24.589  1.00 33.58  ?  248  LEU A H    1 
ATOM   1852 H  HA   . LEU A 1 135 ? 27.227  -6.250  26.132  1.00 33.57  ?  248  LEU A HA   1 
ATOM   1853 H  HB2  . LEU A 1 135 ? 27.388  -4.045  26.460  1.00 30.99  ?  248  LEU A HB2  1 
ATOM   1854 H  HB3  . LEU A 1 135 ? 25.826  -3.905  26.714  1.00 30.99  ?  248  LEU A HB3  1 
ATOM   1855 H  HG   . LEU A 1 135 ? 26.039  -4.925  28.755  1.00 33.03  ?  248  LEU A HG   1 
ATOM   1856 H  HD11 . LEU A 1 135 ? 28.163  -5.433  29.649  1.00 33.36  ?  248  LEU A HD11 1 
ATOM   1857 H  HD12 . LEU A 1 135 ? 27.742  -6.390  28.453  1.00 33.36  ?  248  LEU A HD12 1 
ATOM   1858 H  HD13 . LEU A 1 135 ? 28.774  -5.210  28.200  1.00 33.36  ?  248  LEU A HD13 1 
ATOM   1859 H  HD21 . LEU A 1 135 ? 27.231  -3.269  29.909  1.00 35.19  ?  248  LEU A HD21 1 
ATOM   1860 H  HD22 . LEU A 1 135 ? 27.873  -2.788  28.538  1.00 35.19  ?  248  LEU A HD22 1 
ATOM   1861 H  HD23 . LEU A 1 135 ? 26.313  -2.618  28.788  1.00 35.19  ?  248  LEU A HD23 1 
ATOM   1862 N  N    . CYS A 1 136 ? 25.759  -7.839  27.290  1.00 30.08  ?  249  CYS A N    1 
ATOM   1863 C  CA   . CYS A 1 136 ? 24.840  -8.774  27.930  1.00 24.89  ?  249  CYS A CA   1 
ATOM   1864 C  C    . CYS A 1 136 ? 25.610  -9.634  28.914  1.00 28.49  ?  249  CYS A C    1 
ATOM   1865 O  O    . CYS A 1 136 ? 26.697  -10.121 28.599  1.00 27.17  ?  249  CYS A O    1 
ATOM   1866 C  CB   . CYS A 1 136 ? 24.141  -9.653  26.895  1.00 27.54  ?  249  CYS A CB   1 
ATOM   1867 S  SG   . CYS A 1 136 ? 22.975  -10.838 27.591  1.00 31.99  ?  249  CYS A SG   1 
ATOM   1868 H  H    . CYS A 1 136 ? 26.562  -8.134  27.206  1.00 36.08  ?  249  CYS A H    1 
ATOM   1869 H  HA   . CYS A 1 136 ? 24.165  -8.282  28.423  1.00 29.85  ?  249  CYS A HA   1 
ATOM   1870 H  HB2  . CYS A 1 136 ? 23.650  -9.081  26.285  1.00 33.03  ?  249  CYS A HB2  1 
ATOM   1871 H  HB3  . CYS A 1 136 ? 24.815  -10.155 26.410  1.00 33.03  ?  249  CYS A HB3  1 
ATOM   1872 H  HG   . CYS A 1 136 ? 22.485  -11.473 26.699  1.00 38.37  ?  249  CYS A HG   1 
ATOM   1873 N  N    . VAL A 1 137 ? 25.040  -9.817  30.104  1.00 29.25  ?  250  VAL A N    1 
ATOM   1874 C  CA   . VAL A 1 137 ? 25.592  -10.718 31.110  1.00 31.01  ?  250  VAL A CA   1 
ATOM   1875 C  C    . VAL A 1 137 ? 24.492  -11.678 31.546  1.00 32.37  ?  250  VAL A C    1 
ATOM   1876 O  O    . VAL A 1 137 ? 23.339  -11.271 31.733  1.00 27.75  ?  250  VAL A O    1 
ATOM   1877 C  CB   . VAL A 1 137 ? 26.157  -9.955  32.318  1.00 33.29  ?  250  VAL A CB   1 
ATOM   1878 C  CG1  . VAL A 1 137 ? 26.618  -10.928 33.395  1.00 35.41  ?  250  VAL A CG1  1 
ATOM   1879 C  CG2  . VAL A 1 137 ? 27.322  -9.047  31.867  1.00 34.18  ?  250  VAL A CG2  1 
ATOM   1880 H  H    . VAL A 1 137 ? 24.319  -9.421  30.353  1.00 35.09  ?  250  VAL A H    1 
ATOM   1881 H  HA   . VAL A 1 137 ? 26.314  -11.232 30.717  1.00 37.20  ?  250  VAL A HA   1 
ATOM   1882 H  HB   . VAL A 1 137 ? 25.461  -9.397  32.699  1.00 39.93  ?  250  VAL A HB   1 
ATOM   1883 H  HG11 . VAL A 1 137 ? 27.180  -10.455 34.029  1.00 42.48  ?  250  VAL A HG11 1 
ATOM   1884 H  HG12 . VAL A 1 137 ? 25.840  -11.290 33.848  1.00 42.48  ?  250  VAL A HG12 1 
ATOM   1885 H  HG13 . VAL A 1 137 ? 27.121  -11.645 32.979  1.00 42.48  ?  250  VAL A HG13 1 
ATOM   1886 H  HG21 . VAL A 1 137 ? 27.682  -8.586  32.641  1.00 41.01  ?  250  VAL A HG21 1 
ATOM   1887 H  HG22 . VAL A 1 137 ? 28.011  -9.596  31.459  1.00 41.01  ?  250  VAL A HG22 1 
ATOM   1888 H  HG23 . VAL A 1 137 ? 26.989  -8.403  31.223  1.00 41.01  ?  250  VAL A HG23 1 
ATOM   1889 N  N    . HIS A 1 138 ? 24.855  -12.951 31.698  1.00 32.14  ?  251  HIS A N    1 
ATOM   1890 C  CA   . HIS A 1 138 ? 23.910  -13.981 32.117  1.00 30.63  ?  251  HIS A CA   1 
ATOM   1891 C  C    . HIS A 1 138 ? 23.172  -13.564 33.378  1.00 33.72  ?  251  HIS A C    1 
ATOM   1892 O  O    . HIS A 1 138 ? 23.764  -13.015 34.309  1.00 33.83  ?  251  HIS A O    1 
ATOM   1893 C  CB   . HIS A 1 138 ? 24.660  -15.300 32.351  1.00 33.32  ?  251  HIS A CB   1 
ATOM   1894 C  CG   . HIS A 1 138 ? 23.766  -16.498 32.420  1.00 37.94  ?  251  HIS A CG   1 
ATOM   1895 N  ND1  . HIS A 1 138 ? 23.133  -16.886 33.580  1.00 38.42  ?  251  HIS A ND1  1 
ATOM   1896 C  CD2  . HIS A 1 138 ? 23.398  -17.394 31.472  1.00 39.89  ?  251  HIS A CD2  1 
ATOM   1897 C  CE1  . HIS A 1 138 ? 22.410  -17.967 33.343  1.00 39.96  ?  251  HIS A CE1  1 
ATOM   1898 N  NE2  . HIS A 1 138 ? 22.548  -18.293 32.071  1.00 38.38  ?  251  HIS A NE2  1 
ATOM   1899 H  H    . HIS A 1 138 ? 25.651  -13.248 31.564  1.00 38.55  ?  251  HIS A H    1 
ATOM   1900 H  HA   . HIS A 1 138 ? 23.249  -14.117 31.420  1.00 36.74  ?  251  HIS A HA   1 
ATOM   1901 H  HB2  . HIS A 1 138 ? 25.284  -15.438 31.621  1.00 39.97  ?  251  HIS A HB2  1 
ATOM   1902 H  HB3  . HIS A 1 138 ? 25.141  -15.241 33.191  1.00 39.97  ?  251  HIS A HB3  1 
ATOM   1903 H  HD2  . HIS A 1 138 ? 23.670  -17.399 30.583  1.00 47.86  ?  251  HIS A HD2  1 
ATOM   1904 H  HE1  . HIS A 1 138 ? 21.891  -18.421 33.967  1.00 47.94  ?  251  HIS A HE1  1 
ATOM   1905 H  HE2  . HIS A 1 138 ? 22.169  -18.959 31.681  1.00 46.04  ?  251  HIS A HE2  1 
ATOM   1906 N  N    . LYS A 1 139 ? 21.862  -13.839 33.403  1.00 35.46  ?  252  LYS A N    1 
ATOM   1907 C  CA   . LYS A 1 139 ? 21.026  -13.426 34.530  1.00 33.71  ?  252  LYS A CA   1 
ATOM   1908 C  C    . LYS A 1 139 ? 21.552  -13.954 35.863  1.00 34.39  ?  252  LYS A C    1 
ATOM   1909 O  O    . LYS A 1 139 ? 21.467  -13.263 36.884  1.00 37.30  ?  252  LYS A O    1 
ATOM   1910 C  CB   . LYS A 1 139 ? 19.583  -13.902 34.312  1.00 35.91  ?  252  LYS A CB   1 
ATOM   1911 C  CG   . LYS A 1 139 ? 18.831  -13.183 33.198  1.00 34.77  ?  252  LYS A CG   1 
ATOM   1912 C  CD   . LYS A 1 139 ? 17.368  -13.642 33.144  1.00 39.35  ?  252  LYS A CD   1 
ATOM   1913 C  CE   . LYS A 1 139 ? 16.564  -12.806 32.155  1.00 41.88  ?  252  LYS A CE   1 
ATOM   1914 N  NZ   . LYS A 1 139 ? 15.095  -12.849 32.405  1.00 41.00  ?  252  LYS A NZ   1 
ATOM   1915 H  H    . LYS A 1 139 ? 21.436  -14.258 32.785  1.00 42.53  ?  252  LYS A H    1 
ATOM   1916 H  HA   . LYS A 1 139 ? 21.036  -12.457 34.571  1.00 40.43  ?  252  LYS A HA   1 
ATOM   1917 H  HB2  . LYS A 1 139 ? 19.601  -14.846 34.089  1.00 43.07  ?  252  LYS A HB2  1 
ATOM   1918 H  HB3  . LYS A 1 139 ? 19.087  -13.764 35.134  1.00 43.07  ?  252  LYS A HB3  1 
ATOM   1919 H  HG2  . LYS A 1 139 ? 18.847  -12.227 33.361  1.00 41.71  ?  252  LYS A HG2  1 
ATOM   1920 H  HG3  . LYS A 1 139 ? 19.247  -13.382 32.345  1.00 41.71  ?  252  LYS A HG3  1 
ATOM   1921 H  HD2  . LYS A 1 139 ? 17.332  -14.569 32.863  1.00 47.21  ?  252  LYS A HD2  1 
ATOM   1922 H  HD3  . LYS A 1 139 ? 16.968  -13.546 34.022  1.00 47.21  ?  252  LYS A HD3  1 
ATOM   1923 H  HE2  . LYS A 1 139 ? 16.850  -11.881 32.219  1.00 50.24  ?  252  LYS A HE2  1 
ATOM   1924 H  HE3  . LYS A 1 139 ? 16.723  -13.141 31.258  1.00 50.24  ?  252  LYS A HE3  1 
ATOM   1925 H  HZ1  . LYS A 1 139 ? 14.916  -12.539 33.219  1.00 49.18  ?  252  LYS A HZ1  1 
ATOM   1926 H  HZ2  . LYS A 1 139 ? 14.669  -12.348 31.805  1.00 49.18  ?  252  LYS A HZ2  1 
ATOM   1927 H  HZ3  . LYS A 1 139 ? 14.800  -13.687 32.343  1.00 49.18  ?  252  LYS A HZ3  1 
ATOM   1928 N  N    . LYS A 1 140 ? 22.086  -15.175 35.882  1.00 38.75  ?  253  LYS A N    1 
ATOM   1929 C  CA   . LYS A 1 140 ? 22.545  -15.783 37.129  1.00 41.94  ?  253  LYS A CA   1 
ATOM   1930 C  C    . LYS A 1 140 ? 23.902  -15.269 37.581  1.00 45.42  ?  253  LYS A C    1 
ATOM   1931 O  O    . LYS A 1 140 ? 24.298  -15.524 38.721  1.00 48.04  ?  253  LYS A O    1 
ATOM   1932 C  CB   . LYS A 1 140 ? 22.640  -17.303 36.989  1.00 41.99  ?  253  LYS A CB   1 
ATOM   1933 C  CG   . LYS A 1 140 ? 21.316  -18.028 36.824  1.00 47.02  ?  253  LYS A CG   1 
ATOM   1934 C  CD   . LYS A 1 140 ? 21.472  -19.479 36.311  1.00 50.46  ?  253  LYS A CD   1 
ATOM   1935 C  CE   . LYS A 1 140 ? 22.601  -20.268 36.997  1.00 52.49  ?  253  LYS A CE   1 
ATOM   1936 N  NZ   . LYS A 1 140 ? 22.170  -21.117 38.155  1.00 53.75  ?  253  LYS A NZ   1 
ATOM   1937 H  H    . LYS A 1 140 ? 22.192  -15.671 35.187  1.00 46.48  ?  253  LYS A H    1 
ATOM   1938 H  HA   . LYS A 1 140 ? 21.887  -15.575 37.811  1.00 50.31  ?  253  LYS A HA   1 
ATOM   1939 H  HB2  . LYS A 1 140 ? 23.179  -17.505 36.209  1.00 50.38  ?  253  LYS A HB2  1 
ATOM   1940 H  HB3  . LYS A 1 140 ? 23.065  -17.657 37.786  1.00 50.38  ?  253  LYS A HB3  1 
ATOM   1941 H  HG2  . LYS A 1 140 ? 20.867  -18.064 37.683  1.00 56.40  ?  253  LYS A HG2  1 
ATOM   1942 H  HG3  . LYS A 1 140 ? 20.770  -17.544 36.184  1.00 56.40  ?  253  LYS A HG3  1 
ATOM   1943 H  HD2  . LYS A 1 140 ? 20.642  -19.956 36.468  1.00 60.54  ?  253  LYS A HD2  1 
ATOM   1944 H  HD3  . LYS A 1 140 ? 21.666  -19.454 35.361  1.00 60.54  ?  253  LYS A HD3  1 
ATOM   1945 H  HE2  . LYS A 1 140 ? 23.006  -20.857 36.342  1.00 62.98  ?  253  LYS A HE2  1 
ATOM   1946 H  HE3  . LYS A 1 140 ? 23.259  -19.638 37.329  1.00 62.98  ?  253  LYS A HE3  1 
ATOM   1947 H  HZ1  . LYS A 1 140 ? 21.804  -20.608 38.786  1.00 64.48  ?  253  LYS A HZ1  1 
ATOM   1948 H  HZ2  . LYS A 1 140 ? 22.873  -21.542 38.499  1.00 64.48  ?  253  LYS A HZ2  1 
ATOM   1949 H  HZ3  . LYS A 1 140 ? 21.572  -21.719 37.886  1.00 64.48  ?  253  LYS A HZ3  1 
ATOM   1950 N  N    . LEU A 1 141 ? 24.640  -14.589 36.720  1.00 45.97  ?  254  LEU A N    1 
ATOM   1951 C  CA   . LEU A 1 141 ? 25.970  -14.123 37.081  1.00 49.13  ?  254  LEU A CA   1 
ATOM   1952 C  C    . LEU A 1 141 ? 26.035  -12.605 37.064  1.00 45.68  ?  254  LEU A C    1 
ATOM   1953 O  O    . LEU A 1 141 ? 27.094  -12.028 36.811  1.00 44.91  ?  254  LEU A O    1 
ATOM   1954 C  CB   . LEU A 1 141 ? 27.027  -14.732 36.162  1.00 48.52  ?  254  LEU A CB   1 
ATOM   1955 C  CG   . LEU A 1 141 ? 27.192  -16.247 36.284  1.00 53.51  ?  254  LEU A CG   1 
ATOM   1956 C  CD1  . LEU A 1 141 ? 26.419  -16.979 35.188  1.00 55.09  ?  254  LEU A CD1  1 
ATOM   1957 C  CD2  . LEU A 1 141 ? 28.655  -16.634 36.256  1.00 53.98  ?  254  LEU A CD2  1 
ATOM   1958 H  H    . LEU A 1 141 ? 24.393  -14.386 35.922  1.00 55.15  ?  254  LEU A H    1 
ATOM   1959 H  HA   . LEU A 1 141 ? 26.172  -14.416 37.984  1.00 58.94  ?  254  LEU A HA   1 
ATOM   1960 H  HB2  . LEU A 1 141 ? 26.783  -14.538 35.243  1.00 58.21  ?  254  LEU A HB2  1 
ATOM   1961 H  HB3  . LEU A 1 141 ? 27.884  -14.327 36.370  1.00 58.21  ?  254  LEU A HB3  1 
ATOM   1962 H  HG   . LEU A 1 141 ? 26.825  -16.525 37.138  1.00 64.19  ?  254  LEU A HG   1 
ATOM   1963 H  HD11 . LEU A 1 141 ? 26.634  -17.924 35.228  1.00 66.09  ?  254  LEU A HD11 1 
ATOM   1964 H  HD12 . LEU A 1 141 ? 25.469  -16.850 35.332  1.00 66.09  ?  254  LEU A HD12 1 
ATOM   1965 H  HD13 . LEU A 1 141 ? 26.676  -16.617 34.326  1.00 66.09  ?  254  LEU A HD13 1 
ATOM   1966 H  HD21 . LEU A 1 141 ? 28.735  -17.581 36.454  1.00 64.76  ?  254  LEU A HD21 1 
ATOM   1967 H  HD22 . LEU A 1 141 ? 29.014  -16.449 35.375  1.00 64.76  ?  254  LEU A HD22 1 
ATOM   1968 H  HD23 . LEU A 1 141 ? 29.131  -16.116 36.924  1.00 64.76  ?  254  LEU A HD23 1 
ATOM   1969 N  N    . ARG A 1 142 ? 24.910  -11.947 37.341  1.00 42.78  ?  255  ARG A N    1 
ATOM   1970 C  CA   . ARG A 1 142 ? 24.887  -10.497 37.420  1.00 42.17  ?  255  ARG A CA   1 
ATOM   1971 C  C    . ARG A 1 142 ? 25.211  -10.042 38.837  1.00 46.00  ?  255  ARG A C    1 
ATOM   1972 O  O    . ARG A 1 142 ? 25.232  -10.831 39.785  1.00 46.48  ?  255  ARG A O    1 
ATOM   1973 C  CB   . ARG A 1 142 ? 23.529  -9.957  36.973  1.00 41.06  ?  255  ARG A CB   1 
ATOM   1974 C  CG   . ARG A 1 142 ? 23.354  -9.960  35.466  1.00 40.17  ?  255  ARG A CG   1 
ATOM   1975 C  CD   . ARG A 1 142 ? 21.926  -9.652  35.045  1.00 38.77  ?  255  ARG A CD   1 
ATOM   1976 N  NE   . ARG A 1 142 ? 21.739  -9.913  33.617  1.00 40.55  ?  255  ARG A NE   1 
ATOM   1977 C  CZ   . ARG A 1 142 ? 20.578  -9.832  32.979  1.00 37.84  ?  255  ARG A CZ   1 
ATOM   1978 N  NH1  . ARG A 1 142 ? 19.486  -9.493  33.637  1.00 41.81  ?  255  ARG A NH1  1 
ATOM   1979 N  NH2  . ARG A 1 142 ? 20.511  -10.094 31.680  1.00 34.08  ?  255  ARG A NH2  1 
ATOM   1980 H  H    . ARG A 1 142 ? 24.150  -12.323 37.487  1.00 51.32  ?  255  ARG A H    1 
ATOM   1981 H  HA   . ARG A 1 142 ? 25.559  -10.133 36.823  1.00 50.59  ?  255  ARG A HA   1 
ATOM   1982 H  HB2  . ARG A 1 142 ? 22.829  -10.508 37.357  1.00 49.26  ?  255  ARG A HB2  1 
ATOM   1983 H  HB3  . ARG A 1 142 ? 23.438  -9.042  37.282  1.00 49.26  ?  255  ARG A HB3  1 
ATOM   1984 H  HG2  . ARG A 1 142 ? 23.934  -9.287  35.077  1.00 48.19  ?  255  ARG A HG2  1 
ATOM   1985 H  HG3  . ARG A 1 142 ? 23.585  -10.837 35.122  1.00 48.19  ?  255  ARG A HG3  1 
ATOM   1986 H  HD2  . ARG A 1 142 ? 21.312  -10.213 35.544  1.00 46.51  ?  255  ARG A HD2  1 
ATOM   1987 H  HD3  . ARG A 1 142 ? 21.733  -8.716  35.215  1.00 46.51  ?  255  ARG A HD3  1 
ATOM   1988 H  HE   . ARG A 1 142 ? 22.431  -10.135 33.159  1.00 48.64  ?  255  ARG A HE   1 
ATOM   1989 H  HH11 . ARG A 1 142 ? 19.526  -9.325  34.479  1.00 50.15  ?  255  ARG A HH11 1 
ATOM   1990 H  HH12 . ARG A 1 142 ? 18.734  -9.441  33.223  1.00 50.15  ?  255  ARG A HH12 1 
ATOM   1991 H  HH21 . ARG A 1 142 ? 21.221  -10.317 31.249  1.00 40.88  ?  255  ARG A HH21 1 
ATOM   1992 H  HH22 . ARG A 1 142 ? 19.757  -10.041 31.269  1.00 40.88  ?  255  ARG A HH22 1 
ATOM   1993 N  N    . SER A 1 143 ? 25.471  -8.743  38.970  1.00 45.25  ?  256  SER A N    1 
ATOM   1994 C  CA   . SER A 1 143 ? 25.895  -8.137  40.228  1.00 49.98  ?  256  SER A CA   1 
ATOM   1995 C  C    . SER A 1 143 ? 27.236  -8.689  40.702  1.00 50.48  ?  256  SER A C    1 
ATOM   1996 O  O    . SER A 1 143 ? 27.584  -8.570  41.882  1.00 51.57  ?  256  SER A O    1 
ATOM   1997 C  CB   . SER A 1 143 ? 24.833  -8.315  41.321  1.00 50.78  ?  256  SER A CB   1 
ATOM   1998 O  OG   . SER A 1 143 ? 23.623  -7.674  40.961  1.00 48.44  ?  256  SER A OG   1 
ATOM   1999 H  H    . SER A 1 143 ? 25.405  -8.179  38.324  1.00 54.28  ?  256  SER A H    1 
ATOM   2000 H  HA   . SER A 1 143 ? 26.008  -7.184  40.082  1.00 59.96  ?  256  SER A HA   1 
ATOM   2001 H  HB2  . SER A 1 143 ? 24.664  -9.262  41.445  1.00 60.91  ?  256  SER A HB2  1 
ATOM   2002 H  HB3  . SER A 1 143 ? 25.162  -7.926  42.147  1.00 60.91  ?  256  SER A HB3  1 
ATOM   2003 H  HG   . SER A 1 143 ? 23.051  -7.779  41.567  1.00 58.11  ?  256  SER A HG   1 
ATOM   2004 N  N    . LYS A 1 144 ? 27.995  -9.299  39.795  1.00 48.32  ?  257  LYS A N    1 
ATOM   2005 C  CA   . LYS A 1 144 ? 29.359  -9.726  40.067  1.00 50.96  ?  257  LYS A CA   1 
ATOM   2006 C  C    . LYS A 1 144 ? 30.384  -8.786  39.440  1.00 50.01  ?  257  LYS A C    1 
ATOM   2007 O  O    . LYS A 1 144 ? 31.559  -9.147  39.320  1.00 47.94  ?  257  LYS A O    1 
ATOM   2008 C  CB   . LYS A 1 144 ? 29.575  -11.156 39.571  1.00 48.02  ?  257  LYS A CB   1 
ATOM   2009 C  CG   . LYS A 1 144 ? 28.846  -12.200 40.399  1.00 52.34  ?  257  LYS A CG   1 
ATOM   2010 C  CD   . LYS A 1 144 ? 28.999  -13.580 39.797  1.00 52.64  ?  257  LYS A CD   1 
ATOM   2011 C  CE   . LYS A 1 144 ? 29.126  -14.626 40.878  1.00 50.02  ?  257  LYS A CE   1 
ATOM   2012 N  NZ   . LYS A 1 144 ? 30.401  -14.528 41.634  1.00 43.69  ?  257  LYS A NZ   1 
ATOM   2013 H  H    . LYS A 1 144 ? 27.731  -9.479  38.996  1.00 57.97  ?  257  LYS A H    1 
ATOM   2014 H  HA   . LYS A 1 144 ? 29.501  -9.725  41.027  1.00 61.14  ?  257  LYS A HA   1 
ATOM   2015 H  HB2  . LYS A 1 144 ? 29.253  -11.222 38.659  1.00 57.61  ?  257  LYS A HB2  1 
ATOM   2016 H  HB3  . LYS A 1 144 ? 30.523  -11.359 39.604  1.00 57.61  ?  257  LYS A HB3  1 
ATOM   2017 H  HG2  . LYS A 1 144 ? 29.214  -12.215 41.296  1.00 62.80  ?  257  LYS A HG2  1 
ATOM   2018 H  HG3  . LYS A 1 144 ? 27.901  -11.984 40.431  1.00 62.80  ?  257  LYS A HG3  1 
ATOM   2019 H  HD2  . LYS A 1 144 ? 28.220  -13.787 39.258  1.00 63.16  ?  257  LYS A HD2  1 
ATOM   2020 H  HD3  . LYS A 1 144 ? 29.799  -13.607 39.248  1.00 63.16  ?  257  LYS A HD3  1 
ATOM   2021 H  HE2  . LYS A 1 144 ? 28.396  -14.518 41.508  1.00 60.01  ?  257  LYS A HE2  1 
ATOM   2022 H  HE3  . LYS A 1 144 ? 29.086  -15.506 40.472  1.00 60.01  ?  257  LYS A HE3  1 
ATOM   2023 H  HZ1  . LYS A 1 144 ? 30.451  -15.184 42.233  1.00 52.42  ?  257  LYS A HZ1  1 
ATOM   2024 H  HZ2  . LYS A 1 144 ? 31.091  -14.593 41.076  1.00 52.42  ?  257  LYS A HZ2  1 
ATOM   2025 H  HZ3  . LYS A 1 144 ? 30.445  -13.746 42.057  1.00 52.42  ?  257  LYS A HZ3  1 
ATOM   2026 N  N    . ARG A 1 145 ? 29.952  -7.588  39.044  1.00 50.58  ?  258  ARG A N    1 
ATOM   2027 C  CA   . ARG A 1 145 ? 30.826  -6.586  38.451  1.00 54.90  ?  258  ARG A CA   1 
ATOM   2028 C  C    . ARG A 1 145 ? 31.549  -7.134  37.222  1.00 49.29  ?  258  ARG A C    1 
ATOM   2029 O  O    . ARG A 1 145 ? 32.745  -6.903  37.025  1.00 45.65  ?  258  ARG A O    1 
ATOM   2030 C  CB   . ARG A 1 145 ? 31.824  -6.055  39.480  1.00 64.89  ?  258  ARG A CB   1 
ATOM   2031 C  CG   . ARG A 1 145 ? 31.160  -5.517  40.743  1.00 70.84  ?  258  ARG A CG   1 
ATOM   2032 C  CD   . ARG A 1 145 ? 31.971  -4.399  41.376  1.00 81.92  ?  258  ARG A CD   1 
ATOM   2033 N  NE   . ARG A 1 145 ? 31.920  -3.165  40.591  1.00 87.10  ?  258  ARG A NE   1 
ATOM   2034 C  CZ   . ARG A 1 145 ? 30.857  -2.369  40.521  1.00 89.38  ?  258  ARG A CZ   1 
ATOM   2035 N  NH1  . ARG A 1 145 ? 29.749  -2.681  41.179  1.00 91.52  ?  258  ARG A NH1  1 
ATOM   2036 N  NH2  . ARG A 1 145 ? 30.898  -1.264  39.787  1.00 87.86  ?  258  ARG A NH2  1 
ATOM   2037 H  H    . ARG A 1 145 ? 29.135  -7.329  39.111  1.00 60.68  ?  258  ARG A H    1 
ATOM   2038 H  HA   . ARG A 1 145 ? 30.279  -5.843  38.151  1.00 65.87  ?  258  ARG A HA   1 
ATOM   2039 H  HB2  . ARG A 1 145 ? 32.419  -6.776  39.741  1.00 77.85  ?  258  ARG A HB2  1 
ATOM   2040 H  HB3  . ARG A 1 145 ? 32.333  -5.333  39.080  1.00 77.85  ?  258  ARG A HB3  1 
ATOM   2041 H  HG2  . ARG A 1 145 ? 30.283  -5.166  40.519  1.00 84.99  ?  258  ARG A HG2  1 
ATOM   2042 H  HG3  . ARG A 1 145 ? 31.074  -6.234  41.390  1.00 84.99  ?  258  ARG A HG3  1 
ATOM   2043 H  HD2  . ARG A 1 145 ? 31.618  -4.209  42.260  1.00 98.29  ?  258  ARG A HD2  1 
ATOM   2044 H  HD3  . ARG A 1 145 ? 32.898  -4.676  41.443  1.00 98.29  ?  258  ARG A HD3  1 
ATOM   2045 H  HE   . ARG A 1 145 ? 32.622  -2.941  40.147  1.00 104.50 ?  258  ARG A HE   1 
ATOM   2046 H  HH11 . ARG A 1 145 ? 29.717  -3.399  41.652  1.00 109.81 ?  258  ARG A HH11 1 
ATOM   2047 H  HH12 . ARG A 1 145 ? 29.061  -2.166  41.134  1.00 109.81 ?  258  ARG A HH12 1 
ATOM   2048 H  HH21 . ARG A 1 145 ? 31.613  -1.061  39.354  1.00 105.42 ?  258  ARG A HH21 1 
ATOM   2049 H  HH22 . ARG A 1 145 ? 30.209  -0.751  39.743  1.00 105.42 ?  258  ARG A HH22 1 
ATOM   2050 N  N    . VAL A 1 146 ? 30.814  -7.854  36.380  1.00 44.68  ?  259  VAL A N    1 
ATOM   2051 C  CA   . VAL A 1 146 ? 31.355  -8.304  35.104  1.00 40.83  ?  259  VAL A CA   1 
ATOM   2052 C  C    . VAL A 1 146 ? 31.184  -7.240  34.028  1.00 37.49  ?  259  VAL A C    1 
ATOM   2053 O  O    . VAL A 1 146 ? 32.108  -6.984  33.257  1.00 35.08  ?  259  VAL A O    1 
ATOM   2054 C  CB   . VAL A 1 146 ? 30.684  -9.630  34.695  1.00 38.33  ?  259  VAL A CB   1 
ATOM   2055 C  CG1  . VAL A 1 146 ? 31.196  -10.092 33.337  1.00 36.40  ?  259  VAL A CG1  1 
ATOM   2056 C  CG2  . VAL A 1 146 ? 30.928  -10.693 35.751  1.00 40.29  ?  259  VAL A CG2  1 
ATOM   2057 H  H    . VAL A 1 146 ? 30.001  -8.094  36.524  1.00 53.60  ?  259  VAL A H    1 
ATOM   2058 H  HA   . VAL A 1 146 ? 32.306  -8.467  35.208  1.00 48.98  ?  259  VAL A HA   1 
ATOM   2059 H  HB   . VAL A 1 146 ? 29.727  -9.489  34.622  1.00 45.99  ?  259  VAL A HB   1 
ATOM   2060 H  HG11 . VAL A 1 146 ? 30.931  -11.015 33.197  1.00 43.67  ?  259  VAL A HG11 1 
ATOM   2061 H  HG12 . VAL A 1 146 ? 30.812  -9.530  32.647  1.00 43.67  ?  259  VAL A HG12 1 
ATOM   2062 H  HG13 . VAL A 1 146 ? 32.163  -10.020 33.323  1.00 43.67  ?  259  VAL A HG13 1 
ATOM   2063 H  HG21 . VAL A 1 146 ? 30.556  -11.534 35.444  1.00 48.34  ?  259  VAL A HG21 1 
ATOM   2064 H  HG22 . VAL A 1 146 ? 31.884  -10.786 35.890  1.00 48.34  ?  259  VAL A HG22 1 
ATOM   2065 H  HG23 . VAL A 1 146 ? 30.498  -10.422 36.577  1.00 48.34  ?  259  VAL A HG23 1 
ATOM   2066 N  N    . ALA A 1 147 ? 30.012  -6.607  33.962  1.00 37.42  ?  260  ALA A N    1 
ATOM   2067 C  CA   . ALA A 1 147 ? 29.768  -5.621  32.917  1.00 36.71  ?  260  ALA A CA   1 
ATOM   2068 C  C    . ALA A 1 147 ? 30.766  -4.465  32.943  1.00 35.41  ?  260  ALA A C    1 
ATOM   2069 O  O    . ALA A 1 147 ? 31.204  -4.041  31.859  1.00 33.31  ?  260  ALA A O    1 
ATOM   2070 C  CB   . ALA A 1 147 ? 28.328  -5.105  33.030  1.00 37.09  ?  260  ALA A CB   1 
ATOM   2071 H  H    . ALA A 1 147 ? 29.352  -6.728  34.500  1.00 44.89  ?  260  ALA A H    1 
ATOM   2072 H  HA   . ALA A 1 147 ? 29.865  -6.063  32.059  1.00 44.04  ?  260  ALA A HA   1 
ATOM   2073 H  HB1  . ALA A 1 147 ? 28.174  -4.444  32.337  1.00 44.49  ?  260  ALA A HB1  1 
ATOM   2074 H  HB2  . ALA A 1 147 ? 27.716  -5.849  32.918  1.00 44.49  ?  260  ALA A HB2  1 
ATOM   2075 H  HB3  . ALA A 1 147 ? 28.204  -4.703  33.904  1.00 44.49  ?  260  ALA A HB3  1 
ATOM   2076 N  N    . PRO A 1 148 ? 31.147  -3.906  34.099  1.00 37.16  ?  261  PRO A N    1 
ATOM   2077 C  CA   . PRO A 1 148 ? 32.143  -2.816  34.073  1.00 35.47  ?  261  PRO A CA   1 
ATOM   2078 C  C    . PRO A 1 148 ? 33.474  -3.258  33.495  1.00 35.93  ?  261  PRO A C    1 
ATOM   2079 O  O    . PRO A 1 148 ? 34.116  -2.493  32.766  1.00 33.49  ?  261  PRO A O    1 
ATOM   2080 C  CB   . PRO A 1 148 ? 32.271  -2.416  35.553  1.00 40.06  ?  261  PRO A CB   1 
ATOM   2081 C  CG   . PRO A 1 148 ? 31.024  -2.953  36.226  1.00 41.21  ?  261  PRO A CG   1 
ATOM   2082 C  CD   . PRO A 1 148 ? 30.671  -4.201  35.464  1.00 39.13  ?  261  PRO A CD   1 
ATOM   2083 H  HA   . PRO A 1 148 ? 31.798  -2.062  33.570  1.00 42.54  ?  261  PRO A HA   1 
ATOM   2084 H  HB2  . PRO A 1 148 ? 33.068  -2.817  35.933  1.00 48.06  ?  261  PRO A HB2  1 
ATOM   2085 H  HB3  . PRO A 1 148 ? 32.317  -1.450  35.629  1.00 48.06  ?  261  PRO A HB3  1 
ATOM   2086 H  HG2  . PRO A 1 148 ? 31.212  -3.156  37.155  1.00 49.44  ?  261  PRO A HG2  1 
ATOM   2087 H  HG3  . PRO A 1 148 ? 30.310  -2.299  36.167  1.00 49.44  ?  261  PRO A HG3  1 
ATOM   2088 H  HD2  . PRO A 1 148 ? 31.132  -4.972  35.832  1.00 46.95  ?  261  PRO A HD2  1 
ATOM   2089 H  HD3  . PRO A 1 148 ? 29.713  -4.352  35.472  1.00 46.95  ?  261  PRO A HD3  1 
ATOM   2090 N  N    . VAL A 1 149 ? 33.910  -4.480  33.813  1.00 35.09  ?  262  VAL A N    1 
ATOM   2091 C  CA   . VAL A 1 149 ? 35.148  -5.000  33.245  1.00 34.77  ?  262  VAL A CA   1 
ATOM   2092 C  C    . VAL A 1 149 ? 34.998  -5.166  31.737  1.00 32.43  ?  262  VAL A C    1 
ATOM   2093 O  O    . VAL A 1 149 ? 35.918  -4.873  30.971  1.00 29.82  ?  262  VAL A O    1 
ATOM   2094 C  CB   . VAL A 1 149 ? 35.531  -6.329  33.924  1.00 35.84  ?  262  VAL A CB   1 
ATOM   2095 C  CG1  . VAL A 1 149 ? 36.896  -6.808  33.426  1.00 37.22  ?  262  VAL A CG1  1 
ATOM   2096 C  CG2  . VAL A 1 149 ? 35.538  -6.172  35.429  1.00 40.70  ?  262  VAL A CG2  1 
ATOM   2097 H  H    . VAL A 1 149 ? 33.511  -5.022  34.349  1.00 42.10  ?  262  VAL A H    1 
ATOM   2098 H  HA   . VAL A 1 149 ? 35.861  -4.364  33.412  1.00 41.71  ?  262  VAL A HA   1 
ATOM   2099 H  HB   . VAL A 1 149 ? 34.871  -7.002  33.694  1.00 43.00  ?  262  VAL A HB   1 
ATOM   2100 H  HG11 . VAL A 1 149 ? 37.138  -7.619  33.900  1.00 44.65  ?  262  VAL A HG11 1 
ATOM   2101 H  HG12 . VAL A 1 149 ? 36.841  -6.984  32.474  1.00 44.65  ?  262  VAL A HG12 1 
ATOM   2102 H  HG13 . VAL A 1 149 ? 37.555  -6.116  33.597  1.00 44.65  ?  262  VAL A HG13 1 
ATOM   2103 H  HG21 . VAL A 1 149 ? 35.925  -6.967  35.828  1.00 48.82  ?  262  VAL A HG21 1 
ATOM   2104 H  HG22 . VAL A 1 149 ? 36.067  -5.394  35.663  1.00 48.82  ?  262  VAL A HG22 1 
ATOM   2105 H  HG23 . VAL A 1 149 ? 34.626  -6.057  35.739  1.00 48.82  ?  262  VAL A HG23 1 
ATOM   2106 N  N    . LEU A 1 150 ? 33.837  -5.650  31.289  1.00 32.41  ?  263  LEU A N    1 
ATOM   2107 C  CA   . LEU A 1 150 ? 33.585  -5.772  29.858  1.00 31.09  ?  263  LEU A CA   1 
ATOM   2108 C  C    . LEU A 1 150 ? 33.714  -4.423  29.159  1.00 28.10  ?  263  LEU A C    1 
ATOM   2109 O  O    . LEU A 1 150 ? 34.307  -4.324  28.078  1.00 30.95  ?  263  LEU A O    1 
ATOM   2110 C  CB   . LEU A 1 150 ? 32.195  -6.356  29.628  1.00 28.82  ?  263  LEU A CB   1 
ATOM   2111 C  CG   . LEU A 1 150 ? 32.083  -7.862  29.497  1.00 30.53  ?  263  LEU A CG   1 
ATOM   2112 C  CD1  . LEU A 1 150 ? 30.645  -8.291  29.663  1.00 33.00  ?  263  LEU A CD1  1 
ATOM   2113 C  CD2  . LEU A 1 150 ? 32.621  -8.300  28.143  1.00 32.29  ?  263  LEU A CD2  1 
ATOM   2114 H  H    . LEU A 1 150 ? 33.186  -5.911  31.787  1.00 38.88  ?  263  LEU A H    1 
ATOM   2115 H  HA   . LEU A 1 150 ? 34.240  -6.376  29.473  1.00 37.30  ?  263  LEU A HA   1 
ATOM   2116 H  HB2  . LEU A 1 150 ? 31.637  -6.096  30.377  1.00 34.57  ?  263  LEU A HB2  1 
ATOM   2117 H  HB3  . LEU A 1 150 ? 31.846  -5.976  28.807  1.00 34.57  ?  263  LEU A HB3  1 
ATOM   2118 H  HG   . LEU A 1 150 ? 32.607  -8.294  30.190  1.00 36.62  ?  263  LEU A HG   1 
ATOM   2119 H  HD11 . LEU A 1 150 ? 30.589  -9.254  29.560  1.00 39.59  ?  263  LEU A HD11 1 
ATOM   2120 H  HD12 . LEU A 1 150 ? 30.338  -8.034  30.546  1.00 39.59  ?  263  LEU A HD12 1 
ATOM   2121 H  HD13 . LEU A 1 150 ? 30.105  -7.854  28.985  1.00 39.59  ?  263  LEU A HD13 1 
ATOM   2122 H  HD21 . LEU A 1 150 ? 32.499  -9.257  28.049  1.00 38.73  ?  263  LEU A HD21 1 
ATOM   2123 H  HD22 . LEU A 1 150 ? 32.135  -7.834  27.445  1.00 38.73  ?  263  LEU A HD22 1 
ATOM   2124 H  HD23 . LEU A 1 150 ? 33.565  -8.080  28.092  1.00 38.73  ?  263  LEU A HD23 1 
ATOM   2125 N  N    . ILE A 1 151 ? 33.164  -3.376  29.765  1.00 28.74  ?  264  ILE A N    1 
ATOM   2126 C  CA   . ILE A 1 151 ? 33.229  -2.039  29.177  1.00 30.51  ?  264  ILE A CA   1 
ATOM   2127 C  C    . ILE A 1 151 ? 34.672  -1.556  29.118  1.00 28.66  ?  264  ILE A C    1 
ATOM   2128 O  O    . ILE A 1 151 ? 35.145  -1.076  28.077  1.00 28.87  ?  264  ILE A O    1 
ATOM   2129 C  CB   . ILE A 1 151 ? 32.326  -1.070  29.966  1.00 27.98  ?  264  ILE A CB   1 
ATOM   2130 C  CG1  . ILE A 1 151 ? 30.858  -1.427  29.739  1.00 30.03  ?  264  ILE A CG1  1 
ATOM   2131 C  CG2  . ILE A 1 151 ? 32.582  0.381   29.557  1.00 30.03  ?  264  ILE A CG2  1 
ATOM   2132 C  CD1  . ILE A 1 151 ? 29.884  -0.748  30.705  1.00 27.02  ?  264  ILE A CD1  1 
ATOM   2133 H  H    . ILE A 1 151 ? 32.747  -3.409  30.517  1.00 34.47  ?  264  ILE A H    1 
ATOM   2134 H  HA   . ILE A 1 151 ? 32.898  -2.078  28.266  1.00 36.60  ?  264  ILE A HA   1 
ATOM   2135 H  HB   . ILE A 1 151 ? 32.539  -1.161  30.908  1.00 33.56  ?  264  ILE A HB   1 
ATOM   2136 H  HG12 . ILE A 1 151 ? 30.611  -1.163  28.839  1.00 36.02  ?  264  ILE A HG12 1 
ATOM   2137 H  HG13 . ILE A 1 151 ? 30.754  -2.386  29.844  1.00 36.02  ?  264  ILE A HG13 1 
ATOM   2138 H  HG21 . ILE A 1 151 ? 31.861  0.936   29.894  1.00 36.02  ?  264  ILE A HG21 1 
ATOM   2139 H  HG22 . ILE A 1 151 ? 33.427  0.672   29.934  1.00 36.02  ?  264  ILE A HG22 1 
ATOM   2140 H  HG23 . ILE A 1 151 ? 32.616  0.435   28.589  1.00 36.02  ?  264  ILE A HG23 1 
ATOM   2141 H  HD11 . ILE A 1 151 ? 29.006  -1.146  30.599  1.00 32.41  ?  264  ILE A HD11 1 
ATOM   2142 H  HD12 . ILE A 1 151 ? 30.199  -0.878  31.613  1.00 32.41  ?  264  ILE A HD12 1 
ATOM   2143 H  HD13 . ILE A 1 151 ? 29.846  0.199   30.500  1.00 32.41  ?  264  ILE A HD13 1 
ATOM   2144 N  N    . ARG A 1 152 ? 35.399  -1.687  30.231  1.00 30.03  ?  265  ARG A N    1 
ATOM   2145 C  CA   . ARG A 1 152 ? 36.814  -1.309  30.240  1.00 33.44  ?  265  ARG A CA   1 
ATOM   2146 C  C    . ARG A 1 152 ? 37.599  -2.050  29.169  1.00 33.45  ?  265  ARG A C    1 
ATOM   2147 O  O    . ARG A 1 152 ? 38.454  -1.464  28.493  1.00 30.85  ?  265  ARG A O    1 
ATOM   2148 C  CB   . ARG A 1 152 ? 37.451  -1.620  31.593  1.00 36.73  ?  265  ARG A CB   1 
ATOM   2149 C  CG   . ARG A 1 152 ? 37.089  -0.719  32.721  1.00 45.01  ?  265  ARG A CG   1 
ATOM   2150 C  CD   . ARG A 1 152 ? 37.731  -1.266  33.979  1.00 50.96  ?  265  ARG A CD   1 
ATOM   2151 N  NE   . ARG A 1 152 ? 36.806  -1.237  35.109  1.00 61.01  ?  265  ARG A NE   1 
ATOM   2152 C  CZ   . ARG A 1 152 ? 36.869  -2.066  36.144  1.00 62.27  ?  265  ARG A CZ   1 
ATOM   2153 N  NH1  . ARG A 1 152 ? 37.808  -3.003  36.194  1.00 63.15  ?  265  ARG A NH1  1 
ATOM   2154 N  NH2  . ARG A 1 152 ? 35.988  -1.957  37.125  1.00 62.98  ?  265  ARG A NH2  1 
ATOM   2155 H  H    . ARG A 1 152 ? 35.104  -1.987  30.982  1.00 36.02  ?  265  ARG A H    1 
ATOM   2156 H  HA   . ARG A 1 152 ? 36.855  -0.354  30.077  1.00 40.12  ?  265  ARG A HA   1 
ATOM   2157 H  HB2  . ARG A 1 152 ? 37.189  -2.518  31.850  1.00 44.06  ?  265  ARG A HB2  1 
ATOM   2158 H  HB3  . ARG A 1 152 ? 38.415  -1.573  31.489  1.00 44.06  ?  265  ARG A HB3  1 
ATOM   2159 H  HG2  . ARG A 1 152 ? 37.423  0.177   32.555  1.00 54.00  ?  265  ARG A HG2  1 
ATOM   2160 H  HG3  . ARG A 1 152 ? 36.126  -0.698  32.836  1.00 54.00  ?  265  ARG A HG3  1 
ATOM   2161 H  HD2  . ARG A 1 152 ? 38.000  -2.185  33.829  1.00 61.14  ?  265  ARG A HD2  1 
ATOM   2162 H  HD3  . ARG A 1 152 ? 38.505  -0.727  34.205  1.00 61.14  ?  265  ARG A HD3  1 
ATOM   2163 H  HE   . ARG A 1 152 ? 36.181  -0.646  35.103  1.00 73.19  ?  265  ARG A HE   1 
ATOM   2164 H  HH11 . ARG A 1 152 ? 38.379  -3.074  35.555  1.00 75.76  ?  265  ARG A HH11 1 
ATOM   2165 H  HH12 . ARG A 1 152 ? 37.846  -3.538  36.866  1.00 75.76  ?  265  ARG A HH12 1 
ATOM   2166 H  HH21 . ARG A 1 152 ? 35.378  -1.352  37.090  1.00 75.56  ?  265  ARG A HH21 1 
ATOM   2167 H  HH22 . ARG A 1 152 ? 36.025  -2.492  37.797  1.00 75.56  ?  265  ARG A HH22 1 
ATOM   2168 N  N    . GLU A 1 153 ? 37.359  -3.360  29.035  1.00 31.29  ?  266  GLU A N    1 
ATOM   2169 C  CA   . GLU A 1 153 ? 38.187  -4.176  28.160  1.00 28.88  ?  266  GLU A CA   1 
ATOM   2170 C  C    . GLU A 1 153 ? 37.909  -3.862  26.703  1.00 28.77  ?  266  GLU A C    1 
ATOM   2171 O  O    . GLU A 1 153 ? 38.834  -3.819  25.887  1.00 31.23  ?  266  GLU A O    1 
ATOM   2172 C  CB   . GLU A 1 153 ? 37.954  -5.656  28.451  1.00 27.15  ?  266  GLU A CB   1 
ATOM   2173 C  CG   . GLU A 1 153 ? 38.686  -6.610  27.521  1.00 30.55  ?  266  GLU A CG   1 
ATOM   2174 C  CD   . GLU A 1 153 ? 40.206  -6.586  27.694  1.00 32.28  ?  266  GLU A CD   1 
ATOM   2175 O  OE1  . GLU A 1 153 ? 40.700  -5.917  28.630  1.00 31.79  ?  266  GLU A OE1  1 
ATOM   2176 O  OE2  . GLU A 1 153 ? 40.890  -7.237  26.884  1.00 29.36  ?  266  GLU A OE2  1 
ATOM   2177 H  H    . GLU A 1 153 ? 36.732  -3.791  29.435  1.00 37.53  ?  266  GLU A H    1 
ATOM   2178 H  HA   . GLU A 1 153 ? 39.122  -3.985  28.335  1.00 34.64  ?  266  GLU A HA   1 
ATOM   2179 H  HB2  . GLU A 1 153 ? 38.253  -5.843  29.355  1.00 32.57  ?  266  GLU A HB2  1 
ATOM   2180 H  HB3  . GLU A 1 153 ? 37.005  -5.840  28.371  1.00 32.57  ?  266  GLU A HB3  1 
ATOM   2181 H  HG2  . GLU A 1 153 ? 38.382  -7.514  27.697  1.00 36.64  ?  266  GLU A HG2  1 
ATOM   2182 H  HG3  . GLU A 1 153 ? 38.488  -6.366  26.604  1.00 36.64  ?  266  GLU A HG3  1 
ATOM   2183 N  N    . ILE A 1 154 ? 36.643  -3.649  26.346  1.00 29.07  ?  267  ILE A N    1 
ATOM   2184 C  CA   . ILE A 1 154 ? 36.361  -3.255  24.971  1.00 28.54  ?  267  ILE A CA   1 
ATOM   2185 C  C    . ILE A 1 154 ? 36.941  -1.866  24.699  1.00 29.88  ?  267  ILE A C    1 
ATOM   2186 O  O    . ILE A 1 154 ? 37.418  -1.582  23.595  1.00 27.88  ?  267  ILE A O    1 
ATOM   2187 C  CB   . ILE A 1 154 ? 34.852  -3.321  24.681  1.00 28.97  ?  267  ILE A CB   1 
ATOM   2188 C  CG1  . ILE A 1 154 ? 34.625  -3.313  23.164  1.00 27.37  ?  267  ILE A CG1  1 
ATOM   2189 C  CG2  . ILE A 1 154 ? 34.114  -2.160  25.354  1.00 27.51  ?  267  ILE A CG2  1 
ATOM   2190 C  CD1  . ILE A 1 154 ? 35.302  -4.480  22.419  1.00 27.83  ?  267  ILE A CD1  1 
ATOM   2191 H  H    . ILE A 1 154 ? 35.956  -3.723  26.859  1.00 34.87  ?  267  ILE A H    1 
ATOM   2192 H  HA   . ILE A 1 154 ? 36.793  -3.885  24.373  1.00 34.23  ?  267  ILE A HA   1 
ATOM   2193 H  HB   . ILE A 1 154 ? 34.496  -4.146  25.048  1.00 34.75  ?  267  ILE A HB   1 
ATOM   2194 H  HG12 . ILE A 1 154 ? 33.672  -3.367  22.992  1.00 32.82  ?  267  ILE A HG12 1 
ATOM   2195 H  HG13 . ILE A 1 154 ? 34.981  -2.486  22.802  1.00 32.82  ?  267  ILE A HG13 1 
ATOM   2196 H  HG21 . ILE A 1 154 ? 33.165  -2.242  25.174  1.00 33.00  ?  267  ILE A HG21 1 
ATOM   2197 H  HG22 . ILE A 1 154 ? 34.274  -2.197  26.311  1.00 33.00  ?  267  ILE A HG22 1 
ATOM   2198 H  HG23 . ILE A 1 154 ? 34.448  -1.324  24.995  1.00 33.00  ?  267  ILE A HG23 1 
ATOM   2199 H  HD11 . ILE A 1 154 ? 34.862  -4.606  21.563  1.00 33.38  ?  267  ILE A HD11 1 
ATOM   2200 H  HD12 . ILE A 1 154 ? 36.238  -4.267  22.281  1.00 33.38  ?  267  ILE A HD12 1 
ATOM   2201 H  HD13 . ILE A 1 154 ? 35.221  -5.285  22.954  1.00 33.38  ?  267  ILE A HD13 1 
ATOM   2202 N  N    . THR A 1 155 ? 36.919  -0.978  25.700  1.00 30.27  ?  268  THR A N    1 
ATOM   2203 C  CA   . THR A 1 155 ? 37.545  0.329   25.524  1.00 29.52  ?  268  THR A CA   1 
ATOM   2204 C  C    . THR A 1 155 ? 39.035  0.174   25.245  1.00 29.42  ?  268  THR A C    1 
ATOM   2205 O  O    . THR A 1 155 ? 39.579  0.821   24.351  1.00 29.84  ?  268  THR A O    1 
ATOM   2206 C  CB   . THR A 1 155 ? 37.323  1.205   26.757  1.00 29.96  ?  268  THR A CB   1 
ATOM   2207 O  OG1  . THR A 1 155 ? 35.921  1.432   26.958  1.00 31.24  ?  268  THR A OG1  1 
ATOM   2208 C  CG2  . THR A 1 155 ? 38.028  2.551   26.579  1.00 31.54  ?  268  THR A CG2  1 
ATOM   2209 H  H    . THR A 1 155 ? 36.558  -1.105  26.470  1.00 36.31  ?  268  THR A H    1 
ATOM   2210 H  HA   . THR A 1 155 ? 37.129  0.772   24.769  1.00 35.41  ?  268  THR A HA   1 
ATOM   2211 H  HB   . THR A 1 155 ? 37.686  0.757   27.537  1.00 35.94  ?  268  THR A HB   1 
ATOM   2212 H  HG1  . THR A 1 155 ? 35.525  0.700   27.071  1.00 37.47  ?  268  THR A HG1  1 
ATOM   2213 H  HG21 . THR A 1 155 ? 37.694  3.188   27.230  1.00 37.83  ?  268  THR A HG21 1 
ATOM   2214 H  HG22 . THR A 1 155 ? 38.984  2.444   26.704  1.00 37.83  ?  268  THR A HG22 1 
ATOM   2215 H  HG23 . THR A 1 155 ? 37.863  2.896   25.687  1.00 37.83  ?  268  THR A HG23 1 
ATOM   2216 N  N    . ARG A 1 156 ? 39.707  -0.680  26.013  1.00 28.23  ?  269  ARG A N    1 
ATOM   2217 C  CA   . ARG A 1 156 ? 41.130  -0.919  25.819  1.00 30.95  ?  269  ARG A CA   1 
ATOM   2218 C  C    . ARG A 1 156 ? 41.406  -1.465  24.423  1.00 29.74  ?  269  ARG A C    1 
ATOM   2219 O  O    . ARG A 1 156 ? 42.313  -0.993  23.723  1.00 29.57  ?  269  ARG A O    1 
ATOM   2220 C  CB   . ARG A 1 156 ? 41.630  -1.892  26.890  1.00 32.22  ?  269  ARG A CB   1 
ATOM   2221 C  CG   . ARG A 1 156 ? 43.134  -2.100  26.917  1.00 34.79  ?  269  ARG A CG   1 
ATOM   2222 C  CD   . ARG A 1 156 ? 43.506  -3.246  27.855  1.00 36.50  ?  269  ARG A CD   1 
ATOM   2223 N  NE   . ARG A 1 156 ? 43.069  -4.536  27.332  1.00 33.51  ?  269  ARG A NE   1 
ATOM   2224 C  CZ   . ARG A 1 156 ? 43.778  -5.281  26.490  1.00 37.17  ?  269  ARG A CZ   1 
ATOM   2225 N  NH1  . ARG A 1 156 ? 43.299  -6.441  26.058  1.00 35.97  ?  269  ARG A NH1  1 
ATOM   2226 N  NH2  . ARG A 1 156 ? 44.970  -4.867  26.077  1.00 37.31  ?  269  ARG A NH2  1 
ATOM   2227 H  H    . ARG A 1 156 ? 39.362  -1.137  26.655  1.00 33.86  ?  269  ARG A H    1 
ATOM   2228 H  HA   . ARG A 1 156 ? 41.613  -0.083  25.913  1.00 37.13  ?  269  ARG A HA   1 
ATOM   2229 H  HB2  . ARG A 1 156 ? 41.367  -1.552  27.760  1.00 38.64  ?  269  ARG A HB2  1 
ATOM   2230 H  HB3  . ARG A 1 156 ? 41.219  -2.757  26.734  1.00 38.64  ?  269  ARG A HB3  1 
ATOM   2231 H  HG2  . ARG A 1 156 ? 43.447  -2.319  26.026  1.00 41.73  ?  269  ARG A HG2  1 
ATOM   2232 H  HG3  . ARG A 1 156 ? 43.567  -1.292  27.232  1.00 41.73  ?  269  ARG A HG3  1 
ATOM   2233 H  HD2  . ARG A 1 156 ? 44.470  -3.271  27.963  1.00 43.79  ?  269  ARG A HD2  1 
ATOM   2234 H  HD3  . ARG A 1 156 ? 43.080  -3.107  28.716  1.00 43.79  ?  269  ARG A HD3  1 
ATOM   2235 H  HE   . ARG A 1 156 ? 42.304  -4.834  27.585  1.00 40.20  ?  269  ARG A HE   1 
ATOM   2236 H  HH11 . ARG A 1 156 ? 42.528  -6.714  26.324  1.00 43.15  ?  269  ARG A HH11 1 
ATOM   2237 H  HH12 . ARG A 1 156 ? 43.761  -6.921  25.513  1.00 43.15  ?  269  ARG A HH12 1 
ATOM   2238 H  HH21 . ARG A 1 156 ? 45.285  -4.117  26.355  1.00 44.76  ?  269  ARG A HH21 1 
ATOM   2239 H  HH22 . ARG A 1 156 ? 45.427  -5.350  25.532  1.00 44.76  ?  269  ARG A HH22 1 
ATOM   2240 N  N    . ARG A 1 157 ? 40.638  -2.477  24.005  1.00 28.97  ?  270  ARG A N    1 
ATOM   2241 C  CA   . ARG A 1 157 ? 40.868  -3.082  22.698  1.00 28.33  ?  270  ARG A CA   1 
ATOM   2242 C  C    . ARG A 1 157 ? 40.592  -2.102  21.566  1.00 30.32  ?  270  ARG A C    1 
ATOM   2243 O  O    . ARG A 1 157 ? 41.253  -2.168  20.516  1.00 29.61  ?  270  ARG A O    1 
ATOM   2244 C  CB   . ARG A 1 157 ? 40.001  -4.325  22.535  1.00 27.52  ?  270  ARG A CB   1 
ATOM   2245 C  CG   . ARG A 1 157 ? 40.322  -5.411  23.545  1.00 28.26  ?  270  ARG A CG   1 
ATOM   2246 C  CD   . ARG A 1 157 ? 39.577  -6.691  23.242  1.00 28.48  ?  270  ARG A CD   1 
ATOM   2247 N  NE   . ARG A 1 157 ? 39.754  -7.665  24.314  1.00 31.43  ?  270  ARG A NE   1 
ATOM   2248 C  CZ   . ARG A 1 157 ? 39.382  -8.940  24.229  1.00 33.97  ?  270  ARG A CZ   1 
ATOM   2249 N  NH1  . ARG A 1 157 ? 38.820  -9.386  23.118  1.00 31.44  ?  270  ARG A NH1  1 
ATOM   2250 N  NH2  . ARG A 1 157 ? 39.576  -9.757  25.253  1.00 32.72  ?  270  ARG A NH2  1 
ATOM   2251 H  H    . ARG A 1 157 ? 39.990  -2.825  24.451  1.00 34.75  ?  270  ARG A H    1 
ATOM   2252 H  HA   . ARG A 1 157 ? 41.798  -3.351  22.643  1.00 33.98  ?  270  ARG A HA   1 
ATOM   2253 H  HB2  . ARG A 1 157 ? 39.070  -4.076  22.650  1.00 33.01  ?  270  ARG A HB2  1 
ATOM   2254 H  HB3  . ARG A 1 157 ? 40.140  -4.691  21.648  1.00 33.01  ?  270  ARG A HB3  1 
ATOM   2255 H  HG2  . ARG A 1 157 ? 41.273  -5.599  23.522  1.00 33.90  ?  270  ARG A HG2  1 
ATOM   2256 H  HG3  . ARG A 1 157 ? 40.064  -5.111  24.431  1.00 33.90  ?  270  ARG A HG3  1 
ATOM   2257 H  HD2  . ARG A 1 157 ? 38.630  -6.500  23.153  1.00 34.16  ?  270  ARG A HD2  1 
ATOM   2258 H  HD3  . ARG A 1 157 ? 39.917  -7.075  22.418  1.00 34.16  ?  270  ARG A HD3  1 
ATOM   2259 H  HE   . ARG A 1 157 ? 40.122  -7.399  25.045  1.00 37.71  ?  270  ARG A HE   1 
ATOM   2260 H  HH11 . ARG A 1 157 ? 38.696  -8.854  22.454  1.00 37.71  ?  270  ARG A HH11 1 
ATOM   2261 H  HH12 . ARG A 1 157 ? 38.578  -10.210 23.060  1.00 37.71  ?  270  ARG A HH12 1 
ATOM   2262 H  HH21 . ARG A 1 157 ? 39.943  -9.464  25.973  1.00 39.25  ?  270  ARG A HH21 1 
ATOM   2263 H  HH22 . ARG A 1 157 ? 39.335  -10.581 25.197  1.00 39.25  ?  270  ARG A HH22 1 
ATOM   2264 N  N    . VAL A 1 158 ? 39.630  -1.195  21.749  1.00 27.84  ?  271  VAL A N    1 
ATOM   2265 C  CA   . VAL A 1 158 ? 39.368  -0.184  20.725  1.00 29.80  ?  271  VAL A CA   1 
ATOM   2266 C  C    . VAL A 1 158 ? 40.484  0.856   20.699  1.00 28.75  ?  271  VAL A C    1 
ATOM   2267 O  O    . VAL A 1 158 ? 40.944  1.261   19.628  1.00 28.35  ?  271  VAL A O    1 
ATOM   2268 C  CB   . VAL A 1 158 ? 37.986  0.459   20.960  1.00 28.67  ?  271  VAL A CB   1 
ATOM   2269 C  CG1  . VAL A 1 158 ? 37.767  1.627   20.001  1.00 30.65  ?  271  VAL A CG1  1 
ATOM   2270 C  CG2  . VAL A 1 158 ? 36.898  -0.591  20.786  1.00 28.70  ?  271  VAL A CG2  1 
ATOM   2271 H  H    . VAL A 1 158 ? 39.124  -1.142  22.443  1.00 33.39  ?  271  VAL A H    1 
ATOM   2272 H  HA   . VAL A 1 158 ? 39.353  -0.618  19.858  1.00 35.74  ?  271  VAL A HA   1 
ATOM   2273 H  HB   . VAL A 1 158 ? 37.941  0.807   21.864  1.00 34.39  ?  271  VAL A HB   1 
ATOM   2274 H  HG11 . VAL A 1 158 ? 36.828  1.867   20.005  1.00 36.76  ?  271  VAL A HG11 1 
ATOM   2275 H  HG12 . VAL A 1 158 ? 38.303  2.380   20.294  1.00 36.76  ?  271  VAL A HG12 1 
ATOM   2276 H  HG13 . VAL A 1 158 ? 38.036  1.357   19.109  1.00 36.76  ?  271  VAL A HG13 1 
ATOM   2277 H  HG21 . VAL A 1 158 ? 36.071  -0.254  21.164  1.00 34.43  ?  271  VAL A HG21 1 
ATOM   2278 H  HG22 . VAL A 1 158 ? 36.780  -0.770  19.840  1.00 34.43  ?  271  VAL A HG22 1 
ATOM   2279 H  HG23 . VAL A 1 158 ? 37.165  -1.402  21.246  1.00 34.43  ?  271  VAL A HG23 1 
ATOM   2280 N  N    . ASN A 1 159 ? 40.936  1.299   21.873  1.00 28.28  ?  272  ASN A N    1 
ATOM   2281 C  CA   . ASN A 1 159 ? 42.016  2.271   21.929  1.00 32.02  ?  272  ASN A CA   1 
ATOM   2282 C  C    . ASN A 1 159 ? 43.266  1.739   21.244  1.00 33.16  ?  272  ASN A C    1 
ATOM   2283 O  O    . ASN A 1 159 ? 43.929  2.473   20.490  1.00 32.28  ?  272  ASN A O    1 
ATOM   2284 C  CB   . ASN A 1 159 ? 42.335  2.640   23.381  1.00 34.18  ?  272  ASN A CB   1 
ATOM   2285 C  CG   . ASN A 1 159 ? 41.246  3.464   24.037  1.00 30.49  ?  272  ASN A CG   1 
ATOM   2286 O  OD1  . ASN A 1 159 ? 40.334  3.970   23.371  1.00 32.50  ?  272  ASN A OD1  1 
ATOM   2287 N  ND2  . ASN A 1 159 ? 41.353  3.640   25.341  1.00 27.46  ?  272  ASN A ND2  1 
ATOM   2288 H  H    . ASN A 1 159 ? 40.637  1.056   22.641  1.00 33.92  ?  272  ASN A H    1 
ATOM   2289 H  HA   . ASN A 1 159 ? 41.726  3.075   21.471  1.00 38.41  ?  272  ASN A HA   1 
ATOM   2290 H  HB2  . ASN A 1 159 ? 42.445  1.826   23.896  1.00 41.00  ?  272  ASN A HB2  1 
ATOM   2291 H  HB3  . ASN A 1 159 ? 43.155  3.159   23.401  1.00 41.00  ?  272  ASN A HB3  1 
ATOM   2292 H  HD21 . ASN A 1 159 ? 40.761  4.100   25.763  1.00 32.93  ?  272  ASN A HD21 1 
ATOM   2293 H  HD22 . ASN A 1 159 ? 42.014  3.295   25.769  1.00 32.93  ?  272  ASN A HD22 1 
ATOM   2294 N  N    . LEU A 1 160 ? 43.609  0.466   21.494  1.00 32.92  ?  273  LEU A N    1 
ATOM   2295 C  CA   . LEU A 1 160 ? 44.815  -0.096  20.905  1.00 31.75  ?  273  LEU A CA   1 
ATOM   2296 C  C    . LEU A 1 160 ? 44.747  -0.135  19.385  1.00 34.28  ?  273  LEU A C    1 
ATOM   2297 O  O    . LEU A 1 160 ? 45.784  -0.320  18.734  1.00 35.12  ?  273  LEU A O    1 
ATOM   2298 C  CB   . LEU A 1 160 ? 45.072  -1.517  21.433  1.00 32.92  ?  273  LEU A CB   1 
ATOM   2299 C  CG   . LEU A 1 160 ? 45.590  -1.608  22.873  1.00 34.80  ?  273  LEU A CG   1 
ATOM   2300 C  CD1  . LEU A 1 160 ? 45.740  -3.059  23.308  1.00 38.36  ?  273  LEU A CD1  1 
ATOM   2301 C  CD2  . LEU A 1 160 ? 46.912  -0.858  23.015  1.00 40.95  ?  273  LEU A CD2  1 
ATOM   2302 H  H    . LEU A 1 160 ? 43.165  -0.078  21.991  1.00 39.49  ?  273  LEU A H    1 
ATOM   2303 H  HA   . LEU A 1 160 ? 45.564  0.461   21.169  1.00 38.08  ?  273  LEU A HA   1 
ATOM   2304 H  HB2  . LEU A 1 160 ? 44.237  -2.010  21.396  1.00 39.49  ?  273  LEU A HB2  1 
ATOM   2305 H  HB3  . LEU A 1 160 ? 45.733  -1.939  20.862  1.00 39.49  ?  273  LEU A HB3  1 
ATOM   2306 H  HG   . LEU A 1 160 ? 44.944  -1.191  23.464  1.00 41.74  ?  273  LEU A HG   1 
ATOM   2307 H  HD11 . LEU A 1 160 ? 46.063  -3.083  24.222  1.00 46.01  ?  273  LEU A HD11 1 
ATOM   2308 H  HD12 . LEU A 1 160 ? 44.877  -3.497  23.250  1.00 46.01  ?  273  LEU A HD12 1 
ATOM   2309 H  HD13 . LEU A 1 160 ? 46.375  -3.501  22.722  1.00 46.01  ?  273  LEU A HD13 1 
ATOM   2310 H  HD21 . LEU A 1 160 ? 47.329  -1.109  23.854  1.00 49.13  ?  273  LEU A HD21 1 
ATOM   2311 H  HD22 . LEU A 1 160 ? 47.491  -1.095  22.274  1.00 49.13  ?  273  LEU A HD22 1 
ATOM   2312 H  HD23 . LEU A 1 160 ? 46.737  0.096   23.005  1.00 49.13  ?  273  LEU A HD23 1 
ATOM   2313 N  N    . GLU A 1 161 ? 43.559  0.018   18.807  1.00 30.09  ?  274  GLU A N    1 
ATOM   2314 C  CA   . GLU A 1 161 ? 43.410  0.153   17.363  1.00 28.68  ?  274  GLU A CA   1 
ATOM   2315 C  C    . GLU A 1 161 ? 43.414  1.611   16.927  1.00 28.21  ?  274  GLU A C    1 
ATOM   2316 O  O    . GLU A 1 161 ? 43.207  1.891   15.744  1.00 31.42  ?  274  GLU A O    1 
ATOM   2317 C  CB   . GLU A 1 161 ? 42.131  -0.525  16.876  1.00 28.88  ?  274  GLU A CB   1 
ATOM   2318 C  CG   . GLU A 1 161 ? 42.014  -2.006  17.234  1.00 28.17  ?  274  GLU A CG   1 
ATOM   2319 C  CD   . GLU A 1 161 ? 43.004  -2.876  16.476  1.00 35.52  ?  274  GLU A CD   1 
ATOM   2320 O  OE1  . GLU A 1 161 ? 43.465  -2.464  15.384  1.00 36.61  ?  274  GLU A OE1  1 
ATOM   2321 O  OE2  . GLU A 1 161 ? 43.328  -3.968  16.971  1.00 34.66  ?  274  GLU A OE2  1 
ATOM   2322 H  H    . GLU A 1 161 ? 42.816  0.047   19.237  1.00 36.09  ?  274  GLU A H    1 
ATOM   2323 H  HA   . GLU A 1 161 ? 44.149  -0.304  16.932  1.00 34.40  ?  274  GLU A HA   1 
ATOM   2324 H  HB2  . GLU A 1 161 ? 41.371  -0.069  17.271  1.00 34.64  ?  274  GLU A HB2  1 
ATOM   2325 H  HB3  . GLU A 1 161 ? 42.094  -0.455  15.909  1.00 34.64  ?  274  GLU A HB3  1 
ATOM   2326 H  HG2  . GLU A 1 161 ? 42.183  -2.115  18.182  1.00 33.79  ?  274  GLU A HG2  1 
ATOM   2327 H  HG3  . GLU A 1 161 ? 41.120  -2.313  17.019  1.00 33.79  ?  274  GLU A HG3  1 
ATOM   2328 N  N    . GLY A 1 162 ? 43.639  2.540   17.848  1.00 26.62  ?  275  GLY A N    1 
ATOM   2329 C  CA   . GLY A 1 162 ? 43.750  3.948   17.501  1.00 30.94  ?  275  GLY A CA   1 
ATOM   2330 C  C    . GLY A 1 162 ? 42.447  4.705   17.445  1.00 33.10  ?  275  GLY A C    1 
ATOM   2331 O  O    . GLY A 1 162 ? 42.397  5.777   16.831  1.00 33.29  ?  275  GLY A O    1 
ATOM   2332 H  H    . GLY A 1 162 ? 43.731  2.379   18.688  1.00 31.93  ?  275  GLY A H    1 
ATOM   2333 H  HA2  . GLY A 1 162 ? 44.315  4.383   18.159  1.00 37.11  ?  275  GLY A HA2  1 
ATOM   2334 H  HA3  . GLY A 1 162 ? 44.169  4.018   16.629  1.00 37.11  ?  275  GLY A HA3  1 
ATOM   2335 N  N    . ILE A 1 163 ? 41.392  4.186   18.070  1.00 30.93  ?  276  ILE A N    1 
ATOM   2336 C  CA   . ILE A 1 163 ? 40.077  4.823   18.087  1.00 30.26  ?  276  ILE A CA   1 
ATOM   2337 C  C    . ILE A 1 163 ? 39.762  5.201   19.522  1.00 27.75  ?  276  ILE A C    1 
ATOM   2338 O  O    . ILE A 1 163 ? 39.960  4.398   20.437  1.00 28.57  ?  276  ILE A O    1 
ATOM   2339 C  CB   . ILE A 1 163 ? 38.997  3.896   17.499  1.00 28.70  ?  276  ILE A CB   1 
ATOM   2340 C  CG1  . ILE A 1 163 ? 39.244  3.698   15.998  1.00 34.03  ?  276  ILE A CG1  1 
ATOM   2341 C  CG2  . ILE A 1 163 ? 37.614  4.457   17.758  1.00 31.24  ?  276  ILE A CG2  1 
ATOM   2342 C  CD1  . ILE A 1 163 ? 38.355  2.659   15.330  1.00 34.37  ?  276  ILE A CD1  1 
ATOM   2343 H  H    . ILE A 1 163 ? 41.416  3.444   18.503  1.00 37.10  ?  276  ILE A H    1 
ATOM   2344 H  HA   . ILE A 1 163 ? 40.094  5.635   17.558  1.00 36.30  ?  276  ILE A HA   1 
ATOM   2345 H  HB   . ILE A 1 163 ? 39.052  3.032   17.937  1.00 34.43  ?  276  ILE A HB   1 
ATOM   2346 H  HG12 . ILE A 1 163 ? 39.091  4.544   15.548  1.00 40.82  ?  276  ILE A HG12 1 
ATOM   2347 H  HG13 . ILE A 1 163 ? 40.164  3.417   15.872  1.00 40.82  ?  276  ILE A HG13 1 
ATOM   2348 H  HG21 . ILE A 1 163 ? 36.971  3.976   17.214  1.00 37.47  ?  276  ILE A HG21 1 
ATOM   2349 H  HG22 . ILE A 1 163 ? 37.399  4.348   18.697  1.00 37.47  ?  276  ILE A HG22 1 
ATOM   2350 H  HG23 . ILE A 1 163 ? 37.606  5.399   17.524  1.00 37.47  ?  276  ILE A HG23 1 
ATOM   2351 H  HD11 . ILE A 1 163 ? 38.668  2.511   14.424  1.00 41.23  ?  276  ILE A HD11 1 
ATOM   2352 H  HD12 . ILE A 1 163 ? 38.400  1.833   15.835  1.00 41.23  ?  276  ILE A HD12 1 
ATOM   2353 H  HD13 . ILE A 1 163 ? 37.442  2.988   15.314  1.00 41.23  ?  276  ILE A HD13 1 
ATOM   2354 N  N    . PHE A 1 164 ? 39.264  6.422   19.718  1.00 30.98  ?  277  PHE A N    1 
ATOM   2355 C  CA   . PHE A 1 164 ? 39.077  6.958   21.060  1.00 31.75  ?  277  PHE A CA   1 
ATOM   2356 C  C    . PHE A 1 164 ? 37.714  7.604   21.277  1.00 30.04  ?  277  PHE A C    1 
ATOM   2357 O  O    . PHE A 1 164 ? 37.492  8.206   22.333  1.00 31.05  ?  277  PHE A O    1 
ATOM   2358 C  CB   . PHE A 1 164 ? 40.204  7.965   21.369  1.00 35.06  ?  277  PHE A CB   1 
ATOM   2359 C  CG   . PHE A 1 164 ? 41.567  7.356   21.353  1.00 37.08  ?  277  PHE A CG   1 
ATOM   2360 C  CD1  . PHE A 1 164 ? 42.101  6.776   22.496  1.00 37.75  ?  277  PHE A CD1  1 
ATOM   2361 C  CD2  . PHE A 1 164 ? 42.315  7.332   20.191  1.00 38.97  ?  277  PHE A CD2  1 
ATOM   2362 C  CE1  . PHE A 1 164 ? 43.350  6.194   22.477  1.00 38.97  ?  277  PHE A CE1  1 
ATOM   2363 C  CE2  . PHE A 1 164 ? 43.574  6.752   20.169  1.00 39.50  ?  277  PHE A CE2  1 
ATOM   2364 C  CZ   . PHE A 1 164 ? 44.088  6.183   21.318  1.00 38.08  ?  277  PHE A CZ   1 
ATOM   2365 H  H    . PHE A 1 164 ? 39.027  6.957   19.088  1.00 37.16  ?  277  PHE A H    1 
ATOM   2366 H  HA   . PHE A 1 164 ? 39.130  6.228   21.697  1.00 38.09  ?  277  PHE A HA   1 
ATOM   2367 H  HB2  . PHE A 1 164 ? 40.185  8.670   20.703  1.00 42.06  ?  277  PHE A HB2  1 
ATOM   2368 H  HB3  . PHE A 1 164 ? 40.056  8.339   22.252  1.00 42.06  ?  277  PHE A HB3  1 
ATOM   2369 H  HD1  . PHE A 1 164 ? 41.609  6.781   23.285  1.00 45.29  ?  277  PHE A HD1  1 
ATOM   2370 H  HD2  . PHE A 1 164 ? 41.969  7.710   19.415  1.00 46.75  ?  277  PHE A HD2  1 
ATOM   2371 H  HE1  . PHE A 1 164 ? 43.693  5.808   23.251  1.00 46.75  ?  277  PHE A HE1  1 
ATOM   2372 H  HE2  . PHE A 1 164 ? 44.071  6.746   19.383  1.00 47.39  ?  277  PHE A HE2  1 
ATOM   2373 H  HZ   . PHE A 1 164 ? 44.932  5.792   21.307  1.00 45.68  ?  277  PHE A HZ   1 
ATOM   2374 N  N    . GLN A 1 165 ? 36.797  7.484   20.327  1.00 29.49  ?  278  GLN A N    1 
ATOM   2375 C  CA   . GLN A 1 165 ? 35.413  7.898   20.522  1.00 30.77  ?  278  GLN A CA   1 
ATOM   2376 C  C    . GLN A 1 165 ? 34.494  6.718   20.227  1.00 33.38  ?  278  GLN A C    1 
ATOM   2377 O  O    . GLN A 1 165 ? 34.851  5.806   19.453  1.00 27.54  ?  278  GLN A O    1 
ATOM   2378 C  CB   . GLN A 1 165 ? 35.030  9.077   19.615  1.00 29.40  ?  278  GLN A CB   1 
ATOM   2379 C  CG   . GLN A 1 165 ? 35.446  10.435  20.159  1.00 33.30  ?  278  GLN A CG   1 
ATOM   2380 C  CD   . GLN A 1 165 ? 36.939  10.691  20.017  1.00 33.96  ?  278  GLN A CD   1 
ATOM   2381 O  OE1  . GLN A 1 165 ? 37.575  10.216  19.082  1.00 33.28  ?  278  GLN A OE1  1 
ATOM   2382 N  NE2  . GLN A 1 165 ? 37.497  11.441  20.957  1.00 34.75  ?  278  GLN A NE2  1 
ATOM   2383 H  H    . GLN A 1 165 ? 36.956  7.161   19.547  1.00 35.38  ?  278  GLN A H    1 
ATOM   2384 H  HA   . GLN A 1 165 ? 35.290  8.180   21.441  1.00 36.90  ?  278  GLN A HA   1 
ATOM   2385 H  HB2  . GLN A 1 165 ? 35.460  8.960   18.753  1.00 35.26  ?  278  GLN A HB2  1 
ATOM   2386 H  HB3  . GLN A 1 165 ? 34.066  9.085   19.505  1.00 35.26  ?  278  GLN A HB3  1 
ATOM   2387 H  HG2  . GLN A 1 165 ? 34.974  11.129  19.673  1.00 39.94  ?  278  GLN A HG2  1 
ATOM   2388 H  HG3  . GLN A 1 165 ? 35.222  10.479  21.102  1.00 39.94  ?  278  GLN A HG3  1 
ATOM   2389 H  HE21 . GLN A 1 165 ? 37.018  11.752  21.600  1.00 41.69  ?  278  GLN A HE21 1 
ATOM   2390 H  HE22 . GLN A 1 165 ? 38.339  11.617  20.925  1.00 41.69  ?  278  GLN A HE22 1 
ATOM   2391 N  N    . ALA A 1 166 ? 33.304  6.731   20.838  1.00 28.46  ?  279  ALA A N    1 
ATOM   2392 C  CA   . ALA A 1 166 ? 32.330  5.693   20.536  1.00 27.83  ?  279  ALA A CA   1 
ATOM   2393 C  C    . ALA A 1 166 ? 30.936  6.294   20.484  1.00 28.92  ?  279  ALA A C    1 
ATOM   2394 O  O    . ALA A 1 166 ? 30.695  7.394   20.979  1.00 28.97  ?  279  ALA A O    1 
ATOM   2395 C  CB   . ALA A 1 166 ? 32.362  4.559   21.571  1.00 26.67  ?  279  ALA A CB   1 
ATOM   2396 H  H    . ALA A 1 166 ? 33.051  7.318   21.413  1.00 34.13  ?  279  ALA A H    1 
ATOM   2397 H  HA   . ALA A 1 166 ? 32.536  5.323   19.663  1.00 33.38  ?  279  ALA A HA   1 
ATOM   2398 H  HB1  . ALA A 1 166 ? 31.795  3.835   21.264  1.00 31.99  ?  279  ALA A HB1  1 
ATOM   2399 H  HB2  . ALA A 1 166 ? 33.275  4.247   21.669  1.00 31.99  ?  279  ALA A HB2  1 
ATOM   2400 H  HB3  . ALA A 1 166 ? 32.035  4.898   22.420  1.00 31.99  ?  279  ALA A HB3  1 
ATOM   2401 N  N    . VAL A 1 167 ? 30.013  5.556   19.870  1.00 24.94  ?  280  VAL A N    1 
ATOM   2402 C  CA   . VAL A 1 167 ? 28.593  5.887   19.926  1.00 27.99  ?  280  VAL A CA   1 
ATOM   2403 C  C    . VAL A 1 167 ? 27.835  4.634   20.325  1.00 28.33  ?  280  VAL A C    1 
ATOM   2404 O  O    . VAL A 1 167 ? 28.218  3.512   19.969  1.00 24.62  ?  280  VAL A O    1 
ATOM   2405 C  CB   . VAL A 1 167 ? 28.056  6.440   18.590  1.00 30.14  ?  280  VAL A CB   1 
ATOM   2406 C  CG1  . VAL A 1 167 ? 28.018  5.355   17.531  1.00 30.29  ?  280  VAL A CG1  1 
ATOM   2407 C  CG2  . VAL A 1 167 ? 26.668  7.049   18.791  1.00 27.57  ?  280  VAL A CG2  1 
ATOM   2408 H  H    . VAL A 1 167 ? 30.190  4.851   19.410  1.00 29.91  ?  280  VAL A H    1 
ATOM   2409 H  HA   . VAL A 1 167 ? 28.455  6.572   20.600  1.00 33.58  ?  280  VAL A HA   1 
ATOM   2410 H  HB   . VAL A 1 167 ? 28.654  7.137   18.276  1.00 36.15  ?  280  VAL A HB   1 
ATOM   2411 H  HG11 . VAL A 1 167 ? 27.927  5.769   16.659  1.00 36.33  ?  280  VAL A HG11 1 
ATOM   2412 H  HG12 . VAL A 1 167 ? 28.842  4.846   17.572  1.00 36.33  ?  280  VAL A HG12 1 
ATOM   2413 H  HG13 . VAL A 1 167 ? 27.261  4.773   17.703  1.00 36.33  ?  280  VAL A HG13 1 
ATOM   2414 H  HG21 . VAL A 1 167 ? 26.436  7.572   18.008  1.00 33.07  ?  280  VAL A HG21 1 
ATOM   2415 H  HG22 . VAL A 1 167 ? 26.024  6.333   18.913  1.00 33.07  ?  280  VAL A HG22 1 
ATOM   2416 H  HG23 . VAL A 1 167 ? 26.683  7.617   19.577  1.00 33.07  ?  280  VAL A HG23 1 
ATOM   2417 N  N    . TYR A 1 168 ? 26.757  4.828   21.087  1.00 30.53  ?  281  TYR A N    1 
ATOM   2418 C  CA   . TYR A 1 168 ? 25.940  3.688   21.495  1.00 28.28  ?  281  TYR A CA   1 
ATOM   2419 C  C    . TYR A 1 168 ? 24.581  4.176   21.972  1.00 30.13  ?  281  TYR A C    1 
ATOM   2420 O  O    . TYR A 1 168 ? 24.334  5.374   22.087  1.00 26.86  ?  281  TYR A O    1 
ATOM   2421 C  CB   . TYR A 1 168 ? 26.635  2.866   22.588  1.00 29.26  ?  281  TYR A CB   1 
ATOM   2422 C  CG   . TYR A 1 168 ? 26.926  3.619   23.871  1.00 31.82  ?  281  TYR A CG   1 
ATOM   2423 C  CD1  . TYR A 1 168 ? 28.141  4.249   24.069  1.00 33.45  ?  281  TYR A CD1  1 
ATOM   2424 C  CD2  . TYR A 1 168 ? 25.988  3.684   24.886  1.00 30.64  ?  281  TYR A CD2  1 
ATOM   2425 C  CE1  . TYR A 1 168 ? 28.413  4.926   25.243  1.00 33.69  ?  281  TYR A CE1  1 
ATOM   2426 C  CE2  . TYR A 1 168 ? 26.252  4.353   26.062  1.00 31.64  ?  281  TYR A CE2  1 
ATOM   2427 C  CZ   . TYR A 1 168 ? 27.465  4.965   26.234  1.00 34.28  ?  281  TYR A CZ   1 
ATOM   2428 O  OH   . TYR A 1 168 ? 27.728  5.643   27.411  1.00 42.68  ?  281  TYR A OH   1 
ATOM   2429 H  H    . TYR A 1 168 ? 26.486  5.592   21.374  1.00 36.62  ?  281  TYR A H    1 
ATOM   2430 H  HA   . TYR A 1 168 ? 25.796  3.123   20.720  1.00 33.92  ?  281  TYR A HA   1 
ATOM   2431 H  HB2  . TYR A 1 168 ? 26.066  2.114   22.815  1.00 35.10  ?  281  TYR A HB2  1 
ATOM   2432 H  HB3  . TYR A 1 168 ? 27.483  2.547   22.240  1.00 35.10  ?  281  TYR A HB3  1 
ATOM   2433 H  HD1  . TYR A 1 168 ? 28.786  4.216   23.400  1.00 40.12  ?  281  TYR A HD1  1 
ATOM   2434 H  HD2  . TYR A 1 168 ? 25.164  3.269   24.773  1.00 36.75  ?  281  TYR A HD2  1 
ATOM   2435 H  HE1  . TYR A 1 168 ? 29.231  5.352   25.360  1.00 40.41  ?  281  TYR A HE1  1 
ATOM   2436 H  HE2  . TYR A 1 168 ? 25.611  4.388   26.734  1.00 37.95  ?  281  TYR A HE2  1 
ATOM   2437 H  HH   . TYR A 1 168 ? 27.068  5.588   27.927  1.00 51.20  ?  281  TYR A HH   1 
ATOM   2438 N  N    . THR A 1 169 ? 23.689  3.216   22.218  1.00 31.71  ?  282  THR A N    1 
ATOM   2439 C  CA   . THR A 1 169 ? 22.347  3.495   22.673  1.00 29.56  ?  282  THR A CA   1 
ATOM   2440 C  C    . THR A 1 169 ? 22.068  2.679   23.924  1.00 29.69  ?  282  THR A C    1 
ATOM   2441 O  O    . THR A 1 169 ? 22.732  1.682   24.215  1.00 30.53  ?  282  THR A O    1 
ATOM   2442 C  CB   . THR A 1 169 ? 21.292  3.170   21.608  1.00 29.97  ?  282  THR A CB   1 
ATOM   2443 O  OG1  . THR A 1 169 ? 21.393  1.784   21.238  1.00 29.42  ?  282  THR A OG1  1 
ATOM   2444 C  CG2  . THR A 1 169 ? 21.496  4.051   20.382  1.00 32.33  ?  282  THR A CG2  1 
ATOM   2445 H  H    . THR A 1 169 ? 23.852  2.377   22.123  1.00 38.03  ?  282  THR A H    1 
ATOM   2446 H  HA   . THR A 1 169 ? 22.276  4.439   22.885  1.00 35.46  ?  282  THR A HA   1 
ATOM   2447 H  HB   . THR A 1 169 ? 20.404  3.338   21.960  1.00 35.95  ?  282  THR A HB   1 
ATOM   2448 H  HG1  . THR A 1 169 ? 22.157  1.625   20.926  1.00 35.29  ?  282  THR A HG1  1 
ATOM   2449 H  HG21 . THR A 1 169 ? 20.820  3.854   19.715  1.00 38.78  ?  282  THR A HG21 1 
ATOM   2450 H  HG22 . THR A 1 169 ? 21.430  4.986   20.631  1.00 38.78  ?  282  THR A HG22 1 
ATOM   2451 H  HG23 . THR A 1 169 ? 22.373  3.888   19.999  1.00 38.78  ?  282  THR A HG23 1 
ATOM   2452 N  N    . ALA A 1 170 ? 21.071  3.122   24.670  1.00 29.12  ?  283  ALA A N    1 
ATOM   2453 C  CA   . ALA A 1 170 ? 20.698  2.414   25.884  1.00 30.03  ?  283  ALA A CA   1 
ATOM   2454 C  C    . ALA A 1 170 ? 19.287  2.799   26.279  1.00 32.05  ?  283  ALA A C    1 
ATOM   2455 O  O    . ALA A 1 170 ? 18.802  3.873   25.939  1.00 32.15  ?  283  ALA A O    1 
ATOM   2456 C  CB   . ALA A 1 170 ? 21.669  2.695   27.028  1.00 33.61  ?  283  ALA A CB   1 
ATOM   2457 H  H    . ALA A 1 170 ? 20.600  3.821   24.499  1.00 34.93  ?  283  ALA A H    1 
ATOM   2458 H  HA   . ALA A 1 170 ? 20.710  1.461   25.705  1.00 36.02  ?  283  ALA A HA   1 
ATOM   2459 H  HB1  . ALA A 1 170 ? 21.386  2.197   27.811  1.00 40.32  ?  283  ALA A HB1  1 
ATOM   2460 H  HB2  . ALA A 1 170 ? 22.559  2.417   26.762  1.00 40.32  ?  283  ALA A HB2  1 
ATOM   2461 H  HB3  . ALA A 1 170 ? 21.663  3.646   27.220  1.00 40.32  ?  283  ALA A HB3  1 
ATOM   2462 N  N    . GLY A 1 171 ? 18.629  1.889   26.995  1.00 35.65  ?  284  GLY A N    1 
ATOM   2463 C  CA   . GLY A 1 171 ? 17.353  2.215   27.588  1.00 37.95  ?  284  GLY A CA   1 
ATOM   2464 C  C    . GLY A 1 171 ? 17.510  2.950   28.893  1.00 40.39  ?  284  GLY A C    1 
ATOM   2465 O  O    . GLY A 1 171 ? 16.634  3.732   29.273  1.00 42.83  ?  284  GLY A O    1 
ATOM   2466 H  H    . GLY A 1 171 ? 18.901  1.087   27.146  1.00 42.77  ?  284  GLY A H    1 
ATOM   2467 H  HA2  . GLY A 1 171 ? 16.847  2.775   26.978  1.00 45.53  ?  284  GLY A HA2  1 
ATOM   2468 H  HA3  . GLY A 1 171 ? 16.856  1.398   27.753  1.00 45.53  ?  284  GLY A HA3  1 
ATOM   2469 N  N    . VAL A 1 172 ? 18.621  2.727   29.589  1.00 42.41  ?  285  VAL A N    1 
ATOM   2470 C  CA   . VAL A 1 172 ? 18.860  3.388   30.863  1.00 46.59  ?  285  VAL A CA   1 
ATOM   2471 C  C    . VAL A 1 172 ? 19.259  4.827   30.586  1.00 48.68  ?  285  VAL A C    1 
ATOM   2472 O  O    . VAL A 1 172 ? 19.939  5.126   29.593  1.00 43.67  ?  285  VAL A O    1 
ATOM   2473 C  CB   . VAL A 1 172 ? 19.928  2.641   31.681  1.00 48.40  ?  285  VAL A CB   1 
ATOM   2474 C  CG1  . VAL A 1 172 ? 21.230  2.533   30.921  1.00 51.18  ?  285  VAL A CG1  1 
ATOM   2475 C  CG2  . VAL A 1 172 ? 20.158  3.330   33.025  1.00 54.33  ?  285  VAL A CG2  1 
ATOM   2476 H  H    . VAL A 1 172 ? 19.251  2.196   29.342  1.00 50.87  ?  285  VAL A H    1 
ATOM   2477 H  HA   . VAL A 1 172 ? 18.045  3.386   31.389  1.00 55.90  ?  285  VAL A HA   1 
ATOM   2478 H  HB   . VAL A 1 172 ? 19.604  1.742   31.846  1.00 58.07  ?  285  VAL A HB   1 
ATOM   2479 H  HG11 . VAL A 1 172 ? 21.898  2.127   31.495  1.00 61.40  ?  285  VAL A HG11 1 
ATOM   2480 H  HG12 . VAL A 1 172 ? 21.091  1.983   30.134  1.00 61.40  ?  285  VAL A HG12 1 
ATOM   2481 H  HG13 . VAL A 1 172 ? 21.517  3.421   30.657  1.00 61.40  ?  285  VAL A HG13 1 
ATOM   2482 H  HG21 . VAL A 1 172 ? 20.736  2.773   33.570  1.00 65.18  ?  285  VAL A HG21 1 
ATOM   2483 H  HG22 . VAL A 1 172 ? 20.579  4.190   32.871  1.00 65.18  ?  285  VAL A HG22 1 
ATOM   2484 H  HG23 . VAL A 1 172 ? 19.304  3.453   33.467  1.00 65.18  ?  285  VAL A HG23 1 
ATOM   2485 N  N    . VAL A 1 173 ? 18.797  5.729   31.441  1.00 48.50  ?  286  VAL A N    1 
ATOM   2486 C  CA   . VAL A 1 173 ? 19.148  7.133   31.329  1.00 50.62  ?  286  VAL A CA   1 
ATOM   2487 C  C    . VAL A 1 173 ? 20.473  7.326   32.050  1.00 51.79  ?  286  VAL A C    1 
ATOM   2488 O  O    . VAL A 1 173 ? 20.550  7.226   33.275  1.00 49.29  ?  286  VAL A O    1 
ATOM   2489 C  CB   . VAL A 1 173 ? 18.057  8.048   31.892  1.00 49.46  ?  286  VAL A CB   1 
ATOM   2490 C  CG1  . VAL A 1 173 ? 18.444  9.499   31.657  1.00 45.55  ?  286  VAL A CG1  1 
ATOM   2491 C  CG2  . VAL A 1 173 ? 16.734  7.722   31.244  1.00 48.76  ?  286  VAL A CG2  1 
ATOM   2492 H  H    . VAL A 1 173 ? 18.274  5.548   32.099  1.00 58.18  ?  286  VAL A H    1 
ATOM   2493 H  HA   . VAL A 1 173 ? 19.266  7.362   30.393  1.00 60.73  ?  286  VAL A HA   1 
ATOM   2494 H  HB   . VAL A 1 173 ? 17.961  7.911   32.848  1.00 59.33  ?  286  VAL A HB   1 
ATOM   2495 H  HG11 . VAL A 1 173 ? 17.686  10.066  31.870  1.00 54.64  ?  286  VAL A HG11 1 
ATOM   2496 H  HG12 . VAL A 1 173 ? 19.195  9.722   32.229  1.00 54.64  ?  286  VAL A HG12 1 
ATOM   2497 H  HG13 . VAL A 1 173 ? 18.691  9.613   30.726  1.00 54.64  ?  286  VAL A HG13 1 
ATOM   2498 H  HG21 . VAL A 1 173 ? 16.076  8.379   31.520  1.00 58.50  ?  286  VAL A HG21 1 
ATOM   2499 H  HG22 . VAL A 1 173 ? 16.840  7.745   30.280  1.00 58.50  ?  286  VAL A HG22 1 
ATOM   2500 H  HG23 . VAL A 1 173 ? 16.454  6.836   31.525  1.00 58.50  ?  286  VAL A HG23 1 
ATOM   2501 N  N    . LEU A 1 174 ? 21.516  7.576   31.283  1.00 49.66  ?  287  LEU A N    1 
ATOM   2502 C  CA   . LEU A 1 174 ? 22.825  7.913   31.804  1.00 47.74  ?  287  LEU A CA   1 
ATOM   2503 C  C    . LEU A 1 174 ? 23.054  9.402   31.671  1.00 48.72  ?  287  LEU A C    1 
ATOM   2504 O  O    . LEU A 1 174 ? 22.300  10.104  30.993  1.00 47.11  ?  287  LEU A O    1 
ATOM   2505 C  CB   . LEU A 1 174 ? 23.902  7.128   31.053  1.00 47.93  ?  287  LEU A CB   1 
ATOM   2506 C  CG   . LEU A 1 174 ? 23.836  5.614   31.246  1.00 48.35  ?  287  LEU A CG   1 
ATOM   2507 C  CD1  . LEU A 1 174 ? 24.568  4.887   30.128  1.00 46.01  ?  287  LEU A CD1  1 
ATOM   2508 C  CD2  . LEU A 1 174 ? 24.420  5.231   32.603  1.00 50.82  ?  287  LEU A CD2  1 
ATOM   2509 H  H    . LEU A 1 174 ? 21.486  7.555   30.424  1.00 59.58  ?  287  LEU A H    1 
ATOM   2510 H  HA   . LEU A 1 174 ? 22.886  7.674   32.742  1.00 57.27  ?  287  LEU A HA   1 
ATOM   2511 H  HB2  . LEU A 1 174 ? 23.808  7.306   30.104  1.00 57.50  ?  287  LEU A HB2  1 
ATOM   2512 H  HB3  . LEU A 1 174 ? 24.772  7.425   31.362  1.00 57.50  ?  287  LEU A HB3  1 
ATOM   2513 H  HG   . LEU A 1 174 ? 22.907  5.336   31.220  1.00 58.01  ?  287  LEU A HG   1 
ATOM   2514 H  HD11 . LEU A 1 174 ? 24.514  3.931   30.284  1.00 55.20  ?  287  LEU A HD11 1 
ATOM   2515 H  HD12 . LEU A 1 174 ? 24.150  5.108   29.281  1.00 55.20  ?  287  LEU A HD12 1 
ATOM   2516 H  HD13 . LEU A 1 174 ? 25.496  5.169   30.122  1.00 55.20  ?  287  LEU A HD13 1 
ATOM   2517 H  HD21 . LEU A 1 174 ? 24.381  4.267   32.703  1.00 60.97  ?  287  LEU A HD21 1 
ATOM   2518 H  HD22 . LEU A 1 174 ? 25.341  5.532   32.647  1.00 60.97  ?  287  LEU A HD22 1 
ATOM   2519 H  HD23 . LEU A 1 174 ? 23.899  5.656   33.302  1.00 60.97  ?  287  LEU A HD23 1 
ATOM   2520 N  N    . PRO A 1 175 ? 24.083  9.931   32.320  1.00 48.91  ?  288  PRO A N    1 
ATOM   2521 C  CA   . PRO A 1 175 ? 24.353  11.368  32.208  1.00 51.68  ?  288  PRO A CA   1 
ATOM   2522 C  C    . PRO A 1 175 ? 24.530  11.794  30.757  1.00 50.98  ?  288  PRO A C    1 
ATOM   2523 O  O    . PRO A 1 175 ? 25.214  11.131  29.971  1.00 47.91  ?  288  PRO A O    1 
ATOM   2524 C  CB   . PRO A 1 175 ? 25.643  11.552  33.018  1.00 52.44  ?  288  PRO A CB   1 
ATOM   2525 C  CG   . PRO A 1 175 ? 25.630  10.422  34.000  1.00 54.13  ?  288  PRO A CG   1 
ATOM   2526 C  CD   . PRO A 1 175 ? 25.004  9.262   33.258  1.00 54.09  ?  288  PRO A CD   1 
ATOM   2527 H  HA   . PRO A 1 175 ? 23.635  11.880  32.611  1.00 62.00  ?  288  PRO A HA   1 
ATOM   2528 H  HB2  . PRO A 1 175 ? 26.414  11.498  32.433  1.00 62.92  ?  288  PRO A HB2  1 
ATOM   2529 H  HB3  . PRO A 1 175 ? 25.630  12.410  33.472  1.00 62.92  ?  288  PRO A HB3  1 
ATOM   2530 H  HG2  . PRO A 1 175 ? 26.536  10.210  34.271  1.00 64.93  ?  288  PRO A HG2  1 
ATOM   2531 H  HG3  . PRO A 1 175 ? 25.099  10.664  34.775  1.00 64.93  ?  288  PRO A HG3  1 
ATOM   2532 H  HD2  . PRO A 1 175 ? 25.677  8.752   32.780  1.00 64.89  ?  288  PRO A HD2  1 
ATOM   2533 H  HD3  . PRO A 1 175 ? 24.519  8.683   33.867  1.00 64.89  ?  288  PRO A HD3  1 
ATOM   2534 N  N    . LYS A 1 176 ? 23.873  12.892  30.404  1.00 45.57  ?  289  LYS A N    1 
ATOM   2535 C  CA   . LYS A 1 176 ? 24.159  13.632  29.187  1.00 44.85  ?  289  LYS A CA   1 
ATOM   2536 C  C    . LYS A 1 176 ? 24.034  12.767  27.945  1.00 39.86  ?  289  LYS A C    1 
ATOM   2537 O  O    . LYS A 1 176 ? 25.011  12.585  27.205  1.00 40.25  ?  289  LYS A O    1 
ATOM   2538 C  CB   . LYS A 1 176 ? 25.558  14.244  29.294  1.00 50.29  ?  289  LYS A CB   1 
ATOM   2539 C  CG   . LYS A 1 176 ? 25.694  15.100  30.539  1.00 59.51  ?  289  LYS A CG   1 
ATOM   2540 C  CD   . LYS A 1 176 ? 27.110  15.578  30.793  1.00 68.19  ?  289  LYS A CD   1 
ATOM   2541 C  CE   . LYS A 1 176 ? 27.094  16.665  31.871  1.00 70.05  ?  289  LYS A CE   1 
ATOM   2542 N  NZ   . LYS A 1 176 ? 28.452  17.099  32.307  1.00 69.08  ?  289  LYS A NZ   1 
ATOM   2543 H  H    . LYS A 1 176 ? 23.237  13.239  30.869  1.00 54.66  ?  289  LYS A H    1 
ATOM   2544 H  HA   . LYS A 1 176 ? 23.500  14.336  29.082  1.00 53.81  ?  289  LYS A HA   1 
ATOM   2545 H  HB2  . LYS A 1 176 ? 26.217  13.534  29.337  1.00 60.33  ?  289  LYS A HB2  1 
ATOM   2546 H  HB3  . LYS A 1 176 ? 25.723  14.803  28.519  1.00 60.33  ?  289  LYS A HB3  1 
ATOM   2547 H  HG2  . LYS A 1 176 ? 25.130  15.884  30.444  1.00 71.40  ?  289  LYS A HG2  1 
ATOM   2548 H  HG3  . LYS A 1 176 ? 25.414  14.581  31.309  1.00 71.40  ?  289  LYS A HG3  1 
ATOM   2549 H  HD2  . LYS A 1 176 ? 27.657  14.838  31.102  1.00 81.81  ?  289  LYS A HD2  1 
ATOM   2550 H  HD3  . LYS A 1 176 ? 27.483  15.949  29.979  1.00 81.81  ?  289  LYS A HD3  1 
ATOM   2551 H  HE2  . LYS A 1 176 ? 26.632  17.443  31.523  1.00 84.04  ?  289  LYS A HE2  1 
ATOM   2552 H  HE3  . LYS A 1 176 ? 26.628  16.324  32.651  1.00 84.04  ?  289  LYS A HE3  1 
ATOM   2553 H  HZ1  . LYS A 1 176 ? 28.385  17.729  32.932  1.00 82.88  ?  289  LYS A HZ1  1 
ATOM   2554 H  HZ2  . LYS A 1 176 ? 28.900  16.407  32.642  1.00 82.88  ?  289  LYS A HZ2  1 
ATOM   2555 H  HZ3  . LYS A 1 176 ? 28.904  17.427  31.614  1.00 82.88  ?  289  LYS A HZ3  1 
ATOM   2556 N  N    . PRO A 1 177 ? 22.852  12.222  27.678  1.00 37.44  ?  290  PRO A N    1 
ATOM   2557 C  CA   . PRO A 1 177 ? 22.602  11.669  26.348  1.00 36.95  ?  290  PRO A CA   1 
ATOM   2558 C  C    . PRO A 1 177 ? 22.626  12.778  25.317  1.00 36.16  ?  290  PRO A C    1 
ATOM   2559 O  O    . PRO A 1 177 ? 22.345  13.935  25.614  1.00 34.71  ?  290  PRO A O    1 
ATOM   2560 C  CB   . PRO A 1 177 ? 21.208  11.054  26.471  1.00 33.63  ?  290  PRO A CB   1 
ATOM   2561 C  CG   . PRO A 1 177 ? 20.544  11.895  27.511  1.00 36.88  ?  290  PRO A CG   1 
ATOM   2562 C  CD   . PRO A 1 177 ? 21.640  12.200  28.510  1.00 37.87  ?  290  PRO A CD   1 
ATOM   2563 H  HA   . PRO A 1 177 ? 23.236  10.972  26.120  1.00 44.32  ?  290  PRO A HA   1 
ATOM   2564 H  HB2  . PRO A 1 177 ? 20.740  11.110  25.622  1.00 40.35  ?  290  PRO A HB2  1 
ATOM   2565 H  HB3  . PRO A 1 177 ? 21.272  10.129  26.754  1.00 40.35  ?  290  PRO A HB3  1 
ATOM   2566 H  HG2  . PRO A 1 177 ? 20.201  12.709  27.111  1.00 44.24  ?  290  PRO A HG2  1 
ATOM   2567 H  HG3  . PRO A 1 177 ? 19.821  11.399  27.927  1.00 44.24  ?  290  PRO A HG3  1 
ATOM   2568 H  HD2  . PRO A 1 177 ? 21.494  13.061  28.932  1.00 45.43  ?  290  PRO A HD2  1 
ATOM   2569 H  HD3  . PRO A 1 177 ? 21.696  11.506  29.185  1.00 45.43  ?  290  PRO A HD3  1 
ATOM   2570 N  N    . ILE A 1 178 ? 22.970  12.421  24.088  1.00 34.25  ?  291  ILE A N    1 
ATOM   2571 C  CA   . ILE A 1 178 ? 22.934  13.415  23.039  1.00 36.51  ?  291  ILE A CA   1 
ATOM   2572 C  C    . ILE A 1 178 ? 21.526  13.567  22.486  1.00 37.64  ?  291  ILE A C    1 
ATOM   2573 O  O    . ILE A 1 178 ? 21.185  14.639  21.961  1.00 34.65  ?  291  ILE A O    1 
ATOM   2574 C  CB   . ILE A 1 178 ? 23.952  13.088  21.935  1.00 39.25  ?  291  ILE A CB   1 
ATOM   2575 C  CG1  . ILE A 1 178 ? 23.980  14.248  20.943  1.00 42.12  ?  291  ILE A CG1  1 
ATOM   2576 C  CG2  . ILE A 1 178 ? 23.631  11.777  21.266  1.00 38.82  ?  291  ILE A CG2  1 
ATOM   2577 C  CD1  . ILE A 1 178 ? 24.840  14.004  19.755  1.00 47.43  ?  291  ILE A CD1  1 
ATOM   2578 H  H    . ILE A 1 178 ? 23.219  11.634  23.845  1.00 41.08  ?  291  ILE A H    1 
ATOM   2579 H  HA   . ILE A 1 178 ? 23.198  14.275  23.403  1.00 43.80  ?  291  ILE A HA   1 
ATOM   2580 H  HB   . ILE A 1 178 ? 24.834  12.985  22.324  1.00 47.08  ?  291  ILE A HB   1 
ATOM   2581 H  HG12 . ILE A 1 178 ? 23.078  14.409  20.626  1.00 50.53  ?  291  ILE A HG12 1 
ATOM   2582 H  HG13 . ILE A 1 178 ? 24.318  15.037  21.395  1.00 50.53  ?  291  ILE A HG13 1 
ATOM   2583 H  HG21 . ILE A 1 178 ? 24.359  11.540  20.670  1.00 46.57  ?  291  ILE A HG21 1 
ATOM   2584 H  HG22 . ILE A 1 178 ? 23.525  11.093  21.946  1.00 46.57  ?  291  ILE A HG22 1 
ATOM   2585 H  HG23 . ILE A 1 178 ? 22.809  11.872  20.761  1.00 46.57  ?  291  ILE A HG23 1 
ATOM   2586 H  HD11 . ILE A 1 178 ? 24.962  14.838  19.276  1.00 56.90  ?  291  ILE A HD11 1 
ATOM   2587 H  HD12 . ILE A 1 178 ? 25.700  13.665  20.051  1.00 56.90  ?  291  ILE A HD12 1 
ATOM   2588 H  HD13 . ILE A 1 178 ? 24.408  13.352  19.181  1.00 56.90  ?  291  ILE A HD13 1 
ATOM   2589 N  N    . ALA A 1 179 ? 20.685  12.549  22.629  1.00 33.26  ?  292  ALA A N    1 
ATOM   2590 C  CA   . ALA A 1 179 ? 19.312  12.633  22.161  1.00 34.54  ?  292  ALA A CA   1 
ATOM   2591 C  C    . ALA A 1 179 ? 18.498  11.516  22.799  1.00 34.40  ?  292  ALA A C    1 
ATOM   2592 O  O    . ALA A 1 179 ? 19.043  10.477  23.197  1.00 31.89  ?  292  ALA A O    1 
ATOM   2593 C  CB   . ALA A 1 179 ? 19.233  12.535  20.632  1.00 34.51  ?  292  ALA A CB   1 
ATOM   2594 H  H    . ALA A 1 179 ? 20.888  11.798  22.995  1.00 39.89  ?  292  ALA A H    1 
ATOM   2595 H  HA   . ALA A 1 179 ? 18.933  13.482  22.438  1.00 41.44  ?  292  ALA A HA   1 
ATOM   2596 H  HB1  . ALA A 1 179 ? 18.304  12.593  20.359  1.00 41.40  ?  292  ALA A HB1  1 
ATOM   2597 H  HB2  . ALA A 1 179 ? 19.738  13.266  20.243  1.00 41.40  ?  292  ALA A HB2  1 
ATOM   2598 H  HB3  . ALA A 1 179 ? 19.609  11.687  20.350  1.00 41.40  ?  292  ALA A HB3  1 
ATOM   2599 N  N    . THR A 1 180 ? 17.189  11.758  22.900  1.00 32.14  ?  293  THR A N    1 
ATOM   2600 C  CA   . THR A 1 180 ? 16.228  10.776  23.376  1.00 33.27  ?  293  THR A CA   1 
ATOM   2601 C  C    . THR A 1 180 ? 15.197  10.565  22.280  1.00 32.84  ?  293  THR A C    1 
ATOM   2602 O  O    . THR A 1 180 ? 14.580  11.525  21.814  1.00 32.73  ?  293  THR A O    1 
ATOM   2603 C  CB   . THR A 1 180 ? 15.551  11.233  24.664  1.00 36.28  ?  293  THR A CB   1 
ATOM   2604 O  OG1  . THR A 1 180 ? 16.521  11.318  25.720  1.00 40.49  ?  293  THR A OG1  1 
ATOM   2605 C  CG2  . THR A 1 180 ? 14.453  10.254  25.056  1.00 35.73  ?  293  THR A CG2  1 
ATOM   2606 H  H    . THR A 1 180 ? 16.830  12.511  22.690  1.00 38.55  ?  293  THR A H    1 
ATOM   2607 H  HA   . THR A 1 180 ? 16.679  9.937   23.560  1.00 39.90  ?  293  THR A HA   1 
ATOM   2608 H  HB   . THR A 1 180 ? 15.153  12.107  24.531  1.00 43.52  ?  293  THR A HB   1 
ATOM   2609 H  HG1  . THR A 1 180 ? 17.121  11.869  25.516  1.00 48.57  ?  293  THR A HG1  1 
ATOM   2610 H  HG21 . THR A 1 180 ? 14.206  10.386  25.985  1.00 42.86  ?  293  THR A HG21 1 
ATOM   2611 H  HG22 . THR A 1 180 ? 13.670  10.393  24.499  1.00 42.86  ?  293  THR A HG22 1 
ATOM   2612 H  HG23 . THR A 1 180 ? 14.763  9.343   24.939  1.00 42.86  ?  293  THR A HG23 1 
ATOM   2613 N  N    . CYS A 1 181 ? 15.017  9.315   21.859  1.00 32.59  ?  294  CYS A N    1 
ATOM   2614 C  CA   . CYS A 1 181 ? 14.062  8.976   20.813  1.00 33.81  ?  294  CYS A CA   1 
ATOM   2615 C  C    . CYS A 1 181 ? 12.989  8.059   21.383  1.00 34.70  ?  294  CYS A C    1 
ATOM   2616 O  O    . CYS A 1 181 ? 13.226  7.324   22.343  1.00 32.79  ?  294  CYS A O    1 
ATOM   2617 C  CB   . CYS A 1 181 ? 14.765  8.318   19.623  1.00 29.88  ?  294  CYS A CB   1 
ATOM   2618 S  SG   . CYS A 1 181 ? 16.111  9.326   18.946  1.00 33.52  ?  294  CYS A SG   1 
ATOM   2619 H  H    . CYS A 1 181 ? 15.445  8.638   22.172  1.00 39.09  ?  294  CYS A H    1 
ATOM   2620 H  HA   . CYS A 1 181 ? 13.622  9.777   20.486  1.00 40.55  ?  294  CYS A HA   1 
ATOM   2621 H  HB2  . CYS A 1 181 ? 15.140  7.470   19.908  1.00 35.84  ?  294  CYS A HB2  1 
ATOM   2622 H  HB3  . CYS A 1 181 ? 14.116  8.172   18.916  1.00 35.84  ?  294  CYS A HB3  1 
ATOM   2623 H  HG   . CYS A 1 181 ? 15.904  10.479  19.204  1.00 40.20  ?  294  CYS A HG   1 
ATOM   2624 N  N    . ARG A 1 182 ? 11.799  8.132   20.802  1.00 32.63  ?  295  ARG A N    1 
ATOM   2625 C  CA   . ARG A 1 182 ? 10.654  7.370   21.261  1.00 32.10  ?  295  ARG A CA   1 
ATOM   2626 C  C    . ARG A 1 182 ? 10.279  6.338   20.213  1.00 29.96  ?  295  ARG A C    1 
ATOM   2627 O  O    . ARG A 1 182 ? 10.225  6.643   19.019  1.00 26.64  ?  295  ARG A O    1 
ATOM   2628 C  CB   . ARG A 1 182 ? 9.458   8.287   21.543  1.00 34.16  ?  295  ARG A CB   1 
ATOM   2629 C  CG   . ARG A 1 182 ? 8.137   7.560   21.725  1.00 40.33  ?  295  ARG A CG   1 
ATOM   2630 C  CD   . ARG A 1 182 ? 8.031   6.912   23.100  1.00 43.32  ?  295  ARG A CD   1 
ATOM   2631 N  NE   . ARG A 1 182 ? 8.073   7.921   24.158  1.00 46.12  ?  295  ARG A NE   1 
ATOM   2632 C  CZ   . ARG A 1 182 ? 7.973   7.652   25.454  1.00 50.00  ?  295  ARG A CZ   1 
ATOM   2633 N  NH1  . ARG A 1 182 ? 8.024   8.639   26.340  1.00 53.85  ?  295  ARG A NH1  1 
ATOM   2634 N  NH2  . ARG A 1 182 ? 7.816   6.399   25.865  1.00 49.21  ?  295  ARG A NH2  1 
ATOM   2635 H  H    . ARG A 1 182 ? 11.630  8.631   20.122  1.00 39.14  ?  295  ARG A H    1 
ATOM   2636 H  HA   . ARG A 1 182 ? 10.879  6.908   22.084  1.00 38.50  ?  295  ARG A HA   1 
ATOM   2637 H  HB2  . ARG A 1 182 ? 9.634   8.783   22.358  1.00 40.98  ?  295  ARG A HB2  1 
ATOM   2638 H  HB3  . ARG A 1 182 ? 9.355   8.899   20.797  1.00 40.98  ?  295  ARG A HB3  1 
ATOM   2639 H  HG2  . ARG A 1 182 ? 7.407   8.192   21.631  1.00 48.38  ?  295  ARG A HG2  1 
ATOM   2640 H  HG3  . ARG A 1 182 ? 8.060   6.863   21.055  1.00 48.38  ?  295  ARG A HG3  1 
ATOM   2641 H  HD2  . ARG A 1 182 ? 7.192   6.431   23.167  1.00 51.96  ?  295  ARG A HD2  1 
ATOM   2642 H  HD3  . ARG A 1 182 ? 8.775   6.302   23.228  1.00 51.96  ?  295  ARG A HD3  1 
ATOM   2643 H  HE   . ARG A 1 182 ? 8.169   8.743   23.925  1.00 55.33  ?  295  ARG A HE   1 
ATOM   2644 H  HH11 . ARG A 1 182 ? 8.122   9.451   26.074  1.00 64.60  ?  295  ARG A HH11 1 
ATOM   2645 H  HH12 . ARG A 1 182 ? 7.959   8.466   27.180  1.00 64.60  ?  295  ARG A HH12 1 
ATOM   2646 H  HH21 . ARG A 1 182 ? 7.780   5.760   25.291  1.00 59.04  ?  295  ARG A HH21 1 
ATOM   2647 H  HH22 . ARG A 1 182 ? 7.751   6.227   26.705  1.00 59.04  ?  295  ARG A HH22 1 
ATOM   2648 N  N    . TYR A 1 183 ? 10.009  5.117   20.672  1.00 30.17  ?  296  TYR A N    1 
ATOM   2649 C  CA   . TYR A 1 183 ? 9.488   4.080   19.793  1.00 30.12  ?  296  TYR A CA   1 
ATOM   2650 C  C    . TYR A 1 183 ? 7.995   4.267   19.542  1.00 30.06  ?  296  TYR A C    1 
ATOM   2651 O  O    . TYR A 1 183 ? 7.238   4.587   20.456  1.00 28.16  ?  296  TYR A O    1 
ATOM   2652 C  CB   . TYR A 1 183 ? 9.750   2.695   20.390  1.00 28.33  ?  296  TYR A CB   1 
ATOM   2653 C  CG   . TYR A 1 183 ? 11.061  2.159   19.927  1.00 32.95  ?  296  TYR A CG   1 
ATOM   2654 C  CD1  . TYR A 1 183 ? 11.219  1.778   18.605  1.00 30.53  ?  296  TYR A CD1  1 
ATOM   2655 C  CD2  . TYR A 1 183 ? 12.153  2.090   20.775  1.00 35.58  ?  296  TYR A CD2  1 
ATOM   2656 C  CE1  . TYR A 1 183 ? 12.377  1.339   18.146  1.00 36.94  ?  296  TYR A CE1  1 
ATOM   2657 C  CE2  . TYR A 1 183 ? 13.365  1.624   20.302  1.00 40.16  ?  296  TYR A CE2  1 
ATOM   2658 C  CZ   . TYR A 1 183 ? 13.432  1.258   18.975  1.00 41.57  ?  296  TYR A CZ   1 
ATOM   2659 O  OH   . TYR A 1 183 ? 14.511  0.801   18.309  1.00 49.59  ?  296  TYR A OH   1 
ATOM   2660 H  H    . TYR A 1 183 ? 10.118  4.867   21.488  1.00 36.19  ?  296  TYR A H    1 
ATOM   2661 H  HA   . TYR A 1 183 ? 9.941   4.137   18.937  1.00 36.13  ?  296  TYR A HA   1 
ATOM   2662 H  HB2  . TYR A 1 183 ? 9.766   2.757   21.357  1.00 33.98  ?  296  TYR A HB2  1 
ATOM   2663 H  HB3  . TYR A 1 183 ? 9.050   2.084   20.108  1.00 33.98  ?  296  TYR A HB3  1 
ATOM   2664 H  HD1  . TYR A 1 183 ? 10.492  1.831   18.027  1.00 36.62  ?  296  TYR A HD1  1 
ATOM   2665 H  HD2  . TYR A 1 183 ? 12.071  2.358   21.662  1.00 42.68  ?  296  TYR A HD2  1 
ATOM   2666 H  HE1  . TYR A 1 183 ? 12.462  1.087   17.255  1.00 44.31  ?  296  TYR A HE1  1 
ATOM   2667 H  HE2  . TYR A 1 183 ? 14.107  1.560   20.858  1.00 48.17  ?  296  TYR A HE2  1 
ATOM   2668 H  HH   . TYR A 1 183 ? 14.312  0.657   17.506  1.00 59.49  ?  296  TYR A HH   1 
ATOM   2669 N  N    . TRP A 1 184 ? 7.598   4.077   18.285  1.00 27.80  ?  297  TRP A N    1 
ATOM   2670 C  CA   . TRP A 1 184 ? 6.223   3.993   17.839  1.00 30.40  ?  297  TRP A CA   1 
ATOM   2671 C  C    . TRP A 1 184 ? 6.032   2.665   17.117  1.00 28.61  ?  297  TRP A C    1 
ATOM   2672 O  O    . TRP A 1 184 ? 6.979   2.098   16.548  1.00 25.60  ?  297  TRP A O    1 
ATOM   2673 C  CB   . TRP A 1 184 ? 5.874   5.150   16.895  1.00 31.22  ?  297  TRP A CB   1 
ATOM   2674 C  CG   . TRP A 1 184 ? 5.824   6.478   17.547  1.00 30.96  ?  297  TRP A CG   1 
ATOM   2675 C  CD1  . TRP A 1 184 ? 6.864   7.154   18.118  1.00 33.71  ?  297  TRP A CD1  1 
ATOM   2676 C  CD2  . TRP A 1 184 ? 4.675   7.324   17.682  1.00 32.51  ?  297  TRP A CD2  1 
ATOM   2677 N  NE1  . TRP A 1 184 ? 6.432   8.362   18.607  1.00 32.10  ?  297  TRP A NE1  1 
ATOM   2678 C  CE2  . TRP A 1 184 ? 5.093   8.494   18.352  1.00 31.02  ?  297  TRP A CE2  1 
ATOM   2679 C  CE3  . TRP A 1 184 ? 3.334   7.204   17.310  1.00 33.47  ?  297  TRP A CE3  1 
ATOM   2680 C  CZ2  . TRP A 1 184 ? 4.224   9.534   18.647  1.00 31.19  ?  297  TRP A CZ2  1 
ATOM   2681 C  CZ3  . TRP A 1 184 ? 2.465   8.242   17.608  1.00 33.48  ?  297  TRP A CZ3  1 
ATOM   2682 C  CH2  . TRP A 1 184 ? 2.913   9.385   18.272  1.00 36.92  ?  297  TRP A CH2  1 
ATOM   2683 H  H    . TRP A 1 184 ? 8.152   3.990   17.633  1.00 33.34  ?  297  TRP A H    1 
ATOM   2684 H  HA   . TRP A 1 184 ? 5.618   4.035   18.596  1.00 36.46  ?  297  TRP A HA   1 
ATOM   2685 H  HB2  . TRP A 1 184 ? 6.546   5.192   16.196  1.00 37.45  ?  297  TRP A HB2  1 
ATOM   2686 H  HB3  . TRP A 1 184 ? 5.002   4.981   16.506  1.00 37.45  ?  297  TRP A HB3  1 
ATOM   2687 H  HD1  . TRP A 1 184 ? 7.739   6.842   18.167  1.00 40.44  ?  297  TRP A HD1  1 
ATOM   2688 H  HE1  . TRP A 1 184 ? 6.923   8.942   19.010  1.00 38.51  ?  297  TRP A HE1  1 
ATOM   2689 H  HE3  . TRP A 1 184 ? 3.030   6.442   16.871  1.00 40.15  ?  297  TRP A HE3  1 
ATOM   2690 H  HZ2  . TRP A 1 184 ? 4.518   10.301  19.082  1.00 37.41  ?  297  TRP A HZ2  1 
ATOM   2691 H  HZ3  . TRP A 1 184 ? 1.570   8.175   17.362  1.00 40.16  ?  297  TRP A HZ3  1 
ATOM   2692 H  HH2  . TRP A 1 184 ? 2.306   10.063  18.464  1.00 44.29  ?  297  TRP A HH2  1 
ATOM   2693 N  N    . HIS A 1 185 ? 4.798   2.174   17.129  1.00 29.26  ?  298  HIS A N    1 
ATOM   2694 C  CA   . HIS A 1 185 ? 4.490   0.832   16.637  1.00 28.64  ?  298  HIS A CA   1 
ATOM   2695 C  C    . HIS A 1 185 ? 3.251   0.866   15.759  1.00 30.42  ?  298  HIS A C    1 
ATOM   2696 O  O    . HIS A 1 185 ? 2.224   1.402   16.168  1.00 30.48  ?  298  HIS A O    1 
ATOM   2697 C  CB   . HIS A 1 185 ? 4.271   -0.140  17.804  1.00 30.22  ?  298  HIS A CB   1 
ATOM   2698 C  CG   . HIS A 1 185 ? 5.305   -0.056  18.882  1.00 27.66  ?  298  HIS A CG   1 
ATOM   2699 N  ND1  . HIS A 1 185 ? 6.513   -0.708  18.806  1.00 28.08  ?  298  HIS A ND1  1 
ATOM   2700 C  CD2  . HIS A 1 185 ? 5.294   0.573   20.079  1.00 30.09  ?  298  HIS A CD2  1 
ATOM   2701 C  CE1  . HIS A 1 185 ? 7.211   -0.468  19.901  1.00 29.45  ?  298  HIS A CE1  1 
ATOM   2702 N  NE2  . HIS A 1 185 ? 6.496   0.313   20.687  1.00 28.70  ?  298  HIS A NE2  1 
ATOM   2703 H  H    . HIS A 1 185 ? 4.114   2.604   17.420  1.00 35.09  ?  298  HIS A H    1 
ATOM   2704 H  HA   . HIS A 1 185 ? 5.230   0.520   16.094  1.00 34.35  ?  298  HIS A HA   1 
ATOM   2705 H  HB2  . HIS A 1 185 ? 3.410   0.050   18.209  1.00 36.24  ?  298  HIS A HB2  1 
ATOM   2706 H  HB3  . HIS A 1 185 ? 4.281   -1.046  17.458  1.00 36.24  ?  298  HIS A HB3  1 
ATOM   2707 H  HD1  . HIS A 1 185 ? 6.774   -1.196  18.148  1.00 33.68  ?  298  HIS A HD1  1 
ATOM   2708 H  HD2  . HIS A 1 185 ? 4.600   1.086   20.426  1.00 36.09  ?  298  HIS A HD2  1 
ATOM   2709 H  HE1  . HIS A 1 185 ? 8.061   -0.795  20.087  1.00 35.32  ?  298  HIS A HE1  1 
ATOM   2710 N  N    . ARG A 1 186 ? 3.344   0.277   14.569  1.00 29.28  ?  299  ARG A N    1 
ATOM   2711 C  CA   . ARG A 1 186 ? 2.232   0.168   13.633  1.00 30.85  ?  299  ARG A CA   1 
ATOM   2712 C  C    . ARG A 1 186 ? 1.783   -1.293  13.616  1.00 32.25  ?  299  ARG A C    1 
ATOM   2713 O  O    . ARG A 1 186 ? 2.502   -2.166  13.130  1.00 27.97  ?  299  ARG A O    1 
ATOM   2714 C  CB   . ARG A 1 186 ? 2.644   0.656   12.241  1.00 29.86  ?  299  ARG A CB   1 
ATOM   2715 C  CG   . ARG A 1 186 ? 1.537   1.388   11.453  1.00 35.79  ?  299  ARG A CG   1 
ATOM   2716 C  CD   . ARG A 1 186 ? 0.417   0.454   10.989  1.00 31.56  ?  299  ARG A CD   1 
ATOM   2717 N  NE   . ARG A 1 186 ? -0.544  1.081   10.072  1.00 35.28  ?  299  ARG A NE   1 
ATOM   2718 C  CZ   . ARG A 1 186 ? -1.595  0.448   9.556   1.00 37.50  ?  299  ARG A CZ   1 
ATOM   2719 N  NH1  . ARG A 1 186 ? -1.817  -0.820  9.871   1.00 37.48  ?  299  ARG A NH1  1 
ATOM   2720 N  NH2  . ARG A 1 186 ? -2.424  1.074   8.727   1.00 39.37  ?  299  ARG A NH2  1 
ATOM   2721 H  H    . ARG A 1 186 ? 4.070   -0.080  14.275  1.00 35.12  ?  299  ARG A H    1 
ATOM   2722 H  HA   . ARG A 1 186 ? 1.488   0.714   13.930  1.00 37.01  ?  299  ARG A HA   1 
ATOM   2723 H  HB2  . ARG A 1 186 ? 3.387   1.272   12.339  1.00 35.81  ?  299  ARG A HB2  1 
ATOM   2724 H  HB3  . ARG A 1 186 ? 2.917   -0.111  11.714  1.00 35.81  ?  299  ARG A HB3  1 
ATOM   2725 H  HG2  . ARG A 1 186 ? 1.143   2.068   12.021  1.00 42.93  ?  299  ARG A HG2  1 
ATOM   2726 H  HG3  . ARG A 1 186 ? 1.929   1.799   10.666  1.00 42.93  ?  299  ARG A HG3  1 
ATOM   2727 H  HD2  . ARG A 1 186 ? 0.813   -0.303  10.529  1.00 37.86  ?  299  ARG A HD2  1 
ATOM   2728 H  HD3  . ARG A 1 186 ? -0.075  0.147   11.767  1.00 37.86  ?  299  ARG A HD3  1 
ATOM   2729 H  HE   . ARG A 1 186 ? -0.420  1.904   9.856   1.00 42.32  ?  299  ARG A HE   1 
ATOM   2730 H  HH11 . ARG A 1 186 ? -1.284  -1.230  10.406  1.00 44.96  ?  299  ARG A HH11 1 
ATOM   2731 H  HH12 . ARG A 1 186 ? -2.495  -1.232  9.540   1.00 44.96  ?  299  ARG A HH12 1 
ATOM   2732 H  HH21 . ARG A 1 186 ? -2.285  1.897   8.519   1.00 47.23  ?  299  ARG A HH21 1 
ATOM   2733 H  HH22 . ARG A 1 186 ? -3.101  0.656   8.399   1.00 47.23  ?  299  ARG A HH22 1 
ATOM   2734 N  N    A SER A 1 187 ? 0.606   -1.548  14.187  0.88 34.76  ?  300  SER A N    1 
ATOM   2735 N  N    B SER A 1 187 ? 0.597   -1.554  14.153  0.12 33.91  ?  300  SER A N    1 
ATOM   2736 C  CA   A SER A 1 187 ? 0.034   -2.887  14.189  0.88 36.74  ?  300  SER A CA   1 
ATOM   2737 C  CA   B SER A 1 187 ? 0.116   -2.925  14.237  0.12 36.94  ?  300  SER A CA   1 
ATOM   2738 C  C    A SER A 1 187 ? -0.180  -3.384  12.775  0.88 35.51  ?  300  SER A C    1 
ATOM   2739 C  C    B SER A 1 187 ? -0.240  -3.431  12.845  0.12 36.25  ?  300  SER A C    1 
ATOM   2740 O  O    A SER A 1 187 ? -0.789  -2.695  11.960  0.88 33.81  ?  300  SER A O    1 
ATOM   2741 O  O    B SER A 1 187 ? -0.949  -2.761  12.089  0.12 37.09  ?  300  SER A O    1 
ATOM   2742 C  CB   A SER A 1 187 ? -1.310  -2.911  14.918  0.88 38.22  ?  300  SER A CB   1 
ATOM   2743 C  CB   B SER A 1 187 ? -1.092  -3.016  15.166  0.12 38.33  ?  300  SER A CB   1 
ATOM   2744 O  OG   A SER A 1 187 ? -1.219  -2.364  16.211  0.88 38.29  ?  300  SER A OG   1 
ATOM   2745 O  OG   B SER A 1 187 ? -2.280  -2.622  14.508  0.12 39.44  ?  300  SER A OG   1 
ATOM   2746 H  H    B SER A 1 187 ? 0.059   -0.964  14.473  0.12 40.67  ?  300  SER A H    1 
ATOM   2747 H  HA   A SER A 1 187 ? 0.654   -3.472  14.651  0.88 44.07  ?  300  SER A HA   1 
ATOM   2748 H  HA   B SER A 1 187 ? 0.813   -3.491  14.604  0.12 44.31  ?  300  SER A HA   1 
ATOM   2749 H  HB2  A SER A 1 187 ? -1.950  -2.393  14.406  0.88 45.85  ?  300  SER A HB2  1 
ATOM   2750 H  HB2  B SER A 1 187 ? -1.189  -3.934  15.465  0.12 45.98  ?  300  SER A HB2  1 
ATOM   2751 H  HB3  A SER A 1 187 ? -1.608  -3.831  14.990  0.88 45.85  ?  300  SER A HB3  1 
ATOM   2752 H  HB3  B SER A 1 187 ? -0.947  -2.433  15.927  0.12 45.98  ?  300  SER A HB3  1 
ATOM   2753 H  HG   A SER A 1 187 ? -0.968  -1.564  16.168  0.88 45.94  ?  300  SER A HG   1 
ATOM   2754 H  HG   B SER A 1 187 ? -2.945  -2.774  14.999  0.12 47.32  ?  300  SER A HG   1 
ATOM   2755 N  N    . LEU A 1 188 ? 0.289   -4.604  12.495  1.00 33.84  ?  301  LEU A N    1 
ATOM   2756 C  CA   . LEU A 1 188 ? -0.075  -5.288  11.267  1.00 35.32  ?  301  LEU A CA   1 
ATOM   2757 C  C    . LEU A 1 188 ? -0.949  -6.512  11.521  1.00 36.30  ?  301  LEU A C    1 
ATOM   2758 O  O    . LEU A 1 188 ? -1.695  -6.917  10.626  1.00 38.25  ?  301  LEU A O    1 
ATOM   2759 C  CB   . LEU A 1 188 ? 1.180   -5.715  10.505  1.00 34.52  ?  301  LEU A CB   1 
ATOM   2760 C  CG   . LEU A 1 188 ? 2.215   -4.627  10.212  1.00 34.87  ?  301  LEU A CG   1 
ATOM   2761 C  CD1  . LEU A 1 188 ? 3.484   -5.249  9.617   1.00 32.48  ?  301  LEU A CD1  1 
ATOM   2762 C  CD2  . LEU A 1 188 ? 1.644   -3.588  9.277   1.00 35.78  ?  301  LEU A CD2  1 
ATOM   2763 H  H    A LEU A 1 188 ? 0.818   -5.050  13.005  0.88 40.59  ?  301  LEU A H    1 
ATOM   2764 H  H    B LEU A 1 188 ? 0.871   -5.027  12.965  0.12 40.59  ?  301  LEU A H    1 
ATOM   2765 H  HA   . LEU A 1 188 ? -0.564  -4.681  10.689  1.00 42.37  ?  301  LEU A HA   1 
ATOM   2766 H  HB2  . LEU A 1 188 ? 1.628   -6.400  11.026  1.00 41.41  ?  301  LEU A HB2  1 
ATOM   2767 H  HB3  . LEU A 1 188 ? 0.901   -6.078  9.650   1.00 41.41  ?  301  LEU A HB3  1 
ATOM   2768 H  HG   . LEU A 1 188 ? 2.454   -4.184  11.041  1.00 41.83  ?  301  LEU A HG   1 
ATOM   2769 H  HD11 . LEU A 1 188 ? 4.127   -4.544  9.438   1.00 38.96  ?  301  LEU A HD11 1 
ATOM   2770 H  HD12 . LEU A 1 188 ? 3.855   -5.881  10.253  1.00 38.96  ?  301  LEU A HD12 1 
ATOM   2771 H  HD13 . LEU A 1 188 ? 3.256   -5.705  8.792   1.00 38.96  ?  301  LEU A HD13 1 
ATOM   2772 H  HD21 . LEU A 1 188 ? 2.330   -2.932  9.076   1.00 42.92  ?  301  LEU A HD21 1 
ATOM   2773 H  HD22 . LEU A 1 188 ? 1.354   -4.023  8.460   1.00 42.92  ?  301  LEU A HD22 1 
ATOM   2774 H  HD23 . LEU A 1 188 ? 0.889   -3.156  9.707   1.00 42.92  ?  301  LEU A HD23 1 
ATOM   2775 N  N    . ASN A 1 189 ? -0.867  -7.101  12.714  1.00 36.37  ?  302  ASN A N    1 
ATOM   2776 C  CA   . ASN A 1 189 ? -1.667  -8.255  13.119  1.00 36.97  ?  302  ASN A CA   1 
ATOM   2777 C  C    . ASN A 1 189 ? -2.284  -7.918  14.468  1.00 35.74  ?  302  ASN A C    1 
ATOM   2778 O  O    . ASN A 1 189 ? -1.908  -8.475  15.506  1.00 33.43  ?  302  ASN A O    1 
ATOM   2779 C  CB   . ASN A 1 189 ? -0.819  -9.524  13.189  1.00 38.68  ?  302  ASN A CB   1 
ATOM   2780 C  CG   . ASN A 1 189 ? -1.634  -10.747 13.541  1.00 42.11  ?  302  ASN A CG   1 
ATOM   2781 O  OD1  . ASN A 1 189 ? -2.868  -10.715 13.555  1.00 42.28  ?  302  ASN A OD1  1 
ATOM   2782 N  ND2  . ASN A 1 189 ? -0.948  -11.846 13.820  1.00 44.55  ?  302  ASN A ND2  1 
ATOM   2783 H  H    . ASN A 1 189 ? -0.331  -6.835  13.331  1.00 43.63  ?  302  ASN A H    1 
ATOM   2784 H  HA   . ASN A 1 189 ? -2.372  -8.420  12.474  1.00 44.35  ?  302  ASN A HA   1 
ATOM   2785 H  HB2  . ASN A 1 189 ? -0.405  -9.677  12.326  1.00 46.40  ?  302  ASN A HB2  1 
ATOM   2786 H  HB3  . ASN A 1 189 ? -0.137  -9.412  13.870  1.00 46.40  ?  302  ASN A HB3  1 
ATOM   2787 H  HD21 . ASN A 1 189 ? -1.362  -12.571 14.026  1.00 53.44  ?  302  ASN A HD21 1 
ATOM   2788 H  HD22 . ASN A 1 189 ? -0.088  -11.834 13.794  1.00 53.44  ?  302  ASN A HD22 1 
ATOM   2789 N  N    . PRO A 1 190 ? -3.239  -6.990  14.482  1.00 38.46  ?  303  PRO A N    1 
ATOM   2790 C  CA   . PRO A 1 190 ? -3.780  -6.499  15.764  1.00 37.56  ?  303  PRO A CA   1 
ATOM   2791 C  C    . PRO A 1 190 ? -4.250  -7.594  16.714  1.00 37.94  ?  303  PRO A C    1 
ATOM   2792 O  O    . PRO A 1 190 ? -3.998  -7.485  17.923  1.00 34.99  ?  303  PRO A O    1 
ATOM   2793 C  CB   . PRO A 1 190 ? -4.950  -5.602  15.325  1.00 40.84  ?  303  PRO A CB   1 
ATOM   2794 C  CG   . PRO A 1 190 ? -4.645  -5.218  13.908  1.00 41.48  ?  303  PRO A CG   1 
ATOM   2795 C  CD   . PRO A 1 190 ? -3.881  -6.364  13.312  1.00 38.92  ?  303  PRO A CD   1 
ATOM   2796 H  HA   . PRO A 1 190 ? -3.099  -5.969  16.207  1.00 45.06  ?  303  PRO A HA   1 
ATOM   2797 H  HB2  . PRO A 1 190 ? -5.782  -6.098  15.377  1.00 48.99  ?  303  PRO A HB2  1 
ATOM   2798 H  HB3  . PRO A 1 190 ? -4.994  -4.818  15.894  1.00 48.99  ?  303  PRO A HB3  1 
ATOM   2799 H  HG2  . PRO A 1 190 ? -5.474  -5.073  13.426  1.00 49.76  ?  303  PRO A HG2  1 
ATOM   2800 H  HG3  . PRO A 1 190 ? -4.110  -4.409  13.899  1.00 49.76  ?  303  PRO A HG3  1 
ATOM   2801 H  HD2  . PRO A 1 190 ? -4.480  -6.987  12.873  1.00 46.68  ?  303  PRO A HD2  1 
ATOM   2802 H  HD3  . PRO A 1 190 ? -3.215  -6.044  12.683  1.00 46.68  ?  303  PRO A HD3  1 
ATOM   2803 N  N    . ARG A 1 191 ? -4.934  -8.639  16.227  1.00 37.03  ?  304  ARG A N    1 
ATOM   2804 C  CA   . ARG A 1 191 ? -5.452  -9.630  17.167  1.00 39.39  ?  304  ARG A CA   1 
ATOM   2805 C  C    . ARG A 1 191 ? -4.315  -10.303 17.922  1.00 38.79  ?  304  ARG A C    1 
ATOM   2806 O  O    . ARG A 1 191 ? -4.363  -10.420 19.153  1.00 34.15  ?  304  ARG A O    1 
ATOM   2807 C  CB   . ARG A 1 191 ? -6.327  -10.688 16.500  1.00 43.72  ?  304  ARG A CB   1 
ATOM   2808 C  CG   . ARG A 1 191 ? -6.695  -11.824 17.510  1.00 52.56  ?  304  ARG A CG   1 
ATOM   2809 C  CD   . ARG A 1 191 ? -7.911  -12.684 17.143  1.00 61.37  ?  304  ARG A CD   1 
ATOM   2810 N  NE   . ARG A 1 191 ? -8.074  -13.855 18.024  1.00 69.66  ?  304  ARG A NE   1 
ATOM   2811 C  CZ   . ARG A 1 191 ? -8.609  -13.822 19.245  1.00 76.85  ?  304  ARG A CZ   1 
ATOM   2812 N  NH1  . ARG A 1 191 ? -8.720  -14.940 19.956  1.00 82.48  ?  304  ARG A NH1  1 
ATOM   2813 N  NH2  . ARG A 1 191 ? -9.029  -12.679 19.767  1.00 77.77  ?  304  ARG A NH2  1 
ATOM   2814 H  H    . ARG A 1 191 ? -5.101  -8.788  15.397  1.00 44.42  ?  304  ARG A H    1 
ATOM   2815 H  HA   . ARG A 1 191 ? -6.025  -9.151  17.786  1.00 47.25  ?  304  ARG A HA   1 
ATOM   2816 H  HB2  . ARG A 1 191 ? -7.148  -10.277 16.186  1.00 52.44  ?  304  ARG A HB2  1 
ATOM   2817 H  HB3  . ARG A 1 191 ? -5.847  -11.081 15.754  1.00 52.44  ?  304  ARG A HB3  1 
ATOM   2818 H  HG2  . ARG A 1 191 ? -5.934  -12.422 17.583  1.00 63.05  ?  304  ARG A HG2  1 
ATOM   2819 H  HG3  . ARG A 1 191 ? -6.881  -11.418 18.370  1.00 63.05  ?  304  ARG A HG3  1 
ATOM   2820 H  HD2  . ARG A 1 191 ? -8.712  -12.142 17.215  1.00 73.63  ?  304  ARG A HD2  1 
ATOM   2821 H  HD3  . ARG A 1 191 ? -7.807  -13.005 16.234  1.00 73.63  ?  304  ARG A HD3  1 
ATOM   2822 H  HE   . ARG A 1 191 ? -7.803  -14.616 17.728  1.00 83.57  ?  304  ARG A HE   1 
ATOM   2823 H  HH11 . ARG A 1 191 ? -8.446  -15.687 19.629  1.00 98.96  ?  304  ARG A HH11 1 
ATOM   2824 H  HH12 . ARG A 1 191 ? -9.065  -14.917 20.743  1.00 98.96  ?  304  ARG A HH12 1 
ATOM   2825 H  HH21 . ARG A 1 191 ? -8.958  -11.949 19.317  1.00 93.31  ?  304  ARG A HH21 1 
ATOM   2826 H  HH22 . ARG A 1 191 ? -9.373  -12.666 20.555  1.00 93.31  ?  304  ARG A HH22 1 
ATOM   2827 N  N    . LYS A 1 192 ? -3.280  -10.757 17.208  1.00 38.86  ?  305  LYS A N    1 
ATOM   2828 C  CA   . LYS A 1 192 ? -2.146  -11.373 17.890  1.00 35.79  ?  305  LYS A CA   1 
ATOM   2829 C  C    . LYS A 1 192 ? -1.511  -10.399 18.875  1.00 34.10  ?  305  LYS A C    1 
ATOM   2830 O  O    . LYS A 1 192 ? -1.210  -10.764 20.017  1.00 32.56  ?  305  LYS A O    1 
ATOM   2831 C  CB   . LYS A 1 192 ? -1.109  -11.851 16.870  1.00 39.78  ?  305  LYS A CB   1 
ATOM   2832 C  CG   . LYS A 1 192 ? 0.006   -12.674 17.484  1.00 37.28  ?  305  LYS A CG   1 
ATOM   2833 C  CD   . LYS A 1 192 ? 0.947   -13.164 16.404  1.00 35.91  ?  305  LYS A CD   1 
ATOM   2834 C  CE   . LYS A 1 192 ? 2.121   -13.893 17.016  1.00 41.99  ?  305  LYS A CE   1 
ATOM   2835 N  NZ   . LYS A 1 192 ? 3.129   -14.310 16.000  1.00 37.96  ?  305  LYS A NZ   1 
ATOM   2836 H  H    . LYS A 1 192 ? -3.212  -10.720 16.351  1.00 46.62  ?  305  LYS A H    1 
ATOM   2837 H  HA   . LYS A 1 192 ? -2.464  -12.147 18.381  1.00 42.93  ?  305  LYS A HA   1 
ATOM   2838 H  HB2  . LYS A 1 192 ? -1.553  -12.401 16.206  1.00 47.72  ?  305  LYS A HB2  1 
ATOM   2839 H  HB3  . LYS A 1 192 ? -0.708  -11.076 16.446  1.00 47.72  ?  305  LYS A HB3  1 
ATOM   2840 H  HG2  . LYS A 1 192 ? 0.509   -12.128 18.110  1.00 44.72  ?  305  LYS A HG2  1 
ATOM   2841 H  HG3  . LYS A 1 192 ? -0.369  -13.442 17.942  1.00 44.72  ?  305  LYS A HG3  1 
ATOM   2842 H  HD2  . LYS A 1 192 ? 0.476   -13.775 15.816  1.00 43.07  ?  305  LYS A HD2  1 
ATOM   2843 H  HD3  . LYS A 1 192 ? 1.283   -12.408 15.897  1.00 43.07  ?  305  LYS A HD3  1 
ATOM   2844 H  HE2  . LYS A 1 192 ? 2.560   -13.308 17.653  1.00 50.37  ?  305  LYS A HE2  1 
ATOM   2845 H  HE3  . LYS A 1 192 ? 1.799   -14.690 17.465  1.00 50.37  ?  305  LYS A HE3  1 
ATOM   2846 H  HZ1  . LYS A 1 192 ? 3.803   -14.735 16.397  1.00 45.54  ?  305  LYS A HZ1  1 
ATOM   2847 H  HZ2  . LYS A 1 192 ? 2.755   -14.855 15.405  1.00 45.54  ?  305  LYS A HZ2  1 
ATOM   2848 H  HZ3  . LYS A 1 192 ? 3.448   -13.595 15.576  1.00 45.54  ?  305  LYS A HZ3  1 
ATOM   2849 N  N    . LEU A 1 193 ? -1.306  -9.147  18.453  1.00 31.54  ?  306  LEU A N    1 
ATOM   2850 C  CA   . LEU A 1 193 ? -0.684  -8.171  19.341  1.00 33.22  ?  306  LEU A CA   1 
ATOM   2851 C  C    . LEU A 1 193 ? -1.482  -8.028  20.629  1.00 34.14  ?  306  LEU A C    1 
ATOM   2852 O  O    . LEU A 1 193 ? -0.904  -7.948  21.721  1.00 32.15  ?  306  LEU A O    1 
ATOM   2853 C  CB   . LEU A 1 193 ? -0.551  -6.821  18.639  1.00 33.50  ?  306  LEU A CB   1 
ATOM   2854 C  CG   . LEU A 1 193 ? 0.418   -6.731  17.450  1.00 36.45  ?  306  LEU A CG   1 
ATOM   2855 C  CD1  . LEU A 1 193 ? 0.562   -5.295  16.982  1.00 35.27  ?  306  LEU A CD1  1 
ATOM   2856 C  CD2  . LEU A 1 193 ? 1.779   -7.301  17.808  1.00 36.18  ?  306  LEU A CD2  1 
ATOM   2857 H  H    . LEU A 1 193 ? -1.514  -8.844  17.676  1.00 37.83  ?  306  LEU A H    1 
ATOM   2858 H  HA   . LEU A 1 193 ? 0.209   -8.474  19.566  1.00 39.85  ?  306  LEU A HA   1 
ATOM   2859 H  HB2  . LEU A 1 193 ? -1.427  -6.572  18.305  1.00 40.19  ?  306  LEU A HB2  1 
ATOM   2860 H  HB3  . LEU A 1 193 ? -0.250  -6.173  19.296  1.00 40.19  ?  306  LEU A HB3  1 
ATOM   2861 H  HG   . LEU A 1 193 ? 0.055   -7.257  16.721  1.00 43.73  ?  306  LEU A HG   1 
ATOM   2862 H  HD11 . LEU A 1 193 ? 0.660   -5.286  16.017  1.00 42.31  ?  306  LEU A HD11 1 
ATOM   2863 H  HD12 . LEU A 1 193 ? -0.231  -4.798  17.239  1.00 42.31  ?  306  LEU A HD12 1 
ATOM   2864 H  HD13 . LEU A 1 193 ? 1.347   -4.905  17.398  1.00 42.31  ?  306  LEU A HD13 1 
ATOM   2865 H  HD21 . LEU A 1 193 ? 2.399   -7.116  17.086  1.00 43.40  ?  306  LEU A HD21 1 
ATOM   2866 H  HD22 . LEU A 1 193 ? 2.091   -6.885  18.627  1.00 43.40  ?  306  LEU A HD22 1 
ATOM   2867 H  HD23 . LEU A 1 193 ? 1.696   -8.260  17.935  1.00 43.40  ?  306  LEU A HD23 1 
ATOM   2868 N  N    . VAL A 1 194 ? -2.816  -8.010  20.521  1.00 33.28  ?  307  VAL A N    1 
ATOM   2869 C  CA   . VAL A 1 194 ? -3.660  -7.916  21.710  1.00 34.67  ?  307  VAL A CA   1 
ATOM   2870 C  C    . VAL A 1 194 ? -3.599  -9.202  22.521  1.00 32.55  ?  307  VAL A C    1 
ATOM   2871 O  O    . VAL A 1 194 ? -3.528  -9.163  23.749  1.00 35.37  ?  307  VAL A O    1 
ATOM   2872 C  CB   . VAL A 1 194 ? -5.107  -7.569  21.310  1.00 38.02  ?  307  VAL A CB   1 
ATOM   2873 C  CG1  . VAL A 1 194 ? -6.014  -7.579  22.537  1.00 37.21  ?  307  VAL A CG1  1 
ATOM   2874 C  CG2  . VAL A 1 194 ? -5.161  -6.220  20.610  1.00 34.81  ?  307  VAL A CG2  1 
ATOM   2875 H  H    . VAL A 1 194 ? -3.251  -8.049  19.781  1.00 39.93  ?  307  VAL A H    1 
ATOM   2876 H  HA   . VAL A 1 194 ? -3.319  -7.199  22.267  1.00 41.59  ?  307  VAL A HA   1 
ATOM   2877 H  HB   . VAL A 1 194 ? -5.431  -8.240  20.688  1.00 45.61  ?  307  VAL A HB   1 
ATOM   2878 H  HG11 . VAL A 1 194 ? -6.846  -7.131  22.319  1.00 44.64  ?  307  VAL A HG11 1 
ATOM   2879 H  HG12 . VAL A 1 194 ? -6.190  -8.498  22.792  1.00 44.64  ?  307  VAL A HG12 1 
ATOM   2880 H  HG13 . VAL A 1 194 ? -5.569  -7.114  23.263  1.00 44.64  ?  307  VAL A HG13 1 
ATOM   2881 H  HG21 . VAL A 1 194 ? -6.060  -6.072  20.278  1.00 41.76  ?  307  VAL A HG21 1 
ATOM   2882 H  HG22 . VAL A 1 194 ? -4.924  -5.526  21.244  1.00 41.76  ?  307  VAL A HG22 1 
ATOM   2883 H  HG23 . VAL A 1 194 ? -4.532  -6.222  19.871  1.00 41.76  ?  307  VAL A HG23 1 
ATOM   2884 N  N    . GLU A 1 195 ? -3.625  -10.361 21.860  1.00 35.35  ?  308  GLU A N    1 
ATOM   2885 C  CA   . GLU A 1 195 ? -3.604  -11.621 22.599  1.00 38.32  ?  308  GLU A CA   1 
ATOM   2886 C  C    . GLU A 1 195 ? -2.366  -11.718 23.484  1.00 38.93  ?  308  GLU A C    1 
ATOM   2887 O  O    . GLU A 1 195 ? -2.449  -12.173 24.630  1.00 35.67  ?  308  GLU A O    1 
ATOM   2888 C  CB   . GLU A 1 195 ? -3.627  -12.832 21.667  1.00 39.26  ?  308  GLU A CB   1 
ATOM   2889 C  CG   . GLU A 1 195 ? -4.864  -13.085 20.828  1.00 49.10  ?  308  GLU A CG   1 
ATOM   2890 C  CD   . GLU A 1 195 ? -4.723  -14.383 20.024  1.00 56.96  ?  308  GLU A CD   1 
ATOM   2891 O  OE1  . GLU A 1 195 ? -4.688  -15.473 20.643  1.00 62.56  ?  308  GLU A OE1  1 
ATOM   2892 O  OE2  . GLU A 1 195 ? -4.609  -14.321 18.783  1.00 59.64  ?  308  GLU A OE2  1 
ATOM   2893 H  H    . GLU A 1 195 ? -3.653  -10.445 21.004  1.00 42.41  ?  308  GLU A H    1 
ATOM   2894 H  HA   . GLU A 1 195 ? -4.408  -11.642 23.142  1.00 45.97  ?  308  GLU A HA   1 
ATOM   2895 H  HB2  . GLU A 1 195 ? -2.889  -12.736 21.046  1.00 47.10  ?  308  GLU A HB2  1 
ATOM   2896 H  HB3  . GLU A 1 195 ? -3.500  -13.624 22.214  1.00 47.10  ?  308  GLU A HB3  1 
ATOM   2897 H  HG2  . GLU A 1 195 ? -5.638  -13.164 21.408  1.00 58.90  ?  308  GLU A HG2  1 
ATOM   2898 H  HG3  . GLU A 1 195 ? -4.989  -12.350 20.207  1.00 58.90  ?  308  GLU A HG3  1 
ATOM   2899 N  N    . VAL A 1 196 ? -1.196  -11.314 22.965  1.00 36.77  ?  309  VAL A N    1 
ATOM   2900 C  CA   . VAL A 1 196 ? 0.035   -11.451 23.737  1.00 37.04  ?  309  VAL A CA   1 
ATOM   2901 C  C    . VAL A 1 196 ? 0.304   -10.247 24.620  1.00 33.76  ?  309  VAL A C    1 
ATOM   2902 O  O    . VAL A 1 196 ? 1.331   -10.213 25.308  1.00 34.26  ?  309  VAL A O    1 
ATOM   2903 C  CB   . VAL A 1 196 ? 1.260   -11.711 22.835  1.00 37.45  ?  309  VAL A CB   1 
ATOM   2904 C  CG1  . VAL A 1 196 ? 1.068   -13.000 22.036  1.00 37.53  ?  309  VAL A CG1  1 
ATOM   2905 C  CG2  . VAL A 1 196 ? 1.516   -10.540 21.915  1.00 34.83  ?  309  VAL A CG2  1 
ATOM   2906 H  H    . VAL A 1 196 ? -1.098  -10.966 22.185  1.00 44.11  ?  309  VAL A H    1 
ATOM   2907 H  HA   . VAL A 1 196 ? -0.078  -12.227 24.308  1.00 44.43  ?  309  VAL A HA   1 
ATOM   2908 H  HB   . VAL A 1 196 ? 2.043   -11.815 23.398  1.00 44.92  ?  309  VAL A HB   1 
ATOM   2909 H  HG11 . VAL A 1 196 ? 1.862   -13.162 21.502  1.00 45.02  ?  309  VAL A HG11 1 
ATOM   2910 H  HG12 . VAL A 1 196 ? 0.929   -13.736 22.652  1.00 45.02  ?  309  VAL A HG12 1 
ATOM   2911 H  HG13 . VAL A 1 196 ? 0.296   -12.902 21.458  1.00 45.02  ?  309  VAL A HG13 1 
ATOM   2912 H  HG21 . VAL A 1 196 ? 2.183   -10.794 21.259  1.00 41.78  ?  309  VAL A HG21 1 
ATOM   2913 H  HG22 . VAL A 1 196 ? 0.688   -10.301 21.470  1.00 41.78  ?  309  VAL A HG22 1 
ATOM   2914 H  HG23 . VAL A 1 196 ? 1.837   -9.790  22.441  1.00 41.78  ?  309  VAL A HG23 1 
ATOM   2915 N  N    . LYS A 1 197 ? -0.587  -9.261  24.626  1.00 34.82  ?  310  LYS A N    1 
ATOM   2916 C  CA   . LYS A 1 197 ? -0.468  -8.059  25.448  1.00 34.55  ?  310  LYS A CA   1 
ATOM   2917 C  C    . LYS A 1 197 ? 0.679   -7.156  25.001  1.00 34.43  ?  310  LYS A C    1 
ATOM   2918 O  O    . LYS A 1 197 ? 1.156   -6.325  25.773  1.00 32.21  ?  310  LYS A O    1 
ATOM   2919 C  CB   . LYS A 1 197 ? -0.309  -8.418  26.930  1.00 39.15  ?  310  LYS A CB   1 
ATOM   2920 C  CG   . LYS A 1 197 ? -1.406  -9.346  27.471  1.00 44.80  ?  310  LYS A CG   1 
ATOM   2921 C  CD   . LYS A 1 197 ? -2.270  -8.646  28.505  1.00 48.90  ?  310  LYS A CD   1 
ATOM   2922 C  CE   . LYS A 1 197 ? -3.317  -9.586  29.098  1.00 56.13  ?  310  LYS A CE   1 
ATOM   2923 N  NZ   . LYS A 1 197 ? -4.335  -10.017 28.095  1.00 55.52  ?  310  LYS A NZ   1 
ATOM   2924 H  H    . LYS A 1 197 ? -1.297  -9.268  24.141  1.00 41.77  ?  310  LYS A H    1 
ATOM   2925 H  HA   . LYS A 1 197 ? -1.286  -7.547  25.352  1.00 41.44  ?  310  LYS A HA   1 
ATOM   2926 H  HB2  . LYS A 1 197 ? 0.542   -8.866  27.052  1.00 46.96  ?  310  LYS A HB2  1 
ATOM   2927 H  HB3  . LYS A 1 197 ? -0.332  -7.601  27.452  1.00 46.96  ?  310  LYS A HB3  1 
ATOM   2928 H  HG2  . LYS A 1 197 ? -1.976  -9.630  26.739  1.00 53.75  ?  310  LYS A HG2  1 
ATOM   2929 H  HG3  . LYS A 1 197 ? -0.995  -10.119 27.890  1.00 53.75  ?  310  LYS A HG3  1 
ATOM   2930 H  HD2  . LYS A 1 197 ? -1.708  -8.324  29.226  1.00 58.66  ?  310  LYS A HD2  1 
ATOM   2931 H  HD3  . LYS A 1 197 ? -2.731  -7.903  28.086  1.00 58.66  ?  310  LYS A HD3  1 
ATOM   2932 H  HE2  . LYS A 1 197 ? -2.875  -10.379 29.438  1.00 67.34  ?  310  LYS A HE2  1 
ATOM   2933 H  HE3  . LYS A 1 197 ? -3.779  -9.130  29.819  1.00 67.34  ?  310  LYS A HE3  1 
ATOM   2934 H  HZ1  . LYS A 1 197 ? -4.763  -9.307  27.770  1.00 66.61  ?  310  LYS A HZ1  1 
ATOM   2935 H  HZ2  . LYS A 1 197 ? -4.927  -10.561 28.477  1.00 66.61  ?  310  LYS A HZ2  1 
ATOM   2936 H  HZ3  . LYS A 1 197 ? -3.939  -10.447 27.424  1.00 66.61  ?  310  LYS A HZ3  1 
ATOM   2937 N  N    . PHE A 1 198 ? 1.132   -7.300  23.757  1.00 30.32  ?  311  PHE A N    1 
ATOM   2938 C  CA   . PHE A 1 198 ? 1.968   -6.262  23.164  1.00 33.49  ?  311  PHE A CA   1 
ATOM   2939 C  C    . PHE A 1 198 ? 1.150   -5.002  22.905  1.00 33.25  ?  311  PHE A C    1 
ATOM   2940 O  O    . PHE A 1 198 ? 1.678   -3.885  22.976  1.00 31.91  ?  311  PHE A O    1 
ATOM   2941 C  CB   . PHE A 1 198 ? 2.598   -6.786  21.868  1.00 31.07  ?  311  PHE A CB   1 
ATOM   2942 C  CG   . PHE A 1 198 ? 3.609   -5.851  21.259  1.00 31.29  ?  311  PHE A CG   1 
ATOM   2943 C  CD1  . PHE A 1 198 ? 3.213   -4.878  20.366  1.00 30.03  ?  311  PHE A CD1  1 
ATOM   2944 C  CD2  . PHE A 1 198 ? 4.951   -5.956  21.586  1.00 32.38  ?  311  PHE A CD2  1 
ATOM   2945 C  CE1  . PHE A 1 198 ? 4.143   -4.013  19.804  1.00 32.45  ?  311  PHE A CE1  1 
ATOM   2946 C  CE2  . PHE A 1 198 ? 5.883   -5.103  21.027  1.00 31.15  ?  311  PHE A CE2  1 
ATOM   2947 C  CZ   . PHE A 1 198 ? 5.473   -4.132  20.138  1.00 32.08  ?  311  PHE A CZ   1 
ATOM   2948 H  H    . PHE A 1 198 ? 0.975   -7.973  23.245  1.00 36.36  ?  311  PHE A H    1 
ATOM   2949 H  HA   . PHE A 1 198 ? 2.692   -6.032  23.767  1.00 40.18  ?  311  PHE A HA   1 
ATOM   2950 H  HB2  . PHE A 1 198 ? 3.048   -7.625  22.058  1.00 37.27  ?  311  PHE A HB2  1 
ATOM   2951 H  HB3  . PHE A 1 198 ? 1.895   -6.928  21.215  1.00 37.27  ?  311  PHE A HB3  1 
ATOM   2952 H  HD1  . PHE A 1 198 ? 2.315   -4.799  20.138  1.00 36.03  ?  311  PHE A HD1  1 
ATOM   2953 H  HD2  . PHE A 1 198 ? 5.227   -6.608  22.189  1.00 38.84  ?  311  PHE A HD2  1 
ATOM   2954 H  HE1  . PHE A 1 198 ? 3.869   -3.357  19.205  1.00 38.92  ?  311  PHE A HE1  1 
ATOM   2955 H  HE2  . PHE A 1 198 ? 6.783   -5.184  21.248  1.00 37.36  ?  311  PHE A HE2  1 
ATOM   2956 H  HZ   . PHE A 1 198 ? 6.098   -3.554  19.763  1.00 38.48  ?  311  PHE A HZ   1 
ATOM   2957 N  N    . SER A 1 199 ? -0.136  -5.163  22.619  1.00 31.53  ?  312  SER A N    1 
ATOM   2958 C  CA   . SER A 1 199 ? -1.050  -4.066  22.370  1.00 34.62  ?  312  SER A CA   1 
ATOM   2959 C  C    . SER A 1 199 ? -2.284  -4.262  23.255  1.00 36.06  ?  312  SER A C    1 
ATOM   2960 O  O    . SER A 1 199 ? -2.345  -5.184  24.076  1.00 32.78  ?  312  SER A O    1 
ATOM   2961 C  CB   . SER A 1 199 ? -1.442  -4.014  20.891  1.00 32.50  ?  312  SER A CB   1 
ATOM   2962 O  OG   . SER A 1 199 ? -2.122  -2.810  20.610  1.00 36.42  ?  312  SER A OG   1 
ATOM   2963 H  H    . SER A 1 199 ? -0.513  -5.934  22.561  1.00 37.81  ?  312  SER A H    1 
ATOM   2964 H  HA   . SER A 1 199 ? -0.630  -3.224  22.603  1.00 41.53  ?  312  SER A HA   1 
ATOM   2965 H  HB2  . SER A 1 199 ? -0.640  -4.061  20.347  1.00 38.98  ?  312  SER A HB2  1 
ATOM   2966 H  HB3  . SER A 1 199 ? -2.024  -4.763  20.689  1.00 38.98  ?  312  SER A HB3  1 
ATOM   2967 H  HG   . SER A 1 199 ? -2.336  -2.784  19.798  1.00 43.69  ?  312  SER A HG   1 
ATOM   2968 N  N    . HIS A 1 200 ? -3.274  -3.389  23.087  1.00 34.64  ?  313  HIS A N    1 
ATOM   2969 C  CA   . HIS A 1 200 ? -4.535  -3.516  23.813  1.00 36.73  ?  313  HIS A CA   1 
ATOM   2970 C  C    . HIS A 1 200 ? -5.681  -3.137  22.891  1.00 36.82  ?  313  HIS A C    1 
ATOM   2971 O  O    . HIS A 1 200 ? -5.496  -2.469  21.875  1.00 35.89  ?  313  HIS A O    1 
ATOM   2972 C  CB   . HIS A 1 200 ? -4.553  -2.648  25.079  1.00 37.65  ?  313  HIS A CB   1 
ATOM   2973 C  CG   . HIS A 1 200 ? -4.120  -1.237  24.848  1.00 41.72  ?  313  HIS A CG   1 
ATOM   2974 N  ND1  . HIS A 1 200 ? -4.988  -0.247  24.435  1.00 42.75  ?  313  HIS A ND1  1 
ATOM   2975 C  CD2  . HIS A 1 200 ? -2.902  -0.649  24.950  1.00 43.12  ?  313  HIS A CD2  1 
ATOM   2976 C  CE1  . HIS A 1 200 ? -4.327  0.889   24.300  1.00 39.85  ?  313  HIS A CE1  1 
ATOM   2977 N  NE2  . HIS A 1 200 ? -3.059  0.674   24.605  1.00 41.56  ?  313  HIS A NE2  1 
ATOM   2978 H  H    . HIS A 1 200 ? -3.239  -2.712  22.557  1.00 41.55  ?  313  HIS A H    1 
ATOM   2979 H  HA   . HIS A 1 200 ? -4.659  -4.439  24.084  1.00 44.05  ?  313  HIS A HA   1 
ATOM   2980 H  HB2  . HIS A 1 200 ? -5.457  -2.627  25.430  1.00 45.16  ?  313  HIS A HB2  1 
ATOM   2981 H  HB3  . HIS A 1 200 ? -3.952  -3.039  25.733  1.00 45.16  ?  313  HIS A HB3  1 
ATOM   2982 H  HD1  . HIS A 1 200 ? -5.829  -0.354  24.287  1.00 51.29  ?  313  HIS A HD1  1 
ATOM   2983 H  HD2  . HIS A 1 200 ? -2.109  -1.063  25.204  1.00 51.73  ?  313  HIS A HD2  1 
ATOM   2984 H  HE1  . HIS A 1 200 ? -4.692  1.703   24.036  1.00 47.81  ?  313  HIS A HE1  1 
ATOM   2985 H  HE2  . HIS A 1 200 ? -2.434  1.264   24.591  1.00 49.85  ?  313  HIS A HE2  1 
ATOM   2986 N  N    . LEU A 1 201 ? -6.881  -3.582  23.254  1.00 42.19  ?  314  LEU A N    1 
ATOM   2987 C  CA   . LEU A 1 201 ? -8.066  -3.201  22.501  1.00 45.02  ?  314  LEU A CA   1 
ATOM   2988 C  C    . LEU A 1 201 ? -8.221  -1.687  22.518  1.00 45.40  ?  314  LEU A C    1 
ATOM   2989 O  O    . LEU A 1 201 ? -7.924  -1.028  23.517  1.00 44.87  ?  314  LEU A O    1 
ATOM   2990 C  CB   . LEU A 1 201 ? -9.317  -3.860  23.094  1.00 47.55  ?  314  LEU A CB   1 
ATOM   2991 C  CG   . LEU A 1 201 ? -9.522  -5.345  22.792  1.00 49.48  ?  314  LEU A CG   1 
ATOM   2992 C  CD1  . LEU A 1 201 ? -10.636 -5.922  23.667  1.00 48.37  ?  314  LEU A CD1  1 
ATOM   2993 C  CD2  . LEU A 1 201 ? -9.836  -5.551  21.319  1.00 46.59  ?  314  LEU A CD2  1 
ATOM   2994 H  H    . LEU A 1 201 ? -7.034  -4.098  23.925  1.00 50.61  ?  314  LEU A H    1 
ATOM   2995 H  HA   . LEU A 1 201 ? -7.979  -3.502  21.583  1.00 54.01  ?  314  LEU A HA   1 
ATOM   2996 H  HB2  . LEU A 1 201 ? -9.274  -3.770  24.059  1.00 57.04  ?  314  LEU A HB2  1 
ATOM   2997 H  HB3  . LEU A 1 201 ? -10.093 -3.391  22.751  1.00 57.04  ?  314  LEU A HB3  1 
ATOM   2998 H  HG   . LEU A 1 201 ? -8.703  -5.825  22.994  1.00 59.36  ?  314  LEU A HG   1 
ATOM   2999 H  HD11 . LEU A 1 201 ? -10.749 -6.862  23.457  1.00 58.02  ?  314  LEU A HD11 1 
ATOM   3000 H  HD12 . LEU A 1 201 ? -10.391 -5.818  24.600  1.00 58.02  ?  314  LEU A HD12 1 
ATOM   3001 H  HD13 . LEU A 1 201 ? -11.460 -5.442  23.486  1.00 58.02  ?  314  LEU A HD13 1 
ATOM   3002 H  HD21 . LEU A 1 201 ? -9.846  -6.502  21.128  1.00 55.89  ?  314  LEU A HD21 1 
ATOM   3003 H  HD22 . LEU A 1 201 ? -10.704 -5.164  21.124  1.00 55.89  ?  314  LEU A HD22 1 
ATOM   3004 H  HD23 . LEU A 1 201 ? -9.153  -5.114  20.786  1.00 55.89  ?  314  LEU A HD23 1 
ATOM   3005 N  N    . SER A 1 202 ? -8.674  -1.136  21.395  1.00 46.28  ?  315  SER A N    1 
ATOM   3006 C  CA   . SER A 1 202 ? -8.987  0.280   21.334  1.00 47.75  ?  315  SER A CA   1 
ATOM   3007 C  C    . SER A 1 202 ? -9.814  0.689   22.548  1.00 50.15  ?  315  SER A C    1 
ATOM   3008 O  O    . SER A 1 202 ? -10.570 -0.107  23.118  1.00 46.77  ?  315  SER A O    1 
ATOM   3009 C  CB   . SER A 1 202 ? -9.754  0.601   20.055  1.00 50.65  ?  315  SER A CB   1 
ATOM   3010 O  OG   . SER A 1 202 ? -10.227 1.934   20.079  1.00 53.72  ?  315  SER A OG   1 
ATOM   3011 H  H    . SER A 1 202 ? -8.807  -1.560  20.659  1.00 55.52  ?  315  SER A H    1 
ATOM   3012 H  HA   . SER A 1 202 ? -8.164  0.792   21.330  1.00 57.29  ?  315  SER A HA   1 
ATOM   3013 H  HB2  . SER A 1 202 ? -9.163  0.489   19.294  1.00 60.77  ?  315  SER A HB2  1 
ATOM   3014 H  HB3  . SER A 1 202 ? -10.510 -0.002  19.979  1.00 60.77  ?  315  SER A HB3  1 
ATOM   3015 H  HG   . SER A 1 202 ? -10.358 2.207   19.296  1.00 64.45  ?  315  SER A HG   1 
ATOM   3016 N  N    . ARG A 1 203 ? -9.660  1.949   22.954  1.00 50.17  ?  316  ARG A N    1 
ATOM   3017 C  CA   . ARG A 1 203 ? -10.377 2.429   24.127  1.00 51.40  ?  316  ARG A CA   1 
ATOM   3018 C  C    . ARG A 1 203 ? -11.884 2.413   23.925  1.00 49.71  ?  316  ARG A C    1 
ATOM   3019 O  O    . ARG A 1 203 ? -12.628 2.388   24.911  1.00 49.28  ?  316  ARG A O    1 
ATOM   3020 C  CB   . ARG A 1 203 ? -9.913  3.843   24.482  1.00 54.35  ?  316  ARG A CB   1 
ATOM   3021 C  CG   . ARG A 1 203 ? -9.880  4.804   23.310  1.00 56.86  ?  316  ARG A CG   1 
ATOM   3022 C  CD   . ARG A 1 203 ? -9.388  6.172   23.755  1.00 62.99  ?  316  ARG A CD   1 
ATOM   3023 N  NE   . ARG A 1 203 ? -9.046  7.029   22.622  1.00 69.13  ?  316  ARG A NE   1 
ATOM   3024 C  CZ   . ARG A 1 203 ? -9.920  7.784   21.960  1.00 72.08  ?  316  ARG A CZ   1 
ATOM   3025 N  NH1  . ARG A 1 203 ? -11.200 7.795   22.311  1.00 70.84  ?  316  ARG A NH1  1 
ATOM   3026 N  NH2  . ARG A 1 203 ? -9.509  8.530   20.944  1.00 74.36  ?  316  ARG A NH2  1 
ATOM   3027 H  H    . ARG A 1 203 ? -9.157  2.534   22.575  1.00 60.19  ?  316  ARG A H    1 
ATOM   3028 H  HA   . ARG A 1 203 ? -10.171 1.849   24.877  1.00 61.67  ?  316  ARG A HA   1 
ATOM   3029 H  HB2  . ARG A 1 203 ? -10.518 4.210   25.145  1.00 65.21  ?  316  ARG A HB2  1 
ATOM   3030 H  HB3  . ARG A 1 203 ? -9.014  3.791   24.844  1.00 65.21  ?  316  ARG A HB3  1 
ATOM   3031 H  HG2  . ARG A 1 203 ? -9.277  4.466   22.630  1.00 68.21  ?  316  ARG A HG2  1 
ATOM   3032 H  HG3  . ARG A 1 203 ? -10.773 4.900   22.944  1.00 68.21  ?  316  ARG A HG3  1 
ATOM   3033 H  HD2  . ARG A 1 203 ? -10.087 6.611   24.266  1.00 75.57  ?  316  ARG A HD2  1 
ATOM   3034 H  HD3  . ARG A 1 203 ? -8.595  6.064   24.302  1.00 75.57  ?  316  ARG A HD3  1 
ATOM   3035 H  HE   . ARG A 1 203 ? -8.226  7.046   22.366  1.00 82.94  ?  316  ARG A HE   1 
ATOM   3036 H  HH11 . ARG A 1 203 ? -11.469 7.311   22.969  1.00 84.99  ?  316  ARG A HH11 1 
ATOM   3037 H  HH12 . ARG A 1 203 ? -11.760 8.285   21.879  1.00 84.99  ?  316  ARG A HH12 1 
ATOM   3038 H  HH21 . ARG A 1 203 ? -8.681  8.525   20.714  1.00 89.22  ?  316  ARG A HH21 1 
ATOM   3039 H  HH22 . ARG A 1 203 ? -10.072 9.019   20.515  1.00 89.22  ?  316  ARG A HH22 1 
ATOM   3040 N  N    A ASN A 1 204 ? -12.363 2.389   22.677  0.66 48.29  ?  317  ASN A N    1 
ATOM   3041 N  N    B ASN A 1 204 ? -12.347 2.429   22.663  0.34 48.20  ?  317  ASN A N    1 
ATOM   3042 C  CA   A ASN A 1 204 ? -13.804 2.434   22.452  0.66 47.89  ?  317  ASN A CA   1 
ATOM   3043 C  CA   B ASN A 1 204 ? -13.780 2.492   22.400  0.34 48.36  ?  317  ASN A CA   1 
ATOM   3044 C  C    A ASN A 1 204 ? -14.221 1.740   21.163  0.66 45.93  ?  317  ASN A C    1 
ATOM   3045 C  C    B ASN A 1 204 ? -14.224 1.721   21.164  0.34 45.85  ?  317  ASN A C    1 
ATOM   3046 O  O    A ASN A 1 204 ? -15.237 2.114   20.566  0.66 43.55  ?  317  ASN A O    1 
ATOM   3047 O  O    B ASN A 1 204 ? -15.270 2.050   20.592  0.34 43.02  ?  317  ASN A O    1 
ATOM   3048 C  CB   A ASN A 1 204 ? -14.282 3.889   22.419  0.66 49.64  ?  317  ASN A CB   1 
ATOM   3049 C  CB   B ASN A 1 204 ? -14.240 3.923   22.183  0.34 49.84  ?  317  ASN A CB   1 
ATOM   3050 C  CG   A ASN A 1 204 ? -13.434 4.748   21.507  0.66 50.14  ?  317  ASN A CG   1 
ATOM   3051 C  CG   B ASN A 1 204 ? -14.406 4.661   23.454  0.34 50.93  ?  317  ASN A CG   1 
ATOM   3052 O  OD1  A ASN A 1 204 ? -12.525 4.248   20.834  0.66 48.72  ?  317  ASN A OD1  1 
ATOM   3053 O  OD1  B ASN A 1 204 ? -14.356 4.076   24.524  0.34 50.63  ?  317  ASN A OD1  1 
ATOM   3054 N  ND2  A ASN A 1 204 ? -13.722 6.042   21.473  0.66 52.54  ?  317  ASN A ND2  1 
ATOM   3055 N  ND2  B ASN A 1 204 ? -14.632 5.952   23.354  0.34 53.41  ?  317  ASN A ND2  1 
ATOM   3056 H  H    A ASN A 1 204 ? -11.885 2.348   21.963  0.66 57.94  ?  317  ASN A H    1 
ATOM   3057 H  H    B ASN A 1 204 ? -11.857 2.404   21.956  0.34 57.82  ?  317  ASN A H    1 
ATOM   3058 H  HA   A ASN A 1 204 ? -14.240 1.967   23.182  0.66 57.46  ?  317  ASN A HA   1 
ATOM   3059 H  HA   B ASN A 1 204 ? -14.206 2.114   23.185  0.34 58.01  ?  317  ASN A HA   1 
ATOM   3060 H  HB2  A ASN A 1 204 ? -15.196 3.916   22.096  0.66 59.56  ?  317  ASN A HB2  1 
ATOM   3061 H  HB2  B ASN A 1 204 ? -13.581 4.390   21.647  0.34 59.79  ?  317  ASN A HB2  1 
ATOM   3062 H  HB3  A ASN A 1 204 ? -14.235 4.260   23.314  0.66 59.56  ?  317  ASN A HB3  1 
ATOM   3063 H  HB3  B ASN A 1 204 ? -15.095 3.915   21.725  0.34 59.79  ?  317  ASN A HB3  1 
ATOM   3064 H  HD21 A ASN A 1 204 ? -13.268 6.571   20.970  0.66 63.03  ?  317  ASN A HD21 1 
ATOM   3065 H  HD21 B ASN A 1 204 ? -14.736 6.427   24.063  0.34 64.07  ?  317  ASN A HD21 1 
ATOM   3066 H  HD22 A ASN A 1 204 ? -14.364 6.352   21.955  0.66 63.03  ?  317  ASN A HD22 1 
ATOM   3067 H  HD22 B ASN A 1 204 ? -14.676 6.323   22.579  0.34 64.07  ?  317  ASN A HD22 1 
ATOM   3068 N  N    . MET A 1 205 ? -13.466 0.740   20.718  1.00 43.76  ?  318  MET A N    1 
ATOM   3069 C  CA   . MET A 1 205 ? -13.816 -0.011  19.532  1.00 44.82  ?  318  MET A CA   1 
ATOM   3070 C  C    . MET A 1 205 ? -13.734 -1.495  19.827  1.00 40.28  ?  318  MET A C    1 
ATOM   3071 O  O    . MET A 1 205 ? -12.982 -1.924  20.702  1.00 38.32  ?  318  MET A O    1 
ATOM   3072 C  CB   . MET A 1 205 ? -12.891 0.290   18.364  1.00 47.60  ?  318  MET A CB   1 
ATOM   3073 C  CG   . MET A 1 205 ? -12.799 1.731   17.975  1.00 50.55  ?  318  MET A CG   1 
ATOM   3074 S  SD   . MET A 1 205 ? -11.948 1.790   16.393  1.00 51.38  ?  318  MET A SD   1 
ATOM   3075 C  CE   . MET A 1 205 ? -11.593 3.534   16.325  1.00 54.03  ?  318  MET A CE   1 
ATOM   3076 H  H    A MET A 1 205 ? -12.738 0.482   21.096  0.66 52.50  ?  318  MET A H    1 
ATOM   3077 H  H    B MET A 1 205 ? -12.733 0.489   21.091  0.34 52.50  ?  318  MET A H    1 
ATOM   3078 H  HA   . MET A 1 205 ? -14.720 0.232   19.279  1.00 53.77  ?  318  MET A HA   1 
ATOM   3079 H  HB2  . MET A 1 205 ? -11.997 -0.004  18.599  1.00 57.10  ?  318  MET A HB2  1 
ATOM   3080 H  HB3  . MET A 1 205 ? -13.209 -0.199  17.589  1.00 57.10  ?  318  MET A HB3  1 
ATOM   3081 H  HG2  . MET A 1 205 ? -13.686 2.113   17.881  1.00 60.65  ?  318  MET A HG2  1 
ATOM   3082 H  HG3  . MET A 1 205 ? -12.292 2.228   18.636  1.00 60.65  ?  318  MET A HG3  1 
ATOM   3083 H  HE1  . MET A 1 205 ? -12.290 4.016   16.798  1.00 64.82  ?  318  MET A HE1  1 
ATOM   3084 H  HE2  . MET A 1 205 ? -10.734 3.698   16.744  1.00 64.82  ?  318  MET A HE2  1 
ATOM   3085 H  HE3  . MET A 1 205 ? -11.568 3.815   15.397  1.00 64.82  ?  318  MET A HE3  1 
ATOM   3086 N  N    . THR A 1 206 ? -14.516 -2.269  19.079  1.00 38.99  ?  319  THR A N    1 
ATOM   3087 C  CA   . THR A 1 206 ? -14.397 -3.711  19.138  1.00 38.16  ?  319  THR A CA   1 
ATOM   3088 C  C    . THR A 1 206 ? -13.098 -4.147  18.466  1.00 41.01  ?  319  THR A C    1 
ATOM   3089 O  O    . THR A 1 206 ? -12.492 -3.414  17.681  1.00 40.17  ?  319  THR A O    1 
ATOM   3090 C  CB   . THR A 1 206 ? -15.577 -4.390  18.452  1.00 41.67  ?  319  THR A CB   1 
ATOM   3091 O  OG1  . THR A 1 206 ? -15.543 -4.088  17.048  1.00 41.00  ?  319  THR A OG1  1 
ATOM   3092 C  CG2  . THR A 1 206 ? -16.899 -3.918  19.051  1.00 37.83  ?  319  THR A CG2  1 
ATOM   3093 H  H    . THR A 1 206 ? -15.118 -1.982  18.536  1.00 46.77  ?  319  THR A H    1 
ATOM   3094 H  HA   . THR A 1 206 ? -14.392 -3.996  20.065  1.00 45.77  ?  319  THR A HA   1 
ATOM   3095 H  HB   . THR A 1 206 ? -15.521 -5.350  18.579  1.00 49.99  ?  319  THR A HB   1 
ATOM   3096 H  HG1  . THR A 1 206 ? -16.190 -4.457  16.660  1.00 49.18  ?  319  THR A HG1  1 
ATOM   3097 H  HG21 . THR A 1 206 ? -17.633 -4.431  18.679  1.00 45.38  ?  319  THR A HG21 1 
ATOM   3098 H  HG22 . THR A 1 206 ? -16.887 -4.036  20.013  1.00 45.38  ?  319  THR A HG22 1 
ATOM   3099 H  HG23 . THR A 1 206 ? -17.038 -2.979  18.850  1.00 45.38  ?  319  THR A HG23 1 
ATOM   3100 N  N    . LEU A 1 207 ? -12.670 -5.364  18.790  1.00 42.79  ?  320  LEU A N    1 
ATOM   3101 C  CA   . LEU A 1 207 ? -11.503 -5.933  18.125  1.00 44.58  ?  320  LEU A CA   1 
ATOM   3102 C  C    . LEU A 1 207 ? -11.692 -5.944  16.616  1.00 42.55  ?  320  LEU A C    1 
ATOM   3103 O  O    . LEU A 1 207 ? -10.761 -5.636  15.860  1.00 41.99  ?  320  LEU A O    1 
ATOM   3104 C  CB   . LEU A 1 207 ? -11.248 -7.343  18.646  1.00 47.05  ?  320  LEU A CB   1 
ATOM   3105 C  CG   . LEU A 1 207 ? -10.045 -8.084  18.048  1.00 49.36  ?  320  LEU A CG   1 
ATOM   3106 C  CD1  . LEU A 1 207 ? -8.784  -7.258  18.204  1.00 48.35  ?  320  LEU A CD1  1 
ATOM   3107 C  CD2  . LEU A 1 207 ? -9.900  -9.442  18.717  1.00 50.34  ?  320  LEU A CD2  1 
ATOM   3108 H  H    . LEU A 1 207 ? -13.029 -5.874  19.382  1.00 51.34  ?  320  LEU A H    1 
ATOM   3109 H  HA   . LEU A 1 207 ? -10.724 -5.393  18.328  1.00 53.48  ?  320  LEU A HA   1 
ATOM   3110 H  HB2  . LEU A 1 207 ? -11.102 -7.288  19.603  1.00 56.44  ?  320  LEU A HB2  1 
ATOM   3111 H  HB3  . LEU A 1 207 ? -12.035 -7.879  18.460  1.00 56.44  ?  320  LEU A HB3  1 
ATOM   3112 H  HG   . LEU A 1 207 ? -10.182 -8.226  17.098  1.00 59.22  ?  320  LEU A HG   1 
ATOM   3113 H  HD11 . LEU A 1 207 ? -8.019  -7.799  17.954  1.00 58.00  ?  320  LEU A HD11 1 
ATOM   3114 H  HD12 . LEU A 1 207 ? -8.842  -6.480  17.627  1.00 58.00  ?  320  LEU A HD12 1 
ATOM   3115 H  HD13 . LEU A 1 207 ? -8.702  -6.978  19.129  1.00 58.00  ?  320  LEU A HD13 1 
ATOM   3116 H  HD21 . LEU A 1 207 ? -9.139  -9.904  18.333  1.00 60.39  ?  320  LEU A HD21 1 
ATOM   3117 H  HD22 . LEU A 1 207 ? -9.763  -9.312  19.669  1.00 60.39  ?  320  LEU A HD22 1 
ATOM   3118 H  HD23 . LEU A 1 207 ? -10.709 -9.956  18.567  1.00 60.39  ?  320  LEU A HD23 1 
ATOM   3119 N  N    . GLN A 1 208 ? -12.898 -6.278  16.154  1.00 38.04  ?  321  GLN A N    1 
ATOM   3120 C  CA   . GLN A 1 208 ? -13.123 -6.334  14.720  1.00 38.69  ?  321  GLN A CA   1 
ATOM   3121 C  C    . GLN A 1 208 ? -12.950 -4.966  14.077  1.00 39.66  ?  321  GLN A C    1 
ATOM   3122 O  O    . GLN A 1 208 ? -12.381 -4.854  12.985  1.00 36.85  ?  321  GLN A O    1 
ATOM   3123 C  CB   . GLN A 1 208 ? -14.519 -6.856  14.397  1.00 40.91  ?  321  GLN A CB   1 
ATOM   3124 C  CG   . GLN A 1 208 ? -14.643 -7.001  12.890  1.00 46.19  ?  321  GLN A CG   1 
ATOM   3125 C  CD   . GLN A 1 208 ? -16.000 -6.656  12.350  1.00 57.77  ?  321  GLN A CD   1 
ATOM   3126 O  OE1  . GLN A 1 208 ? -16.825 -7.539  12.123  1.00 60.17  ?  321  GLN A OE1  1 
ATOM   3127 N  NE2  . GLN A 1 208 ? -16.239 -5.366  12.107  1.00 59.68  ?  321  GLN A NE2  1 
ATOM   3128 H  H    . GLN A 1 208 ? -13.582 -6.472  16.638  1.00 45.63  ?  321  GLN A H    1 
ATOM   3129 H  HA   . GLN A 1 208 ? -12.471 -6.950  14.352  1.00 46.41  ?  321  GLN A HA   1 
ATOM   3130 H  HB2  . GLN A 1 208 ? -14.654 -7.722  14.812  1.00 49.08  ?  321  GLN A HB2  1 
ATOM   3131 H  HB3  . GLN A 1 208 ? -15.189 -6.229  14.712  1.00 49.08  ?  321  GLN A HB3  1 
ATOM   3132 H  HG2  . GLN A 1 208 ? -14.000 -6.411  12.467  1.00 55.42  ?  321  GLN A HG2  1 
ATOM   3133 H  HG3  . GLN A 1 208 ? -14.457 -7.922  12.649  1.00 55.42  ?  321  GLN A HG3  1 
ATOM   3134 H  HE21 . GLN A 1 208 ? -15.629 -4.779  12.260  1.00 71.60  ?  321  GLN A HE21 1 
ATOM   3135 H  HE22 . GLN A 1 208 ? -17.003 -5.121  11.797  1.00 71.60  ?  321  GLN A HE22 1 
ATOM   3136 N  N    . ARG A 1 209 ? -13.502 -3.918  14.700  1.00 38.06  ?  322  ARG A N    1 
ATOM   3137 C  CA   . ARG A 1 209 ? -13.360 -2.588  14.130  1.00 43.06  ?  322  ARG A CA   1 
ATOM   3138 C  C    . ARG A 1 209 ? -11.909 -2.133  14.168  1.00 42.07  ?  322  ARG A C    1 
ATOM   3139 O  O    . ARG A 1 209 ? -11.465 -1.420  13.263  1.00 42.45  ?  322  ARG A O    1 
ATOM   3140 C  CB   . ARG A 1 209 ? -14.261 -1.598  14.859  1.00 43.88  ?  322  ARG A CB   1 
ATOM   3141 C  CG   . ARG A 1 209 ? -15.745 -1.756  14.520  1.00 47.97  ?  322  ARG A CG   1 
ATOM   3142 C  CD   . ARG A 1 209 ? -16.455 -0.413  14.454  1.00 49.68  ?  322  ARG A CD   1 
ATOM   3143 N  NE   . ARG A 1 209 ? -16.378 0.332   15.704  1.00 48.80  ?  322  ARG A NE   1 
ATOM   3144 C  CZ   . ARG A 1 209 ? -16.327 1.659   15.797  1.00 45.09  ?  322  ARG A CZ   1 
ATOM   3145 N  NH1  . ARG A 1 209 ? -16.316 2.427   14.714  1.00 48.44  ?  322  ARG A NH1  1 
ATOM   3146 N  NH2  . ARG A 1 209 ? -16.282 2.214   16.996  1.00 45.68  ?  322  ARG A NH2  1 
ATOM   3147 H  H    . ARG A 1 209 ? -13.950 -3.954  15.434  1.00 45.66  ?  322  ARG A H    1 
ATOM   3148 H  HA   . ARG A 1 209 ? -13.647 -2.607  13.203  1.00 51.66  ?  322  ARG A HA   1 
ATOM   3149 H  HB2  . ARG A 1 209 ? -14.159 -1.727  15.814  1.00 52.64  ?  322  ARG A HB2  1 
ATOM   3150 H  HB3  . ARG A 1 209 ? -13.995 -0.697  14.616  1.00 52.64  ?  322  ARG A HB3  1 
ATOM   3151 H  HG2  . ARG A 1 209 ? -15.832 -2.188  13.655  1.00 57.54  ?  322  ARG A HG2  1 
ATOM   3152 H  HG3  . ARG A 1 209 ? -16.174 -2.294  15.204  1.00 57.54  ?  322  ARG A HG3  1 
ATOM   3153 H  HD2  . ARG A 1 209 ? -16.047 0.127   13.759  1.00 59.60  ?  322  ARG A HD2  1 
ATOM   3154 H  HD3  . ARG A 1 209 ? -17.393 -0.561  14.252  1.00 59.60  ?  322  ARG A HD3  1 
ATOM   3155 H  HE   . ARG A 1 209 ? -16.364 -0.119  16.436  1.00 58.55  ?  322  ARG A HE   1 
ATOM   3156 H  HH11 . ARG A 1 209 ? -16.342 2.069   13.933  1.00 58.11  ?  322  ARG A HH11 1 
ATOM   3157 H  HH12 . ARG A 1 209 ? -16.282 3.283   14.794  1.00 58.11  ?  322  ARG A HH12 1 
ATOM   3158 H  HH21 . ARG A 1 209 ? -16.286 1.719   17.699  1.00 54.80  ?  322  ARG A HH21 1 
ATOM   3159 H  HH22 . ARG A 1 209 ? -16.248 3.070   17.073  1.00 54.80  ?  322  ARG A HH22 1 
ATOM   3160 N  N    . THR A 1 210 ? -11.153 -2.543  15.186  1.00 41.17  ?  323  THR A N    1 
ATOM   3161 C  CA   . THR A 1 210 ? -9.722  -2.246  15.207  1.00 43.36  ?  323  THR A CA   1 
ATOM   3162 C  C    . THR A 1 210 ? -9.013  -2.901  14.027  1.00 43.14  ?  323  THR A C    1 
ATOM   3163 O  O    . THR A 1 210 ? -8.219  -2.258  13.330  1.00 45.60  ?  323  THR A O    1 
ATOM   3164 C  CB   . THR A 1 210 ? -9.104  -2.711  16.532  1.00 44.70  ?  323  THR A CB   1 
ATOM   3165 O  OG1  . THR A 1 210 ? -9.773  -2.063  17.634  1.00 43.96  ?  323  THR A OG1  1 
ATOM   3166 C  CG2  . THR A 1 210 ? -7.614  -2.375  16.571  1.00 44.18  ?  323  THR A CG2  1 
ATOM   3167 H  H    A THR A 1 210 ? -11.436 -2.987  15.866  0.73 49.39  ?  323  THR A H    1 
ATOM   3168 H  H    B THR A 1 210 ? -11.436 -2.987  15.866  0.27 49.39  ?  323  THR A H    1 
ATOM   3169 H  HA   . THR A 1 210 ? -9.601  -1.285  15.141  1.00 52.02  ?  323  THR A HA   1 
ATOM   3170 H  HB   . THR A 1 210 ? -9.205  -3.672  16.618  1.00 53.62  ?  323  THR A HB   1 
ATOM   3171 H  HG1  . THR A 1 210 ? -10.589 -2.263  17.632  1.00 52.74  ?  323  THR A HG1  1 
ATOM   3172 H  HG21 . THR A 1 210 ? -7.271  -2.491  17.471  1.00 53.00  ?  323  THR A HG21 1 
ATOM   3173 H  HG22 . THR A 1 210 ? -7.126  -2.960  15.970  1.00 53.00  ?  323  THR A HG22 1 
ATOM   3174 H  HG23 . THR A 1 210 ? -7.474  -1.455  16.298  1.00 53.00  ?  323  THR A HG23 1 
ATOM   3175 N  N    . MET A 1 211 ? -9.287  -4.188  13.789  1.00 41.66  ?  324  MET A N    1 
ATOM   3176 C  CA   . MET A 1 211 ? -8.672  -4.877  12.657  1.00 41.06  ?  324  MET A CA   1 
ATOM   3177 C  C    . MET A 1 211 ? -9.022  -4.190  11.340  1.00 42.83  ?  324  MET A C    1 
ATOM   3178 O  O    . MET A 1 211 ? -8.165  -4.040  10.463  1.00 38.86  ?  324  MET A O    1 
ATOM   3179 C  CB   . MET A 1 211 ? -9.114  -6.345  12.630  1.00 40.68  ?  324  MET A CB   1 
ATOM   3180 C  CG   . MET A 1 211 ? -8.670  -7.129  13.867  1.00 42.22  ?  324  MET A CG   1 
ATOM   3181 S  SD   . MET A 1 211 ? -9.482  -8.726  14.118  1.00 49.30  ?  324  MET A SD   1 
ATOM   3182 C  CE   . MET A 1 211 ? -9.768  -9.200  12.420  1.00 50.67  ?  324  MET A CE   1 
ATOM   3183 H  H    . MET A 1 211 ? -9.815  -4.676  14.259  1.00 49.97  ?  324  MET A H    1 
ATOM   3184 H  HA   . MET A 1 211 ? -7.709  -4.861  12.772  1.00 49.26  ?  324  MET A HA   1 
ATOM   3185 H  HB2  . MET A 1 211 ? -10.082 -6.381  12.586  1.00 48.80  ?  324  MET A HB2  1 
ATOM   3186 H  HB3  . MET A 1 211 ? -8.730  -6.775  11.850  1.00 48.80  ?  324  MET A HB3  1 
ATOM   3187 H  HG2  . MET A 1 211 ? -7.717  -7.300  13.793  1.00 50.65  ?  324  MET A HG2  1 
ATOM   3188 H  HG3  . MET A 1 211 ? -8.850  -6.588  14.651  1.00 50.65  ?  324  MET A HG3  1 
ATOM   3189 H  HE1  . MET A 1 211 ? -10.461 -8.634  12.046  1.00 60.79  ?  324  MET A HE1  1 
ATOM   3190 H  HE2  . MET A 1 211 ? -8.945  -9.089  11.918  1.00 60.79  ?  324  MET A HE2  1 
ATOM   3191 H  HE3  . MET A 1 211 ? -10.049 -10.128 12.394  1.00 60.79  ?  324  MET A HE3  1 
ATOM   3192 N  N    . LYS A 1 212 ? -10.275 -3.758  11.182  1.00 42.85  ?  325  LYS A N    1 
ATOM   3193 C  CA   . LYS A 1 212 ? -10.635 -3.023  9.974   1.00 44.42  ?  325  LYS A CA   1 
ATOM   3194 C  C    . LYS A 1 212 ? -9.909  -1.684  9.905   1.00 44.59  ?  325  LYS A C    1 
ATOM   3195 O  O    . LYS A 1 212 ? -9.578  -1.213  8.809   1.00 42.74  ?  325  LYS A O    1 
ATOM   3196 C  CB   . LYS A 1 212 ? -12.147 -2.812  9.912   1.00 50.90  ?  325  LYS A CB   1 
ATOM   3197 C  CG   . LYS A 1 212 ? -12.606 -1.901  8.786   1.00 55.83  ?  325  LYS A CG   1 
ATOM   3198 C  CD   . LYS A 1 212 ? -14.107 -2.020  8.558   1.00 63.69  ?  325  LYS A CD   1 
ATOM   3199 C  CE   . LYS A 1 212 ? -14.599 -0.984  7.561   1.00 67.40  ?  325  LYS A CE   1 
ATOM   3200 N  NZ   . LYS A 1 212 ? -15.915 -1.353  6.961   1.00 69.64  ?  325  LYS A NZ   1 
ATOM   3201 H  H    . LYS A 1 212 ? -10.917 -3.873  11.743  1.00 51.41  ?  325  LYS A H    1 
ATOM   3202 H  HA   . LYS A 1 212 ? -10.380 -3.549  9.200   1.00 53.28  ?  325  LYS A HA   1 
ATOM   3203 H  HB2  . LYS A 1 212 ? -12.575 -3.673  9.786   1.00 61.06  ?  325  LYS A HB2  1 
ATOM   3204 H  HB3  . LYS A 1 212 ? -12.439 -2.416  10.748  1.00 61.06  ?  325  LYS A HB3  1 
ATOM   3205 H  HG2  . LYS A 1 212 ? -12.403 -0.980  9.013   1.00 66.98  ?  325  LYS A HG2  1 
ATOM   3206 H  HG3  . LYS A 1 212 ? -12.151 -2.148  7.966   1.00 66.98  ?  325  LYS A HG3  1 
ATOM   3207 H  HD2  . LYS A 1 212 ? -14.311 -2.902  8.209   1.00 76.42  ?  325  LYS A HD2  1 
ATOM   3208 H  HD3  . LYS A 1 212 ? -14.573 -1.881  9.398   1.00 76.42  ?  325  LYS A HD3  1 
ATOM   3209 H  HE2  . LYS A 1 212 ? -14.701 -0.132  8.012   1.00 80.87  ?  325  LYS A HE2  1 
ATOM   3210 H  HE3  . LYS A 1 212 ? -13.952 -0.903  6.842   1.00 80.87  ?  325  LYS A HE3  1 
ATOM   3211 H  HZ1  . LYS A 1 212 ? -16.173 -0.727  6.384   1.00 83.56  ?  325  LYS A HZ1  1 
ATOM   3212 H  HZ2  . LYS A 1 212 ? -15.847 -2.130  6.533   1.00 83.56  ?  325  LYS A HZ2  1 
ATOM   3213 H  HZ3  . LYS A 1 212 ? -16.530 -1.428  7.600   1.00 83.56  ?  325  LYS A HZ3  1 
ATOM   3214 N  N    . LEU A 1 213 ? -9.649  -1.063  11.057  1.00 42.05  ?  326  LEU A N    1 
ATOM   3215 C  CA   . LEU A 1 213 ? -8.992  0.239   11.073  1.00 48.46  ?  326  LEU A CA   1 
ATOM   3216 C  C    . LEU A 1 213 ? -7.566  0.143   10.542  1.00 42.44  ?  326  LEU A C    1 
ATOM   3217 O  O    . LEU A 1 213 ? -7.113  1.030   9.817   1.00 41.28  ?  326  LEU A O    1 
ATOM   3218 C  CB   . LEU A 1 213 ? -8.994  0.795   12.498  1.00 46.54  ?  326  LEU A CB   1 
ATOM   3219 C  CG   . LEU A 1 213 ? -8.264  2.113   12.752  1.00 49.38  ?  326  LEU A CG   1 
ATOM   3220 C  CD1  . LEU A 1 213 ? -9.177  3.296   12.492  1.00 50.14  ?  326  LEU A CD1  1 
ATOM   3221 C  CD2  . LEU A 1 213 ? -7.719  2.152   14.176  1.00 51.02  ?  326  LEU A CD2  1 
ATOM   3222 H  H    . LEU A 1 213 ? -9.840  -1.371  11.837  1.00 50.45  ?  326  LEU A H    1 
ATOM   3223 H  HA   . LEU A 1 213 ? -9.484  0.850   10.504  1.00 58.14  ?  326  LEU A HA   1 
ATOM   3224 H  HB2  . LEU A 1 213 ? -9.918  0.933   12.759  1.00 55.83  ?  326  LEU A HB2  1 
ATOM   3225 H  HB3  . LEU A 1 213 ? -8.582  0.132   13.074  1.00 55.83  ?  326  LEU A HB3  1 
ATOM   3226 H  HG   . LEU A 1 213 ? -7.516  2.182   12.139  1.00 59.25  ?  326  LEU A HG   1 
ATOM   3227 H  HD11 . LEU A 1 213 ? -8.682  4.116   12.646  1.00 60.15  ?  326  LEU A HD11 1 
ATOM   3228 H  HD12 . LEU A 1 213 ? -9.483  3.262   11.573  1.00 60.15  ?  326  LEU A HD12 1 
ATOM   3229 H  HD13 . LEU A 1 213 ? -9.934  3.249   13.096  1.00 60.15  ?  326  LEU A HD13 1 
ATOM   3230 H  HD21 . LEU A 1 213 ? -7.285  3.006   14.325  1.00 61.21  ?  326  LEU A HD21 1 
ATOM   3231 H  HD22 . LEU A 1 213 ? -8.455  2.042   14.799  1.00 61.21  ?  326  LEU A HD22 1 
ATOM   3232 H  HD23 . LEU A 1 213 ? -7.080  1.431   14.289  1.00 61.21  ?  326  LEU A HD23 1 
ATOM   3233 N  N    . TYR A 1 214 ? -6.851  -0.923  10.897  1.00 43.64  ?  327  TYR A N    1 
ATOM   3234 C  CA   . TYR A 1 214 ? -5.453  -1.091  10.532  1.00 42.79  ?  327  TYR A CA   1 
ATOM   3235 C  C    . TYR A 1 214 ? -5.265  -1.852  9.227   1.00 42.82  ?  327  TYR A C    1 
ATOM   3236 O  O    . TYR A 1 214 ? -4.128  -2.212  8.890   1.00 43.05  ?  327  TYR A O    1 
ATOM   3237 C  CB   . TYR A 1 214 ? -4.708  -1.805  11.661  1.00 43.94  ?  327  TYR A CB   1 
ATOM   3238 C  CG   . TYR A 1 214 ? -4.494  -0.958  12.896  1.00 48.40  ?  327  TYR A CG   1 
ATOM   3239 C  CD1  . TYR A 1 214 ? -3.868  0.284   12.810  1.00 50.85  ?  327  TYR A CD1  1 
ATOM   3240 C  CD2  . TYR A 1 214 ? -4.911  -1.391  14.141  1.00 48.81  ?  327  TYR A CD2  1 
ATOM   3241 C  CE1  . TYR A 1 214 ? -3.669  1.061   13.936  1.00 53.97  ?  327  TYR A CE1  1 
ATOM   3242 C  CE2  . TYR A 1 214 ? -4.717  -0.621  15.272  1.00 52.80  ?  327  TYR A CE2  1 
ATOM   3243 C  CZ   . TYR A 1 214 ? -4.099  0.606   15.164  1.00 55.58  ?  327  TYR A CZ   1 
ATOM   3244 O  OH   . TYR A 1 214 ? -3.905  1.374   16.285  1.00 57.62  ?  327  TYR A OH   1 
ATOM   3245 H  H    . TYR A 1 214 ? -7.165  -1.575  11.362  1.00 52.35  ?  327  TYR A H    1 
ATOM   3246 H  HA   . TYR A 1 214 ? -5.057  -0.213  10.414  1.00 51.34  ?  327  TYR A HA   1 
ATOM   3247 H  HB2  . TYR A 1 214 ? -5.220  -2.586  11.925  1.00 52.71  ?  327  TYR A HB2  1 
ATOM   3248 H  HB3  . TYR A 1 214 ? -3.836  -2.076  11.334  1.00 52.71  ?  327  TYR A HB3  1 
ATOM   3249 H  HD1  . TYR A 1 214 ? -3.578  0.595   11.983  1.00 61.00  ?  327  TYR A HD1  1 
ATOM   3250 H  HD2  . TYR A 1 214 ? -5.331  -2.217  14.219  1.00 58.56  ?  327  TYR A HD2  1 
ATOM   3251 H  HE1  . TYR A 1 214 ? -3.248  1.887   13.865  1.00 64.75  ?  327  TYR A HE1  1 
ATOM   3252 H  HE2  . TYR A 1 214 ? -5.002  -0.929  16.102  1.00 63.34  ?  327  TYR A HE2  1 
ATOM   3253 H  HH   . TYR A 1 214 ? -4.212  0.980   16.960  1.00 69.13  ?  327  TYR A HH   1 
ATOM   3254 N  N    . ARG A 1 215 ? -6.337  -2.105  8.483   1.00 42.39  ?  328  ARG A N    1 
ATOM   3255 C  CA   . ARG A 1 215 ? -6.216  -2.844  7.235   1.00 46.49  ?  328  ARG A CA   1 
ATOM   3256 C  C    . ARG A 1 215 ? -5.415  -2.039  6.217   1.00 45.10  ?  328  ARG A C    1 
ATOM   3257 O  O    . ARG A 1 215 ? -5.641  -0.837  6.033   1.00 43.92  ?  328  ARG A O    1 
ATOM   3258 C  CB   . ARG A 1 215 ? -7.594  -3.180  6.675   1.00 51.13  ?  328  ARG A CB   1 
ATOM   3259 C  CG   . ARG A 1 215 ? -8.236  -4.393  7.335   1.00 58.44  ?  328  ARG A CG   1 
ATOM   3260 C  CD   . ARG A 1 215 ? -8.472  -5.512  6.326   1.00 64.79  ?  328  ARG A CD   1 
ATOM   3261 N  NE   . ARG A 1 215 ? -9.480  -5.145  5.332   1.00 67.57  ?  328  ARG A NE   1 
ATOM   3262 C  CZ   . ARG A 1 215 ? -10.787 -5.367  5.473   1.00 64.47  ?  328  ARG A CZ   1 
ATOM   3263 N  NH1  . ARG A 1 215 ? -11.630 -4.997  4.520   1.00 61.83  ?  328  ARG A NH1  1 
ATOM   3264 N  NH2  . ARG A 1 215 ? -11.247 -5.960  6.565   1.00 63.78  ?  328  ARG A NH2  1 
ATOM   3265 H  H    . ARG A 1 215 ? -7.139  -1.861  8.677   1.00 50.86  ?  328  ARG A H    1 
ATOM   3266 H  HA   . ARG A 1 215 ? -5.748  -3.677  7.404   1.00 55.77  ?  328  ARG A HA   1 
ATOM   3267 H  HB2  . ARG A 1 215 ? -8.181  -2.421  6.812   1.00 61.34  ?  328  ARG A HB2  1 
ATOM   3268 H  HB3  . ARG A 1 215 ? -7.509  -3.368  5.727   1.00 61.34  ?  328  ARG A HB3  1 
ATOM   3269 H  HG2  . ARG A 1 215 ? -7.650  -4.728  8.032   1.00 70.12  ?  328  ARG A HG2  1 
ATOM   3270 H  HG3  . ARG A 1 215 ? -9.091  -4.137  7.714   1.00 70.12  ?  328  ARG A HG3  1 
ATOM   3271 H  HD2  . ARG A 1 215 ? -7.643  -5.704  5.861   1.00 77.73  ?  328  ARG A HD2  1 
ATOM   3272 H  HD3  . ARG A 1 215 ? -8.781  -6.304  6.794   1.00 77.73  ?  328  ARG A HD3  1 
ATOM   3273 H  HE   . ARG A 1 215 ? -9.213  -4.760  4.611   1.00 81.07  ?  328  ARG A HE   1 
ATOM   3274 H  HH11 . ARG A 1 215 ? -11.334 -4.613  3.809   1.00 74.18  ?  328  ARG A HH11 1 
ATOM   3275 H  HH12 . ARG A 1 215 ? -12.473 -5.141  4.611   1.00 74.18  ?  328  ARG A HH12 1 
ATOM   3276 H  HH21 . ARG A 1 215 ? -10.702 -6.202  7.185   1.00 76.52  ?  328  ARG A HH21 1 
ATOM   3277 H  HH22 . ARG A 1 215 ? -12.090 -6.103  6.654   1.00 76.52  ?  328  ARG A HH22 1 
ATOM   3278 N  N    . LEU A 1 216 ? -4.488  -2.709  5.553   1.00 41.84  ?  329  LEU A N    1 
ATOM   3279 C  CA   . LEU A 1 216 ? -3.640  -2.102  4.542   1.00 42.88  ?  329  LEU A CA   1 
ATOM   3280 C  C    . LEU A 1 216 ? -4.043  -2.568  3.152   1.00 45.56  ?  329  LEU A C    1 
ATOM   3281 O  O    . LEU A 1 216 ? -4.657  -3.630  2.995   1.00 48.23  ?  329  LEU A O    1 
ATOM   3282 C  CB   . LEU A 1 216 ? -2.170  -2.470  4.790   1.00 40.22  ?  329  LEU A CB   1 
ATOM   3283 C  CG   . LEU A 1 216 ? -1.504  -1.868  6.025   1.00 40.53  ?  329  LEU A CG   1 
ATOM   3284 C  CD1  . LEU A 1 216 ? -0.179  -2.563  6.312   1.00 40.26  ?  329  LEU A CD1  1 
ATOM   3285 C  CD2  . LEU A 1 216 ? -1.304  -0.379  5.834   1.00 39.31  ?  329  LEU A CD2  1 
ATOM   3286 H  H    . LEU A 1 216 ? -4.328  -3.545  5.676   1.00 50.19  ?  329  LEU A H    1 
ATOM   3287 H  HA   . LEU A 1 216 ? -3.727  -1.137  4.581   1.00 51.44  ?  329  LEU A HA   1 
ATOM   3288 H  HB2  . LEU A 1 216 ? -2.114  -3.434  4.881   1.00 48.24  ?  329  LEU A HB2  1 
ATOM   3289 H  HB3  . LEU A 1 216 ? -1.655  -2.179  4.022   1.00 48.24  ?  329  LEU A HB3  1 
ATOM   3290 H  HG   . LEU A 1 216 ? -2.078  -1.999  6.797   1.00 48.62  ?  329  LEU A HG   1 
ATOM   3291 H  HD11 . LEU A 1 216 ? 0.225   -2.161  7.097   1.00 48.30  ?  329  LEU A HD11 1 
ATOM   3292 H  HD12 . LEU A 1 216 ? -0.345  -3.505  6.471   1.00 48.30  ?  329  LEU A HD12 1 
ATOM   3293 H  HD13 . LEU A 1 216 ? 0.406   -2.454  5.546   1.00 48.30  ?  329  LEU A HD13 1 
ATOM   3294 H  HD21 . LEU A 1 216 ? -0.825  -0.024  6.599   1.00 47.16  ?  329  LEU A HD21 1 
ATOM   3295 H  HD22 . LEU A 1 216 ? -0.791  -0.231  5.025   1.00 47.16  ?  329  LEU A HD22 1 
ATOM   3296 H  HD23 . LEU A 1 216 ? -2.171  0.049   5.760   1.00 47.16  ?  329  LEU A HD23 1 
ATOM   3297 N  N    . PRO A 1 217 ? -3.707  -1.803  2.112   1.00 45.51  ?  330  PRO A N    1 
ATOM   3298 C  CA   . PRO A 1 217 ? -3.888  -2.302  0.741   1.00 48.22  ?  330  PRO A CA   1 
ATOM   3299 C  C    . PRO A 1 217 ? -3.092  -3.577  0.516   1.00 49.05  ?  330  PRO A C    1 
ATOM   3300 O  O    . PRO A 1 217 ? -2.155  -3.897  1.253   1.00 44.77  ?  330  PRO A O    1 
ATOM   3301 C  CB   . PRO A 1 217 ? -3.370  -1.156  -0.137  1.00 45.03  ?  330  PRO A CB   1 
ATOM   3302 C  CG   . PRO A 1 217 ? -3.423  0.061   0.739   1.00 43.31  ?  330  PRO A CG   1 
ATOM   3303 C  CD   . PRO A 1 217 ? -3.170  -0.430  2.141   1.00 42.56  ?  330  PRO A CD   1 
ATOM   3304 H  HA   . PRO A 1 217 ? -4.826  -2.456  0.548   1.00 57.85  ?  330  PRO A HA   1 
ATOM   3305 H  HB2  . PRO A 1 217 ? -2.461  -1.341  -0.419  1.00 54.02  ?  330  PRO A HB2  1 
ATOM   3306 H  HB3  . PRO A 1 217 ? -3.943  -1.050  -0.912  1.00 54.02  ?  330  PRO A HB3  1 
ATOM   3307 H  HG2  . PRO A 1 217 ? -2.737  0.690   0.466   1.00 51.95  ?  330  PRO A HG2  1 
ATOM   3308 H  HG3  . PRO A 1 217 ? -4.297  0.474   0.672   1.00 51.95  ?  330  PRO A HG3  1 
ATOM   3309 H  HD2  . PRO A 1 217 ? -2.221  -0.434  2.341   1.00 51.06  ?  330  PRO A HD2  1 
ATOM   3310 H  HD3  . PRO A 1 217 ? -3.644  0.114   2.789   1.00 51.06  ?  330  PRO A HD3  1 
ATOM   3311 N  N    . ASP A 1 218 ? -3.479  -4.318  -0.525  1.00 55.42  ?  331  ASP A N    1 
ATOM   3312 C  CA   . ASP A 1 218 ? -2.800  -5.567  -0.840  1.00 57.59  ?  331  ASP A CA   1 
ATOM   3313 C  C    . ASP A 1 218 ? -1.582  -5.377  -1.730  1.00 53.70  ?  331  ASP A C    1 
ATOM   3314 O  O    . ASP A 1 218 ? -0.764  -6.296  -1.833  1.00 52.24  ?  331  ASP A O    1 
ATOM   3315 C  CB   . ASP A 1 218 ? -3.753  -6.548  -1.532  1.00 65.27  ?  331  ASP A CB   1 
ATOM   3316 C  CG   . ASP A 1 218 ? -5.061  -6.713  -0.792  1.00 73.32  ?  331  ASP A CG   1 
ATOM   3317 O  OD1  . ASP A 1 218 ? -5.937  -5.833  -0.942  1.00 75.32  ?  331  ASP A OD1  1 
ATOM   3318 O  OD2  . ASP A 1 218 ? -5.215  -7.717  -0.062  1.00 72.49  ?  331  ASP A OD2  1 
ATOM   3319 H  H    . ASP A 1 218 ? -4.126  -4.117  -1.056  1.00 66.49  ?  331  ASP A H    1 
ATOM   3320 H  HA   . ASP A 1 218 ? -2.512  -5.967  -0.004  1.00 69.09  ?  331  ASP A HA   1 
ATOM   3321 H  HB2  . ASP A 1 218 ? -3.952  -6.220  -2.423  1.00 78.31  ?  331  ASP A HB2  1 
ATOM   3322 H  HB3  . ASP A 1 218 ? -3.327  -7.418  -1.586  1.00 78.31  ?  331  ASP A HB3  1 
ATOM   3323 N  N    . VAL A 1 219 ? -1.445  -4.221  -2.379  1.00 53.11  ?  332  VAL A N    1 
ATOM   3324 C  CA   . VAL A 1 219 ? -0.348  -3.977  -3.306  1.00 53.13  ?  332  VAL A CA   1 
ATOM   3325 C  C    . VAL A 1 219 ? 0.232   -2.593  -3.059  1.00 47.62  ?  332  VAL A C    1 
ATOM   3326 O  O    . VAL A 1 219 ? -0.483  -1.656  -2.695  1.00 46.20  ?  332  VAL A O    1 
ATOM   3327 C  CB   . VAL A 1 219 ? -0.803  -4.121  -4.777  1.00 55.19  ?  332  VAL A CB   1 
ATOM   3328 C  CG1  . VAL A 1 219 ? -1.931  -3.146  -5.083  1.00 52.00  ?  332  VAL A CG1  1 
ATOM   3329 C  CG2  . VAL A 1 219 ? 0.373   -3.888  -5.720  1.00 59.01  ?  332  VAL A CG2  1 
ATOM   3330 H  H    . VAL A 1 219 ? -1.985  -3.557  -2.295  1.00 63.72  ?  332  VAL A H    1 
ATOM   3331 H  HA   . VAL A 1 219 ? 0.355   -4.623  -3.132  1.00 63.74  ?  332  VAL A HA   1 
ATOM   3332 H  HB   . VAL A 1 219 ? -1.134  -5.021  -4.918  1.00 66.21  ?  332  VAL A HB   1 
ATOM   3333 H  HG11 . VAL A 1 219 ? -2.249  -3.304  -5.985  1.00 62.39  ?  332  VAL A HG11 1 
ATOM   3334 H  HG12 . VAL A 1 219 ? -2.652  -3.288  -4.449  1.00 62.39  ?  332  VAL A HG12 1 
ATOM   3335 H  HG13 . VAL A 1 219 ? -1.596  -2.239  -5.004  1.00 62.39  ?  332  VAL A HG13 1 
ATOM   3336 H  HG21 . VAL A 1 219 ? 0.133   -4.198  -6.607  1.00 70.80  ?  332  VAL A HG21 1 
ATOM   3337 H  HG22 . VAL A 1 219 ? 0.575   -2.939  -5.744  1.00 70.80  ?  332  VAL A HG22 1 
ATOM   3338 H  HG23 . VAL A 1 219 ? 1.142   -4.381  -5.393  1.00 70.80  ?  332  VAL A HG23 1 
ATOM   3339 N  N    . THR A 1 220 ? 1.543   -2.469  -3.270  1.00 44.54  ?  333  THR A N    1 
ATOM   3340 C  CA   . THR A 1 220 ? 2.203   -1.179  -3.148  1.00 44.80  ?  333  THR A CA   1 
ATOM   3341 C  C    . THR A 1 220 ? 1.762   -0.247  -4.273  1.00 45.56  ?  333  THR A C    1 
ATOM   3342 O  O    . THR A 1 220 ? 1.218   -0.675  -5.296  1.00 44.80  ?  333  THR A O    1 
ATOM   3343 C  CB   . THR A 1 220 ? 3.731   -1.336  -3.182  1.00 39.14  ?  333  THR A CB   1 
ATOM   3344 O  OG1  . THR A 1 220 ? 4.117   -1.993  -4.391  1.00 37.18  ?  333  THR A OG1  1 
ATOM   3345 C  CG2  . THR A 1 220 ? 4.218   -2.136  -1.985  1.00 37.50  ?  333  THR A CG2  1 
ATOM   3346 H  H    . THR A 1 220 ? 2.068   -3.116  -3.484  1.00 53.44  ?  333  THR A H    1 
ATOM   3347 H  HA   . THR A 1 220 ? 1.961   -0.780  -2.297  1.00 53.74  ?  333  THR A HA   1 
ATOM   3348 H  HB   . THR A 1 220 ? 4.148   -0.460  -3.145  1.00 46.95  ?  333  THR A HB   1 
ATOM   3349 H  HG1  . THR A 1 220 ? 4.952   -2.082  -4.416  1.00 44.60  ?  333  THR A HG1  1 
ATOM   3350 H  HG21 . THR A 1 220 ? 5.184   -2.217  -2.010  1.00 44.99  ?  333  THR A HG21 1 
ATOM   3351 H  HG22 . THR A 1 220 ? 3.961   -1.691  -1.162  1.00 44.99  ?  333  THR A HG22 1 
ATOM   3352 H  HG23 . THR A 1 220 ? 3.827   -3.023  -1.998  1.00 44.99  ?  333  THR A HG23 1 
ATOM   3353 N  N    . LYS A 1 221 ? 2.031   1.044   -4.081  1.00 44.47  ?  334  LYS A N    1 
ATOM   3354 C  CA   . LYS A 1 221 ? 1.585   2.076   -5.007  1.00 47.49  ?  334  LYS A CA   1 
ATOM   3355 C  C    . LYS A 1 221 ? 2.705   2.706   -5.825  1.00 45.10  ?  334  LYS A C    1 
ATOM   3356 O  O    . LYS A 1 221 ? 2.466   3.113   -6.963  1.00 43.57  ?  334  LYS A O    1 
ATOM   3357 C  CB   . LYS A 1 221 ? 0.861   3.192   -4.237  1.00 50.33  ?  334  LYS A CB   1 
ATOM   3358 C  CG   . LYS A 1 221 ? 0.392   4.348   -5.105  1.00 56.90  ?  334  LYS A CG   1 
ATOM   3359 C  CD   . LYS A 1 221 ? 0.076   5.592   -4.276  1.00 63.87  ?  334  LYS A CD   1 
ATOM   3360 C  CE   . LYS A 1 221 ? -1.184  5.418   -3.439  1.00 70.44  ?  334  LYS A CE   1 
ATOM   3361 N  NZ   . LYS A 1 221 ? -1.474  6.631   -2.618  1.00 75.08  ?  334  LYS A NZ   1 
ATOM   3362 H  H    . LYS A 1 221 ? 2.477   1.347   -3.412  1.00 53.35  ?  334  LYS A H    1 
ATOM   3363 H  HA   . LYS A 1 221 ? 0.959   1.676   -5.630  1.00 56.98  ?  334  LYS A HA   1 
ATOM   3364 H  HB2  . LYS A 1 221 ? 0.079   2.814   -3.805  1.00 60.38  ?  334  LYS A HB2  1 
ATOM   3365 H  HB3  . LYS A 1 221 ? 1.467   3.552   -3.571  1.00 60.38  ?  334  LYS A HB3  1 
ATOM   3366 H  HG2  . LYS A 1 221 ? 1.090   4.576   -5.739  1.00 68.27  ?  334  LYS A HG2  1 
ATOM   3367 H  HG3  . LYS A 1 221 ? -0.413  4.087   -5.578  1.00 68.27  ?  334  LYS A HG3  1 
ATOM   3368 H  HD2  . LYS A 1 221 ? 0.816   5.772   -3.676  1.00 76.63  ?  334  LYS A HD2  1 
ATOM   3369 H  HD3  . LYS A 1 221 ? -0.058  6.346   -4.872  1.00 76.63  ?  334  LYS A HD3  1 
ATOM   3370 H  HE2  . LYS A 1 221 ? -1.940  5.260   -4.026  1.00 84.51  ?  334  LYS A HE2  1 
ATOM   3371 H  HE3  . LYS A 1 221 ? -1.068  4.665   -2.838  1.00 84.51  ?  334  LYS A HE3  1 
ATOM   3372 H  HZ1  . LYS A 1 221 ? -2.214  6.505   -2.138  1.00 90.08  ?  334  LYS A HZ1  1 
ATOM   3373 H  HZ2  . LYS A 1 221 ? -0.796  6.794   -2.065  1.00 90.08  ?  334  LYS A HZ2  1 
ATOM   3374 H  HZ3  . LYS A 1 221 ? -1.591  7.337   -3.148  1.00 90.08  ?  334  LYS A HZ3  1 
ATOM   3375 N  N    . THR A 1 222 ? 3.912   2.805   -5.282  1.00 43.95  ?  335  THR A N    1 
ATOM   3376 C  CA   . THR A 1 222 ? 4.958   3.577   -5.930  1.00 40.38  ?  335  THR A CA   1 
ATOM   3377 C  C    . THR A 1 222 ? 5.464   2.869   -7.185  1.00 42.42  ?  335  THR A C    1 
ATOM   3378 O  O    . THR A 1 222 ? 5.796   1.679   -7.156  1.00 42.21  ?  335  THR A O    1 
ATOM   3379 C  CB   . THR A 1 222 ? 6.107   3.813   -4.959  1.00 41.00  ?  335  THR A CB   1 
ATOM   3380 O  OG1  . THR A 1 222 ? 5.601   4.406   -3.752  1.00 41.34  ?  335  THR A OG1  1 
ATOM   3381 C  CG2  . THR A 1 222 ? 7.159   4.727   -5.588  1.00 39.62  ?  335  THR A CG2  1 
ATOM   3382 H  H    . THR A 1 222 ? 4.149   2.437   -4.541  1.00 52.72  ?  335  THR A H    1 
ATOM   3383 H  HA   . THR A 1 222 ? 4.597   4.435   -6.201  1.00 48.44  ?  335  THR A HA   1 
ATOM   3384 H  HB   . THR A 1 222 ? 6.534   2.969   -4.743  1.00 49.18  ?  335  THR A HB   1 
ATOM   3385 H  HG1  . THR A 1 222 ? 5.060   3.883   -3.380  1.00 49.60  ?  335  THR A HG1  1 
ATOM   3386 H  HG21 . THR A 1 222 ? 7.805   5.001   -4.918  1.00 47.52  ?  335  THR A HG21 1 
ATOM   3387 H  HG22 . THR A 1 222 ? 7.623   4.259   -6.300  1.00 47.52  ?  335  THR A HG22 1 
ATOM   3388 H  HG23 . THR A 1 222 ? 6.735   5.518   -5.957  1.00 47.52  ?  335  THR A HG23 1 
ATOM   3389 N  N    . SER A 1 223 ? 5.517   3.607   -8.290  1.00 40.68  ?  336  SER A N    1 
ATOM   3390 C  CA   . SER A 1 223 ? 6.047   3.067   -9.533  1.00 44.36  ?  336  SER A CA   1 
ATOM   3391 C  C    . SER A 1 223 ? 7.552   2.885   -9.421  1.00 42.08  ?  336  SER A C    1 
ATOM   3392 O  O    . SER A 1 223 ? 8.254   3.715   -8.833  1.00 41.10  ?  336  SER A O    1 
ATOM   3393 C  CB   . SER A 1 223 ? 5.738   3.999   -10.704 1.00 45.68  ?  336  SER A CB   1 
ATOM   3394 O  OG   . SER A 1 223 ? 4.341   4.155   -10.875 1.00 54.74  ?  336  SER A OG   1 
ATOM   3395 H  H    . SER A 1 223 ? 5.252   4.423   -8.347  1.00 48.80  ?  336  SER A H    1 
ATOM   3396 H  HA   . SER A 1 223 ? 5.631   2.208   -9.709  1.00 53.22  ?  336  SER A HA   1 
ATOM   3397 H  HB2  . SER A 1 223 ? 6.133   4.868   -10.528 1.00 54.80  ?  336  SER A HB2  1 
ATOM   3398 H  HB3  . SER A 1 223 ? 6.115   3.622   -11.515 1.00 54.80  ?  336  SER A HB3  1 
ATOM   3399 H  HG   . SER A 1 223 ? 4.186   4.668   -11.521 1.00 65.67  ?  336  SER A HG   1 
ATOM   3400 N  N    . GLY A 1 224 ? 8.047   1.799   -10.002 1.00 43.84  ?  337  GLY A N    1 
ATOM   3401 C  CA   . GLY A 1 224 ? 9.470   1.528   -9.984  1.00 41.35  ?  337  GLY A CA   1 
ATOM   3402 C  C    . GLY A 1 224 ? 10.000  0.975   -8.683  1.00 41.84  ?  337  GLY A C    1 
ATOM   3403 O  O    . GLY A 1 224 ? 11.222  0.839   -8.543  1.00 42.01  ?  337  GLY A O    1 
ATOM   3404 H  H    . GLY A 1 224 ? 7.577   1.206   -10.411 1.00 52.59  ?  337  GLY A H    1 
ATOM   3405 H  HA2  . GLY A 1 224 ? 9.672   0.885   -10.682 1.00 49.60  ?  337  GLY A HA2  1 
ATOM   3406 H  HA3  . GLY A 1 224 ? 9.945   2.354   -10.169 1.00 49.60  ?  337  GLY A HA3  1 
ATOM   3407 N  N    . LEU A 1 225 ? 9.128   0.654   -7.727  1.00 40.88  ?  338  LEU A N    1 
ATOM   3408 C  CA   . LEU A 1 225 ? 9.568   0.068   -6.468  1.00 39.50  ?  338  LEU A CA   1 
ATOM   3409 C  C    . LEU A 1 225 ? 9.986   -1.380  -6.691  1.00 37.67  ?  338  LEU A C    1 
ATOM   3410 O  O    . LEU A 1 225 ? 9.215   -2.186  -7.223  1.00 38.99  ?  338  LEU A O    1 
ATOM   3411 C  CB   . LEU A 1 225 ? 8.445   0.147   -5.436  1.00 38.49  ?  338  LEU A CB   1 
ATOM   3412 C  CG   . LEU A 1 225 ? 8.808   -0.037  -3.958  1.00 37.37  ?  338  LEU A CG   1 
ATOM   3413 C  CD1  . LEU A 1 225 ? 9.824   1.000   -3.508  1.00 35.78  ?  338  LEU A CD1  1 
ATOM   3414 C  CD2  . LEU A 1 225 ? 7.542   0.039   -3.104  1.00 40.52  ?  338  LEU A CD2  1 
ATOM   3415 H  H    . LEU A 1 225 ? 8.277   0.766   -7.784  1.00 49.04  ?  338  LEU A H    1 
ATOM   3416 H  HA   . LEU A 1 225 ? 10.331  0.557   -6.123  1.00 47.39  ?  338  LEU A HA   1 
ATOM   3417 H  HB2  . LEU A 1 225 ? 8.034   1.023   -5.515  1.00 46.17  ?  338  LEU A HB2  1 
ATOM   3418 H  HB3  . LEU A 1 225 ? 7.798   -0.543  -5.651  1.00 46.17  ?  338  LEU A HB3  1 
ATOM   3419 H  HG   . LEU A 1 225 ? 9.216   -0.908  -3.837  1.00 44.83  ?  338  LEU A HG   1 
ATOM   3420 H  HD11 . LEU A 1 225 ? 9.964   0.912   -2.552  1.00 42.92  ?  338  LEU A HD11 1 
ATOM   3421 H  HD12 . LEU A 1 225 ? 10.658  0.850   -3.980  1.00 42.92  ?  338  LEU A HD12 1 
ATOM   3422 H  HD13 . LEU A 1 225 ? 9.484   1.885   -3.712  1.00 42.92  ?  338  LEU A HD13 1 
ATOM   3423 H  HD21 . LEU A 1 225 ? 7.783   -0.079  -2.172  1.00 48.61  ?  338  LEU A HD21 1 
ATOM   3424 H  HD22 . LEU A 1 225 ? 7.127   0.906   -3.231  1.00 48.61  ?  338  LEU A HD22 1 
ATOM   3425 H  HD23 . LEU A 1 225 ? 6.933   -0.664  -3.379  1.00 48.61  ?  338  LEU A HD23 1 
ATOM   3426 N  N    . ARG A 1 226 ? 11.208  -1.715  -6.290  1.00 36.07  ?  339  ARG A N    1 
ATOM   3427 C  CA   . ARG A 1 226 ? 11.722  -3.063  -6.500  1.00 37.52  ?  339  ARG A CA   1 
ATOM   3428 C  C    . ARG A 1 226 ? 12.840  -3.319  -5.504  1.00 34.84  ?  339  ARG A C    1 
ATOM   3429 O  O    . ARG A 1 226 ? 13.464  -2.377  -5.015  1.00 33.06  ?  339  ARG A O    1 
ATOM   3430 C  CB   . ARG A 1 226 ? 12.241  -3.249  -7.938  1.00 37.40  ?  339  ARG A CB   1 
ATOM   3431 C  CG   . ARG A 1 226 ? 13.368  -2.285  -8.314  1.00 39.16  ?  339  ARG A CG   1 
ATOM   3432 C  CD   . ARG A 1 226 ? 14.124  -2.770  -9.548  1.00 40.55  ?  339  ARG A CD   1 
ATOM   3433 N  NE   . ARG A 1 226 ? 15.187  -1.849  -9.933  1.00 41.24  ?  339  ARG A NE   1 
ATOM   3434 C  CZ   . ARG A 1 226 ? 16.379  -1.779  -9.340  1.00 40.44  ?  339  ARG A CZ   1 
ATOM   3435 N  NH1  . ARG A 1 226 ? 16.664  -2.579  -8.322  1.00 40.51  ?  339  ARG A NH1  1 
ATOM   3436 N  NH2  . ARG A 1 226 ? 17.281  -0.906  -9.760  1.00 39.81  ?  339  ARG A NH2  1 
ATOM   3437 H  H    . ARG A 1 226 ? 11.755  -1.181  -5.896  1.00 43.27  ?  339  ARG A H    1 
ATOM   3438 H  HA   . ARG A 1 226 ? 11.012  -3.704  -6.339  1.00 45.01  ?  339  ARG A HA   1 
ATOM   3439 H  HB2  . ARG A 1 226 ? 12.579  -4.153  -8.033  1.00 44.86  ?  339  ARG A HB2  1 
ATOM   3440 H  HB3  . ARG A 1 226 ? 11.507  -3.102  -8.555  1.00 44.86  ?  339  ARG A HB3  1 
ATOM   3441 H  HG2  . ARG A 1 226 ? 12.994  -1.412  -8.508  1.00 46.98  ?  339  ARG A HG2  1 
ATOM   3442 H  HG3  . ARG A 1 226 ? 13.996  -2.221  -7.577  1.00 46.98  ?  339  ARG A HG3  1 
ATOM   3443 H  HD2  . ARG A 1 226 ? 14.524  -3.633  -9.360  1.00 48.64  ?  339  ARG A HD2  1 
ATOM   3444 H  HD3  . ARG A 1 226 ? 13.506  -2.846  -10.292 1.00 48.64  ?  339  ARG A HD3  1 
ATOM   3445 H  HE   . ARG A 1 226 ? 15.034  -1.314  -10.588 1.00 49.48  ?  339  ARG A HE   1 
ATOM   3446 H  HH11 . ARG A 1 226 ? 16.079  -3.144  -8.042  1.00 48.60  ?  339  ARG A HH11 1 
ATOM   3447 H  HH12 . ARG A 1 226 ? 17.433  -2.532  -7.941  1.00 48.60  ?  339  ARG A HH12 1 
ATOM   3448 H  HH21 . ARG A 1 226 ? 17.100  -0.381  -10.417 1.00 47.75  ?  339  ARG A HH21 1 
ATOM   3449 H  HH22 . ARG A 1 226 ? 18.050  -0.863  -9.376  1.00 47.75  ?  339  ARG A HH22 1 
ATOM   3450 N  N    . PRO A 1 227 ? 13.135  -4.582  -5.203  1.00 33.86  ?  340  PRO A N    1 
ATOM   3451 C  CA   . PRO A 1 227 ? 14.225  -4.869  -4.262  1.00 33.75  ?  340  PRO A CA   1 
ATOM   3452 C  C    . PRO A 1 227 ? 15.550  -4.297  -4.753  1.00 36.60  ?  340  PRO A C    1 
ATOM   3453 O  O    . PRO A 1 227 ? 15.816  -4.216  -5.955  1.00 38.02  ?  340  PRO A O    1 
ATOM   3454 C  CB   . PRO A 1 227 ? 14.259  -6.405  -4.206  1.00 32.97  ?  340  PRO A CB   1 
ATOM   3455 C  CG   . PRO A 1 227 ? 12.858  -6.832  -4.621  1.00 30.68  ?  340  PRO A CG   1 
ATOM   3456 C  CD   . PRO A 1 227 ? 12.441  -5.810  -5.644  1.00 32.74  ?  340  PRO A CD   1 
ATOM   3457 H  HA   . PRO A 1 227 ? 14.022  -4.514  -3.382  1.00 40.48  ?  340  PRO A HA   1 
ATOM   3458 H  HB2  . PRO A 1 227 ? 14.924  -6.745  -4.824  1.00 39.54  ?  340  PRO A HB2  1 
ATOM   3459 H  HB3  . PRO A 1 227 ? 14.461  -6.700  -3.305  1.00 39.54  ?  340  PRO A HB3  1 
ATOM   3460 H  HG2  . PRO A 1 227 ? 12.881  -7.722  -5.006  1.00 36.80  ?  340  PRO A HG2  1 
ATOM   3461 H  HG3  . PRO A 1 227 ? 12.265  -6.818  -3.853  1.00 36.80  ?  340  PRO A HG3  1 
ATOM   3462 H  HD2  . PRO A 1 227 ? 12.733  -6.071  -6.532  1.00 39.27  ?  340  PRO A HD2  1 
ATOM   3463 H  HD3  . PRO A 1 227 ? 11.479  -5.685  -5.635  1.00 39.27  ?  340  PRO A HD3  1 
ATOM   3464 N  N    . MET A 1 228 ? 16.384  -3.885  -3.800  1.00 35.03  ?  341  MET A N    1 
ATOM   3465 C  CA   . MET A 1 228 ? 17.721  -3.417  -4.133  1.00 33.26  ?  341  MET A CA   1 
ATOM   3466 C  C    . MET A 1 228 ? 18.573  -4.573  -4.655  1.00 35.95  ?  341  MET A C    1 
ATOM   3467 O  O    . MET A 1 228 ? 18.460  -5.715  -4.191  1.00 33.40  ?  341  MET A O    1 
ATOM   3468 C  CB   . MET A 1 228 ? 18.387  -2.800  -2.906  1.00 33.24  ?  341  MET A CB   1 
ATOM   3469 C  CG   . MET A 1 228 ? 19.786  -2.273  -3.158  1.00 33.66  ?  341  MET A CG   1 
ATOM   3470 S  SD   . MET A 1 228 ? 20.637  -1.889  -1.616  1.00 34.31  ?  341  MET A SD   1 
ATOM   3471 C  CE   . MET A 1 228 ? 22.274  -1.420  -2.246  1.00 36.66  ?  341  MET A CE   1 
ATOM   3472 H  H    . MET A 1 228 ? 16.200  -3.866  -2.960  1.00 42.02  ?  341  MET A H    1 
ATOM   3473 H  HA   . MET A 1 228 ? 17.656  -2.732  -4.816  1.00 39.90  ?  341  MET A HA   1 
ATOM   3474 H  HB2  . MET A 1 228 ? 17.843  -2.057  -2.599  1.00 39.87  ?  341  MET A HB2  1 
ATOM   3475 H  HB3  . MET A 1 228 ? 18.447  -3.475  -2.213  1.00 39.87  ?  341  MET A HB3  1 
ATOM   3476 H  HG2  . MET A 1 228 ? 20.302  -2.945  -3.631  1.00 40.38  ?  341  MET A HG2  1 
ATOM   3477 H  HG3  . MET A 1 228 ? 19.733  -1.462  -3.687  1.00 40.38  ?  341  MET A HG3  1 
ATOM   3478 H  HE1  . MET A 1 228 ? 22.863  -1.246  -1.495  1.00 43.97  ?  341  MET A HE1  1 
ATOM   3479 H  HE2  . MET A 1 228 ? 22.627  -2.148  -2.781  1.00 43.97  ?  341  MET A HE2  1 
ATOM   3480 H  HE3  . MET A 1 228 ? 22.187  -0.622  -2.790  1.00 43.97  ?  341  MET A HE3  1 
ATOM   3481 N  N    . GLU A 1 229 ? 19.433  -4.260  -5.613  1.00 34.47  ?  342  GLU A N    1 
ATOM   3482 C  CA   . GLU A 1 229 ? 20.341  -5.202  -6.244  1.00 38.84  ?  342  GLU A CA   1 
ATOM   3483 C  C    . GLU A 1 229 ? 21.761  -4.654  -6.191  1.00 34.36  ?  342  GLU A C    1 
ATOM   3484 O  O    . GLU A 1 229 ? 21.972  -3.458  -5.952  1.00 34.46  ?  342  GLU A O    1 
ATOM   3485 C  CB   . GLU A 1 229 ? 19.946  -5.454  -7.705  1.00 41.59  ?  342  GLU A CB   1 
ATOM   3486 C  CG   . GLU A 1 229 ? 18.509  -5.890  -7.902  1.00 44.63  ?  342  GLU A CG   1 
ATOM   3487 C  CD   . GLU A 1 229 ? 18.127  -5.993  -9.369  1.00 49.76  ?  342  GLU A CD   1 
ATOM   3488 O  OE1  . GLU A 1 229 ? 18.981  -5.690  -10.230 1.00 52.80  ?  342  GLU A OE1  1 
ATOM   3489 O  OE2  . GLU A 1 229 ? 16.975  -6.375  -9.660  1.00 51.53  ?  342  GLU A OE2  1 
ATOM   3490 H  H    . GLU A 1 229 ? 19.509  -3.464  -5.929  1.00 41.34  ?  342  GLU A H    1 
ATOM   3491 H  HA   . GLU A 1 229 ? 20.317  -6.046  -5.765  1.00 46.59  ?  342  GLU A HA   1 
ATOM   3492 H  HB2  . GLU A 1 229 ? 20.074  -4.633  -8.206  1.00 49.90  ?  342  GLU A HB2  1 
ATOM   3493 H  HB3  . GLU A 1 229 ? 20.515  -6.153  -8.063  1.00 49.90  ?  342  GLU A HB3  1 
ATOM   3494 H  HG2  . GLU A 1 229 ? 18.384  -6.762  -7.496  1.00 53.53  ?  342  GLU A HG2  1 
ATOM   3495 H  HG3  . GLU A 1 229 ? 17.922  -5.241  -7.482  1.00 53.53  ?  342  GLU A HG3  1 
ATOM   3496 N  N    . PRO A 1 230 ? 22.761  -5.508  -6.413  1.00 35.16  ?  343  PRO A N    1 
ATOM   3497 C  CA   . PRO A 1 230 ? 24.161  -5.024  -6.368  1.00 34.72  ?  343  PRO A CA   1 
ATOM   3498 C  C    . PRO A 1 230 ? 24.425  -3.823  -7.259  1.00 34.07  ?  343  PRO A C    1 
ATOM   3499 O  O    . PRO A 1 230 ? 25.137  -2.887  -6.857  1.00 37.86  ?  343  PRO A O    1 
ATOM   3500 C  CB   . PRO A 1 230 ? 24.960  -6.258  -6.815  1.00 36.51  ?  343  PRO A CB   1 
ATOM   3501 C  CG   . PRO A 1 230 ? 24.114  -7.418  -6.414  1.00 35.61  ?  343  PRO A CG   1 
ATOM   3502 C  CD   . PRO A 1 230 ? 22.678  -6.967  -6.607  1.00 36.69  ?  343  PRO A CD   1 
ATOM   3503 H  HA   . PRO A 1 230 ? 24.398  -4.796  -5.455  1.00 41.64  ?  343  PRO A HA   1 
ATOM   3504 H  HB2  . PRO A 1 230 ? 25.091  -6.238  -7.776  1.00 43.80  ?  343  PRO A HB2  1 
ATOM   3505 H  HB3  . PRO A 1 230 ? 25.818  -6.280  -6.364  1.00 43.80  ?  343  PRO A HB3  1 
ATOM   3506 H  HG2  . PRO A 1 230 ? 24.314  -8.181  -6.980  1.00 42.71  ?  343  PRO A HG2  1 
ATOM   3507 H  HG3  . PRO A 1 230 ? 24.283  -7.641  -5.486  1.00 42.71  ?  343  PRO A HG3  1 
ATOM   3508 H  HD2  . PRO A 1 230 ? 22.365  -7.180  -7.500  1.00 44.01  ?  343  PRO A HD2  1 
ATOM   3509 H  HD3  . PRO A 1 230 ? 22.096  -7.372  -5.946  1.00 44.01  ?  343  PRO A HD3  1 
ATOM   3510 N  N    . LYS A 1 231 ? 23.857  -3.808  -8.466  1.00 34.39  ?  344  LYS A N    1 
ATOM   3511 C  CA   . LYS A 1 231 ? 24.072  -2.679  -9.369  1.00 35.43  ?  344  LYS A CA   1 
ATOM   3512 C  C    . LYS A 1 231 ? 23.584  -1.358  -8.794  1.00 35.86  ?  344  LYS A C    1 
ATOM   3513 O  O    . LYS A 1 231 ? 23.929  -0.308  -9.337  1.00 38.28  ?  344  LYS A O    1 
ATOM   3514 C  CB   . LYS A 1 231 ? 23.368  -2.942  -10.703 1.00 36.88  ?  344  LYS A CB   1 
ATOM   3515 C  CG   . LYS A 1 231 ? 21.849  -2.864  -10.623 1.00 36.96  ?  344  LYS A CG   1 
ATOM   3516 C  CD   . LYS A 1 231 ? 21.194  -3.063  -11.983 1.00 38.14  ?  344  LYS A CD   1 
ATOM   3517 C  CE   . LYS A 1 231 ? 19.691  -2.839  -11.918 1.00 44.08  ?  344  LYS A CE   1 
ATOM   3518 N  NZ   . LYS A 1 231 ? 19.025  -3.092  -13.227 1.00 46.15  ?  344  LYS A NZ   1 
ATOM   3519 H  H    . LYS A 1 231 ? 23.350  -4.428  -8.780  1.00 41.25  ?  344  LYS A H    1 
ATOM   3520 H  HA   . LYS A 1 231 ? 25.024  -2.597  -9.535  1.00 42.50  ?  344  LYS A HA   1 
ATOM   3521 H  HB2  . LYS A 1 231 ? 23.665  -2.280  -11.348 1.00 44.23  ?  344  LYS A HB2  1 
ATOM   3522 H  HB3  . LYS A 1 231 ? 23.603  -3.832  -11.009 1.00 44.23  ?  344  LYS A HB3  1 
ATOM   3523 H  HG2  . LYS A 1 231 ? 21.524  -3.556  -10.027 1.00 44.33  ?  344  LYS A HG2  1 
ATOM   3524 H  HG3  . LYS A 1 231 ? 21.591  -1.990  -10.289 1.00 44.33  ?  344  LYS A HG3  1 
ATOM   3525 H  HD2  . LYS A 1 231 ? 21.569  -2.431  -12.616 1.00 45.76  ?  344  LYS A HD2  1 
ATOM   3526 H  HD3  . LYS A 1 231 ? 21.353  -3.971  -12.286 1.00 45.76  ?  344  LYS A HD3  1 
ATOM   3527 H  HE2  . LYS A 1 231 ? 19.307  -3.442  -11.262 1.00 52.88  ?  344  LYS A HE2  1 
ATOM   3528 H  HE3  . LYS A 1 231 ? 19.517  -1.919  -11.664 1.00 52.88  ?  344  LYS A HE3  1 
ATOM   3529 H  HZ1  . LYS A 1 231 ? 18.149  -2.952  -13.155 1.00 55.36  ?  344  LYS A HZ1  1 
ATOM   3530 H  HZ2  . LYS A 1 231 ? 19.355  -2.545  -13.847 1.00 55.36  ?  344  LYS A HZ2  1 
ATOM   3531 H  HZ3  . LYS A 1 231 ? 19.163  -3.934  -13.480 1.00 55.36  ?  344  LYS A HZ3  1 
ATOM   3532 N  N    . ASP A 1 232 ? 22.782  -1.380  -7.722  1.00 35.10  ?  345  ASP A N    1 
ATOM   3533 C  CA   . ASP A 1 232 ? 22.278  -0.161  -7.109  1.00 33.65  ?  345  ASP A CA   1 
ATOM   3534 C  C    . ASP A 1 232 ? 23.240  0.460   -6.104  1.00 34.27  ?  345  ASP A C    1 
ATOM   3535 O  O    . ASP A 1 232 ? 23.054  1.623   -5.732  1.00 34.18  ?  345  ASP A O    1 
ATOM   3536 C  CB   . ASP A 1 232 ? 20.939  -0.445  -6.409  1.00 35.96  ?  345  ASP A CB   1 
ATOM   3537 C  CG   . ASP A 1 232 ? 19.871  -0.935  -7.364  1.00 36.26  ?  345  ASP A CG   1 
ATOM   3538 O  OD1  . ASP A 1 232 ? 19.843  -0.459  -8.518  1.00 35.96  ?  345  ASP A OD1  1 
ATOM   3539 O  OD2  . ASP A 1 232 ? 19.054  -1.801  -6.966  1.00 36.53  ?  345  ASP A OD2  1 
ATOM   3540 H  H    . ASP A 1 232 ? 22.517  -2.100  -7.334  1.00 42.10  ?  345  ASP A H    1 
ATOM   3541 H  HA   . ASP A 1 232 ? 22.128  0.492   -7.811  1.00 40.36  ?  345  ASP A HA   1 
ATOM   3542 H  HB2  . ASP A 1 232 ? 21.074  -1.129  -5.734  1.00 43.14  ?  345  ASP A HB2  1 
ATOM   3543 H  HB3  . ASP A 1 232 ? 20.619  0.371   -5.994  1.00 43.14  ?  345  ASP A HB3  1 
ATOM   3544 N  N    . ILE A 1 233 ? 24.266  -0.272  -5.678  1.00 35.86  ?  346  ILE A N    1 
ATOM   3545 C  CA   . ILE A 1 233 ? 25.107  0.136   -4.555  1.00 35.15  ?  346  ILE A CA   1 
ATOM   3546 C  C    . ILE A 1 233 ? 25.506  1.602   -4.649  1.00 35.49  ?  346  ILE A C    1 
ATOM   3547 O  O    . ILE A 1 233 ? 25.108  2.421   -3.815  1.00 37.02  ?  346  ILE A O    1 
ATOM   3548 C  CB   . ILE A 1 233 ? 26.353  -0.775  -4.458  1.00 36.33  ?  346  ILE A CB   1 
ATOM   3549 C  CG1  . ILE A 1 233 ? 25.934  -2.197  -4.058  1.00 38.37  ?  346  ILE A CG1  1 
ATOM   3550 C  CG2  . ILE A 1 233 ? 27.353  -0.221  -3.457  1.00 35.26  ?  346  ILE A CG2  1 
ATOM   3551 C  CD1  . ILE A 1 233 ? 27.054  -3.241  -4.164  1.00 37.10  ?  346  ILE A CD1  1 
ATOM   3552 H  H    . ILE A 1 233 ? 24.499  -1.021  -6.029  1.00 43.01  ?  346  ILE A H    1 
ATOM   3553 H  HA   . ILE A 1 233 ? 24.580  0.053   -3.745  1.00 42.16  ?  346  ILE A HA   1 
ATOM   3554 H  HB   . ILE A 1 233 ? 26.777  -0.803  -5.329  1.00 43.58  ?  346  ILE A HB   1 
ATOM   3555 H  HG12 . ILE A 1 233 ? 25.632  -2.183  -3.136  1.00 46.02  ?  346  ILE A HG12 1 
ATOM   3556 H  HG13 . ILE A 1 233 ? 25.211  -2.482  -4.639  1.00 46.02  ?  346  ILE A HG13 1 
ATOM   3557 H  HG21 . ILE A 1 233 ? 28.019  -0.900  -3.268  1.00 42.30  ?  346  ILE A HG21 1 
ATOM   3558 H  HG22 . ILE A 1 233 ? 27.778  0.563   -3.837  1.00 42.30  ?  346  ILE A HG22 1 
ATOM   3559 H  HG23 . ILE A 1 233 ? 26.885  0.019   -2.642  1.00 42.30  ?  346  ILE A HG23 1 
ATOM   3560 H  HD11 . ILE A 1 233 ? 26.703  -4.108  -3.907  1.00 44.50  ?  346  ILE A HD11 1 
ATOM   3561 H  HD12 . ILE A 1 233 ? 27.371  -3.271  -5.080  1.00 44.50  ?  346  ILE A HD12 1 
ATOM   3562 H  HD13 . ILE A 1 233 ? 27.778  -2.988  -3.571  1.00 44.50  ?  346  ILE A HD13 1 
ATOM   3563 N  N    . LYS A 1 234 ? 26.290  1.957   -5.665  1.00 37.40  ?  347  LYS A N    1 
ATOM   3564 C  CA   . LYS A 1 234 ? 26.801  3.321   -5.734  1.00 39.08  ?  347  LYS A CA   1 
ATOM   3565 C  C    . LYS A 1 234 ? 25.666  4.337   -5.680  1.00 37.62  ?  347  LYS A C    1 
ATOM   3566 O  O    . LYS A 1 234 ? 25.733  5.309   -4.917  1.00 34.87  ?  347  LYS A O    1 
ATOM   3567 C  CB   . LYS A 1 234 ? 27.654  3.492   -6.995  1.00 44.30  ?  347  LYS A CB   1 
ATOM   3568 C  CG   . LYS A 1 234 ? 28.820  2.522   -7.031  1.00 45.89  ?  347  LYS A CG   1 
ATOM   3569 C  CD   . LYS A 1 234 ? 29.911  2.969   -7.984  1.00 49.33  ?  347  LYS A CD   1 
ATOM   3570 C  CE   . LYS A 1 234 ? 30.857  1.826   -8.297  1.00 53.97  ?  347  LYS A CE   1 
ATOM   3571 N  NZ   . LYS A 1 234 ? 31.977  2.269   -9.166  1.00 55.52  ?  347  LYS A NZ   1 
ATOM   3572 H  H    . LYS A 1 234 ? 26.535  1.443   -6.309  1.00 44.87  ?  347  LYS A H    1 
ATOM   3573 H  HA   . LYS A 1 234 ? 27.376  3.491   -4.972  1.00 46.88  ?  347  LYS A HA   1 
ATOM   3574 H  HB2  . LYS A 1 234 ? 27.103  3.332   -7.777  1.00 53.15  ?  347  LYS A HB2  1 
ATOM   3575 H  HB3  . LYS A 1 234 ? 28.009  4.394   -7.019  1.00 53.15  ?  347  LYS A HB3  1 
ATOM   3576 H  HG2  . LYS A 1 234 ? 29.205  2.454   -6.143  1.00 55.05  ?  347  LYS A HG2  1 
ATOM   3577 H  HG3  . LYS A 1 234 ? 28.503  1.653   -7.322  1.00 55.05  ?  347  LYS A HG3  1 
ATOM   3578 H  HD2  . LYS A 1 234 ? 29.511  3.273   -8.814  1.00 59.18  ?  347  LYS A HD2  1 
ATOM   3579 H  HD3  . LYS A 1 234 ? 30.421  3.688   -7.579  1.00 59.18  ?  347  LYS A HD3  1 
ATOM   3580 H  HE2  . LYS A 1 234 ? 31.229  1.482   -7.470  1.00 64.75  ?  347  LYS A HE2  1 
ATOM   3581 H  HE3  . LYS A 1 234 ? 30.371  1.125   -8.759  1.00 64.75  ?  347  LYS A HE3  1 
ATOM   3582 H  HZ1  . LYS A 1 234 ? 32.517  1.583   -9.341  1.00 66.61  ?  347  LYS A HZ1  1 
ATOM   3583 H  HZ2  . LYS A 1 234 ? 31.659  2.590   -9.933  1.00 66.61  ?  347  LYS A HZ2  1 
ATOM   3584 H  HZ3  . LYS A 1 234 ? 32.445  2.907   -8.758  1.00 66.61  ?  347  LYS A HZ3  1 
ATOM   3585 N  N    . SER A 1 235 ? 24.587  4.098   -6.433  1.00 36.37  ?  348  SER A N    1 
ATOM   3586 C  CA   . SER A 1 235 ? 23.455  5.015   -6.391  1.00 38.86  ?  348  SER A CA   1 
ATOM   3587 C  C    . SER A 1 235 ? 22.931  5.149   -4.962  1.00 39.45  ?  348  SER A C    1 
ATOM   3588 O  O    . SER A 1 235 ? 22.810  6.267   -4.432  1.00 36.22  ?  348  SER A O    1 
ATOM   3589 C  CB   . SER A 1 235 ? 22.349  4.537   -7.328  1.00 41.01  ?  348  SER A CB   1 
ATOM   3590 O  OG   . SER A 1 235 ? 22.692  4.760   -8.684  1.00 45.78  ?  348  SER A OG   1 
ATOM   3591 H  H    . SER A 1 235 ? 24.490  3.428   -6.963  1.00 43.63  ?  348  SER A H    1 
ATOM   3592 H  HA   . SER A 1 235 ? 23.744  5.888   -6.699  1.00 46.61  ?  348  SER A HA   1 
ATOM   3593 H  HB2  . SER A 1 235 ? 22.209  3.587   -7.191  1.00 49.20  ?  348  SER A HB2  1 
ATOM   3594 H  HB3  . SER A 1 235 ? 21.534  5.024   -7.126  1.00 49.20  ?  348  SER A HB3  1 
ATOM   3595 H  HG   . SER A 1 235 ? 22.753  5.584   -8.833  1.00 54.92  ?  348  SER A HG   1 
ATOM   3596 N  N    . VAL A 1 236 ? 22.654  4.010   -4.304  1.00 34.43  ?  349  VAL A N    1 
ATOM   3597 C  CA   . VAL A 1 236 ? 22.181  4.064   -2.925  1.00 31.05  ?  349  VAL A CA   1 
ATOM   3598 C  C    . VAL A 1 236 ? 23.154  4.864   -2.077  1.00 33.90  ?  349  VAL A C    1 
ATOM   3599 O  O    . VAL A 1 236 ? 22.747  5.724   -1.286  1.00 34.93  ?  349  VAL A O    1 
ATOM   3600 C  CB   . VAL A 1 236 ? 21.974  2.647   -2.367  1.00 32.48  ?  349  VAL A CB   1 
ATOM   3601 C  CG1  . VAL A 1 236 ? 21.783  2.698   -0.864  1.00 31.07  ?  349  VAL A CG1  1 
ATOM   3602 C  CG2  . VAL A 1 236 ? 20.790  1.968   -3.040  1.00 31.90  ?  349  VAL A CG2  1 
ATOM   3603 H  H    . VAL A 1 236 ? 22.732  3.217   -4.628  1.00 41.30  ?  349  VAL A H    1 
ATOM   3604 H  HA   . VAL A 1 236 ? 21.320  4.511   -2.909  1.00 37.24  ?  349  VAL A HA   1 
ATOM   3605 H  HB   . VAL A 1 236 ? 22.764  2.116   -2.555  1.00 38.96  ?  349  VAL A HB   1 
ATOM   3606 H  HG11 . VAL A 1 236 ? 21.432  1.847   -0.561  1.00 37.27  ?  349  VAL A HG11 1 
ATOM   3607 H  HG12 . VAL A 1 236 ? 22.639  2.872   -0.443  1.00 37.27  ?  349  VAL A HG12 1 
ATOM   3608 H  HG13 . VAL A 1 236 ? 21.159  3.409   -0.649  1.00 37.27  ?  349  VAL A HG13 1 
ATOM   3609 H  HG21 . VAL A 1 236 ? 20.656  1.096   -2.637  1.00 38.26  ?  349  VAL A HG21 1 
ATOM   3610 H  HG22 . VAL A 1 236 ? 19.999  2.516   -2.915  1.00 38.26  ?  349  VAL A HG22 1 
ATOM   3611 H  HG23 . VAL A 1 236 ? 20.979  1.870   -3.986  1.00 38.26  ?  349  VAL A HG23 1 
ATOM   3612 N  N    . ARG A 1 237 ? 24.460  4.640   -2.259  1.00 31.46  ?  350  ARG A N    1 
ATOM   3613 C  CA   . ARG A 1 237 ? 25.425  5.418   -1.490  1.00 35.14  ?  350  ARG A CA   1 
ATOM   3614 C  C    . ARG A 1 237 ? 25.168  6.909   -1.690  1.00 33.79  ?  350  ARG A C    1 
ATOM   3615 O  O    . ARG A 1 237 ? 24.960  7.660   -0.734  1.00 34.88  ?  350  ARG A O    1 
ATOM   3616 C  CB   . ARG A 1 237 ? 26.860  5.070   -1.897  1.00 36.64  ?  350  ARG A CB   1 
ATOM   3617 C  CG   . ARG A 1 237 ? 27.883  5.710   -0.972  1.00 40.16  ?  350  ARG A CG   1 
ATOM   3618 C  CD   . ARG A 1 237 ? 29.275  5.713   -1.559  1.00 45.91  ?  350  ARG A CD   1 
ATOM   3619 N  NE   . ARG A 1 237 ? 30.225  6.325   -0.634  1.00 49.70  ?  350  ARG A NE   1 
ATOM   3620 C  CZ   . ARG A 1 237 ? 31.441  6.739   -0.974  1.00 52.25  ?  350  ARG A CZ   1 
ATOM   3621 N  NH1  . ARG A 1 237 ? 31.857  6.607   -2.223  1.00 56.97  ?  350  ARG A NH1  1 
ATOM   3622 N  NH2  . ARG A 1 237 ? 32.236  7.285   -0.060  1.00 50.82  ?  350  ARG A NH2  1 
ATOM   3623 H  H    . ARG A 1 237 ? 24.798  4.064   -2.801  1.00 37.74  ?  350  ARG A H    1 
ATOM   3624 H  HA   . ARG A 1 237 ? 25.328  5.192   -0.552  1.00 42.15  ?  350  ARG A HA   1 
ATOM   3625 H  HB2  . ARG A 1 237 ? 26.977  4.108   -1.861  1.00 43.95  ?  350  ARG A HB2  1 
ATOM   3626 H  HB3  . ARG A 1 237 ? 27.023  5.390   -2.798  1.00 43.95  ?  350  ARG A HB3  1 
ATOM   3627 H  HG2  . ARG A 1 237 ? 27.626  6.630   -0.802  1.00 48.18  ?  350  ARG A HG2  1 
ATOM   3628 H  HG3  . ARG A 1 237 ? 27.910  5.214   -0.138  1.00 48.18  ?  350  ARG A HG3  1 
ATOM   3629 H  HD2  . ARG A 1 237 ? 29.556  4.801   -1.732  1.00 55.08  ?  350  ARG A HD2  1 
ATOM   3630 H  HD3  . ARG A 1 237 ? 29.277  6.223   -2.384  1.00 55.08  ?  350  ARG A HD3  1 
ATOM   3631 H  HE   . ARG A 1 237 ? 29.981  6.423   0.185   1.00 59.63  ?  350  ARG A HE   1 
ATOM   3632 H  HH11 . ARG A 1 237 ? 31.340  6.254   -2.813  1.00 68.35  ?  350  ARG A HH11 1 
ATOM   3633 H  HH12 . ARG A 1 237 ? 32.644  6.874   -2.445  1.00 68.35  ?  350  ARG A HH12 1 
ATOM   3634 H  HH21 . ARG A 1 237 ? 31.964  7.370   0.751   1.00 60.97  ?  350  ARG A HH21 1 
ATOM   3635 H  HH22 . ARG A 1 237 ? 33.023  7.553   -0.280  1.00 60.97  ?  350  ARG A HH22 1 
ATOM   3636 N  N    . GLU A 1 238 ? 25.158  7.277   -2.930  1.00 35.29  ?  351  GLU A N    1 
ATOM   3637 C  CA   . GLU A 1 238 ? 24.935  8.656   -3.312  1.00 37.09  ?  351  GLU A CA   1 
ATOM   3638 C  C    . GLU A 1 238 ? 23.641  9.194   -2.618  1.00 36.48  ?  351  GLU A C    1 
ATOM   3639 O  O    . GLU A 1 238 ? 23.616  10.253  -2.060  1.00 34.44  ?  351  GLU A O    1 
ATOM   3640 C  CB   . GLU A 1 238 ? 24.838  8.857   -4.858  1.00 45.80  ?  351  GLU A CB   1 
ATOM   3641 C  CG   . GLU A 1 238 ? 24.281  10.166  -5.314  1.00 55.82  ?  351  GLU A CG   1 
ATOM   3642 C  CD   . GLU A 1 238 ? 25.232  11.313  -5.048  1.00 69.37  ?  351  GLU A CD   1 
ATOM   3643 O  OE1  . GLU A 1 238 ? 25.401  12.258  -5.833  1.00 72.00  ?  351  GLU A OE1  1 
ATOM   3644 O  OE2  . GLU A 1 238 ? 25.866  11.258  -3.996  1.00 74.55  ?  351  GLU A OE2  1 
ATOM   3645 H  H    . GLU A 1 238 ? 25.315  6.635   -3.508  1.00 42.33  ?  351  GLU A H    1 
ATOM   3646 H  HA   . GLU A 1 238 ? 25.792  9.099   -3.066  1.00 44.49  ?  351  GLU A HA   1 
ATOM   3647 H  HB2  . GLU A 1 238 ? 25.711  8.679   -5.256  1.00 54.94  ?  351  GLU A HB2  1 
ATOM   3648 H  HB3  . GLU A 1 238 ? 24.206  8.224   -5.250  1.00 54.94  ?  351  GLU A HB3  1 
ATOM   3649 H  HG2  . GLU A 1 238 ? 24.032  10.011  -6.254  1.00 66.97  ?  351  GLU A HG2  1 
ATOM   3650 H  HG3  . GLU A 1 238 ? 23.465  10.345  -4.816  1.00 66.97  ?  351  GLU A HG3  1 
ATOM   3651 N  N    . LEU A 1 239 ? 22.590  8.386   -2.617  1.00 35.44  ?  352  LEU A N    1 
ATOM   3652 C  CA   . LEU A 1 239 ? 21.311  8.808   -2.059  1.00 36.13  ?  352  LEU A CA   1 
ATOM   3653 C  C    . LEU A 1 239 ? 21.420  9.034   -0.557  1.00 34.05  ?  352  LEU A C    1 
ATOM   3654 O  O    . LEU A 1 239 ? 20.920  10.039  -0.043  1.00 32.31  ?  352  LEU A O    1 
ATOM   3655 C  CB   . LEU A 1 239 ? 20.228  7.775   -2.365  1.00 30.46  ?  352  LEU A CB   1 
ATOM   3656 C  CG   . LEU A 1 239 ? 19.657  7.807   -3.788  1.00 33.78  ?  352  LEU A CG   1 
ATOM   3657 C  CD1  . LEU A 1 239 ? 18.652  6.694   -4.010  1.00 37.49  ?  352  LEU A CD1  1 
ATOM   3658 C  CD2  . LEU A 1 239 ? 19.020  9.159   -4.094  1.00 37.06  ?  352  LEU A CD2  1 
ATOM   3659 H  H    . LEU A 1 239 ? 22.603  7.587   -2.933  1.00 42.52  ?  352  LEU A H    1 
ATOM   3660 H  HA   . LEU A 1 239 ? 21.050  9.642   -2.479  1.00 43.34  ?  352  LEU A HA   1 
ATOM   3661 H  HB2  . LEU A 1 239 ? 20.604  6.891   -2.225  1.00 36.54  ?  352  LEU A HB2  1 
ATOM   3662 H  HB3  . LEU A 1 239 ? 19.489  7.921   -1.754  1.00 36.54  ?  352  LEU A HB3  1 
ATOM   3663 H  HG   . LEU A 1 239 ? 20.394  7.670   -4.404  1.00 40.52  ?  352  LEU A HG   1 
ATOM   3664 H  HD11 . LEU A 1 239 ? 18.301  6.762   -4.912  1.00 44.97  ?  352  LEU A HD11 1 
ATOM   3665 H  HD12 . LEU A 1 239 ? 19.095  5.840   -3.891  1.00 44.97  ?  352  LEU A HD12 1 
ATOM   3666 H  HD13 . LEU A 1 239 ? 17.932  6.786   -3.367  1.00 44.97  ?  352  LEU A HD13 1 
ATOM   3667 H  HD21 . LEU A 1 239 ? 18.473  9.077   -4.891  1.00 44.45  ?  352  LEU A HD21 1 
ATOM   3668 H  HD22 . LEU A 1 239 ? 18.470  9.427   -3.341  1.00 44.45  ?  352  LEU A HD22 1 
ATOM   3669 H  HD23 . LEU A 1 239 ? 19.722  9.813   -4.241  1.00 44.45  ?  352  LEU A HD23 1 
ATOM   3670 N  N    . ILE A 1 240 ? 22.099  8.140   0.164   1.00 32.46  ?  353  ILE A N    1 
ATOM   3671 C  CA   . ILE A 1 240 ? 22.025  8.210   1.616   1.00 31.87  ?  353  ILE A CA   1 
ATOM   3672 C  C    . ILE A 1 240 ? 22.937  9.306   2.145   1.00 32.84  ?  353  ILE A C    1 
ATOM   3673 O  O    . ILE A 1 240 ? 22.521  10.135  2.952   1.00 33.71  ?  353  ILE A O    1 
ATOM   3674 C  CB   . ILE A 1 240 ? 22.338  6.837   2.242   1.00 32.31  ?  353  ILE A CB   1 
ATOM   3675 C  CG1  . ILE A 1 240 ? 21.936  6.852   3.730   1.00 34.08  ?  353  ILE A CG1  1 
ATOM   3676 C  CG2  . ILE A 1 240 ? 23.800  6.473   2.074   1.00 31.19  ?  353  ILE A CG2  1 
ATOM   3677 C  CD1  . ILE A 1 240 ? 22.031  5.490   4.419   1.00 34.83  ?  353  ILE A CD1  1 
ATOM   3678 H  H    . ILE A 1 240 ? 22.591  7.510   -0.153  1.00 38.94  ?  353  ILE A H    1 
ATOM   3679 H  HA   . ILE A 1 240 ? 21.116  8.438   1.868   1.00 38.22  ?  353  ILE A HA   1 
ATOM   3680 H  HB   . ILE A 1 240 ? 21.821  6.159   1.780   1.00 38.76  ?  353  ILE A HB   1 
ATOM   3681 H  HG12 . ILE A 1 240 ? 22.523  7.463   4.204   1.00 40.88  ?  353  ILE A HG12 1 
ATOM   3682 H  HG13 . ILE A 1 240 ? 21.017  7.154   3.800   1.00 40.88  ?  353  ILE A HG13 1 
ATOM   3683 H  HG21 . ILE A 1 240 ? 23.916  5.532   2.276   1.00 37.42  ?  353  ILE A HG21 1 
ATOM   3684 H  HG22 . ILE A 1 240 ? 24.066  6.651   1.158   1.00 37.42  ?  353  ILE A HG22 1 
ATOM   3685 H  HG23 . ILE A 1 240 ? 24.331  7.010   2.683   1.00 37.42  ?  353  ILE A HG23 1 
ATOM   3686 H  HD11 . ILE A 1 240 ? 21.722  5.577   5.334   1.00 41.78  ?  353  ILE A HD11 1 
ATOM   3687 H  HD12 . ILE A 1 240 ? 21.474  4.856   3.941   1.00 41.78  ?  353  ILE A HD12 1 
ATOM   3688 H  HD13 . ILE A 1 240 ? 22.954  5.194   4.408   1.00 41.78  ?  353  ILE A HD13 1 
ATOM   3689 N  N    . ASN A 1 241 ? 24.189  9.348   1.681   1.00 37.68  ?  354  ASN A N    1 
ATOM   3690 C  CA   . ASN A 1 241 ? 25.135  10.333  2.197   1.00 35.95  ?  354  ASN A CA   1 
ATOM   3691 C  C    . ASN A 1 241 ? 24.626  11.750  1.974   1.00 36.01  ?  354  ASN A C    1 
ATOM   3692 O  O    . ASN A 1 241 ? 24.818  12.627  2.824   1.00 36.34  ?  354  ASN A O    1 
ATOM   3693 C  CB   . ASN A 1 241 ? 26.502  10.142  1.552   1.00 36.99  ?  354  ASN A CB   1 
ATOM   3694 C  CG   . ASN A 1 241 ? 27.238  8.931   2.099   1.00 38.89  ?  354  ASN A CG   1 
ATOM   3695 O  OD1  . ASN A 1 241 ? 27.078  8.576   3.266   1.00 36.59  ?  354  ASN A OD1  1 
ATOM   3696 N  ND2  . ASN A 1 241 ? 28.041  8.296   1.262   1.00 39.54  ?  354  ASN A ND2  1 
ATOM   3697 H  H    . ASN A 1 241 ? 24.511  8.827   1.077   1.00 45.20  ?  354  ASN A H    1 
ATOM   3698 H  HA   . ASN A 1 241 ? 25.238  10.197  3.152   1.00 43.12  ?  354  ASN A HA   1 
ATOM   3699 H  HB2  . ASN A 1 241 ? 26.388  10.018  0.596   1.00 44.37  ?  354  ASN A HB2  1 
ATOM   3700 H  HB3  . ASN A 1 241 ? 27.046  10.927  1.722   1.00 44.37  ?  354  ASN A HB3  1 
ATOM   3701 H  HD21 . ASN A 1 241 ? 28.479  7.605   1.528   1.00 47.43  ?  354  ASN A HD21 1 
ATOM   3702 H  HD22 . ASN A 1 241 ? 28.126  8.574   0.453   1.00 47.43  ?  354  ASN A HD22 1 
ATOM   3703 N  N    . THR A 1 242 ? 23.979  12.000  0.835   1.00 33.76  ?  355  THR A N    1 
ATOM   3704 C  CA   . THR A 1 242 ? 23.349  13.304  0.636   1.00 36.34  ?  355  THR A CA   1 
ATOM   3705 C  C    . THR A 1 242 ? 22.212  13.518  1.627   1.00 37.68  ?  355  THR A C    1 
ATOM   3706 O  O    . THR A 1 242 ? 22.177  14.535  2.341   1.00 34.47  ?  355  THR A O    1 
ATOM   3707 C  CB   . THR A 1 242 ? 22.840  13.437  -0.800  1.00 37.18  ?  355  THR A CB   1 
ATOM   3708 O  OG1  . THR A 1 242 ? 23.940  13.356  -1.715  1.00 40.98  ?  355  THR A OG1  1 
ATOM   3709 C  CG2  . THR A 1 242 ? 22.123  14.772  -0.992  1.00 39.93  ?  355  THR A CG2  1 
ATOM   3710 H  H    . THR A 1 242 ? 23.891  11.450  0.181   1.00 40.50  ?  355  THR A H    1 
ATOM   3711 H  HA   . THR A 1 242 ? 24.016  13.994  0.780   1.00 43.60  ?  355  THR A HA   1 
ATOM   3712 H  HB   . THR A 1 242 ? 22.213  12.720  -0.985  1.00 44.60  ?  355  THR A HB   1 
ATOM   3713 H  HG1  . THR A 1 242 ? 24.331  12.618  -1.630  1.00 49.16  ?  355  THR A HG1  1 
ATOM   3714 H  HG21 . THR A 1 242 ? 22.009  14.953  -1.938  1.00 47.90  ?  355  THR A HG21 1 
ATOM   3715 H  HG22 . THR A 1 242 ? 21.251  14.744  -0.569  1.00 47.90  ?  355  THR A HG22 1 
ATOM   3716 H  HG23 . THR A 1 242 ? 22.643  15.487  -0.594  1.00 47.90  ?  355  THR A HG23 1 
ATOM   3717 N  N    . TYR A 1 243 ? 21.286  12.550  1.709   1.00 35.96  ?  356  TYR A N    1 
ATOM   3718 C  CA   . TYR A 1 243 ? 20.108  12.728  2.558   1.00 33.12  ?  356  TYR A CA   1 
ATOM   3719 C  C    . TYR A 1 243 ? 20.522  12.967  4.001   1.00 34.76  ?  356  TYR A C    1 
ATOM   3720 O  O    . TYR A 1 243 ? 19.971  13.834  4.682   1.00 33.51  ?  356  TYR A O    1 
ATOM   3721 C  CB   . TYR A 1 243 ? 19.192  11.500  2.473   1.00 32.39  ?  356  TYR A CB   1 
ATOM   3722 C  CG   . TYR A 1 243 ? 17.958  11.555  3.368   1.00 33.98  ?  356  TYR A CG   1 
ATOM   3723 C  CD1  . TYR A 1 243 ? 16.833  12.283  2.987   1.00 35.60  ?  356  TYR A CD1  1 
ATOM   3724 C  CD2  . TYR A 1 243 ? 17.911  10.872  4.582   1.00 33.62  ?  356  TYR A CD2  1 
ATOM   3725 C  CE1  . TYR A 1 243 ? 15.705  12.339  3.790   1.00 37.98  ?  356  TYR A CE1  1 
ATOM   3726 C  CE2  . TYR A 1 243 ? 16.784  10.918  5.390   1.00 34.60  ?  356  TYR A CE2  1 
ATOM   3727 C  CZ   . TYR A 1 243 ? 15.680  11.657  4.985   1.00 37.00  ?  356  TYR A CZ   1 
ATOM   3728 O  OH   . TYR A 1 243 ? 14.557  11.719  5.773   1.00 38.23  ?  356  TYR A OH   1 
ATOM   3729 H  H    . TYR A 1 243 ? 21.317  11.798  1.292   1.00 43.14  ?  356  TYR A H    1 
ATOM   3730 H  HA   . TYR A 1 243 ? 19.608  13.496  2.239   1.00 39.73  ?  356  TYR A HA   1 
ATOM   3731 H  HB2  . TYR A 1 243 ? 18.884  11.410  1.558   1.00 38.86  ?  356  TYR A HB2  1 
ATOM   3732 H  HB3  . TYR A 1 243 ? 19.703  10.717  2.731   1.00 38.86  ?  356  TYR A HB3  1 
ATOM   3733 H  HD1  . TYR A 1 243 ? 16.840  12.740  2.177   1.00 42.71  ?  356  TYR A HD1  1 
ATOM   3734 H  HD2  . TYR A 1 243 ? 18.649  10.376  4.855   1.00 40.33  ?  356  TYR A HD2  1 
ATOM   3735 H  HE1  . TYR A 1 243 ? 14.967  12.837  3.522   1.00 45.56  ?  356  TYR A HE1  1 
ATOM   3736 H  HE2  . TYR A 1 243 ? 16.768  10.458  6.197   1.00 41.51  ?  356  TYR A HE2  1 
ATOM   3737 H  HH   . TYR A 1 243 ? 13.972  12.194  5.401   1.00 45.86  ?  356  TYR A HH   1 
ATOM   3738 N  N    . LEU A 1 244 ? 21.496  12.202  4.490   1.00 34.21  ?  357  LEU A N    1 
ATOM   3739 C  CA   . LEU A 1 244 ? 21.865  12.298  5.892   1.00 34.19  ?  357  LEU A CA   1 
ATOM   3740 C  C    . LEU A 1 244 ? 22.561  13.600  6.232   1.00 35.88  ?  357  LEU A C    1 
ATOM   3741 O  O    . LEU A 1 244 ? 22.806  13.838  7.420   1.00 34.13  ?  357  LEU A O    1 
ATOM   3742 C  CB   . LEU A 1 244 ? 22.756  11.118  6.276   1.00 34.79  ?  357  LEU A CB   1 
ATOM   3743 C  CG   . LEU A 1 244 ? 22.054  9.764   6.239   1.00 34.26  ?  357  LEU A CG   1 
ATOM   3744 C  CD1  . LEU A 1 244 ? 23.024  8.663   6.629   1.00 35.65  ?  357  LEU A CD1  1 
ATOM   3745 C  CD2  . LEU A 1 244 ? 20.824  9.780   7.154   1.00 33.74  ?  357  LEU A CD2  1 
ATOM   3746 H  H    . LEU A 1 244 ? 21.949  11.629  4.036   1.00 41.04  ?  357  LEU A H    1 
ATOM   3747 H  HA   . LEU A 1 244 ? 21.058  12.252  6.427   1.00 41.01  ?  357  LEU A HA   1 
ATOM   3748 H  HB2  . LEU A 1 244 ? 23.502  11.080  5.658   1.00 41.73  ?  357  LEU A HB2  1 
ATOM   3749 H  HB3  . LEU A 1 244 ? 23.080  11.257  7.180   1.00 41.73  ?  357  LEU A HB3  1 
ATOM   3750 H  HG   . LEU A 1 244 ? 21.746  9.578   5.339   1.00 41.09  ?  357  LEU A HG   1 
ATOM   3751 H  HD11 . LEU A 1 244 ? 22.541  7.824   6.688   1.00 42.77  ?  357  LEU A HD11 1 
ATOM   3752 H  HD12 . LEU A 1 244 ? 23.717  8.599   5.953   1.00 42.77  ?  357  LEU A HD12 1 
ATOM   3753 H  HD13 . LEU A 1 244 ? 23.419  8.879   7.488   1.00 42.77  ?  357  LEU A HD13 1 
ATOM   3754 H  HD21 . LEU A 1 244 ? 20.553  8.867   7.335   1.00 40.47  ?  357  LEU A HD21 1 
ATOM   3755 H  HD22 . LEU A 1 244 ? 21.053  10.228  7.983   1.00 40.47  ?  357  LEU A HD22 1 
ATOM   3756 H  HD23 . LEU A 1 244 ? 20.105  10.256  6.709   1.00 40.47  ?  357  LEU A HD23 1 
ATOM   3757 N  N    . LYS A 1 245 ? 22.881  14.442  5.239   1.00 37.90  ?  358  LYS A N    1 
ATOM   3758 C  CA   . LYS A 1 245 ? 23.590  15.682  5.542   1.00 40.07  ?  358  LYS A CA   1 
ATOM   3759 C  C    . LYS A 1 245 ? 22.799  16.577  6.493   1.00 38.70  ?  358  LYS A C    1 
ATOM   3760 O  O    . LYS A 1 245 ? 23.390  17.316  7.286   1.00 40.90  ?  358  LYS A O    1 
ATOM   3761 C  CB   . LYS A 1 245 ? 23.895  16.443  4.249   1.00 45.01  ?  358  LYS A CB   1 
ATOM   3762 C  CG   . LYS A 1 245 ? 25.092  15.921  3.475   1.00 47.23  ?  358  LYS A CG   1 
ATOM   3763 C  CD   . LYS A 1 245 ? 25.469  16.878  2.350   1.00 57.87  ?  358  LYS A CD   1 
ATOM   3764 C  CE   . LYS A 1 245 ? 25.101  16.322  0.987   1.00 62.46  ?  358  LYS A CE   1 
ATOM   3765 N  NZ   . LYS A 1 245 ? 25.388  17.286  -0.117  1.00 71.23  ?  358  LYS A NZ   1 
ATOM   3766 H  H    . LYS A 1 245 ? 22.703  14.320  4.406   1.00 45.47  ?  358  LYS A H    1 
ATOM   3767 H  HA   . LYS A 1 245 ? 24.429  15.453  5.972   1.00 48.07  ?  358  LYS A HA   1 
ATOM   3768 H  HB2  . LYS A 1 245 ? 23.122  16.384  3.666   1.00 54.00  ?  358  LYS A HB2  1 
ATOM   3769 H  HB3  . LYS A 1 245 ? 24.073  17.371  4.471   1.00 54.00  ?  358  LYS A HB3  1 
ATOM   3770 H  HG2  . LYS A 1 245 ? 25.851  15.834  4.073   1.00 56.66  ?  358  LYS A HG2  1 
ATOM   3771 H  HG3  . LYS A 1 245 ? 24.876  15.059  3.086   1.00 56.66  ?  358  LYS A HG3  1 
ATOM   3772 H  HD2  . LYS A 1 245 ? 24.998  17.718  2.473   1.00 69.43  ?  358  LYS A HD2  1 
ATOM   3773 H  HD3  . LYS A 1 245 ? 26.427  17.030  2.367   1.00 69.43  ?  358  LYS A HD3  1 
ATOM   3774 H  HE2  . LYS A 1 245 ? 25.613  15.515  0.824   1.00 74.94  ?  358  LYS A HE2  1 
ATOM   3775 H  HE3  . LYS A 1 245 ? 24.152  16.121  0.972   1.00 74.94  ?  358  LYS A HE3  1 
ATOM   3776 H  HZ1  . LYS A 1 245 ? 25.160  16.928  -0.899  1.00 85.46  ?  358  LYS A HZ1  1 
ATOM   3777 H  HZ2  . LYS A 1 245 ? 24.924  18.035  0.005   1.00 85.46  ?  358  LYS A HZ2  1 
ATOM   3778 H  HZ3  . LYS A 1 245 ? 26.256  17.482  -0.131  1.00 85.46  ?  358  LYS A HZ3  1 
ATOM   3779 N  N    . GLN A 1 246 ? 21.470  16.521  6.438   1.00 37.31  ?  359  GLN A N    1 
ATOM   3780 C  CA   . GLN A 1 246 ? 20.630  17.432  7.209   1.00 36.46  ?  359  GLN A CA   1 
ATOM   3781 C  C    . GLN A 1 246 ? 20.561  17.099  8.696   1.00 34.94  ?  359  GLN A C    1 
ATOM   3782 O  O    . GLN A 1 246 ? 20.008  17.892  9.459   1.00 34.39  ?  359  GLN A O    1 
ATOM   3783 C  CB   . GLN A 1 246 ? 19.218  17.432  6.628   1.00 37.76  ?  359  GLN A CB   1 
ATOM   3784 C  CG   . GLN A 1 246 ? 18.554  16.059  6.635   1.00 37.87  ?  359  GLN A CG   1 
ATOM   3785 C  CD   . GLN A 1 246 ? 17.220  16.046  5.929   1.00 38.54  ?  359  GLN A CD   1 
ATOM   3786 O  OE1  . GLN A 1 246 ? 16.327  16.834  6.247   1.00 39.00  ?  359  GLN A OE1  1 
ATOM   3787 N  NE2  . GLN A 1 246 ? 17.076  15.153  4.955   1.00 38.49  ?  359  GLN A NE2  1 
ATOM   3788 H  H    . GLN A 1 246 ? 21.028  15.961  5.957   1.00 44.75  ?  359  GLN A H    1 
ATOM   3789 H  HA   . GLN A 1 246 ? 21.001  18.325  7.135   1.00 43.74  ?  359  GLN A HA   1 
ATOM   3790 H  HB2  . GLN A 1 246 ? 18.665  18.032  7.152   1.00 45.30  ?  359  GLN A HB2  1 
ATOM   3791 H  HB3  . GLN A 1 246 ? 19.259  17.737  5.708   1.00 45.30  ?  359  GLN A HB3  1 
ATOM   3792 H  HG2  . GLN A 1 246 ? 19.135  15.425  6.187   1.00 45.43  ?  359  GLN A HG2  1 
ATOM   3793 H  HG3  . GLN A 1 246 ? 18.408  15.785  7.554   1.00 45.43  ?  359  GLN A HG3  1 
ATOM   3794 H  HE21 . GLN A 1 246 ? 17.725  14.623  4.759   1.00 46.18  ?  359  GLN A HE21 1 
ATOM   3795 H  HE22 . GLN A 1 246 ? 16.335  15.105  4.522   1.00 46.18  ?  359  GLN A HE22 1 
ATOM   3796 N  N    . PHE A 1 247 ? 21.101  15.964  9.137   1.00 33.05  ?  360  PHE A N    1 
ATOM   3797 C  CA   . PHE A 1 247 ? 21.003  15.570  10.538  1.00 31.61  ?  360  PHE A CA   1 
ATOM   3798 C  C    . PHE A 1 247 ? 22.309  15.840  11.276  1.00 32.74  ?  360  PHE A C    1 
ATOM   3799 O  O    . PHE A 1 247 ? 23.381  15.950  10.675  1.00 30.58  ?  360  PHE A O    1 
ATOM   3800 C  CB   . PHE A 1 247 ? 20.607  14.093  10.644  1.00 32.12  ?  360  PHE A CB   1 
ATOM   3801 C  CG   . PHE A 1 247 ? 19.387  13.746  9.844   1.00 32.03  ?  360  PHE A CG   1 
ATOM   3802 C  CD1  . PHE A 1 247 ? 18.142  14.230  10.217  1.00 32.55  ?  360  PHE A CD1  1 
ATOM   3803 C  CD2  . PHE A 1 247 ? 19.477  12.968  8.713   1.00 31.22  ?  360  PHE A CD2  1 
ATOM   3804 C  CE1  . PHE A 1 247 ? 17.022  13.925  9.480   1.00 32.74  ?  360  PHE A CE1  1 
ATOM   3805 C  CE2  . PHE A 1 247 ? 18.355  12.662  7.969   1.00 33.46  ?  360  PHE A CE2  1 
ATOM   3806 C  CZ   . PHE A 1 247 ? 17.121  13.146  8.359   1.00 33.43  ?  360  PHE A CZ   1 
ATOM   3807 H  H    . PHE A 1 247 ? 21.529  15.408  8.640   1.00 39.65  ?  360  PHE A H    1 
ATOM   3808 H  HA   . PHE A 1 247 ? 20.316  16.097  10.976  1.00 37.91  ?  360  PHE A HA   1 
ATOM   3809 H  HB2  . PHE A 1 247 ? 21.340  13.547  10.320  1.00 38.53  ?  360  PHE A HB2  1 
ATOM   3810 H  HB3  . PHE A 1 247 ? 20.423  13.883  11.573  1.00 38.53  ?  360  PHE A HB3  1 
ATOM   3811 H  HD1  . PHE A 1 247 ? 18.064  14.766  10.973  1.00 39.05  ?  360  PHE A HD1  1 
ATOM   3812 H  HD2  . PHE A 1 247 ? 20.307  12.643  8.446   1.00 37.45  ?  360  PHE A HD2  1 
ATOM   3813 H  HE1  . PHE A 1 247 ? 16.191  14.249  9.745   1.00 39.27  ?  360  PHE A HE1  1 
ATOM   3814 H  HE2  . PHE A 1 247 ? 18.430  12.132  7.208   1.00 40.13  ?  360  PHE A HE2  1 
ATOM   3815 H  HZ   . PHE A 1 247 ? 16.362  12.944  7.862   1.00 40.10  ?  360  PHE A HZ   1 
ATOM   3816 N  N    . HIS A 1 248 ? 22.199  15.955  12.601  1.00 31.53  ?  361  HIS A N    1 
ATOM   3817 C  CA   . HIS A 1 248 ? 23.334  16.326  13.437  1.00 33.22  ?  361  HIS A CA   1 
ATOM   3818 C  C    . HIS A 1 248 ? 24.206  15.137  13.829  1.00 32.62  ?  361  HIS A C    1 
ATOM   3819 O  O    . HIS A 1 248 ? 25.382  15.329  14.161  1.00 30.37  ?  361  HIS A O    1 
ATOM   3820 C  CB   . HIS A 1 248 ? 22.835  17.031  14.707  1.00 34.38  ?  361  HIS A CB   1 
ATOM   3821 C  CG   . HIS A 1 248 ? 22.243  18.387  14.454  1.00 36.76  ?  361  HIS A CG   1 
ATOM   3822 N  ND1  . HIS A 1 248 ? 21.515  19.072  15.403  1.00 38.37  ?  361  HIS A ND1  1 
ATOM   3823 C  CD2  . HIS A 1 248 ? 22.279  19.186  13.360  1.00 39.70  ?  361  HIS A CD2  1 
ATOM   3824 C  CE1  . HIS A 1 248 ? 21.123  20.231  14.903  1.00 40.42  ?  361  HIS A CE1  1 
ATOM   3825 N  NE2  . HIS A 1 248 ? 21.576  20.327  13.666  1.00 41.79  ?  361  HIS A NE2  1 
ATOM   3826 H  H    . HIS A 1 248 ? 21.471  15.823  13.040  1.00 37.82  ?  361  HIS A H    1 
ATOM   3827 H  HA   . HIS A 1 248 ? 23.894  16.947  12.946  1.00 39.85  ?  361  HIS A HA   1 
ATOM   3828 H  HB2  . HIS A 1 248 ? 22.151  16.482  15.120  1.00 41.24  ?  361  HIS A HB2  1 
ATOM   3829 H  HB3  . HIS A 1 248 ? 23.582  17.144  15.315  1.00 41.24  ?  361  HIS A HB3  1 
ATOM   3830 H  HD2  . HIS A 1 248 ? 22.701  18.997  12.553  1.00 47.62  ?  361  HIS A HD2  1 
ATOM   3831 H  HE1  . HIS A 1 248 ? 20.615  20.871  15.347  1.00 48.49  ?  361  HIS A HE1  1 
ATOM   3832 H  HE2  . HIS A 1 248 ? 21.451  20.994  13.137  1.00 50.13  ?  361  HIS A HE2  1 
ATOM   3833 N  N    . LEU A 1 249 ? 23.655  13.926  13.805  1.00 29.65  ?  362  LEU A N    1 
ATOM   3834 C  CA   . LEU A 1 249 ? 24.397  12.713  14.119  1.00 30.64  ?  362  LEU A CA   1 
ATOM   3835 C  C    . LEU A 1 249 ? 24.040  11.682  13.067  1.00 30.38  ?  362  LEU A C    1 
ATOM   3836 O  O    . LEU A 1 249 ? 22.867  11.326  12.928  1.00 30.62  ?  362  LEU A O    1 
ATOM   3837 C  CB   . LEU A 1 249 ? 24.051  12.199  15.523  1.00 29.75  ?  362  LEU A CB   1 
ATOM   3838 C  CG   . LEU A 1 249 ? 24.632  10.834  15.875  1.00 30.39  ?  362  LEU A CG   1 
ATOM   3839 C  CD1  . LEU A 1 249 ? 26.139  10.905  16.095  1.00 28.32  ?  362  LEU A CD1  1 
ATOM   3840 C  CD2  . LEU A 1 249 ? 23.924  10.262  17.101  1.00 29.34  ?  362  LEU A CD2  1 
ATOM   3841 H  H    . LEU A 1 249 ? 22.832  13.781  13.604  1.00 35.57  ?  362  LEU A H    1 
ATOM   3842 H  HA   . LEU A 1 249 ? 25.352  12.882  14.091  1.00 36.75  ?  362  LEU A HA   1 
ATOM   3843 H  HB2  . LEU A 1 249 ? 24.388  12.836  16.173  1.00 35.68  ?  362  LEU A HB2  1 
ATOM   3844 H  HB3  . LEU A 1 249 ? 23.086  12.132  15.595  1.00 35.68  ?  362  LEU A HB3  1 
ATOM   3845 H  HG   . LEU A 1 249 ? 24.486  10.231  15.129  1.00 36.46  ?  362  LEU A HG   1 
ATOM   3846 H  HD11 . LEU A 1 249 ? 26.467  10.021  16.320  1.00 33.97  ?  362  LEU A HD11 1 
ATOM   3847 H  HD12 . LEU A 1 249 ? 26.562  11.217  15.280  1.00 33.97  ?  362  LEU A HD12 1 
ATOM   3848 H  HD13 . LEU A 1 249 ? 26.323  11.521  16.821  1.00 33.97  ?  362  LEU A HD13 1 
ATOM   3849 H  HD21 . LEU A 1 249 ? 24.310  9.398   17.314  1.00 35.19  ?  362  LEU A HD21 1 
ATOM   3850 H  HD22 . LEU A 1 249 ? 24.043  10.871  17.847  1.00 35.19  ?  362  LEU A HD22 1 
ATOM   3851 H  HD23 . LEU A 1 249 ? 22.980  10.163  16.902  1.00 35.19  ?  362  LEU A HD23 1 
ATOM   3852 N  N    . ALA A 1 250 ? 25.029  11.200  12.318  1.00 32.03  ?  363  ALA A N    1 
ATOM   3853 C  CA   . ALA A 1 250 ? 24.686  10.312  11.213  1.00 30.20  ?  363  ALA A CA   1 
ATOM   3854 C  C    . ALA A 1 250 ? 25.912  9.551   10.748  1.00 34.46  ?  363  ALA A C    1 
ATOM   3855 O  O    . ALA A 1 250 ? 27.031  10.049  10.877  1.00 31.57  ?  363  ALA A O    1 
ATOM   3856 C  CB   . ALA A 1 250 ? 24.080  11.108  10.042  1.00 34.27  ?  363  ALA A CB   1 
ATOM   3857 H  H    . ALA A 1 250 ? 25.866  11.366  12.427  1.00 38.42  ?  363  ALA A H    1 
ATOM   3858 H  HA   . ALA A 1 250 ? 24.045  9.657   11.530  1.00 36.23  ?  363  ALA A HA   1 
ATOM   3859 H  HB1  . ALA A 1 250 ? 23.865  10.495  9.322   1.00 41.11  ?  363  ALA A HB1  1 
ATOM   3860 H  HB2  . ALA A 1 250 ? 23.276  11.555  10.348  1.00 41.11  ?  363  ALA A HB2  1 
ATOM   3861 H  HB3  . ALA A 1 250 ? 24.728  11.763  9.737   1.00 41.11  ?  363  ALA A HB3  1 
ATOM   3862 N  N    . PRO A 1 251 ? 25.739  8.355   10.191  1.00 31.65  ?  364  PRO A N    1 
ATOM   3863 C  CA   . PRO A 1 251 ? 26.874  7.642   9.613   1.00 35.86  ?  364  PRO A CA   1 
ATOM   3864 C  C    . PRO A 1 251 ? 27.250  8.200   8.250   1.00 34.71  ?  364  PRO A C    1 
ATOM   3865 O  O    . PRO A 1 251 ? 26.437  8.792   7.541   1.00 34.30  ?  364  PRO A O    1 
ATOM   3866 C  CB   . PRO A 1 251 ? 26.359  6.201   9.501   1.00 34.39  ?  364  PRO A CB   1 
ATOM   3867 C  CG   . PRO A 1 251 ? 24.895  6.385   9.242   1.00 32.03  ?  364  PRO A CG   1 
ATOM   3868 C  CD   . PRO A 1 251 ? 24.482  7.595   10.042  1.00 31.34  ?  364  PRO A CD   1 
ATOM   3869 H  HA   . PRO A 1 251 ? 27.646  7.668   10.201  1.00 43.02  ?  364  PRO A HA   1 
ATOM   3870 H  HB2  . PRO A 1 251 ? 26.794  5.742   8.766   1.00 41.25  ?  364  PRO A HB2  1 
ATOM   3871 H  HB3  . PRO A 1 251 ? 26.514  5.721   10.330  1.00 41.25  ?  364  PRO A HB3  1 
ATOM   3872 H  HG2  . PRO A 1 251 ? 24.748  6.533   8.295   1.00 38.42  ?  364  PRO A HG2  1 
ATOM   3873 H  HG3  . PRO A 1 251 ? 24.410  5.598   9.535   1.00 38.42  ?  364  PRO A HG3  1 
ATOM   3874 H  HD2  . PRO A 1 251 ? 23.819  8.116   9.562   1.00 37.60  ?  364  PRO A HD2  1 
ATOM   3875 H  HD3  . PRO A 1 251 ? 24.133  7.333   10.908  1.00 37.60  ?  364  PRO A HD3  1 
ATOM   3876 N  N    . VAL A 1 252 ? 28.516  8.016   7.897   1.00 34.44  ?  365  VAL A N    1 
ATOM   3877 C  CA   . VAL A 1 252 ? 29.020  8.305   6.556   1.00 36.69  ?  365  VAL A CA   1 
ATOM   3878 C  C    . VAL A 1 252 ? 29.512  6.991   5.981   1.00 33.48  ?  365  VAL A C    1 
ATOM   3879 O  O    . VAL A 1 252 ? 30.433  6.387   6.533   1.00 34.69  ?  365  VAL A O    1 
ATOM   3880 C  CB   . VAL A 1 252 ? 30.140  9.359   6.582   1.00 38.46  ?  365  VAL A CB   1 
ATOM   3881 C  CG1  . VAL A 1 252 ? 30.455  9.826   5.167   1.00 39.33  ?  365  VAL A CG1  1 
ATOM   3882 C  CG2  . VAL A 1 252 ? 29.746  10.532  7.465   1.00 37.83  ?  365  VAL A CG2  1 
ATOM   3883 H  H    . VAL A 1 252 ? 29.119  7.716   8.433   1.00 41.31  ?  365  VAL A H    1 
ATOM   3884 H  HA   . VAL A 1 252 ? 28.305  8.646   5.995   1.00 44.02  ?  365  VAL A HA   1 
ATOM   3885 H  HB   . VAL A 1 252 ? 30.943  8.962   6.956   1.00 46.14  ?  365  VAL A HB   1 
ATOM   3886 H  HG11 . VAL A 1 252 ? 31.134  10.518  5.207   1.00 47.19  ?  365  VAL A HG11 1 
ATOM   3887 H  HG12 . VAL A 1 252 ? 30.781  9.072   4.651   1.00 47.19  ?  365  VAL A HG12 1 
ATOM   3888 H  HG13 . VAL A 1 252 ? 29.646  10.178  4.764   1.00 47.19  ?  365  VAL A HG13 1 
ATOM   3889 H  HG21 . VAL A 1 252 ? 30.396  11.243  7.355   1.00 45.38  ?  365  VAL A HG21 1 
ATOM   3890 H  HG22 . VAL A 1 252 ? 28.866  10.844  7.200   1.00 45.38  ?  365  VAL A HG22 1 
ATOM   3891 H  HG23 . VAL A 1 252 ? 29.728  10.239  8.389   1.00 45.38  ?  365  VAL A HG23 1 
ATOM   3892 N  N    . MET A 1 253 ? 28.904  6.544   4.892   1.00 33.34  ?  366  MET A N    1 
ATOM   3893 C  CA   . MET A 1 253 ? 29.126  5.195   4.390   1.00 35.32  ?  366  MET A CA   1 
ATOM   3894 C  C    . MET A 1 253 ? 29.887  5.199   3.072   1.00 38.12  ?  366  MET A C    1 
ATOM   3895 O  O    . MET A 1 253 ? 29.539  5.947   2.153   1.00 35.35  ?  366  MET A O    1 
ATOM   3896 C  CB   . MET A 1 253 ? 27.799  4.454   4.190   1.00 34.31  ?  366  MET A CB   1 
ATOM   3897 C  CG   . MET A 1 253 ? 26.995  4.242   5.459   1.00 31.70  ?  366  MET A CG   1 
ATOM   3898 S  SD   . MET A 1 253 ? 25.587  3.158   5.169   1.00 33.26  ?  366  MET A SD   1 
ATOM   3899 C  CE   . MET A 1 253 ? 24.848  3.164   6.816   1.00 33.62  ?  366  MET A CE   1 
ATOM   3900 H  H    . MET A 1 253 ? 28.353  7.009   4.424   1.00 40.00  ?  366  MET A H    1 
ATOM   3901 H  HA   . MET A 1 253 ? 29.663  4.732   5.053   1.00 42.36  ?  366  MET A HA   1 
ATOM   3902 H  HB2  . MET A 1 253 ? 27.249  4.967   3.577   1.00 41.16  ?  366  MET A HB2  1 
ATOM   3903 H  HB3  . MET A 1 253 ? 27.987  3.580   3.814   1.00 41.16  ?  366  MET A HB3  1 
ATOM   3904 H  HG2  . MET A 1 253 ? 27.560  3.835   6.134   1.00 38.02  ?  366  MET A HG2  1 
ATOM   3905 H  HG3  . MET A 1 253 ? 26.662  5.097   5.775   1.00 38.02  ?  366  MET A HG3  1 
ATOM   3906 H  HE1  . MET A 1 253 ? 24.056  2.604   6.809   1.00 40.33  ?  366  MET A HE1  1 
ATOM   3907 H  HE2  . MET A 1 253 ? 25.492  2.817   7.453   1.00 40.33  ?  366  MET A HE2  1 
ATOM   3908 H  HE3  . MET A 1 253 ? 24.608  4.074   7.051   1.00 40.33  ?  366  MET A HE3  1 
ATOM   3909 N  N    . ASP A 1 254 ? 30.902  4.333   2.977   1.00 37.07  ?  367  ASP A N    1 
ATOM   3910 C  CA   . ASP A 1 254 ? 31.520  4.023   1.698   1.00 37.93  ?  367  ASP A CA   1 
ATOM   3911 C  C    . ASP A 1 254 ? 30.709  2.927   1.005   1.00 38.62  ?  367  ASP A C    1 
ATOM   3912 O  O    . ASP A 1 254 ? 29.696  2.444   1.525   1.00 33.11  ?  367  ASP A O    1 
ATOM   3913 C  CB   . ASP A 1 254 ? 32.990  3.645   1.891   1.00 37.81  ?  367  ASP A CB   1 
ATOM   3914 C  CG   . ASP A 1 254 ? 33.192  2.366   2.695   1.00 41.34  ?  367  ASP A CG   1 
ATOM   3915 O  OD1  . ASP A 1 254 ? 32.282  1.518   2.753   1.00 39.55  ?  367  ASP A OD1  1 
ATOM   3916 O  OD2  . ASP A 1 254 ? 34.288  2.205   3.274   1.00 41.56  ?  367  ASP A OD2  1 
ATOM   3917 H  H    . ASP A 1 254 ? 31.247  3.914   3.644   1.00 44.47  ?  367  ASP A H    1 
ATOM   3918 H  HA   . ASP A 1 254 ? 31.512  4.807   1.126   1.00 45.50  ?  367  ASP A HA   1 
ATOM   3919 H  HB2  . ASP A 1 254 ? 33.397  3.515   1.020   1.00 45.36  ?  367  ASP A HB2  1 
ATOM   3920 H  HB3  . ASP A 1 254 ? 33.438  4.365   2.362   1.00 45.36  ?  367  ASP A HB3  1 
ATOM   3921 N  N    . GLU A 1 255 ? 31.152  2.522   -0.185  1.00 37.15  ?  368  GLU A N    1 
ATOM   3922 C  CA   . GLU A 1 255 ? 30.352  1.614   -1.002  1.00 37.83  ?  368  GLU A CA   1 
ATOM   3923 C  C    . GLU A 1 255 ? 30.246  0.233   -0.367  1.00 33.67  ?  368  GLU A C    1 
ATOM   3924 O  O    . GLU A 1 255 ? 29.184  -0.401  -0.419  1.00 34.49  ?  368  GLU A O    1 
ATOM   3925 C  CB   . GLU A 1 255 ? 30.943  1.520   -2.412  1.00 40.16  ?  368  GLU A CB   1 
ATOM   3926 C  CG   . GLU A 1 255 ? 30.992  2.862   -3.130  1.00 45.82  ?  368  GLU A CG   1 
ATOM   3927 C  CD   . GLU A 1 255 ? 31.677  2.781   -4.483  1.00 52.36  ?  368  GLU A CD   1 
ATOM   3928 O  OE1  . GLU A 1 255 ? 32.001  1.659   -4.914  1.00 53.56  ?  368  GLU A OE1  1 
ATOM   3929 O  OE2  . GLU A 1 255 ? 31.884  3.841   -5.110  1.00 54.06  ?  368  GLU A OE2  1 
ATOM   3930 H  H    . GLU A 1 255 ? 31.900  2.753   -0.539  1.00 44.57  ?  368  GLU A H    1 
ATOM   3931 H  HA   . GLU A 1 255 ? 29.454  1.972   -1.076  1.00 45.38  ?  368  GLU A HA   1 
ATOM   3932 H  HB2  . GLU A 1 255 ? 31.849  1.180   -2.350  1.00 48.17  ?  368  GLU A HB2  1 
ATOM   3933 H  HB3  . GLU A 1 255 ? 30.398  0.917   -2.941  1.00 48.17  ?  368  GLU A HB3  1 
ATOM   3934 H  HG2  . GLU A 1 255 ? 30.086  3.178   -3.271  1.00 54.97  ?  368  GLU A HG2  1 
ATOM   3935 H  HG3  . GLU A 1 255 ? 31.483  3.496   -2.584  1.00 54.97  ?  368  GLU A HG3  1 
ATOM   3936 N  N    . GLU A 1 256 ? 31.334  -0.252  0.231   1.00 34.93  ?  369  GLU A N    1 
ATOM   3937 C  CA   . GLU A 1 256 ? 31.283  -1.541  0.913   1.00 37.98  ?  369  GLU A CA   1 
ATOM   3938 C  C    . GLU A 1 256 ? 30.245  -1.525  2.023   1.00 32.93  ?  369  GLU A C    1 
ATOM   3939 O  O    . GLU A 1 256 ? 29.506  -2.497  2.208   1.00 28.36  ?  369  GLU A O    1 
ATOM   3940 C  CB   . GLU A 1 256 ? 32.646  -1.891  1.503   1.00 41.39  ?  369  GLU A CB   1 
ATOM   3941 C  CG   . GLU A 1 256 ? 33.627  -2.498  0.537   1.00 51.94  ?  369  GLU A CG   1 
ATOM   3942 C  CD   . GLU A 1 256 ? 34.832  -3.067  1.260   1.00 63.90  ?  369  GLU A CD   1 
ATOM   3943 O  OE1  . GLU A 1 256 ? 35.743  -2.290  1.608   1.00 67.98  ?  369  GLU A OE1  1 
ATOM   3944 O  OE2  . GLU A 1 256 ? 34.849  -4.294  1.510   1.00 69.02  ?  369  GLU A OE2  1 
ATOM   3945 H  H    . GLU A 1 256 ? 32.100  0.137   0.258   1.00 41.91  ?  369  GLU A H    1 
ATOM   3946 H  HA   . GLU A 1 256 ? 31.047  -2.220  0.262   1.00 45.56  ?  369  GLU A HA   1 
ATOM   3947 H  HB2  . GLU A 1 256 ? 33.047  -1.078  1.851   1.00 49.65  ?  369  GLU A HB2  1 
ATOM   3948 H  HB3  . GLU A 1 256 ? 32.514  -2.529  2.222   1.00 49.65  ?  369  GLU A HB3  1 
ATOM   3949 H  HG2  . GLU A 1 256 ? 33.195  -3.217  0.049   1.00 62.31  ?  369  GLU A HG2  1 
ATOM   3950 H  HG3  . GLU A 1 256 ? 33.935  -1.816  -0.081  1.00 62.31  ?  369  GLU A HG3  1 
ATOM   3951 N  N    . GLU A 1 257 ? 30.197  -0.430  2.789   1.00 32.59  ?  370  GLU A N    1 
ATOM   3952 C  CA   . GLU A 1 257 ? 29.256  -0.342  3.897   1.00 32.24  ?  370  GLU A CA   1 
ATOM   3953 C  C    . GLU A 1 257 ? 27.820  -0.289  3.396   1.00 33.09  ?  370  GLU A C    1 
ATOM   3954 O  O    . GLU A 1 257 ? 26.921  -0.904  3.993   1.00 28.63  ?  370  GLU A O    1 
ATOM   3955 C  CB   . GLU A 1 257 ? 29.595  0.870   4.754   1.00 34.48  ?  370  GLU A CB   1 
ATOM   3956 C  CG   . GLU A 1 257 ? 30.919  0.731   5.480   1.00 37.60  ?  370  GLU A CG   1 
ATOM   3957 C  CD   . GLU A 1 257 ? 31.371  2.022   6.136   1.00 44.10  ?  370  GLU A CD   1 
ATOM   3958 O  OE1  . GLU A 1 257 ? 31.269  3.089   5.495   1.00 38.71  ?  370  GLU A OE1  1 
ATOM   3959 O  OE2  . GLU A 1 257 ? 31.836  1.967   7.294   1.00 45.64  ?  370  GLU A OE2  1 
ATOM   3960 H  H    . GLU A 1 257 ? 30.692  0.266   2.688   1.00 39.09  ?  370  GLU A H    1 
ATOM   3961 H  HA   . GLU A 1 257 ? 29.335  -1.131  4.456   1.00 38.68  ?  370  GLU A HA   1 
ATOM   3962 H  HB2  . GLU A 1 257 ? 29.647  1.654   4.185   1.00 41.37  ?  370  GLU A HB2  1 
ATOM   3963 H  HB3  . GLU A 1 257 ? 28.900  0.990   5.420   1.00 41.37  ?  370  GLU A HB3  1 
ATOM   3964 H  HG2  . GLU A 1 257 ? 30.830  0.058   6.173   1.00 45.11  ?  370  GLU A HG2  1 
ATOM   3965 H  HG3  . GLU A 1 257 ? 31.601  0.464   4.844   1.00 45.11  ?  370  GLU A HG3  1 
ATOM   3966 N  N    . VAL A 1 258 ? 27.578  0.442   2.307   1.00 30.68  ?  371  VAL A N    1 
ATOM   3967 C  CA   . VAL A 1 258 ? 26.234  0.468   1.737   1.00 31.01  ?  371  VAL A CA   1 
ATOM   3968 C  C    . VAL A 1 258 ? 25.819  -0.946  1.348   1.00 31.44  ?  371  VAL A C    1 
ATOM   3969 O  O    . VAL A 1 258 ? 24.725  -1.408  1.679   1.00 29.83  ?  371  VAL A O    1 
ATOM   3970 C  CB   . VAL A 1 258 ? 26.154  1.410   0.520   1.00 31.26  ?  371  VAL A CB   1 
ATOM   3971 C  CG1  . VAL A 1 258 ? 24.826  1.222   -0.173  1.00 31.54  ?  371  VAL A CG1  1 
ATOM   3972 C  CG2  . VAL A 1 258 ? 26.346  2.857   0.935   1.00 31.15  ?  371  VAL A CG2  1 
ATOM   3973 H  H    . VAL A 1 258 ? 28.159  0.920   1.890   1.00 36.80  ?  371  VAL A H    1 
ATOM   3974 H  HA   . VAL A 1 258 ? 25.628  0.809   2.413   1.00 37.19  ?  371  VAL A HA   1 
ATOM   3975 H  HB   . VAL A 1 258 ? 26.868  1.194   -0.100  1.00 37.50  ?  371  VAL A HB   1 
ATOM   3976 H  HG11 . VAL A 1 258 ? 24.659  1.985   -0.748  1.00 37.83  ?  371  VAL A HG11 1 
ATOM   3977 H  HG12 . VAL A 1 258 ? 24.858  0.409   -0.702  1.00 37.83  ?  371  VAL A HG12 1 
ATOM   3978 H  HG13 . VAL A 1 258 ? 24.127  1.153   0.496   1.00 37.83  ?  371  VAL A HG13 1 
ATOM   3979 H  HG21 . VAL A 1 258 ? 26.350  3.415   0.142   1.00 37.36  ?  371  VAL A HG21 1 
ATOM   3980 H  HG22 . VAL A 1 258 ? 25.617  3.117   1.519   1.00 37.36  ?  371  VAL A HG22 1 
ATOM   3981 H  HG23 . VAL A 1 258 ? 27.191  2.941   1.403   1.00 37.36  ?  371  VAL A HG23 1 
ATOM   3982 N  N    . ALA A 1 259 ? 26.687  -1.654  0.611   1.00 31.92  ?  372  ALA A N    1 
ATOM   3983 C  CA   . ALA A 1 259 ? 26.343  -3.017  0.216   1.00 31.02  ?  372  ALA A CA   1 
ATOM   3984 C  C    . ALA A 1 259 ? 26.069  -3.888  1.440   1.00 30.58  ?  372  ALA A C    1 
ATOM   3985 O  O    . ALA A 1 259 ? 25.100  -4.653  1.458   1.00 30.38  ?  372  ALA A O    1 
ATOM   3986 C  CB   . ALA A 1 259 ? 27.449  -3.625  -0.641  1.00 32.54  ?  372  ALA A CB   1 
ATOM   3987 H  H    . ALA A 1 259 ? 27.453  -1.376  0.337   1.00 38.29  ?  372  ALA A H    1 
ATOM   3988 H  HA   . ALA A 1 259 ? 25.538  -2.990  -0.325  1.00 37.21  ?  372  ALA A HA   1 
ATOM   3989 H  HB1  . ALA A 1 259 ? 27.166  -4.500  -0.947  1.00 39.04  ?  372  ALA A HB1  1 
ATOM   3990 H  HB2  . ALA A 1 259 ? 27.613  -3.045  -1.401  1.00 39.04  ?  372  ALA A HB2  1 
ATOM   3991 H  HB3  . ALA A 1 259 ? 28.254  -3.706  -0.106  1.00 39.04  ?  372  ALA A HB3  1 
ATOM   3992 N  N    . HIS A 1 260 ? 26.907  -3.790  2.474   1.00 29.52  ?  373  HIS A N    1 
ATOM   3993 C  CA   . HIS A 1 260 ? 26.686  -4.601  3.666   1.00 29.84  ?  373  HIS A CA   1 
ATOM   3994 C  C    . HIS A 1 260 ? 25.322  -4.299  4.288   1.00 29.36  ?  373  HIS A C    1 
ATOM   3995 O  O    . HIS A 1 260 ? 24.521  -5.209  4.546   1.00 26.30  ?  373  HIS A O    1 
ATOM   3996 C  CB   . HIS A 1 260 ? 27.783  -4.371  4.711   1.00 30.16  ?  373  HIS A CB   1 
ATOM   3997 C  CG   . HIS A 1 260 ? 27.639  -5.236  5.933   1.00 32.25  ?  373  HIS A CG   1 
ATOM   3998 N  ND1  . HIS A 1 260 ? 28.046  -6.550  5.958   1.00 31.79  ?  373  HIS A ND1  1 
ATOM   3999 C  CD2  . HIS A 1 260 ? 27.143  -4.979  7.167   1.00 30.45  ?  373  HIS A CD2  1 
ATOM   4000 C  CE1  . HIS A 1 260 ? 27.807  -7.069  7.149   1.00 34.12  ?  373  HIS A CE1  1 
ATOM   4001 N  NE2  . HIS A 1 260 ? 27.263  -6.134  7.906   1.00 33.09  ?  373  HIS A NE2  1 
ATOM   4002 H  H    . HIS A 1 260 ? 27.595  -3.274  2.510   1.00 35.41  ?  373  HIS A H    1 
ATOM   4003 H  HA   . HIS A 1 260 ? 26.721  -5.532  3.396   1.00 35.79  ?  373  HIS A HA   1 
ATOM   4004 H  HB2  . HIS A 1 260 ? 28.644  -4.565  4.309   1.00 36.18  ?  373  HIS A HB2  1 
ATOM   4005 H  HB3  . HIS A 1 260 ? 27.752  -3.444  4.997   1.00 36.18  ?  373  HIS A HB3  1 
ATOM   4006 H  HD2  . HIS A 1 260 ? 26.787  -4.171  7.461   1.00 36.52  ?  373  HIS A HD2  1 
ATOM   4007 H  HE1  . HIS A 1 260 ? 27.990  -7.943  7.410   1.00 40.92  ?  373  HIS A HE1  1 
ATOM   4008 H  HE2  . HIS A 1 260 ? 27.023  -6.231  8.726   1.00 39.69  ?  373  HIS A HE2  1 
ATOM   4009 N  N    . TRP A 1 261 ? 25.047  -3.024  4.558   1.00 28.76  ?  374  TRP A N    1 
ATOM   4010 C  CA   . TRP A 1 261 ? 23.897  -2.680  5.378   1.00 29.29  ?  374  TRP A CA   1 
ATOM   4011 C  C    . TRP A 1 261 ? 22.578  -2.742  4.621   1.00 32.30  ?  374  TRP A C    1 
ATOM   4012 O  O    . TRP A 1 261 ? 21.524  -2.887  5.267   1.00 27.35  ?  374  TRP A O    1 
ATOM   4013 C  CB   . TRP A 1 261 ? 24.061  -1.288  5.992   1.00 28.23  ?  374  TRP A CB   1 
ATOM   4014 C  CG   . TRP A 1 261 ? 25.141  -1.219  7.028   1.00 29.83  ?  374  TRP A CG   1 
ATOM   4015 C  CD1  . TRP A 1 261 ? 26.245  -0.416  7.004   1.00 28.22  ?  374  TRP A CD1  1 
ATOM   4016 C  CD2  . TRP A 1 261 ? 25.230  -1.986  8.238   1.00 29.73  ?  374  TRP A CD2  1 
ATOM   4017 N  NE1  . TRP A 1 261 ? 27.015  -0.630  8.122   1.00 29.54  ?  374  TRP A NE1  1 
ATOM   4018 C  CE2  . TRP A 1 261 ? 26.416  -1.592  8.895   1.00 31.90  ?  374  TRP A CE2  1 
ATOM   4019 C  CE3  . TRP A 1 261 ? 24.430  -2.973  8.824   1.00 31.62  ?  374  TRP A CE3  1 
ATOM   4020 C  CZ2  . TRP A 1 261 ? 26.814  -2.142  10.111  1.00 31.28  ?  374  TRP A CZ2  1 
ATOM   4021 C  CZ3  . TRP A 1 261 ? 24.827  -3.519  10.035  1.00 31.51  ?  374  TRP A CZ3  1 
ATOM   4022 C  CH2  . TRP A 1 261 ? 26.008  -3.109  10.661  1.00 32.86  ?  374  TRP A CH2  1 
ATOM   4023 H  H    . TRP A 1 261 ? 25.505  -2.352  4.281   1.00 34.50  ?  374  TRP A H    1 
ATOM   4024 H  HA   . TRP A 1 261 ? 23.855  -3.320  6.105   1.00 35.13  ?  374  TRP A HA   1 
ATOM   4025 H  HB2  . TRP A 1 261 ? 24.283  -0.659  5.288   1.00 33.86  ?  374  TRP A HB2  1 
ATOM   4026 H  HB3  . TRP A 1 261 ? 23.226  -1.032  6.415   1.00 33.86  ?  374  TRP A HB3  1 
ATOM   4027 H  HD1  . TRP A 1 261 ? 26.448  0.190   6.327   1.00 33.85  ?  374  TRP A HD1  1 
ATOM   4028 H  HE1  . TRP A 1 261 ? 27.752  -0.227  8.307   1.00 35.43  ?  374  TRP A HE1  1 
ATOM   4029 H  HE3  . TRP A 1 261 ? 23.647  -3.257  8.409   1.00 37.93  ?  374  TRP A HE3  1 
ATOM   4030 H  HZ2  . TRP A 1 261 ? 27.595  -1.865  10.534  1.00 37.53  ?  374  TRP A HZ2  1 
ATOM   4031 H  HZ3  . TRP A 1 261 ? 24.299  -4.170  10.437  1.00 37.79  ?  374  TRP A HZ3  1 
ATOM   4032 H  HH2  . TRP A 1 261 ? 26.253  -3.499  11.469  1.00 39.41  ?  374  TRP A HH2  1 
ATOM   4033 N  N    . PHE A 1 262 ? 22.587  -2.681  3.274   1.00 30.69  ?  375  PHE A N    1 
ATOM   4034 C  CA   . PHE A 1 262 ? 21.313  -2.594  2.559   1.00 31.27  ?  375  PHE A CA   1 
ATOM   4035 C  C    . PHE A 1 262 ? 21.008  -3.712  1.556   1.00 30.32  ?  375  PHE A C    1 
ATOM   4036 O  O    . PHE A 1 262 ? 19.824  -3.921  1.277   1.00 31.31  ?  375  PHE A O    1 
ATOM   4037 C  CB   . PHE A 1 262 ? 21.210  -1.222  1.853   1.00 29.74  ?  375  PHE A CB   1 
ATOM   4038 C  CG   . PHE A 1 262 ? 21.257  -0.043  2.817   1.00 30.96  ?  375  PHE A CG   1 
ATOM   4039 C  CD1  . PHE A 1 262 ? 20.137  0.320   3.553   1.00 29.63  ?  375  PHE A CD1  1 
ATOM   4040 C  CD2  . PHE A 1 262 ? 22.423  0.678   2.999   1.00 30.28  ?  375  PHE A CD2  1 
ATOM   4041 C  CE1  . PHE A 1 262 ? 20.192  1.372   4.445   1.00 31.44  ?  375  PHE A CE1  1 
ATOM   4042 C  CE2  . PHE A 1 262 ? 22.479  1.730   3.884   1.00 30.19  ?  375  PHE A CE2  1 
ATOM   4043 C  CZ   . PHE A 1 262 ? 21.358  2.078   4.614   1.00 31.42  ?  375  PHE A CZ   1 
ATOM   4044 H  H    . PHE A 1 262 ? 23.292  -2.689  2.781   1.00 36.82  ?  375  PHE A H    1 
ATOM   4045 H  HA   . PHE A 1 262 ? 20.604  -2.661  3.218   1.00 37.51  ?  375  PHE A HA   1 
ATOM   4046 H  HB2  . PHE A 1 262 ? 21.951  -1.131  1.235   1.00 35.67  ?  375  PHE A HB2  1 
ATOM   4047 H  HB3  . PHE A 1 262 ? 20.369  -1.180  1.372   1.00 35.67  ?  375  PHE A HB3  1 
ATOM   4048 H  HD1  . PHE A 1 262 ? 19.342  -0.150  3.445   1.00 35.54  ?  375  PHE A HD1  1 
ATOM   4049 H  HD2  . PHE A 1 262 ? 23.183  0.447   2.515   1.00 36.32  ?  375  PHE A HD2  1 
ATOM   4050 H  HE1  . PHE A 1 262 ? 19.435  1.604   4.934   1.00 37.71  ?  375  PHE A HE1  1 
ATOM   4051 H  HE2  . PHE A 1 262 ? 23.270  2.207   3.991   1.00 36.21  ?  375  PHE A HE2  1 
ATOM   4052 H  HZ   . PHE A 1 262 ? 21.394  2.785   5.216   1.00 37.69  ?  375  PHE A HZ   1 
ATOM   4053 N  N    . LEU A 1 263 ? 21.997  -4.462  1.028   1.00 33.00  ?  376  LEU A N    1 
ATOM   4054 C  CA   . LEU A 1 263 ? 21.654  -5.539  0.091   1.00 31.77  ?  376  LEU A CA   1 
ATOM   4055 C  C    . LEU A 1 263 ? 20.716  -6.541  0.779   1.00 29.01  ?  376  LEU A C    1 
ATOM   4056 O  O    . LEU A 1 263 ? 21.006  -6.965  1.898   1.00 29.10  ?  376  LEU A O    1 
ATOM   4057 C  CB   . LEU A 1 263 ? 22.897  -6.270  -0.425  1.00 35.39  ?  376  LEU A CB   1 
ATOM   4058 C  CG   . LEU A 1 263 ? 23.768  -5.541  -1.446  1.00 35.72  ?  376  LEU A CG   1 
ATOM   4059 C  CD1  . LEU A 1 263 ? 24.960  -6.350  -1.951  1.00 39.58  ?  376  LEU A CD1  1 
ATOM   4060 C  CD2  . LEU A 1 263 ? 22.890  -5.106  -2.626  1.00 38.04  ?  376  LEU A CD2  1 
ATOM   4061 H  H    . LEU A 1 263 ? 22.836  -4.369  1.191   1.00 39.58  ?  376  LEU A H    1 
ATOM   4062 H  HA   . LEU A 1 263 ? 21.207  -5.146  -0.675  1.00 38.11  ?  376  LEU A HA   1 
ATOM   4063 H  HB2  . LEU A 1 263 ? 23.464  -6.466  0.338   1.00 42.46  ?  376  LEU A HB2  1 
ATOM   4064 H  HB3  . LEU A 1 263 ? 22.605  -7.095  -0.842  1.00 42.46  ?  376  LEU A HB3  1 
ATOM   4065 H  HG   . LEU A 1 263 ? 24.155  -4.773  -0.998  1.00 42.85  ?  376  LEU A HG   1 
ATOM   4066 H  HD11 . LEU A 1 263 ? 24.635  -7.153  -2.387  1.00 47.48  ?  376  LEU A HD11 1 
ATOM   4067 H  HD12 . LEU A 1 263 ? 25.463  -5.811  -2.582  1.00 47.48  ?  376  LEU A HD12 1 
ATOM   4068 H  HD13 . LEU A 1 263 ? 25.523  -6.588  -1.197  1.00 47.48  ?  376  LEU A HD13 1 
ATOM   4069 H  HD21 . LEU A 1 263 ? 22.318  -5.846  -2.885  1.00 45.63  ?  376  LEU A HD21 1 
ATOM   4070 H  HD22 . LEU A 1 263 ? 22.348  -4.349  -2.354  1.00 45.63  ?  376  LEU A HD22 1 
ATOM   4071 H  HD23 . LEU A 1 263 ? 23.461  -4.854  -3.369  1.00 45.63  ?  376  LEU A HD23 1 
ATOM   4072 N  N    . PRO A 1 264 ? 19.609  -6.937  0.140   1.00 31.71  ?  377  PRO A N    1 
ATOM   4073 C  CA   . PRO A 1 264 ? 18.653  -7.842  0.813   1.00 32.00  ?  377  PRO A CA   1 
ATOM   4074 C  C    . PRO A 1 264 ? 19.302  -9.115  1.326   1.00 33.45  ?  377  PRO A C    1 
ATOM   4075 O  O    . PRO A 1 264 ? 20.081  -9.766  0.630   1.00 29.69  ?  377  PRO A O    1 
ATOM   4076 C  CB   . PRO A 1 264 ? 17.628  -8.151  -0.288  1.00 32.45  ?  377  PRO A CB   1 
ATOM   4077 C  CG   . PRO A 1 264 ? 17.627  -6.928  -1.135  1.00 33.82  ?  377  PRO A CG   1 
ATOM   4078 C  CD   . PRO A 1 264 ? 19.057  -6.413  -1.127  1.00 33.40  ?  377  PRO A CD   1 
ATOM   4079 H  HA   . PRO A 1 264 ? 18.234  -7.377  1.554   1.00 38.38  ?  377  PRO A HA   1 
ATOM   4080 H  HB2  . PRO A 1 264 ? 17.908  -8.929  -0.796  1.00 38.93  ?  377  PRO A HB2  1 
ATOM   4081 H  HB3  . PRO A 1 264 ? 16.754  -8.307  0.103   1.00 38.93  ?  377  PRO A HB3  1 
ATOM   4082 H  HG2  . PRO A 1 264 ? 17.348  -7.154  -2.036  1.00 40.57  ?  377  PRO A HG2  1 
ATOM   4083 H  HG3  . PRO A 1 264 ? 17.023  -6.269  -0.756  1.00 40.57  ?  377  PRO A HG3  1 
ATOM   4084 H  HD2  . PRO A 1 264 ? 19.551  -6.760  -1.887  1.00 40.06  ?  377  PRO A HD2  1 
ATOM   4085 H  HD3  . PRO A 1 264 ? 19.074  -5.444  -1.134  1.00 40.06  ?  377  PRO A HD3  1 
ATOM   4086 N  N    . ARG A 1 265 ? 18.960  -9.470  2.564   1.00 29.33  ?  378  ARG A N    1 
ATOM   4087 C  CA   . ARG A 1 265 ? 19.290  -10.772 3.133   1.00 31.62  ?  378  ARG A CA   1 
ATOM   4088 C  C    . ARG A 1 265 ? 18.013  -11.292 3.764   1.00 33.20  ?  378  ARG A C    1 
ATOM   4089 O  O    . ARG A 1 265 ? 17.525  -10.707 4.739   1.00 30.64  ?  378  ARG A O    1 
ATOM   4090 C  CB   . ARG A 1 265 ? 20.411  -10.683 4.163   1.00 31.15  ?  378  ARG A CB   1 
ATOM   4091 C  CG   . ARG A 1 265 ? 21.706  -10.090 3.647   1.00 31.64  ?  378  ARG A CG   1 
ATOM   4092 C  CD   . ARG A 1 265 ? 22.774  -10.187 4.722   1.00 30.09  ?  378  ARG A CD   1 
ATOM   4093 N  NE   . ARG A 1 265 ? 24.018  -9.550  4.320   1.00 32.44  ?  378  ARG A NE   1 
ATOM   4094 C  CZ   . ARG A 1 265 ? 25.181  -9.699  4.953   1.00 32.38  ?  378  ARG A CZ   1 
ATOM   4095 N  NH1  . ARG A 1 265 ? 25.268  -10.473 6.023   1.00 33.31  ?  378  ARG A NH1  1 
ATOM   4096 N  NH2  . ARG A 1 265 ? 26.252  -9.067  4.517   1.00 30.39  ?  378  ARG A NH2  1 
ATOM   4097 H  H    . ARG A 1 265 ? 18.526  -8.960  3.103   1.00 35.18  ?  378  ARG A H    1 
ATOM   4098 H  HA   . ARG A 1 265 ? 19.591  -11.376 2.437   1.00 37.93  ?  378  ARG A HA   1 
ATOM   4099 H  HB2  . ARG A 1 265 ? 20.109  -10.127 4.899   1.00 37.37  ?  378  ARG A HB2  1 
ATOM   4100 H  HB3  . ARG A 1 265 ? 20.607  -11.577 4.483   1.00 37.37  ?  378  ARG A HB3  1 
ATOM   4101 H  HG2  . ARG A 1 265 ? 22.003  -10.581 2.865   1.00 37.95  ?  378  ARG A HG2  1 
ATOM   4102 H  HG3  . ARG A 1 265 ? 21.573  -9.156  3.422   1.00 37.95  ?  378  ARG A HG3  1 
ATOM   4103 H  HD2  . ARG A 1 265 ? 22.457  -9.749  5.527   1.00 36.09  ?  378  ARG A HD2  1 
ATOM   4104 H  HD3  . ARG A 1 265 ? 22.959  -11.122 4.904   1.00 36.09  ?  378  ARG A HD3  1 
ATOM   4105 H  HE   . ARG A 1 265 ? 24.002  -9.043  3.625   1.00 38.92  ?  378  ARG A HE   1 
ATOM   4106 H  HH11 . ARG A 1 265 ? 24.571  -10.884 6.314   1.00 39.96  ?  378  ARG A HH11 1 
ATOM   4107 H  HH12 . ARG A 1 265 ? 26.021  -10.565 6.427   1.00 39.96  ?  378  ARG A HH12 1 
ATOM   4108 H  HH21 . ARG A 1 265 ? 26.199  -8.559  3.824   1.00 36.45  ?  378  ARG A HH21 1 
ATOM   4109 H  HH22 . ARG A 1 265 ? 27.003  -9.162  4.924   1.00 36.45  ?  378  ARG A HH22 1 
ATOM   4110 N  N    . GLU A 1 266 ? 17.469  -12.378 3.214   1.00 34.60  ?  379  GLU A N    1 
ATOM   4111 C  CA   . GLU A 1 266 ? 16.163  -12.849 3.673   1.00 38.60  ?  379  GLU A CA   1 
ATOM   4112 C  C    . GLU A 1 266 ? 16.177  -13.106 5.180   1.00 36.53  ?  379  GLU A C    1 
ATOM   4113 O  O    . GLU A 1 266 ? 17.134  -13.667 5.726   1.00 35.89  ?  379  GLU A O    1 
ATOM   4114 C  CB   . GLU A 1 266 ? 15.761  -14.122 2.927   1.00 46.67  ?  379  GLU A CB   1 
ATOM   4115 C  CG   . GLU A 1 266 ? 14.249  -14.258 2.769   1.00 54.56  ?  379  GLU A CG   1 
ATOM   4116 C  CD   . GLU A 1 266 ? 13.824  -15.604 2.215   1.00 60.47  ?  379  GLU A CD   1 
ATOM   4117 O  OE1  . GLU A 1 266 ? 14.697  -16.475 2.010   1.00 61.37  ?  379  GLU A OE1  1 
ATOM   4118 O  OE2  . GLU A 1 266 ? 12.607  -15.789 1.989   1.00 62.86  ?  379  GLU A OE2  1 
ATOM   4119 H  H    . GLU A 1 266 ? 17.825  -12.849 2.589   1.00 41.50  ?  379  GLU A H    1 
ATOM   4120 H  HA   . GLU A 1 266 ? 15.498  -12.168 3.487   1.00 46.31  ?  379  GLU A HA   1 
ATOM   4121 H  HB2  . GLU A 1 266 ? 16.156  -14.107 2.042   1.00 55.99  ?  379  GLU A HB2  1 
ATOM   4122 H  HB3  . GLU A 1 266 ? 16.082  -14.892 3.421   1.00 55.99  ?  379  GLU A HB3  1 
ATOM   4123 H  HG2  . GLU A 1 266 ? 13.831  -14.147 3.637   1.00 65.45  ?  379  GLU A HG2  1 
ATOM   4124 H  HG3  . GLU A 1 266 ? 13.934  -13.572 2.159   1.00 65.45  ?  379  GLU A HG3  1 
ATOM   4125 N  N    . HIS A 1 267 ? 15.117  -12.659 5.848   1.00 34.43  ?  380  HIS A N    1 
ATOM   4126 C  CA   . HIS A 1 267 ? 14.924  -12.770 7.291   1.00 34.02  ?  380  HIS A CA   1 
ATOM   4127 C  C    . HIS A 1 267 ? 15.842  -11.860 8.090   1.00 29.39  ?  380  HIS A C    1 
ATOM   4128 O  O    . HIS A 1 267 ? 15.954  -12.029 9.313   1.00 27.89  ?  380  HIS A O    1 
ATOM   4129 C  CB   . HIS A 1 267 ? 15.116  -14.209 7.788   1.00 38.12  ?  380  HIS A CB   1 
ATOM   4130 C  CG   . HIS A 1 267 ? 14.235  -15.207 7.112   1.00 41.12  ?  380  HIS A CG   1 
ATOM   4131 N  ND1  . HIS A 1 267 ? 14.722  -16.362 6.538   1.00 47.28  ?  380  HIS A ND1  1 
ATOM   4132 C  CD2  . HIS A 1 267 ? 12.897  -15.224 6.916   1.00 45.45  ?  380  HIS A CD2  1 
ATOM   4133 C  CE1  . HIS A 1 267 ? 13.720  -17.048 6.017   1.00 46.74  ?  380  HIS A CE1  1 
ATOM   4134 N  NE2  . HIS A 1 267 ? 12.601  -16.381 6.237   1.00 46.53  ?  380  HIS A NE2  1 
ATOM   4135 H  H    . HIS A 1 267 ? 14.459  -12.265 5.458   1.00 41.30  ?  380  HIS A H    1 
ATOM   4136 H  HA   . HIS A 1 267 ? 14.010  -12.500 7.473   1.00 40.80  ?  380  HIS A HA   1 
ATOM   4137 H  HB2  . HIS A 1 267 ? 16.036  -14.473 7.630   1.00 45.73  ?  380  HIS A HB2  1 
ATOM   4138 H  HB3  . HIS A 1 267 ? 14.921  -14.239 8.738   1.00 45.73  ?  380  HIS A HB3  1 
ATOM   4139 H  HD2  . HIS A 1 267 ? 12.291  -14.574 7.189   1.00 54.52  ?  380  HIS A HD2  1 
ATOM   4140 H  HE1  . HIS A 1 267 ? 13.790  -17.861 5.571   1.00 56.07  ?  380  HIS A HE1  1 
ATOM   4141 H  HE2  . HIS A 1 267 ? 11.815  -16.631 5.994   1.00 55.82  ?  380  HIS A HE2  1 
ATOM   4142 N  N    . ILE A 1 268 ? 16.503  -10.907 7.445   1.00 29.87  ?  381  ILE A N    1 
ATOM   4143 C  CA   . ILE A 1 268 ? 17.451  -10.047 8.138   1.00 30.14  ?  381  ILE A CA   1 
ATOM   4144 C  C    . ILE A 1 268 ? 17.225  -8.592  7.759   1.00 27.94  ?  381  ILE A C    1 
ATOM   4145 O  O    . ILE A 1 268 ? 16.919  -7.756  8.617   1.00 25.19  ?  381  ILE A O    1 
ATOM   4146 C  CB   . ILE A 1 268 ? 18.906  -10.463 7.844   1.00 28.26  ?  381  ILE A CB   1 
ATOM   4147 C  CG1  . ILE A 1 268 ? 19.138  -11.916 8.267   1.00 31.39  ?  381  ILE A CG1  1 
ATOM   4148 C  CG2  . ILE A 1 268 ? 19.872  -9.515  8.552   1.00 28.11  ?  381  ILE A CG2  1 
ATOM   4149 C  CD1  . ILE A 1 268 ? 20.549  -12.431 8.012   1.00 31.64  ?  381  ILE A CD1  1 
ATOM   4150 H  H    . ILE A 1 268 ? 16.419  -10.739 6.605   1.00 35.83  ?  381  ILE A H    1 
ATOM   4151 H  HA   . ILE A 1 268 ? 17.288  -10.134 9.090   1.00 36.15  ?  381  ILE A HA   1 
ATOM   4152 H  HB   . ILE A 1 268 ? 19.067  -10.403 6.890   1.00 33.90  ?  381  ILE A HB   1 
ATOM   4153 H  HG12 . ILE A 1 268 ? 18.967  -11.992 9.219   1.00 37.66  ?  381  ILE A HG12 1 
ATOM   4154 H  HG13 . ILE A 1 268 ? 18.525  -12.483 7.774   1.00 37.66  ?  381  ILE A HG13 1 
ATOM   4155 H  HG21 . ILE A 1 268 ? 20.771  -9.874  8.486   1.00 33.72  ?  381  ILE A HG21 1 
ATOM   4156 H  HG22 . ILE A 1 268 ? 19.831  -8.646  8.125   1.00 33.72  ?  381  ILE A HG22 1 
ATOM   4157 H  HG23 . ILE A 1 268 ? 19.614  -9.439  9.484   1.00 33.72  ?  381  ILE A HG23 1 
ATOM   4158 H  HD11 . ILE A 1 268 ? 20.511  -13.386 7.844   1.00 37.95  ?  381  ILE A HD11 1 
ATOM   4159 H  HD12 . ILE A 1 268 ? 20.917  -11.974 7.239   1.00 37.95  ?  381  ILE A HD12 1 
ATOM   4160 H  HD13 . ILE A 1 268 ? 21.096  -12.254 8.793   1.00 37.95  ?  381  ILE A HD13 1 
ATOM   4161 N  N    . ILE A 1 269 ? 17.397  -8.280  6.479   1.00 28.83  ?  382  ILE A N    1 
ATOM   4162 C  CA   . ILE A 1 269 ? 17.367  -6.900  5.999   1.00 28.16  ?  382  ILE A CA   1 
ATOM   4163 C  C    . ILE A 1 269 ? 16.671  -6.869  4.648   1.00 30.09  ?  382  ILE A C    1 
ATOM   4164 O  O    . ILE A 1 269 ? 16.998  -7.657  3.756   1.00 27.55  ?  382  ILE A O    1 
ATOM   4165 C  CB   . ILE A 1 269 ? 18.775  -6.291  5.898   1.00 31.22  ?  382  ILE A CB   1 
ATOM   4166 C  CG1  . ILE A 1 269 ? 18.714  -4.933  5.198   1.00 29.97  ?  382  ILE A CG1  1 
ATOM   4167 C  CG2  . ILE A 1 269 ? 19.722  -7.258  5.166   1.00 31.02  ?  382  ILE A CG2  1 
ATOM   4168 C  CD1  . ILE A 1 269 ? 17.981  -3.878  5.996   1.00 28.28  ?  382  ILE A CD1  1 
ATOM   4169 H  H    . ILE A 1 269 ? 17.534  -8.860  5.860   1.00 34.59  ?  382  ILE A H    1 
ATOM   4170 H  HA   . ILE A 1 269 ? 16.850  -6.361  6.618   1.00 33.77  ?  382  ILE A HA   1 
ATOM   4171 H  HB   . ILE A 1 269 ? 19.122  -6.150  6.792   1.00 37.44  ?  382  ILE A HB   1 
ATOM   4172 H  HG12 . ILE A 1 269 ? 19.618  -4.618  5.048   1.00 35.95  ?  382  ILE A HG12 1 
ATOM   4173 H  HG13 . ILE A 1 269 ? 18.254  -5.038  4.351   1.00 35.95  ?  382  ILE A HG13 1 
ATOM   4174 H  HG21 . ILE A 1 269 ? 20.588  -6.833  5.062   1.00 37.21  ?  382  ILE A HG21 1 
ATOM   4175 H  HG22 . ILE A 1 269 ? 19.812  -8.069  5.690   1.00 37.21  ?  382  ILE A HG22 1 
ATOM   4176 H  HG23 . ILE A 1 269 ? 19.350  -7.467  4.295   1.00 37.21  ?  382  ILE A HG23 1 
ATOM   4177 H  HD11 . ILE A 1 269 ? 18.057  -3.027  5.538   1.00 33.92  ?  382  ILE A HD11 1 
ATOM   4178 H  HD12 . ILE A 1 269 ? 17.047  -4.131  6.071   1.00 33.92  ?  382  ILE A HD12 1 
ATOM   4179 H  HD13 . ILE A 1 269 ? 18.379  -3.816  6.878   1.00 33.92  ?  382  ILE A HD13 1 
ATOM   4180 N  N    . ASP A 1 270 ? 15.710  -5.960  4.506   1.00 29.24  ?  383  ASP A N    1 
ATOM   4181 C  CA   . ASP A 1 270 ? 14.985  -5.731  3.265   1.00 29.78  ?  383  ASP A CA   1 
ATOM   4182 C  C    . ASP A 1 270 ? 15.208  -4.290  2.839   1.00 32.13  ?  383  ASP A C    1 
ATOM   4183 O  O    . ASP A 1 270 ? 15.078  -3.370  3.655   1.00 30.88  ?  383  ASP A O    1 
ATOM   4184 C  CB   . ASP A 1 270 ? 13.491  -5.996  3.445   1.00 33.67  ?  383  ASP A CB   1 
ATOM   4185 C  CG   . ASP A 1 270 ? 13.158  -7.474  3.448   1.00 36.84  ?  383  ASP A CG   1 
ATOM   4186 O  OD1  . ASP A 1 270 ? 13.046  -8.054  2.349   1.00 37.13  ?  383  ASP A OD1  1 
ATOM   4187 O  OD2  . ASP A 1 270 ? 13.010  -8.050  4.555   1.00 37.63  ?  383  ASP A OD2  1 
ATOM   4188 H  H    . ASP A 1 270 ? 15.453  -5.445  5.144   1.00 35.07  ?  383  ASP A H    1 
ATOM   4189 H  HA   . ASP A 1 270 ? 15.318  -6.323  2.572   1.00 35.72  ?  383  ASP A HA   1 
ATOM   4190 H  HB2  . ASP A 1 270 ? 13.203  -5.621  4.291   1.00 40.38  ?  383  ASP A HB2  1 
ATOM   4191 H  HB3  . ASP A 1 270 ? 13.006  -5.580  2.715   1.00 40.38  ?  383  ASP A HB3  1 
ATOM   4192 N  N    . THR A 1 271 ? 15.571  -4.096  1.576   1.00 31.72  ?  384  THR A N    1 
ATOM   4193 C  CA   . THR A 1 271 ? 15.751  -2.767  1.013   1.00 30.49  ?  384  THR A CA   1 
ATOM   4194 C  C    . THR A 1 271 ? 15.050  -2.730  -0.336  1.00 34.63  ?  384  THR A C    1 
ATOM   4195 O  O    . THR A 1 271 ? 15.285  -3.603  -1.187  1.00 33.07  ?  384  THR A O    1 
ATOM   4196 C  CB   . THR A 1 271 ? 17.233  -2.408  0.832   1.00 31.43  ?  384  THR A CB   1 
ATOM   4197 O  OG1  . THR A 1 271 ? 17.895  -2.402  2.102   1.00 33.03  ?  384  THR A OG1  1 
ATOM   4198 C  CG2  . THR A 1 271 ? 17.369  -1.029  0.199   1.00 30.81  ?  384  THR A CG2  1 
ATOM   4199 H  H    . THR A 1 271 ? 15.720  -4.733  1.017   1.00 38.04  ?  384  THR A H    1 
ATOM   4200 H  HA   . THR A 1 271 ? 15.358  -2.110  1.609   1.00 36.57  ?  384  THR A HA   1 
ATOM   4201 H  HB   . THR A 1 271 ? 17.652  -3.064  0.253   1.00 37.70  ?  384  THR A HB   1 
ATOM   4202 H  HG1  . THR A 1 271 ? 17.840  -3.161  2.458   1.00 39.62  ?  384  THR A HG1  1 
ATOM   4203 H  HG21 . THR A 1 271 ? 18.293  -0.735  0.239   1.00 36.96  ?  384  THR A HG21 1 
ATOM   4204 H  HG22 . THR A 1 271 ? 17.089  -1.060  -0.729  1.00 36.96  ?  384  THR A HG22 1 
ATOM   4205 H  HG23 . THR A 1 271 ? 16.815  -0.390  0.673   1.00 36.96  ?  384  THR A HG23 1 
ATOM   4206 N  N    . PHE A 1 272 ? 14.192  -1.728  -0.524  1.00 31.20  ?  385  PHE A N    1 
ATOM   4207 C  CA   . PHE A 1 272 ? 13.483  -1.514  -1.777  1.00 33.84  ?  385  PHE A CA   1 
ATOM   4208 C  C    . PHE A 1 272 ? 13.838  -0.127  -2.295  1.00 33.74  ?  385  PHE A C    1 
ATOM   4209 O  O    . PHE A 1 272 ? 13.837  0.852   -1.536  1.00 34.63  ?  385  PHE A O    1 
ATOM   4210 C  CB   . PHE A 1 272 ? 11.967  -1.675  -1.586  1.00 33.71  ?  385  PHE A CB   1 
ATOM   4211 C  CG   . PHE A 1 272 ? 11.534  -3.104  -1.353  1.00 34.05  ?  385  PHE A CG   1 
ATOM   4212 C  CD1  . PHE A 1 272 ? 11.702  -3.702  -0.120  1.00 33.17  ?  385  PHE A CD1  1 
ATOM   4213 C  CD2  . PHE A 1 272 ? 10.970  -3.847  -2.375  1.00 32.80  ?  385  PHE A CD2  1 
ATOM   4214 C  CE1  . PHE A 1 272 ? 11.319  -5.018  0.091   1.00 35.68  ?  385  PHE A CE1  1 
ATOM   4215 C  CE2  . PHE A 1 272 ? 10.591  -5.162  -2.173  1.00 33.83  ?  385  PHE A CE2  1 
ATOM   4216 C  CZ   . PHE A 1 272 ? 10.756  -5.749  -0.938  1.00 34.11  ?  385  PHE A CZ   1 
ATOM   4217 H  H    . PHE A 1 272 ? 14.003  -1.146  0.080   1.00 37.43  ?  385  PHE A H    1 
ATOM   4218 H  HA   . PHE A 1 272 ? 13.758  -2.164  -2.443  1.00 40.59  ?  385  PHE A HA   1 
ATOM   4219 H  HB2  . PHE A 1 272 ? 11.692  -1.153  -0.816  1.00 40.44  ?  385  PHE A HB2  1 
ATOM   4220 H  HB3  . PHE A 1 272 ? 11.516  -1.355  -2.382  1.00 40.44  ?  385  PHE A HB3  1 
ATOM   4221 H  HD1  . PHE A 1 272 ? 12.077  -3.215  0.578   1.00 39.79  ?  385  PHE A HD1  1 
ATOM   4222 H  HD2  . PHE A 1 272 ? 10.844  -3.457  -3.210  1.00 39.34  ?  385  PHE A HD2  1 
ATOM   4223 H  HE1  . PHE A 1 272 ? 11.441  -5.409  0.926   1.00 42.80  ?  385  PHE A HE1  1 
ATOM   4224 H  HE2  . PHE A 1 272 ? 10.224  -5.652  -2.873  1.00 40.58  ?  385  PHE A HE2  1 
ATOM   4225 H  HZ   . PHE A 1 272 ? 10.490  -6.629  -0.798  1.00 40.91  ?  385  PHE A HZ   1 
ATOM   4226 N  N    . VAL A 1 273 ? 14.178  -0.054  -3.573  1.00 34.34  ?  386  VAL A N    1 
ATOM   4227 C  CA   . VAL A 1 273 ? 14.561  1.194   -4.218  1.00 32.83  ?  386  VAL A CA   1 
ATOM   4228 C  C    . VAL A 1 273 ? 13.465  1.587   -5.193  1.00 34.38  ?  386  VAL A C    1 
ATOM   4229 O  O    . VAL A 1 273 ? 12.668  0.758   -5.650  1.00 34.71  ?  386  VAL A O    1 
ATOM   4230 C  CB   . VAL A 1 273 ? 15.922  1.069   -4.953  1.00 36.50  ?  386  VAL A CB   1 
ATOM   4231 C  CG1  . VAL A 1 273 ? 17.015  0.625   -3.987  1.00 32.60  ?  386  VAL A CG1  1 
ATOM   4232 C  CG2  . VAL A 1 273 ? 15.813  0.090   -6.125  1.00 34.91  ?  386  VAL A CG2  1 
ATOM   4233 H  H    . VAL A 1 273 ? 14.195  -0.732  -4.102  1.00 41.19  ?  386  VAL A H    1 
ATOM   4234 H  HA   . VAL A 1 273 ? 14.639  1.890   -3.546  1.00 39.38  ?  386  VAL A HA   1 
ATOM   4235 H  HB   . VAL A 1 273 ? 16.166  1.939   -5.307  1.00 43.78  ?  386  VAL A HB   1 
ATOM   4236 H  HG11 . VAL A 1 273 ? 17.862  0.598   -4.459  1.00 39.11  ?  386  VAL A HG11 1 
ATOM   4237 H  HG12 . VAL A 1 273 ? 17.065  1.258   -3.254  1.00 39.11  ?  386  VAL A HG12 1 
ATOM   4238 H  HG13 . VAL A 1 273 ? 16.798  -0.257  -3.648  1.00 39.11  ?  386  VAL A HG13 1 
ATOM   4239 H  HG21 . VAL A 1 273 ? 16.704  -0.120  -6.445  1.00 41.88  ?  386  VAL A HG21 1 
ATOM   4240 H  HG22 . VAL A 1 273 ? 15.372  -0.718  -5.821  1.00 41.88  ?  386  VAL A HG22 1 
ATOM   4241 H  HG23 . VAL A 1 273 ? 15.296  0.503   -6.834  1.00 41.88  ?  386  VAL A HG23 1 
ATOM   4242 N  N    . VAL A 1 274 ? 13.445  2.869   -5.529  1.00 34.94  ?  387  VAL A N    1 
ATOM   4243 C  CA   . VAL A 1 274 ? 12.512  3.418   -6.507  1.00 39.45  ?  387  VAL A CA   1 
ATOM   4244 C  C    . VAL A 1 274 ? 13.331  3.816   -7.733  1.00 39.97  ?  387  VAL A C    1 
ATOM   4245 O  O    . VAL A 1 274 ? 14.030  4.836   -7.735  1.00 37.09  ?  387  VAL A O    1 
ATOM   4246 C  CB   . VAL A 1 274 ? 11.726  4.610   -5.949  1.00 36.89  ?  387  VAL A CB   1 
ATOM   4247 C  CG1  . VAL A 1 274 ? 10.805  5.180   -7.024  1.00 39.20  ?  387  VAL A CG1  1 
ATOM   4248 C  CG2  . VAL A 1 274 ? 10.938  4.194   -4.721  1.00 37.95  ?  387  VAL A CG2  1 
ATOM   4249 H  H    . VAL A 1 274 ? 13.977  3.456   -5.195  1.00 41.91  ?  387  VAL A H    1 
ATOM   4250 H  HA   . VAL A 1 274 ? 11.883  2.727   -6.767  1.00 47.32  ?  387  VAL A HA   1 
ATOM   4251 H  HB   . VAL A 1 274 ? 12.345  5.307   -5.682  1.00 44.26  ?  387  VAL A HB   1 
ATOM   4252 H  HG11 . VAL A 1 274 ? 10.176  5.791   -6.609  1.00 47.02  ?  387  VAL A HG11 1 
ATOM   4253 H  HG12 . VAL A 1 274 ? 11.340  5.651   -7.681  1.00 47.02  ?  387  VAL A HG12 1 
ATOM   4254 H  HG13 . VAL A 1 274 ? 10.326  4.451   -7.448  1.00 47.02  ?  387  VAL A HG13 1 
ATOM   4255 H  HG21 . VAL A 1 274 ? 10.478  4.970   -4.363  1.00 45.52  ?  387  VAL A HG21 1 
ATOM   4256 H  HG22 . VAL A 1 274 ? 10.293  3.516   -4.975  1.00 45.52  ?  387  VAL A HG22 1 
ATOM   4257 H  HG23 . VAL A 1 274 ? 11.550  3.838   -4.059  1.00 45.52  ?  387  VAL A HG23 1 
ATOM   4258 N  N    . GLU A 1 275 ? 13.240  3.012   -8.784  1.00 43.45  ?  388  GLU A N    1 
ATOM   4259 C  CA   . GLU A 1 275 ? 13.904  3.303   -10.046 1.00 46.14  ?  388  GLU A CA   1 
ATOM   4260 C  C    . GLU A 1 275 ? 12.959  4.124   -10.916 1.00 48.06  ?  388  GLU A C    1 
ATOM   4261 O  O    . GLU A 1 275 ? 11.873  3.651   -11.278 1.00 49.68  ?  388  GLU A O    1 
ATOM   4262 C  CB   . GLU A 1 275 ? 14.308  2.009   -10.754 1.00 46.30  ?  388  GLU A CB   1 
ATOM   4263 C  CG   . GLU A 1 275 ? 14.869  2.223   -12.153 1.00 49.58  ?  388  GLU A CG   1 
ATOM   4264 C  CD   . GLU A 1 275 ? 15.259  0.924   -12.830 1.00 52.71  ?  388  GLU A CD   1 
ATOM   4265 O  OE1  . GLU A 1 275 ? 15.323  -0.116  -12.140 1.00 52.47  ?  388  GLU A OE1  1 
ATOM   4266 O  OE2  . GLU A 1 275 ? 15.503  0.939   -14.052 1.00 56.12  ?  388  GLU A OE2  1 
ATOM   4267 H  H    . GLU A 1 275 ? 12.791  2.279   -8.790  1.00 52.13  ?  388  GLU A H    1 
ATOM   4268 H  HA   . GLU A 1 275 ? 14.708  3.820   -9.884  1.00 55.35  ?  388  GLU A HA   1 
ATOM   4269 H  HB2  . GLU A 1 275 ? 14.991  1.566   -10.227 1.00 55.55  ?  388  GLU A HB2  1 
ATOM   4270 H  HB3  . GLU A 1 275 ? 13.527  1.439   -10.833 1.00 55.55  ?  388  GLU A HB3  1 
ATOM   4271 H  HG2  . GLU A 1 275 ? 14.196  2.657   -12.701 1.00 59.48  ?  388  GLU A HG2  1 
ATOM   4272 H  HG3  . GLU A 1 275 ? 15.660  2.781   -12.095 1.00 59.48  ?  388  GLU A HG3  1 
ATOM   4273 N  N    . SER A 1 276 ? 13.365  5.349   -11.238 1.00 48.48  ?  389  SER A N    1 
ATOM   4274 C  CA   . SER A 1 276 ? 12.576  6.212   -12.098 1.00 50.92  ?  389  SER A CA   1 
ATOM   4275 C  C    . SER A 1 276 ? 12.595  5.666   -13.522 1.00 52.42  ?  389  SER A C    1 
ATOM   4276 O  O    . SER A 1 276 ? 13.391  4.781   -13.854 1.00 51.49  ?  389  SER A O    1 
ATOM   4277 C  CB   . SER A 1 276 ? 13.107  7.641   -12.054 1.00 50.41  ?  389  SER A CB   1 
ATOM   4278 O  OG   . SER A 1 276 ? 14.464  7.698   -12.466 1.00 55.44  ?  389  SER A OG   1 
ATOM   4279 H  H    . SER A 1 276 ? 14.100  5.704   -10.967 1.00 58.16  ?  389  SER A H    1 
ATOM   4280 H  HA   . SER A 1 276 ? 11.657  6.230   -11.788 1.00 61.08  ?  389  SER A HA   1 
ATOM   4281 H  HB2  . SER A 1 276 ? 12.575  8.193   -12.649 1.00 60.48  ?  389  SER A HB2  1 
ATOM   4282 H  HB3  . SER A 1 276 ? 13.041  7.973   -11.145 1.00 60.48  ?  389  SER A HB3  1 
ATOM   4283 H  HG   . SER A 1 276 ? 14.940  7.233   -11.954 1.00 66.51  ?  389  SER A HG   1 
ATOM   4284 N  N    . PRO A 1 277 ? 11.721  6.178   -14.391 1.00 54.48  ?  390  PRO A N    1 
ATOM   4285 C  CA   . PRO A 1 277 ? 11.616  5.597   -15.742 1.00 56.69  ?  390  PRO A CA   1 
ATOM   4286 C  C    . PRO A 1 277 ? 12.934  5.547   -16.497 1.00 56.02  ?  390  PRO A C    1 
ATOM   4287 O  O    . PRO A 1 277 ? 13.218  4.543   -17.161 1.00 60.83  ?  390  PRO A O    1 
ATOM   4288 C  CB   . PRO A 1 277 ? 10.600  6.517   -16.435 1.00 59.46  ?  390  PRO A CB   1 
ATOM   4289 C  CG   . PRO A 1 277 ? 9.790   7.103   -15.314 1.00 58.18  ?  390  PRO A CG   1 
ATOM   4290 C  CD   . PRO A 1 277 ? 10.755  7.270   -14.174 1.00 55.99  ?  390  PRO A CD   1 
ATOM   4291 H  HA   . PRO A 1 277 ? 11.252  4.700   -15.679 1.00 68.01  ?  390  PRO A HA   1 
ATOM   4292 H  HB2  . PRO A 1 277 ? 11.064  7.211   -16.928 1.00 71.34  ?  390  PRO A HB2  1 
ATOM   4293 H  HB3  . PRO A 1 277 ? 10.041  6.000   -17.036 1.00 71.34  ?  390  PRO A HB3  1 
ATOM   4294 H  HG2  . PRO A 1 277 ? 9.423   7.959   -15.585 1.00 69.80  ?  390  PRO A HG2  1 
ATOM   4295 H  HG3  . PRO A 1 277 ? 9.072   6.496   -15.074 1.00 69.80  ?  390  PRO A HG3  1 
ATOM   4296 H  HD2  . PRO A 1 277 ? 11.194  8.134   -14.216 1.00 67.17  ?  390  PRO A HD2  1 
ATOM   4297 H  HD3  . PRO A 1 277 ? 10.304  7.167   -13.321 1.00 67.17  ?  390  PRO A HD3  1 
ATOM   4298 N  N    . ASN A 1 278 ? 13.753  6.596   -16.415 1.00 55.11  ?  391  ASN A N    1 
ATOM   4299 C  CA   . ASN A 1 278 ? 15.001  6.611   -17.167 1.00 55.11  ?  391  ASN A CA   1 
ATOM   4300 C  C    . ASN A 1 278 ? 16.033  5.651   -16.593 1.00 53.68  ?  391  ASN A C    1 
ATOM   4301 O  O    . ASN A 1 278 ? 16.947  5.246   -17.315 1.00 58.15  ?  391  ASN A O    1 
ATOM   4302 C  CB   . ASN A 1 278 ? 15.581  8.028   -17.223 1.00 53.38  ?  391  ASN A CB   1 
ATOM   4303 C  CG   . ASN A 1 278 ? 15.967  8.564   -15.859 1.00 55.10  ?  391  ASN A CG   1 
ATOM   4304 O  OD1  . ASN A 1 278 ? 16.009  7.825   -14.876 1.00 58.99  ?  391  ASN A OD1  1 
ATOM   4305 N  ND2  . ASN A 1 278 ? 16.256  9.852   -15.794 1.00 55.86  ?  391  ASN A ND2  1 
ATOM   4306 H  H    . ASN A 1 278 ? 13.611  7.299   -15.939 1.00 66.11  ?  391  ASN A H    1 
ATOM   4307 H  HA   . ASN A 1 278 ? 14.810  6.337   -18.078 1.00 66.12  ?  391  ASN A HA   1 
ATOM   4308 H  HB2  . ASN A 1 278 ? 16.377  8.022   -17.778 1.00 64.04  ?  391  ASN A HB2  1 
ATOM   4309 H  HB3  . ASN A 1 278 ? 14.918  8.626   -17.602 1.00 64.04  ?  391  ASN A HB3  1 
ATOM   4310 H  HD21 . ASN A 1 278 ? 16.481  10.204  -15.042 1.00 67.02  ?  391  ASN A HD21 1 
ATOM   4311 H  HD22 . ASN A 1 278 ? 16.218  10.338  -16.502 1.00 67.02  ?  391  ASN A HD22 1 
ATOM   4312 N  N    . GLY A 1 279 ? 15.917  5.287   -15.321 1.00 51.32  ?  392  GLY A N    1 
ATOM   4313 C  CA   . GLY A 1 279 ? 16.814  4.316   -14.731 1.00 47.63  ?  392  GLY A CA   1 
ATOM   4314 C  C    . GLY A 1 279 ? 17.476  4.784   -13.450 1.00 49.18  ?  392  GLY A C    1 
ATOM   4315 O  O    . GLY A 1 279 ? 18.129  3.992   -12.760 1.00 48.47  ?  392  GLY A O    1 
ATOM   4316 H  H    . GLY A 1 279 ? 15.323  5.592   -14.779 1.00 61.56  ?  392  GLY A H    1 
ATOM   4317 H  HA2  . GLY A 1 279 ? 16.316  3.509   -14.531 1.00 57.14  ?  392  GLY A HA2  1 
ATOM   4318 H  HA3  . GLY A 1 279 ? 17.514  4.106   -15.369 1.00 57.14  ?  392  GLY A HA3  1 
ATOM   4319 N  N    . LYS A 1 280 ? 17.325  6.063   -13.121 1.00 47.48  ?  393  LYS A N    1 
ATOM   4320 C  CA   . LYS A 1 280 ? 17.952  6.608   -11.927 1.00 50.07  ?  393  LYS A CA   1 
ATOM   4321 C  C    . LYS A 1 280 ? 17.143  6.237   -10.690 1.00 50.24  ?  393  LYS A C    1 
ATOM   4322 O  O    . LYS A 1 280 ? 15.906  6.194   -10.720 1.00 47.63  ?  393  LYS A O    1 
ATOM   4323 C  CB   . LYS A 1 280 ? 18.074  8.129   -12.026 1.00 57.52  ?  393  LYS A CB   1 
ATOM   4324 C  CG   . LYS A 1 280 ? 18.892  8.749   -10.897 1.00 63.55  ?  393  LYS A CG   1 
ATOM   4325 C  CD   . LYS A 1 280 ? 18.734  10.261  -10.838 1.00 70.05  ?  393  LYS A CD   1 
ATOM   4326 C  CE   . LYS A 1 280 ? 17.351  10.655  -10.339 1.00 73.77  ?  393  LYS A CE   1 
ATOM   4327 N  NZ   . LYS A 1 280 ? 17.217  12.127  -10.159 1.00 79.39  ?  393  LYS A NZ   1 
ATOM   4328 H  H    . LYS A 1 280 ? 16.865  6.632   -13.572 1.00 56.96  ?  393  LYS A H    1 
ATOM   4329 H  HA   . LYS A 1 280 ? 18.845  6.239   -11.839 1.00 60.06  ?  393  LYS A HA   1 
ATOM   4330 H  HB2  . LYS A 1 280 ? 18.506  8.354   -12.864 1.00 69.01  ?  393  LYS A HB2  1 
ATOM   4331 H  HB3  . LYS A 1 280 ? 17.185  8.516   -11.996 1.00 69.01  ?  393  LYS A HB3  1 
ATOM   4332 H  HG2  . LYS A 1 280 ? 18.596  8.381   -10.050 1.00 76.24  ?  393  LYS A HG2  1 
ATOM   4333 H  HG3  . LYS A 1 280 ? 19.831  8.549   -11.037 1.00 76.24  ?  393  LYS A HG3  1 
ATOM   4334 H  HD2  . LYS A 1 280 ? 19.394  10.630  -10.230 1.00 84.05  ?  393  LYS A HD2  1 
ATOM   4335 H  HD3  . LYS A 1 280 ? 18.856  10.633  -11.726 1.00 84.05  ?  393  LYS A HD3  1 
ATOM   4336 H  HE2  . LYS A 1 280 ? 16.686  10.368  -10.984 1.00 88.51  ?  393  LYS A HE2  1 
ATOM   4337 H  HE3  . LYS A 1 280 ? 17.188  10.230  -9.483  1.00 88.51  ?  393  LYS A HE3  1 
ATOM   4338 H  HZ1  . LYS A 1 280 ? 16.400  12.325  -9.867  1.00 95.26  ?  393  LYS A HZ1  1 
ATOM   4339 H  HZ2  . LYS A 1 280 ? 17.814  12.416  -9.565  1.00 95.26  ?  393  LYS A HZ2  1 
ATOM   4340 H  HZ3  . LYS A 1 280 ? 17.356  12.542  -10.934 1.00 95.26  ?  393  LYS A HZ3  1 
ATOM   4341 N  N    . LEU A 1 281 ? 17.850  5.963   -9.599  1.00 46.93  ?  394  LEU A N    1 
ATOM   4342 C  CA   . LEU A 1 281 ? 17.208  5.731   -8.314  1.00 42.31  ?  394  LEU A CA   1 
ATOM   4343 C  C    . LEU A 1 281 ? 16.887  7.071   -7.664  1.00 41.62  ?  394  LEU A C    1 
ATOM   4344 O  O    . LEU A 1 281 ? 17.744  7.957   -7.586  1.00 40.47  ?  394  LEU A O    1 
ATOM   4345 C  CB   . LEU A 1 281 ? 18.113  4.900   -7.414  1.00 41.24  ?  394  LEU A CB   1 
ATOM   4346 C  CG   . LEU A 1 281 ? 17.975  3.376   -7.527  1.00 43.00  ?  394  LEU A CG   1 
ATOM   4347 C  CD1  . LEU A 1 281 ? 17.804  2.929   -8.963  1.00 45.05  ?  394  LEU A CD1  1 
ATOM   4348 C  CD2  . LEU A 1 281 ? 19.185  2.688   -6.894  1.00 38.37  ?  394  LEU A CD2  1 
ATOM   4349 H  H    . LEU A 1 281 ? 18.708  5.906   -9.578  1.00 56.30  ?  394  LEU A H    1 
ATOM   4350 H  HA   . LEU A 1 281 ? 16.381  5.239   -8.437  1.00 50.76  ?  394  LEU A HA   1 
ATOM   4351 H  HB2  . LEU A 1 281 ? 19.033  5.120   -7.627  1.00 49.47  ?  394  LEU A HB2  1 
ATOM   4352 H  HB3  . LEU A 1 281 ? 17.920  5.136   -6.493  1.00 49.47  ?  394  LEU A HB3  1 
ATOM   4353 H  HG   . LEU A 1 281 ? 17.175  3.108   -7.049  1.00 51.59  ?  394  LEU A HG   1 
ATOM   4354 H  HD11 . LEU A 1 281 ? 17.906  1.965   -9.008  1.00 54.04  ?  394  LEU A HD11 1 
ATOM   4355 H  HD12 . LEU A 1 281 ? 16.919  3.182   -9.269  1.00 54.04  ?  394  LEU A HD12 1 
ATOM   4356 H  HD13 . LEU A 1 281 ? 18.479  3.359   -9.511  1.00 54.04  ?  394  LEU A HD13 1 
ATOM   4357 H  HD21 . LEU A 1 281 ? 19.063  1.727   -6.942  1.00 46.02  ?  394  LEU A HD21 1 
ATOM   4358 H  HD22 . LEU A 1 281 ? 19.984  2.945   -7.380  1.00 46.02  ?  394  LEU A HD22 1 
ATOM   4359 H  HD23 . LEU A 1 281 ? 19.257  2.966   -5.968  1.00 46.02  ?  394  LEU A HD23 1 
ATOM   4360 N  N    . THR A 1 282 ? 15.643  7.224   -7.200  1.00 40.30  ?  395  THR A N    1 
ATOM   4361 C  CA   . THR A 1 282 ? 15.230  8.464   -6.557  1.00 41.52  ?  395  THR A CA   1 
ATOM   4362 C  C    . THR A 1 282 ? 14.882  8.304   -5.084  1.00 39.70  ?  395  THR A C    1 
ATOM   4363 O  O    . THR A 1 282 ? 14.921  9.298   -4.349  1.00 35.66  ?  395  THR A O    1 
ATOM   4364 C  CB   . THR A 1 282 ? 14.019  9.070   -7.288  1.00 41.83  ?  395  THR A CB   1 
ATOM   4365 O  OG1  . THR A 1 282 ? 12.917  8.161   -7.253  1.00 40.10  ?  395  THR A OG1  1 
ATOM   4366 C  CG2  . THR A 1 282 ? 14.372  9.379   -8.740  1.00 43.22  ?  395  THR A CG2  1 
ATOM   4367 H  H    . THR A 1 282 ? 15.028  6.625   -7.247  1.00 48.35  ?  395  THR A H    1 
ATOM   4368 H  HA   . THR A 1 282 ? 15.959  9.100   -6.619  1.00 49.80  ?  395  THR A HA   1 
ATOM   4369 H  HB   . THR A 1 282 ? 13.764  9.895   -6.847  1.00 50.18  ?  395  THR A HB   1 
ATOM   4370 H  HG1  . THR A 1 282 ? 12.680  8.026   -6.459  1.00 48.11  ?  395  THR A HG1  1 
ATOM   4371 H  HG21 . THR A 1 282 ? 13.582  9.680   -9.217  1.00 51.84  ?  395  THR A HG21 1 
ATOM   4372 H  HG22 . THR A 1 282 ? 15.047  10.075  -8.777  1.00 51.84  ?  395  THR A HG22 1 
ATOM   4373 H  HG23 . THR A 1 282 ? 14.717  8.583   -9.175  1.00 51.84  ?  395  THR A HG23 1 
ATOM   4374 N  N    . ASP A 1 283 ? 14.552  7.090   -4.637  1.00 36.00  ?  396  ASP A N    1 
ATOM   4375 C  CA   . ASP A 1 283 ? 14.176  6.858   -3.250  1.00 37.66  ?  396  ASP A CA   1 
ATOM   4376 C  C    . ASP A 1 283 ? 14.523  5.425   -2.885  1.00 36.25  ?  396  ASP A C    1 
ATOM   4377 O  O    . ASP A 1 283 ? 14.745  4.578   -3.756  1.00 33.90  ?  396  ASP A O    1 
ATOM   4378 C  CB   . ASP A 1 283 ? 12.673  7.083   -3.006  1.00 37.66  ?  396  ASP A CB   1 
ATOM   4379 C  CG   . ASP A 1 283 ? 12.136  8.322   -3.709  1.00 41.04  ?  396  ASP A CG   1 
ATOM   4380 O  OD1  . ASP A 1 283 ? 12.208  9.428   -3.125  1.00 39.95  ?  396  ASP A OD1  1 
ATOM   4381 O  OD2  . ASP A 1 283 ? 11.652  8.183   -4.854  1.00 38.83  ?  396  ASP A OD2  1 
ATOM   4382 H  H    . ASP A 1 283 ? 14.539  6.382   -5.125  1.00 43.19  ?  396  ASP A H    1 
ATOM   4383 H  HA   . ASP A 1 283 ? 14.678  7.471   -2.691  1.00 45.17  ?  396  ASP A HA   1 
ATOM   4384 H  HB2  . ASP A 1 283 ? 12.181  6.315   -3.336  1.00 45.18  ?  396  ASP A HB2  1 
ATOM   4385 H  HB3  . ASP A 1 283 ? 12.521  7.190   -2.054  1.00 45.18  ?  396  ASP A HB3  1 
ATOM   4386 N  N    . PHE A 1 284 ? 14.546  5.150   -1.584  1.00 32.19  ?  397  PHE A N    1 
ATOM   4387 C  CA   . PHE A 1 284 ? 14.551  3.764   -1.141  1.00 33.10  ?  397  PHE A CA   1 
ATOM   4388 C  C    . PHE A 1 284 ? 14.080  3.689   0.308   1.00 30.73  ?  397  PHE A C    1 
ATOM   4389 O  O    . PHE A 1 284 ? 14.176  4.655   1.071   1.00 30.85  ?  397  PHE A O    1 
ATOM   4390 C  CB   . PHE A 1 284 ? 15.943  3.106   -1.321  1.00 33.14  ?  397  PHE A CB   1 
ATOM   4391 C  CG   . PHE A 1 284 ? 16.997  3.578   -0.355  1.00 29.38  ?  397  PHE A CG   1 
ATOM   4392 C  CD1  . PHE A 1 284 ? 17.158  2.964   0.876   1.00 32.07  ?  397  PHE A CD1  1 
ATOM   4393 C  CD2  . PHE A 1 284 ? 17.853  4.597   -0.693  1.00 32.15  ?  397  PHE A CD2  1 
ATOM   4394 C  CE1  . PHE A 1 284 ? 18.144  3.380   1.753   1.00 30.64  ?  397  PHE A CE1  1 
ATOM   4395 C  CE2  . PHE A 1 284 ? 18.840  5.022   0.182   1.00 32.13  ?  397  PHE A CE2  1 
ATOM   4396 C  CZ   . PHE A 1 284 ? 18.984  4.413   1.400   1.00 29.79  ?  397  PHE A CZ   1 
ATOM   4397 H  H    . PHE A 1 284 ? 14.558  5.736   -0.954  1.00 38.62  ?  397  PHE A H    1 
ATOM   4398 H  HA   . PHE A 1 284 ? 13.918  3.258   -1.674  1.00 39.71  ?  397  PHE A HA   1 
ATOM   4399 H  HB2  . PHE A 1 284 ? 15.847  2.148   -1.202  1.00 39.75  ?  397  PHE A HB2  1 
ATOM   4400 H  HB3  . PHE A 1 284 ? 16.260  3.299   -2.217  1.00 39.75  ?  397  PHE A HB3  1 
ATOM   4401 H  HD1  . PHE A 1 284 ? 16.596  2.263   1.116   1.00 38.47  ?  397  PHE A HD1  1 
ATOM   4402 H  HD2  . PHE A 1 284 ? 17.769  5.009   -1.522  1.00 38.56  ?  397  PHE A HD2  1 
ATOM   4403 H  HE1  . PHE A 1 284 ? 18.239  2.964   2.579   1.00 36.75  ?  397  PHE A HE1  1 
ATOM   4404 H  HE2  . PHE A 1 284 ? 19.405  5.720   -0.058  1.00 38.54  ?  397  PHE A HE2  1 
ATOM   4405 H  HZ   . PHE A 1 284 ? 19.648  4.695   1.988   1.00 35.73  ?  397  PHE A HZ   1 
ATOM   4406 N  N    . LEU A 1 285 ? 13.533  2.539   0.654   1.00 32.61  ?  398  LEU A N    1 
ATOM   4407 C  CA   . LEU A 1 285 ? 13.094  2.226   2.005   1.00 31.88  ?  398  LEU A CA   1 
ATOM   4408 C  C    . LEU A 1 285 ? 13.802  0.954   2.455   1.00 31.88  ?  398  LEU A C    1 
ATOM   4409 O  O    . LEU A 1 285 ? 14.209  0.125   1.631   1.00 30.01  ?  398  LEU A O    1 
ATOM   4410 C  CB   . LEU A 1 285 ? 11.573  2.033   2.063   1.00 31.10  ?  398  LEU A CB   1 
ATOM   4411 C  CG   . LEU A 1 285 ? 10.981  0.887   1.258   1.00 32.76  ?  398  LEU A CG   1 
ATOM   4412 C  CD1  . LEU A 1 285 ? 10.948  -0.401  2.085   1.00 29.80  ?  398  LEU A CD1  1 
ATOM   4413 C  CD2  . LEU A 1 285 ? 9.593   1.241   0.733   1.00 35.17  ?  398  LEU A CD2  1 
ATOM   4414 H  H    . LEU A 1 285 ? 13.399  1.895   0.100   1.00 39.11  ?  398  LEU A H    1 
ATOM   4415 H  HA   . LEU A 1 285 ? 13.320  2.947   2.614   1.00 38.24  ?  398  LEU A HA   1 
ATOM   4416 H  HB2  . LEU A 1 285 ? 11.329  1.881   2.990   1.00 37.30  ?  398  LEU A HB2  1 
ATOM   4417 H  HB3  . LEU A 1 285 ? 11.158  2.848   1.740   1.00 37.30  ?  398  LEU A HB3  1 
ATOM   4418 H  HG   . LEU A 1 285 ? 11.548  0.727   0.487   1.00 39.30  ?  398  LEU A HG   1 
ATOM   4419 H  HD11 . LEU A 1 285 ? 10.345  -1.032  1.662   1.00 35.74  ?  398  LEU A HD11 1 
ATOM   4420 H  HD12 . LEU A 1 285 ? 11.843  -0.774  2.124   1.00 35.74  ?  398  LEU A HD12 1 
ATOM   4421 H  HD13 . LEU A 1 285 ? 10.636  -0.194  2.979   1.00 35.74  ?  398  LEU A HD13 1 
ATOM   4422 H  HD21 . LEU A 1 285 ? 9.243   0.487   0.234   1.00 42.19  ?  398  LEU A HD21 1 
ATOM   4423 H  HD22 . LEU A 1 285 ? 9.012   1.439   1.484   1.00 42.19  ?  398  LEU A HD22 1 
ATOM   4424 H  HD23 . LEU A 1 285 ? 9.663   2.017   0.154   1.00 42.19  ?  398  LEU A HD23 1 
ATOM   4425 N  N    . SER A 1 286 ? 13.961  0.808   3.764   1.00 28.55  ?  399  SER A N    1 
ATOM   4426 C  CA   . SER A 1 286 ? 14.592  -0.382  4.304   1.00 28.08  ?  399  SER A CA   1 
ATOM   4427 C  C    . SER A 1 286 ? 14.067  -0.644  5.710   1.00 29.93  ?  399  SER A C    1 
ATOM   4428 O  O    . SER A 1 286 ? 13.698  0.284   6.446   1.00 29.94  ?  399  SER A O    1 
ATOM   4429 C  CB   . SER A 1 286 ? 16.123  -0.244  4.320   1.00 28.56  ?  399  SER A CB   1 
ATOM   4430 O  OG   . SER A 1 286 ? 16.548  0.906   5.027   1.00 32.38  ?  399  SER A OG   1 
ATOM   4431 H  H    . SER A 1 286 ? 13.713  1.383   4.354   1.00 34.25  ?  399  SER A H    1 
ATOM   4432 H  HA   . SER A 1 286 ? 14.358  -1.147  3.756   1.00 33.69  ?  399  SER A HA   1 
ATOM   4433 H  HB2  . SER A 1 286 ? 16.502  -1.028  4.747   1.00 34.26  ?  399  SER A HB2  1 
ATOM   4434 H  HB3  . SER A 1 286 ? 16.439  -0.179  3.405   1.00 34.26  ?  399  SER A HB3  1 
ATOM   4435 H  HG   . SER A 1 286 ? 16.232  1.597   4.669   1.00 38.84  ?  399  SER A HG   1 
ATOM   4436 N  N    . PHE A 1 287 ? 14.010  -1.927  6.057   1.00 27.63  ?  400  PHE A N    1 
ATOM   4437 C  CA   . PHE A 1 287 ? 13.639  -2.350  7.397   1.00 28.97  ?  400  PHE A CA   1 
ATOM   4438 C  C    . PHE A 1 287 ? 14.289  -3.703  7.649   1.00 29.38  ?  400  PHE A C    1 
ATOM   4439 O  O    . PHE A 1 287 ? 14.466  -4.509  6.725   1.00 29.05  ?  400  PHE A O    1 
ATOM   4440 C  CB   . PHE A 1 287 ? 12.113  -2.429  7.584   1.00 28.19  ?  400  PHE A CB   1 
ATOM   4441 C  CG   . PHE A 1 287 ? 11.407  -3.278  6.567   1.00 28.46  ?  400  PHE A CG   1 
ATOM   4442 C  CD1  . PHE A 1 287 ? 11.271  -4.643  6.752   1.00 30.63  ?  400  PHE A CD1  1 
ATOM   4443 C  CD2  . PHE A 1 287 ? 10.853  -2.706  5.432   1.00 30.22  ?  400  PHE A CD2  1 
ATOM   4444 C  CE1  . PHE A 1 287 ? 10.615  -5.424  5.820   1.00 30.71  ?  400  PHE A CE1  1 
ATOM   4445 C  CE2  . PHE A 1 287 ? 10.195  -3.488  4.492   1.00 31.28  ?  400  PHE A CE2  1 
ATOM   4446 C  CZ   . PHE A 1 287 ? 10.082  -4.845  4.686   1.00 30.72  ?  400  PHE A CZ   1 
ATOM   4447 H  H    . PHE A 1 287 ? 14.184  -2.579  5.524   1.00 33.15  ?  400  PHE A H    1 
ATOM   4448 H  HA   . PHE A 1 287 ? 13.968  -1.714  8.052   1.00 34.75  ?  400  PHE A HA   1 
ATOM   4449 H  HB2  . PHE A 1 287 ? 11.928  -2.805  8.459   1.00 33.81  ?  400  PHE A HB2  1 
ATOM   4450 H  HB3  . PHE A 1 287 ? 11.747  -1.533  7.524   1.00 33.81  ?  400  PHE A HB3  1 
ATOM   4451 H  HD1  . PHE A 1 287 ? 11.626  -5.040  7.514   1.00 36.74  ?  400  PHE A HD1  1 
ATOM   4452 H  HD2  . PHE A 1 287 ? 10.922  -1.788  5.300   1.00 36.24  ?  400  PHE A HD2  1 
ATOM   4453 H  HE1  . PHE A 1 287 ? 10.533  -6.340  5.957   1.00 36.83  ?  400  PHE A HE1  1 
ATOM   4454 H  HE2  . PHE A 1 287 ? 9.832   -3.094  3.731   1.00 37.52  ?  400  PHE A HE2  1 
ATOM   4455 H  HZ   . PHE A 1 287 ? 9.646   -5.372  4.055   1.00 36.85  ?  400  PHE A HZ   1 
ATOM   4456 N  N    . TYR A 1 288 ? 14.650  -3.943  8.905   1.00 29.31  ?  401  TYR A N    1 
ATOM   4457 C  CA   . TYR A 1 288 ? 15.309  -5.187  9.278   1.00 27.75  ?  401  TYR A CA   1 
ATOM   4458 C  C    . TYR A 1 288 ? 14.402  -6.035  10.171  1.00 28.93  ?  401  TYR A C    1 
ATOM   4459 O  O    . TYR A 1 288 ? 13.432  -5.552  10.782  1.00 29.60  ?  401  TYR A O    1 
ATOM   4460 C  CB   . TYR A 1 288 ? 16.668  -4.933  9.957   1.00 25.06  ?  401  TYR A CB   1 
ATOM   4461 C  CG   . TYR A 1 288 ? 16.651  -4.070  11.200  1.00 26.71  ?  401  TYR A CG   1 
ATOM   4462 C  CD1  . TYR A 1 288 ? 16.361  -4.616  12.450  1.00 29.00  ?  401  TYR A CD1  1 
ATOM   4463 C  CD2  . TYR A 1 288 ? 16.948  -2.727  11.134  1.00 28.78  ?  401  TYR A CD2  1 
ATOM   4464 C  CE1  . TYR A 1 288 ? 16.354  -3.826  13.591  1.00 29.11  ?  401  TYR A CE1  1 
ATOM   4465 C  CE2  . TYR A 1 288 ? 16.937  -1.932  12.262  1.00 31.67  ?  401  TYR A CE2  1 
ATOM   4466 C  CZ   . TYR A 1 288 ? 16.641  -2.482  13.480  1.00 30.47  ?  401  TYR A CZ   1 
ATOM   4467 O  OH   . TYR A 1 288 ? 16.640  -1.673  14.598  1.00 33.91  ?  401  TYR A OH   1 
ATOM   4468 H  H    . TYR A 1 288 ? 14.523  -3.398  9.558   1.00 35.16  ?  401  TYR A H    1 
ATOM   4469 H  HA   . TYR A 1 288 ? 15.483  -5.699  8.473   1.00 33.28  ?  401  TYR A HA   1 
ATOM   4470 H  HB2  . TYR A 1 288 ? 17.043  -5.791  10.211  1.00 30.06  ?  401  TYR A HB2  1 
ATOM   4471 H  HB3  . TYR A 1 288 ? 17.248  -4.495  9.314   1.00 30.06  ?  401  TYR A HB3  1 
ATOM   4472 H  HD1  . TYR A 1 288 ? 16.170  -5.523  12.520  1.00 34.79  ?  401  TYR A HD1  1 
ATOM   4473 H  HD2  . TYR A 1 288 ? 17.160  -2.348  10.312  1.00 34.52  ?  401  TYR A HD2  1 
ATOM   4474 H  HE1  . TYR A 1 288 ? 16.157  -4.198  14.420  1.00 34.91  ?  401  TYR A HE1  1 
ATOM   4475 H  HE2  . TYR A 1 288 ? 17.130  -1.025  12.194  1.00 37.99  ?  401  TYR A HE2  1 
ATOM   4476 H  HH   . TYR A 1 288 ? 16.434  -2.121  15.277  1.00 40.68  ?  401  TYR A HH   1 
ATOM   4477 N  N    . THR A 1 289 ? 14.728  -7.328  10.216  1.00 27.30  ?  402  THR A N    1 
ATOM   4478 C  CA   . THR A 1 289 ? 13.900  -8.345  10.839  1.00 28.15  ?  402  THR A CA   1 
ATOM   4479 C  C    . THR A 1 289 ? 14.448  -8.675  12.220  1.00 29.66  ?  402  THR A C    1 
ATOM   4480 O  O    . THR A 1 289 ? 15.611  -9.071  12.351  1.00 28.90  ?  402  THR A O    1 
ATOM   4481 C  CB   . THR A 1 289 ? 13.861  -9.606  9.975   1.00 27.61  ?  402  THR A CB   1 
ATOM   4482 O  OG1  . THR A 1 289 ? 13.250  -9.308  8.715   1.00 30.41  ?  402  THR A OG1  1 
ATOM   4483 C  CG2  . THR A 1 289 ? 13.094  -10.713 10.679  1.00 31.00  ?  402  THR A CG2  1 
ATOM   4484 H  H    . THR A 1 289 ? 15.453  -7.645  9.877   1.00 32.74  ?  402  THR A H    1 
ATOM   4485 H  HA   . THR A 1 289 ? 12.999  -8.002  10.944  1.00 33.77  ?  402  THR A HA   1 
ATOM   4486 H  HB   . THR A 1 289 ? 14.764  -9.923  9.818   1.00 33.11  ?  402  THR A HB   1 
ATOM   4487 H  HG1  . THR A 1 289 ? 13.690  -8.714  8.316   1.00 36.48  ?  402  THR A HG1  1 
ATOM   4488 H  HG21 . THR A 1 289 ? 12.850  -11.403 10.043  1.00 37.18  ?  402  THR A HG21 1 
ATOM   4489 H  HG22 . THR A 1 289 ? 13.644  -11.106 11.375  1.00 37.18  ?  402  THR A HG22 1 
ATOM   4490 H  HG23 . THR A 1 289 ? 12.287  -10.354 11.080  1.00 37.18  ?  402  THR A HG23 1 
ATOM   4491 N  N    . LEU A 1 290 ? 13.606  -8.532  13.246  1.00 28.28  ?  403  LEU A N    1 
ATOM   4492 C  CA   . LEU A 1 290 ? 14.039  -8.734  14.628  1.00 27.31  ?  403  LEU A CA   1 
ATOM   4493 C  C    . LEU A 1 290 ? 12.857  -9.207  15.458  1.00 27.92  ?  403  LEU A C    1 
ATOM   4494 O  O    . LEU A 1 290 ? 12.102  -8.400  16.022  1.00 29.21  ?  403  LEU A O    1 
ATOM   4495 C  CB   . LEU A 1 290 ? 14.645  -7.457  15.205  1.00 24.48  ?  403  LEU A CB   1 
ATOM   4496 C  CG   . LEU A 1 290 ? 15.087  -7.510  16.666  1.00 29.49  ?  403  LEU A CG   1 
ATOM   4497 C  CD1  . LEU A 1 290 ? 15.866  -8.783  16.944  1.00 31.36  ?  403  LEU A CD1  1 
ATOM   4498 C  CD2  . LEU A 1 290 ? 15.921  -6.278  17.008  1.00 31.12  ?  403  LEU A CD2  1 
ATOM   4499 H  H    . LEU A 1 290 ? 12.777  -8.318  13.166  1.00 33.92  ?  403  LEU A H    1 
ATOM   4500 H  HA   . LEU A 1 290 ? 14.709  -9.434  14.656  1.00 32.75  ?  403  LEU A HA   1 
ATOM   4501 H  HB2  . LEU A 1 290 ? 15.427  -7.231  14.679  1.00 29.36  ?  403  LEU A HB2  1 
ATOM   4502 H  HB3  . LEU A 1 290 ? 13.982  -6.752  15.135  1.00 29.36  ?  403  LEU A HB3  1 
ATOM   4503 H  HG   . LEU A 1 290 ? 14.304  -7.514  17.238  1.00 35.37  ?  403  LEU A HG   1 
ATOM   4504 H  HD11 . LEU A 1 290 ? 16.288  -8.712  17.815  1.00 37.61  ?  403  LEU A HD11 1 
ATOM   4505 H  HD12 . LEU A 1 290 ? 15.255  -9.536  16.933  1.00 37.61  ?  403  LEU A HD12 1 
ATOM   4506 H  HD13 . LEU A 1 290 ? 16.542  -8.896  16.257  1.00 37.61  ?  403  LEU A HD13 1 
ATOM   4507 H  HD21 . LEU A 1 290 ? 16.187  -6.325  17.939  1.00 37.33  ?  403  LEU A HD21 1 
ATOM   4508 H  HD22 . LEU A 1 290 ? 16.707  -6.261  16.440  1.00 37.33  ?  403  LEU A HD22 1 
ATOM   4509 H  HD23 . LEU A 1 290 ? 15.386  -5.483  16.856  1.00 37.33  ?  403  LEU A HD23 1 
ATOM   4510 N  N    . PRO A 1 291 ? 12.663  -10.519 15.558  1.00 28.48  ?  404  PRO A N    1 
ATOM   4511 C  CA   . PRO A 1 291 ? 11.530  -11.039 16.322  1.00 31.17  ?  404  PRO A CA   1 
ATOM   4512 C  C    . PRO A 1 291 ? 11.752  -10.899 17.820  1.00 32.95  ?  404  PRO A C    1 
ATOM   4513 O  O    . PRO A 1 291 ? 12.868  -10.680 18.304  1.00 30.13  ?  404  PRO A O    1 
ATOM   4514 C  CB   . PRO A 1 291 ? 11.456  -12.525 15.921  1.00 32.16  ?  404  PRO A CB   1 
ATOM   4515 C  CG   . PRO A 1 291 ? 12.476  -12.724 14.821  1.00 31.49  ?  404  PRO A CG   1 
ATOM   4516 C  CD   . PRO A 1 291 ? 13.473  -11.596 14.955  1.00 29.12  ?  404  PRO A CD   1 
ATOM   4517 H  HA   . PRO A 1 291 ? 10.712  -10.587 16.061  1.00 37.39  ?  404  PRO A HA   1 
ATOM   4518 H  HB2  . PRO A 1 291 ? 11.669  -13.079 16.688  1.00 38.58  ?  404  PRO A HB2  1 
ATOM   4519 H  HB3  . PRO A 1 291 ? 10.564  -12.731 15.600  1.00 38.58  ?  404  PRO A HB3  1 
ATOM   4520 H  HG2  . PRO A 1 291 ? 12.914  -13.582 14.936  1.00 37.77  ?  404  PRO A HG2  1 
ATOM   4521 H  HG3  . PRO A 1 291 ? 12.035  -12.689 13.958  1.00 37.77  ?  404  PRO A HG3  1 
ATOM   4522 H  HD2  . PRO A 1 291 ? 14.206  -11.848 15.538  1.00 34.93  ?  404  PRO A HD2  1 
ATOM   4523 H  HD3  . PRO A 1 291 ? 13.815  -11.330 14.087  1.00 34.93  ?  404  PRO A HD3  1 
ATOM   4524 N  N    . SER A 1 292 ? 10.655  -11.038 18.559  1.00 29.13  ?  405  SER A N    1 
ATOM   4525 C  CA   . SER A 1 292 ? 10.707  -11.124 20.010  1.00 31.59  ?  405  SER A CA   1 
ATOM   4526 C  C    . SER A 1 292 ? 10.094  -12.448 20.448  1.00 31.48  ?  405  SER A C    1 
ATOM   4527 O  O    . SER A 1 292 ? 9.043   -12.853 19.936  1.00 31.21  ?  405  SER A O    1 
ATOM   4528 C  CB   . SER A 1 292 ? 9.958   -9.956  20.659  1.00 34.28  ?  405  SER A CB   1 
ATOM   4529 O  OG   . SER A 1 292 ? 10.664  -8.745  20.452  1.00 40.92  ?  405  SER A OG   1 
ATOM   4530 H  H    . SER A 1 292 ? 9.861   -11.084 18.234  1.00 34.94  ?  405  SER A H    1 
ATOM   4531 H  HA   . SER A 1 292 ? 11.630  -11.095 20.306  1.00 37.89  ?  405  SER A HA   1 
ATOM   4532 H  HB2  . SER A 1 292 ? 9.076   -9.883  20.260  1.00 41.12  ?  405  SER A HB2  1 
ATOM   4533 H  HB3  . SER A 1 292 ? 9.878   -10.120 21.611  1.00 41.12  ?  405  SER A HB3  1 
ATOM   4534 H  HG   . SER A 1 292 ? 10.741  -8.594  19.629  1.00 49.09  ?  405  SER A HG   1 
ATOM   4535 N  N    . THR A 1 293 ? 10.774  -13.128 21.362  1.00 31.00  ?  406  THR A N    1 
ATOM   4536 C  CA   . THR A 1 293 ? 10.179  -14.229 22.097  1.00 31.37  ?  406  THR A CA   1 
ATOM   4537 C  C    . THR A 1 293 ? 9.034   -13.705 22.944  1.00 32.02  ?  406  THR A C    1 
ATOM   4538 O  O    . THR A 1 293 ? 9.197   -12.713 23.667  1.00 31.92  ?  406  THR A O    1 
ATOM   4539 C  CB   . THR A 1 293 ? 11.221  -14.880 23.004  1.00 32.24  ?  406  THR A CB   1 
ATOM   4540 O  OG1  . THR A 1 293 ? 12.357  -15.255 22.228  1.00 32.55  ?  406  THR A OG1  1 
ATOM   4541 C  CG2  . THR A 1 293 ? 10.631  -16.099 23.714  1.00 36.08  ?  406  THR A CG2  1 
ATOM   4542 H  H    . THR A 1 293 ? 11.592  -12.971 21.577  1.00 37.18  ?  406  THR A H    1 
ATOM   4543 H  HA   . THR A 1 293 ? 9.850   -14.897 21.476  1.00 37.63  ?  406  THR A HA   1 
ATOM   4544 H  HB   . THR A 1 293 ? 11.501  -14.253 23.689  1.00 38.67  ?  406  THR A HB   1 
ATOM   4545 H  HG1  . THR A 1 293 ? 12.949  -15.584 22.725  1.00 39.05  ?  406  THR A HG1  1 
ATOM   4546 H  HG21 . THR A 1 293 ? 11.344  -16.681 24.021  1.00 43.28  ?  406  THR A HG21 1 
ATOM   4547 H  HG22 . THR A 1 293 ? 10.105  -15.816 24.478  1.00 43.28  ?  406  THR A HG22 1 
ATOM   4548 H  HG23 . THR A 1 293 ? 10.061  -16.594 23.105  1.00 43.28  ?  406  THR A HG23 1 
ATOM   4549 N  N    . VAL A 1 294 ? 7.879   -14.362 22.831  1.00 31.97  ?  407  VAL A N    1 
ATOM   4550 C  CA   . VAL A 1 294 ? 6.761   -14.169 23.750  1.00 32.01  ?  407  VAL A CA   1 
ATOM   4551 C  C    . VAL A 1 294 ? 6.949   -15.195 24.856  1.00 34.48  ?  407  VAL A C    1 
ATOM   4552 O  O    . VAL A 1 294 ? 6.845   -16.403 24.614  1.00 31.59  ?  407  VAL A O    1 
ATOM   4553 C  CB   . VAL A 1 294 ? 5.414   -14.336 23.046  1.00 34.07  ?  407  VAL A CB   1 
ATOM   4554 C  CG1  . VAL A 1 294 ? 4.284   -14.260 24.045  1.00 33.15  ?  407  VAL A CG1  1 
ATOM   4555 C  CG2  . VAL A 1 294 ? 5.246   -13.269 21.969  1.00 34.49  ?  407  VAL A CG2  1 
ATOM   4556 H  H    . VAL A 1 294 ? 7.718   -14.939 22.214  1.00 38.35  ?  407  VAL A H    1 
ATOM   4557 H  HA   . VAL A 1 294 ? 6.780   -13.276 24.128  1.00 38.40  ?  407  VAL A HA   1 
ATOM   4558 H  HB   . VAL A 1 294 ? 5.385   -15.207 22.621  1.00 40.87  ?  407  VAL A HB   1 
ATOM   4559 H  HG11 . VAL A 1 294 ? 3.447   -14.151 23.567  1.00 39.77  ?  407  VAL A HG11 1 
ATOM   4560 H  HG12 . VAL A 1 294 ? 4.264   -15.080 24.563  1.00 39.77  ?  407  VAL A HG12 1 
ATOM   4561 H  HG13 . VAL A 1 294 ? 4.431   -13.502 24.631  1.00 39.77  ?  407  VAL A HG13 1 
ATOM   4562 H  HG21 . VAL A 1 294 ? 4.380   -13.379 21.547  1.00 41.38  ?  407  VAL A HG21 1 
ATOM   4563 H  HG22 . VAL A 1 294 ? 5.304   -12.392 22.381  1.00 41.38  ?  407  VAL A HG22 1 
ATOM   4564 H  HG23 . VAL A 1 294 ? 5.951   -13.371 21.310  1.00 41.38  ?  407  VAL A HG23 1 
ATOM   4565 N  N    . MET A 1 295 ? 7.243   -14.718 26.064  1.00 32.67  ?  408  MET A N    1 
ATOM   4566 C  CA   . MET A 1 295 ? 7.800   -15.599 27.081  1.00 39.21  ?  408  MET A CA   1 
ATOM   4567 C  C    . MET A 1 295 ? 6.745   -16.400 27.822  1.00 44.54  ?  408  MET A C    1 
ATOM   4568 O  O    . MET A 1 295 ? 7.058   -17.474 28.358  1.00 48.12  ?  408  MET A O    1 
ATOM   4569 C  CB   . MET A 1 295 ? 8.600   -14.781 28.089  1.00 42.86  ?  408  MET A CB   1 
ATOM   4570 C  CG   . MET A 1 295 ? 9.937   -14.306 27.537  1.00 41.05  ?  408  MET A CG   1 
ATOM   4571 S  SD   . MET A 1 295 ? 10.797  -13.220 28.670  1.00 54.73  ?  408  MET A SD   1 
ATOM   4572 C  CE   . MET A 1 295 ? 9.882   -11.713 28.495  1.00 42.45  ?  408  MET A CE   1 
ATOM   4573 H  H    . MET A 1 295 ? 7.131   -13.903 26.315  1.00 39.19  ?  408  MET A H    1 
ATOM   4574 H  HA   . MET A 1 295 ? 8.395   -16.220 26.633  1.00 47.04  ?  408  MET A HA   1 
ATOM   4575 H  HB2  . MET A 1 295 ? 8.084   -13.998 28.340  1.00 51.42  ?  408  MET A HB2  1 
ATOM   4576 H  HB3  . MET A 1 295 ? 8.775   -15.328 28.870  1.00 51.42  ?  408  MET A HB3  1 
ATOM   4577 H  HG2  . MET A 1 295 ? 10.502  -15.076 27.369  1.00 49.25  ?  408  MET A HG2  1 
ATOM   4578 H  HG3  . MET A 1 295 ? 9.785   -13.821 26.711  1.00 49.25  ?  408  MET A HG3  1 
ATOM   4579 H  HE1  . MET A 1 295 ? 10.352  -11.002 28.957  1.00 50.93  ?  408  MET A HE1  1 
ATOM   4580 H  HE2  . MET A 1 295 ? 9.803   -11.499 27.552  1.00 50.93  ?  408  MET A HE2  1 
ATOM   4581 H  HE3  . MET A 1 295 ? 9.000   -11.833 28.881  1.00 50.93  ?  408  MET A HE3  1 
ATOM   4582 N  N    . HIS A 1 296 ? 5.501   -15.920 27.912  1.00 42.13  ?  409  HIS A N    1 
ATOM   4583 C  CA   . HIS A 1 296 ? 4.502   -16.640 28.698  1.00 50.54  ?  409  HIS A CA   1 
ATOM   4584 C  C    . HIS A 1 296 ? 3.098   -16.578 28.092  1.00 48.70  ?  409  HIS A C    1 
ATOM   4585 O  O    . HIS A 1 296 ? 2.153   -16.067 28.680  1.00 50.45  ?  409  HIS A O    1 
ATOM   4586 C  CB   . HIS A 1 296 ? 4.464   -16.088 30.118  1.00 53.97  ?  409  HIS A CB   1 
ATOM   4587 C  CG   . HIS A 1 296 ? 5.804   -16.041 30.787  1.00 60.35  ?  409  HIS A CG   1 
ATOM   4588 N  ND1  . HIS A 1 296 ? 6.801   -15.176 30.396  1.00 61.30  ?  409  HIS A ND1  1 
ATOM   4589 C  CD2  . HIS A 1 296 ? 6.316   -16.759 31.814  1.00 64.29  ?  409  HIS A CD2  1 
ATOM   4590 C  CE1  . HIS A 1 296 ? 7.869   -15.364 31.151  1.00 62.59  ?  409  HIS A CE1  1 
ATOM   4591 N  NE2  . HIS A 1 296 ? 7.602   -16.321 32.017  1.00 63.65  ?  409  HIS A NE2  1 
ATOM   4592 H  H    . HIS A 1 296 ? 5.224   -15.199 27.535  1.00 50.54  ?  409  HIS A H    1 
ATOM   4593 H  HA   . HIS A 1 296 ? 4.769   -17.572 28.680  1.00 60.63  ?  409  HIS A HA   1 
ATOM   4594 H  HB2  . HIS A 1 296 ? 4.116   -15.183 30.091  1.00 64.75  ?  409  HIS A HB2  1 
ATOM   4595 H  HB3  . HIS A 1 296 ? 3.885   -16.651 30.655  1.00 64.75  ?  409  HIS A HB3  1 
ATOM   4596 H  HD2  . HIS A 1 296 ? 5.879   -17.426 32.293  1.00 77.14  ?  409  HIS A HD2  1 
ATOM   4597 H  HE1  . HIS A 1 296 ? 8.672   -14.899 31.083  1.00 75.09  ?  409  HIS A HE1  1 
ATOM   4598 H  HE2  . HIS A 1 296 ? 8.144   -16.621 32.613  1.00 76.36  ?  409  HIS A HE2  1 
ATOM   4599 N  N    . HIS A 1 297 ? 2.922   -17.191 26.919  1.00 46.69  ?  410  HIS A N    1 
ATOM   4600 C  CA   . HIS A 1 297 ? 1.610   -17.296 26.313  1.00 47.07  ?  410  HIS A CA   1 
ATOM   4601 C  C    . HIS A 1 297 ? 1.384   -18.736 25.877  1.00 45.96  ?  410  HIS A C    1 
ATOM   4602 O  O    . HIS A 1 297 ? 2.266   -19.341 25.244  1.00 44.29  ?  410  HIS A O    1 
ATOM   4603 C  CB   . HIS A 1 297 ? 1.444   -16.342 25.125  1.00 43.84  ?  410  HIS A CB   1 
ATOM   4604 C  CG   . HIS A 1 297 ? 0.016   -16.151 24.718  1.00 42.87  ?  410  HIS A CG   1 
ATOM   4605 N  ND1  . HIS A 1 297 ? -0.628  -16.989 23.834  1.00 44.64  ?  410  HIS A ND1  1 
ATOM   4606 C  CD2  . HIS A 1 297 ? -0.899  -15.225 25.087  1.00 41.81  ?  410  HIS A CD2  1 
ATOM   4607 C  CE1  . HIS A 1 297 ? -1.878  -16.590 23.674  1.00 43.86  ?  410  HIS A CE1  1 
ATOM   4608 N  NE2  . HIS A 1 297 ? -2.066  -15.517 24.420  1.00 44.98  ?  410  HIS A NE2  1 
ATOM   4609 H  H    . HIS A 1 297 ? 3.555   -17.552 26.461  1.00 56.02  ?  410  HIS A H    1 
ATOM   4610 H  HA   . HIS A 1 297 ? 0.942   -17.057 26.974  1.00 56.47  ?  410  HIS A HA   1 
ATOM   4611 H  HB2  . HIS A 1 297 ? 1.805   -15.474 25.366  1.00 52.60  ?  410  HIS A HB2  1 
ATOM   4612 H  HB3  . HIS A 1 297 ? 1.926   -16.702 24.363  1.00 52.60  ?  410  HIS A HB3  1 
ATOM   4613 H  HD2  . HIS A 1 297 ? -0.763  -14.522 25.681  1.00 50.16  ?  410  HIS A HD2  1 
ATOM   4614 H  HE1  . HIS A 1 297 ? -2.515  -16.996 23.131  1.00 52.62  ?  410  HIS A HE1  1 
ATOM   4615 H  HE2  . HIS A 1 297 ? -2.799  -15.072 24.478  1.00 53.96  ?  410  HIS A HE2  1 
ATOM   4616 N  N    . PRO A 1 298 ? 0.217   -19.318 26.176  1.00 50.44  ?  411  PRO A N    1 
ATOM   4617 C  CA   . PRO A 1 298 ? -0.016  -20.728 25.820  1.00 52.63  ?  411  PRO A CA   1 
ATOM   4618 C  C    . PRO A 1 298 ? -0.063  -20.984 24.323  1.00 47.92  ?  411  PRO A C    1 
ATOM   4619 O  O    . PRO A 1 298 ? 0.155   -22.126 23.910  1.00 55.54  ?  411  PRO A O    1 
ATOM   4620 C  CB   . PRO A 1 298 ? -1.367  -21.034 26.478  1.00 53.89  ?  411  PRO A CB   1 
ATOM   4621 C  CG   . PRO A 1 298 ? -2.063  -19.697 26.511  1.00 54.44  ?  411  PRO A CG   1 
ATOM   4622 C  CD   . PRO A 1 298 ? -0.982  -18.682 26.759  1.00 50.06  ?  411  PRO A CD   1 
ATOM   4623 H  HA   . PRO A 1 298 ? 0.672   -21.287 26.215  1.00 63.14  ?  411  PRO A HA   1 
ATOM   4624 H  HB2  . PRO A 1 298 ? -1.862  -21.675 25.944  1.00 64.66  ?  411  PRO A HB2  1 
ATOM   4625 H  HB3  . PRO A 1 298 ? -1.232  -21.383 27.373  1.00 64.66  ?  411  PRO A HB3  1 
ATOM   4626 H  HG2  . PRO A 1 298 ? -2.499  -19.534 25.661  1.00 65.31  ?  411  PRO A HG2  1 
ATOM   4627 H  HG3  . PRO A 1 298 ? -2.716  -19.686 27.228  1.00 65.31  ?  411  PRO A HG3  1 
ATOM   4628 H  HD2  . PRO A 1 298 ? -1.183  -17.846 26.310  1.00 60.05  ?  411  PRO A HD2  1 
ATOM   4629 H  HD3  . PRO A 1 298 ? -0.863  -18.528 27.710  1.00 60.05  ?  411  PRO A HD3  1 
ATOM   4630 N  N    . ALA A 1 299 ? -0.331  -19.972 23.501  1.00 45.31  ?  412  ALA A N    1 
ATOM   4631 C  CA   . ALA A 1 299 ? -0.544  -20.175 22.076  1.00 45.20  ?  412  ALA A CA   1 
ATOM   4632 C  C    . ALA A 1 299 ? 0.468   -19.481 21.171  1.00 45.10  ?  412  ALA A C    1 
ATOM   4633 O  O    . ALA A 1 299 ? 0.623   -19.899 20.022  1.00 47.80  ?  412  ALA A O    1 
ATOM   4634 C  CB   . ALA A 1 299 ? -1.943  -19.689 21.669  1.00 45.02  ?  412  ALA A CB   1 
ATOM   4635 H  H    . ALA A 1 299 ? -0.395  -19.151 23.751  1.00 54.35  ?  412  ALA A H    1 
ATOM   4636 H  HA   . ALA A 1 299 ? -0.483  -21.127 21.905  1.00 54.23  ?  412  ALA A HA   1 
ATOM   4637 H  HB1  . ALA A 1 299 ? -2.068  -19.844 20.720  1.00 54.01  ?  412  ALA A HB1  1 
ATOM   4638 H  HB2  . ALA A 1 299 ? -2.608  -20.182 22.175  1.00 54.01  ?  412  ALA A HB2  1 
ATOM   4639 H  HB3  . ALA A 1 299 ? -2.017  -18.741 21.862  1.00 54.01  ?  412  ALA A HB3  1 
ATOM   4640 N  N    . HIS A 1 300 ? 1.138   -18.437 21.633  1.00 42.17  ?  413  HIS A N    1 
ATOM   4641 C  CA   . HIS A 1 300 ? 2.087   -17.695 20.815  1.00 42.22  ?  413  HIS A CA   1 
ATOM   4642 C  C    . HIS A 1 300 ? 3.464   -17.777 21.451  1.00 40.25  ?  413  HIS A C    1 
ATOM   4643 O  O    . HIS A 1 300 ? 3.608   -17.559 22.659  1.00 40.74  ?  413  HIS A O    1 
ATOM   4644 C  CB   . HIS A 1 300 ? 1.659   -16.242 20.651  1.00 40.01  ?  413  HIS A CB   1 
ATOM   4645 C  CG   . HIS A 1 300 ? 0.366   -16.070 19.915  1.00 42.71  ?  413  HIS A CG   1 
ATOM   4646 N  ND1  . HIS A 1 300 ? 0.203   -16.443 18.600  1.00 43.11  ?  413  HIS A ND1  1 
ATOM   4647 C  CD2  . HIS A 1 300 ? -0.826  -15.560 20.311  1.00 43.69  ?  413  HIS A CD2  1 
ATOM   4648 C  CE1  . HIS A 1 300 ? -1.031  -16.170 18.216  1.00 43.52  ?  413  HIS A CE1  1 
ATOM   4649 N  NE2  . HIS A 1 300 ? -1.677  -15.633 19.234  1.00 43.46  ?  413  HIS A NE2  1 
ATOM   4650 H  H    . HIS A 1 300 ? 1.057   -18.133 22.434  1.00 50.59  ?  413  HIS A H    1 
ATOM   4651 H  HA   . HIS A 1 300 ? 2.135   -18.094 19.932  1.00 50.65  ?  413  HIS A HA   1 
ATOM   4652 H  HB2  . HIS A 1 300 ? 1.554   -15.848 21.531  1.00 48.00  ?  413  HIS A HB2  1 
ATOM   4653 H  HB3  . HIS A 1 300 ? 2.347   -15.769 20.156  1.00 48.00  ?  413  HIS A HB3  1 
ATOM   4654 H  HD1  . HIS A 1 300 ? 0.810   -16.798 18.106  1.00 51.71  ?  413  HIS A HD1  1 
ATOM   4655 H  HD2  . HIS A 1 300 ? -1.030  -15.224 21.154  1.00 52.42  ?  413  HIS A HD2  1 
ATOM   4656 H  HE1  . HIS A 1 300 ? -1.385  -16.329 17.371  1.00 52.20  ?  413  HIS A HE1  1 
ATOM   4657 N  N    . LYS A 1 301 ? 4.475   -18.091 20.635  1.00 38.17  ?  414  LYS A N    1 
ATOM   4658 C  CA   . LYS A 1 301 ? 5.841   -18.164 21.119  1.00 39.33  ?  414  LYS A CA   1 
ATOM   4659 C  C    . LYS A 1 301 ? 6.734   -17.067 20.568  1.00 38.32  ?  414  LYS A C    1 
ATOM   4660 O  O    . LYS A 1 301 ? 7.814   -16.838 21.122  1.00 35.80  ?  414  LYS A O    1 
ATOM   4661 C  CB   . LYS A 1 301 ? 6.462   -19.524 20.763  1.00 42.82  ?  414  LYS A CB   1 
ATOM   4662 C  CG   . LYS A 1 301 ? 5.740   -20.710 21.383  1.00 54.21  ?  414  LYS A CG   1 
ATOM   4663 C  CD   . LYS A 1 301 ? 6.608   -21.964 21.381  1.00 60.40  ?  414  LYS A CD   1 
ATOM   4664 C  CE   . LYS A 1 301 ? 7.846   -21.783 22.256  1.00 63.79  ?  414  LYS A CE   1 
ATOM   4665 N  NZ   . LYS A 1 301 ? 8.585   -23.058 22.462  1.00 67.34  ?  414  LYS A NZ   1 
ATOM   4666 H  H    . LYS A 1 301 ? 4.386   -18.264 19.797  1.00 45.79  ?  414  LYS A H    1 
ATOM   4667 H  HA   . LYS A 1 301 ? 5.833   -18.087 22.086  1.00 47.18  ?  414  LYS A HA   1 
ATOM   4668 H  HB2  . LYS A 1 301 ? 6.439   -19.635 19.800  1.00 51.37  ?  414  LYS A HB2  1 
ATOM   4669 H  HB3  . LYS A 1 301 ? 7.380   -19.540 21.077  1.00 51.37  ?  414  LYS A HB3  1 
ATOM   4670 H  HG2  . LYS A 1 301 ? 5.511   -20.501 22.302  1.00 65.03  ?  414  LYS A HG2  1 
ATOM   4671 H  HG3  . LYS A 1 301 ? 4.935   -20.896 20.875  1.00 65.03  ?  414  LYS A HG3  1 
ATOM   4672 H  HD2  . LYS A 1 301 ? 6.096   -22.711 21.727  1.00 72.47  ?  414  LYS A HD2  1 
ATOM   4673 H  HD3  . LYS A 1 301 ? 6.899   -22.153 20.475  1.00 72.47  ?  414  LYS A HD3  1 
ATOM   4674 H  HE2  . LYS A 1 301 ? 8.447   -21.152 21.830  1.00 76.53  ?  414  LYS A HE2  1 
ATOM   4675 H  HE3  . LYS A 1 301 ? 7.575   -21.448 23.125  1.00 76.53  ?  414  LYS A HE3  1 
ATOM   4676 H  HZ1  . LYS A 1 301 ? 9.298   -22.917 22.975  1.00 80.79  ?  414  LYS A HZ1  1 
ATOM   4677 H  HZ2  . LYS A 1 301 ? 8.057   -23.654 22.860  1.00 80.79  ?  414  LYS A HZ2  1 
ATOM   4678 H  HZ3  . LYS A 1 301 ? 8.852   -23.385 21.679  1.00 80.79  ?  414  LYS A HZ3  1 
ATOM   4679 N  N    . SER A 1 302 ? 6.318   -16.389 19.506  1.00 35.13  ?  415  SER A N    1 
ATOM   4680 C  CA   . SER A 1 302 ? 7.160   -15.385 18.887  1.00 37.98  ?  415  SER A CA   1 
ATOM   4681 C  C    . SER A 1 302 ? 6.290   -14.285 18.301  1.00 36.80  ?  415  SER A C    1 
ATOM   4682 O  O    . SER A 1 302 ? 5.138   -14.507 17.915  1.00 35.76  ?  415  SER A O    1 
ATOM   4683 C  CB   . SER A 1 302 ? 8.042   -15.981 17.789  1.00 40.09  ?  415  SER A CB   1 
ATOM   4684 O  OG   . SER A 1 302 ? 8.810   -14.960 17.166  1.00 43.06  ?  415  SER A OG   1 
ATOM   4685 H  H    . SER A 1 302 ? 5.552   -16.494 19.129  1.00 42.15  ?  415  SER A H    1 
ATOM   4686 H  HA   . SER A 1 302 ? 7.733   -14.996 19.566  1.00 45.56  ?  415  SER A HA   1 
ATOM   4687 H  HB2  . SER A 1 302 ? 8.641   -16.635 18.182  1.00 48.09  ?  415  SER A HB2  1 
ATOM   4688 H  HB3  . SER A 1 302 ? 7.478   -16.405 17.124  1.00 48.09  ?  415  SER A HB3  1 
ATOM   4689 H  HG   . SER A 1 302 ? 9.293   -15.291 16.564  1.00 51.66  ?  415  SER A HG   1 
ATOM   4690 N  N    . LEU A 1 303 ? 6.869   -13.096 18.236  1.00 36.52  ?  416  LEU A N    1 
ATOM   4691 C  CA   . LEU A 1 303 ? 6.239   -11.912 17.672  1.00 33.63  ?  416  LEU A CA   1 
ATOM   4692 C  C    . LEU A 1 303 ? 7.153   -11.406 16.569  1.00 34.58  ?  416  LEU A C    1 
ATOM   4693 O  O    . LEU A 1 303 ? 8.284   -10.997 16.839  1.00 34.30  ?  416  LEU A O    1 
ATOM   4694 C  CB   . LEU A 1 303 ? 6.035   -10.880 18.769  1.00 41.39  ?  416  LEU A CB   1 
ATOM   4695 C  CG   . LEU A 1 303 ? 5.294   -9.579  18.498  1.00 45.74  ?  416  LEU A CG   1 
ATOM   4696 C  CD1  . LEU A 1 303 ? 3.941   -9.838  17.923  1.00 49.04  ?  416  LEU A CD1  1 
ATOM   4697 C  CD2  . LEU A 1 303 ? 5.188   -8.874  19.846  1.00 45.27  ?  416  LEU A CD2  1 
ATOM   4698 H  H    . LEU A 1 303 ? 7.664   -12.945 18.527  1.00 43.81  ?  416  LEU A H    1 
ATOM   4699 H  HA   . LEU A 1 303 ? 5.376   -12.115 17.279  1.00 40.34  ?  416  LEU A HA   1 
ATOM   4700 H  HB2  . LEU A 1 303 ? 5.547   -11.319 19.482  1.00 49.65  ?  416  LEU A HB2  1 
ATOM   4701 H  HB3  . LEU A 1 303 ? 6.917   -10.622 19.080  1.00 49.65  ?  416  LEU A HB3  1 
ATOM   4702 H  HG   . LEU A 1 303 ? 5.758   -9.028  17.848  1.00 54.87  ?  416  LEU A HG   1 
ATOM   4703 H  HD11 . LEU A 1 303 ? 3.670   -9.070  17.395  1.00 58.83  ?  416  LEU A HD11 1 
ATOM   4704 H  HD12 . LEU A 1 303 ? 3.982   -10.628 17.361  1.00 58.83  ?  416  LEU A HD12 1 
ATOM   4705 H  HD13 . LEU A 1 303 ? 3.311   -9.979  18.647  1.00 58.83  ?  416  LEU A HD13 1 
ATOM   4706 H  HD21 . LEU A 1 303 ? 4.723   -8.031  19.726  1.00 54.31  ?  416  LEU A HD21 1 
ATOM   4707 H  HD22 . LEU A 1 303 ? 4.693   -9.440  20.459  1.00 54.31  ?  416  LEU A HD22 1 
ATOM   4708 H  HD23 . LEU A 1 303 ? 6.080   -8.714  20.190  1.00 54.31  ?  416  LEU A HD23 1 
ATOM   4709 N  N    . LYS A 1 304 ? 6.684   -11.459 15.327  1.00 33.78  ?  417  LYS A N    1 
ATOM   4710 C  CA   . LYS A 1 304 ? 7.509   -11.112 14.165  1.00 34.16  ?  417  LYS A CA   1 
ATOM   4711 C  C    . LYS A 1 304 ? 7.441   -9.603  13.955  1.00 33.38  ?  417  LYS A C    1 
ATOM   4712 O  O    . LYS A 1 304 ? 6.385   -9.061  13.624  1.00 34.15  ?  417  LYS A O    1 
ATOM   4713 C  CB   . LYS A 1 304 ? 7.057   -11.875 12.916  1.00 34.57  ?  417  LYS A CB   1 
ATOM   4714 C  CG   . LYS A 1 304 ? 7.771   -11.484 11.606  1.00 42.19  ?  417  LYS A CG   1 
ATOM   4715 C  CD   . LYS A 1 304 ? 8.828   -12.508 11.135  1.00 47.10  ?  417  LYS A CD   1 
ATOM   4716 C  CE   . LYS A 1 304 ? 9.161   -12.387 9.623   1.00 49.59  ?  417  LYS A CE   1 
ATOM   4717 N  NZ   . LYS A 1 304 ? 8.210   -13.132 8.736   1.00 51.43  ?  417  LYS A NZ   1 
ATOM   4718 H  H    . LYS A 1 304 ? 5.881   -11.694 15.126  1.00 40.52  ?  417  LYS A H    1 
ATOM   4719 H  HA   . LYS A 1 304 ? 8.431   -11.358 14.342  1.00 40.97  ?  417  LYS A HA   1 
ATOM   4720 H  HB2  . LYS A 1 304 ? 7.217   -12.821 13.061  1.00 41.47  ?  417  LYS A HB2  1 
ATOM   4721 H  HB3  . LYS A 1 304 ? 6.109   -11.715 12.788  1.00 41.47  ?  417  LYS A HB3  1 
ATOM   4722 H  HG2  . LYS A 1 304 ? 7.108   -11.401 10.903  1.00 50.61  ?  417  LYS A HG2  1 
ATOM   4723 H  HG3  . LYS A 1 304 ? 8.222   -10.635 11.738  1.00 50.61  ?  417  LYS A HG3  1 
ATOM   4724 H  HD2  . LYS A 1 304 ? 9.648   -12.366 11.633  1.00 56.51  ?  417  LYS A HD2  1 
ATOM   4725 H  HD3  . LYS A 1 304 ? 8.493   -13.404 11.296  1.00 56.51  ?  417  LYS A HD3  1 
ATOM   4726 H  HE2  . LYS A 1 304 ? 9.130   -11.451 9.370   1.00 59.49  ?  417  LYS A HE2  1 
ATOM   4727 H  HE3  . LYS A 1 304 ? 10.050  -12.744 9.470   1.00 59.49  ?  417  LYS A HE3  1 
ATOM   4728 H  HZ1  . LYS A 1 304 ? 7.384   -12.821 8.847   1.00 61.71  ?  417  LYS A HZ1  1 
ATOM   4729 H  HZ2  . LYS A 1 304 ? 8.446   -13.030 7.884   1.00 61.71  ?  417  LYS A HZ2  1 
ATOM   4730 H  HZ3  . LYS A 1 304 ? 8.222   -13.999 8.937   1.00 61.71  ?  417  LYS A HZ3  1 
ATOM   4731 N  N    . ALA A 1 305 ? 8.563   -8.926  14.148  1.00 30.66  ?  418  ALA A N    1 
ATOM   4732 C  CA   . ALA A 1 305 ? 8.595   -7.475  14.103  1.00 28.16  ?  418  ALA A CA   1 
ATOM   4733 C  C    . ALA A 1 305 ? 9.583   -6.988  13.058  1.00 28.70  ?  418  ALA A C    1 
ATOM   4734 O  O    . ALA A 1 305 ? 10.722  -7.487  12.973  1.00 28.51  ?  418  ALA A O    1 
ATOM   4735 C  CB   . ALA A 1 305 ? 8.975   -6.888  15.465  1.00 29.68  ?  418  ALA A CB   1 
ATOM   4736 H  H    . ALA A 1 305 ? 9.324   -9.292  14.307  1.00 36.78  ?  418  ALA A H    1 
ATOM   4737 H  HA   . ALA A 1 305 ? 7.712   -7.163  13.850  1.00 33.78  ?  418  ALA A HA   1 
ATOM   4738 H  HB1  . ALA A 1 305 ? 8.987   -5.921  15.399  1.00 35.60  ?  418  ALA A HB1  1 
ATOM   4739 H  HB2  . ALA A 1 305 ? 8.319   -7.167  16.123  1.00 35.60  ?  418  ALA A HB2  1 
ATOM   4740 H  HB3  . ALA A 1 305 ? 9.854   -7.214  15.715  1.00 35.60  ?  418  ALA A HB3  1 
ATOM   4741 N  N    . ALA A 1 306 ? 9.145   -6.017  12.265  1.00 28.09  ?  419  ALA A N    1 
ATOM   4742 C  CA   . ALA A 1 306 ? 10.025  -5.280  11.368  1.00 26.59  ?  419  ALA A CA   1 
ATOM   4743 C  C    . ALA A 1 306 ? 10.416  -3.967  12.036  1.00 26.61  ?  419  ALA A C    1 
ATOM   4744 O  O    . ALA A 1 306 ? 9.639   -3.396  12.793  1.00 27.49  ?  419  ALA A O    1 
ATOM   4745 C  CB   . ALA A 1 306 ? 9.327   -4.989  10.039  1.00 28.32  ?  419  ALA A CB   1 
ATOM   4746 H  H    . ALA A 1 306 ? 8.324   -5.763  12.229  1.00 33.69  ?  419  ALA A H    1 
ATOM   4747 H  HA   . ALA A 1 306 ? 10.822  -5.798  11.179  1.00 31.90  ?  419  ALA A HA   1 
ATOM   4748 H  HB1  . ALA A 1 306 ? 9.934   -4.494  9.466   1.00 33.97  ?  419  ALA A HB1  1 
ATOM   4749 H  HB2  . ALA A 1 306 ? 9.085   -5.829  9.619   1.00 33.97  ?  419  ALA A HB2  1 
ATOM   4750 H  HB3  . ALA A 1 306 ? 8.530   -4.462  10.209  1.00 33.97  ?  419  ALA A HB3  1 
ATOM   4751 N  N    . TYR A 1 307 ? 11.623  -3.491  11.761  1.00 29.31  ?  420  TYR A N    1 
ATOM   4752 C  CA   . TYR A 1 307 ? 12.081  -2.202  12.267  1.00 27.97  ?  420  TYR A CA   1 
ATOM   4753 C  C    . TYR A 1 307 ? 12.493  -1.315  11.101  1.00 28.98  ?  420  TYR A C    1 
ATOM   4754 O  O    . TYR A 1 307 ? 13.320  -1.727  10.273  1.00 27.45  ?  420  TYR A O    1 
ATOM   4755 C  CB   . TYR A 1 307 ? 13.260  -2.365  13.240  1.00 29.41  ?  420  TYR A CB   1 
ATOM   4756 C  CG   . TYR A 1 307 ? 12.907  -2.891  14.619  1.00 28.45  ?  420  TYR A CG   1 
ATOM   4757 C  CD1  . TYR A 1 307 ? 12.578  -4.231  14.812  1.00 30.57  ?  420  TYR A CD1  1 
ATOM   4758 C  CD2  . TYR A 1 307 ? 12.942  -2.064  15.728  1.00 29.66  ?  420  TYR A CD2  1 
ATOM   4759 C  CE1  . TYR A 1 307 ? 12.272  -4.722  16.072  1.00 29.00  ?  420  TYR A CE1  1 
ATOM   4760 C  CE2  . TYR A 1 307 ? 12.625  -2.540  16.993  1.00 32.92  ?  420  TYR A CE2  1 
ATOM   4761 C  CZ   . TYR A 1 307 ? 12.306  -3.872  17.155  1.00 30.75  ?  420  TYR A CZ   1 
ATOM   4762 O  OH   . TYR A 1 307 ? 11.993  -4.369  18.400  1.00 35.07  ?  420  TYR A OH   1 
ATOM   4763 H  H    . TYR A 1 307 ? 12.202  -3.903  11.277  1.00 35.16  ?  420  TYR A H    1 
ATOM   4764 H  HA   . TYR A 1 307 ? 11.351  -1.772  12.739  1.00 33.55  ?  420  TYR A HA   1 
ATOM   4765 H  HB2  . TYR A 1 307 ? 13.894  -2.986  12.849  1.00 35.28  ?  420  TYR A HB2  1 
ATOM   4766 H  HB3  . TYR A 1 307 ? 13.677  -1.498  13.361  1.00 35.28  ?  420  TYR A HB3  1 
ATOM   4767 H  HD1  . TYR A 1 307 ? 12.563  -4.806  14.082  1.00 36.66  ?  420  TYR A HD1  1 
ATOM   4768 H  HD2  . TYR A 1 307 ? 13.183  -1.171  15.624  1.00 35.58  ?  420  TYR A HD2  1 
ATOM   4769 H  HE1  . TYR A 1 307 ? 12.046  -5.617  16.184  1.00 34.78  ?  420  TYR A HE1  1 
ATOM   4770 H  HE2  . TYR A 1 307 ? 12.627  -1.966  17.725  1.00 39.49  ?  420  TYR A HE2  1 
ATOM   4771 H  HH   . TYR A 1 307 ? 12.049  -3.760  18.975  1.00 42.07  ?  420  TYR A HH   1 
ATOM   4772 N  N    . SER A 1 308 ? 11.930  -0.102  11.046  1.00 28.31  ?  421  SER A N    1 
ATOM   4773 C  CA   . SER A 1 308 ? 12.380  0.911   10.091  1.00 28.20  ?  421  SER A CA   1 
ATOM   4774 C  C    . SER A 1 308 ? 13.881  1.141   10.229  1.00 28.16  ?  421  SER A C    1 
ATOM   4775 O  O    . SER A 1 308 ? 14.397  1.297   11.336  1.00 27.81  ?  421  SER A O    1 
ATOM   4776 C  CB   . SER A 1 308 ? 11.615  2.227   10.328  1.00 26.47  ?  421  SER A CB   1 
ATOM   4777 O  OG   . SER A 1 308 ? 12.045  3.250   9.477   1.00 29.38  ?  421  SER A OG   1 
ATOM   4778 H  H    . SER A 1 308 ? 11.285  0.158   11.551  1.00 33.95  ?  421  SER A H    1 
ATOM   4779 H  HA   . SER A 1 308 ? 12.197  0.611   9.187   1.00 33.83  ?  421  SER A HA   1 
ATOM   4780 H  HB2  . SER A 1 308 ? 10.671  2.069   10.171  1.00 31.75  ?  421  SER A HB2  1 
ATOM   4781 H  HB3  . SER A 1 308 ? 11.756  2.507   11.246  1.00 31.75  ?  421  SER A HB3  1 
ATOM   4782 H  HG   . SER A 1 308 ? 12.845  3.444   9.643   1.00 35.24  ?  421  SER A HG   1 
ATOM   4783 N  N    . PHE A 1 309 ? 14.584  1.188   9.090   1.00 26.34  ?  422  PHE A N    1 
ATOM   4784 C  CA   . PHE A 1 309 ? 16.039  1.330   9.068   1.00 27.72  ?  422  PHE A CA   1 
ATOM   4785 C  C    . PHE A 1 309 ? 16.344  2.702   8.517   1.00 28.58  ?  422  PHE A C    1 
ATOM   4786 O  O    . PHE A 1 309 ? 16.250  3.706   9.265   1.00 31.87  ?  422  PHE A O    1 
ATOM   4787 C  CB   . PHE A 1 309 ? 16.638  0.127   8.294   1.00 27.61  ?  422  PHE A CB   1 
ATOM   4788 C  CG   . PHE A 1 309 ? 18.136  -0.066  8.489   1.00 27.58  ?  422  PHE A CG   1 
ATOM   4789 C  CD1  . PHE A 1 309 ? 18.746  0.183   9.702   1.00 25.46  ?  422  PHE A CD1  1 
ATOM   4790 C  CD2  . PHE A 1 309 ? 18.915  -0.553  7.441   1.00 28.05  ?  422  PHE A CD2  1 
ATOM   4791 C  CE1  . PHE A 1 309 ? 20.112  -0.019  9.857   1.00 30.30  ?  422  PHE A CE1  1 
ATOM   4792 C  CE2  . PHE A 1 309 ? 20.270  -0.755  7.597   1.00 30.24  ?  422  PHE A CE2  1 
ATOM   4793 C  CZ   . PHE A 1 309 ? 20.870  -0.494  8.805   1.00 30.64  ?  422  PHE A CZ   1 
ATOM   4794 H  H    . PHE A 1 309 ? 14.232  1.138   8.307   1.00 31.59  ?  422  PHE A H    1 
ATOM   4795 H  HA   . PHE A 1 309 ? 16.404  1.314   9.967   1.00 33.24  ?  422  PHE A HA   1 
ATOM   4796 H  HB2  . PHE A 1 309 ? 16.197  -0.683  8.593   1.00 33.12  ?  422  PHE A HB2  1 
ATOM   4797 H  HB3  . PHE A 1 309 ? 16.481  0.260   7.347   1.00 33.12  ?  422  PHE A HB3  1 
ATOM   4798 H  HD1  . PHE A 1 309 ? 18.240  0.488   10.420  1.00 30.54  ?  422  PHE A HD1  1 
ATOM   4799 H  HD2  . PHE A 1 309 ? 18.514  -0.745  6.624   1.00 33.65  ?  422  PHE A HD2  1 
ATOM   4800 H  HE1  . PHE A 1 309 ? 20.518  0.166   10.674  1.00 36.35  ?  422  PHE A HE1  1 
ATOM   4801 H  HE2  . PHE A 1 309 ? 20.778  -1.069  6.884   1.00 36.28  ?  422  PHE A HE2  1 
ATOM   4802 H  HZ   . PHE A 1 309 ? 21.783  -0.636  8.913   1.00 36.75  ?  422  PHE A HZ   1 
ATOM   4803 N  N    . TYR A 1 310 ? 16.694  2.854   7.246   1.00 28.68  ?  423  TYR A N    1 
ATOM   4804 C  CA   . TYR A 1 310 ? 16.971  4.138   6.611   1.00 31.97  ?  423  TYR A CA   1 
ATOM   4805 C  C    . TYR A 1 310 ? 16.027  4.277   5.419   1.00 31.74  ?  423  TYR A C    1 
ATOM   4806 O  O    . TYR A 1 310 ? 15.969  3.382   4.575   1.00 30.91  ?  423  TYR A O    1 
ATOM   4807 C  CB   . TYR A 1 310 ? 18.464  4.247   6.182   1.00 30.53  ?  423  TYR A CB   1 
ATOM   4808 C  CG   . TYR A 1 310 ? 19.468  4.352   7.350   1.00 32.70  ?  423  TYR A CG   1 
ATOM   4809 C  CD1  . TYR A 1 310 ? 20.111  3.224   7.861   1.00 29.61  ?  423  TYR A CD1  1 
ATOM   4810 C  CD2  . TYR A 1 310 ? 19.753  5.579   7.938   1.00 29.98  ?  423  TYR A CD2  1 
ATOM   4811 C  CE1  . TYR A 1 310 ? 21.008  3.328   8.932   1.00 33.02  ?  423  TYR A CE1  1 
ATOM   4812 C  CE2  . TYR A 1 310 ? 20.654  5.686   9.005   1.00 30.97  ?  423  TYR A CE2  1 
ATOM   4813 C  CZ   . TYR A 1 310 ? 21.275  4.570   9.493   1.00 32.67  ?  423  TYR A CZ   1 
ATOM   4814 O  OH   . TYR A 1 310 ? 22.158  4.697   10.547  1.00 33.75  ?  423  TYR A OH   1 
ATOM   4815 H  H    . TYR A 1 310 ? 16.782  2.192   6.704   1.00 34.40  ?  423  TYR A H    1 
ATOM   4816 H  HA   . TYR A 1 310 ? 16.805  4.873   7.222   1.00 38.35  ?  423  TYR A HA   1 
ATOM   4817 H  HB2  . TYR A 1 310 ? 18.696  3.457   5.669   1.00 36.62  ?  423  TYR A HB2  1 
ATOM   4818 H  HB3  . TYR A 1 310 ? 18.570  5.041   5.635   1.00 36.62  ?  423  TYR A HB3  1 
ATOM   4819 H  HD1  . TYR A 1 310 ? 19.941  2.390   7.486   1.00 35.52  ?  423  TYR A HD1  1 
ATOM   4820 H  HD2  . TYR A 1 310 ? 19.337  6.346   7.615   1.00 35.96  ?  423  TYR A HD2  1 
ATOM   4821 H  HE1  . TYR A 1 310 ? 21.424  2.567   9.266   1.00 39.61  ?  423  TYR A HE1  1 
ATOM   4822 H  HE2  . TYR A 1 310 ? 20.829  6.518   9.382   1.00 37.15  ?  423  TYR A HE2  1 
ATOM   4823 H  HH   . TYR A 1 310 ? 22.325  3.942   10.875  1.00 40.48  ?  423  TYR A HH   1 
ATOM   4824 N  N    . ASN A 1 311 ? 15.258  5.368   5.375   1.00 28.28  ?  424  ASN A N    1 
ATOM   4825 C  CA   . ASN A 1 311 ? 14.311  5.631   4.291   1.00 29.32  ?  424  ASN A CA   1 
ATOM   4826 C  C    . ASN A 1 311 ? 14.647  6.994   3.703   1.00 31.31  ?  424  ASN A C    1 
ATOM   4827 O  O    . ASN A 1 311 ? 14.603  7.998   4.415   1.00 30.84  ?  424  ASN A O    1 
ATOM   4828 C  CB   . ASN A 1 311 ? 12.872  5.551   4.810   1.00 31.60  ?  424  ASN A CB   1 
ATOM   4829 C  CG   . ASN A 1 311 ? 12.583  4.243   5.531   1.00 28.79  ?  424  ASN A CG   1 
ATOM   4830 O  OD1  . ASN A 1 311 ? 12.494  3.196   4.908   1.00 29.47  ?  424  ASN A OD1  1 
ATOM   4831 N  ND2  . ASN A 1 311 ? 12.445  4.305   6.864   1.00 30.88  ?  424  ASN A ND2  1 
ATOM   4832 H  H    . ASN A 1 311 ? 15.269  5.982   5.976   1.00 33.92  ?  424  ASN A H    1 
ATOM   4833 H  HA   . ASN A 1 311 ? 14.396  4.977   3.580   1.00 35.17  ?  424  ASN A HA   1 
ATOM   4834 H  HB2  . ASN A 1 311 ? 12.719  6.278   5.433   1.00 37.90  ?  424  ASN A HB2  1 
ATOM   4835 H  HB3  . ASN A 1 311 ? 12.261  5.622   4.060   1.00 37.90  ?  424  ASN A HB3  1 
ATOM   4836 H  HD21 . ASN A 1 311 ? 12.281  3.589   7.313   1.00 37.04  ?  424  ASN A HD21 1 
ATOM   4837 H  HD22 . ASN A 1 311 ? 12.521  5.059   7.270   1.00 37.04  ?  424  ASN A HD22 1 
ATOM   4838 N  N    . ILE A 1 312 ? 15.054  7.013   2.431   1.00 33.00  ?  425  ILE A N    1 
ATOM   4839 C  CA   . ILE A 1 312 ? 15.522  8.221   1.768   1.00 32.59  ?  425  ILE A CA   1 
ATOM   4840 C  C    . ILE A 1 312 ? 14.517  8.582   0.696   1.00 34.57  ?  425  ILE A C    1 
ATOM   4841 O  O    . ILE A 1 312 ? 14.104  7.734   -0.102  1.00 36.11  ?  425  ILE A O    1 
ATOM   4842 C  CB   . ILE A 1 312 ? 16.921  8.090   1.148   1.00 33.41  ?  425  ILE A CB   1 
ATOM   4843 C  CG1  . ILE A 1 312 ? 18.016  8.204   2.207   1.00 33.28  ?  425  ILE A CG1  1 
ATOM   4844 C  CG2  . ILE A 1 312 ? 17.167  9.196   0.083   1.00 32.21  ?  425  ILE A CG2  1 
ATOM   4845 C  CD1  . ILE A 1 312 ? 17.944  7.166   3.306   1.00 33.07  ?  425  ILE A CD1  1 
ATOM   4846 H  H    . ILE A 1 312 ? 15.066  6.317   1.926   1.00 39.58  ?  425  ILE A H    1 
ATOM   4847 H  HA   . ILE A 1 312 ? 15.567  8.922   2.438   1.00 39.09  ?  425  ILE A HA   1 
ATOM   4848 H  HB   . ILE A 1 312 ? 16.954  7.213   0.735   1.00 40.08  ?  425  ILE A HB   1 
ATOM   4849 H  HG12 . ILE A 1 312 ? 18.878  8.108   1.771   1.00 39.92  ?  425  ILE A HG12 1 
ATOM   4850 H  HG13 . ILE A 1 312 ? 17.951  9.077   2.624   1.00 39.92  ?  425  ILE A HG13 1 
ATOM   4851 H  HG21 . ILE A 1 312 ? 18.122  9.285   -0.065  1.00 38.64  ?  425  ILE A HG21 1 
ATOM   4852 H  HG22 . ILE A 1 312 ? 16.726  8.943   -0.743  1.00 38.64  ?  425  ILE A HG22 1 
ATOM   4853 H  HG23 . ILE A 1 312 ? 16.803  10.035  0.409   1.00 38.64  ?  425  ILE A HG23 1 
ATOM   4854 H  HD11 . ILE A 1 312 ? 17.651  6.323   2.926   1.00 39.67  ?  425  ILE A HD11 1 
ATOM   4855 H  HD12 . ILE A 1 312 ? 18.823  7.062   3.701   1.00 39.67  ?  425  ILE A HD12 1 
ATOM   4856 H  HD13 . ILE A 1 312 ? 17.312  7.462   3.980   1.00 39.67  ?  425  ILE A HD13 1 
ATOM   4857 N  N    . HIS A 1 313 ? 14.120  9.854   0.654   1.00 36.16  ?  426  HIS A N    1 
ATOM   4858 C  CA   . HIS A 1 313 ? 13.156  10.290  -0.374  1.00 39.26  ?  426  HIS A CA   1 
ATOM   4859 C  C    . HIS A 1 313 ? 13.721  11.529  -1.048  1.00 37.23  ?  426  HIS A C    1 
ATOM   4860 O  O    . HIS A 1 313 ? 14.241  12.450  -0.366  1.00 34.67  ?  426  HIS A O    1 
ATOM   4861 C  CB   . HIS A 1 313 ? 11.795  10.583  0.290   1.00 34.70  ?  426  HIS A CB   1 
ATOM   4862 C  CG   . HIS A 1 313 ? 11.828  11.701  1.274   1.00 38.75  ?  426  HIS A CG   1 
ATOM   4863 N  ND1  . HIS A 1 313 ? 11.536  13.016  0.925   1.00 39.86  ?  426  HIS A ND1  1 
ATOM   4864 C  CD2  . HIS A 1 313 ? 12.143  11.714  2.596   1.00 39.47  ?  426  HIS A CD2  1 
ATOM   4865 C  CE1  . HIS A 1 313 ? 11.675  13.790  1.995   1.00 38.81  ?  426  HIS A CE1  1 
ATOM   4866 N  NE2  . HIS A 1 313 ? 12.038  13.026  3.024   1.00 38.68  ?  426  HIS A NE2  1 
ATOM   4867 H  H    . HIS A 1 313 ? 14.386  10.469  1.193   1.00 43.37  ?  426  HIS A H    1 
ATOM   4868 H  HA   . HIS A 1 313 ? 13.024  9.613   -1.056  1.00 47.10  ?  426  HIS A HA   1 
ATOM   4869 H  HB2  . HIS A 1 313 ? 11.156  10.817  -0.402  1.00 41.62  ?  426  HIS A HB2  1 
ATOM   4870 H  HB3  . HIS A 1 313 ? 11.500  9.786   0.758   1.00 41.62  ?  426  HIS A HB3  1 
ATOM   4871 H  HD2  . HIS A 1 313 ? 12.383  10.980  3.114   1.00 47.35  ?  426  HIS A HD2  1 
ATOM   4872 H  HE1  . HIS A 1 313 ? 11.542  14.710  2.022   1.00 46.56  ?  426  HIS A HE1  1 
ATOM   4873 H  HE2  . HIS A 1 313 ? 12.184  13.303  3.825   1.00 46.40  ?  426  HIS A HE2  1 
ATOM   4874 N  N    . THR A 1 314 ? 13.634  11.546  -2.426  1.00 39.17  ?  427  THR A N    1 
ATOM   4875 C  CA   . THR A 1 314 ? 13.895  12.739  -3.275  1.00 41.50  ?  427  THR A CA   1 
ATOM   4876 C  C    . THR A 1 314 ? 12.779  13.087  -4.276  1.00 43.87  ?  427  THR A C    1 
ATOM   4877 O  O    . THR A 1 314 ? 12.633  14.267  -4.614  1.00 48.40  ?  427  THR A O    1 
ATOM   4878 C  CB   . THR A 1 314 ? 15.249  12.556  -4.081  1.00 38.60  ?  427  THR A CB   1 
ATOM   4879 O  OG1  . THR A 1 314 ? 15.062  11.669  -5.206  1.00 39.86  ?  427  THR A OG1  1 
ATOM   4880 C  CG2  . THR A 1 314 ? 16.417  12.049  -3.199  1.00 38.86  ?  427  THR A CG2  1 
ATOM   4881 H  H    . THR A 1 314 ? 13.418  10.855  -2.890  1.00 46.99  ?  427  THR A H    1 
ATOM   4882 H  HA   . THR A 1 314 ? 13.989  13.501  -2.683  1.00 49.78  ?  427  THR A HA   1 
ATOM   4883 H  HB   . THR A 1 314 ? 15.507  13.433  -4.406  1.00 46.31  ?  427  THR A HB   1 
ATOM   4884 H  HG1  . THR A 1 314 ? 14.786  10.921  -4.940  1.00 47.81  ?  427  THR A HG1  1 
ATOM   4885 H  HG21 . THR A 1 314 ? 17.232  11.999  -3.723  1.00 46.62  ?  427  THR A HG21 1 
ATOM   4886 H  HG22 . THR A 1 314 ? 16.559  12.655  -2.455  1.00 46.62  ?  427  THR A HG22 1 
ATOM   4887 H  HG23 . THR A 1 314 ? 16.212  11.167  -2.851  1.00 46.62  ?  427  THR A HG23 1 
ATOM   4888 N  N    . GLU A 1 315 ? 11.939  12.098  -4.760  1.00 44.09  ?  428  GLU A N    1 
ATOM   4889 C  CA   . GLU A 1 315 ? 10.770  12.245  -5.632  1.00 46.92  ?  428  GLU A CA   1 
ATOM   4890 C  C    . GLU A 1 315 ? 9.504   11.638  -5.070  1.00 44.32  ?  428  GLU A C    1 
ATOM   4891 O  O    . GLU A 1 315 ? 8.416   12.261  -5.206  1.00 45.02  ?  428  GLU A O    1 
ATOM   4892 C  CB   . GLU A 1 315 ? 11.059  11.571  -7.029  1.00 52.46  ?  428  GLU A CB   1 
ATOM   4893 C  CG   . GLU A 1 315 ? 12.405  11.974  -7.645  1.00 60.81  ?  428  GLU A CG   1 
ATOM   4894 C  CD   . GLU A 1 315 ? 12.514  13.477  -7.751  1.00 67.30  ?  428  GLU A CD   1 
ATOM   4895 O  OE1  . GLU A 1 315 ? 11.460  14.072  -7.993  1.00 73.94  ?  428  GLU A OE1  1 
ATOM   4896 O  OE2  . GLU A 1 315 ? 13.590  14.099  -7.577  1.00 70.71  ?  428  GLU A OE2  1 
ATOM   4897 H  H    . GLU A 1 315 ? 12.060  11.269  -4.564  1.00 52.90  ?  428  GLU A H    1 
ATOM   4898 H  HA   . GLU A 1 315 ? 10.612  13.193  -5.762  1.00 56.29  ?  428  GLU A HA   1 
ATOM   4899 H  HB2  . GLU A 1 315 ? 11.063  10.608  -6.915  1.00 62.93  ?  428  GLU A HB2  1 
ATOM   4900 H  HB3  . GLU A 1 315 ? 10.361  11.830  -7.650  1.00 62.93  ?  428  GLU A HB3  1 
ATOM   4901 H  HG2  . GLU A 1 315 ? 13.128  11.650  -7.085  1.00 72.96  ?  428  GLU A HG2  1 
ATOM   4902 H  HG3  . GLU A 1 315 ? 12.480  11.595  -8.535  1.00 72.96  ?  428  GLU A HG3  1 
ATOM   4903 N  N    . THR A 1 316 ? 9.563   10.495  -4.430  1.00 43.16  ?  429  THR A N    1 
ATOM   4904 C  CA   . THR A 1 316 ? 8.368   9.922   -3.813  1.00 42.30  ?  429  THR A CA   1 
ATOM   4905 C  C    . THR A 1 316 ? 8.124   10.580  -2.451  1.00 42.04  ?  429  THR A C    1 
ATOM   4906 O  O    . THR A 1 316 ? 9.068   10.779  -1.685  1.00 39.51  ?  429  THR A O    1 
ATOM   4907 C  CB   . THR A 1 316 ? 8.524   8.407   -3.635  1.00 43.15  ?  429  THR A CB   1 
ATOM   4908 O  OG1  . THR A 1 316 ? 9.012   7.826   -4.851  1.00 46.60  ?  429  THR A OG1  1 
ATOM   4909 C  CG2  . THR A 1 316 ? 7.198   7.727   -3.250  1.00 42.00  ?  429  THR A CG2  1 
ATOM   4910 H  H    . THR A 1 316 ? 10.275  10.023  -4.331  1.00 51.78  ?  429  THR A H    1 
ATOM   4911 H  HA   . THR A 1 316 ? 7.598   10.080  -4.381  1.00 50.74  ?  429  THR A HA   1 
ATOM   4912 H  HB   . THR A 1 316 ? 9.151   8.249   -2.912  1.00 51.76  ?  429  THR A HB   1 
ATOM   4913 H  HG1  . THR A 1 316 ? 9.773   8.131   -5.030  1.00 55.90  ?  429  THR A HG1  1 
ATOM   4914 H  HG21 . THR A 1 316 ? 7.329   6.770   -3.165  1.00 50.39  ?  429  THR A HG21 1 
ATOM   4915 H  HG22 . THR A 1 316 ? 6.879   8.078   -2.404  1.00 50.39  ?  429  THR A HG22 1 
ATOM   4916 H  HG23 . THR A 1 316 ? 6.530   7.894   -3.933  1.00 50.39  ?  429  THR A HG23 1 
ATOM   4917 N  N    . PRO A 1 317 ? 6.879   10.952  -2.130  1.00 42.58  ?  430  PRO A N    1 
ATOM   4918 C  CA   . PRO A 1 317 ? 6.601   11.482  -0.784  1.00 40.95  ?  430  PRO A CA   1 
ATOM   4919 C  C    . PRO A 1 317 ? 6.929   10.448  0.276   1.00 36.28  ?  430  PRO A C    1 
ATOM   4920 O  O    . PRO A 1 317 ? 6.673   9.265   0.099   1.00 37.34  ?  430  PRO A O    1 
ATOM   4921 C  CB   . PRO A 1 317 ? 5.101   11.801  -0.819  1.00 43.19  ?  430  PRO A CB   1 
ATOM   4922 C  CG   . PRO A 1 317 ? 4.750   11.920  -2.263  1.00 44.64  ?  430  PRO A CG   1 
ATOM   4923 C  CD   . PRO A 1 317 ? 5.726   11.085  -3.044  1.00 40.99  ?  430  PRO A CD   1 
ATOM   4924 H  HA   . PRO A 1 317 ? 7.098   12.299  -0.622  1.00 49.13  ?  430  PRO A HA   1 
ATOM   4925 H  HB2  . PRO A 1 317 ? 4.603   11.081  -0.402  1.00 51.81  ?  430  PRO A HB2  1 
ATOM   4926 H  HB3  . PRO A 1 317 ? 4.932   12.635  -0.354  1.00 51.81  ?  430  PRO A HB3  1 
ATOM   4927 H  HG2  . PRO A 1 317 ? 3.846   11.595  -2.400  1.00 53.56  ?  430  PRO A HG2  1 
ATOM   4928 H  HG3  . PRO A 1 317 ? 4.812   12.850  -2.531  1.00 53.56  ?  430  PRO A HG3  1 
ATOM   4929 H  HD2  . PRO A 1 317 ? 5.348   10.216  -3.251  1.00 49.17  ?  430  PRO A HD2  1 
ATOM   4930 H  HD3  . PRO A 1 317 ? 5.987   11.537  -3.862  1.00 49.17  ?  430  PRO A HD3  1 
ATOM   4931 N  N    . LEU A 1 318 ? 7.503   10.906  1.381   1.00 35.88  ?  431  LEU A N    1 
ATOM   4932 C  CA   . LEU A 1 318 ? 7.880   9.984   2.444   1.00 35.65  ?  431  LEU A CA   1 
ATOM   4933 C  C    . LEU A 1 318 ? 6.673   9.206   2.960   1.00 37.45  ?  431  LEU A C    1 
ATOM   4934 O  O    . LEU A 1 318 ? 6.807   8.037   3.346   1.00 34.80  ?  431  LEU A O    1 
ATOM   4935 C  CB   . LEU A 1 318 ? 8.567   10.740  3.580   1.00 33.04  ?  431  LEU A CB   1 
ATOM   4936 C  CG   . LEU A 1 318 ? 9.027   9.915   4.776   1.00 33.05  ?  431  LEU A CG   1 
ATOM   4937 C  CD1  . LEU A 1 318 ? 10.040  8.859   4.350   1.00 33.66  ?  431  LEU A CD1  1 
ATOM   4938 C  CD2  . LEU A 1 318 ? 9.602   10.831  5.845   1.00 32.82  ?  431  LEU A CD2  1 
ATOM   4939 H  H    . LEU A 1 318 ? 7.685   11.732  1.541   1.00 43.04  ?  431  LEU A H    1 
ATOM   4940 H  HA   . LEU A 1 318 ? 8.518   9.342   2.093   1.00 42.77  ?  431  LEU A HA   1 
ATOM   4941 H  HB2  . LEU A 1 318 ? 9.355   11.175  3.216   1.00 39.63  ?  431  LEU A HB2  1 
ATOM   4942 H  HB3  . LEU A 1 318 ? 7.946   11.405  3.916   1.00 39.63  ?  431  LEU A HB3  1 
ATOM   4943 H  HG   . LEU A 1 318 ? 8.267   9.447   5.155   1.00 39.64  ?  431  LEU A HG   1 
ATOM   4944 H  HD11 . LEU A 1 318 ? 10.386  8.416   5.141   1.00 40.38  ?  431  LEU A HD11 1 
ATOM   4945 H  HD12 . LEU A 1 318 ? 9.601   8.213   3.775   1.00 40.38  ?  431  LEU A HD12 1 
ATOM   4946 H  HD13 . LEU A 1 318 ? 10.764  9.291   3.870   1.00 40.38  ?  431  LEU A HD13 1 
ATOM   4947 H  HD21 . LEU A 1 318 ? 9.890   10.294  6.599   1.00 39.37  ?  431  LEU A HD21 1 
ATOM   4948 H  HD22 . LEU A 1 318 ? 10.357  11.314  5.475   1.00 39.37  ?  431  LEU A HD22 1 
ATOM   4949 H  HD23 . LEU A 1 318 ? 8.916   11.457  6.127   1.00 39.37  ?  431  LEU A HD23 1 
ATOM   4950 N  N    . LEU A 1 319 ? 5.486   9.819   2.951   1.00 36.60  ?  432  LEU A N    1 
ATOM   4951 C  CA   . LEU A 1 319 ? 4.296   9.137   3.439   1.00 36.32  ?  432  LEU A CA   1 
ATOM   4952 C  C    . LEU A 1 319 ? 3.962   7.934   2.571   1.00 40.58  ?  432  LEU A C    1 
ATOM   4953 O  O    . LEU A 1 319 ? 3.694   6.839   3.086   1.00 37.66  ?  432  LEU A O    1 
ATOM   4954 C  CB   . LEU A 1 319 ? 3.114   10.109  3.488   1.00 37.86  ?  432  LEU A CB   1 
ATOM   4955 C  CG   . LEU A 1 319 ? 1.870   9.645   4.241   1.00 42.87  ?  432  LEU A CG   1 
ATOM   4956 C  CD1  . LEU A 1 319 ? 2.149   9.544   5.735   1.00 42.21  ?  432  LEU A CD1  1 
ATOM   4957 C  CD2  . LEU A 1 319 ? 0.695   10.586  3.984   1.00 45.08  ?  432  LEU A CD2  1 
ATOM   4958 H  H    . LEU A 1 319 ? 5.347   10.620  2.670   1.00 43.90  ?  432  LEU A H    1 
ATOM   4959 H  HA   . LEU A 1 319 ? 4.464   8.823   4.341   1.00 43.57  ?  432  LEU A HA   1 
ATOM   4960 H  HB2  . LEU A 1 319 ? 3.416   10.926  3.916   1.00 45.41  ?  432  LEU A HB2  1 
ATOM   4961 H  HB3  . LEU A 1 319 ? 2.841   10.295  2.576   1.00 45.41  ?  432  LEU A HB3  1 
ATOM   4962 H  HG   . LEU A 1 319 ? 1.626   8.764   3.917   1.00 51.43  ?  432  LEU A HG   1 
ATOM   4963 H  HD11 . LEU A 1 319 ? 1.314   9.387   6.202   1.00 50.63  ?  432  LEU A HD11 1 
ATOM   4964 H  HD12 . LEU A 1 319 ? 2.760   8.808   5.893   1.00 50.63  ?  432  LEU A HD12 1 
ATOM   4965 H  HD13 . LEU A 1 319 ? 2.547   10.375  6.039   1.00 50.63  ?  432  LEU A HD13 1 
ATOM   4966 H  HD21 . LEU A 1 319 ? -0.079  10.266  4.473   1.00 54.08  ?  432  LEU A HD21 1 
ATOM   4967 H  HD22 . LEU A 1 319 ? 0.931   11.477  4.287   1.00 54.08  ?  432  LEU A HD22 1 
ATOM   4968 H  HD23 . LEU A 1 319 ? 0.503   10.600  3.033   1.00 54.08  ?  432  LEU A HD23 1 
ATOM   4969 N  N    . ASP A 1 320 ? 3.966   8.118   1.244   1.00 40.54  ?  433  ASP A N    1 
ATOM   4970 C  CA   . ASP A 1 320 ? 3.720   6.993   0.350   1.00 39.89  ?  433  ASP A CA   1 
ATOM   4971 C  C    . ASP A 1 320 ? 4.823   5.952   0.470   1.00 40.64  ?  433  ASP A C    1 
ATOM   4972 O  O    . ASP A 1 320 ? 4.559   4.743   0.420   1.00 38.74  ?  433  ASP A O    1 
ATOM   4973 C  CB   . ASP A 1 320 ? 3.610   7.478   -1.095  1.00 46.45  ?  433  ASP A CB   1 
ATOM   4974 C  CG   . ASP A 1 320 ? 2.450   8.416   -1.307  1.00 53.37  ?  433  ASP A CG   1 
ATOM   4975 O  OD1  . ASP A 1 320 ? 2.687   9.628   -1.475  1.00 54.75  ?  433  ASP A OD1  1 
ATOM   4976 O  OD2  . ASP A 1 320 ? 1.294   7.940   -1.281  1.00 58.86  ?  433  ASP A OD2  1 
ATOM   4977 H  H    . ASP A 1 320 ? 4.107   8.868   0.847   1.00 48.63  ?  433  ASP A H    1 
ATOM   4978 H  HA   . ASP A 1 320 ? 2.877   6.580   0.595   1.00 47.86  ?  433  ASP A HA   1 
ATOM   4979 H  HB2  . ASP A 1 320 ? 4.424   7.949   -1.333  1.00 55.73  ?  433  ASP A HB2  1 
ATOM   4980 H  HB3  . ASP A 1 320 ? 3.487   6.712   -1.677  1.00 55.73  ?  433  ASP A HB3  1 
ATOM   4981 N  N    . LEU A 1 321 ? 6.069   6.408   0.610   1.00 38.41  ?  434  LEU A N    1 
ATOM   4982 C  CA   . LEU A 1 321 ? 7.178   5.489   0.811   1.00 38.32  ?  434  LEU A CA   1 
ATOM   4983 C  C    . LEU A 1 321 ? 6.897   4.572   1.995   1.00 35.88  ?  434  LEU A C    1 
ATOM   4984 O  O    . LEU A 1 321 ? 6.919   3.346   1.865   1.00 36.45  ?  434  LEU A O    1 
ATOM   4985 C  CB   . LEU A 1 321 ? 8.482   6.278   1.022   1.00 39.65  ?  434  LEU A CB   1 
ATOM   4986 C  CG   . LEU A 1 321 ? 9.763   5.523   0.698   1.00 41.08  ?  434  LEU A CG   1 
ATOM   4987 C  CD1  . LEU A 1 321 ? 9.773   5.094   -0.789  1.00 43.66  ?  434  LEU A CD1  1 
ATOM   4988 C  CD2  . LEU A 1 321 ? 11.043  6.320   1.011   1.00 40.44  ?  434  LEU A CD2  1 
ATOM   4989 H  H    . LEU A 1 321 ? 6.294   7.237   0.593   1.00 46.08  ?  434  LEU A H    1 
ATOM   4990 H  HA   . LEU A 1 321 ? 7.293   4.940   0.020   1.00 45.97  ?  434  LEU A HA   1 
ATOM   4991 H  HB2  . LEU A 1 321 ? 8.457   7.064   0.454   1.00 47.57  ?  434  LEU A HB2  1 
ATOM   4992 H  HB3  . LEU A 1 321 ? 8.530   6.543   1.954   1.00 47.57  ?  434  LEU A HB3  1 
ATOM   4993 H  HG   . LEU A 1 321 ? 9.777   4.740   1.270   1.00 49.28  ?  434  LEU A HG   1 
ATOM   4994 H  HD11 . LEU A 1 321 ? 9.447   5.828   -1.332  1.00 52.38  ?  434  LEU A HD11 1 
ATOM   4995 H  HD12 . LEU A 1 321 ? 10.681  4.869   -1.047  1.00 52.38  ?  434  LEU A HD12 1 
ATOM   4996 H  HD13 . LEU A 1 321 ? 9.198   4.321   -0.898  1.00 52.38  ?  434  LEU A HD13 1 
ATOM   4997 H  HD21 . LEU A 1 321 ? 11.051  7.127   0.474   1.00 48.51  ?  434  LEU A HD21 1 
ATOM   4998 H  HD22 . LEU A 1 321 ? 11.049  6.549   1.953   1.00 48.51  ?  434  LEU A HD22 1 
ATOM   4999 H  HD23 . LEU A 1 321 ? 11.816  5.773   0.798   1.00 48.51  ?  434  LEU A HD23 1 
ATOM   5000 N  N    . MET A 1 322 ? 6.590   5.157   3.157   1.00 34.17  ?  435  MET A N    1 
ATOM   5001 C  CA   . MET A 1 322 ? 6.410   4.359   4.361   1.00 33.84  ?  435  MET A CA   1 
ATOM   5002 C  C    . MET A 1 322 ? 5.130   3.535   4.299   1.00 34.45  ?  435  MET A C    1 
ATOM   5003 O  O    . MET A 1 322 ? 5.069   2.449   4.880   1.00 32.61  ?  435  MET A O    1 
ATOM   5004 C  CB   . MET A 1 322 ? 6.420   5.265   5.590   1.00 31.35  ?  435  MET A CB   1 
ATOM   5005 C  CG   . MET A 1 322 ? 7.741   6.026   5.759   1.00 33.55  ?  435  MET A CG   1 
ATOM   5006 S  SD   . MET A 1 322 ? 9.194   4.929   5.664   1.00 33.93  ?  435  MET A SD   1 
ATOM   5007 C  CE   . MET A 1 322 ? 8.867   3.850   7.061   1.00 31.80  ?  435  MET A CE   1 
ATOM   5008 H  H    . MET A 1 322 ? 6.482   6.003   3.271   1.00 40.99  ?  435  MET A H    1 
ATOM   5009 H  HA   . MET A 1 322 ? 7.157   3.747   4.448   1.00 40.59  ?  435  MET A HA   1 
ATOM   5010 H  HB2  . MET A 1 322 ? 5.707   5.917   5.507   1.00 37.60  ?  435  MET A HB2  1 
ATOM   5011 H  HB3  . MET A 1 322 ? 6.283   4.723   6.382   1.00 37.60  ?  435  MET A HB3  1 
ATOM   5012 H  HG2  . MET A 1 322 ? 7.817   6.689   5.055   1.00 40.24  ?  435  MET A HG2  1 
ATOM   5013 H  HG3  . MET A 1 322 ? 7.748   6.461   6.626   1.00 40.24  ?  435  MET A HG3  1 
ATOM   5014 H  HE1  . MET A 1 322 ? 9.616   3.244   7.174   1.00 38.15  ?  435  MET A HE1  1 
ATOM   5015 H  HE2  . MET A 1 322 ? 8.757   4.391   7.859   1.00 38.15  ?  435  MET A HE2  1 
ATOM   5016 H  HE3  . MET A 1 322 ? 8.056   3.347   6.888   1.00 38.15  ?  435  MET A HE3  1 
ATOM   5017 N  N    . SER A 1 323 ? 4.111   4.018   3.589   1.00 36.09  ?  436  SER A N    1 
ATOM   5018 C  CA   . SER A 1 323 ? 2.921   3.210   3.356   1.00 38.09  ?  436  SER A CA   1 
ATOM   5019 C  C    . SER A 1 323 ? 3.274   1.935   2.600   1.00 37.34  ?  436  SER A C    1 
ATOM   5020 O  O    . SER A 1 323 ? 2.837   0.830   2.966   1.00 35.43  ?  436  SER A O    1 
ATOM   5021 C  CB   . SER A 1 323 ? 1.888   4.036   2.583   1.00 38.20  ?  436  SER A CB   1 
ATOM   5022 O  OG   . SER A 1 323 ? 0.749   3.248   2.290   1.00 43.42  ?  436  SER A OG   1 
ATOM   5023 H  H    . SER A 1 323 ? 4.083   4.802   3.236   1.00 43.29  ?  436  SER A H    1 
ATOM   5024 H  HA   . SER A 1 323 ? 2.531   2.955   4.207   1.00 45.69  ?  436  SER A HA   1 
ATOM   5025 H  HB2  . SER A 1 323 ? 1.618   4.795   3.123   1.00 45.82  ?  436  SER A HB2  1 
ATOM   5026 H  HB3  . SER A 1 323 ? 2.283   4.344   1.752   1.00 45.82  ?  436  SER A HB3  1 
ATOM   5027 H  HG   . SER A 1 323 ? 0.953   2.636   1.752   1.00 52.09  ?  436  SER A HG   1 
ATOM   5028 N  N    . ASP A 1 324 ? 4.066   2.071   1.531   1.00 38.03  ?  437  ASP A N    1 
ATOM   5029 C  CA   . ASP A 1 324 ? 4.524   0.887   0.809   1.00 37.28  ?  437  ASP A CA   1 
ATOM   5030 C  C    . ASP A 1 324 ? 5.380   -0.004  1.704   1.00 34.23  ?  437  ASP A C    1 
ATOM   5031 O  O    . ASP A 1 324 ? 5.314   -1.237  1.620   1.00 33.12  ?  437  ASP A O    1 
ATOM   5032 C  CB   . ASP A 1 324 ? 5.298   1.302   -0.437  1.00 39.59  ?  437  ASP A CB   1 
ATOM   5033 C  CG   . ASP A 1 324 ? 4.388   1.755   -1.565  1.00 43.55  ?  437  ASP A CG   1 
ATOM   5034 O  OD1  . ASP A 1 324 ? 3.153   1.605   -1.434  1.00 44.94  ?  437  ASP A OD1  1 
ATOM   5035 O  OD2  . ASP A 1 324 ? 4.908   2.256   -2.581  1.00 46.52  ?  437  ASP A OD2  1 
ATOM   5036 H  H    . ASP A 1 324 ? 4.345   2.818   1.212   1.00 45.62  ?  437  ASP A H    1 
ATOM   5037 H  HA   . ASP A 1 324 ? 3.752   0.374   0.523   1.00 44.73  ?  437  ASP A HA   1 
ATOM   5038 H  HB2  . ASP A 1 324 ? 5.888   2.039   -0.213  1.00 47.49  ?  437  ASP A HB2  1 
ATOM   5039 H  HB3  . ASP A 1 324 ? 5.817   0.546   -0.754  1.00 47.49  ?  437  ASP A HB3  1 
ATOM   5040 N  N    . ALA A 1 325 ? 6.194   0.603   2.568   1.00 33.51  ?  438  ALA A N    1 
ATOM   5041 C  CA   . ALA A 1 325 ? 6.975   -0.188  3.515   1.00 34.71  ?  438  ALA A CA   1 
ATOM   5042 C  C    . ALA A 1 325 ? 6.063   -1.038  4.392   1.00 35.27  ?  438  ALA A C    1 
ATOM   5043 O  O    . ALA A 1 325 ? 6.327   -2.225  4.622   1.00 33.69  ?  438  ALA A O    1 
ATOM   5044 C  CB   . ALA A 1 325 ? 7.859   0.733   4.367   1.00 31.00  ?  438  ALA A CB   1 
ATOM   5045 H  H    . ALA A 1 325 ? 6.311   1.453   2.626   1.00 40.19  ?  438  ALA A H    1 
ATOM   5046 H  HA   . ALA A 1 325 ? 7.561   -0.785  3.023   1.00 41.63  ?  438  ALA A HA   1 
ATOM   5047 H  HB1  . ALA A 1 325 ? 8.373   0.192   4.986   1.00 37.19  ?  438  ALA A HB1  1 
ATOM   5048 H  HB2  . ALA A 1 325 ? 8.456   1.226   3.784   1.00 37.19  ?  438  ALA A HB2  1 
ATOM   5049 H  HB3  . ALA A 1 325 ? 7.292   1.349   4.858   1.00 37.19  ?  438  ALA A HB3  1 
ATOM   5050 N  N    . LEU A 1 326 ? 4.986   -0.434  4.903   1.00 36.00  ?  439  LEU A N    1 
ATOM   5051 C  CA   . LEU A 1 326 ? 4.025   -1.177  5.719   1.00 35.38  ?  439  LEU A CA   1 
ATOM   5052 C  C    . LEU A 1 326 ? 3.371   -2.295  4.915   1.00 34.21  ?  439  LEU A C    1 
ATOM   5053 O  O    . LEU A 1 326 ? 3.206   -3.419  5.407   1.00 30.60  ?  439  LEU A O    1 
ATOM   5054 C  CB   . LEU A 1 326 ? 2.960   -0.228  6.271   1.00 34.80  ?  439  LEU A CB   1 
ATOM   5055 C  CG   . LEU A 1 326 ? 3.413   0.866   7.248   1.00 32.97  ?  439  LEU A CG   1 
ATOM   5056 C  CD1  . LEU A 1 326 ? 2.235   1.756   7.665   1.00 34.39  ?  439  LEU A CD1  1 
ATOM   5057 C  CD2  . LEU A 1 326 ? 4.077   0.244   8.470   1.00 33.29  ?  439  LEU A CD2  1 
ATOM   5058 H  H    . LEU A 1 326 ? 4.789   0.396   4.793   1.00 43.18  ?  439  LEU A H    1 
ATOM   5059 H  HA   . LEU A 1 326 ? 4.493   -1.574  6.470   1.00 42.44  ?  439  LEU A HA   1 
ATOM   5060 H  HB2  . LEU A 1 326 ? 2.547   0.223   5.518   1.00 41.74  ?  439  LEU A HB2  1 
ATOM   5061 H  HB3  . LEU A 1 326 ? 2.300   -0.764  6.739   1.00 41.74  ?  439  LEU A HB3  1 
ATOM   5062 H  HG   . LEU A 1 326 ? 4.064   1.431   6.802   1.00 39.54  ?  439  LEU A HG   1 
ATOM   5063 H  HD11 . LEU A 1 326 ? 2.555   2.435   8.280   1.00 41.26  ?  439  LEU A HD11 1 
ATOM   5064 H  HD12 . LEU A 1 326 ? 1.860   2.175   6.875   1.00 41.26  ?  439  LEU A HD12 1 
ATOM   5065 H  HD13 . LEU A 1 326 ? 1.564   1.207   8.099   1.00 41.26  ?  439  LEU A HD13 1 
ATOM   5066 H  HD21 . LEU A 1 326 ? 4.247   0.940   9.124   1.00 39.93  ?  439  LEU A HD21 1 
ATOM   5067 H  HD22 . LEU A 1 326 ? 3.485   -0.426  8.845   1.00 39.93  ?  439  LEU A HD22 1 
ATOM   5068 H  HD23 . LEU A 1 326 ? 4.913   -0.167  8.200   1.00 39.93  ?  439  LEU A HD23 1 
ATOM   5069 N  N    . ILE A 1 327 ? 3.003   -2.006  3.668   1.00 33.93  ?  440  ILE A N    1 
ATOM   5070 C  CA   . ILE A 1 327 ? 2.383   -3.022  2.823   1.00 34.83  ?  440  ILE A CA   1 
ATOM   5071 C  C    . ILE A 1 327 ? 3.326   -4.203  2.633   1.00 34.28  ?  440  ILE A C    1 
ATOM   5072 O  O    . ILE A 1 327 ? 2.915   -5.366  2.716   1.00 36.37  ?  440  ILE A O    1 
ATOM   5073 C  CB   . ILE A 1 327 ? 1.959   -2.409  1.475   1.00 35.35  ?  440  ILE A CB   1 
ATOM   5074 C  CG1  . ILE A 1 327 ? 0.854   -1.369  1.701   1.00 35.11  ?  440  ILE A CG1  1 
ATOM   5075 C  CG2  . ILE A 1 327 ? 1.478   -3.495  0.524   1.00 36.84  ?  440  ILE A CG2  1 
ATOM   5076 C  CD1  . ILE A 1 327 ? 0.336   -0.710  0.433   1.00 38.42  ?  440  ILE A CD1  1 
ATOM   5077 H  H    . ILE A 1 327 ? 3.098   -1.239  3.290   1.00 40.70  ?  440  ILE A H    1 
ATOM   5078 H  HA   . ILE A 1 327 ? 1.585   -3.347  3.268   1.00 41.78  ?  440  ILE A HA   1 
ATOM   5079 H  HB   . ILE A 1 327 ? 2.728   -1.972  1.077   1.00 42.40  ?  440  ILE A HB   1 
ATOM   5080 H  HG12 . ILE A 1 327 ? 0.102   -1.805  2.131   1.00 42.11  ?  440  ILE A HG12 1 
ATOM   5081 H  HG13 . ILE A 1 327 ? 1.202   -0.667  2.273   1.00 42.11  ?  440  ILE A HG13 1 
ATOM   5082 H  HG21 . ILE A 1 327 ? 1.136   -3.080  -0.283  1.00 44.19  ?  440  ILE A HG21 1 
ATOM   5083 H  HG22 . ILE A 1 327 ? 2.222   -4.078  0.306   1.00 44.19  ?  440  ILE A HG22 1 
ATOM   5084 H  HG23 . ILE A 1 327 ? 0.775   -4.005  0.956   1.00 44.19  ?  440  ILE A HG23 1 
ATOM   5085 H  HD11 . ILE A 1 327 ? -0.186  0.071   0.674   1.00 46.09  ?  440  ILE A HD11 1 
ATOM   5086 H  HD12 . ILE A 1 327 ? 1.091   -0.446  -0.116  1.00 46.09  ?  440  ILE A HD12 1 
ATOM   5087 H  HD13 . ILE A 1 327 ? -0.218  -1.344  -0.048  1.00 46.09  ?  440  ILE A HD13 1 
ATOM   5088 N  N    . LEU A 1 328 ? 4.603   -3.927  2.376   1.00 34.77  ?  441  LEU A N    1 
ATOM   5089 C  CA   . LEU A 1 328 ? 5.568   -4.997  2.143   1.00 33.69  ?  441  LEU A CA   1 
ATOM   5090 C  C    . LEU A 1 328 ? 5.791   -5.812  3.411   1.00 35.15  ?  441  LEU A C    1 
ATOM   5091 O  O    . LEU A 1 328 ? 5.793   -7.051  3.373   1.00 35.01  ?  441  LEU A O    1 
ATOM   5092 C  CB   . LEU A 1 328 ? 6.884   -4.417  1.642   1.00 33.35  ?  441  LEU A CB   1 
ATOM   5093 C  CG   . LEU A 1 328 ? 6.829   -3.689  0.296   1.00 35.05  ?  441  LEU A CG   1 
ATOM   5094 C  CD1  . LEU A 1 328 ? 8.121   -2.956  0.049   1.00 36.36  ?  441  LEU A CD1  1 
ATOM   5095 C  CD2  . LEU A 1 328 ? 6.541   -4.675  -0.826  1.00 36.22  ?  441  LEU A CD2  1 
ATOM   5096 H  H    . LEU A 1 328 ? 4.936   -3.135  2.332   1.00 41.71  ?  441  LEU A H    1 
ATOM   5097 H  HA   . LEU A 1 328 ? 5.221   -5.588  1.457   1.00 40.41  ?  441  LEU A HA   1 
ATOM   5098 H  HB2  . LEU A 1 328 ? 7.203   -3.780  2.300   1.00 40.01  ?  441  LEU A HB2  1 
ATOM   5099 H  HB3  . LEU A 1 328 ? 7.519   -5.144  1.550   1.00 40.01  ?  441  LEU A HB3  1 
ATOM   5100 H  HG   . LEU A 1 328 ? 6.111   -3.036  0.311   1.00 42.04  ?  441  LEU A HG   1 
ATOM   5101 H  HD11 . LEU A 1 328 ? 8.067   -2.499  -0.805  1.00 43.62  ?  441  LEU A HD11 1 
ATOM   5102 H  HD12 . LEU A 1 328 ? 8.260   -2.312  0.760   1.00 43.62  ?  441  LEU A HD12 1 
ATOM   5103 H  HD13 . LEU A 1 328 ? 8.850   -3.596  0.035   1.00 43.62  ?  441  LEU A HD13 1 
ATOM   5104 H  HD21 . LEU A 1 328 ? 6.594   -4.210  -1.676  1.00 43.45  ?  441  LEU A HD21 1 
ATOM   5105 H  HD22 . LEU A 1 328 ? 7.198   -5.387  -0.797  1.00 43.45  ?  441  LEU A HD22 1 
ATOM   5106 H  HD23 . LEU A 1 328 ? 5.651   -5.040  -0.704  1.00 43.45  ?  441  LEU A HD23 1 
ATOM   5107 N  N    . ALA A 1 329 ? 5.975   -5.132  4.551   1.00 33.49  ?  442  ALA A N    1 
ATOM   5108 C  CA   . ALA A 1 329 ? 6.129   -5.848  5.813   1.00 34.88  ?  442  ALA A CA   1 
ATOM   5109 C  C    . ALA A 1 329 ? 4.923   -6.742  6.086   1.00 35.61  ?  442  ALA A C    1 
ATOM   5110 O  O    . ALA A 1 329 ? 5.075   -7.890  6.532   1.00 34.42  ?  442  ALA A O    1 
ATOM   5111 C  CB   . ALA A 1 329 ? 6.338   -4.850  6.952   1.00 33.88  ?  442  ALA A CB   1 
ATOM   5112 H  H    . ALA A 1 329 ? 6.013   -4.275  4.617   1.00 40.17  ?  442  ALA A H    1 
ATOM   5113 H  HA   . ALA A 1 329 ? 6.915   -6.415  5.765   1.00 41.84  ?  442  ALA A HA   1 
ATOM   5114 H  HB1  . ALA A 1 329 ? 6.440   -5.338  7.785   1.00 40.64  ?  442  ALA A HB1  1 
ATOM   5115 H  HB2  . ALA A 1 329 ? 7.138   -4.330  6.774   1.00 40.64  ?  442  ALA A HB2  1 
ATOM   5116 H  HB3  . ALA A 1 329 ? 5.567   -4.264  7.004   1.00 40.64  ?  442  ALA A HB3  1 
ATOM   5117 N  N    . LYS A 1 330 ? 3.714   -6.241  5.804   1.00 36.61  ?  443  LYS A N    1 
ATOM   5118 C  CA   . LYS A 1 330 ? 2.513   -7.054  5.974   1.00 36.87  ?  443  LYS A CA   1 
ATOM   5119 C  C    . LYS A 1 330 ? 2.542   -8.275  5.058   1.00 35.27  ?  443  LYS A C    1 
ATOM   5120 O  O    . LYS A 1 330 ? 2.277   -9.401  5.495   1.00 37.81  ?  443  LYS A O    1 
ATOM   5121 C  CB   . LYS A 1 330 ? 1.272   -6.206  5.696   1.00 37.02  ?  443  LYS A CB   1 
ATOM   5122 C  CG   . LYS A 1 330 ? -0.031  -6.976  5.767   1.00 40.77  ?  443  LYS A CG   1 
ATOM   5123 C  CD   . LYS A 1 330 ? -0.242  -7.565  7.145   1.00 46.16  ?  443  LYS A CD   1 
ATOM   5124 C  CE   . LYS A 1 330 ? -1.552  -8.334  7.220   1.00 48.68  ?  443  LYS A CE   1 
ATOM   5125 N  NZ   . LYS A 1 330 ? -1.725  -8.979  8.551   1.00 53.31  ?  443  LYS A NZ   1 
ATOM   5126 H  H    . LYS A 1 330 ? 3.565   -5.444  5.518   1.00 43.92  ?  443  LYS A H    1 
ATOM   5127 H  HA   . LYS A 1 330 ? 2.472   -7.366  6.891   1.00 44.22  ?  443  LYS A HA   1 
ATOM   5128 H  HB2  . LYS A 1 330 ? 1.229   -5.493  6.352   1.00 44.40  ?  443  LYS A HB2  1 
ATOM   5129 H  HB3  . LYS A 1 330 ? 1.345   -5.832  4.804   1.00 44.40  ?  443  LYS A HB3  1 
ATOM   5130 H  HG2  . LYS A 1 330 ? -0.770  -6.379  5.573   1.00 48.91  ?  443  LYS A HG2  1 
ATOM   5131 H  HG3  . LYS A 1 330 ? -0.012  -7.702  5.124   1.00 48.91  ?  443  LYS A HG3  1 
ATOM   5132 H  HD2  . LYS A 1 330 ? 0.483   -8.175  7.350   1.00 55.38  ?  443  LYS A HD2  1 
ATOM   5133 H  HD3  . LYS A 1 330 ? -0.269  -6.850  7.800   1.00 55.38  ?  443  LYS A HD3  1 
ATOM   5134 H  HE2  . LYS A 1 330 ? -2.292  -7.724  7.077   1.00 58.40  ?  443  LYS A HE2  1 
ATOM   5135 H  HE3  . LYS A 1 330 ? -1.558  -9.027  6.541   1.00 58.40  ?  443  LYS A HE3  1 
ATOM   5136 H  HZ1  . LYS A 1 330 ? -1.058  -9.548  8.702   1.00 63.96  ?  443  LYS A HZ1  1 
ATOM   5137 H  HZ2  . LYS A 1 330 ? -1.728  -8.360  9.191   1.00 63.96  ?  443  LYS A HZ2  1 
ATOM   5138 H  HZ3  . LYS A 1 330 ? -2.495  -9.424  8.576   1.00 63.96  ?  443  LYS A HZ3  1 
ATOM   5139 N  N    . SER A 1 331 ? 2.846   -8.065  3.776   1.00 36.02  ?  444  SER A N    1 
ATOM   5140 C  CA   . SER A 1 331 ? 2.913   -9.169  2.831   1.00 36.41  ?  444  SER A CA   1 
ATOM   5141 C  C    . SER A 1 331 ? 3.949   -10.207 3.235   1.00 38.95  ?  444  SER A C    1 
ATOM   5142 O  O    . SER A 1 331 ? 3.851   -11.366 2.816   1.00 38.40  ?  444  SER A O    1 
ATOM   5143 C  CB   . SER A 1 331 ? 3.238   -8.654  1.430   1.00 38.98  ?  444  SER A CB   1 
ATOM   5144 O  OG   . SER A 1 331 ? 4.588   -8.223  1.347   1.00 40.22  ?  444  SER A OG   1 
ATOM   5145 H  H    . SER A 1 331 ? 3.016   -7.296  3.432   1.00 43.21  ?  444  SER A H    1 
ATOM   5146 H  HA   . SER A 1 331 ? 2.043   -9.597  2.802   1.00 43.68  ?  444  SER A HA   1 
ATOM   5147 H  HB2  . SER A 1 331 ? 3.096   -9.369  0.791   1.00 46.77  ?  444  SER A HB2  1 
ATOM   5148 H  HB3  . SER A 1 331 ? 2.656   -7.906  1.227   1.00 46.77  ?  444  SER A HB3  1 
ATOM   5149 H  HG   . SER A 1 331 ? 4.736   -7.629  1.923   1.00 48.24  ?  444  SER A HG   1 
ATOM   5150 N  N    . LYS A 1 332 ? 4.940   -9.825  4.028   1.00 37.17  ?  445  LYS A N    1 
ATOM   5151 C  CA   . LYS A 1 332 ? 5.986   -10.747 4.444   1.00 38.42  ?  445  LYS A CA   1 
ATOM   5152 C  C    . LYS A 1 332 ? 5.691   -11.393 5.787   1.00 37.81  ?  445  LYS A C    1 
ATOM   5153 O  O    . LYS A 1 332 ? 6.560   -12.079 6.336   1.00 35.78  ?  445  LYS A O    1 
ATOM   5154 C  CB   . LYS A 1 332 ? 7.336   -10.019 4.481   1.00 39.34  ?  445  LYS A CB   1 
ATOM   5155 C  CG   . LYS A 1 332 ? 7.898   -9.742  3.102   1.00 38.41  ?  445  LYS A CG   1 
ATOM   5156 C  CD   . LYS A 1 332 ? 8.998   -8.697  3.143   1.00 42.81  ?  445  LYS A CD   1 
ATOM   5157 C  CE   . LYS A 1 332 ? 9.588   -8.471  1.763   1.00 43.32  ?  445  LYS A CE   1 
ATOM   5158 N  NZ   . LYS A 1 332 ? 10.369  -9.652  1.310   1.00 50.23  ?  445  LYS A NZ   1 
ATOM   5159 H  H    . LYS A 1 332 ? 5.027   -9.028  4.341   1.00 44.59  ?  445  LYS A H    1 
ATOM   5160 H  HA   . LYS A 1 332 ? 6.059   -11.460 3.791   1.00 46.09  ?  445  LYS A HA   1 
ATOM   5161 H  HB2  . LYS A 1 332 ? 7.223   -9.169  4.934   1.00 47.19  ?  445  LYS A HB2  1 
ATOM   5162 H  HB3  . LYS A 1 332 ? 7.977   -10.567 4.961   1.00 47.19  ?  445  LYS A HB3  1 
ATOM   5163 H  HG2  . LYS A 1 332 ? 8.270   -10.560 2.737   1.00 46.08  ?  445  LYS A HG2  1 
ATOM   5164 H  HG3  . LYS A 1 332 ? 7.189   -9.415  2.526   1.00 46.08  ?  445  LYS A HG3  1 
ATOM   5165 H  HD2  . LYS A 1 332 ? 8.633   -7.856  3.462   1.00 51.36  ?  445  LYS A HD2  1 
ATOM   5166 H  HD3  . LYS A 1 332 ? 9.707   -8.996  3.734   1.00 51.36  ?  445  LYS A HD3  1 
ATOM   5167 H  HE2  . LYS A 1 332 ? 8.871   -8.317  1.128   1.00 51.96  ?  445  LYS A HE2  1 
ATOM   5168 H  HE3  . LYS A 1 332 ? 10.180  -7.703  1.788   1.00 51.96  ?  445  LYS A HE3  1 
ATOM   5169 H  HZ1  . LYS A 1 332 ? 10.720  -9.495  0.507   1.00 60.26  ?  445  LYS A HZ1  1 
ATOM   5170 H  HZ2  . LYS A 1 332 ? 11.028  -9.820  1.885   1.00 60.26  ?  445  LYS A HZ2  1 
ATOM   5171 H  HZ3  . LYS A 1 332 ? 9.840   -10.366 1.260   1.00 60.26  ?  445  LYS A HZ3  1 
ATOM   5172 N  N    . GLY A 1 333 ? 4.489   -11.194 6.320   1.00 36.97  ?  446  GLY A N    1 
ATOM   5173 C  CA   . GLY A 1 333 ? 4.053   -11.881 7.515   1.00 34.99  ?  446  GLY A CA   1 
ATOM   5174 C  C    . GLY A 1 333 ? 4.429   -11.237 8.827   1.00 35.02  ?  446  GLY A C    1 
ATOM   5175 O  O    . GLY A 1 333 ? 4.297   -11.890 9.873   1.00 34.19  ?  446  GLY A O    1 
ATOM   5176 H  H    . GLY A 1 333 ? 3.902   -10.654 5.997   1.00 44.35  ?  446  GLY A H    1 
ATOM   5177 H  HA2  . GLY A 1 333 ? 3.085   -11.950 7.492   1.00 41.98  ?  446  GLY A HA2  1 
ATOM   5178 H  HA3  . GLY A 1 333 ? 4.433   -12.774 7.510   1.00 41.98  ?  446  GLY A HA3  1 
ATOM   5179 N  N    . PHE A 1 334 ? 4.892   -9.988  8.819   1.00 31.45  ?  447  PHE A N    1 
ATOM   5180 C  CA   . PHE A 1 334 ? 5.246   -9.327  10.069  1.00 33.67  ?  447  PHE A CA   1 
ATOM   5181 C  C    . PHE A 1 334 ? 3.989   -9.008  10.873  1.00 32.35  ?  447  PHE A C    1 
ATOM   5182 O  O    . PHE A 1 334 ? 2.942   -8.679  10.313  1.00 33.89  ?  447  PHE A O    1 
ATOM   5183 C  CB   . PHE A 1 334 ? 6.034   -8.041  9.796   1.00 33.21  ?  447  PHE A CB   1 
ATOM   5184 C  CG   . PHE A 1 334 ? 7.458   -8.286  9.339   1.00 30.67  ?  447  PHE A CG   1 
ATOM   5185 C  CD1  . PHE A 1 334 ? 8.459   -8.532  10.264  1.00 33.71  ?  447  PHE A CD1  1 
ATOM   5186 C  CD2  . PHE A 1 334 ? 7.783   -8.269  8.000   1.00 32.41  ?  447  PHE A CD2  1 
ATOM   5187 C  CE1  . PHE A 1 334 ? 9.766   -8.769  9.856   1.00 35.42  ?  447  PHE A CE1  1 
ATOM   5188 C  CE2  . PHE A 1 334 ? 9.096   -8.493  7.582   1.00 35.55  ?  447  PHE A CE2  1 
ATOM   5189 C  CZ   . PHE A 1 334 ? 10.089  -8.739  8.513   1.00 32.04  ?  447  PHE A CZ   1 
ATOM   5190 H  H    . PHE A 1 334 ? 5.008   -9.509  8.114   1.00 37.73  ?  447  PHE A H    1 
ATOM   5191 H  HA   . PHE A 1 334 ? 5.810   -9.915  10.594  1.00 40.39  ?  447  PHE A HA   1 
ATOM   5192 H  HB2  . PHE A 1 334 ? 5.581   -7.539  9.101   1.00 39.83  ?  447  PHE A HB2  1 
ATOM   5193 H  HB3  . PHE A 1 334 ? 6.070   -7.518  10.613  1.00 39.83  ?  447  PHE A HB3  1 
ATOM   5194 H  HD1  . PHE A 1 334 ? 8.253   -8.539  11.171  1.00 40.43  ?  447  PHE A HD1  1 
ATOM   5195 H  HD2  . PHE A 1 334 ? 7.121   -8.107  7.368   1.00 38.87  ?  447  PHE A HD2  1 
ATOM   5196 H  HE1  . PHE A 1 334 ? 10.425  -8.947  10.488  1.00 42.49  ?  447  PHE A HE1  1 
ATOM   5197 H  HE2  . PHE A 1 334 ? 9.304   -8.477  6.676   1.00 42.65  ?  447  PHE A HE2  1 
ATOM   5198 H  HZ   . PHE A 1 334 ? 10.965  -8.884  8.238   1.00 38.44  ?  447  PHE A HZ   1 
ATOM   5199 N  N    . ASP A 1 335 ? 4.102   -9.108  12.196  1.00 31.45  ?  448  ASP A N    1 
ATOM   5200 C  CA   . ASP A 1 335 ? 3.007   -8.779  13.096  1.00 31.84  ?  448  ASP A CA   1 
ATOM   5201 C  C    . ASP A 1 335 ? 2.958   -7.294  13.445  1.00 33.21  ?  448  ASP A C    1 
ATOM   5202 O  O    . ASP A 1 335 ? 1.885   -6.782  13.781  1.00 31.79  ?  448  ASP A O    1 
ATOM   5203 C  CB   . ASP A 1 335 ? 3.128   -9.588  14.386  1.00 32.67  ?  448  ASP A CB   1 
ATOM   5204 C  CG   . ASP A 1 335 ? 3.016   -11.084 14.147  1.00 35.13  ?  448  ASP A CG   1 
ATOM   5205 O  OD1  . ASP A 1 335 ? 2.088   -11.498 13.421  1.00 34.61  ?  448  ASP A OD1  1 
ATOM   5206 O  OD2  . ASP A 1 335 ? 3.863   -11.834 14.678  1.00 33.13  ?  448  ASP A OD2  1 
ATOM   5207 H  H    . ASP A 1 335 ? 4.814   -9.368  12.601  1.00 37.72  ?  448  ASP A H    1 
ATOM   5208 H  HA   . ASP A 1 335 ? 2.170   -9.016  12.666  1.00 38.20  ?  448  ASP A HA   1 
ATOM   5209 H  HB2  . ASP A 1 335 ? 3.992   -9.412  14.791  1.00 39.19  ?  448  ASP A HB2  1 
ATOM   5210 H  HB3  . ASP A 1 335 ? 2.418   -9.326  14.993  1.00 39.19  ?  448  ASP A HB3  1 
ATOM   5211 N  N    . VAL A 1 336 ? 4.095   -6.600  13.383  1.00 30.56  ?  449  VAL A N    1 
ATOM   5212 C  CA   . VAL A 1 336 ? 4.169   -5.196  13.765  1.00 31.20  ?  449  VAL A CA   1 
ATOM   5213 C  C    . VAL A 1 336 ? 5.337   -4.556  13.033  1.00 29.77  ?  449  VAL A C    1 
ATOM   5214 O  O    . VAL A 1 336 ? 6.323   -5.223  12.702  1.00 26.25  ?  449  VAL A O    1 
ATOM   5215 C  CB   . VAL A 1 336 ? 4.311   -5.030  15.300  1.00 32.64  ?  449  VAL A CB   1 
ATOM   5216 C  CG1  . VAL A 1 336 ? 5.698   -5.469  15.762  1.00 32.60  ?  449  VAL A CG1  1 
ATOM   5217 C  CG2  . VAL A 1 336 ? 4.043   -3.574  15.711  1.00 33.62  ?  449  VAL A CG2  1 
ATOM   5218 H  H    . VAL A 1 336 ? 4.845   -6.927  13.119  1.00 36.66  ?  449  VAL A H    1 
ATOM   5219 H  HA   . VAL A 1 336 ? 3.351   -4.759  13.480  1.00 37.43  ?  449  VAL A HA   1 
ATOM   5220 H  HB   . VAL A 1 336 ? 3.655   -5.596  15.737  1.00 39.15  ?  449  VAL A HB   1 
ATOM   5221 H  HG11 . VAL A 1 336 ? 5.686   -5.596  16.723  1.00 39.11  ?  449  VAL A HG11 1 
ATOM   5222 H  HG12 . VAL A 1 336 ? 5.929   -6.301  15.321  1.00 39.11  ?  449  VAL A HG12 1 
ATOM   5223 H  HG13 . VAL A 1 336 ? 6.341   -4.781  15.528  1.00 39.11  ?  449  VAL A HG13 1 
ATOM   5224 H  HG21 . VAL A 1 336 ? 4.037   -3.516  16.679  1.00 40.33  ?  449  VAL A HG21 1 
ATOM   5225 H  HG22 . VAL A 1 336 ? 4.745   -3.010  15.350  1.00 40.33  ?  449  VAL A HG22 1 
ATOM   5226 H  HG23 . VAL A 1 336 ? 3.183   -3.299  15.357  1.00 40.33  ?  449  VAL A HG23 1 
ATOM   5227 N  N    . PHE A 1 337 ? 5.227   -3.245  12.800  1.00 29.65  ?  450  PHE A N    1 
ATOM   5228 C  CA   . PHE A 1 337 ? 6.271   -2.435  12.172  1.00 29.56  ?  450  PHE A CA   1 
ATOM   5229 C  C    . PHE A 1 337 ? 6.656   -1.322  13.136  1.00 29.36  ?  450  PHE A C    1 
ATOM   5230 O  O    . PHE A 1 337 ? 5.833   -0.459  13.452  1.00 30.80  ?  450  PHE A O    1 
ATOM   5231 C  CB   . PHE A 1 337 ? 5.762   -1.855  10.848  1.00 31.67  ?  450  PHE A CB   1 
ATOM   5232 C  CG   . PHE A 1 337 ? 6.823   -1.200  10.013  1.00 29.41  ?  450  PHE A CG   1 
ATOM   5233 C  CD1  . PHE A 1 337 ? 7.172   0.120   10.219  1.00 29.35  ?  450  PHE A CD1  1 
ATOM   5234 C  CD2  . PHE A 1 337 ? 7.455   -1.902  9.006   1.00 31.21  ?  450  PHE A CD2  1 
ATOM   5235 C  CE1  . PHE A 1 337 ? 8.134   0.724   9.451   1.00 32.09  ?  450  PHE A CE1  1 
ATOM   5236 C  CE2  . PHE A 1 337 ? 8.436   -1.291  8.225   1.00 28.12  ?  450  PHE A CE2  1 
ATOM   5237 C  CZ   . PHE A 1 337 ? 8.768   0.013   8.451   1.00 31.45  ?  450  PHE A CZ   1 
ATOM   5238 H  H    . PHE A 1 337 ? 4.528   -2.788  13.007  1.00 35.56  ?  450  PHE A H    1 
ATOM   5239 H  HA   . PHE A 1 337 ? 7.059   -2.972  11.995  1.00 35.46  ?  450  PHE A HA   1 
ATOM   5240 H  HB2  . PHE A 1 337 ? 5.376   -2.573  10.323  1.00 37.99  ?  450  PHE A HB2  1 
ATOM   5241 H  HB3  . PHE A 1 337 ? 5.087   -1.186  11.042  1.00 37.99  ?  450  PHE A HB3  1 
ATOM   5242 H  HD1  . PHE A 1 337 ? 6.748   0.607   10.889  1.00 35.20  ?  450  PHE A HD1  1 
ATOM   5243 H  HD2  . PHE A 1 337 ? 7.224   -2.789  8.847   1.00 37.43  ?  450  PHE A HD2  1 
ATOM   5244 H  HE1  . PHE A 1 337 ? 8.360   1.614   9.603   1.00 38.49  ?  450  PHE A HE1  1 
ATOM   5245 H  HE2  . PHE A 1 337 ? 8.863   -1.771  7.552   1.00 33.73  ?  450  PHE A HE2  1 
ATOM   5246 H  HZ   . PHE A 1 337 ? 9.422   0.424   7.932   1.00 37.73  ?  450  PHE A HZ   1 
ATOM   5247 N  N    . ASN A 1 338 ? 7.890   -1.341  13.611  1.00 28.81  ?  451  ASN A N    1 
ATOM   5248 C  CA   . ASN A 1 338 ? 8.357   -0.399  14.615  1.00 26.13  ?  451  ASN A CA   1 
ATOM   5249 C  C    . ASN A 1 338 ? 9.185   0.698   13.966  1.00 29.95  ?  451  ASN A C    1 
ATOM   5250 O  O    . ASN A 1 338 ? 9.820   0.493   12.922  1.00 27.67  ?  451  ASN A O    1 
ATOM   5251 C  CB   . ASN A 1 338 ? 9.198   -1.108  15.674  1.00 28.31  ?  451  ASN A CB   1 
ATOM   5252 C  CG   . ASN A 1 338 ? 8.451   -2.251  16.324  1.00 27.49  ?  451  ASN A CG   1 
ATOM   5253 O  OD1  . ASN A 1 338 ? 7.246   -2.197  16.482  1.00 30.72  ?  451  ASN A OD1  1 
ATOM   5254 N  ND2  . ASN A 1 338 ? 9.177   -3.294  16.689  1.00 32.36  ?  451  ASN A ND2  1 
ATOM   5255 H  H    . ASN A 1 338 ? 8.489   -1.904  13.361  1.00 34.56  ?  451  ASN A H    1 
ATOM   5256 H  HA   . ASN A 1 338 ? 7.593   0.010   15.051  1.00 31.34  ?  451  ASN A HA   1 
ATOM   5257 H  HB2  . ASN A 1 338 ? 9.997   -1.467  15.258  1.00 33.96  ?  451  ASN A HB2  1 
ATOM   5258 H  HB3  . ASN A 1 338 ? 9.441   -0.473  16.366  1.00 33.96  ?  451  ASN A HB3  1 
ATOM   5259 H  HD21 . ASN A 1 338 ? 8.800   -3.970  17.063  1.00 38.81  ?  451  ASN A HD21 1 
ATOM   5260 H  HD22 . ASN A 1 338 ? 10.026  -3.296  16.551  1.00 38.81  ?  451  ASN A HD22 1 
ATOM   5261 N  N    . ALA A 1 339 ? 9.177   1.870   14.597  1.00 27.05  ?  452  ALA A N    1 
ATOM   5262 C  CA   . ALA A 1 339 ? 9.982   2.974   14.098  1.00 29.57  ?  452  ALA A CA   1 
ATOM   5263 C  C    . ALA A 1 339 ? 10.215  3.966   15.223  1.00 30.51  ?  452  ALA A C    1 
ATOM   5264 O  O    . ALA A 1 339 ? 9.344   4.158   16.065  1.00 30.29  ?  452  ALA A O    1 
ATOM   5265 C  CB   . ALA A 1 339 ? 9.307   3.673   12.912  1.00 29.05  ?  452  ALA A CB   1 
ATOM   5266 H  H    . ALA A 1 339 ? 8.722   2.045   15.305  1.00 32.44  ?  452  ALA A H    1 
ATOM   5267 H  HA   . ALA A 1 339 ? 10.841  2.634   13.804  1.00 35.47  ?  452  ALA A HA   1 
ATOM   5268 H  HB1  . ALA A 1 339 ? 9.873   4.400   12.609  1.00 34.85  ?  452  ALA A HB1  1 
ATOM   5269 H  HB2  . ALA A 1 339 ? 9.183   3.030   12.196  1.00 34.85  ?  452  ALA A HB2  1 
ATOM   5270 H  HB3  . ALA A 1 339 ? 8.447   4.020   13.197  1.00 34.85  ?  452  ALA A HB3  1 
ATOM   5271 N  N    . LEU A 1 340 ? 11.387  4.586   15.225  1.00 29.61  ?  453  LEU A N    1 
ATOM   5272 C  CA   . LEU A 1 340 ? 11.687  5.624   16.176  1.00 28.99  ?  453  LEU A CA   1 
ATOM   5273 C  C    . LEU A 1 340 ? 11.164  6.957   15.658  1.00 30.19  ?  453  LEU A C    1 
ATOM   5274 O  O    . LEU A 1 340 ? 10.755  7.089   14.490  1.00 28.47  ?  453  LEU A O    1 
ATOM   5275 C  CB   . LEU A 1 340 ? 13.187  5.713   16.422  1.00 29.86  ?  453  LEU A CB   1 
ATOM   5276 C  CG   . LEU A 1 340 ? 13.813  4.548   17.163  1.00 30.76  ?  453  LEU A CG   1 
ATOM   5277 C  CD1  . LEU A 1 340 ? 15.327  4.538   16.975  1.00 29.71  ?  453  LEU A CD1  1 
ATOM   5278 C  CD2  . LEU A 1 340 ? 13.456  4.616   18.635  1.00 32.74  ?  453  LEU A CD2  1 
ATOM   5279 H  H    . LEU A 1 340 ? 12.028  4.416   14.678  1.00 35.51  ?  453  LEU A H    1 
ATOM   5280 H  HA   . LEU A 1 340 ? 11.258  5.421   17.021  1.00 34.78  ?  453  LEU A HA   1 
ATOM   5281 H  HB2  . LEU A 1 340 ? 13.630  5.778   15.562  1.00 35.81  ?  453  LEU A HB2  1 
ATOM   5282 H  HB3  . LEU A 1 340 ? 13.360  6.511   16.945  1.00 35.81  ?  453  LEU A HB3  1 
ATOM   5283 H  HG   . LEU A 1 340 ? 13.467  3.716   16.802  1.00 36.89  ?  453  LEU A HG   1 
ATOM   5284 H  HD11 . LEU A 1 340 ? 15.700  3.786   17.460  1.00 35.63  ?  453  LEU A HD11 1 
ATOM   5285 H  HD12 . LEU A 1 340 ? 15.527  4.454   16.029  1.00 35.63  ?  453  LEU A HD12 1 
ATOM   5286 H  HD13 . LEU A 1 340 ? 15.693  5.368   17.318  1.00 35.63  ?  453  LEU A HD13 1 
ATOM   5287 H  HD21 . LEU A 1 340 ? 14.043  4.024   19.131  1.00 39.27  ?  453  LEU A HD21 1 
ATOM   5288 H  HD22 . LEU A 1 340 ? 13.567  5.528   18.945  1.00 39.27  ?  453  LEU A HD22 1 
ATOM   5289 H  HD23 . LEU A 1 340 ? 12.533  4.337   18.749  1.00 39.27  ?  453  LEU A HD23 1 
ATOM   5290 N  N    . ASP A 1 341 ? 11.180  7.985   16.530  1.00 31.52  ?  454  ASP A N    1 
ATOM   5291 C  CA   . ASP A 1 341 ? 10.699  9.295   16.096  1.00 31.37  ?  454  ASP A CA   1 
ATOM   5292 C  C    . ASP A 1 341 ? 11.845  10.179  15.647  1.00 33.30  ?  454  ASP A C    1 
ATOM   5293 O  O    . ASP A 1 341 ? 11.677  11.439  15.558  1.00 33.45  ?  454  ASP A O    1 
ATOM   5294 C  CB   . ASP A 1 341 ? 9.907   9.987   17.248  1.00 30.70  ?  454  ASP A CB   1 
ATOM   5295 C  CG   . ASP A 1 341 ? 10.696  10.238  18.473  1.00 31.68  ?  454  ASP A CG   1 
ATOM   5296 O  OD1  . ASP A 1 341 ? 11.886  9.889   18.506  1.00 30.12  ?  454  ASP A OD1  1 
ATOM   5297 O  OD2  . ASP A 1 341 ? 10.182  10.794  19.476  1.00 36.26  ?  454  ASP A OD2  1 
ATOM   5298 H  H    . ASP A 1 341 ? 11.455  7.940   17.343  1.00 37.81  ?  454  ASP A H    1 
ATOM   5299 H  HA   . ASP A 1 341 ? 10.084  9.185   15.353  1.00 37.63  ?  454  ASP A HA   1 
ATOM   5300 H  HB2  . ASP A 1 341 ? 9.582   10.844  16.929  1.00 36.82  ?  454  ASP A HB2  1 
ATOM   5301 H  HB3  . ASP A 1 341 ? 9.159   9.419   17.494  1.00 36.82  ?  454  ASP A HB3  1 
ATOM   5302 N  N    . LEU A 1 342 ? 12.990  9.573   15.296  1.00 29.09  ?  455  LEU A N    1 
ATOM   5303 C  CA   . LEU A 1 342 ? 14.054  10.329  14.691  1.00 31.38  ?  455  LEU A CA   1 
ATOM   5304 C  C    . LEU A 1 342 ? 13.812  10.526  13.197  1.00 30.52  ?  455  LEU A C    1 
ATOM   5305 O  O    . LEU A 1 342 ? 12.766  10.190  12.615  1.00 31.70  ?  455  LEU A O    1 
ATOM   5306 C  CB   . LEU A 1 342 ? 15.383  9.634   14.953  1.00 29.54  ?  455  LEU A CB   1 
ATOM   5307 C  CG   . LEU A 1 342 ? 15.529  8.161   14.549  1.00 30.03  ?  455  LEU A CG   1 
ATOM   5308 C  CD1  . LEU A 1 342 ? 15.349  8.007   13.041  1.00 32.88  ?  455  LEU A CD1  1 
ATOM   5309 C  CD2  . LEU A 1 342 ? 16.886  7.591   14.975  1.00 32.99  ?  455  LEU A CD2  1 
ATOM   5310 H  H    . LEU A 1 342 ? 13.156  8.736   15.403  1.00 34.89  ?  455  LEU A H    1 
ATOM   5311 H  HA   . LEU A 1 342 ? 14.077  11.211  15.093  1.00 37.64  ?  455  LEU A HA   1 
ATOM   5312 H  HB2  . LEU A 1 342 ? 16.069  10.122  14.471  1.00 35.44  ?  455  LEU A HB2  1 
ATOM   5313 H  HB3  . LEU A 1 342 ? 15.553  9.677   15.907  1.00 35.44  ?  455  LEU A HB3  1 
ATOM   5314 H  HG   . LEU A 1 342 ? 14.840  7.652   15.005  1.00 36.02  ?  455  LEU A HG   1 
ATOM   5315 H  HD11 . LEU A 1 342 ? 15.783  7.190   12.753  1.00 39.44  ?  455  LEU A HD11 1 
ATOM   5316 H  HD12 . LEU A 1 342 ? 14.401  7.967   12.839  1.00 39.44  ?  455  LEU A HD12 1 
ATOM   5317 H  HD13 . LEU A 1 342 ? 15.750  8.770   12.596  1.00 39.44  ?  455  LEU A HD13 1 
ATOM   5318 H  HD21 . LEU A 1 342 ? 16.924  6.653   14.731  1.00 39.57  ?  455  LEU A HD21 1 
ATOM   5319 H  HD22 . LEU A 1 342 ? 17.590  8.080   14.520  1.00 39.57  ?  455  LEU A HD22 1 
ATOM   5320 H  HD23 . LEU A 1 342 ? 16.982  7.688   15.935  1.00 39.57  ?  455  LEU A HD23 1 
ATOM   5321 N  N    . MET A 1 343 ? 14.836  11.140  12.585  1.00 32.53  ?  456  MET A N    1 
ATOM   5322 C  CA   . MET A 1 343 ? 14.980  11.668  11.211  1.00 30.60  ?  456  MET A CA   1 
ATOM   5323 C  C    . MET A 1 343 ? 13.693  12.482  10.938  1.00 32.23  ?  456  MET A C    1 
ATOM   5324 O  O    . MET A 1 343 ? 13.330  13.350  11.739  1.00 31.63  ?  456  MET A O    1 
ATOM   5325 C  CB   . MET A 1 343 ? 15.312  10.575  10.225  1.00 30.42  ?  456  MET A CB   1 
ATOM   5326 C  CG   . MET A 1 343 ? 16.814  10.124  10.234  1.00 33.38  ?  456  MET A CG   1 
ATOM   5327 S  SD   . MET A 1 343 ? 17.261  8.872   9.016   1.00 34.65  ?  456  MET A SD   1 
ATOM   5328 C  CE   . MET A 1 343 ? 16.593  7.421   9.798   1.00 33.05  ?  456  MET A CE   1 
ATOM   5329 H  H    . MET A 1 343 ? 15.571  11.285  13.008  1.00 39.02  ?  456  MET A H    1 
ATOM   5330 H  HA   . MET A 1 343 ? 15.743  12.266  11.185  1.00 36.71  ?  456  MET A HA   1 
ATOM   5331 H  HB2  . MET A 1 343 ? 14.772  9.797   10.434  1.00 36.49  ?  456  MET A HB2  1 
ATOM   5332 H  HB3  . MET A 1 343 ? 15.107  10.892  9.332   1.00 36.49  ?  456  MET A HB3  1 
ATOM   5333 H  HG2  . MET A 1 343 ? 17.367  10.903  10.063  1.00 40.04  ?  456  MET A HG2  1 
ATOM   5334 H  HG3  . MET A 1 343 ? 17.017  9.759   11.110  1.00 40.04  ?  456  MET A HG3  1 
ATOM   5335 H  HE1  . MET A 1 343 ? 16.767  6.650   9.236   1.00 39.64  ?  456  MET A HE1  1 
ATOM   5336 H  HE2  . MET A 1 343 ? 17.019  7.303   10.662  1.00 39.64  ?  456  MET A HE2  1 
ATOM   5337 H  HE3  . MET A 1 343 ? 15.637  7.536   9.915   1.00 39.64  ?  456  MET A HE3  1 
ATOM   5338 N  N    . GLU A 1 344 ? 13.004  12.210  9.818   1.00 32.32  ?  457  GLU A N    1 
ATOM   5339 C  CA   . GLU A 1 344 ? 11.729  12.893  9.586   1.00 32.46  ?  457  GLU A CA   1 
ATOM   5340 C  C    . GLU A 1 344 ? 10.529  12.012  9.925   1.00 33.02  ?  457  GLU A C    1 
ATOM   5341 O  O    . GLU A 1 344 ? 9.436   12.227  9.388   1.00 32.37  ?  457  GLU A O    1 
ATOM   5342 C  CB   . GLU A 1 344 ? 11.641  13.341  8.127   1.00 34.17  ?  457  GLU A CB   1 
ATOM   5343 C  CG   . GLU A 1 344 ? 12.811  14.175  7.640   1.00 34.54  ?  457  GLU A CG   1 
ATOM   5344 C  CD   . GLU A 1 344 ? 12.682  14.521  6.162   1.00 39.23  ?  457  GLU A CD   1 
ATOM   5345 O  OE1  . GLU A 1 344 ? 11.988  15.503  5.834   1.00 42.22  ?  457  GLU A OE1  1 
ATOM   5346 O  OE2  . GLU A 1 344 ? 13.247  13.795  5.327   1.00 40.14  ?  457  GLU A OE2  1 
ATOM   5347 H  H    . GLU A 1 344 ? 13.249  11.657  9.207   1.00 38.77  ?  457  GLU A H    1 
ATOM   5348 H  HA   . GLU A 1 344 ? 11.694  13.678  10.155  1.00 38.93  ?  457  GLU A HA   1 
ATOM   5349 H  HB2  . GLU A 1 344 ? 11.593  12.551  7.566   1.00 40.98  ?  457  GLU A HB2  1 
ATOM   5350 H  HB3  . GLU A 1 344 ? 10.839  13.875  8.018   1.00 40.98  ?  457  GLU A HB3  1 
ATOM   5351 H  HG2  . GLU A 1 344 ? 12.846  15.003  8.144   1.00 41.43  ?  457  GLU A HG2  1 
ATOM   5352 H  HG3  . GLU A 1 344 ? 13.634  13.676  7.764   1.00 41.43  ?  457  GLU A HG3  1 
ATOM   5353 N  N    . ASN A 1 345 ? 10.706  11.016  10.802  1.00 31.09  ?  458  ASN A N    1 
ATOM   5354 C  CA   . ASN A 1 345 ? 9.652   10.035  11.014  1.00 29.12  ?  458  ASN A CA   1 
ATOM   5355 C  C    . ASN A 1 345 ? 8.407   10.660  11.639  1.00 30.25  ?  458  ASN A C    1 
ATOM   5356 O  O    . ASN A 1 345 ? 7.294   10.207  11.366  1.00 30.60  ?  458  ASN A O    1 
ATOM   5357 C  CB   . ASN A 1 345 ? 10.177  8.887   11.878  1.00 30.88  ?  458  ASN A CB   1 
ATOM   5358 C  CG   . ASN A 1 345 ? 11.146  7.988   11.124  1.00 31.40  ?  458  ASN A CG   1 
ATOM   5359 O  OD1  . ASN A 1 345 ? 11.463  8.234   9.956   1.00 30.74  ?  458  ASN A OD1  1 
ATOM   5360 N  ND2  . ASN A 1 345 ? 11.625  6.944   11.788  1.00 30.53  ?  458  ASN A ND2  1 
ATOM   5361 H  H    . ASN A 1 345 ? 11.413  10.891  11.275  1.00 37.29  ?  458  ASN A H    1 
ATOM   5362 H  HA   . ASN A 1 345 ? 9.390   9.667   10.156  1.00 34.93  ?  458  ASN A HA   1 
ATOM   5363 H  HB2  . ASN A 1 345 ? 10.642  9.255   12.646  1.00 37.04  ?  458  ASN A HB2  1 
ATOM   5364 H  HB3  . ASN A 1 345 ? 9.429   8.344   12.172  1.00 37.04  ?  458  ASN A HB3  1 
ATOM   5365 H  HD21 . ASN A 1 345 ? 12.176  6.407   11.404  1.00 36.62  ?  458  ASN A HD21 1 
ATOM   5366 H  HD22 . ASN A 1 345 ? 11.385  6.805   12.602  1.00 36.62  ?  458  ASN A HD22 1 
ATOM   5367 N  N    . LYS A 1 346 ? 8.562   11.708  12.454  1.00 30.14  ?  459  LYS A N    1 
ATOM   5368 C  CA   . LYS A 1 346 ? 7.395   12.332  13.070  1.00 32.63  ?  459  LYS A CA   1 
ATOM   5369 C  C    . LYS A 1 346 ? 6.402   12.839  12.030  1.00 32.00  ?  459  LYS A C    1 
ATOM   5370 O  O    . LYS A 1 346 ? 5.249   13.096  12.370  1.00 34.46  ?  459  LYS A O    1 
ATOM   5371 C  CB   . LYS A 1 346 ? 7.817   13.488  13.982  1.00 36.05  ?  459  LYS A CB   1 
ATOM   5372 C  CG   . LYS A 1 346 ? 8.443   13.052  15.299  1.00 37.83  ?  459  LYS A CG   1 
ATOM   5373 C  CD   . LYS A 1 346 ? 9.057   14.225  16.047  1.00 43.14  ?  459  LYS A CD   1 
ATOM   5374 C  CE   . LYS A 1 346 ? 9.523   13.814  17.438  1.00 44.88  ?  459  LYS A CE   1 
ATOM   5375 N  NZ   . LYS A 1 346 ? 10.246  14.905  18.152  1.00 48.50  ?  459  LYS A NZ   1 
ATOM   5376 H  H    . LYS A 1 346 ? 9.315   12.068  12.661  1.00 36.15  ?  459  LYS A H    1 
ATOM   5377 H  HA   . LYS A 1 346 ? 6.951   11.668  13.620  1.00 39.14  ?  459  LYS A HA   1 
ATOM   5378 H  HB2  . LYS A 1 346 ? 8.470   14.030  13.512  1.00 43.24  ?  459  LYS A HB2  1 
ATOM   5379 H  HB3  . LYS A 1 346 ? 7.033   14.019  14.191  1.00 43.24  ?  459  LYS A HB3  1 
ATOM   5380 H  HG2  . LYS A 1 346 ? 7.759   12.657  15.863  1.00 45.38  ?  459  LYS A HG2  1 
ATOM   5381 H  HG3  . LYS A 1 346 ? 9.143   12.404  15.123  1.00 45.38  ?  459  LYS A HG3  1 
ATOM   5382 H  HD2  . LYS A 1 346 ? 9.824   14.555  15.553  1.00 51.75  ?  459  LYS A HD2  1 
ATOM   5383 H  HD3  . LYS A 1 346 ? 8.395   14.928  16.142  1.00 51.75  ?  459  LYS A HD3  1 
ATOM   5384 H  HE2  . LYS A 1 346 ? 8.751   13.568  17.970  1.00 53.84  ?  459  LYS A HE2  1 
ATOM   5385 H  HE3  . LYS A 1 346 ? 10.126  13.058  17.358  1.00 53.84  ?  459  LYS A HE3  1 
ATOM   5386 H  HZ1  . LYS A 1 346 ? 9.713   15.611  18.248  1.00 58.18  ?  459  LYS A HZ1  1 
ATOM   5387 H  HZ2  . LYS A 1 346 ? 10.501  14.624  18.957  1.00 58.18  ?  459  LYS A HZ2  1 
ATOM   5388 H  HZ3  . LYS A 1 346 ? 10.966  15.147  17.689  1.00 58.18  ?  459  LYS A HZ3  1 
ATOM   5389 N  N    . THR A 1 347 ? 6.822   13.006  10.774  1.00 34.08  ?  460  THR A N    1 
ATOM   5390 C  CA   . THR A 1 347 ? 5.922   13.540  9.763   1.00 33.61  ?  460  THR A CA   1 
ATOM   5391 C  C    . THR A 1 347 ? 4.915   12.512  9.259   1.00 34.15  ?  460  THR A C    1 
ATOM   5392 O  O    . THR A 1 347 ? 3.919   12.904  8.645   1.00 35.72  ?  460  THR A O    1 
ATOM   5393 C  CB   . THR A 1 347 ? 6.714   14.103  8.576   1.00 31.84  ?  460  THR A CB   1 
ATOM   5394 O  OG1  . THR A 1 347 ? 7.311   13.035  7.830   1.00 37.22  ?  460  THR A OG1  1 
ATOM   5395 C  CG2  . THR A 1 347 ? 7.808   15.059  9.051   1.00 34.20  ?  460  THR A CG2  1 
ATOM   5396 H  H    . THR A 1 347 ? 7.612   12.819  10.489  1.00 40.88  ?  460  THR A H    1 
ATOM   5397 H  HA   . THR A 1 347 ? 5.426   14.272  10.161  1.00 40.32  ?  460  THR A HA   1 
ATOM   5398 H  HB   . THR A 1 347 ? 6.108   14.596  8.001   1.00 38.19  ?  460  THR A HB   1 
ATOM   5399 H  HG1  . THR A 1 347 ? 7.833   12.597  8.322   1.00 44.65  ?  460  THR A HG1  1 
ATOM   5400 H  HG21 . THR A 1 347 ? 8.223   15.493  8.290   1.00 41.03  ?  460  THR A HG21 1 
ATOM   5401 H  HG22 . THR A 1 347 ? 7.427   15.737  9.631   1.00 41.03  ?  460  THR A HG22 1 
ATOM   5402 H  HG23 . THR A 1 347 ? 8.486   14.569  9.543   1.00 41.03  ?  460  THR A HG23 1 
ATOM   5403 N  N    . PHE A 1 348 ? 5.142   11.211  9.500   1.00 32.67  ?  461  PHE A N    1 
ATOM   5404 C  CA   . PHE A 1 348 ? 4.222   10.172  9.052   1.00 31.13  ?  461  PHE A CA   1 
ATOM   5405 C  C    . PHE A 1 348 ? 3.707   9.267   10.167  1.00 34.78  ?  461  PHE A C    1 
ATOM   5406 O  O    . PHE A 1 348 ? 2.744   8.531   9.936   1.00 34.77  ?  461  PHE A O    1 
ATOM   5407 C  CB   . PHE A 1 348 ? 4.863   9.287   7.962   1.00 32.57  ?  461  PHE A CB   1 
ATOM   5408 C  CG   . PHE A 1 348 ? 6.027   8.430   8.448   1.00 32.51  ?  461  PHE A CG   1 
ATOM   5409 C  CD1  . PHE A 1 348 ? 5.806   7.279   9.185   1.00 33.90  ?  461  PHE A CD1  1 
ATOM   5410 C  CD2  . PHE A 1 348 ? 7.335   8.772   8.133   1.00 33.97  ?  461  PHE A CD2  1 
ATOM   5411 C  CE1  . PHE A 1 348 ? 6.866   6.495   9.624   1.00 32.69  ?  461  PHE A CE1  1 
ATOM   5412 C  CE2  . PHE A 1 348 ? 8.397   7.993   8.569   1.00 32.13  ?  461  PHE A CE2  1 
ATOM   5413 C  CZ   . PHE A 1 348 ? 8.161   6.858   9.313   1.00 31.39  ?  461  PHE A CZ   1 
ATOM   5414 H  H    . PHE A 1 348 ? 5.827   10.911  9.924   1.00 39.19  ?  461  PHE A H    1 
ATOM   5415 H  HA   . PHE A 1 348 ? 3.458   10.618  8.655   1.00 37.35  ?  461  PHE A HA   1 
ATOM   5416 H  HB2  . PHE A 1 348 ? 4.185   8.688   7.612   1.00 39.06  ?  461  PHE A HB2  1 
ATOM   5417 H  HB3  . PHE A 1 348 ? 5.196   9.860   7.255   1.00 39.06  ?  461  PHE A HB3  1 
ATOM   5418 H  HD1  . PHE A 1 348 ? 4.935   7.027   9.389   1.00 40.67  ?  461  PHE A HD1  1 
ATOM   5419 H  HD2  . PHE A 1 348 ? 7.502   9.532   7.625   1.00 40.74  ?  461  PHE A HD2  1 
ATOM   5420 H  HE1  . PHE A 1 348 ? 6.703   5.729   10.126  1.00 39.22  ?  461  PHE A HE1  1 
ATOM   5421 H  HE2  . PHE A 1 348 ? 9.270   8.238   8.358   1.00 38.55  ?  461  PHE A HE2  1 
ATOM   5422 H  HZ   . PHE A 1 348 ? 8.873   6.336   9.604   1.00 37.65  ?  461  PHE A HZ   1 
ATOM   5423 N  N    . LEU A 1 349 ? 4.304   9.295   11.359  1.00 33.52  ?  462  LEU A N    1 
ATOM   5424 C  CA   . LEU A 1 349 ? 3.954   8.318   12.385  1.00 31.68  ?  462  LEU A CA   1 
ATOM   5425 C  C    . LEU A 1 349 ? 2.447   8.322   12.653  1.00 35.66  ?  462  LEU A C    1 
ATOM   5426 O  O    . LEU A 1 349 ? 1.779   7.302   12.491  1.00 33.69  ?  462  LEU A O    1 
ATOM   5427 C  CB   . LEU A 1 349 ? 4.754   8.594   13.667  1.00 34.08  ?  462  LEU A CB   1 
ATOM   5428 C  CG   . LEU A 1 349 ? 6.247   8.228   13.608  1.00 31.51  ?  462  LEU A CG   1 
ATOM   5429 C  CD1  . LEU A 1 349 ? 6.986   8.533   14.914  1.00 34.87  ?  462  LEU A CD1  1 
ATOM   5430 C  CD2  . LEU A 1 349 ? 6.417   6.748   13.241  1.00 33.74  ?  462  LEU A CD2  1 
ATOM   5431 H  H    . LEU A 1 349 ? 4.906   9.862   11.595  1.00 40.21  ?  462  LEU A H    1 
ATOM   5432 H  HA   . LEU A 1 349 ? 4.198   7.432   12.074  1.00 38.00  ?  462  LEU A HA   1 
ATOM   5433 H  HB2  . LEU A 1 349 ? 4.696   9.542   13.864  1.00 40.88  ?  462  LEU A HB2  1 
ATOM   5434 H  HB3  . LEU A 1 349 ? 4.359   8.080   14.389  1.00 40.88  ?  462  LEU A HB3  1 
ATOM   5435 H  HG   . LEU A 1 349 ? 6.654   8.781   12.923  1.00 37.79  ?  462  LEU A HG   1 
ATOM   5436 H  HD11 . LEU A 1 349 ? 7.753   7.944   14.987  1.00 41.83  ?  462  LEU A HD11 1 
ATOM   5437 H  HD12 . LEU A 1 349 ? 7.279   9.457   14.903  1.00 41.83  ?  462  LEU A HD12 1 
ATOM   5438 H  HD13 . LEU A 1 349 ? 6.384   8.385   15.659  1.00 41.83  ?  462  LEU A HD13 1 
ATOM   5439 H  HD21 . LEU A 1 349 ? 7.342   6.493   13.379  1.00 40.47  ?  462  LEU A HD21 1 
ATOM   5440 H  HD22 . LEU A 1 349 ? 5.838   6.214   13.808  1.00 40.47  ?  462  LEU A HD22 1 
ATOM   5441 H  HD23 . LEU A 1 349 ? 6.174   6.624   12.311  1.00 40.47  ?  462  LEU A HD23 1 
ATOM   5442 N  N    . GLU A 1 350 ? 1.877   9.476   13.016  1.00 36.18  ?  463  GLU A N    1 
ATOM   5443 C  CA   . GLU A 1 350 ? 0.457   9.502   13.348  1.00 37.28  ?  463  GLU A CA   1 
ATOM   5444 C  C    . GLU A 1 350 ? -0.412  9.252   12.123  1.00 32.80  ?  463  GLU A C    1 
ATOM   5445 O  O    . GLU A 1 350 ? -1.406  8.530   12.205  1.00 32.12  ?  463  GLU A O    1 
ATOM   5446 C  CB   . GLU A 1 350 ? 0.086   10.834  14.004  1.00 41.62  ?  463  GLU A CB   1 
ATOM   5447 C  CG   . GLU A 1 350 ? 0.489   10.918  15.466  1.00 48.67  ?  463  GLU A CG   1 
ATOM   5448 C  CD   . GLU A 1 350 ? -0.262  12.002  16.217  1.00 56.91  ?  463  GLU A CD   1 
ATOM   5449 O  OE1  . GLU A 1 350 ? -0.240  13.164  15.764  1.00 60.36  ?  463  GLU A OE1  1 
ATOM   5450 O  OE2  . GLU A 1 350 ? -0.888  11.682  17.252  1.00 58.67  ?  463  GLU A OE2  1 
ATOM   5451 H  H    . GLU A 1 350 ? 2.280   10.234  13.076  1.00 43.40  ?  463  GLU A H    1 
ATOM   5452 H  HA   . GLU A 1 350 ? 0.284   8.795   13.988  1.00 44.72  ?  463  GLU A HA   1 
ATOM   5453 H  HB2  . GLU A 1 350 ? 0.532   11.552  13.530  1.00 49.93  ?  463  GLU A HB2  1 
ATOM   5454 H  HB3  . GLU A 1 350 ? -0.876  10.950  13.954  1.00 49.93  ?  463  GLU A HB3  1 
ATOM   5455 H  HG2  . GLU A 1 350 ? 0.301   10.069  15.896  1.00 58.39  ?  463  GLU A HG2  1 
ATOM   5456 H  HG3  . GLU A 1 350 ? 1.437   11.115  15.522  1.00 58.39  ?  463  GLU A HG3  1 
ATOM   5457 N  N    . LYS A 1 351 ? -0.051  9.819   10.975  1.00 31.36  ?  464  LYS A N    1 
ATOM   5458 C  CA   . LYS A 1 351 ? -0.878  9.667   9.785   1.00 30.96  ?  464  LYS A CA   1 
ATOM   5459 C  C    . LYS A 1 351 ? -1.001  8.204   9.378   1.00 35.82  ?  464  LYS A C    1 
ATOM   5460 O  O    . LYS A 1 351 ? -2.074  7.758   8.953   1.00 35.59  ?  464  LYS A O    1 
ATOM   5461 C  CB   . LYS A 1 351 ? -0.309  10.499  8.634   1.00 35.74  ?  464  LYS A CB   1 
ATOM   5462 C  CG   . LYS A 1 351 ? -0.395  11.999  8.839   1.00 39.10  ?  464  LYS A CG   1 
ATOM   5463 C  CD   . LYS A 1 351 ? -0.040  12.738  7.552   1.00 44.81  ?  464  LYS A CD   1 
ATOM   5464 C  CE   . LYS A 1 351 ? -0.049  14.246  7.737   1.00 46.15  ?  464  LYS A CE   1 
ATOM   5465 N  NZ   . LYS A 1 351 ? -1.414  14.760  7.973   1.00 52.08  ?  464  LYS A NZ   1 
ATOM   5466 H  H    . LYS A 1 351 ? 0.659   10.291  10.858  1.00 37.62  ?  464  LYS A H    1 
ATOM   5467 H  HA   . LYS A 1 351 ? -1.768  9.999   9.983   1.00 37.14  ?  464  LYS A HA   1 
ATOM   5468 H  HB2  . LYS A 1 351 ? 0.628   10.272  8.523   1.00 42.87  ?  464  LYS A HB2  1 
ATOM   5469 H  HB3  . LYS A 1 351 ? -0.800  10.285  7.826   1.00 42.87  ?  464  LYS A HB3  1 
ATOM   5470 H  HG2  . LYS A 1 351 ? -1.299  12.240  9.095   1.00 46.91  ?  464  LYS A HG2  1 
ATOM   5471 H  HG3  . LYS A 1 351 ? 0.229   12.268  9.531   1.00 46.91  ?  464  LYS A HG3  1 
ATOM   5472 H  HD2  . LYS A 1 351 ? 0.848   12.474  7.267   1.00 53.75  ?  464  LYS A HD2  1 
ATOM   5473 H  HD3  . LYS A 1 351 ? -0.689  12.514  6.867   1.00 53.75  ?  464  LYS A HD3  1 
ATOM   5474 H  HE2  . LYS A 1 351 ? 0.501   14.478  8.502   1.00 55.36  ?  464  LYS A HE2  1 
ATOM   5475 H  HE3  . LYS A 1 351 ? 0.302   14.668  6.937   1.00 55.36  ?  464  LYS A HE3  1 
ATOM   5476 H  HZ1  . LYS A 1 351 ? -1.938  14.563  7.280   1.00 62.48  ?  464  LYS A HZ1  1 
ATOM   5477 H  HZ2  . LYS A 1 351 ? -1.756  14.391  8.707   1.00 62.48  ?  464  LYS A HZ2  1 
ATOM   5478 H  HZ3  . LYS A 1 351 ? -1.393  15.644  8.076   1.00 62.48  ?  464  LYS A HZ3  1 
ATOM   5479 N  N    . LEU A 1 352 ? 0.080   7.435   9.501   1.00 35.46  ?  465  LEU A N    1 
ATOM   5480 C  CA   . LEU A 1 352 ? 0.068   6.024   9.118   1.00 33.68  ?  465  LEU A CA   1 
ATOM   5481 C  C    . LEU A 1 352 ? -0.399  5.115   10.243  1.00 34.69  ?  465  LEU A C    1 
ATOM   5482 O  O    . LEU A 1 352 ? -0.221  3.895   10.162  1.00 34.35  ?  465  LEU A O    1 
ATOM   5483 C  CB   . LEU A 1 352 ? 1.462   5.595   8.642   1.00 37.72  ?  465  LEU A CB   1 
ATOM   5484 C  CG   . LEU A 1 352 ? 1.963   6.329   7.395   1.00 37.50  ?  465  LEU A CG   1 
ATOM   5485 C  CD1  . LEU A 1 352 ? 3.259   5.716   6.875   1.00 33.36  ?  465  LEU A CD1  1 
ATOM   5486 C  CD2  . LEU A 1 352 ? 0.903   6.330   6.299   1.00 38.05  ?  465  LEU A CD2  1 
ATOM   5487 H  H    . LEU A 1 352 ? 0.836   7.710   9.806   1.00 42.53  ?  465  LEU A H    1 
ATOM   5488 H  HA   . LEU A 1 352 ? -0.545  5.911   8.375   1.00 40.41  ?  465  LEU A HA   1 
ATOM   5489 H  HB2  . LEU A 1 352 ? 2.096   5.763   9.357   1.00 45.25  ?  465  LEU A HB2  1 
ATOM   5490 H  HB3  . LEU A 1 352 ? 1.438   4.647   8.435   1.00 45.25  ?  465  LEU A HB3  1 
ATOM   5491 H  HG   . LEU A 1 352 ? 2.145   7.249   7.642   1.00 44.98  ?  465  LEU A HG   1 
ATOM   5492 H  HD11 . LEU A 1 352 ? 3.536   6.193   6.078   1.00 40.02  ?  465  LEU A HD11 1 
ATOM   5493 H  HD12 . LEU A 1 352 ? 3.941   5.791   7.561   1.00 40.02  ?  465  LEU A HD12 1 
ATOM   5494 H  HD13 . LEU A 1 352 ? 3.104   4.782   6.665   1.00 40.02  ?  465  LEU A HD13 1 
ATOM   5495 H  HD21 . LEU A 1 352 ? 1.320   6.576   5.458   1.00 45.65  ?  465  LEU A HD21 1 
ATOM   5496 H  HD22 . LEU A 1 352 ? 0.519   5.442   6.230   1.00 45.65  ?  465  LEU A HD22 1 
ATOM   5497 H  HD23 . LEU A 1 352 ? 0.213   6.972   6.527   1.00 45.65  ?  465  LEU A HD23 1 
ATOM   5498 N  N    . LYS A 1 353 ? -0.996  5.688   11.287  1.00 35.71  ?  466  LYS A N    1 
ATOM   5499 C  CA   . LYS A 1 353 ? -1.628  4.940   12.374  1.00 35.92  ?  466  LYS A CA   1 
ATOM   5500 C  C    . LYS A 1 353 ? -0.611  4.211   13.246  1.00 34.10  ?  466  LYS A C    1 
ATOM   5501 O  O    . LYS A 1 353 ? -0.916  3.166   13.810  1.00 34.07  ?  466  LYS A O    1 
ATOM   5502 C  CB   . LYS A 1 353 ? -2.672  3.957   11.838  1.00 35.16  ?  466  LYS A CB   1 
ATOM   5503 C  CG   . LYS A 1 353 ? -3.786  4.618   11.050  1.00 35.59  ?  466  LYS A CG   1 
ATOM   5504 C  CD   . LYS A 1 353 ? -4.866  3.612   10.648  1.00 40.59  ?  466  LYS A CD   1 
ATOM   5505 C  CE   . LYS A 1 353 ? -6.039  4.304   9.967   1.00 45.79  ?  466  LYS A CE   1 
ATOM   5506 N  NZ   . LYS A 1 353 ? -5.655  4.920   8.672   1.00 48.33  ?  466  LYS A NZ   1 
ATOM   5507 H  H    . LYS A 1 353 ? -1.049  6.540   11.391  1.00 42.83  ?  466  LYS A H    1 
ATOM   5508 H  HA   . LYS A 1 353 ? -2.083  5.576   12.947  1.00 43.09  ?  466  LYS A HA   1 
ATOM   5509 H  HB2  . LYS A 1 353 ? -2.231  3.322   11.252  1.00 42.17  ?  466  LYS A HB2  1 
ATOM   5510 H  HB3  . LYS A 1 353 ? -3.076  3.491   12.588  1.00 42.17  ?  466  LYS A HB3  1 
ATOM   5511 H  HG2  . LYS A 1 353 ? -4.199  5.306   11.594  1.00 42.69  ?  466  LYS A HG2  1 
ATOM   5512 H  HG3  . LYS A 1 353 ? -3.418  5.009   10.242  1.00 42.69  ?  466  LYS A HG3  1 
ATOM   5513 H  HD2  . LYS A 1 353 ? -4.490  2.966   10.029  1.00 48.69  ?  466  LYS A HD2  1 
ATOM   5514 H  HD3  . LYS A 1 353 ? -5.195  3.159   11.440  1.00 48.69  ?  466  LYS A HD3  1 
ATOM   5515 H  HE2  . LYS A 1 353 ? -6.737  3.653   9.797   1.00 54.94  ?  466  LYS A HE2  1 
ATOM   5516 H  HE3  . LYS A 1 353 ? -6.374  5.006   10.547  1.00 54.94  ?  466  LYS A HE3  1 
ATOM   5517 H  HZ1  . LYS A 1 353 ? -5.021  5.531   8.802   1.00 57.98  ?  466  LYS A HZ1  1 
ATOM   5518 H  HZ2  . LYS A 1 353 ? -5.346  4.296   8.118   1.00 57.98  ?  466  LYS A HZ2  1 
ATOM   5519 H  HZ3  . LYS A 1 353 ? -6.362  5.313   8.300   1.00 57.98  ?  466  LYS A HZ3  1 
ATOM   5520 N  N    . PHE A 1 354 ? 0.597   4.756   13.375  1.00 31.74  ?  467  PHE A N    1 
ATOM   5521 C  CA   . PHE A 1 354 ? 1.491   4.290   14.426  1.00 32.40  ?  467  PHE A CA   1 
ATOM   5522 C  C    . PHE A 1 354 ? 0.930   4.707   15.785  1.00 32.24  ?  467  PHE A C    1 
ATOM   5523 O  O    . PHE A 1 354 ? 0.292   5.743   15.916  1.00 30.85  ?  467  PHE A O    1 
ATOM   5524 C  CB   . PHE A 1 354 ? 2.899   4.876   14.256  1.00 30.88  ?  467  PHE A CB   1 
ATOM   5525 C  CG   . PHE A 1 354 ? 3.710   4.239   13.164  1.00 29.15  ?  467  PHE A CG   1 
ATOM   5526 C  CD1  . PHE A 1 354 ? 3.410   4.461   11.833  1.00 31.80  ?  467  PHE A CD1  1 
ATOM   5527 C  CD2  . PHE A 1 354 ? 4.812   3.449   13.475  1.00 27.43  ?  467  PHE A CD2  1 
ATOM   5528 C  CE1  . PHE A 1 354 ? 4.174   3.900   10.833  1.00 31.02  ?  467  PHE A CE1  1 
ATOM   5529 C  CE2  . PHE A 1 354 ? 5.575   2.885   12.482  1.00 28.76  ?  467  PHE A CE2  1 
ATOM   5530 C  CZ   . PHE A 1 354 ? 5.266   3.112   11.158  1.00 30.40  ?  467  PHE A CZ   1 
ATOM   5531 H  H    . PHE A 1 354 ? 0.916   5.381   12.878  1.00 38.07  ?  467  PHE A H    1 
ATOM   5532 H  HA   . PHE A 1 354 ? 1.568   3.324   14.384  1.00 38.86  ?  467  PHE A HA   1 
ATOM   5533 H  HB2  . PHE A 1 354 ? 2.818   5.820   14.048  1.00 37.05  ?  467  PHE A HB2  1 
ATOM   5534 H  HB3  . PHE A 1 354 ? 3.385   4.760   15.087  1.00 37.05  ?  467  PHE A HB3  1 
ATOM   5535 H  HD1  . PHE A 1 354 ? 2.683   4.996   11.610  1.00 38.14  ?  467  PHE A HD1  1 
ATOM   5536 H  HD2  . PHE A 1 354 ? 5.034   3.301   14.366  1.00 32.90  ?  467  PHE A HD2  1 
ATOM   5537 H  HE1  . PHE A 1 354 ? 3.957   4.050   9.942   1.00 37.21  ?  467  PHE A HE1  1 
ATOM   5538 H  HE2  . PHE A 1 354 ? 6.302   2.349   12.703  1.00 34.50  ?  467  PHE A HE2  1 
ATOM   5539 H  HZ   . PHE A 1 354 ? 5.788   2.738   10.485  1.00 36.46  ?  467  PHE A HZ   1 
ATOM   5540 N  N    . GLY A 1 355 ? 1.195   3.901   16.798  1.00 31.74  ?  468  GLY A N    1 
ATOM   5541 C  CA   . GLY A 1 355 ? 0.850   4.239   18.172  1.00 30.64  ?  468  GLY A CA   1 
ATOM   5542 C  C    . GLY A 1 355 ? 2.112   4.378   18.996  1.00 31.45  ?  468  GLY A C    1 
ATOM   5543 O  O    . GLY A 1 355 ? 3.075   3.632   18.799  1.00 30.44  ?  468  GLY A O    1 
ATOM   5544 H  H    . GLY A 1 355 ? 1.583   3.138   16.716  1.00 38.07  ?  468  GLY A H    1 
ATOM   5545 H  HA2  . GLY A 1 355 ? 0.362   5.077   18.196  1.00 36.75  ?  468  GLY A HA2  1 
ATOM   5546 H  HA3  . GLY A 1 355 ? 0.296   3.541   18.556  1.00 36.75  ?  468  GLY A HA3  1 
ATOM   5547 N  N    . ILE A 1 356 ? 2.106   5.340   19.917  1.00 31.41  ?  469  ILE A N    1 
ATOM   5548 C  CA   . ILE A 1 356 ? 3.319   5.646   20.666  1.00 32.72  ?  469  ILE A CA   1 
ATOM   5549 C  C    . ILE A 1 356 ? 3.668   4.458   21.551  1.00 29.24  ?  469  ILE A C    1 
ATOM   5550 O  O    . ILE A 1 356 ? 2.785   3.798   22.118  1.00 29.55  ?  469  ILE A O    1 
ATOM   5551 C  CB   . ILE A 1 356 ? 3.145   6.937   21.487  1.00 31.13  ?  469  ILE A CB   1 
ATOM   5552 C  CG1  . ILE A 1 356 ? 4.505   7.426   21.993  1.00 33.37  ?  469  ILE A CG1  1 
ATOM   5553 C  CG2  . ILE A 1 356 ? 2.194   6.715   22.654  1.00 33.05  ?  469  ILE A CG2  1 
ATOM   5554 C  CD1  . ILE A 1 356 ? 4.452   8.740   22.740  1.00 39.58  ?  469  ILE A CD1  1 
ATOM   5555 H  H    . ILE A 1 356 ? 1.425   5.822   20.123  1.00 37.68  ?  469  ILE A H    1 
ATOM   5556 H  HA   . ILE A 1 356 ? 4.050   5.795   20.046  1.00 39.25  ?  469  ILE A HA   1 
ATOM   5557 H  HB   . ILE A 1 356 ? 2.761   7.614   20.909  1.00 37.34  ?  469  ILE A HB   1 
ATOM   5558 H  HG12 . ILE A 1 356 ? 4.871   6.760   22.595  1.00 40.03  ?  469  ILE A HG12 1 
ATOM   5559 H  HG13 . ILE A 1 356 ? 5.095   7.544   21.232  1.00 40.03  ?  469  ILE A HG13 1 
ATOM   5560 H  HG21 . ILE A 1 356 ? 1.905   7.576   22.994  1.00 39.65  ?  469  ILE A HG21 1 
ATOM   5561 H  HG22 . ILE A 1 356 ? 1.428   6.207   22.345  1.00 39.65  ?  469  ILE A HG22 1 
ATOM   5562 H  HG23 . ILE A 1 356 ? 2.658   6.223   23.350  1.00 39.65  ?  469  ILE A HG23 1 
ATOM   5563 H  HD11 . ILE A 1 356 ? 5.357   9.028   22.938  1.00 47.48  ?  469  ILE A HD11 1 
ATOM   5564 H  HD12 . ILE A 1 356 ? 4.008   9.401   22.186  1.00 47.48  ?  469  ILE A HD12 1 
ATOM   5565 H  HD13 . ILE A 1 356 ? 3.957   8.614   23.565  1.00 47.48  ?  469  ILE A HD13 1 
ATOM   5566 N  N    . GLY A 1 357 ? 4.968   4.145   21.642  1.00 29.06  ?  470  GLY A N    1 
ATOM   5567 C  CA   . GLY A 1 357 ? 5.413   3.036   22.456  1.00 28.87  ?  470  GLY A CA   1 
ATOM   5568 C  C    . GLY A 1 357 ? 5.693   3.464   23.890  1.00 32.38  ?  470  GLY A C    1 
ATOM   5569 O  O    . GLY A 1 357 ? 5.692   4.647   24.203  1.00 31.75  ?  470  GLY A O    1 
ATOM   5570 H  H    . GLY A 1 357 ? 5.602   4.565   21.239  1.00 34.85  ?  470  GLY A H    1 
ATOM   5571 H  HA2  . GLY A 1 357 ? 4.728   2.349   22.468  1.00 34.63  ?  470  GLY A HA2  1 
ATOM   5572 H  HA3  . GLY A 1 357 ? 6.226   2.664   22.080  1.00 34.63  ?  470  GLY A HA3  1 
ATOM   5573 N  N    . ASP A 1 358 ? 5.938   2.473   24.754  1.00 30.30  ?  471  ASP A N    1 
ATOM   5574 C  CA   . ASP A 1 358 ? 6.297   2.738   26.145  1.00 32.39  ?  471  ASP A CA   1 
ATOM   5575 C  C    . ASP A 1 358 ? 7.814   2.766   26.386  1.00 35.53  ?  471  ASP A C    1 
ATOM   5576 O  O    . ASP A 1 358 ? 8.242   2.842   27.538  1.00 37.37  ?  471  ASP A O    1 
ATOM   5577 C  CB   . ASP A 1 358 ? 5.633   1.712   27.083  1.00 32.45  ?  471  ASP A CB   1 
ATOM   5578 C  CG   . ASP A 1 358 ? 6.253   0.310   26.985  1.00 34.51  ?  471  ASP A CG   1 
ATOM   5579 O  OD1  . ASP A 1 358 ? 5.971   -0.540  27.871  1.00 34.86  ?  471  ASP A OD1  1 
ATOM   5580 O  OD2  . ASP A 1 358 ? 7.002   0.052   26.030  1.00 32.54  ?  471  ASP A OD2  1 
ATOM   5581 H  H    . ASP A 1 358 ? 5.901   1.638   24.552  1.00 36.35  ?  471  ASP A H    1 
ATOM   5582 H  HA   . ASP A 1 358 ? 5.950   3.614   26.378  1.00 38.85  ?  471  ASP A HA   1 
ATOM   5583 H  HB2  . ASP A 1 358 ? 5.728   2.016   27.999  1.00 38.92  ?  471  ASP A HB2  1 
ATOM   5584 H  HB3  . ASP A 1 358 ? 4.694   1.638   26.853  1.00 38.92  ?  471  ASP A HB3  1 
ATOM   5585 N  N    . GLY A 1 359 ? 8.623   2.726   25.340  1.00 33.72  ?  472  GLY A N    1 
ATOM   5586 C  CA   . GLY A 1 359 ? 10.073  2.665   25.481  1.00 35.61  ?  472  GLY A CA   1 
ATOM   5587 C  C    . GLY A 1 359 ? 10.762  3.866   24.869  1.00 35.50  ?  472  GLY A C    1 
ATOM   5588 O  O    . GLY A 1 359 ? 10.369  4.334   23.803  1.00 33.67  ?  472  GLY A O    1 
ATOM   5589 H  H    . GLY A 1 359 ? 8.353   2.733   24.524  1.00 40.45  ?  472  GLY A H    1 
ATOM   5590 H  HA2  . GLY A 1 359 ? 10.304  2.628   26.423  1.00 42.71  ?  472  GLY A HA2  1 
ATOM   5591 H  HA3  . GLY A 1 359 ? 10.406  1.866   25.043  1.00 42.71  ?  472  GLY A HA3  1 
ATOM   5592 N  N    . ASN A 1 360 ? 11.799  4.353   25.554  1.00 37.31  ?  473  ASN A N    1 
ATOM   5593 C  CA   . ASN A 1 360 ? 12.649  5.428   25.066  1.00 36.80  ?  473  ASN A CA   1 
ATOM   5594 C  C    . ASN A 1 360 ? 14.068  4.897   24.864  1.00 33.38  ?  473  ASN A C    1 
ATOM   5595 O  O    . ASN A 1 360 ? 14.580  4.125   25.678  1.00 31.41  ?  473  ASN A O    1 
ATOM   5596 C  CB   . ASN A 1 360 ? 12.683  6.618   26.039  1.00 38.64  ?  473  ASN A CB   1 
ATOM   5597 C  CG   . ASN A 1 360 ? 11.442  7.491   25.954  1.00 44.34  ?  473  ASN A CG   1 
ATOM   5598 O  OD1  . ASN A 1 360 ? 10.827  7.628   24.892  1.00 43.56  ?  473  ASN A OD1  1 
ATOM   5599 N  ND2  . ASN A 1 360 ? 11.073  8.098   27.074  1.00 49.43  ?  473  ASN A ND2  1 
ATOM   5600 H  H    . ASN A 1 360 ? 12.032  4.062   26.329  1.00 44.76  ?  473  ASN A H    1 
ATOM   5601 H  HA   . ASN A 1 360 ? 12.304  5.745   24.216  1.00 44.15  ?  473  ASN A HA   1 
ATOM   5602 H  HB2  . ASN A 1 360 ? 12.750  6.281   26.946  1.00 46.36  ?  473  ASN A HB2  1 
ATOM   5603 H  HB3  . ASN A 1 360 ? 13.453  7.171   25.833  1.00 46.36  ?  473  ASN A HB3  1 
ATOM   5604 H  HD21 . ASN A 1 360 ? 10.378  8.603   27.080  1.00 59.30  ?  473  ASN A HD21 1 
ATOM   5605 H  HD22 . ASN A 1 360 ? 11.529  7.985   27.794  1.00 59.30  ?  473  ASN A HD22 1 
ATOM   5606 N  N    . LEU A 1 361 ? 14.706  5.326   23.785  1.00 33.23  ?  474  LEU A N    1 
ATOM   5607 C  CA   . LEU A 1 361 ? 16.077  4.950   23.470  1.00 29.80  ?  474  LEU A CA   1 
ATOM   5608 C  C    . LEU A 1 361 ? 16.947  6.195   23.526  1.00 30.10  ?  474  LEU A C    1 
ATOM   5609 O  O    . LEU A 1 361 ? 16.709  7.145   22.779  1.00 29.77  ?  474  LEU A O    1 
ATOM   5610 C  CB   . LEU A 1 361 ? 16.148  4.298   22.092  1.00 32.64  ?  474  LEU A CB   1 
ATOM   5611 C  CG   . LEU A 1 361 ? 17.497  3.671   21.704  1.00 32.22  ?  474  LEU A CG   1 
ATOM   5612 C  CD1  . LEU A 1 361 ? 17.736  2.426   22.528  1.00 31.74  ?  474  LEU A CD1  1 
ATOM   5613 C  CD2  . LEU A 1 361 ? 17.543  3.370   20.217  1.00 36.19  ?  474  LEU A CD2  1 
ATOM   5614 H  H    . LEU A 1 361 ? 14.353  5.852   23.204  1.00 39.86  ?  474  LEU A H    1 
ATOM   5615 H  HA   . LEU A 1 361 ? 16.410  4.319   24.128  1.00 35.74  ?  474  LEU A HA   1 
ATOM   5616 H  HB2  . LEU A 1 361 ? 15.484  3.592   22.059  1.00 39.16  ?  474  LEU A HB2  1 
ATOM   5617 H  HB3  . LEU A 1 361 ? 15.946  4.976   21.428  1.00 39.16  ?  474  LEU A HB3  1 
ATOM   5618 H  HG   . LEU A 1 361 ? 18.214  4.297   21.888  1.00 38.65  ?  474  LEU A HG   1 
ATOM   5619 H  HD11 . LEU A 1 361 ? 18.550  1.996   22.223  1.00 38.07  ?  474  LEU A HD11 1 
ATOM   5620 H  HD12 . LEU A 1 361 ? 17.824  2.676   23.461  1.00 38.07  ?  474  LEU A HD12 1 
ATOM   5621 H  HD13 . LEU A 1 361 ? 16.983  1.824   22.417  1.00 38.07  ?  474  LEU A HD13 1 
ATOM   5622 H  HD21 . LEU A 1 361 ? 18.408  2.992   19.998  1.00 43.41  ?  474  LEU A HD21 1 
ATOM   5623 H  HD22 . LEU A 1 361 ? 16.840  2.737   20.002  1.00 43.41  ?  474  LEU A HD22 1 
ATOM   5624 H  HD23 . LEU A 1 361 ? 17.408  4.194   19.724  1.00 43.41  ?  474  LEU A HD23 1 
ATOM   5625 N  N    . GLN A 1 362 ? 17.941  6.200   24.413  1.00 29.29  ?  475  GLN A N    1 
ATOM   5626 C  CA   . GLN A 1 362 ? 18.888  7.308   24.491  1.00 31.14  ?  475  GLN A CA   1 
ATOM   5627 C  C    . GLN A 1 362 ? 20.125  6.997   23.657  1.00 29.83  ?  475  GLN A C    1 
ATOM   5628 O  O    . GLN A 1 362 ? 20.586  5.847   23.613  1.00 27.54  ?  475  GLN A O    1 
ATOM   5629 C  CB   . GLN A 1 362 ? 19.312  7.580   25.937  1.00 34.85  ?  475  GLN A CB   1 
ATOM   5630 C  CG   . GLN A 1 362 ? 18.283  8.347   26.767  1.00 35.03  ?  475  GLN A CG   1 
ATOM   5631 C  CD   . GLN A 1 362 ? 17.110  7.487   27.170  1.00 42.72  ?  475  GLN A CD   1 
ATOM   5632 O  OE1  . GLN A 1 362 ? 15.958  7.912   27.085  1.00 44.47  ?  475  GLN A OE1  1 
ATOM   5633 N  NE2  . GLN A 1 362 ? 17.390  6.266   27.622  1.00 44.11  ?  475  GLN A NE2  1 
ATOM   5634 H  H    . GLN A 1 362 ? 18.087  5.571   24.981  1.00 35.14  ?  475  GLN A H    1 
ATOM   5635 H  HA   . GLN A 1 362 ? 18.461  8.107   24.145  1.00 37.35  ?  475  GLN A HA   1 
ATOM   5636 H  HB2  . GLN A 1 362 ? 19.469  6.730   26.377  1.00 41.81  ?  475  GLN A HB2  1 
ATOM   5637 H  HB3  . GLN A 1 362 ? 20.128  8.104   25.926  1.00 41.81  ?  475  GLN A HB3  1 
ATOM   5638 H  HG2  . GLN A 1 362 ? 18.709  8.673   27.576  1.00 42.02  ?  475  GLN A HG2  1 
ATOM   5639 H  HG3  . GLN A 1 362 ? 17.946  9.092   26.246  1.00 42.02  ?  475  GLN A HG3  1 
ATOM   5640 H  HE21 . GLN A 1 362 ? 18.207  6.003   27.674  1.00 52.91  ?  475  GLN A HE21 1 
ATOM   5641 H  HE22 . GLN A 1 362 ? 16.753  5.741   27.864  1.00 52.91  ?  475  GLN A HE22 1 
ATOM   5642 N  N    . TYR A 1 363 ? 20.653  8.033   23.000  1.00 29.34  ?  476  TYR A N    1 
ATOM   5643 C  CA   . TYR A 1 363 ? 21.912  7.966   22.280  1.00 28.52  ?  476  TYR A CA   1 
ATOM   5644 C  C    . TYR A 1 363 ? 23.013  8.634   23.098  1.00 32.21  ?  476  TYR A C    1 
ATOM   5645 O  O    . TYR A 1 363 ? 22.787  9.671   23.739  1.00 30.07  ?  476  TYR A O    1 
ATOM   5646 C  CB   . TYR A 1 363 ? 21.805  8.655   20.915  1.00 28.99  ?  476  TYR A CB   1 
ATOM   5647 C  CG   . TYR A 1 363 ? 21.048  7.870   19.876  1.00 30.76  ?  476  TYR A CG   1 
ATOM   5648 C  CD1  . TYR A 1 363 ? 19.677  7.665   19.986  1.00 30.98  ?  476  TYR A CD1  1 
ATOM   5649 C  CD2  . TYR A 1 363 ? 21.703  7.325   18.775  1.00 31.68  ?  476  TYR A CD2  1 
ATOM   5650 C  CE1  . TYR A 1 363 ? 18.978  6.943   19.032  1.00 29.89  ?  476  TYR A CE1  1 
ATOM   5651 C  CE2  . TYR A 1 363 ? 21.009  6.592   17.816  1.00 29.47  ?  476  TYR A CE2  1 
ATOM   5652 C  CZ   . TYR A 1 363 ? 19.650  6.414   17.947  1.00 30.31  ?  476  TYR A CZ   1 
ATOM   5653 O  OH   . TYR A 1 363 ? 18.952  5.694   16.997  1.00 30.39  ?  476  TYR A OH   1 
ATOM   5654 H  H    . TYR A 1 363 ? 20.281  8.808   22.960  1.00 35.20  ?  476  TYR A H    1 
ATOM   5655 H  HA   . TYR A 1 363 ? 22.147  7.036   22.136  1.00 34.21  ?  476  TYR A HA   1 
ATOM   5656 H  HB2  . TYR A 1 363 ? 21.348  9.503   21.032  1.00 34.77  ?  476  TYR A HB2  1 
ATOM   5657 H  HB3  . TYR A 1 363 ? 22.700  8.805   20.574  1.00 34.77  ?  476  TYR A HB3  1 
ATOM   5658 H  HD1  . TYR A 1 363 ? 19.220  8.019   20.714  1.00 37.16  ?  476  TYR A HD1  1 
ATOM   5659 H  HD2  . TYR A 1 363 ? 22.619  7.452   18.679  1.00 38.00  ?  476  TYR A HD2  1 
ATOM   5660 H  HE1  . TYR A 1 363 ? 18.061  6.815   19.122  1.00 35.85  ?  476  TYR A HE1  1 
ATOM   5661 H  HE2  . TYR A 1 363 ? 21.461  6.225   17.091  1.00 35.35  ?  476  TYR A HE2  1 
ATOM   5662 H  HH   . TYR A 1 363 ? 19.475  5.431   16.395  1.00 36.45  ?  476  TYR A HH   1 
ATOM   5663 N  N    . TYR A 1 364 ? 24.214  8.047   23.050  1.00 28.64  ?  477  TYR A N    1 
ATOM   5664 C  CA   . TYR A 1 364 ? 25.351  8.522   23.813  1.00 25.07  ?  477  TYR A CA   1 
ATOM   5665 C  C    . TYR A 1 364 ? 26.595  8.508   22.935  1.00 31.33  ?  477  TYR A C    1 
ATOM   5666 O  O    . TYR A 1 364 ? 26.771  7.635   22.074  1.00 26.67  ?  477  TYR A O    1 
ATOM   5667 C  CB   . TYR A 1 364 ? 25.614  7.660   25.054  1.00 28.58  ?  477  TYR A CB   1 
ATOM   5668 C  CG   . TYR A 1 364 ? 24.441  7.589   26.012  1.00 31.55  ?  477  TYR A CG   1 
ATOM   5669 C  CD1  . TYR A 1 364 ? 24.224  8.596   26.943  1.00 32.88  ?  477  TYR A CD1  1 
ATOM   5670 C  CD2  . TYR A 1 364 ? 23.556  6.516   25.977  1.00 29.10  ?  477  TYR A CD2  1 
ATOM   5671 C  CE1  . TYR A 1 364 ? 23.159  8.543   27.814  1.00 34.39  ?  477  TYR A CE1  1 
ATOM   5672 C  CE2  . TYR A 1 364 ? 22.480  6.454   26.846  1.00 31.91  ?  477  TYR A CE2  1 
ATOM   5673 C  CZ   . TYR A 1 364 ? 22.282  7.470   27.764  1.00 36.68  ?  477  TYR A CZ   1 
ATOM   5674 O  OH   . TYR A 1 364 ? 21.217  7.423   28.629  1.00 38.89  ?  477  TYR A OH   1 
ATOM   5675 H  H    . TYR A 1 364 ? 24.390  7.357   22.568  1.00 34.35  ?  477  TYR A H    1 
ATOM   5676 H  HA   . TYR A 1 364 ? 25.174  9.432   24.099  1.00 30.06  ?  477  TYR A HA   1 
ATOM   5677 H  HB2  . TYR A 1 364 ? 25.817  6.755   24.767  1.00 34.29  ?  477  TYR A HB2  1 
ATOM   5678 H  HB3  . TYR A 1 364 ? 26.369  8.031   25.537  1.00 34.29  ?  477  TYR A HB3  1 
ATOM   5679 H  HD1  . TYR A 1 364 ? 24.808  9.318   26.980  1.00 39.44  ?  477  TYR A HD1  1 
ATOM   5680 H  HD2  . TYR A 1 364 ? 23.689  5.831   25.361  1.00 34.90  ?  477  TYR A HD2  1 
ATOM   5681 H  HE1  . TYR A 1 364 ? 23.028  9.225   28.433  1.00 41.25  ?  477  TYR A HE1  1 
ATOM   5682 H  HE2  . TYR A 1 364 ? 21.893  5.732   26.814  1.00 38.28  ?  477  TYR A HE2  1 
ATOM   5683 H  HH   . TYR A 1 364 ? 20.768  6.726   28.494  1.00 46.65  ?  477  TYR A HH   1 
ATOM   5684 N  N    . LEU A 1 365 ? 27.461  9.488   23.174  1.00 28.30  ?  478  LEU A N    1 
ATOM   5685 C  CA   . LEU A 1 365 ? 28.803  9.517   22.610  1.00 30.39  ?  478  LEU A CA   1 
ATOM   5686 C  C    . LEU A 1 365 ? 29.795  9.359   23.753  1.00 31.24  ?  478  LEU A C    1 
ATOM   5687 O  O    . LEU A 1 365 ? 29.643  9.992   24.805  1.00 33.53  ?  478  LEU A O    1 
ATOM   5688 C  CB   . LEU A 1 365 ? 29.062  10.814  21.852  1.00 31.93  ?  478  LEU A CB   1 
ATOM   5689 C  CG   . LEU A 1 365 ? 28.233  11.053  20.587  1.00 31.66  ?  478  LEU A CG   1 
ATOM   5690 C  CD1  . LEU A 1 365 ? 28.535  12.435  20.011  1.00 32.65  ?  478  LEU A CD1  1 
ATOM   5691 C  CD2  . LEU A 1 365 ? 28.497  9.975   19.557  1.00 30.13  ?  478  LEU A CD2  1 
ATOM   5692 H  H    . LEU A 1 365 ? 27.285  10.165  23.674  1.00 33.94  ?  478  LEU A H    1 
ATOM   5693 H  HA   . LEU A 1 365 ? 28.919  8.787   21.981  1.00 36.46  ?  478  LEU A HA   1 
ATOM   5694 H  HB2  . LEU A 1 365 ? 28.880  11.553  22.453  1.00 38.30  ?  478  LEU A HB2  1 
ATOM   5695 H  HB3  . LEU A 1 365 ? 29.994  10.824  21.586  1.00 38.30  ?  478  LEU A HB3  1 
ATOM   5696 H  HG   . LEU A 1 365 ? 27.291  11.017  20.816  1.00 37.98  ?  478  LEU A HG   1 
ATOM   5697 H  HD11 . LEU A 1 365 ? 28.250  12.460  19.085  1.00 39.17  ?  478  LEU A HD11 1 
ATOM   5698 H  HD12 . LEU A 1 365 ? 28.053  13.103  20.524  1.00 39.17  ?  478  LEU A HD12 1 
ATOM   5699 H  HD13 . LEU A 1 365 ? 29.489  12.599  20.068  1.00 39.17  ?  478  LEU A HD13 1 
ATOM   5700 H  HD21 . LEU A 1 365 ? 27.962  10.155  18.768  1.00 36.13  ?  478  LEU A HD21 1 
ATOM   5701 H  HD22 . LEU A 1 365 ? 29.439  9.982   19.326  1.00 36.13  ?  478  LEU A HD22 1 
ATOM   5702 H  HD23 . LEU A 1 365 ? 28.254  9.114   19.931  1.00 36.13  ?  478  LEU A HD23 1 
ATOM   5703 N  N    . TYR A 1 366 ? 30.786  8.503   23.551  1.00 29.54  ?  479  TYR A N    1 
ATOM   5704 C  CA   . TYR A 1 366 ? 31.871  8.310   24.493  1.00 30.11  ?  479  TYR A CA   1 
ATOM   5705 C  C    . TYR A 1 366 ? 33.081  9.123   24.050  1.00 30.29  ?  479  TYR A C    1 
ATOM   5706 O  O    . TYR A 1 366 ? 33.539  9.015   22.897  1.00 31.24  ?  479  TYR A O    1 
ATOM   5707 C  CB   . TYR A 1 366 ? 32.249  6.834   24.599  1.00 33.41  ?  479  TYR A CB   1 
ATOM   5708 C  CG   . TYR A 1 366 ? 33.388  6.571   25.542  1.00 29.91  ?  479  TYR A CG   1 
ATOM   5709 C  CD1  . TYR A 1 366 ? 33.151  6.343   26.889  1.00 31.23  ?  479  TYR A CD1  1 
ATOM   5710 C  CD2  . TYR A 1 366 ? 34.697  6.543   25.088  1.00 30.12  ?  479  TYR A CD2  1 
ATOM   5711 C  CE1  . TYR A 1 366 ? 34.199  6.090   27.763  1.00 32.33  ?  479  TYR A CE1  1 
ATOM   5712 C  CE2  . TYR A 1 366 ? 35.753  6.289   25.948  1.00 31.17  ?  479  TYR A CE2  1 
ATOM   5713 C  CZ   . TYR A 1 366 ? 35.490  6.063   27.286  1.00 35.05  ?  479  TYR A CZ   1 
ATOM   5714 O  OH   . TYR A 1 366 ? 36.538  5.807   28.145  1.00 40.26  ?  479  TYR A OH   1 
ATOM   5715 H  H    . TYR A 1 366 ? 30.851  8.008   22.852  1.00 35.43  ?  479  TYR A H    1 
ATOM   5716 H  HA   . TYR A 1 366 ? 31.592  8.619   25.369  1.00 36.12  ?  479  TYR A HA   1 
ATOM   5717 H  HB2  . TYR A 1 366 ? 31.479  6.337   24.916  1.00 40.08  ?  479  TYR A HB2  1 
ATOM   5718 H  HB3  . TYR A 1 366 ? 32.511  6.515   23.721  1.00 40.08  ?  479  TYR A HB3  1 
ATOM   5719 H  HD1  . TYR A 1 366 ? 32.278  6.360   27.211  1.00 37.46  ?  479  TYR A HD1  1 
ATOM   5720 H  HD2  . TYR A 1 366 ? 34.870  6.697   24.188  1.00 36.13  ?  479  TYR A HD2  1 
ATOM   5721 H  HE1  . TYR A 1 366 ? 34.030  5.940   28.665  1.00 38.77  ?  479  TYR A HE1  1 
ATOM   5722 H  HE2  . TYR A 1 366 ? 36.627  6.271   25.630  1.00 37.39  ?  479  TYR A HE2  1 
ATOM   5723 H  HH   . TYR A 1 366 ? 37.264  5.820   27.723  1.00 48.29  ?  479  TYR A HH   1 
ATOM   5724 N  N    . ASN A 1 367 ? 33.603  9.906   24.991  1.00 32.12  ?  480  ASN A N    1 
ATOM   5725 C  CA   . ASN A 1 367 ? 34.765  10.785  24.808  1.00 33.66  ?  480  ASN A CA   1 
ATOM   5726 C  C    . ASN A 1 367 ? 34.491  11.887  23.785  1.00 35.94  ?  480  ASN A C    1 
ATOM   5727 O  O    . ASN A 1 367 ? 35.368  12.284  23.024  1.00 37.13  ?  480  ASN A O    1 
ATOM   5728 C  CB   . ASN A 1 367 ? 36.011  10.008  24.427  1.00 33.24  ?  480  ASN A CB   1 
ATOM   5729 C  CG   . ASN A 1 367 ? 37.278  10.830  24.626  1.00 41.17  ?  480  ASN A CG   1 
ATOM   5730 O  OD1  . ASN A 1 367 ? 37.284  11.779  25.419  1.00 40.22  ?  480  ASN A OD1  1 
ATOM   5731 N  ND2  . ASN A 1 367 ? 38.337  10.485  23.908  1.00 38.23  ?  480  ASN A ND2  1 
ATOM   5732 H  H    . ASN A 1 367 ? 33.286  9.951   25.789  1.00 38.53  ?  480  ASN A H    1 
ATOM   5733 H  HA   . ASN A 1 367 ? 34.934  11.215  25.661  1.00 40.37  ?  480  ASN A HA   1 
ATOM   5734 H  HB2  . ASN A 1 367 ? 36.074  9.214   24.982  1.00 39.87  ?  480  ASN A HB2  1 
ATOM   5735 H  HB3  . ASN A 1 367 ? 35.956  9.755   23.492  1.00 39.87  ?  480  ASN A HB3  1 
ATOM   5736 H  HD21 . ASN A 1 367 ? 39.073  10.923  23.989  1.00 45.86  ?  480  ASN A HD21 1 
ATOM   5737 H  HD22 . ASN A 1 367 ? 38.289  9.823   23.360  1.00 45.86  ?  480  ASN A HD22 1 
ATOM   5738 N  N    . TRP A 1 368 ? 33.268  12.413  23.783  1.00 34.41  ?  481  TRP A N    1 
ATOM   5739 C  CA   . TRP A 1 368 ? 32.948  13.544  22.921  1.00 35.81  ?  481  TRP A CA   1 
ATOM   5740 C  C    . TRP A 1 368 ? 31.912  14.399  23.627  1.00 39.87  ?  481  TRP A C    1 
ATOM   5741 O  O    . TRP A 1 368 ? 30.827  13.914  23.940  1.00 36.21  ?  481  TRP A O    1 
ATOM   5742 C  CB   . TRP A 1 368 ? 32.442  13.087  21.557  1.00 35.45  ?  481  TRP A CB   1 
ATOM   5743 C  CG   . TRP A 1 368 ? 32.441  14.194  20.545  1.00 39.21  ?  481  TRP A CG   1 
ATOM   5744 C  CD1  . TRP A 1 368 ? 31.400  15.015  20.226  1.00 39.80  ?  481  TRP A CD1  1 
ATOM   5745 C  CD2  . TRP A 1 368 ? 33.542  14.604  19.726  1.00 42.52  ?  481  TRP A CD2  1 
ATOM   5746 N  NE1  . TRP A 1 368 ? 31.782  15.911  19.254  1.00 42.31  ?  481  TRP A NE1  1 
ATOM   5747 C  CE2  . TRP A 1 368 ? 33.093  15.683  18.933  1.00 44.26  ?  481  TRP A CE2  1 
ATOM   5748 C  CE3  . TRP A 1 368 ? 34.867  14.168  19.588  1.00 42.00  ?  481  TRP A CE3  1 
ATOM   5749 C  CZ2  . TRP A 1 368 ? 33.922  16.331  18.013  1.00 46.97  ?  481  TRP A CZ2  1 
ATOM   5750 C  CZ3  . TRP A 1 368 ? 35.686  14.815  18.674  1.00 43.63  ?  481  TRP A CZ3  1 
ATOM   5751 C  CH2  . TRP A 1 368 ? 35.210  15.881  17.900  1.00 45.08  ?  481  TRP A CH2  1 
ATOM   5752 H  H    . TRP A 1 368 ? 32.615  12.134  24.268  1.00 41.28  ?  481  TRP A H    1 
ATOM   5753 H  HA   . TRP A 1 368 ? 33.747  14.076  22.777  1.00 42.96  ?  481  TRP A HA   1 
ATOM   5754 H  HB2  . TRP A 1 368 ? 33.016  12.378  21.227  1.00 42.53  ?  481  TRP A HB2  1 
ATOM   5755 H  HB3  . TRP A 1 368 ? 31.533  12.762  21.649  1.00 42.53  ?  481  TRP A HB3  1 
ATOM   5756 H  HD1  . TRP A 1 368 ? 30.554  14.976  20.610  1.00 47.74  ?  481  TRP A HD1  1 
ATOM   5757 H  HE1  . TRP A 1 368 ? 31.279  16.515  18.905  1.00 50.75  ?  481  TRP A HE1  1 
ATOM   5758 H  HE3  . TRP A 1 368 ? 35.190  13.461  20.099  1.00 50.39  ?  481  TRP A HE3  1 
ATOM   5759 H  HZ2  . TRP A 1 368 ? 33.611  17.039  17.497  1.00 56.34  ?  481  TRP A HZ2  1 
ATOM   5760 H  HZ3  . TRP A 1 368 ? 36.568  14.537  18.574  1.00 52.34  ?  481  TRP A HZ3  1 
ATOM   5761 H  HH2  . TRP A 1 368 ? 35.783  16.292  17.293  1.00 54.08  ?  481  TRP A HH2  1 
ATOM   5762 N  N    . ARG A 1 369 ? 32.252  15.661  23.873  1.00 39.70  ?  482  ARG A N    1 
ATOM   5763 C  CA   . ARG A 1 369 ? 31.375  16.610  24.543  1.00 42.77  ?  482  ARG A CA   1 
ATOM   5764 C  C    . ARG A 1 369 ? 30.799  17.564  23.503  1.00 42.89  ?  482  ARG A C    1 
ATOM   5765 O  O    . ARG A 1 369 ? 31.553  18.228  22.782  1.00 39.96  ?  482  ARG A O    1 
ATOM   5766 C  CB   . ARG A 1 369 ? 32.144  17.383  25.611  1.00 47.46  ?  482  ARG A CB   1 
ATOM   5767 C  CG   . ARG A 1 369 ? 31.288  18.310  26.440  1.00 55.79  ?  482  ARG A CG   1 
ATOM   5768 C  CD   . ARG A 1 369 ? 32.132  19.320  27.201  1.00 61.36  ?  482  ARG A CD   1 
ATOM   5769 N  NE   . ARG A 1 369 ? 33.079  18.709  28.133  1.00 69.07  ?  482  ARG A NE   1 
ATOM   5770 C  CZ   . ARG A 1 369 ? 32.736  18.106  29.270  1.00 73.01  ?  482  ARG A CZ   1 
ATOM   5771 N  NH1  . ARG A 1 369 ? 31.460  18.002  29.616  1.00 75.02  ?  482  ARG A NH1  1 
ATOM   5772 N  NH2  . ARG A 1 369 ? 33.674  17.593  30.057  1.00 74.26  ?  482  ARG A NH2  1 
ATOM   5773 H  H    . ARG A 1 369 ? 33.012  15.999  23.654  1.00 47.62  ?  482  ARG A H    1 
ATOM   5774 H  HA   . ARG A 1 369 ? 30.641  16.138  24.968  1.00 51.31  ?  482  ARG A HA   1 
ATOM   5775 H  HB2  . ARG A 1 369 ? 32.560  16.747  26.215  1.00 56.94  ?  482  ARG A HB2  1 
ATOM   5776 H  HB3  . ARG A 1 369 ? 32.824  17.920  25.176  1.00 56.94  ?  482  ARG A HB3  1 
ATOM   5777 H  HG2  . ARG A 1 369 ? 30.684  18.796  25.858  1.00 66.93  ?  482  ARG A HG2  1 
ATOM   5778 H  HG3  . ARG A 1 369 ? 30.782  17.790  27.084  1.00 66.93  ?  482  ARG A HG3  1 
ATOM   5779 H  HD2  . ARG A 1 369 ? 32.640  19.846  26.565  1.00 73.62  ?  482  ARG A HD2  1 
ATOM   5780 H  HD3  . ARG A 1 369 ? 31.543  19.897  27.713  1.00 73.62  ?  482  ARG A HD3  1 
ATOM   5781 H  HE   . ARG A 1 369 ? 33.915  18.741  27.933  1.00 82.86  ?  482  ARG A HE   1 
ATOM   5782 H  HH11 . ARG A 1 369 ? 30.848  18.324  29.105  1.00 90.01  ?  482  ARG A HH11 1 
ATOM   5783 H  HH12 . ARG A 1 369 ? 31.245  17.611  30.351  1.00 90.01  ?  482  ARG A HH12 1 
ATOM   5784 H  HH21 . ARG A 1 369 ? 34.502  17.649  29.832  1.00 89.09  ?  482  ARG A HH21 1 
ATOM   5785 H  HH22 . ARG A 1 369 ? 33.453  17.203  30.791  1.00 89.09  ?  482  ARG A HH22 1 
ATOM   5786 N  N    . CYS A 1 370 ? 29.472  17.646  23.440  1.00 41.63  ?  483  CYS A N    1 
ATOM   5787 C  CA   . CYS A 1 370 ? 28.798  18.485  22.458  1.00 39.21  ?  483  CYS A CA   1 
ATOM   5788 C  C    . CYS A 1 370 ? 27.379  18.748  22.936  1.00 41.05  ?  483  CYS A C    1 
ATOM   5789 O  O    . CYS A 1 370 ? 26.861  18.012  23.781  1.00 39.82  ?  483  CYS A O    1 
ATOM   5790 C  CB   . CYS A 1 370 ? 28.781  17.816  21.077  1.00 40.89  ?  483  CYS A CB   1 
ATOM   5791 S  SG   . CYS A 1 370 ? 27.739  16.317  21.018  1.00 38.21  ?  483  CYS A SG   1 
ATOM   5792 H  H    . CYS A 1 370 ? 28.937  17.220  23.962  1.00 49.94  ?  483  CYS A H    1 
ATOM   5793 H  HA   . CYS A 1 370 ? 29.259  19.336  22.388  1.00 47.03  ?  483  CYS A HA   1 
ATOM   5794 H  HB2  . CYS A 1 370 ? 28.435  18.446  20.426  1.00 49.06  ?  483  CYS A HB2  1 
ATOM   5795 H  HB3  . CYS A 1 370 ? 29.687  17.560  20.841  1.00 49.06  ?  483  CYS A HB3  1 
ATOM   5796 H  HG   . CYS A 1 370 ? 26.609  16.615  21.289  1.00 45.84  ?  483  CYS A HG   1 
ATOM   5797 N  N    . PRO A 1 371 ? 26.723  19.788  22.420  1.00 41.98  ?  484  PRO A N    1 
ATOM   5798 C  CA   . PRO A 1 371 ? 25.326  20.022  22.793  1.00 39.57  ?  484  PRO A CA   1 
ATOM   5799 C  C    . PRO A 1 371 ? 24.442  18.871  22.343  1.00 37.81  ?  484  PRO A C    1 
ATOM   5800 O  O    . PRO A 1 371 ? 24.658  18.273  21.289  1.00 31.65  ?  484  PRO A O    1 
ATOM   5801 C  CB   . PRO A 1 371 ? 24.971  21.323  22.063  1.00 41.12  ?  484  PRO A CB   1 
ATOM   5802 C  CG   . PRO A 1 371 ? 26.296  21.987  21.783  1.00 39.22  ?  484  PRO A CG   1 
ATOM   5803 C  CD   . PRO A 1 371 ? 27.249  20.856  21.547  1.00 38.83  ?  484  PRO A CD   1 
ATOM   5804 H  HA   . PRO A 1 371 ? 25.241  20.152  23.751  1.00 47.47  ?  484  PRO A HA   1 
ATOM   5805 H  HB2  . PRO A 1 371 ? 24.503  21.121  21.238  1.00 49.32  ?  484  PRO A HB2  1 
ATOM   5806 H  HB3  . PRO A 1 371 ? 24.417  21.880  22.632  1.00 49.32  ?  484  PRO A HB3  1 
ATOM   5807 H  HG2  . PRO A 1 371 ? 26.224  22.550  20.997  1.00 47.04  ?  484  PRO A HG2  1 
ATOM   5808 H  HG3  . PRO A 1 371 ? 26.569  22.517  22.548  1.00 47.04  ?  484  PRO A HG3  1 
ATOM   5809 H  HD2  . PRO A 1 371 ? 27.236  20.581  20.617  1.00 46.58  ?  484  PRO A HD2  1 
ATOM   5810 H  HD3  . PRO A 1 371 ? 28.150  21.103  21.807  1.00 46.58  ?  484  PRO A HD3  1 
ATOM   5811 N  N    . GLY A 1 372 ? 23.440  18.566  23.155  1.00 38.55  ?  485  GLY A N    1 
ATOM   5812 C  CA   . GLY A 1 372 ? 22.411  17.635  22.746  1.00 38.94  ?  485  GLY A CA   1 
ATOM   5813 C  C    . GLY A 1 372 ? 21.534  18.237  21.667  1.00 39.53  ?  485  GLY A C    1 
ATOM   5814 O  O    . GLY A 1 372 ? 21.541  19.446  21.412  1.00 36.58  ?  485  GLY A O    1 
ATOM   5815 H  H    . GLY A 1 372 ? 23.335  18.886  23.947  1.00 46.24  ?  485  GLY A H    1 
ATOM   5816 H  HA2  . GLY A 1 372 ? 22.820  16.827  22.400  1.00 46.71  ?  485  GLY A HA2  1 
ATOM   5817 H  HA3  . GLY A 1 372 ? 21.855  17.406  23.508  1.00 46.71  ?  485  GLY A HA3  1 
ATOM   5818 N  N    . THR A 1 373 ? 20.763  17.370  21.015  1.00 34.61  ?  486  THR A N    1 
ATOM   5819 C  CA   . THR A 1 373 ? 19.914  17.776  19.905  1.00 37.24  ?  486  THR A CA   1 
ATOM   5820 C  C    . THR A 1 373 ? 18.582  17.047  20.004  1.00 36.61  ?  486  THR A C    1 
ATOM   5821 O  O    . THR A 1 373 ? 18.373  16.215  20.891  1.00 36.28  ?  486  THR A O    1 
ATOM   5822 C  CB   . THR A 1 373 ? 20.615  17.517  18.564  1.00 38.05  ?  486  THR A CB   1 
ATOM   5823 O  OG1  . THR A 1 373 ? 19.873  18.134  17.503  1.00 38.44  ?  486  THR A OG1  1 
ATOM   5824 C  CG2  . THR A 1 373 ? 20.740  16.016  18.294  1.00 38.20  ?  486  THR A CG2  1 
ATOM   5825 H  H    . THR A 1 373 ? 20.717  16.532  21.202  1.00 41.52  ?  486  THR A H    1 
ATOM   5826 H  HA   . THR A 1 373 ? 19.730  18.726  19.973  1.00 44.67  ?  486  THR A HA   1 
ATOM   5827 H  HB   . THR A 1 373 ? 21.508  17.893  18.594  1.00 45.65  ?  486  THR A HB   1 
ATOM   5828 H  HG1  . THR A 1 373 ? 20.129  17.834  16.761  1.00 46.12  ?  486  THR A HG1  1 
ATOM   5829 H  HG21 . THR A 1 373 ? 21.348  15.862  17.554  1.00 45.82  ?  486  THR A HG21 1 
ATOM   5830 H  HG22 . THR A 1 373 ? 21.082  15.564  19.081  1.00 45.82  ?  486  THR A HG22 1 
ATOM   5831 H  HG23 . THR A 1 373 ? 19.872  15.645  18.071  1.00 45.82  ?  486  THR A HG23 1 
ATOM   5832 N  N    . ASP A 1 374 ? 17.671  17.367  19.088  1.00 35.94  ?  487  ASP A N    1 
ATOM   5833 C  CA   . ASP A 1 374 ? 16.364  16.728  19.082  1.00 39.16  ?  487  ASP A CA   1 
ATOM   5834 C  C    . ASP A 1 374 ? 16.415  15.408  18.314  1.00 36.63  ?  487  ASP A C    1 
ATOM   5835 O  O    . ASP A 1 374 ? 17.318  15.154  17.512  1.00 32.33  ?  487  ASP A O    1 
ATOM   5836 C  CB   . ASP A 1 374 ? 15.315  17.652  18.455  1.00 41.58  ?  487  ASP A CB   1 
ATOM   5837 C  CG   . ASP A 1 374 ? 15.332  19.049  19.056  1.00 47.28  ?  487  ASP A CG   1 
ATOM   5838 O  OD1  . ASP A 1 374 ? 15.762  19.987  18.352  1.00 49.37  ?  487  ASP A OD1  1 
ATOM   5839 O  OD2  . ASP A 1 374 ? 14.929  19.202  20.230  1.00 46.77  ?  487  ASP A OD2  1 
ATOM   5840 H  H    . ASP A 1 374 ? 17.786  17.947  18.464  1.00 43.12  ?  487  ASP A H    1 
ATOM   5841 H  HA   . ASP A 1 374 ? 16.097  16.541  19.996  1.00 46.98  ?  487  ASP A HA   1 
ATOM   5842 H  HB2  . ASP A 1 374 ? 15.491  17.732  17.504  1.00 49.89  ?  487  ASP A HB2  1 
ATOM   5843 H  HB3  . ASP A 1 374 ? 14.433  17.274  18.599  1.00 49.89  ?  487  ASP A HB3  1 
ATOM   5844 N  N    . SER A 1 375 ? 15.419  14.554  18.565  1.00 35.44  ?  488  SER A N    1 
ATOM   5845 C  CA   A SER A 1 375 ? 15.375  13.267  17.881  0.61 34.21  ?  488  SER A CA   1 
ATOM   5846 C  CA   B SER A 1 375 ? 15.382  13.268  17.881  0.39 34.11  ?  488  SER A CA   1 
ATOM   5847 C  C    . SER A 1 375 ? 15.280  13.440  16.371  1.00 33.44  ?  488  SER A C    1 
ATOM   5848 O  O    . SER A 1 375 ? 15.804  12.611  15.617  1.00 32.02  ?  488  SER A O    1 
ATOM   5849 C  CB   A SER A 1 375 ? 14.195  12.435  18.391  0.61 35.45  ?  488  SER A CB   1 
ATOM   5850 C  CB   B SER A 1 375 ? 14.212  12.430  18.398  0.39 35.87  ?  488  SER A CB   1 
ATOM   5851 O  OG   A SER A 1 375 ? 12.961  13.094  18.168  0.61 35.88  ?  488  SER A OG   1 
ATOM   5852 O  OG   B SER A 1 375 ? 14.182  11.163  17.769  0.39 33.07  ?  488  SER A OG   1 
ATOM   5853 H  H    A SER A 1 375 ? 14.772  14.692  19.114  0.61 42.51  ?  488  SER A H    1 
ATOM   5854 H  H    B SER A 1 375 ? 14.770  14.692  19.113  0.39 42.51  ?  488  SER A H    1 
ATOM   5855 H  HA   A SER A 1 375 ? 16.192  12.782  18.079  0.61 41.03  ?  488  SER A HA   1 
ATOM   5856 H  HA   B SER A 1 375 ? 16.202  12.789  18.075  0.39 40.91  ?  488  SER A HA   1 
ATOM   5857 H  HB2  A SER A 1 375 ? 14.185  11.585  17.924  0.61 42.53  ?  488  SER A HB2  1 
ATOM   5858 H  HB2  B SER A 1 375 ? 14.311  12.305  19.354  0.39 43.03  ?  488  SER A HB2  1 
ATOM   5859 H  HB3  A SER A 1 375 ? 14.304  12.288  19.344  0.61 42.53  ?  488  SER A HB3  1 
ATOM   5860 H  HB3  B SER A 1 375 ? 13.382  12.896  18.208  0.39 43.03  ?  488  SER A HB3  1 
ATOM   5861 H  HG   A SER A 1 375 ? 12.328  12.623  18.455  0.61 43.04  ?  488  SER A HG   1 
ATOM   5862 H  HG   B SER A 1 375 ? 13.536  10.712  18.061  0.39 39.67  ?  488  SER A HG   1 
ATOM   5863 N  N    . GLU A 1 376 ? 14.626  14.505  15.903  1.00 33.12  ?  489  GLU A N    1 
ATOM   5864 C  CA   . GLU A 1 376 ? 14.519  14.691  14.455  1.00 32.38  ?  489  GLU A CA   1 
ATOM   5865 C  C    . GLU A 1 376 ? 15.835  15.134  13.831  1.00 34.08  ?  489  GLU A C    1 
ATOM   5866 O  O    . GLU A 1 376 ? 15.931  15.181  12.604  1.00 33.99  ?  489  GLU A O    1 
ATOM   5867 C  CB   . GLU A 1 376 ? 13.401  15.681  14.099  1.00 41.42  ?  489  GLU A CB   1 
ATOM   5868 C  CG   . GLU A 1 376 ? 13.536  17.082  14.665  1.00 44.81  ?  489  GLU A CG   1 
ATOM   5869 C  CD   . GLU A 1 376 ? 12.788  17.270  15.989  1.00 53.08  ?  489  GLU A CD   1 
ATOM   5870 O  OE1  . GLU A 1 376 ? 12.248  18.377  16.209  1.00 59.74  ?  489  GLU A OE1  1 
ATOM   5871 O  OE2  . GLU A 1 376 ? 12.737  16.326  16.808  1.00 44.27  ?  489  GLU A OE2  1 
ATOM   5872 H  H    . GLU A 1 376 ? 14.249  15.111  16.383  1.00 39.73  ?  489  GLU A H    1 
ATOM   5873 H  HA   . GLU A 1 376 ? 14.268  13.842  14.059  1.00 38.85  ?  489  GLU A HA   1 
ATOM   5874 H  HB2  . GLU A 1 376 ? 13.370  15.765  13.133  1.00 49.68  ?  489  GLU A HB2  1 
ATOM   5875 H  HB3  . GLU A 1 376 ? 12.563  15.320  14.428  1.00 49.68  ?  489  GLU A HB3  1 
ATOM   5876 H  HG2  . GLU A 1 376 ? 14.475  17.269  14.823  1.00 53.75  ?  489  GLU A HG2  1 
ATOM   5877 H  HG3  . GLU A 1 376 ? 13.175  17.716  14.025  1.00 53.75  ?  489  GLU A HG3  1 
ATOM   5878 N  N    . LYS A 1 377 ? 16.849  15.442  14.635  1.00 28.77  ?  490  LYS A N    1 
ATOM   5879 C  CA   . LYS A 1 377 ? 18.178  15.700  14.122  1.00 35.30  ?  490  LYS A CA   1 
ATOM   5880 C  C    . LYS A 1 377 ? 19.097  14.491  14.263  1.00 33.68  ?  490  LYS A C    1 
ATOM   5881 O  O    . LYS A 1 377 ? 20.279  14.582  13.910  1.00 32.31  ?  490  LYS A O    1 
ATOM   5882 C  CB   . LYS A 1 377 ? 18.791  16.919  14.814  1.00 37.74  ?  490  LYS A CB   1 
ATOM   5883 C  CG   . LYS A 1 377 ? 18.239  18.243  14.289  1.00 36.94  ?  490  LYS A CG   1 
ATOM   5884 C  CD   . LYS A 1 377 ? 18.454  18.343  12.783  1.00 41.46  ?  490  LYS A CD   1 
ATOM   5885 C  CE   . LYS A 1 377 ? 17.906  19.626  12.202  1.00 47.68  ?  490  LYS A CE   1 
ATOM   5886 N  NZ   . LYS A 1 377 ? 17.957  19.582  10.706  1.00 49.15  ?  490  LYS A NZ   1 
ATOM   5887 H  H    . LYS A 1 377 ? 16.783  15.507  15.490  1.00 34.51  ?  490  LYS A H    1 
ATOM   5888 H  HA   . LYS A 1 377 ? 18.116  15.914  13.178  1.00 42.35  ?  490  LYS A HA   1 
ATOM   5889 H  HB2  . LYS A 1 377 ? 18.601  16.871  15.764  1.00 45.27  ?  490  LYS A HB2  1 
ATOM   5890 H  HB3  . LYS A 1 377 ? 19.750  16.915  14.667  1.00 45.27  ?  490  LYS A HB3  1 
ATOM   5891 H  HG2  . LYS A 1 377 ? 17.288  18.295  14.470  1.00 44.31  ?  490  LYS A HG2  1 
ATOM   5892 H  HG3  . LYS A 1 377 ? 18.700  18.981  14.717  1.00 44.31  ?  490  LYS A HG3  1 
ATOM   5893 H  HD2  . LYS A 1 377 ? 19.405  18.311  12.595  1.00 49.73  ?  490  LYS A HD2  1 
ATOM   5894 H  HD3  . LYS A 1 377 ? 18.005  17.601  12.348  1.00 49.73  ?  490  LYS A HD3  1 
ATOM   5895 H  HE2  . LYS A 1 377 ? 16.983  19.740  12.478  1.00 57.20  ?  490  LYS A HE2  1 
ATOM   5896 H  HE3  . LYS A 1 377 ? 18.439  20.376  12.508  1.00 57.20  ?  490  LYS A HE3  1 
ATOM   5897 H  HZ1  . LYS A 1 377 ? 18.797  19.480  10.433  1.00 58.96  ?  490  LYS A HZ1  1 
ATOM   5898 H  HZ2  . LYS A 1 377 ? 17.470  18.901  10.405  1.00 58.96  ?  490  LYS A HZ2  1 
ATOM   5899 H  HZ3  . LYS A 1 377 ? 17.633  20.339  10.368  1.00 58.96  ?  490  LYS A HZ3  1 
ATOM   5900 N  N    . VAL A 1 378 ? 18.584  13.371  14.757  1.00 29.96  ?  491  VAL A N    1 
ATOM   5901 C  CA   . VAL A 1 378 ? 19.347  12.134  14.846  1.00 29.52  ?  491  VAL A CA   1 
ATOM   5902 C  C    . VAL A 1 378 ? 19.132  11.345  13.564  1.00 29.18  ?  491  VAL A C    1 
ATOM   5903 O  O    . VAL A 1 378 ? 17.993  11.066  13.176  1.00 29.79  ?  491  VAL A O    1 
ATOM   5904 C  CB   . VAL A 1 378 ? 18.925  11.317  16.073  1.00 32.38  ?  491  VAL A CB   1 
ATOM   5905 C  CG1  . VAL A 1 378 ? 19.688  9.983   16.104  1.00 32.14  ?  491  VAL A CG1  1 
ATOM   5906 C  CG2  . VAL A 1 378 ? 19.163  12.100  17.349  1.00 28.19  ?  491  VAL A CG2  1 
ATOM   5907 H  H    . VAL A 1 378 ? 17.779  13.302  15.053  1.00 35.94  ?  491  VAL A H    1 
ATOM   5908 H  HA   . VAL A 1 378 ? 20.291  12.340  14.930  1.00 35.41  ?  491  VAL A HA   1 
ATOM   5909 H  HB   . VAL A 1 378 ? 17.976  11.127  16.016  1.00 38.85  ?  491  VAL A HB   1 
ATOM   5910 H  HG11 . VAL A 1 378 ? 19.580  9.578   16.979  1.00 38.56  ?  491  VAL A HG11 1 
ATOM   5911 H  HG12 . VAL A 1 378 ? 19.326  9.397   15.421  1.00 38.56  ?  491  VAL A HG12 1 
ATOM   5912 H  HG13 . VAL A 1 378 ? 20.627  10.153  15.931  1.00 38.56  ?  491  VAL A HG13 1 
ATOM   5913 H  HG21 . VAL A 1 378 ? 18.919  11.548  18.109  1.00 33.81  ?  491  VAL A HG21 1 
ATOM   5914 H  HG22 . VAL A 1 378 ? 20.101  12.340  17.402  1.00 33.81  ?  491  VAL A HG22 1 
ATOM   5915 H  HG23 . VAL A 1 378 ? 18.617  12.902  17.334  1.00 33.81  ?  491  VAL A HG23 1 
ATOM   5916 N  N    . GLY A 1 379 ? 20.225  10.984  12.906  1.00 27.53  ?  492  GLY A N    1 
ATOM   5917 C  CA   . GLY A 1 379 ? 20.161  10.281  11.644  1.00 29.41  ?  492  GLY A CA   1 
ATOM   5918 C  C    . GLY A 1 379 ? 20.954  8.989   11.673  1.00 30.14  ?  492  GLY A C    1 
ATOM   5919 O  O    . GLY A 1 379 ? 21.536  8.585   10.665  1.00 29.94  ?  492  GLY A O    1 
ATOM   5920 H  H    . GLY A 1 379 ? 21.026  11.139  13.177  1.00 33.02  ?  492  GLY A H    1 
ATOM   5921 H  HA2  . GLY A 1 379 ? 19.236  10.069  11.439  1.00 35.28  ?  492  GLY A HA2  1 
ATOM   5922 H  HA3  . GLY A 1 379 ? 20.518  10.846  10.941  1.00 35.28  ?  492  GLY A HA3  1 
ATOM   5923 N  N    . LEU A 1 380 ? 20.969  8.336   12.832  1.00 30.06  ?  493  LEU A N    1 
ATOM   5924 C  CA   . LEU A 1 380 ? 21.718  7.114   13.058  1.00 29.71  ?  493  LEU A CA   1 
ATOM   5925 C  C    . LEU A 1 380 ? 20.791  6.072   13.667  1.00 28.77  ?  493  LEU A C    1 
ATOM   5926 O  O    . LEU A 1 380 ? 20.088  6.359   14.636  1.00 29.22  ?  493  LEU A O    1 
ATOM   5927 C  CB   . LEU A 1 380 ? 22.905  7.374   13.983  1.00 29.31  ?  493  LEU A CB   1 
ATOM   5928 C  CG   . LEU A 1 380 ? 23.721  6.147   14.424  1.00 31.83  ?  493  LEU A CG   1 
ATOM   5929 C  CD1  . LEU A 1 380 ? 24.465  5.528   13.254  1.00 32.73  ?  493  LEU A CD1  1 
ATOM   5930 C  CD2  . LEU A 1 380 ? 24.687  6.545   15.522  1.00 32.24  ?  493  LEU A CD2  1 
ATOM   5931 H  H    . LEU A 1 380 ? 20.534  8.596   13.526  1.00 36.05  ?  493  LEU A H    1 
ATOM   5932 H  HA   . LEU A 1 380 ? 22.052  6.767   12.216  1.00 35.64  ?  493  LEU A HA   1 
ATOM   5933 H  HB2  . LEU A 1 380 ? 23.516  7.971   13.525  1.00 35.16  ?  493  LEU A HB2  1 
ATOM   5934 H  HB3  . LEU A 1 380 ? 22.570  7.796   14.789  1.00 35.16  ?  493  LEU A HB3  1 
ATOM   5935 H  HG   . LEU A 1 380 ? 23.116  5.471   14.768  1.00 38.18  ?  493  LEU A HG   1 
ATOM   5936 H  HD11 . LEU A 1 380 ? 24.975  4.766   13.572  1.00 39.26  ?  493  LEU A HD11 1 
ATOM   5937 H  HD12 . LEU A 1 380 ? 23.822  5.241   12.588  1.00 39.26  ?  493  LEU A HD12 1 
ATOM   5938 H  HD13 . LEU A 1 380 ? 25.063  6.191   12.874  1.00 39.26  ?  493  LEU A HD13 1 
ATOM   5939 H  HD21 . LEU A 1 380 ? 25.200  5.766   15.790  1.00 38.68  ?  493  LEU A HD21 1 
ATOM   5940 H  HD22 . LEU A 1 380 ? 25.283  7.233   15.186  1.00 38.68  ?  493  LEU A HD22 1 
ATOM   5941 H  HD23 . LEU A 1 380 ? 24.183  6.885   16.278  1.00 38.68  ?  493  LEU A HD23 1 
ATOM   5942 N  N    . VAL A 1 381 ? 20.802  4.865   13.103  1.00 31.22  ?  494  VAL A N    1 
ATOM   5943 C  CA   . VAL A 1 381 ? 19.975  3.760   13.575  1.00 30.95  ?  494  VAL A CA   1 
ATOM   5944 C  C    . VAL A 1 381 ? 20.884  2.568   13.830  1.00 32.26  ?  494  VAL A C    1 
ATOM   5945 O  O    . VAL A 1 381 ? 21.565  2.106   12.915  1.00 35.32  ?  494  VAL A O    1 
ATOM   5946 C  CB   . VAL A 1 381 ? 18.872  3.392   12.567  1.00 31.69  ?  494  VAL A CB   1 
ATOM   5947 C  CG1  . VAL A 1 381 ? 18.065  2.180   13.059  1.00 32.43  ?  494  VAL A CG1  1 
ATOM   5948 C  CG2  . VAL A 1 381 ? 17.956  4.581   12.307  1.00 34.19  ?  494  VAL A CG2  1 
ATOM   5949 H  H    . VAL A 1 381 ? 21.294  4.661   12.428  1.00 37.45  ?  494  VAL A H    1 
ATOM   5950 H  HA   . VAL A 1 381 ? 19.554  4.008   14.413  1.00 37.13  ?  494  VAL A HA   1 
ATOM   5951 H  HB   . VAL A 1 381 ? 19.293  3.152   11.726  1.00 38.01  ?  494  VAL A HB   1 
ATOM   5952 H  HG11 . VAL A 1 381 ? 17.263  2.095   12.520  1.00 38.90  ?  494  VAL A HG11 1 
ATOM   5953 H  HG12 . VAL A 1 381 ? 18.609  1.382   12.971  1.00 38.90  ?  494  VAL A HG12 1 
ATOM   5954 H  HG13 . VAL A 1 381 ? 17.826  2.317   13.989  1.00 38.90  ?  494  VAL A HG13 1 
ATOM   5955 H  HG21 . VAL A 1 381 ? 17.257  4.313   11.690  1.00 41.01  ?  494  VAL A HG21 1 
ATOM   5956 H  HG22 . VAL A 1 381 ? 17.563  4.867   13.147  1.00 41.01  ?  494  VAL A HG22 1 
ATOM   5957 H  HG23 . VAL A 1 381 ? 18.476  5.304   11.923  1.00 41.01  ?  494  VAL A HG23 1 
ATOM   5958 N  N    . LEU A 1 382 ? 20.894  2.072   15.063  1.00 31.81  ?  495  LEU A N    1 
ATOM   5959 C  CA   . LEU A 1 382 ? 21.664  0.895   15.438  1.00 36.41  ?  495  LEU A CA   1 
ATOM   5960 C  C    . LEU A 1 382 ? 20.732  -0.303  15.628  1.00 40.81  ?  495  LEU A C    1 
ATOM   5961 O  O    . LEU A 1 382 ? 19.569  -0.152  16.022  1.00 42.62  ?  495  LEU A O    1 
ATOM   5962 C  CB   . LEU A 1 382 ? 22.447  1.142   16.729  1.00 32.14  ?  495  LEU A CB   1 
ATOM   5963 C  CG   . LEU A 1 382 ? 23.284  2.411   16.819  1.00 38.05  ?  495  LEU A CG   1 
ATOM   5964 C  CD1  . LEU A 1 382 ? 24.203  2.344   18.034  1.00 35.23  ?  495  LEU A CD1  1 
ATOM   5965 C  CD2  . LEU A 1 382 ? 24.077  2.628   15.543  1.00 38.79  ?  495  LEU A CD2  1 
ATOM   5966 H  H    . LEU A 1 382 ? 20.449  2.413   15.716  1.00 38.16  ?  495  LEU A H    1 
ATOM   5967 H  HA   . LEU A 1 382 ? 22.294  0.684   14.732  1.00 43.68  ?  495  LEU A HA   1 
ATOM   5968 H  HB2  . LEU A 1 382 ? 21.811  1.175   17.460  1.00 38.55  ?  495  LEU A HB2  1 
ATOM   5969 H  HB3  . LEU A 1 382 ? 23.056  0.397   16.852  1.00 38.55  ?  495  LEU A HB3  1 
ATOM   5970 H  HG   . LEU A 1 382 ? 22.698  3.177   16.925  1.00 45.64  ?  495  LEU A HG   1 
ATOM   5971 H  HD11 . LEU A 1 382 ? 24.723  3.162   18.082  1.00 42.26  ?  495  LEU A HD11 1 
ATOM   5972 H  HD12 . LEU A 1 382 ? 23.662  2.249   18.834  1.00 42.26  ?  495  LEU A HD12 1 
ATOM   5973 H  HD13 . LEU A 1 382 ? 24.794  1.581   17.942  1.00 42.26  ?  495  LEU A HD13 1 
ATOM   5974 H  HD21 . LEU A 1 382 ? 24.711  3.348   15.684  1.00 46.54  ?  495  LEU A HD21 1 
ATOM   5975 H  HD22 . LEU A 1 382 ? 24.548  1.810   15.321  1.00 46.54  ?  495  LEU A HD22 1 
ATOM   5976 H  HD23 . LEU A 1 382 ? 23.465  2.861   14.827  1.00 46.54  ?  495  LEU A HD23 1 
ATOM   5977 N  N    . GLN A 1 383 ? 21.256  -1.498  15.363  1.00 40.14  ?  496  GLN A N    1 
ATOM   5978 C  CA   . GLN A 1 383 ? 20.469  -2.720  15.485  1.00 41.10  ?  496  GLN A CA   1 
ATOM   5979 C  C    . GLN A 1 383 ? 20.328  -3.192  16.931  1.00 41.70  ?  496  GLN A C    1 
ATOM   5980 O  O    . GLN A 1 383 ? 19.464  -4.012  17.236  1.00 40.33  ?  496  GLN A O    1 
ATOM   5981 C  CB   . GLN A 1 383 ? 21.085  -3.847  14.659  1.00 42.64  ?  496  GLN A CB   1 
ATOM   5982 C  CG   . GLN A 1 383 ? 20.933  -3.686  13.163  1.00 43.05  ?  496  GLN A CG   1 
ATOM   5983 C  CD   . GLN A 1 383 ? 21.941  -2.733  12.581  1.00 42.95  ?  496  GLN A CD   1 
ATOM   5984 O  OE1  . GLN A 1 383 ? 22.973  -2.449  13.191  1.00 43.59  ?  496  GLN A OE1  1 
ATOM   5985 N  NE2  . GLN A 1 383 ? 21.650  -2.226  11.390  1.00 45.92  ?  496  GLN A NE2  1 
ATOM   5986 O  OXT  . GLN A 1 383 ? 21.065  -2.778  17.825  1.00 42.52  ?  496  GLN A OXT  1 
ATOM   5987 H  H    . GLN A 1 383 ? 22.068  -1.627  15.111  1.00 48.16  ?  496  GLN A H    1 
ATOM   5988 H  HA   . GLN A 1 383 ? 19.581  -2.521  15.148  1.00 49.30  ?  496  GLN A HA   1 
ATOM   5989 H  HB2  . GLN A 1 383 ? 22.035  -3.889  14.854  1.00 51.16  ?  496  GLN A HB2  1 
ATOM   5990 H  HB3  . GLN A 1 383 ? 20.658  -4.682  14.909  1.00 51.16  ?  496  GLN A HB3  1 
ATOM   5991 H  HG2  . GLN A 1 383 ? 21.055  -4.549  12.737  1.00 51.64  ?  496  GLN A HG2  1 
ATOM   5992 H  HG3  . GLN A 1 383 ? 20.047  -3.343  12.969  1.00 51.64  ?  496  GLN A HG3  1 
ATOM   5993 H  HE21 . GLN A 1 383 ? 20.919  -2.448  10.995  1.00 55.08  ?  496  GLN A HE21 1 
ATOM   5994 H  HE22 . GLN A 1 383 ? 22.193  -1.676  11.013  1.00 55.08  ?  496  GLN A HE22 1 
ATOM   5995 N  N    . LYS B 2 1   ? 18.314  -2.367  22.102  1.00 40.72  ?  3    LYS C N    1 
ATOM   5996 C  CA   . LYS B 2 1   ? 18.620  -1.976  23.477  1.00 39.50  ?  3    LYS C CA   1 
ATOM   5997 C  C    . LYS B 2 1   ? 17.352  -1.748  24.268  1.00 36.95  ?  3    LYS C C    1 
ATOM   5998 O  O    . LYS B 2 1   ? 17.345  -1.806  25.501  1.00 37.38  ?  3    LYS C O    1 
ATOM   5999 C  CB   . LYS B 2 1   ? 19.490  -0.714  23.501  1.00 37.54  ?  3    LYS C CB   1 
ATOM   6000 C  CG   . LYS B 2 1   ? 20.945  -0.989  23.235  1.00 35.85  ?  3    LYS C CG   1 
ATOM   6001 C  CD   . LYS B 2 1   ? 21.423  -2.200  24.041  1.00 37.06  ?  3    LYS C CD   1 
ATOM   6002 C  CE   . LYS B 2 1   ? 22.886  -2.462  23.858  1.00 36.71  ?  3    LYS C CE   1 
ATOM   6003 N  NZ   . LYS B 2 1   ? 23.612  -1.231  24.160  1.00 40.99  ?  3    LYS C NZ   1 
ATOM   6004 H  HA   . LYS B 2 1   ? 19.120  -2.690  23.903  1.00 47.38  ?  3    LYS C HA   1 
ATOM   6005 H  HB2  . LYS B 2 1   ? 19.173  -0.101  22.819  1.00 45.03  ?  3    LYS C HB2  1 
ATOM   6006 H  HB3  . LYS B 2 1   ? 19.419  -0.301  24.376  1.00 45.03  ?  3    LYS C HB3  1 
ATOM   6007 H  HG2  . LYS B 2 1   ? 21.073  -1.177  22.292  1.00 43.01  ?  3    LYS C HG2  1 
ATOM   6008 H  HG3  . LYS B 2 1   ? 21.474  -0.219  23.495  1.00 43.01  ?  3    LYS C HG3  1 
ATOM   6009 H  HD2  . LYS B 2 1   ? 21.261  -2.040  24.984  1.00 44.45  ?  3    LYS C HD2  1 
ATOM   6010 H  HD3  . LYS B 2 1   ? 20.937  -2.988  23.750  1.00 44.45  ?  3    LYS C HD3  1 
ATOM   6011 H  HE2  . LYS B 2 1   ? 23.179  -3.160  24.464  1.00 44.04  ?  3    LYS C HE2  1 
ATOM   6012 H  HE3  . LYS B 2 1   ? 23.066  -2.721  22.941  1.00 44.04  ?  3    LYS C HE3  1 
ATOM   6013 N  N    . VAL B 2 2   ? 16.266  -1.474  23.560  1.00 39.52  ?  4    VAL C N    1 
ATOM   6014 C  CA   . VAL B 2 2   ? 14.992  -1.182  24.202  1.00 34.22  ?  4    VAL C CA   1 
ATOM   6015 C  C    . VAL B 2 2   ? 13.907  -1.925  23.444  1.00 33.40  ?  4    VAL C C    1 
ATOM   6016 O  O    . VAL B 2 2   ? 13.787  -1.793  22.221  1.00 31.03  ?  4    VAL C O    1 
ATOM   6017 C  CB   . VAL B 2 2   ? 14.708  0.332   24.250  1.00 35.28  ?  4    VAL C CB   1 
ATOM   6018 C  CG1  . VAL B 2 2   ? 13.304  0.590   24.740  1.00 33.80  ?  4    VAL C CG1  1 
ATOM   6019 C  CG2  . VAL B 2 2   ? 15.720  1.017   25.162  1.00 35.92  ?  4    VAL C CG2  1 
ATOM   6020 H  H    . VAL B 2 2   ? 16.242  -1.452  22.701  1.00 47.41  ?  4    VAL C H    1 
ATOM   6021 H  HA   . VAL B 2 2   ? 14.998  -1.507  25.116  1.00 41.05  ?  4    VAL C HA   1 
ATOM   6022 H  HB   . VAL B 2 2   ? 14.789  0.701   23.357  1.00 42.32  ?  4    VAL C HB   1 
ATOM   6023 H  HG11 . VAL B 2 2   ? 13.230  1.517   25.015  1.00 40.55  ?  4    VAL C HG11 1 
ATOM   6024 H  HG12 . VAL B 2 2   ? 12.679  0.408   24.020  1.00 40.55  ?  4    VAL C HG12 1 
ATOM   6025 H  HG13 . VAL B 2 2   ? 13.119  0.007   25.493  1.00 40.55  ?  4    VAL C HG13 1 
ATOM   6026 H  HG21 . VAL B 2 2   ? 15.525  1.967   25.193  1.00 43.09  ?  4    VAL C HG21 1 
ATOM   6027 H  HG22 . VAL B 2 2   ? 15.653  0.636   26.052  1.00 43.09  ?  4    VAL C HG22 1 
ATOM   6028 H  HG23 . VAL B 2 2   ? 16.612  0.874   24.808  1.00 43.09  ?  4    VAL C HG23 1 
ATOM   6029 N  N    . LEU B 2 3   ? 13.134  -2.728  24.167  1.00 29.68  ?  5    LEU C N    1 
ATOM   6030 C  CA   . LEU B 2 3   ? 12.044  -3.498  23.581  1.00 32.77  ?  5    LEU C CA   1 
ATOM   6031 C  C    . LEU B 2 3   ? 10.760  -2.787  23.987  1.00 33.23  ?  5    LEU C C    1 
ATOM   6032 O  O    . LEU B 2 3   ? 10.190  -3.056  25.040  1.00 30.87  ?  5    LEU C O    1 
ATOM   6033 C  CB   . LEU B 2 3   ? 12.081  -4.947  24.053  1.00 35.08  ?  5    LEU C CB   1 
ATOM   6034 C  CG   . LEU B 2 3   ? 11.411  -5.972  23.135  1.00 35.20  ?  5    LEU C CG   1 
ATOM   6035 C  CD1  . LEU B 2 3   ? 11.584  -7.362  23.727  1.00 33.52  ?  5    LEU C CD1  1 
ATOM   6036 C  CD2  . LEU B 2 3   ? 9.946   -5.653  22.916  1.00 37.81  ?  5    LEU C CD2  1 
ATOM   6037 H  H    . LEU B 2 3   ? 13.225  -2.844  25.015  1.00 35.60  ?  5    LEU C H    1 
ATOM   6038 H  HA   . LEU B 2 3   ? 12.114  -3.508  22.614  1.00 39.31  ?  5    LEU C HA   1 
ATOM   6039 H  HB2  . LEU B 2 3   ? 13.010  -5.210  24.147  1.00 42.08  ?  5    LEU C HB2  1 
ATOM   6040 H  HB3  . LEU B 2 3   ? 11.634  -4.996  24.913  1.00 42.08  ?  5    LEU C HB3  1 
ATOM   6041 H  HG   . LEU B 2 3   ? 11.832  -5.944  22.262  1.00 42.23  ?  5    LEU C HG   1 
ATOM   6042 H  HD11 . LEU B 2 3   ? 11.158  -8.009  23.143  1.00 40.21  ?  5    LEU C HD11 1 
ATOM   6043 H  HD12 . LEU B 2 3   ? 12.531  -7.557  23.803  1.00 40.21  ?  5    LEU C HD12 1 
ATOM   6044 H  HD13 . LEU B 2 3   ? 11.170  -7.385  24.604  1.00 40.21  ?  5    LEU C HD13 1 
ATOM   6045 H  HD21 . LEU B 2 3   ? 9.528   -6.394  22.450  1.00 45.35  ?  5    LEU C HD21 1 
ATOM   6046 H  HD22 . LEU B 2 3   ? 9.519   -5.521  23.777  1.00 45.35  ?  5    LEU C HD22 1 
ATOM   6047 H  HD23 . LEU B 2 3   ? 9.874   -4.845  22.384  1.00 45.35  ?  5    LEU C HD23 1 
ATOM   6048 N  N    . SER B 2 4   ? 10.326  -1.847  23.154  1.00 31.66  ?  6    SER C N    1 
ATOM   6049 C  CA   . SER B 2 4   ? 9.124   -1.077  23.436  1.00 32.95  ?  6    SER C CA   1 
ATOM   6050 C  C    . SER B 2 4   ? 7.888   -1.835  22.962  1.00 34.12  ?  6    SER C C    1 
ATOM   6051 O  O    . SER B 2 4   ? 7.939   -2.604  21.996  1.00 32.22  ?  6    SER C O    1 
ATOM   6052 C  CB   . SER B 2 4   ? 9.207   0.288   22.746  1.00 32.99  ?  6    SER C CB   1 
ATOM   6053 O  OG   . SER B 2 4   ? 8.020   1.034   22.895  1.00 31.29  ?  6    SER C OG   1 
ATOM   6054 H  H    . SER B 2 4   ? 10.712  -1.636  22.415  1.00 37.97  ?  6    SER C H    1 
ATOM   6055 H  HA   . SER B 2 4   ? 9.037   -0.929  24.390  1.00 39.52  ?  6    SER C HA   1 
ATOM   6056 H  HB2  . SER B 2 4   ? 9.940   0.789   23.138  1.00 39.57  ?  6    SER C HB2  1 
ATOM   6057 H  HB3  . SER B 2 4   ? 9.369   0.148   21.800  1.00 39.57  ?  6    SER C HB3  1 
ATOM   6058 H  HG   . SER B 2 4   ? 7.353   0.530   22.818  1.00 37.53  ?  6    SER C HG   1 
ATOM   6059 N  N    . LYS B 2 5   ? 6.777   -1.618  23.660  1.00 30.93  ?  7    LYS C N    1 
ATOM   6060 C  CA   . LYS B 2 5   ? 5.470   -2.111  23.242  1.00 32.52  ?  7    LYS C CA   1 
ATOM   6061 C  C    . LYS B 2 5   ? 4.490   -0.942  23.205  1.00 32.65  ?  7    LYS C C    1 
ATOM   6062 O  O    . LYS B 2 5   ? 4.818   0.180   23.602  1.00 29.59  ?  7    LYS C O    1 
ATOM   6063 C  CB   . LYS B 2 5   ? 4.961   -3.244  24.158  1.00 34.91  ?  7    LYS C CB   1 
ATOM   6064 C  CG   . LYS B 2 5   ? 4.737   -2.919  25.633  1.00 33.75  ?  7    LYS C CG   1 
ATOM   6065 C  CD   . LYS B 2 5   ? 4.252   -4.185  26.368  1.00 38.40  ?  7    LYS C CD   1 
ATOM   6066 C  CE   . LYS B 2 5   ? 4.234   -4.049  27.888  1.00 39.45  ?  7    LYS C CE   1 
ATOM   6067 N  NZ   . LYS B 2 5   ? 5.299   -3.161  28.413  1.00 42.51  ?  7    LYS C NZ   1 
ATOM   6068 H  H    . LYS B 2 5   ? 6.758   -1.177  24.398  1.00 37.10  ?  7    LYS C H    1 
ATOM   6069 H  HA   . LYS B 2 5   ? 5.532   -2.478  22.346  1.00 39.01  ?  7    LYS C HA   1 
ATOM   6070 H  HB2  . LYS B 2 5   ? 4.110   -3.549  23.807  1.00 41.87  ?  7    LYS C HB2  1 
ATOM   6071 H  HB3  . LYS B 2 5   ? 5.610   -3.965  24.126  1.00 41.87  ?  7    LYS C HB3  1 
ATOM   6072 H  HG2  . LYS B 2 5   ? 5.568   -2.622  26.035  1.00 40.48  ?  7    LYS C HG2  1 
ATOM   6073 H  HG3  . LYS B 2 5   ? 4.061   -2.228  25.719  1.00 40.48  ?  7    LYS C HG3  1 
ATOM   6074 H  HD2  . LYS B 2 5   ? 3.349   -4.387  26.079  1.00 46.06  ?  7    LYS C HD2  1 
ATOM   6075 H  HD3  . LYS B 2 5   ? 4.844   -4.921  26.145  1.00 46.06  ?  7    LYS C HD3  1 
ATOM   6076 H  HE2  . LYS B 2 5   ? 3.379   -3.680  28.160  1.00 47.32  ?  7    LYS C HE2  1 
ATOM   6077 H  HE3  . LYS B 2 5   ? 4.357   -4.926  28.284  1.00 47.32  ?  7    LYS C HE3  1 
ATOM   6078 H  HZ1  . LYS B 2 5   ? 6.095   -3.437  28.125  1.00 51.00  ?  7    LYS C HZ1  1 
ATOM   6079 H  HZ2  . LYS B 2 5   ? 5.164   -2.326  28.133  1.00 51.00  ?  7    LYS C HZ2  1 
ATOM   6080 H  HZ3  . LYS B 2 5   ? 5.294   -3.172  29.302  1.00 51.00  ?  7    LYS C HZ3  1 
ATOM   6081 N  N    . ILE B 2 6   ? 3.285   -1.200  22.692  1.00 31.59  ?  8    ILE C N    1 
ATOM   6082 C  CA   . ILE B 2 6   ? 2.301   -0.135  22.536  1.00 34.83  ?  8    ILE C CA   1 
ATOM   6083 C  C    . ILE B 2 6   ? 1.830   0.319   23.908  1.00 36.45  ?  8    ILE C C    1 
ATOM   6084 O  O    . ILE B 2 6   ? 1.478   -0.498  24.767  1.00 34.37  ?  8    ILE C O    1 
ATOM   6085 C  CB   . ILE B 2 6   ? 1.127   -0.598  21.660  1.00 35.58  ?  8    ILE C CB   1 
ATOM   6086 C  CG1  . ILE B 2 6   ? 1.552   -0.604  20.188  1.00 37.38  ?  8    ILE C CG1  1 
ATOM   6087 C  CG2  . ILE B 2 6   ? -0.072  0.308   21.867  1.00 38.77  ?  8    ILE C CG2  1 
ATOM   6088 C  CD1  . ILE B 2 6   ? 0.964   -1.731  19.381  1.00 38.39  ?  8    ILE C CD1  1 
ATOM   6089 H  H    . ILE B 2 6   ? 3.017   -1.974  22.430  1.00 37.90  ?  8    ILE C H    1 
ATOM   6090 H  HA   . ILE B 2 6   ? 2.721   0.619   22.094  1.00 41.77  ?  8    ILE C HA   1 
ATOM   6091 H  HB   . ILE B 2 6   ? 0.877   -1.500  21.918  1.00 42.68  ?  8    ILE C HB   1 
ATOM   6092 H  HG12 . ILE B 2 6   ? 1.268   0.229   19.780  1.00 44.84  ?  8    ILE C HG12 1 
ATOM   6093 H  HG13 . ILE B 2 6   ? 2.518   -0.683  20.143  1.00 44.84  ?  8    ILE C HG13 1 
ATOM   6094 H  HG21 . ILE B 2 6   ? -0.683  0.198   21.123  1.00 46.51  ?  8    ILE C HG21 1 
ATOM   6095 H  HG22 . ILE B 2 6   ? -0.512  0.065   22.696  1.00 46.51  ?  8    ILE C HG22 1 
ATOM   6096 H  HG23 . ILE B 2 6   ? 0.232   1.228   21.912  1.00 46.51  ?  8    ILE C HG23 1 
ATOM   6097 H  HD11 . ILE B 2 6   ? 1.280   -1.664  18.466  1.00 46.05  ?  8    ILE C HD11 1 
ATOM   6098 H  HD12 . ILE B 2 6   ? 1.245   -2.576  19.766  1.00 46.05  ?  8    ILE C HD12 1 
ATOM   6099 H  HD13 . ILE B 2 6   ? -0.004  -1.663  19.402  1.00 46.05  ?  8    ILE C HD13 1 
ATOM   6100 N  N    . PHE B 2 7   ? 1.837   1.628   24.127  1.00 35.62  ?  9    PHE C N    1 
ATOM   6101 C  CA   . PHE B 2 7   ? 1.396   2.180   25.403  1.00 39.92  ?  9    PHE C CA   1 
ATOM   6102 C  C    . PHE B 2 7   ? -0.131  2.198   25.471  1.00 43.12  ?  9    PHE C C    1 
ATOM   6103 O  O    . PHE B 2 7   ? -0.811  2.553   24.504  1.00 43.23  ?  9    PHE C O    1 
ATOM   6104 C  CB   . PHE B 2 7   ? 1.946   3.590   25.612  1.00 36.12  ?  9    PHE C CB   1 
ATOM   6105 C  CG   . PHE B 2 7   ? 1.527   4.212   26.916  1.00 40.25  ?  9    PHE C CG   1 
ATOM   6106 C  CD1  . PHE B 2 7   ? 0.479   5.119   26.961  1.00 42.16  ?  9    PHE C CD1  1 
ATOM   6107 C  CD2  . PHE B 2 7   ? 2.172   3.884   28.097  1.00 39.64  ?  9    PHE C CD2  1 
ATOM   6108 C  CE1  . PHE B 2 7   ? 0.085   5.689   28.160  1.00 40.05  ?  9    PHE C CE1  1 
ATOM   6109 C  CE2  . PHE B 2 7   ? 1.782   4.452   29.300  1.00 42.06  ?  9    PHE C CE2  1 
ATOM   6110 C  CZ   . PHE B 2 7   ? 0.739   5.355   29.330  1.00 38.24  ?  9    PHE C CZ   1 
ATOM   6111 O  OXT  . PHE B 2 7   ? -0.711  1.860   26.498  1.00 45.95  ?  9    PHE C OXT  1 
ATOM   6112 H  H    . PHE B 2 7   ? 2.091   2.217   23.554  1.00 42.72  ?  9    PHE C H    1 
ATOM   6113 H  HA   . PHE B 2 7   ? 1.736   1.626   26.124  1.00 47.89  ?  9    PHE C HA   1 
ATOM   6114 H  HB2  . PHE B 2 7   ? 2.915   3.553   25.598  1.00 43.33  ?  9    PHE C HB2  1 
ATOM   6115 H  HB3  . PHE B 2 7   ? 1.625   4.160   24.895  1.00 43.33  ?  9    PHE C HB3  1 
ATOM   6116 H  HD1  . PHE B 2 7   ? 0.035   5.347   26.176  1.00 50.58  ?  9    PHE C HD1  1 
ATOM   6117 H  HD2  . PHE B 2 7   ? 2.875   3.276   28.084  1.00 47.55  ?  9    PHE C HD2  1 
ATOM   6118 H  HE1  . PHE B 2 7   ? -0.619  6.296   28.178  1.00 48.04  ?  9    PHE C HE1  1 
ATOM   6119 H  HE2  . PHE B 2 7   ? 2.222   4.224   30.087  1.00 50.46  ?  9    PHE C HE2  1 
ATOM   6120 H  HZ   . PHE B 2 7   ? 0.477   5.739   30.136  1.00 45.88  ?  9    PHE C HZ   1 
HETATM 6121 MG MG   . MG  C 3 .   ? 28.198  -9.317  37.183  1.00 70.76  ?  501  MG  A MG   1 
HETATM 6122 C  C1   . GOL D 4 .   ? 15.334  -7.175  30.905  1.00 53.92  ?  502  GOL A C1   1 
HETATM 6123 O  O1   . GOL D 4 .   ? 15.818  -6.085  30.164  1.00 49.13  ?  502  GOL A O1   1 
HETATM 6124 C  C2   . GOL D 4 .   ? 16.526  -7.803  31.654  1.00 53.49  ?  502  GOL A C2   1 
HETATM 6125 O  O2   . GOL D 4 .   ? 16.228  -8.030  32.991  1.00 52.81  ?  502  GOL A O2   1 
HETATM 6126 C  C3   . GOL D 4 .   ? 16.794  -9.118  30.909  1.00 48.65  ?  502  GOL A C3   1 
HETATM 6127 O  O3   . GOL D 4 .   ? 18.079  -9.532  31.259  1.00 49.84  ?  502  GOL A O3   1 
HETATM 6128 H  H11  . GOL D 4 .   ? 14.657  -6.914  31.549  1.00 64.69  ?  502  GOL A H11  1 
HETATM 6129 H  H12  . GOL D 4 .   ? 14.921  -7.850  30.344  1.00 64.69  ?  502  GOL A H12  1 
HETATM 6130 H  HO1  . GOL D 4 .   ? 15.196  -5.505  30.153  1.00 58.94  ?  502  GOL A HO1  1 
HETATM 6131 H  H2   . GOL D 4 .   ? 17.297  -7.215  31.636  1.00 64.17  ?  502  GOL A H2   1 
HETATM 6132 H  HO2  . GOL D 4 .   ? 16.912  -8.379  33.356  1.00 63.36  ?  502  GOL A HO2  1 
HETATM 6133 H  H31  . GOL D 4 .   ? 16.106  -9.759  31.146  1.00 58.36  ?  502  GOL A H31  1 
HETATM 6134 H  H32  . GOL D 4 .   ? 16.685  -8.966  29.957  1.00 58.36  ?  502  GOL A H32  1 
HETATM 6135 H  HO3  . GOL D 4 .   ? 17.996  -10.279 31.654  1.00 59.79  ?  502  GOL A HO3  1 
HETATM 6136 C  C1   . GOL E 4 .   ? 16.124  -0.514  19.713  1.00 57.05  ?  503  GOL A C1   1 
HETATM 6137 O  O1   . GOL E 4 .   ? 16.948  -0.394  20.816  1.00 59.80  ?  503  GOL A O1   1 
HETATM 6138 C  C2   . GOL E 4 .   ? 16.866  -1.100  18.521  1.00 55.52  ?  503  GOL A C2   1 
HETATM 6139 O  O2   . GOL E 4 .   ? 18.211  -1.340  18.758  1.00 58.83  ?  503  GOL A O2   1 
HETATM 6140 C  C3   . GOL E 4 .   ? 16.148  -2.434  18.161  1.00 47.86  ?  503  GOL A C3   1 
HETATM 6141 O  O3   . GOL E 4 .   ? 16.601  -2.802  16.866  1.00 42.69  ?  503  GOL A O3   1 
HETATM 6142 H  H11  . GOL E 4 .   ? 15.360  -1.082  19.898  1.00 68.45  ?  503  GOL A H11  1 
HETATM 6143 H  H12  . GOL E 4 .   ? 15.759  0.344   19.445  1.00 68.45  ?  503  GOL A H12  1 
HETATM 6144 H  HO1  . GOL E 4 .   ? 17.361  0.344   20.731  1.00 71.74  ?  503  GOL A HO1  1 
HETATM 6145 H  H2   . GOL E 4 .   ? 16.817  -0.449  17.803  1.00 66.61  ?  503  GOL A H2   1 
HETATM 6146 H  HO2  . GOL E 4 .   ? 18.604  -0.589  18.817  1.00 70.58  ?  503  GOL A HO2  1 
HETATM 6147 H  H31  . GOL E 4 .   ? 16.350  -3.095  18.842  1.00 57.42  ?  503  GOL A H31  1 
HETATM 6148 H  H32  . GOL E 4 .   ? 15.189  -2.300  18.210  1.00 57.42  ?  503  GOL A H32  1 
HETATM 6149 H  HO3  . GOL E 4 .   ? 17.368  -3.155  16.966  1.00 51.22  ?  503  GOL A HO3  1 
HETATM 6150 C  C1   . GOL F 4 .   ? 27.582  12.219  25.228  1.00 48.58  ?  504  GOL A C1   1 
HETATM 6151 O  O1   . GOL F 4 .   ? 26.477  11.379  25.350  1.00 39.26  ?  504  GOL A O1   1 
HETATM 6152 C  C2   . GOL F 4 .   ? 27.006  13.589  24.991  1.00 55.33  ?  504  GOL A C2   1 
HETATM 6153 O  O2   . GOL F 4 .   ? 26.505  14.196  26.134  1.00 58.26  ?  504  GOL A O2   1 
HETATM 6154 C  C3   . GOL F 4 .   ? 28.191  14.384  24.422  1.00 54.36  ?  504  GOL A C3   1 
HETATM 6155 O  O3   . GOL F 4 .   ? 27.756  15.706  24.207  1.00 58.82  ?  504  GOL A O3   1 
HETATM 6156 H  H11  . GOL F 4 .   ? 28.141  12.228  26.021  1.00 58.28  ?  504  GOL A H11  1 
HETATM 6157 H  H12  . GOL F 4 .   ? 28.166  11.975  24.494  1.00 58.28  ?  504  GOL A H12  1 
HETATM 6158 H  HO1  . GOL F 4 .   ? 26.667  10.816  25.957  1.00 47.10  ?  504  GOL A HO1  1 
HETATM 6159 H  H2   . GOL F 4 .   ? 26.252  13.528  24.383  1.00 66.38  ?  504  GOL A H2   1 
HETATM 6160 H  HO2  . GOL F 4 .   ? 25.663  14.080  26.144  1.00 69.90  ?  504  GOL A HO2  1 
HETATM 6161 H  H31  . GOL F 4 .   ? 28.932  14.322  25.044  1.00 65.22  ?  504  GOL A H31  1 
HETATM 6162 H  H32  . GOL F 4 .   ? 28.498  13.946  23.613  1.00 65.22  ?  504  GOL A H32  1 
HETATM 6163 H  HO3  . GOL F 4 .   ? 27.508  15.752  23.395  1.00 70.57  ?  504  GOL A HO3  1 
HETATM 6164 C  C1   . GOL G 4 .   ? 39.334  -9.750  12.145  1.00 39.71  ?  505  GOL A C1   1 
HETATM 6165 O  O1   . GOL G 4 .   ? 40.309  -9.644  13.117  1.00 43.81  ?  505  GOL A O1   1 
HETATM 6166 C  C2   . GOL G 4 .   ? 39.873  -10.497 10.922  1.00 55.31  ?  505  GOL A C2   1 
HETATM 6167 O  O2   . GOL G 4 .   ? 40.128  -11.821 11.171  1.00 57.21  ?  505  GOL A O2   1 
HETATM 6168 C  C3   . GOL G 4 .   ? 38.705  -10.297 9.931   1.00 53.63  ?  505  GOL A C3   1 
HETATM 6169 O  O3   . GOL G 4 .   ? 39.209  -10.349 8.634   1.00 59.16  ?  505  GOL A O3   1 
HETATM 6170 H  H11  . GOL G 4 .   ? 38.551  -10.222 12.469  1.00 47.64  ?  505  GOL A H11  1 
HETATM 6171 H  H12  . GOL G 4 .   ? 39.018  -8.880  11.854  1.00 47.64  ?  505  GOL A H12  1 
HETATM 6172 H  HO1  . GOL G 4 .   ? 40.343  -8.823  13.337  1.00 52.55  ?  505  GOL A HO1  1 
HETATM 6173 H  H2   . GOL G 4 .   ? 40.723  -10.148 10.609  1.00 66.36  ?  505  GOL A H2   1 
HETATM 6174 H  H31  . GOL G 4 .   ? 38.036  -10.977 10.105  1.00 64.34  ?  505  GOL A H31  1 
HETATM 6175 H  H32  . GOL G 4 .   ? 38.272  -9.453  10.136  1.00 64.34  ?  505  GOL A H32  1 
HETATM 6176 C  C1   . GOL H 4 .   ? 24.076  2.171   11.165  1.00 57.77  ?  506  GOL A C1   1 
HETATM 6177 O  O1   . GOL H 4 .   ? 23.363  2.344   9.998   1.00 59.67  ?  506  GOL A O1   1 
HETATM 6178 C  C2   . GOL H 4 .   ? 24.116  0.670   11.399  1.00 55.26  ?  506  GOL A C2   1 
HETATM 6179 O  O2   . GOL H 4 .   ? 24.264  -0.030  10.218  1.00 57.72  ?  506  GOL A O2   1 
HETATM 6180 C  C3   . GOL H 4 .   ? 25.305  0.462   12.318  1.00 52.22  ?  506  GOL A C3   1 
HETATM 6181 O  O3   . GOL H 4 .   ? 24.810  -0.084  13.497  1.00 51.43  ?  506  GOL A O3   1 
HETATM 6182 H  H11  . GOL H 4 .   ? 24.980  2.518   11.111  1.00 69.31  ?  506  GOL A H11  1 
HETATM 6183 H  H12  . GOL H 4 .   ? 23.668  2.610   11.927  1.00 69.31  ?  506  GOL A H12  1 
HETATM 6184 H  HO1  . GOL H 4 .   ? 23.898  2.175   9.360   1.00 71.59  ?  506  GOL A HO1  1 
HETATM 6185 H  H2   . GOL H 4 .   ? 23.289  0.362   11.802  1.00 66.29  ?  506  GOL A H2   1 
HETATM 6186 H  H31  . GOL H 4 .   ? 25.952  -0.106  11.872  1.00 62.65  ?  506  GOL A H31  1 
HETATM 6187 H  H32  . GOL H 4 .   ? 25.755  1.312   12.447  1.00 62.65  ?  506  GOL A H32  1 
HETATM 6188 C  C1   . GOL I 4 .   ? 10.559  -18.654 20.010  1.00 57.03  ?  507  GOL A C1   1 
HETATM 6189 O  O1   . GOL I 4 .   ? 10.092  -19.740 19.228  1.00 60.83  ?  507  GOL A O1   1 
HETATM 6190 C  C2   . GOL I 4 .   ? 11.998  -18.980 20.483  1.00 57.41  ?  507  GOL A C2   1 
HETATM 6191 O  O2   . GOL I 4 .   ? 12.877  -19.112 19.424  1.00 60.97  ?  507  GOL A O2   1 
HETATM 6192 C  C3   . GOL I 4 .   ? 12.402  -17.782 21.364  1.00 50.60  ?  507  GOL A C3   1 
HETATM 6193 O  O3   . GOL I 4 .   ? 13.519  -18.148 22.146  1.00 51.08  ?  507  GOL A O3   1 
HETATM 6194 H  H11  . GOL I 4 .   ? 10.572  -17.821 19.513  1.00 68.42  ?  507  GOL A H11  1 
HETATM 6195 H  H12  . GOL I 4 .   ? 10.001  -18.491 20.786  1.00 68.42  ?  507  GOL A H12  1 
HETATM 6196 H  HO1  . GOL I 4 .   ? 9.243   -19.696 19.235  1.00 72.99  ?  507  GOL A HO1  1 
HETATM 6197 H  H2   . GOL I 4 .   ? 12.004  -19.819 20.970  1.00 68.87  ?  507  GOL A H2   1 
HETATM 6198 H  HO2  . GOL I 4 .   ? 13.565  -19.524 19.706  1.00 73.15  ?  507  GOL A HO2  1 
HETATM 6199 H  H31  . GOL I 4 .   ? 12.577  -17.024 20.785  1.00 60.70  ?  507  GOL A H31  1 
HETATM 6200 H  H32  . GOL I 4 .   ? 11.634  -17.525 21.898  1.00 60.70  ?  507  GOL A H32  1 
HETATM 6201 H  HO3  . GOL I 4 .   ? 13.249  -18.198 22.950  1.00 61.28  ?  507  GOL A HO3  1 
HETATM 6202 C  C1   . GOL J 4 .   ? 37.037  -16.286 9.571   1.00 61.18  ?  508  GOL A C1   1 
HETATM 6203 O  O1   . GOL J 4 .   ? 37.603  -15.069 10.012  1.00 61.61  ?  508  GOL A O1   1 
HETATM 6204 C  C2   . GOL J 4 .   ? 37.761  -17.406 10.343  1.00 65.17  ?  508  GOL A C2   1 
HETATM 6205 O  O2   . GOL J 4 .   ? 37.897  -17.080 11.693  1.00 67.26  ?  508  GOL A O2   1 
HETATM 6206 C  C3   . GOL J 4 .   ? 36.923  -18.707 10.172  1.00 67.99  ?  508  GOL A C3   1 
HETATM 6207 O  O3   . GOL J 4 .   ? 37.521  -19.727 10.977  1.00 71.11  ?  508  GOL A O3   1 
HETATM 6208 H  H11  . GOL J 4 .   ? 36.083  -16.339 9.740   1.00 73.40  ?  508  GOL A H11  1 
HETATM 6209 H  H12  . GOL J 4 .   ? 37.145  -16.426 8.617   1.00 73.40  ?  508  GOL A H12  1 
HETATM 6210 H  HO1  . GOL J 4 .   ? 37.605  -14.546 9.342   1.00 73.91  ?  508  GOL A HO1  1 
HETATM 6211 H  H2   . GOL J 4 .   ? 38.647  -17.528 9.966   1.00 78.19  ?  508  GOL A H2   1 
HETATM 6212 H  HO2  . GOL J 4 .   ? 37.763  -17.786 12.147  1.00 80.69  ?  508  GOL A HO2  1 
HETATM 6213 H  H31  . GOL J 4 .   ? 36.005  -18.516 10.418  1.00 81.57  ?  508  GOL A H31  1 
HETATM 6214 H  H32  . GOL J 4 .   ? 36.894  -18.933 9.229   1.00 81.57  ?  508  GOL A H32  1 
HETATM 6215 H  HO3  . GOL J 4 .   ? 37.357  -20.467 10.593  1.00 85.32  ?  508  GOL A HO3  1 
HETATM 6216 C  C1   . GOL K 4 .   ? 34.928  1.126   8.652   1.00 69.08  ?  509  GOL A C1   1 
HETATM 6217 O  O1   . GOL K 4 .   ? 34.143  2.187   9.085   1.00 65.91  ?  509  GOL A O1   1 
HETATM 6218 C  C2   . GOL K 4 .   ? 35.093  1.272   7.131   1.00 71.30  ?  509  GOL A C2   1 
HETATM 6219 O  O2   . GOL K 4 .   ? 35.681  2.470   6.783   1.00 74.44  ?  509  GOL A O2   1 
HETATM 6220 C  C3   . GOL K 4 .   ? 35.959  0.063   6.765   1.00 68.39  ?  509  GOL A C3   1 
HETATM 6221 O  O3   . GOL K 4 .   ? 35.748  -0.193  5.413   1.00 66.36  ?  509  GOL A O3   1 
HETATM 6222 H  H11  . GOL K 4 .   ? 35.804  1.118   9.069   1.00 82.89  ?  509  GOL A H11  1 
HETATM 6223 H  H12  . GOL K 4 .   ? 34.531  0.264   8.850   1.00 82.89  ?  509  GOL A H12  1 
HETATM 6224 H  HO1  . GOL K 4 .   ? 33.866  1.982   9.862   1.00 79.08  ?  509  GOL A HO1  1 
HETATM 6225 H  H2   . GOL K 4 .   ? 34.239  1.265   6.670   1.00 85.54  ?  509  GOL A H2   1 
HETATM 6226 H  H31  . GOL K 4 .   ? 36.884  0.264   6.978   1.00 82.05  ?  509  GOL A H31  1 
HETATM 6227 H  H32  . GOL K 4 .   ? 35.719  -0.680  7.339   1.00 82.05  ?  509  GOL A H32  1 
HETATM 6228 C  C1   . GOL L 4 .   ? 38.995  -1.342  11.762  1.00 48.96  ?  510  GOL A C1   1 
HETATM 6229 O  O1   . GOL L 4 .   ? 39.050  -2.287  10.750  1.00 49.03  ?  510  GOL A O1   1 
HETATM 6230 C  C2   . GOL L 4 .   ? 39.316  0.023   11.134  1.00 62.24  ?  510  GOL A C2   1 
HETATM 6231 O  O2   . GOL L 4 .   ? 38.361  0.411   10.215  1.00 63.43  ?  510  GOL A O2   1 
HETATM 6232 C  C3   . GOL L 4 .   ? 39.368  0.956   12.349  1.00 60.61  ?  510  GOL A C3   1 
HETATM 6233 O  O3   . GOL L 4 .   ? 39.925  2.166   11.922  1.00 66.74  ?  510  GOL A O3   1 
HETATM 6234 H  H11  . GOL L 4 .   ? 38.123  -1.301  12.185  1.00 58.73  ?  510  GOL A H11  1 
HETATM 6235 H  H12  . GOL L 4 .   ? 39.627  -1.522  12.475  1.00 58.73  ?  510  GOL A H12  1 
HETATM 6236 H  HO1  . GOL L 4 .   ? 38.976  -3.046  11.124  1.00 58.82  ?  510  GOL A HO1  1 
HETATM 6237 H  H2   . GOL L 4 .   ? 40.154  0.007   10.644  1.00 74.67  ?  510  GOL A H2   1 
HETATM 6238 H  HO2  . GOL L 4 .   ? 38.589  1.169   9.906   1.00 76.10  ?  510  GOL A HO2  1 
HETATM 6239 H  H31  . GOL L 4 .   ? 38.471  1.052   12.707  1.00 72.72  ?  510  GOL A H31  1 
HETATM 6240 H  H32  . GOL L 4 .   ? 39.879  0.526   13.052  1.00 72.72  ?  510  GOL A H32  1 
HETATM 6241 H  HO3  . GOL L 4 .   ? 40.072  2.627   12.620  1.00 80.08  ?  510  GOL A HO3  1 
HETATM 6242 O  O19  . 4PS M 5 .   ? 25.724  -4.609  38.288  1.00 64.03  -1 511  4PS A O19  1 
HETATM 6243 P  P20  . 4PS M 5 .   ? 27.029  -4.960  37.603  1.00 63.61  ?  511  4PS A P20  1 
HETATM 6244 O  O21  . 4PS M 5 .   ? 27.736  -6.087  38.329  1.00 58.85  ?  511  4PS A O21  1 
HETATM 6245 O  O22  . 4PS M 5 .   ? 27.992  -3.614  37.532  1.00 62.59  ?  511  4PS A O22  1 
HETATM 6246 O  O23  . 4PS M 5 .   ? 26.631  -5.372  36.058  1.00 59.32  ?  511  4PS A O23  1 
HETATM 6247 P  P24  . 4PS M 5 .   ? 26.175  -6.883  35.591  1.00 58.06  ?  511  4PS A P24  1 
HETATM 6248 O  O25  . 4PS M 5 .   ? 27.411  -7.722  35.354  1.00 52.50  -1 511  4PS A O25  1 
HETATM 6249 O  O26  . 4PS M 5 .   ? 25.257  -7.524  36.617  1.00 56.52  ?  511  4PS A O26  1 
HETATM 6250 O  O27  . 4PS M 5 .   ? 25.397  -6.652  34.149  1.00 53.08  ?  511  4PS A O27  1 
HETATM 6251 C  C28  . 4PS M 5 .   ? 24.839  -5.383  33.907  1.00 47.15  ?  511  4PS A C28  1 
HETATM 6252 C  C29  . 4PS M 5 .   ? 23.971  -5.545  32.643  1.00 42.23  ?  511  4PS A C29  1 
HETATM 6253 C  C30  . 4PS M 5 .   ? 23.182  -4.263  32.409  1.00 46.71  ?  511  4PS A C30  1 
HETATM 6254 C  C31  . 4PS M 5 .   ? 24.873  -5.864  31.444  1.00 41.09  ?  511  4PS A C31  1 
HETATM 6255 C  C32  . 4PS M 5 .   ? 23.002  -6.729  32.845  1.00 42.26  ?  511  4PS A C32  1 
HETATM 6256 O  O33  . 4PS M 5 .   ? 21.975  -6.341  33.705  1.00 37.90  ?  511  4PS A O33  1 
HETATM 6257 C  C34  . 4PS M 5 .   ? 22.361  -7.200  31.524  1.00 37.25  ?  511  4PS A C34  1 
HETATM 6258 O  O35  . 4PS M 5 .   ? 22.915  -7.955  30.782  1.00 33.42  ?  511  4PS A O35  1 
HETATM 6259 N  N36  . 4PS M 5 .   ? 21.016  -6.729  31.177  1.00 36.55  ?  511  4PS A N36  1 
HETATM 6260 C  C37  . 4PS M 5 .   ? 20.390  -7.184  29.921  1.00 35.03  ?  511  4PS A C37  1 
HETATM 6261 C  C38  . 4PS M 5 .   ? 21.190  -6.643  28.722  1.00 35.07  ?  511  4PS A C38  1 
HETATM 6262 C  C39  . 4PS M 5 .   ? 21.060  -5.097  28.622  1.00 36.42  ?  511  4PS A C39  1 
HETATM 6263 O  O40  . 4PS M 5 .   ? 20.125  -4.555  29.121  1.00 35.08  ?  511  4PS A O40  1 
HETATM 6264 N  N41  . 4PS M 5 .   ? 22.097  -4.310  27.919  1.00 37.66  ?  511  4PS A N41  1 
HETATM 6265 C  C42  . 4PS M 5 .   ? 21.947  -2.844  27.812  1.00 41.47  ?  511  4PS A C42  1 
HETATM 6266 C  C43  . 4PS M 5 .   ? 23.263  -2.041  28.015  1.00 44.93  ?  511  4PS A C43  1 
HETATM 6267 S  S44  . 4PS M 5 .   ? 22.854  -0.535  29.016  1.00 51.08  ?  511  4PS A S44  1 
HETATM 6268 H  H28  . 4PS M 5 .   ? 25.539  -4.729  33.755  1.00 56.57  ?  511  4PS A H28  1 
HETATM 6269 H  H28A . 4PS M 5 .   ? 24.294  -5.104  34.659  1.00 56.57  ?  511  4PS A H28A 1 
HETATM 6270 H  H30  . 4PS M 5 .   ? 23.762  -3.595  32.009  1.00 56.04  ?  511  4PS A H30  1 
HETATM 6271 H  H30A . 4PS M 5 .   ? 22.439  -4.445  31.812  1.00 56.04  ?  511  4PS A H30A 1 
HETATM 6272 H  H30B . 4PS M 5 .   ? 22.843  -3.933  33.255  1.00 56.04  ?  511  4PS A H30B 1 
HETATM 6273 H  H31  . 4PS M 5 .   ? 25.663  -5.301  31.474  1.00 49.29  ?  511  4PS A H31  1 
HETATM 6274 H  H31A . 4PS M 5 .   ? 24.388  -5.697  30.621  1.00 49.29  ?  511  4PS A H31A 1 
HETATM 6275 H  H31B . 4PS M 5 .   ? 25.139  -6.797  31.479  1.00 49.29  ?  511  4PS A H31B 1 
HETATM 6276 H  H32  . 4PS M 5 .   ? 23.520  -7.462  33.212  1.00 50.69  ?  511  4PS A H32  1 
HETATM 6277 H  HO33 . 4PS M 5 .   ? 21.424  -6.982  33.797  1.00 45.47  ?  511  4PS A HO33 1 
HETATM 6278 H  HN36 . 4PS M 5 .   ? 20.596  -6.192  31.701  1.00 43.85  ?  511  4PS A HN36 1 
HETATM 6279 H  H37  . 4PS M 5 .   ? 19.478  -6.855  29.877  1.00 42.03  ?  511  4PS A H37  1 
HETATM 6280 H  H37A . 4PS M 5 .   ? 20.385  -8.154  29.895  1.00 42.03  ?  511  4PS A H37A 1 
HETATM 6281 H  H38  . 4PS M 5 .   ? 22.125  -6.876  28.833  1.00 42.07  ?  511  4PS A H38  1 
HETATM 6282 H  H38A . 4PS M 5 .   ? 20.851  -7.044  27.907  1.00 42.07  ?  511  4PS A H38A 1 
HETATM 6283 H  HN41 . 4PS M 5 .   ? 22.782  -4.702  27.576  1.00 45.18  ?  511  4PS A HN41 1 
HETATM 6284 H  H42  . 4PS M 5 .   ? 21.310  -2.555  28.484  1.00 49.75  ?  511  4PS A H42  1 
HETATM 6285 H  H42A . 4PS M 5 .   ? 21.601  -2.639  26.929  1.00 49.75  ?  511  4PS A H42A 1 
HETATM 6286 H  H43  . 4PS M 5 .   ? 23.625  -1.777  27.155  1.00 53.90  ?  511  4PS A H43  1 
HETATM 6287 H  H43A . 4PS M 5 .   ? 23.912  -2.585  28.487  1.00 53.90  ?  511  4PS A H43A 1 
HETATM 6288 S  S    . SO4 N 6 .   ? -15.239 1.107   11.440  1.00 134.28 ?  512  SO4 A S    1 
HETATM 6289 O  O1   . SO4 N 6 .   ? -14.039 0.833   10.681  1.00 130.82 ?  512  SO4 A O1   1 
HETATM 6290 O  O2   . SO4 N 6 .   ? -16.425 0.476   10.852  1.00 137.23 ?  512  SO4 A O2   1 
HETATM 6291 O  O3   . SO4 N 6 .   ? -14.794 0.513   12.659  1.00 136.93 ?  512  SO4 A O3   1 
HETATM 6292 O  O4   . SO4 N 6 .   ? -15.457 2.527   11.683  1.00 136.64 ?  512  SO4 A O4   1 
HETATM 6293 C  C1   . MYR O 7 .   ? 24.827  -1.568  24.469  1.00 38.67  ?  1000 MYR C C1   1 
HETATM 6294 O  O1   . MYR O 7 .   ? 25.298  -2.650  24.311  1.00 34.88  ?  1000 MYR C O1   1 
HETATM 6295 C  C2   . MYR O 7 .   ? 25.786  -0.364  24.658  1.00 33.33  ?  1000 MYR C C2   1 
HETATM 6296 C  C3   . MYR O 7 .   ? 26.534  -0.540  26.010  1.00 34.29  ?  1000 MYR C C3   1 
HETATM 6297 C  C4   . MYR O 7 .   ? 27.484  0.679   26.125  1.00 27.61  ?  1000 MYR C C4   1 
HETATM 6298 C  C5   . MYR O 7 .   ? 28.230  0.543   27.492  1.00 31.76  ?  1000 MYR C C5   1 
HETATM 6299 C  C6   . MYR O 7 .   ? 29.290  1.697   27.645  1.00 29.61  ?  1000 MYR C C6   1 
HETATM 6300 C  C7   . MYR O 7 .   ? 30.321  1.669   26.449  1.00 26.83  ?  1000 MYR C C7   1 
HETATM 6301 C  C8   . MYR O 7 .   ? 31.341  2.844   26.630  1.00 27.51  ?  1000 MYR C C8   1 
HETATM 6302 C  C9   . MYR O 7 .   ? 32.270  2.977   25.366  1.00 23.67  ?  1000 MYR C C9   1 
HETATM 6303 C  C10  . MYR O 7 .   ? 33.174  1.709   25.273  1.00 27.18  ?  1000 MYR C C10  1 
HETATM 6304 C  C11  . MYR O 7 .   ? 34.052  1.769   23.985  1.00 26.50  ?  1000 MYR C C11  1 
HETATM 6305 C  C12  . MYR O 7 .   ? 35.057  2.938   24.091  1.00 28.61  ?  1000 MYR C C12  1 
HETATM 6306 C  C13  . MYR O 7 .   ? 35.884  2.973   22.793  1.00 29.00  ?  1000 MYR C C13  1 
HETATM 6307 C  C14  . MYR O 7 .   ? 36.705  4.268   22.753  1.00 29.80  ?  1000 MYR C C14  1 
HETATM 6308 O  O    . HOH P 8 .   ? 36.158  -21.438 11.684  1.00 57.85  ?  601  HOH A O    1 
HETATM 6309 O  O    . HOH P 8 .   ? 26.788  3.067   11.318  1.00 39.90  ?  602  HOH A O    1 
HETATM 6310 O  O    . HOH P 8 .   ? 32.956  5.619   5.678   1.00 42.22  ?  603  HOH A O    1 
HETATM 6311 O  O    . HOH P 8 .   ? 40.341  12.052  21.323  1.00 37.72  ?  604  HOH A O    1 
HETATM 6312 O  O    . HOH P 8 .   ? 14.623  -14.137 23.592  1.00 31.82  ?  605  HOH A O    1 
HETATM 6313 O  O    . HOH P 8 .   ? 19.780  12.112  -1.047  1.00 39.24  ?  606  HOH A O    1 
HETATM 6314 O  O    . HOH P 8 .   ? 20.728  -4.345  20.842  1.00 31.39  ?  607  HOH A O    1 
HETATM 6315 O  O    . HOH P 8 .   ? 29.267  0.632   8.520   1.00 40.74  ?  608  HOH A O    1 
HETATM 6316 O  O    . HOH P 8 .   ? 4.435   -0.543  -6.915  1.00 44.58  ?  609  HOH A O    1 
HETATM 6317 O  O    . HOH P 8 .   ? 27.982  -21.536 26.270  1.00 35.18  ?  610  HOH A O    1 
HETATM 6318 O  O    . HOH P 8 .   ? 13.775  -7.307  6.952   1.00 29.34  ?  611  HOH A O    1 
HETATM 6319 O  O    . HOH P 8 .   ? -5.114  -9.349  13.427  1.00 38.68  ?  612  HOH A O    1 
HETATM 6320 O  O    . HOH P 8 .   ? 35.044  -19.371 21.703  1.00 33.08  ?  613  HOH A O    1 
HETATM 6321 O  O    . HOH P 8 .   ? 19.443  -14.259 20.182  1.00 28.80  ?  614  HOH A O    1 
HETATM 6322 O  O    . HOH P 8 .   ? 11.239  -7.232  18.355  1.00 30.26  ?  615  HOH A O    1 
HETATM 6323 O  O    . HOH P 8 .   ? 33.808  -12.976 15.378  1.00 27.81  ?  616  HOH A O    1 
HETATM 6324 O  O    . HOH P 8 .   ? 3.212   11.847  13.530  1.00 36.18  ?  617  HOH A O    1 
HETATM 6325 O  O    . HOH P 8 .   ? 10.963  1.309   5.991   1.00 31.92  ?  618  HOH A O    1 
HETATM 6326 O  O    . HOH P 8 .   ? 23.530  -7.090  2.938   1.00 30.29  ?  619  HOH A O    1 
HETATM 6327 O  O    . HOH P 8 .   ? 15.070  7.941   7.051   1.00 30.81  ?  620  HOH A O    1 
HETATM 6328 O  O    . HOH P 8 .   ? -5.138  1.066   8.009   1.00 41.02  ?  621  HOH A O    1 
HETATM 6329 O  O    . HOH P 8 .   ? 40.196  11.478  18.479  1.00 48.48  ?  622  HOH A O    1 
HETATM 6330 O  O    . HOH P 8 .   ? 1.023   2.824   -0.346  1.00 39.56  ?  623  HOH A O    1 
HETATM 6331 O  O    . HOH P 8 .   ? 14.002  4.747   10.563  1.00 28.24  ?  624  HOH A O    1 
HETATM 6332 O  O    . HOH P 8 .   ? -3.114  -3.395  18.171  1.00 32.96  ?  625  HOH A O    1 
HETATM 6333 O  O    . HOH P 8 .   ? -17.660 -5.259  15.808  1.00 35.81  ?  626  HOH A O    1 
HETATM 6334 O  O    . HOH P 8 .   ? 38.626  8.283   17.480  1.00 42.15  ?  627  HOH A O    1 
HETATM 6335 O  O    . HOH P 8 .   ? 7.468   10.812  19.805  1.00 34.09  ?  628  HOH A O    1 
HETATM 6336 O  O    . HOH P 8 .   ? 19.642  0.951   19.204  1.00 38.94  ?  629  HOH A O    1 
HETATM 6337 O  O    . HOH P 8 .   ? 16.087  -16.768 30.730  1.00 36.81  ?  630  HOH A O    1 
HETATM 6338 O  O    . HOH P 8 .   ? 41.728  -11.285 21.149  1.00 36.92  ?  631  HOH A O    1 
HETATM 6339 O  O    . HOH P 8 .   ? 12.622  10.163  8.031   1.00 34.64  ?  632  HOH A O    1 
HETATM 6340 O  O    . HOH P 8 .   ? 2.335   -13.734 11.840  1.00 51.26  ?  633  HOH A O    1 
HETATM 6341 O  O    . HOH P 8 .   ? 25.090  -19.322 28.041  1.00 34.63  ?  634  HOH A O    1 
HETATM 6342 O  O    . HOH P 8 .   ? 34.085  -6.044  15.158  1.00 24.44  ?  635  HOH A O    1 
HETATM 6343 O  O    . HOH P 8 .   ? 4.711   6.412   26.094  1.00 38.75  ?  636  HOH A O    1 
HETATM 6344 O  O    . HOH P 8 .   ? 37.322  -7.030  8.571   1.00 34.34  ?  637  HOH A O    1 
HETATM 6345 O  O    . HOH P 8 .   ? 20.994  21.800  22.763  1.00 46.63  ?  638  HOH A O    1 
HETATM 6346 O  O    . HOH P 8 .   ? 31.263  20.171  14.389  1.00 43.46  ?  639  HOH A O    1 
HETATM 6347 O  O    . HOH P 8 .   ? 13.182  6.591   8.523   1.00 36.30  ?  640  HOH A O    1 
HETATM 6348 O  O    . HOH P 8 .   ? 24.325  2.356   -8.657  1.00 42.33  ?  641  HOH A O    1 
HETATM 6349 O  O    . HOH P 8 .   ? 2.250   -12.508 26.597  1.00 39.92  ?  642  HOH A O    1 
HETATM 6350 O  O    . HOH P 8 .   ? 41.939  2.149   27.626  1.00 37.81  ?  643  HOH A O    1 
HETATM 6351 O  O    . HOH P 8 .   ? 30.606  4.144   8.548   1.00 37.90  ?  644  HOH A O    1 
HETATM 6352 O  O    . HOH P 8 .   ? 39.256  -16.772 19.232  1.00 52.13  ?  645  HOH A O    1 
HETATM 6353 O  O    . HOH P 8 .   ? 4.904   -18.389 25.030  1.00 38.69  ?  646  HOH A O    1 
HETATM 6354 O  O    . HOH P 8 .   ? -13.675 -6.601  21.107  1.00 44.71  ?  647  HOH A O    1 
HETATM 6355 O  O    . HOH P 8 .   ? 13.343  4.215   13.238  1.00 29.34  ?  648  HOH A O    1 
HETATM 6356 O  O    . HOH P 8 .   ? 12.085  -11.125 6.907   1.00 40.56  ?  649  HOH A O    1 
HETATM 6357 O  O    . HOH P 8 .   ? 42.895  -4.357  19.851  1.00 29.26  ?  650  HOH A O    1 
HETATM 6358 O  O    . HOH P 8 .   ? 4.563   -12.931 27.550  1.00 36.20  ?  651  HOH A O    1 
HETATM 6359 O  O    . HOH P 8 .   ? 37.171  -11.701 24.949  1.00 39.53  ?  652  HOH A O    1 
HETATM 6360 O  O    . HOH P 8 .   ? 32.478  -15.126 43.452  1.00 51.06  ?  653  HOH A O    1 
HETATM 6361 O  O    . HOH P 8 .   ? 1.782   -16.280 14.478  1.00 53.01  ?  654  HOH A O    1 
HETATM 6362 O  O    . HOH P 8 .   ? 15.644  14.850  0.184   1.00 42.97  ?  655  HOH A O    1 
HETATM 6363 O  O    . HOH P 8 .   ? 35.683  2.780   29.442  1.00 36.62  ?  656  HOH A O    1 
HETATM 6364 O  O    . HOH P 8 .   ? 10.968  13.029  13.291  1.00 33.22  ?  657  HOH A O    1 
HETATM 6365 O  O    . HOH P 8 .   ? 28.745  -3.512  17.944  1.00 28.96  ?  658  HOH A O    1 
HETATM 6366 O  O    . HOH P 8 .   ? 32.869  -23.355 22.260  1.00 47.17  ?  659  HOH A O    1 
HETATM 6367 O  O    . HOH P 8 .   ? 44.817  7.007   15.958  1.00 42.67  ?  660  HOH A O    1 
HETATM 6368 O  O    . HOH P 8 .   ? 24.023  0.472   21.367  1.00 30.15  ?  661  HOH A O    1 
HETATM 6369 O  O    . HOH P 8 .   ? 15.219  -14.957 15.187  1.00 32.54  ?  662  HOH A O    1 
HETATM 6370 O  O    . HOH P 8 .   ? 16.033  1.172   15.925  1.00 40.49  ?  663  HOH A O    1 
HETATM 6371 O  O    . HOH P 8 .   ? 18.797  2.793   16.865  1.00 34.36  ?  664  HOH A O    1 
HETATM 6372 O  O    . HOH P 8 .   ? 29.049  -19.287 11.443  1.00 38.45  ?  665  HOH A O    1 
HETATM 6373 O  O    . HOH P 8 .   ? 23.820  -12.709 7.634   1.00 31.31  ?  666  HOH A O    1 
HETATM 6374 O  O    . HOH P 8 .   ? 26.370  12.475  7.083   1.00 39.67  ?  667  HOH A O    1 
HETATM 6375 O  O    . HOH P 8 .   ? 18.373  -11.984 21.185  1.00 29.22  ?  668  HOH A O    1 
HETATM 6376 O  O    . HOH P 8 .   ? 19.724  -14.737 5.052   1.00 36.27  ?  669  HOH A O    1 
HETATM 6377 O  O    . HOH P 8 .   ? 20.837  6.705   -9.770  1.00 49.28  ?  670  HOH A O    1 
HETATM 6378 O  O    . HOH P 8 .   ? -14.772 -8.032  17.503  1.00 38.52  ?  671  HOH A O    1 
HETATM 6379 O  O    . HOH P 8 .   ? 14.151  1.737   14.220  1.00 36.29  ?  672  HOH A O    1 
HETATM 6380 O  O    . HOH P 8 .   ? 26.619  0.258   -8.033  1.00 44.89  ?  673  HOH A O    1 
HETATM 6381 O  O    . HOH P 8 .   ? -3.248  5.804   7.106   1.00 49.83  ?  674  HOH A O    1 
HETATM 6382 O  O    . HOH P 8 .   ? -1.943  3.419   7.028   1.00 41.77  ?  675  HOH A O    1 
HETATM 6383 O  O    . HOH P 8 .   ? 50.401  -2.258  29.731  1.00 55.79  ?  676  HOH A O    1 
HETATM 6384 O  O    . HOH P 8 .   ? 16.428  14.550  22.352  1.00 32.65  ?  677  HOH A O    1 
HETATM 6385 O  O    . HOH P 8 .   ? -0.676  0.527   16.060  1.00 35.31  ?  678  HOH A O    1 
HETATM 6386 O  O    . HOH P 8 .   ? 14.273  -6.691  0.041   1.00 34.91  ?  679  HOH A O    1 
HETATM 6387 O  O    . HOH P 8 .   ? 1.991   11.952  11.051  1.00 36.27  ?  680  HOH A O    1 
HETATM 6388 O  O    . HOH P 8 .   ? 15.753  18.121  8.845   1.00 52.48  ?  681  HOH A O    1 
HETATM 6389 O  O    . HOH P 8 .   ? 31.318  11.978  26.218  1.00 39.51  ?  682  HOH A O    1 
HETATM 6390 O  O    . HOH P 8 .   ? 26.568  20.597  10.866  1.00 51.13  ?  683  HOH A O    1 
HETATM 6391 O  O    . HOH P 8 .   ? 28.405  9.635   -1.354  1.00 42.86  ?  684  HOH A O    1 
HETATM 6392 O  O    . HOH P 8 .   ? 12.853  16.932  3.388   1.00 47.43  ?  685  HOH A O    1 
HETATM 6393 O  O    . HOH P 8 .   ? -6.561  0.537   3.575   1.00 47.75  ?  686  HOH A O    1 
HETATM 6394 O  O    . HOH P 8 .   ? 35.911  -18.469 19.467  1.00 32.34  ?  687  HOH A O    1 
HETATM 6395 O  O    . HOH P 8 .   ? 17.292  4.920   33.874  1.00 44.63  ?  688  HOH A O    1 
HETATM 6396 O  O    . HOH P 8 .   ? 26.848  -1.879  35.394  1.00 52.90  ?  689  HOH A O    1 
HETATM 6397 O  O    . HOH P 8 .   ? 28.752  -10.579 5.156   1.00 43.40  ?  690  HOH A O    1 
HETATM 6398 O  O    . HOH P 8 .   ? 15.907  -2.818  -13.290 1.00 50.66  ?  691  HOH A O    1 
HETATM 6399 O  O    . HOH P 8 .   ? 26.075  18.647  7.272   1.00 53.59  ?  692  HOH A O    1 
HETATM 6400 O  O    . HOH P 8 .   ? 30.505  -5.313  1.859   1.00 38.75  ?  693  HOH A O    1 
HETATM 6401 O  O    . HOH P 8 .   ? 42.662  -5.072  36.049  1.00 42.80  ?  694  HOH A O    1 
HETATM 6402 O  O    . HOH P 8 .   ? 14.090  -17.991 25.521  1.00 39.91  ?  695  HOH A O    1 
HETATM 6403 O  O    . HOH P 8 .   ? 15.402  -9.939  2.543   1.00 38.56  ?  696  HOH A O    1 
HETATM 6404 O  O    . HOH P 8 .   ? 12.423  -11.021 4.332   1.00 48.66  ?  697  HOH A O    1 
HETATM 6405 O  O    . HOH P 8 .   ? 16.741  -11.471 13.840  1.00 30.05  ?  698  HOH A O    1 
HETATM 6406 O  O    . HOH P 8 .   ? 19.100  -13.924 1.161   1.00 44.43  ?  699  HOH A O    1 
HETATM 6407 O  O    . HOH P 8 .   ? 26.014  -8.034  1.663   1.00 35.68  ?  700  HOH A O    1 
HETATM 6408 O  O    . HOH P 8 .   ? 25.497  -20.219 25.529  1.00 34.48  ?  701  HOH A O    1 
HETATM 6409 O  O    . HOH P 8 .   ? 40.460  -12.953 24.689  1.00 38.64  ?  702  HOH A O    1 
HETATM 6410 O  O    . HOH P 8 .   ? 34.717  -20.993 37.495  1.00 35.51  ?  703  HOH A O    1 
HETATM 6411 O  O    . HOH P 8 .   ? 13.041  -4.680  31.342  1.00 47.08  ?  704  HOH A O    1 
HETATM 6412 O  O    . HOH P 8 .   ? -0.426  7.080   19.989  1.00 40.52  ?  705  HOH A O    1 
HETATM 6413 O  O    . HOH P 8 .   ? 28.501  6.644   -5.072  1.00 47.60  ?  706  HOH A O    1 
HETATM 6414 O  O    . HOH P 8 .   ? -1.411  3.347   4.482   1.00 47.29  ?  707  HOH A O    1 
HETATM 6415 O  O    . HOH P 8 .   ? 8.236   13.875  1.739   1.00 45.76  ?  708  HOH A O    1 
HETATM 6416 O  O    . HOH P 8 .   ? 31.135  -1.250  -5.438  1.00 58.28  ?  709  HOH A O    1 
HETATM 6417 O  O    . HOH P 8 .   ? 6.200   -0.575  -10.696 1.00 45.39  ?  710  HOH A O    1 
HETATM 6418 O  O    . HOH P 8 .   ? 8.678   -5.705  18.556  1.00 32.84  ?  711  HOH A O    1 
HETATM 6419 O  O    . HOH P 8 .   ? 17.542  14.231  25.909  1.00 53.62  ?  712  HOH A O    1 
HETATM 6420 O  O    . HOH P 8 .   ? 39.129  6.514   24.663  1.00 37.62  ?  713  HOH A O    1 
HETATM 6421 O  O    . HOH P 8 .   ? 28.048  -10.780 7.572   1.00 36.58  ?  714  HOH A O    1 
HETATM 6422 O  O    . HOH P 8 .   ? -19.445 -6.945  13.699  1.00 40.96  ?  715  HOH A O    1 
HETATM 6423 O  O    . HOH P 8 .   ? 20.532  22.662  11.881  1.00 56.41  ?  716  HOH A O    1 
HETATM 6424 O  O    . HOH P 8 .   ? 5.114   12.944  2.872   1.00 43.84  ?  717  HOH A O    1 
HETATM 6425 O  O    . HOH P 8 .   ? 33.585  -13.890 41.746  1.00 52.32  ?  718  HOH A O    1 
HETATM 6426 O  O    . HOH P 8 .   ? 36.561  -6.539  6.309   1.00 42.54  ?  719  HOH A O    1 
HETATM 6427 O  O    . HOH P 8 .   ? 41.357  -12.285 34.411  1.00 40.27  ?  720  HOH A O    1 
HETATM 6428 O  O    . HOH P 8 .   ? 14.341  16.591  10.254  1.00 52.02  ?  721  HOH A O    1 
HETATM 6429 O  O    . HOH P 8 .   ? 22.682  -6.236  -10.143 1.00 42.82  ?  722  HOH A O    1 
HETATM 6430 O  O    . HOH P 8 .   ? 44.734  -7.211  23.287  1.00 58.65  ?  723  HOH A O    1 
HETATM 6431 O  O    . HOH P 8 .   ? 13.909  15.133  21.359  1.00 40.44  ?  724  HOH A O    1 
HETATM 6432 O  O    . HOH P 8 .   ? 33.745  3.747   -1.677  1.00 47.02  ?  725  HOH A O    1 
HETATM 6433 O  O    . HOH P 8 .   ? -10.663 5.372   18.437  1.00 50.33  ?  726  HOH A O    1 
HETATM 6434 O  O    . HOH P 8 .   ? 38.904  10.531  12.737  1.00 46.53  ?  727  HOH A O    1 
HETATM 6435 O  O    . HOH P 8 .   ? 32.978  10.149  28.170  1.00 44.92  ?  728  HOH A O    1 
HETATM 6436 O  O    . HOH P 8 .   ? -7.951  1.838   17.755  1.00 50.58  ?  729  HOH A O    1 
HETATM 6437 O  O    . HOH P 8 .   ? 20.840  1.566   -10.870 1.00 46.42  ?  730  HOH A O    1 
HETATM 6438 O  O    . HOH P 8 .   ? -6.830  3.293   22.048  1.00 44.64  ?  731  HOH A O    1 
HETATM 6439 O  O    . HOH P 8 .   ? 2.915   -5.376  -3.833  1.00 40.18  ?  732  HOH A O    1 
HETATM 6440 O  O    . HOH P 8 .   ? 45.156  -10.370 33.033  1.00 44.51  ?  733  HOH A O    1 
HETATM 6441 O  O    . HOH P 8 .   ? 21.172  -23.653 40.092  1.00 43.25  ?  734  HOH A O    1 
HETATM 6442 O  O    . HOH P 8 .   ? 24.870  19.148  10.723  1.00 49.76  ?  735  HOH A O    1 
HETATM 6443 O  O    . HOH P 8 .   ? 26.336  -3.778  16.125  1.00 35.88  ?  736  HOH A O    1 
HETATM 6444 O  O    . HOH P 8 .   ? -0.140  -11.613 4.769   1.00 52.00  ?  737  HOH A O    1 
HETATM 6445 O  O    . HOH P 8 .   ? 36.187  -22.064 25.351  1.00 50.05  ?  738  HOH A O    1 
HETATM 6446 O  O    . HOH P 8 .   ? 10.614  11.011  24.382  1.00 46.81  ?  739  HOH A O    1 
HETATM 6447 O  O    . HOH P 8 .   ? -1.090  9.193   19.615  1.00 56.80  ?  740  HOH A O    1 
HETATM 6448 O  O    . HOH P 8 .   ? 18.382  -12.211 -1.098  1.00 43.18  ?  741  HOH A O    1 
HETATM 6449 O  O    . HOH P 8 .   ? 40.033  -17.590 37.268  1.00 47.54  ?  742  HOH A O    1 
HETATM 6450 O  O    . HOH P 8 .   ? 36.630  -20.853 17.761  1.00 46.56  ?  743  HOH A O    1 
HETATM 6451 O  O    . HOH P 8 .   ? 8.827   15.338  4.268   1.00 49.87  ?  744  HOH A O    1 
HETATM 6452 O  O    . HOH P 8 .   ? 28.449  14.184  5.453   1.00 50.47  ?  745  HOH A O    1 
HETATM 6453 O  O    . HOH P 8 .   ? 31.358  -7.067  4.840   1.00 41.02  ?  746  HOH A O    1 
HETATM 6454 O  O    . HOH P 8 .   ? 7.639   -4.756  -5.294  1.00 48.33  ?  747  HOH A O    1 
HETATM 6455 O  O    . HOH P 8 .   ? 44.650  -9.342  24.347  1.00 49.97  ?  748  HOH A O    1 
HETATM 6456 O  O    . HOH P 8 .   ? -9.332  -10.374 22.605  1.00 45.73  ?  749  HOH A O    1 
HETATM 6457 O  O    . HOH P 8 .   ? 28.415  9.805   28.698  1.00 40.70  ?  750  HOH A O    1 
HETATM 6458 O  O    . HOH P 8 .   ? 11.687  16.406  10.431  1.00 40.07  ?  751  HOH A O    1 
HETATM 6459 O  O    . HOH P 8 .   ? 28.418  2.746   8.908   1.00 34.93  ?  752  HOH A O    1 
HETATM 6460 O  O    . HOH P 8 .   ? 42.945  -8.656  22.572  1.00 44.49  ?  753  HOH A O    1 
HETATM 6461 O  O    . HOH P 8 .   ? 28.288  -7.056  0.903   1.00 44.20  ?  754  HOH A O    1 
HETATM 6462 O  O    . HOH P 8 .   ? 21.452  9.230   -7.479  1.00 50.04  ?  755  HOH A O    1 
HETATM 6463 O  O    . HOH P 8 .   ? 2.825   -0.637  -8.894  1.00 51.69  ?  756  HOH A O    1 
HETATM 6464 O  O    . HOH P 8 .   ? 18.292  14.225  -0.234  1.00 42.86  ?  757  HOH A O    1 
HETATM 6465 O  O    . HOH P 8 .   ? 33.039  21.778  24.593  1.00 47.98  ?  758  HOH A O    1 
HETATM 6466 O  O    . HOH P 8 .   ? 24.704  -10.219 0.375   1.00 45.57  ?  759  HOH A O    1 
HETATM 6467 O  O    . HOH P 8 .   ? 24.803  -22.767 24.789  1.00 41.35  ?  760  HOH A O    1 
HETATM 6468 O  O    . HOH P 8 .   ? 29.112  -1.879  -7.270  1.00 53.02  ?  761  HOH A O    1 
HETATM 6469 O  O    . HOH P 8 .   ? 9.867   15.614  11.803  1.00 46.57  ?  762  HOH A O    1 
HETATM 6470 O  O    . HOH P 8 .   ? 42.338  -12.199 18.911  1.00 61.96  ?  763  HOH A O    1 
HETATM 6471 O  O    . HOH P 8 .   ? 27.360  -24.232 27.481  1.00 49.17  ?  764  HOH A O    1 
HETATM 6472 O  O    . HOH P 8 .   ? 31.125  5.984   30.352  1.00 42.91  ?  765  HOH A O    1 
HETATM 6473 O  O    . HOH P 8 .   ? 43.833  -6.583  21.108  1.00 39.28  ?  766  HOH A O    1 
HETATM 6474 O  O    . HOH P 8 .   ? 24.548  0.093   30.261  1.00 47.88  ?  767  HOH A O    1 
HETATM 6475 O  O    . HOH Q 8 .   ? 13.286  -2.501  26.753  1.00 32.40  ?  1101 HOH C O    1 
HETATM 6476 O  O    . HOH Q 8 .   ? 9.227   -3.718  19.899  1.00 34.55  ?  1102 HOH C O    1 
HETATM 6477 O  O    . HOH Q 8 .   ? 8.977   -1.906  27.176  1.00 35.42  ?  1103 HOH C O    1 
HETATM 6478 O  O    . HOH Q 8 .   ? -0.324  3.919   22.177  1.00 38.92  ?  1104 HOH C O    1 
HETATM 6479 O  O    . HOH Q 8 .   ? 19.034  -0.916  27.535  1.00 43.18  ?  1105 HOH C O    1 
HETATM 6480 O  O    . HOH Q 8 .   ? 11.644  -1.633  20.404  1.00 31.16  ?  1106 HOH C O    1 
HETATM 6481 O  O    . HOH Q 8 .   ? 15.973  -1.683  28.238  1.00 49.04  ?  1107 HOH C O    1 
HETATM 6482 O  O    . HOH Q 8 .   ? 0.245   -2.672  26.928  1.00 49.08  ?  1108 HOH C O    1 
HETATM 6483 O  O    . HOH Q 8 .   ? -1.626  6.004   23.189  1.00 46.81  ?  1109 HOH C O    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LYS 1   114 ?   ?   ?   A . n 
A 1 2   HIS 2   115 ?   ?   ?   A . n 
A 1 3   ARG 3   116 ?   ?   ?   A . n 
A 1 4   TYR 4   117 ?   ?   ?   A . n 
A 1 5   GLN 5   118 ?   ?   ?   A . n 
A 1 6   PHE 6   119 ?   ?   ?   A . n 
A 1 7   TRP 7   120 ?   ?   ?   A . n 
A 1 8   ASP 8   121 ?   ?   ?   A . n 
A 1 9   THR 9   122 ?   ?   ?   A . n 
A 1 10  GLN 10  123 ?   ?   ?   A . n 
A 1 11  PRO 11  124 ?   ?   ?   A . n 
A 1 12  VAL 12  125 ?   ?   ?   A . n 
A 1 13  PRO 13  126 ?   ?   ?   A . n 
A 1 14  LYS 14  127 ?   ?   ?   A . n 
A 1 15  LEU 15  128 ?   ?   ?   A . n 
A 1 16  ASP 16  129 ?   ?   ?   A . n 
A 1 17  GLU 17  130 ?   ?   ?   A . n 
A 1 18  VAL 18  131 ?   ?   ?   A . n 
A 1 19  ILE 19  132 ?   ?   ?   A . n 
A 1 20  THR 20  133 ?   ?   ?   A . n 
A 1 21  SER 21  134 ?   ?   ?   A . n 
A 1 22  HIS 22  135 ?   ?   ?   A . n 
A 1 23  GLY 23  136 136 GLY GLY A . n 
A 1 24  ALA 24  137 137 ALA ALA A . n 
A 1 25  ILE 25  138 138 ILE ILE A . n 
A 1 26  GLU 26  139 139 GLU GLU A . n 
A 1 27  PRO 27  140 140 PRO PRO A . n 
A 1 28  ASP 28  141 141 ASP ASP A . n 
A 1 29  LYS 29  142 142 LYS LYS A . n 
A 1 30  ASP 30  143 143 ASP ASP A . n 
A 1 31  ASN 31  144 144 ASN ASN A . n 
A 1 32  VAL 32  145 145 VAL VAL A . n 
A 1 33  ARG 33  146 146 ARG ARG A . n 
A 1 34  GLN 34  147 147 GLN GLN A . n 
A 1 35  GLU 35  148 148 GLU GLU A . n 
A 1 36  PRO 36  149 149 PRO PRO A . n 
A 1 37  TYR 37  150 150 TYR TYR A . n 
A 1 38  SER 38  151 151 SER SER A . n 
A 1 39  LEU 39  152 152 LEU LEU A . n 
A 1 40  PRO 40  153 153 PRO PRO A . n 
A 1 41  GLN 41  154 154 GLN GLN A . n 
A 1 42  GLY 42  155 155 GLY GLY A . n 
A 1 43  PHE 43  156 156 PHE PHE A . n 
A 1 44  MET 44  157 157 MET MET A . n 
A 1 45  TRP 45  158 158 TRP TRP A . n 
A 1 46  ASP 46  159 159 ASP ASP A . n 
A 1 47  THR 47  160 160 THR THR A . n 
A 1 48  LEU 48  161 161 LEU LEU A . n 
A 1 49  ASP 49  162 162 ASP ASP A . n 
A 1 50  LEU 50  163 163 LEU LEU A . n 
A 1 51  SER 51  164 164 SER SER A . n 
A 1 52  ASP 52  165 165 ASP ASP A . n 
A 1 53  ALA 53  166 166 ALA ALA A . n 
A 1 54  GLU 54  167 167 GLU GLU A . n 
A 1 55  VAL 55  168 168 VAL VAL A . n 
A 1 56  LEU 56  169 169 LEU LEU A . n 
A 1 57  LYS 57  170 170 LYS LYS A . n 
A 1 58  GLU 58  171 171 GLU GLU A . n 
A 1 59  LEU 59  172 172 LEU LEU A . n 
A 1 60  TYR 60  173 173 TYR TYR A . n 
A 1 61  THR 61  174 174 THR THR A . n 
A 1 62  LEU 62  175 175 LEU LEU A . n 
A 1 63  LEU 63  176 176 LEU LEU A . n 
A 1 64  ASN 64  177 177 ASN ASN A . n 
A 1 65  GLU 65  178 178 GLU GLU A . n 
A 1 66  ASN 66  179 179 ASN ASN A . n 
A 1 67  TYR 67  180 180 TYR TYR A . n 
A 1 68  VAL 68  181 181 VAL VAL A . n 
A 1 69  GLU 69  182 182 GLU GLU A . n 
A 1 70  ASP 70  183 183 ASP ASP A . n 
A 1 71  ASP 71  184 184 ASP ASP A . n 
A 1 72  ASP 72  185 185 ASP ASP A . n 
A 1 73  ASN 73  186 186 ASN ASN A . n 
A 1 74  MET 74  187 187 MET MET A . n 
A 1 75  PHE 75  188 188 PHE PHE A . n 
A 1 76  ARG 76  189 189 ARG ARG A . n 
A 1 77  PHE 77  190 190 PHE PHE A . n 
A 1 78  ASP 78  191 191 ASP ASP A . n 
A 1 79  TYR 79  192 192 TYR TYR A . n 
A 1 80  SER 80  193 193 SER SER A . n 
A 1 81  PRO 81  194 194 PRO PRO A . n 
A 1 82  GLU 82  195 195 GLU GLU A . n 
A 1 83  PHE 83  196 196 PHE PHE A . n 
A 1 84  LEU 84  197 197 LEU LEU A . n 
A 1 85  LEU 85  198 198 LEU LEU A . n 
A 1 86  TRP 86  199 199 TRP TRP A . n 
A 1 87  ALA 87  200 200 ALA ALA A . n 
A 1 88  LEU 88  201 201 LEU LEU A . n 
A 1 89  ARG 89  202 202 ARG ARG A . n 
A 1 90  PRO 90  203 203 PRO PRO A . n 
A 1 91  PRO 91  204 204 PRO PRO A . n 
A 1 92  GLY 92  205 205 GLY GLY A . n 
A 1 93  TRP 93  206 206 TRP TRP A . n 
A 1 94  LEU 94  207 207 LEU LEU A . n 
A 1 95  LEU 95  208 208 LEU LEU A . n 
A 1 96  GLN 96  209 209 GLN GLN A . n 
A 1 97  TRP 97  210 210 TRP TRP A . n 
A 1 98  HIS 98  211 211 HIS HIS A . n 
A 1 99  CYS 99  212 212 CYS CYS A . n 
A 1 100 GLY 100 213 213 GLY GLY A . n 
A 1 101 VAL 101 214 214 VAL VAL A . n 
A 1 102 ARG 102 215 215 ARG ARG A . n 
A 1 103 VAL 103 216 216 VAL VAL A . n 
A 1 104 SER 104 217 217 SER SER A . n 
A 1 105 SER 105 218 218 SER SER A . n 
A 1 106 ASN 106 219 219 ASN ASN A . n 
A 1 107 LYS 107 220 220 LYS LYS A . n 
A 1 108 LYS 108 221 221 LYS LYS A . n 
A 1 109 LEU 109 222 222 LEU LEU A . n 
A 1 110 VAL 110 223 223 VAL VAL A . n 
A 1 111 GLY 111 224 224 GLY GLY A . n 
A 1 112 PHE 112 225 225 PHE PHE A . n 
A 1 113 ILE 113 226 226 ILE ILE A . n 
A 1 114 SER 114 227 227 SER SER A . n 
A 1 115 ALA 115 228 228 ALA ALA A . n 
A 1 116 ILE 116 229 229 ILE ILE A . n 
A 1 117 PRO 117 230 230 PRO PRO A . n 
A 1 118 ALA 118 231 231 ALA ALA A . n 
A 1 119 ASN 119 232 232 ASN ASN A . n 
A 1 120 ILE 120 233 233 ILE ILE A . n 
A 1 121 ARG 121 234 234 ARG ARG A . n 
A 1 122 ILE 122 235 235 ILE ILE A . n 
A 1 123 TYR 123 236 236 TYR TYR A . n 
A 1 124 ASP 124 237 237 ASP ASP A . n 
A 1 125 SER 125 238 238 SER SER A . n 
A 1 126 VAL 126 239 239 VAL VAL A . n 
A 1 127 LYS 127 240 240 LYS LYS A . n 
A 1 128 LYS 128 241 241 LYS LYS A . n 
A 1 129 MET 129 242 242 MET MET A . n 
A 1 130 VAL 130 243 243 VAL VAL A . n 
A 1 131 GLU 131 244 244 GLU GLU A . n 
A 1 132 ILE 132 245 245 ILE ILE A . n 
A 1 133 ASN 133 246 246 ASN ASN A . n 
A 1 134 PHE 134 247 247 PHE PHE A . n 
A 1 135 LEU 135 248 248 LEU LEU A . n 
A 1 136 CYS 136 249 249 CYS CYS A . n 
A 1 137 VAL 137 250 250 VAL VAL A . n 
A 1 138 HIS 138 251 251 HIS HIS A . n 
A 1 139 LYS 139 252 252 LYS LYS A . n 
A 1 140 LYS 140 253 253 LYS LYS A . n 
A 1 141 LEU 141 254 254 LEU LEU A . n 
A 1 142 ARG 142 255 255 ARG ARG A . n 
A 1 143 SER 143 256 256 SER SER A . n 
A 1 144 LYS 144 257 257 LYS LYS A . n 
A 1 145 ARG 145 258 258 ARG ARG A . n 
A 1 146 VAL 146 259 259 VAL VAL A . n 
A 1 147 ALA 147 260 260 ALA ALA A . n 
A 1 148 PRO 148 261 261 PRO PRO A . n 
A 1 149 VAL 149 262 262 VAL VAL A . n 
A 1 150 LEU 150 263 263 LEU LEU A . n 
A 1 151 ILE 151 264 264 ILE ILE A . n 
A 1 152 ARG 152 265 265 ARG ARG A . n 
A 1 153 GLU 153 266 266 GLU GLU A . n 
A 1 154 ILE 154 267 267 ILE ILE A . n 
A 1 155 THR 155 268 268 THR THR A . n 
A 1 156 ARG 156 269 269 ARG ARG A . n 
A 1 157 ARG 157 270 270 ARG ARG A . n 
A 1 158 VAL 158 271 271 VAL VAL A . n 
A 1 159 ASN 159 272 272 ASN ASN A . n 
A 1 160 LEU 160 273 273 LEU LEU A . n 
A 1 161 GLU 161 274 274 GLU GLU A . n 
A 1 162 GLY 162 275 275 GLY GLY A . n 
A 1 163 ILE 163 276 276 ILE ILE A . n 
A 1 164 PHE 164 277 277 PHE PHE A . n 
A 1 165 GLN 165 278 278 GLN GLN A . n 
A 1 166 ALA 166 279 279 ALA ALA A . n 
A 1 167 VAL 167 280 280 VAL VAL A . n 
A 1 168 TYR 168 281 281 TYR TYR A . n 
A 1 169 THR 169 282 282 THR THR A . n 
A 1 170 ALA 170 283 283 ALA ALA A . n 
A 1 171 GLY 171 284 284 GLY GLY A . n 
A 1 172 VAL 172 285 285 VAL VAL A . n 
A 1 173 VAL 173 286 286 VAL VAL A . n 
A 1 174 LEU 174 287 287 LEU LEU A . n 
A 1 175 PRO 175 288 288 PRO PRO A . n 
A 1 176 LYS 176 289 289 LYS LYS A . n 
A 1 177 PRO 177 290 290 PRO PRO A . n 
A 1 178 ILE 178 291 291 ILE ILE A . n 
A 1 179 ALA 179 292 292 ALA ALA A . n 
A 1 180 THR 180 293 293 THR THR A . n 
A 1 181 CYS 181 294 294 CYS CYS A . n 
A 1 182 ARG 182 295 295 ARG ARG A . n 
A 1 183 TYR 183 296 296 TYR TYR A . n 
A 1 184 TRP 184 297 297 TRP TRP A . n 
A 1 185 HIS 185 298 298 HIS HIS A . n 
A 1 186 ARG 186 299 299 ARG ARG A . n 
A 1 187 SER 187 300 300 SER SER A . n 
A 1 188 LEU 188 301 301 LEU LEU A . n 
A 1 189 ASN 189 302 302 ASN ASN A . n 
A 1 190 PRO 190 303 303 PRO PRO A . n 
A 1 191 ARG 191 304 304 ARG ARG A . n 
A 1 192 LYS 192 305 305 LYS LYS A . n 
A 1 193 LEU 193 306 306 LEU LEU A . n 
A 1 194 VAL 194 307 307 VAL VAL A . n 
A 1 195 GLU 195 308 308 GLU GLU A . n 
A 1 196 VAL 196 309 309 VAL VAL A . n 
A 1 197 LYS 197 310 310 LYS LYS A . n 
A 1 198 PHE 198 311 311 PHE PHE A . n 
A 1 199 SER 199 312 312 SER SER A . n 
A 1 200 HIS 200 313 313 HIS HIS A . n 
A 1 201 LEU 201 314 314 LEU LEU A . n 
A 1 202 SER 202 315 315 SER SER A . n 
A 1 203 ARG 203 316 316 ARG ARG A . n 
A 1 204 ASN 204 317 317 ASN ASN A . n 
A 1 205 MET 205 318 318 MET MET A . n 
A 1 206 THR 206 319 319 THR THR A . n 
A 1 207 LEU 207 320 320 LEU LEU A . n 
A 1 208 GLN 208 321 321 GLN GLN A . n 
A 1 209 ARG 209 322 322 ARG ARG A . n 
A 1 210 THR 210 323 323 THR THR A . n 
A 1 211 MET 211 324 324 MET MET A . n 
A 1 212 LYS 212 325 325 LYS LYS A . n 
A 1 213 LEU 213 326 326 LEU LEU A . n 
A 1 214 TYR 214 327 327 TYR TYR A . n 
A 1 215 ARG 215 328 328 ARG ARG A . n 
A 1 216 LEU 216 329 329 LEU LEU A . n 
A 1 217 PRO 217 330 330 PRO PRO A . n 
A 1 218 ASP 218 331 331 ASP ASP A . n 
A 1 219 VAL 219 332 332 VAL VAL A . n 
A 1 220 THR 220 333 333 THR THR A . n 
A 1 221 LYS 221 334 334 LYS LYS A . n 
A 1 222 THR 222 335 335 THR THR A . n 
A 1 223 SER 223 336 336 SER SER A . n 
A 1 224 GLY 224 337 337 GLY GLY A . n 
A 1 225 LEU 225 338 338 LEU LEU A . n 
A 1 226 ARG 226 339 339 ARG ARG A . n 
A 1 227 PRO 227 340 340 PRO PRO A . n 
A 1 228 MET 228 341 341 MET MET A . n 
A 1 229 GLU 229 342 342 GLU GLU A . n 
A 1 230 PRO 230 343 343 PRO PRO A . n 
A 1 231 LYS 231 344 344 LYS LYS A . n 
A 1 232 ASP 232 345 345 ASP ASP A . n 
A 1 233 ILE 233 346 346 ILE ILE A . n 
A 1 234 LYS 234 347 347 LYS LYS A . n 
A 1 235 SER 235 348 348 SER SER A . n 
A 1 236 VAL 236 349 349 VAL VAL A . n 
A 1 237 ARG 237 350 350 ARG ARG A . n 
A 1 238 GLU 238 351 351 GLU GLU A . n 
A 1 239 LEU 239 352 352 LEU LEU A . n 
A 1 240 ILE 240 353 353 ILE ILE A . n 
A 1 241 ASN 241 354 354 ASN ASN A . n 
A 1 242 THR 242 355 355 THR THR A . n 
A 1 243 TYR 243 356 356 TYR TYR A . n 
A 1 244 LEU 244 357 357 LEU LEU A . n 
A 1 245 LYS 245 358 358 LYS LYS A . n 
A 1 246 GLN 246 359 359 GLN GLN A . n 
A 1 247 PHE 247 360 360 PHE PHE A . n 
A 1 248 HIS 248 361 361 HIS HIS A . n 
A 1 249 LEU 249 362 362 LEU LEU A . n 
A 1 250 ALA 250 363 363 ALA ALA A . n 
A 1 251 PRO 251 364 364 PRO PRO A . n 
A 1 252 VAL 252 365 365 VAL VAL A . n 
A 1 253 MET 253 366 366 MET MET A . n 
A 1 254 ASP 254 367 367 ASP ASP A . n 
A 1 255 GLU 255 368 368 GLU GLU A . n 
A 1 256 GLU 256 369 369 GLU GLU A . n 
A 1 257 GLU 257 370 370 GLU GLU A . n 
A 1 258 VAL 258 371 371 VAL VAL A . n 
A 1 259 ALA 259 372 372 ALA ALA A . n 
A 1 260 HIS 260 373 373 HIS HIS A . n 
A 1 261 TRP 261 374 374 TRP TRP A . n 
A 1 262 PHE 262 375 375 PHE PHE A . n 
A 1 263 LEU 263 376 376 LEU LEU A . n 
A 1 264 PRO 264 377 377 PRO PRO A . n 
A 1 265 ARG 265 378 378 ARG ARG A . n 
A 1 266 GLU 266 379 379 GLU GLU A . n 
A 1 267 HIS 267 380 380 HIS HIS A . n 
A 1 268 ILE 268 381 381 ILE ILE A . n 
A 1 269 ILE 269 382 382 ILE ILE A . n 
A 1 270 ASP 270 383 383 ASP ASP A . n 
A 1 271 THR 271 384 384 THR THR A . n 
A 1 272 PHE 272 385 385 PHE PHE A . n 
A 1 273 VAL 273 386 386 VAL VAL A . n 
A 1 274 VAL 274 387 387 VAL VAL A . n 
A 1 275 GLU 275 388 388 GLU GLU A . n 
A 1 276 SER 276 389 389 SER SER A . n 
A 1 277 PRO 277 390 390 PRO PRO A . n 
A 1 278 ASN 278 391 391 ASN ASN A . n 
A 1 279 GLY 279 392 392 GLY GLY A . n 
A 1 280 LYS 280 393 393 LYS LYS A . n 
A 1 281 LEU 281 394 394 LEU LEU A . n 
A 1 282 THR 282 395 395 THR THR A . n 
A 1 283 ASP 283 396 396 ASP ASP A . n 
A 1 284 PHE 284 397 397 PHE PHE A . n 
A 1 285 LEU 285 398 398 LEU LEU A . n 
A 1 286 SER 286 399 399 SER SER A . n 
A 1 287 PHE 287 400 400 PHE PHE A . n 
A 1 288 TYR 288 401 401 TYR TYR A . n 
A 1 289 THR 289 402 402 THR THR A . n 
A 1 290 LEU 290 403 403 LEU LEU A . n 
A 1 291 PRO 291 404 404 PRO PRO A . n 
A 1 292 SER 292 405 405 SER SER A . n 
A 1 293 THR 293 406 406 THR THR A . n 
A 1 294 VAL 294 407 407 VAL VAL A . n 
A 1 295 MET 295 408 408 MET MET A . n 
A 1 296 HIS 296 409 409 HIS HIS A . n 
A 1 297 HIS 297 410 410 HIS HIS A . n 
A 1 298 PRO 298 411 411 PRO PRO A . n 
A 1 299 ALA 299 412 412 ALA ALA A . n 
A 1 300 HIS 300 413 413 HIS HIS A . n 
A 1 301 LYS 301 414 414 LYS LYS A . n 
A 1 302 SER 302 415 415 SER SER A . n 
A 1 303 LEU 303 416 416 LEU LEU A . n 
A 1 304 LYS 304 417 417 LYS LYS A . n 
A 1 305 ALA 305 418 418 ALA ALA A . n 
A 1 306 ALA 306 419 419 ALA ALA A . n 
A 1 307 TYR 307 420 420 TYR TYR A . n 
A 1 308 SER 308 421 421 SER SER A . n 
A 1 309 PHE 309 422 422 PHE PHE A . n 
A 1 310 TYR 310 423 423 TYR TYR A . n 
A 1 311 ASN 311 424 424 ASN ASN A . n 
A 1 312 ILE 312 425 425 ILE ILE A . n 
A 1 313 HIS 313 426 426 HIS HIS A . n 
A 1 314 THR 314 427 427 THR THR A . n 
A 1 315 GLU 315 428 428 GLU GLU A . n 
A 1 316 THR 316 429 429 THR THR A . n 
A 1 317 PRO 317 430 430 PRO PRO A . n 
A 1 318 LEU 318 431 431 LEU LEU A . n 
A 1 319 LEU 319 432 432 LEU LEU A . n 
A 1 320 ASP 320 433 433 ASP ASP A . n 
A 1 321 LEU 321 434 434 LEU LEU A . n 
A 1 322 MET 322 435 435 MET MET A . n 
A 1 323 SER 323 436 436 SER SER A . n 
A 1 324 ASP 324 437 437 ASP ASP A . n 
A 1 325 ALA 325 438 438 ALA ALA A . n 
A 1 326 LEU 326 439 439 LEU LEU A . n 
A 1 327 ILE 327 440 440 ILE ILE A . n 
A 1 328 LEU 328 441 441 LEU LEU A . n 
A 1 329 ALA 329 442 442 ALA ALA A . n 
A 1 330 LYS 330 443 443 LYS LYS A . n 
A 1 331 SER 331 444 444 SER SER A . n 
A 1 332 LYS 332 445 445 LYS LYS A . n 
A 1 333 GLY 333 446 446 GLY GLY A . n 
A 1 334 PHE 334 447 447 PHE PHE A . n 
A 1 335 ASP 335 448 448 ASP ASP A . n 
A 1 336 VAL 336 449 449 VAL VAL A . n 
A 1 337 PHE 337 450 450 PHE PHE A . n 
A 1 338 ASN 338 451 451 ASN ASN A . n 
A 1 339 ALA 339 452 452 ALA ALA A . n 
A 1 340 LEU 340 453 453 LEU LEU A . n 
A 1 341 ASP 341 454 454 ASP ASP A . n 
A 1 342 LEU 342 455 455 LEU LEU A . n 
A 1 343 MET 343 456 456 MET MET A . n 
A 1 344 GLU 344 457 457 GLU GLU A . n 
A 1 345 ASN 345 458 458 ASN ASN A . n 
A 1 346 LYS 346 459 459 LYS LYS A . n 
A 1 347 THR 347 460 460 THR THR A . n 
A 1 348 PHE 348 461 461 PHE PHE A . n 
A 1 349 LEU 349 462 462 LEU LEU A . n 
A 1 350 GLU 350 463 463 GLU GLU A . n 
A 1 351 LYS 351 464 464 LYS LYS A . n 
A 1 352 LEU 352 465 465 LEU LEU A . n 
A 1 353 LYS 353 466 466 LYS LYS A . n 
A 1 354 PHE 354 467 467 PHE PHE A . n 
A 1 355 GLY 355 468 468 GLY GLY A . n 
A 1 356 ILE 356 469 469 ILE ILE A . n 
A 1 357 GLY 357 470 470 GLY GLY A . n 
A 1 358 ASP 358 471 471 ASP ASP A . n 
A 1 359 GLY 359 472 472 GLY GLY A . n 
A 1 360 ASN 360 473 473 ASN ASN A . n 
A 1 361 LEU 361 474 474 LEU LEU A . n 
A 1 362 GLN 362 475 475 GLN GLN A . n 
A 1 363 TYR 363 476 476 TYR TYR A . n 
A 1 364 TYR 364 477 477 TYR TYR A . n 
A 1 365 LEU 365 478 478 LEU LEU A . n 
A 1 366 TYR 366 479 479 TYR TYR A . n 
A 1 367 ASN 367 480 480 ASN ASN A . n 
A 1 368 TRP 368 481 481 TRP TRP A . n 
A 1 369 ARG 369 482 482 ARG ARG A . n 
A 1 370 CYS 370 483 483 CYS CYS A . n 
A 1 371 PRO 371 484 484 PRO PRO A . n 
A 1 372 GLY 372 485 485 GLY GLY A . n 
A 1 373 THR 373 486 486 THR THR A . n 
A 1 374 ASP 374 487 487 ASP ASP A . n 
A 1 375 SER 375 488 488 SER SER A . n 
A 1 376 GLU 376 489 489 GLU GLU A . n 
A 1 377 LYS 377 490 490 LYS LYS A . n 
A 1 378 VAL 378 491 491 VAL VAL A . n 
A 1 379 GLY 379 492 492 GLY GLY A . n 
A 1 380 LEU 380 493 493 LEU LEU A . n 
A 1 381 VAL 381 494 494 VAL VAL A . n 
A 1 382 LEU 382 495 495 LEU LEU A . n 
A 1 383 GLN 383 496 496 GLN GLN A . n 
B 2 1   LYS 1   3   3   LYS LYS C . n 
B 2 2   VAL 2   4   4   VAL VAL C . n 
B 2 3   LEU 3   5   5   LEU LEU C . n 
B 2 4   SER 4   6   6   SER SER C . n 
B 2 5   LYS 5   7   7   LYS LYS C . n 
B 2 6   ILE 6   8   8   ILE ILE C . n 
B 2 7   PHE 7   9   9   PHE PHE C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 MG  1   501  1    MG  MG  A . 
D 4 GOL 1   502  1    GOL GOL A . 
E 4 GOL 1   503  2    GOL GOL A . 
F 4 GOL 1   504  3    GOL GOL A . 
G 4 GOL 1   505  4    GOL GOL A . 
H 4 GOL 1   506  5    GOL GOL A . 
I 4 GOL 1   507  6    GOL GOL A . 
J 4 GOL 1   508  7    GOL GOL A . 
K 4 GOL 1   509  8    GOL GOL A . 
L 4 GOL 1   510  9    GOL GOL A . 
M 5 4PS 1   511  1    4PS NHW A . 
N 6 SO4 1   512  1    SO4 SO4 A . 
O 7 MYR 1   1000 1000 MYR MYR C . 
P 8 HOH 1   601  114  HOH HOH A . 
P 8 HOH 2   602  9    HOH HOH A . 
P 8 HOH 3   603  76   HOH HOH A . 
P 8 HOH 4   604  44   HOH HOH A . 
P 8 HOH 5   605  30   HOH HOH A . 
P 8 HOH 6   606  124  HOH HOH A . 
P 8 HOH 7   607  20   HOH HOH A . 
P 8 HOH 8   608  11   HOH HOH A . 
P 8 HOH 9   609  46   HOH HOH A . 
P 8 HOH 10  610  27   HOH HOH A . 
P 8 HOH 11  611  50   HOH HOH A . 
P 8 HOH 12  612  39   HOH HOH A . 
P 8 HOH 13  613  84   HOH HOH A . 
P 8 HOH 14  614  28   HOH HOH A . 
P 8 HOH 15  615  16   HOH HOH A . 
P 8 HOH 16  616  14   HOH HOH A . 
P 8 HOH 17  617  136  HOH HOH A . 
P 8 HOH 18  618  98   HOH HOH A . 
P 8 HOH 19  619  23   HOH HOH A . 
P 8 HOH 20  620  56   HOH HOH A . 
P 8 HOH 21  621  87   HOH HOH A . 
P 8 HOH 22  622  125  HOH HOH A . 
P 8 HOH 23  623  47   HOH HOH A . 
P 8 HOH 24  624  21   HOH HOH A . 
P 8 HOH 25  625  17   HOH HOH A . 
P 8 HOH 26  626  82   HOH HOH A . 
P 8 HOH 27  627  36   HOH HOH A . 
P 8 HOH 28  628  75   HOH HOH A . 
P 8 HOH 29  629  80   HOH HOH A . 
P 8 HOH 30  630  89   HOH HOH A . 
P 8 HOH 31  631  41   HOH HOH A . 
P 8 HOH 32  632  57   HOH HOH A . 
P 8 HOH 33  633  111  HOH HOH A . 
P 8 HOH 34  634  15   HOH HOH A . 
P 8 HOH 35  635  13   HOH HOH A . 
P 8 HOH 36  636  95   HOH HOH A . 
P 8 HOH 37  637  18   HOH HOH A . 
P 8 HOH 38  638  99   HOH HOH A . 
P 8 HOH 39  639  35   HOH HOH A . 
P 8 HOH 40  640  122  HOH HOH A . 
P 8 HOH 41  641  77   HOH HOH A . 
P 8 HOH 42  642  70   HOH HOH A . 
P 8 HOH 43  643  88   HOH HOH A . 
P 8 HOH 44  644  10   HOH HOH A . 
P 8 HOH 45  645  134  HOH HOH A . 
P 8 HOH 46  646  69   HOH HOH A . 
P 8 HOH 47  647  145  HOH HOH A . 
P 8 HOH 48  648  58   HOH HOH A . 
P 8 HOH 49  649  137  HOH HOH A . 
P 8 HOH 50  650  37   HOH HOH A . 
P 8 HOH 51  651  32   HOH HOH A . 
P 8 HOH 52  652  115  HOH HOH A . 
P 8 HOH 53  653  144  HOH HOH A . 
P 8 HOH 54  654  3    HOH HOH A . 
P 8 HOH 55  655  78   HOH HOH A . 
P 8 HOH 56  656  67   HOH HOH A . 
P 8 HOH 57  657  73   HOH HOH A . 
P 8 HOH 58  658  34   HOH HOH A . 
P 8 HOH 59  659  107  HOH HOH A . 
P 8 HOH 60  660  106  HOH HOH A . 
P 8 HOH 61  661  1    HOH HOH A . 
P 8 HOH 62  662  86   HOH HOH A . 
P 8 HOH 63  663  24   HOH HOH A . 
P 8 HOH 64  664  79   HOH HOH A . 
P 8 HOH 65  665  43   HOH HOH A . 
P 8 HOH 66  666  7    HOH HOH A . 
P 8 HOH 67  667  53   HOH HOH A . 
P 8 HOH 68  668  29   HOH HOH A . 
P 8 HOH 69  669  54   HOH HOH A . 
P 8 HOH 70  670  166  HOH HOH A . 
P 8 HOH 71  671  100  HOH HOH A . 
P 8 HOH 72  672  55   HOH HOH A . 
P 8 HOH 73  673  51   HOH HOH A . 
P 8 HOH 74  674  141  HOH HOH A . 
P 8 HOH 75  675  61   HOH HOH A . 
P 8 HOH 76  676  129  HOH HOH A . 
P 8 HOH 77  677  45   HOH HOH A . 
P 8 HOH 78  678  22   HOH HOH A . 
P 8 HOH 79  679  49   HOH HOH A . 
P 8 HOH 80  680  60   HOH HOH A . 
P 8 HOH 81  681  101  HOH HOH A . 
P 8 HOH 82  682  2    HOH HOH A . 
P 8 HOH 83  683  123  HOH HOH A . 
P 8 HOH 84  684  52   HOH HOH A . 
P 8 HOH 85  685  96   HOH HOH A . 
P 8 HOH 86  686  162  HOH HOH A . 
P 8 HOH 87  687  85   HOH HOH A . 
P 8 HOH 88  688  116  HOH HOH A . 
P 8 HOH 89  689  119  HOH HOH A . 
P 8 HOH 90  690  108  HOH HOH A . 
P 8 HOH 91  691  62   HOH HOH A . 
P 8 HOH 92  692  131  HOH HOH A . 
P 8 HOH 93  693  64   HOH HOH A . 
P 8 HOH 94  694  26   HOH HOH A . 
P 8 HOH 95  695  63   HOH HOH A . 
P 8 HOH 96  696  105  HOH HOH A . 
P 8 HOH 97  697  165  HOH HOH A . 
P 8 HOH 98  698  33   HOH HOH A . 
P 8 HOH 99  699  104  HOH HOH A . 
P 8 HOH 100 700  6    HOH HOH A . 
P 8 HOH 101 701  4    HOH HOH A . 
P 8 HOH 102 702  42   HOH HOH A . 
P 8 HOH 103 703  25   HOH HOH A . 
P 8 HOH 104 704  66   HOH HOH A . 
P 8 HOH 105 705  72   HOH HOH A . 
P 8 HOH 106 706  148  HOH HOH A . 
P 8 HOH 107 707  161  HOH HOH A . 
P 8 HOH 108 708  59   HOH HOH A . 
P 8 HOH 109 709  94   HOH HOH A . 
P 8 HOH 110 710  48   HOH HOH A . 
P 8 HOH 111 711  90   HOH HOH A . 
P 8 HOH 112 712  118  HOH HOH A . 
P 8 HOH 113 713  68   HOH HOH A . 
P 8 HOH 114 714  40   HOH HOH A . 
P 8 HOH 115 715  147  HOH HOH A . 
P 8 HOH 116 716  97   HOH HOH A . 
P 8 HOH 117 717  110  HOH HOH A . 
P 8 HOH 118 718  149  HOH HOH A . 
P 8 HOH 119 719  91   HOH HOH A . 
P 8 HOH 120 720  156  HOH HOH A . 
P 8 HOH 121 721  102  HOH HOH A . 
P 8 HOH 122 722  142  HOH HOH A . 
P 8 HOH 123 723  139  HOH HOH A . 
P 8 HOH 124 724  74   HOH HOH A . 
P 8 HOH 125 725  158  HOH HOH A . 
P 8 HOH 126 726  155  HOH HOH A . 
P 8 HOH 127 727  157  HOH HOH A . 
P 8 HOH 128 728  154  HOH HOH A . 
P 8 HOH 129 729  174  HOH HOH A . 
P 8 HOH 130 730  159  HOH HOH A . 
P 8 HOH 131 731  167  HOH HOH A . 
P 8 HOH 132 732  153  HOH HOH A . 
P 8 HOH 133 733  175  HOH HOH A . 
P 8 HOH 134 734  65   HOH HOH A . 
P 8 HOH 135 735  126  HOH HOH A . 
P 8 HOH 136 736  81   HOH HOH A . 
P 8 HOH 137 737  160  HOH HOH A . 
P 8 HOH 138 738  168  HOH HOH A . 
P 8 HOH 139 739  164  HOH HOH A . 
P 8 HOH 140 740  133  HOH HOH A . 
P 8 HOH 141 741  173  HOH HOH A . 
P 8 HOH 142 742  150  HOH HOH A . 
P 8 HOH 143 743  103  HOH HOH A . 
P 8 HOH 144 744  163  HOH HOH A . 
P 8 HOH 145 745  143  HOH HOH A . 
P 8 HOH 146 746  172  HOH HOH A . 
P 8 HOH 147 747  152  HOH HOH A . 
P 8 HOH 148 748  120  HOH HOH A . 
P 8 HOH 149 749  176  HOH HOH A . 
P 8 HOH 150 750  170  HOH HOH A . 
P 8 HOH 151 751  109  HOH HOH A . 
P 8 HOH 152 752  8    HOH HOH A . 
P 8 HOH 153 753  135  HOH HOH A . 
P 8 HOH 154 754  93   HOH HOH A . 
P 8 HOH 155 755  171  HOH HOH A . 
P 8 HOH 156 756  127  HOH HOH A . 
P 8 HOH 157 757  146  HOH HOH A . 
P 8 HOH 158 758  121  HOH HOH A . 
P 8 HOH 159 759  92   HOH HOH A . 
P 8 HOH 160 760  5    HOH HOH A . 
P 8 HOH 161 761  128  HOH HOH A . 
P 8 HOH 162 762  113  HOH HOH A . 
P 8 HOH 163 763  132  HOH HOH A . 
P 8 HOH 164 764  130  HOH HOH A . 
P 8 HOH 165 765  169  HOH HOH A . 
P 8 HOH 166 766  83   HOH HOH A . 
P 8 HOH 167 767  138  HOH HOH A . 
Q 8 HOH 1   1101 19   HOH HOH C . 
Q 8 HOH 2   1102 112  HOH HOH C . 
Q 8 HOH 3   1103 31   HOH HOH C . 
Q 8 HOH 4   1104 12   HOH HOH C . 
Q 8 HOH 5   1105 140  HOH HOH C . 
Q 8 HOH 6   1106 38   HOH HOH C . 
Q 8 HOH 7   1107 117  HOH HOH C . 
Q 8 HOH 8   1108 151  HOH HOH C . 
Q 8 HOH 9   1109 71   HOH HOH C . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4820  ? 
1 MORE         -19   ? 
1 'SSA (A^2)'  16210 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 O ? A LEU 141 ? A LEU 254 ? 1_555 MG ? C MG . ? A MG 501 ? 1_555 N   ? A LYS 144 ? A LYS 257 ? 1_555 95.9  ? 
2 O ? A LEU 141 ? A LEU 254 ? 1_555 MG ? C MG . ? A MG 501 ? 1_555 O25 ? M 4PS .   ? A 4PS 511 ? 1_555 111.6 ? 
3 N ? A LYS 144 ? A LYS 257 ? 1_555 MG ? C MG . ? A MG 501 ? 1_555 O25 ? M 4PS .   ? A 4PS 511 ? 1_555 133.4 ? 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2020-03-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX  ? ? ? '(1.13_2998: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS     ? ? ? .                  2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .                  3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .                  4 
# 
_pdbx_entry_details.entry_id                 6PAU 
_pdbx_entry_details.has_ligand_of_interest   Y 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   S44 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   4PS 
_pdbx_validate_close_contact.auth_seq_id_1    511 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    767 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 236 ? ? 50.20   -117.92 
2 1 SER A 315 ? ? -46.62  150.34  
3 1 ASN A 317 ? A -151.69 28.56   
4 1 ASN A 317 ? B -145.55 22.81   
5 1 ILE A 381 ? ? -133.64 -62.17  
6 1 PHE A 422 ? ? -111.08 -99.68  
7 1 MET A 456 ? ? 46.96   -128.18 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A LYS 114 ? A LYS 1  
2  1 Y 1 A HIS 115 ? A HIS 2  
3  1 Y 1 A ARG 116 ? A ARG 3  
4  1 Y 1 A TYR 117 ? A TYR 4  
5  1 Y 1 A GLN 118 ? A GLN 5  
6  1 Y 1 A PHE 119 ? A PHE 6  
7  1 Y 1 A TRP 120 ? A TRP 7  
8  1 Y 1 A ASP 121 ? A ASP 8  
9  1 Y 1 A THR 122 ? A THR 9  
10 1 Y 1 A GLN 123 ? A GLN 10 
11 1 Y 1 A PRO 124 ? A PRO 11 
12 1 Y 1 A VAL 125 ? A VAL 12 
13 1 Y 1 A PRO 126 ? A PRO 13 
14 1 Y 1 A LYS 127 ? A LYS 14 
15 1 Y 1 A LEU 128 ? A LEU 15 
16 1 Y 1 A ASP 129 ? A ASP 16 
17 1 Y 1 A GLU 130 ? A GLU 17 
18 1 Y 1 A VAL 131 ? A VAL 18 
19 1 Y 1 A ILE 132 ? A ILE 19 
20 1 Y 1 A THR 133 ? A THR 20 
21 1 Y 1 A SER 134 ? A SER 21 
22 1 Y 1 A HIS 135 ? A HIS 22 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute of Diabetes and Digestive and Kidney Disease (NIH/NIDDK)' 'United States' 
1R01DK107868      1 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)'                  'United States' 
'R01 GM086703-07' 2 
# 
_pdbx_entity_instance_feature.ordinal        1 
_pdbx_entity_instance_feature.comp_id        4PS 
_pdbx_entity_instance_feature.asym_id        ? 
_pdbx_entity_instance_feature.seq_num        ? 
_pdbx_entity_instance_feature.auth_comp_id   4PS 
_pdbx_entity_instance_feature.auth_asym_id   ? 
_pdbx_entity_instance_feature.auth_seq_num   ? 
_pdbx_entity_instance_feature.feature_type   'SUBJECT OF INVESTIGATION' 
_pdbx_entity_instance_feature.details        ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'MAGNESIUM ION'            MG  
4 GLYCEROL                   GOL 
5 
;4'-diphospho pantetheine
;
4PS 
6 'SULFATE ION'              SO4 
7 'MYRISTIC ACID'            MYR 
8 water                      HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'mass spectrometry' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#